data_4LGD
# 
_entry.id   4LGD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4LGD         
RCSB  RCSB080595   
WWPDB D_1000080595 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4LG4 
_pdbx_database_related.details        'Mst2 kinase domain structure' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        4LGD 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-06-27 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Luo, X.'        1 
'Ni, L.'         2 
'Tomchick, D.R.' 3 
# 
_citation.id                        primary 
_citation.title                     'Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            21 
_citation.page_first                1757 
_citation.page_last                 1768 
_citation.year                      2013 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23972470 
_citation.pdbx_database_id_DOI      10.1016/j.str.2013.07.008 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ni, L.'          1 
primary 'Li, S.'          2 
primary 'Yu, J.'          3 
primary 'Min, J.'         4 
primary 'Brautigam, C.A.' 5 
primary 'Tomchick, D.R.'  6 
primary 'Pan, D.'         7 
primary 'Luo, X.'         8 
# 
_cell.length_a           123.403 
_cell.length_b           237.136 
_cell.length_c           95.862 
_cell.angle_alpha        90.000 
_cell.angle_beta         100.700 
_cell.angle_gamma        90.000 
_cell.entry_id           4LGD 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.entry_id                         4LGD 
_symmetry.Int_Tables_number                5 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein kinase 3'              43626.164 4 2.7.11.1 D146N 
'kinase domain, SARAH domain, UNP residues 1-313, 428-491' ? 
2 polymer     man 'Ras association domain family member 5, RASSF5' 5963.654  4 ?        ?     'SARAH domain, UNP residues 365-413' 
? 
3 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER'    506.196   4 ?        ?     ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                  24.305    4 ?        ?     ? ? 
5 non-polymer syn 'SULFATE ION'                                    96.063    9 ?        ?     ? ? 
6 non-polymer syn 'SODIUM ION'                                     22.990    3 ?        ?     ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;Mammalian STE20-like protein kinase 2, MST-2, STE20-like kinase MST2, Serine/threonine-protein kinase Krs-1, Serine/threonine-protein kinase 3 36kDa subunit, MST2/N, Serine/threonine-protein kinase 3 20kDa subunit, MST2/C
;
2 'New ras effector 1, Regulator for cell adhesion and polarization enriched in lymphoid tissues, RAPL' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MHHHHHHGSSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS
PYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGH
AKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPP
TFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEENWKVPQ
DGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQNF
;
;MHHHHHHGSSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS
PYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGH
AKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPP
TFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEENWKVPQ
DGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQNF
;
A,B,C,D ? 
2 'polypeptide(L)' no no GEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES GEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES 
E,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   GLY n 
1 9   SER n 
1 10  SER n 
1 11  LYS n 
1 12  LEU n 
1 13  LYS n 
1 14  LYS n 
1 15  LEU n 
1 16  SER n 
1 17  GLU n 
1 18  ASP n 
1 19  SER n 
1 20  LEU n 
1 21  THR n 
1 22  LYS n 
1 23  GLN n 
1 24  PRO n 
1 25  GLU n 
1 26  GLU n 
1 27  VAL n 
1 28  PHE n 
1 29  ASP n 
1 30  VAL n 
1 31  LEU n 
1 32  GLU n 
1 33  LYS n 
1 34  LEU n 
1 35  GLY n 
1 36  GLU n 
1 37  GLY n 
1 38  SER n 
1 39  TYR n 
1 40  GLY n 
1 41  SER n 
1 42  VAL n 
1 43  PHE n 
1 44  LYS n 
1 45  ALA n 
1 46  ILE n 
1 47  HIS n 
1 48  LYS n 
1 49  GLU n 
1 50  SER n 
1 51  GLY n 
1 52  GLN n 
1 53  VAL n 
1 54  VAL n 
1 55  ALA n 
1 56  ILE n 
1 57  LYS n 
1 58  GLN n 
1 59  VAL n 
1 60  PRO n 
1 61  VAL n 
1 62  GLU n 
1 63  SER n 
1 64  ASP n 
1 65  LEU n 
1 66  GLN n 
1 67  GLU n 
1 68  ILE n 
1 69  ILE n 
1 70  LYS n 
1 71  GLU n 
1 72  ILE n 
1 73  SER n 
1 74  ILE n 
1 75  MET n 
1 76  GLN n 
1 77  GLN n 
1 78  CYS n 
1 79  ASP n 
1 80  SER n 
1 81  PRO n 
1 82  TYR n 
1 83  VAL n 
1 84  VAL n 
1 85  LYS n 
1 86  TYR n 
1 87  TYR n 
1 88  GLY n 
1 89  SER n 
1 90  TYR n 
1 91  PHE n 
1 92  LYS n 
1 93  ASN n 
1 94  THR n 
1 95  ASP n 
1 96  LEU n 
1 97  TRP n 
1 98  ILE n 
1 99  VAL n 
1 100 MET n 
1 101 GLU n 
1 102 TYR n 
1 103 CYS n 
1 104 GLY n 
1 105 ALA n 
1 106 GLY n 
1 107 SER n 
1 108 VAL n 
1 109 SER n 
1 110 ASP n 
1 111 ILE n 
1 112 ILE n 
1 113 ARG n 
1 114 LEU n 
1 115 ARG n 
1 116 ASN n 
1 117 LYS n 
1 118 THR n 
1 119 LEU n 
1 120 ILE n 
1 121 GLU n 
1 122 ASP n 
1 123 GLU n 
1 124 ILE n 
1 125 ALA n 
1 126 THR n 
1 127 ILE n 
1 128 LEU n 
1 129 LYS n 
1 130 SER n 
1 131 THR n 
1 132 LEU n 
1 133 LYS n 
1 134 GLY n 
1 135 LEU n 
1 136 GLU n 
1 137 TYR n 
1 138 LEU n 
1 139 HIS n 
1 140 PHE n 
1 141 MET n 
1 142 ARG n 
1 143 LYS n 
1 144 ILE n 
1 145 HIS n 
1 146 ARG n 
1 147 ASN n 
1 148 ILE n 
1 149 LYS n 
1 150 ALA n 
1 151 GLY n 
1 152 ASN n 
1 153 ILE n 
1 154 LEU n 
1 155 LEU n 
1 156 ASN n 
1 157 THR n 
1 158 GLU n 
1 159 GLY n 
1 160 HIS n 
1 161 ALA n 
1 162 LYS n 
1 163 LEU n 
1 164 ALA n 
1 165 ASP n 
1 166 PHE n 
1 167 GLY n 
1 168 VAL n 
1 169 ALA n 
1 170 GLY n 
1 171 GLN n 
1 172 LEU n 
1 173 THR n 
1 174 ASP n 
1 175 THR n 
1 176 MET n 
1 177 ALA n 
1 178 LYS n 
1 179 ARG n 
1 180 ASN n 
1 181 THR n 
1 182 VAL n 
1 183 ILE n 
1 184 GLY n 
1 185 THR n 
1 186 PRO n 
1 187 PHE n 
1 188 TRP n 
1 189 MET n 
1 190 ALA n 
1 191 PRO n 
1 192 GLU n 
1 193 VAL n 
1 194 ILE n 
1 195 GLN n 
1 196 GLU n 
1 197 ILE n 
1 198 GLY n 
1 199 TYR n 
1 200 ASN n 
1 201 CYS n 
1 202 VAL n 
1 203 ALA n 
1 204 ASP n 
1 205 ILE n 
1 206 TRP n 
1 207 SER n 
1 208 LEU n 
1 209 GLY n 
1 210 ILE n 
1 211 THR n 
1 212 SER n 
1 213 ILE n 
1 214 GLU n 
1 215 MET n 
1 216 ALA n 
1 217 GLU n 
1 218 GLY n 
1 219 LYS n 
1 220 PRO n 
1 221 PRO n 
1 222 TYR n 
1 223 ALA n 
1 224 ASP n 
1 225 ILE n 
1 226 HIS n 
1 227 PRO n 
1 228 MET n 
1 229 ARG n 
1 230 ALA n 
1 231 ILE n 
1 232 PHE n 
1 233 MET n 
1 234 ILE n 
1 235 PRO n 
1 236 THR n 
1 237 ASN n 
1 238 PRO n 
1 239 PRO n 
1 240 PRO n 
1 241 THR n 
1 242 PHE n 
1 243 ARG n 
1 244 LYS n 
1 245 PRO n 
1 246 GLU n 
1 247 LEU n 
1 248 TRP n 
1 249 SER n 
1 250 ASP n 
1 251 ASP n 
1 252 PHE n 
1 253 THR n 
1 254 ASP n 
1 255 PHE n 
1 256 VAL n 
1 257 LYS n 
1 258 LYS n 
1 259 CYS n 
1 260 LEU n 
1 261 VAL n 
1 262 LYS n 
1 263 ASN n 
1 264 PRO n 
1 265 GLU n 
1 266 GLN n 
1 267 ARG n 
1 268 ALA n 
1 269 THR n 
1 270 ALA n 
1 271 THR n 
1 272 GLN n 
1 273 LEU n 
1 274 LEU n 
1 275 GLN n 
1 276 HIS n 
1 277 PRO n 
1 278 PHE n 
1 279 ILE n 
1 280 LYS n 
1 281 ASN n 
1 282 ALA n 
1 283 LYS n 
1 284 PRO n 
1 285 VAL n 
1 286 SER n 
1 287 ILE n 
1 288 LEU n 
1 289 ARG n 
1 290 ASP n 
1 291 LEU n 
1 292 ILE n 
1 293 THR n 
1 294 GLU n 
1 295 ALA n 
1 296 MET n 
1 297 GLU n 
1 298 ILE n 
1 299 LYS n 
1 300 ALA n 
1 301 LYS n 
1 302 ARG n 
1 303 HIS n 
1 304 GLU n 
1 305 GLU n 
1 306 GLN n 
1 307 GLN n 
1 308 ARG n 
1 309 GLU n 
1 310 LEU n 
1 311 GLU n 
1 312 GLU n 
1 313 GLU n 
1 314 GLU n 
1 315 ASN n 
1 316 TRP n 
1 317 LYS n 
1 318 VAL n 
1 319 PRO n 
1 320 GLN n 
1 321 ASP n 
1 322 GLY n 
1 323 ASP n 
1 324 PHE n 
1 325 ASP n 
1 326 PHE n 
1 327 LEU n 
1 328 LYS n 
1 329 ASN n 
1 330 LEU n 
1 331 SER n 
1 332 LEU n 
1 333 GLU n 
1 334 GLU n 
1 335 LEU n 
1 336 GLN n 
1 337 MET n 
1 338 ARG n 
1 339 LEU n 
1 340 LYS n 
1 341 ALA n 
1 342 LEU n 
1 343 ASP n 
1 344 PRO n 
1 345 MET n 
1 346 MET n 
1 347 GLU n 
1 348 ARG n 
1 349 GLU n 
1 350 ILE n 
1 351 GLU n 
1 352 GLU n 
1 353 LEU n 
1 354 ARG n 
1 355 GLN n 
1 356 ARG n 
1 357 TYR n 
1 358 THR n 
1 359 ALA n 
1 360 LYS n 
1 361 ARG n 
1 362 GLN n 
1 363 PRO n 
1 364 ILE n 
1 365 LEU n 
1 366 ASP n 
1 367 ALA n 
1 368 MET n 
1 369 ASP n 
1 370 ALA n 
1 371 LYS n 
1 372 LYS n 
1 373 ARG n 
1 374 ARG n 
1 375 GLN n 
1 376 GLN n 
1 377 ASN n 
1 378 PHE n 
2 1   GLY n 
2 2   GLU n 
2 3   VAL n 
2 4   GLU n 
2 5   TRP n 
2 6   ASP n 
2 7   ALA n 
2 8   PHE n 
2 9   SER n 
2 10  ILE n 
2 11  PRO n 
2 12  GLU n 
2 13  LEU n 
2 14  GLN n 
2 15  ASN n 
2 16  PHE n 
2 17  LEU n 
2 18  THR n 
2 19  ILE n 
2 20  LEU n 
2 21  GLU n 
2 22  LYS n 
2 23  GLU n 
2 24  GLU n 
2 25  GLN n 
2 26  ASP n 
2 27  LYS n 
2 28  ILE n 
2 29  GLN n 
2 30  GLN n 
2 31  VAL n 
2 32  GLN n 
2 33  LYS n 
2 34  LYS n 
2 35  TYR n 
2 36  ASP n 
2 37  LYS n 
2 38  PHE n 
2 39  ARG n 
2 40  GLN n 
2 41  LYS n 
2 42  LEU n 
2 43  GLU n 
2 44  GLU n 
2 45  ALA n 
2 46  LEU n 
2 47  ARG n 
2 48  GLU n 
2 49  SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 10  314 human ? 'STK3, KRS1, MST2'    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? 
? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET29   ? ? 
1 2 sample ? 315 378 human ? 'STK3, KRS1, MST2'    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? 
? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET29   ? ? 
2 1 sample ? ?   ?   human ? 'RASSF5, NORE1, RAPL' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? 
? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pGEX-6p ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP STK3_HUMAN  Q13188 1 
;SKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGS
YFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVA
GQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWS
DDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEE
;
9   ? 
2 UNP STK3_HUMAN  Q13188 1 NWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQNF 428 ? 
3 UNP RASF5_HUMAN Q8WWW0 2 GEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES 365 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4LGD A 10  ? 314 ? Q13188 9   ? 313 ? 9   313 
2  2 4LGD A 315 ? 378 ? Q13188 428 ? 491 ? 428 491 
3  1 4LGD B 10  ? 314 ? Q13188 9   ? 313 ? 9   313 
4  2 4LGD B 315 ? 378 ? Q13188 428 ? 491 ? 428 491 
5  1 4LGD C 10  ? 314 ? Q13188 9   ? 313 ? 9   313 
6  2 4LGD C 315 ? 378 ? Q13188 428 ? 491 ? 428 491 
7  1 4LGD D 10  ? 314 ? Q13188 9   ? 313 ? 9   313 
8  2 4LGD D 315 ? 378 ? Q13188 428 ? 491 ? 428 491 
9  3 4LGD E 1   ? 49  ? Q8WWW0 365 ? 413 ? 365 413 
10 3 4LGD F 1   ? 49  ? Q8WWW0 365 ? 413 ? 365 413 
11 3 4LGD G 1   ? 49  ? Q8WWW0 365 ? 413 ? 365 413 
12 3 4LGD H 1   ? 49  ? Q8WWW0 365 ? 413 ? 365 413 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4LGD MET A 1   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      0   1  
1 4LGD HIS A 2   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      1   2  
1 4LGD HIS A 3   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      2   3  
1 4LGD HIS A 4   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      3   4  
1 4LGD HIS A 5   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      4   5  
1 4LGD HIS A 6   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      5   6  
1 4LGD HIS A 7   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      6   7  
1 4LGD GLY A 8   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      7   8  
1 4LGD SER A 9   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      8   9  
1 4LGD ASN A 147 ? UNP Q13188 ASP 146 'ENGINEERED MUTATION' 146 10 
3 4LGD MET B 1   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      0   11 
3 4LGD HIS B 2   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      1   12 
3 4LGD HIS B 3   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      2   13 
3 4LGD HIS B 4   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      3   14 
3 4LGD HIS B 5   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      4   15 
3 4LGD HIS B 6   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      5   16 
3 4LGD HIS B 7   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      6   17 
3 4LGD GLY B 8   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      7   18 
3 4LGD SER B 9   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      8   19 
3 4LGD ASN B 147 ? UNP Q13188 ASP 146 'ENGINEERED MUTATION' 146 20 
5 4LGD MET C 1   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      0   21 
5 4LGD HIS C 2   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      1   22 
5 4LGD HIS C 3   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      2   23 
5 4LGD HIS C 4   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      3   24 
5 4LGD HIS C 5   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      4   25 
5 4LGD HIS C 6   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      5   26 
5 4LGD HIS C 7   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      6   27 
5 4LGD GLY C 8   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      7   28 
5 4LGD SER C 9   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      8   29 
5 4LGD ASN C 147 ? UNP Q13188 ASP 146 'ENGINEERED MUTATION' 146 30 
7 4LGD MET D 1   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      0   31 
7 4LGD HIS D 2   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      1   32 
7 4LGD HIS D 3   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      2   33 
7 4LGD HIS D 4   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      3   34 
7 4LGD HIS D 5   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      4   35 
7 4LGD HIS D 6   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      5   36 
7 4LGD HIS D 7   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      6   37 
7 4LGD GLY D 8   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      7   38 
7 4LGD SER D 9   ? UNP Q13188 ?   ?   'EXPRESSION TAG'      8   39 
7 4LGD ASN D 147 ? UNP Q13188 ASP 146 'ENGINEERED MUTATION' 146 40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
NA  non-polymer         . 'SODIUM ION'                                  ? 'Na 1'              22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                                 ? 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4LGD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
loop_
_exptl_crystal.id 
_exptl_crystal.density_meas 
_exptl_crystal.density_Matthews 
_exptl_crystal.density_percent_sol 
_exptl_crystal.description 
_exptl_crystal.F_000 
_exptl_crystal.preparation 
1 ? 3.47 64.59 ? ? ? 
2 ? 3.47 64.59 ? ? ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   8.5 
_exptl_crystal_grow.pdbx_details    
'0.1 M Bis-Tris propane, 200 mM Na2SO4, 20% (w/v) PEG 3350, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 2 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 315r' 2011-02-12 MONOCHROMATOR 
2 CCD 'ADSC QUANTUM 315r' 2011-03-14 MONOCHROMATOR 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'SAGITALLY FOCUSED SI(111)' 'SINGLE WAVELENGTH' x-ray 
2 1 M 'SAGITALLY FOCUSED SI(111)' 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.97929 1.0 
2 0.97921 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'APS BEAMLINE 19-ID' APS 19-ID 0.97929 ? 
2 SYNCHROTRON 'APS BEAMLINE 19-ID' APS 19-ID 0.97921 ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4LGD 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             46.049 
_reflns.d_resolution_high            3.050 
_reflns.number_obs                   50456 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.2 
_reflns.pdbx_Rmerge_I_obs            0.109 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.4 
_reflns.B_iso_Wilson_estimate        71.84 
_reflns.pdbx_redundancy              4.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.05 
_reflns_shell.d_res_low              3.10 
_reflns_shell.percent_possible_all   90.7 
_reflns_shell.Rmerge_I_obs           0.762 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.6 
_reflns_shell.pdbx_redundancy        3.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4LGD 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     50374 
_refine.ls_number_reflns_all                     65746 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            3.05 
_refine.ls_percent_reflns_obs                    98.6 
_refine.ls_R_factor_obs                          0.202 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.244 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2524 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               135.90 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.99 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4LG4' 
_refine.pdbx_method_to_determine_struct          MR-SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.29 
_refine.pdbx_overall_phase_error                 32.15 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        12609 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         176 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12785 
_refine_hist.d_res_high                       3.05 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.006  ? ? 13027 'X-RAY DIFFRACTION' ? 
f_angle_d          0.610  ? ? 17577 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.557 ? ? 5083  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.036  ? ? 1935  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.002  ? ? 2230  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.0532 3.1119  2308 0.2938 85.00  0.3933 . . 124 . . . . 
'X-RAY DIFFRACTION' . 3.1119 3.1753  2498 0.3045 93.00  0.3534 . . 132 . . . . 
'X-RAY DIFFRACTION' . 3.1753 3.2443  2618 0.2932 98.00  0.3368 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.2443 3.3197  2672 0.2587 99.00  0.2980 . . 133 . . . . 
'X-RAY DIFFRACTION' . 3.3197 3.4026  2690 0.2408 99.00  0.3038 . . 131 . . . . 
'X-RAY DIFFRACTION' . 3.4026 3.4944  2690 0.2222 100.00 0.2899 . . 139 . . . . 
'X-RAY DIFFRACTION' . 3.4944 3.5971  2682 0.2023 100.00 0.2756 . . 143 . . . . 
'X-RAY DIFFRACTION' . 3.5971 3.7130  2691 0.1910 100.00 0.2363 . . 165 . . . . 
'X-RAY DIFFRACTION' . 3.7130 3.8454  2698 0.1891 100.00 0.2584 . . 127 . . . . 
'X-RAY DIFFRACTION' . 3.8454 3.9990  2701 0.1734 100.00 0.2584 . . 133 . . . . 
'X-RAY DIFFRACTION' . 3.9990 4.1806  2702 0.1774 100.00 0.2247 . . 148 . . . . 
'X-RAY DIFFRACTION' . 4.1806 4.4003  2665 0.1673 100.00 0.2090 . . 149 . . . . 
'X-RAY DIFFRACTION' . 4.4003 4.6750  2691 0.1642 100.00 0.2182 . . 131 . . . . 
'X-RAY DIFFRACTION' . 4.6750 5.0344  2694 0.1896 100.00 0.2242 . . 159 . . . . 
'X-RAY DIFFRACTION' . 5.0344 5.5380  2713 0.2072 100.00 0.2410 . . 131 . . . . 
'X-RAY DIFFRACTION' . 5.5380 6.3326  2721 0.2159 100.00 0.2880 . . 136 . . . . 
'X-RAY DIFFRACTION' . 6.3326 7.9528  2713 0.2044 100.00 0.2177 . . 136 . . . . 
'X-RAY DIFFRACTION' . 7.9528 29.6520 2703 0.1768 99.00  0.2006 . . 165 . . . . 
# 
_struct.entry_id                  4LGD 
_struct.title                     'Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5' 
_struct.pdbx_descriptor           
'Serine/threonine-protein kinase 3 (E.C.2.7.11.1), Ras association domain family member 5, RASSF5' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4LGD 
_struct_keywords.text            'Hippo, Mst autoactivation, RASSF, SARAH domain, dimerization, SIGNALING PROTEIN' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 4 ? 
K  N N 5 ? 
L  N N 3 ? 
M  N N 4 ? 
N  N N 5 ? 
O  N N 5 ? 
P  N N 5 ? 
Q  N N 5 ? 
R  N N 3 ? 
S  N N 4 ? 
T  N N 5 ? 
U  N N 6 ? 
V  N N 6 ? 
W  N N 3 ? 
X  N N 4 ? 
Y  N N 5 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 17  ? LYS A 22  ? GLU A 16  LYS A 21  1 ? 6  
HELX_P HELX_P2  2  GLN A 23  ? GLU A 26  ? GLN A 22  GLU A 25  5 ? 4  
HELX_P HELX_P3  3  ASP A 64  ? GLN A 77  ? ASP A 63  GLN A 76  1 ? 14 
HELX_P HELX_P4  4  VAL A 108 ? ASN A 116 ? VAL A 107 ASN A 115 1 ? 9  
HELX_P HELX_P5  5  ILE A 120 ? MET A 141 ? ILE A 119 MET A 140 1 ? 22 
HELX_P HELX_P6  6  LYS A 149 ? GLY A 151 ? LYS A 148 GLY A 150 5 ? 3  
HELX_P HELX_P7  7  ALA A 177 ? VAL A 182 ? ALA A 176 VAL A 181 1 ? 6  
HELX_P HELX_P8  8  ALA A 190 ? ILE A 197 ? ALA A 189 ILE A 196 1 ? 8  
HELX_P HELX_P9  9  ASN A 200 ? GLY A 218 ? ASN A 199 GLY A 217 1 ? 19 
HELX_P HELX_P10 10 HIS A 226 ? ILE A 234 ? HIS A 225 ILE A 233 1 ? 9  
HELX_P HELX_P11 11 LYS A 244 ? TRP A 248 ? LYS A 243 TRP A 247 5 ? 5  
HELX_P HELX_P12 12 SER A 249 ? LEU A 260 ? SER A 248 LEU A 259 1 ? 12 
HELX_P HELX_P13 13 THR A 269 ? LEU A 274 ? THR A 268 LEU A 273 1 ? 6  
HELX_P HELX_P14 14 HIS A 276 ? ASN A 281 ? HIS A 275 ASN A 280 1 ? 6  
HELX_P HELX_P15 15 VAL A 285 ? GLU A 311 ? VAL A 284 GLU A 310 1 ? 27 
HELX_P HELX_P16 16 SER A 331 ? ALA A 341 ? SER A 444 ALA A 454 1 ? 11 
HELX_P HELX_P17 17 ASP A 343 ? ARG A 348 ? ASP A 456 ARG A 461 1 ? 6  
HELX_P HELX_P18 18 ILE A 350 ? ARG A 361 ? ILE A 463 ARG A 474 1 ? 12 
HELX_P HELX_P19 19 ARG A 361 ? GLN A 375 ? ARG A 474 GLN A 488 1 ? 15 
HELX_P HELX_P20 20 GLN B 23  ? VAL B 27  ? GLN B 22  VAL B 26  1 ? 5  
HELX_P HELX_P21 21 ASP B 64  ? GLN B 77  ? ASP B 63  GLN B 76  1 ? 14 
HELX_P HELX_P22 22 VAL B 108 ? ASN B 116 ? VAL B 107 ASN B 115 1 ? 9  
HELX_P HELX_P23 23 ILE B 120 ? MET B 141 ? ILE B 119 MET B 140 1 ? 22 
HELX_P HELX_P24 24 LYS B 149 ? GLY B 151 ? LYS B 148 GLY B 150 5 ? 3  
HELX_P HELX_P25 25 ALA B 190 ? ILE B 197 ? ALA B 189 ILE B 196 1 ? 8  
HELX_P HELX_P26 26 VAL B 202 ? GLY B 218 ? VAL B 201 GLY B 217 1 ? 17 
HELX_P HELX_P27 27 HIS B 226 ? ASN B 237 ? HIS B 225 ASN B 236 1 ? 12 
HELX_P HELX_P28 28 LYS B 244 ? TRP B 248 ? LYS B 243 TRP B 247 5 ? 5  
HELX_P HELX_P29 29 SER B 249 ? LEU B 260 ? SER B 248 LEU B 259 1 ? 12 
HELX_P HELX_P30 30 THR B 269 ? LEU B 274 ? THR B 268 LEU B 273 1 ? 6  
HELX_P HELX_P31 31 HIS B 276 ? ASN B 281 ? HIS B 275 ASN B 280 1 ? 6  
HELX_P HELX_P32 32 PRO B 284 ? ILE B 287 ? PRO B 283 ILE B 286 5 ? 4  
HELX_P HELX_P33 33 LEU B 288 ? GLU B 313 ? LEU B 287 GLU B 312 1 ? 26 
HELX_P HELX_P34 34 SER B 331 ? LEU B 335 ? SER B 444 LEU B 448 5 ? 5  
HELX_P HELX_P35 35 LEU B 342 ? MET B 346 ? LEU B 455 MET B 459 5 ? 5  
HELX_P HELX_P36 36 ILE B 350 ? GLN B 375 ? ILE B 463 GLN B 488 1 ? 26 
HELX_P HELX_P37 37 GLN C 23  ? GLU C 26  ? GLN C 22  GLU C 25  5 ? 4  
HELX_P HELX_P38 38 ASP C 64  ? GLN C 77  ? ASP C 63  GLN C 76  1 ? 14 
HELX_P HELX_P39 39 VAL C 108 ? ASN C 116 ? VAL C 107 ASN C 115 1 ? 9  
HELX_P HELX_P40 40 ILE C 120 ? MET C 141 ? ILE C 119 MET C 140 1 ? 22 
HELX_P HELX_P41 41 LYS C 149 ? GLY C 151 ? LYS C 148 GLY C 150 5 ? 3  
HELX_P HELX_P42 42 ALA C 177 ? VAL C 182 ? ALA C 176 VAL C 181 1 ? 6  
HELX_P HELX_P43 43 ALA C 190 ? ILE C 197 ? ALA C 189 ILE C 196 1 ? 8  
HELX_P HELX_P44 44 VAL C 202 ? GLY C 218 ? VAL C 201 GLY C 217 1 ? 17 
HELX_P HELX_P45 45 HIS C 226 ? ASN C 237 ? HIS C 225 ASN C 236 1 ? 12 
HELX_P HELX_P46 46 LYS C 244 ? TRP C 248 ? LYS C 243 TRP C 247 5 ? 5  
HELX_P HELX_P47 47 SER C 249 ? LEU C 260 ? SER C 248 LEU C 259 1 ? 12 
HELX_P HELX_P48 48 ASN C 263 ? ARG C 267 ? ASN C 262 ARG C 266 5 ? 5  
HELX_P HELX_P49 49 THR C 269 ? LEU C 274 ? THR C 268 LEU C 273 1 ? 6  
HELX_P HELX_P50 50 HIS C 276 ? ASN C 281 ? HIS C 275 ASN C 280 1 ? 6  
HELX_P HELX_P51 51 VAL C 285 ? GLU C 313 ? VAL C 284 GLU C 312 1 ? 29 
HELX_P HELX_P52 52 SER C 331 ? LEU C 335 ? SER C 444 LEU C 448 5 ? 5  
HELX_P HELX_P53 53 LEU C 342 ? ARG C 361 ? LEU C 455 ARG C 474 1 ? 20 
HELX_P HELX_P54 54 ARG C 361 ? ASN C 377 ? ARG C 474 ASN C 490 1 ? 17 
HELX_P HELX_P55 55 SER D 16  ? LYS D 22  ? SER D 15  LYS D 21  1 ? 7  
HELX_P HELX_P56 56 GLN D 23  ? VAL D 27  ? GLN D 22  VAL D 26  1 ? 5  
HELX_P HELX_P57 57 ASP D 64  ? GLN D 77  ? ASP D 63  GLN D 76  1 ? 14 
HELX_P HELX_P58 58 VAL D 108 ? ARG D 115 ? VAL D 107 ARG D 114 1 ? 8  
HELX_P HELX_P59 59 ILE D 120 ? MET D 141 ? ILE D 119 MET D 140 1 ? 22 
HELX_P HELX_P60 60 LYS D 149 ? GLY D 151 ? LYS D 148 GLY D 150 5 ? 3  
HELX_P HELX_P61 61 MET D 176 ? VAL D 182 ? MET D 175 VAL D 181 1 ? 7  
HELX_P HELX_P62 62 ALA D 190 ? GLU D 196 ? ALA D 189 GLU D 195 1 ? 7  
HELX_P HELX_P63 63 VAL D 202 ? GLY D 218 ? VAL D 201 GLY D 217 1 ? 17 
HELX_P HELX_P64 64 HIS D 226 ? ASN D 237 ? HIS D 225 ASN D 236 1 ? 12 
HELX_P HELX_P65 65 LYS D 244 ? TRP D 248 ? LYS D 243 TRP D 247 5 ? 5  
HELX_P HELX_P66 66 SER D 249 ? LEU D 260 ? SER D 248 LEU D 259 1 ? 12 
HELX_P HELX_P67 67 THR D 269 ? LEU D 274 ? THR D 268 LEU D 273 1 ? 6  
HELX_P HELX_P68 68 HIS D 276 ? ASN D 281 ? HIS D 275 ASN D 280 1 ? 6  
HELX_P HELX_P69 69 PRO D 284 ? ILE D 287 ? PRO D 283 ILE D 286 5 ? 4  
HELX_P HELX_P70 70 LEU D 288 ? GLU D 312 ? LEU D 287 GLU D 311 1 ? 25 
HELX_P HELX_P71 71 MET D 346 ? ARG D 361 ? MET D 459 ARG D 474 1 ? 16 
HELX_P HELX_P72 72 ARG D 361 ? GLN D 376 ? ARG D 474 GLN D 489 1 ? 16 
HELX_P HELX_P73 73 GLU E 4   ? PHE E 8   ? GLU E 368 PHE E 372 5 ? 5  
HELX_P HELX_P74 74 SER E 9   ? ARG E 47  ? SER E 373 ARG E 411 1 ? 39 
HELX_P HELX_P75 75 SER F 9   ? LYS F 34  ? SER F 373 LYS F 398 1 ? 26 
HELX_P HELX_P76 76 GLU G 4   ? PHE G 8   ? GLU G 368 PHE G 372 5 ? 5  
HELX_P HELX_P77 77 SER G 9   ? ARG G 47  ? SER G 373 ARG G 411 1 ? 39 
HELX_P HELX_P78 78 GLU H 4   ? PHE H 8   ? GLU H 368 PHE H 372 5 ? 5  
HELX_P HELX_P79 79 SER H 9   ? GLN H 29  ? SER H 373 GLN H 393 1 ? 21 
HELX_P HELX_P80 80 VAL H 31  ? GLN H 40  ? VAL H 395 GLN H 404 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C ASP 165 OD1 ? ? ? 1_555 S  MG . MG ? ? C ASP 164 C MG 502 1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc2  metalc ? ? I ANP .   O2B ? ? ? 1_555 J  MG . MG ? ? A ANP 501 A MG 502 1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc3  metalc ? ? C ASP 165 OD2 ? ? ? 1_555 S  MG . MG ? ? C ASP 164 C MG 502 1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc4  metalc ? ? A ASP 165 OD2 ? ? ? 1_555 J  MG . MG ? ? A ASP 164 A MG 502 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc5  metalc ? ? D ASP 165 OD1 ? ? ? 1_555 X  MG . MG ? ? D ASP 164 D MG 502 1_555 ? ? ? ? ? ? ? 2.103 ? 
metalc6  metalc ? ? R ANP .   O2B ? ? ? 1_555 S  MG . MG ? ? C ANP 501 C MG 502 1_555 ? ? ? ? ? ? ? 2.113 ? 
metalc7  metalc ? ? W ANP .   O1A ? ? ? 1_555 X  MG . MG ? ? D ANP 501 D MG 502 1_555 ? ? ? ? ? ? ? 2.122 ? 
metalc8  metalc ? ? B ASP 165 OD1 ? ? ? 1_555 M  MG . MG ? ? B ASP 164 B MG 502 1_555 ? ? ? ? ? ? ? 2.124 ? 
metalc9  metalc ? ? D ASP 165 OD2 ? ? ? 1_555 X  MG . MG ? ? D ASP 164 D MG 502 1_555 ? ? ? ? ? ? ? 2.160 ? 
metalc10 metalc ? ? R ANP .   O1A ? ? ? 1_555 S  MG . MG ? ? C ANP 501 C MG 502 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc11 metalc ? ? A ASP 165 OD1 ? ? ? 1_555 J  MG . MG ? ? A ASP 164 A MG 502 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc12 metalc ? ? B ASP 165 OD2 ? ? ? 1_555 M  MG . MG ? ? B ASP 164 B MG 502 1_555 ? ? ? ? ? ? ? 2.202 ? 
metalc13 metalc ? ? W ANP .   O2B ? ? ? 1_555 X  MG . MG ? ? D ANP 501 D MG 502 1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc14 metalc ? ? I ANP .   O1A ? ? ? 1_555 J  MG . MG ? ? A ANP 501 A MG 502 1_555 ? ? ? ? ? ? ? 2.212 ? 
metalc15 metalc ? ? L ANP .   O2A ? ? ? 1_555 M  MG . MG ? ? B ANP 501 B MG 502 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc16 metalc ? ? C ASP 122 OD2 ? ? ? 1_555 U  NA . NA ? ? C ASP 121 C NA 504 1_555 ? ? ? ? ? ? ? 2.480 ? 
metalc17 metalc ? ? H ASN 15  OD1 ? ? ? 1_555 V  NA . NA ? ? H ASN 379 C NA 505 1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc18 metalc ? ? L ANP .   O2B ? ? ? 1_555 M  MG . MG ? ? B ANP 501 B MG 502 1_555 ? ? ? ? ? ? ? 2.520 ? 
metalc19 metalc ? ? D ASP 122 OD1 ? ? ? 1_555 BA NA . NA ? ? D ASP 121 D NA 506 1_555 ? ? ? ? ? ? ? 2.521 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 5 ? 
D ? 3 ? 
E ? 5 ? 
F ? 3 ? 
G ? 5 ? 
H ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 28  ? GLU A 36  ? PHE A 27  GLU A 35  
A 2 SER A 41  ? HIS A 47  ? SER A 40  HIS A 46  
A 3 VAL A 53  ? PRO A 60  ? VAL A 52  PRO A 59  
A 4 ASP A 95  ? GLU A 101 ? ASP A 94  GLU A 100 
A 5 TYR A 86  ? LYS A 92  ? TYR A 85  LYS A 91  
B 1 GLY A 106 ? SER A 107 ? GLY A 105 SER A 106 
B 2 ILE A 153 ? LEU A 155 ? ILE A 152 LEU A 154 
B 3 ALA A 161 ? LEU A 163 ? ALA A 160 LEU A 162 
C 1 PHE B 28  ? GLU B 36  ? PHE B 27  GLU B 35  
C 2 SER B 41  ? HIS B 47  ? SER B 40  HIS B 46  
C 3 GLN B 52  ? PRO B 60  ? GLN B 51  PRO B 59  
C 4 ASP B 95  ? GLU B 101 ? ASP B 94  GLU B 100 
C 5 TYR B 86  ? LYS B 92  ? TYR B 85  LYS B 91  
D 1 GLY B 106 ? SER B 107 ? GLY B 105 SER B 106 
D 2 ILE B 153 ? LEU B 155 ? ILE B 152 LEU B 154 
D 3 ALA B 161 ? LEU B 163 ? ALA B 160 LEU B 162 
E 1 PHE C 28  ? VAL C 30  ? PHE C 27  VAL C 29  
E 2 VAL C 42  ? HIS C 47  ? VAL C 41  HIS C 46  
E 3 VAL C 53  ? PRO C 60  ? VAL C 52  PRO C 59  
E 4 ASP C 95  ? GLU C 101 ? ASP C 94  GLU C 100 
E 5 TYR C 86  ? LYS C 92  ? TYR C 85  LYS C 91  
F 1 GLY C 106 ? SER C 107 ? GLY C 105 SER C 106 
F 2 ILE C 153 ? LEU C 155 ? ILE C 152 LEU C 154 
F 3 ALA C 161 ? LEU C 163 ? ALA C 160 LEU C 162 
G 1 PHE D 28  ? GLU D 36  ? PHE D 27  GLU D 35  
G 2 SER D 41  ? HIS D 47  ? SER D 40  HIS D 46  
G 3 VAL D 53  ? PRO D 60  ? VAL D 52  PRO D 59  
G 4 ASP D 95  ? GLU D 101 ? ASP D 94  GLU D 100 
G 5 TYR D 86  ? LYS D 92  ? TYR D 85  LYS D 91  
H 1 GLY D 106 ? SER D 107 ? GLY D 105 SER D 106 
H 2 ILE D 153 ? LEU D 155 ? ILE D 152 LEU D 154 
H 3 ALA D 161 ? LEU D 163 ? ALA D 160 LEU D 162 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 31  ? N LEU A 30  O LYS A 44  ? O LYS A 43  
A 2 3 N PHE A 43  ? N PHE A 42  O ILE A 56  ? O ILE A 55  
A 3 4 N ALA A 55  ? N ALA A 54  O MET A 100 ? O MET A 99  
A 4 5 O ASP A 95  ? O ASP A 94  N LYS A 92  ? N LYS A 91  
B 1 2 N GLY A 106 ? N GLY A 105 O LEU A 155 ? O LEU A 154 
B 2 3 N LEU A 154 ? N LEU A 153 O LYS A 162 ? O LYS A 161 
C 1 2 N LEU B 31  ? N LEU B 30  O LYS B 44  ? O LYS B 43  
C 2 3 N ALA B 45  ? N ALA B 44  O VAL B 54  ? O VAL B 53  
C 3 4 N ALA B 55  ? N ALA B 54  O MET B 100 ? O MET B 99  
C 4 5 O TRP B 97  ? O TRP B 96  N TYR B 90  ? N TYR B 89  
D 1 2 N GLY B 106 ? N GLY B 105 O LEU B 155 ? O LEU B 154 
D 2 3 N LEU B 154 ? N LEU B 153 O LYS B 162 ? O LYS B 161 
E 1 2 N ASP C 29  ? N ASP C 28  O ILE C 46  ? O ILE C 45  
E 2 3 N PHE C 43  ? N PHE C 42  O ILE C 56  ? O ILE C 55  
E 3 4 N VAL C 59  ? N VAL C 58  O LEU C 96  ? O LEU C 95  
E 4 5 O VAL C 99  ? O VAL C 98  N GLY C 88  ? N GLY C 87  
F 1 2 N GLY C 106 ? N GLY C 105 O LEU C 155 ? O LEU C 154 
F 2 3 N LEU C 154 ? N LEU C 153 O LYS C 162 ? O LYS C 161 
G 1 2 N LEU D 31  ? N LEU D 30  O LYS D 44  ? O LYS D 43  
G 2 3 N ALA D 45  ? N ALA D 44  O VAL D 54  ? O VAL D 53  
G 3 4 N VAL D 59  ? N VAL D 58  O LEU D 96  ? O LEU D 95  
G 4 5 O TRP D 97  ? O TRP D 96  N TYR D 90  ? N TYR D 89  
H 1 2 N GLY D 106 ? N GLY D 105 O LEU D 155 ? O LEU D 154 
H 2 3 N LEU D 154 ? N LEU D 153 O LYS D 162 ? O LYS D 161 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE ANP A 501' 
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG A 502'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 503' 
AC4 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE ANP B 501' 
AC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG B 502'  
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 503' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 B 504' 
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 B 505' 
AC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 B 506' 
BC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE ANP C 501' 
BC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG C 502'  
BC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 C 503' 
BC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE NA C 504'  
BC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA C 505'  
BC6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE ANP D 501' 
BC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG D 502'  
BC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 D 503' 
BC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 D 504' 
CC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 D 505' 
CC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE NA D 506'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 12 LEU A 34  ? LEU A 33  . ? 1_555 ? 
2   AC1 12 GLU A 36  ? GLU A 35  . ? 1_555 ? 
3   AC1 12 GLY A 37  ? GLY A 36  . ? 1_555 ? 
4   AC1 12 VAL A 42  ? VAL A 41  . ? 1_555 ? 
5   AC1 12 ALA A 55  ? ALA A 54  . ? 1_555 ? 
6   AC1 12 LYS A 57  ? LYS A 56  . ? 1_555 ? 
7   AC1 12 MET A 100 ? MET A 99  . ? 1_555 ? 
8   AC1 12 GLU A 101 ? GLU A 100 . ? 1_555 ? 
9   AC1 12 CYS A 103 ? CYS A 102 . ? 1_555 ? 
10  AC1 12 ASP A 110 ? ASP A 109 . ? 1_555 ? 
11  AC1 12 ASP A 165 ? ASP A 164 . ? 1_555 ? 
12  AC1 12 MG  J .   ? MG  A 502 . ? 1_555 ? 
13  AC2 2  ASP A 165 ? ASP A 164 . ? 1_555 ? 
14  AC2 2  ANP I .   ? ANP A 501 . ? 1_555 ? 
15  AC3 5  ARG A 146 ? ARG A 145 . ? 1_555 ? 
16  AC3 5  ALA A 169 ? ALA A 168 . ? 1_555 ? 
17  AC3 5  GLY A 170 ? GLY A 169 . ? 1_555 ? 
18  AC3 5  GLY A 198 ? GLY A 197 . ? 1_555 ? 
19  AC3 5  TYR A 199 ? TYR A 198 . ? 1_555 ? 
20  AC4 11 GLY B 37  ? GLY B 36  . ? 1_555 ? 
21  AC4 11 SER B 38  ? SER B 37  . ? 1_555 ? 
22  AC4 11 GLY B 40  ? GLY B 39  . ? 1_555 ? 
23  AC4 11 ALA B 55  ? ALA B 54  . ? 1_555 ? 
24  AC4 11 LYS B 57  ? LYS B 56  . ? 1_555 ? 
25  AC4 11 MET B 100 ? MET B 99  . ? 1_555 ? 
26  AC4 11 GLU B 101 ? GLU B 100 . ? 1_555 ? 
27  AC4 11 CYS B 103 ? CYS B 102 . ? 1_555 ? 
28  AC4 11 ASP B 110 ? ASP B 109 . ? 1_555 ? 
29  AC4 11 ASP B 165 ? ASP B 164 . ? 1_555 ? 
30  AC4 11 MG  M .   ? MG  B 502 . ? 1_555 ? 
31  AC5 2  ASP B 165 ? ASP B 164 . ? 1_555 ? 
32  AC5 2  ANP L .   ? ANP B 501 . ? 1_555 ? 
33  AC6 4  ARG B 146 ? ARG B 145 . ? 1_555 ? 
34  AC6 4  ALA B 169 ? ALA B 168 . ? 1_555 ? 
35  AC6 4  GLY B 170 ? GLY B 169 . ? 1_555 ? 
36  AC6 4  TYR B 199 ? TYR B 198 . ? 1_555 ? 
37  AC7 5  LEU B 15  ? LEU B 14  . ? 1_555 ? 
38  AC7 5  SER B 16  ? SER B 15  . ? 1_555 ? 
39  AC7 5  SER B 19  ? SER B 18  . ? 1_555 ? 
40  AC7 5  HIS B 47  ? HIS B 46  . ? 1_555 ? 
41  AC7 5  GLU B 49  ? GLU B 48  . ? 1_555 ? 
42  AC8 5  ASP B 122 ? ASP B 121 . ? 1_555 ? 
43  AC8 5  ALA B 125 ? ALA B 124 . ? 1_555 ? 
44  AC8 5  PHE B 278 ? PHE B 277 . ? 1_555 ? 
45  AC8 5  ASN B 281 ? ASN B 280 . ? 1_555 ? 
46  AC8 5  ALA B 282 ? ALA B 281 . ? 1_555 ? 
47  AC9 7  LEU B 20  ? LEU B 19  . ? 1_555 ? 
48  AC9 7  THR B 21  ? THR B 20  . ? 1_555 ? 
49  AC9 7  LYS B 22  ? LYS B 21  . ? 1_555 ? 
50  AC9 7  GLN B 23  ? GLN B 22  . ? 1_555 ? 
51  AC9 7  TYR B 90  ? TYR B 89  . ? 1_555 ? 
52  AC9 7  PHE B 91  ? PHE B 90  . ? 1_555 ? 
53  AC9 7  ASN E 15  ? ASN E 379 . ? 1_555 ? 
54  BC1 8  VAL C 42  ? VAL C 41  . ? 1_555 ? 
55  BC1 8  ALA C 55  ? ALA C 54  . ? 1_555 ? 
56  BC1 8  LYS C 57  ? LYS C 56  . ? 1_555 ? 
57  BC1 8  GLU C 101 ? GLU C 100 . ? 1_555 ? 
58  BC1 8  CYS C 103 ? CYS C 102 . ? 1_555 ? 
59  BC1 8  ASP C 110 ? ASP C 109 . ? 1_555 ? 
60  BC1 8  ASP C 165 ? ASP C 164 . ? 1_555 ? 
61  BC1 8  MG  S .   ? MG  C 502 . ? 1_555 ? 
62  BC2 2  ASP C 165 ? ASP C 164 . ? 1_555 ? 
63  BC2 2  ANP R .   ? ANP C 501 . ? 1_555 ? 
64  BC3 5  ARG C 146 ? ARG C 145 . ? 1_555 ? 
65  BC3 5  ALA C 169 ? ALA C 168 . ? 1_555 ? 
66  BC3 5  GLY C 170 ? GLY C 169 . ? 1_555 ? 
67  BC3 5  GLY C 198 ? GLY C 197 . ? 1_555 ? 
68  BC3 5  TYR C 199 ? TYR C 198 . ? 1_555 ? 
69  BC4 1  ASP C 122 ? ASP C 121 . ? 1_555 ? 
70  BC5 3  TYR C 90  ? TYR C 89  . ? 1_555 ? 
71  BC5 3  PHE C 91  ? PHE C 90  . ? 1_555 ? 
72  BC5 3  ASN H 15  ? ASN H 379 . ? 1_555 ? 
73  BC6 12 GLU D 36  ? GLU D 35  . ? 1_555 ? 
74  BC6 12 GLY D 37  ? GLY D 36  . ? 1_555 ? 
75  BC6 12 SER D 38  ? SER D 37  . ? 1_555 ? 
76  BC6 12 GLY D 40  ? GLY D 39  . ? 1_555 ? 
77  BC6 12 VAL D 42  ? VAL D 41  . ? 1_555 ? 
78  BC6 12 LYS D 57  ? LYS D 56  . ? 1_555 ? 
79  BC6 12 GLU D 101 ? GLU D 100 . ? 1_555 ? 
80  BC6 12 CYS D 103 ? CYS D 102 . ? 1_555 ? 
81  BC6 12 ASP D 110 ? ASP D 109 . ? 1_555 ? 
82  BC6 12 LEU D 154 ? LEU D 153 . ? 1_555 ? 
83  BC6 12 ASP D 165 ? ASP D 164 . ? 1_555 ? 
84  BC6 12 MG  X .   ? MG  D 502 . ? 1_555 ? 
85  BC7 2  ASP D 165 ? ASP D 164 . ? 1_555 ? 
86  BC7 2  ANP W .   ? ANP D 501 . ? 1_555 ? 
87  BC8 4  ARG D 146 ? ARG D 145 . ? 1_555 ? 
88  BC8 4  ALA D 169 ? ALA D 168 . ? 1_555 ? 
89  BC8 4  GLY D 170 ? GLY D 169 . ? 1_555 ? 
90  BC8 4  TYR D 199 ? TYR D 198 . ? 1_555 ? 
91  BC9 5  LEU D 15  ? LEU D 14  . ? 1_555 ? 
92  BC9 5  SER D 16  ? SER D 15  . ? 1_555 ? 
93  BC9 5  SER D 19  ? SER D 18  . ? 1_555 ? 
94  BC9 5  HIS D 47  ? HIS D 46  . ? 1_555 ? 
95  BC9 5  GLU D 49  ? GLU D 48  . ? 1_555 ? 
96  CC1 4  LEU D 20  ? LEU D 19  . ? 1_555 ? 
97  CC1 4  THR D 21  ? THR D 20  . ? 1_555 ? 
98  CC1 4  PHE D 91  ? PHE D 90  . ? 1_555 ? 
99  CC1 4  ASN G 15  ? ASN G 379 . ? 1_555 ? 
100 CC2 1  ASP D 122 ? ASP D 121 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4LGD 
_atom_sites.fract_transf_matrix[1][1]   0.008104 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001531 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004217 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010616 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
H  
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N      . GLU A  1 17  ? 47.367  -70.761 23.882  1.00 226.49 ? 16  GLU A N      1 
ATOM   2     C  CA     . GLU A  1 17  ? 47.830  -70.079 22.680  1.00 236.25 ? 16  GLU A CA     1 
ATOM   3     C  C      . GLU A  1 17  ? 47.968  -71.056 21.516  1.00 252.52 ? 16  GLU A C      1 
ATOM   4     O  O      . GLU A  1 17  ? 47.945  -70.655 20.352  1.00 253.93 ? 16  GLU A O      1 
ATOM   5     C  CB     . GLU A  1 17  ? 49.169  -69.387 22.944  1.00 234.49 ? 16  GLU A CB     1 
ATOM   6     C  CG     . GLU A  1 17  ? 49.736  -68.661 21.735  1.00 236.63 ? 16  GLU A CG     1 
ATOM   7     C  CD     . GLU A  1 17  ? 51.002  -67.891 22.056  1.00 241.39 ? 16  GLU A CD     1 
ATOM   8     O  OE1    . GLU A  1 17  ? 50.983  -67.082 23.008  1.00 242.42 ? 16  GLU A OE1    1 
ATOM   9     O  OE2    . GLU A  1 17  ? 52.017  -68.096 21.358  1.00 244.33 ? 16  GLU A OE2    1 
ATOM   10    H  HA     . GLU A  1 17  ? 47.177  -69.393 22.428  1.00 283.50 ? 16  GLU A HA     1 
ATOM   11    H  HB2    . GLU A  1 17  ? 49.050  -68.735 23.652  1.00 281.39 ? 16  GLU A HB2    1 
ATOM   12    H  HB3    . GLU A  1 17  ? 49.817  -70.055 23.219  1.00 281.39 ? 16  GLU A HB3    1 
ATOM   13    H  HG2    . GLU A  1 17  ? 49.947  -69.310 21.046  1.00 283.95 ? 16  GLU A HG2    1 
ATOM   14    H  HG3    . GLU A  1 17  ? 49.076  -68.030 21.407  1.00 283.95 ? 16  GLU A HG3    1 
ATOM   15    N  N      . ASP A  1 18  ? 48.108  -72.338 21.836  1.00 261.72 ? 17  ASP A N      1 
ATOM   16    C  CA     . ASP A  1 18  ? 48.241  -73.373 20.818  1.00 267.61 ? 17  ASP A CA     1 
ATOM   17    C  C      . ASP A  1 18  ? 46.920  -73.584 20.081  1.00 268.78 ? 17  ASP A C      1 
ATOM   18    O  O      . ASP A  1 18  ? 46.908  -73.918 18.897  1.00 266.53 ? 17  ASP A O      1 
ATOM   19    C  CB     . ASP A  1 18  ? 48.697  -74.690 21.450  1.00 271.32 ? 17  ASP A CB     1 
ATOM   20    C  CG     . ASP A  1 18  ? 50.070  -74.589 22.087  1.00 272.87 ? 17  ASP A CG     1 
ATOM   21    O  OD1    . ASP A  1 18  ? 50.883  -73.759 21.629  1.00 273.55 ? 17  ASP A OD1    1 
ATOM   22    O  OD2    . ASP A  1 18  ? 50.337  -75.344 23.046  1.00 273.46 ? 17  ASP A OD2    1 
ATOM   23    H  H      . ASP A  1 18  ? 48.130  -72.637 22.643  1.00 314.06 ? 17  ASP A H      1 
ATOM   24    H  HA     . ASP A  1 18  ? 48.916  -73.097 20.163  1.00 321.13 ? 17  ASP A HA     1 
ATOM   25    H  HB2    . ASP A  1 18  ? 48.064  -74.946 22.139  1.00 325.58 ? 17  ASP A HB2    1 
ATOM   26    H  HB3    . ASP A  1 18  ? 48.735  -75.374 20.763  1.00 325.58 ? 17  ASP A HB3    1 
ATOM   27    N  N      . SER A  1 19  ? 45.811  -73.390 20.789  1.00 270.97 ? 18  SER A N      1 
ATOM   28    C  CA     . SER A  1 19  ? 44.487  -73.553 20.198  1.00 270.22 ? 18  SER A CA     1 
ATOM   29    C  C      . SER A  1 19  ? 44.163  -72.400 19.250  1.00 271.20 ? 18  SER A C      1 
ATOM   30    O  O      . SER A  1 19  ? 43.245  -72.497 18.436  1.00 276.79 ? 18  SER A O      1 
ATOM   31    C  CB     . SER A  1 19  ? 43.421  -73.648 21.293  1.00 264.24 ? 18  SER A CB     1 
ATOM   32    O  OG     . SER A  1 19  ? 42.137  -73.890 20.741  1.00 262.05 ? 18  SER A OG     1 
ATOM   33    H  H      . SER A  1 19  ? 45.799  -73.162 21.618  1.00 325.16 ? 18  SER A H      1 
ATOM   34    H  HA     . SER A  1 19  ? 44.468  -74.386 19.682  1.00 324.27 ? 18  SER A HA     1 
ATOM   35    H  HB2    . SER A  1 19  ? 43.649  -74.376 21.891  1.00 317.08 ? 18  SER A HB2    1 
ATOM   36    H  HB3    . SER A  1 19  ? 43.399  -72.811 21.783  1.00 317.08 ? 18  SER A HB3    1 
ATOM   37    H  HG     . SER A  1 19  ? 42.188  -73.939 19.924  1.00 314.46 ? 18  SER A HG     1 
ATOM   38    N  N      . LEU A  1 20  ? 44.916  -71.310 19.363  1.00 260.96 ? 19  LEU A N      1 
ATOM   39    C  CA     . LEU A  1 20  ? 44.734  -70.153 18.492  1.00 247.21 ? 19  LEU A CA     1 
ATOM   40    C  C      . LEU A  1 20  ? 45.407  -70.366 17.139  1.00 242.93 ? 19  LEU A C      1 
ATOM   41    O  O      . LEU A  1 20  ? 45.005  -69.776 16.137  1.00 237.11 ? 19  LEU A O      1 
ATOM   42    C  CB     . LEU A  1 20  ? 45.294  -68.895 19.156  1.00 239.92 ? 19  LEU A CB     1 
ATOM   43    C  CG     . LEU A  1 20  ? 44.510  -68.358 20.355  1.00 227.55 ? 19  LEU A CG     1 
ATOM   44    C  CD1    . LEU A  1 20  ? 45.272  -67.223 21.007  1.00 218.89 ? 19  LEU A CD1    1 
ATOM   45    C  CD2    . LEU A  1 20  ? 43.127  -67.890 19.932  1.00 220.03 ? 19  LEU A CD2    1 
ATOM   46    H  H      . LEU A  1 20  ? 45.544  -71.214 19.943  1.00 313.15 ? 19  LEU A H      1 
ATOM   47    H  HA     . LEU A  1 20  ? 43.776  -70.016 18.337  1.00 296.65 ? 19  LEU A HA     1 
ATOM   48    H  HB2    . LEU A  1 20  ? 46.193  -69.088 19.463  1.00 287.90 ? 19  LEU A HB2    1 
ATOM   49    H  HB3    . LEU A  1 20  ? 45.325  -68.189 18.492  1.00 287.90 ? 19  LEU A HB3    1 
ATOM   50    H  HG     . LEU A  1 20  ? 44.403  -69.066 21.009  1.00 273.05 ? 19  LEU A HG     1 
ATOM   51    H  HD11   . LEU A  1 20  ? 44.768  -66.898 21.756  1.00 262.66 ? 19  LEU A HD11   1 
ATOM   52    H  HD12   . LEU A  1 20  ? 46.125  -67.549 21.303  1.00 262.66 ? 19  LEU A HD12   1 
ATOM   53    H  HD13   . LEU A  1 20  ? 45.395  -66.520 20.365  1.00 262.66 ? 19  LEU A HD13   1 
ATOM   54    H  HD21   . LEU A  1 20  ? 42.660  -67.559 20.703  1.00 264.04 ? 19  LEU A HD21   1 
ATOM   55    H  HD22   . LEU A  1 20  ? 43.220  -67.191 19.280  1.00 264.04 ? 19  LEU A HD22   1 
ATOM   56    H  HD23   . LEU A  1 20  ? 42.649  -68.631 19.552  1.00 264.04 ? 19  LEU A HD23   1 
ATOM   57    N  N      . THR A  1 21  ? 46.433  -71.211 17.118  1.00 244.99 ? 20  THR A N      1 
ATOM   58    C  CA     . THR A  1 21  ? 47.162  -71.499 15.889  1.00 235.42 ? 20  THR A CA     1 
ATOM   59    C  C      . THR A  1 21  ? 46.431  -72.530 15.033  1.00 234.24 ? 20  THR A C      1 
ATOM   60    O  O      . THR A  1 21  ? 46.647  -72.607 13.823  1.00 238.59 ? 20  THR A O      1 
ATOM   61    C  CB     . THR A  1 21  ? 48.583  -72.011 16.188  1.00 224.45 ? 20  THR A CB     1 
ATOM   62    O  OG1    . THR A  1 21  ? 48.520  -73.070 17.152  1.00 219.73 ? 20  THR A OG1    1 
ATOM   63    C  CG2    . THR A  1 21  ? 49.450  -70.887 16.734  1.00 219.83 ? 20  THR A CG2    1 
ATOM   64    H  H      . THR A  1 21  ? 46.729  -71.632 17.807  1.00 293.99 ? 20  THR A H      1 
ATOM   65    H  HA     . THR A  1 21  ? 47.242  -70.674 15.366  1.00 282.51 ? 20  THR A HA     1 
ATOM   66    H  HB     . THR A  1 21  ? 48.987  -72.341 15.371  1.00 269.34 ? 20  THR A HB     1 
ATOM   67    H  HG1    . THR A  1 21  ? 48.068  -73.688 16.860  1.00 263.67 ? 20  THR A HG1    1 
ATOM   68    H  HG21   . THR A  1 21  ? 50.333  -71.214 16.918  1.00 263.79 ? 20  THR A HG21   1 
ATOM   69    H  HG22   . THR A  1 21  ? 49.508  -70.176 16.091  1.00 263.79 ? 20  THR A HG22   1 
ATOM   70    H  HG23   . THR A  1 21  ? 49.069  -70.543 17.546  1.00 263.79 ? 20  THR A HG23   1 
ATOM   71    N  N      . LYS A  1 22  ? 45.568  -73.322 15.661  1.00 228.27 ? 21  LYS A N      1 
ATOM   72    C  CA     . LYS A  1 22  ? 44.778  -74.310 14.935  1.00 225.95 ? 21  LYS A CA     1 
ATOM   73    C  C      . LYS A  1 22  ? 43.663  -73.620 14.159  1.00 249.83 ? 21  LYS A C      1 
ATOM   74    O  O      . LYS A  1 22  ? 43.296  -72.485 14.462  1.00 250.13 ? 21  LYS A O      1 
ATOM   75    C  CB     . LYS A  1 22  ? 44.179  -75.337 15.898  1.00 210.39 ? 21  LYS A CB     1 
ATOM   76    C  CG     . LYS A  1 22  ? 45.189  -75.980 16.833  1.00 209.46 ? 21  LYS A CG     1 
ATOM   77    C  CD     . LYS A  1 22  ? 44.814  -77.419 17.164  1.00 204.99 ? 21  LYS A CD     1 
ATOM   78    C  CE     . LYS A  1 22  ? 43.415  -77.520 17.752  1.00 199.99 ? 21  LYS A CE     1 
ATOM   79    N  NZ     . LYS A  1 22  ? 43.042  -78.929 18.053  1.00 199.50 ? 21  LYS A NZ     1 
ATOM   80    H  H      . LYS A  1 22  ? 45.421  -73.308 16.508  1.00 273.92 ? 21  LYS A H      1 
ATOM   81    H  HA     . LYS A  1 22  ? 45.353  -74.782 14.297  1.00 271.14 ? 21  LYS A HA     1 
ATOM   82    H  HB2    . LYS A  1 22  ? 43.509  -74.897 16.445  1.00 252.46 ? 21  LYS A HB2    1 
ATOM   83    H  HB3    . LYS A  1 22  ? 43.765  -76.045 15.379  1.00 252.46 ? 21  LYS A HB3    1 
ATOM   84    H  HG2    . LYS A  1 22  ? 46.061  -75.984 16.408  1.00 251.35 ? 21  LYS A HG2    1 
ATOM   85    H  HG3    . LYS A  1 22  ? 45.223  -75.477 17.662  1.00 251.35 ? 21  LYS A HG3    1 
ATOM   86    H  HD2    . LYS A  1 22  ? 44.840  -77.950 16.352  1.00 245.98 ? 21  LYS A HD2    1 
ATOM   87    H  HD3    . LYS A  1 22  ? 45.442  -77.771 17.814  1.00 245.98 ? 21  LYS A HD3    1 
ATOM   88    H  HE2    . LYS A  1 22  ? 43.380  -77.013 18.578  1.00 239.98 ? 21  LYS A HE2    1 
ATOM   89    H  HE3    . LYS A  1 22  ? 42.775  -77.166 17.115  1.00 239.98 ? 21  LYS A HE3    1 
ATOM   90    H  HZ1    . LYS A  1 22  ? 42.221  -78.959 18.396  1.00 239.40 ? 21  LYS A HZ1    1 
ATOM   91    H  HZ2    . LYS A  1 22  ? 43.063  -79.415 17.308  1.00 239.40 ? 21  LYS A HZ2    1 
ATOM   92    H  HZ3    . LYS A  1 22  ? 43.613  -79.275 18.641  1.00 239.40 ? 21  LYS A HZ3    1 
ATOM   93    N  N      . GLN A  1 23  ? 43.128  -74.309 13.157  1.00 273.35 ? 22  GLN A N      1 
ATOM   94    C  CA     . GLN A  1 23  ? 42.021  -73.773 12.373  1.00 295.59 ? 22  GLN A CA     1 
ATOM   95    C  C      . GLN A  1 23  ? 40.724  -73.836 13.177  1.00 307.46 ? 22  GLN A C      1 
ATOM   96    O  O      . GLN A  1 23  ? 40.504  -74.784 13.931  1.00 311.74 ? 22  GLN A O      1 
ATOM   97    C  CB     . GLN A  1 23  ? 41.874  -74.541 11.059  1.00 305.12 ? 22  GLN A CB     1 
ATOM   98    C  CG     . GLN A  1 23  ? 42.777  -74.031 9.941   1.00 314.15 ? 22  GLN A CG     1 
ATOM   99    C  CD     . GLN A  1 23  ? 42.096  -73.002 9.054   1.00 321.17 ? 22  GLN A CD     1 
ATOM   100   O  OE1    . GLN A  1 23  ? 40.869  -72.961 8.959   1.00 324.32 ? 22  GLN A OE1    1 
ATOM   101   N  NE2    . GLN A  1 23  ? 42.892  -72.167 8.396   1.00 322.66 ? 22  GLN A NE2    1 
ATOM   102   H  H      . GLN A  1 23  ? 43.388  -75.090 12.910  1.00 328.02 ? 22  GLN A H      1 
ATOM   103   H  HA     . GLN A  1 23  ? 42.203  -72.834 12.160  1.00 354.71 ? 22  GLN A HA     1 
ATOM   104   H  HB2    . GLN A  1 23  ? 42.093  -75.473 11.215  1.00 366.15 ? 22  GLN A HB2    1 
ATOM   105   H  HB3    . GLN A  1 23  ? 40.956  -74.466 10.755  1.00 366.15 ? 22  GLN A HB3    1 
ATOM   106   H  HG2    . GLN A  1 23  ? 43.561  -73.615 10.334  1.00 376.98 ? 22  GLN A HG2    1 
ATOM   107   H  HG3    . GLN A  1 23  ? 43.043  -74.779 9.384   1.00 376.98 ? 22  GLN A HG3    1 
ATOM   108   H  HE21   . GLN A  1 23  ? 43.745  -72.226 8.486   1.00 387.19 ? 22  GLN A HE21   1 
ATOM   109   H  HE22   . GLN A  1 23  ? 42.554  -71.567 7.881   1.00 387.19 ? 22  GLN A HE22   1 
ATOM   110   N  N      . PRO A  1 24  ? 39.861  -72.821 13.014  1.00 311.24 ? 23  PRO A N      1 
ATOM   111   C  CA     . PRO A  1 24  ? 38.619  -72.674 13.785  1.00 307.66 ? 23  PRO A CA     1 
ATOM   112   C  C      . PRO A  1 24  ? 37.721  -73.913 13.795  1.00 302.26 ? 23  PRO A C      1 
ATOM   113   O  O      . PRO A  1 24  ? 37.382  -74.400 14.873  1.00 302.56 ? 23  PRO A O      1 
ATOM   114   C  CB     . PRO A  1 24  ? 37.904  -71.503 13.093  1.00 307.96 ? 23  PRO A CB     1 
ATOM   115   C  CG     . PRO A  1 24  ? 38.633  -71.281 11.802  1.00 310.06 ? 23  PRO A CG     1 
ATOM   116   C  CD     . PRO A  1 24  ? 40.030  -71.728 12.044  1.00 312.09 ? 23  PRO A CD     1 
ATOM   117   H  HA     . PRO A  1 24  ? 38.826  -72.422 14.710  1.00 369.19 ? 23  PRO A HA     1 
ATOM   118   H  HB2    . PRO A  1 24  ? 36.979  -71.742 12.925  1.00 369.55 ? 23  PRO A HB2    1 
ATOM   119   H  HB3    . PRO A  1 24  ? 37.956  -70.714 13.654  1.00 369.55 ? 23  PRO A HB3    1 
ATOM   120   H  HG2    . PRO A  1 24  ? 38.222  -71.810 11.101  1.00 372.07 ? 23  PRO A HG2    1 
ATOM   121   H  HG3    . PRO A  1 24  ? 38.611  -70.338 11.575  1.00 372.07 ? 23  PRO A HG3    1 
ATOM   122   H  HD2    . PRO A  1 24  ? 40.427  -72.060 11.224  1.00 374.50 ? 23  PRO A HD2    1 
ATOM   123   H  HD3    . PRO A  1 24  ? 40.554  -71.009 12.430  1.00 374.50 ? 23  PRO A HD3    1 
ATOM   124   N  N      . GLU A  1 25  ? 37.341  -74.409 12.620  1.00 291.76 ? 24  GLU A N      1 
ATOM   125   C  CA     . GLU A  1 25  ? 36.408  -75.533 12.531  1.00 272.61 ? 24  GLU A CA     1 
ATOM   126   C  C      . GLU A  1 25  ? 36.897  -76.771 13.282  1.00 262.69 ? 24  GLU A C      1 
ATOM   127   O  O      . GLU A  1 25  ? 36.103  -77.650 13.621  1.00 256.66 ? 24  GLU A O      1 
ATOM   128   C  CB     . GLU A  1 25  ? 36.138  -75.901 11.069  1.00 259.38 ? 24  GLU A CB     1 
ATOM   129   C  CG     . GLU A  1 25  ? 35.288  -74.886 10.311  1.00 246.54 ? 24  GLU A CG     1 
ATOM   130   C  CD     . GLU A  1 25  ? 36.110  -73.926 9.470   1.00 236.78 ? 24  GLU A CD     1 
ATOM   131   O  OE1    . GLU A  1 25  ? 37.356  -73.966 9.552   1.00 236.33 ? 24  GLU A OE1    1 
ATOM   132   O  OE2    . GLU A  1 25  ? 35.504  -73.130 8.722   1.00 229.31 ? 24  GLU A OE2    1 
ATOM   133   H  H      . GLU A  1 25  ? 37.608  -74.113 11.858  1.00 350.11 ? 24  GLU A H      1 
ATOM   134   H  HA     . GLU A  1 25  ? 35.555  -75.262 12.931  1.00 327.13 ? 24  GLU A HA     1 
ATOM   135   H  HB2    . GLU A  1 25  ? 36.986  -75.978 10.606  1.00 311.26 ? 24  GLU A HB2    1 
ATOM   136   H  HB3    . GLU A  1 25  ? 35.673  -76.752 11.043  1.00 311.26 ? 24  GLU A HB3    1 
ATOM   137   H  HG2    . GLU A  1 25  ? 34.684  -75.361 9.719   1.00 295.85 ? 24  GLU A HG2    1 
ATOM   138   H  HG3    . GLU A  1 25  ? 34.779  -74.362 10.950  1.00 295.85 ? 24  GLU A HG3    1 
ATOM   139   N  N      . GLU A  1 26  ? 38.198  -76.838 13.542  1.00 257.09 ? 25  GLU A N      1 
ATOM   140   C  CA     . GLU A  1 26  ? 38.785  -78.003 14.196  1.00 249.07 ? 25  GLU A CA     1 
ATOM   141   C  C      . GLU A  1 26  ? 38.793  -77.863 15.718  1.00 236.57 ? 25  GLU A C      1 
ATOM   142   O  O      . GLU A  1 26  ? 39.091  -78.821 16.433  1.00 220.11 ? 25  GLU A O      1 
ATOM   143   C  CB     . GLU A  1 26  ? 40.208  -78.232 13.683  1.00 248.44 ? 25  GLU A CB     1 
ATOM   144   C  CG     . GLU A  1 26  ? 40.314  -78.256 12.164  1.00 239.87 ? 25  GLU A CG     1 
ATOM   145   C  CD     . GLU A  1 26  ? 41.699  -78.637 11.676  1.00 232.04 ? 25  GLU A CD     1 
ATOM   146   O  OE1    . GLU A  1 26  ? 42.682  -78.008 12.120  1.00 228.89 ? 25  GLU A OE1    1 
ATOM   147   O  OE2    . GLU A  1 26  ? 41.803  -79.567 10.850  1.00 232.17 ? 25  GLU A OE2    1 
ATOM   148   H  H      . GLU A  1 26  ? 38.765  -76.221 13.350  1.00 308.51 ? 25  GLU A H      1 
ATOM   149   H  HA     . GLU A  1 26  ? 38.253  -78.795 13.970  1.00 298.89 ? 25  GLU A HA     1 
ATOM   150   H  HB2    . GLU A  1 26  ? 40.777  -77.517 14.009  1.00 298.13 ? 25  GLU A HB2    1 
ATOM   151   H  HB3    . GLU A  1 26  ? 40.527  -79.085 14.016  1.00 298.13 ? 25  GLU A HB3    1 
ATOM   152   H  HG2    . GLU A  1 26  ? 39.684  -78.905 11.813  1.00 287.85 ? 25  GLU A HG2    1 
ATOM   153   H  HG3    . GLU A  1 26  ? 40.107  -77.373 11.819  1.00 287.85 ? 25  GLU A HG3    1 
ATOM   154   N  N      . VAL A  1 27  ? 38.467  -76.671 16.209  1.00 242.03 ? 26  VAL A N      1 
ATOM   155   C  CA     . VAL A  1 27  ? 38.428  -76.421 17.646  1.00 239.94 ? 26  VAL A CA     1 
ATOM   156   C  C      . VAL A  1 27  ? 36.991  -76.332 18.156  1.00 227.97 ? 26  VAL A C      1 
ATOM   157   O  O      . VAL A  1 27  ? 36.696  -76.756 19.273  1.00 221.94 ? 26  VAL A O      1 
ATOM   158   C  CB     . VAL A  1 27  ? 39.166  -75.116 18.009  1.00 244.48 ? 26  VAL A CB     1 
ATOM   159   C  CG1    . VAL A  1 27  ? 39.215  -74.933 19.519  1.00 242.97 ? 26  VAL A CG1    1 
ATOM   160   C  CG2    . VAL A  1 27  ? 40.571  -75.120 17.427  1.00 249.19 ? 26  VAL A CG2    1 
ATOM   161   H  H      . VAL A  1 27  ? 38.264  -75.988 15.729  1.00 290.43 ? 26  VAL A H      1 
ATOM   162   H  HA     . VAL A  1 27  ? 38.870  -77.160 18.112  1.00 287.93 ? 26  VAL A HA     1 
ATOM   163   H  HB     . VAL A  1 27  ? 38.680  -74.356 17.626  1.00 293.38 ? 26  VAL A HB     1 
ATOM   164   H  HG11   . VAL A  1 27  ? 39.678  -74.117 19.720  1.00 291.57 ? 26  VAL A HG11   1 
ATOM   165   H  HG12   . VAL A  1 27  ? 38.318  -74.894 19.858  1.00 291.57 ? 26  VAL A HG12   1 
ATOM   166   H  HG13   . VAL A  1 27  ? 39.680  -75.678 19.908  1.00 291.57 ? 26  VAL A HG13   1 
ATOM   167   H  HG21   . VAL A  1 27  ? 41.010  -74.300 17.665  1.00 299.03 ? 26  VAL A HG21   1 
ATOM   168   H  HG22   . VAL A  1 27  ? 41.055  -75.867 17.785  1.00 299.03 ? 26  VAL A HG22   1 
ATOM   169   H  HG23   . VAL A  1 27  ? 40.512  -75.195 16.471  1.00 299.03 ? 26  VAL A HG23   1 
ATOM   170   N  N      . PHE A  1 28  ? 36.101  -75.781 17.334  1.00 225.61 ? 27  PHE A N      1 
ATOM   171   C  CA     . PHE A  1 28  ? 34.708  -75.591 17.727  1.00 226.20 ? 27  PHE A CA     1 
ATOM   172   C  C      . PHE A  1 28  ? 33.746  -76.216 16.720  1.00 220.63 ? 27  PHE A C      1 
ATOM   173   O  O      . PHE A  1 28  ? 33.987  -76.182 15.513  1.00 220.74 ? 27  PHE A O      1 
ATOM   174   C  CB     . PHE A  1 28  ? 34.391  -74.098 17.859  1.00 227.85 ? 27  PHE A CB     1 
ATOM   175   C  CG     . PHE A  1 28  ? 35.314  -73.358 18.785  1.00 216.97 ? 27  PHE A CG     1 
ATOM   176   C  CD1    . PHE A  1 28  ? 35.109  -73.381 20.154  1.00 210.87 ? 27  PHE A CD1    1 
ATOM   177   C  CD2    . PHE A  1 28  ? 36.383  -72.631 18.285  1.00 210.38 ? 27  PHE A CD2    1 
ATOM   178   C  CE1    . PHE A  1 28  ? 35.955  -72.699 21.007  1.00 207.37 ? 27  PHE A CE1    1 
ATOM   179   C  CE2    . PHE A  1 28  ? 37.232  -71.947 19.133  1.00 204.66 ? 27  PHE A CE2    1 
ATOM   180   C  CZ     . PHE A  1 28  ? 37.017  -71.981 20.496  1.00 206.93 ? 27  PHE A CZ     1 
ATOM   181   H  H      . PHE A  1 28  ? 36.281  -75.507 16.538  1.00 270.73 ? 27  PHE A H      1 
ATOM   182   H  HA     . PHE A  1 28  ? 34.559  -76.015 18.598  1.00 271.44 ? 27  PHE A HA     1 
ATOM   183   H  HB2    . PHE A  1 28  ? 34.458  -73.687 16.983  1.00 273.42 ? 27  PHE A HB2    1 
ATOM   184   H  HB3    . PHE A  1 28  ? 33.489  -74.000 18.200  1.00 273.42 ? 27  PHE A HB3    1 
ATOM   185   H  HD1    . PHE A  1 28  ? 34.395  -73.864 20.503  1.00 253.04 ? 27  PHE A HD1    1 
ATOM   186   H  HD2    . PHE A  1 28  ? 36.532  -72.606 17.367  1.00 252.45 ? 27  PHE A HD2    1 
ATOM   187   H  HE1    . PHE A  1 28  ? 35.808  -72.722 21.925  1.00 248.84 ? 27  PHE A HE1    1 
ATOM   188   H  HE2    . PHE A  1 28  ? 37.947  -71.464 18.786  1.00 245.59 ? 27  PHE A HE2    1 
ATOM   189   H  HZ     . PHE A  1 28  ? 37.588  -71.521 21.069  1.00 248.31 ? 27  PHE A HZ     1 
ATOM   190   N  N      . ASP A  1 29  ? 32.656  -76.785 17.228  1.00 216.81 ? 28  ASP A N      1 
ATOM   191   C  CA     . ASP A  1 29  ? 31.572  -77.269 16.380  1.00 213.84 ? 28  ASP A CA     1 
ATOM   192   C  C      . ASP A  1 29  ? 30.444  -76.244 16.355  1.00 194.48 ? 28  ASP A C      1 
ATOM   193   O  O      . ASP A  1 29  ? 29.632  -76.176 17.278  1.00 178.84 ? 28  ASP A O      1 
ATOM   194   C  CB     . ASP A  1 29  ? 31.039  -78.611 16.889  1.00 226.11 ? 28  ASP A CB     1 
ATOM   195   C  CG     . ASP A  1 29  ? 31.621  -79.796 16.139  1.00 239.78 ? 28  ASP A CG     1 
ATOM   196   O  OD1    . ASP A  1 29  ? 32.003  -79.634 14.961  1.00 240.20 ? 28  ASP A OD1    1 
ATOM   197   O  OD2    . ASP A  1 29  ? 31.691  -80.895 16.730  1.00 248.55 ? 28  ASP A OD2    1 
ATOM   198   H  H      . ASP A  1 29  ? 32.520  -76.903 18.068  1.00 260.17 ? 28  ASP A H      1 
ATOM   199   H  HA     . ASP A  1 29  ? 31.901  -77.392 15.465  1.00 256.61 ? 28  ASP A HA     1 
ATOM   200   H  HB2    . ASP A  1 29  ? 31.269  -78.707 17.827  1.00 271.33 ? 28  ASP A HB2    1 
ATOM   201   H  HB3    . ASP A  1 29  ? 30.076  -78.631 16.780  1.00 271.33 ? 28  ASP A HB3    1 
ATOM   202   N  N      . VAL A  1 30  ? 30.402  -75.444 15.295  1.00 193.21 ? 29  VAL A N      1 
ATOM   203   C  CA     . VAL A  1 30  ? 29.399  -74.393 15.172  1.00 199.55 ? 29  VAL A CA     1 
ATOM   204   C  C      . VAL A  1 30  ? 28.013  -74.996 14.964  1.00 206.57 ? 29  VAL A C      1 
ATOM   205   O  O      . VAL A  1 30  ? 27.829  -75.887 14.134  1.00 209.52 ? 29  VAL A O      1 
ATOM   206   C  CB     . VAL A  1 30  ? 29.725  -73.435 14.008  1.00 197.99 ? 29  VAL A CB     1 
ATOM   207   C  CG1    . VAL A  1 30  ? 28.622  -72.398 13.840  1.00 169.30 ? 29  VAL A CG1    1 
ATOM   208   C  CG2    . VAL A  1 30  ? 31.067  -72.754 14.243  1.00 193.34 ? 29  VAL A CG2    1 
ATOM   209   H  H      . VAL A  1 30  ? 30.945  -75.490 14.629  1.00 231.85 ? 29  VAL A H      1 
ATOM   210   H  HA     . VAL A  1 30  ? 29.381  -73.870 16.000  1.00 239.46 ? 29  VAL A HA     1 
ATOM   211   H  HB     . VAL A  1 30  ? 29.787  -73.950 13.177  1.00 237.59 ? 29  VAL A HB     1 
ATOM   212   H  HG11   . VAL A  1 30  ? 28.850  -71.816 13.111  1.00 203.16 ? 29  VAL A HG11   1 
ATOM   213   H  HG12   . VAL A  1 30  ? 27.796  -72.849 13.653  1.00 203.16 ? 29  VAL A HG12   1 
ATOM   214   H  HG13   . VAL A  1 30  ? 28.544  -71.892 14.652  1.00 203.16 ? 29  VAL A HG13   1 
ATOM   215   H  HG21   . VAL A  1 30  ? 31.250  -72.164 13.508  1.00 232.01 ? 29  VAL A HG21   1 
ATOM   216   H  HG22   . VAL A  1 30  ? 31.025  -72.256 15.062  1.00 232.01 ? 29  VAL A HG22   1 
ATOM   217   H  HG23   . VAL A  1 30  ? 31.751  -73.426 14.303  1.00 232.01 ? 29  VAL A HG23   1 
ATOM   218   N  N      . LEU A  1 31  ? 27.042  -74.503 15.727  1.00 212.35 ? 30  LEU A N      1 
ATOM   219   C  CA     . LEU A  1 31  ? 25.679  -75.016 15.672  1.00 216.14 ? 30  LEU A CA     1 
ATOM   220   C  C      . LEU A  1 31  ? 24.747  -74.023 14.970  1.00 222.14 ? 30  LEU A C      1 
ATOM   221   O  O      . LEU A  1 31  ? 25.101  -73.461 13.933  1.00 220.25 ? 30  LEU A O      1 
ATOM   222   C  CB     . LEU A  1 31  ? 25.181  -75.324 17.087  1.00 211.06 ? 30  LEU A CB     1 
ATOM   223   C  CG     . LEU A  1 31  ? 26.071  -76.261 17.910  1.00 204.08 ? 30  LEU A CG     1 
ATOM   224   C  CD1    . LEU A  1 31  ? 25.544  -76.393 19.331  1.00 206.48 ? 30  LEU A CD1    1 
ATOM   225   C  CD2    . LEU A  1 31  ? 26.168  -77.624 17.245  1.00 194.06 ? 30  LEU A CD2    1 
ATOM   226   H  H      . LEU A  1 31  ? 27.151  -73.863 16.291  1.00 254.82 ? 30  LEU A H      1 
ATOM   227   H  HA     . LEU A  1 31  ? 25.672  -75.851 15.159  1.00 259.36 ? 30  LEU A HA     1 
ATOM   228   H  HB2    . LEU A  1 31  ? 25.107  -74.489 17.575  1.00 253.27 ? 30  LEU A HB2    1 
ATOM   229   H  HB3    . LEU A  1 31  ? 24.306  -75.739 17.021  1.00 253.27 ? 30  LEU A HB3    1 
ATOM   230   H  HG     . LEU A  1 31  ? 26.964  -75.886 17.956  1.00 244.90 ? 30  LEU A HG     1 
ATOM   231   H  HD11   . LEU A  1 31  ? 26.119  -76.984 19.823  1.00 247.77 ? 30  LEU A HD11   1 
ATOM   232   H  HD12   . LEU A  1 31  ? 25.535  -75.526 19.742  1.00 247.77 ? 30  LEU A HD12   1 
ATOM   233   H  HD13   . LEU A  1 31  ? 24.654  -76.752 19.301  1.00 247.77 ? 30  LEU A HD13   1 
ATOM   234   H  HD21   . LEU A  1 31  ? 26.730  -78.192 17.778  1.00 232.88 ? 30  LEU A HD21   1 
ATOM   235   H  HD22   . LEU A  1 31  ? 25.288  -78.003 17.179  1.00 232.88 ? 30  LEU A HD22   1 
ATOM   236   H  HD23   . LEU A  1 31  ? 26.546  -77.518 16.369  1.00 232.88 ? 30  LEU A HD23   1 
ATOM   237   N  N      . GLU A  1 32  ? 23.564  -73.807 15.537  1.00 238.31 ? 31  GLU A N      1 
ATOM   238   C  CA     . GLU A  1 32  ? 22.553  -72.953 14.918  1.00 261.16 ? 31  GLU A CA     1 
ATOM   239   C  C      . GLU A  1 32  ? 22.996  -71.496 14.824  1.00 261.39 ? 31  GLU A C      1 
ATOM   240   O  O      . GLU A  1 32  ? 23.853  -71.046 15.585  1.00 266.04 ? 31  GLU A O      1 
ATOM   241   C  CB     . GLU A  1 32  ? 21.250  -73.025 15.717  1.00 280.56 ? 31  GLU A CB     1 
ATOM   242   C  CG     . GLU A  1 32  ? 21.352  -72.433 17.119  1.00 293.80 ? 31  GLU A CG     1 
ATOM   243   C  CD     . GLU A  1 32  ? 20.046  -72.514 17.886  1.00 302.42 ? 31  GLU A CD     1 
ATOM   244   O  OE1    . GLU A  1 32  ? 19.297  -73.494 17.688  1.00 309.83 ? 31  GLU A OE1    1 
ATOM   245   O  OE2    . GLU A  1 32  ? 19.766  -71.594 18.684  1.00 298.90 ? 31  GLU A OE2    1 
ATOM   246   H  H      . GLU A  1 32  ? 23.319  -74.147 16.288  1.00 285.97 ? 31  GLU A H      1 
ATOM   247   H  HA     . GLU A  1 32  ? 22.373  -73.276 14.011  1.00 313.39 ? 31  GLU A HA     1 
ATOM   248   H  HB2    . GLU A  1 32  ? 20.563  -72.536 15.238  1.00 336.68 ? 31  GLU A HB2    1 
ATOM   249   H  HB3    . GLU A  1 32  ? 20.990  -73.955 15.806  1.00 336.68 ? 31  GLU A HB3    1 
ATOM   250   H  HG2    . GLU A  1 32  ? 22.024  -72.921 17.620  1.00 352.56 ? 31  GLU A HG2    1 
ATOM   251   H  HG3    . GLU A  1 32  ? 21.602  -71.498 17.050  1.00 352.56 ? 31  GLU A HG3    1 
ATOM   252   N  N      . LYS A  1 33  ? 22.402  -70.766 13.884  1.00 254.43 ? 32  LYS A N      1 
ATOM   253   C  CA     . LYS A  1 33  ? 22.597  -69.323 13.791  1.00 250.08 ? 32  LYS A CA     1 
ATOM   254   C  C      . LYS A  1 33  ? 21.722  -68.625 14.828  1.00 255.12 ? 32  LYS A C      1 
ATOM   255   O  O      . LYS A  1 33  ? 20.626  -69.092 15.135  1.00 258.03 ? 32  LYS A O      1 
ATOM   256   C  CB     . LYS A  1 33  ? 22.252  -68.824 12.387  1.00 236.24 ? 32  LYS A CB     1 
ATOM   257   C  CG     . LYS A  1 33  ? 22.134  -67.311 12.286  1.00 225.95 ? 32  LYS A CG     1 
ATOM   258   C  CD     . LYS A  1 33  ? 21.996  -66.846 10.845  1.00 214.05 ? 32  LYS A CD     1 
ATOM   259   C  CE     . LYS A  1 33  ? 21.593  -65.379 10.779  1.00 195.44 ? 32  LYS A CE     1 
ATOM   260   N  NZ     . LYS A  1 33  ? 22.364  -64.625 9.754   1.00 182.70 ? 32  LYS A NZ     1 
ATOM   261   H  H      . LYS A  1 33  ? 21.877  -71.086 13.283  1.00 305.32 ? 32  LYS A H      1 
ATOM   262   H  HA     . LYS A  1 33  ? 23.535  -69.107 13.977  1.00 300.10 ? 32  LYS A HA     1 
ATOM   263   H  HB2    . LYS A  1 33  ? 22.947  -69.109 11.774  1.00 283.49 ? 32  LYS A HB2    1 
ATOM   264   H  HB3    . LYS A  1 33  ? 21.401  -69.206 12.120  1.00 283.49 ? 32  LYS A HB3    1 
ATOM   265   H  HG2    . LYS A  1 33  ? 21.349  -67.019 12.775  1.00 271.13 ? 32  LYS A HG2    1 
ATOM   266   H  HG3    . LYS A  1 33  ? 22.931  -66.904 12.660  1.00 271.13 ? 32  LYS A HG3    1 
ATOM   267   H  HD2    . LYS A  1 33  ? 22.846  -66.950 10.390  1.00 256.86 ? 32  LYS A HD2    1 
ATOM   268   H  HD3    . LYS A  1 33  ? 21.310  -67.371 10.402  1.00 256.86 ? 32  LYS A HD3    1 
ATOM   269   H  HE2    . LYS A  1 33  ? 20.652  -65.319 10.552  1.00 234.53 ? 32  LYS A HE2    1 
ATOM   270   H  HE3    . LYS A  1 33  ? 21.756  -64.967 11.641  1.00 234.53 ? 32  LYS A HE3    1 
ATOM   271   H  HZ1    . LYS A  1 33  ? 22.104  -63.774 9.743   1.00 219.25 ? 32  LYS A HZ1    1 
ATOM   272   H  HZ2    . LYS A  1 33  ? 23.234  -64.659 9.941   1.00 219.25 ? 32  LYS A HZ2    1 
ATOM   273   H  HZ3    . LYS A  1 33  ? 22.228  -64.980 8.949   1.00 219.25 ? 32  LYS A HZ3    1 
ATOM   274   N  N      . LEU A  1 34  ? 22.205  -67.507 15.362  1.00 255.93 ? 33  LEU A N      1 
ATOM   275   C  CA     . LEU A  1 34  ? 21.495  -66.800 16.426  1.00 256.82 ? 33  LEU A CA     1 
ATOM   276   C  C      . LEU A  1 34  ? 20.891  -65.478 15.961  1.00 253.06 ? 33  LEU A C      1 
ATOM   277   O  O      . LEU A  1 34  ? 19.964  -64.960 16.585  1.00 246.23 ? 33  LEU A O      1 
ATOM   278   C  CB     . LEU A  1 34  ? 22.432  -66.549 17.609  1.00 261.36 ? 33  LEU A CB     1 
ATOM   279   C  CG     . LEU A  1 34  ? 22.965  -67.800 18.310  1.00 266.73 ? 33  LEU A CG     1 
ATOM   280   C  CD1    . LEU A  1 34  ? 23.786  -67.408 19.523  1.00 270.08 ? 33  LEU A CD1    1 
ATOM   281   C  CD2    . LEU A  1 34  ? 21.833  -68.738 18.709  1.00 265.75 ? 33  LEU A CD2    1 
ATOM   282   H  H      . LEU A  1 34  ? 22.944  -67.135 15.127  1.00 307.12 ? 33  LEU A H      1 
ATOM   283   H  HA     . LEU A  1 34  ? 20.761  -67.367 16.743  1.00 308.18 ? 33  LEU A HA     1 
ATOM   284   H  HB2    . LEU A  1 34  ? 23.198  -66.045 17.292  1.00 313.63 ? 33  LEU A HB2    1 
ATOM   285   H  HB3    . LEU A  1 34  ? 21.954  -66.026 18.272  1.00 313.63 ? 33  LEU A HB3    1 
ATOM   286   H  HG     . LEU A  1 34  ? 23.547  -68.278 17.698  1.00 320.08 ? 33  LEU A HG     1 
ATOM   287   H  HD11   . LEU A  1 34  ? 24.112  -68.204 19.949  1.00 324.09 ? 33  LEU A HD11   1 
ATOM   288   H  HD12   . LEU A  1 34  ? 24.523  -66.863 19.238  1.00 324.09 ? 33  LEU A HD12   1 
ATOM   289   H  HD13   . LEU A  1 34  ? 23.230  -66.915 20.130  1.00 324.09 ? 33  LEU A HD13   1 
ATOM   290   H  HD21   . LEU A  1 34  ? 22.205  -69.509 19.144  1.00 318.91 ? 33  LEU A HD21   1 
ATOM   291   H  HD22   . LEU A  1 34  ? 21.242  -68.277 19.308  1.00 318.91 ? 33  LEU A HD22   1 
ATOM   292   H  HD23   . LEU A  1 34  ? 21.356  -69.005 17.919  1.00 318.91 ? 33  LEU A HD23   1 
ATOM   293   N  N      . GLY A  1 35  ? 21.416  -64.930 14.871  1.00 255.29 ? 34  GLY A N      1 
ATOM   294   C  CA     . GLY A  1 35  ? 20.911  -63.677 14.344  1.00 252.58 ? 34  GLY A CA     1 
ATOM   295   C  C      . GLY A  1 35  ? 21.982  -62.856 13.655  1.00 250.87 ? 34  GLY A C      1 
ATOM   296   O  O      . GLY A  1 35  ? 22.924  -63.402 13.081  1.00 251.68 ? 34  GLY A O      1 
ATOM   297   H  H      . GLY A  1 35  ? 22.066  -65.267 14.420  1.00 306.34 ? 34  GLY A H      1 
ATOM   298   H  HA2    . GLY A  1 35  ? 20.205  -63.858 13.703  1.00 303.10 ? 34  GLY A HA2    1 
ATOM   299   H  HA3    . GLY A  1 35  ? 20.539  -63.149 15.068  1.00 303.10 ? 34  GLY A HA3    1 
ATOM   300   N  N      . GLU A  1 36  ? 21.837  -61.536 13.718  1.00 246.00 ? 35  GLU A N      1 
ATOM   301   C  CA     . GLU A  1 36  ? 22.752  -60.633 13.034  1.00 238.73 ? 35  GLU A CA     1 
ATOM   302   C  C      . GLU A  1 36  ? 22.463  -59.182 13.397  1.00 221.46 ? 35  GLU A C      1 
ATOM   303   O  O      . GLU A  1 36  ? 21.522  -58.889 14.134  1.00 215.84 ? 35  GLU A O      1 
ATOM   304   C  CB     . GLU A  1 36  ? 22.631  -60.819 11.522  1.00 250.42 ? 35  GLU A CB     1 
ATOM   305   C  CG     . GLU A  1 36  ? 21.201  -60.748 11.012  1.00 261.17 ? 35  GLU A CG     1 
ATOM   306   C  CD     . GLU A  1 36  ? 21.093  -61.041 9.530   1.00 277.55 ? 35  GLU A CD     1 
ATOM   307   O  OE1    . GLU A  1 36  ? 22.089  -60.827 8.806   1.00 286.08 ? 35  GLU A OE1    1 
ATOM   308   O  OE2    . GLU A  1 36  ? 20.015  -61.490 9.088   1.00 281.44 ? 35  GLU A OE2    1 
ATOM   309   H  H      . GLU A  1 36  ? 21.213  -61.137 14.154  1.00 295.20 ? 35  GLU A H      1 
ATOM   310   H  HA     . GLU A  1 36  ? 23.673  -60.841 13.299  1.00 286.48 ? 35  GLU A HA     1 
ATOM   311   H  HB2    . GLU A  1 36  ? 23.139  -60.121 11.079  1.00 300.50 ? 35  GLU A HB2    1 
ATOM   312   H  HB3    . GLU A  1 36  ? 22.989  -61.688 11.283  1.00 300.50 ? 35  GLU A HB3    1 
ATOM   313   H  HG2    . GLU A  1 36  ? 20.663  -61.402 11.487  1.00 313.41 ? 35  GLU A HG2    1 
ATOM   314   H  HG3    . GLU A  1 36  ? 20.853  -59.856 11.168  1.00 313.41 ? 35  GLU A HG3    1 
ATOM   315   N  N      . GLY A  1 37  ? 23.283  -58.276 12.874  1.00 214.55 ? 36  GLY A N      1 
ATOM   316   C  CA     . GLY A  1 37  ? 23.108  -56.855 13.109  1.00 208.26 ? 36  GLY A CA     1 
ATOM   317   C  C      . GLY A  1 37  ? 23.395  -56.043 11.862  1.00 204.22 ? 36  GLY A C      1 
ATOM   318   O  O      . GLY A  1 37  ? 22.502  -55.803 11.048  1.00 196.11 ? 36  GLY A O      1 
ATOM   319   H  H      . GLY A  1 37  ? 23.955  -58.466 12.372  1.00 257.46 ? 36  GLY A H      1 
ATOM   320   H  HA2    . GLY A  1 37  ? 22.196  -56.681 13.390  1.00 249.91 ? 36  GLY A HA2    1 
ATOM   321   H  HA3    . GLY A  1 37  ? 23.710  -56.565 13.812  1.00 249.91 ? 36  GLY A HA3    1 
ATOM   322   N  N      . SER A  1 38  ? 24.645  -55.617 11.711  1.00 206.91 ? 37  SER A N      1 
ATOM   323   C  CA     . SER A  1 38  ? 25.047  -54.828 10.552  1.00 201.38 ? 37  SER A CA     1 
ATOM   324   C  C      . SER A  1 38  ? 26.486  -55.096 10.105  1.00 208.59 ? 37  SER A C      1 
ATOM   325   O  O      . SER A  1 38  ? 26.995  -54.409 9.219   1.00 210.45 ? 37  SER A O      1 
ATOM   326   C  CB     . SER A  1 38  ? 24.886  -53.337 10.858  1.00 187.10 ? 37  SER A CB     1 
ATOM   327   O  OG     . SER A  1 38  ? 23.536  -53.017 11.147  1.00 179.06 ? 37  SER A OG     1 
ATOM   328   H  H      . SER A  1 38  ? 25.282  -55.772 12.268  1.00 248.29 ? 37  SER A H      1 
ATOM   329   H  HA     . SER A  1 38  ? 24.455  -55.046 9.802   1.00 241.66 ? 37  SER A HA     1 
ATOM   330   H  HB2    . SER A  1 38  ? 25.434  -53.112 11.626  1.00 224.52 ? 37  SER A HB2    1 
ATOM   331   H  HB3    . SER A  1 38  ? 25.172  -52.824 10.086  1.00 224.52 ? 37  SER A HB3    1 
ATOM   332   H  HG     . SER A  1 38  ? 23.467  -52.216 11.309  1.00 214.87 ? 37  SER A HG     1 
ATOM   333   N  N      . TYR A  1 39  ? 27.138  -56.090 10.703  1.00 212.17 ? 38  TYR A N      1 
ATOM   334   C  CA     . TYR A  1 39  ? 28.539  -56.364 10.391  1.00 217.15 ? 38  TYR A CA     1 
ATOM   335   C  C      . TYR A  1 39  ? 28.837  -57.854 10.236  1.00 223.33 ? 38  TYR A C      1 
ATOM   336   O  O      . TYR A  1 39  ? 29.998  -58.248 10.131  1.00 223.79 ? 38  TYR A O      1 
ATOM   337   C  CB     . TYR A  1 39  ? 29.444  -55.767 11.471  1.00 219.27 ? 38  TYR A CB     1 
ATOM   338   C  CG     . TYR A  1 39  ? 29.233  -54.285 11.691  1.00 225.16 ? 38  TYR A CG     1 
ATOM   339   C  CD1    . TYR A  1 39  ? 29.891  -53.347 10.907  1.00 224.81 ? 38  TYR A CD1    1 
ATOM   340   C  CD2    . TYR A  1 39  ? 28.376  -53.825 12.683  1.00 222.67 ? 38  TYR A CD2    1 
ATOM   341   C  CE1    . TYR A  1 39  ? 29.701  -51.991 11.104  1.00 215.37 ? 38  TYR A CE1    1 
ATOM   342   C  CE2    . TYR A  1 39  ? 28.180  -52.471 12.887  1.00 211.82 ? 38  TYR A CE2    1 
ATOM   343   C  CZ     . TYR A  1 39  ? 28.845  -51.560 12.095  1.00 206.07 ? 38  TYR A CZ     1 
ATOM   344   O  OH     . TYR A  1 39  ? 28.652  -50.213 12.295  1.00 199.54 ? 38  TYR A OH     1 
ATOM   345   H  H      . TYR A  1 39  ? 26.796  -56.617 11.290  1.00 254.61 ? 38  TYR A H      1 
ATOM   346   H  HA     . TYR A  1 39  ? 28.761  -55.927 9.542   1.00 260.58 ? 38  TYR A HA     1 
ATOM   347   H  HB2    . TYR A  1 39  ? 29.269  -56.219 12.311  1.00 263.13 ? 38  TYR A HB2    1 
ATOM   348   H  HB3    . TYR A  1 39  ? 30.369  -55.900 11.212  1.00 263.13 ? 38  TYR A HB3    1 
ATOM   349   H  HD1    . TYR A  1 39  ? 30.469  -53.634 10.238  1.00 269.77 ? 38  TYR A HD1    1 
ATOM   350   H  HD2    . TYR A  1 39  ? 27.926  -54.437 13.218  1.00 267.20 ? 38  TYR A HD2    1 
ATOM   351   H  HE1    . TYR A  1 39  ? 30.149  -51.374 10.571  1.00 258.45 ? 38  TYR A HE1    1 
ATOM   352   H  HE2    . TYR A  1 39  ? 27.603  -52.178 13.554  1.00 254.19 ? 38  TYR A HE2    1 
ATOM   353   H  HH     . TYR A  1 39  ? 28.875  -50.008 13.057  1.00 239.44 ? 38  TYR A HH     1 
ATOM   354   N  N      . GLY A  1 40  ? 27.797  -58.682 10.217  1.00 231.28 ? 39  GLY A N      1 
ATOM   355   C  CA     . GLY A  1 40  ? 27.981  -60.112 10.050  1.00 241.84 ? 39  GLY A CA     1 
ATOM   356   C  C      . GLY A  1 40  ? 26.995  -60.945 10.845  1.00 246.99 ? 39  GLY A C      1 
ATOM   357   O  O      . GLY A  1 40  ? 26.099  -60.413 11.499  1.00 249.33 ? 39  GLY A O      1 
ATOM   358   H  H      . GLY A  1 40  ? 26.976  -58.438 10.299  1.00 277.54 ? 39  GLY A H      1 
ATOM   359   H  HA2    . GLY A  1 40  ? 27.884  -60.339 9.112   1.00 290.21 ? 39  GLY A HA2    1 
ATOM   360   H  HA3    . GLY A  1 40  ? 28.878  -60.353 10.330  1.00 290.21 ? 39  GLY A HA3    1 
ATOM   361   N  N      . SER A  1 41  ? 27.170  -62.261 10.785  1.00 247.58 ? 40  SER A N      1 
ATOM   362   C  CA     . SER A  1 41  ? 26.274  -63.192 11.457  1.00 248.82 ? 40  SER A CA     1 
ATOM   363   C  C      . SER A  1 41  ? 26.878  -63.716 12.755  1.00 251.63 ? 40  SER A C      1 
ATOM   364   O  O      . SER A  1 41  ? 28.081  -63.964 12.837  1.00 258.68 ? 40  SER A O      1 
ATOM   365   C  CB     . SER A  1 41  ? 25.953  -64.368 10.533  1.00 249.24 ? 40  SER A CB     1 
ATOM   366   O  OG     . SER A  1 41  ? 25.199  -63.947 9.410   1.00 248.19 ? 40  SER A OG     1 
ATOM   367   H  H      . SER A  1 41  ? 27.809  -62.644 10.355  1.00 297.10 ? 40  SER A H      1 
ATOM   368   H  HA     . SER A  1 41  ? 25.435  -62.734 11.673  1.00 298.58 ? 40  SER A HA     1 
ATOM   369   H  HB2    . SER A  1 41  ? 26.784  -64.762 10.225  1.00 299.09 ? 40  SER A HB2    1 
ATOM   370   H  HB3    . SER A  1 41  ? 25.440  -65.026 11.028  1.00 299.09 ? 40  SER A HB3    1 
ATOM   371   H  HG     . SER A  1 41  ? 25.035  -64.588 8.926   1.00 297.83 ? 40  SER A HG     1 
ATOM   372   N  N      . VAL A  1 42  ? 26.030  -63.881 13.765  1.00 240.73 ? 41  VAL A N      1 
ATOM   373   C  CA     . VAL A  1 42  ? 26.443  -64.453 15.041  1.00 221.92 ? 41  VAL A CA     1 
ATOM   374   C  C      . VAL A  1 42  ? 25.997  -65.909 15.113  1.00 226.58 ? 41  VAL A C      1 
ATOM   375   O  O      . VAL A  1 42  ? 24.896  -66.250 14.680  1.00 228.74 ? 41  VAL A O      1 
ATOM   376   C  CB     . VAL A  1 42  ? 25.841  -63.671 16.224  1.00 196.32 ? 41  VAL A CB     1 
ATOM   377   C  CG1    . VAL A  1 42  ? 26.004  -64.445 17.525  1.00 188.96 ? 41  VAL A CG1    1 
ATOM   378   C  CG2    . VAL A  1 42  ? 26.487  -62.299 16.332  1.00 189.15 ? 41  VAL A CG2    1 
ATOM   379   H  H      . VAL A  1 42  ? 25.198  -63.665 13.735  1.00 288.88 ? 41  VAL A H      1 
ATOM   380   H  HA     . VAL A  1 42  ? 27.420  -64.422 15.112  1.00 266.30 ? 41  VAL A HA     1 
ATOM   381   H  HB     . VAL A  1 42  ? 24.883  -63.542 16.067  1.00 235.58 ? 41  VAL A HB     1 
ATOM   382   H  HG11   . VAL A  1 42  ? 25.621  -63.935 18.242  1.00 226.75 ? 41  VAL A HG11   1 
ATOM   383   H  HG12   . VAL A  1 42  ? 25.552  -65.288 17.445  1.00 226.75 ? 41  VAL A HG12   1 
ATOM   384   H  HG13   . VAL A  1 42  ? 26.939  -64.589 17.688  1.00 226.75 ? 41  VAL A HG13   1 
ATOM   385   H  HG21   . VAL A  1 42  ? 26.099  -61.828 17.073  1.00 226.98 ? 41  VAL A HG21   1 
ATOM   386   H  HG22   . VAL A  1 42  ? 27.431  -62.408 16.470  1.00 226.98 ? 41  VAL A HG22   1 
ATOM   387   H  HG23   . VAL A  1 42  ? 26.329  -61.815 15.518  1.00 226.98 ? 41  VAL A HG23   1 
ATOM   388   N  N      . PHE A  1 43  ? 26.854  -66.764 15.661  1.00 226.75 ? 42  PHE A N      1 
ATOM   389   C  CA     . PHE A  1 43  ? 26.567  -68.192 15.731  1.00 227.29 ? 42  PHE A CA     1 
ATOM   390   C  C      . PHE A  1 43  ? 26.848  -68.776 17.111  1.00 222.74 ? 42  PHE A C      1 
ATOM   391   O  O      . PHE A  1 43  ? 27.656  -68.245 17.874  1.00 221.11 ? 42  PHE A O      1 
ATOM   392   C  CB     . PHE A  1 43  ? 27.390  -68.950 14.687  1.00 232.14 ? 42  PHE A CB     1 
ATOM   393   C  CG     . PHE A  1 43  ? 26.870  -68.811 13.286  1.00 235.27 ? 42  PHE A CG     1 
ATOM   394   C  CD1    . PHE A  1 43  ? 25.988  -69.744 12.766  1.00 234.22 ? 42  PHE A CD1    1 
ATOM   395   C  CD2    . PHE A  1 43  ? 27.264  -67.751 12.487  1.00 235.33 ? 42  PHE A CD2    1 
ATOM   396   C  CE1    . PHE A  1 43  ? 25.508  -69.622 11.476  1.00 233.36 ? 42  PHE A CE1    1 
ATOM   397   C  CE2    . PHE A  1 43  ? 26.786  -67.624 11.196  1.00 233.23 ? 42  PHE A CE2    1 
ATOM   398   C  CZ     . PHE A  1 43  ? 25.907  -68.560 10.691  1.00 233.00 ? 42  PHE A CZ     1 
ATOM   399   H  H      . PHE A  1 43  ? 27.612  -66.542 16.000  1.00 272.10 ? 42  PHE A H      1 
ATOM   400   H  HA     . PHE A  1 43  ? 25.618  -68.336 15.531  1.00 272.74 ? 42  PHE A HA     1 
ATOM   401   H  HB2    . PHE A  1 43  ? 28.299  -68.612 14.701  1.00 278.57 ? 42  PHE A HB2    1 
ATOM   402   H  HB3    . PHE A  1 43  ? 27.387  -69.894 14.912  1.00 278.57 ? 42  PHE A HB3    1 
ATOM   403   H  HD1    . PHE A  1 43  ? 25.716  -70.461 13.291  1.00 281.06 ? 42  PHE A HD1    1 
ATOM   404   H  HD2    . PHE A  1 43  ? 27.855  -67.117 12.823  1.00 282.39 ? 42  PHE A HD2    1 
ATOM   405   H  HE1    . PHE A  1 43  ? 24.916  -70.254 11.138  1.00 280.04 ? 42  PHE A HE1    1 
ATOM   406   H  HE2    . PHE A  1 43  ? 27.057  -66.907 10.669  1.00 279.88 ? 42  PHE A HE2    1 
ATOM   407   H  HZ     . PHE A  1 43  ? 25.585  -68.476 9.823   1.00 279.59 ? 42  PHE A HZ     1 
ATOM   408   N  N      . LYS A  1 44  ? 26.168  -69.876 17.418  1.00 218.55 ? 43  LYS A N      1 
ATOM   409   C  CA     . LYS A  1 44  ? 26.420  -70.635 18.634  1.00 208.14 ? 43  LYS A CA     1 
ATOM   410   C  C      . LYS A  1 44  ? 27.480  -71.688 18.331  1.00 202.40 ? 43  LYS A C      1 
ATOM   411   O  O      . LYS A  1 44  ? 27.554  -72.191 17.211  1.00 195.93 ? 43  LYS A O      1 
ATOM   412   C  CB     . LYS A  1 44  ? 25.129  -71.304 19.110  1.00 205.02 ? 43  LYS A CB     1 
ATOM   413   C  CG     . LYS A  1 44  ? 25.273  -72.137 20.374  1.00 200.04 ? 43  LYS A CG     1 
ATOM   414   C  CD     . LYS A  1 44  ? 23.987  -72.892 20.678  1.00 193.27 ? 43  LYS A CD     1 
ATOM   415   C  CE     . LYS A  1 44  ? 24.111  -73.731 21.939  1.00 184.97 ? 43  LYS A CE     1 
ATOM   416   N  NZ     . LYS A  1 44  ? 22.909  -74.584 22.155  1.00 178.70 ? 43  LYS A NZ     1 
ATOM   417   H  H      . LYS A  1 44  ? 25.545  -70.207 16.927  1.00 262.26 ? 43  LYS A H      1 
ATOM   418   H  HA     . LYS A  1 44  ? 26.751  -70.041 19.339  1.00 249.77 ? 43  LYS A HA     1 
ATOM   419   H  HB2    . LYS A  1 44  ? 24.470  -70.615 19.287  1.00 246.02 ? 43  LYS A HB2    1 
ATOM   420   H  HB3    . LYS A  1 44  ? 24.807  -71.891 18.408  1.00 246.02 ? 43  LYS A HB3    1 
ATOM   421   H  HG2    . LYS A  1 44  ? 25.986  -72.783 20.255  1.00 240.05 ? 43  LYS A HG2    1 
ATOM   422   H  HG3    . LYS A  1 44  ? 25.469  -71.553 21.124  1.00 240.05 ? 43  LYS A HG3    1 
ATOM   423   H  HD2    . LYS A  1 44  ? 23.266  -72.256 20.807  1.00 231.93 ? 43  LYS A HD2    1 
ATOM   424   H  HD3    . LYS A  1 44  ? 23.783  -73.485 19.938  1.00 231.93 ? 43  LYS A HD3    1 
ATOM   425   H  HE2    . LYS A  1 44  ? 24.884  -74.312 21.861  1.00 221.96 ? 43  LYS A HE2    1 
ATOM   426   H  HE3    . LYS A  1 44  ? 24.208  -73.144 22.705  1.00 221.96 ? 43  LYS A HE3    1 
ATOM   427   H  HZ1    . LYS A  1 44  ? 23.007  -75.064 22.898  1.00 214.44 ? 43  LYS A HZ1    1 
ATOM   428   H  HZ2    . LYS A  1 44  ? 22.184  -74.073 22.234  1.00 214.44 ? 43  LYS A HZ2    1 
ATOM   429   H  HZ3    . LYS A  1 44  ? 22.799  -75.136 21.466  1.00 214.44 ? 43  LYS A HZ3    1 
ATOM   430   N  N      . ALA A  1 45  ? 28.303  -72.014 19.321  1.00 204.71 ? 44  ALA A N      1 
ATOM   431   C  CA     . ALA A  1 45  ? 29.368  -72.993 19.127  1.00 206.62 ? 44  ALA A CA     1 
ATOM   432   C  C      . ALA A  1 45  ? 29.716  -73.699 20.432  1.00 213.64 ? 44  ALA A C      1 
ATOM   433   O  O      . ALA A  1 45  ? 29.343  -73.245 21.514  1.00 216.87 ? 44  ALA A O      1 
ATOM   434   C  CB     . ALA A  1 45  ? 30.602  -72.319 18.545  1.00 201.20 ? 44  ALA A CB     1 
ATOM   435   H  H      . ALA A  1 45  ? 28.267  -71.685 20.115  1.00 245.65 ? 44  ALA A H      1 
ATOM   436   H  HA     . ALA A  1 45  ? 29.064  -73.672 18.488  1.00 247.95 ? 44  ALA A HA     1 
ATOM   437   H  HB1    . ALA A  1 45  ? 31.289  -72.978 18.424  1.00 241.44 ? 44  ALA A HB1    1 
ATOM   438   H  HB2    . ALA A  1 45  ? 30.373  -71.926 17.699  1.00 241.44 ? 44  ALA A HB2    1 
ATOM   439   H  HB3    . ALA A  1 45  ? 30.902  -71.639 19.152  1.00 241.44 ? 44  ALA A HB3    1 
ATOM   440   N  N      . ILE A  1 46  ? 30.434  -74.813 20.320  1.00 217.28 ? 45  ILE A N      1 
ATOM   441   C  CA     . ILE A  1 46  ? 30.850  -75.582 21.487  1.00 217.48 ? 45  ILE A CA     1 
ATOM   442   C  C      . ILE A  1 46  ? 32.339  -75.915 21.424  1.00 224.90 ? 45  ILE A C      1 
ATOM   443   O  O      . ILE A  1 46  ? 32.820  -76.483 20.444  1.00 231.96 ? 45  ILE A O      1 
ATOM   444   C  CB     . ILE A  1 46  ? 30.039  -76.890 21.624  1.00 207.92 ? 45  ILE A CB     1 
ATOM   445   C  CG1    . ILE A  1 46  ? 30.561  -77.716 22.803  1.00 202.50 ? 45  ILE A CG1    1 
ATOM   446   C  CG2    . ILE A  1 46  ? 30.100  -77.701 20.335  1.00 206.56 ? 45  ILE A CG2    1 
ATOM   447   C  CD1    . ILE A  1 46  ? 29.697  -78.911 23.145  1.00 199.86 ? 45  ILE A CD1    1 
ATOM   448   H  H      . ILE A  1 46  ? 30.694  -75.147 19.571  1.00 260.74 ? 45  ILE A H      1 
ATOM   449   H  HA     . ILE A  1 46  ? 30.695  -75.046 22.292  1.00 260.98 ? 45  ILE A HA     1 
ATOM   450   H  HB     . ILE A  1 46  ? 29.113  -76.660 21.797  1.00 249.50 ? 45  ILE A HB     1 
ATOM   451   H  HG12   . ILE A  1 46  ? 31.447  -78.045 22.586  1.00 243.01 ? 45  ILE A HG12   1 
ATOM   452   H  HG13   . ILE A  1 46  ? 30.604  -77.148 23.587  1.00 243.01 ? 45  ILE A HG13   1 
ATOM   453   H  HG21   . ILE A  1 46  ? 29.589  -78.506 20.448  1.00 247.87 ? 45  ILE A HG21   1 
ATOM   454   H  HG22   . ILE A  1 46  ? 29.733  -77.178 19.619  1.00 247.87 ? 45  ILE A HG22   1 
ATOM   455   H  HG23   . ILE A  1 46  ? 31.016  -77.918 20.146  1.00 247.87 ? 45  ILE A HG23   1 
ATOM   456   H  HD11   . ILE A  1 46  ? 30.087  -79.375 23.890  1.00 239.83 ? 45  ILE A HD11   1 
ATOM   457   H  HD12   . ILE A  1 46  ? 28.817  -78.604 23.375  1.00 239.83 ? 45  ILE A HD12   1 
ATOM   458   H  HD13   . ILE A  1 46  ? 29.652  -79.493 22.383  1.00 239.83 ? 45  ILE A HD13   1 
ATOM   459   N  N      . HIS A  1 47  ? 33.063  -75.549 22.476  1.00 224.39 ? 46  HIS A N      1 
ATOM   460   C  CA     . HIS A  1 47  ? 34.484  -75.854 22.575  1.00 229.03 ? 46  HIS A CA     1 
ATOM   461   C  C      . HIS A  1 47  ? 34.668  -77.359 22.733  1.00 240.33 ? 46  HIS A C      1 
ATOM   462   O  O      . HIS A  1 47  ? 34.373  -77.922 23.786  1.00 243.16 ? 46  HIS A O      1 
ATOM   463   C  CB     . HIS A  1 47  ? 35.099  -75.113 23.764  1.00 228.28 ? 46  HIS A CB     1 
ATOM   464   C  CG     . HIS A  1 47  ? 36.591  -75.216 23.838  1.00 231.14 ? 46  HIS A CG     1 
ATOM   465   N  ND1    . HIS A  1 47  ? 37.272  -75.285 25.033  1.00 230.75 ? 46  HIS A ND1    1 
ATOM   466   C  CD2    . HIS A  1 47  ? 37.533  -75.248 22.866  1.00 234.52 ? 46  HIS A CD2    1 
ATOM   467   C  CE1    . HIS A  1 47  ? 38.569  -75.364 24.796  1.00 232.23 ? 46  HIS A CE1    1 
ATOM   468   N  NE2    . HIS A  1 47  ? 38.754  -75.343 23.488  1.00 234.60 ? 46  HIS A NE2    1 
ATOM   469   H  H      . HIS A  1 47  ? 32.751  -75.120 23.153  1.00 269.27 ? 46  HIS A H      1 
ATOM   470   H  HA     . HIS A  1 47  ? 34.941  -75.566 21.757  1.00 274.83 ? 46  HIS A HA     1 
ATOM   471   H  HB2    . HIS A  1 47  ? 34.870  -74.173 23.698  1.00 273.94 ? 46  HIS A HB2    1 
ATOM   472   H  HB3    . HIS A  1 47  ? 34.736  -75.483 24.584  1.00 273.94 ? 46  HIS A HB3    1 
ATOM   473   H  HD1    . HIS A  1 47  ? 36.909  -75.282 25.813  1.00 276.90 ? 46  HIS A HD1    1 
ATOM   474   H  HD2    . HIS A  1 47  ? 37.381  -75.217 21.949  1.00 281.42 ? 46  HIS A HD2    1 
ATOM   475   H  HE1    . HIS A  1 47  ? 39.237  -75.423 25.440  1.00 278.67 ? 46  HIS A HE1    1 
ATOM   476   H  HE2    . HIS A  1 47  ? 39.516  -75.382 23.091  1.00 281.52 ? 46  HIS A HE2    1 
ATOM   477   N  N      . LYS A  1 48  ? 35.153  -78.005 21.677  1.00 246.84 ? 47  LYS A N      1 
ATOM   478   C  CA     . LYS A  1 48  ? 35.278  -79.460 21.649  1.00 246.13 ? 47  LYS A CA     1 
ATOM   479   C  C      . LYS A  1 48  ? 36.081  -80.010 22.827  1.00 235.88 ? 47  LYS A C      1 
ATOM   480   O  O      . LYS A  1 48  ? 35.797  -81.100 23.324  1.00 233.27 ? 47  LYS A O      1 
ATOM   481   C  CB     . LYS A  1 48  ? 35.933  -79.910 20.340  1.00 251.26 ? 47  LYS A CB     1 
ATOM   482   C  CG     . LYS A  1 48  ? 35.118  -79.610 19.093  1.00 255.44 ? 47  LYS A CG     1 
ATOM   483   C  CD     . LYS A  1 48  ? 35.767  -80.210 17.855  1.00 263.02 ? 47  LYS A CD     1 
ATOM   484   C  CE     . LYS A  1 48  ? 34.967  -79.901 16.603  1.00 266.75 ? 47  LYS A CE     1 
ATOM   485   N  NZ     . LYS A  1 48  ? 35.478  -80.631 15.410  1.00 269.49 ? 47  LYS A NZ     1 
ATOM   486   H  H      . LYS A  1 48  ? 35.419  -77.620 20.956  1.00 296.20 ? 47  LYS A H      1 
ATOM   487   H  HA     . LYS A  1 48  ? 34.382  -79.855 21.687  1.00 295.36 ? 47  LYS A HA     1 
ATOM   488   H  HB2    . LYS A  1 48  ? 36.787  -79.458 20.249  1.00 301.51 ? 47  LYS A HB2    1 
ATOM   489   H  HB3    . LYS A  1 48  ? 36.073  -80.869 20.377  1.00 301.51 ? 47  LYS A HB3    1 
ATOM   490   H  HG2    . LYS A  1 48  ? 34.232  -79.994 19.189  1.00 306.53 ? 47  LYS A HG2    1 
ATOM   491   H  HG3    . LYS A  1 48  ? 35.058  -78.650 18.972  1.00 306.53 ? 47  LYS A HG3    1 
ATOM   492   H  HD2    . LYS A  1 48  ? 36.656  -79.836 17.748  1.00 315.62 ? 47  LYS A HD2    1 
ATOM   493   H  HD3    . LYS A  1 48  ? 35.817  -81.173 17.954  1.00 315.62 ? 47  LYS A HD3    1 
ATOM   494   H  HE2    . LYS A  1 48  ? 34.044  -80.163 16.744  1.00 320.10 ? 47  LYS A HE2    1 
ATOM   495   H  HE3    . LYS A  1 48  ? 35.019  -78.950 16.419  1.00 320.10 ? 47  LYS A HE3    1 
ATOM   496   H  HZ1    . LYS A  1 48  ? 34.987  -80.428 14.696  1.00 323.39 ? 47  LYS A HZ1    1 
ATOM   497   H  HZ2    . LYS A  1 48  ? 36.324  -80.404 15.254  1.00 323.39 ? 47  LYS A HZ2    1 
ATOM   498   H  HZ3    . LYS A  1 48  ? 35.435  -81.509 15.549  1.00 323.39 ? 47  LYS A HZ3    1 
ATOM   499   N  N      . GLU A  1 49  ? 37.081  -79.254 23.269  1.00 229.47 ? 48  GLU A N      1 
ATOM   500   C  CA     . GLU A  1 49  ? 38.010  -79.732 24.289  1.00 223.66 ? 48  GLU A CA     1 
ATOM   501   C  C      . GLU A  1 49  ? 37.416  -79.736 25.698  1.00 219.87 ? 48  GLU A C      1 
ATOM   502   O  O      . GLU A  1 49  ? 37.447  -80.758 26.384  1.00 208.38 ? 48  GLU A O      1 
ATOM   503   C  CB     . GLU A  1 49  ? 39.291  -78.894 24.261  1.00 224.99 ? 48  GLU A CB     1 
ATOM   504   C  CG     . GLU A  1 49  ? 40.151  -79.135 23.029  1.00 232.17 ? 48  GLU A CG     1 
ATOM   505   C  CD     . GLU A  1 49  ? 41.293  -78.145 22.905  1.00 238.35 ? 48  GLU A CD     1 
ATOM   506   O  OE1    . GLU A  1 49  ? 41.341  -77.187 23.705  1.00 237.99 ? 48  GLU A OE1    1 
ATOM   507   O  OE2    . GLU A  1 49  ? 42.142  -78.327 22.007  1.00 243.28 ? 48  GLU A OE2    1 
ATOM   508   H  H      . GLU A  1 49  ? 37.244  -78.456 22.993  1.00 275.37 ? 48  GLU A H      1 
ATOM   509   H  HA     . GLU A  1 49  ? 38.258  -80.655 24.073  1.00 268.40 ? 48  GLU A HA     1 
ATOM   510   H  HB2    . GLU A  1 49  ? 39.050  -77.954 24.276  1.00 269.98 ? 48  GLU A HB2    1 
ATOM   511   H  HB3    . GLU A  1 49  ? 39.823  -79.110 25.042  1.00 269.98 ? 48  GLU A HB3    1 
ATOM   512   H  HG2    . GLU A  1 49  ? 40.532  -80.026 23.079  1.00 278.60 ? 48  GLU A HG2    1 
ATOM   513   H  HG3    . GLU A  1 49  ? 39.598  -79.055 22.236  1.00 278.60 ? 48  GLU A HG3    1 
ATOM   514   N  N      . SER A  1 50  ? 36.877  -78.599 26.129  1.00 231.64 ? 49  SER A N      1 
ATOM   515   C  CA     . SER A  1 50  ? 36.365  -78.471 27.493  1.00 236.08 ? 49  SER A CA     1 
ATOM   516   C  C      . SER A  1 50  ? 34.839  -78.534 27.548  1.00 249.89 ? 49  SER A C      1 
ATOM   517   O  O      . SER A  1 50  ? 34.258  -78.686 28.623  1.00 252.05 ? 49  SER A O      1 
ATOM   518   C  CB     . SER A  1 50  ? 36.849  -77.163 28.123  1.00 222.83 ? 49  SER A CB     1 
ATOM   519   O  OG     . SER A  1 50  ? 38.256  -77.032 28.006  1.00 220.09 ? 49  SER A OG     1 
ATOM   520   H  H      . SER A  1 50  ? 36.796  -77.887 25.654  1.00 277.97 ? 49  SER A H      1 
ATOM   521   H  HA     . SER A  1 50  ? 36.714  -79.210 28.032  1.00 283.30 ? 49  SER A HA     1 
ATOM   522   H  HB2    . SER A  1 50  ? 36.425  -76.418 27.669  1.00 267.40 ? 49  SER A HB2    1 
ATOM   523   H  HB3    . SER A  1 50  ? 36.610  -77.158 29.063  1.00 267.40 ? 49  SER A HB3    1 
ATOM   524   H  HG     . SER A  1 50  ? 38.501  -76.327 28.347  1.00 264.11 ? 49  SER A HG     1 
ATOM   525   N  N      . GLY A  1 51  ? 34.194  -78.414 26.393  1.00 260.43 ? 50  GLY A N      1 
ATOM   526   C  CA     . GLY A  1 51  ? 32.744  -78.453 26.324  1.00 269.39 ? 50  GLY A CA     1 
ATOM   527   C  C      . GLY A  1 51  ? 32.099  -77.130 26.695  1.00 278.90 ? 50  GLY A C      1 
ATOM   528   O  O      . GLY A  1 51  ? 30.874  -77.011 26.703  1.00 275.47 ? 50  GLY A O      1 
ATOM   529   H  H      . GLY A  1 51  ? 34.578  -78.307 25.631  1.00 312.52 ? 50  GLY A H      1 
ATOM   530   H  HA2    . GLY A  1 51  ? 32.471  -78.684 25.423  1.00 323.27 ? 50  GLY A HA2    1 
ATOM   531   H  HA3    . GLY A  1 51  ? 32.412  -79.135 26.929  1.00 323.27 ? 50  GLY A HA3    1 
ATOM   532   N  N      . GLN A  1 52  ? 32.923  -76.133 27.001  1.00 293.71 ? 51  GLN A N      1 
ATOM   533   C  CA     . GLN A  1 52  ? 32.426  -74.813 27.370  1.00 147.12 ? 51  GLN A CA     1 
ATOM   534   C  C      . GLN A  1 52  ? 31.806  -74.131 26.155  1.00 141.37 ? 51  GLN A C      1 
ATOM   535   O  O      . GLN A  1 52  ? 32.486  -73.888 25.158  1.00 155.53 ? 51  GLN A O      1 
ATOM   536   C  CB     . GLN A  1 52  ? 33.564  -73.954 27.920  1.00 161.63 ? 51  GLN A CB     1 
ATOM   537   C  CG     . GLN A  1 52  ? 33.105  -72.740 28.714  1.00 170.37 ? 51  GLN A CG     1 
ATOM   538   C  CD     . GLN A  1 52  ? 32.610  -73.104 30.102  1.00 178.51 ? 51  GLN A CD     1 
ATOM   539   O  OE1    . GLN A  1 52  ? 32.486  -74.282 30.441  1.00 182.92 ? 51  GLN A OE1    1 
ATOM   540   N  NE2    . GLN A  1 52  ? 32.329  -72.092 30.915  1.00 176.27 ? 51  GLN A NE2    1 
ATOM   541   H  H      . GLN A  1 52  ? 33.781  -76.196 27.001  1.00 352.45 ? 51  GLN A H      1 
ATOM   542   H  HA     . GLN A  1 52  ? 31.738  -74.903 28.063  1.00 176.54 ? 51  GLN A HA     1 
ATOM   543   H  HB2    . GLN A  1 52  ? 34.111  -74.500 28.507  1.00 193.96 ? 51  GLN A HB2    1 
ATOM   544   H  HB3    . GLN A  1 52  ? 34.100  -73.635 27.177  1.00 193.96 ? 51  GLN A HB3    1 
ATOM   545   H  HG2    . GLN A  1 52  ? 33.849  -72.126 28.812  1.00 204.45 ? 51  GLN A HG2    1 
ATOM   546   H  HG3    . GLN A  1 52  ? 32.377  -72.308 28.239  1.00 204.45 ? 51  GLN A HG3    1 
ATOM   547   H  HE21   . GLN A  1 52  ? 32.431  -71.282 30.645  1.00 211.52 ? 51  GLN A HE21   1 
ATOM   548   H  HE22   . GLN A  1 52  ? 32.046  -72.246 31.712  1.00 211.52 ? 51  GLN A HE22   1 
ATOM   549   N  N      . VAL A  1 53  ? 30.517  -73.821 26.243  1.00 276.15 ? 52  VAL A N      1 
ATOM   550   C  CA     . VAL A  1 53  ? 29.806  -73.195 25.134  1.00 239.48 ? 52  VAL A CA     1 
ATOM   551   C  C      . VAL A  1 53  ? 30.340  -71.788 24.883  1.00 218.17 ? 52  VAL A C      1 
ATOM   552   O  O      . VAL A  1 53  ? 30.535  -71.013 25.820  1.00 223.16 ? 52  VAL A O      1 
ATOM   553   C  CB     . VAL A  1 53  ? 28.290  -73.113 25.409  1.00 229.44 ? 52  VAL A CB     1 
ATOM   554   C  CG1    . VAL A  1 53  ? 27.571  -72.439 24.247  1.00 225.21 ? 52  VAL A CG1    1 
ATOM   555   C  CG2    . VAL A  1 53  ? 27.716  -74.501 25.659  1.00 227.78 ? 52  VAL A CG2    1 
ATOM   556   H  H      . VAL A  1 53  ? 30.029  -73.964 26.937  1.00 331.38 ? 52  VAL A H      1 
ATOM   557   H  HA     . VAL A  1 53  ? 29.942  -73.725 24.322  1.00 287.37 ? 52  VAL A HA     1 
ATOM   558   H  HB     . VAL A  1 53  ? 28.140  -72.573 26.213  1.00 275.32 ? 52  VAL A HB     1 
ATOM   559   H  HG11   . VAL A  1 53  ? 26.632  -72.400 24.442  1.00 270.25 ? 52  VAL A HG11   1 
ATOM   560   H  HG12   . VAL A  1 53  ? 27.920  -71.551 24.136  1.00 270.25 ? 52  VAL A HG12   1 
ATOM   561   H  HG13   . VAL A  1 53  ? 27.720  -72.951 23.449  1.00 270.25 ? 52  VAL A HG13   1 
ATOM   562   H  HG21   . VAL A  1 53  ? 26.774  -74.423 25.827  1.00 273.34 ? 52  VAL A HG21   1 
ATOM   563   H  HG22   . VAL A  1 53  ? 27.866  -75.045 24.883  1.00 273.34 ? 52  VAL A HG22   1 
ATOM   564   H  HG23   . VAL A  1 53  ? 28.154  -74.887 26.421  1.00 273.34 ? 52  VAL A HG23   1 
ATOM   565   N  N      . VAL A  1 54  ? 30.578  -71.466 23.615  1.00 201.55 ? 53  VAL A N      1 
ATOM   566   C  CA     . VAL A  1 54  ? 31.048  -70.139 23.237  1.00 196.50 ? 53  VAL A CA     1 
ATOM   567   C  C      . VAL A  1 54  ? 30.238  -69.601 22.064  1.00 202.30 ? 53  VAL A C      1 
ATOM   568   O  O      . VAL A  1 54  ? 29.393  -70.301 21.506  1.00 205.44 ? 53  VAL A O      1 
ATOM   569   C  CB     . VAL A  1 54  ? 32.538  -70.155 22.839  1.00 186.26 ? 53  VAL A CB     1 
ATOM   570   C  CG1    . VAL A  1 54  ? 33.369  -70.827 23.920  1.00 183.47 ? 53  VAL A CG1    1 
ATOM   571   C  CG2    . VAL A  1 54  ? 32.730  -70.856 21.500  1.00 193.34 ? 53  VAL A CG2    1 
ATOM   572   H  H      . VAL A  1 54  ? 30.473  -72.003 22.952  1.00 241.86 ? 53  VAL A H      1 
ATOM   573   H  HA     . VAL A  1 54  ? 30.938  -69.527 23.994  1.00 235.80 ? 53  VAL A HA     1 
ATOM   574   H  HB     . VAL A  1 54  ? 32.853  -69.232 22.745  1.00 223.52 ? 53  VAL A HB     1 
ATOM   575   H  HG11   . VAL A  1 54  ? 34.291  -70.825 23.651  1.00 220.16 ? 53  VAL A HG11   1 
ATOM   576   H  HG12   . VAL A  1 54  ? 33.266  -70.341 24.741  1.00 220.16 ? 53  VAL A HG12   1 
ATOM   577   H  HG13   . VAL A  1 54  ? 33.063  -71.730 24.033  1.00 220.16 ? 53  VAL A HG13   1 
ATOM   578   H  HG21   . VAL A  1 54  ? 33.663  -70.852 21.277  1.00 232.01 ? 53  VAL A HG21   1 
ATOM   579   H  HG22   . VAL A  1 54  ? 32.414  -71.760 21.574  1.00 232.01 ? 53  VAL A HG22   1 
ATOM   580   H  HG23   . VAL A  1 54  ? 32.230  -70.387 20.828  1.00 232.01 ? 53  VAL A HG23   1 
ATOM   581   N  N      . ALA A  1 55  ? 30.505  -68.352 21.696  1.00 202.97 ? 54  ALA A N      1 
ATOM   582   C  CA     . ALA A  1 55  ? 29.851  -67.725 20.554  1.00 195.47 ? 54  ALA A CA     1 
ATOM   583   C  C      . ALA A  1 55  ? 30.893  -67.380 19.497  1.00 182.24 ? 54  ALA A C      1 
ATOM   584   O  O      . ALA A  1 55  ? 32.057  -67.147 19.818  1.00 170.60 ? 54  ALA A O      1 
ATOM   585   C  CB     . ALA A  1 55  ? 29.105  -66.477 20.994  1.00 191.94 ? 54  ALA A CB     1 
ATOM   586   H  H      . ALA A  1 55  ? 31.068  -67.840 22.098  1.00 243.56 ? 54  ALA A H      1 
ATOM   587   H  HA     . ALA A  1 55  ? 29.206  -68.351 20.163  1.00 234.56 ? 54  ALA A HA     1 
ATOM   588   H  HB1    . ALA A  1 55  ? 28.682  -66.081 20.228  1.00 230.33 ? 54  ALA A HB1    1 
ATOM   589   H  HB2    . ALA A  1 55  ? 28.442  -66.722 21.644  1.00 230.33 ? 54  ALA A HB2    1 
ATOM   590   H  HB3    . ALA A  1 55  ? 29.730  -65.859 21.380  1.00 230.33 ? 54  ALA A HB3    1 
ATOM   591   N  N      . ILE A  1 56  ? 30.474  -67.353 18.236  1.00 184.43 ? 55  ILE A N      1 
ATOM   592   C  CA     . ILE A  1 56  ? 31.389  -67.061 17.138  1.00 191.38 ? 55  ILE A CA     1 
ATOM   593   C  C      . ILE A  1 56  ? 30.747  -66.149 16.097  1.00 192.46 ? 55  ILE A C      1 
ATOM   594   O  O      . ILE A  1 56  ? 29.791  -66.532 15.422  1.00 194.72 ? 55  ILE A O      1 
ATOM   595   C  CB     . ILE A  1 56  ? 31.870  -68.352 16.453  1.00 188.48 ? 55  ILE A CB     1 
ATOM   596   C  CG1    . ILE A  1 56  ? 32.756  -69.153 17.411  1.00 196.19 ? 55  ILE A CG1    1 
ATOM   597   C  CG2    . ILE A  1 56  ? 32.635  -68.023 15.179  1.00 178.35 ? 55  ILE A CG2    1 
ATOM   598   C  CD1    . ILE A  1 56  ? 33.219  -70.482 16.859  1.00 202.43 ? 55  ILE A CD1    1 
ATOM   599   H  H      . ILE A  1 56  ? 29.664  -67.501 17.989  1.00 221.32 ? 55  ILE A H      1 
ATOM   600   H  HA     . ILE A  1 56  ? 32.176  -66.601 17.497  1.00 229.66 ? 55  ILE A HA     1 
ATOM   601   H  HB     . ILE A  1 56  ? 31.096  -68.889 16.222  1.00 226.18 ? 55  ILE A HB     1 
ATOM   602   H  HG12   . ILE A  1 56  ? 33.545  -68.628 17.617  1.00 235.42 ? 55  ILE A HG12   1 
ATOM   603   H  HG13   . ILE A  1 56  ? 32.256  -69.328 18.224  1.00 235.42 ? 55  ILE A HG13   1 
ATOM   604   H  HG21   . ILE A  1 56  ? 32.925  -68.841 14.769  1.00 214.02 ? 55  ILE A HG21   1 
ATOM   605   H  HG22   . ILE A  1 56  ? 32.056  -67.545 14.581  1.00 214.02 ? 55  ILE A HG22   1 
ATOM   606   H  HG23   . ILE A  1 56  ? 33.395  -67.481 15.402  1.00 214.02 ? 55  ILE A HG23   1 
ATOM   607   H  HD11   . ILE A  1 56  ? 33.765  -70.919 17.515  1.00 242.92 ? 55  ILE A HD11   1 
ATOM   608   H  HD12   . ILE A  1 56  ? 32.450  -71.022 16.660  1.00 242.92 ? 55  ILE A HD12   1 
ATOM   609   H  HD13   . ILE A  1 56  ? 33.727  -70.328 16.059  1.00 242.92 ? 55  ILE A HD13   1 
ATOM   610   N  N      . LYS A  1 57  ? 31.287  -64.941 15.974  1.00 188.23 ? 56  LYS A N      1 
ATOM   611   C  CA     . LYS A  1 57  ? 30.804  -63.977 14.996  1.00 191.39 ? 56  LYS A CA     1 
ATOM   612   C  C      . LYS A  1 57  ? 31.677  -64.038 13.747  1.00 207.25 ? 56  LYS A C      1 
ATOM   613   O  O      . LYS A  1 57  ? 32.872  -64.321 13.830  1.00 215.33 ? 56  LYS A O      1 
ATOM   614   C  CB     . LYS A  1 57  ? 30.827  -62.566 15.586  1.00 181.50 ? 56  LYS A CB     1 
ATOM   615   C  CG     . LYS A  1 57  ? 30.083  -61.532 14.756  1.00 178.98 ? 56  LYS A CG     1 
ATOM   616   C  CD     . LYS A  1 57  ? 30.162  -60.152 15.386  1.00 166.41 ? 56  LYS A CD     1 
ATOM   617   C  CE     . LYS A  1 57  ? 29.287  -59.155 14.647  1.00 166.76 ? 56  LYS A CE     1 
ATOM   618   N  NZ     . LYS A  1 57  ? 29.350  -57.798 15.257  1.00 175.41 ? 56  LYS A NZ     1 
ATOM   619   H  H      . LYS A  1 57  ? 31.942  -64.653 16.452  1.00 225.88 ? 56  LYS A H      1 
ATOM   620   H  HA     . LYS A  1 57  ? 29.883  -64.196 14.745  1.00 229.67 ? 56  LYS A HA     1 
ATOM   621   H  HB2    . LYS A  1 57  ? 30.417  -62.590 16.465  1.00 217.80 ? 56  LYS A HB2    1 
ATOM   622   H  HB3    . LYS A  1 57  ? 31.749  -62.275 15.663  1.00 217.80 ? 56  LYS A HB3    1 
ATOM   623   H  HG2    . LYS A  1 57  ? 30.480  -61.486 13.872  1.00 214.78 ? 56  LYS A HG2    1 
ATOM   624   H  HG3    . LYS A  1 57  ? 29.149  -61.785 14.692  1.00 214.78 ? 56  LYS A HG3    1 
ATOM   625   H  HD2    . LYS A  1 57  ? 29.857  -60.202 16.305  1.00 199.69 ? 56  LYS A HD2    1 
ATOM   626   H  HD3    . LYS A  1 57  ? 31.078  -59.836 15.352  1.00 199.69 ? 56  LYS A HD3    1 
ATOM   627   H  HE2    . LYS A  1 57  ? 29.588  -59.088 13.727  1.00 200.11 ? 56  LYS A HE2    1 
ATOM   628   H  HE3    . LYS A  1 57  ? 28.366  -59.458 14.675  1.00 200.11 ? 56  LYS A HE3    1 
ATOM   629   H  HZ1    . LYS A  1 57  ? 28.828  -57.237 14.804  1.00 210.49 ? 56  LYS A HZ1    1 
ATOM   630   H  HZ2    . LYS A  1 57  ? 29.073  -57.832 16.102  1.00 210.49 ? 56  LYS A HZ2    1 
ATOM   631   H  HZ3    . LYS A  1 57  ? 30.186  -57.495 15.239  1.00 210.49 ? 56  LYS A HZ3    1 
ATOM   632   N  N      . GLN A  1 58  ? 31.074  -63.775 12.591  1.00 208.25 ? 57  GLN A N      1 
ATOM   633   C  CA     . GLN A  1 58  ? 31.789  -63.831 11.322  1.00 208.04 ? 57  GLN A CA     1 
ATOM   634   C  C      . GLN A  1 58  ? 31.651  -62.520 10.554  1.00 199.09 ? 57  GLN A C      1 
ATOM   635   O  O      . GLN A  1 58  ? 30.559  -62.161 10.114  1.00 186.58 ? 57  GLN A O      1 
ATOM   636   C  CB     . GLN A  1 58  ? 31.265  -64.993 10.476  1.00 213.26 ? 57  GLN A CB     1 
ATOM   637   C  CG     . GLN A  1 58  ? 31.604  -66.365 11.041  1.00 219.10 ? 57  GLN A CG     1 
ATOM   638   C  CD     . GLN A  1 58  ? 30.870  -67.488 10.332  1.00 226.26 ? 57  GLN A CD     1 
ATOM   639   O  OE1    . GLN A  1 58  ? 29.922  -67.251 9.584   1.00 239.09 ? 57  GLN A OE1    1 
ATOM   640   N  NE2    . GLN A  1 58  ? 31.307  -68.721 10.565  1.00 215.84 ? 57  GLN A NE2    1 
ATOM   641   H  H      . GLN A  1 58  ? 30.245  -63.559 12.516  1.00 249.90 ? 57  GLN A H      1 
ATOM   642   H  HA     . GLN A  1 58  ? 32.742  -63.984 11.496  1.00 249.64 ? 57  GLN A HA     1 
ATOM   643   H  HB2    . GLN A  1 58  ? 30.300  -64.926 10.418  1.00 255.92 ? 57  GLN A HB2    1 
ATOM   644   H  HB3    . GLN A  1 58  ? 31.653  -64.934 9.589   1.00 255.92 ? 57  GLN A HB3    1 
ATOM   645   H  HG2    . GLN A  1 58  ? 32.556  -66.521 10.944  1.00 262.92 ? 57  GLN A HG2    1 
ATOM   646   H  HG3    . GLN A  1 58  ? 31.357  -66.391 11.979  1.00 262.92 ? 57  GLN A HG3    1 
ATOM   647   H  HE21   . GLN A  1 58  ? 31.973  -68.848 11.094  1.00 259.01 ? 57  GLN A HE21   1 
ATOM   648   H  HE22   . GLN A  1 58  ? 30.924  -69.391 10.187  1.00 259.01 ? 57  GLN A HE22   1 
ATOM   649   N  N      . VAL A  1 59  ? 32.765  -61.811 10.396  1.00 205.76 ? 58  VAL A N      1 
ATOM   650   C  CA     . VAL A  1 59  ? 32.772  -60.536 9.689   1.00 217.13 ? 58  VAL A CA     1 
ATOM   651   C  C      . VAL A  1 59  ? 33.620  -60.629 8.424   1.00 233.37 ? 58  VAL A C      1 
ATOM   652   O  O      . VAL A  1 59  ? 34.650  -61.302 8.413   1.00 238.13 ? 58  VAL A O      1 
ATOM   653   C  CB     . VAL A  1 59  ? 33.329  -59.400 10.573  1.00 214.44 ? 58  VAL A CB     1 
ATOM   654   C  CG1    . VAL A  1 59  ? 32.562  -59.318 11.884  1.00 220.74 ? 58  VAL A CG1    1 
ATOM   655   C  CG2    . VAL A  1 59  ? 34.815  -59.602 10.841  1.00 207.99 ? 58  VAL A CG2    1 
ATOM   656   H  H      . VAL A  1 59  ? 33.537  -62.050 10.692  1.00 246.91 ? 58  VAL A H      1 
ATOM   657   H  HA     . VAL A  1 59  ? 31.856  -60.304 9.430   1.00 260.56 ? 58  VAL A HA     1 
ATOM   658   H  HB     . VAL A  1 59  ? 33.219  -58.546 10.104  1.00 257.33 ? 58  VAL A HB     1 
ATOM   659   H  HG11   . VAL A  1 59  ? 32.926  -58.606 12.415  1.00 264.89 ? 58  VAL A HG11   1 
ATOM   660   H  HG12   . VAL A  1 59  ? 31.637  -59.145 11.694  1.00 264.89 ? 58  VAL A HG12   1 
ATOM   661   H  HG13   . VAL A  1 59  ? 32.651  -60.153 12.350  1.00 264.89 ? 58  VAL A HG13   1 
ATOM   662   H  HG21   . VAL A  1 59  ? 35.134  -58.882 11.392  1.00 249.59 ? 58  VAL A HG21   1 
ATOM   663   H  HG22   . VAL A  1 59  ? 34.940  -60.440 11.292  1.00 249.59 ? 58  VAL A HG22   1 
ATOM   664   H  HG23   . VAL A  1 59  ? 35.285  -59.606 10.004  1.00 249.59 ? 58  VAL A HG23   1 
ATOM   665   N  N      . PRO A  1 60  ? 33.185  -59.954 7.348   1.00 239.30 ? 59  PRO A N      1 
ATOM   666   C  CA     . PRO A  1 60  ? 33.968  -59.905 6.108   1.00 239.51 ? 59  PRO A CA     1 
ATOM   667   C  C      . PRO A  1 60  ? 35.150  -58.945 6.223   1.00 236.92 ? 59  PRO A C      1 
ATOM   668   O  O      . PRO A  1 60  ? 34.953  -57.757 6.479   1.00 231.77 ? 59  PRO A O      1 
ATOM   669   C  CB     . PRO A  1 60  ? 32.957  -59.399 5.078   1.00 239.40 ? 59  PRO A CB     1 
ATOM   670   C  CG     . PRO A  1 60  ? 31.985  -58.599 5.868   1.00 236.57 ? 59  PRO A CG     1 
ATOM   671   C  CD     . PRO A  1 60  ? 31.893  -59.259 7.214   1.00 237.80 ? 59  PRO A CD     1 
ATOM   672   H  HA     . PRO A  1 60  ? 34.284  -60.798 5.857   1.00 287.41 ? 59  PRO A HA     1 
ATOM   673   H  HB2    . PRO A  1 60  ? 33.406  -58.844 4.421   1.00 287.28 ? 59  PRO A HB2    1 
ATOM   674   H  HB3    . PRO A  1 60  ? 32.517  -60.151 4.652   1.00 287.28 ? 59  PRO A HB3    1 
ATOM   675   H  HG2    . PRO A  1 60  ? 32.312  -57.690 5.957   1.00 283.88 ? 59  PRO A HG2    1 
ATOM   676   H  HG3    . PRO A  1 60  ? 31.122  -58.608 5.425   1.00 283.88 ? 59  PRO A HG3    1 
ATOM   677   H  HD2    . PRO A  1 60  ? 31.796  -58.591 7.912   1.00 285.36 ? 59  PRO A HD2    1 
ATOM   678   H  HD3    . PRO A  1 60  ? 31.163  -59.897 7.228   1.00 285.36 ? 59  PRO A HD3    1 
ATOM   679   N  N      . VAL A  1 61  ? 36.361  -59.463 6.037   1.00 233.67 ? 60  VAL A N      1 
ATOM   680   C  CA     . VAL A  1 61  ? 37.575  -58.667 6.198   1.00 223.39 ? 60  VAL A CA     1 
ATOM   681   C  C      . VAL A  1 61  ? 37.583  -57.440 5.291   1.00 221.43 ? 60  VAL A C      1 
ATOM   682   O  O      . VAL A  1 61  ? 38.084  -56.381 5.672   1.00 217.60 ? 60  VAL A O      1 
ATOM   683   C  CB     . VAL A  1 61  ? 38.843  -59.501 5.905   1.00 209.06 ? 60  VAL A CB     1 
ATOM   684   C  CG1    . VAL A  1 61  ? 38.966  -60.651 6.894   1.00 199.85 ? 60  VAL A CG1    1 
ATOM   685   C  CG2    . VAL A  1 61  ? 38.836  -60.017 4.468   1.00 206.04 ? 60  VAL A CG2    1 
ATOM   686   H  H      . VAL A  1 61  ? 36.507  -60.280 5.814   1.00 280.40 ? 60  VAL A H      1 
ATOM   687   H  HA     . VAL A  1 61  ? 37.628  -58.356 7.125   1.00 268.07 ? 60  VAL A HA     1 
ATOM   688   H  HB     . VAL A  1 61  ? 39.630  -58.927 6.013   1.00 250.87 ? 60  VAL A HB     1 
ATOM   689   H  HG11   . VAL A  1 61  ? 39.759  -61.153 6.692   1.00 239.82 ? 60  VAL A HG11   1 
ATOM   690   H  HG12   . VAL A  1 61  ? 39.022  -60.294 7.783   1.00 239.82 ? 60  VAL A HG12   1 
ATOM   691   H  HG13   . VAL A  1 61  ? 38.193  -61.215 6.815   1.00 239.82 ? 60  VAL A HG13   1 
ATOM   692   H  HG21   . VAL A  1 61  ? 39.633  -60.529 4.316   1.00 247.25 ? 60  VAL A HG21   1 
ATOM   693   H  HG22   . VAL A  1 61  ? 38.062  -60.569 4.338   1.00 247.25 ? 60  VAL A HG22   1 
ATOM   694   H  HG23   . VAL A  1 61  ? 38.808  -59.268 3.868   1.00 247.25 ? 60  VAL A HG23   1 
ATOM   695   N  N      . GLU A  1 62  ? 37.029  -57.590 4.093   1.00 222.62 ? 61  GLU A N      1 
ATOM   696   C  CA     . GLU A  1 62  ? 37.033  -56.522 3.097   1.00 220.97 ? 61  GLU A CA     1 
ATOM   697   C  C      . GLU A  1 62  ? 36.471  -55.205 3.632   1.00 222.37 ? 61  GLU A C      1 
ATOM   698   O  O      . GLU A  1 62  ? 36.902  -54.129 3.217   1.00 220.94 ? 61  GLU A O      1 
ATOM   699   C  CB     . GLU A  1 62  ? 36.248  -56.951 1.851   1.00 218.80 ? 61  GLU A CB     1 
ATOM   700   C  CG     . GLU A  1 62  ? 34.820  -57.407 2.128   1.00 214.18 ? 61  GLU A CG     1 
ATOM   701   C  CD     . GLU A  1 62  ? 34.072  -57.788 0.864   1.00 204.58 ? 61  GLU A CD     1 
ATOM   702   O  OE1    . GLU A  1 62  ? 34.579  -57.497 -0.240  1.00 197.53 ? 61  GLU A OE1    1 
ATOM   703   O  OE2    . GLU A  1 62  ? 32.979  -58.383 0.974   1.00 201.29 ? 61  GLU A OE2    1 
ATOM   704   H  H      . GLU A  1 62  ? 36.640  -58.310 3.828   1.00 267.14 ? 61  GLU A H      1 
ATOM   705   H  HA     . GLU A  1 62  ? 37.959  -56.357 2.821   1.00 265.17 ? 61  GLU A HA     1 
ATOM   706   H  HB2    . GLU A  1 62  ? 36.204  -56.200 1.239   1.00 262.56 ? 61  GLU A HB2    1 
ATOM   707   H  HB3    . GLU A  1 62  ? 36.715  -57.689 1.430   1.00 262.56 ? 61  GLU A HB3    1 
ATOM   708   H  HG2    . GLU A  1 62  ? 34.842  -58.183 2.709   1.00 257.02 ? 61  GLU A HG2    1 
ATOM   709   H  HG3    . GLU A  1 62  ? 34.335  -56.684 2.558   1.00 257.02 ? 61  GLU A HG3    1 
ATOM   710   N  N      . SER A  1 63  ? 35.514  -55.292 4.552   1.00 227.08 ? 62  SER A N      1 
ATOM   711   C  CA     . SER A  1 63  ? 34.836  -54.103 5.061   1.00 234.19 ? 62  SER A CA     1 
ATOM   712   C  C      . SER A  1 63  ? 35.477  -53.562 6.337   1.00 236.59 ? 62  SER A C      1 
ATOM   713   O  O      . SER A  1 63  ? 35.172  -54.021 7.439   1.00 234.11 ? 62  SER A O      1 
ATOM   714   C  CB     . SER A  1 63  ? 33.356  -54.403 5.314   1.00 239.69 ? 62  SER A CB     1 
ATOM   715   O  OG     . SER A  1 63  ? 33.193  -55.422 6.284   1.00 244.67 ? 62  SER A OG     1 
ATOM   716   H  H      . SER A  1 63  ? 35.238  -56.030 4.897   1.00 272.50 ? 62  SER A H      1 
ATOM   717   H  HA     . SER A  1 63  ? 34.886  -53.399 4.382   1.00 281.03 ? 62  SER A HA     1 
ATOM   718   H  HB2    . SER A  1 63  ? 32.922  -53.595 5.631   1.00 287.62 ? 62  SER A HB2    1 
ATOM   719   H  HB3    . SER A  1 63  ? 32.948  -54.692 4.483   1.00 287.62 ? 62  SER A HB3    1 
ATOM   720   H  HG     . SER A  1 63  ? 33.926  -55.679 6.547   1.00 293.60 ? 62  SER A HG     1 
ATOM   721   N  N      . ASP A  1 64  ? 36.360  -52.581 6.173   1.00 239.08 ? 63  ASP A N      1 
ATOM   722   C  CA     . ASP A  1 64  ? 36.961  -51.868 7.299   1.00 239.86 ? 63  ASP A CA     1 
ATOM   723   C  C      . ASP A  1 64  ? 37.428  -52.791 8.419   1.00 237.76 ? 63  ASP A C      1 
ATOM   724   O  O      . ASP A  1 64  ? 36.717  -53.003 9.401   1.00 240.65 ? 63  ASP A O      1 
ATOM   725   C  CB     . ASP A  1 64  ? 35.976  -50.843 7.860   1.00 240.64 ? 63  ASP A CB     1 
ATOM   726   C  CG     . ASP A  1 64  ? 35.731  -49.689 6.908   1.00 237.96 ? 63  ASP A CG     1 
ATOM   727   O  OD1    . ASP A  1 64  ? 35.847  -49.895 5.682   1.00 238.21 ? 63  ASP A OD1    1 
ATOM   728   O  OD2    . ASP A  1 64  ? 35.425  -48.578 7.386   1.00 235.53 ? 63  ASP A OD2    1 
ATOM   729   H  H      . ASP A  1 64  ? 36.632  -52.304 5.406   1.00 286.89 ? 63  ASP A H      1 
ATOM   730   H  HA     . ASP A  1 64  ? 37.746  -51.378 6.974   1.00 287.84 ? 63  ASP A HA     1 
ATOM   731   H  HB2    . ASP A  1 64  ? 35.126  -51.279 8.027   1.00 288.77 ? 63  ASP A HB2    1 
ATOM   732   H  HB3    . ASP A  1 64  ? 36.332  -50.480 8.686   1.00 288.77 ? 63  ASP A HB3    1 
ATOM   733   N  N      . LEU A  1 65  ? 38.632  -53.329 8.265   1.00 230.16 ? 64  LEU A N      1 
ATOM   734   C  CA     . LEU A  1 65  ? 39.242  -54.169 9.290   1.00 220.10 ? 64  LEU A CA     1 
ATOM   735   C  C      . LEU A  1 65  ? 39.639  -53.363 10.523  1.00 220.85 ? 64  LEU A C      1 
ATOM   736   O  O      . LEU A  1 65  ? 39.611  -53.873 11.642  1.00 222.25 ? 64  LEU A O      1 
ATOM   737   C  CB     . LEU A  1 65  ? 40.475  -54.878 8.720   1.00 206.13 ? 64  LEU A CB     1 
ATOM   738   C  CG     . LEU A  1 65  ? 41.577  -53.996 8.120   1.00 191.23 ? 64  LEU A CG     1 
ATOM   739   C  CD1    . LEU A  1 65  ? 42.571  -53.541 9.180   1.00 191.17 ? 64  LEU A CD1    1 
ATOM   740   C  CD2    . LEU A  1 65  ? 42.295  -54.728 6.995   1.00 176.89 ? 64  LEU A CD2    1 
ATOM   741   H  H      . LEU A  1 65  ? 39.123  -53.221 7.567   1.00 276.20 ? 64  LEU A H      1 
ATOM   742   H  HA     . LEU A  1 65  ? 38.599  -54.853 9.568   1.00 264.12 ? 64  LEU A HA     1 
ATOM   743   H  HB2    . LEU A  1 65  ? 40.880  -55.395 9.434   1.00 247.35 ? 64  LEU A HB2    1 
ATOM   744   H  HB3    . LEU A  1 65  ? 40.178  -55.480 8.020   1.00 247.35 ? 64  LEU A HB3    1 
ATOM   745   H  HG     . LEU A  1 65  ? 41.168  -53.202 7.741   1.00 229.47 ? 64  LEU A HG     1 
ATOM   746   H  HD11   . LEU A  1 65  ? 43.242  -52.994 8.765   1.00 229.40 ? 64  LEU A HD11   1 
ATOM   747   H  HD12   . LEU A  1 65  ? 42.104  -53.036 9.850   1.00 229.40 ? 64  LEU A HD12   1 
ATOM   748   H  HD13   . LEU A  1 65  ? 42.979  -54.314 9.578   1.00 229.40 ? 64  LEU A HD13   1 
ATOM   749   H  HD21   . LEU A  1 65  ? 42.978  -54.156 6.637   1.00 212.26 ? 64  LEU A HD21   1 
ATOM   750   H  HD22   . LEU A  1 65  ? 42.689  -55.530 7.346   1.00 212.26 ? 64  LEU A HD22   1 
ATOM   751   H  HD23   . LEU A  1 65  ? 41.659  -54.947 6.310   1.00 212.26 ? 64  LEU A HD23   1 
ATOM   752   N  N      . GLN A  1 66  ? 40.008  -52.104 10.310  1.00 220.28 ? 65  GLN A N      1 
ATOM   753   C  CA     . GLN A  1 66  ? 40.515  -51.257 11.385  1.00 218.35 ? 65  GLN A CA     1 
ATOM   754   C  C      . GLN A  1 66  ? 39.466  -50.994 12.464  1.00 213.34 ? 65  GLN A C      1 
ATOM   755   O  O      . GLN A  1 66  ? 39.786  -50.951 13.652  1.00 199.48 ? 65  GLN A O      1 
ATOM   756   C  CB     . GLN A  1 66  ? 41.019  -49.932 10.807  1.00 221.49 ? 65  GLN A CB     1 
ATOM   757   C  CG     . GLN A  1 66  ? 41.408  -48.903 11.855  1.00 226.53 ? 65  GLN A CG     1 
ATOM   758   C  CD     . GLN A  1 66  ? 41.885  -47.600 11.242  1.00 222.86 ? 65  GLN A CD     1 
ATOM   759   O  OE1    . GLN A  1 66  ? 42.750  -47.592 10.367  1.00 230.20 ? 65  GLN A OE1    1 
ATOM   760   N  NE2    . GLN A  1 66  ? 41.313  -46.490 11.695  1.00 209.18 ? 65  GLN A NE2    1 
ATOM   761   H  H      . GLN A  1 66  ? 39.974  -51.713 9.545   1.00 264.34 ? 65  GLN A H      1 
ATOM   762   H  HA     . GLN A  1 66  ? 41.275  -51.707 11.809  1.00 262.03 ? 65  GLN A HA     1 
ATOM   763   H  HB2    . GLN A  1 66  ? 41.801  -50.108 10.261  1.00 265.79 ? 65  GLN A HB2    1 
ATOM   764   H  HB3    . GLN A  1 66  ? 40.318  -49.545 10.260  1.00 265.79 ? 65  GLN A HB3    1 
ATOM   765   H  HG2    . GLN A  1 66  ? 40.637  -48.710 12.411  1.00 271.84 ? 65  GLN A HG2    1 
ATOM   766   H  HG3    . GLN A  1 66  ? 42.128  -49.261 12.398  1.00 271.84 ? 65  GLN A HG3    1 
ATOM   767   H  HE21   . GLN A  1 66  ? 40.707  -46.536 12.304  1.00 251.02 ? 65  GLN A HE21   1 
ATOM   768   H  HE22   . GLN A  1 66  ? 41.549  -45.726 11.379  1.00 251.02 ? 65  GLN A HE22   1 
ATOM   769   N  N      . GLU A  1 67  ? 38.216  -50.820 12.049  1.00 222.12 ? 66  GLU A N      1 
ATOM   770   C  CA     . GLU A  1 67  ? 37.143  -50.503 12.983  1.00 227.74 ? 66  GLU A CA     1 
ATOM   771   C  C      . GLU A  1 67  ? 36.801  -51.700 13.864  1.00 232.21 ? 66  GLU A C      1 
ATOM   772   O  O      . GLU A  1 67  ? 36.576  -51.553 15.065  1.00 230.94 ? 66  GLU A O      1 
ATOM   773   C  CB     . GLU A  1 67  ? 35.901  -50.038 12.222  1.00 231.96 ? 66  GLU A CB     1 
ATOM   774   C  CG     . GLU A  1 67  ? 36.096  -48.732 11.474  1.00 235.13 ? 66  GLU A CG     1 
ATOM   775   C  CD     . GLU A  1 67  ? 34.874  -48.332 10.675  1.00 236.60 ? 66  GLU A CD     1 
ATOM   776   O  OE1    . GLU A  1 67  ? 33.917  -49.133 10.611  1.00 235.96 ? 66  GLU A OE1    1 
ATOM   777   O  OE2    . GLU A  1 67  ? 34.868  -47.218 10.110  1.00 237.85 ? 66  GLU A OE2    1 
ATOM   778   H  H      . GLU A  1 67  ? 37.963  -50.881 11.230  1.00 266.54 ? 66  GLU A H      1 
ATOM   779   H  HA     . GLU A  1 67  ? 37.433  -49.770 13.566  1.00 273.29 ? 66  GLU A HA     1 
ATOM   780   H  HB2    . GLU A  1 67  ? 35.659  -50.718 11.574  1.00 278.36 ? 66  GLU A HB2    1 
ATOM   781   H  HB3    . GLU A  1 67  ? 35.176  -49.913 12.854  1.00 278.36 ? 66  GLU A HB3    1 
ATOM   782   H  HG2    . GLU A  1 67  ? 36.282  -48.026 12.113  1.00 282.16 ? 66  GLU A HG2    1 
ATOM   783   H  HG3    . GLU A  1 67  ? 36.840  -48.827 10.859  1.00 282.16 ? 66  GLU A HG3    1 
ATOM   784   N  N      . ILE A  1 68  ? 36.763  -52.884 13.261  1.00 238.72 ? 67  ILE A N      1 
ATOM   785   C  CA     . ILE A  1 68  ? 36.464  -54.110 13.994  1.00 239.62 ? 67  ILE A CA     1 
ATOM   786   C  C      . ILE A  1 68  ? 37.525  -54.390 15.051  1.00 233.47 ? 67  ILE A C      1 
ATOM   787   O  O      . ILE A  1 68  ? 37.209  -54.671 16.207  1.00 234.74 ? 67  ILE A O      1 
ATOM   788   C  CB     . ILE A  1 68  ? 36.388  -55.324 13.045  1.00 242.40 ? 67  ILE A CB     1 
ATOM   789   C  CG1    . ILE A  1 68  ? 35.175  -55.207 12.118  1.00 243.19 ? 67  ILE A CG1    1 
ATOM   790   C  CG2    . ILE A  1 68  ? 36.328  -56.625 13.837  1.00 243.34 ? 67  ILE A CG2    1 
ATOM   791   C  CD1    . ILE A  1 68  ? 33.839  -55.254 12.835  1.00 246.89 ? 67  ILE A CD1    1 
ATOM   792   H  H      . ILE A  1 68  ? 36.908  -53.005 12.422  1.00 286.46 ? 67  ILE A H      1 
ATOM   793   H  HA     . ILE A  1 68  ? 35.598  -54.016 14.444  1.00 287.54 ? 67  ILE A HA     1 
ATOM   794   H  HB     . ILE A  1 68  ? 37.190  -55.335 12.499  1.00 290.88 ? 67  ILE A HB     1 
ATOM   795   H  HG12   . ILE A  1 68  ? 35.226  -54.363 11.643  1.00 291.83 ? 67  ILE A HG12   1 
ATOM   796   H  HG13   . ILE A  1 68  ? 35.196  -55.941 11.484  1.00 291.83 ? 67  ILE A HG13   1 
ATOM   797   H  HG21   . ILE A  1 68  ? 36.281  -57.363 13.224  1.00 292.01 ? 67  ILE A HG21   1 
ATOM   798   H  HG22   . ILE A  1 68  ? 37.117  -56.698 14.379  1.00 292.01 ? 67  ILE A HG22   1 
ATOM   799   H  HG23   . ILE A  1 68  ? 35.547  -56.614 14.396  1.00 292.01 ? 67  ILE A HG23   1 
ATOM   800   H  HD11   . ILE A  1 68  ? 33.134  -55.175 12.188  1.00 296.27 ? 67  ILE A HD11   1 
ATOM   801   H  HD12   . ILE A  1 68  ? 33.764  -56.089 13.301  1.00 296.27 ? 67  ILE A HD12   1 
ATOM   802   H  HD13   . ILE A  1 68  ? 33.794  -54.525 13.459  1.00 296.27 ? 67  ILE A HD13   1 
ATOM   803   N  N      . ILE A  1 69  ? 38.787  -54.313 14.643  1.00 226.58 ? 68  ILE A N      1 
ATOM   804   C  CA     . ILE A  1 69  ? 39.904  -54.642 15.520  1.00 218.97 ? 68  ILE A CA     1 
ATOM   805   C  C      . ILE A  1 69  ? 40.009  -53.690 16.709  1.00 220.94 ? 68  ILE A C      1 
ATOM   806   O  O      . ILE A  1 69  ? 40.469  -54.081 17.782  1.00 222.23 ? 68  ILE A O      1 
ATOM   807   C  CB     . ILE A  1 69  ? 41.230  -54.629 14.739  1.00 210.62 ? 68  ILE A CB     1 
ATOM   808   C  CG1    . ILE A  1 69  ? 41.259  -55.792 13.745  1.00 201.03 ? 68  ILE A CG1    1 
ATOM   809   C  CG2    . ILE A  1 69  ? 42.413  -54.721 15.690  1.00 211.98 ? 68  ILE A CG2    1 
ATOM   810   C  CD1    . ILE A  1 69  ? 42.353  -55.688 12.706  1.00 196.79 ? 68  ILE A CD1    1 
ATOM   811   H  H      . ILE A  1 69  ? 39.025  -54.071 13.853  1.00 271.90 ? 68  ILE A H      1 
ATOM   812   H  HA     . ILE A  1 69  ? 39.773  -55.547 15.872  1.00 262.76 ? 68  ILE A HA     1 
ATOM   813   H  HB     . ILE A  1 69  ? 41.292  -53.796 14.245  1.00 252.74 ? 68  ILE A HB     1 
ATOM   814   H  HG12   . ILE A  1 69  ? 41.396  -56.618 14.236  1.00 241.24 ? 68  ILE A HG12   1 
ATOM   815   H  HG13   . ILE A  1 69  ? 40.410  -55.825 13.278  1.00 241.24 ? 68  ILE A HG13   1 
ATOM   816   H  HG21   . ILE A  1 69  ? 43.226  -54.711 15.179  1.00 254.37 ? 68  ILE A HG21   1 
ATOM   817   H  HG22   . ILE A  1 69  ? 42.393  -53.970 16.287  1.00 254.37 ? 68  ILE A HG22   1 
ATOM   818   H  HG23   . ILE A  1 69  ? 42.350  -55.539 16.189  1.00 254.37 ? 68  ILE A HG23   1 
ATOM   819   H  HD11   . ILE A  1 69  ? 42.305  -56.450 12.124  1.00 236.14 ? 68  ILE A HD11   1 
ATOM   820   H  HD12   . ILE A  1 69  ? 42.227  -54.881 12.201  1.00 236.14 ? 68  ILE A HD12   1 
ATOM   821   H  HD13   . ILE A  1 69  ? 43.204  -55.667 13.150  1.00 236.14 ? 68  ILE A HD13   1 
ATOM   822   N  N      . LYS A  1 70  ? 39.582  -52.445 16.521  1.00 219.75 ? 69  LYS A N      1 
ATOM   823   C  CA     . LYS A  1 70  ? 39.657  -51.453 17.587  1.00 208.30 ? 69  LYS A CA     1 
ATOM   824   C  C      . LYS A  1 70  ? 38.737  -51.842 18.740  1.00 204.39 ? 69  LYS A C      1 
ATOM   825   O  O      . LYS A  1 70  ? 39.073  -51.645 19.907  1.00 205.62 ? 69  LYS A O      1 
ATOM   826   C  CB     . LYS A  1 70  ? 39.287  -50.064 17.066  1.00 200.77 ? 69  LYS A CB     1 
ATOM   827   C  CG     . LYS A  1 70  ? 39.800  -48.928 17.942  1.00 201.04 ? 69  LYS A CG     1 
ATOM   828   C  CD     . LYS A  1 70  ? 39.303  -47.569 17.467  1.00 205.66 ? 69  LYS A CD     1 
ATOM   829   C  CE     . LYS A  1 70  ? 39.718  -47.287 16.032  1.00 212.85 ? 69  LYS A CE     1 
ATOM   830   N  NZ     . LYS A  1 70  ? 39.351  -45.909 15.605  1.00 213.11 ? 69  LYS A NZ     1 
ATOM   831   H  H      . LYS A  1 70  ? 39.245  -52.150 15.786  1.00 263.69 ? 69  LYS A H      1 
ATOM   832   H  HA     . LYS A  1 70  ? 40.575  -51.417 17.928  1.00 249.96 ? 69  LYS A HA     1 
ATOM   833   H  HB2    . LYS A  1 70  ? 39.665  -49.950 16.180  1.00 240.92 ? 69  LYS A HB2    1 
ATOM   834   H  HB3    . LYS A  1 70  ? 38.320  -49.992 17.023  1.00 240.92 ? 69  LYS A HB3    1 
ATOM   835   H  HG2    . LYS A  1 70  ? 39.490  -49.062 18.851  1.00 241.25 ? 69  LYS A HG2    1 
ATOM   836   H  HG3    . LYS A  1 70  ? 40.769  -48.920 17.917  1.00 241.25 ? 69  LYS A HG3    1 
ATOM   837   H  HD2    . LYS A  1 70  ? 38.334  -47.549 17.512  1.00 246.79 ? 69  LYS A HD2    1 
ATOM   838   H  HD3    . LYS A  1 70  ? 39.679  -46.876 18.033  1.00 246.79 ? 69  LYS A HD3    1 
ATOM   839   H  HE2    . LYS A  1 70  ? 40.681  -47.382 15.954  1.00 255.42 ? 69  LYS A HE2    1 
ATOM   840   H  HE3    . LYS A  1 70  ? 39.272  -47.915 15.442  1.00 255.42 ? 69  LYS A HE3    1 
ATOM   841   H  HZ1    . LYS A  1 70  ? 39.606  -45.774 14.763  1.00 255.74 ? 69  LYS A HZ1    1 
ATOM   842   H  HZ2    . LYS A  1 70  ? 38.470  -45.797 15.661  1.00 255.74 ? 69  LYS A HZ2    1 
ATOM   843   H  HZ3    . LYS A  1 70  ? 39.753  -45.311 16.128  1.00 255.74 ? 69  LYS A HZ3    1 
ATOM   844   N  N      . GLU A  1 71  ? 37.575  -52.396 18.406  1.00 202.90 ? 70  GLU A N      1 
ATOM   845   C  CA     . GLU A  1 71  ? 36.638  -52.867 19.417  1.00 206.24 ? 70  GLU A CA     1 
ATOM   846   C  C      . GLU A  1 71  ? 37.184  -54.129 20.075  1.00 213.98 ? 70  GLU A C      1 
ATOM   847   O  O      . GLU A  1 71  ? 37.014  -54.342 21.276  1.00 222.78 ? 70  GLU A O      1 
ATOM   848   C  CB     . GLU A  1 71  ? 35.271  -53.157 18.793  1.00 202.29 ? 70  GLU A CB     1 
ATOM   849   C  CG     . GLU A  1 71  ? 34.146  -53.290 19.811  1.00 202.51 ? 70  GLU A CG     1 
ATOM   850   C  CD     . GLU A  1 71  ? 32.850  -53.777 19.194  1.00 202.12 ? 70  GLU A CD     1 
ATOM   851   O  OE1    . GLU A  1 71  ? 31.846  -53.889 19.930  1.00 196.40 ? 70  GLU A OE1    1 
ATOM   852   O  OE2    . GLU A  1 71  ? 32.833  -54.049 17.975  1.00 209.19 ? 70  GLU A OE2    1 
ATOM   853   H  H      . GLU A  1 71  ? 37.306  -52.510 17.597  1.00 243.48 ? 70  GLU A H      1 
ATOM   854   H  HA     . GLU A  1 71  ? 36.526  -52.180 20.107  1.00 247.49 ? 70  GLU A HA     1 
ATOM   855   H  HB2    . GLU A  1 71  ? 35.042  -52.432 18.192  1.00 242.74 ? 70  GLU A HB2    1 
ATOM   856   H  HB3    . GLU A  1 71  ? 35.324  -53.990 18.299  1.00 242.74 ? 70  GLU A HB3    1 
ATOM   857   H  HG2    . GLU A  1 71  ? 34.411  -53.927 20.493  1.00 243.01 ? 70  GLU A HG2    1 
ATOM   858   H  HG3    . GLU A  1 71  ? 33.980  -52.423 20.213  1.00 243.01 ? 70  GLU A HG3    1 
ATOM   859   N  N      . ILE A  1 72  ? 37.840  -54.964 19.275  1.00 208.95 ? 71  ILE A N      1 
ATOM   860   C  CA     . ILE A  1 72  ? 38.444  -56.196 19.768  1.00 205.36 ? 71  ILE A CA     1 
ATOM   861   C  C      . ILE A  1 72  ? 39.497  -55.912 20.833  1.00 205.42 ? 71  ILE A C      1 
ATOM   862   O  O      . ILE A  1 72  ? 39.565  -56.603 21.849  1.00 202.75 ? 71  ILE A O      1 
ATOM   863   C  CB     . ILE A  1 72  ? 39.091  -56.996 18.619  1.00 207.17 ? 71  ILE A CB     1 
ATOM   864   C  CG1    . ILE A  1 72  ? 38.026  -57.803 17.872  1.00 203.52 ? 71  ILE A CG1    1 
ATOM   865   C  CG2    . ILE A  1 72  ? 40.169  -57.926 19.155  1.00 208.96 ? 71  ILE A CG2    1 
ATOM   866   C  CD1    . ILE A  1 72  ? 38.549  -58.545 16.660  1.00 195.45 ? 71  ILE A CD1    1 
ATOM   867   H  H      . ILE A  1 72  ? 37.950  -54.837 18.431  1.00 250.75 ? 71  ILE A H      1 
ATOM   868   H  HA     . ILE A  1 72  ? 37.746  -56.754 20.172  1.00 246.44 ? 71  ILE A HA     1 
ATOM   869   H  HB     . ILE A  1 72  ? 39.500  -56.373 17.998  1.00 248.60 ? 71  ILE A HB     1 
ATOM   870   H  HG12   . ILE A  1 72  ? 37.649  -58.458 18.480  1.00 244.23 ? 71  ILE A HG12   1 
ATOM   871   H  HG13   . ILE A  1 72  ? 37.331  -57.198 17.571  1.00 244.23 ? 71  ILE A HG13   1 
ATOM   872   H  HG21   . ILE A  1 72  ? 40.556  -58.411 18.423  1.00 250.75 ? 71  ILE A HG21   1 
ATOM   873   H  HG22   . ILE A  1 72  ? 40.844  -57.401 19.593  1.00 250.75 ? 71  ILE A HG22   1 
ATOM   874   H  HG23   . ILE A  1 72  ? 39.772  -58.537 19.780  1.00 250.75 ? 71  ILE A HG23   1 
ATOM   875   H  HD11   . ILE A  1 72  ? 37.824  -59.024 16.250  1.00 234.54 ? 71  ILE A HD11   1 
ATOM   876   H  HD12   . ILE A  1 72  ? 38.915  -57.911 16.040  1.00 234.54 ? 71  ILE A HD12   1 
ATOM   877   H  HD13   . ILE A  1 72  ? 39.230  -59.161 16.941  1.00 234.54 ? 71  ILE A HD13   1 
ATOM   878   N  N      . SER A  1 73  ? 40.318  -54.894 20.596  1.00 210.44 ? 72  SER A N      1 
ATOM   879   C  CA     . SER A  1 73  ? 41.402  -54.556 21.512  1.00 210.23 ? 72  SER A CA     1 
ATOM   880   C  C      . SER A  1 73  ? 40.877  -53.988 22.828  1.00 213.21 ? 72  SER A C      1 
ATOM   881   O  O      . SER A  1 73  ? 41.544  -54.076 23.860  1.00 218.32 ? 72  SER A O      1 
ATOM   882   C  CB     . SER A  1 73  ? 42.364  -53.560 20.859  1.00 202.43 ? 72  SER A CB     1 
ATOM   883   O  OG     . SER A  1 73  ? 41.718  -52.335 20.554  1.00 193.29 ? 72  SER A OG     1 
ATOM   884   H  H      . SER A  1 73  ? 40.268  -54.381 19.907  1.00 252.53 ? 72  SER A H      1 
ATOM   885   H  HA     . SER A  1 73  ? 41.907  -55.371 21.718  1.00 252.28 ? 72  SER A HA     1 
ATOM   886   H  HB2    . SER A  1 73  ? 43.096  -53.384 21.471  1.00 242.92 ? 72  SER A HB2    1 
ATOM   887   H  HB3    . SER A  1 73  ? 42.707  -53.947 20.038  1.00 242.92 ? 72  SER A HB3    1 
ATOM   888   H  HG     . SER A  1 73  ? 40.931  -52.369 20.781  1.00 231.95 ? 72  SER A HG     1 
ATOM   889   N  N      . ILE A  1 74  ? 39.682  -53.406 22.791  1.00 208.48 ? 73  ILE A N      1 
ATOM   890   C  CA     . ILE A  1 74  ? 39.087  -52.810 23.982  1.00 203.04 ? 73  ILE A CA     1 
ATOM   891   C  C      . ILE A  1 74  ? 38.416  -53.864 24.859  1.00 204.53 ? 73  ILE A C      1 
ATOM   892   O  O      . ILE A  1 74  ? 38.461  -53.778 26.085  1.00 200.50 ? 73  ILE A O      1 
ATOM   893   C  CB     . ILE A  1 74  ? 38.056  -51.724 23.614  1.00 190.18 ? 73  ILE A CB     1 
ATOM   894   C  CG1    . ILE A  1 74  ? 38.763  -50.509 23.009  1.00 175.67 ? 73  ILE A CG1    1 
ATOM   895   C  CG2    . ILE A  1 74  ? 37.263  -51.304 24.845  1.00 191.22 ? 73  ILE A CG2    1 
ATOM   896   C  CD1    . ILE A  1 74  ? 37.823  -49.410 22.550  1.00 169.68 ? 73  ILE A CD1    1 
ATOM   897   H  H      . ILE A  1 74  ? 39.195  -53.343 22.085  1.00 250.18 ? 73  ILE A H      1 
ATOM   898   H  HA     . ILE A  1 74  ? 39.795  -52.386 24.510  1.00 243.65 ? 73  ILE A HA     1 
ATOM   899   H  HB     . ILE A  1 74  ? 37.442  -52.087 22.957  1.00 228.21 ? 73  ILE A HB     1 
ATOM   900   H  HG12   . ILE A  1 74  ? 39.358  -50.130 23.675  1.00 210.80 ? 73  ILE A HG12   1 
ATOM   901   H  HG13   . ILE A  1 74  ? 39.276  -50.799 22.238  1.00 210.80 ? 73  ILE A HG13   1 
ATOM   902   H  HG21   . ILE A  1 74  ? 36.629  -50.628 24.592  1.00 229.46 ? 73  ILE A HG21   1 
ATOM   903   H  HG22   . ILE A  1 74  ? 36.803  -52.069 25.196  1.00 229.46 ? 73  ILE A HG22   1 
ATOM   904   H  HG23   . ILE A  1 74  ? 37.869  -50.954 25.502  1.00 229.46 ? 73  ILE A HG23   1 
ATOM   905   H  HD11   . ILE A  1 74  ? 38.341  -48.689 22.185  1.00 203.62 ? 73  ILE A HD11   1 
ATOM   906   H  HD12   . ILE A  1 74  ? 37.234  -49.763 21.880  1.00 203.62 ? 73  ILE A HD12   1 
ATOM   907   H  HD13   . ILE A  1 74  ? 37.314  -49.100 23.304  1.00 203.62 ? 73  ILE A HD13   1 
ATOM   908   N  N      . MET A  1 75  ? 37.793  -54.856 24.231  1.00 212.02 ? 74  MET A N      1 
ATOM   909   C  CA     . MET A  1 75  ? 37.106  -55.907 24.974  1.00 228.29 ? 74  MET A CA     1 
ATOM   910   C  C      . MET A  1 75  ? 38.089  -56.905 25.578  1.00 256.88 ? 74  MET A C      1 
ATOM   911   O  O      . MET A  1 75  ? 37.855  -57.438 26.663  1.00 259.05 ? 74  MET A O      1 
ATOM   912   C  CB     . MET A  1 75  ? 36.118  -56.650 24.073  1.00 222.04 ? 74  MET A CB     1 
ATOM   913   C  CG     . MET A  1 75  ? 34.952  -55.806 23.588  1.00 217.61 ? 74  MET A CG     1 
ATOM   914   S  SD     . MET A  1 75  ? 33.495  -56.802 23.213  1.00 299.27 ? 74  MET A SD     1 
ATOM   915   C  CE     . MET A  1 75  ? 34.214  -58.115 22.226  1.00 177.03 ? 74  MET A CE     1 
ATOM   916   H  H      . MET A  1 75  ? 37.753  -54.944 23.377  1.00 254.42 ? 74  MET A H      1 
ATOM   917   H  HA     . MET A  1 75  ? 36.593  -55.493 25.700  1.00 273.95 ? 74  MET A HA     1 
ATOM   918   H  HB2    . MET A  1 75  ? 36.593  -56.972 23.291  1.00 266.45 ? 74  MET A HB2    1 
ATOM   919   H  HB3    . MET A  1 75  ? 35.752  -57.401 24.566  1.00 266.45 ? 74  MET A HB3    1 
ATOM   920   H  HG2    . MET A  1 75  ? 34.712  -55.168 24.279  1.00 261.13 ? 74  MET A HG2    1 
ATOM   921   H  HG3    . MET A  1 75  ? 35.213  -55.338 22.779  1.00 261.13 ? 74  MET A HG3    1 
ATOM   922   H  HE1    . MET A  1 75  ? 33.519  -58.722 21.962  1.00 212.43 ? 74  MET A HE1    1 
ATOM   923   H  HE2    . MET A  1 75  ? 34.627  -57.730 21.450  1.00 212.43 ? 74  MET A HE2    1 
ATOM   924   H  HE3    . MET A  1 75  ? 34.871  -58.577 22.752  1.00 212.43 ? 74  MET A HE3    1 
ATOM   925   N  N      . GLN A  1 76  ? 39.188  -57.158 24.874  1.00 283.36 ? 75  GLN A N      1 
ATOM   926   C  CA     . GLN A  1 76  ? 40.164  -58.149 25.313  1.00 146.29 ? 75  GLN A CA     1 
ATOM   927   C  C      . GLN A  1 76  ? 40.887  -57.692 26.576  1.00 149.78 ? 75  GLN A C      1 
ATOM   928   O  O      . GLN A  1 76  ? 41.332  -58.514 27.377  1.00 169.76 ? 75  GLN A O      1 
ATOM   929   C  CB     . GLN A  1 76  ? 41.180  -58.426 24.205  1.00 163.29 ? 75  GLN A CB     1 
ATOM   930   C  CG     . GLN A  1 76  ? 41.784  -59.821 24.264  1.00 175.08 ? 75  GLN A CG     1 
ATOM   931   C  CD     . GLN A  1 76  ? 42.539  -60.186 23.001  1.00 188.10 ? 75  GLN A CD     1 
ATOM   932   O  OE1    . GLN A  1 76  ? 43.020  -59.315 22.275  1.00 187.68 ? 75  GLN A OE1    1 
ATOM   933   N  NE2    . GLN A  1 76  ? 42.640  -61.483 22.729  1.00 196.31 ? 75  GLN A NE2    1 
ATOM   934   H  H      . GLN A  1 76  ? 39.391  -56.768 24.135  1.00 340.03 ? 75  GLN A H      1 
ATOM   935   H  HA     . GLN A  1 76  ? 39.699  -58.987 25.516  1.00 175.55 ? 75  GLN A HA     1 
ATOM   936   H  HB2    . GLN A  1 76  ? 40.741  -58.329 23.346  1.00 195.94 ? 75  GLN A HB2    1 
ATOM   937   H  HB3    . GLN A  1 76  ? 41.905  -57.786 24.278  1.00 195.94 ? 75  GLN A HB3    1 
ATOM   938   H  HG2    . GLN A  1 76  ? 42.404  -59.865 25.008  1.00 210.09 ? 75  GLN A HG2    1 
ATOM   939   H  HG3    . GLN A  1 76  ? 41.072  -60.468 24.386  1.00 210.09 ? 75  GLN A HG3    1 
ATOM   940   H  HE21   . GLN A  1 76  ? 42.286  -62.062 23.257  1.00 235.57 ? 75  GLN A HE21   1 
ATOM   941   H  HE22   . GLN A  1 76  ? 43.058  -61.743 22.024  1.00 235.57 ? 75  GLN A HE22   1 
ATOM   942   N  N      . GLN A  1 77  ? 41.003  -56.379 26.749  1.00 237.28 ? 76  GLN A N      1 
ATOM   943   C  CA     . GLN A  1 77  ? 41.671  -55.822 27.921  1.00 215.01 ? 76  GLN A CA     1 
ATOM   944   C  C      . GLN A  1 77  ? 40.712  -55.684 29.104  1.00 202.73 ? 76  GLN A C      1 
ATOM   945   O  O      . GLN A  1 77  ? 41.100  -55.209 30.172  1.00 200.60 ? 76  GLN A O      1 
ATOM   946   C  CB     . GLN A  1 77  ? 42.304  -54.466 27.592  1.00 209.51 ? 76  GLN A CB     1 
ATOM   947   C  CG     . GLN A  1 77  ? 41.315  -53.392 27.168  1.00 212.25 ? 76  GLN A CG     1 
ATOM   948   C  CD     . GLN A  1 77  ? 41.976  -52.044 26.950  1.00 213.28 ? 76  GLN A CD     1 
ATOM   949   O  OE1    . GLN A  1 77  ? 43.200  -51.924 27.006  1.00 218.34 ? 76  GLN A OE1    1 
ATOM   950   N  NE2    . GLN A  1 77  ? 41.166  -51.021 26.700  1.00 204.80 ? 76  GLN A NE2    1 
ATOM   951   H  H      . GLN A  1 77  ? 40.702  -55.788 26.202  1.00 284.73 ? 76  GLN A H      1 
ATOM   952   H  HA     . GLN A  1 77  ? 42.391  -56.430 28.190  1.00 258.01 ? 76  GLN A HA     1 
ATOM   953   H  HB2    . GLN A  1 77  ? 42.770  -54.143 28.379  1.00 251.41 ? 76  GLN A HB2    1 
ATOM   954   H  HB3    . GLN A  1 77  ? 42.935  -54.587 26.866  1.00 251.41 ? 76  GLN A HB3    1 
ATOM   955   H  HG2    . GLN A  1 77  ? 40.894  -53.659 26.336  1.00 254.70 ? 76  GLN A HG2    1 
ATOM   956   H  HG3    . GLN A  1 77  ? 40.644  -53.288 27.861  1.00 254.70 ? 76  GLN A HG3    1 
ATOM   957   H  HE21   . GLN A  1 77  ? 40.315  -51.144 26.670  1.00 245.76 ? 76  GLN A HE21   1 
ATOM   958   H  HE22   . GLN A  1 77  ? 41.492  -50.236 26.569  1.00 245.76 ? 76  GLN A HE22   1 
ATOM   959   N  N      . CYS A  1 78  ? 39.463  -56.097 28.911  1.00 192.69 ? 77  CYS A N      1 
ATOM   960   C  CA     . CYS A  1 78  ? 38.491  -56.123 29.999  1.00 182.36 ? 77  CYS A CA     1 
ATOM   961   C  C      . CYS A  1 78  ? 38.430  -57.510 30.621  1.00 180.33 ? 77  CYS A C      1 
ATOM   962   O  O      . CYS A  1 78  ? 38.464  -58.519 29.917  1.00 187.07 ? 77  CYS A O      1 
ATOM   963   C  CB     . CYS A  1 78  ? 37.104  -55.719 29.498  1.00 179.17 ? 77  CYS A CB     1 
ATOM   964   S  SG     . CYS A  1 78  ? 36.930  -53.959 29.138  1.00 179.06 ? 77  CYS A SG     1 
ATOM   965   H  H      . CYS A  1 78  ? 39.153  -56.369 28.157  1.00 231.23 ? 77  CYS A H      1 
ATOM   966   H  HA     . CYS A  1 78  ? 38.764  -55.487 30.692  1.00 218.83 ? 77  CYS A HA     1 
ATOM   967   H  HB2    . CYS A  1 78  ? 36.914  -56.207 28.682  1.00 215.01 ? 77  CYS A HB2    1 
ATOM   968   H  HB3    . CYS A  1 78  ? 36.449  -55.947 30.176  1.00 215.01 ? 77  CYS A HB3    1 
ATOM   969   H  HG     . CYS A  1 78  ? 35.813  -53.747 28.754  1.00 214.87 ? 77  CYS A HG     1 
ATOM   970   N  N      . ASP A  1 79  ? 38.337  -57.549 31.945  1.00 166.93 ? 78  ASP A N      1 
ATOM   971   C  CA     . ASP A  1 79  ? 38.287  -58.807 32.678  1.00 165.88 ? 78  ASP A CA     1 
ATOM   972   C  C      . ASP A  1 79  ? 37.285  -58.701 33.819  1.00 160.30 ? 78  ASP A C      1 
ATOM   973   O  O      . ASP A  1 79  ? 37.655  -58.446 34.965  1.00 160.14 ? 78  ASP A O      1 
ATOM   974   C  CB     . ASP A  1 79  ? 39.671  -59.161 33.225  1.00 168.26 ? 78  ASP A CB     1 
ATOM   975   C  CG     . ASP A  1 79  ? 39.702  -60.519 33.897  1.00 168.43 ? 78  ASP A CG     1 
ATOM   976   O  OD1    . ASP A  1 79  ? 39.538  -60.577 35.133  1.00 175.16 ? 78  ASP A OD1    1 
ATOM   977   O  OD2    . ASP A  1 79  ? 39.891  -61.531 33.188  1.00 167.56 ? 78  ASP A OD2    1 
ATOM   978   H  H      . ASP A  1 79  ? 38.302  -56.853 32.448  1.00 200.31 ? 78  ASP A H      1 
ATOM   979   H  HA     . ASP A  1 79  ? 37.998  -59.525 32.076  1.00 199.06 ? 78  ASP A HA     1 
ATOM   980   H  HB2    . ASP A  1 79  ? 40.307  -59.173 32.492  1.00 201.91 ? 78  ASP A HB2    1 
ATOM   981   H  HB3    . ASP A  1 79  ? 39.932  -58.495 33.880  1.00 201.91 ? 78  ASP A HB3    1 
ATOM   982   N  N      . SER A  1 80  ? 36.012  -58.898 33.495  1.00 151.48 ? 79  SER A N      1 
ATOM   983   C  CA     . SER A  1 80  ? 34.947  -58.754 34.476  1.00 141.28 ? 79  SER A CA     1 
ATOM   984   C  C      . SER A  1 80  ? 33.797  -59.706 34.178  1.00 136.82 ? 79  SER A C      1 
ATOM   985   O  O      . SER A  1 80  ? 33.493  -59.975 33.017  1.00 135.08 ? 79  SER A O      1 
ATOM   986   C  CB     . SER A  1 80  ? 34.436  -57.312 34.483  1.00 134.84 ? 79  SER A CB     1 
ATOM   987   O  OG     . SER A  1 80  ? 33.304  -57.173 35.323  1.00 133.75 ? 79  SER A OG     1 
ATOM   988   H  H      . SER A  1 80  ? 35.739  -59.117 32.710  1.00 181.77 ? 79  SER A H      1 
ATOM   989   H  HA     . SER A  1 80  ? 35.297  -58.962 35.367  1.00 169.54 ? 79  SER A HA     1 
ATOM   990   H  HB2    . SER A  1 80  ? 35.141  -56.730 34.807  1.00 161.81 ? 79  SER A HB2    1 
ATOM   991   H  HB3    . SER A  1 80  ? 34.190  -57.061 33.579  1.00 161.81 ? 79  SER A HB3    1 
ATOM   992   H  HG     . SER A  1 80  ? 33.043  -56.395 35.315  1.00 160.51 ? 79  SER A HG     1 
ATOM   993   N  N      . PRO A  1 81  ? 33.151  -60.221 35.234  1.00 134.41 ? 80  PRO A N      1 
ATOM   994   C  CA     . PRO A  1 81  ? 31.968  -61.071 35.069  1.00 131.39 ? 80  PRO A CA     1 
ATOM   995   C  C      . PRO A  1 81  ? 30.758  -60.274 34.588  1.00 141.12 ? 80  PRO A C      1 
ATOM   996   O  O      . PRO A  1 81  ? 29.726  -60.861 34.264  1.00 141.18 ? 80  PRO A O      1 
ATOM   997   C  CB     . PRO A  1 81  ? 31.728  -61.612 36.481  1.00 131.62 ? 80  PRO A CB     1 
ATOM   998   C  CG     . PRO A  1 81  ? 32.330  -60.599 37.380  1.00 132.09 ? 80  PRO A CG     1 
ATOM   999   C  CD     . PRO A  1 81  ? 33.518  -60.056 36.651  1.00 125.50 ? 80  PRO A CD     1 
ATOM   1000  H  HA     . PRO A  1 81  ? 32.150  -61.811 34.453  1.00 157.67 ? 80  PRO A HA     1 
ATOM   1001  H  HB2    . PRO A  1 81  ? 30.775  -61.694 36.643  1.00 157.94 ? 80  PRO A HB2    1 
ATOM   1002  H  HB3    . PRO A  1 81  ? 32.171  -62.469 36.583  1.00 157.94 ? 80  PRO A HB3    1 
ATOM   1003  H  HG2    . PRO A  1 81  ? 31.685  -59.894 37.553  1.00 158.50 ? 80  PRO A HG2    1 
ATOM   1004  H  HG3    . PRO A  1 81  ? 32.603  -61.022 38.209  1.00 158.50 ? 80  PRO A HG3    1 
ATOM   1005  H  HD2    . PRO A  1 81  ? 33.644  -59.117 36.860  1.00 150.61 ? 80  PRO A HD2    1 
ATOM   1006  H  HD3    . PRO A  1 81  ? 34.310  -60.577 36.859  1.00 150.61 ? 80  PRO A HD3    1 
ATOM   1007  N  N      . TYR A  1 82  ? 30.894  -58.952 34.545  1.00 141.69 ? 81  TYR A N      1 
ATOM   1008  C  CA     . TYR A  1 82  ? 29.816  -58.077 34.104  1.00 130.14 ? 81  TYR A CA     1 
ATOM   1009  C  C      . TYR A  1 82  ? 30.112  -57.500 32.725  1.00 127.66 ? 81  TYR A C      1 
ATOM   1010  O  O      . TYR A  1 82  ? 29.294  -56.781 32.154  1.00 123.43 ? 81  TYR A O      1 
ATOM   1011  C  CB     . TYR A  1 82  ? 29.616  -56.950 35.116  1.00 137.06 ? 81  TYR A CB     1 
ATOM   1012  C  CG     . TYR A  1 82  ? 29.515  -57.449 36.536  1.00 137.14 ? 81  TYR A CG     1 
ATOM   1013  C  CD1    . TYR A  1 82  ? 28.333  -57.992 37.015  1.00 119.76 ? 81  TYR A CD1    1 
ATOM   1014  C  CD2    . TYR A  1 82  ? 30.605  -57.388 37.393  1.00 137.00 ? 81  TYR A CD2    1 
ATOM   1015  C  CE1    . TYR A  1 82  ? 28.235  -58.457 38.308  1.00 133.71 ? 81  TYR A CE1    1 
ATOM   1016  C  CE2    . TYR A  1 82  ? 30.516  -57.850 38.692  1.00 140.19 ? 81  TYR A CE2    1 
ATOM   1017  C  CZ     . TYR A  1 82  ? 29.329  -58.385 39.143  1.00 139.96 ? 81  TYR A CZ     1 
ATOM   1018  O  OH     . TYR A  1 82  ? 29.234  -58.849 40.435  1.00 147.57 ? 81  TYR A OH     1 
ATOM   1019  H  H      . TYR A  1 82  ? 31.611  -58.533 34.769  1.00 170.03 ? 81  TYR A H      1 
ATOM   1020  H  HA     . TYR A  1 82  ? 28.984  -58.592 34.049  1.00 156.17 ? 81  TYR A HA     1 
ATOM   1021  H  HB2    . TYR A  1 82  ? 30.370  -56.342 35.065  1.00 164.47 ? 81  TYR A HB2    1 
ATOM   1022  H  HB3    . TYR A  1 82  ? 28.795  -56.479 34.905  1.00 164.47 ? 81  TYR A HB3    1 
ATOM   1023  H  HD1    . TYR A  1 82  ? 27.594  -58.044 36.453  1.00 143.71 ? 81  TYR A HD1    1 
ATOM   1024  H  HD2    . TYR A  1 82  ? 31.407  -57.029 37.089  1.00 164.39 ? 81  TYR A HD2    1 
ATOM   1025  H  HE1    . TYR A  1 82  ? 27.435  -58.818 38.615  1.00 160.45 ? 81  TYR A HE1    1 
ATOM   1026  H  HE2    . TYR A  1 82  ? 31.253  -57.803 39.257  1.00 168.23 ? 81  TYR A HE2    1 
ATOM   1027  H  HH     . TYR A  1 82  ? 29.388  -58.240 40.963  1.00 177.08 ? 81  TYR A HH     1 
ATOM   1028  N  N      . VAL A  1 83  ? 31.291  -57.813 32.198  1.00 140.92 ? 82  VAL A N      1 
ATOM   1029  C  CA     . VAL A  1 83  ? 31.648  -57.435 30.838  1.00 151.60 ? 82  VAL A CA     1 
ATOM   1030  C  C      . VAL A  1 83  ? 31.872  -58.700 30.024  1.00 154.24 ? 82  VAL A C      1 
ATOM   1031  O  O      . VAL A  1 83  ? 32.607  -59.593 30.447  1.00 159.09 ? 82  VAL A O      1 
ATOM   1032  C  CB     . VAL A  1 83  ? 32.925  -56.575 30.803  1.00 153.24 ? 82  VAL A CB     1 
ATOM   1033  C  CG1    . VAL A  1 83  ? 33.226  -56.130 29.378  1.00 155.67 ? 82  VAL A CG1    1 
ATOM   1034  C  CG2    . VAL A  1 83  ? 32.784  -55.370 31.725  1.00 135.84 ? 82  VAL A CG2    1 
ATOM   1035  H  H      . VAL A  1 83  ? 31.907  -58.248 32.613  1.00 169.10 ? 82  VAL A H      1 
ATOM   1036  H  HA     . VAL A  1 83  ? 30.915  -56.926 30.433  1.00 181.92 ? 82  VAL A HA     1 
ATOM   1037  H  HB     . VAL A  1 83  ? 33.681  -57.112 31.119  1.00 183.89 ? 82  VAL A HB     1 
ATOM   1038  H  HG11   . VAL A  1 83  ? 34.024  -55.596 29.380  1.00 186.80 ? 82  VAL A HG11   1 
ATOM   1039  H  HG12   . VAL A  1 83  ? 33.351  -56.906 28.828  1.00 186.80 ? 82  VAL A HG12   1 
ATOM   1040  H  HG13   . VAL A  1 83  ? 32.486  -55.612 29.050  1.00 186.80 ? 82  VAL A HG13   1 
ATOM   1041  H  HG21   . VAL A  1 83  ? 33.590  -54.851 31.686  1.00 163.01 ? 82  VAL A HG21   1 
ATOM   1042  H  HG22   . VAL A  1 83  ? 32.038  -54.841 31.435  1.00 163.01 ? 82  VAL A HG22   1 
ATOM   1043  H  HG23   . VAL A  1 83  ? 32.636  -55.680 32.622  1.00 163.01 ? 82  VAL A HG23   1 
ATOM   1044  N  N      . VAL A  1 84  ? 31.234  -58.778 28.862  1.00 153.01 ? 83  VAL A N      1 
ATOM   1045  C  CA     . VAL A  1 84  ? 31.334  -59.965 28.020  1.00 151.13 ? 83  VAL A CA     1 
ATOM   1046  C  C      . VAL A  1 84  ? 32.798  -60.292 27.747  1.00 143.26 ? 83  VAL A C      1 
ATOM   1047  O  O      . VAL A  1 84  ? 33.550  -59.455 27.246  1.00 129.17 ? 83  VAL A O      1 
ATOM   1048  C  CB     . VAL A  1 84  ? 30.584  -59.780 26.688  1.00 148.42 ? 83  VAL A CB     1 
ATOM   1049  C  CG1    . VAL A  1 84  ? 30.819  -60.969 25.772  1.00 145.11 ? 83  VAL A CG1    1 
ATOM   1050  C  CG2    . VAL A  1 84  ? 29.097  -59.605 26.941  1.00 154.10 ? 83  VAL A CG2    1 
ATOM   1051  H  H      . VAL A  1 84  ? 30.736  -58.157 28.537  1.00 183.61 ? 83  VAL A H      1 
ATOM   1052  H  HA     . VAL A  1 84  ? 30.935  -60.726 28.491  1.00 181.36 ? 83  VAL A HA     1 
ATOM   1053  H  HB     . VAL A  1 84  ? 30.916  -58.975 26.239  1.00 178.10 ? 83  VAL A HB     1 
ATOM   1054  H  HG11   . VAL A  1 84  ? 30.342  -60.829 24.951  1.00 174.13 ? 83  VAL A HG11   1 
ATOM   1055  H  HG12   . VAL A  1 84  ? 31.760  -61.045 25.596  1.00 174.13 ? 83  VAL A HG12   1 
ATOM   1056  H  HG13   . VAL A  1 84  ? 30.501  -61.764 26.205  1.00 174.13 ? 83  VAL A HG13   1 
ATOM   1057  H  HG21   . VAL A  1 84  ? 28.649  -59.491 26.100  1.00 184.92 ? 83  VAL A HG21   1 
ATOM   1058  H  HG22   . VAL A  1 84  ? 28.762  -60.385 27.388  1.00 184.92 ? 83  VAL A HG22   1 
ATOM   1059  H  HG23   . VAL A  1 84  ? 28.963  -58.829 27.490  1.00 184.92 ? 83  VAL A HG23   1 
ATOM   1060  N  N      . LYS A  1 85  ? 33.193  -61.514 28.091  1.00 145.98 ? 84  LYS A N      1 
ATOM   1061  C  CA     . LYS A  1 85  ? 34.580  -61.942 27.970  1.00 156.36 ? 84  LYS A CA     1 
ATOM   1062  C  C      . LYS A  1 85  ? 34.931  -62.268 26.524  1.00 194.07 ? 84  LYS A C      1 
ATOM   1063  O  O      . LYS A  1 85  ? 34.176  -62.948 25.829  1.00 208.08 ? 84  LYS A O      1 
ATOM   1064  C  CB     . LYS A  1 85  ? 34.833  -63.171 28.848  1.00 158.02 ? 84  LYS A CB     1 
ATOM   1065  C  CG     . LYS A  1 85  ? 34.464  -62.984 30.317  1.00 173.66 ? 84  LYS A CG     1 
ATOM   1066  C  CD     . LYS A  1 85  ? 34.622  -64.284 31.101  1.00 181.26 ? 84  LYS A CD     1 
ATOM   1067  C  CE     . LYS A  1 85  ? 34.010  -64.192 32.492  1.00 173.25 ? 84  LYS A CE     1 
ATOM   1068  N  NZ     . LYS A  1 85  ? 34.612  -63.115 33.322  1.00 171.67 ? 84  LYS A NZ     1 
ATOM   1069  H  H      . LYS A  1 85  ? 32.668  -62.121 28.401  1.00 175.17 ? 84  LYS A H      1 
ATOM   1070  H  HA     . LYS A  1 85  ? 35.169  -61.220 28.274  1.00 187.63 ? 84  LYS A HA     1 
ATOM   1071  H  HB2    . LYS A  1 85  ? 34.308  -63.911 28.504  1.00 189.62 ? 84  LYS A HB2    1 
ATOM   1072  H  HB3    . LYS A  1 85  ? 35.776  -63.393 28.807  1.00 189.62 ? 84  LYS A HB3    1 
ATOM   1073  H  HG2    . LYS A  1 85  ? 35.048  -62.318 30.711  1.00 208.39 ? 84  LYS A HG2    1 
ATOM   1074  H  HG3    . LYS A  1 85  ? 33.539  -62.701 30.381  1.00 208.39 ? 84  LYS A HG3    1 
ATOM   1075  H  HD2    . LYS A  1 85  ? 34.177  -65.000 30.622  1.00 217.52 ? 84  LYS A HD2    1 
ATOM   1076  H  HD3    . LYS A  1 85  ? 35.566  -64.483 31.199  1.00 217.52 ? 84  LYS A HD3    1 
ATOM   1077  H  HE2    . LYS A  1 85  ? 33.061  -64.010 32.408  1.00 207.90 ? 84  LYS A HE2    1 
ATOM   1078  H  HE3    . LYS A  1 85  ? 34.145  -65.035 32.952  1.00 207.90 ? 84  LYS A HE3    1 
ATOM   1079  H  HZ1    . LYS A  1 85  ? 34.226  -63.098 34.124  1.00 206.00 ? 84  LYS A HZ1    1 
ATOM   1080  H  HZ2    . LYS A  1 85  ? 35.484  -63.262 33.424  1.00 206.00 ? 84  LYS A HZ2    1 
ATOM   1081  H  HZ3    . LYS A  1 85  ? 34.495  -62.326 32.927  1.00 206.00 ? 84  LYS A HZ3    1 
ATOM   1082  N  N      . TYR A  1 86  ? 36.084  -61.779 26.078  1.00 216.82 ? 85  TYR A N      1 
ATOM   1083  C  CA     . TYR A  1 86  ? 36.585  -62.083 24.744  1.00 235.86 ? 85  TYR A CA     1 
ATOM   1084  C  C      . TYR A  1 86  ? 37.738  -63.076 24.852  1.00 232.40 ? 85  TYR A C      1 
ATOM   1085  O  O      . TYR A  1 86  ? 38.592  -62.949 25.729  1.00 234.63 ? 85  TYR A O      1 
ATOM   1086  C  CB     . TYR A  1 86  ? 37.039  -60.805 24.041  1.00 256.05 ? 85  TYR A CB     1 
ATOM   1087  C  CG     . TYR A  1 86  ? 37.698  -61.051 22.707  1.00 277.11 ? 85  TYR A CG     1 
ATOM   1088  C  CD1    . TYR A  1 86  ? 37.079  -61.827 21.739  1.00 286.52 ? 85  TYR A CD1    1 
ATOM   1089  C  CD2    . TYR A  1 86  ? 38.937  -60.503 22.414  1.00 286.60 ? 85  TYR A CD2    1 
ATOM   1090  C  CE1    . TYR A  1 86  ? 37.679  -62.054 20.520  1.00 292.17 ? 85  TYR A CE1    1 
ATOM   1091  C  CE2    . TYR A  1 86  ? 39.544  -60.723 21.198  1.00 291.90 ? 85  TYR A CE2    1 
ATOM   1092  C  CZ     . TYR A  1 86  ? 38.911  -61.501 20.254  1.00 294.79 ? 85  TYR A CZ     1 
ATOM   1093  O  OH     . TYR A  1 86  ? 39.506  -61.725 19.036  1.00 298.29 ? 85  TYR A OH     1 
ATOM   1094  H  H      . TYR A  1 86  ? 36.598  -61.262 26.534  1.00 260.18 ? 85  TYR A H      1 
ATOM   1095  H  HA     . TYR A  1 86  ? 35.871  -62.493 24.213  1.00 283.04 ? 85  TYR A HA     1 
ATOM   1096  H  HB2    . TYR A  1 86  ? 36.265  -60.240 23.890  1.00 307.26 ? 85  TYR A HB2    1 
ATOM   1097  H  HB3    . TYR A  1 86  ? 37.677  -60.345 24.608  1.00 307.26 ? 85  TYR A HB3    1 
ATOM   1098  H  HD1    . TYR A  1 86  ? 36.248  -62.204 21.917  1.00 343.83 ? 85  TYR A HD1    1 
ATOM   1099  H  HD2    . TYR A  1 86  ? 39.367  -59.979 23.051  1.00 343.92 ? 85  TYR A HD2    1 
ATOM   1100  H  HE1    . TYR A  1 86  ? 37.253  -62.577 19.879  1.00 350.60 ? 85  TYR A HE1    1 
ATOM   1101  H  HE2    . TYR A  1 86  ? 40.376  -60.350 21.015  1.00 350.28 ? 85  TYR A HE2    1 
ATOM   1102  H  HH     . TYR A  1 86  ? 39.029  -61.440 18.433  1.00 357.95 ? 85  TYR A HH     1 
ATOM   1103  N  N      . TYR A  1 87  ? 37.760  -64.062 23.960  1.00 227.90 ? 86  TYR A N      1 
ATOM   1104  C  CA     . TYR A  1 87  ? 38.679  -65.190 24.099  1.00 226.52 ? 86  TYR A CA     1 
ATOM   1105  C  C      . TYR A  1 87  ? 39.790  -65.245 23.045  1.00 221.38 ? 86  TYR A C      1 
ATOM   1106  O  O      . TYR A  1 87  ? 40.924  -65.601 23.365  1.00 218.77 ? 86  TYR A O      1 
ATOM   1107  C  CB     . TYR A  1 87  ? 37.887  -66.502 24.108  1.00 223.60 ? 86  TYR A CB     1 
ATOM   1108  C  CG     . TYR A  1 87  ? 37.043  -66.697 25.354  1.00 212.33 ? 86  TYR A CG     1 
ATOM   1109  C  CD1    . TYR A  1 87  ? 35.794  -67.301 25.284  1.00 204.05 ? 86  TYR A CD1    1 
ATOM   1110  C  CD2    . TYR A  1 87  ? 37.500  -66.282 26.600  1.00 206.95 ? 86  TYR A CD2    1 
ATOM   1111  C  CE1    . TYR A  1 87  ? 35.023  -67.480 26.418  1.00 199.48 ? 86  TYR A CE1    1 
ATOM   1112  C  CE2    . TYR A  1 87  ? 36.736  -66.459 27.736  1.00 203.86 ? 86  TYR A CE2    1 
ATOM   1113  C  CZ     . TYR A  1 87  ? 35.501  -67.060 27.639  1.00 201.20 ? 86  TYR A CZ     1 
ATOM   1114  O  OH     . TYR A  1 87  ? 34.741  -67.236 28.772  1.00 197.38 ? 86  TYR A OH     1 
ATOM   1115  H  H      . TYR A  1 87  ? 37.255  -64.103 23.266  1.00 273.48 ? 86  TYR A H      1 
ATOM   1116  H  HA     . TYR A  1 87  ? 39.119  -65.114 24.972  1.00 271.83 ? 86  TYR A HA     1 
ATOM   1117  H  HB2    . TYR A  1 87  ? 37.292  -66.514 23.342  1.00 268.31 ? 86  TYR A HB2    1 
ATOM   1118  H  HB3    . TYR A  1 87  ? 38.510  -67.244 24.053  1.00 268.31 ? 86  TYR A HB3    1 
ATOM   1119  H  HD1    . TYR A  1 87  ? 35.469  -67.586 24.461  1.00 244.85 ? 86  TYR A HD1    1 
ATOM   1120  H  HD2    . TYR A  1 87  ? 38.334  -65.877 26.669  1.00 248.34 ? 86  TYR A HD2    1 
ATOM   1121  H  HE1    . TYR A  1 87  ? 34.189  -67.885 26.356  1.00 239.38 ? 86  TYR A HE1    1 
ATOM   1122  H  HE2    . TYR A  1 87  ? 37.055  -66.176 28.562  1.00 244.63 ? 86  TYR A HE2    1 
ATOM   1123  H  HH     . TYR A  1 87  ? 34.582  -66.510 29.119  1.00 236.86 ? 86  TYR A HH     1 
ATOM   1124  N  N      . GLY A  1 88  ? 39.480  -64.903 21.798  1.00 219.83 ? 87  GLY A N      1 
ATOM   1125  C  CA     . GLY A  1 88  ? 40.489  -64.946 20.752  1.00 224.16 ? 87  GLY A CA     1 
ATOM   1126  C  C      . GLY A  1 88  ? 39.955  -64.758 19.345  1.00 229.92 ? 87  GLY A C      1 
ATOM   1127  O  O      . GLY A  1 88  ? 38.797  -64.389 19.152  1.00 230.43 ? 87  GLY A O      1 
ATOM   1128  H  H      . GLY A  1 88  ? 38.703  -64.645 21.536  1.00 263.80 ? 87  GLY A H      1 
ATOM   1129  H  HA2    . GLY A  1 88  ? 41.145  -64.250 20.918  1.00 269.00 ? 87  GLY A HA2    1 
ATOM   1130  H  HA3    . GLY A  1 88  ? 40.944  -65.802 20.788  1.00 269.00 ? 87  GLY A HA3    1 
ATOM   1131  N  N      . SER A  1 89  ? 40.809  -65.019 18.357  1.00 233.05 ? 88  SER A N      1 
ATOM   1132  C  CA     . SER A  1 89  ? 40.449  -64.828 16.956  1.00 233.21 ? 88  SER A CA     1 
ATOM   1133  C  C      . SER A  1 89  ? 41.158  -65.812 16.027  1.00 235.15 ? 88  SER A C      1 
ATOM   1134  O  O      . SER A  1 89  ? 42.155  -66.433 16.396  1.00 227.74 ? 88  SER A O      1 
ATOM   1135  C  CB     . SER A  1 89  ? 40.783  -63.402 16.518  1.00 233.41 ? 88  SER A CB     1 
ATOM   1136  O  OG     . SER A  1 89  ? 39.935  -62.456 17.142  1.00 236.57 ? 88  SER A OG     1 
ATOM   1137  H  H      . SER A  1 89  ? 41.610  -65.309 18.475  1.00 279.65 ? 88  SER A H      1 
ATOM   1138  H  HA     . SER A  1 89  ? 39.483  -64.958 16.855  1.00 279.85 ? 88  SER A HA     1 
ATOM   1139  H  HB2    . SER A  1 89  ? 41.702  -63.207 16.759  1.00 280.09 ? 88  SER A HB2    1 
ATOM   1140  H  HB3    . SER A  1 89  ? 40.674  -63.335 15.556  1.00 280.09 ? 88  SER A HB3    1 
ATOM   1141  H  HG     . SER A  1 89  ? 40.130  -61.699 16.894  1.00 283.89 ? 88  SER A HG     1 
ATOM   1142  N  N      . TYR A  1 90  ? 40.627  -65.939 14.814  1.00 247.48 ? 89  TYR A N      1 
ATOM   1143  C  CA     . TYR A  1 90  ? 41.231  -66.763 13.773  1.00 263.13 ? 89  TYR A CA     1 
ATOM   1144  C  C      . TYR A  1 90  ? 41.001  -66.103 12.419  1.00 274.82 ? 89  TYR A C      1 
ATOM   1145  O  O      . TYR A  1 90  ? 40.329  -65.077 12.329  1.00 273.07 ? 89  TYR A O      1 
ATOM   1146  C  CB     . TYR A  1 90  ? 40.608  -68.159 13.757  1.00 265.90 ? 89  TYR A CB     1 
ATOM   1147  C  CG     . TYR A  1 90  ? 40.759  -68.938 15.043  1.00 266.45 ? 89  TYR A CG     1 
ATOM   1148  C  CD1    . TYR A  1 90  ? 41.830  -69.800 15.233  1.00 266.52 ? 89  TYR A CD1    1 
ATOM   1149  C  CD2    . TYR A  1 90  ? 39.822  -68.822 16.061  1.00 265.85 ? 89  TYR A CD2    1 
ATOM   1150  C  CE1    . TYR A  1 90  ? 41.968  -70.520 16.405  1.00 265.66 ? 89  TYR A CE1    1 
ATOM   1151  C  CE2    . TYR A  1 90  ? 39.952  -69.538 17.237  1.00 265.36 ? 89  TYR A CE2    1 
ATOM   1152  C  CZ     . TYR A  1 90  ? 41.026  -70.385 17.404  1.00 263.92 ? 89  TYR A CZ     1 
ATOM   1153  O  OH     . TYR A  1 90  ? 41.152  -71.099 18.574  1.00 261.45 ? 89  TYR A OH     1 
ATOM   1154  H  H      . TYR A  1 90  ? 39.902  -65.549 14.566  1.00 296.98 ? 89  TYR A H      1 
ATOM   1155  H  HA     . TYR A  1 90  ? 42.195  -66.845 13.928  1.00 315.75 ? 89  TYR A HA     1 
ATOM   1156  H  HB2    . TYR A  1 90  ? 39.659  -68.072 13.577  1.00 319.09 ? 89  TYR A HB2    1 
ATOM   1157  H  HB3    . TYR A  1 90  ? 41.027  -68.676 13.051  1.00 319.09 ? 89  TYR A HB3    1 
ATOM   1158  H  HD1    . TYR A  1 90  ? 42.466  -69.893 14.562  1.00 319.82 ? 89  TYR A HD1    1 
ATOM   1159  H  HD2    . TYR A  1 90  ? 39.096  -68.251 15.951  1.00 319.02 ? 89  TYR A HD2    1 
ATOM   1160  H  HE1    . TYR A  1 90  ? 42.692  -71.093 16.519  1.00 318.79 ? 89  TYR A HE1    1 
ATOM   1161  H  HE2    . TYR A  1 90  ? 39.317  -69.448 17.911  1.00 318.44 ? 89  TYR A HE2    1 
ATOM   1162  H  HH     . TYR A  1 90  ? 41.856  -70.906 18.947  1.00 313.74 ? 89  TYR A HH     1 
ATOM   1163  N  N      . PHE A  1 91  ? 41.555  -66.698 11.367  1.00 287.34 ? 90  PHE A N      1 
ATOM   1164  C  CA     . PHE A  1 91  ? 41.286  -66.248 10.005  1.00 297.61 ? 90  PHE A CA     1 
ATOM   1165  C  C      . PHE A  1 91  ? 40.847  -67.426 9.142   1.00 310.04 ? 90  PHE A C      1 
ATOM   1166  O  O      . PHE A  1 91  ? 41.491  -68.475 9.137   1.00 311.29 ? 90  PHE A O      1 
ATOM   1167  C  CB     . PHE A  1 91  ? 42.518  -65.576 9.394   1.00 296.59 ? 90  PHE A CB     1 
ATOM   1168  C  CG     . PHE A  1 91  ? 42.315  -65.121 7.977   1.00 297.33 ? 90  PHE A CG     1 
ATOM   1169  C  CD1    . PHE A  1 91  ? 41.232  -64.325 7.641   1.00 299.17 ? 90  PHE A CD1    1 
ATOM   1170  C  CD2    . PHE A  1 91  ? 43.207  -65.484 6.981   1.00 296.53 ? 90  PHE A CD2    1 
ATOM   1171  C  CE1    . PHE A  1 91  ? 41.039  -63.904 6.339   1.00 300.04 ? 90  PHE A CE1    1 
ATOM   1172  C  CE2    . PHE A  1 91  ? 43.020  -65.064 5.677   1.00 296.90 ? 90  PHE A CE2    1 
ATOM   1173  C  CZ     . PHE A  1 91  ? 41.935  -64.273 5.356   1.00 298.88 ? 90  PHE A CZ     1 
ATOM   1174  H  H      . PHE A  1 91  ? 42.094  -67.367 11.415  1.00 344.81 ? 90  PHE A H      1 
ATOM   1175  H  HA     . PHE A  1 91  ? 40.558  -65.593 10.021  1.00 357.14 ? 90  PHE A HA     1 
ATOM   1176  H  HB2    . PHE A  1 91  ? 42.746  -64.798 9.927   1.00 355.91 ? 90  PHE A HB2    1 
ATOM   1177  H  HB3    . PHE A  1 91  ? 43.255  -66.207 9.401   1.00 355.91 ? 90  PHE A HB3    1 
ATOM   1178  H  HD1    . PHE A  1 91  ? 40.625  -64.074 8.299   1.00 359.01 ? 90  PHE A HD1    1 
ATOM   1179  H  HD2    . PHE A  1 91  ? 43.939  -66.017 7.192   1.00 355.83 ? 90  PHE A HD2    1 
ATOM   1180  H  HE1    . PHE A  1 91  ? 40.308  -63.371 6.126   1.00 360.05 ? 90  PHE A HE1    1 
ATOM   1181  H  HE2    . PHE A  1 91  ? 43.625  -65.314 5.016   1.00 356.28 ? 90  PHE A HE2    1 
ATOM   1182  H  HZ     . PHE A  1 91  ? 41.807  -63.990 4.480   1.00 358.66 ? 90  PHE A HZ     1 
ATOM   1183  N  N      . LYS A  1 92  ? 39.748  -67.247 8.415   1.00 319.81 ? 91  LYS A N      1 
ATOM   1184  C  CA     . LYS A  1 92  ? 39.181  -68.328 7.616   1.00 215.33 ? 91  LYS A CA     1 
ATOM   1185  C  C      . LYS A  1 92  ? 38.316  -67.810 6.471   1.00 221.60 ? 91  LYS A C      1 
ATOM   1186  O  O      . LYS A  1 92  ? 37.303  -67.149 6.696   1.00 240.36 ? 91  LYS A O      1 
ATOM   1187  C  CB     . LYS A  1 92  ? 38.349  -69.252 8.507   1.00 224.34 ? 91  LYS A CB     1 
ATOM   1188  C  CG     . LYS A  1 92  ? 37.555  -70.298 7.744   1.00 224.74 ? 91  LYS A CG     1 
ATOM   1189  C  CD     . LYS A  1 92  ? 38.457  -71.145 6.862   1.00 224.24 ? 91  LYS A CD     1 
ATOM   1190  C  CE     . LYS A  1 92  ? 37.654  -72.127 6.028   1.00 221.62 ? 91  LYS A CE     1 
ATOM   1191  N  NZ     . LYS A  1 92  ? 38.523  -72.910 5.109   1.00 217.35 ? 91  LYS A NZ     1 
ATOM   1192  H  H      . LYS A  1 92  ? 39.311  -66.508 8.368   1.00 383.77 ? 91  LYS A H      1 
ATOM   1193  H  HA     . LYS A  1 92  ? 39.911  -68.855 7.230   1.00 258.40 ? 91  LYS A HA     1 
ATOM   1194  H  HB2    . LYS A  1 92  ? 38.944  -69.718 9.115   1.00 269.20 ? 91  LYS A HB2    1 
ATOM   1195  H  HB3    . LYS A  1 92  ? 37.719  -68.714 9.013   1.00 269.20 ? 91  LYS A HB3    1 
ATOM   1196  H  HG2    . LYS A  1 92  ? 37.109  -70.885 8.374   1.00 269.69 ? 91  LYS A HG2    1 
ATOM   1197  H  HG3    . LYS A  1 92  ? 36.904  -69.856 7.177   1.00 269.69 ? 91  LYS A HG3    1 
ATOM   1198  H  HD2    . LYS A  1 92  ? 38.951  -70.567 6.260   1.00 269.08 ? 91  LYS A HD2    1 
ATOM   1199  H  HD3    . LYS A  1 92  ? 39.068  -71.650 7.421   1.00 269.08 ? 91  LYS A HD3    1 
ATOM   1200  H  HE2    . LYS A  1 92  ? 37.198  -72.748 6.617   1.00 265.94 ? 91  LYS A HE2    1 
ATOM   1201  H  HE3    . LYS A  1 92  ? 37.009  -71.638 5.492   1.00 265.94 ? 91  LYS A HE3    1 
ATOM   1202  H  HZ1    . LYS A  1 92  ? 38.029  -73.477 4.632   1.00 260.82 ? 91  LYS A HZ1    1 
ATOM   1203  H  HZ2    . LYS A  1 92  ? 38.951  -72.361 4.553   1.00 260.82 ? 91  LYS A HZ2    1 
ATOM   1204  H  HZ3    . LYS A  1 92  ? 39.122  -73.372 5.577   1.00 260.82 ? 91  LYS A HZ3    1 
ATOM   1205  N  N      . ASN A  1 93  ? 38.721  -68.125 5.243   1.00 319.50 ? 92  ASN A N      1 
ATOM   1206  C  CA     . ASN A  1 93  ? 37.949  -67.778 4.052   1.00 309.91 ? 92  ASN A CA     1 
ATOM   1207  C  C      . ASN A  1 93  ? 37.372  -66.366 4.089   1.00 308.45 ? 92  ASN A C      1 
ATOM   1208  O  O      . ASN A  1 93  ? 36.161  -66.185 4.210   1.00 306.71 ? 92  ASN A O      1 
ATOM   1209  C  CB     . ASN A  1 93  ? 36.817  -68.788 3.844   1.00 300.19 ? 92  ASN A CB     1 
ATOM   1210  C  CG     . ASN A  1 93  ? 37.304  -70.101 3.263   1.00 288.02 ? 92  ASN A CG     1 
ATOM   1211  O  OD1    . ASN A  1 93  ? 38.488  -70.429 3.342   1.00 283.28 ? 92  ASN A OD1    1 
ATOM   1212  N  ND2    . ASN A  1 93  ? 36.389  -70.860 2.672   1.00 282.78 ? 92  ASN A ND2    1 
ATOM   1213  H  H      . ASN A  1 93  ? 39.451  -68.546 5.071   1.00 383.40 ? 92  ASN A H      1 
ATOM   1214  H  HA     . ASN A  1 93  ? 38.540  -67.834 3.273   1.00 371.89 ? 92  ASN A HA     1 
ATOM   1215  H  HB2    . ASN A  1 93  ? 36.399  -68.975 4.699   1.00 360.23 ? 92  ASN A HB2    1 
ATOM   1216  H  HB3    . ASN A  1 93  ? 36.166  -68.412 3.232   1.00 360.23 ? 92  ASN A HB3    1 
ATOM   1217  H  HD21   . ASN A  1 93  ? 35.571  -70.598 2.635   1.00 339.34 ? 92  ASN A HD21   1 
ATOM   1218  H  HD22   . ASN A  1 93  ? 36.614  -71.615 2.327   1.00 339.34 ? 92  ASN A HD22   1 
ATOM   1219  N  N      . THR A  1 94  ? 38.246  -65.370 3.989   1.00 308.04 ? 93  THR A N      1 
ATOM   1220  C  CA     . THR A  1 94  ? 37.831  -63.971 3.919   1.00 307.20 ? 93  THR A CA     1 
ATOM   1221  C  C      . THR A  1 94  ? 36.992  -63.525 5.119   1.00 314.47 ? 93  THR A C      1 
ATOM   1222  O  O      . THR A  1 94  ? 36.503  -62.396 5.152   1.00 316.44 ? 93  THR A O      1 
ATOM   1223  C  CB     . THR A  1 94  ? 37.016  -63.684 2.637   1.00 300.06 ? 93  THR A CB     1 
ATOM   1224  O  OG1    . THR A  1 94  ? 35.643  -64.048 2.837   1.00 300.40 ? 93  THR A OG1    1 
ATOM   1225  C  CG2    . THR A  1 94  ? 37.587  -64.444 1.447   1.00 296.13 ? 93  THR A CG2    1 
ATOM   1226  H  H      . THR A  1 94  ? 39.099  -65.480 3.959   1.00 369.64 ? 93  THR A H      1 
ATOM   1227  H  HA     . THR A  1 94  ? 38.633  -63.408 3.892   1.00 368.64 ? 93  THR A HA     1 
ATOM   1228  H  HB     . THR A  1 94  ? 37.065  -62.736 2.438   1.00 360.08 ? 93  THR A HB     1 
ATOM   1229  H  HG1    . THR A  1 94  ? 35.587  -64.847 3.015   1.00 360.48 ? 93  THR A HG1    1 
ATOM   1230  H  HG21   . THR A  1 94  ? 37.070  -64.256 0.660   1.00 355.36 ? 93  THR A HG21   1 
ATOM   1231  H  HG22   . THR A  1 94  ? 38.496  -64.179 1.294   1.00 355.36 ? 93  THR A HG22   1 
ATOM   1232  H  HG23   . THR A  1 94  ? 37.562  -65.389 1.618   1.00 355.36 ? 93  THR A HG23   1 
ATOM   1233  N  N      . ASP A  1 95  ? 36.831  -64.402 6.105   1.00 318.81 ? 94  ASP A N      1 
ATOM   1234  C  CA     . ASP A  1 95  ? 36.030  -64.085 7.281   1.00 322.72 ? 94  ASP A CA     1 
ATOM   1235  C  C      . ASP A  1 95  ? 36.892  -64.112 8.534   1.00 302.45 ? 94  ASP A C      1 
ATOM   1236  O  O      . ASP A  1 95  ? 37.613  -65.079 8.782   1.00 318.91 ? 94  ASP A O      1 
ATOM   1237  C  CB     . ASP A  1 95  ? 34.868  -65.070 7.427   1.00 336.29 ? 94  ASP A CB     1 
ATOM   1238  C  CG     . ASP A  1 95  ? 33.813  -64.893 6.352   1.00 349.68 ? 94  ASP A CG     1 
ATOM   1239  O  OD1    . ASP A  1 95  ? 33.623  -63.751 5.884   1.00 354.51 ? 94  ASP A OD1    1 
ATOM   1240  O  OD2    . ASP A  1 95  ? 33.170  -65.897 5.977   1.00 355.42 ? 94  ASP A OD2    1 
ATOM   1241  H  H      . ASP A  1 95  ? 37.175  -65.190 6.116   1.00 382.57 ? 94  ASP A H      1 
ATOM   1242  H  HA     . ASP A  1 95  ? 35.657  -63.183 7.184   1.00 387.26 ? 94  ASP A HA     1 
ATOM   1243  H  HB2    . ASP A  1 95  ? 35.212  -65.975 7.364   1.00 403.55 ? 94  ASP A HB2    1 
ATOM   1244  H  HB3    . ASP A  1 95  ? 34.445  -64.935 8.289   1.00 403.55 ? 94  ASP A HB3    1 
ATOM   1245  N  N      . LEU A  1 96  ? 36.821  -63.042 9.317   1.00 269.91 ? 95  LEU A N      1 
ATOM   1246  C  CA     . LEU A  1 96  ? 37.531  -62.974 10.585  1.00 239.06 ? 95  LEU A CA     1 
ATOM   1247  C  C      . LEU A  1 96  ? 36.632  -63.526 11.684  1.00 234.60 ? 95  LEU A C      1 
ATOM   1248  O  O      . LEU A  1 96  ? 35.551  -62.994 11.935  1.00 239.77 ? 95  LEU A O      1 
ATOM   1249  C  CB     . LEU A  1 96  ? 37.923  -61.531 10.901  1.00 211.20 ? 95  LEU A CB     1 
ATOM   1250  C  CG     . LEU A  1 96  ? 38.787  -61.340 12.148  1.00 187.04 ? 95  LEU A CG     1 
ATOM   1251  C  CD1    . LEU A  1 96  ? 40.194  -61.863 11.909  1.00 175.53 ? 95  LEU A CD1    1 
ATOM   1252  C  CD2    . LEU A  1 96  ? 38.817  -59.879 12.563  1.00 179.70 ? 95  LEU A CD2    1 
ATOM   1253  H  H      . LEU A  1 96  ? 36.363  -62.337 9.133   1.00 323.90 ? 95  LEU A H      1 
ATOM   1254  H  HA     . LEU A  1 96  ? 38.344  -63.518 10.539  1.00 286.88 ? 95  LEU A HA     1 
ATOM   1255  H  HB2    . LEU A  1 96  ? 38.419  -61.175 10.147  1.00 253.45 ? 95  LEU A HB2    1 
ATOM   1256  H  HB3    . LEU A  1 96  ? 37.112  -61.013 11.027  1.00 253.45 ? 95  LEU A HB3    1 
ATOM   1257  H  HG     . LEU A  1 96  ? 38.400  -61.849 12.878  1.00 224.44 ? 95  LEU A HG     1 
ATOM   1258  H  HD11   . LEU A  1 96  ? 40.715  -61.732 12.705  1.00 210.64 ? 95  LEU A HD11   1 
ATOM   1259  H  HD12   . LEU A  1 96  ? 40.147  -62.798 11.698  1.00 210.64 ? 95  LEU A HD12   1 
ATOM   1260  H  HD13   . LEU A  1 96  ? 40.586  -61.381 11.177  1.00 210.64 ? 95  LEU A HD13   1 
ATOM   1261  H  HD21   . LEU A  1 96  ? 39.364  -59.788 13.346  1.00 215.64 ? 95  LEU A HD21   1 
ATOM   1262  H  HD22   . LEU A  1 96  ? 39.183  -59.358 11.844  1.00 215.64 ? 95  LEU A HD22   1 
ATOM   1263  H  HD23   . LEU A  1 96  ? 37.921  -59.590 12.753  1.00 215.64 ? 95  LEU A HD23   1 
ATOM   1264  N  N      . TRP A  1 97  ? 37.078  -64.595 12.334  1.00 226.63 ? 96  TRP A N      1 
ATOM   1265  C  CA     . TRP A  1 97  ? 36.274  -65.251 13.360  1.00 226.10 ? 96  TRP A CA     1 
ATOM   1266  C  C      . TRP A  1 97  ? 36.562  -64.691 14.749  1.00 207.48 ? 96  TRP A C      1 
ATOM   1267  O  O      . TRP A  1 97  ? 37.709  -64.662 15.195  1.00 197.42 ? 96  TRP A O      1 
ATOM   1268  C  CB     . TRP A  1 97  ? 36.510  -66.763 13.342  1.00 246.95 ? 96  TRP A CB     1 
ATOM   1269  C  CG     . TRP A  1 97  ? 35.921  -67.442 12.142  1.00 268.76 ? 96  TRP A CG     1 
ATOM   1270  C  CD1    . TRP A  1 97  ? 35.794  -66.924 10.886  1.00 278.00 ? 96  TRP A CD1    1 
ATOM   1271  C  CD2    . TRP A  1 97  ? 35.367  -68.763 12.089  1.00 277.98 ? 96  TRP A CD2    1 
ATOM   1272  N  NE1    . TRP A  1 97  ? 35.201  -67.841 10.053  1.00 282.78 ? 96  TRP A NE1    1 
ATOM   1273  C  CE2    . TRP A  1 97  ? 34.928  -68.978 10.767  1.00 281.04 ? 96  TRP A CE2    1 
ATOM   1274  C  CE3    . TRP A  1 97  ? 35.200  -69.784 13.029  1.00 279.99 ? 96  TRP A CE3    1 
ATOM   1275  C  CZ2    . TRP A  1 97  ? 34.335  -70.172 10.362  1.00 280.10 ? 96  TRP A CZ2    1 
ATOM   1276  C  CZ3    . TRP A  1 97  ? 34.609  -70.968 12.624  1.00 279.85 ? 96  TRP A CZ3    1 
ATOM   1277  C  CH2    . TRP A  1 97  ? 34.186  -71.152 11.303  1.00 280.09 ? 96  TRP A CH2    1 
ATOM   1278  H  H      . TRP A  1 97  ? 37.845  -64.962 12.200  1.00 271.96 ? 96  TRP A H      1 
ATOM   1279  H  HA     . TRP A  1 97  ? 35.327  -65.094 13.165  1.00 271.32 ? 96  TRP A HA     1 
ATOM   1280  H  HB2    . TRP A  1 97  ? 37.466  -66.931 13.341  1.00 296.34 ? 96  TRP A HB2    1 
ATOM   1281  H  HB3    . TRP A  1 97  ? 36.107  -67.153 14.134  1.00 296.34 ? 96  TRP A HB3    1 
ATOM   1282  H  HD1    . TRP A  1 97  ? 36.073  -66.074 10.631  1.00 333.60 ? 96  TRP A HD1    1 
ATOM   1283  H  HE1    . TRP A  1 97  ? 35.029  -67.721 9.219   1.00 339.33 ? 96  TRP A HE1    1 
ATOM   1284  H  HE3    . TRP A  1 97  ? 35.480  -69.670 13.908  1.00 335.99 ? 96  TRP A HE3    1 
ATOM   1285  H  HZ2    . TRP A  1 97  ? 34.052  -70.297 9.485   1.00 336.12 ? 96  TRP A HZ2    1 
ATOM   1286  H  HZ3    . TRP A  1 97  ? 34.494  -71.655 13.241  1.00 335.82 ? 96  TRP A HZ3    1 
ATOM   1287  H  HH2    . TRP A  1 97  ? 33.793  -71.959 11.060  1.00 336.10 ? 96  TRP A HH2    1 
ATOM   1288  N  N      . ILE A  1 98  ? 35.506  -64.248 15.424  1.00 200.78 ? 97  ILE A N      1 
ATOM   1289  C  CA     . ILE A  1 98  ? 35.615  -63.687 16.764  1.00 201.88 ? 97  ILE A CA     1 
ATOM   1290  C  C      . ILE A  1 98  ? 34.918  -64.595 17.770  1.00 205.49 ? 97  ILE A C      1 
ATOM   1291  O  O      . ILE A  1 98  ? 33.708  -64.801 17.692  1.00 209.78 ? 97  ILE A O      1 
ATOM   1292  C  CB     . ILE A  1 98  ? 34.972  -62.287 16.832  1.00 202.05 ? 97  ILE A CB     1 
ATOM   1293  C  CG1    . ILE A  1 98  ? 35.657  -61.338 15.846  1.00 197.49 ? 97  ILE A CG1    1 
ATOM   1294  C  CG2    . ILE A  1 98  ? 35.052  -61.729 18.245  1.00 199.78 ? 97  ILE A CG2    1 
ATOM   1295  C  CD1    . ILE A  1 98  ? 35.019  -59.964 15.773  1.00 194.57 ? 97  ILE A CD1    1 
ATOM   1296  H  H      . ILE A  1 98  ? 34.701  -64.263 15.121  1.00 240.93 ? 97  ILE A H      1 
ATOM   1297  H  HA     . ILE A  1 98  ? 36.560  -63.610 17.013  1.00 242.25 ? 97  ILE A HA     1 
ATOM   1298  H  HB     . ILE A  1 98  ? 34.037  -62.366 16.584  1.00 242.46 ? 97  ILE A HB     1 
ATOM   1299  H  HG12   . ILE A  1 98  ? 36.581  -61.221 16.117  1.00 236.98 ? 97  ILE A HG12   1 
ATOM   1300  H  HG13   . ILE A  1 98  ? 35.621  -61.729 14.960  1.00 236.98 ? 97  ILE A HG13   1 
ATOM   1301  H  HG21   . ILE A  1 98  ? 34.645  -60.859 18.261  1.00 239.74 ? 97  ILE A HG21   1 
ATOM   1302  H  HG22   . ILE A  1 98  ? 34.585  -62.319 18.841  1.00 239.74 ? 97  ILE A HG22   1 
ATOM   1303  H  HG23   . ILE A  1 98  ? 35.974  -61.664 18.504  1.00 239.74 ? 97  ILE A HG23   1 
ATOM   1304  H  HD11   . ILE A  1 98  ? 35.501  -59.430 15.138  1.00 233.49 ? 97  ILE A HD11   1 
ATOM   1305  H  HD12   . ILE A  1 98  ? 34.105  -60.059 15.494  1.00 233.49 ? 97  ILE A HD12   1 
ATOM   1306  H  HD13   . ILE A  1 98  ? 35.056  -59.556 16.641  1.00 233.49 ? 97  ILE A HD13   1 
ATOM   1307  N  N      . VAL A  1 99  ? 35.682  -65.138 18.714  1.00 202.73 ? 98  VAL A N      1 
ATOM   1308  C  CA     . VAL A  1 99  ? 35.119  -66.002 19.746  1.00 204.15 ? 98  VAL A CA     1 
ATOM   1309  C  C      . VAL A  1 99  ? 34.756  -65.180 20.980  1.00 215.99 ? 98  VAL A C      1 
ATOM   1310  O  O      . VAL A  1 99  ? 35.618  -64.558 21.600  1.00 224.72 ? 98  VAL A O      1 
ATOM   1311  C  CB     . VAL A  1 99  ? 36.098  -67.120 20.148  1.00 197.02 ? 98  VAL A CB     1 
ATOM   1312  C  CG1    . VAL A  1 99  ? 35.458  -68.041 21.177  1.00 189.43 ? 98  VAL A CG1    1 
ATOM   1313  C  CG2    . VAL A  1 99  ? 36.532  -67.910 18.921  1.00 198.28 ? 98  VAL A CG2    1 
ATOM   1314  H  H      . VAL A  1 99  ? 36.532  -65.021 18.778  1.00 243.28 ? 98  VAL A H      1 
ATOM   1315  H  HA     . VAL A  1 99  ? 34.301  -66.420 19.405  1.00 244.98 ? 98  VAL A HA     1 
ATOM   1316  H  HB     . VAL A  1 99  ? 36.896  -66.719 20.551  1.00 236.43 ? 98  VAL A HB     1 
ATOM   1317  H  HG11   . VAL A  1 99  ? 36.085  -68.729 21.413  1.00 227.31 ? 98  VAL A HG11   1 
ATOM   1318  H  HG12   . VAL A  1 99  ? 35.228  -67.527 21.955  1.00 227.31 ? 98  VAL A HG12   1 
ATOM   1319  H  HG13   . VAL A  1 99  ? 34.668  -68.433 20.798  1.00 227.31 ? 98  VAL A HG13   1 
ATOM   1320  H  HG21   . VAL A  1 99  ? 37.140  -68.600 19.194  1.00 237.94 ? 98  VAL A HG21   1 
ATOM   1321  H  HG22   . VAL A  1 99  ? 35.756  -68.299 18.511  1.00 237.94 ? 98  VAL A HG22   1 
ATOM   1322  H  HG23   . VAL A  1 99  ? 36.965  -67.315 18.305  1.00 237.94 ? 98  VAL A HG23   1 
ATOM   1323  N  N      . MET A  1 100 ? 33.473  -65.187 21.330  1.00 209.35 ? 99  MET A N      1 
ATOM   1324  C  CA     . MET A  1 100 ? 32.960  -64.365 22.419  1.00 184.55 ? 99  MET A CA     1 
ATOM   1325  C  C      . MET A  1 100 ? 32.296  -65.246 23.471  1.00 176.77 ? 99  MET A C      1 
ATOM   1326  O  O      . MET A  1 100 ? 32.067  -66.432 23.238  1.00 189.68 ? 99  MET A O      1 
ATOM   1327  C  CB     . MET A  1 100 ? 31.946  -63.365 21.864  1.00 171.09 ? 99  MET A CB     1 
ATOM   1328  C  CG     . MET A  1 100 ? 31.981  -62.003 22.524  1.00 176.73 ? 99  MET A CG     1 
ATOM   1329  S  SD     . MET A  1 100 ? 31.180  -60.737 21.518  1.00 271.41 ? 99  MET A SD     1 
ATOM   1330  C  CE     . MET A  1 100 ? 29.558  -61.458 21.279  1.00 171.65 ? 99  MET A CE     1 
ATOM   1331  H  H      . MET A  1 100 ? 32.872  -65.667 20.946  1.00 251.21 ? 99  MET A H      1 
ATOM   1332  H  HA     . MET A  1 100 ? 33.698  -63.866 22.828  1.00 221.46 ? 99  MET A HA     1 
ATOM   1333  H  HB2    . MET A  1 100 ? 32.122  -63.238 20.918  1.00 205.30 ? 99  MET A HB2    1 
ATOM   1334  H  HB3    . MET A  1 100 ? 31.055  -63.728 21.984  1.00 205.30 ? 99  MET A HB3    1 
ATOM   1335  H  HG2    . MET A  1 100 ? 31.517  -62.051 23.375  1.00 212.08 ? 99  MET A HG2    1 
ATOM   1336  H  HG3    . MET A  1 100 ? 32.904  -61.740 22.662  1.00 212.08 ? 99  MET A HG3    1 
ATOM   1337  H  HE1    . MET A  1 100 ? 29.027  -60.862 20.746  1.00 205.98 ? 99  MET A HE1    1 
ATOM   1338  H  HE2    . MET A  1 100 ? 29.655  -62.301 20.831  1.00 205.98 ? 99  MET A HE2    1 
ATOM   1339  H  HE3    . MET A  1 100 ? 29.145  -61.587 22.136  1.00 205.98 ? 99  MET A HE3    1 
ATOM   1340  N  N      . GLU A  1 101 ? 31.987  -64.671 24.629  1.00 162.24 ? 100 GLU A N      1 
ATOM   1341  C  CA     . GLU A  1 101 ? 31.289  -65.413 25.673  1.00 164.79 ? 100 GLU A CA     1 
ATOM   1342  C  C      . GLU A  1 101 ? 29.839  -65.645 25.265  1.00 173.06 ? 100 GLU A C      1 
ATOM   1343  O  O      . GLU A  1 101 ? 29.200  -64.763 24.693  1.00 175.34 ? 100 GLU A O      1 
ATOM   1344  C  CB     . GLU A  1 101 ? 31.343  -64.668 27.006  1.00 156.94 ? 100 GLU A CB     1 
ATOM   1345  C  CG     . GLU A  1 101 ? 30.484  -65.300 28.088  1.00 156.75 ? 100 GLU A CG     1 
ATOM   1346  C  CD     . GLU A  1 101 ? 30.700  -64.671 29.446  1.00 158.69 ? 100 GLU A CD     1 
ATOM   1347  O  OE1    . GLU A  1 101 ? 31.341  -63.602 29.510  1.00 173.92 ? 100 GLU A OE1    1 
ATOM   1348  O  OE2    . GLU A  1 101 ? 30.232  -65.248 30.450  1.00 153.16 ? 100 GLU A OE2    1 
ATOM   1349  H  H      . GLU A  1 101 ? 32.170  -63.856 24.834  1.00 194.69 ? 100 GLU A H      1 
ATOM   1350  H  HA     . GLU A  1 101 ? 31.718  -66.286 25.791  1.00 197.75 ? 100 GLU A HA     1 
ATOM   1351  H  HB2    . GLU A  1 101 ? 32.260  -64.658 27.323  1.00 188.33 ? 100 GLU A HB2    1 
ATOM   1352  H  HB3    . GLU A  1 101 ? 31.031  -63.760 26.871  1.00 188.33 ? 100 GLU A HB3    1 
ATOM   1353  H  HG2    . GLU A  1 101 ? 29.549  -65.192 27.852  1.00 188.10 ? 100 GLU A HG2    1 
ATOM   1354  H  HG3    . GLU A  1 101 ? 30.703  -66.243 28.155  1.00 188.10 ? 100 GLU A HG3    1 
ATOM   1355  N  N      . TYR A  1 102 ? 29.323  -66.833 25.567  1.00 178.39 ? 101 TYR A N      1 
ATOM   1356  C  CA     . TYR A  1 102 ? 27.983  -67.211 25.134  1.00 184.90 ? 101 TYR A CA     1 
ATOM   1357  C  C      . TYR A  1 102 ? 26.900  -66.719 26.089  1.00 181.75 ? 101 TYR A C      1 
ATOM   1358  O  O      . TYR A  1 102 ? 26.701  -67.282 27.165  1.00 181.07 ? 101 TYR A O      1 
ATOM   1359  C  CB     . TYR A  1 102 ? 27.881  -68.728 24.975  1.00 189.48 ? 101 TYR A CB     1 
ATOM   1360  C  CG     . TYR A  1 102 ? 26.539  -69.190 24.453  1.00 187.65 ? 101 TYR A CG     1 
ATOM   1361  C  CD1    . TYR A  1 102 ? 26.160  -68.939 23.141  1.00 170.27 ? 101 TYR A CD1    1 
ATOM   1362  C  CD2    . TYR A  1 102 ? 25.652  -69.878 25.270  1.00 197.63 ? 101 TYR A CD2    1 
ATOM   1363  C  CE1    . TYR A  1 102 ? 24.936  -69.357 22.659  1.00 172.24 ? 101 TYR A CE1    1 
ATOM   1364  C  CE2    . TYR A  1 102 ? 24.424  -70.302 24.794  1.00 196.28 ? 101 TYR A CE2    1 
ATOM   1365  C  CZ     . TYR A  1 102 ? 24.072  -70.039 23.487  1.00 187.01 ? 101 TYR A CZ     1 
ATOM   1366  O  OH     . TYR A  1 102 ? 22.852  -70.456 23.005  1.00 190.21 ? 101 TYR A OH     1 
ATOM   1367  H  H      . TYR A  1 102 ? 29.730  -67.439 26.022  1.00 214.07 ? 101 TYR A H      1 
ATOM   1368  H  HA     . TYR A  1 102 ? 27.811  -66.808 24.258  1.00 221.88 ? 101 TYR A HA     1 
ATOM   1369  H  HB2    . TYR A  1 102 ? 28.561  -69.025 24.350  1.00 227.37 ? 101 TYR A HB2    1 
ATOM   1370  H  HB3    . TYR A  1 102 ? 28.023  -69.145 25.840  1.00 227.37 ? 101 TYR A HB3    1 
ATOM   1371  H  HD1    . TYR A  1 102 ? 26.741  -68.479 22.578  1.00 204.32 ? 101 TYR A HD1    1 
ATOM   1372  H  HD2    . TYR A  1 102 ? 25.887  -70.057 26.152  1.00 237.15 ? 101 TYR A HD2    1 
ATOM   1373  H  HE1    . TYR A  1 102 ? 24.697  -69.182 21.777  1.00 206.69 ? 101 TYR A HE1    1 
ATOM   1374  H  HE2    . TYR A  1 102 ? 23.839  -70.762 25.353  1.00 235.53 ? 101 TYR A HE2    1 
ATOM   1375  H  HH     . TYR A  1 102 ? 22.247  -70.116 23.442  1.00 228.25 ? 101 TYR A HH     1 
ATOM   1376  N  N      . CYS A  1 103 ? 26.203  -65.663 25.681  1.00 173.56 ? 102 CYS A N      1 
ATOM   1377  C  CA     . CYS A  1 103 ? 25.039  -65.180 26.412  1.00 173.45 ? 102 CYS A CA     1 
ATOM   1378  C  C      . CYS A  1 103 ? 23.774  -65.705 25.734  1.00 167.75 ? 102 CYS A C      1 
ATOM   1379  O  O      . CYS A  1 103 ? 23.206  -65.045 24.866  1.00 159.74 ? 102 CYS A O      1 
ATOM   1380  C  CB     . CYS A  1 103 ? 25.029  -63.649 26.450  1.00 178.88 ? 102 CYS A CB     1 
ATOM   1381  S  SG     . CYS A  1 103 ? 26.554  -62.901 27.079  1.00 168.07 ? 102 CYS A SG     1 
ATOM   1382  H  H      . CYS A  1 103 ? 26.386  -65.206 24.977  1.00 208.27 ? 102 CYS A H      1 
ATOM   1383  H  HA     . CYS A  1 103 ? 25.065  -65.516 27.332  1.00 208.15 ? 102 CYS A HA     1 
ATOM   1384  H  HB2    . CYS A  1 103 ? 24.889  -63.318 25.549  1.00 214.66 ? 102 CYS A HB2    1 
ATOM   1385  H  HB3    . CYS A  1 103 ? 24.301  -63.358 27.021  1.00 214.66 ? 102 CYS A HB3    1 
ATOM   1386  H  HG     . CYS A  1 103 ? 26.438  -61.706 27.066  1.00 201.69 ? 102 CYS A HG     1 
ATOM   1387  N  N      . GLY A  1 104 ? 23.339  -66.895 26.138  1.00 177.09 ? 103 GLY A N      1 
ATOM   1388  C  CA     . GLY A  1 104 ? 22.252  -67.588 25.467  1.00 177.70 ? 103 GLY A CA     1 
ATOM   1389  C  C      . GLY A  1 104 ? 20.940  -66.830 25.402  1.00 162.50 ? 103 GLY A C      1 
ATOM   1390  O  O      . GLY A  1 104 ? 20.246  -66.869 24.385  1.00 156.89 ? 103 GLY A O      1 
ATOM   1391  H  H      . GLY A  1 104 ? 23.664  -67.325 26.808  1.00 212.51 ? 103 GLY A H      1 
ATOM   1392  H  HA2    . GLY A  1 104 ? 22.524  -67.790 24.558  1.00 213.24 ? 103 GLY A HA2    1 
ATOM   1393  H  HA3    . GLY A  1 104 ? 22.088  -68.428 25.924  1.00 213.24 ? 103 GLY A HA3    1 
ATOM   1394  N  N      . ALA A  1 105 ? 20.594  -66.139 26.483  1.00 154.97 ? 104 ALA A N      1 
ATOM   1395  C  CA     . ALA A  1 105 ? 19.295  -65.480 26.584  1.00 157.28 ? 104 ALA A CA     1 
ATOM   1396  C  C      . ALA A  1 105 ? 19.202  -64.221 25.719  1.00 171.87 ? 104 ALA A C      1 
ATOM   1397  O  O      . ALA A  1 105 ? 18.142  -63.601 25.634  1.00 177.96 ? 104 ALA A O      1 
ATOM   1398  C  CB     . ALA A  1 105 ? 18.983  -65.149 28.040  1.00 153.30 ? 104 ALA A CB     1 
ATOM   1399  H  H      . ALA A  1 105 ? 21.095  -66.037 27.175  1.00 185.96 ? 104 ALA A H      1 
ATOM   1400  H  HA     . ALA A  1 105 ? 18.607  -66.103 26.270  1.00 188.73 ? 104 ALA A HA     1 
ATOM   1401  H  HB1    . ALA A  1 105 ? 18.126  -64.717 28.085  1.00 183.97 ? 104 ALA A HB1    1 
ATOM   1402  H  HB2    . ALA A  1 105 ? 18.966  -65.963 28.548  1.00 183.97 ? 104 ALA A HB2    1 
ATOM   1403  H  HB3    . ALA A  1 105 ? 19.663  -64.563 28.379  1.00 183.97 ? 104 ALA A HB3    1 
ATOM   1404  N  N      . GLY A  1 106 ? 20.307  -63.847 25.080  1.00 174.81 ? 105 GLY A N      1 
ATOM   1405  C  CA     . GLY A  1 106 ? 20.323  -62.679 24.218  1.00 161.04 ? 105 GLY A CA     1 
ATOM   1406  C  C      . GLY A  1 106 ? 20.374  -61.385 25.007  1.00 155.72 ? 105 GLY A C      1 
ATOM   1407  O  O      . GLY A  1 106 ? 20.679  -61.387 26.199  1.00 150.00 ? 105 GLY A O      1 
ATOM   1408  H  H      . GLY A  1 106 ? 21.061  -64.256 25.132  1.00 209.77 ? 105 GLY A H      1 
ATOM   1409  H  HA2    . GLY A  1 106 ? 21.099  -62.716 23.637  1.00 193.24 ? 105 GLY A HA2    1 
ATOM   1410  H  HA3    . GLY A  1 106 ? 19.525  -62.672 23.666  1.00 193.24 ? 105 GLY A HA3    1 
ATOM   1411  N  N      . SER A  1 107 ? 20.073  -60.275 24.340  1.00 155.85 ? 106 SER A N      1 
ATOM   1412  C  CA     . SER A  1 107 ? 20.101  -58.965 24.981  1.00 141.83 ? 106 SER A CA     1 
ATOM   1413  C  C      . SER A  1 107 ? 18.774  -58.668 25.662  1.00 138.89 ? 106 SER A C      1 
ATOM   1414  O  O      . SER A  1 107 ? 17.747  -59.254 25.325  1.00 149.14 ? 106 SER A O      1 
ATOM   1415  C  CB     . SER A  1 107 ? 20.409  -57.871 23.958  1.00 135.38 ? 106 SER A CB     1 
ATOM   1416  O  OG     . SER A  1 107 ? 19.329  -57.699 23.057  1.00 149.68 ? 106 SER A OG     1 
ATOM   1417  H  H      . SER A  1 107 ? 19.848  -60.253 23.510  1.00 187.02 ? 106 SER A H      1 
ATOM   1418  H  HA     . SER A  1 107 ? 20.806  -58.955 25.663  1.00 170.19 ? 106 SER A HA     1 
ATOM   1419  H  HB2    . SER A  1 107 ? 20.564  -57.036 24.426  1.00 162.45 ? 106 SER A HB2    1 
ATOM   1420  H  HB3    . SER A  1 107 ? 21.200  -58.122 23.456  1.00 162.45 ? 106 SER A HB3    1 
ATOM   1421  H  HG     . SER A  1 107 ? 19.507  -57.111 22.515  1.00 179.61 ? 106 SER A HG     1 
ATOM   1422  N  N      . VAL A  1 108 ? 18.801  -57.749 26.622  1.00 135.34 ? 107 VAL A N      1 
ATOM   1423  C  CA     . VAL A  1 108 ? 17.591  -57.350 27.329  1.00 145.13 ? 107 VAL A CA     1 
ATOM   1424  C  C      . VAL A  1 108 ? 16.537  -56.886 26.331  1.00 158.69 ? 107 VAL A C      1 
ATOM   1425  O  O      . VAL A  1 108 ? 15.341  -57.091 26.534  1.00 162.51 ? 107 VAL A O      1 
ATOM   1426  C  CB     . VAL A  1 108 ? 17.872  -56.213 28.329  1.00 141.18 ? 107 VAL A CB     1 
ATOM   1427  C  CG1    . VAL A  1 108 ? 16.574  -55.713 28.949  1.00 147.59 ? 107 VAL A CG1    1 
ATOM   1428  C  CG2    . VAL A  1 108 ? 18.834  -56.681 29.414  1.00 136.24 ? 107 VAL A CG2    1 
ATOM   1429  H  H      . VAL A  1 108 ? 19.511  -57.341 26.883  1.00 162.41 ? 107 VAL A H      1 
ATOM   1430  H  HA     . VAL A  1 108 ? 17.234  -58.117 27.823  1.00 174.15 ? 107 VAL A HA     1 
ATOM   1431  H  HB     . VAL A  1 108 ? 18.290  -55.465 27.854  1.00 169.41 ? 107 VAL A HB     1 
ATOM   1432  H  HG11   . VAL A  1 108 ? 16.776  -55.007 29.567  1.00 177.11 ? 107 VAL A HG11   1 
ATOM   1433  H  HG12   . VAL A  1 108 ? 16.002  -55.385 28.251  1.00 177.11 ? 107 VAL A HG12   1 
ATOM   1434  H  HG13   . VAL A  1 108 ? 16.148  -56.440 29.409  1.00 177.11 ? 107 VAL A HG13   1 
ATOM   1435  H  HG21   . VAL A  1 108 ? 18.993  -55.956 30.024  1.00 163.49 ? 107 VAL A HG21   1 
ATOM   1436  H  HG22   . VAL A  1 108 ? 18.442  -57.422 29.881  1.00 163.49 ? 107 VAL A HG22   1 
ATOM   1437  H  HG23   . VAL A  1 108 ? 19.659  -56.950 29.004  1.00 163.49 ? 107 VAL A HG23   1 
ATOM   1438  N  N      . SER A  1 109 ? 16.992  -56.263 25.249  1.00 165.37 ? 108 SER A N      1 
ATOM   1439  C  CA     . SER A  1 109 ? 16.091  -55.768 24.218  1.00 160.98 ? 108 SER A CA     1 
ATOM   1440  C  C      . SER A  1 109 ? 15.456  -56.926 23.453  1.00 162.85 ? 108 SER A C      1 
ATOM   1441  O  O      . SER A  1 109 ? 14.289  -56.858 23.068  1.00 160.79 ? 108 SER A O      1 
ATOM   1442  C  CB     . SER A  1 109 ? 16.842  -54.850 23.253  1.00 149.53 ? 108 SER A CB     1 
ATOM   1443  O  OG     . SER A  1 109 ? 15.952  -54.232 22.341  1.00 155.05 ? 108 SER A OG     1 
ATOM   1444  H  H      . SER A  1 109 ? 17.823  -56.115 25.088  1.00 198.45 ? 108 SER A H      1 
ATOM   1445  H  HA     . SER A  1 109 ? 15.374  -55.249 24.639  1.00 193.18 ? 108 SER A HA     1 
ATOM   1446  H  HB2    . SER A  1 109 ? 17.299  -54.163 23.763  1.00 179.44 ? 108 SER A HB2    1 
ATOM   1447  H  HB3    . SER A  1 109 ? 17.487  -55.377 22.756  1.00 179.44 ? 108 SER A HB3    1 
ATOM   1448  H  HG     . SER A  1 109 ? 16.368  -53.743 21.831  1.00 186.06 ? 108 SER A HG     1 
ATOM   1449  N  N      . ASP A  1 110 ? 16.228  -57.987 23.238  1.00 166.38 ? 109 ASP A N      1 
ATOM   1450  C  CA     . ASP A  1 110 ? 15.738  -59.157 22.516  1.00 176.15 ? 109 ASP A CA     1 
ATOM   1451  C  C      . ASP A  1 110 ? 14.724  -59.944 23.341  1.00 172.38 ? 109 ASP A C      1 
ATOM   1452  O  O      . ASP A  1 110 ? 13.733  -60.442 22.808  1.00 158.77 ? 109 ASP A O      1 
ATOM   1453  C  CB     . ASP A  1 110 ? 16.900  -60.073 22.124  1.00 190.33 ? 109 ASP A CB     1 
ATOM   1454  C  CG     . ASP A  1 110 ? 17.769  -59.478 21.034  1.00 206.50 ? 109 ASP A CG     1 
ATOM   1455  O  OD1    . ASP A  1 110 ? 18.989  -59.747 21.033  1.00 210.81 ? 109 ASP A OD1    1 
ATOM   1456  O  OD2    . ASP A  1 110 ? 17.234  -58.745 20.176  1.00 213.91 ? 109 ASP A OD2    1 
ATOM   1457  H  H      . ASP A  1 110 ? 17.044  -58.055 23.501  1.00 199.66 ? 109 ASP A H      1 
ATOM   1458  H  HA     . ASP A  1 110 ? 15.294  -58.862 21.694  1.00 211.38 ? 109 ASP A HA     1 
ATOM   1459  H  HB2    . ASP A  1 110 ? 17.458  -60.226 22.902  1.00 228.39 ? 109 ASP A HB2    1 
ATOM   1460  H  HB3    . ASP A  1 110 ? 16.544  -60.914 21.799  1.00 228.39 ? 109 ASP A HB3    1 
ATOM   1461  N  N      . ILE A  1 111 ? 14.979  -60.057 24.640  1.00 175.69 ? 110 ILE A N      1 
ATOM   1462  C  CA     . ILE A  1 111 ? 14.092  -60.793 25.534  1.00 165.64 ? 110 ILE A CA     1 
ATOM   1463  C  C      . ILE A  1 111 ? 12.736  -60.103 25.636  1.00 162.87 ? 110 ILE A C      1 
ATOM   1464  O  O      . ILE A  1 111 ? 11.692  -60.755 25.606  1.00 171.49 ? 110 ILE A O      1 
ATOM   1465  C  CB     . ILE A  1 111 ? 14.709  -60.934 26.936  1.00 152.72 ? 110 ILE A CB     1 
ATOM   1466  C  CG1    . ILE A  1 111 ? 15.934  -61.849 26.874  1.00 138.84 ? 110 ILE A CG1    1 
ATOM   1467  C  CG2    . ILE A  1 111 ? 13.689  -61.492 27.917  1.00 160.08 ? 110 ILE A CG2    1 
ATOM   1468  C  CD1    . ILE A  1 111 ? 16.782  -61.826 28.122  1.00 124.95 ? 110 ILE A CD1    1 
ATOM   1469  H  H      . ILE A  1 111 ? 15.663  -59.714 25.031  1.00 210.82 ? 110 ILE A H      1 
ATOM   1470  H  HA     . ILE A  1 111 ? 13.948  -61.693 25.172  1.00 198.76 ? 110 ILE A HA     1 
ATOM   1471  H  HB     . ILE A  1 111 ? 14.990  -60.058 27.242  1.00 183.26 ? 110 ILE A HB     1 
ATOM   1472  H  HG12   . ILE A  1 111 ? 15.635  -62.761 26.736  1.00 166.61 ? 110 ILE A HG12   1 
ATOM   1473  H  HG13   . ILE A  1 111 ? 16.493  -61.571 26.131  1.00 166.61 ? 110 ILE A HG13   1 
ATOM   1474  H  HG21   . ILE A  1 111 ? 14.098  -61.570 28.782  1.00 192.09 ? 110 ILE A HG21   1 
ATOM   1475  H  HG22   . ILE A  1 111 ? 12.939  -60.894 27.962  1.00 192.09 ? 110 ILE A HG22   1 
ATOM   1476  H  HG23   . ILE A  1 111 ? 13.401  -62.356 27.612  1.00 192.09 ? 110 ILE A HG23   1 
ATOM   1477  H  HD11   . ILE A  1 111 ? 17.526  -62.422 28.005  1.00 149.94 ? 110 ILE A HD11   1 
ATOM   1478  H  HD12   . ILE A  1 111 ? 17.098  -60.932 28.268  1.00 149.94 ? 110 ILE A HD12   1 
ATOM   1479  H  HD13   . ILE A  1 111 ? 16.248  -62.111 28.867  1.00 149.94 ? 110 ILE A HD13   1 
ATOM   1480  N  N      . ILE A  1 112 ? 12.758  -58.781 25.757  1.00 153.98 ? 111 ILE A N      1 
ATOM   1481  C  CA     . ILE A  1 112 ? 11.531  -57.995 25.779  1.00 150.42 ? 111 ILE A CA     1 
ATOM   1482  C  C      . ILE A  1 112 ? 10.816  -58.120 24.437  1.00 164.71 ? 111 ILE A C      1 
ATOM   1483  O  O      . ILE A  1 112 ? 9.587   -58.100 24.372  1.00 165.92 ? 111 ILE A O      1 
ATOM   1484  C  CB     . ILE A  1 112 ? 11.824  -56.511 26.072  1.00 133.31 ? 111 ILE A CB     1 
ATOM   1485  C  CG1    . ILE A  1 112 ? 12.385  -56.357 27.488  1.00 135.37 ? 111 ILE A CG1    1 
ATOM   1486  C  CG2    . ILE A  1 112 ? 10.563  -55.668 25.917  1.00 121.00 ? 111 ILE A CG2    1 
ATOM   1487  C  CD1    . ILE A  1 112 ? 12.965  -54.992 27.773  1.00 132.39 ? 111 ILE A CD1    1 
ATOM   1488  H  H      . ILE A  1 112 ? 13.475  -58.312 25.829  1.00 184.78 ? 111 ILE A H      1 
ATOM   1489  H  HA     . ILE A  1 112 ? 10.937  -58.338 26.479  1.00 180.50 ? 111 ILE A HA     1 
ATOM   1490  H  HB     . ILE A  1 112 ? 12.488  -56.195 25.440  1.00 159.98 ? 111 ILE A HB     1 
ATOM   1491  H  HG12   . ILE A  1 112 ? 11.671  -56.514 28.125  1.00 162.44 ? 111 ILE A HG12   1 
ATOM   1492  H  HG13   . ILE A  1 112 ? 13.090  -57.011 27.617  1.00 162.44 ? 111 ILE A HG13   1 
ATOM   1493  H  HG21   . ILE A  1 112 ? 10.775  -54.751 26.106  1.00 145.20 ? 111 ILE A HG21   1 
ATOM   1494  H  HG22   . ILE A  1 112 ? 10.241  -55.752 25.017  1.00 145.20 ? 111 ILE A HG22   1 
ATOM   1495  H  HG23   . ILE A  1 112 ? 9.899   -55.984 26.534  1.00 145.20 ? 111 ILE A HG23   1 
ATOM   1496  H  HD11   . ILE A  1 112 ? 13.294  -54.975 28.675  1.00 158.86 ? 111 ILE A HD11   1 
ATOM   1497  H  HD12   . ILE A  1 112 ? 13.683  -54.823 27.159  1.00 158.86 ? 111 ILE A HD12   1 
ATOM   1498  H  HD13   . ILE A  1 112 ? 12.277  -54.331 27.663  1.00 158.86 ? 111 ILE A HD13   1 
ATOM   1499  N  N      . ARG A  1 113 ? 11.598  -58.259 23.371  1.00 177.14 ? 112 ARG A N      1 
ATOM   1500  C  CA     . ARG A  1 113 ? 11.054  -58.388 22.025  1.00 184.50 ? 112 ARG A CA     1 
ATOM   1501  C  C      . ARG A  1 113 ? 10.420  -59.762 21.823  1.00 185.50 ? 112 ARG A C      1 
ATOM   1502  O  O      . ARG A  1 113 ? 9.310   -59.875 21.304  1.00 187.38 ? 112 ARG A O      1 
ATOM   1503  C  CB     . ARG A  1 113 ? 12.160  -58.177 20.988  1.00 191.91 ? 112 ARG A CB     1 
ATOM   1504  C  CG     . ARG A  1 113 ? 11.672  -57.618 19.663  1.00 198.48 ? 112 ARG A CG     1 
ATOM   1505  C  CD     . ARG A  1 113 ? 12.718  -57.762 18.566  1.00 203.07 ? 112 ARG A CD     1 
ATOM   1506  N  NE     . ARG A  1 113 ? 12.882  -59.153 18.142  1.00 205.88 ? 112 ARG A NE     1 
ATOM   1507  C  CZ     . ARG A  1 113 ? 13.957  -59.908 18.365  1.00 202.95 ? 112 ARG A CZ     1 
ATOM   1508  N  NH1    . ARG A  1 113 ? 15.016  -59.433 19.009  1.00 204.36 ? 112 ARG A NH1    1 
ATOM   1509  N  NH2    . ARG A  1 113 ? 13.977  -61.159 17.930  1.00 198.00 ? 112 ARG A NH2    1 
ATOM   1510  H  H      . ARG A  1 113 ? 12.457  -58.282 23.402  1.00 212.57 ? 112 ARG A H      1 
ATOM   1511  H  HA     . ARG A  1 113 ? 10.364  -57.705 21.885  1.00 221.40 ? 112 ARG A HA     1 
ATOM   1512  H  HB2    . ARG A  1 113 ? 12.811  -57.556 21.350  1.00 230.29 ? 112 ARG A HB2    1 
ATOM   1513  H  HB3    . ARG A  1 113 ? 12.585  -59.030 20.810  1.00 230.29 ? 112 ARG A HB3    1 
ATOM   1514  H  HG2    . ARG A  1 113 ? 10.876  -58.099 19.387  1.00 238.18 ? 112 ARG A HG2    1 
ATOM   1515  H  HG3    . ARG A  1 113 ? 11.473  -56.674 19.769  1.00 238.18 ? 112 ARG A HG3    1 
ATOM   1516  H  HD2    . ARG A  1 113 ? 12.444  -57.241 17.795  1.00 243.68 ? 112 ARG A HD2    1 
ATOM   1517  H  HD3    . ARG A  1 113 ? 13.573  -57.445 18.898  1.00 243.68 ? 112 ARG A HD3    1 
ATOM   1518  H  HE     . ARG A  1 113 ? 12.230  -59.514 17.713  1.00 247.05 ? 112 ARG A HE     1 
ATOM   1519  H  HH11   . ARG A  1 113 ? 15.016  -58.623 19.298  1.00 245.23 ? 112 ARG A HH11   1 
ATOM   1520  H  HH12   . ARG A  1 113 ? 15.701  -59.936 19.141  1.00 245.23 ? 112 ARG A HH12   1 
ATOM   1521  H  HH21   . ARG A  1 113 ? 13.298  -61.478 17.509  1.00 237.60 ? 112 ARG A HH21   1 
ATOM   1522  H  HH22   . ARG A  1 113 ? 14.669  -61.651 18.067  1.00 237.60 ? 112 ARG A HH22   1 
ATOM   1523  N  N      . LEU A  1 114 ? 11.134  -60.803 22.242  1.00 180.82 ? 113 LEU A N      1 
ATOM   1524  C  CA     . LEU A  1 114 ? 10.693  -62.181 22.046  1.00 179.72 ? 113 LEU A CA     1 
ATOM   1525  C  C      . LEU A  1 114 ? 9.358   -62.467 22.727  1.00 182.52 ? 113 LEU A C      1 
ATOM   1526  O  O      . LEU A  1 114 ? 8.440   -63.007 22.110  1.00 177.82 ? 113 LEU A O      1 
ATOM   1527  C  CB     . LEU A  1 114 ? 11.751  -63.153 22.574  1.00 174.67 ? 113 LEU A CB     1 
ATOM   1528  C  CG     . LEU A  1 114 ? 12.988  -63.357 21.697  1.00 169.73 ? 113 LEU A CG     1 
ATOM   1529  C  CD1    . LEU A  1 114 ? 14.081  -64.076 22.473  1.00 161.58 ? 113 LEU A CD1    1 
ATOM   1530  C  CD2    . LEU A  1 114 ? 12.629  -64.134 20.441  1.00 170.34 ? 113 LEU A CD2    1 
ATOM   1531  H  H      . LEU A  1 114 ? 11.889  -60.736 22.648  1.00 216.99 ? 113 LEU A H      1 
ATOM   1532  H  HA     . LEU A  1 114 ? 10.583  -62.346 21.086  1.00 215.67 ? 113 LEU A HA     1 
ATOM   1533  H  HB2    . LEU A  1 114 ? 12.060  -62.827 23.435  1.00 209.61 ? 113 LEU A HB2    1 
ATOM   1534  H  HB3    . LEU A  1 114 ? 11.335  -64.021 22.691  1.00 209.61 ? 113 LEU A HB3    1 
ATOM   1535  H  HG     . LEU A  1 114 ? 13.331  -62.491 21.428  1.00 203.67 ? 113 LEU A HG     1 
ATOM   1536  H  HD11   . LEU A  1 114 ? 14.844  -64.192 21.903  1.00 193.89 ? 113 LEU A HD11   1 
ATOM   1537  H  HD12   . LEU A  1 114 ? 14.320  -63.547 23.238  1.00 193.89 ? 113 LEU A HD12   1 
ATOM   1538  H  HD13   . LEU A  1 114 ? 13.751  -64.932 22.757  1.00 193.89 ? 113 LEU A HD13   1 
ATOM   1539  H  HD21   . LEU A  1 114 ? 13.419  -64.249 19.909  1.00 204.41 ? 113 LEU A HD21   1 
ATOM   1540  H  HD22   . LEU A  1 114 ? 12.277  -64.990 20.694  1.00 204.41 ? 113 LEU A HD22   1 
ATOM   1541  H  HD23   . LEU A  1 114 ? 11.970  -63.641 19.947  1.00 204.41 ? 113 LEU A HD23   1 
ATOM   1542  N  N      . ARG A  1 115 ? 9.258   -62.104 24.001  1.00 185.95 ? 114 ARG A N      1 
ATOM   1543  C  CA     . ARG A  1 115 ? 8.078   -62.422 24.796  1.00 184.43 ? 114 ARG A CA     1 
ATOM   1544  C  C      . ARG A  1 115 ? 6.919   -61.471 24.514  1.00 173.27 ? 114 ARG A C      1 
ATOM   1545  O  O      . ARG A  1 115 ? 5.772   -61.773 24.839  1.00 173.01 ? 114 ARG A O      1 
ATOM   1546  C  CB     . ARG A  1 115 ? 8.415   -62.373 26.286  1.00 189.47 ? 114 ARG A CB     1 
ATOM   1547  C  CG     . ARG A  1 115 ? 9.626   -63.199 26.687  1.00 189.79 ? 114 ARG A CG     1 
ATOM   1548  C  CD     . ARG A  1 115 ? 9.648   -63.439 28.186  1.00 189.92 ? 114 ARG A CD     1 
ATOM   1549  N  NE     . ARG A  1 115 ? 9.391   -62.217 28.944  1.00 190.99 ? 114 ARG A NE     1 
ATOM   1550  C  CZ     . ARG A  1 115 ? 9.180   -62.179 30.256  1.00 189.40 ? 114 ARG A CZ     1 
ATOM   1551  N  NH1    . ARG A  1 115 ? 9.190   -63.298 30.968  1.00 174.16 ? 114 ARG A NH1    1 
ATOM   1552  N  NH2    . ARG A  1 115 ? 8.953   -61.020 30.857  1.00 198.07 ? 114 ARG A NH2    1 
ATOM   1553  H  H      . ARG A  1 115 ? 9.864   -61.671 24.432  1.00 223.14 ? 114 ARG A H      1 
ATOM   1554  H  HA     . ARG A  1 115 ? 7.783   -63.331 24.580  1.00 221.32 ? 114 ARG A HA     1 
ATOM   1555  H  HB2    . ARG A  1 115 ? 8.592   -61.452 26.534  1.00 227.37 ? 114 ARG A HB2    1 
ATOM   1556  H  HB3    . ARG A  1 115 ? 7.653   -62.705 26.787  1.00 227.37 ? 114 ARG A HB3    1 
ATOM   1557  H  HG2    . ARG A  1 115 ? 9.591   -64.059 26.240  1.00 227.74 ? 114 ARG A HG2    1 
ATOM   1558  H  HG3    . ARG A  1 115 ? 10.435  -62.723 26.441  1.00 227.74 ? 114 ARG A HG3    1 
ATOM   1559  H  HD2    . ARG A  1 115 ? 8.962   -64.086 28.415  1.00 227.91 ? 114 ARG A HD2    1 
ATOM   1560  H  HD3    . ARG A  1 115 ? 10.521  -63.774 28.442  1.00 227.91 ? 114 ARG A HD3    1 
ATOM   1561  H  HE     . ARG A  1 115 ? 9.374   -61.473 28.513  1.00 229.19 ? 114 ARG A HE     1 
ATOM   1562  H  HH11   . ARG A  1 115 ? 9.336   -64.052 30.581  1.00 208.99 ? 114 ARG A HH11   1 
ATOM   1563  H  HH12   . ARG A  1 115 ? 9.052   -63.269 31.816  1.00 208.99 ? 114 ARG A HH12   1 
ATOM   1564  H  HH21   . ARG A  1 115 ? 8.945   -60.292 30.399  1.00 237.69 ? 114 ARG A HH21   1 
ATOM   1565  H  HH22   . ARG A  1 115 ? 8.816   -60.996 31.706  1.00 237.69 ? 114 ARG A HH22   1 
ATOM   1566  N  N      . ASN A  1 116 ? 7.220   -60.324 23.915  1.00 172.89 ? 115 ASN A N      1 
ATOM   1567  C  CA     . ASN A  1 116 ? 6.206   -59.306 23.674  1.00 185.40 ? 115 ASN A CA     1 
ATOM   1568  C  C      . ASN A  1 116 ? 5.685   -58.766 25.003  1.00 170.90 ? 115 ASN A C      1 
ATOM   1569  O  O      . ASN A  1 116 ? 4.493   -58.500 25.156  1.00 163.71 ? 115 ASN A O      1 
ATOM   1570  C  CB     . ASN A  1 116 ? 5.054   -59.881 22.845  1.00 207.85 ? 115 ASN A CB     1 
ATOM   1571  C  CG     . ASN A  1 116 ? 4.150   -58.805 22.271  1.00 223.57 ? 115 ASN A CG     1 
ATOM   1572  O  OD1    . ASN A  1 116 ? 4.411   -58.268 21.194  1.00 220.16 ? 115 ASN A OD1    1 
ATOM   1573  N  ND2    . ASN A  1 116 ? 3.077   -58.490 22.986  1.00 234.45 ? 115 ASN A ND2    1 
ATOM   1574  H  H      . ASN A  1 116 ? 8.006   -60.110 23.638  1.00 207.47 ? 115 ASN A H      1 
ATOM   1575  H  HA     . ASN A  1 116 ? 6.604   -58.563 23.175  1.00 222.48 ? 115 ASN A HA     1 
ATOM   1576  H  HB2    . ASN A  1 116 ? 5.420   -60.391 22.106  1.00 249.42 ? 115 ASN A HB2    1 
ATOM   1577  H  HB3    . ASN A  1 116 ? 4.514   -60.456 23.410  1.00 249.42 ? 115 ASN A HB3    1 
ATOM   1578  H  HD21   . ASN A  1 116 ? 2.924   -58.890 23.732  1.00 281.34 ? 115 ASN A HD21   1 
ATOM   1579  H  HD22   . ASN A  1 116 ? 2.534   -57.886 22.703  1.00 281.34 ? 115 ASN A HD22   1 
ATOM   1580  N  N      . LYS A  1 117 ? 6.593   -58.609 25.961  1.00 168.54 ? 116 LYS A N      1 
ATOM   1581  C  CA     . LYS A  1 117 ? 6.236   -58.149 27.297  1.00 175.91 ? 116 LYS A CA     1 
ATOM   1582  C  C      . LYS A  1 117 ? 7.349   -57.295 27.892  1.00 164.58 ? 116 LYS A C      1 
ATOM   1583  O  O      . LYS A  1 117 ? 8.530   -57.608 27.739  1.00 175.84 ? 116 LYS A O      1 
ATOM   1584  C  CB     . LYS A  1 117 ? 5.976   -59.344 28.216  1.00 182.81 ? 116 LYS A CB     1 
ATOM   1585  C  CG     . LYS A  1 117 ? 4.782   -60.195 27.819  1.00 185.09 ? 116 LYS A CG     1 
ATOM   1586  C  CD     . LYS A  1 117 ? 4.735   -61.489 28.619  1.00 185.53 ? 116 LYS A CD     1 
ATOM   1587  C  CE     . LYS A  1 117 ? 4.667   -61.224 30.114  1.00 186.61 ? 116 LYS A CE     1 
ATOM   1588  N  NZ     . LYS A  1 117 ? 4.606   -62.485 30.901  1.00 182.86 ? 116 LYS A NZ     1 
ATOM   1589  H  H      . LYS A  1 117 ? 7.433   -58.766 25.860  1.00 202.25 ? 116 LYS A H      1 
ATOM   1590  H  HA     . LYS A  1 117 ? 5.420   -57.608 27.251  1.00 211.09 ? 116 LYS A HA     1 
ATOM   1591  H  HB2    . LYS A  1 117 ? 6.760   -59.915 28.210  1.00 219.37 ? 116 LYS A HB2    1 
ATOM   1592  H  HB3    . LYS A  1 117 ? 5.818   -59.015 29.115  1.00 219.37 ? 116 LYS A HB3    1 
ATOM   1593  H  HG2    . LYS A  1 117 ? 3.965   -59.701 27.990  1.00 222.11 ? 116 LYS A HG2    1 
ATOM   1594  H  HG3    . LYS A  1 117 ? 4.847   -60.421 26.878  1.00 222.11 ? 116 LYS A HG3    1 
ATOM   1595  H  HD2    . LYS A  1 117 ? 3.946   -61.993 28.364  1.00 222.64 ? 116 LYS A HD2    1 
ATOM   1596  H  HD3    . LYS A  1 117 ? 5.536   -62.005 28.438  1.00 222.64 ? 116 LYS A HD3    1 
ATOM   1597  H  HE2    . LYS A  1 117 ? 5.458   -60.735 30.388  1.00 223.93 ? 116 LYS A HE2    1 
ATOM   1598  H  HE3    . LYS A  1 117 ? 3.870   -60.706 30.310  1.00 223.93 ? 116 LYS A HE3    1 
ATOM   1599  H  HZ1    . LYS A  1 117 ? 4.567   -62.299 31.771  1.00 219.44 ? 116 LYS A HZ1    1 
ATOM   1600  H  HZ2    . LYS A  1 117 ? 3.883   -62.952 30.673  1.00 219.44 ? 116 LYS A HZ2    1 
ATOM   1601  H  HZ3    . LYS A  1 117 ? 5.330   -62.977 30.743  1.00 219.44 ? 116 LYS A HZ3    1 
ATOM   1602  N  N      . THR A  1 118 ? 6.970   -56.220 28.576  1.00 134.13 ? 117 THR A N      1 
ATOM   1603  C  CA     . THR A  1 118 ? 7.939   -55.377 29.264  1.00 138.25 ? 117 THR A CA     1 
ATOM   1604  C  C      . THR A  1 118 ? 8.431   -56.080 30.526  1.00 148.72 ? 117 THR A C      1 
ATOM   1605  O  O      . THR A  1 118 ? 7.885   -57.111 30.926  1.00 142.23 ? 117 THR A O      1 
ATOM   1606  C  CB     . THR A  1 118 ? 7.337   -54.011 29.649  1.00 151.82 ? 117 THR A CB     1 
ATOM   1607  O  OG1    . THR A  1 118 ? 6.281   -54.196 30.599  1.00 159.42 ? 117 THR A OG1    1 
ATOM   1608  C  CG2    . THR A  1 118 ? 6.794   -53.295 28.419  1.00 158.28 ? 117 THR A CG2    1 
ATOM   1609  H  H      . THR A  1 118 ? 6.155   -55.956 28.656  1.00 160.96 ? 117 THR A H      1 
ATOM   1610  H  HA     . THR A  1 118 ? 8.709   -55.221 28.678  1.00 165.91 ? 117 THR A HA     1 
ATOM   1611  H  HB     . THR A  1 118 ? 8.029   -53.456 30.043  1.00 182.18 ? 117 THR A HB     1 
ATOM   1612  H  HG1    . THR A  1 118 ? 5.959   -53.470 30.806  1.00 191.31 ? 117 THR A HG1    1 
ATOM   1613  H  HG21   . THR A  1 118 ? 6.422   -52.447 28.671  1.00 189.93 ? 117 THR A HG21   1 
ATOM   1614  H  HG22   . THR A  1 118 ? 7.500   -53.150 27.785  1.00 189.93 ? 117 THR A HG22   1 
ATOM   1615  H  HG23   . THR A  1 118 ? 6.109   -53.826 28.007  1.00 189.93 ? 117 THR A HG23   1 
ATOM   1616  N  N      . LEU A  1 119 ? 9.461   -55.521 31.153  1.00 151.60 ? 118 LEU A N      1 
ATOM   1617  C  CA     . LEU A  1 119 ? 10.052  -56.134 32.337  1.00 144.80 ? 118 LEU A CA     1 
ATOM   1618  C  C      . LEU A  1 119 ? 9.492   -55.539 33.622  1.00 151.93 ? 118 LEU A C      1 
ATOM   1619  O  O      . LEU A  1 119 ? 9.268   -54.333 33.723  1.00 156.10 ? 118 LEU A O      1 
ATOM   1620  C  CB     . LEU A  1 119 ? 11.574  -55.981 32.319  1.00 136.98 ? 118 LEU A CB     1 
ATOM   1621  C  CG     . LEU A  1 119 ? 12.283  -56.569 31.099  1.00 132.84 ? 118 LEU A CG     1 
ATOM   1622  C  CD1    . LEU A  1 119 ? 13.788  -56.576 31.315  1.00 129.79 ? 118 LEU A CD1    1 
ATOM   1623  C  CD2    . LEU A  1 119 ? 11.776  -57.970 30.789  1.00 133.91 ? 118 LEU A CD2    1 
ATOM   1624  H  H      . LEU A  1 119 ? 9.837   -54.786 30.912  1.00 181.93 ? 118 LEU A H      1 
ATOM   1625  H  HA     . LEU A  1 119 ? 9.846   -57.092 32.334  1.00 173.76 ? 118 LEU A HA     1 
ATOM   1626  H  HB2    . LEU A  1 119 ? 11.787  -55.036 32.351  1.00 164.38 ? 118 LEU A HB2    1 
ATOM   1627  H  HB3    . LEU A  1 119 ? 11.935  -56.421 33.105  1.00 164.38 ? 118 LEU A HB3    1 
ATOM   1628  H  HG     . LEU A  1 119 ? 12.097  -56.009 30.329  1.00 159.41 ? 118 LEU A HG     1 
ATOM   1629  H  HD11   . LEU A  1 119 ? 14.213  -56.948 30.539  1.00 155.75 ? 118 LEU A HD11   1 
ATOM   1630  H  HD12   . LEU A  1 119 ? 14.088  -55.674 31.453  1.00 155.75 ? 118 LEU A HD12   1 
ATOM   1631  H  HD13   . LEU A  1 119 ? 13.990  -57.110 32.087  1.00 155.75 ? 118 LEU A HD13   1 
ATOM   1632  H  HD21   . LEU A  1 119 ? 12.241  -58.308 30.020  1.00 160.70 ? 118 LEU A HD21   1 
ATOM   1633  H  HD22   . LEU A  1 119 ? 11.941  -58.537 31.546  1.00 160.70 ? 118 LEU A HD22   1 
ATOM   1634  H  HD23   . LEU A  1 119 ? 10.834  -57.928 30.609  1.00 160.70 ? 118 LEU A HD23   1 
ATOM   1635  N  N      . ILE A  1 120 ? 9.272   -56.408 34.602  1.00 157.10 ? 119 ILE A N      1 
ATOM   1636  C  CA     . ILE A  1 120 ? 8.784   -56.000 35.911  1.00 161.52 ? 119 ILE A CA     1 
ATOM   1637  C  C      . ILE A  1 120 ? 9.947   -55.467 36.741  1.00 159.90 ? 119 ILE A C      1 
ATOM   1638  O  O      . ILE A  1 120 ? 11.099  -55.829 36.509  1.00 149.27 ? 119 ILE A O      1 
ATOM   1639  C  CB     . ILE A  1 120 ? 8.125   -57.186 36.637  1.00 177.22 ? 119 ILE A CB     1 
ATOM   1640  C  CG1    . ILE A  1 120 ? 6.972   -57.736 35.794  1.00 173.45 ? 119 ILE A CG1    1 
ATOM   1641  C  CG2    . ILE A  1 120 ? 7.621   -56.765 38.010  1.00 184.80 ? 119 ILE A CG2    1 
ATOM   1642  C  CD1    . ILE A  1 120 ? 6.470   -59.087 36.245  1.00 171.98 ? 119 ILE A CD1    1 
ATOM   1643  H  H      . ILE A  1 120 ? 9.400   -57.255 34.531  1.00 188.53 ? 119 ILE A H      1 
ATOM   1644  H  HA     . ILE A  1 120 ? 8.120   -55.287 35.808  1.00 193.82 ? 119 ILE A HA     1 
ATOM   1645  H  HB     . ILE A  1 120 ? 8.786   -57.886 36.751  1.00 212.66 ? 119 ILE A HB     1 
ATOM   1646  H  HG12   . ILE A  1 120 ? 6.229   -57.114 35.839  1.00 208.14 ? 119 ILE A HG12   1 
ATOM   1647  H  HG13   . ILE A  1 120 ? 7.272   -57.823 34.876  1.00 208.14 ? 119 ILE A HG13   1 
ATOM   1648  H  HG21   . ILE A  1 120 ? 7.215   -57.522 38.439  1.00 221.76 ? 119 ILE A HG21   1 
ATOM   1649  H  HG22   . ILE A  1 120 ? 8.363   -56.452 38.532  1.00 221.76 ? 119 ILE A HG22   1 
ATOM   1650  H  HG23   . ILE A  1 120 ? 6.975   -56.064 37.904  1.00 221.76 ? 119 ILE A HG23   1 
ATOM   1651  H  HD11   . ILE A  1 120 ? 5.752   -59.361 35.669  1.00 206.38 ? 119 ILE A HD11   1 
ATOM   1652  H  HD12   . ILE A  1 120 ? 7.190   -59.720 36.195  1.00 206.38 ? 119 ILE A HD12   1 
ATOM   1653  H  HD13   . ILE A  1 120 ? 6.156   -59.017 37.149  1.00 206.38 ? 119 ILE A HD13   1 
ATOM   1654  N  N      . GLU A  1 121 ? 9.640   -54.602 37.702  1.00 168.21 ? 120 GLU A N      1 
ATOM   1655  C  CA     . GLU A  1 121 ? 10.667  -53.980 38.533  1.00 173.01 ? 120 GLU A CA     1 
ATOM   1656  C  C      . GLU A  1 121 ? 11.714  -54.982 39.011  1.00 178.72 ? 120 GLU A C      1 
ATOM   1657  O  O      . GLU A  1 121 ? 12.888  -54.872 38.659  1.00 174.23 ? 120 GLU A O      1 
ATOM   1658  C  CB     . GLU A  1 121 ? 10.031  -53.290 39.739  1.00 112.66 ? 120 GLU A CB     1 
ATOM   1659  C  CG     . GLU A  1 121 ? 9.125   -52.128 39.379  1.00 111.93 ? 120 GLU A CG     1 
ATOM   1660  C  CD     . GLU A  1 121 ? 8.859   -51.208 40.555  1.00 137.49 ? 120 GLU A CD     1 
ATOM   1661  O  OE1    . GLU A  1 121 ? 7.792   -50.560 40.569  1.00 151.03 ? 120 GLU A OE1    1 
ATOM   1662  O  OE2    . GLU A  1 121 ? 9.719   -51.125 41.458  1.00 118.07 ? 120 GLU A OE2    1 
ATOM   1663  H  H      . GLU A  1 121 ? 8.839   -54.357 37.895  1.00 201.85 ? 120 GLU A H      1 
ATOM   1664  H  HA     . GLU A  1 121 ? 11.127  -53.295 38.004  1.00 207.61 ? 120 GLU A HA     1 
ATOM   1665  H  HB2    . GLU A  1 121 ? 9.500   -53.939 40.225  1.00 135.19 ? 120 GLU A HB2    1 
ATOM   1666  H  HB3    . GLU A  1 121 ? 10.737  -52.949 40.310  1.00 135.19 ? 120 GLU A HB3    1 
ATOM   1667  H  HG2    . GLU A  1 121 ? 9.544   -51.605 38.678  1.00 134.31 ? 120 GLU A HG2    1 
ATOM   1668  H  HG3    . GLU A  1 121 ? 8.273   -52.475 39.071  1.00 134.31 ? 120 GLU A HG3    1 
ATOM   1669  N  N      . ASP A  1 122 ? 11.289  -55.952 39.814  1.00 180.42 ? 121 ASP A N      1 
ATOM   1670  C  CA     . ASP A  1 122 ? 12.204  -56.951 40.357  1.00 169.93 ? 121 ASP A CA     1 
ATOM   1671  C  C      . ASP A  1 122 ? 13.171  -57.433 39.284  1.00 155.89 ? 121 ASP A C      1 
ATOM   1672  O  O      . ASP A  1 122 ? 14.374  -57.544 39.523  1.00 155.17 ? 121 ASP A O      1 
ATOM   1673  C  CB     . ASP A  1 122 ? 11.424  -58.132 40.933  1.00 181.18 ? 121 ASP A CB     1 
ATOM   1674  C  CG     . ASP A  1 122 ? 10.565  -57.738 42.117  1.00 193.25 ? 121 ASP A CG     1 
ATOM   1675  O  OD1    . ASP A  1 122 ? 9.447   -58.277 42.250  1.00 196.10 ? 121 ASP A OD1    1 
ATOM   1676  O  OD2    . ASP A  1 122 ? 11.009  -56.885 42.914  1.00 199.30 ? 121 ASP A OD2    1 
ATOM   1677  H  H      . ASP A  1 122 ? 10.472  -56.055 40.061  1.00 216.51 ? 121 ASP A H      1 
ATOM   1678  H  HA     . ASP A  1 122 ? 12.727  -56.548 41.081  1.00 203.91 ? 121 ASP A HA     1 
ATOM   1679  H  HB2    . ASP A  1 122 ? 10.842  -58.493 40.246  1.00 217.42 ? 121 ASP A HB2    1 
ATOM   1680  H  HB3    . ASP A  1 122 ? 12.050  -58.811 41.229  1.00 217.42 ? 121 ASP A HB3    1 
ATOM   1681  N  N      . GLU A  1 123 ? 12.639  -57.707 38.098  1.00 139.20 ? 122 GLU A N      1 
ATOM   1682  C  CA     . GLU A  1 123 ? 13.463  -58.131 36.976  1.00 142.23 ? 122 GLU A CA     1 
ATOM   1683  C  C      . GLU A  1 123 ? 14.446  -57.022 36.618  1.00 147.15 ? 122 GLU A C      1 
ATOM   1684  O  O      . GLU A  1 123 ? 15.629  -57.273 36.396  1.00 156.47 ? 122 GLU A O      1 
ATOM   1685  C  CB     . GLU A  1 123 ? 12.592  -58.467 35.765  1.00 146.98 ? 122 GLU A CB     1 
ATOM   1686  C  CG     . GLU A  1 123 ? 11.505  -59.493 36.041  1.00 150.52 ? 122 GLU A CG     1 
ATOM   1687  C  CD     . GLU A  1 123 ? 10.617  -59.729 34.837  1.00 167.83 ? 122 GLU A CD     1 
ATOM   1688  O  OE1    . GLU A  1 123 ? 10.849  -59.084 33.792  1.00 175.98 ? 122 GLU A OE1    1 
ATOM   1689  O  OE2    . GLU A  1 123 ? 9.685   -60.555 34.934  1.00 177.44 ? 122 GLU A OE2    1 
ATOM   1690  H  H      . GLU A  1 123 ? 11.800  -57.653 37.917  1.00 167.04 ? 122 GLU A H      1 
ATOM   1691  H  HA     . GLU A  1 123 ? 13.972  -58.931 37.226  1.00 170.68 ? 122 GLU A HA     1 
ATOM   1692  H  HB2    . GLU A  1 123 ? 12.159  -57.655 35.459  1.00 176.37 ? 122 GLU A HB2    1 
ATOM   1693  H  HB3    . GLU A  1 123 ? 13.159  -58.821 35.063  1.00 176.37 ? 122 GLU A HB3    1 
ATOM   1694  H  HG2    . GLU A  1 123 ? 11.918  -60.337 36.280  1.00 180.62 ? 122 GLU A HG2    1 
ATOM   1695  H  HG3    . GLU A  1 123 ? 10.947  -59.176 36.769  1.00 180.62 ? 122 GLU A HG3    1 
ATOM   1696  N  N      . ILE A  1 124 ? 13.943  -55.792 36.573  1.00 136.56 ? 123 ILE A N      1 
ATOM   1697  C  CA     . ILE A  1 124 ? 14.760  -54.633 36.237  1.00 132.98 ? 123 ILE A CA     1 
ATOM   1698  C  C      . ILE A  1 124 ? 15.867  -54.408 37.262  1.00 129.14 ? 123 ILE A C      1 
ATOM   1699  O  O      . ILE A  1 124 ? 17.024  -54.199 36.900  1.00 128.66 ? 123 ILE A O      1 
ATOM   1700  C  CB     . ILE A  1 124 ? 13.897  -53.360 36.136  1.00 136.03 ? 123 ILE A CB     1 
ATOM   1701  C  CG1    . ILE A  1 124 ? 13.028  -53.414 34.878  1.00 147.79 ? 123 ILE A CG1    1 
ATOM   1702  C  CG2    . ILE A  1 124 ? 14.774  -52.117 36.119  1.00 127.65 ? 123 ILE A CG2    1 
ATOM   1703  C  CD1    . ILE A  1 124 ? 11.994  -52.315 34.800  1.00 148.20 ? 123 ILE A CD1    1 
ATOM   1704  H  H      . ILE A  1 124 ? 13.120  -55.602 36.735  1.00 163.88 ? 123 ILE A H      1 
ATOM   1705  H  HA     . ILE A  1 124 ? 15.182  -54.783 35.365  1.00 159.57 ? 123 ILE A HA     1 
ATOM   1706  H  HB     . ILE A  1 124 ? 13.316  -53.318 36.912  1.00 163.23 ? 123 ILE A HB     1 
ATOM   1707  H  HG12   . ILE A  1 124 ? 13.602  -53.337 34.099  1.00 177.34 ? 123 ILE A HG12   1 
ATOM   1708  H  HG13   . ILE A  1 124 ? 12.560  -54.263 34.858  1.00 177.34 ? 123 ILE A HG13   1 
ATOM   1709  H  HG21   . ILE A  1 124 ? 14.213  -51.341 36.056  1.00 153.18 ? 123 ILE A HG21   1 
ATOM   1710  H  HG22   . ILE A  1 124 ? 15.287  -52.086 36.930  1.00 153.18 ? 123 ILE A HG22   1 
ATOM   1711  H  HG23   . ILE A  1 124 ? 15.361  -52.160 35.361  1.00 153.18 ? 123 ILE A HG23   1 
ATOM   1712  H  HD11   . ILE A  1 124 ? 11.492  -52.415 33.988  1.00 177.84 ? 123 ILE A HD11   1 
ATOM   1713  H  HD12   . ILE A  1 124 ? 11.408  -52.383 35.558  1.00 177.84 ? 123 ILE A HD12   1 
ATOM   1714  H  HD13   . ILE A  1 124 ? 12.440  -51.465 34.806  1.00 177.84 ? 123 ILE A HD13   1 
ATOM   1715  N  N      . ALA A  1 125 ? 15.510  -54.452 38.541  1.00 129.05 ? 124 ALA A N      1 
ATOM   1716  C  CA     . ALA A  1 125 ? 16.470  -54.206 39.609  1.00 138.83 ? 124 ALA A CA     1 
ATOM   1717  C  C      . ALA A  1 125 ? 17.662  -55.148 39.492  1.00 142.31 ? 124 ALA A C      1 
ATOM   1718  O  O      . ALA A  1 125 ? 18.812  -54.709 39.461  1.00 145.96 ? 124 ALA A O      1 
ATOM   1719  C  CB     . ALA A  1 125 ? 15.801  -54.361 40.964  1.00 142.41 ? 124 ALA A CB     1 
ATOM   1720  H  H      . ALA A  1 125 ? 14.713  -54.623 38.817  1.00 154.86 ? 124 ALA A H      1 
ATOM   1721  H  HA     . ALA A  1 125 ? 16.800  -53.286 39.537  1.00 166.60 ? 124 ALA A HA     1 
ATOM   1722  H  HB1    . ALA A  1 125 ? 16.450  -54.196 41.652  1.00 170.90 ? 124 ALA A HB1    1 
ATOM   1723  H  HB2    . ALA A  1 125 ? 15.082  -53.729 41.031  1.00 170.90 ? 124 ALA A HB2    1 
ATOM   1724  H  HB3    . ALA A  1 125 ? 15.461  -55.256 41.043  1.00 170.90 ? 124 ALA A HB3    1 
ATOM   1725  N  N      . THR A  1 126 ? 17.383  -56.445 39.424  1.00 135.56 ? 125 THR A N      1 
ATOM   1726  C  CA     . THR A  1 126 ? 18.435  -57.447 39.315  1.00 145.89 ? 125 THR A CA     1 
ATOM   1727  C  C      . THR A  1 126 ? 19.363  -57.146 38.144  1.00 145.33 ? 125 THR A C      1 
ATOM   1728  O  O      . THR A  1 126 ? 20.584  -57.105 38.301  1.00 147.17 ? 125 THR A O      1 
ATOM   1729  C  CB     . THR A  1 126 ? 17.846  -58.851 39.126  1.00 154.30 ? 125 THR A CB     1 
ATOM   1730  O  OG1    . THR A  1 126 ? 17.134  -59.236 40.309  1.00 161.65 ? 125 THR A OG1    1 
ATOM   1731  C  CG2    . THR A  1 126 ? 18.948  -59.859 38.854  1.00 152.68 ? 125 THR A CG2    1 
ATOM   1732  H  H      . THR A  1 126 ? 16.588  -56.772 39.439  1.00 162.67 ? 125 THR A H      1 
ATOM   1733  H  HA     . THR A  1 126 ? 18.969  -57.446 40.137  1.00 175.07 ? 125 THR A HA     1 
ATOM   1734  H  HB     . THR A  1 126 ? 17.238  -58.848 38.370  1.00 185.16 ? 125 THR A HB     1 
ATOM   1735  H  HG1    . THR A  1 126 ? 17.643  -59.241 40.952  1.00 193.99 ? 125 THR A HG1    1 
ATOM   1736  H  HG21   . THR A  1 126 ? 18.570  -60.734 38.737  1.00 183.21 ? 125 THR A HG21   1 
ATOM   1737  H  HG22   . THR A  1 126 ? 19.425  -59.616 38.057  1.00 183.21 ? 125 THR A HG22   1 
ATOM   1738  H  HG23   . THR A  1 126 ? 19.562  -59.880 39.591  1.00 183.21 ? 125 THR A HG23   1 
ATOM   1739  N  N      . ILE A  1 127 ? 18.776  -56.940 36.969  1.00 139.67 ? 126 ILE A N      1 
ATOM   1740  C  CA     . ILE A  1 127 ? 19.548  -56.650 35.768  1.00 131.91 ? 126 ILE A CA     1 
ATOM   1741  C  C      . ILE A  1 127 ? 20.391  -55.396 35.977  1.00 129.53 ? 126 ILE A C      1 
ATOM   1742  O  O      . ILE A  1 127 ? 21.563  -55.356 35.602  1.00 129.35 ? 126 ILE A O      1 
ATOM   1743  C  CB     . ILE A  1 127 ? 18.632  -56.451 34.545  1.00 128.48 ? 126 ILE A CB     1 
ATOM   1744  C  CG1    . ILE A  1 127 ? 17.848  -57.732 34.250  1.00 129.97 ? 126 ILE A CG1    1 
ATOM   1745  C  CG2    . ILE A  1 127 ? 19.451  -56.059 33.323  1.00 125.74 ? 126 ILE A CG2    1 
ATOM   1746  C  CD1    . ILE A  1 127 ? 16.669  -57.529 33.320  1.00 132.09 ? 126 ILE A CD1    1 
ATOM   1747  H  H      . ILE A  1 127 ? 17.926  -56.962 36.842  1.00 167.61 ? 126 ILE A H      1 
ATOM   1748  H  HA     . ILE A  1 127 ? 20.152  -57.400 35.582  1.00 158.29 ? 126 ILE A HA     1 
ATOM   1749  H  HB     . ILE A  1 127 ? 18.003  -55.739 34.739  1.00 154.18 ? 126 ILE A HB     1 
ATOM   1750  H  HG12   . ILE A  1 127 ? 18.444  -58.376 33.836  1.00 155.97 ? 126 ILE A HG12   1 
ATOM   1751  H  HG13   . ILE A  1 127 ? 17.507  -58.089 35.085  1.00 155.97 ? 126 ILE A HG13   1 
ATOM   1752  H  HG21   . ILE A  1 127 ? 18.861  -55.941 32.576  1.00 150.89 ? 126 ILE A HG21   1 
ATOM   1753  H  HG22   . ILE A  1 127 ? 19.914  -55.239 33.508  1.00 150.89 ? 126 ILE A HG22   1 
ATOM   1754  H  HG23   . ILE A  1 127 ? 20.084  -56.756 33.135  1.00 150.89 ? 126 ILE A HG23   1 
ATOM   1755  H  HD11   . ILE A  1 127 ? 16.230  -58.372 33.184  1.00 158.51 ? 126 ILE A HD11   1 
ATOM   1756  H  HD12   . ILE A  1 127 ? 16.061  -56.903 33.719  1.00 158.51 ? 126 ILE A HD12   1 
ATOM   1757  H  HD13   . ILE A  1 127 ? 16.989  -57.187 32.482  1.00 158.51 ? 126 ILE A HD13   1 
ATOM   1758  N  N      . LEU A  1 128 ? 19.787  -54.380 36.585  1.00 125.02 ? 127 LEU A N      1 
ATOM   1759  C  CA     . LEU A  1 128 ? 20.475  -53.121 36.847  1.00 126.09 ? 127 LEU A CA     1 
ATOM   1760  C  C      . LEU A  1 128 ? 21.595  -53.297 37.866  1.00 136.38 ? 127 LEU A C      1 
ATOM   1761  O  O      . LEU A  1 128 ? 22.608  -52.602 37.807  1.00 137.74 ? 127 LEU A O      1 
ATOM   1762  C  CB     . LEU A  1 128 ? 19.488  -52.068 37.354  1.00 139.82 ? 127 LEU A CB     1 
ATOM   1763  C  CG     . LEU A  1 128 ? 18.510  -51.484 36.333  1.00 149.11 ? 127 LEU A CG     1 
ATOM   1764  C  CD1    . LEU A  1 128 ? 17.509  -50.583 37.036  1.00 156.08 ? 127 LEU A CD1    1 
ATOM   1765  C  CD2    . LEU A  1 128 ? 19.246  -50.720 35.244  1.00 137.10 ? 127 LEU A CD2    1 
ATOM   1766  H  H      . LEU A  1 128 ? 18.972  -54.395 36.858  1.00 150.02 ? 127 LEU A H      1 
ATOM   1767  H  HA     . LEU A  1 128 ? 20.871  -52.792 36.013  1.00 151.31 ? 127 LEU A HA     1 
ATOM   1768  H  HB2    . LEU A  1 128 ? 18.958  -52.467 38.061  1.00 167.79 ? 127 LEU A HB2    1 
ATOM   1769  H  HB3    . LEU A  1 128 ? 19.998  -51.327 37.717  1.00 167.79 ? 127 LEU A HB3    1 
ATOM   1770  H  HG     . LEU A  1 128 ? 18.020  -52.208 35.913  1.00 178.94 ? 127 LEU A HG     1 
ATOM   1771  H  HD11   . LEU A  1 128 ? 16.901  -50.224 36.385  1.00 187.29 ? 127 LEU A HD11   1 
ATOM   1772  H  HD12   . LEU A  1 128 ? 17.025  -51.100 37.685  1.00 187.29 ? 127 LEU A HD12   1 
ATOM   1773  H  HD13   . LEU A  1 128 ? 17.982  -49.870 37.472  1.00 187.29 ? 127 LEU A HD13   1 
ATOM   1774  H  HD21   . LEU A  1 128 ? 18.605  -50.368 34.622  1.00 164.52 ? 127 LEU A HD21   1 
ATOM   1775  H  HD22   . LEU A  1 128 ? 19.741  -50.002 35.646  1.00 164.52 ? 127 LEU A HD22   1 
ATOM   1776  H  HD23   . LEU A  1 128 ? 19.846  -51.319 34.793  1.00 164.52 ? 127 LEU A HD23   1 
ATOM   1777  N  N      . LYS A  1 129 ? 21.411  -54.225 38.801  1.00 145.25 ? 128 LYS A N      1 
ATOM   1778  C  CA     . LYS A  1 129 ? 22.395  -54.446 39.855  1.00 146.51 ? 128 LYS A CA     1 
ATOM   1779  C  C      . LYS A  1 129 ? 23.725  -54.904 39.266  1.00 149.76 ? 128 LYS A C      1 
ATOM   1780  O  O      . LYS A  1 129 ? 24.789  -54.501 39.731  1.00 152.62 ? 128 LYS A O      1 
ATOM   1781  C  CB     . LYS A  1 129 ? 21.882  -55.475 40.867  1.00 141.44 ? 128 LYS A CB     1 
ATOM   1782  C  CG     . LYS A  1 129 ? 22.780  -55.638 42.088  1.00 139.95 ? 128 LYS A CG     1 
ATOM   1783  C  CD     . LYS A  1 129 ? 22.099  -56.429 43.198  1.00 156.22 ? 128 LYS A CD     1 
ATOM   1784  C  CE     . LYS A  1 129 ? 21.757  -57.846 42.757  1.00 181.85 ? 128 LYS A CE     1 
ATOM   1785  N  NZ     . LYS A  1 129 ? 21.227  -58.674 43.879  1.00 179.55 ? 128 LYS A NZ     1 
ATOM   1786  H  H      . LYS A  1 129 ? 20.724  -54.740 38.846  1.00 174.30 ? 128 LYS A H      1 
ATOM   1787  H  HA     . LYS A  1 129 ? 22.548  -53.603 40.331  1.00 175.81 ? 128 LYS A HA     1 
ATOM   1788  H  HB2    . LYS A  1 129 ? 21.006  -55.198 41.178  1.00 169.73 ? 128 LYS A HB2    1 
ATOM   1789  H  HB3    . LYS A  1 129 ? 21.817  -56.338 40.430  1.00 169.73 ? 128 LYS A HB3    1 
ATOM   1790  H  HG2    . LYS A  1 129 ? 23.585  -56.112 41.829  1.00 167.94 ? 128 LYS A HG2    1 
ATOM   1791  H  HG3    . LYS A  1 129 ? 23.005  -54.761 42.436  1.00 167.94 ? 128 LYS A HG3    1 
ATOM   1792  H  HD2    . LYS A  1 129 ? 22.695  -56.484 43.961  1.00 187.46 ? 128 LYS A HD2    1 
ATOM   1793  H  HD3    . LYS A  1 129 ? 21.275  -55.982 43.448  1.00 187.46 ? 128 LYS A HD3    1 
ATOM   1794  H  HE2    . LYS A  1 129 ? 21.079  -57.809 42.064  1.00 218.22 ? 128 LYS A HE2    1 
ATOM   1795  H  HE3    . LYS A  1 129 ? 22.558  -58.275 42.418  1.00 218.22 ? 128 LYS A HE3    1 
ATOM   1796  H  HZ1    . LYS A  1 129 ? 21.038  -59.494 43.589  1.00 215.46 ? 128 LYS A HZ1    1 
ATOM   1797  H  HZ2    . LYS A  1 129 ? 21.833  -58.730 44.529  1.00 215.46 ? 128 LYS A HZ2    1 
ATOM   1798  H  HZ3    . LYS A  1 129 ? 20.486  -58.304 44.206  1.00 215.46 ? 128 LYS A HZ3    1 
ATOM   1799  N  N      . SER A  1 130 ? 23.658  -55.741 38.236  1.00 144.77 ? 129 SER A N      1 
ATOM   1800  C  CA     . SER A  1 130 ? 24.859  -56.241 37.580  1.00 147.61 ? 129 SER A CA     1 
ATOM   1801  C  C      . SER A  1 130 ? 25.352  -55.260 36.521  1.00 144.88 ? 129 SER A C      1 
ATOM   1802  O  O      . SER A  1 130 ? 26.554  -55.141 36.282  1.00 147.53 ? 129 SER A O      1 
ATOM   1803  C  CB     . SER A  1 130 ? 24.584  -57.606 36.952  1.00 161.10 ? 129 SER A CB     1 
ATOM   1804  O  OG     . SER A  1 130 ? 24.220  -58.549 37.945  1.00 170.25 ? 129 SER A OG     1 
ATOM   1805  H  H      . SER A  1 130 ? 22.925  -56.036 37.897  1.00 173.73 ? 129 SER A H      1 
ATOM   1806  H  HA     . SER A  1 130 ? 25.568  -56.350 38.248  1.00 177.13 ? 129 SER A HA     1 
ATOM   1807  H  HB2    . SER A  1 130 ? 23.857  -57.521 36.315  1.00 193.32 ? 129 SER A HB2    1 
ATOM   1808  H  HB3    . SER A  1 130 ? 25.386  -57.915 36.501  1.00 193.32 ? 129 SER A HB3    1 
ATOM   1809  H  HG     . SER A  1 130 ? 24.074  -59.278 37.600  1.00 204.30 ? 129 SER A HG     1 
ATOM   1810  N  N      . THR A  1 131 ? 24.419  -54.558 35.887  1.00 142.99 ? 130 THR A N      1 
ATOM   1811  C  CA     . THR A  1 131 ? 24.769  -53.542 34.904  1.00 140.98 ? 130 THR A CA     1 
ATOM   1812  C  C      . THR A  1 131 ? 25.546  -52.424 35.589  1.00 131.50 ? 130 THR A C      1 
ATOM   1813  O  O      . THR A  1 131 ? 26.520  -51.905 35.047  1.00 122.85 ? 130 THR A O      1 
ATOM   1814  C  CB     . THR A  1 131 ? 23.516  -52.957 34.232  1.00 136.17 ? 130 THR A CB     1 
ATOM   1815  O  OG1    . THR A  1 131 ? 22.838  -53.984 33.499  1.00 142.71 ? 130 THR A OG1    1 
ATOM   1816  C  CG2    . THR A  1 131 ? 23.891  -51.836 33.280  1.00 116.34 ? 130 THR A CG2    1 
ATOM   1817  H  H      . THR A  1 131 ? 23.573  -54.652 36.009  1.00 171.59 ? 130 THR A H      1 
ATOM   1818  H  HA     . THR A  1 131 ? 25.339  -53.939 34.212  1.00 169.18 ? 130 THR A HA     1 
ATOM   1819  H  HB     . THR A  1 131 ? 22.923  -52.598 34.911  1.00 163.41 ? 130 THR A HB     1 
ATOM   1820  H  HG1    . THR A  1 131 ? 22.613  -54.589 34.005  1.00 171.25 ? 130 THR A HG1    1 
ATOM   1821  H  HG21   . THR A  1 131 ? 23.101  -51.479 32.867  1.00 139.61 ? 130 THR A HG21   1 
ATOM   1822  H  HG22   . THR A  1 131 ? 24.337  -51.134 33.759  1.00 139.61 ? 130 THR A HG22   1 
ATOM   1823  H  HG23   . THR A  1 131 ? 24.477  -52.169 32.596  1.00 139.61 ? 130 THR A HG23   1 
ATOM   1824  N  N      . LEU A  1 132 ? 25.104  -52.061 36.789  1.00 135.88 ? 131 LEU A N      1 
ATOM   1825  C  CA     . LEU A  1 132 ? 25.793  -51.058 37.592  1.00 136.73 ? 131 LEU A CA     1 
ATOM   1826  C  C      . LEU A  1 132 ? 27.182  -51.553 37.986  1.00 136.23 ? 131 LEU A C      1 
ATOM   1827  O  O      . LEU A  1 132 ? 28.155  -50.802 37.922  1.00 129.12 ? 131 LEU A O      1 
ATOM   1828  C  CB     . LEU A  1 132 ? 24.975  -50.717 38.842  1.00 126.34 ? 131 LEU A CB     1 
ATOM   1829  C  CG     . LEU A  1 132 ? 23.928  -49.614 38.666  1.00 124.06 ? 131 LEU A CG     1 
ATOM   1830  C  CD1    . LEU A  1 132 ? 22.833  -49.717 39.717  1.00 116.19 ? 131 LEU A CD1    1 
ATOM   1831  C  CD2    . LEU A  1 132 ? 24.592  -48.246 38.728  1.00 123.27 ? 131 LEU A CD2    1 
ATOM   1832  H  H      . LEU A  1 132 ? 24.401  -52.385 37.164  1.00 163.05 ? 131 LEU A H      1 
ATOM   1833  H  HA     . LEU A  1 132 ? 25.898  -50.240 37.063  1.00 164.07 ? 131 LEU A HA     1 
ATOM   1834  H  HB2    . LEU A  1 132 ? 24.508  -51.517 39.130  1.00 151.61 ? 131 LEU A HB2    1 
ATOM   1835  H  HB3    . LEU A  1 132 ? 25.585  -50.430 39.539  1.00 151.61 ? 131 LEU A HB3    1 
ATOM   1836  H  HG     . LEU A  1 132 ? 23.515  -49.707 37.793  1.00 148.87 ? 131 LEU A HG     1 
ATOM   1837  H  HD11   . LEU A  1 132 ? 22.197  -49.012 39.576  1.00 139.43 ? 131 LEU A HD11   1 
ATOM   1838  H  HD12   . LEU A  1 132 ? 22.400  -50.570 39.635  1.00 139.43 ? 131 LEU A HD12   1 
ATOM   1839  H  HD13   . LEU A  1 132 ? 23.228  -49.633 40.588  1.00 139.43 ? 131 LEU A HD13   1 
ATOM   1840  H  HD21   . LEU A  1 132 ? 23.921  -47.569 38.616  1.00 147.93 ? 131 LEU A HD21   1 
ATOM   1841  H  HD22   . LEU A  1 132 ? 25.020  -48.146 39.581  1.00 147.93 ? 131 LEU A HD22   1 
ATOM   1842  H  HD23   . LEU A  1 132 ? 25.242  -48.183 38.024  1.00 147.93 ? 131 LEU A HD23   1 
ATOM   1843  N  N      . LYS A  1 133 ? 27.268  -52.817 38.392  1.00 131.29 ? 132 LYS A N      1 
ATOM   1844  C  CA     . LYS A  1 133 ? 28.548  -53.423 38.743  1.00 122.17 ? 132 LYS A CA     1 
ATOM   1845  C  C      . LYS A  1 133 ? 29.532  -53.274 37.586  1.00 131.82 ? 132 LYS A C      1 
ATOM   1846  O  O      . LYS A  1 133 ? 30.712  -52.992 37.794  1.00 130.93 ? 132 LYS A O      1 
ATOM   1847  C  CB     . LYS A  1 133 ? 28.367  -54.904 39.080  1.00 124.10 ? 132 LYS A CB     1 
ATOM   1848  C  CG     . LYS A  1 133 ? 27.584  -55.169 40.356  1.00 136.12 ? 132 LYS A CG     1 
ATOM   1849  C  CD     . LYS A  1 133 ? 28.499  -55.304 41.565  1.00 144.20 ? 132 LYS A CD     1 
ATOM   1850  C  CE     . LYS A  1 133 ? 27.736  -55.764 42.801  1.00 143.36 ? 132 LYS A CE     1 
ATOM   1851  N  NZ     . LYS A  1 133 ? 27.145  -57.122 42.639  1.00 140.73 ? 132 LYS A NZ     1 
ATOM   1852  H  H      . LYS A  1 133 ? 26.596  -53.347 38.473  1.00 157.55 ? 132 LYS A H      1 
ATOM   1853  H  HA     . LYS A  1 133 ? 28.921  -52.968 39.527  1.00 146.60 ? 132 LYS A HA     1 
ATOM   1854  H  HB2    . LYS A  1 133 ? 27.894  -55.332 38.350  1.00 148.92 ? 132 LYS A HB2    1 
ATOM   1855  H  HB3    . LYS A  1 133 ? 29.243  -55.307 39.184  1.00 148.92 ? 132 LYS A HB3    1 
ATOM   1856  H  HG2    . LYS A  1 133 ? 26.977  -54.430 40.517  1.00 163.34 ? 132 LYS A HG2    1 
ATOM   1857  H  HG3    . LYS A  1 133 ? 27.087  -55.996 40.259  1.00 163.34 ? 132 LYS A HG3    1 
ATOM   1858  H  HD2    . LYS A  1 133 ? 29.188  -55.959 41.373  1.00 173.04 ? 132 LYS A HD2    1 
ATOM   1859  H  HD3    . LYS A  1 133 ? 28.900  -54.443 41.760  1.00 173.04 ? 132 LYS A HD3    1 
ATOM   1860  H  HE2    . LYS A  1 133 ? 28.344  -55.789 43.557  1.00 172.04 ? 132 LYS A HE2    1 
ATOM   1861  H  HE3    . LYS A  1 133 ? 27.014  -55.141 42.977  1.00 172.04 ? 132 LYS A HE3    1 
ATOM   1862  H  HZ1    . LYS A  1 133 ? 26.709  -57.355 43.379  1.00 168.88 ? 132 LYS A HZ1    1 
ATOM   1863  H  HZ2    . LYS A  1 133 ? 26.576  -57.126 41.955  1.00 168.88 ? 132 LYS A HZ2    1 
ATOM   1864  H  HZ3    . LYS A  1 133 ? 27.788  -57.717 42.483  1.00 168.88 ? 132 LYS A HZ3    1 
ATOM   1865  N  N      . GLY A  1 134 ? 29.034  -53.466 36.368  1.00 131.79 ? 133 GLY A N      1 
ATOM   1866  C  CA     . GLY A  1 134 ? 29.854  -53.342 35.178  1.00 132.17 ? 133 GLY A CA     1 
ATOM   1867  C  C      . GLY A  1 134 ? 30.303  -51.913 34.940  1.00 143.21 ? 133 GLY A C      1 
ATOM   1868  O  O      . GLY A  1 134 ? 31.464  -51.664 34.613  1.00 141.68 ? 133 GLY A O      1 
ATOM   1869  H  H      . GLY A  1 134 ? 28.215  -53.672 36.208  1.00 158.15 ? 133 GLY A H      1 
ATOM   1870  H  HA2    . GLY A  1 134 ? 30.642  -53.902 35.267  1.00 158.61 ? 133 GLY A HA2    1 
ATOM   1871  H  HA3    . GLY A  1 134 ? 29.350  -53.639 34.405  1.00 158.61 ? 133 GLY A HA3    1 
ATOM   1872  N  N      . LEU A  1 135 ? 29.380  -50.969 35.100  1.00 143.70 ? 134 LEU A N      1 
ATOM   1873  C  CA     . LEU A  1 135 ? 29.696  -49.555 34.928  1.00 134.30 ? 134 LEU A CA     1 
ATOM   1874  C  C      . LEU A  1 135 ? 30.738  -49.112 35.948  1.00 129.85 ? 134 LEU A C      1 
ATOM   1875  O  O      . LEU A  1 135 ? 31.696  -48.418 35.608  1.00 117.38 ? 134 LEU A O      1 
ATOM   1876  C  CB     . LEU A  1 135 ? 28.433  -48.702 35.062  1.00 125.03 ? 134 LEU A CB     1 
ATOM   1877  C  CG     . LEU A  1 135 ? 27.484  -48.736 33.863  1.00 112.45 ? 134 LEU A CG     1 
ATOM   1878  C  CD1    . LEU A  1 135 ? 26.138  -48.130 34.226  1.00 96.70  ? 134 LEU A CD1    1 
ATOM   1879  C  CD2    . LEU A  1 135 ? 28.098  -48.004 32.679  1.00 108.96 ? 134 LEU A CD2    1 
ATOM   1880  H  H      . LEU A  1 135 ? 28.560  -51.122 35.308  1.00 172.44 ? 134 LEU A H      1 
ATOM   1881  H  HA     . LEU A  1 135 ? 30.067  -49.415 34.032  1.00 161.16 ? 134 LEU A HA     1 
ATOM   1882  H  HB2    . LEU A  1 135 ? 27.935  -49.011 35.836  1.00 150.03 ? 134 LEU A HB2    1 
ATOM   1883  H  HB3    . LEU A  1 135 ? 28.699  -47.779 35.197  1.00 150.03 ? 134 LEU A HB3    1 
ATOM   1884  H  HG     . LEU A  1 135 ? 27.337  -49.658 33.602  1.00 134.94 ? 134 LEU A HG     1 
ATOM   1885  H  HD11   . LEU A  1 135 ? 25.564  -48.163 33.457  1.00 116.04 ? 134 LEU A HD11   1 
ATOM   1886  H  HD12   . LEU A  1 135 ? 25.753  -48.634 34.946  1.00 116.04 ? 134 LEU A HD12   1 
ATOM   1887  H  HD13   . LEU A  1 135 ? 26.269  -47.218 34.497  1.00 116.04 ? 134 LEU A HD13   1 
ATOM   1888  H  HD21   . LEU A  1 135 ? 27.487  -48.038 31.940  1.00 130.76 ? 134 LEU A HD21   1 
ATOM   1889  H  HD22   . LEU A  1 135 ? 28.262  -47.091 32.928  1.00 130.76 ? 134 LEU A HD22   1 
ATOM   1890  H  HD23   . LEU A  1 135 ? 28.924  -48.432 32.442  1.00 130.76 ? 134 LEU A HD23   1 
ATOM   1891  N  N      . GLU A  1 136 ? 30.546  -49.519 37.199  1.00 135.18 ? 135 GLU A N      1 
ATOM   1892  C  CA     . GLU A  1 136 ? 31.487  -49.194 38.262  1.00 136.97 ? 135 GLU A CA     1 
ATOM   1893  C  C      . GLU A  1 136 ? 32.871  -49.731 37.914  1.00 147.91 ? 135 GLU A C      1 
ATOM   1894  O  O      . GLU A  1 136 ? 33.869  -49.019 38.018  1.00 154.25 ? 135 GLU A O      1 
ATOM   1895  C  CB     . GLU A  1 136 ? 31.015  -49.788 39.589  1.00 137.09 ? 135 GLU A CB     1 
ATOM   1896  C  CG     . GLU A  1 136 ? 31.931  -49.486 40.765  1.00 142.36 ? 135 GLU A CG     1 
ATOM   1897  C  CD     . GLU A  1 136 ? 31.456  -50.129 42.052  1.00 158.01 ? 135 GLU A CD     1 
ATOM   1898  O  OE1    . GLU A  1 136 ? 31.432  -49.436 43.091  1.00 167.65 ? 135 GLU A OE1    1 
ATOM   1899  O  OE2    . GLU A  1 136 ? 31.111  -51.330 42.027  1.00 162.52 ? 135 GLU A OE2    1 
ATOM   1900  H  H      . GLU A  1 136 ? 29.873  -49.988 37.458  1.00 162.21 ? 135 GLU A H      1 
ATOM   1901  H  HA     . GLU A  1 136 ? 31.547  -48.221 38.361  1.00 164.37 ? 135 GLU A HA     1 
ATOM   1902  H  HB2    . GLU A  1 136 ? 30.139  -49.428 39.797  1.00 164.51 ? 135 GLU A HB2    1 
ATOM   1903  H  HB3    . GLU A  1 136 ? 30.960  -50.752 39.497  1.00 164.51 ? 135 GLU A HB3    1 
ATOM   1904  H  HG2    . GLU A  1 136 ? 32.819  -49.824 40.569  1.00 170.83 ? 135 GLU A HG2    1 
ATOM   1905  H  HG3    . GLU A  1 136 ? 31.963  -48.526 40.902  1.00 170.83 ? 135 GLU A HG3    1 
ATOM   1906  N  N      . TYR A  1 137 ? 32.919  -50.992 37.499  1.00 143.24 ? 136 TYR A N      1 
ATOM   1907  C  CA     . TYR A  1 137 ? 34.168  -51.622 37.096  1.00 141.71 ? 136 TYR A CA     1 
ATOM   1908  C  C      . TYR A  1 137 ? 34.852  -50.816 35.996  1.00 148.16 ? 136 TYR A C      1 
ATOM   1909  O  O      . TYR A  1 137 ? 36.047  -50.529 36.078  1.00 149.81 ? 136 TYR A O      1 
ATOM   1910  C  CB     . TYR A  1 137 ? 33.906  -53.050 36.614  1.00 149.74 ? 136 TYR A CB     1 
ATOM   1911  C  CG     . TYR A  1 137 ? 35.100  -53.706 35.960  1.00 154.83 ? 136 TYR A CG     1 
ATOM   1912  C  CD1    . TYR A  1 137 ? 36.041  -54.392 36.715  1.00 148.85 ? 136 TYR A CD1    1 
ATOM   1913  C  CD2    . TYR A  1 137 ? 35.285  -53.640 34.585  1.00 163.24 ? 136 TYR A CD2    1 
ATOM   1914  C  CE1    . TYR A  1 137 ? 37.133  -54.991 36.121  1.00 156.24 ? 136 TYR A CE1    1 
ATOM   1915  C  CE2    . TYR A  1 137 ? 36.373  -54.238 33.982  1.00 165.26 ? 136 TYR A CE2    1 
ATOM   1916  C  CZ     . TYR A  1 137 ? 37.293  -54.912 34.755  1.00 169.61 ? 136 TYR A CZ     1 
ATOM   1917  O  OH     . TYR A  1 137 ? 38.382  -55.511 34.165  1.00 177.54 ? 136 TYR A OH     1 
ATOM   1918  H  H      . TYR A  1 137 ? 32.233  -51.509 37.441  1.00 171.88 ? 136 TYR A H      1 
ATOM   1919  H  HA     . TYR A  1 137 ? 34.772  -51.665 37.866  1.00 170.06 ? 136 TYR A HA     1 
ATOM   1920  H  HB2    . TYR A  1 137 ? 33.649  -53.594 37.375  1.00 179.68 ? 136 TYR A HB2    1 
ATOM   1921  H  HB3    . TYR A  1 137 ? 33.185  -53.033 35.965  1.00 179.68 ? 136 TYR A HB3    1 
ATOM   1922  H  HD1    . TYR A  1 137 ? 35.935  -54.447 37.637  1.00 178.63 ? 136 TYR A HD1    1 
ATOM   1923  H  HD2    . TYR A  1 137 ? 34.665  -53.186 34.061  1.00 195.89 ? 136 TYR A HD2    1 
ATOM   1924  H  HE1    . TYR A  1 137 ? 37.755  -55.448 36.639  1.00 187.49 ? 136 TYR A HE1    1 
ATOM   1925  H  HE2    . TYR A  1 137 ? 36.485  -54.185 33.060  1.00 198.31 ? 136 TYR A HE2    1 
ATOM   1926  H  HH     . TYR A  1 137 ? 38.375  -56.317 34.316  1.00 213.05 ? 136 TYR A HH     1 
ATOM   1927  N  N      . LEU A  1 138 ? 34.089  -50.450 34.970  1.00 149.51 ? 137 LEU A N      1 
ATOM   1928  C  CA     . LEU A  1 138 ? 34.621  -49.683 33.849  1.00 152.45 ? 137 LEU A CA     1 
ATOM   1929  C  C      . LEU A  1 138 ? 35.118  -48.309 34.288  1.00 159.63 ? 137 LEU A C      1 
ATOM   1930  O  O      . LEU A  1 138 ? 36.269  -47.946 34.045  1.00 161.86 ? 137 LEU A O      1 
ATOM   1931  C  CB     . LEU A  1 138 ? 33.553  -49.512 32.765  1.00 150.81 ? 137 LEU A CB     1 
ATOM   1932  C  CG     . LEU A  1 138 ? 33.290  -50.713 31.856  1.00 148.47 ? 137 LEU A CG     1 
ATOM   1933  C  CD1    . LEU A  1 138 ? 32.158  -50.406 30.888  1.00 143.38 ? 137 LEU A CD1    1 
ATOM   1934  C  CD2    . LEU A  1 138 ? 34.548  -51.098 31.095  1.00 146.45 ? 137 LEU A CD2    1 
ATOM   1935  H  H      . LEU A  1 138 ? 33.252  -50.636 34.900  1.00 179.42 ? 137 LEU A H      1 
ATOM   1936  H  HA     . LEU A  1 138 ? 35.377  -50.169 33.458  1.00 182.94 ? 137 LEU A HA     1 
ATOM   1937  H  HB2    . LEU A  1 138 ? 32.714  -49.294 33.200  1.00 180.97 ? 137 LEU A HB2    1 
ATOM   1938  H  HB3    . LEU A  1 138 ? 33.818  -48.774 32.194  1.00 180.97 ? 137 LEU A HB3    1 
ATOM   1939  H  HG     . LEU A  1 138 ? 33.023  -51.471 32.400  1.00 178.17 ? 137 LEU A HG     1 
ATOM   1940  H  HD11   . LEU A  1 138 ? 32.009  -51.171 30.328  1.00 172.05 ? 137 LEU A HD11   1 
ATOM   1941  H  HD12   . LEU A  1 138 ? 31.363  -50.207 31.389  1.00 172.05 ? 137 LEU A HD12   1 
ATOM   1942  H  HD13   . LEU A  1 138 ? 32.404  -49.649 30.350  1.00 172.05 ? 137 LEU A HD13   1 
ATOM   1943  H  HD21   . LEU A  1 138 ? 34.354  -51.853 30.534  1.00 175.75 ? 137 LEU A HD21   1 
ATOM   1944  H  HD22   . LEU A  1 138 ? 34.828  -50.353 30.558  1.00 175.75 ? 137 LEU A HD22   1 
ATOM   1945  H  HD23   . LEU A  1 138 ? 35.236  -51.326 31.725  1.00 175.75 ? 137 LEU A HD23   1 
ATOM   1946  N  N      . HIS A  1 139 ? 34.240  -47.551 34.934  1.00 162.48 ? 138 HIS A N      1 
ATOM   1947  C  CA     . HIS A  1 139 ? 34.551  -46.184 35.333  1.00 159.85 ? 138 HIS A CA     1 
ATOM   1948  C  C      . HIS A  1 139 ? 35.746  -46.126 36.280  1.00 173.36 ? 138 HIS A C      1 
ATOM   1949  O  O      . HIS A  1 139 ? 36.538  -45.185 36.229  1.00 185.60 ? 138 HIS A O      1 
ATOM   1950  C  CB     . HIS A  1 139 ? 33.327  -45.534 35.983  1.00 151.73 ? 138 HIS A CB     1 
ATOM   1951  C  CG     . HIS A  1 139 ? 32.159  -45.391 35.056  1.00 144.83 ? 138 HIS A CG     1 
ATOM   1952  N  ND1    . HIS A  1 139 ? 30.886  -45.109 35.500  1.00 136.28 ? 138 HIS A ND1    1 
ATOM   1953  C  CD2    . HIS A  1 139 ? 32.075  -45.492 33.708  1.00 142.50 ? 138 HIS A CD2    1 
ATOM   1954  C  CE1    . HIS A  1 139 ? 30.066  -45.042 34.465  1.00 140.89 ? 138 HIS A CE1    1 
ATOM   1955  N  NE2    . HIS A  1 139 ? 30.763  -45.271 33.367  1.00 144.66 ? 138 HIS A NE2    1 
ATOM   1956  H  H      . HIS A  1 139 ? 33.450  -47.807 35.155  1.00 194.98 ? 138 HIS A H      1 
ATOM   1957  H  HA     . HIS A  1 139 ? 34.777  -45.665 34.533  1.00 191.81 ? 138 HIS A HA     1 
ATOM   1958  H  HB2    . HIS A  1 139 ? 33.045  -46.079 36.734  1.00 182.08 ? 138 HIS A HB2    1 
ATOM   1959  H  HB3    . HIS A  1 139 ? 33.571  -44.648 36.292  1.00 182.08 ? 138 HIS A HB3    1 
ATOM   1960  H  HD1    . HIS A  1 139 ? 30.659  -44.995 36.322  1.00 163.54 ? 138 HIS A HD1    1 
ATOM   1961  H  HD2    . HIS A  1 139 ? 32.775  -45.676 33.124  1.00 171.00 ? 138 HIS A HD2    1 
ATOM   1962  H  HE1    . HIS A  1 139 ? 29.154  -44.864 34.503  1.00 169.07 ? 138 HIS A HE1    1 
ATOM   1963  H  HE2    . HIS A  1 139 ? 30.446  -45.279 32.567  1.00 173.59 ? 138 HIS A HE2    1 
ATOM   1964  N  N      . PHE A  1 140 ? 35.878  -47.132 37.139  1.00 173.77 ? 139 PHE A N      1 
ATOM   1965  C  CA     . PHE A  1 140 ? 36.990  -47.182 38.083  1.00 180.36 ? 139 PHE A CA     1 
ATOM   1966  C  C      . PHE A  1 140 ? 38.320  -47.284 37.346  1.00 182.41 ? 139 PHE A C      1 
ATOM   1967  O  O      . PHE A  1 140 ? 39.344  -46.798 37.826  1.00 165.49 ? 139 PHE A O      1 
ATOM   1968  C  CB     . PHE A  1 140 ? 36.832  -48.363 39.042  1.00 191.82 ? 139 PHE A CB     1 
ATOM   1969  C  CG     . PHE A  1 140 ? 38.003  -48.552 39.965  1.00 192.05 ? 139 PHE A CG     1 
ATOM   1970  C  CD1    . PHE A  1 140 ? 38.887  -49.602 39.780  1.00 191.87 ? 139 PHE A CD1    1 
ATOM   1971  C  CD2    . PHE A  1 140 ? 38.223  -47.674 41.014  1.00 182.58 ? 139 PHE A CD2    1 
ATOM   1972  C  CE1    . PHE A  1 140 ? 39.965  -49.778 40.627  1.00 184.70 ? 139 PHE A CE1    1 
ATOM   1973  C  CE2    . PHE A  1 140 ? 39.300  -47.844 41.863  1.00 180.46 ? 139 PHE A CE2    1 
ATOM   1974  C  CZ     . PHE A  1 140 ? 40.172  -48.897 41.669  1.00 183.23 ? 139 PHE A CZ     1 
ATOM   1975  H  H      . PHE A  1 140 ? 35.337  -47.798 37.196  1.00 208.53 ? 139 PHE A H      1 
ATOM   1976  H  HA     . PHE A  1 140 ? 36.998  -46.358 38.613  1.00 216.43 ? 139 PHE A HA     1 
ATOM   1977  H  HB2    . PHE A  1 140 ? 36.044  -48.219 39.588  1.00 230.18 ? 139 PHE A HB2    1 
ATOM   1978  H  HB3    . PHE A  1 140 ? 36.729  -49.176 38.523  1.00 230.18 ? 139 PHE A HB3    1 
ATOM   1979  H  HD1    . PHE A  1 140 ? 38.751  -50.199 39.079  1.00 230.25 ? 139 PHE A HD1    1 
ATOM   1980  H  HD2    . PHE A  1 140 ? 37.639  -46.964 41.150  1.00 219.10 ? 139 PHE A HD2    1 
ATOM   1981  H  HE1    . PHE A  1 140 ? 40.551  -50.487 40.494  1.00 221.64 ? 139 PHE A HE1    1 
ATOM   1982  H  HE2    . PHE A  1 140 ? 39.438  -47.250 42.565  1.00 216.55 ? 139 PHE A HE2    1 
ATOM   1983  H  HZ     . PHE A  1 140 ? 40.897  -49.013 42.240  1.00 219.88 ? 139 PHE A HZ     1 
ATOM   1984  N  N      . MET A  1 141 ? 38.298  -47.917 36.178  1.00 207.96 ? 140 MET A N      1 
ATOM   1985  C  CA     . MET A  1 141 ? 39.486  -48.015 35.339  1.00 137.62 ? 140 MET A CA     1 
ATOM   1986  C  C      . MET A  1 141 ? 39.588  -46.802 34.417  1.00 138.32 ? 140 MET A C      1 
ATOM   1987  O  O      . MET A  1 141 ? 40.354  -46.808 33.454  1.00 149.64 ? 140 MET A O      1 
ATOM   1988  C  CB     . MET A  1 141 ? 39.445  -49.297 34.505  1.00 143.67 ? 140 MET A CB     1 
ATOM   1989  C  CG     . MET A  1 141 ? 39.404  -50.574 35.331  1.00 155.20 ? 140 MET A CG     1 
ATOM   1990  S  SD     . MET A  1 141 ? 39.401  -52.065 34.315  1.00 174.19 ? 140 MET A SD     1 
ATOM   1991  C  CE     . MET A  1 141 ? 41.026  -51.972 33.565  1.00 142.01 ? 140 MET A CE     1 
ATOM   1992  H  H      . MET A  1 141 ? 37.603  -48.300 35.847  1.00 249.55 ? 140 MET A H      1 
ATOM   1993  H  HA     . MET A  1 141 ? 40.280  -48.049 35.911  1.00 165.15 ? 140 MET A HA     1 
ATOM   1994  H  HB2    . MET A  1 141 ? 38.652  -49.281 33.947  1.00 172.40 ? 140 MET A HB2    1 
ATOM   1995  H  HB3    . MET A  1 141 ? 40.238  -49.331 33.948  1.00 172.40 ? 140 MET A HB3    1 
ATOM   1996  H  HG2    . MET A  1 141 ? 40.185  -50.604 35.905  1.00 186.24 ? 140 MET A HG2    1 
ATOM   1997  H  HG3    . MET A  1 141 ? 38.597  -50.577 35.869  1.00 186.24 ? 140 MET A HG3    1 
ATOM   1998  H  HE1    . MET A  1 141 ? 41.147  -52.730 32.988  1.00 170.41 ? 140 MET A HE1    1 
ATOM   1999  H  HE2    . MET A  1 141 ? 41.090  -51.160 33.058  1.00 170.41 ? 140 MET A HE2    1 
ATOM   2000  H  HE3    . MET A  1 141 ? 41.690  -51.979 34.258  1.00 170.41 ? 140 MET A HE3    1 
ATOM   2001  N  N      . ARG A  1 142 ? 38.813  -45.765 34.719  1.00 224.28 ? 141 ARG A N      1 
ATOM   2002  C  CA     . ARG A  1 142 ? 38.795  -44.548 33.913  1.00 217.48 ? 141 ARG A CA     1 
ATOM   2003  C  C      . ARG A  1 142 ? 38.464  -44.839 32.449  1.00 203.80 ? 141 ARG A C      1 
ATOM   2004  O  O      . ARG A  1 142 ? 38.957  -44.165 31.544  1.00 206.25 ? 141 ARG A O      1 
ATOM   2005  C  CB     . ARG A  1 142 ? 40.131  -43.808 34.028  1.00 226.45 ? 141 ARG A CB     1 
ATOM   2006  C  CG     . ARG A  1 142 ? 40.357  -43.175 35.393  1.00 236.10 ? 141 ARG A CG     1 
ATOM   2007  C  CD     . ARG A  1 142 ? 41.581  -42.272 35.415  1.00 244.16 ? 141 ARG A CD     1 
ATOM   2008  N  NE     . ARG A  1 142 ? 42.799  -42.990 35.784  1.00 253.47 ? 141 ARG A NE     1 
ATOM   2009  C  CZ     . ARG A  1 142 ? 43.616  -43.600 34.927  1.00 257.57 ? 141 ARG A CZ     1 
ATOM   2010  N  NH1    . ARG A  1 142 ? 44.695  -44.221 35.378  1.00 258.99 ? 141 ARG A NH1    1 
ATOM   2011  N  NH2    . ARG A  1 142 ? 43.364  -43.596 33.624  1.00 257.73 ? 141 ARG A NH2    1 
ATOM   2012  H  H      . ARG A  1 142 ? 38.281  -45.741 35.395  1.00 269.13 ? 141 ARG A H      1 
ATOM   2013  H  HA     . ARG A  1 142 ? 38.098  -43.954 34.261  1.00 260.98 ? 141 ARG A HA     1 
ATOM   2014  H  HB2    . ARG A  1 142 ? 40.853  -44.437 33.868  1.00 271.74 ? 141 ARG A HB2    1 
ATOM   2015  H  HB3    . ARG A  1 142 ? 40.157  -43.101 33.364  1.00 271.74 ? 141 ARG A HB3    1 
ATOM   2016  H  HG2    . ARG A  1 142 ? 39.582  -42.640 35.627  1.00 283.32 ? 141 ARG A HG2    1 
ATOM   2017  H  HG3    . ARG A  1 142 ? 40.488  -43.877 36.051  1.00 283.32 ? 141 ARG A HG3    1 
ATOM   2018  H  HD2    . ARG A  1 142 ? 41.711  -41.893 34.532  1.00 292.99 ? 141 ARG A HD2    1 
ATOM   2019  H  HD3    . ARG A  1 142 ? 41.441  -41.564 36.063  1.00 292.99 ? 141 ARG A HD3    1 
ATOM   2020  H  HE     . ARG A  1 142 ? 43.004  -43.022 36.619  1.00 304.16 ? 141 ARG A HE     1 
ATOM   2021  H  HH11   . ARG A  1 142 ? 44.866  -44.229 36.221  1.00 310.79 ? 141 ARG A HH11   1 
ATOM   2022  H  HH12   . ARG A  1 142 ? 45.225  -44.617 34.829  1.00 310.79 ? 141 ARG A HH12   1 
ATOM   2023  H  HH21   . ARG A  1 142 ? 42.666  -43.196 33.322  1.00 309.27 ? 141 ARG A HH21   1 
ATOM   2024  H  HH22   . ARG A  1 142 ? 43.900  -43.994 33.081  1.00 309.27 ? 141 ARG A HH22   1 
ATOM   2025  N  N      . LYS A  1 143 ? 37.625  -45.847 32.228  1.00 182.36 ? 142 LYS A N      1 
ATOM   2026  C  CA     . LYS A  1 143 ? 37.121  -46.151 30.894  1.00 155.47 ? 142 LYS A CA     1 
ATOM   2027  C  C      . LYS A  1 143 ? 35.678  -45.674 30.774  1.00 151.27 ? 142 LYS A C      1 
ATOM   2028  O  O      . LYS A  1 143 ? 35.029  -45.382 31.778  1.00 167.76 ? 142 LYS A O      1 
ATOM   2029  C  CB     . LYS A  1 143 ? 37.193  -47.653 30.617  1.00 146.48 ? 142 LYS A CB     1 
ATOM   2030  C  CG     . LYS A  1 143 ? 38.603  -48.222 30.606  1.00 147.87 ? 142 LYS A CG     1 
ATOM   2031  C  CD     . LYS A  1 143 ? 38.600  -49.715 30.299  1.00 154.83 ? 142 LYS A CD     1 
ATOM   2032  C  CE     . LYS A  1 143 ? 38.207  -49.995 28.854  1.00 153.43 ? 142 LYS A CE     1 
ATOM   2033  N  NZ     . LYS A  1 143 ? 38.020  -51.448 28.597  1.00 130.09 ? 142 LYS A NZ     1 
ATOM   2034  H  H      . LYS A  1 143 ? 37.331  -46.375 32.840  1.00 218.83 ? 142 LYS A H      1 
ATOM   2035  H  HA     . LYS A  1 143 ? 37.661  -45.684 30.223  1.00 186.57 ? 142 LYS A HA     1 
ATOM   2036  H  HB2    . LYS A  1 143 ? 36.692  -48.120 31.305  1.00 175.78 ? 142 LYS A HB2    1 
ATOM   2037  H  HB3    . LYS A  1 143 ? 36.798  -47.829 29.749  1.00 175.78 ? 142 LYS A HB3    1 
ATOM   2038  H  HG2    . LYS A  1 143 ? 39.125  -47.772 29.923  1.00 177.44 ? 142 LYS A HG2    1 
ATOM   2039  H  HG3    . LYS A  1 143 ? 39.008  -48.092 31.478  1.00 177.44 ? 142 LYS A HG3    1 
ATOM   2040  H  HD2    . LYS A  1 143 ? 39.490  -50.072 30.445  1.00 185.79 ? 142 LYS A HD2    1 
ATOM   2041  H  HD3    . LYS A  1 143 ? 37.961  -50.159 30.878  1.00 185.79 ? 142 LYS A HD3    1 
ATOM   2042  H  HE2    . LYS A  1 143 ? 37.370  -49.544 28.659  1.00 184.12 ? 142 LYS A HE2    1 
ATOM   2043  H  HE3    . LYS A  1 143 ? 38.906  -49.671 28.265  1.00 184.12 ? 142 LYS A HE3    1 
ATOM   2044  H  HZ1    . LYS A  1 143 ? 37.791  -51.579 27.747  1.00 156.10 ? 142 LYS A HZ1    1 
ATOM   2045  H  HZ2    . LYS A  1 143 ? 38.776  -51.886 28.764  1.00 156.10 ? 142 LYS A HZ2    1 
ATOM   2046  H  HZ3    . LYS A  1 143 ? 37.378  -51.770 29.122  1.00 156.10 ? 142 LYS A HZ3    1 
ATOM   2047  N  N      . ILE A  1 144 ? 35.179  -45.596 29.545  1.00 135.85 ? 143 ILE A N      1 
ATOM   2048  C  CA     . ILE A  1 144 ? 33.811  -45.154 29.298  1.00 118.49 ? 143 ILE A CA     1 
ATOM   2049  C  C      . ILE A  1 144 ? 33.140  -46.055 28.269  1.00 128.57 ? 143 ILE A C      1 
ATOM   2050  O  O      . ILE A  1 144 ? 33.732  -46.385 27.240  1.00 154.06 ? 143 ILE A O      1 
ATOM   2051  C  CB     . ILE A  1 144 ? 33.778  -43.705 28.783  1.00 118.14 ? 143 ILE A CB     1 
ATOM   2052  C  CG1    . ILE A  1 144 ? 34.555  -42.785 29.726  1.00 128.66 ? 143 ILE A CG1    1 
ATOM   2053  C  CG2    . ILE A  1 144 ? 32.341  -43.228 28.644  1.00 114.05 ? 143 ILE A CG2    1 
ATOM   2054  C  CD1    . ILE A  1 144 ? 34.806  -41.402 29.163  1.00 133.53 ? 143 ILE A CD1    1 
ATOM   2055  H  H      . ILE A  1 144 ? 35.616  -45.795 28.831  1.00 163.02 ? 143 ILE A H      1 
ATOM   2056  H  HA     . ILE A  1 144 ? 33.299  -45.198 30.132  1.00 142.19 ? 143 ILE A HA     1 
ATOM   2057  H  HB     . ILE A  1 144 ? 34.198  -43.679 27.909  1.00 141.77 ? 143 ILE A HB     1 
ATOM   2058  H  HG12   . ILE A  1 144 ? 34.051  -42.683 30.549  1.00 154.39 ? 143 ILE A HG12   1 
ATOM   2059  H  HG13   . ILE A  1 144 ? 35.417  -43.188 29.916  1.00 154.39 ? 143 ILE A HG13   1 
ATOM   2060  H  HG21   . ILE A  1 144 ? 32.343  -42.323 28.321  1.00 136.86 ? 143 ILE A HG21   1 
ATOM   2061  H  HG22   . ILE A  1 144 ? 31.882  -43.797 28.022  1.00 136.86 ? 143 ILE A HG22   1 
ATOM   2062  H  HG23   . ILE A  1 144 ? 31.914  -43.269 29.503  1.00 136.86 ? 143 ILE A HG23   1 
ATOM   2063  H  HD11   . ILE A  1 144 ? 35.296  -40.886 29.808  1.00 160.24 ? 143 ILE A HD11   1 
ATOM   2064  H  HD12   . ILE A  1 144 ? 35.315  -41.482 28.353  1.00 160.24 ? 143 ILE A HD12   1 
ATOM   2065  H  HD13   . ILE A  1 144 ? 33.962  -40.982 28.979  1.00 160.24 ? 143 ILE A HD13   1 
ATOM   2066  N  N      . HIS A  1 145 ? 31.901  -46.451 28.546  1.00 110.19 ? 144 HIS A N      1 
ATOM   2067  C  CA     . HIS A  1 145 ? 31.155  -47.310 27.632  1.00 116.46 ? 144 HIS A CA     1 
ATOM   2068  C  C      . HIS A  1 145 ? 30.703  -46.510 26.414  1.00 111.20 ? 144 HIS A C      1 
ATOM   2069  O  O      . HIS A  1 145 ? 30.757  -46.998 25.286  1.00 101.93 ? 144 HIS A O      1 
ATOM   2070  C  CB     . HIS A  1 145 ? 29.951  -47.932 28.342  1.00 102.67 ? 144 HIS A CB     1 
ATOM   2071  C  CG     . HIS A  1 145 ? 29.390  -49.132 27.644  1.00 99.93  ? 144 HIS A CG     1 
ATOM   2072  N  ND1    . HIS A  1 145 ? 28.579  -49.041 26.532  1.00 97.27  ? 144 HIS A ND1    1 
ATOM   2073  C  CD2    . HIS A  1 145 ? 29.521  -50.455 27.903  1.00 112.11 ? 144 HIS A CD2    1 
ATOM   2074  C  CE1    . HIS A  1 145 ? 28.237  -50.254 26.136  1.00 115.87 ? 144 HIS A CE1    1 
ATOM   2075  N  NE2    . HIS A  1 145 ? 28.796  -51.130 26.952  1.00 121.87 ? 144 HIS A NE2    1 
ATOM   2076  H  H      . HIS A  1 145 ? 31.469  -46.235 29.258  1.00 132.23 ? 144 HIS A H      1 
ATOM   2077  H  HA     . HIS A  1 145 ? 31.738  -48.036 27.324  1.00 139.75 ? 144 HIS A HA     1 
ATOM   2078  H  HB2    . HIS A  1 145 ? 30.220  -48.206 29.232  1.00 123.20 ? 144 HIS A HB2    1 
ATOM   2079  H  HB3    . HIS A  1 145 ? 29.247  -47.268 28.401  1.00 123.20 ? 144 HIS A HB3    1 
ATOM   2080  H  HD1    . HIS A  1 145 ? 28.336  -48.307 26.155  1.00 116.73 ? 144 HIS A HD1    1 
ATOM   2081  H  HD2    . HIS A  1 145 ? 30.011  -50.836 28.596  1.00 134.53 ? 144 HIS A HD2    1 
ATOM   2082  H  HE1    . HIS A  1 145 ? 27.696  -50.457 25.408  1.00 139.04 ? 144 HIS A HE1    1 
ATOM   2083  H  HE2    . HIS A  1 145 ? 28.718  -51.985 26.897  1.00 146.24 ? 144 HIS A HE2    1 
ATOM   2084  N  N      . ARG A  1 146 ? 30.254  -45.281 26.651  1.00 121.18 ? 145 ARG A N      1 
ATOM   2085  C  CA     . ARG A  1 146 ? 29.928  -44.353 25.572  1.00 127.08 ? 145 ARG A CA     1 
ATOM   2086  C  C      . ARG A  1 146 ? 28.697  -44.775 24.771  1.00 113.94 ? 145 ARG A C      1 
ATOM   2087  O  O      . ARG A  1 146 ? 28.355  -44.130 23.781  1.00 133.03 ? 145 ARG A O      1 
ATOM   2088  C  CB     . ARG A  1 146 ? 31.119  -44.217 24.616  1.00 130.01 ? 145 ARG A CB     1 
ATOM   2089  C  CG     . ARG A  1 146 ? 32.430  -43.841 25.283  1.00 141.41 ? 145 ARG A CG     1 
ATOM   2090  C  CD     . ARG A  1 146 ? 33.597  -43.991 24.324  1.00 146.97 ? 145 ARG A CD     1 
ATOM   2091  N  NE     . ARG A  1 146 ? 34.860  -43.603 24.944  1.00 156.29 ? 145 ARG A NE     1 
ATOM   2092  C  CZ     . ARG A  1 146 ? 35.263  -42.346 25.105  1.00 163.12 ? 145 ARG A CZ     1 
ATOM   2093  N  NH1    . ARG A  1 146 ? 34.503  -41.339 24.695  1.00 156.90 ? 145 ARG A NH1    1 
ATOM   2094  N  NH2    . ARG A  1 146 ? 36.429  -42.093 25.680  1.00 171.16 ? 145 ARG A NH2    1 
ATOM   2095  H  H      . ARG A  1 146 ? 30.129  -44.956 27.438  1.00 145.41 ? 145 ARG A H      1 
ATOM   2096  H  HA     . ARG A  1 146 ? 29.748  -43.470 25.957  1.00 152.49 ? 145 ARG A HA     1 
ATOM   2097  H  HB2    . ARG A  1 146 ? 31.252  -45.066 24.166  1.00 156.01 ? 145 ARG A HB2    1 
ATOM   2098  H  HB3    . ARG A  1 146 ? 30.914  -43.530 23.963  1.00 156.01 ? 145 ARG A HB3    1 
ATOM   2099  H  HG2    . ARG A  1 146 ? 32.389  -42.916 25.572  1.00 169.70 ? 145 ARG A HG2    1 
ATOM   2100  H  HG3    . ARG A  1 146 ? 32.583  -44.425 26.043  1.00 169.70 ? 145 ARG A HG3    1 
ATOM   2101  H  HD2    . ARG A  1 146 ? 33.667  -44.918 24.048  1.00 176.36 ? 145 ARG A HD2    1 
ATOM   2102  H  HD3    . ARG A  1 146 ? 33.451  -43.422 23.552  1.00 176.36 ? 145 ARG A HD3    1 
ATOM   2103  H  HE     . ARG A  1 146 ? 35.379  -44.229 25.224  1.00 187.54 ? 145 ARG A HE     1 
ATOM   2104  H  HH11   . ARG A  1 146 ? 33.745  -41.497 24.321  1.00 188.27 ? 145 ARG A HH11   1 
ATOM   2105  H  HH12   . ARG A  1 146 ? 34.769  -40.528 24.803  1.00 188.27 ? 145 ARG A HH12   1 
ATOM   2106  H  HH21   . ARG A  1 146 ? 36.926  -42.741 25.948  1.00 205.40 ? 145 ARG A HH21   1 
ATOM   2107  H  HH22   . ARG A  1 146 ? 36.689  -41.280 25.785  1.00 205.40 ? 145 ARG A HH22   1 
ATOM   2108  N  N      . ASN A  1 147 ? 28.023  -45.839 25.195  1.00 104.07 ? 146 ASN A N      1 
ATOM   2109  C  CA     . ASN A  1 147 ? 26.959  -46.421 24.384  1.00 108.75 ? 146 ASN A CA     1 
ATOM   2110  C  C      . ASN A  1 147 ? 26.131  -47.460 25.140  1.00 106.83 ? 146 ASN A C      1 
ATOM   2111  O  O      . ASN A  1 147 ? 25.961  -48.584 24.677  1.00 100.89 ? 146 ASN A O      1 
ATOM   2112  C  CB     . ASN A  1 147 ? 27.577  -47.061 23.138  1.00 135.27 ? 146 ASN A CB     1 
ATOM   2113  C  CG     . ASN A  1 147 ? 26.556  -47.363 22.061  1.00 137.26 ? 146 ASN A CG     1 
ATOM   2114  O  OD1    . ASN A  1 147 ? 25.586  -46.626 21.875  1.00 139.22 ? 146 ASN A OD1    1 
ATOM   2115  N  ND2    . ASN A  1 147 ? 26.776  -48.455 21.335  1.00 126.69 ? 146 ASN A ND2    1 
ATOM   2116  H  H      . ASN A  1 147 ? 28.161  -46.241 25.943  1.00 124.89 ? 146 ASN A H      1 
ATOM   2117  H  HA     . ASN A  1 147 ? 26.355  -45.708 24.090  1.00 130.50 ? 146 ASN A HA     1 
ATOM   2118  H  HB2    . ASN A  1 147 ? 28.235  -46.454 22.766  1.00 162.33 ? 146 ASN A HB2    1 
ATOM   2119  H  HB3    . ASN A  1 147 ? 28.002  -47.896 23.391  1.00 162.33 ? 146 ASN A HB3    1 
ATOM   2120  H  HD21   . ASN A  1 147 ? 27.466  -48.943 21.491  1.00 152.03 ? 146 ASN A HD21   1 
ATOM   2121  H  HD22   . ASN A  1 147 ? 26.227  -48.674 20.710  1.00 152.03 ? 146 ASN A HD22   1 
ATOM   2122  N  N      . ILE A  1 148 ? 25.619  -47.081 26.306  1.00 127.37 ? 147 ILE A N      1 
ATOM   2123  C  CA     . ILE A  1 148 ? 24.780  -47.978 27.091  1.00 114.80 ? 147 ILE A CA     1 
ATOM   2124  C  C      . ILE A  1 148 ? 23.340  -47.970 26.586  1.00 107.01 ? 147 ILE A C      1 
ATOM   2125  O  O      . ILE A  1 148 ? 22.788  -46.920 26.259  1.00 110.65 ? 147 ILE A O      1 
ATOM   2126  C  CB     . ILE A  1 148 ? 24.785  -47.592 28.580  1.00 118.32 ? 147 ILE A CB     1 
ATOM   2127  C  CG1    . ILE A  1 148 ? 26.139  -47.921 29.214  1.00 128.41 ? 147 ILE A CG1    1 
ATOM   2128  C  CG2    . ILE A  1 148 ? 23.675  -48.320 29.321  1.00 122.44 ? 147 ILE A CG2    1 
ATOM   2129  C  CD1    . ILE A  1 148 ? 26.431  -49.412 29.330  1.00 93.49  ? 147 ILE A CD1    1 
ATOM   2130  H  H      . ILE A  1 148 ? 25.742  -46.309 26.665  1.00 152.85 ? 147 ILE A H      1 
ATOM   2131  H  HA     . ILE A  1 148 ? 25.126  -48.891 27.012  1.00 137.76 ? 147 ILE A HA     1 
ATOM   2132  H  HB     . ILE A  1 148 ? 24.633  -46.636 28.653  1.00 141.99 ? 147 ILE A HB     1 
ATOM   2133  H  HG12   . ILE A  1 148 ? 26.840  -47.524 28.673  1.00 154.09 ? 147 ILE A HG12   1 
ATOM   2134  H  HG13   . ILE A  1 148 ? 26.163  -47.545 30.108  1.00 154.09 ? 147 ILE A HG13   1 
ATOM   2135  H  HG21   . ILE A  1 148 ? 23.697  -48.064 30.246  1.00 146.92 ? 147 ILE A HG21   1 
ATOM   2136  H  HG22   . ILE A  1 148 ? 22.830  -48.077 28.934  1.00 146.92 ? 147 ILE A HG22   1 
ATOM   2137  H  HG23   . ILE A  1 148 ? 23.813  -49.266 29.240  1.00 146.92 ? 147 ILE A HG23   1 
ATOM   2138  H  HD11   . ILE A  1 148 ? 27.293  -49.531 29.735  1.00 112.19 ? 147 ILE A HD11   1 
ATOM   2139  H  HD12   . ILE A  1 148 ? 25.754  -49.821 29.874  1.00 112.19 ? 147 ILE A HD12   1 
ATOM   2140  H  HD13   . ILE A  1 148 ? 26.425  -49.801 28.452  1.00 112.19 ? 147 ILE A HD13   1 
ATOM   2141  N  N      . LYS A  1 149 ? 22.741  -49.154 26.531  1.00 99.62  ? 148 LYS A N      1 
ATOM   2142  C  CA     . LYS A  1 149 ? 21.349  -49.303 26.129  1.00 110.09 ? 148 LYS A CA     1 
ATOM   2143  C  C      . LYS A  1 149 ? 20.917  -50.755 26.308  1.00 124.75 ? 148 LYS A C      1 
ATOM   2144  O  O      . LYS A  1 149 ? 21.752  -51.634 26.520  1.00 129.28 ? 148 LYS A O      1 
ATOM   2145  C  CB     . LYS A  1 149 ? 21.154  -48.863 24.677  1.00 117.84 ? 148 LYS A CB     1 
ATOM   2146  C  CG     . LYS A  1 149 ? 22.131  -49.496 23.701  1.00 116.99 ? 148 LYS A CG     1 
ATOM   2147  C  CD     . LYS A  1 149 ? 21.931  -48.965 22.291  1.00 136.24 ? 148 LYS A CD     1 
ATOM   2148  C  CE     . LYS A  1 149 ? 20.548  -49.297 21.755  1.00 147.89 ? 148 LYS A CE     1 
ATOM   2149  N  NZ     . LYS A  1 149 ? 20.391  -48.893 20.330  1.00 145.17 ? 148 LYS A NZ     1 
ATOM   2150  H  H      . LYS A  1 149 ? 23.127  -49.898 26.724  1.00 119.54 ? 148 LYS A H      1 
ATOM   2151  H  HA     . LYS A  1 149 ? 20.784  -48.741 26.699  1.00 132.11 ? 148 LYS A HA     1 
ATOM   2152  H  HB2    . LYS A  1 149 ? 20.258  -49.104 24.395  1.00 141.41 ? 148 LYS A HB2    1 
ATOM   2153  H  HB3    . LYS A  1 149 ? 21.267  -47.901 24.625  1.00 141.41 ? 148 LYS A HB3    1 
ATOM   2154  H  HG2    . LYS A  1 149 ? 23.037  -49.291 23.978  1.00 140.39 ? 148 LYS A HG2    1 
ATOM   2155  H  HG3    . LYS A  1 149 ? 21.993  -50.456 23.687  1.00 140.39 ? 148 LYS A HG3    1 
ATOM   2156  H  HD2    . LYS A  1 149 ? 22.030  -48.000 22.296  1.00 163.48 ? 148 LYS A HD2    1 
ATOM   2157  H  HD3    . LYS A  1 149 ? 22.589  -49.366 21.703  1.00 163.48 ? 148 LYS A HD3    1 
ATOM   2158  H  HE2    . LYS A  1 149 ? 20.404  -50.255 21.815  1.00 177.47 ? 148 LYS A HE2    1 
ATOM   2159  H  HE3    . LYS A  1 149 ? 19.881  -48.826 22.279  1.00 177.47 ? 148 LYS A HE3    1 
ATOM   2160  H  HZ1    . LYS A  1 149 ? 19.574  -49.099 20.044  1.00 174.20 ? 148 LYS A HZ1    1 
ATOM   2161  H  HZ2    . LYS A  1 149 ? 20.513  -48.015 20.248  1.00 174.20 ? 148 LYS A HZ2    1 
ATOM   2162  H  HZ3    . LYS A  1 149 ? 20.989  -49.317 19.826  1.00 174.20 ? 148 LYS A HZ3    1 
ATOM   2163  N  N      . ALA A  1 150 ? 19.615  -51.004 26.223  1.00 132.49 ? 149 ALA A N      1 
ATOM   2164  C  CA     . ALA A  1 150 ? 19.080  -52.346 26.437  1.00 133.12 ? 149 ALA A CA     1 
ATOM   2165  C  C      . ALA A  1 150 ? 19.689  -53.354 25.469  1.00 142.87 ? 149 ALA A C      1 
ATOM   2166  O  O      . ALA A  1 150 ? 20.023  -54.474 25.856  1.00 150.83 ? 149 ALA A O      1 
ATOM   2167  C  CB     . ALA A  1 150 ? 17.569  -52.337 26.298  1.00 132.41 ? 149 ALA A CB     1 
ATOM   2168  H  H      . ALA A  1 150 ? 19.017  -50.413 26.042  1.00 158.98 ? 149 ALA A H      1 
ATOM   2169  H  HA     . ALA A  1 150 ? 19.297  -52.633 27.349  1.00 159.74 ? 149 ALA A HA     1 
ATOM   2170  H  HB1    . ALA A  1 150 ? 17.237  -53.226 26.443  1.00 158.89 ? 149 ALA A HB1    1 
ATOM   2171  H  HB2    . ALA A  1 150 ? 17.199  -51.739 26.952  1.00 158.89 ? 149 ALA A HB2    1 
ATOM   2172  H  HB3    . ALA A  1 150 ? 17.339  -52.040 25.415  1.00 158.89 ? 149 ALA A HB3    1 
ATOM   2173  N  N      . GLY A  1 151 ? 19.832  -52.950 24.212  1.00 140.04 ? 150 GLY A N      1 
ATOM   2174  C  CA     . GLY A  1 151 ? 20.345  -53.834 23.181  1.00 124.06 ? 150 GLY A CA     1 
ATOM   2175  C  C      . GLY A  1 151 ? 21.782  -54.260 23.408  1.00 116.12 ? 150 GLY A C      1 
ATOM   2176  O  O      . GLY A  1 151 ? 22.252  -55.213 22.787  1.00 138.57 ? 150 GLY A O      1 
ATOM   2177  H  H      . GLY A  1 151 ? 19.637  -52.161 23.931  1.00 168.05 ? 150 GLY A H      1 
ATOM   2178  H  HA2    . GLY A  1 151 ? 19.794  -54.631 23.142  1.00 148.87 ? 150 GLY A HA2    1 
ATOM   2179  H  HA3    . GLY A  1 151 ? 20.293  -53.386 22.322  1.00 148.87 ? 150 GLY A HA3    1 
ATOM   2180  N  N      . ASN A  1 152 ? 22.485  -53.560 24.293  1.00 112.37 ? 151 ASN A N      1 
ATOM   2181  C  CA     . ASN A  1 152 ? 23.886  -53.864 24.563  1.00 117.87 ? 151 ASN A CA     1 
ATOM   2182  C  C      . ASN A  1 152 ? 24.113  -54.484 25.939  1.00 126.94 ? 151 ASN A C      1 
ATOM   2183  O  O      . ASN A  1 152 ? 25.250  -54.587 26.401  1.00 143.83 ? 151 ASN A O      1 
ATOM   2184  C  CB     . ASN A  1 152 ? 24.734  -52.605 24.413  1.00 116.02 ? 151 ASN A CB     1 
ATOM   2185  C  CG     . ASN A  1 152 ? 24.726  -52.067 22.997  1.00 117.14 ? 151 ASN A CG     1 
ATOM   2186  O  OD1    . ASN A  1 152 ? 24.522  -52.814 22.039  1.00 126.91 ? 151 ASN A OD1    1 
ATOM   2187  N  ND2    . ASN A  1 152 ? 24.946  -50.766 22.857  1.00 114.87 ? 151 ASN A ND2    1 
ATOM   2188  H  H      . ASN A  1 152 ? 22.172  -52.903 24.751  1.00 134.85 ? 151 ASN A H      1 
ATOM   2189  H  HA     . ASN A  1 152 ? 24.196  -54.510 23.895  1.00 141.44 ? 151 ASN A HA     1 
ATOM   2190  H  HB2    . ASN A  1 152 ? 24.385  -51.915 24.998  1.00 139.22 ? 151 ASN A HB2    1 
ATOM   2191  H  HB3    . ASN A  1 152 ? 25.652  -52.810 24.651  1.00 139.22 ? 151 ASN A HB3    1 
ATOM   2192  H  HD21   . ASN A  1 152 ? 25.084  -50.276 23.550  1.00 137.84 ? 151 ASN A HD21   1 
ATOM   2193  H  HD22   . ASN A  1 152 ? 24.951  -50.412 22.073  1.00 137.84 ? 151 ASN A HD22   1 
ATOM   2194  N  N      . ILE A  1 153 ? 23.029  -54.893 26.591  1.00 116.48 ? 152 ILE A N      1 
ATOM   2195  C  CA     . ILE A  1 153 ? 23.120  -55.641 27.839  1.00 120.77 ? 152 ILE A CA     1 
ATOM   2196  C  C      . ILE A  1 153 ? 22.679  -57.081 27.594  1.00 125.23 ? 152 ILE A C      1 
ATOM   2197  O  O      . ILE A  1 153 ? 21.516  -57.335 27.282  1.00 126.62 ? 152 ILE A O      1 
ATOM   2198  C  CB     . ILE A  1 153 ? 22.253  -55.009 28.939  1.00 122.70 ? 152 ILE A CB     1 
ATOM   2199  C  CG1    . ILE A  1 153 ? 22.830  -53.650 29.344  1.00 136.68 ? 152 ILE A CG1    1 
ATOM   2200  C  CG2    . ILE A  1 153 ? 22.177  -55.927 30.150  1.00 124.64 ? 152 ILE A CG2    1 
ATOM   2201  C  CD1    . ILE A  1 153 ? 21.995  -52.901 30.362  1.00 145.24 ? 152 ILE A CD1    1 
ATOM   2202  H  H      . ILE A  1 153 ? 22.223  -54.747 26.329  1.00 139.77 ? 152 ILE A H      1 
ATOM   2203  H  HA     . ILE A  1 153 ? 24.051  -55.651 28.145  1.00 144.92 ? 152 ILE A HA     1 
ATOM   2204  H  HB     . ILE A  1 153 ? 21.357  -54.876 28.592  1.00 147.24 ? 152 ILE A HB     1 
ATOM   2205  H  HG12   . ILE A  1 153 ? 23.711  -53.788 29.727  1.00 164.01 ? 152 ILE A HG12   1 
ATOM   2206  H  HG13   . ILE A  1 153 ? 22.900  -53.094 28.552  1.00 164.01 ? 152 ILE A HG13   1 
ATOM   2207  H  HG21   . ILE A  1 153 ? 21.631  -55.512 30.822  1.00 149.57 ? 152 ILE A HG21   1 
ATOM   2208  H  HG22   . ILE A  1 153 ? 21.789  -56.764 29.884  1.00 149.57 ? 152 ILE A HG22   1 
ATOM   2209  H  HG23   . ILE A  1 153 ? 23.063  -56.070 30.490  1.00 149.57 ? 152 ILE A HG23   1 
ATOM   2210  H  HD11   . ILE A  1 153 ? 22.423  -52.064 30.562  1.00 174.29 ? 152 ILE A HD11   1 
ATOM   2211  H  HD12   . ILE A  1 153 ? 21.122  -52.743 29.995  1.00 174.29 ? 152 ILE A HD12   1 
ATOM   2212  H  HD13   . ILE A  1 153 ? 21.925  -53.431 31.160  1.00 174.29 ? 152 ILE A HD13   1 
ATOM   2213  N  N      . LEU A  1 154 ? 23.613  -58.018 27.737  1.00 121.86 ? 153 LEU A N      1 
ATOM   2214  C  CA     . LEU A  1 154 ? 23.363  -59.416 27.395  1.00 132.89 ? 153 LEU A CA     1 
ATOM   2215  C  C      . LEU A  1 154 ? 23.202  -60.308 28.624  1.00 137.03 ? 153 LEU A C      1 
ATOM   2216  O  O      . LEU A  1 154 ? 23.979  -60.223 29.576  1.00 137.97 ? 153 LEU A O      1 
ATOM   2217  C  CB     . LEU A  1 154 ? 24.502  -59.954 26.526  1.00 139.66 ? 153 LEU A CB     1 
ATOM   2218  C  CG     . LEU A  1 154 ? 24.792  -59.171 25.243  1.00 134.79 ? 153 LEU A CG     1 
ATOM   2219  C  CD1    . LEU A  1 154 ? 25.942  -59.807 24.481  1.00 114.70 ? 153 LEU A CD1    1 
ATOM   2220  C  CD2    . LEU A  1 154 ? 23.552  -59.087 24.372  1.00 139.07 ? 153 LEU A CD2    1 
ATOM   2221  H  H      . LEU A  1 154 ? 24.407  -57.868 28.032  1.00 146.23 ? 153 LEU A H      1 
ATOM   2222  H  HA     . LEU A  1 154 ? 22.535  -59.471 26.874  1.00 159.47 ? 153 LEU A HA     1 
ATOM   2223  H  HB2    . LEU A  1 154 ? 25.316  -59.954 27.054  1.00 167.59 ? 153 LEU A HB2    1 
ATOM   2224  H  HB3    . LEU A  1 154 ? 24.285  -60.863 26.267  1.00 167.59 ? 153 LEU A HB3    1 
ATOM   2225  H  HG     . LEU A  1 154 ? 25.053  -58.267 25.479  1.00 161.75 ? 153 LEU A HG     1 
ATOM   2226  H  HD11   . LEU A  1 154 ? 26.105  -59.300 23.683  1.00 137.64 ? 153 LEU A HD11   1 
ATOM   2227  H  HD12   . LEU A  1 154 ? 26.724  -59.803 25.037  1.00 137.64 ? 153 LEU A HD12   1 
ATOM   2228  H  HD13   . LEU A  1 154 ? 25.705  -60.709 24.254  1.00 137.64 ? 153 LEU A HD13   1 
ATOM   2229  H  HD21   . LEU A  1 154 ? 23.762  -58.592 23.577  1.00 166.89 ? 153 LEU A HD21   1 
ATOM   2230  H  HD22   . LEU A  1 154 ? 23.272  -59.976 24.140  1.00 166.89 ? 153 LEU A HD22   1 
ATOM   2231  H  HD23   . LEU A  1 154 ? 22.856  -58.641 24.861  1.00 166.89 ? 153 LEU A HD23   1 
ATOM   2232  N  N      . LEU A  1 155 ? 22.188  -61.166 28.585  1.00 134.48 ? 154 LEU A N      1 
ATOM   2233  C  CA     . LEU A  1 155 ? 21.964  -62.158 29.628  1.00 141.99 ? 154 LEU A CA     1 
ATOM   2234  C  C      . LEU A  1 155 ? 22.348  -63.540 29.115  1.00 153.92 ? 154 LEU A C      1 
ATOM   2235  O  O      . LEU A  1 155 ? 21.979  -63.918 28.003  1.00 158.25 ? 154 LEU A O      1 
ATOM   2236  C  CB     . LEU A  1 155 ? 20.492  -62.169 30.046  1.00 146.74 ? 154 LEU A CB     1 
ATOM   2237  C  CG     . LEU A  1 155 ? 20.000  -61.023 30.931  1.00 156.52 ? 154 LEU A CG     1 
ATOM   2238  C  CD1    . LEU A  1 155 ? 18.495  -61.109 31.111  1.00 160.54 ? 154 LEU A CD1    1 
ATOM   2239  C  CD2    . LEU A  1 155 ? 20.692  -61.053 32.281  1.00 162.20 ? 154 LEU A CD2    1 
ATOM   2240  H  H      . LEU A  1 155 ? 21.605  -61.192 27.953  1.00 161.37 ? 154 LEU A H      1 
ATOM   2241  H  HA     . LEU A  1 155 ? 22.513  -61.947 30.411  1.00 170.38 ? 154 LEU A HA     1 
ATOM   2242  H  HB2    . LEU A  1 155 ? 19.952  -62.158 29.240  1.00 176.08 ? 154 LEU A HB2    1 
ATOM   2243  H  HB3    . LEU A  1 155 ? 20.324  -62.993 30.529  1.00 176.08 ? 154 LEU A HB3    1 
ATOM   2244  H  HG     . LEU A  1 155 ? 20.207  -60.178 30.503  1.00 187.82 ? 154 LEU A HG     1 
ATOM   2245  H  HD11   . LEU A  1 155 ? 18.206  -60.383 31.668  1.00 192.65 ? 154 LEU A HD11   1 
ATOM   2246  H  HD12   . LEU A  1 155 ? 18.074  -61.050 30.250  1.00 192.65 ? 154 LEU A HD12   1 
ATOM   2247  H  HD13   . LEU A  1 155 ? 18.278  -61.947 31.525  1.00 192.65 ? 154 LEU A HD13   1 
ATOM   2248  H  HD21   . LEU A  1 155 ? 20.366  -60.326 32.815  1.00 194.64 ? 154 LEU A HD21   1 
ATOM   2249  H  HD22   . LEU A  1 155 ? 20.499  -61.889 32.712  1.00 194.64 ? 154 LEU A HD22   1 
ATOM   2250  H  HD23   . LEU A  1 155 ? 21.639  -60.964 32.148  1.00 194.64 ? 154 LEU A HD23   1 
ATOM   2251  N  N      . ASN A  1 156 ? 23.089  -64.294 29.921  1.00 155.46 ? 155 ASN A N      1 
ATOM   2252  C  CA     . ASN A  1 156 ? 23.418  -65.668 29.564  1.00 158.83 ? 155 ASN A CA     1 
ATOM   2253  C  C      . ASN A  1 156 ? 22.357  -66.631 30.088  1.00 156.47 ? 155 ASN A C      1 
ATOM   2254  O  O      . ASN A  1 156 ? 21.401  -66.218 30.746  1.00 131.51 ? 155 ASN A O      1 
ATOM   2255  C  CB     . ASN A  1 156 ? 24.816  -66.056 30.066  1.00 156.46 ? 155 ASN A CB     1 
ATOM   2256  C  CG     . ASN A  1 156 ? 24.918  -66.070 31.577  1.00 153.15 ? 155 ASN A CG     1 
ATOM   2257  O  OD1    . ASN A  1 156 ? 23.910  -66.114 32.282  1.00 160.78 ? 155 ASN A OD1    1 
ATOM   2258  N  ND2    . ASN A  1 156 ? 26.145  -66.043 32.085  1.00 148.64 ? 155 ASN A ND2    1 
ATOM   2259  H  H      . ASN A  1 156 ? 23.412  -64.035 30.675  1.00 186.56 ? 155 ASN A H      1 
ATOM   2260  H  HA     . ASN A  1 156 ? 23.426  -65.741 28.587  1.00 190.59 ? 155 ASN A HA     1 
ATOM   2261  H  HB2    . ASN A  1 156 ? 25.032  -66.944 29.743  1.00 187.75 ? 155 ASN A HB2    1 
ATOM   2262  H  HB3    . ASN A  1 156 ? 25.461  -65.415 29.728  1.00 187.75 ? 155 ASN A HB3    1 
ATOM   2263  H  HD21   . ASN A  1 156 ? 26.827  -66.018 31.561  1.00 178.37 ? 155 ASN A HD21   1 
ATOM   2264  H  HD22   . ASN A  1 156 ? 26.258  -66.049 32.937  1.00 178.37 ? 155 ASN A HD22   1 
ATOM   2265  N  N      . THR A  1 157 ? 22.532  -67.914 29.793  1.00 167.50 ? 156 THR A N      1 
ATOM   2266  C  CA     . THR A  1 157 ? 21.528  -68.923 30.116  1.00 165.98 ? 156 THR A CA     1 
ATOM   2267  C  C      . THR A  1 157 ? 21.213  -68.994 31.610  1.00 171.18 ? 156 THR A C      1 
ATOM   2268  O  O      . THR A  1 157 ? 20.195  -69.562 32.004  1.00 169.04 ? 156 THR A O      1 
ATOM   2269  C  CB     . THR A  1 157 ? 21.978  -70.317 29.645  1.00 159.83 ? 156 THR A CB     1 
ATOM   2270  O  OG1    . THR A  1 157 ? 23.224  -70.656 30.266  1.00 152.77 ? 156 THR A OG1    1 
ATOM   2271  C  CG2    . THR A  1 157 ? 22.141  -70.346 28.130  1.00 164.08 ? 156 THR A CG2    1 
ATOM   2272  H  H      . THR A  1 157 ? 23.229  -68.230 29.401  1.00 201.00 ? 156 THR A H      1 
ATOM   2273  H  HA     . THR A  1 157 ? 20.697  -68.702 29.646  1.00 199.18 ? 156 THR A HA     1 
ATOM   2274  H  HB     . THR A  1 157 ? 21.307  -70.972 29.893  1.00 191.79 ? 156 THR A HB     1 
ATOM   2275  H  HG1    . THR A  1 157 ? 23.468  -71.398 30.018  1.00 183.32 ? 156 THR A HG1    1 
ATOM   2276  H  HG21   . THR A  1 157 ? 22.422  -71.219 27.847  1.00 196.90 ? 156 THR A HG21   1 
ATOM   2277  H  HG22   . THR A  1 157 ? 21.307  -70.133 27.707  1.00 196.90 ? 156 THR A HG22   1 
ATOM   2278  H  HG23   . THR A  1 157 ? 22.801  -69.703 27.860  1.00 196.90 ? 156 THR A HG23   1 
ATOM   2279  N  N      . GLU A  1 158 ? 22.082  -68.417 32.435  1.00 177.95 ? 157 GLU A N      1 
ATOM   2280  C  CA     . GLU A  1 158 ? 21.931  -68.495 33.884  1.00 179.76 ? 157 GLU A CA     1 
ATOM   2281  C  C      . GLU A  1 158 ? 21.183  -67.293 34.457  1.00 185.10 ? 157 GLU A C      1 
ATOM   2282  O  O      . GLU A  1 158 ? 20.524  -67.403 35.491  1.00 189.22 ? 157 GLU A O      1 
ATOM   2283  C  CB     . GLU A  1 158 ? 23.307  -68.610 34.543  1.00 182.97 ? 157 GLU A CB     1 
ATOM   2284  C  CG     . GLU A  1 158 ? 24.146  -69.764 34.017  1.00 188.02 ? 157 GLU A CG     1 
ATOM   2285  C  CD     . GLU A  1 158 ? 25.564  -69.748 34.553  1.00 186.88 ? 157 GLU A CD     1 
ATOM   2286  O  OE1    . GLU A  1 158 ? 25.742  -69.487 35.761  1.00 185.28 ? 157 GLU A OE1    1 
ATOM   2287  O  OE2    . GLU A  1 158 ? 26.501  -69.993 33.763  1.00 187.07 ? 157 GLU A OE2    1 
ATOM   2288  H  H      . GLU A  1 158 ? 22.772  -67.971 32.178  1.00 213.54 ? 157 GLU A H      1 
ATOM   2289  H  HA     . GLU A  1 158 ? 21.422  -69.302 34.107  1.00 215.71 ? 157 GLU A HA     1 
ATOM   2290  H  HB2    . GLU A  1 158 ? 23.799  -67.789 34.385  1.00 219.56 ? 157 GLU A HB2    1 
ATOM   2291  H  HB3    . GLU A  1 158 ? 23.187  -68.742 35.497  1.00 219.56 ? 157 GLU A HB3    1 
ATOM   2292  H  HG2    . GLU A  1 158 ? 23.734  -70.601 34.282  1.00 225.62 ? 157 GLU A HG2    1 
ATOM   2293  H  HG3    . GLU A  1 158 ? 24.190  -69.707 33.049  1.00 225.62 ? 157 GLU A HG3    1 
ATOM   2294  N  N      . GLY A  1 159 ? 21.288  -66.151 33.782  1.00 191.75 ? 158 GLY A N      1 
ATOM   2295  C  CA     . GLY A  1 159 ? 20.650  -64.926 34.234  1.00 180.95 ? 158 GLY A CA     1 
ATOM   2296  C  C      . GLY A  1 159 ? 21.641  -63.863 34.672  1.00 169.73 ? 158 GLY A C      1 
ATOM   2297  O  O      . GLY A  1 159 ? 21.321  -62.995 35.483  1.00 176.37 ? 158 GLY A O      1 
ATOM   2298  H  H      . GLY A  1 159 ? 21.730  -66.063 33.050  1.00 230.10 ? 158 GLY A H      1 
ATOM   2299  H  HA2    . GLY A  1 159 ? 20.111  -64.562 33.515  1.00 217.14 ? 158 GLY A HA2    1 
ATOM   2300  H  HA3    . GLY A  1 159 ? 20.067  -65.125 34.982  1.00 217.14 ? 158 GLY A HA3    1 
ATOM   2301  N  N      . HIS A  1 160 ? 22.849  -63.929 34.124  1.00 162.33 ? 159 HIS A N      1 
ATOM   2302  C  CA     . HIS A  1 160 ? 23.905  -62.991 34.471  1.00 160.15 ? 159 HIS A CA     1 
ATOM   2303  C  C      . HIS A  1 160 ? 24.046  -61.932 33.385  1.00 157.85 ? 159 HIS A C      1 
ATOM   2304  O  O      . HIS A  1 160 ? 24.395  -62.243 32.247  1.00 163.56 ? 159 HIS A O      1 
ATOM   2305  C  CB     . HIS A  1 160 ? 25.226  -63.739 34.647  1.00 168.57 ? 159 HIS A CB     1 
ATOM   2306  C  CG     . HIS A  1 160 ? 25.228  -64.705 35.792  1.00 167.29 ? 159 HIS A CG     1 
ATOM   2307  N  ND1    . HIS A  1 160 ? 24.242  -65.652 35.969  1.00 168.89 ? 159 HIS A ND1    1 
ATOM   2308  C  CD2    . HIS A  1 160 ? 26.098  -64.872 36.816  1.00 162.91 ? 159 HIS A CD2    1 
ATOM   2309  C  CE1    . HIS A  1 160 ? 24.503  -66.358 37.056  1.00 170.74 ? 159 HIS A CE1    1 
ATOM   2310  N  NE2    . HIS A  1 160 ? 25.622  -65.904 37.588  1.00 167.76 ? 159 HIS A NE2    1 
ATOM   2311  H  H      . HIS A  1 160 ? 23.083  -64.516 33.541  1.00 194.79 ? 159 HIS A H      1 
ATOM   2312  H  HA     . HIS A  1 160 ? 23.684  -62.545 35.315  1.00 192.18 ? 159 HIS A HA     1 
ATOM   2313  H  HB2    . HIS A  1 160 ? 25.411  -64.240 33.837  1.00 202.29 ? 159 HIS A HB2    1 
ATOM   2314  H  HB3    . HIS A  1 160 ? 25.933  -63.094 34.802  1.00 202.29 ? 159 HIS A HB3    1 
ATOM   2315  H  HD1    . HIS A  1 160 ? 23.562  -65.764 35.455  1.00 202.67 ? 159 HIS A HD1    1 
ATOM   2316  H  HD2    . HIS A  1 160 ? 26.870  -64.378 36.970  1.00 195.49 ? 159 HIS A HD2    1 
ATOM   2317  H  HE1    . HIS A  1 160 ? 23.986  -67.056 37.389  1.00 204.89 ? 159 HIS A HE1    1 
ATOM   2318  H  HE2    . HIS A  1 160 ? 25.995  -66.208 38.301  1.00 201.32 ? 159 HIS A HE2    1 
ATOM   2319  N  N      . ALA A  1 161 ? 23.770  -60.681 33.742  1.00 149.46 ? 160 ALA A N      1 
ATOM   2320  C  CA     . ALA A  1 161 ? 23.812  -59.582 32.783  1.00 137.20 ? 160 ALA A CA     1 
ATOM   2321  C  C      . ALA A  1 161 ? 25.245  -59.141 32.508  1.00 126.20 ? 160 ALA A C      1 
ATOM   2322  O  O      . ALA A  1 161 ? 26.082  -59.118 33.409  1.00 129.25 ? 160 ALA A O      1 
ATOM   2323  C  CB     . ALA A  1 161 ? 22.989  -58.416 33.290  1.00 139.37 ? 160 ALA A CB     1 
ATOM   2324  H  H      . ALA A  1 161 ? 23.556  -60.441 34.540  1.00 179.36 ? 160 ALA A H      1 
ATOM   2325  H  HA     . ALA A  1 161 ? 23.420  -59.883 31.937  1.00 164.64 ? 160 ALA A HA     1 
ATOM   2326  H  HB1    . ALA A  1 161 ? 23.027  -57.704 32.647  1.00 167.24 ? 160 ALA A HB1    1 
ATOM   2327  H  HB2    . ALA A  1 161 ? 22.080  -58.702 33.408  1.00 167.24 ? 160 ALA A HB2    1 
ATOM   2328  H  HB3    . ALA A  1 161 ? 23.350  -58.120 34.129  1.00 167.24 ? 160 ALA A HB3    1 
ATOM   2329  N  N      . LYS A  1 162 ? 25.517  -58.786 31.257  1.00 118.26 ? 161 LYS A N      1 
ATOM   2330  C  CA     . LYS A  1 162 ? 26.862  -58.401 30.849  1.00 134.00 ? 161 LYS A CA     1 
ATOM   2331  C  C      . LYS A  1 162 ? 26.839  -57.250 29.844  1.00 140.78 ? 161 LYS A C      1 
ATOM   2332  O  O      . LYS A  1 162 ? 25.928  -57.145 29.023  1.00 144.59 ? 161 LYS A O      1 
ATOM   2333  C  CB     . LYS A  1 162 ? 27.590  -59.608 30.252  1.00 137.09 ? 161 LYS A CB     1 
ATOM   2334  C  CG     . LYS A  1 162 ? 27.959  -60.672 31.274  1.00 143.65 ? 161 LYS A CG     1 
ATOM   2335  C  CD     . LYS A  1 162 ? 28.088  -62.045 30.636  1.00 157.38 ? 161 LYS A CD     1 
ATOM   2336  C  CE     . LYS A  1 162 ? 28.425  -63.108 31.672  1.00 154.94 ? 161 LYS A CE     1 
ATOM   2337  N  NZ     . LYS A  1 162 ? 29.802  -62.951 32.217  1.00 149.77 ? 161 LYS A NZ     1 
ATOM   2338  H  H      . LYS A  1 162 ? 24.937  -58.759 30.623  1.00 141.91 ? 161 LYS A H      1 
ATOM   2339  H  HA     . LYS A  1 162 ? 27.363  -58.105 31.637  1.00 160.80 ? 161 LYS A HA     1 
ATOM   2340  H  HB2    . LYS A  1 162 ? 27.016  -60.021 29.588  1.00 164.51 ? 161 LYS A HB2    1 
ATOM   2341  H  HB3    . LYS A  1 162 ? 28.410  -59.302 29.833  1.00 164.51 ? 161 LYS A HB3    1 
ATOM   2342  H  HG2    . LYS A  1 162 ? 28.811  -60.444 31.678  1.00 172.39 ? 161 LYS A HG2    1 
ATOM   2343  H  HG3    . LYS A  1 162 ? 27.268  -60.716 31.953  1.00 172.39 ? 161 LYS A HG3    1 
ATOM   2344  H  HD2    . LYS A  1 162 ? 27.246  -62.284 30.218  1.00 188.86 ? 161 LYS A HD2    1 
ATOM   2345  H  HD3    . LYS A  1 162 ? 28.798  -62.027 29.976  1.00 188.86 ? 161 LYS A HD3    1 
ATOM   2346  H  HE2    . LYS A  1 162 ? 27.799  -63.041 32.410  1.00 185.92 ? 161 LYS A HE2    1 
ATOM   2347  H  HE3    . LYS A  1 162 ? 28.362  -63.984 31.260  1.00 185.92 ? 161 LYS A HE3    1 
ATOM   2348  H  HZ1    . LYS A  1 162 ? 29.966  -63.587 32.818  1.00 179.72 ? 161 LYS A HZ1    1 
ATOM   2349  H  HZ2    . LYS A  1 162 ? 30.399  -63.015 31.559  1.00 179.72 ? 161 LYS A HZ2    1 
ATOM   2350  H  HZ3    . LYS A  1 162 ? 29.886  -62.156 32.608  1.00 179.72 ? 161 LYS A HZ3    1 
ATOM   2351  N  N      . LEU A  1 163 ? 27.851  -56.391 29.916  1.00 129.99 ? 162 LEU A N      1 
ATOM   2352  C  CA     . LEU A  1 163 ? 27.956  -55.243 29.025  1.00 123.63 ? 162 LEU A CA     1 
ATOM   2353  C  C      . LEU A  1 163 ? 28.708  -55.617 27.754  1.00 122.74 ? 162 LEU A C      1 
ATOM   2354  O  O      . LEU A  1 163 ? 29.748  -56.272 27.812  1.00 137.03 ? 162 LEU A O      1 
ATOM   2355  C  CB     . LEU A  1 163 ? 28.671  -54.093 29.735  1.00 127.78 ? 162 LEU A CB     1 
ATOM   2356  C  CG     . LEU A  1 163 ? 27.947  -53.533 30.959  1.00 126.19 ? 162 LEU A CG     1 
ATOM   2357  C  CD1    . LEU A  1 163 ? 28.806  -52.499 31.670  1.00 126.99 ? 162 LEU A CD1    1 
ATOM   2358  C  CD2    . LEU A  1 163 ? 26.614  -52.931 30.552  1.00 125.93 ? 162 LEU A CD2    1 
ATOM   2359  H  H      . LEU A  1 163 ? 28.497  -56.454 30.480  1.00 155.98 ? 162 LEU A H      1 
ATOM   2360  H  HA     . LEU A  1 163 ? 27.057  -54.941 28.776  1.00 148.36 ? 162 LEU A HA     1 
ATOM   2361  H  HB2    . LEU A  1 163 ? 29.541  -54.406 30.029  1.00 153.34 ? 162 LEU A HB2    1 
ATOM   2362  H  HB3    . LEU A  1 163 ? 28.784  -53.365 29.105  1.00 153.34 ? 162 LEU A HB3    1 
ATOM   2363  H  HG     . LEU A  1 163 ? 27.771  -54.256 31.581  1.00 151.43 ? 162 LEU A HG     1 
ATOM   2364  H  HD11   . LEU A  1 163 ? 28.326  -52.166 32.432  1.00 152.39 ? 162 LEU A HD11   1 
ATOM   2365  H  HD12   . LEU A  1 163 ? 29.624  -52.914 31.953  1.00 152.39 ? 162 LEU A HD12   1 
ATOM   2366  H  HD13   . LEU A  1 163 ? 28.996  -51.780 31.063  1.00 152.39 ? 162 LEU A HD13   1 
ATOM   2367  H  HD21   . LEU A  1 163 ? 26.176  -52.586 31.333  1.00 151.12 ? 162 LEU A HD21   1 
ATOM   2368  H  HD22   . LEU A  1 163 ? 26.771  -52.223 29.923  1.00 151.12 ? 162 LEU A HD22   1 
ATOM   2369  H  HD23   . LEU A  1 163 ? 26.074  -53.614 30.148  1.00 151.12 ? 162 LEU A HD23   1 
ATOM   2370  N  N      . ALA A  1 164 ? 28.179  -55.197 26.609  1.00 121.74 ? 163 ALA A N      1 
ATOM   2371  C  CA     . ALA A  1 164 ? 28.769  -55.546 25.321  1.00 134.76 ? 163 ALA A CA     1 
ATOM   2372  C  C      . ALA A  1 164 ? 28.614  -54.413 24.312  1.00 147.15 ? 163 ALA A C      1 
ATOM   2373  O  O      . ALA A  1 164 ? 28.055  -53.361 24.625  1.00 134.90 ? 163 ALA A O      1 
ATOM   2374  C  CB     . ALA A  1 164 ? 28.133  -56.819 24.784  1.00 123.86 ? 163 ALA A CB     1 
ATOM   2375  H  H      . ALA A  1 164 ? 27.475  -54.706 26.550  1.00 146.09 ? 163 ALA A H      1 
ATOM   2376  H  HA     . ALA A  1 164 ? 29.726  -55.714 25.443  1.00 161.71 ? 163 ALA A HA     1 
ATOM   2377  H  HB1    . ALA A  1 164 ? 28.532  -57.034 23.937  1.00 148.63 ? 163 ALA A HB1    1 
ATOM   2378  H  HB2    . ALA A  1 164 ? 28.286  -57.531 25.409  1.00 148.63 ? 163 ALA A HB2    1 
ATOM   2379  H  HB3    . ALA A  1 164 ? 27.190  -56.675 24.675  1.00 148.63 ? 163 ALA A HB3    1 
ATOM   2380  N  N      . ASP A  1 165 ? 29.110  -54.644 23.099  1.00 158.49 ? 164 ASP A N      1 
ATOM   2381  C  CA     . ASP A  1 165 ? 29.042  -53.653 22.031  1.00 146.18 ? 164 ASP A CA     1 
ATOM   2382  C  C      . ASP A  1 165 ? 29.406  -52.268 22.549  1.00 134.60 ? 164 ASP A C      1 
ATOM   2383  O  O      . ASP A  1 165 ? 28.567  -51.369 22.609  1.00 135.18 ? 164 ASP A O      1 
ATOM   2384  C  CB     . ASP A  1 165 ? 27.650  -53.646 21.406  1.00 144.44 ? 164 ASP A CB     1 
ATOM   2385  C  CG     . ASP A  1 165 ? 27.322  -54.955 20.720  1.00 156.53 ? 164 ASP A CG     1 
ATOM   2386  O  OD1    . ASP A  1 165 ? 26.144  -55.365 20.724  1.00 153.71 ? 164 ASP A OD1    1 
ATOM   2387  O  OD2    . ASP A  1 165 ? 28.253  -55.583 20.177  1.00 171.88 ? 164 ASP A OD2    1 
ATOM   2388  H  H      . ASP A  1 165 ? 29.496  -55.377 22.868  1.00 190.19 ? 164 ASP A H      1 
ATOM   2389  H  HA     . ASP A  1 165 ? 29.686  -53.893 21.332  1.00 175.42 ? 164 ASP A HA     1 
ATOM   2390  H  HB2    . ASP A  1 165 ? 26.990  -53.497 22.102  1.00 173.33 ? 164 ASP A HB2    1 
ATOM   2391  H  HB3    . ASP A  1 165 ? 27.602  -52.938 20.744  1.00 173.33 ? 164 ASP A HB3    1 
ATOM   2392  N  N      . PHE A  1 166 ? 30.671  -52.111 22.919  1.00 129.43 ? 165 PHE A N      1 
ATOM   2393  C  CA     . PHE A  1 166 ? 31.162  -50.866 23.488  1.00 124.60 ? 165 PHE A CA     1 
ATOM   2394  C  C      . PHE A  1 166 ? 31.216  -49.762 22.446  1.00 118.38 ? 165 PHE A C      1 
ATOM   2395  O  O      . PHE A  1 166 ? 31.373  -50.023 21.254  1.00 135.76 ? 165 PHE A O      1 
ATOM   2396  C  CB     . PHE A  1 166 ? 32.570  -51.066 24.047  1.00 137.08 ? 165 PHE A CB     1 
ATOM   2397  C  CG     . PHE A  1 166 ? 32.609  -51.748 25.383  1.00 147.27 ? 165 PHE A CG     1 
ATOM   2398  C  CD1    . PHE A  1 166 ? 33.438  -51.273 26.383  1.00 153.90 ? 165 PHE A CD1    1 
ATOM   2399  C  CD2    . PHE A  1 166 ? 31.823  -52.860 25.643  1.00 149.95 ? 165 PHE A CD2    1 
ATOM   2400  C  CE1    . PHE A  1 166 ? 33.488  -51.891 27.614  1.00 162.78 ? 165 PHE A CE1    1 
ATOM   2401  C  CE2    . PHE A  1 166 ? 31.867  -53.483 26.875  1.00 152.58 ? 165 PHE A CE2    1 
ATOM   2402  C  CZ     . PHE A  1 166 ? 32.701  -52.997 27.862  1.00 162.00 ? 165 PHE A CZ     1 
ATOM   2403  H  H      . PHE A  1 166 ? 31.273  -52.722 22.850  1.00 155.32 ? 165 PHE A H      1 
ATOM   2404  H  HA     . PHE A  1 166 ? 30.573  -50.581 24.217  1.00 149.52 ? 165 PHE A HA     1 
ATOM   2405  H  HB2    . PHE A  1 166 ? 33.079  -51.608 23.423  1.00 164.50 ? 165 PHE A HB2    1 
ATOM   2406  H  HB3    . PHE A  1 166 ? 32.992  -50.198 24.146  1.00 164.50 ? 165 PHE A HB3    1 
ATOM   2407  H  HD1    . PHE A  1 166 ? 33.972  -50.528 26.222  1.00 184.68 ? 165 PHE A HD1    1 
ATOM   2408  H  HD2    . PHE A  1 166 ? 31.261  -53.191 24.980  1.00 179.94 ? 165 PHE A HD2    1 
ATOM   2409  H  HE1    . PHE A  1 166 ? 34.049  -51.561 28.278  1.00 195.34 ? 165 PHE A HE1    1 
ATOM   2410  H  HE2    . PHE A  1 166 ? 31.336  -54.228 27.040  1.00 183.09 ? 165 PHE A HE2    1 
ATOM   2411  H  HZ     . PHE A  1 166 ? 32.732  -53.414 28.693  1.00 194.39 ? 165 PHE A HZ     1 
ATOM   2412  N  N      . GLY A  1 167 ? 31.084  -48.524 22.906  1.00 106.78 ? 166 GLY A N      1 
ATOM   2413  C  CA     . GLY A  1 167 ? 31.413  -47.377 22.087  1.00 115.99 ? 166 GLY A CA     1 
ATOM   2414  C  C      . GLY A  1 167 ? 32.917  -47.197 22.137  1.00 134.97 ? 166 GLY A C      1 
ATOM   2415  O  O      . GLY A  1 167 ? 33.577  -47.765 23.008  1.00 150.14 ? 166 GLY A O      1 
ATOM   2416  H  H      . GLY A  1 167 ? 30.804  -48.325 23.695  1.00 128.13 ? 166 GLY A H      1 
ATOM   2417  H  HA2    . GLY A  1 167 ? 31.135  -47.525 21.169  1.00 139.19 ? 166 GLY A HA2    1 
ATOM   2418  H  HA3    . GLY A  1 167 ? 30.980  -46.579 22.430  1.00 139.19 ? 166 GLY A HA3    1 
ATOM   2419  N  N      . VAL A  1 168 ? 33.469  -46.420 21.212  1.00 135.35 ? 167 VAL A N      1 
ATOM   2420  C  CA     . VAL A  1 168 ? 34.913  -46.215 21.169  1.00 133.98 ? 167 VAL A CA     1 
ATOM   2421  C  C      . VAL A  1 168 ? 35.254  -44.731 21.252  1.00 136.45 ? 167 VAL A C      1 
ATOM   2422  O  O      . VAL A  1 168 ? 34.522  -43.884 20.740  1.00 123.55 ? 167 VAL A O      1 
ATOM   2423  C  CB     . VAL A  1 168 ? 35.536  -46.834 19.896  1.00 124.25 ? 167 VAL A CB     1 
ATOM   2424  C  CG1    . VAL A  1 168 ? 34.573  -47.831 19.266  1.00 119.53 ? 167 VAL A CG1    1 
ATOM   2425  C  CG2    . VAL A  1 168 ? 35.926  -45.753 18.896  1.00 126.22 ? 167 VAL A CG2    1 
ATOM   2426  H  H      . VAL A  1 168 ? 33.032  -46.001 20.600  1.00 162.42 ? 167 VAL A H      1 
ATOM   2427  H  HA     . VAL A  1 168 ? 35.316  -46.658 21.944  1.00 160.78 ? 167 VAL A HA     1 
ATOM   2428  H  HB     . VAL A  1 168 ? 36.350  -47.319 20.147  1.00 149.10 ? 167 VAL A HB     1 
ATOM   2429  H  HG11   . VAL A  1 168 ? 34.979  -48.203 18.480  1.00 143.43 ? 167 VAL A HG11   1 
ATOM   2430  H  HG12   . VAL A  1 168 ? 34.387  -48.529 19.899  1.00 143.43 ? 167 VAL A HG12   1 
ATOM   2431  H  HG13   . VAL A  1 168 ? 33.761  -47.376 19.032  1.00 143.43 ? 167 VAL A HG13   1 
ATOM   2432  H  HG21   . VAL A  1 168 ? 36.309  -46.170 18.120  1.00 151.46 ? 167 VAL A HG21   1 
ATOM   2433  H  HG22   . VAL A  1 168 ? 35.141  -45.259 18.649  1.00 151.46 ? 167 VAL A HG22   1 
ATOM   2434  H  HG23   . VAL A  1 168 ? 36.568  -45.167 19.304  1.00 151.46 ? 167 VAL A HG23   1 
ATOM   2435  N  N      . ALA A  1 169 ? 36.370  -44.427 21.906  1.00 145.42 ? 168 ALA A N      1 
ATOM   2436  C  CA     . ALA A  1 169 ? 36.797  -43.047 22.101  1.00 144.76 ? 168 ALA A CA     1 
ATOM   2437  C  C      . ALA A  1 169 ? 36.863  -42.294 20.777  1.00 145.69 ? 168 ALA A C      1 
ATOM   2438  O  O      . ALA A  1 169 ? 37.495  -42.747 19.824  1.00 151.90 ? 168 ALA A O      1 
ATOM   2439  C  CB     . ALA A  1 169 ? 38.150  -43.010 22.797  1.00 144.99 ? 168 ALA A CB     1 
ATOM   2440  H  H      . ALA A  1 169 ? 36.903  -45.008 22.250  1.00 174.50 ? 168 ALA A H      1 
ATOM   2441  H  HA     . ALA A  1 169 ? 36.148  -42.591 22.677  1.00 173.71 ? 168 ALA A HA     1 
ATOM   2442  H  HB1    . ALA A  1 169 ? 38.414  -42.095 22.917  1.00 173.99 ? 168 ALA A HB1    1 
ATOM   2443  H  HB2    . ALA A  1 169 ? 38.074  -43.444 23.650  1.00 173.99 ? 168 ALA A HB2    1 
ATOM   2444  H  HB3    . ALA A  1 169 ? 38.793  -43.469 22.252  1.00 173.99 ? 168 ALA A HB3    1 
ATOM   2445  N  N      . GLY A  1 170 ? 36.202  -41.141 20.729  1.00 143.23 ? 169 GLY A N      1 
ATOM   2446  C  CA     . GLY A  1 170 ? 36.217  -40.296 19.550  1.00 139.99 ? 169 GLY A CA     1 
ATOM   2447  C  C      . GLY A  1 170 ? 35.224  -40.743 18.495  1.00 142.60 ? 169 GLY A C      1 
ATOM   2448  O  O      . GLY A  1 170 ? 35.370  -40.411 17.320  1.00 153.32 ? 169 GLY A O      1 
ATOM   2449  H  H      . GLY A  1 170 ? 35.732  -40.826 21.376  1.00 171.87 ? 169 GLY A H      1 
ATOM   2450  H  HA2    . GLY A  1 170 ? 36.004  -39.385 19.804  1.00 167.99 ? 169 GLY A HA2    1 
ATOM   2451  H  HA3    . GLY A  1 170 ? 37.105  -40.306 19.158  1.00 167.99 ? 169 GLY A HA3    1 
ATOM   2452  N  N      . GLN A  1 171 ? 34.207  -41.492 18.913  1.00 140.47 ? 170 GLN A N      1 
ATOM   2453  C  CA     . GLN A  1 171 ? 33.210  -42.009 17.980  1.00 142.91 ? 170 GLN A CA     1 
ATOM   2454  C  C      . GLN A  1 171 ? 32.240  -40.923 17.527  1.00 148.30 ? 170 GLN A C      1 
ATOM   2455  O  O      . GLN A  1 171 ? 31.368  -41.174 16.696  1.00 154.29 ? 170 GLN A O      1 
ATOM   2456  C  CB     . GLN A  1 171 ? 32.430  -43.174 18.602  1.00 145.10 ? 170 GLN A CB     1 
ATOM   2457  C  CG     . GLN A  1 171 ? 31.546  -42.798 19.784  1.00 142.07 ? 170 GLN A CG     1 
ATOM   2458  C  CD     . GLN A  1 171 ? 30.684  -43.957 20.252  1.00 134.05 ? 170 GLN A CD     1 
ATOM   2459  O  OE1    . GLN A  1 171 ? 31.153  -45.091 20.358  1.00 118.87 ? 170 GLN A OE1    1 
ATOM   2460  N  NE2    . GLN A  1 171 ? 29.412  -43.679 20.519  1.00 132.77 ? 170 GLN A NE2    1 
ATOM   2461  H  H      . GLN A  1 171 ? 34.072  -41.715 19.732  1.00 168.57 ? 170 GLN A H      1 
ATOM   2462  H  HA     . GLN A  1 171 ? 33.670  -42.349 17.185  1.00 171.49 ? 170 GLN A HA     1 
ATOM   2463  H  HB2    . GLN A  1 171 ? 31.858  -43.560 17.920  1.00 174.12 ? 170 GLN A HB2    1 
ATOM   2464  H  HB3    . GLN A  1 171 ? 33.064  -43.840 18.910  1.00 174.12 ? 170 GLN A HB3    1 
ATOM   2465  H  HG2    . GLN A  1 171 ? 32.108  -42.523 20.525  1.00 170.49 ? 170 GLN A HG2    1 
ATOM   2466  H  HG3    . GLN A  1 171 ? 30.959  -42.072 19.523  1.00 170.49 ? 170 GLN A HG3    1 
ATOM   2467  H  HE21   . GLN A  1 171 ? 29.118  -42.877 20.423  1.00 159.32 ? 170 GLN A HE21   1 
ATOM   2468  H  HE22   . GLN A  1 171 ? 28.883  -44.302 20.788  1.00 159.32 ? 170 GLN A HE22   1 
ATOM   2469  N  N      . LEU A  1 172 ? 32.389  -39.720 18.073  1.00 153.43 ? 171 LEU A N      1 
ATOM   2470  C  CA     . LEU A  1 172 ? 31.550  -38.594 17.678  1.00 149.97 ? 171 LEU A CA     1 
ATOM   2471  C  C      . LEU A  1 172 ? 32.235  -37.734 16.622  1.00 156.81 ? 171 LEU A C      1 
ATOM   2472  O  O      . LEU A  1 172 ? 31.592  -37.256 15.690  1.00 158.45 ? 171 LEU A O      1 
ATOM   2473  C  CB     . LEU A  1 172 ? 31.204  -37.733 18.893  1.00 145.28 ? 171 LEU A CB     1 
ATOM   2474  C  CG     . LEU A  1 172 ? 30.273  -38.363 19.927  1.00 141.35 ? 171 LEU A CG     1 
ATOM   2475  C  CD1    . LEU A  1 172 ? 30.112  -37.430 21.118  1.00 136.05 ? 171 LEU A CD1    1 
ATOM   2476  C  CD2    . LEU A  1 172 ? 28.919  -38.689 19.317  1.00 140.59 ? 171 LEU A CD2    1 
ATOM   2477  H  H      . LEU A  1 172 ? 32.970  -39.529 18.677  1.00 184.11 ? 171 LEU A H      1 
ATOM   2478  H  HA     . LEU A  1 172 ? 30.713  -38.935 17.298  1.00 179.97 ? 171 LEU A HA     1 
ATOM   2479  H  HB2    . LEU A  1 172 ? 32.030  -37.506 19.349  1.00 174.33 ? 171 LEU A HB2    1 
ATOM   2480  H  HB3    . LEU A  1 172 ? 30.777  -36.921 18.578  1.00 174.33 ? 171 LEU A HB3    1 
ATOM   2481  H  HG     . LEU A  1 172 ? 30.666  -39.191 20.245  1.00 169.62 ? 171 LEU A HG     1 
ATOM   2482  H  HD11   . LEU A  1 172 ? 29.526  -37.840 21.758  1.00 163.26 ? 171 LEU A HD11   1 
ATOM   2483  H  HD12   . LEU A  1 172 ? 30.974  -37.278 21.513  1.00 163.26 ? 171 LEU A HD12   1 
ATOM   2484  H  HD13   . LEU A  1 172 ? 29.739  -36.599 20.815  1.00 163.26 ? 171 LEU A HD13   1 
ATOM   2485  H  HD21   . LEU A  1 172 ? 28.359  -39.082 19.990  1.00 168.71 ? 171 LEU A HD21   1 
ATOM   2486  H  HD22   . LEU A  1 172 ? 28.520  -37.878 18.991  1.00 168.71 ? 171 LEU A HD22   1 
ATOM   2487  H  HD23   . LEU A  1 172 ? 29.044  -39.307 18.593  1.00 168.71 ? 171 LEU A HD23   1 
ATOM   2488  N  N      . THR A  1 173 ? 33.541  -37.542 16.771  1.00 164.68 ? 172 THR A N      1 
ATOM   2489  C  CA     . THR A  1 173 ? 34.294  -36.676 15.872  1.00 178.65 ? 172 THR A CA     1 
ATOM   2490  C  C      . THR A  1 173 ? 35.201  -37.486 14.952  1.00 191.32 ? 172 THR A C      1 
ATOM   2491  O  O      . THR A  1 173 ? 36.372  -37.148 14.776  1.00 190.42 ? 172 THR A O      1 
ATOM   2492  C  CB     . THR A  1 173 ? 35.164  -35.683 16.663  1.00 183.58 ? 172 THR A CB     1 
ATOM   2493  O  OG1    . THR A  1 173 ? 36.206  -36.393 17.343  1.00 186.72 ? 172 THR A OG1    1 
ATOM   2494  C  CG2    . THR A  1 173 ? 34.323  -34.922 17.679  1.00 188.67 ? 172 THR A CG2    1 
ATOM   2495  H  H      . THR A  1 173 ? 34.017  -37.904 17.389  1.00 197.62 ? 172 THR A H      1 
ATOM   2496  H  HA     . THR A  1 173 ? 33.669  -36.165 15.316  1.00 214.39 ? 172 THR A HA     1 
ATOM   2497  H  HB     . THR A  1 173 ? 35.558  -35.042 16.050  1.00 220.29 ? 172 THR A HB     1 
ATOM   2498  H  HG1    . THR A  1 173 ? 36.673  -35.868 17.767  1.00 224.06 ? 172 THR A HG1    1 
ATOM   2499  H  HG21   . THR A  1 173 ? 34.875  -34.306 18.166  1.00 226.40 ? 172 THR A HG21   1 
ATOM   2500  H  HG22   . THR A  1 173 ? 33.630  -34.432 17.230  1.00 226.40 ? 172 THR A HG22   1 
ATOM   2501  H  HG23   . THR A  1 173 ? 33.920  -35.536 18.297  1.00 226.40 ? 172 THR A HG23   1 
ATOM   2502  N  N      . ASP A  1 174 ? 34.660  -38.550 14.365  1.00 205.34 ? 173 ASP A N      1 
ATOM   2503  C  CA     . ASP A  1 174 ? 35.448  -39.423 13.499  1.00 222.13 ? 173 ASP A CA     1 
ATOM   2504  C  C      . ASP A  1 174 ? 35.001  -39.334 12.039  1.00 226.54 ? 173 ASP A C      1 
ATOM   2505  O  O      . ASP A  1 174 ? 34.685  -40.346 11.414  1.00 219.78 ? 173 ASP A O      1 
ATOM   2506  C  CB     . ASP A  1 174 ? 35.370  -40.871 13.989  1.00 230.93 ? 173 ASP A CB     1 
ATOM   2507  C  CG     . ASP A  1 174 ? 36.613  -41.668 13.648  1.00 242.51 ? 173 ASP A CG     1 
ATOM   2508  O  OD1    . ASP A  1 174 ? 37.237  -41.382 12.605  1.00 251.36 ? 173 ASP A OD1    1 
ATOM   2509  O  OD2    . ASP A  1 174 ? 36.970  -42.577 14.428  1.00 240.49 ? 173 ASP A OD2    1 
ATOM   2510  H  H      . ASP A  1 174 ? 33.839  -38.789 14.453  1.00 246.40 ? 173 ASP A H      1 
ATOM   2511  H  HA     . ASP A  1 174 ? 36.386  -39.143 13.541  1.00 266.55 ? 173 ASP A HA     1 
ATOM   2512  H  HB2    . ASP A  1 174 ? 35.267  -40.874 14.954  1.00 277.11 ? 173 ASP A HB2    1 
ATOM   2513  H  HB3    . ASP A  1 174 ? 34.610  -41.306 13.572  1.00 277.11 ? 173 ASP A HB3    1 
ATOM   2514  N  N      . THR A  1 175 ? 34.974  -38.112 11.513  1.00 232.70 ? 174 THR A N      1 
ATOM   2515  C  CA     . THR A  1 175 ? 34.733  -37.862 10.090  1.00 233.72 ? 174 THR A CA     1 
ATOM   2516  C  C      . THR A  1 175 ? 33.246  -37.819 9.719   1.00 232.18 ? 174 THR A C      1 
ATOM   2517  O  O      . THR A  1 175 ? 32.620  -36.762 9.798   1.00 232.76 ? 174 THR A O      1 
ATOM   2518  C  CB     . THR A  1 175 ? 35.471  -38.881 9.191   1.00 235.82 ? 174 THR A CB     1 
ATOM   2519  O  OG1    . THR A  1 175 ? 36.851  -38.950 9.573   1.00 237.14 ? 174 THR A OG1    1 
ATOM   2520  C  CG2    . THR A  1 175 ? 35.376  -38.470 7.732   1.00 233.59 ? 174 THR A CG2    1 
ATOM   2521  H  H      . THR A  1 175 ? 35.094  -37.394 11.970  1.00 279.24 ? 174 THR A H      1 
ATOM   2522  H  HA     . THR A  1 175 ? 35.102  -36.979 9.877   1.00 280.47 ? 174 THR A HA     1 
ATOM   2523  H  HB     . THR A  1 175 ? 35.064  -39.756 9.292   1.00 282.99 ? 174 THR A HB     1 
ATOM   2524  H  HG1    . THR A  1 175 ? 37.246  -39.490 9.099   1.00 284.57 ? 174 THR A HG1    1 
ATOM   2525  H  HG21   . THR A  1 175 ? 35.836  -39.107 7.181   1.00 280.31 ? 174 THR A HG21   1 
ATOM   2526  H  HG22   . THR A  1 175 ? 34.455  -38.431 7.462   1.00 280.31 ? 174 THR A HG22   1 
ATOM   2527  H  HG23   . THR A  1 175 ? 35.774  -37.605 7.609   1.00 280.31 ? 174 THR A HG23   1 
ATOM   2528  N  N      . MET A  1 176 ? 32.682  -38.955 9.313   1.00 231.88 ? 175 MET A N      1 
ATOM   2529  C  CA     . MET A  1 176 ? 31.321  -38.966 8.780   1.00 235.05 ? 175 MET A CA     1 
ATOM   2530  C  C      . MET A  1 176 ? 30.540  -40.238 9.117   1.00 249.27 ? 175 MET A C      1 
ATOM   2531  O  O      . MET A  1 176 ? 29.377  -40.165 9.510   1.00 250.85 ? 175 MET A O      1 
ATOM   2532  C  CB     . MET A  1 176 ? 31.351  -38.770 7.260   1.00 230.55 ? 175 MET A CB     1 
ATOM   2533  C  CG     . MET A  1 176 ? 32.058  -39.882 6.498   1.00 231.03 ? 175 MET A CG     1 
ATOM   2534  S  SD     . MET A  1 176 ? 32.120  -39.592 4.717   1.00 321.41 ? 175 MET A SD     1 
ATOM   2535  C  CE     . MET A  1 176 ? 33.183  -38.153 4.629   1.00 155.71 ? 175 MET A CE     1 
ATOM   2536  H  H      . MET A  1 176 ? 33.062  -39.726 9.335   1.00 278.26 ? 175 MET A H      1 
ATOM   2537  H  HA     . MET A  1 176 ? 30.838  -38.203 9.161   1.00 282.06 ? 175 MET A HA     1 
ATOM   2538  H  HB2    . MET A  1 176 ? 30.439  -38.724 6.935   1.00 276.66 ? 175 MET A HB2    1 
ATOM   2539  H  HB3    . MET A  1 176 ? 31.811  -37.939 7.063   1.00 276.66 ? 175 MET A HB3    1 
ATOM   2540  H  HG2    . MET A  1 176 ? 32.970  -39.955 6.820   1.00 277.24 ? 175 MET A HG2    1 
ATOM   2541  H  HG3    . MET A  1 176 ? 31.587  -40.716 6.648   1.00 277.24 ? 175 MET A HG3    1 
ATOM   2542  H  HE1    . MET A  1 176 ? 33.291  -37.901 3.709   1.00 186.85 ? 175 MET A HE1    1 
ATOM   2543  H  HE2    . MET A  1 176 ? 32.778  -37.435 5.121   1.00 186.85 ? 175 MET A HE2    1 
ATOM   2544  H  HE3    . MET A  1 176 ? 34.036  -38.371 5.012   1.00 186.85 ? 175 MET A HE3    1 
ATOM   2545  N  N      . ALA A  1 177 ? 31.170  -41.398 8.959   1.00 160.62 ? 176 ALA A N      1 
ATOM   2546  C  CA     . ALA A  1 177 ? 30.484  -42.671 9.173   1.00 166.18 ? 176 ALA A CA     1 
ATOM   2547  C  C      . ALA A  1 177 ? 29.929  -42.783 10.591  1.00 162.80 ? 176 ALA A C      1 
ATOM   2548  O  O      . ALA A  1 177 ? 28.734  -43.019 10.780  1.00 266.06 ? 176 ALA A O      1 
ATOM   2549  C  CB     . ALA A  1 177 ? 31.420  -43.831 8.880   1.00 174.37 ? 176 ALA A CB     1 
ATOM   2550  H  H      . ALA A  1 177 ? 31.994  -41.477 8.727   1.00 192.74 ? 176 ALA A H      1 
ATOM   2551  H  HA     . ALA A  1 177 ? 29.729  -42.731 8.551   1.00 199.42 ? 176 ALA A HA     1 
ATOM   2552  H  HB1    . ALA A  1 177 ? 30.951  -44.656 9.027   1.00 209.25 ? 176 ALA A HB1    1 
ATOM   2553  H  HB2    . ALA A  1 177 ? 31.708  -43.777 7.966   1.00 209.25 ? 176 ALA A HB2    1 
ATOM   2554  H  HB3    . ALA A  1 177 ? 32.178  -43.777 9.467   1.00 209.25 ? 176 ALA A HB3    1 
ATOM   2555  N  N      . LYS A  1 178 ? 30.797  -42.618 11.583  1.00 218.52 ? 177 LYS A N      1 
ATOM   2556  C  CA     . LYS A  1 178 ? 30.384  -42.704 12.980  1.00 210.86 ? 177 LYS A CA     1 
ATOM   2557  C  C      . LYS A  1 178 ? 30.073  -41.329 13.566  1.00 214.10 ? 177 LYS A C      1 
ATOM   2558  O  O      . LYS A  1 178 ? 29.524  -41.222 14.662  1.00 220.83 ? 177 LYS A O      1 
ATOM   2559  C  CB     . LYS A  1 178 ? 31.453  -43.409 13.814  1.00 204.25 ? 177 LYS A CB     1 
ATOM   2560  C  CG     . LYS A  1 178 ? 31.484  -44.918 13.612  1.00 202.42 ? 177 LYS A CG     1 
ATOM   2561  C  CD     . LYS A  1 178 ? 32.566  -45.580 14.451  1.00 202.71 ? 177 LYS A CD     1 
ATOM   2562  C  CE     . LYS A  1 178 ? 32.307  -45.395 15.936  1.00 200.27 ? 177 LYS A CE     1 
ATOM   2563  N  NZ     . LYS A  1 178 ? 33.402  -45.944 16.777  1.00 196.88 ? 177 LYS A NZ     1 
ATOM   2564  H  H      . LYS A  1 178 ? 31.634  -42.453 11.474  1.00 262.22 ? 177 LYS A H      1 
ATOM   2565  H  HA     . LYS A  1 178 ? 29.565  -43.241 13.031  1.00 253.03 ? 177 LYS A HA     1 
ATOM   2566  H  HB2    . LYS A  1 178 ? 32.323  -43.058 13.570  1.00 245.10 ? 177 LYS A HB2    1 
ATOM   2567  H  HB3    . LYS A  1 178 ? 31.280  -43.239 14.753  1.00 245.10 ? 177 LYS A HB3    1 
ATOM   2568  H  HG2    . LYS A  1 178 ? 30.628  -45.293 13.871  1.00 242.91 ? 177 LYS A HG2    1 
ATOM   2569  H  HG3    . LYS A  1 178 ? 31.665  -45.111 12.678  1.00 242.91 ? 177 LYS A HG3    1 
ATOM   2570  H  HD2    . LYS A  1 178 ? 32.582  -46.531 14.261  1.00 243.25 ? 177 LYS A HD2    1 
ATOM   2571  H  HD3    . LYS A  1 178 ? 33.424  -45.180 14.240  1.00 243.25 ? 177 LYS A HD3    1 
ATOM   2572  H  HE2    . LYS A  1 178 ? 32.226  -44.448 16.128  1.00 240.32 ? 177 LYS A HE2    1 
ATOM   2573  H  HE3    . LYS A  1 178 ? 31.486  -45.854 16.174  1.00 240.32 ? 177 LYS A HE3    1 
ATOM   2574  H  HZ1    . LYS A  1 178 ? 33.216  -45.818 17.638  1.00 236.26 ? 177 LYS A HZ1    1 
ATOM   2575  H  HZ2    . LYS A  1 178 ? 33.494  -46.816 16.625  1.00 236.26 ? 177 LYS A HZ2    1 
ATOM   2576  H  HZ3    . LYS A  1 178 ? 34.168  -45.535 16.584  1.00 236.26 ? 177 LYS A HZ3    1 
ATOM   2577  N  N      . ARG A  1 179 ? 30.419  -40.279 12.829  1.00 214.93 ? 178 ARG A N      1 
ATOM   2578  C  CA     . ARG A  1 179 ? 30.049  -38.921 13.209  1.00 215.23 ? 178 ARG A CA     1 
ATOM   2579  C  C      . ARG A  1 179 ? 28.622  -38.630 12.750  1.00 210.08 ? 178 ARG A C      1 
ATOM   2580  O  O      . ARG A  1 179 ? 28.152  -37.496 12.827  1.00 213.64 ? 178 ARG A O      1 
ATOM   2581  C  CB     . ARG A  1 179 ? 31.023  -37.915 12.586  1.00 221.72 ? 178 ARG A CB     1 
ATOM   2582  C  CG     . ARG A  1 179 ? 30.738  -36.456 12.922  1.00 225.25 ? 178 ARG A CG     1 
ATOM   2583  C  CD     . ARG A  1 179 ? 31.956  -35.581 12.662  1.00 230.18 ? 178 ARG A CD     1 
ATOM   2584  N  NE     . ARG A  1 179 ? 31.852  -34.279 13.314  1.00 235.42 ? 178 ARG A NE     1 
ATOM   2585  C  CZ     . ARG A  1 179 ? 32.846  -33.399 13.397  1.00 232.56 ? 178 ARG A CZ     1 
ATOM   2586  N  NH1    . ARG A  1 179 ? 34.033  -33.675 12.873  1.00 234.90 ? 178 ARG A NH1    1 
ATOM   2587  N  NH2    . ARG A  1 179 ? 32.656  -32.241 14.010  1.00 224.16 ? 178 ARG A NH2    1 
ATOM   2588  H  H      . ARG A  1 179 ? 30.871  -40.327 12.099  1.00 257.92 ? 178 ARG A H      1 
ATOM   2589  H  HA     . ARG A  1 179 ? 30.089  -38.830 14.184  1.00 258.27 ? 178 ARG A HA     1 
ATOM   2590  H  HB2    . ARG A  1 179 ? 31.919  -38.119 12.898  1.00 266.07 ? 178 ARG A HB2    1 
ATOM   2591  H  HB3    . ARG A  1 179 ? 30.986  -38.006 11.621  1.00 266.07 ? 178 ARG A HB3    1 
ATOM   2592  H  HG2    . ARG A  1 179 ? 30.009  -36.135 12.368  1.00 270.30 ? 178 ARG A HG2    1 
ATOM   2593  H  HG3    . ARG A  1 179 ? 30.506  -36.382 13.861  1.00 270.30 ? 178 ARG A HG3    1 
ATOM   2594  H  HD2    . ARG A  1 179 ? 32.747  -36.028 13.003  1.00 276.21 ? 178 ARG A HD2    1 
ATOM   2595  H  HD3    . ARG A  1 179 ? 32.043  -35.434 11.707  1.00 276.21 ? 178 ARG A HD3    1 
ATOM   2596  H  HE     . ARG A  1 179 ? 31.098  -34.067 13.669  1.00 282.50 ? 178 ARG A HE     1 
ATOM   2597  H  HH11   . ARG A  1 179 ? 34.162  -34.426 12.474  1.00 281.88 ? 178 ARG A HH11   1 
ATOM   2598  H  HH12   . ARG A  1 179 ? 34.672  -33.103 12.930  1.00 281.88 ? 178 ARG A HH12   1 
ATOM   2599  H  HH21   . ARG A  1 179 ? 31.889  -32.056 14.353  1.00 268.99 ? 178 ARG A HH21   1 
ATOM   2600  H  HH22   . ARG A  1 179 ? 33.299  -31.672 14.065  1.00 268.99 ? 178 ARG A HH22   1 
ATOM   2601  N  N      . ASN A  1 180 ? 27.937  -39.667 12.274  1.00 196.50 ? 179 ASN A N      1 
ATOM   2602  C  CA     . ASN A  1 180 ? 26.599  -39.516 11.714  1.00 178.53 ? 179 ASN A CA     1 
ATOM   2603  C  C      . ASN A  1 180 ? 25.638  -40.635 12.133  1.00 145.21 ? 179 ASN A C      1 
ATOM   2604  O  O      . ASN A  1 180 ? 24.433  -40.409 12.248  1.00 133.23 ? 179 ASN A O      1 
ATOM   2605  C  CB     . ASN A  1 180 ? 26.699  -39.449 10.188  1.00 182.55 ? 179 ASN A CB     1 
ATOM   2606  C  CG     . ASN A  1 180 ? 25.460  -38.869 9.541   1.00 184.59 ? 179 ASN A CG     1 
ATOM   2607  O  OD1    . ASN A  1 180 ? 24.489  -38.523 10.216  1.00 190.54 ? 179 ASN A OD1    1 
ATOM   2608  N  ND2    . ASN A  1 180 ? 25.495  -38.741 8.220   1.00 180.99 ? 179 ASN A ND2    1 
ATOM   2609  H  H      . ASN A  1 180 ? 28.229  -40.476 12.265  1.00 235.80 ? 179 ASN A H      1 
ATOM   2610  H  HA     . ASN A  1 180 ? 26.222  -38.667 12.026  1.00 214.24 ? 179 ASN A HA     1 
ATOM   2611  H  HB2    . ASN A  1 180 ? 27.453  -38.890 9.945   1.00 219.06 ? 179 ASN A HB2    1 
ATOM   2612  H  HB3    . ASN A  1 180 ? 26.826  -40.346 9.840   1.00 219.06 ? 179 ASN A HB3    1 
ATOM   2613  H  HD21   . ASN A  1 180 ? 26.196  -38.983 7.784   1.00 217.19 ? 179 ASN A HD21   1 
ATOM   2614  H  HD22   . ASN A  1 180 ? 24.818  -38.417 7.801   1.00 217.19 ? 179 ASN A HD22   1 
ATOM   2615  N  N      . THR A  1 181 ? 26.164  -41.836 12.360  1.00 139.02 ? 180 THR A N      1 
ATOM   2616  C  CA     . THR A  1 181 ? 25.334  -42.968 12.763  1.00 148.02 ? 180 THR A CA     1 
ATOM   2617  C  C      . THR A  1 181 ? 24.888  -42.833 14.218  1.00 147.94 ? 180 THR A C      1 
ATOM   2618  O  O      . THR A  1 181 ? 23.788  -43.252 14.581  1.00 140.79 ? 180 THR A O      1 
ATOM   2619  C  CB     . THR A  1 181 ? 26.082  -44.309 12.593  1.00 157.15 ? 180 THR A CB     1 
ATOM   2620  O  OG1    . THR A  1 181 ? 25.138  -45.384 12.523  1.00 166.25 ? 180 THR A OG1    1 
ATOM   2621  C  CG2    . THR A  1 181 ? 27.044  -44.550 13.752  1.00 153.90 ? 180 THR A CG2    1 
ATOM   2622  H  H      . THR A  1 181 ? 27.001  -42.022 12.287  1.00 166.82 ? 180 THR A H      1 
ATOM   2623  H  HA     . THR A  1 181 ? 24.533  -42.994 12.200  1.00 177.62 ? 180 THR A HA     1 
ATOM   2624  H  HB     . THR A  1 181 ? 26.598  -44.284 11.772  1.00 188.58 ? 180 THR A HB     1 
ATOM   2625  H  HG1    . THR A  1 181 ? 25.532  -46.098 12.432  1.00 199.50 ? 180 THR A HG1    1 
ATOM   2626  H  HG21   . THR A  1 181 ? 27.500  -45.386 13.631  1.00 184.68 ? 180 THR A HG21   1 
ATOM   2627  H  HG22   . THR A  1 181 ? 27.693  -43.843 13.792  1.00 184.68 ? 180 THR A HG22   1 
ATOM   2628  H  HG23   . THR A  1 181 ? 26.559  -44.576 14.580  1.00 184.68 ? 180 THR A HG23   1 
ATOM   2629  N  N      . VAL A  1 182 ? 25.753  -42.255 15.046  1.00 156.94 ? 181 VAL A N      1 
ATOM   2630  C  CA     . VAL A  1 182 ? 25.429  -42.002 16.447  1.00 158.25 ? 181 VAL A CA     1 
ATOM   2631  C  C      . VAL A  1 182 ? 24.414  -40.869 16.555  1.00 140.18 ? 181 VAL A C      1 
ATOM   2632  O  O      . VAL A  1 182 ? 23.521  -40.899 17.401  1.00 147.54 ? 181 VAL A O      1 
ATOM   2633  C  CB     . VAL A  1 182 ? 26.690  -41.631 17.257  1.00 160.72 ? 181 VAL A CB     1 
ATOM   2634  C  CG1    . VAL A  1 182 ? 26.312  -41.096 18.635  1.00 169.01 ? 181 VAL A CG1    1 
ATOM   2635  C  CG2    . VAL A  1 182 ? 27.616  -42.833 17.380  1.00 141.25 ? 181 VAL A CG2    1 
ATOM   2636  H  H      . VAL A  1 182 ? 26.542  -41.997 14.819  1.00 188.33 ? 181 VAL A H      1 
ATOM   2637  H  HA     . VAL A  1 182 ? 25.035  -42.809 16.840  1.00 189.90 ? 181 VAL A HA     1 
ATOM   2638  H  HB     . VAL A  1 182 ? 27.175  -40.924 16.783  1.00 192.86 ? 181 VAL A HB     1 
ATOM   2639  H  HG11   . VAL A  1 182 ? 27.113  -40.875 19.115  1.00 202.81 ? 181 VAL A HG11   1 
ATOM   2640  H  HG12   . VAL A  1 182 ? 25.767  -40.313 18.527  1.00 202.81 ? 181 VAL A HG12   1 
ATOM   2641  H  HG13   . VAL A  1 182 ? 25.823  -41.773 19.109  1.00 202.81 ? 181 VAL A HG13   1 
ATOM   2642  H  HG21   . VAL A  1 182 ? 28.391  -42.580 17.887  1.00 169.50 ? 181 VAL A HG21   1 
ATOM   2643  H  HG22   . VAL A  1 182 ? 27.149  -43.543 17.828  1.00 169.50 ? 181 VAL A HG22   1 
ATOM   2644  H  HG23   . VAL A  1 182 ? 27.878  -43.117 16.501  1.00 169.50 ? 181 VAL A HG23   1 
ATOM   2645  N  N      . ILE A  1 183 ? 24.563  -39.871 15.691  1.00 112.82 ? 182 ILE A N      1 
ATOM   2646  C  CA     . ILE A  1 183 ? 23.638  -38.746 15.639  1.00 131.28 ? 182 ILE A CA     1 
ATOM   2647  C  C      . ILE A  1 183 ? 22.218  -39.212 15.326  1.00 128.96 ? 182 ILE A C      1 
ATOM   2648  O  O      . ILE A  1 183 ? 21.245  -38.641 15.817  1.00 137.57 ? 182 ILE A O      1 
ATOM   2649  C  CB     . ILE A  1 183 ? 24.075  -37.722 14.569  1.00 158.04 ? 182 ILE A CB     1 
ATOM   2650  C  CG1    . ILE A  1 183 ? 25.324  -36.969 15.034  1.00 161.42 ? 182 ILE A CG1    1 
ATOM   2651  C  CG2    . ILE A  1 183 ? 22.953  -36.734 14.271  1.00 167.90 ? 182 ILE A CG2    1 
ATOM   2652  C  CD1    . ILE A  1 183 ? 25.852  -35.975 14.020  1.00 152.37 ? 182 ILE A CD1    1 
ATOM   2653  H  H      . ILE A  1 183 ? 25.202  -39.821 15.117  1.00 135.39 ? 182 ILE A H      1 
ATOM   2654  H  HA     . ILE A  1 183 ? 23.628  -38.295 16.509  1.00 157.54 ? 182 ILE A HA     1 
ATOM   2655  H  HB     . ILE A  1 183 ? 24.289  -38.200 13.753  1.00 189.64 ? 182 ILE A HB     1 
ATOM   2656  H  HG12   . ILE A  1 183 ? 25.111  -36.481 15.844  1.00 193.71 ? 182 ILE A HG12   1 
ATOM   2657  H  HG13   . ILE A  1 183 ? 26.028  -37.612 15.213  1.00 193.71 ? 182 ILE A HG13   1 
ATOM   2658  H  HG21   . ILE A  1 183 ? 23.253  -36.112 13.605  1.00 201.48 ? 182 ILE A HG21   1 
ATOM   2659  H  HG22   . ILE A  1 183 ? 22.189  -37.218 13.948  1.00 201.48 ? 182 ILE A HG22   1 
ATOM   2660  H  HG23   . ILE A  1 183 ? 22.727  -36.266 15.079  1.00 201.48 ? 182 ILE A HG23   1 
ATOM   2661  H  HD11   . ILE A  1 183 ? 26.631  -35.545 14.380  1.00 182.84 ? 182 ILE A HD11   1 
ATOM   2662  H  HD12   . ILE A  1 183 ? 26.080  -36.443 13.213  1.00 182.84 ? 182 ILE A HD12   1 
ATOM   2663  H  HD13   . ILE A  1 183 ? 25.171  -35.322 13.839  1.00 182.84 ? 182 ILE A HD13   1 
ATOM   2664  N  N      . GLY A  1 184 ? 22.107  -40.251 14.506  1.00 125.37 ? 183 GLY A N      1 
ATOM   2665  C  CA     . GLY A  1 184 ? 20.814  -40.746 14.070  1.00 123.29 ? 183 GLY A CA     1 
ATOM   2666  C  C      . GLY A  1 184 ? 19.996  -41.377 15.182  1.00 128.27 ? 183 GLY A C      1 
ATOM   2667  O  O      . GLY A  1 184 ? 18.781  -41.523 15.054  1.00 131.45 ? 183 GLY A O      1 
ATOM   2668  H  H      . GLY A  1 184 ? 22.775  -40.689 14.186  1.00 150.44 ? 183 GLY A H      1 
ATOM   2669  H  HA2    . GLY A  1 184 ? 20.301  -40.012 13.697  1.00 147.95 ? 183 GLY A HA2    1 
ATOM   2670  H  HA3    . GLY A  1 184 ? 20.944  -41.410 13.375  1.00 147.95 ? 183 GLY A HA3    1 
ATOM   2671  N  N      . THR A  1 185 ? 20.660  -41.755 16.271  1.00 138.39 ? 184 THR A N      1 
ATOM   2672  C  CA     . THR A  1 185 ? 19.989  -42.396 17.398  1.00 130.80 ? 184 THR A CA     1 
ATOM   2673  C  C      . THR A  1 185 ? 20.518  -41.845 18.721  1.00 117.26 ? 184 THR A C      1 
ATOM   2674  O  O      . THR A  1 185 ? 21.332  -42.486 19.387  1.00 134.16 ? 184 THR A O      1 
ATOM   2675  C  CB     . THR A  1 185 ? 20.196  -43.918 17.361  1.00 129.35 ? 184 THR A CB     1 
ATOM   2676  O  OG1    . THR A  1 185 ? 19.809  -44.423 16.077  1.00 135.92 ? 184 THR A OG1    1 
ATOM   2677  C  CG2    . THR A  1 185 ? 19.370  -44.600 18.438  1.00 142.85 ? 184 THR A CG2    1 
ATOM   2678  H  H      . THR A  1 185 ? 21.507  -41.650 16.382  1.00 166.06 ? 184 THR A H      1 
ATOM   2679  H  HA     . THR A  1 185 ? 19.028  -42.213 17.350  1.00 156.96 ? 184 THR A HA     1 
ATOM   2680  H  HB     . THR A  1 185 ? 21.131  -44.121 17.519  1.00 155.22 ? 184 THR A HB     1 
ATOM   2681  H  HG1    . THR A  1 185 ? 19.917  -45.235 16.051  1.00 163.11 ? 184 THR A HG1    1 
ATOM   2682  H  HG21   . THR A  1 185 ? 19.508  -45.549 18.404  1.00 171.42 ? 184 THR A HG21   1 
ATOM   2683  H  HG22   . THR A  1 185 ? 19.630  -44.277 19.304  1.00 171.42 ? 184 THR A HG22   1 
ATOM   2684  H  HG23   . THR A  1 185 ? 18.438  -44.415 18.302  1.00 171.42 ? 184 THR A HG23   1 
ATOM   2685  N  N      . PRO A  1 186 ? 20.054  -40.645 19.103  1.00 88.23  ? 185 PRO A N      1 
ATOM   2686  C  CA     . PRO A  1 186 ? 20.549  -39.917 20.274  1.00 107.14 ? 185 PRO A CA     1 
ATOM   2687  C  C      . PRO A  1 186 ? 19.671  -40.059 21.519  1.00 111.47 ? 185 PRO A C      1 
ATOM   2688  O  O      . PRO A  1 186 ? 19.844  -39.298 22.471  1.00 104.16 ? 185 PRO A O      1 
ATOM   2689  C  CB     . PRO A  1 186 ? 20.511  -38.470 19.791  1.00 110.54 ? 185 PRO A CB     1 
ATOM   2690  C  CG     . PRO A  1 186 ? 19.289  -38.429 18.913  1.00 104.22 ? 185 PRO A CG     1 
ATOM   2691  C  CD     . PRO A  1 186 ? 19.148  -39.809 18.295  1.00 91.38  ? 185 PRO A CD     1 
ATOM   2692  H  HA     . PRO A  1 186 ? 21.471  -40.175 20.482  1.00 128.57 ? 185 PRO A HA     1 
ATOM   2693  H  HB2    . PRO A  1 186 ? 20.417  -37.870 20.547  1.00 132.65 ? 185 PRO A HB2    1 
ATOM   2694  H  HB3    . PRO A  1 186 ? 21.312  -38.269 19.282  1.00 132.65 ? 185 PRO A HB3    1 
ATOM   2695  H  HG2    . PRO A  1 186 ? 18.511  -38.219 19.453  1.00 125.07 ? 185 PRO A HG2    1 
ATOM   2696  H  HG3    . PRO A  1 186 ? 19.412  -37.760 18.222  1.00 125.07 ? 185 PRO A HG3    1 
ATOM   2697  H  HD2    . PRO A  1 186 ? 18.234  -40.124 18.378  1.00 109.65 ? 185 PRO A HD2    1 
ATOM   2698  H  HD3    . PRO A  1 186 ? 19.437  -39.796 17.369  1.00 109.65 ? 185 PRO A HD3    1 
ATOM   2699  N  N      . PHE A  1 187 ? 18.754  -41.021 21.517  1.00 115.39 ? 186 PHE A N      1 
ATOM   2700  C  CA     . PHE A  1 187 ? 17.765  -41.133 22.586  1.00 119.08 ? 186 PHE A CA     1 
ATOM   2701  C  C      . PHE A  1 187 ? 18.379  -41.507 23.938  1.00 120.28 ? 186 PHE A C      1 
ATOM   2702  O  O      . PHE A  1 187 ? 17.778  -41.261 24.984  1.00 122.52 ? 186 PHE A O      1 
ATOM   2703  C  CB     . PHE A  1 187 ? 16.684  -42.147 22.202  1.00 116.31 ? 186 PHE A CB     1 
ATOM   2704  C  CG     . PHE A  1 187 ? 16.054  -41.880 20.865  1.00 112.00 ? 186 PHE A CG     1 
ATOM   2705  C  CD1    . PHE A  1 187 ? 16.103  -42.829 19.858  1.00 124.31 ? 186 PHE A CD1    1 
ATOM   2706  C  CD2    . PHE A  1 187 ? 15.424  -40.674 20.610  1.00 115.08 ? 186 PHE A CD2    1 
ATOM   2707  C  CE1    . PHE A  1 187 ? 15.527  -42.582 18.625  1.00 123.27 ? 186 PHE A CE1    1 
ATOM   2708  C  CE2    . PHE A  1 187 ? 14.849  -40.422 19.379  1.00 118.23 ? 186 PHE A CE2    1 
ATOM   2709  C  CZ     . PHE A  1 187 ? 14.900  -41.377 18.386  1.00 118.19 ? 186 PHE A CZ     1 
ATOM   2710  H  H      . PHE A  1 187 ? 18.682  -41.624 20.907  1.00 138.47 ? 186 PHE A H      1 
ATOM   2711  H  HA     . PHE A  1 187 ? 17.327  -40.263 22.694  1.00 142.90 ? 186 PHE A HA     1 
ATOM   2712  H  HB2    . PHE A  1 187 ? 17.081  -43.031 22.172  1.00 139.57 ? 186 PHE A HB2    1 
ATOM   2713  H  HB3    . PHE A  1 187 ? 15.982  -42.124 22.871  1.00 139.57 ? 186 PHE A HB3    1 
ATOM   2714  H  HD1    . PHE A  1 187 ? 16.524  -43.643 20.014  1.00 149.17 ? 186 PHE A HD1    1 
ATOM   2715  H  HD2    . PHE A  1 187 ? 15.386  -40.027 21.277  1.00 138.10 ? 186 PHE A HD2    1 
ATOM   2716  H  HE1    . PHE A  1 187 ? 15.564  -43.228 17.956  1.00 147.92 ? 186 PHE A HE1    1 
ATOM   2717  H  HE2    . PHE A  1 187 ? 14.426  -39.609 19.221  1.00 141.88 ? 186 PHE A HE2    1 
ATOM   2718  H  HZ     . PHE A  1 187 ? 14.513  -41.209 17.557  1.00 141.83 ? 186 PHE A HZ     1 
ATOM   2719  N  N      . TRP A  1 188 ? 19.570  -42.099 23.915  1.00 120.00 ? 187 TRP A N      1 
ATOM   2720  C  CA     . TRP A  1 188 ? 20.236  -42.519 25.145  1.00 109.13 ? 187 TRP A CA     1 
ATOM   2721  C  C      . TRP A  1 188 ? 21.366  -41.567 25.534  1.00 100.77 ? 187 TRP A C      1 
ATOM   2722  O  O      . TRP A  1 188 ? 22.093  -41.819 26.496  1.00 99.03  ? 187 TRP A O      1 
ATOM   2723  C  CB     . TRP A  1 188 ? 20.795  -43.936 24.990  1.00 110.77 ? 187 TRP A CB     1 
ATOM   2724  C  CG     . TRP A  1 188 ? 19.739  -44.999 24.921  1.00 121.67 ? 187 TRP A CG     1 
ATOM   2725  C  CD1    . TRP A  1 188 ? 19.243  -45.730 25.962  1.00 135.82 ? 187 TRP A CD1    1 
ATOM   2726  C  CD2    . TRP A  1 188 ? 19.049  -45.453 23.748  1.00 122.99 ? 187 TRP A CD2    1 
ATOM   2727  N  NE1    . TRP A  1 188 ? 18.288  -46.609 25.510  1.00 129.62 ? 187 TRP A NE1    1 
ATOM   2728  C  CE2    . TRP A  1 188 ? 18.151  -46.458 24.159  1.00 113.86 ? 187 TRP A CE2    1 
ATOM   2729  C  CE3    . TRP A  1 188 ? 19.105  -45.104 22.396  1.00 127.41 ? 187 TRP A CE3    1 
ATOM   2730  C  CZ2    . TRP A  1 188 ? 17.316  -47.119 23.260  1.00 101.27 ? 187 TRP A CZ2    1 
ATOM   2731  C  CZ3    . TRP A  1 188 ? 18.273  -45.763 21.509  1.00 124.31 ? 187 TRP A CZ3    1 
ATOM   2732  C  CH2    . TRP A  1 188 ? 17.391  -46.758 21.945  1.00 118.06 ? 187 TRP A CH2    1 
ATOM   2733  H  H      . TRP A  1 188 ? 20.014  -42.269 23.199  1.00 143.99 ? 187 TRP A H      1 
ATOM   2734  H  HA     . TRP A  1 188 ? 19.583  -42.528 25.875  1.00 130.96 ? 187 TRP A HA     1 
ATOM   2735  H  HB2    . TRP A  1 188 ? 21.313  -43.980 24.171  1.00 132.92 ? 187 TRP A HB2    1 
ATOM   2736  H  HB3    . TRP A  1 188 ? 21.364  -44.133 25.750  1.00 132.92 ? 187 TRP A HB3    1 
ATOM   2737  H  HD1    . TRP A  1 188 ? 19.513  -45.646 26.848  1.00 162.98 ? 187 TRP A HD1    1 
ATOM   2738  H  HE1    . TRP A  1 188 ? 17.849  -47.164 25.998  1.00 155.54 ? 187 TRP A HE1    1 
ATOM   2739  H  HE3    . TRP A  1 188 ? 19.688  -44.444 22.100  1.00 152.89 ? 187 TRP A HE3    1 
ATOM   2740  H  HZ2    . TRP A  1 188 ? 16.728  -47.781 23.545  1.00 121.53 ? 187 TRP A HZ2    1 
ATOM   2741  H  HZ3    . TRP A  1 188 ? 18.301  -45.540 20.607  1.00 149.18 ? 187 TRP A HZ3    1 
ATOM   2742  H  HH2    . TRP A  1 188 ? 16.844  -47.184 21.324  1.00 141.67 ? 187 TRP A HH2    1 
ATOM   2743  N  N      . MET A  1 189 ? 21.510  -40.473 24.793  1.00 82.63  ? 188 MET A N      1 
ATOM   2744  C  CA     . MET A  1 189 ? 22.615  -39.551 25.024  1.00 98.50  ? 188 MET A CA     1 
ATOM   2745  C  C      . MET A  1 189 ? 22.312  -38.579 26.158  1.00 105.52 ? 188 MET A C      1 
ATOM   2746  O  O      . MET A  1 189 ? 21.189  -38.087 26.290  1.00 90.06  ? 188 MET A O      1 
ATOM   2747  C  CB     . MET A  1 189 ? 22.938  -38.777 23.746  1.00 95.31  ? 188 MET A CB     1 
ATOM   2748  C  CG     . MET A  1 189 ? 23.333  -39.664 22.581  1.00 116.19 ? 188 MET A CG     1 
ATOM   2749  S  SD     . MET A  1 189 ? 23.789  -38.729 21.108  1.00 131.52 ? 188 MET A SD     1 
ATOM   2750  C  CE     . MET A  1 189 ? 25.301  -37.945 21.659  1.00 152.65 ? 188 MET A CE     1 
ATOM   2751  H  H      . MET A  1 189 ? 20.983  -40.242 24.154  1.00 99.16  ? 188 MET A H      1 
ATOM   2752  H  HA     . MET A  1 189 ? 23.410  -40.072 25.264  1.00 118.20 ? 188 MET A HA     1 
ATOM   2753  H  HB2    . MET A  1 189 ? 22.154  -38.270 23.481  1.00 114.37 ? 188 MET A HB2    1 
ATOM   2754  H  HB3    . MET A  1 189 ? 23.676  -38.173 23.923  1.00 114.37 ? 188 MET A HB3    1 
ATOM   2755  H  HG2    . MET A  1 189 ? 24.096  -40.204 22.840  1.00 139.43 ? 188 MET A HG2    1 
ATOM   2756  H  HG3    . MET A  1 189 ? 22.584  -40.236 22.352  1.00 139.43 ? 188 MET A HG3    1 
ATOM   2757  H  HE1    . MET A  1 189 ? 25.651  -37.405 20.947  1.00 183.18 ? 188 MET A HE1    1 
ATOM   2758  H  HE2    . MET A  1 189 ? 25.107  -37.395 22.422  1.00 183.18 ? 188 MET A HE2    1 
ATOM   2759  H  HE3    . MET A  1 189 ? 25.936  -38.625 21.898  1.00 183.18 ? 188 MET A HE3    1 
ATOM   2760  N  N      . ALA A  1 190 ? 23.324  -38.311 26.976  1.00 112.47 ? 189 ALA A N      1 
ATOM   2761  C  CA     . ALA A  1 190 ? 23.204  -37.329 28.043  1.00 102.49 ? 189 ALA A CA     1 
ATOM   2762  C  C      . ALA A  1 190 ? 23.288  -35.938 27.433  1.00 104.49 ? 189 ALA A C      1 
ATOM   2763  O  O      . ALA A  1 190 ? 23.830  -35.774 26.342  1.00 97.49  ? 189 ALA A O      1 
ATOM   2764  C  CB     . ALA A  1 190 ? 24.300  -37.529 29.076  1.00 103.94 ? 189 ALA A CB     1 
ATOM   2765  H  H      . ALA A  1 190 ? 24.096  -38.687 26.933  1.00 134.96 ? 189 ALA A H      1 
ATOM   2766  H  HA     . ALA A  1 190 ? 22.334  -37.427 28.485  1.00 122.98 ? 189 ALA A HA     1 
ATOM   2767  H  HB1    . ALA A  1 190 ? 24.200  -36.871 29.768  1.00 124.72 ? 189 ALA A HB1    1 
ATOM   2768  H  HB2    . ALA A  1 190 ? 24.223  -38.411 29.448  1.00 124.72 ? 189 ALA A HB2    1 
ATOM   2769  H  HB3    . ALA A  1 190 ? 25.154  -37.427 28.648  1.00 124.72 ? 189 ALA A HB3    1 
ATOM   2770  N  N      . PRO A  1 191 ? 22.750  -34.930 28.136  1.00 111.10 ? 190 PRO A N      1 
ATOM   2771  C  CA     . PRO A  1 191 ? 22.730  -33.552 27.631  1.00 105.00 ? 190 PRO A CA     1 
ATOM   2772  C  C      . PRO A  1 191 ? 24.120  -33.008 27.319  1.00 106.49 ? 190 PRO A C      1 
ATOM   2773  O  O      . PRO A  1 191 ? 24.313  -32.404 26.264  1.00 110.96 ? 190 PRO A O      1 
ATOM   2774  C  CB     . PRO A  1 191 ? 22.110  -32.765 28.788  1.00 104.95 ? 190 PRO A CB     1 
ATOM   2775  C  CG     . PRO A  1 191 ? 21.336  -33.763 29.560  1.00 105.94 ? 190 PRO A CG     1 
ATOM   2776  C  CD     . PRO A  1 191 ? 22.108  -35.036 29.456  1.00 105.04 ? 190 PRO A CD     1 
ATOM   2777  H  HA     . PRO A  1 191 ? 22.159  -33.481 26.838  1.00 126.00 ? 190 PRO A HA     1 
ATOM   2778  H  HB2    . PRO A  1 191 ? 22.812  -32.378 29.335  1.00 125.94 ? 190 PRO A HB2    1 
ATOM   2779  H  HB3    . PRO A  1 191 ? 21.526  -32.074 28.438  1.00 125.94 ? 190 PRO A HB3    1 
ATOM   2780  H  HG2    . PRO A  1 191 ? 21.268  -33.478 30.485  1.00 127.13 ? 190 PRO A HG2    1 
ATOM   2781  H  HG3    . PRO A  1 191 ? 20.454  -33.865 29.168  1.00 127.13 ? 190 PRO A HG3    1 
ATOM   2782  H  HD2    . PRO A  1 191 ? 22.778  -35.084 30.156  1.00 126.05 ? 190 PRO A HD2    1 
ATOM   2783  H  HD3    . PRO A  1 191 ? 21.510  -35.799 29.482  1.00 126.05 ? 190 PRO A HD3    1 
ATOM   2784  N  N      . GLU A  1 192 ? 25.074  -33.216 28.222  1.00 112.27 ? 191 GLU A N      1 
ATOM   2785  C  CA     . GLU A  1 192 ? 26.405  -32.640 28.050  1.00 111.07 ? 191 GLU A CA     1 
ATOM   2786  C  C      . GLU A  1 192 ? 27.161  -33.288 26.894  1.00 105.95 ? 191 GLU A C      1 
ATOM   2787  O  O      . GLU A  1 192 ? 28.146  -32.739 26.410  1.00 131.28 ? 191 GLU A O      1 
ATOM   2788  C  CB     . GLU A  1 192 ? 27.231  -32.729 29.341  1.00 106.46 ? 191 GLU A CB     1 
ATOM   2789  C  CG     . GLU A  1 192 ? 27.832  -34.091 29.635  1.00 115.38 ? 191 GLU A CG     1 
ATOM   2790  C  CD     . GLU A  1 192 ? 26.846  -35.031 30.294  1.00 121.80 ? 191 GLU A CD     1 
ATOM   2791  O  OE1    . GLU A  1 192 ? 27.232  -36.179 30.603  1.00 123.04 ? 191 GLU A OE1    1 
ATOM   2792  O  OE2    . GLU A  1 192 ? 25.686  -34.617 30.507  1.00 103.02 ? 191 GLU A OE2    1 
ATOM   2793  H  H      . GLU A  1 192 ? 24.979  -33.683 28.937  1.00 134.72 ? 191 GLU A H      1 
ATOM   2794  H  HA     . GLU A  1 192 ? 26.303  -31.689 27.835  1.00 133.29 ? 191 GLU A HA     1 
ATOM   2795  H  HB2    . GLU A  1 192 ? 27.962  -32.094 29.283  1.00 127.75 ? 191 GLU A HB2    1 
ATOM   2796  H  HB3    . GLU A  1 192 ? 26.658  -32.496 30.088  1.00 127.75 ? 191 GLU A HB3    1 
ATOM   2797  H  HG2    . GLU A  1 192 ? 28.122  -34.495 28.803  1.00 138.46 ? 191 GLU A HG2    1 
ATOM   2798  H  HG3    . GLU A  1 192 ? 28.588  -33.981 30.233  1.00 138.46 ? 191 GLU A HG3    1 
ATOM   2799  N  N      . VAL A  1 193 ? 26.701  -34.453 26.454  1.00 105.00 ? 192 VAL A N      1 
ATOM   2800  C  CA     . VAL A  1 193 ? 27.306  -35.119 25.306  1.00 107.77 ? 192 VAL A CA     1 
ATOM   2801  C  C      . VAL A  1 193 ? 26.960  -34.363 24.025  1.00 100.48 ? 192 VAL A C      1 
ATOM   2802  O  O      . VAL A  1 193 ? 27.786  -34.230 23.123  1.00 105.52 ? 192 VAL A O      1 
ATOM   2803  C  CB     . VAL A  1 193 ? 26.823  -36.574 25.191  1.00 100.13 ? 192 VAL A CB     1 
ATOM   2804  C  CG1    . VAL A  1 193 ? 27.431  -37.245 23.970  1.00 83.48  ? 192 VAL A CG1    1 
ATOM   2805  C  CG2    . VAL A  1 193 ? 27.168  -37.344 26.456  1.00 107.39 ? 192 VAL A CG2    1 
ATOM   2806  H  H      . VAL A  1 193 ? 26.040  -34.879 26.802  1.00 126.00 ? 192 VAL A H      1 
ATOM   2807  H  HA     . VAL A  1 193 ? 28.280  -35.124 25.409  1.00 129.32 ? 192 VAL A HA     1 
ATOM   2808  H  HB     . VAL A  1 193 ? 25.849  -36.580 25.087  1.00 120.15 ? 192 VAL A HB     1 
ATOM   2809  H  HG11   . VAL A  1 193 ? 27.115  -38.150 23.922  1.00 100.18 ? 192 VAL A HG11   1 
ATOM   2810  H  HG12   . VAL A  1 193 ? 27.166  -36.762 23.184  1.00 100.18 ? 192 VAL A HG12   1 
ATOM   2811  H  HG13   . VAL A  1 193 ? 28.388  -37.236 24.054  1.00 100.18 ? 192 VAL A HG13   1 
ATOM   2812  H  HG21   . VAL A  1 193 ? 26.859  -38.249 26.365  1.00 128.87 ? 192 VAL A HG21   1 
ATOM   2813  H  HG22   . VAL A  1 193 ? 28.120  -37.334 26.578  1.00 128.87 ? 192 VAL A HG22   1 
ATOM   2814  H  HG23   . VAL A  1 193 ? 26.736  -36.925 27.204  1.00 128.87 ? 192 VAL A HG23   1 
ATOM   2815  N  N      . ILE A  1 194 ? 25.732  -33.861 23.961  1.00 93.72  ? 193 ILE A N      1 
ATOM   2816  C  CA     . ILE A  1 194 ? 25.278  -33.071 22.826  1.00 97.98  ? 193 ILE A CA     1 
ATOM   2817  C  C      . ILE A  1 194 ? 25.928  -31.690 22.810  1.00 103.99 ? 193 ILE A C      1 
ATOM   2818  O  O      . ILE A  1 194 ? 26.202  -31.139 21.745  1.00 125.77 ? 193 ILE A O      1 
ATOM   2819  C  CB     . ILE A  1 194 ? 23.745  -32.903 22.855  1.00 101.45 ? 193 ILE A CB     1 
ATOM   2820  C  CG1    . ILE A  1 194 ? 23.066  -34.247 22.575  1.00 91.51  ? 193 ILE A CG1    1 
ATOM   2821  C  CG2    . ILE A  1 194 ? 23.298  -31.854 21.844  1.00 98.82  ? 193 ILE A CG2    1 
ATOM   2822  C  CD1    . ILE A  1 194 ? 21.554  -34.177 22.511  1.00 92.04  ? 193 ILE A CD1    1 
ATOM   2823  H  H      . ILE A  1 194 ? 25.136  -33.967 24.571  1.00 112.46 ? 193 ILE A H      1 
ATOM   2824  H  HA     . ILE A  1 194 ? 25.519  -33.532 21.996  1.00 117.57 ? 193 ILE A HA     1 
ATOM   2825  H  HB     . ILE A  1 194 ? 23.485  -32.606 23.741  1.00 121.74 ? 193 ILE A HB     1 
ATOM   2826  H  HG12   . ILE A  1 194 ? 23.382  -34.584 21.722  1.00 109.81 ? 193 ILE A HG12   1 
ATOM   2827  H  HG13   . ILE A  1 194 ? 23.303  -34.868 23.281  1.00 109.81 ? 193 ILE A HG13   1 
ATOM   2828  H  HG21   . ILE A  1 194 ? 22.343  -31.770 21.883  1.00 118.58 ? 193 ILE A HG21   1 
ATOM   2829  H  HG22   . ILE A  1 194 ? 23.710  -31.015 22.063  1.00 118.58 ? 193 ILE A HG22   1 
ATOM   2830  H  HG23   . ILE A  1 194 ? 23.567  -32.133 20.966  1.00 118.58 ? 193 ILE A HG23   1 
ATOM   2831  H  HD11   . ILE A  1 194 ? 21.208  -35.055 22.333  1.00 110.45 ? 193 ILE A HD11   1 
ATOM   2832  H  HD12   . ILE A  1 194 ? 21.220  -33.858 23.352  1.00 110.45 ? 193 ILE A HD12   1 
ATOM   2833  H  HD13   . ILE A  1 194 ? 21.299  -33.576 21.807  1.00 110.45 ? 193 ILE A HD13   1 
ATOM   2834  N  N      . GLN A  1 195 ? 26.177  -31.135 23.992  1.00 107.69 ? 194 GLN A N      1 
ATOM   2835  C  CA     . GLN A  1 195 ? 26.698  -29.776 24.101  1.00 119.25 ? 194 GLN A CA     1 
ATOM   2836  C  C      . GLN A  1 195 ? 28.226  -29.728 24.147  1.00 127.25 ? 194 GLN A C      1 
ATOM   2837  O  O      . GLN A  1 195 ? 28.832  -28.723 23.771  1.00 119.91 ? 194 GLN A O      1 
ATOM   2838  C  CB     . GLN A  1 195 ? 26.124  -29.094 25.343  1.00 122.22 ? 194 GLN A CB     1 
ATOM   2839  C  CG     . GLN A  1 195 ? 24.605  -29.082 25.390  1.00 136.49 ? 194 GLN A CG     1 
ATOM   2840  C  CD     . GLN A  1 195 ? 24.067  -28.346 26.600  1.00 152.03 ? 194 GLN A CD     1 
ATOM   2841  O  OE1    . GLN A  1 195 ? 23.353  -28.920 27.424  1.00 162.28 ? 194 GLN A OE1    1 
ATOM   2842  N  NE2    . GLN A  1 195 ? 24.407  -27.067 26.714  1.00 144.67 ? 194 GLN A NE2    1 
ATOM   2843  H  H      . GLN A  1 195 ? 26.052  -31.525 24.748  1.00 129.22 ? 194 GLN A H      1 
ATOM   2844  H  HA     . GLN A  1 195 ? 26.407  -29.264 23.318  1.00 143.10 ? 194 GLN A HA     1 
ATOM   2845  H  HB2    . GLN A  1 195 ? 26.441  -29.562 26.131  1.00 146.66 ? 194 GLN A HB2    1 
ATOM   2846  H  HB3    . GLN A  1 195 ? 26.428  -28.173 25.363  1.00 146.66 ? 194 GLN A HB3    1 
ATOM   2847  H  HG2    . GLN A  1 195 ? 24.267  -28.640 24.595  1.00 163.79 ? 194 GLN A HG2    1 
ATOM   2848  H  HG3    . GLN A  1 195 ? 24.282  -29.996 25.425  1.00 163.79 ? 194 GLN A HG3    1 
ATOM   2849  H  HE21   . GLN A  1 195 ? 24.906  -26.700 26.117  1.00 173.61 ? 194 GLN A HE21   1 
ATOM   2850  H  HE22   . GLN A  1 195 ? 24.127  -26.605 27.383  1.00 173.61 ? 194 GLN A HE22   1 
ATOM   2851  N  N      . GLU A  1 196 ? 28.844  -30.810 24.612  1.00 134.04 ? 195 GLU A N      1 
ATOM   2852  C  CA     . GLU A  1 196 ? 30.300  -30.883 24.707  1.00 140.03 ? 195 GLU A CA     1 
ATOM   2853  C  C      . GLU A  1 196 ? 30.892  -31.682 23.552  1.00 134.78 ? 195 GLU A C      1 
ATOM   2854  O  O      . GLU A  1 196 ? 32.091  -31.601 23.286  1.00 149.69 ? 195 GLU A O      1 
ATOM   2855  C  CB     . GLU A  1 196 ? 30.728  -31.531 26.027  1.00 167.16 ? 195 GLU A CB     1 
ATOM   2856  C  CG     . GLU A  1 196 ? 30.225  -30.824 27.279  1.00 183.62 ? 195 GLU A CG     1 
ATOM   2857  C  CD     . GLU A  1 196 ? 30.591  -31.561 28.558  1.00 193.09 ? 195 GLU A CD     1 
ATOM   2858  O  OE1    . GLU A  1 196 ? 30.335  -31.015 29.652  1.00 193.00 ? 195 GLU A OE1    1 
ATOM   2859  O  OE2    . GLU A  1 196 ? 31.134  -32.683 28.470  1.00 197.54 ? 195 GLU A OE2    1 
ATOM   2860  H  H      . GLU A  1 196 ? 28.440  -31.520 24.880  1.00 160.85 ? 195 GLU A H      1 
ATOM   2861  H  HA     . GLU A  1 196 ? 30.672  -29.976 24.675  1.00 168.03 ? 195 GLU A HA     1 
ATOM   2862  H  HB2    . GLU A  1 196 ? 30.391  -32.440 26.049  1.00 200.60 ? 195 GLU A HB2    1 
ATOM   2863  H  HB3    . GLU A  1 196 ? 31.697  -31.542 26.066  1.00 200.60 ? 195 GLU A HB3    1 
ATOM   2864  H  HG2    . GLU A  1 196 ? 30.617  -29.937 27.321  1.00 220.35 ? 195 GLU A HG2    1 
ATOM   2865  H  HG3    . GLU A  1 196 ? 29.258  -30.757 27.238  1.00 220.35 ? 195 GLU A HG3    1 
ATOM   2866  N  N      . ILE A  1 197 ? 30.050  -32.455 22.871  1.00 122.94 ? 196 ILE A N      1 
ATOM   2867  C  CA     . ILE A  1 197 ? 30.519  -33.359 21.826  1.00 125.93 ? 196 ILE A CA     1 
ATOM   2868  C  C      . ILE A  1 197 ? 31.637  -34.229 22.392  1.00 138.41 ? 196 ILE A C      1 
ATOM   2869  O  O      . ILE A  1 197 ? 32.758  -34.240 21.884  1.00 142.19 ? 196 ILE A O      1 
ATOM   2870  C  CB     . ILE A  1 197 ? 31.026  -32.593 20.590  1.00 127.50 ? 196 ILE A CB     1 
ATOM   2871  C  CG1    . ILE A  1 197 ? 29.983  -31.569 20.139  1.00 127.29 ? 196 ILE A CG1    1 
ATOM   2872  C  CG2    . ILE A  1 197 ? 31.341  -33.559 19.451  1.00 121.80 ? 196 ILE A CG2    1 
ATOM   2873  C  CD1    . ILE A  1 197 ? 28.652  -32.182 19.741  1.00 126.55 ? 196 ILE A CD1    1 
ATOM   2874  H  H      . ILE A  1 197 ? 29.200  -32.475 22.996  1.00 147.53 ? 196 ILE A H      1 
ATOM   2875  H  HA     . ILE A  1 197 ? 29.784  -33.944 21.548  1.00 151.12 ? 196 ILE A HA     1 
ATOM   2876  H  HB     . ILE A  1 197 ? 31.839  -32.122 20.830  1.00 153.00 ? 196 ILE A HB     1 
ATOM   2877  H  HG12   . ILE A  1 197 ? 29.819  -30.949 20.866  1.00 152.74 ? 196 ILE A HG12   1 
ATOM   2878  H  HG13   . ILE A  1 197 ? 30.330  -31.088 19.370  1.00 152.74 ? 196 ILE A HG13   1 
ATOM   2879  H  HG21   . ILE A  1 197 ? 31.654  -33.058 18.694  1.00 146.16 ? 196 ILE A HG21   1 
ATOM   2880  H  HG22   . ILE A  1 197 ? 32.020  -34.173 19.741  1.00 146.16 ? 196 ILE A HG22   1 
ATOM   2881  H  HG23   . ILE A  1 197 ? 30.543  -34.039 19.218  1.00 146.16 ? 196 ILE A HG23   1 
ATOM   2882  H  HD11   . ILE A  1 197 ? 28.054  -31.481 19.471  1.00 151.86 ? 196 ILE A HD11   1 
ATOM   2883  H  HD12   . ILE A  1 197 ? 28.794  -32.790 19.012  1.00 151.86 ? 196 ILE A HD12   1 
ATOM   2884  H  HD13   . ILE A  1 197 ? 28.287  -32.652 20.494  1.00 151.86 ? 196 ILE A HD13   1 
ATOM   2885  N  N      . GLY A  1 198 ? 31.314  -34.948 23.461  1.00 152.02 ? 197 GLY A N      1 
ATOM   2886  C  CA     . GLY A  1 198 ? 32.271  -35.802 24.137  1.00 149.06 ? 197 GLY A CA     1 
ATOM   2887  C  C      . GLY A  1 198 ? 31.584  -36.603 25.225  1.00 141.66 ? 197 GLY A C      1 
ATOM   2888  O  O      . GLY A  1 198 ? 30.366  -36.525 25.383  1.00 122.35 ? 197 GLY A O      1 
ATOM   2889  H  H      . GLY A  1 198 ? 30.532  -34.956 23.818  1.00 182.42 ? 197 GLY A H      1 
ATOM   2890  H  HA2    . GLY A  1 198 ? 32.673  -36.415 23.502  1.00 178.87 ? 197 GLY A HA2    1 
ATOM   2891  H  HA3    . GLY A  1 198 ? 32.970  -35.262 24.539  1.00 178.87 ? 197 GLY A HA3    1 
ATOM   2892  N  N      . TYR A  1 199 ? 32.363  -37.368 25.983  1.00 156.55 ? 198 TYR A N      1 
ATOM   2893  C  CA     . TYR A  1 199 ? 31.798  -38.241 27.003  1.00 164.66 ? 198 TYR A CA     1 
ATOM   2894  C  C      . TYR A  1 199 ? 32.517  -38.142 28.345  1.00 165.86 ? 198 TYR A C      1 
ATOM   2895  O  O      . TYR A  1 199 ? 33.739  -38.008 28.406  1.00 169.44 ? 198 TYR A O      1 
ATOM   2896  C  CB     . TYR A  1 199 ? 31.839  -39.694 26.528  1.00 162.74 ? 198 TYR A CB     1 
ATOM   2897  C  CG     . TYR A  1 199 ? 30.809  -40.035 25.476  1.00 154.06 ? 198 TYR A CG     1 
ATOM   2898  C  CD1    . TYR A  1 199 ? 29.588  -40.592 25.832  1.00 160.24 ? 198 TYR A CD1    1 
ATOM   2899  C  CD2    . TYR A  1 199 ? 31.058  -39.810 24.129  1.00 133.08 ? 198 TYR A CD2    1 
ATOM   2900  C  CE1    . TYR A  1 199 ? 28.643  -40.912 24.878  1.00 154.55 ? 198 TYR A CE1    1 
ATOM   2901  C  CE2    . TYR A  1 199 ? 30.118  -40.128 23.168  1.00 132.33 ? 198 TYR A CE2    1 
ATOM   2902  C  CZ     . TYR A  1 199 ? 28.912  -40.677 23.548  1.00 136.79 ? 198 TYR A CZ     1 
ATOM   2903  O  OH     . TYR A  1 199 ? 27.970  -40.995 22.596  1.00 123.06 ? 198 TYR A OH     1 
ATOM   2904  H  H      . TYR A  1 199 ? 33.220  -37.399 25.925  1.00 187.86 ? 198 TYR A H      1 
ATOM   2905  H  HA     . TYR A  1 199 ? 30.860  -37.997 27.146  1.00 197.59 ? 198 TYR A HA     1 
ATOM   2906  H  HB2    . TYR A  1 199 ? 32.715  -39.874 26.152  1.00 195.29 ? 198 TYR A HB2    1 
ATOM   2907  H  HB3    . TYR A  1 199 ? 31.685  -40.274 27.290  1.00 195.29 ? 198 TYR A HB3    1 
ATOM   2908  H  HD1    . TYR A  1 199 ? 29.403  -40.752 26.729  1.00 192.28 ? 198 TYR A HD1    1 
ATOM   2909  H  HD2    . TYR A  1 199 ? 31.870  -39.440 23.870  1.00 159.70 ? 198 TYR A HD2    1 
ATOM   2910  H  HE1    . TYR A  1 199 ? 27.829  -41.283 25.132  1.00 185.46 ? 198 TYR A HE1    1 
ATOM   2911  H  HE2    . TYR A  1 199 ? 30.297  -39.970 22.269  1.00 158.80 ? 198 TYR A HE2    1 
ATOM   2912  H  HH     . TYR A  1 199 ? 28.277  -41.545 22.071  1.00 147.67 ? 198 TYR A HH     1 
ATOM   2913  N  N      . ASN A  1 200 ? 31.734  -38.209 29.417  1.00 159.32 ? 199 ASN A N      1 
ATOM   2914  C  CA     . ASN A  1 200 ? 32.267  -38.389 30.759  1.00 153.81 ? 199 ASN A CA     1 
ATOM   2915  C  C      . ASN A  1 200 ? 31.650  -39.638 31.367  1.00 156.77 ? 199 ASN A C      1 
ATOM   2916  O  O      . ASN A  1 200 ? 30.597  -40.095 30.924  1.00 155.63 ? 199 ASN A O      1 
ATOM   2917  C  CB     . ASN A  1 200 ? 31.971  -37.173 31.632  1.00 151.63 ? 199 ASN A CB     1 
ATOM   2918  C  CG     . ASN A  1 200 ? 32.744  -35.947 31.199  1.00 161.40 ? 199 ASN A CG     1 
ATOM   2919  O  OD1    . ASN A  1 200 ? 33.963  -35.882 31.358  1.00 155.52 ? 199 ASN A OD1    1 
ATOM   2920  N  ND2    . ASN A  1 200 ? 32.039  -34.962 30.653  1.00 175.06 ? 199 ASN A ND2    1 
ATOM   2921  H  H      . ASN A  1 200 ? 30.877  -38.151 29.391  1.00 191.19 ? 199 ASN A H      1 
ATOM   2922  H  HA     . ASN A  1 200 ? 33.238  -38.512 30.713  1.00 184.57 ? 199 ASN A HA     1 
ATOM   2923  H  HB2    . ASN A  1 200 ? 31.024  -36.967 31.578  1.00 181.95 ? 199 ASN A HB2    1 
ATOM   2924  H  HB3    . ASN A  1 200 ? 32.215  -37.374 32.549  1.00 181.95 ? 199 ASN A HB3    1 
ATOM   2925  H  HD21   . ASN A  1 200 ? 31.188  -35.042 30.561  1.00 210.07 ? 199 ASN A HD21   1 
ATOM   2926  H  HD22   . ASN A  1 200 ? 32.434  -34.245 30.391  1.00 210.07 ? 199 ASN A HD22   1 
ATOM   2927  N  N      . CYS A  1 201 ? 32.305  -40.193 32.378  1.00 157.90 ? 200 CYS A N      1 
ATOM   2928  C  CA     . CYS A  1 201 ? 31.821  -41.412 33.012  1.00 150.10 ? 200 CYS A CA     1 
ATOM   2929  C  C      . CYS A  1 201 ? 30.330  -41.319 33.325  1.00 147.37 ? 200 CYS A C      1 
ATOM   2930  O  O      . CYS A  1 201 ? 29.568  -42.238 33.026  1.00 150.82 ? 200 CYS A O      1 
ATOM   2931  C  CB     . CYS A  1 201 ? 32.612  -41.690 34.290  1.00 155.49 ? 200 CYS A CB     1 
ATOM   2932  S  SG     . CYS A  1 201 ? 34.385  -41.917 34.012  1.00 164.57 ? 200 CYS A SG     1 
ATOM   2933  H  H      . CYS A  1 201 ? 33.033  -39.884 32.716  1.00 189.48 ? 200 CYS A H      1 
ATOM   2934  H  HA     . CYS A  1 201 ? 31.957  -42.165 32.400  1.00 180.12 ? 200 CYS A HA     1 
ATOM   2935  H  HB2    . CYS A  1 201 ? 32.500  -40.941 34.896  1.00 186.59 ? 200 CYS A HB2    1 
ATOM   2936  H  HB3    . CYS A  1 201 ? 32.270  -42.500 34.699  1.00 186.59 ? 200 CYS A HB3    1 
ATOM   2937  H  HG     . CYS A  1 201 ? 34.921  -42.129 35.065  1.00 197.48 ? 200 CYS A HG     1 
ATOM   2938  N  N      . VAL A  1 202 ? 29.918  -40.201 33.915  1.00 144.06 ? 201 VAL A N      1 
ATOM   2939  C  CA     . VAL A  1 202 ? 28.524  -40.007 34.314  1.00 137.51 ? 201 VAL A CA     1 
ATOM   2940  C  C      . VAL A  1 202 ? 27.555  -40.000 33.134  1.00 123.30 ? 201 VAL A C      1 
ATOM   2941  O  O      . VAL A  1 202 ? 26.345  -40.119 33.323  1.00 119.10 ? 201 VAL A O      1 
ATOM   2942  C  CB     . VAL A  1 202 ? 28.336  -38.697 35.102  1.00 135.48 ? 201 VAL A CB     1 
ATOM   2943  C  CG1    . VAL A  1 202 ? 29.070  -38.769 36.435  1.00 147.81 ? 201 VAL A CG1    1 
ATOM   2944  C  CG2    . VAL A  1 202 ? 28.795  -37.499 34.278  1.00 117.26 ? 201 VAL A CG2    1 
ATOM   2945  H  H      . VAL A  1 202 ? 30.429  -39.534 34.097  1.00 172.87 ? 201 VAL A H      1 
ATOM   2946  H  HA     . VAL A  1 202 ? 28.265  -40.746 34.903  1.00 165.01 ? 201 VAL A HA     1 
ATOM   2947  H  HB     . VAL A  1 202 ? 27.382  -38.579 35.293  1.00 162.58 ? 201 VAL A HB     1 
ATOM   2948  H  HG11   . VAL A  1 202 ? 28.939  -37.944 36.908  1.00 177.37 ? 201 VAL A HG11   1 
ATOM   2949  H  HG12   . VAL A  1 202 ? 28.717  -39.500 36.946  1.00 177.37 ? 201 VAL A HG12   1 
ATOM   2950  H  HG13   . VAL A  1 202 ? 30.005  -38.906 36.268  1.00 177.37 ? 201 VAL A HG13   1 
ATOM   2951  H  HG21   . VAL A  1 202 ? 28.667  -36.699 34.792  1.00 140.71 ? 201 VAL A HG21   1 
ATOM   2952  H  HG22   . VAL A  1 202 ? 29.725  -37.606 34.064  1.00 140.71 ? 201 VAL A HG22   1 
ATOM   2953  H  HG23   . VAL A  1 202 ? 28.276  -37.458 33.471  1.00 140.71 ? 201 VAL A HG23   1 
ATOM   2954  N  N      . ALA A  1 203 ? 28.078  -39.850 31.922  1.00 108.41 ? 202 ALA A N      1 
ATOM   2955  C  CA     . ALA A  1 203 ? 27.239  -39.914 30.734  1.00 93.89  ? 202 ALA A CA     1 
ATOM   2956  C  C      . ALA A  1 203 ? 26.545  -41.269 30.670  1.00 100.07 ? 202 ALA A C      1 
ATOM   2957  O  O      . ALA A  1 203 ? 25.377  -41.359 30.291  1.00 113.56 ? 202 ALA A O      1 
ATOM   2958  C  CB     . ALA A  1 203 ? 28.063  -39.676 29.481  1.00 87.38  ? 202 ALA A CB     1 
ATOM   2959  H  H      . ALA A  1 203 ? 28.912  -39.712 31.762  1.00 130.09 ? 202 ALA A H      1 
ATOM   2960  H  HA     . ALA A  1 203 ? 26.551  -39.218 30.787  1.00 112.67 ? 202 ALA A HA     1 
ATOM   2961  H  HB1    . ALA A  1 203 ? 27.486  -39.723 28.715  1.00 104.86 ? 202 ALA A HB1    1 
ATOM   2962  H  HB2    . ALA A  1 203 ? 28.467  -38.807 29.534  1.00 104.86 ? 202 ALA A HB2    1 
ATOM   2963  H  HB3    . ALA A  1 203 ? 28.743  -40.351 29.422  1.00 104.86 ? 202 ALA A HB3    1 
ATOM   2964  N  N      . ASP A  1 204 ? 27.266  -42.319 31.052  1.00 88.37  ? 203 ASP A N      1 
ATOM   2965  C  CA     . ASP A  1 204 ? 26.721  -43.669 31.006  1.00 111.12 ? 203 ASP A CA     1 
ATOM   2966  C  C      . ASP A  1 204 ? 25.588  -43.837 32.009  1.00 115.42 ? 203 ASP A C      1 
ATOM   2967  O  O      . ASP A  1 204 ? 24.662  -44.614 31.785  1.00 119.41 ? 203 ASP A O      1 
ATOM   2968  C  CB     . ASP A  1 204 ? 27.818  -44.701 31.276  1.00 122.26 ? 203 ASP A CB     1 
ATOM   2969  C  CG     . ASP A  1 204 ? 28.846  -44.763 30.164  1.00 137.52 ? 203 ASP A CG     1 
ATOM   2970  O  OD1    . ASP A  1 204 ? 30.048  -44.897 30.473  1.00 139.94 ? 203 ASP A OD1    1 
ATOM   2971  O  OD2    . ASP A  1 204 ? 28.450  -44.676 28.981  1.00 136.10 ? 203 ASP A OD2    1 
ATOM   2972  H  H      . ASP A  1 204 ? 28.074  -42.275 31.343  1.00 106.04 ? 203 ASP A H      1 
ATOM   2973  H  HA     . ASP A  1 204 ? 26.361  -43.838 30.110  1.00 133.34 ? 203 ASP A HA     1 
ATOM   2974  H  HB2    . ASP A  1 204 ? 28.278  -44.467 32.097  1.00 146.71 ? 203 ASP A HB2    1 
ATOM   2975  H  HB3    . ASP A  1 204 ? 27.414  -45.579 31.360  1.00 146.71 ? 203 ASP A HB3    1 
ATOM   2976  N  N      . ILE A  1 205 ? 25.665  -43.107 33.117  1.00 119.25 ? 204 ILE A N      1 
ATOM   2977  C  CA     . ILE A  1 205 ? 24.627  -43.170 34.136  1.00 117.15 ? 204 ILE A CA     1 
ATOM   2978  C  C      . ILE A  1 205 ? 23.312  -42.631 33.587  1.00 124.32 ? 204 ILE A C      1 
ATOM   2979  O  O      . ILE A  1 205 ? 22.248  -43.195 33.840  1.00 128.72 ? 204 ILE A O      1 
ATOM   2980  C  CB     . ILE A  1 205 ? 25.015  -42.365 35.384  1.00 116.39 ? 204 ILE A CB     1 
ATOM   2981  C  CG1    . ILE A  1 205 ? 26.279  -42.950 36.019  1.00 113.97 ? 204 ILE A CG1    1 
ATOM   2982  C  CG2    . ILE A  1 205 ? 23.866  -42.353 36.382  1.00 121.13 ? 204 ILE A CG2    1 
ATOM   2983  C  CD1    . ILE A  1 205 ? 26.129  -44.383 36.483  1.00 111.60 ? 204 ILE A CD1    1 
ATOM   2984  H  H      . ILE A  1 205 ? 26.309  -42.567 33.301  1.00 143.10 ? 204 ILE A H      1 
ATOM   2985  H  HA     . ILE A  1 205 ? 24.491  -44.103 34.402  1.00 140.58 ? 204 ILE A HA     1 
ATOM   2986  H  HB     . ILE A  1 205 ? 25.199  -41.451 35.116  1.00 139.67 ? 204 ILE A HB     1 
ATOM   2987  H  HG12   . ILE A  1 205 ? 26.996  -42.924 35.367  1.00 136.77 ? 204 ILE A HG12   1 
ATOM   2988  H  HG13   . ILE A  1 205 ? 26.517  -42.412 36.790  1.00 136.77 ? 204 ILE A HG13   1 
ATOM   2989  H  HG21   . ILE A  1 205 ? 24.129  -41.846 37.154  1.00 145.36 ? 204 ILE A HG21   1 
ATOM   2990  H  HG22   . ILE A  1 205 ? 23.099  -41.950 35.970  1.00 145.36 ? 204 ILE A HG22   1 
ATOM   2991  H  HG23   . ILE A  1 205 ? 23.665  -43.257 36.637  1.00 145.36 ? 204 ILE A HG23   1 
ATOM   2992  H  HD11   . ILE A  1 205 ? 26.959  -44.674 36.867  1.00 133.92 ? 204 ILE A HD11   1 
ATOM   2993  H  HD12   . ILE A  1 205 ? 25.431  -44.426 37.140  1.00 133.92 ? 204 ILE A HD12   1 
ATOM   2994  H  HD13   . ILE A  1 205 ? 25.905  -44.933 35.730  1.00 133.92 ? 204 ILE A HD13   1 
ATOM   2995  N  N      . TRP A  1 206 ? 23.387  -41.533 32.842  1.00 119.54 ? 205 TRP A N      1 
ATOM   2996  C  CA     . TRP A  1 206 ? 22.204  -40.996 32.185  1.00 113.14 ? 205 TRP A CA     1 
ATOM   2997  C  C      . TRP A  1 206 ? 21.640  -42.041 31.234  1.00 120.05 ? 205 TRP A C      1 
ATOM   2998  O  O      . TRP A  1 206 ? 20.447  -42.341 31.261  1.00 126.25 ? 205 TRP A O      1 
ATOM   2999  C  CB     . TRP A  1 206 ? 22.531  -39.723 31.408  1.00 110.43 ? 205 TRP A CB     1 
ATOM   3000  C  CG     . TRP A  1 206 ? 21.357  -39.208 30.630  1.00 109.64 ? 205 TRP A CG     1 
ATOM   3001  C  CD1    . TRP A  1 206 ? 20.949  -39.619 29.395  1.00 101.81 ? 205 TRP A CD1    1 
ATOM   3002  C  CD2    . TRP A  1 206 ? 20.432  -38.193 31.042  1.00 108.20 ? 205 TRP A CD2    1 
ATOM   3003  N  NE1    . TRP A  1 206 ? 19.829  -38.921 29.011  1.00 99.17  ? 205 TRP A NE1    1 
ATOM   3004  C  CE2    . TRP A  1 206 ? 19.492  -38.042 30.003  1.00 97.67  ? 205 TRP A CE2    1 
ATOM   3005  C  CE3    . TRP A  1 206 ? 20.310  -37.400 32.186  1.00 120.67 ? 205 TRP A CE3    1 
ATOM   3006  C  CZ2    . TRP A  1 206 ? 18.443  -37.125 30.076  1.00 90.01  ? 205 TRP A CZ2    1 
ATOM   3007  C  CZ3    . TRP A  1 206 ? 19.268  -36.491 32.254  1.00 120.83 ? 205 TRP A CZ3    1 
ATOM   3008  C  CH2    . TRP A  1 206 ? 18.348  -36.362 31.206  1.00 107.95 ? 205 TRP A CH2    1 
ATOM   3009  H  H      . TRP A  1 206 ? 24.106  -41.084 32.701  1.00 143.45 ? 205 TRP A H      1 
ATOM   3010  H  HA     . TRP A  1 206 ? 21.522  -40.785 32.857  1.00 135.77 ? 205 TRP A HA     1 
ATOM   3011  H  HB2    . TRP A  1 206 ? 22.805  -39.033 32.032  1.00 132.52 ? 205 TRP A HB2    1 
ATOM   3012  H  HB3    . TRP A  1 206 ? 23.249  -39.909 30.782  1.00 132.52 ? 205 TRP A HB3    1 
ATOM   3013  H  HD1    . TRP A  1 206 ? 21.367  -40.276 28.887  1.00 122.17 ? 205 TRP A HD1    1 
ATOM   3014  H  HE1    . TRP A  1 206 ? 19.408  -39.021 28.268  1.00 119.00 ? 205 TRP A HE1    1 
ATOM   3015  H  HE3    . TRP A  1 206 ? 20.917  -37.480 32.886  1.00 144.81 ? 205 TRP A HE3    1 
ATOM   3016  H  HZ2    . TRP A  1 206 ? 17.832  -37.036 29.381  1.00 108.01 ? 205 TRP A HZ2    1 
ATOM   3017  H  HZ3    . TRP A  1 206 ? 19.176  -35.958 33.010  1.00 145.00 ? 205 TRP A HZ3    1 
ATOM   3018  H  HH2    . TRP A  1 206 ? 17.659  -35.743 31.280  1.00 129.54 ? 205 TRP A HH2    1 
ATOM   3019  N  N      . SER A  1 207 ? 22.510  -42.592 30.394  1.00 114.59 ? 206 SER A N      1 
ATOM   3020  C  CA     . SER A  1 207 ? 22.115  -43.637 29.462  1.00 103.53 ? 206 SER A CA     1 
ATOM   3021  C  C      . SER A  1 207 ? 21.450  -44.779 30.221  1.00 116.08 ? 206 SER A C      1 
ATOM   3022  O  O      . SER A  1 207 ? 20.442  -45.326 29.777  1.00 123.12 ? 206 SER A O      1 
ATOM   3023  C  CB     . SER A  1 207 ? 23.332  -44.156 28.698  1.00 112.77 ? 206 SER A CB     1 
ATOM   3024  O  OG     . SER A  1 207 ? 23.966  -43.114 27.978  1.00 133.67 ? 206 SER A OG     1 
ATOM   3025  H  H      . SER A  1 207 ? 23.341  -42.376 30.345  1.00 137.51 ? 206 SER A H      1 
ATOM   3026  H  HA     . SER A  1 207 ? 21.472  -43.275 28.817  1.00 124.24 ? 206 SER A HA     1 
ATOM   3027  H  HB2    . SER A  1 207 ? 23.964  -44.531 29.331  1.00 135.33 ? 206 SER A HB2    1 
ATOM   3028  H  HB3    . SER A  1 207 ? 23.043  -44.840 28.074  1.00 135.33 ? 206 SER A HB3    1 
ATOM   3029  H  HG     . SER A  1 207 ? 23.567  -42.408 28.097  1.00 160.40 ? 206 SER A HG     1 
ATOM   3030  N  N      . LEU A  1 208 ? 22.019  -45.132 31.370  1.00 109.96 ? 207 LEU A N      1 
ATOM   3031  C  CA     . LEU A  1 208 ? 21.464  -46.192 32.202  1.00 109.15 ? 207 LEU A CA     1 
ATOM   3032  C  C      . LEU A  1 208 ? 20.062  -45.808 32.654  1.00 115.31 ? 207 LEU A C      1 
ATOM   3033  O  O      . LEU A  1 208 ? 19.153  -46.639 32.666  1.00 109.92 ? 207 LEU A O      1 
ATOM   3034  C  CB     . LEU A  1 208 ? 22.353  -46.440 33.422  1.00 112.93 ? 207 LEU A CB     1 
ATOM   3035  C  CG     . LEU A  1 208 ? 21.982  -47.667 34.260  1.00 119.23 ? 207 LEU A CG     1 
ATOM   3036  C  CD1    . LEU A  1 208 ? 22.360  -48.949 33.532  1.00 95.26  ? 207 LEU A CD1    1 
ATOM   3037  C  CD2    . LEU A  1 208 ? 22.639  -47.612 35.631  1.00 125.77 ? 207 LEU A CD2    1 
ATOM   3038  H  H      . LEU A  1 208 ? 22.730  -44.771 31.691  1.00 131.95 ? 207 LEU A H      1 
ATOM   3039  H  HA     . LEU A  1 208 ? 21.409  -47.021 31.683  1.00 130.98 ? 207 LEU A HA     1 
ATOM   3040  H  HB2    . LEU A  1 208 ? 23.266  -46.560 33.118  1.00 135.52 ? 207 LEU A HB2    1 
ATOM   3041  H  HB3    . LEU A  1 208 ? 22.303  -45.665 34.002  1.00 135.52 ? 207 LEU A HB3    1 
ATOM   3042  H  HG     . LEU A  1 208 ? 21.021  -47.674 34.393  1.00 143.07 ? 207 LEU A HG     1 
ATOM   3043  H  HD11   . LEU A  1 208 ? 22.117  -49.701 34.078  1.00 114.32 ? 207 LEU A HD11   1 
ATOM   3044  H  HD12   . LEU A  1 208 ? 21.887  -48.984 32.697  1.00 114.32 ? 207 LEU A HD12   1 
ATOM   3045  H  HD13   . LEU A  1 208 ? 23.306  -48.951 33.374  1.00 114.32 ? 207 LEU A HD13   1 
ATOM   3046  H  HD21   . LEU A  1 208 ? 22.387  -48.393 36.130  1.00 150.92 ? 207 LEU A HD21   1 
ATOM   3047  H  HD22   . LEU A  1 208 ? 23.592  -47.588 35.520  1.00 150.92 ? 207 LEU A HD22   1 
ATOM   3048  H  HD23   . LEU A  1 208 ? 22.343  -46.821 36.088  1.00 150.92 ? 207 LEU A HD23   1 
ATOM   3049  N  N      . GLY A  1 209 ? 19.895  -44.542 33.025  1.00 122.11 ? 208 GLY A N      1 
ATOM   3050  C  CA     . GLY A  1 209 ? 18.605  -44.034 33.451  1.00 114.26 ? 208 GLY A CA     1 
ATOM   3051  C  C      . GLY A  1 209 ? 17.564  -44.188 32.362  1.00 109.29 ? 208 GLY A C      1 
ATOM   3052  O  O      . GLY A  1 209 ? 16.458  -44.666 32.609  1.00 113.95 ? 208 GLY A O      1 
ATOM   3053  H  H      . GLY A  1 209 ? 20.523  -43.955 33.037  1.00 146.54 ? 208 GLY A H      1 
ATOM   3054  H  HA2    . GLY A  1 209 ? 18.306  -44.518 34.237  1.00 137.11 ? 208 GLY A HA2    1 
ATOM   3055  H  HA3    . GLY A  1 209 ? 18.682  -43.094 33.676  1.00 137.11 ? 208 GLY A HA3    1 
ATOM   3056  N  N      . ILE A  1 210 ? 17.920  -43.783 31.148  1.00 97.70  ? 209 ILE A N      1 
ATOM   3057  C  CA     . ILE A  1 210 ? 17.029  -43.930 30.007  1.00 102.06 ? 209 ILE A CA     1 
ATOM   3058  C  C      . ILE A  1 210 ? 16.774  -45.410 29.737  1.00 113.95 ? 209 ILE A C      1 
ATOM   3059  O  O      . ILE A  1 210 ? 15.655  -45.812 29.417  1.00 120.05 ? 209 ILE A O      1 
ATOM   3060  C  CB     . ILE A  1 210 ? 17.622  -43.276 28.747  1.00 89.23  ? 209 ILE A CB     1 
ATOM   3061  C  CG1    . ILE A  1 210 ? 17.772  -41.767 28.952  1.00 80.26  ? 209 ILE A CG1    1 
ATOM   3062  C  CG2    . ILE A  1 210 ? 16.745  -43.554 27.540  1.00 94.45  ? 209 ILE A CG2    1 
ATOM   3063  C  CD1    . ILE A  1 210 ? 16.460  -41.041 29.156  1.00 91.82  ? 209 ILE A CD1    1 
ATOM   3064  H  H      . ILE A  1 210 ? 18.676  -43.419 30.959  1.00 117.25 ? 209 ILE A H      1 
ATOM   3065  H  HA     . ILE A  1 210 ? 16.171  -43.499 30.205  1.00 122.47 ? 209 ILE A HA     1 
ATOM   3066  H  HB     . ILE A  1 210 ? 18.500  -43.655 28.586  1.00 107.08 ? 209 ILE A HB     1 
ATOM   3067  H  HG12   . ILE A  1 210 ? 18.321  -41.612 29.736  1.00 96.32  ? 209 ILE A HG12   1 
ATOM   3068  H  HG13   . ILE A  1 210 ? 18.201  -41.387 28.169  1.00 96.32  ? 209 ILE A HG13   1 
ATOM   3069  H  HG21   . ILE A  1 210 ? 17.134  -43.137 26.768  1.00 113.34 ? 209 ILE A HG21   1 
ATOM   3070  H  HG22   . ILE A  1 210 ? 16.690  -44.504 27.407  1.00 113.34 ? 209 ILE A HG22   1 
ATOM   3071  H  HG23   . ILE A  1 210 ? 15.869  -43.195 27.701  1.00 113.34 ? 209 ILE A HG23   1 
ATOM   3072  H  HD11   . ILE A  1 210 ? 16.636  -40.105 29.277  1.00 110.18 ? 209 ILE A HD11   1 
ATOM   3073  H  HD12   . ILE A  1 210 ? 15.906  -41.173 28.383  1.00 110.18 ? 209 ILE A HD12   1 
ATOM   3074  H  HD13   . ILE A  1 210 ? 16.025  -41.396 29.936  1.00 110.18 ? 209 ILE A HD13   1 
ATOM   3075  N  N      . THR A  1 211 ? 17.820  -46.219 29.878  1.00 100.85 ? 210 THR A N      1 
ATOM   3076  C  CA     . THR A  1 211 ? 17.709  -47.656 29.665  1.00 110.58 ? 210 THR A CA     1 
ATOM   3077  C  C      . THR A  1 211 ? 16.745  -48.256 30.682  1.00 123.19 ? 210 THR A C      1 
ATOM   3078  O  O      . THR A  1 211 ? 16.089  -49.261 30.410  1.00 125.01 ? 210 THR A O      1 
ATOM   3079  C  CB     . THR A  1 211 ? 19.077  -48.359 29.786  1.00 118.45 ? 210 THR A CB     1 
ATOM   3080  O  OG1    . THR A  1 211 ? 19.986  -47.826 28.815  1.00 131.00 ? 210 THR A OG1    1 
ATOM   3081  C  CG2    . THR A  1 211 ? 18.936  -49.862 29.558  1.00 100.19 ? 210 THR A CG2    1 
ATOM   3082  H  H      . THR A  1 211 ? 18.609  -45.957 30.097  1.00 121.02 ? 210 THR A H      1 
ATOM   3083  H  HA     . THR A  1 211 ? 17.354  -47.824 28.768  1.00 132.70 ? 210 THR A HA     1 
ATOM   3084  H  HB     . THR A  1 211 ? 19.436  -48.217 30.676  1.00 142.14 ? 210 THR A HB     1 
ATOM   3085  H  HG1    . THR A  1 211 ? 20.087  -47.021 28.938  1.00 157.20 ? 210 THR A HG1    1 
ATOM   3086  H  HG21   . THR A  1 211 ? 19.793  -50.287 29.636  1.00 120.23 ? 210 THR A HG21   1 
ATOM   3087  H  HG22   . THR A  1 211 ? 18.340  -50.238 30.211  1.00 120.23 ? 210 THR A HG22   1 
ATOM   3088  H  HG23   . THR A  1 211 ? 18.583  -50.029 28.681  1.00 120.23 ? 210 THR A HG23   1 
ATOM   3089  N  N      . SER A  1 212 ? 16.664  -47.637 31.855  1.00 129.38 ? 211 SER A N      1 
ATOM   3090  C  CA     . SER A  1 212 ? 15.741  -48.089 32.889  1.00 134.25 ? 211 SER A CA     1 
ATOM   3091  C  C      . SER A  1 212 ? 14.301  -47.952 32.405  1.00 132.42 ? 211 SER A C      1 
ATOM   3092  O  O      . SER A  1 212 ? 13.488  -48.858 32.590  1.00 134.70 ? 211 SER A O      1 
ATOM   3093  C  CB     . SER A  1 212 ? 15.943  -47.296 34.182  1.00 143.19 ? 211 SER A CB     1 
ATOM   3094  O  OG     . SER A  1 212 ? 17.275  -47.414 34.650  1.00 147.48 ? 211 SER A OG     1 
ATOM   3095  H  H      . SER A  1 212 ? 17.132  -46.951 32.077  1.00 155.26 ? 211 SER A H      1 
ATOM   3096  H  HA     . SER A  1 212 ? 15.911  -49.035 33.080  1.00 161.10 ? 211 SER A HA     1 
ATOM   3097  H  HB2    . SER A  1 212 ? 15.751  -46.361 34.011  1.00 171.83 ? 211 SER A HB2    1 
ATOM   3098  H  HB3    . SER A  1 212 ? 15.340  -47.640 34.859  1.00 171.83 ? 211 SER A HB3    1 
ATOM   3099  H  HG     . SER A  1 212 ? 17.710  -47.890 34.143  1.00 176.97 ? 211 SER A HG     1 
ATOM   3100  N  N      . ILE A  1 213 ? 13.990  -46.819 31.783  1.00 129.48 ? 212 ILE A N      1 
ATOM   3101  C  CA     . ILE A  1 213 ? 12.663  -46.600 31.221  1.00 119.24 ? 212 ILE A CA     1 
ATOM   3102  C  C      . ILE A  1 213 ? 12.440  -47.501 30.010  1.00 124.99 ? 212 ILE A C      1 
ATOM   3103  O  O      . ILE A  1 213 ? 11.322  -47.951 29.757  1.00 131.11 ? 212 ILE A O      1 
ATOM   3104  C  CB     . ILE A  1 213 ? 12.464  -45.135 30.798  1.00 106.44 ? 212 ILE A CB     1 
ATOM   3105  C  CG1    . ILE A  1 213 ? 12.453  -44.229 32.033  1.00 115.89 ? 212 ILE A CG1    1 
ATOM   3106  C  CG2    . ILE A  1 213 ? 11.167  -44.986 30.020  1.00 112.93 ? 212 ILE A CG2    1 
ATOM   3107  C  CD1    . ILE A  1 213 ? 12.082  -42.785 31.748  1.00 94.69  ? 212 ILE A CD1    1 
ATOM   3108  H  H      . ILE A  1 213 ? 14.532  -46.161 31.673  1.00 155.37 ? 212 ILE A H      1 
ATOM   3109  H  HA     . ILE A  1 213 ? 11.987  -46.820 31.895  1.00 143.09 ? 212 ILE A HA     1 
ATOM   3110  H  HB     . ILE A  1 213 ? 13.202  -44.873 30.226  1.00 127.73 ? 212 ILE A HB     1 
ATOM   3111  H  HG12   . ILE A  1 213 ? 11.809  -44.579 32.669  1.00 139.06 ? 212 ILE A HG12   1 
ATOM   3112  H  HG13   . ILE A  1 213 ? 13.338  -44.233 32.428  1.00 139.06 ? 212 ILE A HG13   1 
ATOM   3113  H  HG21   . ILE A  1 213 ? 11.060  -44.067 29.765  1.00 135.52 ? 212 ILE A HG21   1 
ATOM   3114  H  HG22   . ILE A  1 213 ? 11.208  -45.541 29.237  1.00 135.52 ? 212 ILE A HG22   1 
ATOM   3115  H  HG23   . ILE A  1 213 ? 10.435  -45.259 30.578  1.00 135.52 ? 212 ILE A HG23   1 
ATOM   3116  H  HD11   . ILE A  1 213 ? 12.099  -42.290 32.571  1.00 113.62 ? 212 ILE A HD11   1 
ATOM   3117  H  HD12   . ILE A  1 213 ? 12.716  -42.415 31.130  1.00 113.62 ? 212 ILE A HD12   1 
ATOM   3118  H  HD13   . ILE A  1 213 ? 11.200  -42.758 31.368  1.00 113.62 ? 212 ILE A HD13   1 
ATOM   3119  N  N      . GLU A  1 214 ? 13.512  -47.756 29.265  1.00 111.77 ? 213 GLU A N      1 
ATOM   3120  C  CA     . GLU A  1 214 ? 13.446  -48.610 28.084  1.00 122.59 ? 213 GLU A CA     1 
ATOM   3121  C  C      . GLU A  1 214 ? 12.992  -50.021 28.452  1.00 137.05 ? 213 GLU A C      1 
ATOM   3122  O  O      . GLU A  1 214 ? 12.295  -50.679 27.680  1.00 135.69 ? 213 GLU A O      1 
ATOM   3123  C  CB     . GLU A  1 214 ? 14.813  -48.669 27.393  1.00 131.06 ? 213 GLU A CB     1 
ATOM   3124  C  CG     . GLU A  1 214 ? 14.819  -49.462 26.089  1.00 132.10 ? 213 GLU A CG     1 
ATOM   3125  C  CD     . GLU A  1 214 ? 16.198  -49.562 25.461  1.00 139.73 ? 213 GLU A CD     1 
ATOM   3126  O  OE1    . GLU A  1 214 ? 16.305  -50.120 24.348  1.00 150.64 ? 213 GLU A OE1    1 
ATOM   3127  O  OE2    . GLU A  1 214 ? 17.175  -49.087 26.078  1.00 134.50 ? 213 GLU A OE2    1 
ATOM   3128  H  H      . GLU A  1 214 ? 14.296  -47.442 29.424  1.00 134.13 ? 213 GLU A H      1 
ATOM   3129  H  HA     . GLU A  1 214 ? 12.799  -48.236 27.451  1.00 147.11 ? 213 GLU A HA     1 
ATOM   3130  H  HB2    . GLU A  1 214 ? 15.099  -47.765 27.191  1.00 157.28 ? 213 GLU A HB2    1 
ATOM   3131  H  HB3    . GLU A  1 214 ? 15.449  -49.086 27.996  1.00 157.28 ? 213 GLU A HB3    1 
ATOM   3132  H  HG2    . GLU A  1 214 ? 14.505  -50.362 26.266  1.00 158.52 ? 213 GLU A HG2    1 
ATOM   3133  H  HG3    . GLU A  1 214 ? 14.231  -49.026 25.452  1.00 158.52 ? 213 GLU A HG3    1 
ATOM   3134  N  N      . MET A  1 215 ? 13.389  -50.480 29.635  1.00 136.56 ? 214 MET A N      1 
ATOM   3135  C  CA     . MET A  1 215 ? 13.064  -51.830 30.080  1.00 132.86 ? 214 MET A CA     1 
ATOM   3136  C  C      . MET A  1 215 ? 11.637  -51.932 30.613  1.00 137.24 ? 214 MET A C      1 
ATOM   3137  O  O      . MET A  1 215 ? 11.017  -52.993 30.545  1.00 143.51 ? 214 MET A O      1 
ATOM   3138  C  CB     . MET A  1 215 ? 14.055  -52.284 31.155  1.00 119.97 ? 214 MET A CB     1 
ATOM   3139  C  CG     . MET A  1 215 ? 15.442  -52.600 30.617  1.00 100.98 ? 214 MET A CG     1 
ATOM   3140  S  SD     . MET A  1 215 ? 16.542  -53.298 31.863  1.00 153.80 ? 214 MET A SD     1 
ATOM   3141  C  CE     . MET A  1 215 ? 17.137  -51.825 32.688  1.00 105.34 ? 214 MET A CE     1 
ATOM   3142  H  H      . MET A  1 215 ? 13.850  -50.026 30.201  1.00 163.87 ? 214 MET A H      1 
ATOM   3143  H  HA     . MET A  1 215 ? 13.156  -52.439 29.317  1.00 159.43 ? 214 MET A HA     1 
ATOM   3144  H  HB2    . MET A  1 215 ? 14.146  -51.579 31.814  1.00 143.96 ? 214 MET A HB2    1 
ATOM   3145  H  HB3    . MET A  1 215 ? 13.711  -53.087 31.577  1.00 143.96 ? 214 MET A HB3    1 
ATOM   3146  H  HG2    . MET A  1 215 ? 15.361  -53.243 29.895  1.00 121.18 ? 214 MET A HG2    1 
ATOM   3147  H  HG3    . MET A  1 215 ? 15.846  -51.781 30.287  1.00 121.18 ? 214 MET A HG3    1 
ATOM   3148  H  HE1    . MET A  1 215 ? 17.744  -52.081 33.386  1.00 126.41 ? 214 MET A HE1    1 
ATOM   3149  H  HE2    . MET A  1 215 ? 17.589  -51.270 32.048  1.00 126.41 ? 214 MET A HE2    1 
ATOM   3150  H  HE3    . MET A  1 215 ? 16.389  -51.352 33.060  1.00 126.41 ? 214 MET A HE3    1 
ATOM   3151  N  N      . ALA A  1 216 ? 11.117  -50.827 31.137  1.00 134.29 ? 215 ALA A N      1 
ATOM   3152  C  CA     . ALA A  1 216 ? 9.789   -50.821 31.740  1.00 136.42 ? 215 ALA A CA     1 
ATOM   3153  C  C      . ALA A  1 216 ? 8.690   -50.529 30.720  1.00 150.87 ? 215 ALA A C      1 
ATOM   3154  O  O      . ALA A  1 216 ? 7.581   -51.052 30.829  1.00 161.73 ? 215 ALA A O      1 
ATOM   3155  C  CB     . ALA A  1 216 ? 9.734   -49.805 32.874  1.00 119.60 ? 215 ALA A CB     1 
ATOM   3156  H  H      . ALA A  1 216 ? 11.515  -50.065 31.156  1.00 161.15 ? 215 ALA A H      1 
ATOM   3157  H  HA     . ALA A  1 216 ? 9.613   -51.706 32.123  1.00 163.70 ? 215 ALA A HA     1 
ATOM   3158  H  HB1    . ALA A  1 216 ? 8.855   -49.815 33.259  1.00 143.51 ? 215 ALA A HB1    1 
ATOM   3159  H  HB2    . ALA A  1 216 ? 10.385  -50.043 33.538  1.00 143.51 ? 215 ALA A HB2    1 
ATOM   3160  H  HB3    . ALA A  1 216 ? 9.929   -48.934 32.521  1.00 143.51 ? 215 ALA A HB3    1 
ATOM   3161  N  N      . GLU A  1 217 ? 9.001   -49.699 29.729  1.00 145.97 ? 216 GLU A N      1 
ATOM   3162  C  CA     . GLU A  1 217 ? 7.997   -49.242 28.772  1.00 135.53 ? 216 GLU A CA     1 
ATOM   3163  C  C      . GLU A  1 217 ? 8.190   -49.833 27.375  1.00 139.17 ? 216 GLU A C      1 
ATOM   3164  O  O      . GLU A  1 217 ? 7.307   -49.721 26.523  1.00 132.94 ? 216 GLU A O      1 
ATOM   3165  C  CB     . GLU A  1 217 ? 8.012   -47.717 28.690  1.00 125.97 ? 216 GLU A CB     1 
ATOM   3166  C  CG     . GLU A  1 217 ? 7.977   -47.033 30.043  1.00 126.93 ? 216 GLU A CG     1 
ATOM   3167  C  CD     . GLU A  1 217 ? 7.722   -45.546 29.934  1.00 143.24 ? 216 GLU A CD     1 
ATOM   3168  O  OE1    . GLU A  1 217 ? 8.006   -44.971 28.862  1.00 154.85 ? 216 GLU A OE1    1 
ATOM   3169  O  OE2    . GLU A  1 217 ? 7.232   -44.953 30.918  1.00 145.81 ? 216 GLU A OE2    1 
ATOM   3170  H  H      . GLU A  1 217 ? 9.789   -49.384 29.588  1.00 175.17 ? 216 GLU A H      1 
ATOM   3171  H  HA     . GLU A  1 217 ? 7.112   -49.516 29.091  1.00 162.64 ? 216 GLU A HA     1 
ATOM   3172  H  HB2    . GLU A  1 217 ? 8.823   -47.436 28.237  1.00 151.16 ? 216 GLU A HB2    1 
ATOM   3173  H  HB3    . GLU A  1 217 ? 7.236   -47.422 28.189  1.00 151.16 ? 216 GLU A HB3    1 
ATOM   3174  H  HG2    . GLU A  1 217 ? 7.266   -47.422 30.576  1.00 152.31 ? 216 GLU A HG2    1 
ATOM   3175  H  HG3    . GLU A  1 217 ? 8.831   -47.160 30.485  1.00 152.31 ? 216 GLU A HG3    1 
ATOM   3176  N  N      . GLY A  1 218 ? 9.344   -50.450 27.138  1.00 137.34 ? 217 GLY A N      1 
ATOM   3177  C  CA     . GLY A  1 218 ? 9.604   -51.110 25.871  1.00 137.08 ? 217 GLY A CA     1 
ATOM   3178  C  C      . GLY A  1 218 ? 10.406  -50.264 24.901  1.00 135.23 ? 217 GLY A C      1 
ATOM   3179  O  O      . GLY A  1 218 ? 10.964  -50.783 23.934  1.00 138.05 ? 217 GLY A O      1 
ATOM   3180  H  H      . GLY A  1 218 ? 9.993   -50.499 27.700  1.00 164.81 ? 217 GLY A H      1 
ATOM   3181  H  HA2    . GLY A  1 218 ? 10.094  -51.931 26.034  1.00 164.50 ? 217 GLY A HA2    1 
ATOM   3182  H  HA3    . GLY A  1 218 ? 8.760   -51.337 25.450  1.00 164.50 ? 217 GLY A HA3    1 
ATOM   3183  N  N      . LYS A  1 219 ? 10.464  -48.960 25.154  1.00 137.98 ? 218 LYS A N      1 
ATOM   3184  C  CA     . LYS A  1 219 ? 11.192  -48.039 24.288  1.00 126.52 ? 218 LYS A CA     1 
ATOM   3185  C  C      . LYS A  1 219 ? 11.548  -46.770 25.056  1.00 127.46 ? 218 LYS A C      1 
ATOM   3186  O  O      . LYS A  1 219 ? 10.835  -46.383 25.982  1.00 129.13 ? 218 LYS A O      1 
ATOM   3187  C  CB     . LYS A  1 219 ? 10.347  -47.694 23.061  1.00 123.24 ? 218 LYS A CB     1 
ATOM   3188  C  CG     . LYS A  1 219 ? 9.031   -47.008 23.392  1.00 141.27 ? 218 LYS A CG     1 
ATOM   3189  C  CD     . LYS A  1 219 ? 8.005   -47.177 22.280  1.00 144.64 ? 218 LYS A CD     1 
ATOM   3190  C  CE     . LYS A  1 219 ? 7.492   -48.609 22.188  1.00 146.30 ? 218 LYS A CE     1 
ATOM   3191  N  NZ     . LYS A  1 219 ? 6.771   -49.043 23.421  1.00 148.40 ? 218 LYS A NZ     1 
ATOM   3192  H  H      . LYS A  1 219 ? 10.086  -48.581 25.828  1.00 165.57 ? 218 LYS A H      1 
ATOM   3193  H  HA     . LYS A  1 219 ? 12.022  -48.462 23.985  1.00 151.82 ? 218 LYS A HA     1 
ATOM   3194  H  HB2    . LYS A  1 219 ? 10.856  -47.099 22.489  1.00 147.89 ? 218 LYS A HB2    1 
ATOM   3195  H  HB3    . LYS A  1 219 ? 10.142  -48.513 22.584  1.00 147.89 ? 218 LYS A HB3    1 
ATOM   3196  H  HG2    . LYS A  1 219 ? 8.665   -47.394 24.203  1.00 169.53 ? 218 LYS A HG2    1 
ATOM   3197  H  HG3    . LYS A  1 219 ? 9.189   -46.059 23.516  1.00 169.53 ? 218 LYS A HG3    1 
ATOM   3198  H  HD2    . LYS A  1 219 ? 7.249   -46.595 22.454  1.00 173.57 ? 218 LYS A HD2    1 
ATOM   3199  H  HD3    . LYS A  1 219 ? 8.415   -46.948 21.431  1.00 173.57 ? 218 LYS A HD3    1 
ATOM   3200  H  HE2    . LYS A  1 219 ? 6.878   -48.678 21.441  1.00 175.56 ? 218 LYS A HE2    1 
ATOM   3201  H  HE3    . LYS A  1 219 ? 8.245   -49.207 22.055  1.00 175.56 ? 218 LYS A HE3    1 
ATOM   3202  H  HZ1    . LYS A  1 219 ? 6.488   -49.882 23.328  1.00 178.08 ? 218 LYS A HZ1    1 
ATOM   3203  H  HZ2    . LYS A  1 219 ? 7.316   -48.997 24.123  1.00 178.08 ? 218 LYS A HZ2    1 
ATOM   3204  H  HZ3    . LYS A  1 219 ? 6.069   -48.515 23.564  1.00 178.08 ? 218 LYS A HZ3    1 
ATOM   3205  N  N      . PRO A  1 220 ? 12.654  -46.113 24.672  1.00 128.25 ? 219 PRO A N      1 
ATOM   3206  C  CA     . PRO A  1 220 ? 13.119  -44.923 25.394  1.00 122.98 ? 219 PRO A CA     1 
ATOM   3207  C  C      . PRO A  1 220 ? 12.280  -43.687 25.085  1.00 125.13 ? 219 PRO A C      1 
ATOM   3208  O  O      . PRO A  1 220 ? 11.580  -43.664 24.073  1.00 120.32 ? 219 PRO A O      1 
ATOM   3209  C  CB     . PRO A  1 220 ? 14.542  -44.739 24.867  1.00 112.47 ? 219 PRO A CB     1 
ATOM   3210  C  CG     . PRO A  1 220 ? 14.487  -45.271 23.487  1.00 109.81 ? 219 PRO A CG     1 
ATOM   3211  C  CD     . PRO A  1 220 ? 13.525  -46.432 23.526  1.00 119.25 ? 219 PRO A CD     1 
ATOM   3212  H  HA     . PRO A  1 220 ? 13.138  -45.084 26.360  1.00 147.57 ? 219 PRO A HA     1 
ATOM   3213  H  HB2    . PRO A  1 220 ? 14.774  -43.797 24.866  1.00 134.96 ? 219 PRO A HB2    1 
ATOM   3214  H  HB3    . PRO A  1 220 ? 15.163  -45.249 25.410  1.00 134.96 ? 219 PRO A HB3    1 
ATOM   3215  H  HG2    . PRO A  1 220 ? 14.165  -44.581 22.886  1.00 131.77 ? 219 PRO A HG2    1 
ATOM   3216  H  HG3    . PRO A  1 220 ? 15.371  -45.569 23.220  1.00 131.77 ? 219 PRO A HG3    1 
ATOM   3217  H  HD2    . PRO A  1 220 ? 13.006  -46.469 22.707  1.00 143.09 ? 219 PRO A HD2    1 
ATOM   3218  H  HD3    . PRO A  1 220 ? 14.002  -47.261 23.685  1.00 143.09 ? 219 PRO A HD3    1 
ATOM   3219  N  N      . PRO A  1 221 ? 12.346  -42.668 25.954  1.00 121.28 ? 220 PRO A N      1 
ATOM   3220  C  CA     . PRO A  1 221 ? 11.631  -41.408 25.725  1.00 117.44 ? 220 PRO A CA     1 
ATOM   3221  C  C      . PRO A  1 221 ? 12.075  -40.723 24.436  1.00 120.03 ? 220 PRO A C      1 
ATOM   3222  O  O      . PRO A  1 221 ? 13.274  -40.638 24.172  1.00 115.40 ? 220 PRO A O      1 
ATOM   3223  C  CB     . PRO A  1 221 ? 12.018  -40.560 26.941  1.00 129.85 ? 220 PRO A CB     1 
ATOM   3224  C  CG     . PRO A  1 221 ? 12.417  -41.546 27.987  1.00 124.92 ? 220 PRO A CG     1 
ATOM   3225  C  CD     . PRO A  1 221 ? 13.061  -42.668 27.241  1.00 113.19 ? 220 PRO A CD     1 
ATOM   3226  H  HA     . PRO A  1 221 ? 10.661  -41.551 25.713  1.00 140.92 ? 220 PRO A HA     1 
ATOM   3227  H  HB2    . PRO A  1 221 ? 12.763  -39.981 26.713  1.00 155.82 ? 220 PRO A HB2    1 
ATOM   3228  H  HB3    . PRO A  1 221 ? 11.255  -40.039 27.234  1.00 155.82 ? 220 PRO A HB3    1 
ATOM   3229  H  HG2    . PRO A  1 221 ? 13.047  -41.136 28.600  1.00 149.91 ? 220 PRO A HG2    1 
ATOM   3230  H  HG3    . PRO A  1 221 ? 11.629  -41.857 28.460  1.00 149.91 ? 220 PRO A HG3    1 
ATOM   3231  H  HD2    . PRO A  1 221 ? 14.004  -42.487 27.105  1.00 135.82 ? 220 PRO A HD2    1 
ATOM   3232  H  HD3    . PRO A  1 221 ? 12.923  -43.508 27.706  1.00 135.82 ? 220 PRO A HD3    1 
ATOM   3233  N  N      . TYR A  1 222 ? 11.109  -40.251 23.651  1.00 138.54 ? 221 TYR A N      1 
ATOM   3234  C  CA     . TYR A  1 222 ? 11.371  -39.563 22.383  1.00 138.19 ? 221 TYR A CA     1 
ATOM   3235  C  C      . TYR A  1 222 ? 11.740  -40.528 21.255  1.00 142.59 ? 221 TYR A C      1 
ATOM   3236  O  O      . TYR A  1 222 ? 12.113  -40.096 20.165  1.00 155.25 ? 221 TYR A O      1 
ATOM   3237  C  CB     . TYR A  1 222 ? 12.486  -38.520 22.531  1.00 120.25 ? 221 TYR A CB     1 
ATOM   3238  C  CG     . TYR A  1 222 ? 12.317  -37.553 23.683  1.00 123.40 ? 221 TYR A CG     1 
ATOM   3239  C  CD1    . TYR A  1 222 ? 11.108  -37.436 24.357  1.00 124.96 ? 221 TYR A CD1    1 
ATOM   3240  C  CD2    . TYR A  1 222 ? 13.374  -36.749 24.091  1.00 126.76 ? 221 TYR A CD2    1 
ATOM   3241  C  CE1    . TYR A  1 222 ? 10.961  -36.550 25.408  1.00 125.34 ? 221 TYR A CE1    1 
ATOM   3242  C  CE2    . TYR A  1 222 ? 13.235  -35.862 25.140  1.00 128.11 ? 221 TYR A CE2    1 
ATOM   3243  C  CZ     . TYR A  1 222 ? 12.028  -35.767 25.795  1.00 129.37 ? 221 TYR A CZ     1 
ATOM   3244  O  OH     . TYR A  1 222 ? 11.886  -34.883 26.839  1.00 138.91 ? 221 TYR A OH     1 
ATOM   3245  H  H      . TYR A  1 222 ? 10.272  -40.318 23.834  1.00 166.25 ? 221 TYR A H      1 
ATOM   3246  H  HA     . TYR A  1 222 ? 10.557  -39.089 22.112  1.00 165.83 ? 221 TYR A HA     1 
ATOM   3247  H  HB2    . TYR A  1 222 ? 13.327  -38.985 22.661  1.00 144.30 ? 221 TYR A HB2    1 
ATOM   3248  H  HB3    . TYR A  1 222 ? 12.528  -37.996 21.715  1.00 144.30 ? 221 TYR A HB3    1 
ATOM   3249  H  HD1    . TYR A  1 222 ? 10.387  -37.965 24.100  1.00 149.96 ? 221 TYR A HD1    1 
ATOM   3250  H  HD2    . TYR A  1 222 ? 14.191  -36.812 23.652  1.00 152.11 ? 221 TYR A HD2    1 
ATOM   3251  H  HE1    . TYR A  1 222 ? 10.147  -36.483 25.853  1.00 150.40 ? 221 TYR A HE1    1 
ATOM   3252  H  HE2    . TYR A  1 222 ? 13.953  -35.332 25.402  1.00 153.73 ? 221 TYR A HE2    1 
ATOM   3253  H  HH     . TYR A  1 222 ? 12.030  -34.118 26.581  1.00 166.69 ? 221 TYR A HH     1 
ATOM   3254  N  N      . ALA A  1 223 ? 11.632  -41.828 21.510  1.00 135.63 ? 222 ALA A N      1 
ATOM   3255  C  CA     . ALA A  1 223 ? 12.033  -42.833 20.529  1.00 134.22 ? 222 ALA A CA     1 
ATOM   3256  C  C      . ALA A  1 223 ? 11.310  -42.652 19.197  1.00 134.70 ? 222 ALA A C      1 
ATOM   3257  O  O      . ALA A  1 223 ? 11.918  -42.763 18.133  1.00 140.46 ? 222 ALA A O      1 
ATOM   3258  C  CB     . ALA A  1 223 ? 11.783  -44.232 21.075  1.00 139.28 ? 222 ALA A CB     1 
ATOM   3259  H  H      . ALA A  1 223 ? 11.329  -42.155 22.245  1.00 162.75 ? 222 ALA A H      1 
ATOM   3260  H  HA     . ALA A  1 223 ? 12.995  -42.744 20.361  1.00 161.06 ? 222 ALA A HA     1 
ATOM   3261  H  HB1    . ALA A  1 223 ? 12.053  -44.876 20.416  1.00 167.13 ? 222 ALA A HB1    1 
ATOM   3262  H  HB2    . ALA A  1 223 ? 12.296  -44.349 21.878  1.00 167.13 ? 222 ALA A HB2    1 
ATOM   3263  H  HB3    . ALA A  1 223 ? 10.848  -44.330 21.266  1.00 167.13 ? 222 ALA A HB3    1 
ATOM   3264  N  N      . ASP A  1 224 ? 10.012  -42.373 19.260  1.00 134.19 ? 223 ASP A N      1 
ATOM   3265  C  CA     . ASP A  1 224 ? 9.189   -42.280 18.058  1.00 135.87 ? 223 ASP A CA     1 
ATOM   3266  C  C      . ASP A  1 224 ? 9.290   -40.917 17.377  1.00 136.00 ? 223 ASP A C      1 
ATOM   3267  O  O      . ASP A  1 224 ? 8.679   -40.694 16.332  1.00 143.73 ? 223 ASP A O      1 
ATOM   3268  C  CB     . ASP A  1 224 ? 7.728   -42.575 18.401  1.00 150.58 ? 223 ASP A CB     1 
ATOM   3269  C  CG     . ASP A  1 224 ? 7.521   -43.994 18.888  1.00 170.29 ? 223 ASP A CG     1 
ATOM   3270  O  OD1    . ASP A  1 224 ? 6.822   -44.180 19.907  1.00 176.89 ? 223 ASP A OD1    1 
ATOM   3271  O  OD2    . ASP A  1 224 ? 8.059   -44.925 18.251  1.00 172.97 ? 223 ASP A OD2    1 
ATOM   3272  H  H      . ASP A  1 224 ? 9.581   -42.232 19.991  1.00 161.03 ? 223 ASP A H      1 
ATOM   3273  H  HA     . ASP A  1 224 ? 9.489   -42.958 17.417  1.00 163.04 ? 223 ASP A HA     1 
ATOM   3274  H  HB2    . ASP A  1 224 ? 7.439   -41.971 19.103  1.00 180.69 ? 223 ASP A HB2    1 
ATOM   3275  H  HB3    . ASP A  1 224 ? 7.184   -42.448 17.608  1.00 180.69 ? 223 ASP A HB3    1 
ATOM   3276  N  N      . ILE A  1 225 ? 10.063  -40.010 17.966  1.00 139.00 ? 224 ILE A N      1 
ATOM   3277  C  CA     . ILE A  1 225 ? 10.210  -38.663 17.425  1.00 119.88 ? 224 ILE A CA     1 
ATOM   3278  C  C      . ILE A  1 225 ? 11.460  -38.541 16.558  1.00 118.28 ? 224 ILE A C      1 
ATOM   3279  O  O      . ILE A  1 225 ? 12.442  -39.255 16.758  1.00 123.18 ? 224 ILE A O      1 
ATOM   3280  C  CB     . ILE A  1 225 ? 10.256  -37.613 18.553  1.00 115.08 ? 224 ILE A CB     1 
ATOM   3281  C  CG1    . ILE A  1 225 ? 8.875   -37.493 19.206  1.00 119.43 ? 224 ILE A CG1    1 
ATOM   3282  C  CG2    . ILE A  1 225 ? 10.716  -36.265 18.014  1.00 123.23 ? 224 ILE A CG2    1 
ATOM   3283  C  CD1    . ILE A  1 225 ? 8.682   -36.239 20.041  1.00 140.71 ? 224 ILE A CD1    1 
ATOM   3284  H  H      . ILE A  1 225 ? 10.516  -40.151 18.683  1.00 166.80 ? 224 ILE A H      1 
ATOM   3285  H  HA     . ILE A  1 225 ? 9.434   -38.463 16.861  1.00 143.86 ? 224 ILE A HA     1 
ATOM   3286  H  HB     . ILE A  1 225 ? 10.890  -37.909 19.224  1.00 138.10 ? 224 ILE A HB     1 
ATOM   3287  H  HG12   . ILE A  1 225 ? 8.201   -37.489 18.508  1.00 143.32 ? 224 ILE A HG12   1 
ATOM   3288  H  HG13   . ILE A  1 225 ? 8.740   -38.258 19.787  1.00 143.32 ? 224 ILE A HG13   1 
ATOM   3289  H  HG21   . ILE A  1 225 ? 10.735  -35.632 18.735  1.00 147.88 ? 224 ILE A HG21   1 
ATOM   3290  H  HG22   . ILE A  1 225 ? 11.594  -36.362 17.639  1.00 147.88 ? 224 ILE A HG22   1 
ATOM   3291  H  HG23   . ILE A  1 225 ? 10.101  -35.973 17.338  1.00 147.88 ? 224 ILE A HG23   1 
ATOM   3292  H  HD11   . ILE A  1 225 ? 7.796   -36.245 20.411  1.00 168.85 ? 224 ILE A HD11   1 
ATOM   3293  H  HD12   . ILE A  1 225 ? 9.332   -36.232 20.747  1.00 168.85 ? 224 ILE A HD12   1 
ATOM   3294  H  HD13   . ILE A  1 225 ? 8.798   -35.469 19.480  1.00 168.85 ? 224 ILE A HD13   1 
ATOM   3295  N  N      . HIS A  1 226 ? 11.406  -37.632 15.590  1.00 113.87 ? 225 HIS A N      1 
ATOM   3296  C  CA     . HIS A  1 226 ? 12.509  -37.417 14.660  1.00 107.76 ? 225 HIS A CA     1 
ATOM   3297  C  C      . HIS A  1 226 ? 13.787  -37.029 15.404  1.00 102.85 ? 225 HIS A C      1 
ATOM   3298  O  O      . HIS A  1 226 ? 13.749  -36.190 16.301  1.00 118.57 ? 225 HIS A O      1 
ATOM   3299  C  CB     . HIS A  1 226 ? 12.135  -36.321 13.665  1.00 112.41 ? 225 HIS A CB     1 
ATOM   3300  C  CG     . HIS A  1 226 ? 12.998  -36.299 12.444  1.00 130.72 ? 225 HIS A CG     1 
ATOM   3301  N  ND1    . HIS A  1 226 ? 14.309  -35.878 12.467  1.00 132.01 ? 225 HIS A ND1    1 
ATOM   3302  C  CD2    . HIS A  1 226 ? 12.736  -36.649 11.163  1.00 127.66 ? 225 HIS A CD2    1 
ATOM   3303  C  CE1    . HIS A  1 226 ? 14.819  -35.970 11.254  1.00 122.96 ? 225 HIS A CE1    1 
ATOM   3304  N  NE2    . HIS A  1 226 ? 13.887  -36.434 10.442  1.00 124.24 ? 225 HIS A NE2    1 
ATOM   3305  H  H      . HIS A  1 226 ? 10.731  -37.119 15.450  1.00 136.64 ? 225 HIS A H      1 
ATOM   3306  H  HA     . HIS A  1 226 ? 12.680  -38.243 14.162  1.00 129.31 ? 225 HIS A HA     1 
ATOM   3307  H  HB2    . HIS A  1 226 ? 11.218  -36.458 13.379  1.00 134.90 ? 225 HIS A HB2    1 
ATOM   3308  H  HB3    . HIS A  1 226 ? 12.218  -35.460 14.103  1.00 134.90 ? 225 HIS A HB3    1 
ATOM   3309  H  HD1    . HIS A  1 226 ? 14.730  -35.601 13.163  1.00 158.41 ? 225 HIS A HD1    1 
ATOM   3310  H  HD2    . HIS A  1 226 ? 11.929  -36.974 10.832  1.00 153.20 ? 225 HIS A HD2    1 
ATOM   3311  H  HE1    . HIS A  1 226 ? 15.687  -35.744 11.012  1.00 147.55 ? 225 HIS A HE1    1 
ATOM   3312  H  HE2    . HIS A  1 226 ? 13.984  -36.578 9.599   1.00 149.09 ? 225 HIS A HE2    1 
ATOM   3313  N  N      . PRO A  1 227 ? 14.926  -37.635 15.030  1.00 101.86 ? 226 PRO A N      1 
ATOM   3314  C  CA     . PRO A  1 227 ? 16.183  -37.417 15.759  1.00 104.00 ? 226 PRO A CA     1 
ATOM   3315  C  C      . PRO A  1 227 ? 16.546  -35.947 15.921  1.00 89.59  ? 226 PRO A C      1 
ATOM   3316  O  O      . PRO A  1 227 ? 16.664  -35.465 17.045  1.00 117.36 ? 226 PRO A O      1 
ATOM   3317  C  CB     . PRO A  1 227 ? 17.222  -38.123 14.884  1.00 106.95 ? 226 PRO A CB     1 
ATOM   3318  C  CG     . PRO A  1 227 ? 16.462  -39.159 14.167  1.00 111.78 ? 226 PRO A CG     1 
ATOM   3319  C  CD     . PRO A  1 227 ? 15.098  -38.588 13.920  1.00 106.64 ? 226 PRO A CD     1 
ATOM   3320  H  HA     . PRO A  1 227 ? 16.150  -37.846 16.640  1.00 124.80 ? 226 PRO A HA     1 
ATOM   3321  H  HB2    . PRO A  1 227 ? 17.612  -37.490 14.262  1.00 128.34 ? 226 PRO A HB2    1 
ATOM   3322  H  HB3    . PRO A  1 227 ? 17.906  -38.523 15.444  1.00 128.34 ? 226 PRO A HB3    1 
ATOM   3323  H  HG2    . PRO A  1 227 ? 16.903  -39.360 13.327  1.00 134.14 ? 226 PRO A HG2    1 
ATOM   3324  H  HG3    . PRO A  1 227 ? 16.402  -39.955 14.718  1.00 134.14 ? 226 PRO A HG3    1 
ATOM   3325  H  HD2    . PRO A  1 227 ? 15.074  -38.124 13.069  1.00 127.96 ? 226 PRO A HD2    1 
ATOM   3326  H  HD3    . PRO A  1 227 ? 14.425  -39.285 13.966  1.00 127.96 ? 226 PRO A HD3    1 
ATOM   3327  N  N      . MET A  1 228 ? 16.735  -35.252 14.807  1.00 99.03  ? 227 MET A N      1 
ATOM   3328  C  CA     . MET A  1 228 ? 17.046  -33.830 14.825  1.00 107.84 ? 227 MET A CA     1 
ATOM   3329  C  C      . MET A  1 228 ? 16.269  -33.106 15.927  1.00 113.71 ? 227 MET A C      1 
ATOM   3330  O  O      . MET A  1 228 ? 16.821  -32.265 16.638  1.00 111.66 ? 227 MET A O      1 
ATOM   3331  C  CB     . MET A  1 228 ? 16.721  -33.228 13.459  1.00 86.39  ? 227 MET A CB     1 
ATOM   3332  C  CG     . MET A  1 228 ? 17.229  -31.825 13.255  1.00 107.38 ? 227 MET A CG     1 
ATOM   3333  S  SD     . MET A  1 228 ? 17.077  -31.297 11.536  1.00 126.75 ? 227 MET A SD     1 
ATOM   3334  C  CE     . MET A  1 228 ? 15.324  -31.541 11.260  1.00 200.09 ? 227 MET A CE     1 
ATOM   3335  H  H      . MET A  1 228 ? 16.687  -35.587 14.016  1.00 118.84 ? 227 MET A H      1 
ATOM   3336  H  HA     . MET A  1 228 ? 18.006  -33.716 14.985  1.00 129.41 ? 227 MET A HA     1 
ATOM   3337  H  HB2    . MET A  1 228 ? 17.116  -33.787 12.772  1.00 103.67 ? 227 MET A HB2    1 
ATOM   3338  H  HB3    . MET A  1 228 ? 15.757  -33.210 13.350  1.00 103.67 ? 227 MET A HB3    1 
ATOM   3339  H  HG2    . MET A  1 228 ? 16.714  -31.216 13.806  1.00 128.86 ? 227 MET A HG2    1 
ATOM   3340  H  HG3    . MET A  1 228 ? 18.167  -31.787 13.501  1.00 128.86 ? 227 MET A HG3    1 
ATOM   3341  H  HE1    . MET A  1 228 ? 15.112  -31.289 10.359  1.00 240.11 ? 227 MET A HE1    1 
ATOM   3342  H  HE2    . MET A  1 228 ? 15.112  -32.467 11.400  1.00 240.11 ? 227 MET A HE2    1 
ATOM   3343  H  HE3    . MET A  1 228 ? 14.832  -30.995 11.878  1.00 240.11 ? 227 MET A HE3    1 
ATOM   3344  N  N      . ARG A  1 229 ? 14.991  -33.449 16.072  1.00 112.32 ? 228 ARG A N      1 
ATOM   3345  C  CA     . ARG A  1 229 ? 14.129  -32.841 17.083  1.00 106.62 ? 228 ARG A CA     1 
ATOM   3346  C  C      . ARG A  1 229 ? 14.515  -33.292 18.488  1.00 100.81 ? 228 ARG A C      1 
ATOM   3347  O  O      . ARG A  1 229 ? 14.460  -32.512 19.438  1.00 120.97 ? 228 ARG A O      1 
ATOM   3348  C  CB     . ARG A  1 229 ? 12.666  -33.190 16.799  1.00 114.25 ? 228 ARG A CB     1 
ATOM   3349  C  CG     . ARG A  1 229 ? 11.683  -32.764 17.872  1.00 115.54 ? 228 ARG A CG     1 
ATOM   3350  C  CD     . ARG A  1 229 ? 10.264  -32.748 17.322  1.00 115.97 ? 228 ARG A CD     1 
ATOM   3351  N  NE     . ARG A  1 229 ? 9.259   -32.533 18.360  1.00 130.84 ? 228 ARG A NE     1 
ATOM   3352  C  CZ     . ARG A  1 229 ? 8.988   -31.356 18.918  1.00 130.44 ? 228 ARG A CZ     1 
ATOM   3353  N  NH1    . ARG A  1 229 ? 9.654   -30.266 18.560  1.00 113.99 ? 228 ARG A NH1    1 
ATOM   3354  N  NH2    . ARG A  1 229 ? 8.051   -31.271 19.850  1.00 150.65 ? 228 ARG A NH2    1 
ATOM   3355  H  H      . ARG A  1 229 ? 14.595  -34.040 15.589  1.00 134.78 ? 228 ARG A H      1 
ATOM   3356  H  HA     . ARG A  1 229 ? 14.223  -31.866 17.041  1.00 127.94 ? 228 ARG A HA     1 
ATOM   3357  H  HB2    . ARG A  1 229 ? 12.401  -32.758 15.972  1.00 137.11 ? 228 ARG A HB2    1 
ATOM   3358  H  HB3    . ARG A  1 229 ? 12.592  -34.152 16.700  1.00 137.11 ? 228 ARG A HB3    1 
ATOM   3359  H  HG2    . ARG A  1 229 ? 11.718  -33.393 18.611  1.00 138.65 ? 228 ARG A HG2    1 
ATOM   3360  H  HG3    . ARG A  1 229 ? 11.904  -31.870 18.177  1.00 138.65 ? 228 ARG A HG3    1 
ATOM   3361  H  HD2    . ARG A  1 229 ? 10.184  -32.031 16.674  1.00 139.16 ? 228 ARG A HD2    1 
ATOM   3362  H  HD3    . ARG A  1 229 ? 10.079  -33.601 16.898  1.00 139.16 ? 228 ARG A HD3    1 
ATOM   3363  H  HE     . ARG A  1 229 ? 8.811   -33.215 18.629  1.00 157.01 ? 228 ARG A HE     1 
ATOM   3364  H  HH11   . ARG A  1 229 ? 10.263  -30.313 17.955  1.00 136.79 ? 228 ARG A HH11   1 
ATOM   3365  H  HH12   . ARG A  1 229 ? 9.472   -29.510 18.929  1.00 136.79 ? 228 ARG A HH12   1 
ATOM   3366  H  HH21   . ARG A  1 229 ? 7.618   -31.974 20.090  1.00 180.78 ? 228 ARG A HH21   1 
ATOM   3367  H  HH22   . ARG A  1 229 ? 7.877   -30.512 20.216  1.00 180.78 ? 228 ARG A HH22   1 
ATOM   3368  N  N      . ALA A  1 230 ? 14.903  -34.555 18.616  1.00 90.49  ? 229 ALA A N      1 
ATOM   3369  C  CA     . ALA A  1 230 ? 15.358  -35.087 19.893  1.00 99.21  ? 229 ALA A CA     1 
ATOM   3370  C  C      . ALA A  1 230 ? 16.660  -34.409 20.312  1.00 109.75 ? 229 ALA A C      1 
ATOM   3371  O  O      . ALA A  1 230 ? 16.812  -33.994 21.460  1.00 123.54 ? 229 ALA A O      1 
ATOM   3372  C  CB     . ALA A  1 230 ? 15.542  -36.603 19.805  1.00 68.16  ? 229 ALA A CB     1 
ATOM   3373  H  H      . ALA A  1 230 ? 14.912  -35.127 17.974  1.00 108.59 ? 229 ALA A H      1 
ATOM   3374  H  HA     . ALA A  1 230 ? 14.683  -34.901 20.578  1.00 119.05 ? 229 ALA A HA     1 
ATOM   3375  H  HB1    . ALA A  1 230 ? 15.842  -36.931 20.656  1.00 81.79  ? 229 ALA A HB1    1 
ATOM   3376  H  HB2    . ALA A  1 230 ? 14.702  -37.007 19.576  1.00 81.79  ? 229 ALA A HB2    1 
ATOM   3377  H  HB3    . ALA A  1 230 ? 16.195  -36.800 19.129  1.00 81.79  ? 229 ALA A HB3    1 
ATOM   3378  N  N      . ILE A  1 231 ? 17.591  -34.287 19.370  1.00 100.77 ? 230 ILE A N      1 
ATOM   3379  C  CA     . ILE A  1 231 ? 18.887  -33.673 19.638  1.00 94.78  ? 230 ILE A CA     1 
ATOM   3380  C  C      . ILE A  1 231 ? 18.711  -32.305 20.290  1.00 114.48 ? 230 ILE A C      1 
ATOM   3381  O  O      . ILE A  1 231 ? 19.570  -31.849 21.046  1.00 126.99 ? 230 ILE A O      1 
ATOM   3382  C  CB     . ILE A  1 231 ? 19.704  -33.528 18.339  1.00 95.39  ? 230 ILE A CB     1 
ATOM   3383  C  CG1    . ILE A  1 231 ? 20.112  -34.909 17.823  1.00 95.29  ? 230 ILE A CG1    1 
ATOM   3384  C  CG2    . ILE A  1 231 ? 20.945  -32.680 18.569  1.00 105.69 ? 230 ILE A CG2    1 
ATOM   3385  C  CD1    . ILE A  1 231 ? 20.696  -34.899 16.436  1.00 100.32 ? 230 ILE A CD1    1 
ATOM   3386  H  H      . ILE A  1 231 ? 17.494  -34.555 18.559  1.00 120.92 ? 230 ILE A H      1 
ATOM   3387  H  HA     . ILE A  1 231 ? 19.392  -34.243 20.254  1.00 113.73 ? 230 ILE A HA     1 
ATOM   3388  H  HB     . ILE A  1 231 ? 19.151  -33.096 17.669  1.00 114.47 ? 230 ILE A HB     1 
ATOM   3389  H  HG12   . ILE A  1 231 ? 20.778  -35.281 18.422  1.00 114.35 ? 230 ILE A HG12   1 
ATOM   3390  H  HG13   . ILE A  1 231 ? 19.328  -35.481 17.809  1.00 114.35 ? 230 ILE A HG13   1 
ATOM   3391  H  HG21   . ILE A  1 231 ? 21.432  -32.608 17.744  1.00 126.82 ? 230 ILE A HG21   1 
ATOM   3392  H  HG22   . ILE A  1 231 ? 20.676  -31.808 18.867  1.00 126.82 ? 230 ILE A HG22   1 
ATOM   3393  H  HG23   . ILE A  1 231 ? 21.492  -33.101 19.236  1.00 126.82 ? 230 ILE A HG23   1 
ATOM   3394  H  HD11   . ILE A  1 231 ? 20.925  -35.797 16.187  1.00 120.38 ? 230 ILE A HD11   1 
ATOM   3395  H  HD12   . ILE A  1 231 ? 20.045  -34.545 15.826  1.00 120.38 ? 230 ILE A HD12   1 
ATOM   3396  H  HD13   . ILE A  1 231 ? 21.482  -34.348 16.433  1.00 120.38 ? 230 ILE A HD13   1 
ATOM   3397  N  N      . PHE A  1 232 ? 17.583  -31.664 20.000  1.00 116.45 ? 231 PHE A N      1 
ATOM   3398  C  CA     . PHE A  1 232 ? 17.280  -30.338 20.527  1.00 105.43 ? 231 PHE A CA     1 
ATOM   3399  C  C      . PHE A  1 232 ? 16.526  -30.407 21.852  1.00 115.47 ? 231 PHE A C      1 
ATOM   3400  O  O      . PHE A  1 232 ? 16.678  -29.535 22.707  1.00 122.43 ? 231 PHE A O      1 
ATOM   3401  C  CB     . PHE A  1 232 ? 16.456  -29.554 19.505  1.00 94.85  ? 231 PHE A CB     1 
ATOM   3402  C  CG     . PHE A  1 232 ? 15.726  -28.376 20.086  1.00 97.02  ? 231 PHE A CG     1 
ATOM   3403  C  CD1    . PHE A  1 232 ? 16.418  -27.255 20.511  1.00 98.35  ? 231 PHE A CD1    1 
ATOM   3404  C  CD2    . PHE A  1 232 ? 14.344  -28.385 20.195  1.00 94.14  ? 231 PHE A CD2    1 
ATOM   3405  C  CE1    . PHE A  1 232 ? 15.747  -26.168 21.040  1.00 102.99 ? 231 PHE A CE1    1 
ATOM   3406  C  CE2    . PHE A  1 232 ? 13.668  -27.300 20.722  1.00 80.03  ? 231 PHE A CE2    1 
ATOM   3407  C  CZ     . PHE A  1 232 ? 14.370  -26.191 21.145  1.00 94.68  ? 231 PHE A CZ     1 
ATOM   3408  H  H      . PHE A  1 232 ? 16.967  -31.982 19.491  1.00 139.74 ? 231 PHE A H      1 
ATOM   3409  H  HA     . PHE A  1 232 ? 18.119  -29.854 20.678  1.00 126.52 ? 231 PHE A HA     1 
ATOM   3410  H  HB2    . PHE A  1 232 ? 17.049  -29.223 18.813  1.00 113.82 ? 231 PHE A HB2    1 
ATOM   3411  H  HB3    . PHE A  1 232 ? 15.795  -30.148 19.116  1.00 113.82 ? 231 PHE A HB3    1 
ATOM   3412  H  HD1    . PHE A  1 232 ? 17.345  -27.234 20.442  1.00 118.02 ? 231 PHE A HD1    1 
ATOM   3413  H  HD2    . PHE A  1 232 ? 13.866  -29.130 19.911  1.00 112.97 ? 231 PHE A HD2    1 
ATOM   3414  H  HE1    . PHE A  1 232 ? 16.222  -25.421 21.324  1.00 123.59 ? 231 PHE A HE1    1 
ATOM   3415  H  HE2    . PHE A  1 232 ? 12.740  -27.319 20.793  1.00 96.03  ? 231 PHE A HE2    1 
ATOM   3416  H  HZ     . PHE A  1 232 ? 13.918  -25.461 21.501  1.00 113.61 ? 231 PHE A HZ     1 
ATOM   3417  N  N      . MET A  1 233 ? 15.710  -31.444 22.017  1.00 111.93 ? 232 MET A N      1 
ATOM   3418  C  CA     . MET A  1 233 ? 14.890  -31.595 23.216  1.00 110.19 ? 232 MET A CA     1 
ATOM   3419  C  C      . MET A  1 233 ? 15.706  -32.009 24.438  1.00 104.36 ? 232 MET A C      1 
ATOM   3420  O  O      . MET A  1 233 ? 15.574  -31.419 25.509  1.00 112.15 ? 232 MET A O      1 
ATOM   3421  C  CB     . MET A  1 233 ? 13.791  -32.633 22.975  1.00 118.53 ? 232 MET A CB     1 
ATOM   3422  C  CG     . MET A  1 233 ? 12.562  -32.096 22.263  1.00 115.95 ? 232 MET A CG     1 
ATOM   3423  S  SD     . MET A  1 233 ? 11.368  -33.397 21.888  1.00 139.17 ? 232 MET A SD     1 
ATOM   3424  C  CE     . MET A  1 233 ? 9.822   -32.512 22.079  1.00 147.42 ? 232 MET A CE     1 
ATOM   3425  H  H      . MET A  1 233 ? 15.612  -32.078 21.445  1.00 134.32 ? 232 MET A H      1 
ATOM   3426  H  HA     . MET A  1 233 ? 14.454  -30.738 23.406  1.00 132.23 ? 232 MET A HA     1 
ATOM   3427  H  HB2    . MET A  1 233 ? 14.155  -33.350 22.434  1.00 142.24 ? 232 MET A HB2    1 
ATOM   3428  H  HB3    . MET A  1 233 ? 13.503  -32.984 23.833  1.00 142.24 ? 232 MET A HB3    1 
ATOM   3429  H  HG2    . MET A  1 233 ? 12.126  -31.441 22.830  1.00 139.14 ? 232 MET A HG2    1 
ATOM   3430  H  HG3    . MET A  1 233 ? 12.833  -31.685 21.427  1.00 139.14 ? 232 MET A HG3    1 
ATOM   3431  H  HE1    . MET A  1 233 ? 9.095   -33.113 21.901  1.00 176.90 ? 232 MET A HE1    1 
ATOM   3432  H  HE2    . MET A  1 233 ? 9.762   -32.181 22.978  1.00 176.90 ? 232 MET A HE2    1 
ATOM   3433  H  HE3    . MET A  1 233 ? 9.803   -31.781 21.458  1.00 176.90 ? 232 MET A HE3    1 
ATOM   3434  N  N      . ILE A  1 234 ? 16.544  -33.027 24.270  1.00 95.62  ? 233 ILE A N      1 
ATOM   3435  C  CA     . ILE A  1 234 ? 17.245  -33.648 25.390  1.00 96.41  ? 233 ILE A CA     1 
ATOM   3436  C  C      . ILE A  1 234 ? 17.986  -32.644 26.279  1.00 113.22 ? 233 ILE A C      1 
ATOM   3437  O  O      . ILE A  1 234 ? 17.882  -32.711 27.505  1.00 118.28 ? 233 ILE A O      1 
ATOM   3438  C  CB     . ILE A  1 234 ? 18.212  -34.743 24.891  1.00 89.96  ? 233 ILE A CB     1 
ATOM   3439  C  CG1    . ILE A  1 234 ? 17.415  -35.960 24.417  1.00 97.25  ? 233 ILE A CG1    1 
ATOM   3440  C  CG2    . ILE A  1 234 ? 19.180  -35.152 25.990  1.00 88.97  ? 233 ILE A CG2    1 
ATOM   3441  C  CD1    . ILE A  1 234 ? 18.020  -36.668 23.223  1.00 85.43  ? 233 ILE A CD1    1 
ATOM   3442  H  H      . ILE A  1 234 ? 16.725  -33.381 23.507  1.00 114.74 ? 233 ILE A H      1 
ATOM   3443  H  HA     . ILE A  1 234 ? 16.578  -34.091 25.955  1.00 115.69 ? 233 ILE A HA     1 
ATOM   3444  H  HB     . ILE A  1 234 ? 18.721  -34.393 24.142  1.00 107.95 ? 233 ILE A HB     1 
ATOM   3445  H  HG12   . ILE A  1 234 ? 17.362  -36.600 25.144  1.00 116.70 ? 233 ILE A HG12   1 
ATOM   3446  H  HG13   . ILE A  1 234 ? 16.523  -35.671 24.169  1.00 116.70 ? 233 ILE A HG13   1 
ATOM   3447  H  HG21   . ILE A  1 234 ? 19.767  -35.832 25.652  1.00 106.76 ? 233 ILE A HG21   1 
ATOM   3448  H  HG22   . ILE A  1 234 ? 19.688  -34.383 26.259  1.00 106.76 ? 233 ILE A HG22   1 
ATOM   3449  H  HG23   . ILE A  1 234 ? 18.679  -35.492 26.735  1.00 106.76 ? 233 ILE A HG23   1 
ATOM   3450  H  HD11   . ILE A  1 234 ? 17.464  -37.415 22.988  1.00 102.51 ? 233 ILE A HD11   1 
ATOM   3451  H  HD12   . ILE A  1 234 ? 18.069  -36.053 22.487  1.00 102.51 ? 233 ILE A HD12   1 
ATOM   3452  H  HD13   . ILE A  1 234 ? 18.900  -36.973 23.454  1.00 102.51 ? 233 ILE A HD13   1 
ATOM   3453  N  N      . PRO A  1 235 ? 18.739  -31.712 25.673  1.00 108.10 ? 234 PRO A N      1 
ATOM   3454  C  CA     . PRO A  1 235 ? 19.446  -30.725 26.497  1.00 110.54 ? 234 PRO A CA     1 
ATOM   3455  C  C      . PRO A  1 235 ? 18.570  -29.544 26.918  1.00 110.87 ? 234 PRO A C      1 
ATOM   3456  O  O      . PRO A  1 235 ? 19.024  -28.701 27.691  1.00 113.72 ? 234 PRO A O      1 
ATOM   3457  C  CB     . PRO A  1 235 ? 20.573  -30.233 25.574  1.00 110.33 ? 234 PRO A CB     1 
ATOM   3458  C  CG     . PRO A  1 235 ? 20.547  -31.136 24.368  1.00 101.59 ? 234 PRO A CG     1 
ATOM   3459  C  CD     . PRO A  1 235 ? 19.144  -31.622 24.264  1.00 94.91  ? 234 PRO A CD     1 
ATOM   3460  H  HA     . PRO A  1 235 ? 19.832  -31.150 27.292  1.00 132.65 ? 234 PRO A HA     1 
ATOM   3461  H  HB2    . PRO A  1 235 ? 20.402  -29.314 25.315  1.00 132.39 ? 234 PRO A HB2    1 
ATOM   3462  H  HB3    . PRO A  1 235 ? 21.424  -30.305 26.034  1.00 132.39 ? 234 PRO A HB3    1 
ATOM   3463  H  HG2    . PRO A  1 235 ? 20.794  -30.631 23.578  1.00 121.91 ? 234 PRO A HG2    1 
ATOM   3464  H  HG3    . PRO A  1 235 ? 21.157  -31.878 24.504  1.00 121.91 ? 234 PRO A HG3    1 
ATOM   3465  H  HD2    . PRO A  1 235 ? 18.594  -30.978 23.791  1.00 113.89 ? 234 PRO A HD2    1 
ATOM   3466  H  HD3    . PRO A  1 235 ? 19.116  -32.496 23.844  1.00 113.89 ? 234 PRO A HD3    1 
ATOM   3467  N  N      . THR A  1 236 ? 17.339  -29.485 26.418  1.00 109.00 ? 235 THR A N      1 
ATOM   3468  C  CA     . THR A  1 236 ? 16.447  -28.364 26.708  1.00 117.86 ? 235 THR A CA     1 
ATOM   3469  C  C      . THR A  1 236 ? 15.366  -28.734 27.721  1.00 127.37 ? 235 THR A C      1 
ATOM   3470  O  O      . THR A  1 236 ? 15.243  -28.101 28.770  1.00 136.33 ? 235 THR A O      1 
ATOM   3471  C  CB     . THR A  1 236 ? 15.765  -27.851 25.425  1.00 111.74 ? 235 THR A CB     1 
ATOM   3472  O  OG1    . THR A  1 236 ? 16.749  -27.281 24.554  1.00 106.53 ? 235 THR A OG1    1 
ATOM   3473  C  CG2    . THR A  1 236 ? 14.717  -26.797 25.753  1.00 117.28 ? 235 THR A CG2    1 
ATOM   3474  H  H      . THR A  1 236 ? 16.994  -30.083 25.905  1.00 130.80 ? 235 THR A H      1 
ATOM   3475  H  HA     . THR A  1 236 ? 16.974  -27.628 27.085  1.00 141.43 ? 235 THR A HA     1 
ATOM   3476  H  HB     . THR A  1 236 ? 15.326  -28.590 24.976  1.00 134.08 ? 235 THR A HB     1 
ATOM   3477  H  HG1    . THR A  1 236 ? 17.308  -27.847 24.353  1.00 127.84 ? 235 THR A HG1    1 
ATOM   3478  H  HG21   . THR A  1 236 ? 14.301  -26.486 24.945  1.00 140.74 ? 235 THR A HG21   1 
ATOM   3479  H  HG22   . THR A  1 236 ? 14.044  -27.171 26.327  1.00 140.74 ? 235 THR A HG22   1 
ATOM   3480  H  HG23   . THR A  1 236 ? 15.128  -26.052 26.198  1.00 140.74 ? 235 THR A HG23   1 
ATOM   3481  N  N      . ASN A  1 237 ? 14.581  -29.755 27.395  1.00 118.26 ? 236 ASN A N      1 
ATOM   3482  C  CA     . ASN A  1 237 ? 13.481  -30.185 28.250  1.00 114.75 ? 236 ASN A CA     1 
ATOM   3483  C  C      . ASN A  1 237 ? 13.955  -30.740 29.587  1.00 125.97 ? 236 ASN A C      1 
ATOM   3484  O  O      . ASN A  1 237 ? 15.136  -31.044 29.758  1.00 130.19 ? 236 ASN A O      1 
ATOM   3485  C  CB     . ASN A  1 237 ? 12.649  -31.249 27.535  1.00 106.56 ? 236 ASN A CB     1 
ATOM   3486  C  CG     . ASN A  1 237 ? 11.804  -30.676 26.420  1.00 125.55 ? 236 ASN A CG     1 
ATOM   3487  O  OD1    . ASN A  1 237 ? 12.068  -29.580 25.923  1.00 137.01 ? 236 ASN A OD1    1 
ATOM   3488  N  ND2    . ASN A  1 237 ? 10.777  -31.417 26.019  1.00 122.98 ? 236 ASN A ND2    1 
ATOM   3489  H  H      . ASN A  1 237 ? 14.666  -30.220 26.677  1.00 141.91 ? 236 ASN A H      1 
ATOM   3490  H  HA     . ASN A  1 237 ? 12.900  -29.416 28.431  1.00 137.70 ? 236 ASN A HA     1 
ATOM   3491  H  HB2    . ASN A  1 237 ? 13.245  -31.911 27.151  1.00 127.88 ? 236 ASN A HB2    1 
ATOM   3492  H  HB3    . ASN A  1 237 ? 12.055  -31.669 28.176  1.00 127.88 ? 236 ASN A HB3    1 
ATOM   3493  H  HD21   . ASN A  1 237 ? 10.625  -32.177 26.391  1.00 147.58 ? 236 ASN A HD21   1 
ATOM   3494  H  HD22   . ASN A  1 237 ? 10.265  -31.136 25.388  1.00 147.58 ? 236 ASN A HD22   1 
ATOM   3495  N  N      . PRO A  1 238 ? 13.023  -30.882 30.542  1.00 128.58 ? 237 PRO A N      1 
ATOM   3496  C  CA     . PRO A  1 238 ? 13.340  -31.521 31.821  1.00 125.50 ? 237 PRO A CA     1 
ATOM   3497  C  C      . PRO A  1 238 ? 13.388  -33.036 31.660  1.00 117.07 ? 237 PRO A C      1 
ATOM   3498  O  O      . PRO A  1 238 ? 12.691  -33.570 30.797  1.00 113.43 ? 237 PRO A O      1 
ATOM   3499  C  CB     . PRO A  1 238 ? 12.170  -31.109 32.728  1.00 124.44 ? 237 PRO A CB     1 
ATOM   3500  C  CG     . PRO A  1 238 ? 11.222  -30.295 31.864  1.00 121.75 ? 237 PRO A CG     1 
ATOM   3501  C  CD     . PRO A  1 238 ? 11.597  -30.537 30.447  1.00 117.18 ? 237 PRO A CD     1 
ATOM   3502  H  HA     . PRO A  1 238 ? 14.187  -31.188 32.186  1.00 150.60 ? 237 PRO A HA     1 
ATOM   3503  H  HB2    . PRO A  1 238 ? 11.726  -31.903 33.064  1.00 149.33 ? 237 PRO A HB2    1 
ATOM   3504  H  HB3    . PRO A  1 238 ? 12.505  -30.571 33.463  1.00 149.33 ? 237 PRO A HB3    1 
ATOM   3505  H  HG2    . PRO A  1 238 ? 10.311  -30.587 32.026  1.00 146.10 ? 237 PRO A HG2    1 
ATOM   3506  H  HG3    . PRO A  1 238 ? 11.317  -29.355 32.082  1.00 146.10 ? 237 PRO A HG3    1 
ATOM   3507  H  HD2    . PRO A  1 238 ? 11.091  -31.280 30.083  1.00 140.61 ? 237 PRO A HD2    1 
ATOM   3508  H  HD3    . PRO A  1 238 ? 11.477  -29.731 29.921  1.00 140.61 ? 237 PRO A HD3    1 
ATOM   3509  N  N      . PRO A  1 239 ? 14.199  -33.724 32.477  1.00 119.80 ? 238 PRO A N      1 
ATOM   3510  C  CA     . PRO A  1 239 ? 14.367  -35.174 32.327  1.00 115.71 ? 238 PRO A CA     1 
ATOM   3511  C  C      . PRO A  1 239 ? 13.031  -35.910 32.216  1.00 103.83 ? 238 PRO A C      1 
ATOM   3512  O  O      . PRO A  1 239 ? 12.057  -35.501 32.846  1.00 110.31 ? 238 PRO A O      1 
ATOM   3513  C  CB     . PRO A  1 239 ? 15.098  -35.573 33.611  1.00 121.26 ? 238 PRO A CB     1 
ATOM   3514  C  CG     . PRO A  1 239 ? 15.831  -34.344 34.022  1.00 106.38 ? 238 PRO A CG     1 
ATOM   3515  C  CD     . PRO A  1 239 ? 14.956  -33.194 33.625  1.00 97.44  ? 238 PRO A CD     1 
ATOM   3516  H  HA     . PRO A  1 239 ? 14.926  -35.381 31.550  1.00 138.86 ? 238 PRO A HA     1 
ATOM   3517  H  HB2    . PRO A  1 239 ? 14.454  -35.833 34.288  1.00 145.51 ? 238 PRO A HB2    1 
ATOM   3518  H  HB3    . PRO A  1 239 ? 15.716  -36.297 33.425  1.00 145.51 ? 238 PRO A HB3    1 
ATOM   3519  H  HG2    . PRO A  1 239 ? 15.967  -34.353 34.983  1.00 127.65 ? 238 PRO A HG2    1 
ATOM   3520  H  HG3    . PRO A  1 239 ? 16.682  -34.301 33.557  1.00 127.65 ? 238 PRO A HG3    1 
ATOM   3521  H  HD2    . PRO A  1 239 ? 14.353  -32.961 34.349  1.00 116.92 ? 238 PRO A HD2    1 
ATOM   3522  H  HD3    . PRO A  1 239 ? 15.496  -32.435 33.353  1.00 116.92 ? 238 PRO A HD3    1 
ATOM   3523  N  N      . PRO A  1 240 ? 12.984  -36.985 31.414  1.00 112.46 ? 239 PRO A N      1 
ATOM   3524  C  CA     . PRO A  1 240 ? 11.740  -37.736 31.212  1.00 118.38 ? 239 PRO A CA     1 
ATOM   3525  C  C      . PRO A  1 240 ? 11.361  -38.600 32.410  1.00 126.74 ? 239 PRO A C      1 
ATOM   3526  O  O      . PRO A  1 240 ? 12.210  -38.926 33.242  1.00 120.17 ? 239 PRO A O      1 
ATOM   3527  C  CB     . PRO A  1 240 ? 12.061  -38.621 30.003  1.00 101.62 ? 239 PRO A CB     1 
ATOM   3528  C  CG     . PRO A  1 240 ? 13.532  -38.825 30.072  1.00 94.24  ? 239 PRO A CG     1 
ATOM   3529  C  CD     . PRO A  1 240 ? 14.095  -37.535 30.615  1.00 111.49 ? 239 PRO A CD     1 
ATOM   3530  H  HA     . PRO A  1 240 ? 11.001  -37.131 30.991  1.00 142.05 ? 239 PRO A HA     1 
ATOM   3531  H  HB2    . PRO A  1 240 ? 11.592  -39.466 30.080  1.00 121.95 ? 239 PRO A HB2    1 
ATOM   3532  H  HB3    . PRO A  1 240 ? 11.814  -38.162 29.185  1.00 121.95 ? 239 PRO A HB3    1 
ATOM   3533  H  HG2    . PRO A  1 240 ? 13.731  -39.563 30.669  1.00 113.09 ? 239 PRO A HG2    1 
ATOM   3534  H  HG3    . PRO A  1 240 ? 13.878  -39.001 29.183  1.00 113.09 ? 239 PRO A HG3    1 
ATOM   3535  H  HD2    . PRO A  1 240 ? 14.862  -37.713 31.182  1.00 133.79 ? 239 PRO A HD2    1 
ATOM   3536  H  HD3    . PRO A  1 240 ? 14.320  -36.932 29.890  1.00 133.79 ? 239 PRO A HD3    1 
ATOM   3537  N  N      . THR A  1 241 ? 10.084  -38.959 32.489  1.00 137.99 ? 240 THR A N      1 
ATOM   3538  C  CA     . THR A  1 241 ? 9.595   -39.861 33.522  1.00 144.38 ? 240 THR A CA     1 
ATOM   3539  C  C      . THR A  1 241 ? 8.759   -40.948 32.859  1.00 153.91 ? 240 THR A C      1 
ATOM   3540  O  O      . THR A  1 241 ? 8.799   -41.110 31.640  1.00 147.37 ? 240 THR A O      1 
ATOM   3541  C  CB     . THR A  1 241 ? 8.736   -39.118 34.560  1.00 150.10 ? 240 THR A CB     1 
ATOM   3542  O  OG1    . THR A  1 241 ? 7.477   -38.760 33.977  1.00 160.84 ? 240 THR A OG1    1 
ATOM   3543  C  CG2    . THR A  1 241 ? 9.448   -37.862 35.044  1.00 140.34 ? 240 THR A CG2    1 
ATOM   3544  H  H      . THR A  1 241 ? 9.474   -38.688 31.948  1.00 165.59 ? 240 THR A H      1 
ATOM   3545  H  HA     . THR A  1 241 ? 10.352  -40.281 33.981  1.00 173.26 ? 240 THR A HA     1 
ATOM   3546  H  HB     . THR A  1 241 ? 8.584   -39.696 35.323  1.00 180.12 ? 240 THR A HB     1 
ATOM   3547  H  HG1    . THR A  1 241 ? 7.016   -38.363 34.527  1.00 193.01 ? 240 THR A HG1    1 
ATOM   3548  H  HG21   . THR A  1 241 ? 8.904   -37.406 35.691  1.00 168.40 ? 240 THR A HG21   1 
ATOM   3549  H  HG22   . THR A  1 241 ? 10.286  -38.096 35.450  1.00 168.40 ? 240 THR A HG22   1 
ATOM   3550  H  HG23   . THR A  1 241 ? 9.613   -37.273 34.304  1.00 168.40 ? 240 THR A HG23   1 
ATOM   3551  N  N      . PHE A  1 242 ? 8.001   -41.690 33.657  1.00 168.05 ? 241 PHE A N      1 
ATOM   3552  C  CA     . PHE A  1 242 ? 7.168   -42.757 33.120  1.00 173.88 ? 241 PHE A CA     1 
ATOM   3553  C  C      . PHE A  1 242 ? 5.874   -42.189 32.550  1.00 170.42 ? 241 PHE A C      1 
ATOM   3554  O  O      . PHE A  1 242 ? 5.298   -41.257 33.111  1.00 178.80 ? 241 PHE A O      1 
ATOM   3555  C  CB     . PHE A  1 242 ? 6.849   -43.783 34.207  1.00 169.88 ? 241 PHE A CB     1 
ATOM   3556  C  CG     . PHE A  1 242 ? 8.061   -44.302 34.924  1.00 162.52 ? 241 PHE A CG     1 
ATOM   3557  C  CD1    . PHE A  1 242 ? 8.738   -45.416 34.457  1.00 142.64 ? 241 PHE A CD1    1 
ATOM   3558  C  CD2    . PHE A  1 242 ? 8.522   -43.676 36.068  1.00 172.90 ? 241 PHE A CD2    1 
ATOM   3559  C  CE1    . PHE A  1 242 ? 9.853   -45.894 35.119  1.00 146.06 ? 241 PHE A CE1    1 
ATOM   3560  C  CE2    . PHE A  1 242 ? 9.635   -44.148 36.732  1.00 174.34 ? 241 PHE A CE2    1 
ATOM   3561  C  CZ     . PHE A  1 242 ? 10.302  -45.258 36.258  1.00 161.79 ? 241 PHE A CZ     1 
ATOM   3562  H  H      . PHE A  1 242 ? 7.951   -41.596 34.510  1.00 201.66 ? 241 PHE A H      1 
ATOM   3563  H  HA     . PHE A  1 242 ? 7.650   -43.212 32.398  1.00 208.66 ? 241 PHE A HA     1 
ATOM   3564  H  HB2    . PHE A  1 242 ? 6.269   -43.370 34.865  1.00 203.85 ? 241 PHE A HB2    1 
ATOM   3565  H  HB3    . PHE A  1 242 ? 6.399   -44.540 33.800  1.00 203.85 ? 241 PHE A HB3    1 
ATOM   3566  H  HD1    . PHE A  1 242 ? 8.439   -45.848 33.689  1.00 171.17 ? 241 PHE A HD1    1 
ATOM   3567  H  HD2    . PHE A  1 242 ? 8.077   -42.927 36.393  1.00 207.48 ? 241 PHE A HD2    1 
ATOM   3568  H  HE1    . PHE A  1 242 ? 10.301  -46.642 34.796  1.00 175.28 ? 241 PHE A HE1    1 
ATOM   3569  H  HE2    . PHE A  1 242 ? 9.935   -43.718 37.500  1.00 209.21 ? 241 PHE A HE2    1 
ATOM   3570  H  HZ     . PHE A  1 242 ? 11.052  -45.577 36.705  1.00 194.15 ? 241 PHE A HZ     1 
ATOM   3571  N  N      . ARG A  1 243 ? 5.422   -42.749 31.432  1.00 149.41 ? 242 ARG A N      1 
ATOM   3572  C  CA     . ARG A  1 243 ? 4.156   -42.341 30.834  1.00 161.42 ? 242 ARG A CA     1 
ATOM   3573  C  C      . ARG A  1 243 ? 3.005   -42.637 31.792  1.00 187.66 ? 242 ARG A C      1 
ATOM   3574  O  O      . ARG A  1 243 ? 1.934   -42.036 31.701  1.00 198.57 ? 242 ARG A O      1 
ATOM   3575  C  CB     . ARG A  1 243 ? 3.940   -43.050 29.495  1.00 167.09 ? 242 ARG A CB     1 
ATOM   3576  C  CG     . ARG A  1 243 ? 4.933   -42.629 28.415  1.00 181.17 ? 242 ARG A CG     1 
ATOM   3577  C  CD     . ARG A  1 243 ? 4.740   -43.397 27.114  1.00 185.55 ? 242 ARG A CD     1 
ATOM   3578  N  NE     . ARG A  1 243 ? 4.790   -44.844 27.316  1.00 198.21 ? 242 ARG A NE     1 
ATOM   3579  C  CZ     . ARG A  1 243 ? 3.755   -45.674 27.194  1.00 212.47 ? 242 ARG A CZ     1 
ATOM   3580  N  NH1    . ARG A  1 243 ? 2.551   -45.230 26.854  1.00 216.40 ? 242 ARG A NH1    1 
ATOM   3581  N  NH2    . ARG A  1 243 ? 3.927   -46.970 27.408  1.00 217.52 ? 242 ARG A NH2    1 
ATOM   3582  H  H      . ARG A  1 243 ? 5.831   -43.370 30.999  1.00 179.30 ? 242 ARG A H      1 
ATOM   3583  H  HA     . ARG A  1 243 ? 4.175   -41.375 30.669  1.00 193.71 ? 242 ARG A HA     1 
ATOM   3584  H  HB2    . ARG A  1 243 ? 4.032   -44.006 29.628  1.00 200.51 ? 242 ARG A HB2    1 
ATOM   3585  H  HB3    . ARG A  1 243 ? 3.047   -42.846 29.174  1.00 200.51 ? 242 ARG A HB3    1 
ATOM   3586  H  HG2    . ARG A  1 243 ? 4.816   -41.685 28.227  1.00 217.40 ? 242 ARG A HG2    1 
ATOM   3587  H  HG3    . ARG A  1 243 ? 5.834   -42.796 28.731  1.00 217.40 ? 242 ARG A HG3    1 
ATOM   3588  H  HD2    . ARG A  1 243 ? 3.873   -43.174 26.739  1.00 222.66 ? 242 ARG A HD2    1 
ATOM   3589  H  HD3    . ARG A  1 243 ? 5.445   -43.153 26.494  1.00 222.66 ? 242 ARG A HD3    1 
ATOM   3590  H  HE     . ARG A  1 243 ? 5.549   -45.187 27.530  1.00 237.85 ? 242 ARG A HE     1 
ATOM   3591  H  HH11   . ARG A  1 243 ? 2.426   -44.391 26.713  1.00 259.68 ? 242 ARG A HH11   1 
ATOM   3592  H  HH12   . ARG A  1 243 ? 1.895   -45.781 26.779  1.00 259.68 ? 242 ARG A HH12   1 
ATOM   3593  H  HH21   . ARG A  1 243 ? 4.703   -47.270 27.627  1.00 261.03 ? 242 ARG A HH21   1 
ATOM   3594  H  HH22   . ARG A  1 243 ? 3.263   -47.511 27.328  1.00 261.03 ? 242 ARG A HH22   1 
ATOM   3595  N  N      . LYS A  1 244 ? 3.239   -43.569 32.712  1.00 197.40 ? 243 LYS A N      1 
ATOM   3596  C  CA     . LYS A  1 244 ? 2.276   -43.896 33.757  1.00 194.67 ? 243 LYS A CA     1 
ATOM   3597  C  C      . LYS A  1 244 ? 3.024   -44.189 35.055  1.00 187.51 ? 243 LYS A C      1 
ATOM   3598  O  O      . LYS A  1 244 ? 3.286   -45.348 35.377  1.00 180.85 ? 243 LYS A O      1 
ATOM   3599  C  CB     . LYS A  1 244 ? 1.431   -45.102 33.344  1.00 198.29 ? 243 LYS A CB     1 
ATOM   3600  C  CG     . LYS A  1 244 ? 0.481   -44.822 32.187  1.00 203.91 ? 243 LYS A CG     1 
ATOM   3601  C  CD     . LYS A  1 244 ? -0.199  -46.090 31.698  1.00 201.96 ? 243 LYS A CD     1 
ATOM   3602  C  CE     . LYS A  1 244 ? -1.209  -45.793 30.600  1.00 193.61 ? 243 LYS A CE     1 
ATOM   3603  N  NZ     . LYS A  1 244 ? -1.830  -47.037 30.064  1.00 184.24 ? 243 LYS A NZ     1 
ATOM   3604  H  H      . LYS A  1 244 ? 3.962   -44.032 32.753  1.00 236.88 ? 243 LYS A H      1 
ATOM   3605  H  HA     . LYS A  1 244 ? 1.679   -43.132 33.904  1.00 233.61 ? 243 LYS A HA     1 
ATOM   3606  H  HB2    . LYS A  1 244 ? 2.024   -45.821 33.073  1.00 237.95 ? 243 LYS A HB2    1 
ATOM   3607  H  HB3    . LYS A  1 244 ? 0.898   -45.385 34.103  1.00 237.95 ? 243 LYS A HB3    1 
ATOM   3608  H  HG2    . LYS A  1 244 ? -0.205  -44.203 32.480  1.00 244.69 ? 243 LYS A HG2    1 
ATOM   3609  H  HG3    . LYS A  1 244 ? 0.982   -44.442 31.448  1.00 244.69 ? 243 LYS A HG3    1 
ATOM   3610  H  HD2    . LYS A  1 244 ? 0.470   -46.695 31.341  1.00 242.36 ? 243 LYS A HD2    1 
ATOM   3611  H  HD3    . LYS A  1 244 ? -0.668  -46.507 32.438  1.00 242.36 ? 243 LYS A HD3    1 
ATOM   3612  H  HE2    . LYS A  1 244 ? -1.915  -45.233 30.959  1.00 232.33 ? 243 LYS A HE2    1 
ATOM   3613  H  HE3    . LYS A  1 244 ? -0.762  -45.340 29.869  1.00 232.33 ? 243 LYS A HE3    1 
ATOM   3614  H  HZ1    . LYS A  1 244 ? -2.416  -46.834 29.425  1.00 221.08 ? 243 LYS A HZ1    1 
ATOM   3615  H  HZ2    . LYS A  1 244 ? -1.203  -47.568 29.723  1.00 221.08 ? 243 LYS A HZ2    1 
ATOM   3616  H  HZ3    . LYS A  1 244 ? -2.253  -47.471 30.716  1.00 221.08 ? 243 LYS A HZ3    1 
ATOM   3617  N  N      . PRO A  1 245 ? 3.371   -43.130 35.807  1.00 187.97 ? 244 PRO A N      1 
ATOM   3618  C  CA     . PRO A  1 245 ? 4.228   -43.214 36.998  1.00 193.16 ? 244 PRO A CA     1 
ATOM   3619  C  C      . PRO A  1 245 ? 3.597   -43.934 38.190  1.00 200.06 ? 244 PRO A C      1 
ATOM   3620  O  O      . PRO A  1 245 ? 4.312   -44.296 39.124  1.00 200.33 ? 244 PRO A O      1 
ATOM   3621  C  CB     . PRO A  1 245 ? 4.481   -41.743 37.348  1.00 187.81 ? 244 PRO A CB     1 
ATOM   3622  C  CG     . PRO A  1 245 ? 3.310   -41.019 36.798  1.00 184.89 ? 244 PRO A CG     1 
ATOM   3623  C  CD     . PRO A  1 245 ? 2.930   -41.748 35.546  1.00 181.94 ? 244 PRO A CD     1 
ATOM   3624  H  HA     . PRO A  1 245 ? 5.079   -43.643 36.774  1.00 231.79 ? 244 PRO A HA     1 
ATOM   3625  H  HB2    . PRO A  1 245 ? 4.529   -41.638 38.311  1.00 225.38 ? 244 PRO A HB2    1 
ATOM   3626  H  HB3    . PRO A  1 245 ? 5.301   -41.442 36.927  1.00 225.38 ? 244 PRO A HB3    1 
ATOM   3627  H  HG2    . PRO A  1 245 ? 2.583   -41.042 37.440  1.00 221.87 ? 244 PRO A HG2    1 
ATOM   3628  H  HG3    . PRO A  1 245 ? 3.559   -40.104 36.597  1.00 221.87 ? 244 PRO A HG3    1 
ATOM   3629  H  HD2    . PRO A  1 245 ? 1.969   -41.718 35.416  1.00 218.33 ? 244 PRO A HD2    1 
ATOM   3630  H  HD3    . PRO A  1 245 ? 3.404   -41.380 34.784  1.00 218.33 ? 244 PRO A HD3    1 
ATOM   3631  N  N      . GLU A  1 246 ? 2.284   -44.136 38.161  1.00 202.74 ? 245 GLU A N      1 
ATOM   3632  C  CA     . GLU A  1 246 ? 1.596   -44.791 39.269  1.00 195.15 ? 245 GLU A CA     1 
ATOM   3633  C  C      . GLU A  1 246 ? 1.878   -46.293 39.299  1.00 187.29 ? 245 GLU A C      1 
ATOM   3634  O  O      . GLU A  1 246 ? 1.810   -46.921 40.355  1.00 195.12 ? 245 GLU A O      1 
ATOM   3635  C  CB     . GLU A  1 246 ? 0.084   -44.542 39.203  1.00 199.57 ? 245 GLU A CB     1 
ATOM   3636  C  CG     . GLU A  1 246 ? -0.634  -45.234 38.049  1.00 212.14 ? 245 GLU A CG     1 
ATOM   3637  C  CD     . GLU A  1 246 ? -0.566  -44.455 36.748  1.00 228.17 ? 245 GLU A CD     1 
ATOM   3638  O  OE1    . GLU A  1 246 ? -1.082  -44.957 35.727  1.00 231.38 ? 245 GLU A OE1    1 
ATOM   3639  O  OE2    . GLU A  1 246 ? -0.000  -43.342 36.746  1.00 235.65 ? 245 GLU A OE2    1 
ATOM   3640  H  H      . GLU A  1 246 ? 1.768   -43.903 37.513  1.00 243.29 ? 245 GLU A H      1 
ATOM   3641  H  HA     . GLU A  1 246 ? 1.923   -44.411 40.111  1.00 234.18 ? 245 GLU A HA     1 
ATOM   3642  H  HB2    . GLU A  1 246 ? -0.317  -44.858 40.028  1.00 239.49 ? 245 GLU A HB2    1 
ATOM   3643  H  HB3    . GLU A  1 246 ? -0.068  -43.589 39.112  1.00 239.49 ? 245 GLU A HB3    1 
ATOM   3644  H  HG2    . GLU A  1 246 ? -0.226  -46.101 37.899  1.00 254.57 ? 245 GLU A HG2    1 
ATOM   3645  H  HG3    . GLU A  1 246 ? -1.570  -45.345 38.281  1.00 254.57 ? 245 GLU A HG3    1 
ATOM   3646  N  N      . LEU A  1 247 ? 2.197   -46.861 38.139  1.00 173.38 ? 246 LEU A N      1 
ATOM   3647  C  CA     . LEU A  1 247 ? 2.469   -48.294 38.032  1.00 165.49 ? 246 LEU A CA     1 
ATOM   3648  C  C      . LEU A  1 247 ? 3.820   -48.680 38.626  1.00 155.12 ? 246 LEU A C      1 
ATOM   3649  O  O      . LEU A  1 247 ? 4.121   -49.865 38.774  1.00 156.08 ? 246 LEU A O      1 
ATOM   3650  C  CB     . LEU A  1 247 ? 2.424   -48.743 36.568  1.00 168.12 ? 246 LEU A CB     1 
ATOM   3651  C  CG     . LEU A  1 247 ? 1.136   -49.419 36.094  1.00 161.63 ? 246 LEU A CG     1 
ATOM   3652  C  CD1    . LEU A  1 247 ? 0.004   -48.413 35.966  1.00 144.93 ? 246 LEU A CD1    1 
ATOM   3653  C  CD2    . LEU A  1 247 ? 1.370   -50.146 34.777  1.00 158.58 ? 246 LEU A CD2    1 
ATOM   3654  H  H      . LEU A  1 247 ? 2.263   -46.437 37.394  1.00 208.05 ? 246 LEU A H      1 
ATOM   3655  H  HA     . LEU A  1 247 ? 1.774   -48.785 38.519  1.00 198.58 ? 246 LEU A HA     1 
ATOM   3656  H  HB2    . LEU A  1 247 ? 2.561   -47.963 36.008  1.00 201.74 ? 246 LEU A HB2    1 
ATOM   3657  H  HB3    . LEU A  1 247 ? 3.148   -49.373 36.423  1.00 201.74 ? 246 LEU A HB3    1 
ATOM   3658  H  HG     . LEU A  1 247 ? 0.870   -50.080 36.753  1.00 193.96 ? 246 LEU A HG     1 
ATOM   3659  H  HD11   . LEU A  1 247 ? -0.787  -48.869 35.668  1.00 173.91 ? 246 LEU A HD11   1 
ATOM   3660  H  HD12   . LEU A  1 247 ? -0.154  -48.010 36.823  1.00 173.91 ? 246 LEU A HD12   1 
ATOM   3661  H  HD13   . LEU A  1 247 ? 0.254   -47.741 35.329  1.00 173.91 ? 246 LEU A HD13   1 
ATOM   3662  H  HD21   . LEU A  1 247 ? 0.550   -50.561 34.499  1.00 190.29 ? 246 LEU A HD21   1 
ATOM   3663  H  HD22   . LEU A  1 247 ? 1.656   -49.510 34.116  1.00 190.29 ? 246 LEU A HD22   1 
ATOM   3664  H  HD23   . LEU A  1 247 ? 2.049   -50.813 34.905  1.00 190.29 ? 246 LEU A HD23   1 
ATOM   3665  N  N      . TRP A  1 248 ? 4.635   -47.685 38.960  1.00 149.28 ? 247 TRP A N      1 
ATOM   3666  C  CA     . TRP A  1 248 ? 5.988   -47.943 39.437  1.00 147.39 ? 247 TRP A CA     1 
ATOM   3667  C  C      . TRP A  1 248 ? 6.188   -47.435 40.861  1.00 144.09 ? 247 TRP A C      1 
ATOM   3668  O  O      . TRP A  1 248 ? 5.597   -46.433 41.266  1.00 151.42 ? 247 TRP A O      1 
ATOM   3669  C  CB     . TRP A  1 248 ? 7.002   -47.300 38.489  1.00 153.59 ? 247 TRP A CB     1 
ATOM   3670  C  CG     . TRP A  1 248 ? 6.663   -47.519 37.045  1.00 154.45 ? 247 TRP A CG     1 
ATOM   3671  C  CD1    . TRP A  1 248 ? 6.233   -46.581 36.152  1.00 144.21 ? 247 TRP A CD1    1 
ATOM   3672  C  CD2    . TRP A  1 248 ? 6.708   -48.762 36.330  1.00 161.32 ? 247 TRP A CD2    1 
ATOM   3673  N  NE1    . TRP A  1 248 ? 6.016   -47.160 34.924  1.00 152.98 ? 247 TRP A NE1    1 
ATOM   3674  C  CE2    . TRP A  1 248 ? 6.299   -48.496 35.007  1.00 166.73 ? 247 TRP A CE2    1 
ATOM   3675  C  CE3    . TRP A  1 248 ? 7.058   -50.069 36.680  1.00 157.59 ? 247 TRP A CE3    1 
ATOM   3676  C  CZ2    . TRP A  1 248 ? 6.231   -49.493 34.034  1.00 168.92 ? 247 TRP A CZ2    1 
ATOM   3677  C  CZ3    . TRP A  1 248 ? 6.990   -51.056 35.711  1.00 167.45 ? 247 TRP A CZ3    1 
ATOM   3678  C  CH2    . TRP A  1 248 ? 6.579   -50.762 34.405  1.00 171.81 ? 247 TRP A CH2    1 
ATOM   3679  H  H      . TRP A  1 248 ? 4.428   -46.851 38.920  1.00 179.13 ? 247 TRP A H      1 
ATOM   3680  H  HA     . TRP A  1 248 ? 6.146   -48.910 39.437  1.00 176.87 ? 247 TRP A HA     1 
ATOM   3681  H  HB2    . TRP A  1 248 ? 7.024   -46.344 38.651  1.00 184.31 ? 247 TRP A HB2    1 
ATOM   3682  H  HB3    . TRP A  1 248 ? 7.877   -47.685 38.654  1.00 184.31 ? 247 TRP A HB3    1 
ATOM   3683  H  HD1    . TRP A  1 248 ? 6.109   -45.680 36.345  1.00 173.05 ? 247 TRP A HD1    1 
ATOM   3684  H  HE1    . TRP A  1 248 ? 5.744   -46.749 34.219  1.00 183.58 ? 247 TRP A HE1    1 
ATOM   3685  H  HE3    . TRP A  1 248 ? 7.332   -50.272 37.545  1.00 189.10 ? 247 TRP A HE3    1 
ATOM   3686  H  HZ2    . TRP A  1 248 ? 5.959   -49.301 33.165  1.00 202.70 ? 247 TRP A HZ2    1 
ATOM   3687  H  HZ3    . TRP A  1 248 ? 7.220   -51.930 35.932  1.00 200.94 ? 247 TRP A HZ3    1 
ATOM   3688  H  HH2    . TRP A  1 248 ? 6.543   -51.446 33.775  1.00 206.17 ? 247 TRP A HH2    1 
ATOM   3689  N  N      . SER A  1 249 ? 7.030   -48.138 41.612  1.00 131.50 ? 248 SER A N      1 
ATOM   3690  C  CA     . SER A  1 249 ? 7.250   -47.844 43.023  1.00 139.22 ? 248 SER A CA     1 
ATOM   3691  C  C      . SER A  1 249 ? 7.927   -46.494 43.224  1.00 131.00 ? 248 SER A C      1 
ATOM   3692  O  O      . SER A  1 249 ? 8.226   -45.787 42.264  1.00 137.32 ? 248 SER A O      1 
ATOM   3693  C  CB     . SER A  1 249 ? 8.102   -48.945 43.659  1.00 151.31 ? 248 SER A CB     1 
ATOM   3694  O  OG     . SER A  1 249 ? 9.397   -48.982 43.086  1.00 147.96 ? 248 SER A OG     1 
ATOM   3695  H  H      . SER A  1 249 ? 7.493   -48.802 41.322  1.00 157.80 ? 248 SER A H      1 
ATOM   3696  H  HA     . SER A  1 249 ? 6.386   -47.823 43.485  1.00 167.06 ? 248 SER A HA     1 
ATOM   3697  H  HB2    . SER A  1 249 ? 8.183   -48.770 44.610  1.00 181.57 ? 248 SER A HB2    1 
ATOM   3698  H  HB3    . SER A  1 249 ? 7.669   -49.801 43.516  1.00 181.57 ? 248 SER A HB3    1 
ATOM   3699  H  HG     . SER A  1 249 ? 9.842   -49.576 43.436  1.00 177.55 ? 248 SER A HG     1 
ATOM   3700  N  N      . ASP A  1 250 ? 8.161   -46.142 44.483  1.00 137.48 ? 249 ASP A N      1 
ATOM   3701  C  CA     . ASP A  1 250 ? 8.845   -44.901 44.818  1.00 150.41 ? 249 ASP A CA     1 
ATOM   3702  C  C      . ASP A  1 250 ? 10.354  -45.096 44.782  1.00 151.72 ? 249 ASP A C      1 
ATOM   3703  O  O      . ASP A  1 250 ? 11.099  -44.169 44.469  1.00 161.17 ? 249 ASP A O      1 
ATOM   3704  C  CB     . ASP A  1 250 ? 8.409   -44.407 46.196  1.00 167.22 ? 249 ASP A CB     1 
ATOM   3705  C  CG     . ASP A  1 250 ? 7.013   -43.818 46.185  1.00 187.85 ? 249 ASP A CG     1 
ATOM   3706  O  OD1    . ASP A  1 250 ? 6.225   -44.133 47.101  1.00 195.77 ? 249 ASP A OD1    1 
ATOM   3707  O  OD2    . ASP A  1 250 ? 6.705   -43.039 45.258  1.00 189.45 ? 249 ASP A OD2    1 
ATOM   3708  H  H      . ASP A  1 250 ? 7.931   -46.610 45.168  1.00 164.98 ? 249 ASP A H      1 
ATOM   3709  H  HA     . ASP A  1 250 ? 8.609   -44.216 44.158  1.00 180.49 ? 249 ASP A HA     1 
ATOM   3710  H  HB2    . ASP A  1 250 ? 8.416   -45.153 46.816  1.00 200.66 ? 249 ASP A HB2    1 
ATOM   3711  H  HB3    . ASP A  1 250 ? 9.023   -43.719 46.495  1.00 200.66 ? 249 ASP A HB3    1 
ATOM   3712  N  N      . ASP A  1 251 ? 10.802  -46.303 45.108  1.00 140.66 ? 250 ASP A N      1 
ATOM   3713  C  CA     . ASP A  1 251 ? 12.213  -46.634 44.998  1.00 132.34 ? 250 ASP A CA     1 
ATOM   3714  C  C      . ASP A  1 251 ? 12.618  -46.595 43.532  1.00 134.69 ? 250 ASP A C      1 
ATOM   3715  O  O      . ASP A  1 251 ? 13.594  -45.946 43.164  1.00 140.32 ? 250 ASP A O      1 
ATOM   3716  C  CB     . ASP A  1 251 ? 12.495  -48.016 45.592  1.00 150.71 ? 250 ASP A CB     1 
ATOM   3717  C  CG     . ASP A  1 251 ? 12.381  -48.035 47.104  1.00 158.51 ? 250 ASP A CG     1 
ATOM   3718  O  OD1    . ASP A  1 251 ? 12.520  -46.961 47.726  1.00 153.61 ? 250 ASP A OD1    1 
ATOM   3719  O  OD2    . ASP A  1 251 ? 12.161  -49.126 47.672  1.00 154.00 ? 250 ASP A OD2    1 
ATOM   3720  H  H      . ASP A  1 251 ? 10.308  -46.946 45.396  1.00 168.79 ? 250 ASP A H      1 
ATOM   3721  H  HA     . ASP A  1 251 ? 12.745  -45.971 45.487  1.00 158.80 ? 250 ASP A HA     1 
ATOM   3722  H  HB2    . ASP A  1 251 ? 11.854  -48.650 45.234  1.00 180.85 ? 250 ASP A HB2    1 
ATOM   3723  H  HB3    . ASP A  1 251 ? 13.396  -48.285 45.354  1.00 180.85 ? 250 ASP A HB3    1 
ATOM   3724  N  N      . PHE A  1 252 ? 11.852  -47.285 42.694  1.00 146.01 ? 251 PHE A N      1 
ATOM   3725  C  CA     . PHE A  1 252 ? 12.098  -47.291 41.257  1.00 138.46 ? 251 PHE A CA     1 
ATOM   3726  C  C      . PHE A  1 252 ? 12.064  -45.867 40.712  1.00 137.89 ? 251 PHE A C      1 
ATOM   3727  O  O      . PHE A  1 252 ? 13.022  -45.402 40.094  1.00 139.14 ? 251 PHE A O      1 
ATOM   3728  C  CB     . PHE A  1 252 ? 11.040  -48.139 40.546  1.00 127.80 ? 251 PHE A CB     1 
ATOM   3729  C  CG     . PHE A  1 252 ? 11.333  -48.395 39.090  1.00 133.60 ? 251 PHE A CG     1 
ATOM   3730  C  CD1    . PHE A  1 252 ? 10.395  -49.022 38.285  1.00 131.55 ? 251 PHE A CD1    1 
ATOM   3731  C  CD2    . PHE A  1 252 ? 12.546  -48.023 38.528  1.00 130.76 ? 251 PHE A CD2    1 
ATOM   3732  C  CE1    . PHE A  1 252 ? 10.655  -49.265 36.949  1.00 132.07 ? 251 PHE A CE1    1 
ATOM   3733  C  CE2    . PHE A  1 252 ? 12.810  -48.266 37.194  1.00 127.52 ? 251 PHE A CE2    1 
ATOM   3734  C  CZ     . PHE A  1 252 ? 11.865  -48.886 36.404  1.00 128.75 ? 251 PHE A CZ     1 
ATOM   3735  H  H      . PHE A  1 252 ? 11.178  -47.761 42.935  1.00 175.21 ? 251 PHE A H      1 
ATOM   3736  H  HA     . PHE A  1 252 ? 12.981  -47.676 41.075  1.00 166.15 ? 251 PHE A HA     1 
ATOM   3737  H  HB2    . PHE A  1 252 ? 10.979  -48.998 40.992  1.00 153.36 ? 251 PHE A HB2    1 
ATOM   3738  H  HB3    . PHE A  1 252 ? 10.187  -47.680 40.600  1.00 153.36 ? 251 PHE A HB3    1 
ATOM   3739  H  HD1    . PHE A  1 252 ? 9.577   -49.279 38.647  1.00 157.86 ? 251 PHE A HD1    1 
ATOM   3740  H  HD2    . PHE A  1 252 ? 13.187  -47.604 39.055  1.00 156.92 ? 251 PHE A HD2    1 
ATOM   3741  H  HE1    . PHE A  1 252 ? 10.016  -49.684 36.419  1.00 158.48 ? 251 PHE A HE1    1 
ATOM   3742  H  HE2    . PHE A  1 252 ? 13.626  -48.009 36.827  1.00 153.03 ? 251 PHE A HE2    1 
ATOM   3743  H  HZ     . PHE A  1 252 ? 12.042  -49.049 35.505  1.00 154.50 ? 251 PHE A HZ     1 
ATOM   3744  N  N      . THR A  1 253 ? 10.951  -45.181 40.951  1.00 126.25 ? 252 THR A N      1 
ATOM   3745  C  CA     . THR A  1 253 ? 10.760  -43.819 40.468  1.00 117.19 ? 252 THR A CA     1 
ATOM   3746  C  C      . THR A  1 253 ? 11.893  -42.898 40.903  1.00 117.20 ? 252 THR A C      1 
ATOM   3747  O  O      . THR A  1 253 ? 12.395  -42.104 40.107  1.00 138.08 ? 252 THR A O      1 
ATOM   3748  C  CB     . THR A  1 253 ? 9.419   -43.233 40.960  1.00 128.43 ? 252 THR A CB     1 
ATOM   3749  O  OG1    . THR A  1 253 ? 8.335   -43.848 40.251  1.00 131.41 ? 252 THR A OG1    1 
ATOM   3750  C  CG2    . THR A  1 253 ? 9.369   -41.727 40.737  1.00 130.04 ? 252 THR A CG2    1 
ATOM   3751  H  H      . THR A  1 253 ? 10.283  -45.488 41.397  1.00 151.51 ? 252 THR A H      1 
ATOM   3752  H  HA     . THR A  1 253 ? 10.742  -43.831 39.488  1.00 140.63 ? 252 THR A HA     1 
ATOM   3753  H  HB     . THR A  1 253 ? 9.321   -43.406 41.910  1.00 154.12 ? 252 THR A HB     1 
ATOM   3754  H  HG1    . THR A  1 253 ? 8.339   -44.657 40.380  1.00 157.70 ? 252 THR A HG1    1 
ATOM   3755  H  HG21   . THR A  1 253 ? 8.531   -41.377 41.048  1.00 156.04 ? 252 THR A HG21   1 
ATOM   3756  H  HG22   . THR A  1 253 ? 10.083  -41.301 41.218  1.00 156.04 ? 252 THR A HG22   1 
ATOM   3757  H  HG23   . THR A  1 253 ? 9.462   -41.530 39.802  1.00 156.04 ? 252 THR A HG23   1 
ATOM   3758  N  N      . ASP A  1 254 ? 12.291  -43.001 42.165  1.00 117.75 ? 253 ASP A N      1 
ATOM   3759  C  CA     . ASP A  1 254 ? 13.334  -42.135 42.696  1.00 132.85 ? 253 ASP A CA     1 
ATOM   3760  C  C      . ASP A  1 254 ? 14.683  -42.458 42.065  1.00 120.28 ? 253 ASP A C      1 
ATOM   3761  O  O      . ASP A  1 254 ? 15.430  -41.558 41.682  1.00 108.29 ? 253 ASP A O      1 
ATOM   3762  C  CB     . ASP A  1 254 ? 13.424  -42.269 44.216  1.00 136.60 ? 253 ASP A CB     1 
ATOM   3763  C  CG     . ASP A  1 254 ? 14.442  -41.324 44.820  1.00 139.29 ? 253 ASP A CG     1 
ATOM   3764  O  OD1    . ASP A  1 254 ? 14.076  -40.169 45.125  1.00 151.36 ? 253 ASP A OD1    1 
ATOM   3765  O  OD2    . ASP A  1 254 ? 15.611  -41.734 44.982  1.00 120.03 ? 253 ASP A OD2    1 
ATOM   3766  H  H      . ASP A  1 254 ? 11.973  -43.563 42.733  1.00 141.30 ? 253 ASP A H      1 
ATOM   3767  H  HA     . ASP A  1 254 ? 13.115  -41.203 42.486  1.00 159.42 ? 253 ASP A HA     1 
ATOM   3768  H  HB2    . ASP A  1 254 ? 12.558  -42.066 44.604  1.00 163.92 ? 253 ASP A HB2    1 
ATOM   3769  H  HB3    . ASP A  1 254 ? 13.685  -43.176 44.440  1.00 163.92 ? 253 ASP A HB3    1 
ATOM   3770  N  N      . PHE A  1 255 ? 14.994  -43.745 41.963  1.00 124.72 ? 254 PHE A N      1 
ATOM   3771  C  CA     . PHE A  1 255 ? 16.247  -44.179 41.363  1.00 127.77 ? 254 PHE A CA     1 
ATOM   3772  C  C      . PHE A  1 255 ? 16.431  -43.547 39.989  1.00 133.03 ? 254 PHE A C      1 
ATOM   3773  O  O      . PHE A  1 255 ? 17.489  -42.996 39.683  1.00 131.24 ? 254 PHE A O      1 
ATOM   3774  C  CB     . PHE A  1 255 ? 16.275  -45.700 41.242  1.00 131.21 ? 254 PHE A CB     1 
ATOM   3775  C  CG     . PHE A  1 255 ? 17.467  -46.223 40.501  1.00 131.34 ? 254 PHE A CG     1 
ATOM   3776  C  CD1    . PHE A  1 255 ? 18.696  -46.322 41.128  1.00 131.45 ? 254 PHE A CD1    1 
ATOM   3777  C  CD2    . PHE A  1 255 ? 17.361  -46.615 39.178  1.00 118.24 ? 254 PHE A CD2    1 
ATOM   3778  C  CE1    . PHE A  1 255 ? 19.796  -46.801 40.451  1.00 127.61 ? 254 PHE A CE1    1 
ATOM   3779  C  CE2    . PHE A  1 255 ? 18.458  -47.096 38.495  1.00 119.88 ? 254 PHE A CE2    1 
ATOM   3780  C  CZ     . PHE A  1 255 ? 19.679  -47.189 39.133  1.00 128.11 ? 254 PHE A CZ     1 
ATOM   3781  H  H      . PHE A  1 255 ? 14.493  -44.388 42.236  1.00 149.66 ? 254 PHE A H      1 
ATOM   3782  H  HA     . PHE A  1 255 ? 16.994  -43.901 41.933  1.00 153.32 ? 254 PHE A HA     1 
ATOM   3783  H  HB2    . PHE A  1 255 ? 16.286  -46.085 42.132  1.00 157.45 ? 254 PHE A HB2    1 
ATOM   3784  H  HB3    . PHE A  1 255 ? 15.480  -45.991 40.768  1.00 157.45 ? 254 PHE A HB3    1 
ATOM   3785  H  HD1    . PHE A  1 255 ? 18.781  -46.062 42.016  1.00 157.74 ? 254 PHE A HD1    1 
ATOM   3786  H  HD2    . PHE A  1 255 ? 16.540  -46.554 38.745  1.00 141.88 ? 254 PHE A HD2    1 
ATOM   3787  H  HE1    . PHE A  1 255 ? 20.617  -46.863 40.883  1.00 153.13 ? 254 PHE A HE1    1 
ATOM   3788  H  HE2    . PHE A  1 255 ? 18.376  -47.357 37.606  1.00 143.86 ? 254 PHE A HE2    1 
ATOM   3789  H  HZ     . PHE A  1 255 ? 20.420  -47.513 38.675  1.00 153.74 ? 254 PHE A HZ     1 
ATOM   3790  N  N      . VAL A  1 256 ? 15.392  -43.630 39.165  1.00 132.33 ? 255 VAL A N      1 
ATOM   3791  C  CA     . VAL A  1 256 ? 15.422  -43.048 37.829  1.00 122.96 ? 255 VAL A CA     1 
ATOM   3792  C  C      . VAL A  1 256 ? 15.710  -41.552 37.892  1.00 119.09 ? 255 VAL A C      1 
ATOM   3793  O  O      . VAL A  1 256 ? 16.531  -41.040 37.131  1.00 116.47 ? 255 VAL A O      1 
ATOM   3794  C  CB     . VAL A  1 256 ? 14.089  -43.275 37.093  1.00 123.89 ? 255 VAL A CB     1 
ATOM   3795  C  CG1    . VAL A  1 256 ? 13.990  -42.377 35.867  1.00 131.55 ? 255 VAL A CG1    1 
ATOM   3796  C  CG2    . VAL A  1 256 ? 13.944  -44.737 36.702  1.00 125.30 ? 255 VAL A CG2    1 
ATOM   3797  H  H      . VAL A  1 256 ? 14.652  -44.021 39.358  1.00 158.80 ? 255 VAL A H      1 
ATOM   3798  H  HA     . VAL A  1 256 ? 16.135  -43.474 37.309  1.00 147.55 ? 255 VAL A HA     1 
ATOM   3799  H  HB     . VAL A  1 256 ? 13.350  -43.047 37.695  1.00 148.67 ? 255 VAL A HB     1 
ATOM   3800  H  HG11   . VAL A  1 256 ? 13.151  -42.539 35.428  1.00 157.86 ? 255 VAL A HG11   1 
ATOM   3801  H  HG12   . VAL A  1 256 ? 14.042  -41.460 36.146  1.00 157.86 ? 255 VAL A HG12   1 
ATOM   3802  H  HG13   . VAL A  1 256 ? 14.715  -42.581 35.272  1.00 157.86 ? 255 VAL A HG13   1 
ATOM   3803  H  HG21   . VAL A  1 256 ? 13.108  -44.857 36.246  1.00 150.35 ? 255 VAL A HG21   1 
ATOM   3804  H  HG22   . VAL A  1 256 ? 14.670  -44.979 36.124  1.00 150.35 ? 255 VAL A HG22   1 
ATOM   3805  H  HG23   . VAL A  1 256 ? 13.963  -45.276 37.497  1.00 150.35 ? 255 VAL A HG23   1 
ATOM   3806  N  N      . LYS A  1 257 ? 15.031  -40.857 38.800  1.00 105.82 ? 256 LYS A N      1 
ATOM   3807  C  CA     . LYS A  1 257 ? 15.228  -39.422 38.963  1.00 102.90 ? 256 LYS A CA     1 
ATOM   3808  C  C      . LYS A  1 257 ? 16.689  -39.088 39.251  1.00 124.81 ? 256 LYS A C      1 
ATOM   3809  O  O      . LYS A  1 257 ? 17.201  -38.067 38.789  1.00 145.77 ? 256 LYS A O      1 
ATOM   3810  C  CB     . LYS A  1 257 ? 14.338  -38.876 40.082  1.00 101.02 ? 256 LYS A CB     1 
ATOM   3811  C  CG     . LYS A  1 257 ? 14.783  -37.516 40.610  1.00 112.54 ? 256 LYS A CG     1 
ATOM   3812  C  CD     . LYS A  1 257 ? 13.739  -36.882 41.513  1.00 122.48 ? 256 LYS A CD     1 
ATOM   3813  C  CE     . LYS A  1 257 ? 14.250  -35.581 42.116  1.00 147.24 ? 256 LYS A CE     1 
ATOM   3814  N  NZ     . LYS A  1 257 ? 13.231  -34.900 42.966  1.00 155.71 ? 256 LYS A NZ     1 
ATOM   3815  H  H      . LYS A  1 257 ? 14.448  -41.195 39.335  1.00 126.99 ? 256 LYS A H      1 
ATOM   3816  H  HA     . LYS A  1 257 ? 14.975  -38.971 38.130  1.00 123.48 ? 256 LYS A HA     1 
ATOM   3817  H  HB2    . LYS A  1 257 ? 13.433  -38.781 39.745  1.00 121.22 ? 256 LYS A HB2    1 
ATOM   3818  H  HB3    . LYS A  1 257 ? 14.349  -39.500 40.824  1.00 121.22 ? 256 LYS A HB3    1 
ATOM   3819  H  HG2    . LYS A  1 257 ? 15.599  -37.625 41.123  1.00 135.05 ? 256 LYS A HG2    1 
ATOM   3820  H  HG3    . LYS A  1 257 ? 14.937  -36.918 39.862  1.00 135.05 ? 256 LYS A HG3    1 
ATOM   3821  H  HD2    . LYS A  1 257 ? 12.942  -36.686 40.995  1.00 146.98 ? 256 LYS A HD2    1 
ATOM   3822  H  HD3    . LYS A  1 257 ? 13.528  -37.492 42.238  1.00 146.98 ? 256 LYS A HD3    1 
ATOM   3823  H  HE2    . LYS A  1 257 ? 15.024  -35.771 42.669  1.00 176.69 ? 256 LYS A HE2    1 
ATOM   3824  H  HE3    . LYS A  1 257 ? 14.496  -34.975 41.399  1.00 176.69 ? 256 LYS A HE3    1 
ATOM   3825  H  HZ1    . LYS A  1 257 ? 13.567  -34.146 43.299  1.00 186.86 ? 256 LYS A HZ1    1 
ATOM   3826  H  HZ2    . LYS A  1 257 ? 12.510  -34.707 42.481  1.00 186.86 ? 256 LYS A HZ2    1 
ATOM   3827  H  HZ3    . LYS A  1 257 ? 12.992  -35.432 43.639  1.00 186.86 ? 256 LYS A HZ3    1 
ATOM   3828  N  N      . LYS A  1 258 ? 17.357  -39.953 40.008  1.00 118.40 ? 257 LYS A N      1 
ATOM   3829  C  CA     . LYS A  1 258 ? 18.743  -39.716 40.400  1.00 128.66 ? 257 LYS A CA     1 
ATOM   3830  C  C      . LYS A  1 258 ? 19.713  -39.915 39.237  1.00 132.35 ? 257 LYS A C      1 
ATOM   3831  O  O      . LYS A  1 258 ? 20.794  -39.324 39.215  1.00 126.17 ? 257 LYS A O      1 
ATOM   3832  C  CB     . LYS A  1 258 ? 19.125  -40.636 41.561  1.00 142.97 ? 257 LYS A CB     1 
ATOM   3833  C  CG     . LYS A  1 258 ? 18.331  -40.384 42.835  1.00 172.31 ? 257 LYS A CG     1 
ATOM   3834  C  CD     . LYS A  1 258 ? 18.620  -39.005 43.417  1.00 185.16 ? 257 LYS A CD     1 
ATOM   3835  C  CE     . LYS A  1 258 ? 17.769  -38.720 44.645  1.00 172.88 ? 257 LYS A CE     1 
ATOM   3836  N  NZ     . LYS A  1 258 ? 18.006  -39.696 45.742  1.00 168.42 ? 257 LYS A NZ     1 
ATOM   3837  H  H      . LYS A  1 258 ? 17.029  -40.688 40.309  1.00 142.08 ? 257 LYS A H      1 
ATOM   3838  H  HA     . LYS A  1 258 ? 18.830  -38.790 40.709  1.00 154.39 ? 257 LYS A HA     1 
ATOM   3839  H  HB2    . LYS A  1 258 ? 18.972  -41.555 41.294  1.00 171.56 ? 257 LYS A HB2    1 
ATOM   3840  H  HB3    . LYS A  1 258 ? 20.064  -40.505 41.767  1.00 171.56 ? 257 LYS A HB3    1 
ATOM   3841  H  HG2    . LYS A  1 258 ? 17.383  -40.437 42.636  1.00 206.77 ? 257 LYS A HG2    1 
ATOM   3842  H  HG3    . LYS A  1 258 ? 18.572  -41.050 43.498  1.00 206.77 ? 257 LYS A HG3    1 
ATOM   3843  H  HD2    . LYS A  1 258 ? 19.553  -38.958 43.677  1.00 222.20 ? 257 LYS A HD2    1 
ATOM   3844  H  HD3    . LYS A  1 258 ? 18.424  -38.330 42.749  1.00 222.20 ? 257 LYS A HD3    1 
ATOM   3845  H  HE2    . LYS A  1 258 ? 17.982  -37.835 44.980  1.00 207.46 ? 257 LYS A HE2    1 
ATOM   3846  H  HE3    . LYS A  1 258 ? 16.832  -38.766 44.399  1.00 207.46 ? 257 LYS A HE3    1 
ATOM   3847  H  HZ1    . LYS A  1 258 ? 17.493  -39.498 46.442  1.00 202.10 ? 257 LYS A HZ1    1 
ATOM   3848  H  HZ2    . LYS A  1 258 ? 17.812  -40.519 45.464  1.00 202.10 ? 257 LYS A HZ2    1 
ATOM   3849  H  HZ3    . LYS A  1 258 ? 18.860  -39.670 45.993  1.00 202.10 ? 257 LYS A HZ3    1 
ATOM   3850  N  N      . CYS A  1 259 ? 19.330  -40.751 38.276  1.00 126.49 ? 258 CYS A N      1 
ATOM   3851  C  CA     . CYS A  1 259 ? 20.157  -40.984 37.097  1.00 119.94 ? 258 CYS A CA     1 
ATOM   3852  C  C      . CYS A  1 259 ? 19.973  -39.858 36.094  1.00 124.66 ? 258 CYS A C      1 
ATOM   3853  O  O      . CYS A  1 259 ? 20.943  -39.266 35.623  1.00 138.59 ? 258 CYS A O      1 
ATOM   3854  C  CB     . CYS A  1 259 ? 19.798  -42.314 36.439  1.00 111.59 ? 258 CYS A CB     1 
ATOM   3855  S  SG     . CYS A  1 259 ? 20.058  -43.752 37.489  1.00 140.97 ? 258 CYS A SG     1 
ATOM   3856  H  H      . CYS A  1 259 ? 18.595  -41.197 38.283  1.00 151.78 ? 258 CYS A H      1 
ATOM   3857  H  HA     . CYS A  1 259 ? 21.101  -41.013 37.361  1.00 143.92 ? 258 CYS A HA     1 
ATOM   3858  H  HB2    . CYS A  1 259 ? 18.861  -42.295 36.190  1.00 133.91 ? 258 CYS A HB2    1 
ATOM   3859  H  HB3    . CYS A  1 259 ? 20.345  -42.426 35.645  1.00 133.91 ? 258 CYS A HB3    1 
ATOM   3860  H  HG     . CYS A  1 259 ? 19.378  -43.646 38.473  1.00 169.16 ? 258 CYS A HG     1 
ATOM   3861  N  N      . LEU A  1 260 ? 18.719  -39.566 35.770  1.00 120.17 ? 259 LEU A N      1 
ATOM   3862  C  CA     . LEU A  1 260 ? 18.408  -38.527 34.799  1.00 119.71 ? 259 LEU A CA     1 
ATOM   3863  C  C      . LEU A  1 260 ? 18.532  -37.144 35.435  1.00 123.85 ? 259 LEU A C      1 
ATOM   3864  O  O      . LEU A  1 260 ? 17.539  -36.441 35.623  1.00 129.07 ? 259 LEU A O      1 
ATOM   3865  C  CB     . LEU A  1 260 ? 17.002  -38.730 34.234  1.00 113.84 ? 259 LEU A CB     1 
ATOM   3866  C  CG     . LEU A  1 260 ? 16.730  -40.126 33.672  1.00 110.81 ? 259 LEU A CG     1 
ATOM   3867  C  CD1    . LEU A  1 260 ? 15.309  -40.226 33.143  1.00 112.55 ? 259 LEU A CD1    1 
ATOM   3868  C  CD2    . LEU A  1 260 ? 17.737  -40.467 32.582  1.00 116.11 ? 259 LEU A CD2    1 
ATOM   3869  H  H      . LEU A  1 260 ? 18.028  -39.958 36.100  1.00 144.20 ? 259 LEU A H      1 
ATOM   3870  H  HA     . LEU A  1 260 ? 19.045  -38.580 34.057  1.00 143.66 ? 259 LEU A HA     1 
ATOM   3871  H  HB2    . LEU A  1 260 ? 16.358  -38.569 34.942  1.00 136.61 ? 259 LEU A HB2    1 
ATOM   3872  H  HB3    . LEU A  1 260 ? 16.863  -38.093 33.516  1.00 136.61 ? 259 LEU A HB3    1 
ATOM   3873  H  HG     . LEU A  1 260 ? 16.829  -40.777 34.384  1.00 132.97 ? 259 LEU A HG     1 
ATOM   3874  H  HD11   . LEU A  1 260 ? 15.166  -41.110 32.797  1.00 135.06 ? 259 LEU A HD11   1 
ATOM   3875  H  HD12   . LEU A  1 260 ? 14.696  -40.052 33.861  1.00 135.06 ? 259 LEU A HD12   1 
ATOM   3876  H  HD13   . LEU A  1 260 ? 15.190  -39.578 32.445  1.00 135.06 ? 259 LEU A HD13   1 
ATOM   3877  H  HD21   . LEU A  1 260 ? 17.546  -41.345 32.245  1.00 139.34 ? 259 LEU A HD21   1 
ATOM   3878  H  HD22   . LEU A  1 260 ? 17.662  -39.821 31.875  1.00 139.34 ? 259 LEU A HD22   1 
ATOM   3879  H  HD23   . LEU A  1 260 ? 18.621  -40.443 32.956  1.00 139.34 ? 259 LEU A HD23   1 
ATOM   3880  N  N      . VAL A  1 261 ? 19.760  -36.770 35.777  1.00 113.99 ? 260 VAL A N      1 
ATOM   3881  C  CA     . VAL A  1 261 ? 20.048  -35.434 36.281  1.00 105.82 ? 260 VAL A CA     1 
ATOM   3882  C  C      . VAL A  1 261 ? 20.862  -34.676 35.238  1.00 118.07 ? 260 VAL A C      1 
ATOM   3883  O  O      . VAL A  1 261 ? 22.008  -35.026 34.959  1.00 131.95 ? 260 VAL A O      1 
ATOM   3884  C  CB     . VAL A  1 261 ? 20.829  -35.488 37.604  1.00 96.11  ? 260 VAL A CB     1 
ATOM   3885  C  CG1    . VAL A  1 261 ? 21.198  -34.084 38.067  1.00 87.70  ? 260 VAL A CG1    1 
ATOM   3886  C  CG2    . VAL A  1 261 ? 20.013  -36.203 38.663  1.00 87.68  ? 260 VAL A CG2    1 
ATOM   3887  H  H      . VAL A  1 261 ? 20.451  -37.279 35.726  1.00 136.78 ? 260 VAL A H      1 
ATOM   3888  H  HA     . VAL A  1 261 ? 19.208  -34.952 36.433  1.00 126.98 ? 260 VAL A HA     1 
ATOM   3889  H  HB     . VAL A  1 261 ? 21.659  -35.991 37.466  1.00 115.33 ? 260 VAL A HB     1 
ATOM   3890  H  HG11   . VAL A  1 261 ? 21.684  -34.145 38.892  1.00 105.24 ? 260 VAL A HG11   1 
ATOM   3891  H  HG12   . VAL A  1 261 ? 21.744  -33.667 37.396  1.00 105.24 ? 260 VAL A HG12   1 
ATOM   3892  H  HG13   . VAL A  1 261 ? 20.394  -33.576 38.197  1.00 105.24 ? 260 VAL A HG13   1 
ATOM   3893  H  HG21   . VAL A  1 261 ? 20.516  -36.227 39.481  1.00 105.22 ? 260 VAL A HG21   1 
ATOM   3894  H  HG22   . VAL A  1 261 ? 19.191  -35.727 38.798  1.00 105.22 ? 260 VAL A HG22   1 
ATOM   3895  H  HG23   . VAL A  1 261 ? 19.830  -37.097 38.365  1.00 105.22 ? 260 VAL A HG23   1 
ATOM   3896  N  N      . LYS A  1 262 ? 20.265  -33.638 34.665  1.00 118.96 ? 261 LYS A N      1 
ATOM   3897  C  CA     . LYS A  1 262 ? 20.885  -32.925 33.555  1.00 118.10 ? 261 LYS A CA     1 
ATOM   3898  C  C      . LYS A  1 262 ? 22.274  -32.402 33.910  1.00 118.42 ? 261 LYS A C      1 
ATOM   3899  O  O      . LYS A  1 262 ? 23.173  -32.399 33.070  1.00 115.34 ? 261 LYS A O      1 
ATOM   3900  C  CB     . LYS A  1 262 ? 19.985  -31.784 33.083  1.00 98.19  ? 261 LYS A CB     1 
ATOM   3901  C  CG     . LYS A  1 262 ? 18.638  -32.265 32.568  1.00 102.48 ? 261 LYS A CG     1 
ATOM   3902  C  CD     . LYS A  1 262 ? 17.804  -31.135 32.004  1.00 117.23 ? 261 LYS A CD     1 
ATOM   3903  C  CE     . LYS A  1 262 ? 18.393  -30.582 30.716  1.00 118.94 ? 261 LYS A CE     1 
ATOM   3904  N  NZ     . LYS A  1 262 ? 17.691  -29.344 30.282  1.00 115.67 ? 261 LYS A NZ     1 
ATOM   3905  H  H      . LYS A  1 262 ? 19.499  -33.325 34.901  1.00 142.76 ? 261 LYS A H      1 
ATOM   3906  H  HA     . LYS A  1 262 ? 20.988  -33.548 32.806  1.00 141.71 ? 261 LYS A HA     1 
ATOM   3907  H  HB2    . LYS A  1 262 ? 19.823  -31.182 33.826  1.00 117.82 ? 261 LYS A HB2    1 
ATOM   3908  H  HB3    . LYS A  1 262 ? 20.429  -31.310 32.363  1.00 117.82 ? 261 LYS A HB3    1 
ATOM   3909  H  HG2    . LYS A  1 262 ? 18.782  -32.915 31.862  1.00 122.98 ? 261 LYS A HG2    1 
ATOM   3910  H  HG3    . LYS A  1 262 ? 18.144  -32.669 33.298  1.00 122.98 ? 261 LYS A HG3    1 
ATOM   3911  H  HD2    . LYS A  1 262 ? 16.912  -31.462 31.813  1.00 140.68 ? 261 LYS A HD2    1 
ATOM   3912  H  HD3    . LYS A  1 262 ? 17.765  -30.414 32.652  1.00 140.68 ? 261 LYS A HD3    1 
ATOM   3913  H  HE2    . LYS A  1 262 ? 19.329  -30.367 30.858  1.00 142.73 ? 261 LYS A HE2    1 
ATOM   3914  H  HE3    . LYS A  1 262 ? 18.304  -31.244 30.013  1.00 142.73 ? 261 LYS A HE3    1 
ATOM   3915  H  HZ1    . LYS A  1 262 ? 18.052  -29.039 29.528  1.00 138.81 ? 261 LYS A HZ1    1 
ATOM   3916  H  HZ2    . LYS A  1 262 ? 16.829  -29.517 30.141  1.00 138.81 ? 261 LYS A HZ2    1 
ATOM   3917  H  HZ3    . LYS A  1 262 ? 17.762  -28.718 30.910  1.00 138.81 ? 261 LYS A HZ3    1 
ATOM   3918  N  N      . ASN A  1 263 ? 22.450  -31.960 35.150  1.00 120.87 ? 262 ASN A N      1 
ATOM   3919  C  CA     . ASN A  1 263 ? 23.765  -31.536 35.614  1.00 135.56 ? 262 ASN A CA     1 
ATOM   3920  C  C      . ASN A  1 263 ? 24.667  -32.746 35.856  1.00 143.95 ? 262 ASN A C      1 
ATOM   3921  O  O      . ASN A  1 263 ? 24.416  -33.535 36.768  1.00 144.69 ? 262 ASN A O      1 
ATOM   3922  C  CB     . ASN A  1 263 ? 23.640  -30.712 36.895  1.00 148.44 ? 262 ASN A CB     1 
ATOM   3923  C  CG     . ASN A  1 263 ? 22.890  -29.415 36.681  1.00 183.99 ? 262 ASN A CG     1 
ATOM   3924  O  OD1    . ASN A  1 263 ? 21.721  -29.291 37.047  1.00 198.74 ? 262 ASN A OD1    1 
ATOM   3925  N  ND2    . ASN A  1 263 ? 23.557  -28.440 36.075  1.00 200.12 ? 262 ASN A ND2    1 
ATOM   3926  H  H      . ASN A  1 263 ? 21.828  -31.895 35.740  1.00 145.04 ? 262 ASN A H      1 
ATOM   3927  H  HA     . ASN A  1 263 ? 24.183  -30.975 34.929  1.00 162.67 ? 262 ASN A HA     1 
ATOM   3928  H  HB2    . ASN A  1 263 ? 23.160  -31.231 37.560  1.00 178.13 ? 262 ASN A HB2    1 
ATOM   3929  H  HB3    . ASN A  1 263 ? 24.528  -30.496 37.220  1.00 178.13 ? 262 ASN A HB3    1 
ATOM   3930  H  HD21   . ASN A  1 263 ? 24.372  -28.565 35.828  1.00 240.14 ? 262 ASN A HD21   1 
ATOM   3931  H  HD22   . ASN A  1 263 ? 23.176  -27.683 35.930  1.00 240.14 ? 262 ASN A HD22   1 
ATOM   3932  N  N      . PRO A  1 264 ? 25.726  -32.896 35.042  1.00 130.87 ? 263 PRO A N      1 
ATOM   3933  C  CA     . PRO A  1 264 ? 26.619  -34.055 35.176  1.00 126.21 ? 263 PRO A CA     1 
ATOM   3934  C  C      . PRO A  1 264 ? 27.390  -34.075 36.496  1.00 138.97 ? 263 PRO A C      1 
ATOM   3935  O  O      . PRO A  1 264 ? 27.908  -35.125 36.878  1.00 151.04 ? 263 PRO A O      1 
ATOM   3936  C  CB     . PRO A  1 264 ? 27.581  -33.899 33.993  1.00 111.04 ? 263 PRO A CB     1 
ATOM   3937  C  CG     . PRO A  1 264 ? 27.559  -32.453 33.671  1.00 118.13 ? 263 PRO A CG     1 
ATOM   3938  C  CD     . PRO A  1 264 ? 26.171  -31.980 33.978  1.00 120.38 ? 263 PRO A CD     1 
ATOM   3939  H  HA     . PRO A  1 264 ? 26.114  -34.890 35.079  1.00 151.46 ? 263 PRO A HA     1 
ATOM   3940  H  HB2    . PRO A  1 264 ? 28.472  -34.179 34.257  1.00 133.25 ? 263 PRO A HB2    1 
ATOM   3941  H  HB3    . PRO A  1 264 ? 27.263  -34.424 33.242  1.00 133.25 ? 263 PRO A HB3    1 
ATOM   3942  H  HG2    . PRO A  1 264 ? 28.206  -31.988 34.224  1.00 141.75 ? 263 PRO A HG2    1 
ATOM   3943  H  HG3    . PRO A  1 264 ? 27.761  -32.327 32.731  1.00 141.75 ? 263 PRO A HG3    1 
ATOM   3944  H  HD2    . PRO A  1 264 ? 26.189  -31.067 34.304  1.00 144.45 ? 263 PRO A HD2    1 
ATOM   3945  H  HD3    . PRO A  1 264 ? 25.603  -32.068 33.197  1.00 144.45 ? 263 PRO A HD3    1 
ATOM   3946  N  N      . GLU A  1 265 ? 27.461  -32.935 37.179  1.00 130.17 ? 264 GLU A N      1 
ATOM   3947  C  CA     . GLU A  1 265 ? 28.147  -32.857 38.467  1.00 127.08 ? 264 GLU A CA     1 
ATOM   3948  C  C      . GLU A  1 265 ? 27.213  -33.212 39.625  1.00 134.02 ? 264 GLU A C      1 
ATOM   3949  O  O      . GLU A  1 265 ? 27.666  -33.463 40.743  1.00 135.92 ? 264 GLU A O      1 
ATOM   3950  C  CB     . GLU A  1 265 ? 28.741  -31.463 38.683  1.00 126.73 ? 264 GLU A CB     1 
ATOM   3951  C  CG     . GLU A  1 265 ? 29.844  -31.092 37.699  1.00 148.95 ? 264 GLU A CG     1 
ATOM   3952  C  CD     . GLU A  1 265 ? 29.312  -30.694 36.334  1.00 169.80 ? 264 GLU A CD     1 
ATOM   3953  O  OE1    . GLU A  1 265 ? 28.086  -30.489 36.206  1.00 185.18 ? 264 GLU A OE1    1 
ATOM   3954  O  OE2    . GLU A  1 265 ? 30.121  -30.584 35.388  1.00 164.28 ? 264 GLU A OE2    1 
ATOM   3955  H  H      . GLU A  1 265 ? 27.120  -32.190 36.918  1.00 156.20 ? 264 GLU A H      1 
ATOM   3956  H  HA     . GLU A  1 265 ? 28.886  -33.501 38.470  1.00 152.49 ? 264 GLU A HA     1 
ATOM   3957  H  HB2    . GLU A  1 265 ? 28.033  -30.807 38.594  1.00 152.07 ? 264 GLU A HB2    1 
ATOM   3958  H  HB3    . GLU A  1 265 ? 29.116  -31.421 39.577  1.00 152.07 ? 264 GLU A HB3    1 
ATOM   3959  H  HG2    . GLU A  1 265 ? 30.345  -30.342 38.055  1.00 178.74 ? 264 GLU A HG2    1 
ATOM   3960  H  HG3    . GLU A  1 265 ? 30.430  -31.856 37.581  1.00 178.74 ? 264 GLU A HG3    1 
ATOM   3961  N  N      . GLN A  1 266 ? 25.911  -33.227 39.353  1.00 133.44 ? 265 GLN A N      1 
ATOM   3962  C  CA     . GLN A  1 266 ? 24.920  -33.621 40.348  1.00 127.45 ? 265 GLN A CA     1 
ATOM   3963  C  C      . GLN A  1 266 ? 24.289  -34.960 39.991  1.00 132.64 ? 265 GLN A C      1 
ATOM   3964  O  O      . GLN A  1 266 ? 23.210  -35.294 40.479  1.00 136.18 ? 265 GLN A O      1 
ATOM   3965  C  CB     . GLN A  1 266 ? 23.821  -32.566 40.461  1.00 142.55 ? 265 GLN A CB     1 
ATOM   3966  C  CG     . GLN A  1 266 ? 24.202  -31.344 41.272  1.00 153.65 ? 265 GLN A CG     1 
ATOM   3967  C  CD     . GLN A  1 266 ? 23.018  -30.436 41.529  1.00 155.33 ? 265 GLN A CD     1 
ATOM   3968  O  OE1    . GLN A  1 266 ? 21.898  -30.728 41.110  1.00 154.06 ? 265 GLN A OE1    1 
ATOM   3969  N  NE2    . GLN A  1 266 ? 23.258  -29.330 42.223  1.00 160.48 ? 265 GLN A NE2    1 
ATOM   3970  H  H      . GLN A  1 266 ? 25.574  -33.011 38.592  1.00 160.13 ? 265 GLN A H      1 
ATOM   3971  H  HA     . GLN A  1 266 ? 25.354  -33.709 41.223  1.00 152.94 ? 265 GLN A HA     1 
ATOM   3972  H  HB2    . GLN A  1 266 ? 23.587  -32.266 39.569  1.00 171.06 ? 265 GLN A HB2    1 
ATOM   3973  H  HB3    . GLN A  1 266 ? 23.046  -32.969 40.883  1.00 171.06 ? 265 GLN A HB3    1 
ATOM   3974  H  HG2    . GLN A  1 266 ? 24.555  -31.629 42.130  1.00 184.38 ? 265 GLN A HG2    1 
ATOM   3975  H  HG3    . GLN A  1 266 ? 24.872  -30.837 40.788  1.00 184.38 ? 265 GLN A HG3    1 
ATOM   3976  H  HE21   . GLN A  1 266 ? 24.055  -29.161 42.501  1.00 192.58 ? 265 GLN A HE21   1 
ATOM   3977  H  HE22   . GLN A  1 266 ? 22.618  -28.782 42.394  1.00 192.58 ? 265 GLN A HE22   1 
ATOM   3978  N  N      . ARG A  1 267 ? 24.959  -35.722 39.133  1.00 140.90 ? 266 ARG A N      1 
ATOM   3979  C  CA     . ARG A  1 267 ? 24.451  -37.021 38.716  1.00 129.11 ? 266 ARG A CA     1 
ATOM   3980  C  C      . ARG A  1 267 ? 25.167  -38.129 39.476  1.00 122.28 ? 266 ARG A C      1 
ATOM   3981  O  O      . ARG A  1 267 ? 26.397  -38.190 39.483  1.00 131.88 ? 266 ARG A O      1 
ATOM   3982  C  CB     . ARG A  1 267 ? 24.647  -37.208 37.214  1.00 111.03 ? 266 ARG A CB     1 
ATOM   3983  C  CG     . ARG A  1 267 ? 23.733  -38.253 36.600  1.00 116.69 ? 266 ARG A CG     1 
ATOM   3984  C  CD     . ARG A  1 267 ? 24.015  -38.414 35.121  1.00 122.54 ? 266 ARG A CD     1 
ATOM   3985  N  NE     . ARG A  1 267 ? 23.936  -37.138 34.418  1.00 111.02 ? 266 ARG A NE     1 
ATOM   3986  C  CZ     . ARG A  1 267 ? 24.381  -36.930 33.184  1.00 101.10 ? 266 ARG A CZ     1 
ATOM   3987  N  NH1    . ARG A  1 267 ? 24.264  -35.732 32.633  1.00 103.67 ? 266 ARG A NH1    1 
ATOM   3988  N  NH2    . ARG A  1 267 ? 24.948  -37.912 32.500  1.00 106.45 ? 266 ARG A NH2    1 
ATOM   3989  H  H      . ARG A  1 267 ? 25.713  -35.508 38.778  1.00 169.08 ? 266 ARG A H      1 
ATOM   3990  H  HA     . ARG A  1 267 ? 23.493  -37.077 38.914  1.00 154.93 ? 266 ARG A HA     1 
ATOM   3991  H  HB2    . ARG A  1 267 ? 24.473  -36.364 36.769  1.00 133.24 ? 266 ARG A HB2    1 
ATOM   3992  H  HB3    . ARG A  1 267 ? 25.563  -37.483 37.050  1.00 133.24 ? 266 ARG A HB3    1 
ATOM   3993  H  HG2    . ARG A  1 267 ? 23.883  -39.108 37.035  1.00 140.02 ? 266 ARG A HG2    1 
ATOM   3994  H  HG3    . ARG A  1 267 ? 22.810  -37.977 36.707  1.00 140.02 ? 266 ARG A HG3    1 
ATOM   3995  H  HD2    . ARG A  1 267 ? 24.910  -38.770 35.002  1.00 147.05 ? 266 ARG A HD2    1 
ATOM   3996  H  HD3    . ARG A  1 267 ? 23.360  -39.015 34.733  1.00 147.05 ? 266 ARG A HD3    1 
ATOM   3997  H  HE     . ARG A  1 267 ? 23.577  -36.475 34.831  1.00 133.22 ? 266 ARG A HE     1 
ATOM   3998  H  HH11   . ARG A  1 267 ? 23.898  -35.090 33.072  1.00 124.40 ? 266 ARG A HH11   1 
ATOM   3999  H  HH12   . ARG A  1 267 ? 24.553  -35.596 31.834  1.00 124.40 ? 266 ARG A HH12   1 
ATOM   4000  H  HH21   . ARG A  1 267 ? 25.028  -38.693 32.853  1.00 127.74 ? 266 ARG A HH21   1 
ATOM   4001  H  HH22   . ARG A  1 267 ? 25.235  -37.771 31.702  1.00 127.74 ? 266 ARG A HH22   1 
ATOM   4002  N  N      . ALA A  1 268 ? 24.390  -39.001 40.111  1.00 121.54 ? 267 ALA A N      1 
ATOM   4003  C  CA     . ALA A  1 268 ? 24.941  -40.085 40.919  1.00 123.03 ? 267 ALA A CA     1 
ATOM   4004  C  C      . ALA A  1 268 ? 25.922  -40.941 40.124  1.00 121.77 ? 267 ALA A C      1 
ATOM   4005  O  O      . ALA A  1 268 ? 25.735  -41.169 38.930  1.00 128.96 ? 267 ALA A O      1 
ATOM   4006  C  CB     . ALA A  1 268 ? 23.816  -40.952 41.467  1.00 97.91  ? 267 ALA A CB     1 
ATOM   4007  H  H      . ALA A  1 268 ? 23.530  -38.986 40.089  1.00 145.85 ? 267 ALA A H      1 
ATOM   4008  H  HA     . ALA A  1 268 ? 25.424  -39.700 41.680  1.00 147.64 ? 267 ALA A HA     1 
ATOM   4009  H  HB1    . ALA A  1 268 ? 24.195  -41.658 41.995  1.00 117.49 ? 267 ALA A HB1    1 
ATOM   4010  H  HB2    . ALA A  1 268 ? 23.240  -40.409 42.011  1.00 117.49 ? 267 ALA A HB2    1 
ATOM   4011  H  HB3    . ALA A  1 268 ? 23.321  -41.322 40.733  1.00 117.49 ? 267 ALA A HB3    1 
ATOM   4012  N  N      . THR A  1 269 ? 26.970  -41.411 40.796  1.00 124.33 ? 268 THR A N      1 
ATOM   4013  C  CA     . THR A  1 269 ? 27.942  -42.303 40.175  1.00 135.16 ? 268 THR A CA     1 
ATOM   4014  C  C      . THR A  1 269 ? 27.481  -43.750 40.296  1.00 142.32 ? 268 THR A C      1 
ATOM   4015  O  O      . THR A  1 269 ? 26.524  -44.050 41.012  1.00 141.04 ? 268 THR A O      1 
ATOM   4016  C  CB     . THR A  1 269 ? 29.330  -42.179 40.832  1.00 143.48 ? 268 THR A CB     1 
ATOM   4017  O  OG1    . THR A  1 269 ? 29.248  -42.567 42.209  1.00 164.30 ? 268 THR A OG1    1 
ATOM   4018  C  CG2    . THR A  1 269 ? 29.847  -40.752 40.734  1.00 138.50 ? 268 THR A CG2    1 
ATOM   4019  H  H      . THR A  1 269 ? 27.140  -41.227 41.618  1.00 149.19 ? 268 THR A H      1 
ATOM   4020  H  HA     . THR A  1 269 ? 28.027  -42.082 39.224  1.00 162.19 ? 268 THR A HA     1 
ATOM   4021  H  HB     . THR A  1 269 ? 29.955  -42.761 40.372  1.00 172.18 ? 268 THR A HB     1 
ATOM   4022  H  HG1    . THR A  1 269 ? 29.985  -42.502 42.563  1.00 197.16 ? 268 THR A HG1    1 
ATOM   4023  H  HG21   . THR A  1 269 ? 30.711  -40.688 41.147  1.00 166.20 ? 268 THR A HG21   1 
ATOM   4024  H  HG22   . THR A  1 269 ? 29.920  -40.492 39.813  1.00 166.20 ? 268 THR A HG22   1 
ATOM   4025  H  HG23   . THR A  1 269 ? 29.243  -40.153 41.180  1.00 166.20 ? 268 THR A HG23   1 
ATOM   4026  N  N      . ALA A  1 270 ? 28.169  -44.646 39.596  1.00 130.91 ? 269 ALA A N      1 
ATOM   4027  C  CA     . ALA A  1 270 ? 27.836  -46.064 39.638  1.00 126.57 ? 269 ALA A CA     1 
ATOM   4028  C  C      . ALA A  1 270 ? 28.018  -46.609 41.049  1.00 143.11 ? 269 ALA A C      1 
ATOM   4029  O  O      . ALA A  1 270 ? 27.215  -47.411 41.524  1.00 149.46 ? 269 ALA A O      1 
ATOM   4030  C  CB     . ALA A  1 270 ? 28.699  -46.836 38.663  1.00 128.33 ? 269 ALA A CB     1 
ATOM   4031  H  H      . ALA A  1 270 ? 28.837  -44.458 39.088  1.00 157.09 ? 269 ALA A H      1 
ATOM   4032  H  HA     . ALA A  1 270 ? 26.898  -46.184 39.381  1.00 151.89 ? 269 ALA A HA     1 
ATOM   4033  H  HB1    . ALA A  1 270 ? 28.464  -47.766 38.706  1.00 154.00 ? 269 ALA A HB1    1 
ATOM   4034  H  HB2    . ALA A  1 270 ? 28.546  -46.500 37.777  1.00 154.00 ? 269 ALA A HB2    1 
ATOM   4035  H  HB3    . ALA A  1 270 ? 29.622  -46.720 38.902  1.00 154.00 ? 269 ALA A HB3    1 
ATOM   4036  N  N      . THR A  1 271 ? 29.081  -46.169 41.712  1.00 152.28 ? 270 THR A N      1 
ATOM   4037  C  CA     . THR A  1 271 ? 29.366  -46.600 43.073  1.00 151.45 ? 270 THR A CA     1 
ATOM   4038  C  C      . THR A  1 271 ? 28.202  -46.265 44.001  1.00 149.72 ? 270 THR A C      1 
ATOM   4039  O  O      . THR A  1 271 ? 27.878  -47.036 44.905  1.00 146.80 ? 270 THR A O      1 
ATOM   4040  C  CB     . THR A  1 271 ? 30.641  -45.927 43.614  1.00 150.75 ? 270 THR A CB     1 
ATOM   4041  O  OG1    . THR A  1 271 ? 31.703  -46.070 42.663  1.00 163.82 ? 270 THR A OG1    1 
ATOM   4042  C  CG2    . THR A  1 271 ? 31.058  -46.549 44.937  1.00 141.64 ? 270 THR A CG2    1 
ATOM   4043  H  H      . THR A  1 271 ? 29.657  -45.615 41.392  1.00 182.73 ? 270 THR A H      1 
ATOM   4044  H  HA     . THR A  1 271 ? 29.501  -47.571 43.085  1.00 181.74 ? 270 THR A HA     1 
ATOM   4045  H  HB     . THR A  1 271 ? 30.468  -44.984 43.761  1.00 180.90 ? 270 THR A HB     1 
ATOM   4046  H  HG1    . THR A  1 271 ? 32.384  -45.713 42.947  1.00 196.58 ? 270 THR A HG1    1 
ATOM   4047  H  HG21   . THR A  1 271 ? 31.853  -46.122 45.264  1.00 169.97 ? 270 THR A HG21   1 
ATOM   4048  H  HG22   . THR A  1 271 ? 30.358  -46.443 45.584  1.00 169.97 ? 270 THR A HG22   1 
ATOM   4049  H  HG23   . THR A  1 271 ? 31.234  -47.486 44.818  1.00 169.97 ? 270 THR A HG23   1 
ATOM   4050  N  N      . GLN A  1 272 ? 27.572  -45.118 43.766  1.00 139.79 ? 271 GLN A N      1 
ATOM   4051  C  CA     . GLN A  1 272 ? 26.500  -44.638 44.632  1.00 143.72 ? 271 GLN A CA     1 
ATOM   4052  C  C      . GLN A  1 272 ? 25.146  -45.262 44.306  1.00 144.30 ? 271 GLN A C      1 
ATOM   4053  O  O      . GLN A  1 272 ? 24.362  -45.559 45.207  1.00 142.65 ? 271 GLN A O      1 
ATOM   4054  C  CB     . GLN A  1 272 ? 26.395  -43.116 44.547  1.00 149.30 ? 271 GLN A CB     1 
ATOM   4055  C  CG     . GLN A  1 272 ? 27.524  -42.383 45.244  1.00 152.44 ? 271 GLN A CG     1 
ATOM   4056  C  CD     . GLN A  1 272 ? 27.369  -40.880 45.161  1.00 145.42 ? 271 GLN A CD     1 
ATOM   4057  O  OE1    . GLN A  1 272 ? 27.182  -40.324 44.079  1.00 129.81 ? 271 GLN A OE1    1 
ATOM   4058  N  NE2    . GLN A  1 272 ? 27.434  -40.213 46.308  1.00 152.29 ? 271 GLN A NE2    1 
ATOM   4059  H  H      . GLN A  1 272 ? 27.748  -44.596 43.105  1.00 167.74 ? 271 GLN A H      1 
ATOM   4060  H  HA     . GLN A  1 272 ? 26.719  -44.870 45.559  1.00 172.46 ? 271 GLN A HA     1 
ATOM   4061  H  HB2    . GLN A  1 272 ? 26.404  -42.854 43.613  1.00 179.16 ? 271 GLN A HB2    1 
ATOM   4062  H  HB3    . GLN A  1 272 ? 25.562  -42.837 44.959  1.00 179.16 ? 271 GLN A HB3    1 
ATOM   4063  H  HG2    . GLN A  1 272 ? 27.535  -42.634 46.180  1.00 182.92 ? 271 GLN A HG2    1 
ATOM   4064  H  HG3    . GLN A  1 272 ? 28.365  -42.623 44.824  1.00 182.92 ? 271 GLN A HG3    1 
ATOM   4065  H  HE21   . GLN A  1 272 ? 27.558  -40.638 47.046  1.00 182.74 ? 271 GLN A HE21   1 
ATOM   4066  H  HE22   . GLN A  1 272 ? 27.352  -39.357 46.313  1.00 182.74 ? 271 GLN A HE22   1 
ATOM   4067  N  N      . LEU A  1 273 ? 24.868  -45.452 43.021  1.00 144.65 ? 272 LEU A N      1 
ATOM   4068  C  CA     . LEU A  1 273 ? 23.595  -46.028 42.601  1.00 148.62 ? 272 LEU A CA     1 
ATOM   4069  C  C      . LEU A  1 273 ? 23.426  -47.467 43.090  1.00 156.40 ? 272 LEU A C      1 
ATOM   4070  O  O      . LEU A  1 273 ? 22.313  -47.994 43.118  1.00 161.53 ? 272 LEU A O      1 
ATOM   4071  C  CB     . LEU A  1 273 ? 23.460  -45.970 41.079  1.00 128.25 ? 272 LEU A CB     1 
ATOM   4072  C  CG     . LEU A  1 273 ? 23.132  -44.602 40.482  1.00 120.07 ? 272 LEU A CG     1 
ATOM   4073  C  CD1    . LEU A  1 273 ? 22.932  -44.722 38.980  1.00 144.71 ? 272 LEU A CD1    1 
ATOM   4074  C  CD2    . LEU A  1 273 ? 21.901  -43.994 41.131  1.00 106.37 ? 272 LEU A CD2    1 
ATOM   4075  H  H      . LEU A  1 273 ? 25.398  -45.256 42.373  1.00 173.58 ? 272 LEU A H      1 
ATOM   4076  H  HA     . LEU A  1 273 ? 22.867  -45.496 42.986  1.00 178.34 ? 272 LEU A HA     1 
ATOM   4077  H  HB2    . LEU A  1 273 ? 24.298  -46.262 40.688  1.00 153.90 ? 272 LEU A HB2    1 
ATOM   4078  H  HB3    . LEU A  1 273 ? 22.752  -46.578 40.813  1.00 153.90 ? 272 LEU A HB3    1 
ATOM   4079  H  HG     . LEU A  1 273 ? 23.879  -44.003 40.638  1.00 144.09 ? 272 LEU A HG     1 
ATOM   4080  H  HD11   . LEU A  1 273 ? 22.727  -43.855 38.623  1.00 173.65 ? 272 LEU A HD11   1 
ATOM   4081  H  HD12   . LEU A  1 273 ? 23.739  -45.057 38.584  1.00 173.65 ? 272 LEU A HD12   1 
ATOM   4082  H  HD13   . LEU A  1 273 ? 22.207  -45.327 38.809  1.00 173.65 ? 272 LEU A HD13   1 
ATOM   4083  H  HD21   . LEU A  1 273 ? 21.728  -43.139 40.731  1.00 127.64 ? 272 LEU A HD21   1 
ATOM   4084  H  HD22   . LEU A  1 273 ? 21.153  -44.579 40.990  1.00 127.64 ? 272 LEU A HD22   1 
ATOM   4085  H  HD23   . LEU A  1 273 ? 22.063  -43.890 42.071  1.00 127.64 ? 272 LEU A HD23   1 
ATOM   4086  N  N      . LEU A  1 274 ? 24.530  -48.100 43.473  1.00 147.01 ? 273 LEU A N      1 
ATOM   4087  C  CA     . LEU A  1 274 ? 24.482  -49.446 44.033  1.00 152.56 ? 273 LEU A CA     1 
ATOM   4088  C  C      . LEU A  1 274 ? 23.963  -49.427 45.468  1.00 147.98 ? 273 LEU A C      1 
ATOM   4089  O  O      . LEU A  1 274 ? 23.588  -50.464 46.015  1.00 142.55 ? 273 LEU A O      1 
ATOM   4090  C  CB     . LEU A  1 274 ? 25.869  -50.088 43.990  1.00 151.32 ? 273 LEU A CB     1 
ATOM   4091  C  CG     . LEU A  1 274 ? 26.299  -50.636 42.629  1.00 144.44 ? 273 LEU A CG     1 
ATOM   4092  C  CD1    . LEU A  1 274 ? 27.792  -50.923 42.614  1.00 150.15 ? 273 LEU A CD1    1 
ATOM   4093  C  CD2    . LEU A  1 274 ? 25.509  -51.892 42.289  1.00 128.23 ? 273 LEU A CD2    1 
ATOM   4094  H  H      . LEU A  1 274 ? 25.323  -47.770 43.419  1.00 176.41 ? 273 LEU A H      1 
ATOM   4095  H  HA     . LEU A  1 274 ? 23.874  -49.995 43.496  1.00 183.07 ? 273 LEU A HA     1 
ATOM   4096  H  HB2    . LEU A  1 274 ? 26.523  -49.423 44.256  1.00 181.59 ? 273 LEU A HB2    1 
ATOM   4097  H  HB3    . LEU A  1 274 ? 25.884  -50.826 44.619  1.00 181.59 ? 273 LEU A HB3    1 
ATOM   4098  H  HG     . LEU A  1 274 ? 26.114  -49.971 41.948  1.00 173.33 ? 273 LEU A HG     1 
ATOM   4099  H  HD11   . LEU A  1 274 ? 28.035  -51.265 41.751  1.00 180.18 ? 273 LEU A HD11   1 
ATOM   4100  H  HD12   . LEU A  1 274 ? 28.269  -50.109 42.790  1.00 180.18 ? 273 LEU A HD12   1 
ATOM   4101  H  HD13   . LEU A  1 274 ? 27.992  -51.573 43.292  1.00 180.18 ? 273 LEU A HD13   1 
ATOM   4102  H  HD21   . LEU A  1 274 ? 25.794  -52.218 41.433  1.00 153.88 ? 273 LEU A HD21   1 
ATOM   4103  H  HD22   . LEU A  1 274 ? 25.672  -52.555 42.964  1.00 153.88 ? 273 LEU A HD22   1 
ATOM   4104  H  HD23   . LEU A  1 274 ? 24.574  -51.674 42.262  1.00 153.88 ? 273 LEU A HD23   1 
ATOM   4105  N  N      . GLN A  1 275 ? 23.936  -48.240 46.069  1.00 145.95 ? 274 GLN A N      1 
ATOM   4106  C  CA     . GLN A  1 275 ? 23.504  -48.082 47.451  1.00 137.48 ? 274 GLN A CA     1 
ATOM   4107  C  C      . GLN A  1 275 ? 22.015  -47.755 47.529  1.00 131.41 ? 274 GLN A C      1 
ATOM   4108  O  O      . GLN A  1 275 ? 21.425  -47.771 48.607  1.00 120.23 ? 274 GLN A O      1 
ATOM   4109  C  CB     . GLN A  1 275 ? 24.306  -46.966 48.126  1.00 132.51 ? 274 GLN A CB     1 
ATOM   4110  C  CG     . GLN A  1 275 ? 25.802  -47.008 47.842  1.00 135.39 ? 274 GLN A CG     1 
ATOM   4111  C  CD     . GLN A  1 275 ? 26.461  -48.281 48.339  1.00 146.02 ? 274 GLN A CD     1 
ATOM   4112  O  OE1    . GLN A  1 275 ? 25.882  -49.029 49.127  1.00 138.85 ? 274 GLN A OE1    1 
ATOM   4113  N  NE2    . GLN A  1 275 ? 27.681  -48.534 47.877  1.00 149.54 ? 274 GLN A NE2    1 
ATOM   4114  H  H      . GLN A  1 275 ? 24.167  -47.503 45.690  1.00 175.15 ? 274 GLN A H      1 
ATOM   4115  H  HA     . GLN A  1 275 ? 23.664  -48.916 47.940  1.00 164.98 ? 274 GLN A HA     1 
ATOM   4116  H  HB2    . GLN A  1 275 ? 23.972  -46.111 47.814  1.00 159.01 ? 274 GLN A HB2    1 
ATOM   4117  H  HB3    . GLN A  1 275 ? 24.186  -47.034 49.086  1.00 159.01 ? 274 GLN A HB3    1 
ATOM   4118  H  HG2    . GLN A  1 275 ? 25.944  -46.952 46.885  1.00 162.46 ? 274 GLN A HG2    1 
ATOM   4119  H  HG3    . GLN A  1 275 ? 26.229  -46.258 48.285  1.00 162.46 ? 274 GLN A HG3    1 
ATOM   4120  H  HE21   . GLN A  1 275 ? 28.054  -47.988 47.326  1.00 179.45 ? 274 GLN A HE21   1 
ATOM   4121  H  HE22   . GLN A  1 275 ? 28.098  -49.243 48.128  1.00 179.45 ? 274 GLN A HE22   1 
ATOM   4122  N  N      . HIS A  1 276 ? 21.410  -47.458 46.385  1.00 141.39 ? 275 HIS A N      1 
ATOM   4123  C  CA     . HIS A  1 276 ? 20.007  -47.065 46.354  1.00 140.40 ? 275 HIS A CA     1 
ATOM   4124  C  C      . HIS A  1 276 ? 19.103  -48.260 46.659  1.00 129.90 ? 275 HIS A C      1 
ATOM   4125  O  O      . HIS A  1 276 ? 19.333  -49.356 46.150  1.00 138.87 ? 275 HIS A O      1 
ATOM   4126  C  CB     . HIS A  1 276 ? 19.653  -46.466 44.992  1.00 129.92 ? 275 HIS A CB     1 
ATOM   4127  C  CG     . HIS A  1 276 ? 18.316  -45.797 44.964  1.00 134.16 ? 275 HIS A CG     1 
ATOM   4128  N  ND1    . HIS A  1 276 ? 17.149  -46.479 44.695  1.00 136.92 ? 275 HIS A ND1    1 
ATOM   4129  C  CD2    . HIS A  1 276 ? 17.959  -44.511 45.188  1.00 134.99 ? 275 HIS A CD2    1 
ATOM   4130  C  CE1    . HIS A  1 276 ? 16.132  -45.640 44.750  1.00 136.00 ? 275 HIS A CE1    1 
ATOM   4131  N  NE2    . HIS A  1 276 ? 16.592  -44.440 45.047  1.00 135.54 ? 275 HIS A NE2    1 
ATOM   4132  H  H      . HIS A  1 276 ? 21.789  -47.477 45.613  1.00 169.67 ? 275 HIS A H      1 
ATOM   4133  H  HA     . HIS A  1 276 ? 19.850  -46.381 47.038  1.00 168.48 ? 275 HIS A HA     1 
ATOM   4134  H  HB2    . HIS A  1 276 ? 20.322  -45.805 44.757  1.00 155.90 ? 275 HIS A HB2    1 
ATOM   4135  H  HB3    . HIS A  1 276 ? 19.645  -47.176 44.330  1.00 155.90 ? 275 HIS A HB3    1 
ATOM   4136  H  HD1    . HIS A  1 276 ? 17.093  -47.318 44.519  1.00 164.30 ? 275 HIS A HD1    1 
ATOM   4137  H  HD2    . HIS A  1 276 ? 18.530  -43.807 45.398  1.00 161.99 ? 275 HIS A HD2    1 
ATOM   4138  H  HE1    . HIS A  1 276 ? 15.240  -45.858 44.602  1.00 163.20 ? 275 HIS A HE1    1 
ATOM   4139  H  HE2    . HIS A  1 276 ? 16.116  -43.729 45.135  1.00 162.65 ? 275 HIS A HE2    1 
ATOM   4140  N  N      . PRO A  1 277 ? 18.071  -48.050 47.495  1.00 113.97 ? 276 PRO A N      1 
ATOM   4141  C  CA     . PRO A  1 277 ? 17.156  -49.113 47.932  1.00 110.58 ? 276 PRO A CA     1 
ATOM   4142  C  C      . PRO A  1 277 ? 16.711  -50.042 46.807  1.00 142.95 ? 276 PRO A C      1 
ATOM   4143  O  O      . PRO A  1 277 ? 16.896  -51.253 46.903  1.00 160.51 ? 276 PRO A O      1 
ATOM   4144  C  CB     . PRO A  1 277 ? 15.956  -48.333 48.469  1.00 106.27 ? 276 PRO A CB     1 
ATOM   4145  C  CG     . PRO A  1 277 ? 16.543  -47.070 48.974  1.00 120.48 ? 276 PRO A CG     1 
ATOM   4146  C  CD     . PRO A  1 277 ? 17.689  -46.742 48.058  1.00 110.64 ? 276 PRO A CD     1 
ATOM   4147  H  HA     . PRO A  1 277 ? 17.557  -49.639 48.655  1.00 132.69 ? 276 PRO A HA     1 
ATOM   4148  H  HB2    . PRO A  1 277 ? 15.327  -48.159 47.751  1.00 127.53 ? 276 PRO A HB2    1 
ATOM   4149  H  HB3    . PRO A  1 277 ? 15.534  -48.830 49.187  1.00 127.53 ? 276 PRO A HB3    1 
ATOM   4150  H  HG2    . PRO A  1 277 ? 15.873  -46.368 48.946  1.00 144.58 ? 276 PRO A HG2    1 
ATOM   4151  H  HG3    . PRO A  1 277 ? 16.860  -47.201 49.881  1.00 144.58 ? 276 PRO A HG3    1 
ATOM   4152  H  HD2    . PRO A  1 277 ? 17.397  -46.143 47.353  1.00 132.77 ? 276 PRO A HD2    1 
ATOM   4153  H  HD3    . PRO A  1 277 ? 18.426  -46.363 48.562  1.00 132.77 ? 276 PRO A HD3    1 
ATOM   4154  N  N      . PHE A  1 278 ? 16.117  -49.472 45.765  1.00 149.45 ? 277 PHE A N      1 
ATOM   4155  C  CA     . PHE A  1 278 ? 15.681  -50.237 44.603  1.00 147.99 ? 277 PHE A CA     1 
ATOM   4156  C  C      . PHE A  1 278 ? 16.684  -51.335 44.244  1.00 141.27 ? 277 PHE A C      1 
ATOM   4157  O  O      . PHE A  1 278 ? 16.298  -52.452 43.899  1.00 141.91 ? 277 PHE A O      1 
ATOM   4158  C  CB     . PHE A  1 278 ? 15.477  -49.295 43.411  1.00 144.83 ? 277 PHE A CB     1 
ATOM   4159  C  CG     . PHE A  1 278 ? 14.897  -49.961 42.198  1.00 136.86 ? 277 PHE A CG     1 
ATOM   4160  C  CD1    . PHE A  1 278 ? 13.720  -50.684 42.282  1.00 134.61 ? 277 PHE A CD1    1 
ATOM   4161  C  CD2    . PHE A  1 278 ? 15.522  -49.850 40.968  1.00 141.87 ? 277 PHE A CD2    1 
ATOM   4162  C  CE1    . PHE A  1 278 ? 13.185  -51.294 41.166  1.00 132.32 ? 277 PHE A CE1    1 
ATOM   4163  C  CE2    . PHE A  1 278 ? 14.990  -50.456 39.848  1.00 148.45 ? 277 PHE A CE2    1 
ATOM   4164  C  CZ     . PHE A  1 278 ? 13.819  -51.179 39.947  1.00 143.92 ? 277 PHE A CZ     1 
ATOM   4165  H  H      . PHE A  1 278 ? 15.952  -48.630 45.707  1.00 179.34 ? 277 PHE A H      1 
ATOM   4166  H  HA     . PHE A  1 278 ? 14.822  -50.664 44.804  1.00 177.59 ? 277 PHE A HA     1 
ATOM   4167  H  HB2    . PHE A  1 278 ? 14.872  -48.584 43.675  1.00 173.80 ? 277 PHE A HB2    1 
ATOM   4168  H  HB3    . PHE A  1 278 ? 16.335  -48.919 43.160  1.00 173.80 ? 277 PHE A HB3    1 
ATOM   4169  H  HD1    . PHE A  1 278 ? 13.289  -50.766 43.102  1.00 161.53 ? 277 PHE A HD1    1 
ATOM   4170  H  HD2    . PHE A  1 278 ? 16.312  -49.364 40.896  1.00 170.24 ? 277 PHE A HD2    1 
ATOM   4171  H  HE1    . PHE A  1 278 ? 12.395  -51.780 41.235  1.00 158.78 ? 277 PHE A HE1    1 
ATOM   4172  H  HE2    . PHE A  1 278 ? 15.421  -50.377 39.027  1.00 178.14 ? 277 PHE A HE2    1 
ATOM   4173  H  HZ     . PHE A  1 278 ? 13.459  -51.588 39.193  1.00 172.70 ? 277 PHE A HZ     1 
ATOM   4174  N  N      . ILE A  1 279 ? 17.971  -51.013 44.341  1.00 133.20 ? 278 ILE A N      1 
ATOM   4175  C  CA     . ILE A  1 279 ? 19.032  -51.939 43.956  1.00 122.51 ? 278 ILE A CA     1 
ATOM   4176  C  C      . ILE A  1 279 ? 19.499  -52.793 45.131  1.00 132.63 ? 278 ILE A C      1 
ATOM   4177  O  O      . ILE A  1 279 ? 19.603  -54.014 45.019  1.00 139.21 ? 278 ILE A O      1 
ATOM   4178  C  CB     . ILE A  1 279 ? 20.245  -51.178 43.388  1.00 126.75 ? 278 ILE A CB     1 
ATOM   4179  C  CG1    . ILE A  1 279 ? 19.805  -50.243 42.260  1.00 141.97 ? 278 ILE A CG1    1 
ATOM   4180  C  CG2    . ILE A  1 279 ? 21.303  -52.148 42.892  1.00 117.00 ? 278 ILE A CG2    1 
ATOM   4181  C  CD1    . ILE A  1 279 ? 19.057  -50.938 41.141  1.00 143.12 ? 278 ILE A CD1    1 
ATOM   4182  H  H      . ILE A  1 279 ? 18.258  -50.256 44.631  1.00 159.85 ? 278 ILE A H      1 
ATOM   4183  H  HA     . ILE A  1 279 ? 18.695  -52.539 43.258  1.00 147.02 ? 278 ILE A HA     1 
ATOM   4184  H  HB     . ILE A  1 279 ? 20.630  -50.642 44.099  1.00 152.11 ? 278 ILE A HB     1 
ATOM   4185  H  HG12   . ILE A  1 279 ? 19.221  -49.562 42.628  1.00 170.37 ? 278 ILE A HG12   1 
ATOM   4186  H  HG13   . ILE A  1 279 ? 20.593  -49.827 41.875  1.00 170.37 ? 278 ILE A HG13   1 
ATOM   4187  H  HG21   . ILE A  1 279 ? 22.046  -51.649 42.545  1.00 140.40 ? 278 ILE A HG21   1 
ATOM   4188  H  HG22   . ILE A  1 279 ? 21.592  -52.697 43.625  1.00 140.40 ? 278 ILE A HG22   1 
ATOM   4189  H  HG23   . ILE A  1 279 ? 20.925  -52.696 42.201  1.00 140.40 ? 278 ILE A HG23   1 
ATOM   4190  H  HD11   . ILE A  1 279 ? 18.816  -50.289 40.476  1.00 171.75 ? 278 ILE A HD11   1 
ATOM   4191  H  HD12   . ILE A  1 279 ? 19.625  -51.609 40.755  1.00 171.75 ? 278 ILE A HD12   1 
ATOM   4192  H  HD13   . ILE A  1 279 ? 18.266  -51.347 41.502  1.00 171.75 ? 278 ILE A HD13   1 
ATOM   4193  N  N      . LYS A  1 280 ? 19.785  -52.146 46.255  1.00 156.40 ? 279 LYS A N      1 
ATOM   4194  C  CA     . LYS A  1 280 ? 20.273  -52.846 47.438  1.00 158.92 ? 279 LYS A CA     1 
ATOM   4195  C  C      . LYS A  1 280 ? 19.296  -53.937 47.866  1.00 151.17 ? 279 LYS A C      1 
ATOM   4196  O  O      . LYS A  1 280 ? 19.702  -54.988 48.359  1.00 157.22 ? 279 LYS A O      1 
ATOM   4197  C  CB     . LYS A  1 280 ? 20.496  -51.856 48.582  1.00 159.80 ? 279 LYS A CB     1 
ATOM   4198  C  CG     . LYS A  1 280 ? 21.224  -52.442 49.781  1.00 178.46 ? 279 LYS A CG     1 
ATOM   4199  C  CD     . LYS A  1 280 ? 21.630  -51.362 50.776  1.00 191.42 ? 279 LYS A CD     1 
ATOM   4200  C  CE     . LYS A  1 280 ? 22.626  -50.379 50.176  1.00 190.71 ? 279 LYS A CE     1 
ATOM   4201  N  NZ     . LYS A  1 280 ? 23.874  -51.043 49.702  1.00 181.70 ? 279 LYS A NZ     1 
ATOM   4202  H  H      . LYS A  1 280 ? 19.704  -51.296 46.360  1.00 187.67 ? 279 LYS A H      1 
ATOM   4203  H  HA     . LYS A  1 280 ? 21.132  -53.270 47.229  1.00 190.70 ? 279 LYS A HA     1 
ATOM   4204  H  HB2    . LYS A  1 280 ? 21.023  -51.112 48.251  1.00 191.76 ? 279 LYS A HB2    1 
ATOM   4205  H  HB3    . LYS A  1 280 ? 19.633  -51.535 48.888  1.00 191.76 ? 279 LYS A HB3    1 
ATOM   4206  H  HG2    . LYS A  1 280 ? 20.639  -53.068 50.235  1.00 214.16 ? 279 LYS A HG2    1 
ATOM   4207  H  HG3    . LYS A  1 280 ? 22.027  -52.893 49.478  1.00 214.16 ? 279 LYS A HG3    1 
ATOM   4208  H  HD2    . LYS A  1 280 ? 20.842  -50.866 51.048  1.00 229.70 ? 279 LYS A HD2    1 
ATOM   4209  H  HD3    . LYS A  1 280 ? 22.045  -51.780 51.547  1.00 229.70 ? 279 LYS A HD3    1 
ATOM   4210  H  HE2    . LYS A  1 280 ? 22.215  -49.936 49.417  1.00 228.85 ? 279 LYS A HE2    1 
ATOM   4211  H  HE3    . LYS A  1 280 ? 22.871  -49.725 50.849  1.00 228.85 ? 279 LYS A HE3    1 
ATOM   4212  H  HZ1    . LYS A  1 280 ? 24.429  -50.438 49.359  1.00 218.04 ? 279 LYS A HZ1    1 
ATOM   4213  H  HZ2    . LYS A  1 280 ? 24.277  -51.453 50.382  1.00 218.04 ? 279 LYS A HZ2    1 
ATOM   4214  H  HZ3    . LYS A  1 280 ? 23.679  -51.645 49.076  1.00 218.04 ? 279 LYS A HZ3    1 
ATOM   4215  N  N      . ASN A  1 281 ? 18.007  -53.682 47.664  1.00 146.43 ? 280 ASN A N      1 
ATOM   4216  C  CA     . ASN A  1 281 ? 16.966  -54.643 48.002  1.00 141.53 ? 280 ASN A CA     1 
ATOM   4217  C  C      . ASN A  1 281 ? 16.534  -55.447 46.781  1.00 144.92 ? 280 ASN A C      1 
ATOM   4218  O  O      . ASN A  1 281 ? 15.365  -55.805 46.643  1.00 150.12 ? 280 ASN A O      1 
ATOM   4219  C  CB     . ASN A  1 281 ? 15.757  -53.921 48.602  1.00 141.48 ? 280 ASN A CB     1 
ATOM   4220  C  CG     . ASN A  1 281 ? 16.077  -53.250 49.925  1.00 153.75 ? 280 ASN A CG     1 
ATOM   4221  O  OD1    . ASN A  1 281 ? 16.675  -53.857 50.813  1.00 177.64 ? 280 ASN A OD1    1 
ATOM   4222  N  ND2    . ASN A  1 281 ? 15.686  -51.988 50.060  1.00 136.93 ? 280 ASN A ND2    1 
ATOM   4223  H  H      . ASN A  1 281 ? 17.707  -52.949 47.327  1.00 175.71 ? 280 ASN A H      1 
ATOM   4224  H  HA     . ASN A  1 281 ? 17.311  -55.269 48.673  1.00 169.83 ? 280 ASN A HA     1 
ATOM   4225  H  HB2    . ASN A  1 281 ? 15.458  -53.238 47.983  1.00 169.77 ? 280 ASN A HB2    1 
ATOM   4226  H  HB3    . ASN A  1 281 ? 15.048  -54.565 48.756  1.00 169.77 ? 280 ASN A HB3    1 
ATOM   4227  H  HD21   . ASN A  1 281 ? 15.275  -51.594 49.415  1.00 164.32 ? 280 ASN A HD21   1 
ATOM   4228  H  HD22   . ASN A  1 281 ? 15.845  -51.564 50.791  1.00 164.32 ? 280 ASN A HD22   1 
ATOM   4229  N  N      . ALA A  1 282 ? 17.486  -55.730 45.896  1.00 145.00 ? 281 ALA A N      1 
ATOM   4230  C  CA     . ALA A  1 282 ? 17.198  -56.476 44.678  1.00 148.02 ? 281 ALA A CA     1 
ATOM   4231  C  C      . ALA A  1 282 ? 17.237  -57.977 44.945  1.00 145.76 ? 281 ALA A C      1 
ATOM   4232  O  O      . ALA A  1 282 ? 17.957  -58.442 45.827  1.00 141.12 ? 281 ALA A O      1 
ATOM   4233  C  CB     . ALA A  1 282 ? 18.188  -56.106 43.581  1.00 139.44 ? 281 ALA A CB     1 
ATOM   4234  H  H      . ALA A  1 282 ? 18.310  -55.499 45.979  1.00 174.00 ? 281 ALA A H      1 
ATOM   4235  H  HA     . ALA A  1 282 ? 16.298  -56.246 44.366  1.00 177.62 ? 281 ALA A HA     1 
ATOM   4236  H  HB1    . ALA A  1 282 ? 17.980  -56.608 42.790  1.00 167.33 ? 281 ALA A HB1    1 
ATOM   4237  H  HB2    . ALA A  1 282 ? 18.116  -55.166 43.401  1.00 167.33 ? 281 ALA A HB2    1 
ATOM   4238  H  HB3    . ALA A  1 282 ? 19.076  -56.316 43.879  1.00 167.33 ? 281 ALA A HB3    1 
ATOM   4239  N  N      . LYS A  1 283 ? 16.460  -58.726 44.170  1.00 152.49 ? 282 LYS A N      1 
ATOM   4240  C  CA     . LYS A  1 283 ? 16.370  -60.172 44.324  1.00 142.93 ? 282 LYS A CA     1 
ATOM   4241  C  C      . LYS A  1 283 ? 17.573  -60.844 43.678  1.00 140.58 ? 282 LYS A C      1 
ATOM   4242  O  O      . LYS A  1 283 ? 18.306  -60.211 42.917  1.00 118.23 ? 282 LYS A O      1 
ATOM   4243  C  CB     . LYS A  1 283 ? 15.092  -60.687 43.664  1.00 130.01 ? 282 LYS A CB     1 
ATOM   4244  C  CG     . LYS A  1 283 ? 13.830  -59.939 44.063  1.00 136.39 ? 282 LYS A CG     1 
ATOM   4245  C  CD     . LYS A  1 283 ? 13.457  -60.191 45.512  1.00 158.52 ? 282 LYS A CD     1 
ATOM   4246  C  CE     . LYS A  1 283 ? 12.276  -59.333 45.937  1.00 171.21 ? 282 LYS A CE     1 
ATOM   4247  N  NZ     . LYS A  1 283 ? 11.078  -59.551 45.077  1.00 175.19 ? 282 LYS A NZ     1 
ATOM   4248  H  H      . LYS A  1 283 ? 15.968  -58.415 43.537  1.00 182.99 ? 282 LYS A H      1 
ATOM   4249  H  HA     . LYS A  1 283 ? 16.351  -60.404 45.276  1.00 171.51 ? 282 LYS A HA     1 
ATOM   4250  H  HB2    . LYS A  1 283 ? 15.187  -60.610 42.701  1.00 156.01 ? 282 LYS A HB2    1 
ATOM   4251  H  HB3    . LYS A  1 283 ? 14.971  -61.618 43.906  1.00 156.01 ? 282 LYS A HB3    1 
ATOM   4252  H  HG2    . LYS A  1 283 ? 13.974  -58.987 43.948  1.00 163.67 ? 282 LYS A HG2    1 
ATOM   4253  H  HG3    . LYS A  1 283 ? 13.094  -60.235 43.505  1.00 163.67 ? 282 LYS A HG3    1 
ATOM   4254  H  HD2    . LYS A  1 283 ? 13.212  -61.123 45.623  1.00 190.22 ? 282 LYS A HD2    1 
ATOM   4255  H  HD3    . LYS A  1 283 ? 14.212  -59.972 46.080  1.00 190.22 ? 282 LYS A HD3    1 
ATOM   4256  H  HE2    . LYS A  1 283 ? 12.035  -59.554 46.850  1.00 205.46 ? 282 LYS A HE2    1 
ATOM   4257  H  HE3    . LYS A  1 283 ? 12.525  -58.398 45.874  1.00 205.46 ? 282 LYS A HE3    1 
ATOM   4258  H  HZ1    . LYS A  1 283 ? 10.408  -59.035 45.353  1.00 210.22 ? 282 LYS A HZ1    1 
ATOM   4259  H  HZ2    . LYS A  1 283 ? 11.270  -59.350 44.232  1.00 210.22 ? 282 LYS A HZ2    1 
ATOM   4260  H  HZ3    . LYS A  1 283 ? 10.824  -60.403 45.121  1.00 210.22 ? 282 LYS A HZ3    1 
ATOM   4261  N  N      . PRO A  1 284 ? 17.786  -62.134 43.981  1.00 154.88 ? 283 PRO A N      1 
ATOM   4262  C  CA     . PRO A  1 284 ? 18.846  -62.891 43.308  1.00 148.66 ? 283 PRO A CA     1 
ATOM   4263  C  C      . PRO A  1 284 ? 18.590  -63.050 41.816  1.00 137.49 ? 283 PRO A C      1 
ATOM   4264  O  O      . PRO A  1 284 ? 17.474  -62.816 41.359  1.00 132.09 ? 283 PRO A O      1 
ATOM   4265  C  CB     . PRO A  1 284 ? 18.821  -64.252 44.020  1.00 158.97 ? 283 PRO A CB     1 
ATOM   4266  C  CG     . PRO A  1 284 ? 17.491  -64.319 44.699  1.00 162.63 ? 283 PRO A CG     1 
ATOM   4267  C  CD     . PRO A  1 284 ? 17.158  -62.911 45.062  1.00 161.74 ? 283 PRO A CD     1 
ATOM   4268  H  HA     . PRO A  1 284 ? 19.717  -62.463 43.449  1.00 178.39 ? 283 PRO A HA     1 
ATOM   4269  H  HB2    . PRO A  1 284 ? 18.908  -64.964 43.367  1.00 190.77 ? 283 PRO A HB2    1 
ATOM   4270  H  HB3    . PRO A  1 284 ? 19.540  -64.293 44.670  1.00 190.77 ? 283 PRO A HB3    1 
ATOM   4271  H  HG2    . PRO A  1 284 ? 16.830  -64.680 44.087  1.00 195.15 ? 283 PRO A HG2    1 
ATOM   4272  H  HG3    . PRO A  1 284 ? 17.558  -64.870 45.494  1.00 195.15 ? 283 PRO A HG3    1 
ATOM   4273  H  HD2    . PRO A  1 284 ? 16.197  -62.778 45.061  1.00 194.09 ? 283 PRO A HD2    1 
ATOM   4274  H  HD3    . PRO A  1 284 ? 17.550  -62.679 45.918  1.00 194.09 ? 283 PRO A HD3    1 
ATOM   4275  N  N      . VAL A  1 285 ? 19.617  -63.449 41.071  1.00 140.73 ? 284 VAL A N      1 
ATOM   4276  C  CA     . VAL A  1 285 ? 19.506  -63.577 39.621  1.00 152.26 ? 284 VAL A CA     1 
ATOM   4277  C  C      . VAL A  1 285 ? 18.541  -64.697 39.241  1.00 166.71 ? 284 VAL A C      1 
ATOM   4278  O  O      . VAL A  1 285 ? 18.182  -64.848 38.074  1.00 163.51 ? 284 VAL A O      1 
ATOM   4279  C  CB     . VAL A  1 285 ? 20.875  -63.851 38.959  1.00 153.33 ? 284 VAL A CB     1 
ATOM   4280  C  CG1    . VAL A  1 285 ? 21.907  -62.818 39.402  1.00 155.35 ? 284 VAL A CG1    1 
ATOM   4281  C  CG2    . VAL A  1 285 ? 21.356  -65.259 39.275  1.00 162.93 ? 284 VAL A CG2    1 
ATOM   4282  H  H      . VAL A  1 285 ? 20.392  -63.653 41.383  1.00 168.88 ? 284 VAL A H      1 
ATOM   4283  H  HA     . VAL A  1 285 ? 19.156  -62.739 39.255  1.00 182.71 ? 284 VAL A HA     1 
ATOM   4284  H  HB     . VAL A  1 285 ? 20.776  -63.779 37.987  1.00 184.00 ? 284 VAL A HB     1 
ATOM   4285  H  HG11   . VAL A  1 285 ? 22.745  -63.012 38.976  1.00 186.42 ? 284 VAL A HG11   1 
ATOM   4286  H  HG12   . VAL A  1 285 ? 21.604  -61.944 39.145  1.00 186.42 ? 284 VAL A HG12   1 
ATOM   4287  H  HG13   . VAL A  1 285 ? 22.005  -62.863 40.355  1.00 186.42 ? 284 VAL A HG13   1 
ATOM   4288  H  HG21   . VAL A  1 285 ? 22.206  -65.401 38.852  1.00 195.52 ? 284 VAL A HG21   1 
ATOM   4289  H  HG22   . VAL A  1 285 ? 21.443  -65.353 40.226  1.00 195.52 ? 284 VAL A HG22   1 
ATOM   4290  H  HG23   . VAL A  1 285 ? 20.714  -65.890 38.941  1.00 195.52 ? 284 VAL A HG23   1 
ATOM   4291  N  N      . SER A  1 286 ? 18.124  -65.480 40.232  1.00 178.35 ? 285 SER A N      1 
ATOM   4292  C  CA     . SER A  1 286 ? 17.216  -66.595 39.999  1.00 180.27 ? 285 SER A CA     1 
ATOM   4293  C  C      . SER A  1 286 ? 15.828  -66.134 39.554  1.00 202.59 ? 285 SER A C      1 
ATOM   4294  O  O      . SER A  1 286 ? 15.073  -66.911 38.970  1.00 215.42 ? 285 SER A O      1 
ATOM   4295  C  CB     . SER A  1 286 ? 17.097  -67.450 41.261  1.00 152.35 ? 285 SER A CB     1 
ATOM   4296  O  OG     . SER A  1 286 ? 16.559  -66.701 42.335  1.00 142.44 ? 285 SER A OG     1 
ATOM   4297  H  H      . SER A  1 286 ? 18.355  -65.384 41.055  1.00 214.02 ? 285 SER A H      1 
ATOM   4298  H  HA     . SER A  1 286 ? 17.585  -67.160 39.288  1.00 216.32 ? 285 SER A HA     1 
ATOM   4299  H  HB2    . SER A  1 286 ? 16.512  -68.202 41.078  1.00 182.82 ? 285 SER A HB2    1 
ATOM   4300  H  HB3    . SER A  1 286 ? 17.978  -67.769 41.510  1.00 182.82 ? 285 SER A HB3    1 
ATOM   4301  H  HG     . SER A  1 286 ? 16.501  -67.171 43.004  1.00 170.93 ? 285 SER A HG     1 
ATOM   4302  N  N      . ILE A  1 287 ? 15.489  -64.877 39.827  1.00 201.40 ? 286 ILE A N      1 
ATOM   4303  C  CA     . ILE A  1 287 ? 14.185  -64.354 39.428  1.00 196.26 ? 286 ILE A CA     1 
ATOM   4304  C  C      . ILE A  1 287 ? 14.140  -64.120 37.919  1.00 194.50 ? 286 ILE A C      1 
ATOM   4305  O  O      . ILE A  1 287 ? 13.065  -64.018 37.329  1.00 185.71 ? 286 ILE A O      1 
ATOM   4306  C  CB     . ILE A  1 287 ? 13.828  -63.046 40.167  1.00 192.64 ? 286 ILE A CB     1 
ATOM   4307  C  CG1    . ILE A  1 287 ? 14.734  -61.898 39.718  1.00 196.85 ? 286 ILE A CG1    1 
ATOM   4308  C  CG2    . ILE A  1 287 ? 13.924  -63.244 41.674  1.00 193.32 ? 286 ILE A CG2    1 
ATOM   4309  C  CD1    . ILE A  1 287 ? 14.175  -60.535 40.034  1.00 201.85 ? 286 ILE A CD1    1 
ATOM   4310  H  H      . ILE A  1 287 ? 15.989  -64.312 40.239  1.00 241.68 ? 286 ILE A H      1 
ATOM   4311  H  HA     . ILE A  1 287 ? 13.499  -65.018 39.648  1.00 235.51 ? 286 ILE A HA     1 
ATOM   4312  H  HB     . ILE A  1 287 ? 12.912  -62.814 39.948  1.00 231.17 ? 286 ILE A HB     1 
ATOM   4313  H  HG12   . ILE A  1 287 ? 15.590  -61.980 40.167  1.00 236.22 ? 286 ILE A HG12   1 
ATOM   4314  H  HG13   . ILE A  1 287 ? 14.859  -61.953 38.758  1.00 236.22 ? 286 ILE A HG13   1 
ATOM   4315  H  HG21   . ILE A  1 287 ? 13.698  -62.419 42.112  1.00 231.99 ? 286 ILE A HG21   1 
ATOM   4316  H  HG22   . ILE A  1 287 ? 13.311  -63.934 41.938  1.00 231.99 ? 286 ILE A HG22   1 
ATOM   4317  H  HG23   . ILE A  1 287 ? 14.821  -63.499 41.899  1.00 231.99 ? 286 ILE A HG23   1 
ATOM   4318  H  HD11   . ILE A  1 287 ? 14.791  -59.866 39.727  1.00 242.22 ? 286 ILE A HD11   1 
ATOM   4319  H  HD12   . ILE A  1 287 ? 13.331  -60.434 39.588  1.00 242.22 ? 286 ILE A HD12   1 
ATOM   4320  H  HD13   . ILE A  1 287 ? 14.055  -60.460 40.984  1.00 242.22 ? 286 ILE A HD13   1 
ATOM   4321  N  N      . LEU A  1 288 ? 15.315  -64.035 37.302  1.00 207.86 ? 287 LEU A N      1 
ATOM   4322  C  CA     . LEU A  1 288 ? 15.417  -63.909 35.853  1.00 135.91 ? 287 LEU A CA     1 
ATOM   4323  C  C      . LEU A  1 288 ? 15.276  -65.281 35.204  1.00 145.27 ? 287 LEU A C      1 
ATOM   4324  O  O      . LEU A  1 288 ? 14.930  -65.393 34.028  1.00 151.57 ? 287 LEU A O      1 
ATOM   4325  C  CB     . LEU A  1 288 ? 16.764  -63.299 35.465  1.00 133.84 ? 287 LEU A CB     1 
ATOM   4326  C  CG     . LEU A  1 288 ? 17.115  -61.952 36.098  1.00 134.69 ? 287 LEU A CG     1 
ATOM   4327  C  CD1    . LEU A  1 288 ? 18.576  -61.623 35.849  1.00 128.88 ? 287 LEU A CD1    1 
ATOM   4328  C  CD2    . LEU A  1 288 ? 16.218  -60.852 35.558  1.00 143.00 ? 287 LEU A CD2    1 
ATOM   4329  H  H      . LEU A  1 288 ? 16.075  -64.049 37.705  1.00 249.44 ? 287 LEU A H      1 
ATOM   4330  H  HA     . LEU A  1 288 ? 14.701  -63.328 35.521  1.00 163.09 ? 287 LEU A HA     1 
ATOM   4331  H  HB2    . LEU A  1 288 ? 17.463  -63.924 35.715  1.00 160.61 ? 287 LEU A HB2    1 
ATOM   4332  H  HB3    . LEU A  1 288 ? 16.775  -63.175 34.503  1.00 160.61 ? 287 LEU A HB3    1 
ATOM   4333  H  HG     . LEU A  1 288 ? 16.979  -62.008 37.057  1.00 161.63 ? 287 LEU A HG     1 
ATOM   4334  H  HD11   . LEU A  1 288 ? 18.779  -60.776 36.252  1.00 154.65 ? 287 LEU A HD11   1 
ATOM   4335  H  HD12   . LEU A  1 288 ? 19.122  -62.311 36.238  1.00 154.65 ? 287 LEU A HD12   1 
ATOM   4336  H  HD13   . LEU A  1 288 ? 18.729  -61.581 34.902  1.00 154.65 ? 287 LEU A HD13   1 
ATOM   4337  H  HD21   . LEU A  1 288 ? 16.460  -60.020 35.972  1.00 171.59 ? 287 LEU A HD21   1 
ATOM   4338  H  HD22   . LEU A  1 288 ? 16.336  -60.791 34.607  1.00 171.59 ? 287 LEU A HD22   1 
ATOM   4339  H  HD23   . LEU A  1 288 ? 15.304  -61.066 35.762  1.00 171.59 ? 287 LEU A HD23   1 
ATOM   4340  N  N      . ARG A  1 289 ? 15.556  -66.322 35.981  1.00 275.25 ? 288 ARG A N      1 
ATOM   4341  C  CA     . ARG A  1 289 ? 15.494  -67.696 35.496  1.00 250.80 ? 288 ARG A CA     1 
ATOM   4342  C  C      . ARG A  1 289 ? 14.197  -67.965 34.738  1.00 233.30 ? 288 ARG A C      1 
ATOM   4343  O  O      . ARG A  1 289 ? 14.208  -68.596 33.681  1.00 221.98 ? 288 ARG A O      1 
ATOM   4344  C  CB     . ARG A  1 289 ? 15.612  -68.667 36.672  1.00 246.12 ? 288 ARG A CB     1 
ATOM   4345  C  CG     . ARG A  1 289 ? 15.750  -70.125 36.272  1.00 238.37 ? 288 ARG A CG     1 
ATOM   4346  C  CD     . ARG A  1 289 ? 15.694  -71.031 37.492  1.00 229.59 ? 288 ARG A CD     1 
ATOM   4347  N  NE     . ARG A  1 289 ? 15.893  -72.436 37.148  1.00 229.82 ? 288 ARG A NE     1 
ATOM   4348  C  CZ     . ARG A  1 289 ? 15.837  -73.438 38.022  1.00 235.79 ? 288 ARG A CZ     1 
ATOM   4349  N  NH1    . ARG A  1 289 ? 15.584  -73.198 39.301  1.00 244.65 ? 288 ARG A NH1    1 
ATOM   4350  N  NH2    . ARG A  1 289 ? 16.033  -74.684 37.615  1.00 229.76 ? 288 ARG A NH2    1 
ATOM   4351  H  H      . ARG A  1 289 ? 15.788  -66.257 36.807  1.00 330.30 ? 288 ARG A H      1 
ATOM   4352  H  HA     . ARG A  1 289 ? 16.244  -67.857 34.887  1.00 300.96 ? 288 ARG A HA     1 
ATOM   4353  H  HB2    . ARG A  1 289 ? 16.396  -68.429 37.193  1.00 295.34 ? 288 ARG A HB2    1 
ATOM   4354  H  HB3    . ARG A  1 289 ? 14.818  -68.586 37.222  1.00 295.34 ? 288 ARG A HB3    1 
ATOM   4355  H  HG2    . ARG A  1 289 ? 15.022  -70.366 35.679  1.00 286.04 ? 288 ARG A HG2    1 
ATOM   4356  H  HG3    . ARG A  1 289 ? 16.604  -70.258 35.831  1.00 286.04 ? 288 ARG A HG3    1 
ATOM   4357  H  HD2    . ARG A  1 289 ? 16.392  -70.771 38.113  1.00 275.51 ? 288 ARG A HD2    1 
ATOM   4358  H  HD3    . ARG A  1 289 ? 14.824  -70.944 37.913  1.00 275.51 ? 288 ARG A HD3    1 
ATOM   4359  H  HE     . ARG A  1 289 ? 16.058  -72.629 36.326  1.00 275.78 ? 288 ARG A HE     1 
ATOM   4360  H  HH11   . ARG A  1 289 ? 15.456  -72.391 39.570  1.00 293.58 ? 288 ARG A HH11   1 
ATOM   4361  H  HH12   . ARG A  1 289 ? 15.548  -73.849 39.862  1.00 293.58 ? 288 ARG A HH12   1 
ATOM   4362  H  HH21   . ARG A  1 289 ? 16.197  -74.845 36.787  1.00 275.71 ? 288 ARG A HH21   1 
ATOM   4363  H  HH22   . ARG A  1 289 ? 15.996  -75.331 38.180  1.00 275.71 ? 288 ARG A HH22   1 
ATOM   4364  N  N      . ASP A  1 290 ? 13.083  -67.485 35.282  1.00 229.44 ? 289 ASP A N      1 
ATOM   4365  C  CA     . ASP A  1 290 ? 11.774  -67.741 34.691  1.00 223.69 ? 289 ASP A CA     1 
ATOM   4366  C  C      . ASP A  1 290 ? 11.544  -66.937 33.413  1.00 216.17 ? 289 ASP A C      1 
ATOM   4367  O  O      . ASP A  1 290 ? 11.059  -67.477 32.420  1.00 219.19 ? 289 ASP A O      1 
ATOM   4368  C  CB     . ASP A  1 290 ? 10.663  -67.454 35.704  1.00 225.19 ? 289 ASP A CB     1 
ATOM   4369  C  CG     . ASP A  1 290 ? 10.492  -68.575 36.714  1.00 223.48 ? 289 ASP A CG     1 
ATOM   4370  O  OD1    . ASP A  1 290 ? 11.489  -69.266 37.014  1.00 218.66 ? 289 ASP A OD1    1 
ATOM   4371  O  OD2    . ASP A  1 290 ? 9.360   -68.769 37.204  1.00 224.18 ? 289 ASP A OD2    1 
ATOM   4372  H  H      . ASP A  1 290 ? 13.059  -67.006 35.996  1.00 275.33 ? 289 ASP A H      1 
ATOM   4373  H  HA     . ASP A  1 290 ? 11.720  -68.690 34.455  1.00 268.43 ? 289 ASP A HA     1 
ATOM   4374  H  HB2    . ASP A  1 290 ? 10.878  -66.643 36.190  1.00 270.23 ? 289 ASP A HB2    1 
ATOM   4375  H  HB3    . ASP A  1 290 ? 9.823   -67.346 35.231  1.00 270.23 ? 289 ASP A HB3    1 
ATOM   4376  N  N      . LEU A  1 291 ? 11.888  -65.652 33.433  1.00 206.55 ? 290 LEU A N      1 
ATOM   4377  C  CA     . LEU A  1 291 ? 11.709  -64.813 32.251  1.00 201.69 ? 290 LEU A CA     1 
ATOM   4378  C  C      . LEU A  1 291 ? 12.710  -65.196 31.166  1.00 196.77 ? 290 LEU A C      1 
ATOM   4379  O  O      . LEU A  1 291 ? 12.501  -64.912 29.986  1.00 210.72 ? 290 LEU A O      1 
ATOM   4380  C  CB     . LEU A  1 291 ? 11.844  -63.326 32.603  1.00 201.01 ? 290 LEU A CB     1 
ATOM   4381  C  CG     . LEU A  1 291 ? 13.238  -62.767 32.908  1.00 196.11 ? 290 LEU A CG     1 
ATOM   4382  C  CD1    . LEU A  1 291 ? 14.034  -62.481 31.638  1.00 182.29 ? 290 LEU A CD1    1 
ATOM   4383  C  CD2    . LEU A  1 291 ? 13.120  -61.504 33.744  1.00 196.58 ? 290 LEU A CD2    1 
ATOM   4384  H  H      . LEU A  1 291 ? 12.224  -65.245 34.111  1.00 247.86 ? 290 LEU A H      1 
ATOM   4385  H  HA     . LEU A  1 291 ? 10.808  -64.957 31.894  1.00 242.02 ? 290 LEU A HA     1 
ATOM   4386  H  HB2    . LEU A  1 291 ? 11.494  -62.813 31.858  1.00 241.22 ? 290 LEU A HB2    1 
ATOM   4387  H  HB3    . LEU A  1 291 ? 11.297  -63.156 33.386  1.00 241.22 ? 290 LEU A HB3    1 
ATOM   4388  H  HG     . LEU A  1 291 ? 13.731  -63.421 33.427  1.00 235.33 ? 290 LEU A HG     1 
ATOM   4389  H  HD11   . LEU A  1 291 ? 14.896  -62.135 31.881  1.00 218.75 ? 290 LEU A HD11   1 
ATOM   4390  H  HD12   . LEU A  1 291 ? 14.137  -63.298 31.144  1.00 218.75 ? 290 LEU A HD12   1 
ATOM   4391  H  HD13   . LEU A  1 291 ? 13.558  -61.836 31.110  1.00 218.75 ? 290 LEU A HD13   1 
ATOM   4392  H  HD21   . LEU A  1 291 ? 14.001  -61.167 33.927  1.00 235.90 ? 290 LEU A HD21   1 
ATOM   4393  H  HD22   . LEU A  1 291 ? 12.614  -60.851 33.255  1.00 235.90 ? 290 LEU A HD22   1 
ATOM   4394  H  HD23   . LEU A  1 291 ? 12.673  -61.715 34.567  1.00 235.90 ? 290 LEU A HD23   1 
ATOM   4395  N  N      . ILE A  1 292 ? 13.797  -65.841 31.575  1.00 174.09 ? 291 ILE A N      1 
ATOM   4396  C  CA     . ILE A  1 292 ? 14.834  -66.276 30.648  1.00 168.87 ? 291 ILE A CA     1 
ATOM   4397  C  C      . ILE A  1 292 ? 14.439  -67.571 29.948  1.00 178.16 ? 291 ILE A C      1 
ATOM   4398  O  O      . ILE A  1 292 ? 14.702  -67.749 28.759  1.00 178.08 ? 291 ILE A O      1 
ATOM   4399  C  CB     . ILE A  1 292 ? 16.174  -66.473 31.380  1.00 165.22 ? 291 ILE A CB     1 
ATOM   4400  C  CG1    . ILE A  1 292 ? 16.920  -65.144 31.465  1.00 163.61 ? 291 ILE A CG1    1 
ATOM   4401  C  CG2    . ILE A  1 292 ? 17.037  -67.499 30.666  1.00 176.95 ? 291 ILE A CG2    1 
ATOM   4402  C  CD1    . ILE A  1 292 ? 17.872  -65.055 32.625  1.00 163.08 ? 291 ILE A CD1    1 
ATOM   4403  H  H      . ILE A  1 292 ? 13.959  -66.042 32.396  1.00 208.91 ? 291 ILE A H      1 
ATOM   4404  H  HA     . ILE A  1 292 ? 14.960  -65.586 29.963  1.00 202.64 ? 291 ILE A HA     1 
ATOM   4405  H  HB     . ILE A  1 292 ? 15.994  -66.789 32.280  1.00 198.26 ? 291 ILE A HB     1 
ATOM   4406  H  HG12   . ILE A  1 292 ? 17.432  -65.020 30.651  1.00 196.33 ? 291 ILE A HG12   1 
ATOM   4407  H  HG13   . ILE A  1 292 ? 16.272  -64.428 31.558  1.00 196.33 ? 291 ILE A HG13   1 
ATOM   4408  H  HG21   . ILE A  1 292 ? 17.863  -67.599 31.145  1.00 212.34 ? 291 ILE A HG21   1 
ATOM   4409  H  HG22   . ILE A  1 292 ? 16.570  -68.337 30.640  1.00 212.34 ? 291 ILE A HG22   1 
ATOM   4410  H  HG23   . ILE A  1 292 ? 17.212  -67.192 29.773  1.00 212.34 ? 291 ILE A HG23   1 
ATOM   4411  H  HD11   . ILE A  1 292 ? 18.300  -64.196 32.612  1.00 195.69 ? 291 ILE A HD11   1 
ATOM   4412  H  HD12   . ILE A  1 292 ? 17.379  -65.163 33.442  1.00 195.69 ? 291 ILE A HD12   1 
ATOM   4413  H  HD13   . ILE A  1 292 ? 18.528  -65.751 32.544  1.00 195.69 ? 291 ILE A HD13   1 
ATOM   4414  N  N      . THR A  1 293 ? 13.804  -68.472 30.691  1.00 182.79 ? 292 THR A N      1 
ATOM   4415  C  CA     . THR A  1 293 ? 13.379  -69.753 30.140  1.00 178.44 ? 292 THR A CA     1 
ATOM   4416  C  C      . THR A  1 293 ? 12.311  -69.548 29.071  1.00 179.51 ? 292 THR A C      1 
ATOM   4417  O  O      . THR A  1 293 ? 12.340  -70.191 28.021  1.00 171.33 ? 292 THR A O      1 
ATOM   4418  C  CB     . THR A  1 293 ? 12.821  -70.682 31.235  1.00 175.62 ? 292 THR A CB     1 
ATOM   4419  O  OG1    . THR A  1 293 ? 13.848  -70.974 32.190  1.00 183.79 ? 292 THR A OG1    1 
ATOM   4420  C  CG2    . THR A  1 293 ? 12.320  -71.985 30.630  1.00 168.75 ? 292 THR A CG2    1 
ATOM   4421  H  H      . THR A  1 293 ? 13.607  -68.365 31.521  1.00 219.35 ? 292 THR A H      1 
ATOM   4422  H  HA     . THR A  1 293 ? 14.147  -70.197 29.725  1.00 214.12 ? 292 THR A HA     1 
ATOM   4423  H  HB     . THR A  1 293 ? 12.079  -70.246 31.682  1.00 210.74 ? 292 THR A HB     1 
ATOM   4424  H  HG1    . THR A  1 293 ? 14.114  -70.280 32.537  1.00 220.55 ? 292 THR A HG1    1 
ATOM   4425  H  HG21   . THR A  1 293 ? 11.975  -72.556 31.320  1.00 202.49 ? 292 THR A HG21   1 
ATOM   4426  H  HG22   . THR A  1 293 ? 11.622  -71.806 29.995  1.00 202.49 ? 292 THR A HG22   1 
ATOM   4427  H  HG23   . THR A  1 293 ? 13.040  -72.437 30.182  1.00 202.49 ? 292 THR A HG23   1 
ATOM   4428  N  N      . GLU A  1 294 ? 11.370  -68.649 29.344  1.00 178.10 ? 293 GLU A N      1 
ATOM   4429  C  CA     . GLU A  1 294 ? 10.310  -68.338 28.392  1.00 173.04 ? 293 GLU A CA     1 
ATOM   4430  C  C      . GLU A  1 294 ? 10.910  -67.788 27.106  1.00 184.28 ? 293 GLU A C      1 
ATOM   4431  O  O      . GLU A  1 294 ? 10.551  -68.215 26.010  1.00 188.44 ? 293 GLU A O      1 
ATOM   4432  C  CB     . GLU A  1 294 ? 9.337   -67.317 28.986  1.00 159.81 ? 293 GLU A CB     1 
ATOM   4433  C  CG     . GLU A  1 294 ? 8.601   -67.804 30.226  1.00 180.25 ? 293 GLU A CG     1 
ATOM   4434  C  CD     . GLU A  1 294 ? 7.750   -66.722 30.864  1.00 211.54 ? 293 GLU A CD     1 
ATOM   4435  O  OE1    . GLU A  1 294 ? 7.409   -66.859 32.059  1.00 218.17 ? 293 GLU A OE1    1 
ATOM   4436  O  OE2    . GLU A  1 294 ? 7.419   -65.737 30.171  1.00 224.15 ? 293 GLU A OE2    1 
ATOM   4437  H  H      . GLU A  1 294 ? 11.323  -68.204 30.078  1.00 213.72 ? 293 GLU A H      1 
ATOM   4438  H  HA     . GLU A  1 294 ? 9.812   -69.154 28.179  1.00 207.65 ? 293 GLU A HA     1 
ATOM   4439  H  HB2    . GLU A  1 294 ? 9.832   -66.520 29.231  1.00 191.77 ? 293 GLU A HB2    1 
ATOM   4440  H  HB3    . GLU A  1 294 ? 8.671   -67.096 28.316  1.00 191.77 ? 293 GLU A HB3    1 
ATOM   4441  H  HG2    . GLU A  1 294 ? 8.017   -68.538 29.979  1.00 216.30 ? 293 GLU A HG2    1 
ATOM   4442  H  HG3    . GLU A  1 294 ? 9.250   -68.102 30.882  1.00 216.30 ? 293 GLU A HG3    1 
ATOM   4443  N  N      . ALA A  1 295 ? 11.829  -66.840 27.250  1.00 188.27 ? 294 ALA A N      1 
ATOM   4444  C  CA     . ALA A  1 295 ? 12.484  -66.229 26.101  1.00 190.92 ? 294 ALA A CA     1 
ATOM   4445  C  C      . ALA A  1 295 ? 13.227  -67.275 25.276  1.00 190.36 ? 294 ALA A C      1 
ATOM   4446  O  O      . ALA A  1 295 ? 13.060  -67.347 24.059  1.00 193.93 ? 294 ALA A O      1 
ATOM   4447  C  CB     . ALA A  1 295 ? 13.437  -65.140 26.561  1.00 191.36 ? 294 ALA A CB     1 
ATOM   4448  H  H      . ALA A  1 295 ? 12.092  -66.530 28.008  1.00 225.92 ? 294 ALA A H      1 
ATOM   4449  H  HA     . ALA A  1 295 ? 11.805  -65.816 25.528  1.00 229.10 ? 294 ALA A HA     1 
ATOM   4450  H  HB1    . ALA A  1 295 ? 13.859  -64.749 25.791  1.00 229.63 ? 294 ALA A HB1    1 
ATOM   4451  H  HB2    . ALA A  1 295 ? 12.940  -64.470 27.037  1.00 229.63 ? 294 ALA A HB2    1 
ATOM   4452  H  HB3    . ALA A  1 295 ? 14.100  -65.527 27.136  1.00 229.63 ? 294 ALA A HB3    1 
ATOM   4453  N  N      . MET A  1 296 ? 14.043  -68.087 25.942  1.00 186.53 ? 295 MET A N      1 
ATOM   4454  C  CA     . MET A  1 296 ? 14.826  -69.110 25.258  1.00 172.41 ? 295 MET A CA     1 
ATOM   4455  C  C      . MET A  1 296 ? 13.928  -70.189 24.663  1.00 169.98 ? 295 MET A C      1 
ATOM   4456  O  O      . MET A  1 296 ? 14.209  -70.715 23.586  1.00 169.69 ? 295 MET A O      1 
ATOM   4457  C  CB     . MET A  1 296 ? 15.829  -69.749 26.220  1.00 164.16 ? 295 MET A CB     1 
ATOM   4458  C  CG     . MET A  1 296 ? 16.951  -68.822 26.650  1.00 166.30 ? 295 MET A CG     1 
ATOM   4459  S  SD     . MET A  1 296 ? 18.276  -69.686 27.516  1.00 248.88 ? 295 MET A SD     1 
ATOM   4460  C  CE     . MET A  1 296 ? 17.349  -70.589 28.755  1.00 205.64 ? 295 MET A CE     1 
ATOM   4461  H  H      . MET A  1 296 ? 14.161  -68.066 26.793  1.00 223.84 ? 295 MET A H      1 
ATOM   4462  H  HA     . MET A  1 296 ? 15.334  -68.688 24.535  1.00 206.90 ? 295 MET A HA     1 
ATOM   4463  H  HB2    . MET A  1 296 ? 15.357  -70.033 27.019  1.00 196.99 ? 295 MET A HB2    1 
ATOM   4464  H  HB3    . MET A  1 296 ? 16.230  -70.518 25.786  1.00 196.99 ? 295 MET A HB3    1 
ATOM   4465  H  HG2    . MET A  1 296 ? 17.331  -68.400 25.864  1.00 199.56 ? 295 MET A HG2    1 
ATOM   4466  H  HG3    . MET A  1 296 ? 16.592  -68.147 27.248  1.00 199.56 ? 295 MET A HG3    1 
ATOM   4467  H  HE1    . MET A  1 296 ? 17.960  -71.099 29.291  1.00 246.77 ? 295 MET A HE1    1 
ATOM   4468  H  HE2    . MET A  1 296 ? 16.873  -69.963 29.306  1.00 246.77 ? 295 MET A HE2    1 
ATOM   4469  H  HE3    . MET A  1 296 ? 16.729  -71.176 28.315  1.00 246.77 ? 295 MET A HE3    1 
ATOM   4470  N  N      . GLU A  1 297 ? 12.850  -70.517 25.369  1.00 172.36 ? 296 GLU A N      1 
ATOM   4471  C  CA     . GLU A  1 297 ? 11.907  -71.527 24.898  1.00 183.09 ? 296 GLU A CA     1 
ATOM   4472  C  C      . GLU A  1 297 ? 11.235  -71.053 23.617  1.00 178.54 ? 296 GLU A C      1 
ATOM   4473  O  O      . GLU A  1 297 ? 11.178  -71.782 22.627  1.00 183.69 ? 296 GLU A O      1 
ATOM   4474  C  CB     . GLU A  1 297 ? 10.849  -71.824 25.964  1.00 200.79 ? 296 GLU A CB     1 
ATOM   4475  C  CG     . GLU A  1 297 ? 9.853   -72.907 25.553  1.00 216.56 ? 296 GLU A CG     1 
ATOM   4476  C  CD     . GLU A  1 297 ? 8.789   -73.169 26.604  1.00 225.59 ? 296 GLU A CD     1 
ATOM   4477  O  OE1    . GLU A  1 297 ? 8.125   -72.204 27.037  1.00 237.15 ? 296 GLU A OE1    1 
ATOM   4478  O  OE2    . GLU A  1 297 ? 8.615   -74.344 26.995  1.00 214.59 ? 296 GLU A OE2    1 
ATOM   4479  H  H      . GLU A  1 297 ? 12.641  -70.169 26.126  1.00 206.83 ? 296 GLU A H      1 
ATOM   4480  H  HA     . GLU A  1 297 ? 12.391  -72.357 24.704  1.00 219.71 ? 296 GLU A HA     1 
ATOM   4481  H  HB2    . GLU A  1 297 ? 11.295  -72.121 26.773  1.00 240.95 ? 296 GLU A HB2    1 
ATOM   4482  H  HB3    . GLU A  1 297 ? 10.349  -71.012 26.143  1.00 240.95 ? 296 GLU A HB3    1 
ATOM   4483  H  HG2    . GLU A  1 297 ? 9.406   -72.631 24.738  1.00 259.87 ? 296 GLU A HG2    1 
ATOM   4484  H  HG3    . GLU A  1 297 ? 10.334  -73.736 25.402  1.00 259.87 ? 296 GLU A HG3    1 
ATOM   4485  N  N      . ILE A  1 298 ? 10.725  -69.827 23.643  1.00 173.19 ? 297 ILE A N      1 
ATOM   4486  C  CA     . ILE A  1 298 ? 10.118  -69.223 22.465  1.00 170.54 ? 297 ILE A CA     1 
ATOM   4487  C  C      . ILE A  1 298 ? 11.147  -69.154 21.342  1.00 165.40 ? 297 ILE A C      1 
ATOM   4488  O  O      . ILE A  1 298 ? 10.811  -69.309 20.168  1.00 163.19 ? 297 ILE A O      1 
ATOM   4489  C  CB     . ILE A  1 298 ? 9.593   -67.806 22.769  1.00 179.02 ? 297 ILE A CB     1 
ATOM   4490  C  CG1    . ILE A  1 298 ? 8.434   -67.872 23.767  1.00 174.17 ? 297 ILE A CG1    1 
ATOM   4491  C  CG2    . ILE A  1 298 ? 9.138   -67.117 21.489  1.00 184.37 ? 297 ILE A CG2    1 
ATOM   4492  C  CD1    . ILE A  1 298 ? 7.987   -66.520 24.282  1.00 173.68 ? 297 ILE A CD1    1 
ATOM   4493  H  H      . ILE A  1 298 ? 10.719  -69.320 24.338  1.00 207.83 ? 297 ILE A H      1 
ATOM   4494  H  HA     . ILE A  1 298 ? 9.367   -69.776 22.165  1.00 204.65 ? 297 ILE A HA     1 
ATOM   4495  H  HB     . ILE A  1 298 ? 10.311  -67.287 23.163  1.00 214.82 ? 297 ILE A HB     1 
ATOM   4496  H  HG12   . ILE A  1 298 ? 7.673   -68.290 23.335  1.00 209.00 ? 297 ILE A HG12   1 
ATOM   4497  H  HG13   . ILE A  1 298 ? 8.710   -68.403 24.531  1.00 209.00 ? 297 ILE A HG13   1 
ATOM   4498  H  HG21   . ILE A  1 298 ? 8.816   -66.238 21.705  1.00 221.24 ? 297 ILE A HG21   1 
ATOM   4499  H  HG22   . ILE A  1 298 ? 9.883   -67.054 20.887  1.00 221.24 ? 297 ILE A HG22   1 
ATOM   4500  H  HG23   . ILE A  1 298 ? 8.435   -67.634 21.089  1.00 221.24 ? 297 ILE A HG23   1 
ATOM   4501  H  HD11   . ILE A  1 298 ? 7.262   -66.645 24.899  1.00 208.41 ? 297 ILE A HD11   1 
ATOM   4502  H  HD12   . ILE A  1 298 ? 8.725   -66.096 24.726  1.00 208.41 ? 297 ILE A HD12   1 
ATOM   4503  H  HD13   . ILE A  1 298 ? 7.698   -65.984 23.541  1.00 208.41 ? 297 ILE A HD13   1 
ATOM   4504  N  N      . LYS A  1 299 ? 12.402  -68.923 21.712  1.00 163.66 ? 298 LYS A N      1 
ATOM   4505  C  CA     . LYS A  1 299 ? 13.490  -68.861 20.745  1.00 163.82 ? 298 LYS A CA     1 
ATOM   4506  C  C      . LYS A  1 299 ? 13.635  -70.209 20.047  1.00 173.25 ? 298 LYS A C      1 
ATOM   4507  O  O      . LYS A  1 299 ? 13.957  -70.275 18.861  1.00 177.27 ? 298 LYS A O      1 
ATOM   4508  C  CB     . LYS A  1 299 ? 14.800  -68.483 21.443  1.00 155.30 ? 298 LYS A CB     1 
ATOM   4509  C  CG     . LYS A  1 299 ? 15.776  -67.706 20.572  1.00 151.62 ? 298 LYS A CG     1 
ATOM   4510  C  CD     . LYS A  1 299 ? 16.915  -67.132 21.403  1.00 154.48 ? 298 LYS A CD     1 
ATOM   4511  C  CE     . LYS A  1 299 ? 17.750  -66.143 20.604  1.00 156.24 ? 298 LYS A CE     1 
ATOM   4512  N  NZ     . LYS A  1 299 ? 18.755  -65.444 21.454  1.00 150.78 ? 298 LYS A NZ     1 
ATOM   4513  H  H      . LYS A  1 299 ? 12.651  -68.799 22.526  1.00 196.39 ? 298 LYS A H      1 
ATOM   4514  H  HA     . LYS A  1 299 ? 13.290  -68.180 20.069  1.00 196.58 ? 298 LYS A HA     1 
ATOM   4515  H  HB2    . LYS A  1 299 ? 14.593  -67.934 22.215  1.00 186.36 ? 298 LYS A HB2    1 
ATOM   4516  H  HB3    . LYS A  1 299 ? 15.244  -69.296 21.730  1.00 186.36 ? 298 LYS A HB3    1 
ATOM   4517  H  HG2    . LYS A  1 299 ? 16.154  -68.300 19.904  1.00 181.94 ? 298 LYS A HG2    1 
ATOM   4518  H  HG3    . LYS A  1 299 ? 15.310  -66.972 20.143  1.00 181.94 ? 298 LYS A HG3    1 
ATOM   4519  H  HD2    . LYS A  1 299 ? 16.547  -66.668 22.171  1.00 185.37 ? 298 LYS A HD2    1 
ATOM   4520  H  HD3    . LYS A  1 299 ? 17.494  -67.854 21.693  1.00 185.37 ? 298 LYS A HD3    1 
ATOM   4521  H  HE2    . LYS A  1 299 ? 18.225  -66.620 19.905  1.00 187.49 ? 298 LYS A HE2    1 
ATOM   4522  H  HE3    . LYS A  1 299 ? 17.166  -65.474 20.215  1.00 187.49 ? 298 LYS A HE3    1 
ATOM   4523  H  HZ1    . LYS A  1 299 ? 19.227  -64.874 20.959  1.00 180.94 ? 298 LYS A HZ1    1 
ATOM   4524  H  HZ2    . LYS A  1 299 ? 18.345  -64.994 22.102  1.00 180.94 ? 298 LYS A HZ2    1 
ATOM   4525  H  HZ3    . LYS A  1 299 ? 19.309  -66.037 21.819  1.00 180.94 ? 298 LYS A HZ3    1 
ATOM   4526  N  N      . ALA A  1 300 ? 13.390  -71.282 20.794  1.00 174.62 ? 299 ALA A N      1 
ATOM   4527  C  CA     . ALA A  1 300 ? 13.451  -72.633 20.250  1.00 173.25 ? 299 ALA A CA     1 
ATOM   4528  C  C      . ALA A  1 300 ? 12.201  -72.949 19.437  1.00 176.04 ? 299 ALA A C      1 
ATOM   4529  O  O      . ALA A  1 300 ? 12.284  -73.536 18.358  1.00 177.86 ? 299 ALA A O      1 
ATOM   4530  C  CB     . ALA A  1 300 ? 13.617  -73.643 21.373  1.00 168.33 ? 299 ALA A CB     1 
ATOM   4531  H  H      . ALA A  1 300 ? 13.183  -71.252 21.628  1.00 209.55 ? 299 ALA A H      1 
ATOM   4532  H  HA     . ALA A  1 300 ? 14.228  -72.705 19.656  1.00 207.90 ? 299 ALA A HA     1 
ATOM   4533  H  HB1    . ALA A  1 300 ? 13.656  -74.525 20.995  1.00 201.99 ? 299 ALA A HB1    1 
ATOM   4534  H  HB2    . ALA A  1 300 ? 14.430  -73.453 21.846  1.00 201.99 ? 299 ALA A HB2    1 
ATOM   4535  H  HB3    . ALA A  1 300 ? 12.867  -73.574 21.968  1.00 201.99 ? 299 ALA A HB3    1 
ATOM   4536  N  N      . LYS A  1 301 ? 11.042  -72.561 19.961  1.00 177.70 ? 300 LYS A N      1 
ATOM   4537  C  CA     . LYS A  1 301 ? 9.774   -72.804 19.283  1.00 181.32 ? 300 LYS A CA     1 
ATOM   4538  C  C      . LYS A  1 301 ? 9.765   -72.131 17.915  1.00 181.30 ? 300 LYS A C      1 
ATOM   4539  O  O      . LYS A  1 301 ? 9.270   -72.696 16.941  1.00 181.26 ? 300 LYS A O      1 
ATOM   4540  C  CB     . LYS A  1 301 ? 8.609   -72.290 20.128  1.00 191.49 ? 300 LYS A CB     1 
ATOM   4541  C  CG     . LYS A  1 301 ? 7.236   -72.656 19.581  1.00 196.58 ? 300 LYS A CG     1 
ATOM   4542  C  CD     . LYS A  1 301 ? 6.125   -71.922 20.318  1.00 199.04 ? 300 LYS A CD     1 
ATOM   4543  C  CE     . LYS A  1 301 ? 6.050   -72.328 21.782  1.00 190.79 ? 300 LYS A CE     1 
ATOM   4544  N  NZ     . LYS A  1 301 ? 5.095   -71.479 22.547  1.00 176.46 ? 300 LYS A NZ     1 
ATOM   4545  H  H      . LYS A  1 301 ? 10.964  -72.153 20.714  1.00 213.24 ? 300 LYS A H      1 
ATOM   4546  H  HA     . LYS A  1 301 ? 9.657   -73.768 19.152  1.00 217.58 ? 300 LYS A HA     1 
ATOM   4547  H  HB2    . LYS A  1 301 ? 8.681   -72.664 21.020  1.00 229.78 ? 300 LYS A HB2    1 
ATOM   4548  H  HB3    . LYS A  1 301 ? 8.660   -71.322 20.174  1.00 229.78 ? 300 LYS A HB3    1 
ATOM   4549  H  HG2    . LYS A  1 301 ? 7.191   -72.413 18.643  1.00 235.89 ? 300 LYS A HG2    1 
ATOM   4550  H  HG3    . LYS A  1 301 ? 7.094   -73.609 19.687  1.00 235.89 ? 300 LYS A HG3    1 
ATOM   4551  H  HD2    . LYS A  1 301 ? 6.291   -70.967 20.276  1.00 238.84 ? 300 LYS A HD2    1 
ATOM   4552  H  HD3    . LYS A  1 301 ? 5.274   -72.131 19.902  1.00 238.84 ? 300 LYS A HD3    1 
ATOM   4553  H  HE2    . LYS A  1 301 ? 5.753   -73.249 21.843  1.00 228.95 ? 300 LYS A HE2    1 
ATOM   4554  H  HE3    . LYS A  1 301 ? 6.928   -72.233 22.184  1.00 228.95 ? 300 LYS A HE3    1 
ATOM   4555  H  HZ1    . LYS A  1 301 ? 5.072   -71.739 23.398  1.00 211.75 ? 300 LYS A HZ1    1 
ATOM   4556  H  HZ2    . LYS A  1 301 ? 5.349   -70.627 22.510  1.00 211.75 ? 300 LYS A HZ2    1 
ATOM   4557  H  HZ3    . LYS A  1 301 ? 4.279   -71.553 22.200  1.00 211.75 ? 300 LYS A HZ3    1 
ATOM   4558  N  N      . ARG A  1 302 ? 10.312  -70.920 17.848  1.00 175.85 ? 301 ARG A N      1 
ATOM   4559  C  CA     . ARG A  1 302 ? 10.428  -70.208 16.583  1.00 165.01 ? 301 ARG A CA     1 
ATOM   4560  C  C      . ARG A  1 302 ? 11.403  -70.929 15.661  1.00 173.97 ? 301 ARG A C      1 
ATOM   4561  O  O      . ARG A  1 302 ? 11.172  -71.036 14.457  1.00 179.27 ? 301 ARG A O      1 
ATOM   4562  C  CB     . ARG A  1 302 ? 10.909  -68.773 16.807  1.00 158.66 ? 301 ARG A CB     1 
ATOM   4563  C  CG     . ARG A  1 302 ? 9.881   -67.845 17.437  1.00 160.32 ? 301 ARG A CG     1 
ATOM   4564  C  CD     . ARG A  1 302 ? 10.139  -66.395 17.047  1.00 165.23 ? 301 ARG A CD     1 
ATOM   4565  N  NE     . ARG A  1 302 ? 11.552  -66.036 17.147  1.00 173.18 ? 301 ARG A NE     1 
ATOM   4566  C  CZ     . ARG A  1 302 ? 12.058  -64.862 16.780  1.00 183.29 ? 301 ARG A CZ     1 
ATOM   4567  N  NH1    . ARG A  1 302 ? 11.271  -63.916 16.284  1.00 185.96 ? 301 ARG A NH1    1 
ATOM   4568  N  NH2    . ARG A  1 302 ? 13.357  -64.632 16.908  1.00 188.79 ? 301 ARG A NH2    1 
ATOM   4569  H  H      . ARG A  1 302 ? 10.624  -70.490 18.524  1.00 211.02 ? 301 ARG A H      1 
ATOM   4570  H  HA     . ARG A  1 302 ? 9.552   -70.176 16.145  1.00 198.01 ? 301 ARG A HA     1 
ATOM   4571  H  HB2    . ARG A  1 302 ? 11.682  -68.794 17.393  1.00 190.39 ? 301 ARG A HB2    1 
ATOM   4572  H  HB3    . ARG A  1 302 ? 11.160  -68.393 15.951  1.00 190.39 ? 301 ARG A HB3    1 
ATOM   4573  H  HG2    . ARG A  1 302 ? 8.995   -68.091 17.128  1.00 192.39 ? 301 ARG A HG2    1 
ATOM   4574  H  HG3    . ARG A  1 302 ? 9.933   -67.916 18.403  1.00 192.39 ? 301 ARG A HG3    1 
ATOM   4575  H  HD2    . ARG A  1 302 ? 9.858   -66.258 16.129  1.00 198.28 ? 301 ARG A HD2    1 
ATOM   4576  H  HD3    . ARG A  1 302 ? 9.638   -65.813 17.640  1.00 198.28 ? 301 ARG A HD3    1 
ATOM   4577  H  HE     . ARG A  1 302 ? 12.094  -66.624 17.465  1.00 207.81 ? 301 ARG A HE     1 
ATOM   4578  H  HH11   . ARG A  1 302 ? 10.427  -64.060 16.198  1.00 223.16 ? 301 ARG A HH11   1 
ATOM   4579  H  HH12   . ARG A  1 302 ? 11.604  -63.159 16.048  1.00 223.16 ? 301 ARG A HH12   1 
ATOM   4580  H  HH21   . ARG A  1 302 ? 13.872  -65.241 17.230  1.00 226.55 ? 301 ARG A HH21   1 
ATOM   4581  H  HH22   . ARG A  1 302 ? 13.684  -63.873 16.672  1.00 226.55 ? 301 ARG A HH22   1 
ATOM   4582  N  N      . HIS A  1 303 ? 12.496  -71.422 16.236  1.00 178.80 ? 302 HIS A N      1 
ATOM   4583  C  CA     . HIS A  1 303 ? 13.528  -72.105 15.464  1.00 176.56 ? 302 HIS A CA     1 
ATOM   4584  C  C      . HIS A  1 303 ? 12.958  -73.326 14.749  1.00 165.63 ? 302 HIS A C      1 
ATOM   4585  O  O      . HIS A  1 303 ? 13.054  -73.440 13.527  1.00 156.95 ? 302 HIS A O      1 
ATOM   4586  C  CB     . HIS A  1 303 ? 14.684  -72.528 16.374  1.00 184.45 ? 302 HIS A CB     1 
ATOM   4587  C  CG     . HIS A  1 303 ? 15.874  -73.050 15.632  1.00 193.60 ? 302 HIS A CG     1 
ATOM   4588  N  ND1    . HIS A  1 303 ? 15.893  -74.292 15.034  1.00 193.55 ? 302 HIS A ND1    1 
ATOM   4589  C  CD2    . HIS A  1 303 ? 17.086  -72.498 15.389  1.00 202.45 ? 302 HIS A CD2    1 
ATOM   4590  C  CE1    . HIS A  1 303 ? 17.065  -74.482 14.455  1.00 197.66 ? 302 HIS A CE1    1 
ATOM   4591  N  NE2    . HIS A  1 303 ? 17.807  -73.409 14.656  1.00 203.53 ? 302 HIS A NE2    1 
ATOM   4592  H  H      . HIS A  1 303 ? 12.665  -71.373 17.077  1.00 214.56 ? 302 HIS A H      1 
ATOM   4593  H  HA     . HIS A  1 303 ? 13.881  -71.492 14.787  1.00 211.87 ? 302 HIS A HA     1 
ATOM   4594  H  HB2    . HIS A  1 303 ? 14.971  -71.759 16.892  1.00 221.34 ? 302 HIS A HB2    1 
ATOM   4595  H  HB3    . HIS A  1 303 ? 14.373  -73.228 16.969  1.00 221.34 ? 302 HIS A HB3    1 
ATOM   4596  H  HD1    . HIS A  1 303 ? 15.242  -74.855 15.037  1.00 232.26 ? 302 HIS A HD1    1 
ATOM   4597  H  HD2    . HIS A  1 303 ? 17.376  -71.659 15.667  1.00 242.94 ? 302 HIS A HD2    1 
ATOM   4598  H  HE1    . HIS A  1 303 ? 17.323  -75.243 13.987  1.00 237.19 ? 302 HIS A HE1    1 
ATOM   4599  H  HE2    . HIS A  1 303 ? 18.612  -73.298 14.374  1.00 244.24 ? 302 HIS A HE2    1 
ATOM   4600  N  N      . GLU A  1 304 ? 12.368  -74.237 15.515  1.00 172.71 ? 303 GLU A N      1 
ATOM   4601  C  CA     . GLU A  1 304 ? 11.800  -75.456 14.950  1.00 180.45 ? 303 GLU A CA     1 
ATOM   4602  C  C      . GLU A  1 304 ? 10.613  -75.143 14.044  1.00 182.94 ? 303 GLU A C      1 
ATOM   4603  O  O      . GLU A  1 304 ? 10.468  -75.728 12.971  1.00 181.22 ? 303 GLU A O      1 
ATOM   4604  C  CB     . GLU A  1 304 ? 11.370  -76.419 16.061  1.00 182.85 ? 303 GLU A CB     1 
ATOM   4605  C  CG     . GLU A  1 304 ? 10.258  -75.896 16.960  1.00 188.57 ? 303 GLU A CG     1 
ATOM   4606  C  CD     . GLU A  1 304 ? 9.794   -76.931 17.966  1.00 189.84 ? 303 GLU A CD     1 
ATOM   4607  O  OE1    . GLU A  1 304 ? 10.246  -78.092 17.876  1.00 173.59 ? 303 GLU A OE1    1 
ATOM   4608  O  OE2    . GLU A  1 304 ? 8.978   -76.585 18.846  1.00 201.88 ? 303 GLU A OE2    1 
ATOM   4609  H  H      . GLU A  1 304 ? 12.282  -74.173 16.369  1.00 207.25 ? 303 GLU A H      1 
ATOM   4610  H  HA     . GLU A  1 304 ? 12.483  -75.904 14.409  1.00 216.53 ? 303 GLU A HA     1 
ATOM   4611  H  HB2    . GLU A  1 304 ? 11.056  -77.241 15.653  1.00 219.42 ? 303 GLU A HB2    1 
ATOM   4612  H  HB3    . GLU A  1 304 ? 12.138  -76.606 16.623  1.00 219.42 ? 303 GLU A HB3    1 
ATOM   4613  H  HG2    . GLU A  1 304 ? 10.583  -75.124 17.449  1.00 226.28 ? 303 GLU A HG2    1 
ATOM   4614  H  HG3    . GLU A  1 304 ? 9.498   -75.647 16.411  1.00 226.28 ? 303 GLU A HG3    1 
ATOM   4615  N  N      . GLU A  1 305 ? 9.767   -74.216 14.482  1.00 184.51 ? 304 GLU A N      1 
ATOM   4616  C  CA     . GLU A  1 305 ? 8.582   -73.841 13.720  1.00 187.38 ? 304 GLU A CA     1 
ATOM   4617  C  C      . GLU A  1 305 ? 8.969   -73.265 12.363  1.00 193.52 ? 304 GLU A C      1 
ATOM   4618  O  O      . GLU A  1 305 ? 8.256   -73.446 11.378  1.00 194.02 ? 304 GLU A O      1 
ATOM   4619  C  CB     . GLU A  1 305 ? 7.748   -72.820 14.499  1.00 193.77 ? 304 GLU A CB     1 
ATOM   4620  C  CG     . GLU A  1 305 ? 6.483   -72.370 13.780  1.00 200.13 ? 304 GLU A CG     1 
ATOM   4621  C  CD     . GLU A  1 305 ? 5.709   -71.317 14.555  1.00 203.73 ? 304 GLU A CD     1 
ATOM   4622  O  OE1    . GLU A  1 305 ? 6.238   -70.810 15.566  1.00 204.97 ? 304 GLU A OE1    1 
ATOM   4623  O  OE2    . GLU A  1 305 ? 4.572   -70.996 14.151  1.00 202.74 ? 304 GLU A OE2    1 
ATOM   4624  H  H      . GLU A  1 305 ? 9.857   -73.787 15.222  1.00 221.41 ? 304 GLU A H      1 
ATOM   4625  H  HA     . GLU A  1 305 ? 8.030   -74.636 13.570  1.00 224.86 ? 304 GLU A HA     1 
ATOM   4626  H  HB2    . GLU A  1 305 ? 7.483   -73.214 15.345  1.00 232.53 ? 304 GLU A HB2    1 
ATOM   4627  H  HB3    . GLU A  1 305 ? 8.292   -72.033 14.661  1.00 232.53 ? 304 GLU A HB3    1 
ATOM   4628  H  HG2    . GLU A  1 305 ? 6.725   -71.992 12.920  1.00 240.15 ? 304 GLU A HG2    1 
ATOM   4629  H  HG3    . GLU A  1 305 ? 5.902   -73.136 13.654  1.00 240.15 ? 304 GLU A HG3    1 
ATOM   4630  N  N      . GLN A  1 306 ? 10.104  -72.575 12.317  1.00 200.54 ? 305 GLN A N      1 
ATOM   4631  C  CA     . GLN A  1 306 ? 10.549  -71.921 11.092  1.00 205.14 ? 305 GLN A CA     1 
ATOM   4632  C  C      . GLN A  1 306 ? 11.363  -72.865 10.211  1.00 206.21 ? 305 GLN A C      1 
ATOM   4633  O  O      . GLN A  1 306 ? 11.375  -72.724 8.989   1.00 207.77 ? 305 GLN A O      1 
ATOM   4634  C  CB     . GLN A  1 306 ? 11.373  -70.674 11.422  1.00 205.69 ? 305 GLN A CB     1 
ATOM   4635  C  CG     . GLN A  1 306 ? 11.788  -69.870 10.201  1.00 204.45 ? 305 GLN A CG     1 
ATOM   4636  C  CD     . GLN A  1 306 ? 12.431  -68.547 10.566  1.00 210.83 ? 305 GLN A CD     1 
ATOM   4637  O  OE1    . GLN A  1 306 ? 12.547  -68.202 11.742  1.00 207.34 ? 305 GLN A OE1    1 
ATOM   4638  N  NE2    . GLN A  1 306 ? 12.852  -67.795 9.555   1.00 217.17 ? 305 GLN A NE2    1 
ATOM   4639  H  H      . GLN A  1 306 ? 10.637  -72.470 12.984  1.00 240.65 ? 305 GLN A H      1 
ATOM   4640  H  HA     . GLN A  1 306 ? 9.763   -71.636 10.581  1.00 246.16 ? 305 GLN A HA     1 
ATOM   4641  H  HB2    . GLN A  1 306 ? 10.845  -70.094 11.993  1.00 246.83 ? 305 GLN A HB2    1 
ATOM   4642  H  HB3    . GLN A  1 306 ? 12.180  -70.947 11.886  1.00 246.83 ? 305 GLN A HB3    1 
ATOM   4643  H  HG2    . GLN A  1 306 ? 12.430  -70.384 9.687   1.00 245.34 ? 305 GLN A HG2    1 
ATOM   4644  H  HG3    . GLN A  1 306 ? 11.003  -69.684 9.662   1.00 245.34 ? 305 GLN A HG3    1 
ATOM   4645  H  HE21   . GLN A  1 306 ? 12.753  -68.069 8.745   1.00 260.61 ? 305 GLN A HE21   1 
ATOM   4646  H  HE22   . GLN A  1 306 ? 13.224  -67.035 9.709   1.00 260.61 ? 305 GLN A HE22   1 
ATOM   4647  N  N      . GLN A  1 307 ? 12.042  -73.825 10.830  1.00 205.57 ? 306 GLN A N      1 
ATOM   4648  C  CA     . GLN A  1 307 ? 12.837  -74.790 10.082  1.00 209.66 ? 306 GLN A CA     1 
ATOM   4649  C  C      . GLN A  1 307 ? 11.931  -75.780 9.356   1.00 215.43 ? 306 GLN A C      1 
ATOM   4650  O  O      . GLN A  1 307 ? 12.289  -76.305 8.302   1.00 218.31 ? 306 GLN A O      1 
ATOM   4651  C  CB     . GLN A  1 307 ? 13.799  -75.536 11.008  1.00 214.87 ? 306 GLN A CB     1 
ATOM   4652  C  CG     . GLN A  1 307 ? 14.727  -76.497 10.281  1.00 219.48 ? 306 GLN A CG     1 
ATOM   4653  C  CD     . GLN A  1 307 ? 15.780  -77.099 11.191  1.00 223.75 ? 306 GLN A CD     1 
ATOM   4654  O  OE1    . GLN A  1 307 ? 15.886  -76.736 12.363  1.00 221.62 ? 306 GLN A OE1    1 
ATOM   4655  N  NE2    . GLN A  1 307 ? 16.566  -78.025 10.654  1.00 227.09 ? 306 GLN A NE2    1 
ATOM   4656  H  H      . GLN A  1 307 ? 12.058  -73.939 11.683  1.00 246.69 ? 306 GLN A H      1 
ATOM   4657  H  HA     . GLN A  1 307 ? 13.369  -74.315 9.409   1.00 251.59 ? 306 GLN A HA     1 
ATOM   4658  H  HB2    . GLN A  1 307 ? 14.350  -74.888 11.475  1.00 257.84 ? 306 GLN A HB2    1 
ATOM   4659  H  HB3    . GLN A  1 307 ? 13.282  -76.050 11.648  1.00 257.84 ? 306 GLN A HB3    1 
ATOM   4660  H  HG2    . GLN A  1 307 ? 14.202  -77.223 9.909   1.00 263.37 ? 306 GLN A HG2    1 
ATOM   4661  H  HG3    . GLN A  1 307 ? 15.183  -76.020 9.570   1.00 263.37 ? 306 GLN A HG3    1 
ATOM   4662  H  HE21   . GLN A  1 307 ? 16.462  -78.252 9.831   1.00 272.51 ? 306 GLN A HE21   1 
ATOM   4663  H  HE22   . GLN A  1 307 ? 17.179  -78.396 11.129  1.00 272.51 ? 306 GLN A HE22   1 
ATOM   4664  N  N      . ARG A  1 308 ? 10.757  -76.031 9.927   1.00 217.60 ? 307 ARG A N      1 
ATOM   4665  C  CA     . ARG A  1 308 ? 9.781   -76.922 9.309   1.00 214.69 ? 307 ARG A CA     1 
ATOM   4666  C  C      . ARG A  1 308 ? 9.041   -76.214 8.177   1.00 215.47 ? 307 ARG A C      1 
ATOM   4667  O  O      . ARG A  1 308 ? 8.449   -76.860 7.314   1.00 221.04 ? 307 ARG A O      1 
ATOM   4668  C  CB     . ARG A  1 308 ? 8.782   -77.430 10.353  1.00 207.99 ? 307 ARG A CB     1 
ATOM   4669  C  CG     . ARG A  1 308 ? 7.727   -78.376 9.793   1.00 201.47 ? 307 ARG A CG     1 
ATOM   4670  C  CD     . ARG A  1 308 ? 6.793   -78.890 10.879  1.00 197.05 ? 307 ARG A CD     1 
ATOM   4671  N  NE     . ARG A  1 308 ? 5.787   -79.803 10.342  1.00 193.42 ? 307 ARG A NE     1 
ATOM   4672  C  CZ     . ARG A  1 308 ? 4.841   -80.391 11.068  1.00 187.68 ? 307 ARG A CZ     1 
ATOM   4673  N  NH1    . ARG A  1 308 ? 4.760   -80.170 12.373  1.00 175.62 ? 307 ARG A NH1    1 
ATOM   4674  N  NH2    . ARG A  1 308 ? 3.971   -81.206 10.486  1.00 191.95 ? 307 ARG A NH2    1 
ATOM   4675  H  H      . ARG A  1 308 ? 10.500  -75.695 10.676  1.00 261.11 ? 307 ARG A H      1 
ATOM   4676  H  HA     . ARG A  1 308 ? 10.248  -77.696 8.932   1.00 257.63 ? 307 ARG A HA     1 
ATOM   4677  H  HB2    . ARG A  1 308 ? 9.268   -77.905 11.045  1.00 249.59 ? 307 ARG A HB2    1 
ATOM   4678  H  HB3    . ARG A  1 308 ? 8.321   -76.669 10.740  1.00 249.59 ? 307 ARG A HB3    1 
ATOM   4679  H  HG2    . ARG A  1 308 ? 7.195   -77.906 9.133   1.00 241.77 ? 307 ARG A HG2    1 
ATOM   4680  H  HG3    . ARG A  1 308 ? 8.167   -79.139 9.387   1.00 241.77 ? 307 ARG A HG3    1 
ATOM   4681  H  HD2    . ARG A  1 308 ? 7.311   -79.368 11.546  1.00 236.46 ? 307 ARG A HD2    1 
ATOM   4682  H  HD3    . ARG A  1 308 ? 6.334   -78.139 11.287  1.00 236.46 ? 307 ARG A HD3    1 
ATOM   4683  H  HE     . ARG A  1 308 ? 5.808   -79.971 9.499   1.00 232.10 ? 307 ARG A HE     1 
ATOM   4684  H  HH11   . ARG A  1 308 ? 5.321   -79.643 12.755  1.00 210.75 ? 307 ARG A HH11   1 
ATOM   4685  H  HH12   . ARG A  1 308 ? 4.146   -80.554 12.837  1.00 210.75 ? 307 ARG A HH12   1 
ATOM   4686  H  HH21   . ARG A  1 308 ? 4.020   -81.352 9.640   1.00 230.33 ? 307 ARG A HH21   1 
ATOM   4687  H  HH22   . ARG A  1 308 ? 3.359   -81.587 10.954  1.00 230.33 ? 307 ARG A HH22   1 
ATOM   4688  N  N      . GLU A  1 309 ? 9.078   -74.885 8.182   1.00 210.40 ? 308 GLU A N      1 
ATOM   4689  C  CA     . GLU A  1 309 ? 8.407   -74.099 7.153   1.00 214.54 ? 308 GLU A CA     1 
ATOM   4690  C  C      . GLU A  1 309 ? 9.280   -73.935 5.911   1.00 224.50 ? 308 GLU A C      1 
ATOM   4691  O  O      . GLU A  1 309 ? 8.798   -74.056 4.785   1.00 227.32 ? 308 GLU A O      1 
ATOM   4692  C  CB     . GLU A  1 309 ? 8.014   -72.727 7.704   1.00 211.22 ? 308 GLU A CB     1 
ATOM   4693  C  CG     . GLU A  1 309 ? 6.816   -72.762 8.640   1.00 209.23 ? 308 GLU A CG     1 
ATOM   4694  C  CD     . GLU A  1 309 ? 6.501   -71.405 9.238   1.00 215.16 ? 308 GLU A CD     1 
ATOM   4695  O  OE1    . GLU A  1 309 ? 7.178   -70.422 8.870   1.00 218.20 ? 308 GLU A OE1    1 
ATOM   4696  O  OE2    . GLU A  1 309 ? 5.578   -71.322 10.076  1.00 218.31 ? 308 GLU A OE2    1 
ATOM   4697  H  H      . GLU A  1 309 ? 9.488   -74.413 8.772   1.00 252.48 ? 308 GLU A H      1 
ATOM   4698  H  HA     . GLU A  1 309 ? 7.586   -74.562 6.884   1.00 257.45 ? 308 GLU A HA     1 
ATOM   4699  H  HB2    . GLU A  1 309 ? 8.765   -72.362 8.198   1.00 253.46 ? 308 GLU A HB2    1 
ATOM   4700  H  HB3    . GLU A  1 309 ? 7.793   -72.143 6.962   1.00 253.46 ? 308 GLU A HB3    1 
ATOM   4701  H  HG2    . GLU A  1 309 ? 6.037   -73.059 8.145   1.00 251.08 ? 308 GLU A HG2    1 
ATOM   4702  H  HG3    . GLU A  1 309 ? 7.001   -73.376 9.368   1.00 251.08 ? 308 GLU A HG3    1 
ATOM   4703  N  N      . LEU A  1 310 ? 10.563  -73.660 6.121   1.00 229.18 ? 309 LEU A N      1 
ATOM   4704  C  CA     . LEU A  1 310 ? 11.501  -73.496 5.013   1.00 228.86 ? 309 LEU A CA     1 
ATOM   4705  C  C      . LEU A  1 310 ? 11.798  -74.829 4.329   1.00 228.36 ? 309 LEU A C      1 
ATOM   4706  O  O      . LEU A  1 310 ? 12.312  -74.860 3.211   1.00 234.03 ? 309 LEU A O      1 
ATOM   4707  C  CB     . LEU A  1 310 ? 12.804  -72.847 5.497   1.00 229.93 ? 309 LEU A CB     1 
ATOM   4708  C  CG     . LEU A  1 310 ? 13.587  -73.537 6.621   1.00 233.89 ? 309 LEU A CG     1 
ATOM   4709  C  CD1    . LEU A  1 310 ? 14.347  -74.761 6.127   1.00 232.72 ? 309 LEU A CD1    1 
ATOM   4710  C  CD2    . LEU A  1 310 ? 14.543  -72.549 7.274   1.00 236.07 ? 309 LEU A CD2    1 
ATOM   4711  H  H      . LEU A  1 310 ? 10.918  -73.562 6.898   1.00 275.01 ? 309 LEU A H      1 
ATOM   4712  H  HA     . LEU A  1 310 ? 11.100  -72.901 4.347   1.00 274.63 ? 309 LEU A HA     1 
ATOM   4713  H  HB2    . LEU A  1 310 ? 13.403  -72.782 4.737   1.00 275.92 ? 309 LEU A HB2    1 
ATOM   4714  H  HB3    . LEU A  1 310 ? 12.593  -71.954 5.809   1.00 275.92 ? 309 LEU A HB3    1 
ATOM   4715  H  HG     . LEU A  1 310 ? 12.960  -73.833 7.300   1.00 280.67 ? 309 LEU A HG     1 
ATOM   4716  H  HD11   . LEU A  1 310 ? 14.818  -75.154 6.864   1.00 279.27 ? 309 LEU A HD11   1 
ATOM   4717  H  HD12   . LEU A  1 310 ? 13.721  -75.391 5.763   1.00 279.27 ? 309 LEU A HD12   1 
ATOM   4718  H  HD13   . LEU A  1 310 ? 14.969  -74.488 5.448   1.00 279.27 ? 309 LEU A HD13   1 
ATOM   4719  H  HD21   . LEU A  1 310 ? 15.024  -72.997 7.974   1.00 283.28 ? 309 LEU A HD21   1 
ATOM   4720  H  HD22   . LEU A  1 310 ? 15.157  -72.224 6.611   1.00 283.28 ? 309 LEU A HD22   1 
ATOM   4721  H  HD23   . LEU A  1 310 ? 14.037  -71.819 7.639   1.00 283.28 ? 309 LEU A HD23   1 
ATOM   4722  N  N      . GLU A  1 311 ? 11.469  -75.925 5.005   1.00 221.36 ? 310 GLU A N      1 
ATOM   4723  C  CA     . GLU A  1 311 ? 11.733  -77.261 4.482   1.00 215.64 ? 310 GLU A CA     1 
ATOM   4724  C  C      . GLU A  1 311 ? 10.530  -77.819 3.725   1.00 212.27 ? 310 GLU A C      1 
ATOM   4725  O  O      . GLU A  1 311 ? 10.651  -78.798 2.988   1.00 207.93 ? 310 GLU A O      1 
ATOM   4726  C  CB     . GLU A  1 311 ? 12.108  -78.202 5.631   1.00 210.91 ? 310 GLU A CB     1 
ATOM   4727  C  CG     . GLU A  1 311 ? 12.283  -79.658 5.227   1.00 207.73 ? 310 GLU A CG     1 
ATOM   4728  C  CD     . GLU A  1 311 ? 12.672  -80.542 6.397   1.00 214.97 ? 310 GLU A CD     1 
ATOM   4729  O  OE1    . GLU A  1 311 ? 12.757  -80.026 7.532   1.00 216.98 ? 310 GLU A OE1    1 
ATOM   4730  O  OE2    . GLU A  1 311 ? 12.889  -81.753 6.184   1.00 216.10 ? 310 GLU A OE2    1 
ATOM   4731  H  H      . GLU A  1 311 ? 11.089  -75.922 5.776   1.00 265.63 ? 310 GLU A H      1 
ATOM   4732  H  HA     . GLU A  1 311 ? 12.491  -77.219 3.862   1.00 258.76 ? 310 GLU A HA     1 
ATOM   4733  H  HB2    . GLU A  1 311 ? 12.946  -77.901 6.016   1.00 253.09 ? 310 GLU A HB2    1 
ATOM   4734  H  HB3    . GLU A  1 311 ? 11.409  -78.165 6.302   1.00 253.09 ? 310 GLU A HB3    1 
ATOM   4735  H  HG2    . GLU A  1 311 ? 11.446  -79.989 4.865   1.00 249.27 ? 310 GLU A HG2    1 
ATOM   4736  H  HG3    . GLU A  1 311 ? 12.983  -79.720 4.558   1.00 249.27 ? 310 GLU A HG3    1 
ATOM   4737  N  N      . GLU A  1 312 ? 9.372   -77.190 3.900   1.00 211.95 ? 311 GLU A N      1 
ATOM   4738  C  CA     . GLU A  1 312 ? 8.131   -77.702 3.327   1.00 208.96 ? 311 GLU A CA     1 
ATOM   4739  C  C      . GLU A  1 312 ? 7.792   -77.083 1.973   1.00 206.84 ? 311 GLU A C      1 
ATOM   4740  O  O      . GLU A  1 312 ? 7.775   -77.776 0.956   1.00 205.29 ? 311 GLU A O      1 
ATOM   4741  C  CB     . GLU A  1 312 ? 6.973   -77.485 4.304   1.00 210.60 ? 311 GLU A CB     1 
ATOM   4742  C  CG     . GLU A  1 312 ? 6.911   -78.514 5.422   1.00 215.69 ? 311 GLU A CG     1 
ATOM   4743  C  CD     . GLU A  1 312 ? 5.865   -78.179 6.467   1.00 221.97 ? 311 GLU A CD     1 
ATOM   4744  O  OE1    . GLU A  1 312 ? 5.258   -77.091 6.375   1.00 230.14 ? 311 GLU A OE1    1 
ATOM   4745  O  OE2    . GLU A  1 312 ? 5.648   -79.004 7.380   1.00 217.06 ? 311 GLU A OE2    1 
ATOM   4746  H  H      . GLU A  1 312 ? 9.278   -76.461 4.347   1.00 254.34 ? 311 GLU A H      1 
ATOM   4747  H  HA     . GLU A  1 312 ? 8.227   -78.668 3.193   1.00 250.76 ? 311 GLU A HA     1 
ATOM   4748  H  HB2    . GLU A  1 312 ? 7.068   -76.610 4.712   1.00 252.72 ? 311 GLU A HB2    1 
ATOM   4749  H  HB3    . GLU A  1 312 ? 6.138   -77.530 3.813   1.00 252.72 ? 311 GLU A HB3    1 
ATOM   4750  H  HG2    . GLU A  1 312 ? 6.691   -79.380 5.044   1.00 258.83 ? 311 GLU A HG2    1 
ATOM   4751  H  HG3    . GLU A  1 312 ? 7.774   -78.554 5.863   1.00 258.83 ? 311 GLU A HG3    1 
ATOM   4752  N  N      . GLU A  1 313 ? 7.529   -75.779 1.958   1.00 209.74 ? 312 GLU A N      1 
ATOM   4753  C  CA     . GLU A  1 313 ? 7.050   -75.113 0.750   1.00 214.99 ? 312 GLU A CA     1 
ATOM   4754  C  C      . GLU A  1 313 ? 8.177   -74.706 -0.198  1.00 235.15 ? 312 GLU A C      1 
ATOM   4755  O  O      . GLU A  1 313 ? 8.025   -73.768 -0.981  1.00 220.96 ? 312 GLU A O      1 
ATOM   4756  C  CB     . GLU A  1 313 ? 6.218   -73.882 1.119   1.00 204.50 ? 312 GLU A CB     1 
ATOM   4757  C  CG     . GLU A  1 313 ? 4.979   -74.199 1.945   1.00 197.60 ? 312 GLU A CG     1 
ATOM   4758  C  CD     . GLU A  1 313 ? 4.128   -72.975 2.221   1.00 195.24 ? 312 GLU A CD     1 
ATOM   4759  O  OE1    . GLU A  1 313 ? 4.491   -71.876 1.751   1.00 187.27 ? 312 GLU A OE1    1 
ATOM   4760  O  OE2    . GLU A  1 313 ? 3.095   -73.114 2.910   1.00 198.66 ? 312 GLU A OE2    1 
ATOM   4761  H  H      . GLU A  1 313 ? 7.621   -75.257 2.635   1.00 251.69 ? 312 GLU A H      1 
ATOM   4762  H  HA     . GLU A  1 313 ? 6.465   -75.731 0.264   1.00 257.99 ? 312 GLU A HA     1 
ATOM   4763  H  HB2    . GLU A  1 313 ? 6.771   -73.275 1.637   1.00 245.40 ? 312 GLU A HB2    1 
ATOM   4764  H  HB3    . GLU A  1 313 ? 5.927   -73.446 0.303   1.00 245.40 ? 312 GLU A HB3    1 
ATOM   4765  H  HG2    . GLU A  1 313 ? 4.434   -74.841 1.462   1.00 237.12 ? 312 GLU A HG2    1 
ATOM   4766  H  HG3    . GLU A  1 313 ? 5.254   -74.572 2.797   1.00 237.12 ? 312 GLU A HG3    1 
ATOM   4767  N  N      . GLU A  1 314 ? 9.304   -75.409 -0.133  1.00 142.10 ? 313 GLU A N      1 
ATOM   4768  C  CA     . GLU A  1 314 ? 10.411  -75.141 -1.044  1.00 154.35 ? 313 GLU A CA     1 
ATOM   4769  C  C      . GLU A  1 314 ? 10.007  -75.476 -2.477  1.00 140.88 ? 313 GLU A C      1 
ATOM   4770  O  O      . GLU A  1 314 ? 10.771  -76.086 -3.224  1.00 262.30 ? 313 GLU A O      1 
ATOM   4771  C  CB     . GLU A  1 314 ? 11.654  -75.942 -0.640  1.00 165.91 ? 313 GLU A CB     1 
ATOM   4772  C  CG     . GLU A  1 314 ? 11.441  -77.450 -0.601  1.00 170.07 ? 313 GLU A CG     1 
ATOM   4773  C  CD     . GLU A  1 314 ? 12.709  -78.217 -0.280  1.00 169.83 ? 313 GLU A CD     1 
ATOM   4774  O  OE1    . GLU A  1 314 ? 13.784  -77.586 -0.202  1.00 169.98 ? 313 GLU A OE1    1 
ATOM   4775  O  OE2    . GLU A  1 314 ? 12.631  -79.452 -0.102  1.00 167.73 ? 313 GLU A OE2    1 
ATOM   4776  H  H      . GLU A  1 314 ? 9.451   -76.044 0.427   1.00 170.52 ? 313 GLU A H      1 
ATOM   4777  H  HA     . GLU A  1 314 ? 10.636  -74.188 -1.006  1.00 185.22 ? 313 GLU A HA     1 
ATOM   4778  H  HB2    . GLU A  1 314 ? 12.362  -75.761 -1.278  1.00 199.09 ? 313 GLU A HB2    1 
ATOM   4779  H  HB3    . GLU A  1 314 ? 11.931  -75.660 0.245   1.00 199.09 ? 313 GLU A HB3    1 
ATOM   4780  H  HG2    . GLU A  1 314 ? 10.784  -77.659 0.081   1.00 204.08 ? 313 GLU A HG2    1 
ATOM   4781  H  HG3    . GLU A  1 314 ? 11.123  -77.747 -1.469  1.00 204.08 ? 313 GLU A HG3    1 
ATOM   4782  N  N      . PHE A  1 324 ? 27.674  -73.670 1.086   1.00 162.89 ? 437 PHE A N      1 
ATOM   4783  C  CA     . PHE A  1 324 ? 28.576  -74.791 0.856   1.00 170.81 ? 437 PHE A CA     1 
ATOM   4784  C  C      . PHE A  1 324 ? 28.735  -75.628 2.120   1.00 184.70 ? 437 PHE A C      1 
ATOM   4785  O  O      . PHE A  1 324 ? 29.824  -76.113 2.425   1.00 183.09 ? 437 PHE A O      1 
ATOM   4786  C  CB     . PHE A  1 324 ? 29.944  -74.290 0.387   1.00 170.65 ? 437 PHE A CB     1 
ATOM   4787  C  CG     . PHE A  1 324 ? 29.954  -73.766 -1.026  1.00 174.84 ? 437 PHE A CG     1 
ATOM   4788  C  CD1    . PHE A  1 324 ? 28.771  -73.553 -1.719  1.00 173.65 ? 437 PHE A CD1    1 
ATOM   4789  C  CD2    . PHE A  1 324 ? 31.153  -73.495 -1.666  1.00 179.88 ? 437 PHE A CD2    1 
ATOM   4790  C  CE1    . PHE A  1 324 ? 28.787  -73.074 -3.018  1.00 171.26 ? 437 PHE A CE1    1 
ATOM   4791  C  CE2    . PHE A  1 324 ? 31.174  -73.018 -2.964  1.00 178.09 ? 437 PHE A CE2    1 
ATOM   4792  C  CZ     . PHE A  1 324 ? 29.990  -72.808 -3.640  1.00 172.19 ? 437 PHE A CZ     1 
ATOM   4793  H  HA     . PHE A  1 324 ? 28.204  -75.365 0.154   1.00 204.97 ? 437 PHE A HA     1 
ATOM   4794  H  HB2    . PHE A  1 324 ? 30.230  -73.570 0.972   1.00 204.78 ? 437 PHE A HB2    1 
ATOM   4795  H  HB3    . PHE A  1 324 ? 30.578  -75.023 0.435   1.00 204.78 ? 437 PHE A HB3    1 
ATOM   4796  H  HD1    . PHE A  1 324 ? 27.957  -73.731 -1.305  1.00 208.38 ? 437 PHE A HD1    1 
ATOM   4797  H  HD2    . PHE A  1 324 ? 31.955  -73.634 -1.215  1.00 215.86 ? 437 PHE A HD2    1 
ATOM   4798  H  HE1    . PHE A  1 324 ? 27.988  -72.934 -3.472  1.00 205.52 ? 437 PHE A HE1    1 
ATOM   4799  H  HE2    . PHE A  1 324 ? 31.985  -72.838 -3.381  1.00 213.70 ? 437 PHE A HE2    1 
ATOM   4800  H  HZ     . PHE A  1 324 ? 30.002  -72.487 -4.512  1.00 206.63 ? 437 PHE A HZ     1 
ATOM   4801  N  N      . ASP A  1 325 ? 27.640  -75.798 2.851   1.00 202.25 ? 438 ASP A N      1 
ATOM   4802  C  CA     . ASP A  1 325 ? 27.649  -76.587 4.077   1.00 222.28 ? 438 ASP A CA     1 
ATOM   4803  C  C      . ASP A  1 325 ? 26.431  -77.498 4.138   1.00 219.91 ? 438 ASP A C      1 
ATOM   4804  O  O      . ASP A  1 325 ? 26.552  -78.697 4.386   1.00 223.05 ? 438 ASP A O      1 
ATOM   4805  C  CB     . ASP A  1 325 ? 27.683  -75.673 5.304   1.00 240.17 ? 438 ASP A CB     1 
ATOM   4806  C  CG     . ASP A  1 325 ? 29.042  -75.035 5.515   1.00 255.18 ? 438 ASP A CG     1 
ATOM   4807  O  OD1    . ASP A  1 325 ? 29.901  -75.667 6.166   1.00 261.71 ? 438 ASP A OD1    1 
ATOM   4808  O  OD2    . ASP A  1 325 ? 29.253  -73.904 5.028   1.00 260.83 ? 438 ASP A OD2    1 
ATOM   4809  H  H      . ASP A  1 325 ? 26.872  -75.463 2.657   1.00 242.69 ? 438 ASP A H      1 
ATOM   4810  H  HA     . ASP A  1 325 ? 28.452  -77.149 4.092   1.00 266.74 ? 438 ASP A HA     1 
ATOM   4811  H  HB2    . ASP A  1 325 ? 27.032  -74.963 5.189   1.00 288.20 ? 438 ASP A HB2    1 
ATOM   4812  H  HB3    . ASP A  1 325 ? 27.470  -76.194 6.094   1.00 288.20 ? 438 ASP A HB3    1 
ATOM   4813  N  N      . PHE A  1 326 ? 25.257  -76.922 3.911   1.00 210.13 ? 439 PHE A N      1 
ATOM   4814  C  CA     . PHE A  1 326 ? 24.017  -77.684 3.931   1.00 198.07 ? 439 PHE A CA     1 
ATOM   4815  C  C      . PHE A  1 326 ? 24.061  -78.849 2.942   1.00 207.38 ? 439 PHE A C      1 
ATOM   4816  O  O      . PHE A  1 326 ? 23.479  -79.901 3.196   1.00 220.39 ? 439 PHE A O      1 
ATOM   4817  C  CB     . PHE A  1 326 ? 22.814  -76.774 3.650   1.00 177.09 ? 439 PHE A CB     1 
ATOM   4818  C  CG     . PHE A  1 326 ? 22.871  -76.069 2.320   1.00 156.97 ? 439 PHE A CG     1 
ATOM   4819  C  CD1    . PHE A  1 326 ? 22.252  -76.614 1.209   1.00 157.82 ? 439 PHE A CD1    1 
ATOM   4820  C  CD2    . PHE A  1 326 ? 23.526  -74.855 2.186   1.00 148.22 ? 439 PHE A CD2    1 
ATOM   4821  C  CE1    . PHE A  1 326 ? 22.294  -75.968 -0.011  1.00 163.26 ? 439 PHE A CE1    1 
ATOM   4822  C  CE2    . PHE A  1 326 ? 23.572  -74.207 0.968   1.00 117.90 ? 439 PHE A CE2    1 
ATOM   4823  C  CZ     . PHE A  1 326 ? 22.955  -74.764 -0.131  1.00 166.51 ? 439 PHE A CZ     1 
ATOM   4824  H  H      . PHE A  1 326 ? 25.151  -76.085 3.741   1.00 252.16 ? 439 PHE A H      1 
ATOM   4825  H  HA     . PHE A  1 326 ? 23.898  -78.062 4.827   1.00 237.68 ? 439 PHE A HA     1 
ATOM   4826  H  HB2    . PHE A  1 326 ? 22.007  -77.311 3.665   1.00 212.50 ? 439 PHE A HB2    1 
ATOM   4827  H  HB3    . PHE A  1 326 ? 22.769  -76.095 4.342   1.00 212.50 ? 439 PHE A HB3    1 
ATOM   4828  H  HD1    . PHE A  1 326 ? 21.805  -77.427 1.283   1.00 189.39 ? 439 PHE A HD1    1 
ATOM   4829  H  HD2    . PHE A  1 326 ? 23.944  -74.475 2.924   1.00 177.86 ? 439 PHE A HD2    1 
ATOM   4830  H  HE1    . PHE A  1 326 ? 21.878  -76.346 -0.752  1.00 195.91 ? 439 PHE A HE1    1 
ATOM   4831  H  HE2    . PHE A  1 326 ? 24.017  -73.394 0.889   1.00 141.48 ? 439 PHE A HE2    1 
ATOM   4832  H  HZ     . PHE A  1 326 ? 22.985  -74.328 -0.952  1.00 199.81 ? 439 PHE A HZ     1 
ATOM   4833  N  N      . LEU A  1 327 ? 24.765  -78.667 1.828   1.00 194.64 ? 440 LEU A N      1 
ATOM   4834  C  CA     . LEU A  1 327 ? 24.882  -79.720 0.821   1.00 174.98 ? 440 LEU A CA     1 
ATOM   4835  C  C      . LEU A  1 327 ? 25.772  -80.862 1.302   1.00 177.11 ? 440 LEU A C      1 
ATOM   4836  O  O      . LEU A  1 327 ? 25.549  -82.023 0.957   1.00 175.58 ? 440 LEU A O      1 
ATOM   4837  C  CB     . LEU A  1 327 ? 25.425  -79.152 -0.491  1.00 163.41 ? 440 LEU A CB     1 
ATOM   4838  C  CG     . LEU A  1 327 ? 24.498  -78.177 -1.220  1.00 150.37 ? 440 LEU A CG     1 
ATOM   4839  C  CD1    . LEU A  1 327 ? 25.057  -77.833 -2.592  1.00 136.80 ? 440 LEU A CD1    1 
ATOM   4840  C  CD2    . LEU A  1 327 ? 23.095  -78.754 -1.341  1.00 152.65 ? 440 LEU A CD2    1 
ATOM   4841  H  H      . LEU A  1 327 ? 25.185  -77.943 1.630   1.00 233.57 ? 440 LEU A H      1 
ATOM   4842  H  HA     . LEU A  1 327 ? 23.991  -80.088 0.644   1.00 209.98 ? 440 LEU A HA     1 
ATOM   4843  H  HB2    . LEU A  1 327 ? 26.251  -78.681 -0.302  1.00 196.09 ? 440 LEU A HB2    1 
ATOM   4844  H  HB3    . LEU A  1 327 ? 25.603  -79.890 -1.094  1.00 196.09 ? 440 LEU A HB3    1 
ATOM   4845  H  HG     . LEU A  1 327 ? 24.440  -77.356 -0.707  1.00 180.45 ? 440 LEU A HG     1 
ATOM   4846  H  HD11   . LEU A  1 327 ? 24.459  -77.221 -3.028  1.00 164.15 ? 440 LEU A HD11   1 
ATOM   4847  H  HD12   . LEU A  1 327 ? 25.920  -77.427 -2.484  1.00 164.15 ? 440 LEU A HD12   1 
ATOM   4848  H  HD13   . LEU A  1 327 ? 25.136  -78.639 -3.108  1.00 164.15 ? 440 LEU A HD13   1 
ATOM   4849  H  HD21   . LEU A  1 327 ? 22.537  -78.122 -1.802  1.00 183.18 ? 440 LEU A HD21   1 
ATOM   4850  H  HD22   . LEU A  1 327 ? 23.137  -79.575 -1.836  1.00 183.18 ? 440 LEU A HD22   1 
ATOM   4851  H  HD23   . LEU A  1 327 ? 22.748  -78.917 -0.462  1.00 183.18 ? 440 LEU A HD23   1 
ATOM   4852  N  N      . LYS A  1 328 ? 26.782  -80.528 2.097   1.00 186.57 ? 441 LYS A N      1 
ATOM   4853  C  CA     . LYS A  1 328 ? 27.660  -81.537 2.674   1.00 194.93 ? 441 LYS A CA     1 
ATOM   4854  C  C      . LYS A  1 328 ? 26.944  -82.258 3.814   1.00 197.74 ? 441 LYS A C      1 
ATOM   4855  O  O      . LYS A  1 328 ? 27.295  -83.384 4.166   1.00 192.04 ? 441 LYS A O      1 
ATOM   4856  C  CB     . LYS A  1 328 ? 28.948  -80.889 3.186   1.00 199.63 ? 441 LYS A CB     1 
ATOM   4857  C  CG     . LYS A  1 328 ? 30.016  -81.883 3.616   1.00 202.82 ? 441 LYS A CG     1 
ATOM   4858  C  CD     . LYS A  1 328 ? 31.306  -81.182 4.026   1.00 198.11 ? 441 LYS A CD     1 
ATOM   4859  C  CE     . LYS A  1 328 ? 31.111  -80.313 5.260   1.00 187.47 ? 441 LYS A CE     1 
ATOM   4860  N  NZ     . LYS A  1 328 ? 32.384  -79.681 5.707   1.00 177.16 ? 441 LYS A NZ     1 
ATOM   4861  H  H      . LYS A  1 328 ? 26.981  -79.721 2.318   1.00 223.88 ? 441 LYS A H      1 
ATOM   4862  H  HA     . LYS A  1 328 ? 27.895  -82.196 1.989   1.00 233.92 ? 441 LYS A HA     1 
ATOM   4863  H  HB2    . LYS A  1 328 ? 29.323  -80.341 2.479   1.00 239.55 ? 441 LYS A HB2    1 
ATOM   4864  H  HB3    . LYS A  1 328 ? 28.735  -80.335 3.953   1.00 239.55 ? 441 LYS A HB3    1 
ATOM   4865  H  HG2    . LYS A  1 328 ? 29.692  -82.390 4.377   1.00 243.38 ? 441 LYS A HG2    1 
ATOM   4866  H  HG3    . LYS A  1 328 ? 30.216  -82.477 2.877   1.00 243.38 ? 441 LYS A HG3    1 
ATOM   4867  H  HD2    . LYS A  1 328 ? 31.980  -81.849 4.229   1.00 237.73 ? 441 LYS A HD2    1 
ATOM   4868  H  HD3    . LYS A  1 328 ? 31.604  -80.613 3.299   1.00 237.73 ? 441 LYS A HD3    1 
ATOM   4869  H  HE2    . LYS A  1 328 ? 30.478  -79.606 5.055   1.00 224.96 ? 441 LYS A HE2    1 
ATOM   4870  H  HE3    . LYS A  1 328 ? 30.775  -80.861 5.986   1.00 224.96 ? 441 LYS A HE3    1 
ATOM   4871  H  HZ1    . LYS A  1 328 ? 32.238  -79.181 6.428   1.00 212.60 ? 441 LYS A HZ1    1 
ATOM   4872  H  HZ2    . LYS A  1 328 ? 32.981  -80.310 5.907   1.00 212.60 ? 441 LYS A HZ2    1 
ATOM   4873  H  HZ3    . LYS A  1 328 ? 32.711  -79.166 5.059   1.00 212.60 ? 441 LYS A HZ3    1 
ATOM   4874  N  N      . ASN A  1 329 ? 25.936  -81.600 4.381   1.00 205.04 ? 442 ASN A N      1 
ATOM   4875  C  CA     . ASN A  1 329 ? 25.156  -82.163 5.477   1.00 211.53 ? 442 ASN A CA     1 
ATOM   4876  C  C      . ASN A  1 329 ? 23.780  -82.647 5.021   1.00 206.44 ? 442 ASN A C      1 
ATOM   4877  O  O      . ASN A  1 329 ? 22.936  -83.000 5.846   1.00 210.66 ? 442 ASN A O      1 
ATOM   4878  C  CB     . ASN A  1 329 ? 24.987  -81.117 6.584   1.00 223.37 ? 442 ASN A CB     1 
ATOM   4879  C  CG     . ASN A  1 329 ? 25.646  -81.528 7.888   1.00 235.01 ? 442 ASN A CG     1 
ATOM   4880  O  OD1    . ASN A  1 329 ? 26.545  -82.370 7.909   1.00 241.81 ? 442 ASN A OD1    1 
ATOM   4881  N  ND2    . ASN A  1 329 ? 25.202  -80.927 8.987   1.00 235.83 ? 442 ASN A ND2    1 
ATOM   4882  H  H      . ASN A  1 329 ? 25.682  -80.813 4.144   1.00 246.05 ? 442 ASN A H      1 
ATOM   4883  H  HA     . ASN A  1 329 ? 25.638  -82.929 5.853   1.00 253.84 ? 442 ASN A HA     1 
ATOM   4884  H  HB2    . ASN A  1 329 ? 25.389  -80.283 6.294   1.00 268.04 ? 442 ASN A HB2    1 
ATOM   4885  H  HB3    . ASN A  1 329 ? 24.041  -80.988 6.754   1.00 268.04 ? 442 ASN A HB3    1 
ATOM   4886  H  HD21   . ASN A  1 329 ? 24.575  -80.342 8.933   1.00 282.99 ? 442 ASN A HD21   1 
ATOM   4887  H  HD22   . ASN A  1 329 ? 25.543  -81.124 9.752   1.00 282.99 ? 442 ASN A HD22   1 
ATOM   4888  N  N      . LEU A  1 330 ? 23.557  -82.664 3.710   1.00 194.89 ? 443 LEU A N      1 
ATOM   4889  C  CA     . LEU A  1 330 ? 22.259  -83.047 3.159   1.00 187.42 ? 443 LEU A CA     1 
ATOM   4890  C  C      . LEU A  1 330 ? 22.264  -84.492 2.675   1.00 188.40 ? 443 LEU A C      1 
ATOM   4891  O  O      . LEU A  1 330 ? 23.318  -85.053 2.372   1.00 190.67 ? 443 LEU A O      1 
ATOM   4892  C  CB     . LEU A  1 330 ? 21.877  -82.119 2.004   1.00 178.60 ? 443 LEU A CB     1 
ATOM   4893  C  CG     . LEU A  1 330 ? 20.491  -82.314 1.388   1.00 173.43 ? 443 LEU A CG     1 
ATOM   4894  C  CD1    . LEU A  1 330 ? 19.405  -82.065 2.422   1.00 176.78 ? 443 LEU A CD1    1 
ATOM   4895  C  CD2    . LEU A  1 330 ? 20.312  -81.390 0.194   1.00 170.69 ? 443 LEU A CD2    1 
ATOM   4896  H  H      . LEU A  1 330 ? 24.143  -82.458 3.115   1.00 233.87 ? 443 LEU A H      1 
ATOM   4897  H  HA     . LEU A  1 330 ? 21.577  -82.962 3.857   1.00 224.90 ? 443 LEU A HA     1 
ATOM   4898  H  HB2    . LEU A  1 330 ? 21.921  -81.205 2.325   1.00 214.32 ? 443 LEU A HB2    1 
ATOM   4899  H  HB3    . LEU A  1 330 ? 22.526  -82.239 1.293   1.00 214.32 ? 443 LEU A HB3    1 
ATOM   4900  H  HG     . LEU A  1 330 ? 20.407  -83.229 1.076   1.00 208.12 ? 443 LEU A HG     1 
ATOM   4901  H  HD11   . LEU A  1 330 ? 18.547  -82.194 2.011   1.00 212.14 ? 443 LEU A HD11   1 
ATOM   4902  H  HD12   . LEU A  1 330 ? 19.517  -82.684 3.147   1.00 212.14 ? 443 LEU A HD12   1 
ATOM   4903  H  HD13   . LEU A  1 330 ? 19.482  -81.164 2.744   1.00 212.14 ? 443 LEU A HD13   1 
ATOM   4904  H  HD21   . LEU A  1 330 ? 19.438  -81.527 -0.178  1.00 204.83 ? 443 LEU A HD21   1 
ATOM   4905  H  HD22   . LEU A  1 330 ? 20.405  -80.480 0.488   1.00 204.83 ? 443 LEU A HD22   1 
ATOM   4906  H  HD23   . LEU A  1 330 ? 20.984  -81.592 -0.461  1.00 204.83 ? 443 LEU A HD23   1 
ATOM   4907  N  N      . SER A  1 331 ? 21.077  -85.086 2.602   1.00 188.00 ? 444 SER A N      1 
ATOM   4908  C  CA     . SER A  1 331 ? 20.931  -86.462 2.144   1.00 192.85 ? 444 SER A CA     1 
ATOM   4909  C  C      . SER A  1 331 ? 20.807  -86.515 0.627   1.00 180.98 ? 444 SER A C      1 
ATOM   4910  O  O      . SER A  1 331 ? 20.555  -85.501 -0.022  1.00 180.86 ? 444 SER A O      1 
ATOM   4911  C  CB     . SER A  1 331 ? 19.706  -87.107 2.792   1.00 208.40 ? 444 SER A CB     1 
ATOM   4912  O  OG     . SER A  1 331 ? 18.535  -86.358 2.523   1.00 217.57 ? 444 SER A OG     1 
ATOM   4913  H  H      . SER A  1 331 ? 20.334  -84.709 2.815   1.00 225.60 ? 444 SER A H      1 
ATOM   4914  H  HA     . SER A  1 331 ? 21.724  -86.975 2.406   1.00 231.42 ? 444 SER A HA     1 
ATOM   4915  H  HB2    . SER A  1 331 ? 19.596  -88.003 2.435   1.00 250.08 ? 444 SER A HB2    1 
ATOM   4916  H  HB3    . SER A  1 331 ? 19.841  -87.148 3.751   1.00 250.08 ? 444 SER A HB3    1 
ATOM   4917  H  HG     . SER A  1 331 ? 17.886  -86.715 2.875   1.00 261.09 ? 444 SER A HG     1 
ATOM   4918  N  N      . LEU A  1 332 ? 20.979  -87.708 0.068   1.00 181.75 ? 445 LEU A N      1 
ATOM   4919  C  CA     . LEU A  1 332 ? 20.973  -87.892 -1.379  1.00 187.40 ? 445 LEU A CA     1 
ATOM   4920  C  C      . LEU A  1 332 ? 19.612  -87.602 -2.007  1.00 192.33 ? 445 LEU A C      1 
ATOM   4921  O  O      . LEU A  1 332 ? 19.536  -87.023 -3.089  1.00 195.02 ? 445 LEU A O      1 
ATOM   4922  C  CB     . LEU A  1 332 ? 21.415  -89.318 -1.727  1.00 185.59 ? 445 LEU A CB     1 
ATOM   4923  C  CG     . LEU A  1 332 ? 21.328  -89.739 -3.197  1.00 176.50 ? 445 LEU A CG     1 
ATOM   4924  C  CD1    . LEU A  1 332 ? 22.391  -90.780 -3.511  1.00 178.38 ? 445 LEU A CD1    1 
ATOM   4925  C  CD2    . LEU A  1 332 ? 19.947  -90.289 -3.530  1.00 174.64 ? 445 LEU A CD2    1 
ATOM   4926  H  H      . LEU A  1 332 ? 21.102  -88.434 0.511   1.00 218.10 ? 445 LEU A H      1 
ATOM   4927  H  HA     . LEU A  1 332 ? 21.621  -87.274 -1.776  1.00 224.88 ? 445 LEU A HA     1 
ATOM   4928  H  HB2    . LEU A  1 332 ? 22.341  -89.420 -1.456  1.00 222.71 ? 445 LEU A HB2    1 
ATOM   4929  H  HB3    . LEU A  1 332 ? 20.865  -89.935 -1.221  1.00 222.71 ? 445 LEU A HB3    1 
ATOM   4930  H  HG     . LEU A  1 332 ? 21.488  -88.965 -3.759  1.00 211.80 ? 445 LEU A HG     1 
ATOM   4931  H  HD11   . LEU A  1 332 ? 22.319  -91.030 -4.436  1.00 214.05 ? 445 LEU A HD11   1 
ATOM   4932  H  HD12   . LEU A  1 332 ? 23.257  -90.404 -3.340  1.00 214.05 ? 445 LEU A HD12   1 
ATOM   4933  H  HD13   . LEU A  1 332 ? 22.251  -91.548 -2.952  1.00 214.05 ? 445 LEU A HD13   1 
ATOM   4934  H  HD21   . LEU A  1 332 ? 19.928  -90.543 -4.456  1.00 209.57 ? 445 LEU A HD21   1 
ATOM   4935  H  HD22   . LEU A  1 332 ? 19.774  -91.055 -2.977  1.00 209.57 ? 445 LEU A HD22   1 
ATOM   4936  H  HD23   . LEU A  1 332 ? 19.291  -89.609 -3.363  1.00 209.57 ? 445 LEU A HD23   1 
ATOM   4937  N  N      . GLU A  1 333 ? 18.540  -88.005 -1.333  1.00 197.27 ? 446 GLU A N      1 
ATOM   4938  C  CA     . GLU A  1 333 ? 17.202  -87.892 -1.907  1.00 202.07 ? 446 GLU A CA     1 
ATOM   4939  C  C      . GLU A  1 333 ? 16.570  -86.518 -1.688  1.00 204.84 ? 446 GLU A C      1 
ATOM   4940  O  O      . GLU A  1 333 ? 15.676  -86.120 -2.432  1.00 208.65 ? 446 GLU A O      1 
ATOM   4941  C  CB     . GLU A  1 333 ? 16.290  -88.990 -1.356  1.00 212.73 ? 446 GLU A CB     1 
ATOM   4942  C  CG     . GLU A  1 333 ? 16.607  -90.373 -1.905  1.00 217.30 ? 446 GLU A CG     1 
ATOM   4943  C  CD     . GLU A  1 333 ? 15.630  -91.429 -1.429  1.00 214.36 ? 446 GLU A CD     1 
ATOM   4944  O  OE1    . GLU A  1 333 ? 14.828  -91.130 -0.519  1.00 220.88 ? 446 GLU A OE1    1 
ATOM   4945  O  OE2    . GLU A  1 333 ? 15.662  -92.556 -1.966  1.00 203.40 ? 446 GLU A OE2    1 
ATOM   4946  H  H      . GLU A  1 333 ? 18.559  -88.346 -0.544  1.00 236.72 ? 446 GLU A H      1 
ATOM   4947  H  HA     . GLU A  1 333 ? 17.271  -88.029 -2.875  1.00 242.49 ? 446 GLU A HA     1 
ATOM   4948  H  HB2    . GLU A  1 333 ? 16.386  -89.023 -0.392  1.00 255.28 ? 446 GLU A HB2    1 
ATOM   4949  H  HB3    . GLU A  1 333 ? 15.372  -88.781 -1.589  1.00 255.28 ? 446 GLU A HB3    1 
ATOM   4950  H  HG2    . GLU A  1 333 ? 16.570  -90.345 -2.874  1.00 260.76 ? 446 GLU A HG2    1 
ATOM   4951  H  HG3    . GLU A  1 333 ? 17.495  -90.633 -1.614  1.00 260.76 ? 446 GLU A HG3    1 
ATOM   4952  N  N      . GLU A  1 334 ? 17.030  -85.797 -0.671  1.00 203.50 ? 447 GLU A N      1 
ATOM   4953  C  CA     . GLU A  1 334 ? 16.576  -84.427 -0.455  1.00 194.94 ? 447 GLU A CA     1 
ATOM   4954  C  C      . GLU A  1 334 ? 17.448  -83.450 -1.237  1.00 182.36 ? 447 GLU A C      1 
ATOM   4955  O  O      . GLU A  1 334 ? 17.165  -82.254 -1.289  1.00 181.33 ? 447 GLU A O      1 
ATOM   4956  C  CB     . GLU A  1 334 ? 16.596  -84.074 1.032   1.00 192.96 ? 447 GLU A CB     1 
ATOM   4957  C  CG     . GLU A  1 334 ? 15.515  -84.768 1.843   1.00 197.26 ? 447 GLU A CG     1 
ATOM   4958  C  CD     . GLU A  1 334 ? 15.520  -84.346 3.297   1.00 196.46 ? 447 GLU A CD     1 
ATOM   4959  O  OE1    . GLU A  1 334 ? 16.415  -83.567 3.687   1.00 191.03 ? 447 GLU A OE1    1 
ATOM   4960  O  OE2    . GLU A  1 334 ? 14.627  -84.791 4.050   1.00 200.77 ? 447 GLU A OE2    1 
ATOM   4961  H  H      . GLU A  1 334 ? 17.603  -86.075 -0.094  1.00 244.20 ? 447 GLU A H      1 
ATOM   4962  H  HA     . GLU A  1 334 ? 15.654  -84.339 -0.777  1.00 233.93 ? 447 GLU A HA     1 
ATOM   4963  H  HB2    . GLU A  1 334 ? 17.455  -84.331 1.402   1.00 231.56 ? 447 GLU A HB2    1 
ATOM   4964  H  HB3    . GLU A  1 334 ? 16.470  -83.117 1.128   1.00 231.56 ? 447 GLU A HB3    1 
ATOM   4965  H  HG2    . GLU A  1 334 ? 14.648  -84.547 1.469   1.00 236.71 ? 447 GLU A HG2    1 
ATOM   4966  H  HG3    . GLU A  1 334 ? 15.658  -85.726 1.807   1.00 236.71 ? 447 GLU A HG3    1 
ATOM   4967  N  N      . LEU A  1 335 ? 18.510  -83.973 -1.841  1.00 166.87 ? 448 LEU A N      1 
ATOM   4968  C  CA     . LEU A  1 335 ? 19.414  -83.169 -2.650  1.00 142.72 ? 448 LEU A CA     1 
ATOM   4969  C  C      . LEU A  1 335 ? 19.063  -83.318 -4.127  1.00 146.92 ? 448 LEU A C      1 
ATOM   4970  O  O      . LEU A  1 335 ? 19.270  -82.402 -4.922  1.00 163.08 ? 448 LEU A O      1 
ATOM   4971  C  CB     . LEU A  1 335 ? 20.860  -83.600 -2.390  1.00 132.42 ? 448 LEU A CB     1 
ATOM   4972  C  CG     . LEU A  1 335 ? 21.971  -82.718 -2.960  1.00 140.80 ? 448 LEU A CG     1 
ATOM   4973  C  CD1    . LEU A  1 335 ? 23.208  -82.783 -2.076  1.00 143.34 ? 448 LEU A CD1    1 
ATOM   4974  C  CD2    . LEU A  1 335 ? 22.324  -83.138 -4.368  1.00 146.87 ? 448 LEU A CD2    1 
ATOM   4975  H  H      . LEU A  1 335 ? 18.729  -84.804 -1.797  1.00 200.24 ? 448 LEU A H      1 
ATOM   4976  H  HA     . LEU A  1 335 ? 19.322  -82.225 -2.402  1.00 171.27 ? 448 LEU A HA     1 
ATOM   4977  H  HB2    . LEU A  1 335 ? 20.994  -83.640 -1.431  1.00 158.90 ? 448 LEU A HB2    1 
ATOM   4978  H  HB3    . LEU A  1 335 ? 20.981  -84.486 -2.766  1.00 158.90 ? 448 LEU A HB3    1 
ATOM   4979  H  HG     . LEU A  1 335 ? 21.666  -81.797 -2.986  1.00 168.95 ? 448 LEU A HG     1 
ATOM   4980  H  HD11   . LEU A  1 335 ? 23.890  -82.222 -2.452  1.00 172.01 ? 448 LEU A HD11   1 
ATOM   4981  H  HD12   . LEU A  1 335 ? 22.979  -82.475 -1.196  1.00 172.01 ? 448 LEU A HD12   1 
ATOM   4982  H  HD13   . LEU A  1 335 ? 23.515  -83.692 -2.036  1.00 172.01 ? 448 LEU A HD13   1 
ATOM   4983  H  HD21   . LEU A  1 335 ? 23.023  -82.568 -4.698  1.00 176.24 ? 448 LEU A HD21   1 
ATOM   4984  H  HD22   . LEU A  1 335 ? 22.624  -84.050 -4.355  1.00 176.24 ? 448 LEU A HD22   1 
ATOM   4985  H  HD23   . LEU A  1 335 ? 21.545  -83.057 -4.923  1.00 176.24 ? 448 LEU A HD23   1 
ATOM   4986  N  N      . GLN A  1 336 ? 18.517  -84.476 -4.485  1.00 163.00 ? 449 GLN A N      1 
ATOM   4987  C  CA     . GLN A  1 336 ? 18.134  -84.752 -5.864  1.00 182.72 ? 449 GLN A CA     1 
ATOM   4988  C  C      . GLN A  1 336 ? 16.785  -84.131 -6.215  1.00 190.33 ? 449 GLN A C      1 
ATOM   4989  O  O      . GLN A  1 336 ? 16.527  -83.811 -7.375  1.00 185.97 ? 449 GLN A O      1 
ATOM   4990  C  CB     . GLN A  1 336 ? 18.078  -86.262 -6.107  1.00 196.39 ? 449 GLN A CB     1 
ATOM   4991  C  CG     . GLN A  1 336 ? 19.438  -86.930 -6.214  1.00 215.00 ? 449 GLN A CG     1 
ATOM   4992  C  CD     . GLN A  1 336 ? 19.336  -88.438 -6.349  1.00 233.58 ? 449 GLN A CD     1 
ATOM   4993  O  OE1    . GLN A  1 336 ? 18.262  -89.016 -6.180  1.00 238.93 ? 449 GLN A OE1    1 
ATOM   4994  N  NE2    . GLN A  1 336 ? 20.455  -89.083 -6.657  1.00 241.69 ? 449 GLN A NE2    1 
ATOM   4995  H  H      . GLN A  1 336 ? 18.356  -85.123 -3.942  1.00 195.60 ? 449 GLN A H      1 
ATOM   4996  H  HA     . GLN A  1 336 ? 18.808  -84.372 -6.465  1.00 219.26 ? 449 GLN A HA     1 
ATOM   4997  H  HB2    . GLN A  1 336 ? 17.603  -86.677 -5.370  1.00 235.66 ? 449 GLN A HB2    1 
ATOM   4998  H  HB3    . GLN A  1 336 ? 17.603  -86.425 -6.936  1.00 235.66 ? 449 GLN A HB3    1 
ATOM   4999  H  HG2    . GLN A  1 336 ? 19.898  -86.589 -6.997  1.00 258.00 ? 449 GLN A HG2    1 
ATOM   5000  H  HG3    . GLN A  1 336 ? 19.952  -86.734 -5.415  1.00 258.00 ? 449 GLN A HG3    1 
ATOM   5001  H  HE21   . GLN A  1 336 ? 21.187  -88.646 -6.770  1.00 290.03 ? 449 GLN A HE21   1 
ATOM   5002  H  HE22   . GLN A  1 336 ? 20.448  -89.939 -6.745  1.00 290.03 ? 449 GLN A HE22   1 
ATOM   5003  N  N      . MET A  1 337 ? 15.926  -83.960 -5.215  1.00 201.17 ? 450 MET A N      1 
ATOM   5004  C  CA     . MET A  1 337 ? 14.568  -83.479 -5.455  1.00 204.72 ? 450 MET A CA     1 
ATOM   5005  C  C      . MET A  1 337 ? 14.484  -81.952 -5.440  1.00 194.98 ? 450 MET A C      1 
ATOM   5006  O  O      . MET A  1 337 ? 13.558  -81.373 -6.008  1.00 195.82 ? 450 MET A O      1 
ATOM   5007  C  CB     . MET A  1 337 ? 13.603  -84.078 -4.430  1.00 210.66 ? 450 MET A CB     1 
ATOM   5008  C  CG     . MET A  1 337 ? 13.502  -85.597 -4.506  1.00 215.04 ? 450 MET A CG     1 
ATOM   5009  S  SD     . MET A  1 337 ? 12.873  -86.197 -6.088  1.00 292.57 ? 450 MET A SD     1 
ATOM   5010  C  CE     . MET A  1 337 ? 11.155  -85.701 -5.994  1.00 194.45 ? 450 MET A CE     1 
ATOM   5011  H  H      . MET A  1 337 ? 16.104  -84.115 -4.388  1.00 241.40 ? 450 MET A H      1 
ATOM   5012  H  HA     . MET A  1 337 ? 14.284  -83.792 -6.339  1.00 245.67 ? 450 MET A HA     1 
ATOM   5013  H  HB2    . MET A  1 337 ? 13.907  -83.845 -3.539  1.00 252.79 ? 450 MET A HB2    1 
ATOM   5014  H  HB3    . MET A  1 337 ? 12.717  -83.713 -4.582  1.00 252.79 ? 450 MET A HB3    1 
ATOM   5015  H  HG2    . MET A  1 337 ? 14.384  -85.978 -4.373  1.00 258.05 ? 450 MET A HG2    1 
ATOM   5016  H  HG3    . MET A  1 337 ? 12.901  -85.907 -3.810  1.00 258.05 ? 450 MET A HG3    1 
ATOM   5017  H  HE1    . MET A  1 337 ? 10.708  -85.973 -6.798  1.00 233.35 ? 450 MET A HE1    1 
ATOM   5018  H  HE2    . MET A  1 337 ? 10.749  -86.125 -5.234  1.00 233.35 ? 450 MET A HE2    1 
ATOM   5019  H  HE3    . MET A  1 337 ? 11.111  -84.747 -5.900  1.00 233.35 ? 450 MET A HE3    1 
ATOM   5020  N  N      . ARG A  1 338 ? 15.447  -81.303 -4.793  1.00 181.60 ? 451 ARG A N      1 
ATOM   5021  C  CA     . ARG A  1 338 ? 15.532  -79.846 -4.834  1.00 160.74 ? 451 ARG A CA     1 
ATOM   5022  C  C      . ARG A  1 338 ? 16.051  -79.409 -6.195  1.00 152.57 ? 451 ARG A C      1 
ATOM   5023  O  O      . ARG A  1 338 ? 15.582  -78.426 -6.767  1.00 142.04 ? 451 ARG A O      1 
ATOM   5024  C  CB     . ARG A  1 338 ? 16.455  -79.322 -3.735  1.00 147.18 ? 451 ARG A CB     1 
ATOM   5025  C  CG     . ARG A  1 338 ? 15.920  -79.526 -2.332  1.00 166.44 ? 451 ARG A CG     1 
ATOM   5026  C  CD     . ARG A  1 338 ? 16.886  -78.991 -1.289  1.00 181.53 ? 451 ARG A CD     1 
ATOM   5027  N  NE     . ARG A  1 338 ? 16.423  -79.248 0.071   1.00 199.02 ? 451 ARG A NE     1 
ATOM   5028  C  CZ     . ARG A  1 338 ? 17.064  -78.855 1.168   1.00 212.30 ? 451 ARG A CZ     1 
ATOM   5029  N  NH1    . ARG A  1 338 ? 18.202  -78.180 1.074   1.00 213.32 ? 451 ARG A NH1    1 
ATOM   5030  N  NH2    . ARG A  1 338 ? 16.564  -79.136 2.363   1.00 220.28 ? 451 ARG A NH2    1 
ATOM   5031  H  H      . ARG A  1 338 ? 16.062  -81.680 -4.326  1.00 217.92 ? 451 ARG A H      1 
ATOM   5032  H  HA     . ARG A  1 338 ? 14.640  -79.462 -4.702  1.00 192.89 ? 451 ARG A HA     1 
ATOM   5033  H  HB2    . ARG A  1 338 ? 17.307  -79.782 -3.797  1.00 176.61 ? 451 ARG A HB2    1 
ATOM   5034  H  HB3    . ARG A  1 338 ? 16.586  -78.370 -3.866  1.00 176.61 ? 451 ARG A HB3    1 
ATOM   5035  H  HG2    . ARG A  1 338 ? 15.078  -79.054 -2.237  1.00 199.73 ? 451 ARG A HG2    1 
ATOM   5036  H  HG3    . ARG A  1 338 ? 15.794  -80.474 -2.171  1.00 199.73 ? 451 ARG A HG3    1 
ATOM   5037  H  HD2    . ARG A  1 338 ? 17.747  -79.423 -1.402  1.00 217.84 ? 451 ARG A HD2    1 
ATOM   5038  H  HD3    . ARG A  1 338 ? 16.976  -78.032 -1.401  1.00 217.84 ? 451 ARG A HD3    1 
ATOM   5039  H  HE     . ARG A  1 338 ? 15.688  -79.683 0.170   1.00 238.83 ? 451 ARG A HE     1 
ATOM   5040  H  HH11   . ARG A  1 338 ? 18.530  -77.996 0.300   1.00 255.98 ? 451 ARG A HH11   1 
ATOM   5041  H  HH12   . ARG A  1 338 ? 18.613  -77.928 1.786   1.00 255.98 ? 451 ARG A HH12   1 
ATOM   5042  H  HH21   . ARG A  1 338 ? 15.827  -79.573 2.429   1.00 264.33 ? 451 ARG A HH21   1 
ATOM   5043  H  HH22   . ARG A  1 338 ? 16.978  -78.881 3.073   1.00 264.33 ? 451 ARG A HH22   1 
ATOM   5044  N  N      . LEU A  1 339 ? 17.027  -80.152 -6.707  1.00 156.64 ? 452 LEU A N      1 
ATOM   5045  C  CA     . LEU A  1 339 ? 17.602  -79.878 -8.016  1.00 156.19 ? 452 LEU A CA     1 
ATOM   5046  C  C      . LEU A  1 339 ? 16.536  -79.993 -9.099  1.00 180.51 ? 452 LEU A C      1 
ATOM   5047  O  O      . LEU A  1 339 ? 16.553  -79.252 -10.081 1.00 175.90 ? 452 LEU A O      1 
ATOM   5048  C  CB     . LEU A  1 339 ? 18.743  -80.856 -8.301  1.00 139.90 ? 452 LEU A CB     1 
ATOM   5049  C  CG     . LEU A  1 339 ? 19.527  -80.627 -9.594  1.00 130.01 ? 452 LEU A CG     1 
ATOM   5050  C  CD1    . LEU A  1 339 ? 20.174  -79.251 -9.592  1.00 145.45 ? 452 LEU A CD1    1 
ATOM   5051  C  CD2    . LEU A  1 339 ? 20.576  -81.712 -9.780  1.00 124.69 ? 452 LEU A CD2    1 
ATOM   5052  H  H      . LEU A  1 339 ? 17.377  -80.830 -6.308  1.00 187.97 ? 452 LEU A H      1 
ATOM   5053  H  HA     . LEU A  1 339 ? 17.963  -78.967 -8.030  1.00 187.43 ? 452 LEU A HA     1 
ATOM   5054  H  HB2    . LEU A  1 339 ? 19.377  -80.806 -7.568  1.00 167.88 ? 452 LEU A HB2    1 
ATOM   5055  H  HB3    . LEU A  1 339 ? 18.373  -81.752 -8.344  1.00 167.88 ? 452 LEU A HB3    1 
ATOM   5056  H  HG     . LEU A  1 339 ? 18.916  -80.670 -10.346 1.00 156.01 ? 452 LEU A HG     1 
ATOM   5057  H  HD11   . LEU A  1 339 ? 20.659  -79.133 -10.412 1.00 174.54 ? 452 LEU A HD11   1 
ATOM   5058  H  HD12   . LEU A  1 339 ? 19.489  -78.584 -9.517  1.00 174.54 ? 452 LEU A HD12   1 
ATOM   5059  H  HD13   . LEU A  1 339 ? 20.775  -79.190 -8.845  1.00 174.54 ? 452 LEU A HD13   1 
ATOM   5060  H  HD21   . LEU A  1 339 ? 21.054  -81.548 -10.596 1.00 149.63 ? 452 LEU A HD21   1 
ATOM   5061  H  HD22   . LEU A  1 339 ? 21.181  -81.691 -9.035  1.00 149.63 ? 452 LEU A HD22   1 
ATOM   5062  H  HD23   . LEU A  1 339 ? 20.138  -82.565 -9.822  1.00 149.63 ? 452 LEU A HD23   1 
ATOM   5063  N  N      . LYS A  1 340 ? 15.608  -80.926 -8.911  1.00 220.32 ? 453 LYS A N      1 
ATOM   5064  C  CA     . LYS A  1 340 ? 14.531  -81.143 -9.870  1.00 141.98 ? 453 LYS A CA     1 
ATOM   5065  C  C      . LYS A  1 340 ? 13.454  -80.070 -9.732  1.00 135.57 ? 453 LYS A C      1 
ATOM   5066  O  O      . LYS A  1 340 ? 12.835  -79.668 -10.718 1.00 140.09 ? 453 LYS A O      1 
ATOM   5067  C  CB     . LYS A  1 340 ? 13.923  -82.535 -9.681  1.00 165.38 ? 453 LYS A CB     1 
ATOM   5068  C  CG     . LYS A  1 340 ? 14.852  -83.677 -10.080 1.00 177.07 ? 453 LYS A CG     1 
ATOM   5069  C  CD     . LYS A  1 340 ? 14.261  -85.035 -9.731  1.00 182.11 ? 453 LYS A CD     1 
ATOM   5070  C  CE     . LYS A  1 340 ? 15.219  -86.166 -10.077 1.00 179.09 ? 453 LYS A CE     1 
ATOM   5071  N  NZ     . LYS A  1 340 ? 14.654  -87.505 -9.748  1.00 172.88 ? 453 LYS A NZ     1 
ATOM   5072  H  H      . LYS A  1 340 ? 15.580  -81.451 -8.230  1.00 264.39 ? 453 LYS A H      1 
ATOM   5073  H  HA     . LYS A  1 340 ? 14.896  -81.091 -10.778 1.00 170.37 ? 453 LYS A HA     1 
ATOM   5074  H  HB2    . LYS A  1 340 ? 13.696  -82.652 -8.745  1.00 198.46 ? 453 LYS A HB2    1 
ATOM   5075  H  HB3    . LYS A  1 340 ? 13.121  -82.602 -10.223 1.00 198.46 ? 453 LYS A HB3    1 
ATOM   5076  H  HG2    . LYS A  1 340 ? 14.999  -83.647 -11.039 1.00 212.48 ? 453 LYS A HG2    1 
ATOM   5077  H  HG3    . LYS A  1 340 ? 15.694  -83.582 -9.609  1.00 212.48 ? 453 LYS A HG3    1 
ATOM   5078  H  HD2    . LYS A  1 340 ? 14.079  -85.071 -8.779  1.00 218.54 ? 453 LYS A HD2    1 
ATOM   5079  H  HD3    . LYS A  1 340 ? 13.442  -85.167 -10.234 1.00 218.54 ? 453 LYS A HD3    1 
ATOM   5080  H  HE2    . LYS A  1 340 ? 15.408  -86.143 -11.028 1.00 214.91 ? 453 LYS A HE2    1 
ATOM   5081  H  HE3    . LYS A  1 340 ? 16.039  -86.052 -9.571  1.00 214.91 ? 453 LYS A HE3    1 
ATOM   5082  H  HZ1    . LYS A  1 340 ? 15.238  -88.142 -9.962  1.00 207.45 ? 453 LYS A HZ1    1 
ATOM   5083  H  HZ2    . LYS A  1 340 ? 14.477  -87.555 -8.877  1.00 207.45 ? 453 LYS A HZ2    1 
ATOM   5084  H  HZ3    . LYS A  1 340 ? 13.902  -87.638 -10.204 1.00 207.45 ? 453 LYS A HZ3    1 
ATOM   5085  N  N      . ALA A  1 341 ? 13.240  -79.604 -8.505  1.00 208.45 ? 454 ALA A N      1 
ATOM   5086  C  CA     . ALA A  1 341 ? 12.264  -78.553 -8.245  1.00 189.92 ? 454 ALA A CA     1 
ATOM   5087  C  C      . ALA A  1 341 ? 12.942  -77.186 -8.227  1.00 180.84 ? 454 ALA A C      1 
ATOM   5088  O  O      . ALA A  1 341 ? 12.483  -76.261 -7.555  1.00 179.01 ? 454 ALA A O      1 
ATOM   5089  C  CB     . ALA A  1 341 ? 11.555  -78.809 -6.926  1.00 182.10 ? 454 ALA A CB     1 
ATOM   5090  H  H      . ALA A  1 341 ? 13.650  -79.883 -7.802  1.00 250.14 ? 454 ALA A H      1 
ATOM   5091  H  HA     . ALA A  1 341 ? 11.592  -78.553 -8.958  1.00 227.91 ? 454 ALA A HA     1 
ATOM   5092  H  HB1    . ALA A  1 341 ? 10.918  -78.108 -6.773  1.00 218.52 ? 454 ALA A HB1    1 
ATOM   5093  H  HB2    . ALA A  1 341 ? 11.106  -79.656 -6.972  1.00 218.52 ? 454 ALA A HB2    1 
ATOM   5094  H  HB3    . ALA A  1 341 ? 12.205  -78.821 -6.219  1.00 218.52 ? 454 ALA A HB3    1 
ATOM   5095  N  N      . LEU A  1 342 ? 14.032  -77.064 -8.976  1.00 168.46 ? 455 LEU A N      1 
ATOM   5096  C  CA     . LEU A  1 342 ? 14.806  -75.830 -9.013  1.00 141.01 ? 455 LEU A CA     1 
ATOM   5097  C  C      . LEU A  1 342 ? 14.254  -74.869 -10.061 1.00 124.56 ? 455 LEU A C      1 
ATOM   5098  O  O      . LEU A  1 342 ? 14.170  -73.666 -9.824  1.00 124.94 ? 455 LEU A O      1 
ATOM   5099  C  CB     . LEU A  1 342 ? 16.275  -76.146 -9.304  1.00 135.24 ? 455 LEU A CB     1 
ATOM   5100  C  CG     . LEU A  1 342 ? 17.255  -74.973 -9.266  1.00 132.52 ? 455 LEU A CG     1 
ATOM   5101  C  CD1    . LEU A  1 342 ? 18.617  -75.442 -8.778  1.00 115.83 ? 455 LEU A CD1    1 
ATOM   5102  C  CD2    . LEU A  1 342 ? 17.379  -74.329 -10.639 1.00 150.58 ? 455 LEU A CD2    1 
ATOM   5103  H  H      . LEU A  1 342 ? 14.347  -77.688 -9.477  1.00 202.15 ? 455 LEU A H      1 
ATOM   5104  H  HA     . LEU A  1 342 ? 14.754  -75.391 -8.139  1.00 169.21 ? 455 LEU A HA     1 
ATOM   5105  H  HB2    . LEU A  1 342 ? 16.579  -76.794 -8.649  1.00 162.29 ? 455 LEU A HB2    1 
ATOM   5106  H  HB3    . LEU A  1 342 ? 16.330  -76.537 -10.190 1.00 162.29 ? 455 LEU A HB3    1 
ATOM   5107  H  HG     . LEU A  1 342 ? 16.926  -74.304 -8.647  1.00 159.03 ? 455 LEU A HG     1 
ATOM   5108  H  HD11   . LEU A  1 342 ? 19.217  -74.693 -8.761  1.00 139.00 ? 455 LEU A HD11   1 
ATOM   5109  H  HD12   . LEU A  1 342 ? 18.523  -75.807 -7.895  1.00 139.00 ? 455 LEU A HD12   1 
ATOM   5110  H  HD13   . LEU A  1 342 ? 18.948  -76.115 -9.377  1.00 139.00 ? 455 LEU A HD13   1 
ATOM   5111  H  HD21   . LEU A  1 342 ? 17.998  -73.598 -10.585 1.00 180.69 ? 455 LEU A HD21   1 
ATOM   5112  H  HD22   . LEU A  1 342 ? 17.697  -74.984 -11.263 1.00 180.69 ? 455 LEU A HD22   1 
ATOM   5113  H  HD23   . LEU A  1 342 ? 16.516  -74.008 -10.912 1.00 180.69 ? 455 LEU A HD23   1 
ATOM   5114  N  N      . ASP A  1 343 ? 13.873  -75.404 -11.217 1.00 136.41 ? 456 ASP A N      1 
ATOM   5115  C  CA     . ASP A  1 343 ? 13.356  -74.577 -12.305 1.00 151.27 ? 456 ASP A CA     1 
ATOM   5116  C  C      . ASP A  1 343 ? 12.016  -73.932 -11.953 1.00 153.16 ? 456 ASP A C      1 
ATOM   5117  O  O      . ASP A  1 343 ? 11.807  -72.751 -12.228 1.00 158.04 ? 456 ASP A O      1 
ATOM   5118  C  CB     . ASP A  1 343 ? 13.230  -75.392 -13.595 1.00 163.76 ? 456 ASP A CB     1 
ATOM   5119  C  CG     . ASP A  1 343 ? 14.575  -75.683 -14.233 1.00 183.68 ? 456 ASP A CG     1 
ATOM   5120  O  OD1    . ASP A  1 343 ? 15.083  -74.814 -14.973 1.00 195.39 ? 456 ASP A OD1    1 
ATOM   5121  O  OD2    . ASP A  1 343 ? 15.123  -76.781 -13.997 1.00 187.49 ? 456 ASP A OD2    1 
ATOM   5122  H  H      . ASP A  1 343 ? 13.904  -76.244 -11.398 1.00 163.69 ? 456 ASP A H      1 
ATOM   5123  H  HA     . ASP A  1 343 ? 13.995  -73.854 -12.475 1.00 181.52 ? 456 ASP A HA     1 
ATOM   5124  H  HB2    . ASP A  1 343 ? 12.803  -76.239 -13.394 1.00 196.51 ? 456 ASP A HB2    1 
ATOM   5125  H  HB3    . ASP A  1 343 ? 12.697  -74.894 -14.234 1.00 196.51 ? 456 ASP A HB3    1 
ATOM   5126  N  N      . PRO A  1 344 ? 11.098  -74.705 -11.351 1.00 150.43 ? 457 PRO A N      1 
ATOM   5127  C  CA     . PRO A  1 344 ? 9.819   -74.132 -10.914 1.00 148.85 ? 457 PRO A CA     1 
ATOM   5128  C  C      . PRO A  1 344 ? 9.995   -72.931 -9.985  1.00 145.58 ? 457 PRO A C      1 
ATOM   5129  O  O      . PRO A  1 344 ? 9.110   -72.078 -9.916  1.00 123.65 ? 457 PRO A O      1 
ATOM   5130  C  CB     . PRO A  1 344 ? 9.155   -75.294 -10.170 1.00 141.99 ? 457 PRO A CB     1 
ATOM   5131  C  CG     . PRO A  1 344 ? 9.726   -76.511 -10.799 1.00 146.77 ? 457 PRO A CG     1 
ATOM   5132  C  CD     . PRO A  1 344 ? 11.143  -76.165 -11.150 1.00 150.25 ? 457 PRO A CD     1 
ATOM   5133  H  HA     . PRO A  1 344 ? 9.272   -73.878 -11.686 1.00 178.62 ? 457 PRO A HA     1 
ATOM   5134  H  HB2    . PRO A  1 344 ? 9.382   -75.254 -9.228  1.00 170.39 ? 457 PRO A HB2    1 
ATOM   5135  H  HB3    . PRO A  1 344 ? 8.194   -75.259 -10.297 1.00 170.39 ? 457 PRO A HB3    1 
ATOM   5136  H  HG2    . PRO A  1 344 ? 9.701   -77.245 -10.165 1.00 176.12 ? 457 PRO A HG2    1 
ATOM   5137  H  HG3    . PRO A  1 344 ? 9.221   -76.731 -11.597 1.00 176.12 ? 457 PRO A HG3    1 
ATOM   5138  H  HD2    . PRO A  1 344 ? 11.737  -76.387 -10.416 1.00 180.30 ? 457 PRO A HD2    1 
ATOM   5139  H  HD3    . PRO A  1 344 ? 11.407  -76.611 -11.970 1.00 180.30 ? 457 PRO A HD3    1 
ATOM   5140  N  N      . MET A  1 345 ? 11.123  -72.871 -9.282  1.00 153.83 ? 458 MET A N      1 
ATOM   5141  C  CA     . MET A  1 345 ? 11.410  -71.757 -8.380  1.00 157.67 ? 458 MET A CA     1 
ATOM   5142  C  C      . MET A  1 345 ? 11.880  -70.518 -9.138  1.00 155.25 ? 458 MET A C      1 
ATOM   5143  O  O      . MET A  1 345 ? 11.911  -69.420 -8.585  1.00 144.64 ? 458 MET A O      1 
ATOM   5144  C  CB     . MET A  1 345 ? 12.477  -72.155 -7.359  1.00 162.23 ? 458 MET A CB     1 
ATOM   5145  C  CG     . MET A  1 345 ? 11.924  -72.683 -6.046  1.00 165.85 ? 458 MET A CG     1 
ATOM   5146  S  SD     . MET A  1 345 ? 13.221  -73.060 -4.848  1.00 159.98 ? 458 MET A SD     1 
ATOM   5147  C  CE     . MET A  1 345 ? 13.986  -71.452 -4.643  1.00 139.79 ? 458 MET A CE     1 
ATOM   5148  H  H      . MET A  1 345 ? 11.743  -73.466 -9.310  1.00 184.59 ? 458 MET A H      1 
ATOM   5149  H  HA     . MET A  1 345 ? 10.593  -71.533 -7.887  1.00 189.20 ? 458 MET A HA     1 
ATOM   5150  H  HB2    . MET A  1 345 ? 13.033  -72.850 -7.745  1.00 194.68 ? 458 MET A HB2    1 
ATOM   5151  H  HB3    . MET A  1 345 ? 13.020  -71.377 -7.158  1.00 194.68 ? 458 MET A HB3    1 
ATOM   5152  H  HG2    . MET A  1 345 ? 11.340  -72.013 -5.656  1.00 199.03 ? 458 MET A HG2    1 
ATOM   5153  H  HG3    . MET A  1 345 ? 11.427  -73.498 -6.217  1.00 199.03 ? 458 MET A HG3    1 
ATOM   5154  H  HE1    . MET A  1 345 ? 14.707  -71.527 -4.014  1.00 167.75 ? 458 MET A HE1    1 
ATOM   5155  H  HE2    . MET A  1 345 ? 14.321  -71.155 -5.492  1.00 167.75 ? 458 MET A HE2    1 
ATOM   5156  H  HE3    . MET A  1 345 ? 13.329  -70.833 -4.316  1.00 167.75 ? 458 MET A HE3    1 
ATOM   5157  N  N      . MET A  1 346 ? 12.252  -70.698 -10.400 1.00 156.40 ? 459 MET A N      1 
ATOM   5158  C  CA     . MET A  1 346 ? 12.747  -69.594 -11.211 1.00 143.39 ? 459 MET A CA     1 
ATOM   5159  C  C      . MET A  1 346 ? 11.600  -68.895 -11.932 1.00 149.81 ? 459 MET A C      1 
ATOM   5160  O  O      . MET A  1 346 ? 11.582  -67.670 -12.040 1.00 152.41 ? 459 MET A O      1 
ATOM   5161  C  CB     . MET A  1 346 ? 13.777  -70.101 -12.223 1.00 145.48 ? 459 MET A CB     1 
ATOM   5162  C  CG     . MET A  1 346 ? 14.536  -68.997 -12.941 1.00 150.81 ? 459 MET A CG     1 
ATOM   5163  S  SD     . MET A  1 346 ? 15.876  -69.621 -13.977 1.00 121.01 ? 459 MET A SD     1 
ATOM   5164  C  CE     . MET A  1 346 ? 14.952  -70.410 -15.294 1.00 252.14 ? 459 MET A CE     1 
ATOM   5165  H  H      . MET A  1 346 ? 12.228  -71.453 -10.812 1.00 187.69 ? 459 MET A H      1 
ATOM   5166  H  HA     . MET A  1 346 ? 13.194  -68.947 -10.626 1.00 172.07 ? 459 MET A HA     1 
ATOM   5167  H  HB2    . MET A  1 346 ? 14.426  -70.651 -11.758 1.00 174.58 ? 459 MET A HB2    1 
ATOM   5168  H  HB3    . MET A  1 346 ? 13.320  -70.630 -12.895 1.00 174.58 ? 459 MET A HB3    1 
ATOM   5169  H  HG2    . MET A  1 346 ? 13.920  -68.510 -13.510 1.00 180.97 ? 459 MET A HG2    1 
ATOM   5170  H  HG3    . MET A  1 346 ? 14.921  -68.399 -12.281 1.00 180.97 ? 459 MET A HG3    1 
ATOM   5171  H  HE1    . MET A  1 346 ? 15.569  -70.789 -15.924 1.00 302.57 ? 459 MET A HE1    1 
ATOM   5172  H  HE2    . MET A  1 346 ? 14.401  -71.100 -14.918 1.00 302.57 ? 459 MET A HE2    1 
ATOM   5173  H  HE3    . MET A  1 346 ? 14.404  -69.752 -15.727 1.00 302.57 ? 459 MET A HE3    1 
ATOM   5174  N  N      . GLU A  1 347 ? 10.640  -69.675 -12.420 1.00 164.24 ? 460 GLU A N      1 
ATOM   5175  C  CA     . GLU A  1 347 ? 9.481   -69.115 -13.106 1.00 176.31 ? 460 GLU A CA     1 
ATOM   5176  C  C      . GLU A  1 347 ? 8.655   -68.237 -12.170 1.00 177.08 ? 460 GLU A C      1 
ATOM   5177  O  O      . GLU A  1 347 ? 7.932   -67.351 -12.619 1.00 178.08 ? 460 GLU A O      1 
ATOM   5178  C  CB     . GLU A  1 347 ? 8.605   -70.228 -13.686 1.00 187.21 ? 460 GLU A CB     1 
ATOM   5179  C  CG     . GLU A  1 347 ? 9.227   -70.951 -14.870 1.00 196.74 ? 460 GLU A CG     1 
ATOM   5180  C  CD     . GLU A  1 347 ? 8.306   -72.000 -15.464 1.00 205.85 ? 460 GLU A CD     1 
ATOM   5181  O  OE1    . GLU A  1 347 ? 7.202   -72.205 -14.917 1.00 207.26 ? 460 GLU A OE1    1 
ATOM   5182  O  OE2    . GLU A  1 347 ? 8.685   -72.618 -16.482 1.00 210.30 ? 460 GLU A OE2    1 
ATOM   5183  H  H      . GLU A  1 347 ? 10.636  -70.534 -12.366 1.00 197.08 ? 460 GLU A H      1 
ATOM   5184  H  HA     . GLU A  1 347 ? 9.791   -68.556 -13.849 1.00 211.57 ? 460 GLU A HA     1 
ATOM   5185  H  HB2    . GLU A  1 347 ? 8.437   -70.885 -12.993 1.00 224.65 ? 460 GLU A HB2    1 
ATOM   5186  H  HB3    . GLU A  1 347 ? 7.766   -69.842 -13.982 1.00 224.65 ? 460 GLU A HB3    1 
ATOM   5187  H  HG2    . GLU A  1 347 ? 9.433   -70.305 -15.563 1.00 236.09 ? 460 GLU A HG2    1 
ATOM   5188  H  HG3    . GLU A  1 347 ? 10.039  -71.395 -14.579 1.00 236.09 ? 460 GLU A HG3    1 
ATOM   5189  N  N      . ARG A  1 348 ? 8.765   -68.488 -10.869 1.00 178.84 ? 461 ARG A N      1 
ATOM   5190  C  CA     . ARG A  1 348 ? 8.055   -67.689 -9.875  1.00 185.20 ? 461 ARG A CA     1 
ATOM   5191  C  C      . ARG A  1 348 ? 8.938   -66.564 -9.346  1.00 179.88 ? 461 ARG A C      1 
ATOM   5192  O  O      . ARG A  1 348 ? 8.446   -65.595 -8.768  1.00 183.22 ? 461 ARG A O      1 
ATOM   5193  C  CB     . ARG A  1 348 ? 7.586   -68.565 -8.712  1.00 195.57 ? 461 ARG A CB     1 
ATOM   5194  C  CG     . ARG A  1 348 ? 8.699   -69.348 -8.034  1.00 205.91 ? 461 ARG A CG     1 
ATOM   5195  C  CD     . ARG A  1 348 ? 8.419   -69.546 -6.557  1.00 210.96 ? 461 ARG A CD     1 
ATOM   5196  N  NE     . ARG A  1 348 ? 8.616   -68.312 -5.801  1.00 213.33 ? 461 ARG A NE     1 
ATOM   5197  C  CZ     . ARG A  1 348 ? 8.345   -68.172 -4.507  1.00 214.43 ? 461 ARG A CZ     1 
ATOM   5198  N  NH1    . ARG A  1 348 ? 7.855   -69.188 -3.810  1.00 216.24 ? 461 ARG A NH1    1 
ATOM   5199  N  NH2    . ARG A  1 348 ? 8.561   -67.009 -3.909  1.00 210.08 ? 461 ARG A NH2    1 
ATOM   5200  H  H      . ARG A  1 348 ? 9.245   -69.118 -10.534 1.00 214.60 ? 461 ARG A H      1 
ATOM   5201  H  HA     . ARG A  1 348 ? 7.265   -67.286 -10.292 1.00 222.23 ? 461 ARG A HA     1 
ATOM   5202  H  HB2    . ARG A  1 348 ? 7.174   -67.998 -8.041  1.00 234.68 ? 461 ARG A HB2    1 
ATOM   5203  H  HB3    . ARG A  1 348 ? 6.937   -69.204 -9.045  1.00 234.68 ? 461 ARG A HB3    1 
ATOM   5204  H  HG2    . ARG A  1 348 ? 8.774   -70.221 -8.449  1.00 247.09 ? 461 ARG A HG2    1 
ATOM   5205  H  HG3    . ARG A  1 348 ? 9.533   -68.860 -8.123  1.00 247.09 ? 461 ARG A HG3    1 
ATOM   5206  H  HD2    . ARG A  1 348 ? 7.498   -69.829 -6.441  1.00 253.15 ? 461 ARG A HD2    1 
ATOM   5207  H  HD3    . ARG A  1 348 ? 9.023   -70.218 -6.204  1.00 253.15 ? 461 ARG A HD3    1 
ATOM   5208  H  HE     . ARG A  1 348 ? 8.928   -67.630 -6.221  1.00 255.99 ? 461 ARG A HE     1 
ATOM   5209  H  HH11   . ARG A  1 348 ? 7.714   -69.945 -4.194  1.00 259.49 ? 461 ARG A HH11   1 
ATOM   5210  H  HH12   . ARG A  1 348 ? 7.681   -69.091 -2.973  1.00 259.49 ? 461 ARG A HH12   1 
ATOM   5211  H  HH21   . ARG A  1 348 ? 8.877   -66.347 -4.357  1.00 252.10 ? 461 ARG A HH21   1 
ATOM   5212  H  HH22   . ARG A  1 348 ? 8.384   -66.917 -3.072  1.00 252.10 ? 461 ARG A HH22   1 
ATOM   5213  N  N      . GLU A  1 349 ? 10.245  -66.698 -9.546  1.00 171.28 ? 462 GLU A N      1 
ATOM   5214  C  CA     . GLU A  1 349 ? 11.202  -65.716 -9.052  1.00 164.03 ? 462 GLU A CA     1 
ATOM   5215  C  C      . GLU A  1 349 ? 11.337  -64.538 -10.014 1.00 146.30 ? 462 GLU A C      1 
ATOM   5216  O  O      . GLU A  1 349 ? 11.484  -63.393 -9.586  1.00 150.66 ? 462 GLU A O      1 
ATOM   5217  C  CB     . GLU A  1 349 ? 12.568  -66.374 -8.854  1.00 172.14 ? 462 GLU A CB     1 
ATOM   5218  C  CG     . GLU A  1 349 ? 13.611  -65.483 -8.204  1.00 163.63 ? 462 GLU A CG     1 
ATOM   5219  C  CD     . GLU A  1 349 ? 13.819  -65.794 -6.736  1.00 160.20 ? 462 GLU A CD     1 
ATOM   5220  O  OE1    . GLU A  1 349 ? 12.989  -66.523 -6.153  1.00 168.99 ? 462 GLU A OE1    1 
ATOM   5221  O  OE2    . GLU A  1 349 ? 14.824  -65.317 -6.168  1.00 146.65 ? 462 GLU A OE2    1 
ATOM   5222  H  H      . GLU A  1 349 ? 10.605  -67.355 -9.968  1.00 205.54 ? 462 GLU A H      1 
ATOM   5223  H  HA     . GLU A  1 349 ? 10.897  -65.372 -8.187  1.00 196.84 ? 462 GLU A HA     1 
ATOM   5224  H  HB2    . GLU A  1 349 ? 12.456  -67.156 -8.290  1.00 206.57 ? 462 GLU A HB2    1 
ATOM   5225  H  HB3    . GLU A  1 349 ? 12.911  -66.644 -9.721  1.00 206.57 ? 462 GLU A HB3    1 
ATOM   5226  H  HG2    . GLU A  1 349 ? 14.458  -65.605 -8.660  1.00 196.36 ? 462 GLU A HG2    1 
ATOM   5227  H  HG3    . GLU A  1 349 ? 13.325  -64.559 -8.277  1.00 196.36 ? 462 GLU A HG3    1 
ATOM   5228  N  N      . ILE A  1 350 ? 11.289  -64.822 -11.312 1.00 133.72 ? 463 ILE A N      1 
ATOM   5229  C  CA     . ILE A  1 350 ? 11.482  -63.788 -12.324 1.00 127.80 ? 463 ILE A CA     1 
ATOM   5230  C  C      . ILE A  1 350 ? 10.160  -63.288 -12.897 1.00 134.09 ? 463 ILE A C      1 
ATOM   5231  O  O      . ILE A  1 350 ? 10.125  -62.265 -13.577 1.00 153.41 ? 463 ILE A O      1 
ATOM   5232  C  CB     . ILE A  1 350 ? 12.386  -64.278 -13.475 1.00 130.88 ? 463 ILE A CB     1 
ATOM   5233  C  CG1    . ILE A  1 350 ? 11.633  -65.250 -14.386 1.00 162.24 ? 463 ILE A CG1    1 
ATOM   5234  C  CG2    . ILE A  1 350 ? 13.645  -64.916 -12.913 1.00 115.34 ? 463 ILE A CG2    1 
ATOM   5235  C  CD1    . ILE A  1 350 ? 12.446  -65.719 -15.574 1.00 182.52 ? 463 ILE A CD1    1 
ATOM   5236  H  H      . ILE A  1 350 ? 11.145  -65.607 -11.634 1.00 160.46 ? 463 ILE A H      1 
ATOM   5237  H  HA     . ILE A  1 350 ? 11.929  -63.023 -11.903 1.00 153.36 ? 463 ILE A HA     1 
ATOM   5238  H  HB     . ILE A  1 350 ? 12.647  -63.508 -14.005 1.00 157.05 ? 463 ILE A HB     1 
ATOM   5239  H  HG12   . ILE A  1 350 ? 11.382  -66.033 -13.870 1.00 194.69 ? 463 ILE A HG12   1 
ATOM   5240  H  HG13   . ILE A  1 350 ? 10.837  -64.811 -14.725 1.00 194.69 ? 463 ILE A HG13   1 
ATOM   5241  H  HG21   . ILE A  1 350 ? 14.196  -65.215 -13.640 1.00 138.41 ? 463 ILE A HG21   1 
ATOM   5242  H  HG22   . ILE A  1 350 ? 14.119  -64.265 -12.390 1.00 138.41 ? 463 ILE A HG22   1 
ATOM   5243  H  HG23   . ILE A  1 350 ? 13.397  -65.662 -12.362 1.00 138.41 ? 463 ILE A HG23   1 
ATOM   5244  H  HD11   . ILE A  1 350 ? 11.913  -66.323 -16.098 1.00 219.02 ? 463 ILE A HD11   1 
ATOM   5245  H  HD12   . ILE A  1 350 ? 12.693  -64.957 -16.103 1.00 219.02 ? 463 ILE A HD12   1 
ATOM   5246  H  HD13   . ILE A  1 350 ? 13.233  -66.167 -15.257 1.00 219.02 ? 463 ILE A HD13   1 
ATOM   5247  N  N      . GLU A  1 351 ? 9.075   -64.007 -12.629 1.00 137.51 ? 464 GLU A N      1 
ATOM   5248  C  CA     . GLU A  1 351 ? 7.752   -63.547 -13.031 1.00 149.66 ? 464 GLU A CA     1 
ATOM   5249  C  C      . GLU A  1 351 ? 7.274   -62.483 -12.050 1.00 162.11 ? 464 GLU A C      1 
ATOM   5250  O  O      . GLU A  1 351 ? 6.407   -61.671 -12.370 1.00 170.43 ? 464 GLU A O      1 
ATOM   5251  C  CB     . GLU A  1 351 ? 6.762   -64.710 -13.080 1.00 157.67 ? 464 GLU A CB     1 
ATOM   5252  C  CG     . GLU A  1 351 ? 5.391   -64.344 -13.634 1.00 162.21 ? 464 GLU A CG     1 
ATOM   5253  C  CD     . GLU A  1 351 ? 5.420   -64.046 -15.121 1.00 164.99 ? 464 GLU A CD     1 
ATOM   5254  O  OE1    . GLU A  1 351 ? 6.528   -63.951 -15.690 1.00 158.00 ? 464 GLU A OE1    1 
ATOM   5255  O  OE2    . GLU A  1 351 ? 4.334   -63.913 -15.723 1.00 171.27 ? 464 GLU A OE2    1 
ATOM   5256  H  H      . GLU A  1 351 ? 9.078   -64.762 -12.217 1.00 165.01 ? 464 GLU A H      1 
ATOM   5257  H  HA     . GLU A  1 351 ? 7.804   -63.145 -13.923 1.00 179.60 ? 464 GLU A HA     1 
ATOM   5258  H  HB2    . GLU A  1 351 ? 7.131   -65.409 -13.643 1.00 189.21 ? 464 GLU A HB2    1 
ATOM   5259  H  HB3    . GLU A  1 351 ? 6.635   -65.049 -12.180 1.00 189.21 ? 464 GLU A HB3    1 
ATOM   5260  H  HG2    . GLU A  1 351 ? 4.783   -65.086 -13.489 1.00 194.65 ? 464 GLU A HG2    1 
ATOM   5261  H  HG3    . GLU A  1 351 ? 5.066   -63.554 -13.176 1.00 194.65 ? 464 GLU A HG3    1 
ATOM   5262  N  N      . GLU A  1 352 ? 7.847   -62.496 -10.850 1.00 166.28 ? 465 GLU A N      1 
ATOM   5263  C  CA     . GLU A  1 352 ? 7.576   -61.464 -9.859  1.00 169.69 ? 465 GLU A CA     1 
ATOM   5264  C  C      . GLU A  1 352 ? 8.344   -60.201 -10.226 1.00 154.32 ? 465 GLU A C      1 
ATOM   5265  O  O      . GLU A  1 352 ? 7.882   -59.085 -9.989  1.00 153.49 ? 465 GLU A O      1 
ATOM   5266  C  CB     . GLU A  1 352 ? 7.996   -61.937 -8.467  1.00 184.51 ? 465 GLU A CB     1 
ATOM   5267  C  CG     . GLU A  1 352 ? 7.664   -60.952 -7.354  1.00 191.56 ? 465 GLU A CG     1 
ATOM   5268  C  CD     . GLU A  1 352 ? 8.253   -61.356 -6.017  1.00 192.01 ? 465 GLU A CD     1 
ATOM   5269  O  OE1    . GLU A  1 352 ? 7.534   -61.268 -4.999  1.00 189.69 ? 465 GLU A OE1    1 
ATOM   5270  O  OE2    . GLU A  1 352 ? 9.437   -61.754 -5.980  1.00 193.36 ? 465 GLU A OE2    1 
ATOM   5271  H  H      . GLU A  1 352 ? 8.400   -63.098 -10.585 1.00 199.53 ? 465 GLU A H      1 
ATOM   5272  H  HA     . GLU A  1 352 ? 6.618   -61.258 -9.847  1.00 203.63 ? 465 GLU A HA     1 
ATOM   5273  H  HB2    . GLU A  1 352 ? 7.540   -62.770 -8.270  1.00 221.41 ? 465 GLU A HB2    1 
ATOM   5274  H  HB3    . GLU A  1 352 ? 8.955   -62.078 -8.462  1.00 221.41 ? 465 GLU A HB3    1 
ATOM   5275  H  HG2    . GLU A  1 352 ? 8.020   -60.080 -7.588  1.00 229.88 ? 465 GLU A HG2    1 
ATOM   5276  H  HG3    . GLU A  1 352 ? 6.701   -60.901 -7.255  1.00 229.88 ? 465 GLU A HG3    1 
ATOM   5277  N  N      . LEU A  1 353 ? 9.525   -60.391 -10.805 1.00 143.24 ? 466 LEU A N      1 
ATOM   5278  C  CA     . LEU A  1 353 ? 10.363  -59.278 -11.227 1.00 134.64 ? 466 LEU A CA     1 
ATOM   5279  C  C      . LEU A  1 353 ? 9.729   -58.567 -12.418 1.00 148.68 ? 466 LEU A C      1 
ATOM   5280  O  O      . LEU A  1 353 ? 9.851   -57.351 -12.561 1.00 159.14 ? 466 LEU A O      1 
ATOM   5281  C  CB     . LEU A  1 353 ? 11.761  -59.778 -11.597 1.00 127.63 ? 466 LEU A CB     1 
ATOM   5282  C  CG     . LEU A  1 353 ? 12.935  -58.945 -11.079 1.00 132.65 ? 466 LEU A CG     1 
ATOM   5283  C  CD1    . LEU A  1 353 ? 12.982  -58.965 -9.560  1.00 133.14 ? 466 LEU A CD1    1 
ATOM   5284  C  CD2    . LEU A  1 353 ? 14.244  -59.453 -11.660 1.00 137.77 ? 466 LEU A CD2    1 
ATOM   5285  H  H      . LEU A  1 353 ? 9.866   -61.165 -10.966 1.00 171.88 ? 466 LEU A H      1 
ATOM   5286  H  HA     . LEU A  1 353 ? 10.447  -58.636 -10.492 1.00 161.57 ? 466 LEU A HA     1 
ATOM   5287  H  HB2    . LEU A  1 353 ? 11.867  -60.676 -11.244 1.00 153.15 ? 466 LEU A HB2    1 
ATOM   5288  H  HB3    . LEU A  1 353 ? 11.830  -59.803 -12.564 1.00 153.15 ? 466 LEU A HB3    1 
ATOM   5289  H  HG     . LEU A  1 353 ? 12.818  -58.025 -11.363 1.00 159.17 ? 466 LEU A HG     1 
ATOM   5290  H  HD11   . LEU A  1 353 ? 13.726  -58.435 -9.264  1.00 159.77 ? 466 LEU A HD11   1 
ATOM   5291  H  HD12   . LEU A  1 353 ? 12.162  -58.600 -9.217  1.00 159.77 ? 466 LEU A HD12   1 
ATOM   5292  H  HD13   . LEU A  1 353 ? 13.086  -59.872 -9.263  1.00 159.77 ? 466 LEU A HD13   1 
ATOM   5293  H  HD21   . LEU A  1 353 ? 14.964  -58.916 -11.321 1.00 165.33 ? 466 LEU A HD21   1 
ATOM   5294  H  HD22   . LEU A  1 353 ? 14.367  -60.368 -11.398 1.00 165.33 ? 466 LEU A HD22   1 
ATOM   5295  H  HD23   . LEU A  1 353 ? 14.208  -59.387 -12.617 1.00 165.33 ? 466 LEU A HD23   1 
ATOM   5296  N  N      . ARG A  1 354 ? 9.055   -59.333 -13.271 1.00 158.82 ? 467 ARG A N      1 
ATOM   5297  C  CA     . ARG A  1 354 ? 8.371   -58.771 -14.431 1.00 166.01 ? 467 ARG A CA     1 
ATOM   5298  C  C      . ARG A  1 354 ? 7.118   -58.004 -14.014 1.00 172.02 ? 467 ARG A C      1 
ATOM   5299  O  O      . ARG A  1 354 ? 6.671   -57.103 -14.723 1.00 181.55 ? 467 ARG A O      1 
ATOM   5300  C  CB     . ARG A  1 354 ? 8.001   -59.876 -15.425 1.00 166.31 ? 467 ARG A CB     1 
ATOM   5301  C  CG     . ARG A  1 354 ? 9.189   -60.479 -16.161 1.00 166.54 ? 467 ARG A CG     1 
ATOM   5302  C  CD     . ARG A  1 354 ? 8.755   -61.605 -17.087 1.00 169.62 ? 467 ARG A CD     1 
ATOM   5303  N  NE     . ARG A  1 354 ? 9.893   -62.262 -17.728 1.00 174.51 ? 467 ARG A NE     1 
ATOM   5304  C  CZ     . ARG A  1 354 ? 10.494  -61.828 -18.833 1.00 184.23 ? 467 ARG A CZ     1 
ATOM   5305  N  NH1    . ARG A  1 354 ? 10.081  -60.723 -19.441 1.00 183.78 ? 467 ARG A NH1    1 
ATOM   5306  N  NH2    . ARG A  1 354 ? 11.520  -62.501 -19.334 1.00 187.68 ? 467 ARG A NH2    1 
ATOM   5307  H  H      . ARG A  1 354 ? 8.977   -60.187 -13.198 1.00 190.58 ? 467 ARG A H      1 
ATOM   5308  H  HA     . ARG A  1 354 ? 8.973   -58.145 -14.884 1.00 199.22 ? 467 ARG A HA     1 
ATOM   5309  H  HB2    . ARG A  1 354 ? 7.558   -60.592 -14.943 1.00 199.57 ? 467 ARG A HB2    1 
ATOM   5310  H  HB3    . ARG A  1 354 ? 7.399   -59.507 -16.089 1.00 199.57 ? 467 ARG A HB3    1 
ATOM   5311  H  HG2    . ARG A  1 354 ? 9.616   -59.792 -16.696 1.00 199.84 ? 467 ARG A HG2    1 
ATOM   5312  H  HG3    . ARG A  1 354 ? 9.816   -60.840 -15.515 1.00 199.84 ? 467 ARG A HG3    1 
ATOM   5313  H  HD2    . ARG A  1 354 ? 8.273   -62.271 -16.573 1.00 203.54 ? 467 ARG A HD2    1 
ATOM   5314  H  HD3    . ARG A  1 354 ? 8.185   -61.243 -17.783 1.00 203.54 ? 467 ARG A HD3    1 
ATOM   5315  H  HE     . ARG A  1 354 ? 10.195  -62.981 -17.365 1.00 209.42 ? 467 ARG A HE     1 
ATOM   5316  H  HH11   . ARG A  1 354 ? 9.416   -60.280 -19.123 1.00 220.54 ? 467 ARG A HH11   1 
ATOM   5317  H  HH12   . ARG A  1 354 ? 10.477  -60.451 -20.154 1.00 220.54 ? 467 ARG A HH12   1 
ATOM   5318  H  HH21   . ARG A  1 354 ? 11.794  -63.218 -18.945 1.00 225.21 ? 467 ARG A HH21   1 
ATOM   5319  H  HH22   . ARG A  1 354 ? 11.911  -62.222 -20.047 1.00 225.21 ? 467 ARG A HH22   1 
ATOM   5320  N  N      . GLN A  1 355 ? 6.554   -58.368 -12.866 1.00 169.21 ? 468 GLN A N      1 
ATOM   5321  C  CA     . GLN A  1 355 ? 5.386   -57.674 -12.333 1.00 173.65 ? 468 GLN A CA     1 
ATOM   5322  C  C      . GLN A  1 355 ? 5.796   -56.400 -11.599 1.00 173.93 ? 468 GLN A C      1 
ATOM   5323  O  O      . GLN A  1 355 ? 5.054   -55.418 -11.581 1.00 180.14 ? 468 GLN A O      1 
ATOM   5324  C  CB     . GLN A  1 355 ? 4.604   -58.586 -11.386 1.00 177.23 ? 468 GLN A CB     1 
ATOM   5325  C  CG     . GLN A  1 355 ? 3.843   -59.704 -12.081 1.00 181.69 ? 468 GLN A CG     1 
ATOM   5326  C  CD     . GLN A  1 355 ? 3.058   -60.566 -11.111 1.00 185.06 ? 468 GLN A CD     1 
ATOM   5327  O  OE1    . GLN A  1 355 ? 2.874   -60.202 -9.949  1.00 186.94 ? 468 GLN A OE1    1 
ATOM   5328  N  NE2    . GLN A  1 355 ? 2.591   -61.717 -11.583 1.00 181.85 ? 468 GLN A NE2    1 
ATOM   5329  H  H      . GLN A  1 355 ? 6.830   -59.017 -12.374 1.00 203.05 ? 468 GLN A H      1 
ATOM   5330  H  HA     . GLN A  1 355 ? 4.795   -57.423 -13.074 1.00 208.38 ? 468 GLN A HA     1 
ATOM   5331  H  HB2    . GLN A  1 355 ? 5.226   -58.994 -10.764 1.00 212.67 ? 468 GLN A HB2    1 
ATOM   5332  H  HB3    . GLN A  1 355 ? 3.959   -58.049 -10.899 1.00 212.67 ? 468 GLN A HB3    1 
ATOM   5333  H  HG2    . GLN A  1 355 ? 3.218   -59.316 -12.713 1.00 218.03 ? 468 GLN A HG2    1 
ATOM   5334  H  HG3    . GLN A  1 355 ? 4.475   -60.275 -12.547 1.00 218.03 ? 468 GLN A HG3    1 
ATOM   5335  H  HE21   . GLN A  1 355 ? 2.740   -61.939 -12.400 1.00 218.22 ? 468 GLN A HE21   1 
ATOM   5336  H  HE22   . GLN A  1 355 ? 2.140   -62.241 -11.071 1.00 218.22 ? 468 GLN A HE22   1 
ATOM   5337  N  N      . ARG A  1 356 ? 6.980   -56.424 -10.995 1.00 164.92 ? 469 ARG A N      1 
ATOM   5338  C  CA     . ARG A  1 356 ? 7.490   -55.276 -10.253 1.00 150.73 ? 469 ARG A CA     1 
ATOM   5339  C  C      . ARG A  1 356 ? 7.867   -54.134 -11.193 1.00 143.16 ? 469 ARG A C      1 
ATOM   5340  O  O      . ARG A  1 356 ? 7.705   -52.960 -10.857 1.00 148.77 ? 469 ARG A O      1 
ATOM   5341  C  CB     . ARG A  1 356 ? 8.712   -55.684 -9.429  1.00 140.04 ? 469 ARG A CB     1 
ATOM   5342  C  CG     . ARG A  1 356 ? 9.265   -54.575 -8.544  1.00 135.32 ? 469 ARG A CG     1 
ATOM   5343  C  CD     . ARG A  1 356 ? 10.656  -54.907 -8.020  1.00 137.32 ? 469 ARG A CD     1 
ATOM   5344  N  NE     . ARG A  1 356 ? 10.728  -56.243 -7.433  1.00 159.41 ? 469 ARG A NE     1 
ATOM   5345  C  CZ     . ARG A  1 356 ? 11.809  -56.749 -6.846  1.00 166.03 ? 469 ARG A CZ     1 
ATOM   5346  N  NH1    . ARG A  1 356 ? 12.923  -56.032 -6.758  1.00 165.50 ? 469 ARG A NH1    1 
ATOM   5347  N  NH2    . ARG A  1 356 ? 11.775  -57.975 -6.344  1.00 162.81 ? 469 ARG A NH2    1 
ATOM   5348  H  H      . ARG A  1 356 ? 7.511   -57.100 -10.999 1.00 197.91 ? 469 ARG A H      1 
ATOM   5349  H  HA     . ARG A  1 356 ? 6.798   -54.953 -9.639  1.00 180.87 ? 469 ARG A HA     1 
ATOM   5350  H  HB2    . ARG A  1 356 ? 8.467   -56.426 -8.855  1.00 168.05 ? 469 ARG A HB2    1 
ATOM   5351  H  HB3    . ARG A  1 356 ? 9.418   -55.958 -10.035 1.00 168.05 ? 469 ARG A HB3    1 
ATOM   5352  H  HG2    . ARG A  1 356 ? 9.324   -53.755 -9.058  1.00 162.38 ? 469 ARG A HG2    1 
ATOM   5353  H  HG3    . ARG A  1 356 ? 8.677   -54.451 -7.783  1.00 162.38 ? 469 ARG A HG3    1 
ATOM   5354  H  HD2    . ARG A  1 356 ? 11.289  -54.867 -8.754  1.00 164.79 ? 469 ARG A HD2    1 
ATOM   5355  H  HD3    . ARG A  1 356 ? 10.899  -54.264 -7.335  1.00 164.79 ? 469 ARG A HD3    1 
ATOM   5356  H  HE     . ARG A  1 356 ? 10.023  -56.735 -7.468  1.00 191.30 ? 469 ARG A HE     1 
ATOM   5357  H  HH11   . ARG A  1 356 ? 12.949  -55.237 -7.083  1.00 198.59 ? 469 ARG A HH11   1 
ATOM   5358  H  HH12   . ARG A  1 356 ? 13.619  -56.365 -6.378  1.00 198.59 ? 469 ARG A HH12   1 
ATOM   5359  H  HH21   . ARG A  1 356 ? 11.055  -58.442 -6.398  1.00 195.37 ? 469 ARG A HH21   1 
ATOM   5360  H  HH22   . ARG A  1 356 ? 12.473  -58.302 -5.963  1.00 195.37 ? 469 ARG A HH22   1 
ATOM   5361  N  N      . TYR A  1 357 ? 8.368   -54.485 -12.372 1.00 124.32 ? 470 TYR A N      1 
ATOM   5362  C  CA     . TYR A  1 357 ? 8.854   -53.490 -13.321 1.00 118.00 ? 470 TYR A CA     1 
ATOM   5363  C  C      . TYR A  1 357 ? 7.768   -53.027 -14.285 1.00 142.27 ? 470 TYR A C      1 
ATOM   5364  O  O      . TYR A  1 357 ? 7.933   -52.021 -14.975 1.00 154.70 ? 470 TYR A O      1 
ATOM   5365  C  CB     . TYR A  1 357 ? 10.064  -54.030 -14.081 1.00 112.79 ? 470 TYR A CB     1 
ATOM   5366  C  CG     . TYR A  1 357 ? 11.350  -53.849 -13.314 1.00 117.31 ? 470 TYR A CG     1 
ATOM   5367  C  CD1    . TYR A  1 357 ? 12.351  -53.014 -13.787 1.00 124.35 ? 470 TYR A CD1    1 
ATOM   5368  C  CD2    . TYR A  1 357 ? 11.551  -54.491 -12.101 1.00 125.92 ? 470 TYR A CD2    1 
ATOM   5369  C  CE1    . TYR A  1 357 ? 13.523  -52.840 -13.083 1.00 132.31 ? 470 TYR A CE1    1 
ATOM   5370  C  CE2    . TYR A  1 357 ? 12.718  -54.320 -11.390 1.00 134.04 ? 470 TYR A CE2    1 
ATOM   5371  C  CZ     . TYR A  1 357 ? 13.699  -53.492 -11.884 1.00 133.90 ? 470 TYR A CZ     1 
ATOM   5372  O  OH     . TYR A  1 357 ? 14.863  -53.322 -11.175 1.00 134.68 ? 470 TYR A OH     1 
ATOM   5373  H  H      . TYR A  1 357 ? 8.439   -55.297 -12.648 1.00 149.18 ? 470 TYR A H      1 
ATOM   5374  H  HA     . TYR A  1 357 ? 9.151   -52.704 -12.817 1.00 141.60 ? 470 TYR A HA     1 
ATOM   5375  H  HB2    . TYR A  1 357 ? 9.940   -54.978 -14.242 1.00 135.35 ? 470 TYR A HB2    1 
ATOM   5376  H  HB3    . TYR A  1 357 ? 10.146  -53.556 -14.923 1.00 135.35 ? 470 TYR A HB3    1 
ATOM   5377  H  HD1    . TYR A  1 357 ? 12.234  -52.572 -14.597 1.00 149.22 ? 470 TYR A HD1    1 
ATOM   5378  H  HD2    . TYR A  1 357 ? 10.889  -55.050 -11.764 1.00 151.11 ? 470 TYR A HD2    1 
ATOM   5379  H  HE1    . TYR A  1 357 ? 14.188  -52.280 -13.414 1.00 158.78 ? 470 TYR A HE1    1 
ATOM   5380  H  HE2    . TYR A  1 357 ? 12.842  -54.760 -10.580 1.00 160.85 ? 470 TYR A HE2    1 
ATOM   5381  H  HH     . TYR A  1 357 ? 15.240  -54.044 -11.079 1.00 161.62 ? 470 TYR A HH     1 
ATOM   5382  N  N      . THR A  1 358 ? 6.660   -53.759 -14.333 1.00 150.36 ? 471 THR A N      1 
ATOM   5383  C  CA     . THR A  1 358 ? 5.483   -53.288 -15.050 1.00 161.45 ? 471 THR A CA     1 
ATOM   5384  C  C      . THR A  1 358 ? 4.802   -52.223 -14.197 1.00 171.77 ? 471 THR A C      1 
ATOM   5385  O  O      . THR A  1 358 ? 4.139   -51.324 -14.714 1.00 178.22 ? 471 THR A O      1 
ATOM   5386  C  CB     . THR A  1 358 ? 4.496   -54.431 -15.344 1.00 154.89 ? 471 THR A CB     1 
ATOM   5387  O  OG1    . THR A  1 358 ? 5.088   -55.349 -16.272 1.00 160.99 ? 471 THR A OG1    1 
ATOM   5388  C  CG2    . THR A  1 358 ? 3.202   -53.888 -15.938 1.00 149.49 ? 471 THR A CG2    1 
ATOM   5389  H  H      . THR A  1 358 ? 6.565   -54.528 -13.961 1.00 180.43 ? 471 THR A H      1 
ATOM   5390  H  HA     . THR A  1 358 ? 5.755   -52.882 -15.899 1.00 193.73 ? 471 THR A HA     1 
ATOM   5391  H  HB     . THR A  1 358 ? 4.285   -54.896 -14.520 1.00 185.86 ? 471 THR A HB     1 
ATOM   5392  H  HG1    . THR A  1 358 ? 5.777   -55.662 -15.955 1.00 193.19 ? 471 THR A HG1    1 
ATOM   5393  H  HG21   . THR A  1 358 ? 2.595   -54.610 -16.117 1.00 179.39 ? 471 THR A HG21   1 
ATOM   5394  H  HG22   . THR A  1 358 ? 2.788   -53.279 -15.322 1.00 179.39 ? 471 THR A HG22   1 
ATOM   5395  H  HG23   . THR A  1 358 ? 3.386   -53.425 -16.758 1.00 179.39 ? 471 THR A HG23   1 
ATOM   5396  N  N      . ALA A  1 359 ? 4.984   -52.332 -12.884 1.00 165.01 ? 472 ALA A N      1 
ATOM   5397  C  CA     . ALA A  1 359 ? 4.448   -51.355 -11.946 1.00 152.89 ? 472 ALA A CA     1 
ATOM   5398  C  C      . ALA A  1 359 ? 5.275   -50.075 -11.983 1.00 161.97 ? 472 ALA A C      1 
ATOM   5399  O  O      . ALA A  1 359 ? 4.729   -48.972 -11.962 1.00 164.60 ? 472 ALA A O      1 
ATOM   5400  C  CB     . ALA A  1 359 ? 4.429   -51.933 -10.540 1.00 130.08 ? 472 ALA A CB     1 
ATOM   5401  H  H      . ALA A  1 359 ? 5.420   -52.972 -12.509 1.00 198.01 ? 472 ALA A H      1 
ATOM   5402  H  HA     . ALA A  1 359 ? 3.527   -51.134 -12.200 1.00 183.46 ? 472 ALA A HA     1 
ATOM   5403  H  HB1    . ALA A  1 359 ? 4.074   -51.276 -9.938  1.00 156.10 ? 472 ALA A HB1    1 
ATOM   5404  H  HB2    . ALA A  1 359 ? 3.877   -52.718 -10.533 1.00 156.10 ? 472 ALA A HB2    1 
ATOM   5405  H  HB3    . ALA A  1 359 ? 5.326   -52.160 -10.285 1.00 156.10 ? 472 ALA A HB3    1 
ATOM   5406  N  N      . LYS A  1 360 ? 6.595   -50.227 -12.038 1.00 159.40 ? 473 LYS A N      1 
ATOM   5407  C  CA     . LYS A  1 360 ? 7.495   -49.080 -12.092 1.00 151.97 ? 473 LYS A CA     1 
ATOM   5408  C  C      . LYS A  1 360 ? 7.321   -48.294 -13.387 1.00 171.45 ? 473 LYS A C      1 
ATOM   5409  O  O      . LYS A  1 360 ? 7.497   -47.076 -13.407 1.00 175.80 ? 473 LYS A O      1 
ATOM   5410  C  CB     . LYS A  1 360 ? 8.953   -49.530 -11.956 1.00 130.31 ? 473 LYS A CB     1 
ATOM   5411  C  CG     . LYS A  1 360 ? 9.377   -49.868 -10.534 1.00 115.69 ? 473 LYS A CG     1 
ATOM   5412  C  CD     . LYS A  1 360 ? 10.883  -50.065 -10.445 1.00 122.33 ? 473 LYS A CD     1 
ATOM   5413  C  CE     . LYS A  1 360 ? 11.351  -50.176 -9.003  1.00 135.87 ? 473 LYS A CE     1 
ATOM   5414  N  NZ     . LYS A  1 360 ? 12.837  -50.221 -8.903  1.00 142.31 ? 473 LYS A NZ     1 
ATOM   5415  H  H      . LYS A  1 360 ? 6.996   -50.988 -12.045 1.00 191.28 ? 473 LYS A H      1 
ATOM   5416  H  HA     . LYS A  1 360 ? 7.293   -48.481 -11.344 1.00 182.36 ? 473 LYS A HA     1 
ATOM   5417  H  HB2    . LYS A  1 360 ? 9.085   -50.323 -12.499 1.00 156.38 ? 473 LYS A HB2    1 
ATOM   5418  H  HB3    . LYS A  1 360 ? 9.529   -48.817 -12.273 1.00 156.38 ? 473 LYS A HB3    1 
ATOM   5419  H  HG2    . LYS A  1 360 ? 9.128   -49.141 -9.943  1.00 138.83 ? 473 LYS A HG2    1 
ATOM   5420  H  HG3    . LYS A  1 360 ? 8.945   -50.691 -10.257 1.00 138.83 ? 473 LYS A HG3    1 
ATOM   5421  H  HD2    . LYS A  1 360 ? 11.127  -50.882 -10.907 1.00 146.80 ? 473 LYS A HD2    1 
ATOM   5422  H  HD3    . LYS A  1 360 ? 11.329  -49.305 -10.850 1.00 146.80 ? 473 LYS A HD3    1 
ATOM   5423  H  HE2    . LYS A  1 360 ? 11.037  -49.405 -8.505  1.00 163.04 ? 473 LYS A HE2    1 
ATOM   5424  H  HE3    . LYS A  1 360 ? 10.997  -50.992 -8.615  1.00 163.04 ? 473 LYS A HE3    1 
ATOM   5425  H  HZ1    . LYS A  1 360 ? 13.082  -50.286 -8.050  1.00 170.77 ? 473 LYS A HZ1    1 
ATOM   5426  H  HZ2    . LYS A  1 360 ? 13.150  -50.924 -9.349  1.00 170.77 ? 473 LYS A HZ2    1 
ATOM   5427  H  HZ3    . LYS A  1 360 ? 13.187  -49.479 -9.249  1.00 170.77 ? 473 LYS A HZ3    1 
ATOM   5428  N  N      . ARG A  1 361 ? 6.979   -48.993 -14.466 1.00 192.92 ? 474 ARG A N      1 
ATOM   5429  C  CA     . ARG A  1 361 ? 6.808   -48.355 -15.768 1.00 113.80 ? 474 ARG A CA     1 
ATOM   5430  C  C      . ARG A  1 361 ? 5.354   -47.979 -16.044 1.00 117.84 ? 474 ARG A C      1 
ATOM   5431  O  O      . ARG A  1 361 ? 5.050   -47.381 -17.078 1.00 115.57 ? 474 ARG A O      1 
ATOM   5432  C  CB     . ARG A  1 361 ? 7.310   -49.273 -16.885 1.00 130.97 ? 474 ARG A CB     1 
ATOM   5433  C  CG     . ARG A  1 361 ? 8.818   -49.448 -16.929 1.00 148.88 ? 474 ARG A CG     1 
ATOM   5434  C  CD     . ARG A  1 361 ? 9.248   -50.111 -18.229 1.00 160.50 ? 474 ARG A CD     1 
ATOM   5435  N  NE     . ARG A  1 361 ? 8.486   -51.328 -18.506 1.00 163.95 ? 474 ARG A NE     1 
ATOM   5436  C  CZ     . ARG A  1 361 ? 8.963   -52.569 -18.432 1.00 174.70 ? 474 ARG A CZ     1 
ATOM   5437  N  NH1    . ARG A  1 361 ? 10.226  -52.804 -18.096 1.00 180.67 ? 474 ARG A NH1    1 
ATOM   5438  N  NH2    . ARG A  1 361 ? 8.168   -53.592 -18.704 1.00 177.07 ? 474 ARG A NH2    1 
ATOM   5439  H  H      . ARG A  1 361 ? 6.840   -49.841 -14.470 1.00 231.51 ? 474 ARG A H      1 
ATOM   5440  H  HA     . ARG A  1 361 ? 7.342   -47.533 -15.790 1.00 136.56 ? 474 ARG A HA     1 
ATOM   5441  H  HB2    . ARG A  1 361 ? 6.916   -50.151 -16.765 1.00 157.16 ? 474 ARG A HB2    1 
ATOM   5442  H  HB3    . ARG A  1 361 ? 7.032   -48.903 -17.737 1.00 157.16 ? 474 ARG A HB3    1 
ATOM   5443  H  HG2    . ARG A  1 361 ? 9.245   -48.579 -16.873 1.00 178.66 ? 474 ARG A HG2    1 
ATOM   5444  H  HG3    . ARG A  1 361 ? 9.099   -50.010 -16.191 1.00 178.66 ? 474 ARG A HG3    1 
ATOM   5445  H  HD2    . ARG A  1 361 ? 9.108   -49.493 -18.963 1.00 192.60 ? 474 ARG A HD2    1 
ATOM   5446  H  HD3    . ARG A  1 361 ? 10.187  -50.350 -18.169 1.00 192.60 ? 474 ARG A HD3    1 
ATOM   5447  H  HE     . ARG A  1 361 ? 7.662   -51.235 -18.735 1.00 196.74 ? 474 ARG A HE     1 
ATOM   5448  H  HH11   . ARG A  1 361 ? 10.752  -52.147 -17.917 1.00 216.81 ? 474 ARG A HH11   1 
ATOM   5449  H  HH12   . ARG A  1 361 ? 10.518  -53.612 -18.055 1.00 216.81 ? 474 ARG A HH12   1 
ATOM   5450  H  HH21   . ARG A  1 361 ? 7.348   -53.453 -18.925 1.00 212.48 ? 474 ARG A HH21   1 
ATOM   5451  H  HH22   . ARG A  1 361 ? 8.471   -54.396 -18.661 1.00 212.48 ? 474 ARG A HH22   1 
ATOM   5452  N  N      . GLN A  1 362 ? 4.457   -48.329 -15.127 1.00 198.59 ? 475 GLN A N      1 
ATOM   5453  C  CA     . GLN A  1 362 ? 3.040   -48.037 -15.312 1.00 178.44 ? 475 GLN A CA     1 
ATOM   5454  C  C      . GLN A  1 362 ? 2.794   -46.529 -15.387 1.00 167.02 ? 475 GLN A C      1 
ATOM   5455  O  O      . GLN A  1 362 ? 2.043   -46.063 -16.246 1.00 163.87 ? 475 GLN A O      1 
ATOM   5456  C  CB     . GLN A  1 362 ? 2.203   -48.659 -14.190 1.00 164.57 ? 475 GLN A CB     1 
ATOM   5457  C  CG     . GLN A  1 362 ? 0.714   -48.694 -14.483 1.00 152.78 ? 475 GLN A CG     1 
ATOM   5458  C  CD     . GLN A  1 362 ? 0.387   -49.494 -15.728 1.00 140.51 ? 475 GLN A CD     1 
ATOM   5459  O  OE1    . GLN A  1 362 ? 0.201   -50.710 -15.666 1.00 155.88 ? 475 GLN A OE1    1 
ATOM   5460  N  NE2    . GLN A  1 362 ? 0.322   -48.817 -16.868 1.00 118.27 ? 475 GLN A NE2    1 
ATOM   5461  H  H      . GLN A  1 362 ? 4.642   -48.735 -14.393 1.00 238.31 ? 475 GLN A H      1 
ATOM   5462  H  HA     . GLN A  1 362 ? 2.744   -48.431 -16.160 1.00 214.12 ? 475 GLN A HA     1 
ATOM   5463  H  HB2    . GLN A  1 362 ? 2.498   -49.573 -14.050 1.00 197.48 ? 475 GLN A HB2    1 
ATOM   5464  H  HB3    . GLN A  1 362 ? 2.333   -48.143 -13.380 1.00 197.48 ? 475 GLN A HB3    1 
ATOM   5465  H  HG2    . GLN A  1 362 ? 0.253   -49.101 -13.734 1.00 183.34 ? 475 GLN A HG2    1 
ATOM   5466  H  HG3    . GLN A  1 362 ? 0.397   -47.787 -14.617 1.00 183.34 ? 475 GLN A HG3    1 
ATOM   5467  H  HE21   . GLN A  1 362 ? 0.461   -47.968 -16.872 1.00 141.93 ? 475 GLN A HE21   1 
ATOM   5468  H  HE22   . GLN A  1 362 ? 0.139   -49.226 -17.602 1.00 141.93 ? 475 GLN A HE22   1 
ATOM   5469  N  N      . PRO A  1 363 ? 3.427   -45.759 -14.485 1.00 147.58 ? 476 PRO A N      1 
ATOM   5470  C  CA     . PRO A  1 363 ? 3.296   -44.300 -14.534 1.00 134.50 ? 476 PRO A CA     1 
ATOM   5471  C  C      . PRO A  1 363 ? 3.835   -43.720 -15.837 1.00 140.49 ? 476 PRO A C      1 
ATOM   5472  O  O      . PRO A  1 363 ? 3.161   -42.919 -16.483 1.00 150.35 ? 476 PRO A O      1 
ATOM   5473  C  CB     . PRO A  1 363 ? 4.159   -43.829 -13.357 1.00 116.37 ? 476 PRO A CB     1 
ATOM   5474  C  CG     . PRO A  1 363 ? 4.264   -45.002 -12.455 1.00 113.97 ? 476 PRO A CG     1 
ATOM   5475  C  CD     . PRO A  1 363 ? 4.256   -46.197 -13.350 1.00 134.16 ? 476 PRO A CD     1 
ATOM   5476  H  HA     . PRO A  1 363 ? 2.365   -44.024 -14.400 1.00 161.40 ? 476 PRO A HA     1 
ATOM   5477  H  HB2    . PRO A  1 363 ? 5.035   -43.566 -13.680 1.00 139.65 ? 476 PRO A HB2    1 
ATOM   5478  H  HB3    . PRO A  1 363 ? 3.722   -43.089 -12.907 1.00 139.65 ? 476 PRO A HB3    1 
ATOM   5479  H  HG2    . PRO A  1 363 ? 5.094   -44.955 -11.955 1.00 136.77 ? 476 PRO A HG2    1 
ATOM   5480  H  HG3    . PRO A  1 363 ? 3.503   -45.020 -11.853 1.00 136.77 ? 476 PRO A HG3    1 
ATOM   5481  H  HD2    . PRO A  1 363 ? 5.156   -46.404 -13.647 1.00 161.00 ? 476 PRO A HD2    1 
ATOM   5482  H  HD3    . PRO A  1 363 ? 3.845   -46.953 -12.901 1.00 161.00 ? 476 PRO A HD3    1 
ATOM   5483  N  N      . ILE A  1 364 ? 5.042   -44.132 -16.212 1.00 129.99 ? 477 ILE A N      1 
ATOM   5484  C  CA     . ILE A  1 364 ? 5.705   -43.597 -17.396 1.00 122.52 ? 477 ILE A CA     1 
ATOM   5485  C  C      . ILE A  1 364 ? 4.877   -43.852 -18.652 1.00 138.20 ? 477 ILE A C      1 
ATOM   5486  O  O      . ILE A  1 364 ? 4.901   -43.058 -19.592 1.00 147.87 ? 477 ILE A O      1 
ATOM   5487  C  CB     . ILE A  1 364 ? 7.109   -44.207 -17.578 1.00 107.63 ? 477 ILE A CB     1 
ATOM   5488  C  CG1    . ILE A  1 364 ? 7.986   -43.886 -16.366 1.00 108.82 ? 477 ILE A CG1    1 
ATOM   5489  C  CG2    . ILE A  1 364 ? 7.758   -43.678 -18.850 1.00 114.28 ? 477 ILE A CG2    1 
ATOM   5490  C  CD1    . ILE A  1 364 ? 9.411   -44.384 -16.483 1.00 112.68 ? 477 ILE A CD1    1 
ATOM   5491  H  H      . ILE A  1 364 ? 5.502   -44.725 -15.793 1.00 155.99 ? 477 ILE A H      1 
ATOM   5492  H  HA     . ILE A  1 364 ? 5.807   -42.628 -17.293 1.00 147.03 ? 477 ILE A HA     1 
ATOM   5493  H  HB     . ILE A  1 364 ? 7.022   -45.170 -17.652 1.00 129.16 ? 477 ILE A HB     1 
ATOM   5494  H  HG12   . ILE A  1 364 ? 8.018   -42.923 -16.251 1.00 130.59 ? 477 ILE A HG12   1 
ATOM   5495  H  HG13   . ILE A  1 364 ? 7.594   -44.297 -15.580 1.00 130.59 ? 477 ILE A HG13   1 
ATOM   5496  H  HG21   . ILE A  1 364 ? 8.629   -44.070 -18.943 1.00 137.14 ? 477 ILE A HG21   1 
ATOM   5497  H  HG22   . ILE A  1 364 ? 7.210   -43.915 -19.602 1.00 137.14 ? 477 ILE A HG22   1 
ATOM   5498  H  HG23   . ILE A  1 364 ? 7.833   -42.723 -18.788 1.00 137.14 ? 477 ILE A HG23   1 
ATOM   5499  H  HD11   . ILE A  1 364 ? 9.892   -44.144 -15.688 1.00 135.22 ? 477 ILE A HD11   1 
ATOM   5500  H  HD12   . ILE A  1 364 ? 9.401   -45.338 -16.585 1.00 135.22 ? 477 ILE A HD12   1 
ATOM   5501  H  HD13   . ILE A  1 364 ? 9.821   -43.977 -17.250 1.00 135.22 ? 477 ILE A HD13   1 
ATOM   5502  N  N      . LEU A  1 365 ? 4.143   -44.960 -18.662 1.00 141.23 ? 478 LEU A N      1 
ATOM   5503  C  CA     . LEU A  1 365 ? 3.312   -45.310 -19.807 1.00 153.30 ? 478 LEU A CA     1 
ATOM   5504  C  C      . LEU A  1 365 ? 1.979   -44.570 -19.770 1.00 163.19 ? 478 LEU A C      1 
ATOM   5505  O  O      . LEU A  1 365 ? 1.417   -44.236 -20.813 1.00 167.58 ? 478 LEU A O      1 
ATOM   5506  C  CB     . LEU A  1 365 ? 3.077   -46.820 -19.851 1.00 155.56 ? 478 LEU A CB     1 
ATOM   5507  C  CG     . LEU A  1 365 ? 4.314   -47.660 -20.176 1.00 149.37 ? 478 LEU A CG     1 
ATOM   5508  C  CD1    . LEU A  1 365 ? 4.003   -49.141 -20.038 1.00 151.94 ? 478 LEU A CD1    1 
ATOM   5509  C  CD2    . LEU A  1 365 ? 4.823   -47.347 -21.574 1.00 143.21 ? 478 LEU A CD2    1 
ATOM   5510  H  H      . LEU A  1 365 ? 4.108   -45.526 -18.015 1.00 169.48 ? 478 LEU A H      1 
ATOM   5511  H  HA     . LEU A  1 365 ? 3.779   -45.052 -20.630 1.00 183.96 ? 478 LEU A HA     1 
ATOM   5512  H  HB2    . LEU A  1 365 ? 2.749   -47.106 -18.985 1.00 186.67 ? 478 LEU A HB2    1 
ATOM   5513  H  HB3    . LEU A  1 365 ? 2.410   -47.008 -20.530 1.00 186.67 ? 478 LEU A HB3    1 
ATOM   5514  H  HG     . LEU A  1 365 ? 5.018   -47.442 -19.545 1.00 179.25 ? 478 LEU A HG     1 
ATOM   5515  H  HD11   . LEU A  1 365 ? 4.793   -49.646 -20.246 1.00 182.33 ? 478 LEU A HD11   1 
ATOM   5516  H  HD12   . LEU A  1 365 ? 3.728   -49.320 -19.136 1.00 182.33 ? 478 LEU A HD12   1 
ATOM   5517  H  HD13   . LEU A  1 365 ? 3.298   -49.370 -20.648 1.00 182.33 ? 478 LEU A HD13   1 
ATOM   5518  H  HD21   . LEU A  1 365 ? 5.597   -47.886 -21.752 1.00 171.86 ? 478 LEU A HD21   1 
ATOM   5519  H  HD22   . LEU A  1 365 ? 4.132   -47.546 -22.210 1.00 171.86 ? 478 LEU A HD22   1 
ATOM   5520  H  HD23   . LEU A  1 365 ? 5.054   -46.416 -21.621 1.00 171.86 ? 478 LEU A HD23   1 
ATOM   5521  N  N      . ASP A  1 366 ? 1.475   -44.318 -18.567 1.00 169.01 ? 479 ASP A N      1 
ATOM   5522  C  CA     . ASP A  1 366 ? 0.236   -43.570 -18.408 1.00 174.00 ? 479 ASP A CA     1 
ATOM   5523  C  C      . ASP A  1 366 ? 0.468   -42.114 -18.799 1.00 158.26 ? 479 ASP A C      1 
ATOM   5524  O  O      . ASP A  1 366 ? -0.431  -41.445 -19.310 1.00 146.76 ? 479 ASP A O      1 
ATOM   5525  C  CB     . ASP A  1 366 ? -0.259  -43.659 -16.964 1.00 194.25 ? 479 ASP A CB     1 
ATOM   5526  C  CG     . ASP A  1 366 ? -1.721  -43.280 -16.823 1.00 212.48 ? 479 ASP A CG     1 
ATOM   5527  O  OD1    . ASP A  1 366 ? -2.234  -42.540 -17.688 1.00 215.87 ? 479 ASP A OD1    1 
ATOM   5528  O  OD2    . ASP A  1 366 ? -2.359  -43.726 -15.846 1.00 222.30 ? 479 ASP A OD2    1 
ATOM   5529  H  H      . ASP A  1 366 ? 1.833   -44.569 -17.827 1.00 202.81 ? 479 ASP A H      1 
ATOM   5530  H  HA     . ASP A  1 366 ? -0.451  -43.945 -18.997 1.00 208.80 ? 479 ASP A HA     1 
ATOM   5531  H  HB2    . ASP A  1 366 ? -0.153  -44.570 -16.648 1.00 233.09 ? 479 ASP A HB2    1 
ATOM   5532  H  HB3    . ASP A  1 366 ? 0.262   -43.054 -16.413 1.00 233.09 ? 479 ASP A HB3    1 
ATOM   5533  N  N      . ALA A  1 367 ? 1.682   -41.629 -18.557 1.00 158.36 ? 480 ALA A N      1 
ATOM   5534  C  CA     . ALA A  1 367 ? 2.051   -40.267 -18.919 1.00 159.87 ? 480 ALA A CA     1 
ATOM   5535  C  C      . ALA A  1 367 ? 2.224   -40.154 -20.428 1.00 162.23 ? 480 ALA A C      1 
ATOM   5536  O  O      . ALA A  1 367 ? 1.717   -39.222 -21.053 1.00 168.04 ? 480 ALA A O      1 
ATOM   5537  C  CB     . ALA A  1 367 ? 3.331   -39.860 -18.209 1.00 158.61 ? 480 ALA A CB     1 
ATOM   5538  H  H      . ALA A  1 367 ? 2.315   -42.075 -18.182 1.00 190.03 ? 480 ALA A H      1 
ATOM   5539  H  HA     . ALA A  1 367 ? 1.338   -39.654 -18.644 1.00 191.85 ? 480 ALA A HA     1 
ATOM   5540  H  HB1    . ALA A  1 367 ? 3.555   -38.961 -18.461 1.00 190.33 ? 480 ALA A HB1    1 
ATOM   5541  H  HB2    . ALA A  1 367 ? 3.191   -39.909 -17.261 1.00 190.33 ? 480 ALA A HB2    1 
ATOM   5542  H  HB3    . ALA A  1 367 ? 4.035   -40.458 -18.468 1.00 190.33 ? 480 ALA A HB3    1 
ATOM   5543  N  N      . MET A  1 368 ? 2.946   -41.108 -21.008 1.00 154.62 ? 481 MET A N      1 
ATOM   5544  C  CA     . MET A  1 368 ? 3.138   -41.140 -22.451 1.00 159.07 ? 481 MET A CA     1 
ATOM   5545  C  C      . MET A  1 368 ? 1.795   -41.270 -23.160 1.00 171.67 ? 481 MET A C      1 
ATOM   5546  O  O      . MET A  1 368 ? 1.627   -40.785 -24.278 1.00 177.87 ? 481 MET A O      1 
ATOM   5547  C  CB     . MET A  1 368 ? 4.061   -42.293 -22.848 1.00 159.69 ? 481 MET A CB     1 
ATOM   5548  C  CG     . MET A  1 368 ? 5.535   -42.016 -22.593 1.00 162.69 ? 481 MET A CG     1 
ATOM   5549  S  SD     . MET A  1 368 ? 6.619   -43.343 -23.158 1.00 162.82 ? 481 MET A SD     1 
ATOM   5550  C  CE     . MET A  1 368 ? 6.330   -43.300 -24.925 1.00 154.91 ? 481 MET A CE     1 
ATOM   5551  H  H      . MET A  1 368 ? 3.335   -41.748 -20.586 1.00 185.54 ? 481 MET A H      1 
ATOM   5552  H  HA     . MET A  1 368 ? 3.564   -40.303 -22.732 1.00 190.89 ? 481 MET A HA     1 
ATOM   5553  H  HB2    . MET A  1 368 ? 3.815   -43.080 -22.337 1.00 191.62 ? 481 MET A HB2    1 
ATOM   5554  H  HB3    . MET A  1 368 ? 3.952   -42.469 -23.795 1.00 191.62 ? 481 MET A HB3    1 
ATOM   5555  H  HG2    . MET A  1 368 ? 5.788   -41.205 -23.061 1.00 195.23 ? 481 MET A HG2    1 
ATOM   5556  H  HG3    . MET A  1 368 ? 5.674   -41.903 -21.639 1.00 195.23 ? 481 MET A HG3    1 
ATOM   5557  H  HE1    . MET A  1 368 ? 6.864   -43.977 -25.345 1.00 185.89 ? 481 MET A HE1    1 
ATOM   5558  H  HE2    . MET A  1 368 ? 5.399   -43.465 -25.093 1.00 185.89 ? 481 MET A HE2    1 
ATOM   5559  H  HE3    . MET A  1 368 ? 6.575   -42.434 -25.260 1.00 185.89 ? 481 MET A HE3    1 
ATOM   5560  N  N      . ASP A  1 369 ? 0.839   -41.923 -22.507 1.00 177.64 ? 482 ASP A N      1 
ATOM   5561  C  CA     . ASP A  1 369 ? -0.507  -42.040 -23.056 1.00 188.68 ? 482 ASP A CA     1 
ATOM   5562  C  C      . ASP A  1 369 ? -1.107  -40.657 -23.275 1.00 195.56 ? 482 ASP A C      1 
ATOM   5563  O  O      . ASP A  1 369 ? -1.628  -40.360 -24.349 1.00 202.66 ? 482 ASP A O      1 
ATOM   5564  C  CB     . ASP A  1 369 ? -1.405  -42.858 -22.125 1.00 192.00 ? 482 ASP A CB     1 
ATOM   5565  C  CG     . ASP A  1 369 ? -1.257  -44.353 -22.335 1.00 194.62 ? 482 ASP A CG     1 
ATOM   5566  O  OD1    . ASP A  1 369 ? -1.043  -44.775 -23.491 1.00 192.82 ? 482 ASP A OD1    1 
ATOM   5567  O  OD2    . ASP A  1 369 ? -1.360  -45.107 -21.344 1.00 195.88 ? 482 ASP A OD2    1 
ATOM   5568  H  H      . ASP A  1 369 ? 0.944   -42.308 -21.745 1.00 213.17 ? 482 ASP A H      1 
ATOM   5569  H  HA     . ASP A  1 369 ? -0.464  -42.497 -23.922 1.00 226.41 ? 482 ASP A HA     1 
ATOM   5570  H  HB2    . ASP A  1 369 ? -1.171  -42.660 -21.205 1.00 230.41 ? 482 ASP A HB2    1 
ATOM   5571  H  HB3    . ASP A  1 369 ? -2.331  -42.622 -22.291 1.00 230.41 ? 482 ASP A HB3    1 
ATOM   5572  N  N      . ALA A  1 370 ? -1.023  -39.812 -22.252 1.00 191.39 ? 483 ALA A N      1 
ATOM   5573  C  CA     . ALA A  1 370 ? -1.568  -38.463 -22.329 1.00 187.21 ? 483 ALA A CA     1 
ATOM   5574  C  C      . ALA A  1 370 ? -0.886  -37.659 -23.430 1.00 184.22 ? 483 ALA A C      1 
ATOM   5575  O  O      . ALA A  1 370 ? -1.551  -37.022 -24.245 1.00 191.53 ? 483 ALA A O      1 
ATOM   5576  C  CB     . ALA A  1 370 ? -1.416  -37.758 -20.992 1.00 187.52 ? 483 ALA A CB     1 
ATOM   5577  H  H      . ALA A  1 370 ? -0.653  -39.998 -21.499 1.00 229.67 ? 483 ALA A H      1 
ATOM   5578  H  HA     . ALA A  1 370 ? -2.524  -38.515 -22.539 1.00 224.65 ? 483 ALA A HA     1 
ATOM   5579  H  HB1    . ALA A  1 370 ? -1.780  -36.873 -21.063 1.00 225.02 ? 483 ALA A HB1    1 
ATOM   5580  H  HB2    . ALA A  1 370 ? -1.891  -38.255 -20.322 1.00 225.02 ? 483 ALA A HB2    1 
ATOM   5581  H  HB3    . ALA A  1 370 ? -0.484  -37.713 -20.768 1.00 225.02 ? 483 ALA A HB3    1 
ATOM   5582  N  N      . LYS A  1 371 ? 0.443   -37.695 -23.454 1.00 173.81 ? 484 LYS A N      1 
ATOM   5583  C  CA     . LYS A  1 371 ? 1.210   -36.926 -24.429 1.00 164.69 ? 484 LYS A CA     1 
ATOM   5584  C  C      . LYS A  1 371 ? 0.941   -37.388 -25.861 1.00 159.33 ? 484 LYS A C      1 
ATOM   5585  O  O      . LYS A  1 371 ? 1.088   -36.614 -26.807 1.00 141.08 ? 484 LYS A O      1 
ATOM   5586  C  CB     . LYS A  1 371 ? 2.707   -37.016 -24.118 1.00 159.40 ? 484 LYS A CB     1 
ATOM   5587  C  CG     . LYS A  1 371 ? 3.099   -36.405 -22.781 1.00 150.03 ? 484 LYS A CG     1 
ATOM   5588  C  CD     . LYS A  1 371 ? 2.796   -34.915 -22.739 1.00 162.98 ? 484 LYS A CD     1 
ATOM   5589  C  CE     . LYS A  1 371 ? 3.101   -34.316 -21.375 1.00 172.60 ? 484 LYS A CE     1 
ATOM   5590  N  NZ     . LYS A  1 371 ? 4.547   -34.393 -21.031 1.00 175.39 ? 484 LYS A NZ     1 
ATOM   5591  H  H      . LYS A  1 371 ? 0.926   -38.159 -22.914 1.00 208.57 ? 484 LYS A H      1 
ATOM   5592  H  HA     . LYS A  1 371 ? 0.947   -35.985 -24.364 1.00 197.63 ? 484 LYS A HA     1 
ATOM   5593  H  HB2    . LYS A  1 371 ? 2.967   -37.950 -24.104 1.00 191.27 ? 484 LYS A HB2    1 
ATOM   5594  H  HB3    . LYS A  1 371 ? 3.198   -36.548 -24.811 1.00 191.27 ? 484 LYS A HB3    1 
ATOM   5595  H  HG2    . LYS A  1 371 ? 2.598   -36.837 -22.072 1.00 180.03 ? 484 LYS A HG2    1 
ATOM   5596  H  HG3    . LYS A  1 371 ? 4.051   -36.526 -22.641 1.00 180.03 ? 484 LYS A HG3    1 
ATOM   5597  H  HD2    . LYS A  1 371 ? 3.342   -34.460 -23.398 1.00 195.57 ? 484 LYS A HD2    1 
ATOM   5598  H  HD3    . LYS A  1 371 ? 1.856   -34.775 -22.928 1.00 195.57 ? 484 LYS A HD3    1 
ATOM   5599  H  HE2    . LYS A  1 371 ? 2.840   -33.382 -21.373 1.00 207.12 ? 484 LYS A HE2    1 
ATOM   5600  H  HE3    . LYS A  1 371 ? 2.605   -34.802 -20.698 1.00 207.12 ? 484 LYS A HE3    1 
ATOM   5601  H  HZ1    . LYS A  1 371 ? 4.688   -34.034 -20.229 1.00 210.46 ? 484 LYS A HZ1    1 
ATOM   5602  H  HZ2    . LYS A  1 371 ? 4.812   -35.242 -21.019 1.00 210.46 ? 484 LYS A HZ2    1 
ATOM   5603  H  HZ3    . LYS A  1 371 ? 5.027   -33.949 -21.635 1.00 210.46 ? 484 LYS A HZ3    1 
ATOM   5604  N  N      . LYS A  1 372 ? 0.549   -38.647 -26.020 1.00 176.28 ? 485 LYS A N      1 
ATOM   5605  C  CA     . LYS A  1 372 ? 0.203   -39.171 -27.336 1.00 181.23 ? 485 LYS A CA     1 
ATOM   5606  C  C      . LYS A  1 372 ? -1.214  -38.761 -27.736 1.00 187.95 ? 485 LYS A C      1 
ATOM   5607  O  O      . LYS A  1 372 ? -1.610  -38.916 -28.892 1.00 191.69 ? 485 LYS A O      1 
ATOM   5608  C  CB     . LYS A  1 372 ? 0.344   -40.695 -27.365 1.00 169.06 ? 485 LYS A CB     1 
ATOM   5609  C  CG     . LYS A  1 372 ? 1.786   -41.182 -27.375 1.00 165.06 ? 485 LYS A CG     1 
ATOM   5610  C  CD     . LYS A  1 372 ? 1.865   -42.697 -27.476 1.00 169.93 ? 485 LYS A CD     1 
ATOM   5611  C  CE     . LYS A  1 372 ? 3.307   -43.178 -27.481 1.00 166.99 ? 485 LYS A CE     1 
ATOM   5612  N  NZ     . LYS A  1 372 ? 3.409   -44.643 -27.721 1.00 156.05 ? 485 LYS A NZ     1 
ATOM   5613  H  H      . LYS A  1 372 ? 0.475   -39.219 -25.382 1.00 211.54 ? 485 LYS A H      1 
ATOM   5614  H  HA     . LYS A  1 372 ? 0.822   -38.798 -27.998 1.00 217.47 ? 485 LYS A HA     1 
ATOM   5615  H  HB2    . LYS A  1 372 ? -0.088  -41.063 -26.578 1.00 202.87 ? 485 LYS A HB2    1 
ATOM   5616  H  HB3    . LYS A  1 372 ? -0.088  -41.033 -28.165 1.00 202.87 ? 485 LYS A HB3    1 
ATOM   5617  H  HG2    . LYS A  1 372 ? 2.247   -40.802 -28.140 1.00 198.07 ? 485 LYS A HG2    1 
ATOM   5618  H  HG3    . LYS A  1 372 ? 2.221   -40.910 -26.552 1.00 198.07 ? 485 LYS A HG3    1 
ATOM   5619  H  HD2    . LYS A  1 372 ? 1.415   -43.093 -26.714 1.00 203.92 ? 485 LYS A HD2    1 
ATOM   5620  H  HD3    . LYS A  1 372 ? 1.445   -42.985 -28.302 1.00 203.92 ? 485 LYS A HD3    1 
ATOM   5621  H  HE2    . LYS A  1 372 ? 3.792   -42.722 -28.186 1.00 200.38 ? 485 LYS A HE2    1 
ATOM   5622  H  HE3    . LYS A  1 372 ? 3.709   -42.985 -26.620 1.00 200.38 ? 485 LYS A HE3    1 
ATOM   5623  H  HZ1    . LYS A  1 372 ? 4.263   -44.893 -27.718 1.00 187.27 ? 485 LYS A HZ1    1 
ATOM   5624  H  HZ2    . LYS A  1 372 ? 2.976   -45.087 -27.083 1.00 187.27 ? 485 LYS A HZ2    1 
ATOM   5625  H  HZ3    . LYS A  1 372 ? 3.051   -44.847 -28.510 1.00 187.27 ? 485 LYS A HZ3    1 
ATOM   5626  N  N      . ARG A  1 373 ? -1.973  -38.238 -26.777 1.00 184.91 ? 486 ARG A N      1 
ATOM   5627  C  CA     . ARG A  1 373 ? -3.330  -37.769 -27.037 1.00 183.47 ? 486 ARG A CA     1 
ATOM   5628  C  C      . ARG A  1 373 ? -3.365  -36.269 -27.323 1.00 192.97 ? 486 ARG A C      1 
ATOM   5629  O  O      . ARG A  1 373 ? -4.296  -35.777 -27.960 1.00 195.26 ? 486 ARG A O      1 
ATOM   5630  C  CB     . ARG A  1 373 ? -4.242  -38.078 -25.846 1.00 178.50 ? 486 ARG A CB     1 
ATOM   5631  C  CG     . ARG A  1 373 ? -4.561  -39.552 -25.655 1.00 180.74 ? 486 ARG A CG     1 
ATOM   5632  C  CD     . ARG A  1 373 ? -5.671  -39.746 -24.631 1.00 176.03 ? 486 ARG A CD     1 
ATOM   5633  N  NE     . ARG A  1 373 ? -5.979  -41.158 -24.406 1.00 178.91 ? 486 ARG A NE     1 
ATOM   5634  C  CZ     . ARG A  1 373 ? -5.509  -41.894 -23.400 1.00 185.27 ? 486 ARG A CZ     1 
ATOM   5635  N  NH1    . ARG A  1 373 ? -4.698  -41.371 -22.489 1.00 189.80 ? 486 ARG A NH1    1 
ATOM   5636  N  NH2    . ARG A  1 373 ? -5.858  -43.168 -23.300 1.00 184.82 ? 486 ARG A NH2    1 
ATOM   5637  H  H      . ARG A  1 373 ? -1.721  -38.143 -25.960 1.00 221.89 ? 486 ARG A H      1 
ATOM   5638  H  HA     . ARG A  1 373 ? -3.685  -38.237 -27.821 1.00 220.16 ? 486 ARG A HA     1 
ATOM   5639  H  HB2    . ARG A  1 373 ? -3.810  -37.764 -25.036 1.00 214.20 ? 486 ARG A HB2    1 
ATOM   5640  H  HB3    . ARG A  1 373 ? -5.082  -37.610 -25.970 1.00 214.20 ? 486 ARG A HB3    1 
ATOM   5641  H  HG2    . ARG A  1 373 ? -4.855  -39.929 -26.499 1.00 216.89 ? 486 ARG A HG2    1 
ATOM   5642  H  HG3    . ARG A  1 373 ? -3.769  -40.014 -25.338 1.00 216.89 ? 486 ARG A HG3    1 
ATOM   5643  H  HD2    . ARG A  1 373 ? -5.394  -39.360 -23.785 1.00 211.24 ? 486 ARG A HD2    1 
ATOM   5644  H  HD3    . ARG A  1 373 ? -6.476  -39.309 -24.949 1.00 211.24 ? 486 ARG A HD3    1 
ATOM   5645  H  HE     . ARG A  1 373 ? -6.505  -41.543 -24.967 1.00 214.70 ? 486 ARG A HE     1 
ATOM   5646  H  HH11   . ARG A  1 373 ? -4.464  -40.545 -22.543 1.00 227.76 ? 486 ARG A HH11   1 
ATOM   5647  H  HH12   . ARG A  1 373 ? -4.403  -41.859 -21.844 1.00 227.76 ? 486 ARG A HH12   1 
ATOM   5648  H  HH21   . ARG A  1 373 ? -6.384  -43.517 -23.884 1.00 221.79 ? 486 ARG A HH21   1 
ATOM   5649  H  HH22   . ARG A  1 373 ? -5.558  -43.646 -22.651 1.00 221.79 ? 486 ARG A HH22   1 
ATOM   5650  N  N      . ARG A  1 374 ? -2.354  -35.546 -26.851 1.00 201.12 ? 487 ARG A N      1 
ATOM   5651  C  CA     . ARG A  1 374 ? -2.333  -34.090 -26.979 1.00 201.65 ? 487 ARG A CA     1 
ATOM   5652  C  C      . ARG A  1 374 ? -1.859  -33.636 -28.359 1.00 210.05 ? 487 ARG A C      1 
ATOM   5653  O  O      . ARG A  1 374 ? -2.487  -32.784 -28.986 1.00 207.01 ? 487 ARG A O      1 
ATOM   5654  C  CB     . ARG A  1 374 ? -1.459  -33.469 -25.882 1.00 189.57 ? 487 ARG A CB     1 
ATOM   5655  C  CG     . ARG A  1 374 ? -1.967  -33.722 -24.466 1.00 183.18 ? 487 ARG A CG     1 
ATOM   5656  C  CD     . ARG A  1 374 ? -3.334  -33.091 -24.229 1.00 185.89 ? 487 ARG A CD     1 
ATOM   5657  N  NE     . ARG A  1 374 ? -3.987  -33.615 -23.032 1.00 188.41 ? 487 ARG A NE     1 
ATOM   5658  C  CZ     . ARG A  1 374 ? -5.236  -33.332 -22.673 1.00 183.33 ? 487 ARG A CZ     1 
ATOM   5659  N  NH1    . ARG A  1 374 ? -5.980  -32.524 -23.416 1.00 182.70 ? 487 ARG A NH1    1 
ATOM   5660  N  NH2    . ARG A  1 374 ? -5.744  -33.859 -21.569 1.00 175.83 ? 487 ARG A NH2    1 
ATOM   5661  H  H      . ARG A  1 374 ? -1.666  -35.873 -26.452 1.00 241.34 ? 487 ARG A H      1 
ATOM   5662  H  HA     . ARG A  1 374 ? -3.246  -33.754 -26.855 1.00 241.98 ? 487 ARG A HA     1 
ATOM   5663  H  HB2    . ARG A  1 374 ? -0.566  -33.841 -25.948 1.00 227.48 ? 487 ARG A HB2    1 
ATOM   5664  H  HB3    . ARG A  1 374 ? -1.425  -32.509 -26.017 1.00 227.48 ? 487 ARG A HB3    1 
ATOM   5665  H  HG2    . ARG A  1 374 ? -2.045  -34.678 -24.321 1.00 219.82 ? 487 ARG A HG2    1 
ATOM   5666  H  HG3    . ARG A  1 374 ? -1.343  -33.338 -23.830 1.00 219.82 ? 487 ARG A HG3    1 
ATOM   5667  H  HD2    . ARG A  1 374 ? -3.228  -32.134 -24.120 1.00 223.06 ? 487 ARG A HD2    1 
ATOM   5668  H  HD3    . ARG A  1 374 ? -3.906  -33.279 -24.990 1.00 223.06 ? 487 ARG A HD3    1 
ATOM   5669  H  HE     . ARG A  1 374 ? -3.533  -34.142 -22.525 1.00 226.09 ? 487 ARG A HE     1 
ATOM   5670  H  HH11   . ARG A  1 374 ? -5.656  -32.180 -24.134 1.00 219.24 ? 487 ARG A HH11   1 
ATOM   5671  H  HH12   . ARG A  1 374 ? -6.787  -32.344 -23.179 1.00 219.24 ? 487 ARG A HH12   1 
ATOM   5672  H  HH21   . ARG A  1 374 ? -5.266  -34.383 -21.083 1.00 211.00 ? 487 ARG A HH21   1 
ATOM   5673  H  HH22   . ARG A  1 374 ? -6.552  -33.674 -21.336 1.00 211.00 ? 487 ARG A HH22   1 
ATOM   5674  N  N      . GLN A  1 375 ? -0.754  -34.203 -28.831 1.00 223.39 ? 488 GLN A N      1 
ATOM   5675  C  CA     . GLN A  1 375 ? -0.236  -33.859 -30.149 1.00 137.91 ? 488 GLN A CA     1 
ATOM   5676  C  C      . GLN A  1 375 ? -1.223  -34.276 -31.235 1.00 141.07 ? 488 GLN A C      1 
ATOM   5677  O  O      . GLN A  1 375 ? -0.895  -34.279 -32.421 1.00 144.23 ? 488 GLN A O      1 
ATOM   5678  C  CB     . GLN A  1 375 ? 1.119   -34.526 -30.390 1.00 161.11 ? 488 GLN A CB     1 
ATOM   5679  C  CG     . GLN A  1 375 ? 2.261   -33.925 -29.587 1.00 179.09 ? 488 GLN A CG     1 
ATOM   5680  C  CD     . GLN A  1 375 ? 3.601   -34.545 -29.931 1.00 191.69 ? 488 GLN A CD     1 
ATOM   5681  O  OE1    . GLN A  1 375 ? 3.712   -35.323 -30.879 1.00 192.17 ? 488 GLN A OE1    1 
ATOM   5682  N  NE2    . GLN A  1 375 ? 4.627   -34.204 -29.160 1.00 196.93 ? 488 GLN A NE2    1 
ATOM   5683  H  H      . GLN A  1 375 ? -0.286  -34.788 -28.408 1.00 268.07 ? 488 GLN A H      1 
ATOM   5684  H  HA     . GLN A  1 375 ? -0.113  -32.888 -30.204 1.00 165.50 ? 488 GLN A HA     1 
ATOM   5685  H  HB2    . GLN A  1 375 ? 1.051   -35.464 -30.150 1.00 193.33 ? 488 GLN A HB2    1 
ATOM   5686  H  HB3    . GLN A  1 375 ? 1.344   -34.444 -31.330 1.00 193.33 ? 488 GLN A HB3    1 
ATOM   5687  H  HG2    . GLN A  1 375 ? 2.313   -32.974 -29.773 1.00 214.90 ? 488 GLN A HG2    1 
ATOM   5688  H  HG3    . GLN A  1 375 ? 2.095   -34.070 -28.642 1.00 214.90 ? 488 GLN A HG3    1 
ATOM   5689  H  HE21   . GLN A  1 375 ? 4.511   -33.657 -28.507 1.00 236.31 ? 488 GLN A HE21   1 
ATOM   5690  H  HE22   . GLN A  1 375 ? 5.408   -34.529 -29.315 1.00 236.31 ? 488 GLN A HE22   1 
ATOM   5691  N  N      . LYS B  1 11  ? 19.277  -16.508 -25.070 1.00 129.78 ? 10  LYS B N      1 
ATOM   5692  C  CA     . LYS B  1 11  ? 18.829  -17.702 -24.364 1.00 133.88 ? 10  LYS B CA     1 
ATOM   5693  C  C      . LYS B  1 11  ? 18.373  -18.794 -25.326 1.00 135.83 ? 10  LYS B C      1 
ATOM   5694  O  O      . LYS B  1 11  ? 17.474  -18.584 -26.142 1.00 119.30 ? 10  LYS B O      1 
ATOM   5695  C  CB     . LYS B  1 11  ? 17.673  -17.363 -23.419 1.00 144.95 ? 10  LYS B CB     1 
ATOM   5696  C  CG     . LYS B  1 11  ? 18.074  -16.598 -22.171 1.00 163.89 ? 10  LYS B CG     1 
ATOM   5697  C  CD     . LYS B  1 11  ? 16.844  -16.165 -21.391 1.00 163.62 ? 10  LYS B CD     1 
ATOM   5698  C  CE     . LYS B  1 11  ? 17.208  -15.527 -20.061 1.00 140.51 ? 10  LYS B CE     1 
ATOM   5699  N  NZ     . LYS B  1 11  ? 15.998  -15.114 -19.299 1.00 119.33 ? 10  LYS B NZ     1 
ATOM   5700  H  HA     . LYS B  1 11  ? 19.569  -18.055 -23.828 1.00 160.66 ? 10  LYS B HA     1 
ATOM   5701  H  HB2    . LYS B  1 11  ? 17.029  -16.821 -23.901 1.00 173.94 ? 10  LYS B HB2    1 
ATOM   5702  H  HB3    . LYS B  1 11  ? 17.255  -18.191 -23.134 1.00 173.94 ? 10  LYS B HB3    1 
ATOM   5703  H  HG2    . LYS B  1 11  ? 18.613  -17.169 -21.602 1.00 196.67 ? 10  LYS B HG2    1 
ATOM   5704  H  HG3    . LYS B  1 11  ? 18.572  -15.805 -22.424 1.00 196.67 ? 10  LYS B HG3    1 
ATOM   5705  H  HD2    . LYS B  1 11  ? 16.350  -15.514 -21.913 1.00 196.35 ? 10  LYS B HD2    1 
ATOM   5706  H  HD3    . LYS B  1 11  ? 16.290  -16.941 -21.213 1.00 196.35 ? 10  LYS B HD3    1 
ATOM   5707  H  HE2    . LYS B  1 11  ? 17.700  -16.168 -19.524 1.00 168.61 ? 10  LYS B HE2    1 
ATOM   5708  H  HE3    . LYS B  1 11  ? 17.749  -14.739 -20.222 1.00 168.61 ? 10  LYS B HE3    1 
ATOM   5709  H  HZ1    . LYS B  1 11  ? 16.238  -14.744 -18.525 1.00 143.19 ? 10  LYS B HZ1    1 
ATOM   5710  H  HZ2    . LYS B  1 11  ? 15.530  -14.521 -19.770 1.00 143.19 ? 10  LYS B HZ2    1 
ATOM   5711  H  HZ3    . LYS B  1 11  ? 15.486  -15.822 -19.134 1.00 143.19 ? 10  LYS B HZ3    1 
ATOM   5712  N  N      . LEU B  1 12  ? 19.007  -19.958 -25.227 1.00 136.64 ? 11  LEU B N      1 
ATOM   5713  C  CA     . LEU B  1 12  ? 18.495  -21.167 -25.856 1.00 124.33 ? 11  LEU B CA     1 
ATOM   5714  C  C      . LEU B  1 12  ? 17.418  -21.719 -24.933 1.00 145.58 ? 11  LEU B C      1 
ATOM   5715  O  O      . LEU B  1 12  ? 17.543  -21.629 -23.711 1.00 158.25 ? 11  LEU B O      1 
ATOM   5716  C  CB     . LEU B  1 12  ? 19.617  -22.191 -26.040 1.00 112.52 ? 11  LEU B CB     1 
ATOM   5717  C  CG     . LEU B  1 12  ? 19.211  -23.607 -26.461 1.00 95.57  ? 11  LEU B CG     1 
ATOM   5718  C  CD1    . LEU B  1 12  ? 18.730  -23.639 -27.904 1.00 98.97  ? 11  LEU B CD1    1 
ATOM   5719  C  CD2    . LEU B  1 12  ? 20.369  -24.568 -26.260 1.00 74.02  ? 11  LEU B CD2    1 
ATOM   5720  H  H      . LEU B  1 12  ? 19.743  -20.073 -24.797 1.00 163.97 ? 11  LEU B H      1 
ATOM   5721  H  HA     . LEU B  1 12  ? 18.100  -20.957 -26.728 1.00 149.20 ? 11  LEU B HA     1 
ATOM   5722  H  HB2    . LEU B  1 12  ? 20.223  -21.855 -26.719 1.00 135.02 ? 11  LEU B HB2    1 
ATOM   5723  H  HB3    . LEU B  1 12  ? 20.093  -22.270 -25.199 1.00 135.02 ? 11  LEU B HB3    1 
ATOM   5724  H  HG     . LEU B  1 12  ? 18.478  -23.902 -25.898 1.00 114.69 ? 11  LEU B HG     1 
ATOM   5725  H  HD11   . LEU B  1 12  ? 18.485  -24.539 -28.131 1.00 118.77 ? 11  LEU B HD11   1 
ATOM   5726  H  HD12   . LEU B  1 12  ? 17.970  -23.059 -27.993 1.00 118.77 ? 11  LEU B HD12   1 
ATOM   5727  H  HD13   . LEU B  1 12  ? 19.440  -23.338 -28.476 1.00 118.77 ? 11  LEU B HD13   1 
ATOM   5728  H  HD21   . LEU B  1 12  ? 20.095  -25.448 -26.529 1.00 88.82  ? 11  LEU B HD21   1 
ATOM   5729  H  HD22   . LEU B  1 12  ? 21.112  -24.278 -26.794 1.00 88.82  ? 11  LEU B HD22   1 
ATOM   5730  H  HD23   . LEU B  1 12  ? 20.614  -24.571 -25.332 1.00 88.82  ? 11  LEU B HD23   1 
ATOM   5731  N  N      . LYS B  1 13  ? 16.357  -22.280 -25.504 1.00 148.10 ? 12  LYS B N      1 
ATOM   5732  C  CA     . LYS B  1 13  ? 15.248  -22.780 -24.695 1.00 154.05 ? 12  LYS B CA     1 
ATOM   5733  C  C      . LYS B  1 13  ? 14.905  -24.231 -25.036 1.00 137.60 ? 12  LYS B C      1 
ATOM   5734  O  O      . LYS B  1 13  ? 15.457  -24.797 -25.978 1.00 137.71 ? 12  LYS B O      1 
ATOM   5735  C  CB     . LYS B  1 13  ? 14.036  -21.855 -24.835 1.00 169.05 ? 12  LYS B CB     1 
ATOM   5736  C  CG     . LYS B  1 13  ? 14.307  -20.458 -24.279 1.00 178.74 ? 12  LYS B CG     1 
ATOM   5737  C  CD     . LYS B  1 13  ? 13.091  -19.545 -24.321 1.00 173.86 ? 12  LYS B CD     1 
ATOM   5738  C  CE     . LYS B  1 13  ? 13.395  -18.213 -23.642 1.00 159.08 ? 12  LYS B CE     1 
ATOM   5739  N  NZ     . LYS B  1 13  ? 12.225  -17.291 -23.620 1.00 146.39 ? 12  LYS B NZ     1 
ATOM   5740  H  H      . LYS B  1 13  ? 16.253  -22.382 -26.351 1.00 177.72 ? 12  LYS B H      1 
ATOM   5741  H  HA     . LYS B  1 13  ? 15.522  -22.760 -23.754 1.00 184.86 ? 12  LYS B HA     1 
ATOM   5742  H  HB2    . LYS B  1 13  ? 13.810  -21.767 -25.774 1.00 202.86 ? 12  LYS B HB2    1 
ATOM   5743  H  HB3    . LYS B  1 13  ? 13.288  -22.234 -24.347 1.00 202.86 ? 12  LYS B HB3    1 
ATOM   5744  H  HG2    . LYS B  1 13  ? 14.588  -20.538 -23.353 1.00 214.48 ? 12  LYS B HG2    1 
ATOM   5745  H  HG3    . LYS B  1 13  ? 15.010  -20.043 -24.802 1.00 214.48 ? 12  LYS B HG3    1 
ATOM   5746  H  HD2    . LYS B  1 13  ? 12.851  -19.371 -25.245 1.00 208.63 ? 12  LYS B HD2    1 
ATOM   5747  H  HD3    . LYS B  1 13  ? 12.354  -19.967 -23.853 1.00 208.63 ? 12  LYS B HD3    1 
ATOM   5748  H  HE2    . LYS B  1 13  ? 13.661  -18.380 -22.724 1.00 190.90 ? 12  LYS B HE2    1 
ATOM   5749  H  HE3    . LYS B  1 13  ? 14.114  -17.772 -24.120 1.00 190.90 ? 12  LYS B HE3    1 
ATOM   5750  H  HZ1    . LYS B  1 13  ? 12.446  -16.529 -23.216 1.00 175.67 ? 12  LYS B HZ1    1 
ATOM   5751  H  HZ2    . LYS B  1 13  ? 11.963  -17.112 -24.451 1.00 175.67 ? 12  LYS B HZ2    1 
ATOM   5752  H  HZ3    . LYS B  1 13  ? 11.550  -17.667 -23.178 1.00 175.67 ? 12  LYS B HZ3    1 
ATOM   5753  N  N      . LYS B  1 14  ? 13.999  -24.818 -24.256 1.00 129.97 ? 13  LYS B N      1 
ATOM   5754  C  CA     . LYS B  1 14  ? 13.740  -26.262 -24.285 1.00 144.65 ? 13  LYS B CA     1 
ATOM   5755  C  C      . LYS B  1 14  ? 14.058  -26.919 -25.629 1.00 148.13 ? 13  LYS B C      1 
ATOM   5756  O  O      . LYS B  1 14  ? 13.600  -26.473 -26.683 1.00 154.95 ? 13  LYS B O      1 
ATOM   5757  C  CB     . LYS B  1 14  ? 12.293  -26.563 -23.877 1.00 152.55 ? 13  LYS B CB     1 
ATOM   5758  C  CG     . LYS B  1 14  ? 11.239  -26.174 -24.903 1.00 169.47 ? 13  LYS B CG     1 
ATOM   5759  C  CD     . LYS B  1 14  ? 9.847   -26.573 -24.432 1.00 169.61 ? 13  LYS B CD     1 
ATOM   5760  C  CE     . LYS B  1 14  ? 8.794   -26.307 -25.496 1.00 164.92 ? 13  LYS B CE     1 
ATOM   5761  N  NZ     . LYS B  1 14  ? 7.437   -26.723 -25.048 1.00 161.20 ? 13  LYS B NZ     1 
ATOM   5762  H  H      . LYS B  1 14  ? 13.511  -24.395 -23.688 1.00 155.96 ? 13  LYS B H      1 
ATOM   5763  H  HA     . LYS B  1 14  ? 14.319  -26.685 -23.617 1.00 173.58 ? 13  LYS B HA     1 
ATOM   5764  H  HB2    . LYS B  1 14  ? 12.209  -27.517 -23.719 1.00 183.06 ? 13  LYS B HB2    1 
ATOM   5765  H  HB3    . LYS B  1 14  ? 12.096  -26.080 -23.058 1.00 183.06 ? 13  LYS B HB3    1 
ATOM   5766  H  HG2    . LYS B  1 14  ? 11.254  -25.212 -25.031 1.00 203.36 ? 13  LYS B HG2    1 
ATOM   5767  H  HG3    . LYS B  1 14  ? 11.421  -26.629 -25.740 1.00 203.36 ? 13  LYS B HG3    1 
ATOM   5768  H  HD2    . LYS B  1 14  ? 9.839   -27.521 -24.228 1.00 203.53 ? 13  LYS B HD2    1 
ATOM   5769  H  HD3    . LYS B  1 14  ? 9.617   -26.059 -23.642 1.00 203.53 ? 13  LYS B HD3    1 
ATOM   5770  H  HE2    . LYS B  1 14  ? 8.771   -25.357 -25.691 1.00 197.91 ? 13  LYS B HE2    1 
ATOM   5771  H  HE3    . LYS B  1 14  ? 9.016   -26.808 -26.297 1.00 197.91 ? 13  LYS B HE3    1 
ATOM   5772  H  HZ1    . LYS B  1 14  ? 6.841   -26.556 -25.688 1.00 193.44 ? 13  LYS B HZ1    1 
ATOM   5773  H  HZ2    . LYS B  1 14  ? 7.430   -27.594 -24.866 1.00 193.44 ? 13  LYS B HZ2    1 
ATOM   5774  H  HZ3    . LYS B  1 14  ? 7.207   -26.273 -24.315 1.00 193.44 ? 13  LYS B HZ3    1 
ATOM   5775  N  N      . LEU B  1 15  ? 14.847  -27.988 -25.573 1.00 128.66 ? 14  LEU B N      1 
ATOM   5776  C  CA     . LEU B  1 15  ? 15.305  -28.684 -26.770 1.00 105.28 ? 14  LEU B CA     1 
ATOM   5777  C  C      . LEU B  1 15  ? 14.155  -29.319 -27.543 1.00 113.21 ? 14  LEU B C      1 
ATOM   5778  O  O      . LEU B  1 15  ? 13.281  -29.964 -26.962 1.00 106.58 ? 14  LEU B O      1 
ATOM   5779  C  CB     . LEU B  1 15  ? 16.324  -29.762 -26.393 1.00 91.44  ? 14  LEU B CB     1 
ATOM   5780  C  CG     . LEU B  1 15  ? 17.696  -29.250 -25.953 1.00 93.86  ? 14  LEU B CG     1 
ATOM   5781  C  CD1    . LEU B  1 15  ? 18.467  -30.341 -25.233 1.00 97.58  ? 14  LEU B CD1    1 
ATOM   5782  C  CD2    . LEU B  1 15  ? 18.480  -28.746 -27.152 1.00 104.45 ? 14  LEU B CD2    1 
ATOM   5783  H  H      . LEU B  1 15  ? 15.136  -28.334 -24.840 1.00 154.39 ? 14  LEU B H      1 
ATOM   5784  H  HA     . LEU B  1 15  ? 15.749  -28.042 -27.362 1.00 126.33 ? 14  LEU B HA     1 
ATOM   5785  H  HB2    . LEU B  1 15  ? 15.960  -30.283 -25.661 1.00 109.73 ? 14  LEU B HB2    1 
ATOM   5786  H  HB3    . LEU B  1 15  ? 16.461  -30.336 -27.162 1.00 109.73 ? 14  LEU B HB3    1 
ATOM   5787  H  HG     . LEU B  1 15  ? 17.576  -28.509 -25.339 1.00 112.64 ? 14  LEU B HG     1 
ATOM   5788  H  HD11   . LEU B  1 15  ? 19.323  -29.995 -24.968 1.00 117.10 ? 14  LEU B HD11   1 
ATOM   5789  H  HD12   . LEU B  1 15  ? 17.971  -30.615 -24.459 1.00 117.10 ? 14  LEU B HD12   1 
ATOM   5790  H  HD13   . LEU B  1 15  ? 18.585  -31.085 -25.828 1.00 117.10 ? 14  LEU B HD13   1 
ATOM   5791  H  HD21   . LEU B  1 15  ? 19.336  -28.430 -26.854 1.00 125.33 ? 14  LEU B HD21   1 
ATOM   5792  H  HD22   . LEU B  1 15  ? 18.595  -29.467 -27.775 1.00 125.33 ? 14  LEU B HD22   1 
ATOM   5793  H  HD23   . LEU B  1 15  ? 17.992  -28.030 -27.565 1.00 125.33 ? 14  LEU B HD23   1 
ATOM   5794  N  N      . SER B  1 16  ? 14.173  -29.136 -28.860 1.00 117.92 ? 15  SER B N      1 
ATOM   5795  C  CA     . SER B  1 16  ? 13.158  -29.708 -29.737 1.00 109.03 ? 15  SER B CA     1 
ATOM   5796  C  C      . SER B  1 16  ? 13.002  -31.202 -29.489 1.00 124.43 ? 15  SER B C      1 
ATOM   5797  O  O      . SER B  1 16  ? 13.973  -31.898 -29.186 1.00 125.98 ? 15  SER B O      1 
ATOM   5798  C  CB     . SER B  1 16  ? 13.536  -29.477 -31.199 1.00 114.35 ? 15  SER B CB     1 
ATOM   5799  O  OG     . SER B  1 16  ? 14.762  -30.118 -31.506 1.00 121.17 ? 15  SER B OG     1 
ATOM   5800  H  H      . SER B  1 16  ? 14.771  -28.677 -29.275 1.00 141.50 ? 15  SER B H      1 
ATOM   5801  H  HA     . SER B  1 16  ? 12.297  -29.273 -29.567 1.00 130.84 ? 15  SER B HA     1 
ATOM   5802  H  HB2    . SER B  1 16  ? 12.839  -29.840 -31.767 1.00 137.22 ? 15  SER B HB2    1 
ATOM   5803  H  HB3    . SER B  1 16  ? 13.629  -28.524 -31.355 1.00 137.22 ? 15  SER B HB3    1 
ATOM   5804  H  HG     . SER B  1 16  ? 15.052  -30.500 -30.841 1.00 145.40 ? 15  SER B HG     1 
ATOM   5805  N  N      . GLU B  1 17  ? 11.776  -31.692 -29.628 1.00 125.33 ? 16  GLU B N      1 
ATOM   5806  C  CA     . GLU B  1 17  ? 11.491  -33.101 -29.403 1.00 126.75 ? 16  GLU B CA     1 
ATOM   5807  C  C      . GLU B  1 17  ? 12.298  -33.986 -30.347 1.00 136.30 ? 16  GLU B C      1 
ATOM   5808  O  O      . GLU B  1 17  ? 12.572  -35.147 -30.042 1.00 137.27 ? 16  GLU B O      1 
ATOM   5809  C  CB     . GLU B  1 17  ? 9.996   -33.373 -29.574 1.00 130.26 ? 16  GLU B CB     1 
ATOM   5810  C  CG     . GLU B  1 17  ? 9.612   -34.824 -29.355 1.00 141.08 ? 16  GLU B CG     1 
ATOM   5811  C  CD     . GLU B  1 17  ? 8.113   -35.022 -29.251 1.00 149.06 ? 16  GLU B CD     1 
ATOM   5812  O  OE1    . GLU B  1 17  ? 7.523   -34.584 -28.240 1.00 157.90 ? 16  GLU B OE1    1 
ATOM   5813  O  OE2    . GLU B  1 17  ? 7.525   -35.615 -30.180 1.00 138.30 ? 16  GLU B OE2    1 
ATOM   5814  H  H      . GLU B  1 17  ? 11.090  -31.226 -29.854 1.00 150.39 ? 16  GLU B H      1 
ATOM   5815  H  HA     . GLU B  1 17  ? 11.739  -33.333 -28.484 1.00 152.10 ? 16  GLU B HA     1 
ATOM   5816  H  HB2    . GLU B  1 17  ? 9.505   -32.835 -28.932 1.00 156.31 ? 16  GLU B HB2    1 
ATOM   5817  H  HB3    . GLU B  1 17  ? 9.735   -33.129 -30.475 1.00 156.31 ? 16  GLU B HB3    1 
ATOM   5818  H  HG2    . GLU B  1 17  ? 9.933   -35.353 -30.102 1.00 169.30 ? 16  GLU B HG2    1 
ATOM   5819  H  HG3    . GLU B  1 17  ? 10.013  -35.137 -28.529 1.00 169.30 ? 16  GLU B HG3    1 
ATOM   5820  N  N      . ASP B  1 18  ? 12.682  -33.433 -31.493 1.00 145.25 ? 17  ASP B N      1 
ATOM   5821  C  CA     . ASP B  1 18  ? 13.446  -34.184 -32.481 1.00 152.75 ? 17  ASP B CA     1 
ATOM   5822  C  C      . ASP B  1 18  ? 14.910  -34.310 -32.079 1.00 136.29 ? 17  ASP B C      1 
ATOM   5823  O  O      . ASP B  1 18  ? 15.505  -35.379 -32.202 1.00 138.06 ? 17  ASP B O      1 
ATOM   5824  C  CB     . ASP B  1 18  ? 13.339  -33.516 -33.852 1.00 174.87 ? 17  ASP B CB     1 
ATOM   5825  C  CG     . ASP B  1 18  ? 11.930  -33.558 -34.408 1.00 196.04 ? 17  ASP B CG     1 
ATOM   5826  O  OD1    . ASP B  1 18  ? 11.205  -34.530 -34.109 1.00 194.79 ? 17  ASP B OD1    1 
ATOM   5827  O  OD2    . ASP B  1 18  ? 11.546  -32.621 -35.138 1.00 211.16 ? 17  ASP B OD2    1 
ATOM   5828  H  H      . ASP B  1 18  ? 12.513  -32.622 -31.722 1.00 174.30 ? 17  ASP B H      1 
ATOM   5829  H  HA     . ASP B  1 18  ? 13.073  -35.087 -32.554 1.00 183.30 ? 17  ASP B HA     1 
ATOM   5830  H  HB2    . ASP B  1 18  ? 13.604  -32.586 -33.774 1.00 209.85 ? 17  ASP B HB2    1 
ATOM   5831  H  HB3    . ASP B  1 18  ? 13.922  -33.977 -34.476 1.00 209.85 ? 17  ASP B HB3    1 
ATOM   5832  N  N      . SER B  1 19  ? 15.487  -33.217 -31.594 1.00 122.12 ? 18  SER B N      1 
ATOM   5833  C  CA     . SER B  1 19  ? 16.892  -33.213 -31.213 1.00 112.45 ? 18  SER B CA     1 
ATOM   5834  C  C      . SER B  1 19  ? 17.133  -34.039 -29.951 1.00 123.36 ? 18  SER B C      1 
ATOM   5835  O  O      . SER B  1 19  ? 18.277  -34.343 -29.611 1.00 133.76 ? 18  SER B O      1 
ATOM   5836  C  CB     . SER B  1 19  ? 17.382  -31.782 -31.001 1.00 91.34  ? 18  SER B CB     1 
ATOM   5837  O  OG     . SER B  1 19  ? 18.789  -31.749 -30.853 1.00 93.40  ? 18  SER B OG     1 
ATOM   5838  H  H      . SER B  1 19  ? 15.086  -32.465 -31.477 1.00 146.54 ? 18  SER B H      1 
ATOM   5839  H  HA     . SER B  1 19  ? 17.420  -33.609 -31.938 1.00 134.95 ? 18  SER B HA     1 
ATOM   5840  H  HB2    . SER B  1 19  ? 17.133  -31.246 -31.771 1.00 109.61 ? 18  SER B HB2    1 
ATOM   5841  H  HB3    . SER B  1 19  ? 16.971  -31.422 -30.199 1.00 109.61 ? 18  SER B HB3    1 
ATOM   5842  H  HG     . SER B  1 19  ? 19.042  -30.977 -30.740 1.00 112.08 ? 18  SER B HG     1 
ATOM   5843  N  N      . LEU B  1 20  ? 16.056  -34.400 -29.260 1.00 109.75 ? 19  LEU B N      1 
ATOM   5844  C  CA     . LEU B  1 20  ? 16.162  -35.214 -28.055 1.00 89.43  ? 19  LEU B CA     1 
ATOM   5845  C  C      . LEU B  1 20  ? 16.282  -36.702 -28.377 1.00 96.95  ? 19  LEU B C      1 
ATOM   5846  O  O      . LEU B  1 20  ? 16.697  -37.492 -27.531 1.00 110.08 ? 19  LEU B O      1 
ATOM   5847  C  CB     . LEU B  1 20  ? 14.959  -34.976 -27.141 1.00 85.10  ? 19  LEU B CB     1 
ATOM   5848  C  CG     . LEU B  1 20  ? 15.027  -33.728 -26.261 1.00 99.51  ? 19  LEU B CG     1 
ATOM   5849  C  CD1    . LEU B  1 20  ? 13.722  -33.540 -25.506 1.00 107.26 ? 19  LEU B CD1    1 
ATOM   5850  C  CD2    . LEU B  1 20  ? 16.198  -33.814 -25.291 1.00 89.67  ? 19  LEU B CD2    1 
ATOM   5851  H  H      . LEU B  1 20  ? 15.249  -34.186 -29.470 1.00 131.70 ? 19  LEU B H      1 
ATOM   5852  H  HA     . LEU B  1 20  ? 16.968  -34.948 -27.564 1.00 107.32 ? 19  LEU B HA     1 
ATOM   5853  H  HB2    . LEU B  1 20  ? 14.166  -34.897 -27.695 1.00 102.12 ? 19  LEU B HB2    1 
ATOM   5854  H  HB3    . LEU B  1 20  ? 14.866  -35.742 -26.552 1.00 102.12 ? 19  LEU B HB3    1 
ATOM   5855  H  HG     . LEU B  1 20  ? 15.162  -32.951 -26.826 1.00 119.41 ? 19  LEU B HG     1 
ATOM   5856  H  HD11   . LEU B  1 20  ? 13.788  -32.752 -24.961 1.00 128.71 ? 19  LEU B HD11   1 
ATOM   5857  H  HD12   . LEU B  1 20  ? 13.007  -33.442 -26.138 1.00 128.71 ? 19  LEU B HD12   1 
ATOM   5858  H  HD13   . LEU B  1 20  ? 13.568  -34.309 -24.952 1.00 128.71 ? 19  LEU B HD13   1 
ATOM   5859  H  HD21   . LEU B  1 20  ? 16.217  -33.019 -24.753 1.00 107.61 ? 19  LEU B HD21   1 
ATOM   5860  H  HD22   . LEU B  1 20  ? 16.085  -34.586 -24.732 1.00 107.61 ? 19  LEU B HD22   1 
ATOM   5861  H  HD23   . LEU B  1 20  ? 17.014  -33.889 -25.792 1.00 107.61 ? 19  LEU B HD23   1 
ATOM   5862  N  N      . THR B  1 21  ? 15.915  -37.083 -29.596 1.00 100.94 ? 20  THR B N      1 
ATOM   5863  C  CA     . THR B  1 21  ? 16.034  -38.475 -30.017 1.00 113.79 ? 20  THR B CA     1 
ATOM   5864  C  C      . THR B  1 21  ? 17.439  -38.771 -30.531 1.00 104.97 ? 20  THR B C      1 
ATOM   5865  O  O      . THR B  1 21  ? 17.939  -39.885 -30.381 1.00 112.27 ? 20  THR B O      1 
ATOM   5866  C  CB     . THR B  1 21  ? 15.012  -38.843 -31.110 1.00 114.38 ? 20  THR B CB     1 
ATOM   5867  O  OG1    . THR B  1 21  ? 15.182  -37.986 -32.247 1.00 112.26 ? 20  THR B OG1    1 
ATOM   5868  C  CG2    . THR B  1 21  ? 13.590  -38.725 -30.578 1.00 117.55 ? 20  THR B CG2    1 
ATOM   5869  H  H      . THR B  1 21  ? 15.595  -36.558 -30.197 1.00 121.13 ? 20  THR B H      1 
ATOM   5870  H  HA     . THR B  1 21  ? 15.869  -39.054 -29.244 1.00 136.55 ? 20  THR B HA     1 
ATOM   5871  H  HB     . THR B  1 21  ? 15.156  -39.763 -31.382 1.00 137.25 ? 20  THR B HB     1 
ATOM   5872  H  HG1    . THR B  1 21  ? 15.068  -37.204 -32.028 1.00 134.71 ? 20  THR B HG1    1 
ATOM   5873  H  HG21   . THR B  1 21  ? 12.962  -38.956 -31.266 1.00 141.07 ? 20  THR B HG21   1 
ATOM   5874  H  HG22   . THR B  1 21  ? 13.468  -39.318 -29.833 1.00 141.07 ? 20  THR B HG22   1 
ATOM   5875  H  HG23   . THR B  1 21  ? 13.421  -37.825 -30.291 1.00 141.07 ? 20  THR B HG23   1 
ATOM   5876  N  N      . LYS B  1 22  ? 18.071  -37.770 -31.135 1.00 91.51  ? 21  LYS B N      1 
ATOM   5877  C  CA     . LYS B  1 22  ? 19.432  -37.924 -31.635 1.00 91.85  ? 21  LYS B CA     1 
ATOM   5878  C  C      . LYS B  1 22  ? 20.386  -38.167 -30.471 1.00 94.14  ? 21  LYS B C      1 
ATOM   5879  O  O      . LYS B  1 22  ? 20.108  -37.774 -29.339 1.00 97.46  ? 21  LYS B O      1 
ATOM   5880  C  CB     . LYS B  1 22  ? 19.858  -36.679 -32.420 1.00 89.26  ? 21  LYS B CB     1 
ATOM   5881  C  CG     . LYS B  1 22  ? 18.864  -36.258 -33.494 1.00 103.20 ? 21  LYS B CG     1 
ATOM   5882  C  CD     . LYS B  1 22  ? 19.545  -35.608 -34.692 1.00 120.35 ? 21  LYS B CD     1 
ATOM   5883  C  CE     . LYS B  1 22  ? 20.229  -34.300 -34.323 1.00 141.91 ? 21  LYS B CE     1 
ATOM   5884  N  NZ     . LYS B  1 22  ? 20.770  -33.595 -35.521 1.00 136.21 ? 21  LYS B NZ     1 
ATOM   5885  H  H      . LYS B  1 22  ? 17.734  -36.991 -31.268 1.00 109.81 ? 21  LYS B H      1 
ATOM   5886  H  HA     . LYS B  1 22  ? 19.472  -38.697 -32.236 1.00 110.22 ? 21  LYS B HA     1 
ATOM   5887  H  HB2    . LYS B  1 22  ? 19.958  -35.939 -31.801 1.00 107.11 ? 21  LYS B HB2    1 
ATOM   5888  H  HB3    . LYS B  1 22  ? 20.706  -36.860 -32.855 1.00 107.11 ? 21  LYS B HB3    1 
ATOM   5889  H  HG2    . LYS B  1 22  ? 18.385  -37.042 -33.808 1.00 123.84 ? 21  LYS B HG2    1 
ATOM   5890  H  HG3    . LYS B  1 22  ? 18.242  -35.617 -33.116 1.00 123.84 ? 21  LYS B HG3    1 
ATOM   5891  H  HD2    . LYS B  1 22  ? 20.219  -36.212 -35.042 1.00 144.42 ? 21  LYS B HD2    1 
ATOM   5892  H  HD3    . LYS B  1 22  ? 18.880  -35.420 -35.373 1.00 144.42 ? 21  LYS B HD3    1 
ATOM   5893  H  HE2    . LYS B  1 22  ? 19.585  -33.715 -33.893 1.00 170.30 ? 21  LYS B HE2    1 
ATOM   5894  H  HE3    . LYS B  1 22  ? 20.967  -34.485 -33.721 1.00 170.30 ? 21  LYS B HE3    1 
ATOM   5895  H  HZ1    . LYS B  1 22  ? 21.163  -32.835 -35.275 1.00 163.45 ? 21  LYS B HZ1    1 
ATOM   5896  H  HZ2    . LYS B  1 22  ? 21.369  -34.110 -35.932 1.00 163.45 ? 21  LYS B HZ2    1 
ATOM   5897  H  HZ3    . LYS B  1 22  ? 20.110  -33.409 -36.088 1.00 163.45 ? 21  LYS B HZ3    1 
ATOM   5898  N  N      . GLN B  1 23  ? 21.507  -38.825 -30.749 1.00 91.32  ? 22  GLN B N      1 
ATOM   5899  C  CA     . GLN B  1 23  ? 22.510  -39.076 -29.722 1.00 84.32  ? 22  GLN B CA     1 
ATOM   5900  C  C      . GLN B  1 23  ? 23.169  -37.760 -29.323 1.00 97.77  ? 22  GLN B C      1 
ATOM   5901  O  O      . GLN B  1 23  ? 23.465  -36.930 -30.180 1.00 110.86 ? 22  GLN B O      1 
ATOM   5902  C  CB     . GLN B  1 23  ? 23.557  -40.071 -30.227 1.00 91.57  ? 22  GLN B CB     1 
ATOM   5903  C  CG     . GLN B  1 23  ? 23.056  -41.510 -30.307 1.00 98.54  ? 22  GLN B CG     1 
ATOM   5904  C  CD     . GLN B  1 23  ? 23.619  -42.390 -29.206 1.00 128.30 ? 22  GLN B CD     1 
ATOM   5905  O  OE1    . GLN B  1 23  ? 24.799  -42.299 -28.864 1.00 137.35 ? 22  GLN B OE1    1 
ATOM   5906  N  NE2    . GLN B  1 23  ? 22.775  -43.247 -28.641 1.00 141.10 ? 22  GLN B NE2    1 
ATOM   5907  H  H      . GLN B  1 23  ? 21.710  -39.136 -31.524 1.00 109.59 ? 22  GLN B H      1 
ATOM   5908  H  HA     . GLN B  1 23  ? 22.076  -39.458 -28.930 1.00 101.18 ? 22  GLN B HA     1 
ATOM   5909  H  HB2    . GLN B  1 23  ? 23.837  -39.804 -31.116 1.00 109.89 ? 22  GLN B HB2    1 
ATOM   5910  H  HB3    . GLN B  1 23  ? 24.317  -40.055 -29.625 1.00 109.89 ? 22  GLN B HB3    1 
ATOM   5911  H  HG2    . GLN B  1 23  ? 22.089  -41.513 -30.228 1.00 118.25 ? 22  GLN B HG2    1 
ATOM   5912  H  HG3    . GLN B  1 23  ? 23.320  -41.889 -31.160 1.00 118.25 ? 22  GLN B HG3    1 
ATOM   5913  H  HE21   . GLN B  1 23  ? 21.957  -43.281 -28.905 1.00 169.32 ? 22  GLN B HE21   1 
ATOM   5914  H  HE22   . GLN B  1 23  ? 23.047  -43.768 -28.013 1.00 169.32 ? 22  GLN B HE22   1 
ATOM   5915  N  N      . PRO B  1 24  ? 23.399  -37.565 -28.015 1.00 104.71 ? 23  PRO B N      1 
ATOM   5916  C  CA     . PRO B  1 24  ? 23.906  -36.296 -27.475 1.00 95.93  ? 23  PRO B CA     1 
ATOM   5917  C  C      . PRO B  1 24  ? 25.120  -35.729 -28.217 1.00 89.57  ? 23  PRO B C      1 
ATOM   5918  O  O      . PRO B  1 24  ? 25.108  -34.546 -28.565 1.00 80.99  ? 23  PRO B O      1 
ATOM   5919  C  CB     . PRO B  1 24  ? 24.270  -36.644 -26.021 1.00 85.96  ? 23  PRO B CB     1 
ATOM   5920  C  CG     . PRO B  1 24  ? 24.196  -38.137 -25.921 1.00 110.74 ? 23  PRO B CG     1 
ATOM   5921  C  CD     . PRO B  1 24  ? 23.221  -38.572 -26.959 1.00 117.12 ? 23  PRO B CD     1 
ATOM   5922  H  HA     . PRO B  1 24  ? 23.192  -35.625 -27.472 1.00 115.11 ? 23  PRO B HA     1 
ATOM   5923  H  HB2    . PRO B  1 24  ? 25.170  -36.334 -25.829 1.00 103.16 ? 23  PRO B HB2    1 
ATOM   5924  H  HB3    . PRO B  1 24  ? 23.632  -36.230 -25.419 1.00 103.16 ? 23  PRO B HB3    1 
ATOM   5925  H  HG2    . PRO B  1 24  ? 25.070  -38.517 -26.096 1.00 132.88 ? 23  PRO B HG2    1 
ATOM   5926  H  HG3    . PRO B  1 24  ? 23.886  -38.387 -25.037 1.00 132.88 ? 23  PRO B HG3    1 
ATOM   5927  H  HD2    . PRO B  1 24  ? 23.447  -39.455 -27.289 1.00 140.54 ? 23  PRO B HD2    1 
ATOM   5928  H  HD3    . PRO B  1 24  ? 22.316  -38.541 -26.609 1.00 140.54 ? 23  PRO B HD3    1 
ATOM   5929  N  N      . GLU B  1 25  ? 26.143  -36.546 -28.454 1.00 82.13  ? 24  GLU B N      1 
ATOM   5930  C  CA     . GLU B  1 25  ? 27.360  -36.065 -29.109 1.00 95.92  ? 24  GLU B CA     1 
ATOM   5931  C  C      . GLU B  1 25  ? 27.075  -35.438 -30.479 1.00 102.59 ? 24  GLU B C      1 
ATOM   5932  O  O      . GLU B  1 25  ? 27.858  -34.622 -30.970 1.00 87.69  ? 24  GLU B O      1 
ATOM   5933  C  CB     . GLU B  1 25  ? 28.380  -37.195 -29.261 1.00 110.67 ? 24  GLU B CB     1 
ATOM   5934  C  CG     . GLU B  1 25  ? 28.908  -37.742 -27.943 1.00 129.47 ? 24  GLU B CG     1 
ATOM   5935  C  CD     . GLU B  1 25  ? 28.263  -39.059 -27.550 1.00 151.51 ? 24  GLU B CD     1 
ATOM   5936  O  OE1    . GLU B  1 25  ? 27.274  -39.462 -28.201 1.00 153.46 ? 24  GLU B OE1    1 
ATOM   5937  O  OE2    . GLU B  1 25  ? 28.751  -39.695 -26.591 1.00 151.17 ? 24  GLU B OE2    1 
ATOM   5938  H  H      . GLU B  1 25  ? 26.159  -37.380 -28.247 1.00 98.56  ? 24  GLU B H      1 
ATOM   5939  H  HA     . GLU B  1 25  ? 27.765  -35.373 -28.546 1.00 115.11 ? 24  GLU B HA     1 
ATOM   5940  H  HB2    . GLU B  1 25  ? 27.962  -37.928 -29.739 1.00 132.80 ? 24  GLU B HB2    1 
ATOM   5941  H  HB3    . GLU B  1 25  ? 29.137  -36.863 -29.768 1.00 132.80 ? 24  GLU B HB3    1 
ATOM   5942  H  HG2    . GLU B  1 25  ? 29.863  -37.887 -28.022 1.00 155.37 ? 24  GLU B HG2    1 
ATOM   5943  H  HG3    . GLU B  1 25  ? 28.727  -37.099 -27.239 1.00 155.37 ? 24  GLU B HG3    1 
ATOM   5944  N  N      . GLU B  1 26  ? 25.958  -35.824 -31.090 1.00 102.45 ? 25  GLU B N      1 
ATOM   5945  C  CA     . GLU B  1 26  ? 25.562  -35.286 -32.389 1.00 84.37  ? 25  GLU B CA     1 
ATOM   5946  C  C      . GLU B  1 26  ? 25.018  -33.870 -32.248 1.00 88.37  ? 25  GLU B C      1 
ATOM   5947  O  O      . GLU B  1 26  ? 25.095  -33.068 -33.179 1.00 101.35 ? 25  GLU B O      1 
ATOM   5948  C  CB     . GLU B  1 26  ? 24.490  -36.170 -33.028 1.00 90.42  ? 25  GLU B CB     1 
ATOM   5949  C  CG     . GLU B  1 26  ? 24.872  -37.636 -33.143 1.00 119.88 ? 25  GLU B CG     1 
ATOM   5950  C  CD     . GLU B  1 26  ? 23.828  -38.454 -33.879 1.00 140.08 ? 25  GLU B CD     1 
ATOM   5951  O  OE1    . GLU B  1 26  ? 22.624  -38.149 -33.739 1.00 145.06 ? 25  GLU B OE1    1 
ATOM   5952  O  OE2    . GLU B  1 26  ? 24.211  -39.399 -34.601 1.00 142.18 ? 25  GLU B OE2    1 
ATOM   5953  H  H      . GLU B  1 26  ? 25.407  -36.401 -30.769 1.00 122.94 ? 25  GLU B H      1 
ATOM   5954  H  HA     . GLU B  1 26  ? 26.341  -35.262 -32.983 1.00 101.25 ? 25  GLU B HA     1 
ATOM   5955  H  HB2    . GLU B  1 26  ? 23.683  -36.117 -32.492 1.00 108.51 ? 25  GLU B HB2    1 
ATOM   5956  H  HB3    . GLU B  1 26  ? 24.310  -35.842 -33.923 1.00 108.51 ? 25  GLU B HB3    1 
ATOM   5957  H  HG2    . GLU B  1 26  ? 25.708  -37.709 -33.629 1.00 143.85 ? 25  GLU B HG2    1 
ATOM   5958  H  HG3    . GLU B  1 26  ? 24.972  -38.008 -32.252 1.00 143.85 ? 25  GLU B HG3    1 
ATOM   5959  N  N      . VAL B  1 27  ? 24.461  -33.572 -31.080 1.00 82.06  ? 26  VAL B N      1 
ATOM   5960  C  CA     . VAL B  1 27  ? 23.840  -32.278 -30.834 1.00 78.13  ? 26  VAL B CA     1 
ATOM   5961  C  C      . VAL B  1 27  ? 24.782  -31.320 -30.108 1.00 73.77  ? 26  VAL B C      1 
ATOM   5962  O  O      . VAL B  1 27  ? 24.698  -30.104 -30.293 1.00 81.53  ? 26  VAL B O      1 
ATOM   5963  C  CB     . VAL B  1 27  ? 22.548  -32.439 -30.006 1.00 72.51  ? 26  VAL B CB     1 
ATOM   5964  C  CG1    . VAL B  1 27  ? 21.943  -31.084 -29.681 1.00 59.01  ? 26  VAL B CG1    1 
ATOM   5965  C  CG2    . VAL B  1 27  ? 21.543  -33.315 -30.750 1.00 62.22  ? 26  VAL B CG2    1 
ATOM   5966  H  H      . VAL B  1 27  ? 24.430  -34.107 -30.408 1.00 98.47  ? 26  VAL B H      1 
ATOM   5967  H  HA     . VAL B  1 27  ? 23.599  -31.873 -31.693 1.00 93.76  ? 26  VAL B HA     1 
ATOM   5968  H  HB     . VAL B  1 27  ? 22.766  -32.883 -29.159 1.00 87.01  ? 26  VAL B HB     1 
ATOM   5969  H  HG11   . VAL B  1 27  ? 21.143  -31.214 -29.167 1.00 70.81  ? 26  VAL B HG11   1 
ATOM   5970  H  HG12   . VAL B  1 27  ? 22.579  -30.572 -29.175 1.00 70.81  ? 26  VAL B HG12   1 
ATOM   5971  H  HG13   . VAL B  1 27  ? 21.735  -30.631 -30.501 1.00 70.81  ? 26  VAL B HG13   1 
ATOM   5972  H  HG21   . VAL B  1 27  ? 20.749  -33.401 -30.217 1.00 74.66  ? 26  VAL B HG21   1 
ATOM   5973  H  HG22   . VAL B  1 27  ? 21.331  -32.901 -31.590 1.00 74.66  ? 26  VAL B HG22   1 
ATOM   5974  H  HG23   . VAL B  1 27  ? 21.933  -34.179 -30.899 1.00 74.66  ? 26  VAL B HG23   1 
ATOM   5975  N  N      . PHE B  1 28  ? 25.679  -31.863 -29.289 1.00 66.51  ? 27  PHE B N      1 
ATOM   5976  C  CA     . PHE B  1 28  ? 26.571  -31.029 -28.485 1.00 85.67  ? 27  PHE B CA     1 
ATOM   5977  C  C      . PHE B  1 28  ? 28.048  -31.334 -28.711 1.00 84.58  ? 27  PHE B C      1 
ATOM   5978  O  O      . PHE B  1 28  ? 28.423  -32.465 -29.020 1.00 87.99  ? 27  PHE B O      1 
ATOM   5979  C  CB     . PHE B  1 28  ? 26.249  -31.185 -26.994 1.00 83.52  ? 27  PHE B CB     1 
ATOM   5980  C  CG     . PHE B  1 28  ? 24.882  -30.697 -26.620 1.00 71.34  ? 27  PHE B CG     1 
ATOM   5981  C  CD1    . PHE B  1 28  ? 24.659  -29.355 -26.361 1.00 67.62  ? 27  PHE B CD1    1 
ATOM   5982  C  CD2    . PHE B  1 28  ? 23.817  -31.577 -26.539 1.00 68.34  ? 27  PHE B CD2    1 
ATOM   5983  C  CE1    . PHE B  1 28  ? 23.398  -28.900 -26.023 1.00 69.90  ? 27  PHE B CE1    1 
ATOM   5984  C  CE2    . PHE B  1 28  ? 22.555  -31.128 -26.200 1.00 68.40  ? 27  PHE B CE2    1 
ATOM   5985  C  CZ     . PHE B  1 28  ? 22.345  -29.790 -25.942 1.00 69.96  ? 27  PHE B CZ     1 
ATOM   5986  H  H      . PHE B  1 28  ? 25.792  -32.708 -29.181 1.00 79.81  ? 27  PHE B H      1 
ATOM   5987  H  HA     . PHE B  1 28  ? 26.422  -30.091 -28.725 1.00 102.81 ? 27  PHE B HA     1 
ATOM   5988  H  HB2    . PHE B  1 28  ? 26.303  -32.124 -26.758 1.00 100.22 ? 27  PHE B HB2    1 
ATOM   5989  H  HB3    . PHE B  1 28  ? 26.896  -30.678 -26.479 1.00 100.22 ? 27  PHE B HB3    1 
ATOM   5990  H  HD1    . PHE B  1 28  ? 25.366  -28.752 -26.415 1.00 81.14  ? 27  PHE B HD1    1 
ATOM   5991  H  HD2    . PHE B  1 28  ? 23.953  -32.480 -26.712 1.00 82.01  ? 27  PHE B HD2    1 
ATOM   5992  H  HE1    . PHE B  1 28  ? 23.260  -27.997 -25.849 1.00 83.89  ? 27  PHE B HE1    1 
ATOM   5993  H  HE2    . PHE B  1 28  ? 21.846  -31.729 -26.146 1.00 82.08  ? 27  PHE B HE2    1 
ATOM   5994  H  HZ     . PHE B  1 28  ? 21.496  -29.487 -25.713 1.00 83.95  ? 27  PHE B HZ     1 
ATOM   5995  N  N      . ASP B  1 29  ? 28.873  -30.299 -28.572 1.00 80.25  ? 28  ASP B N      1 
ATOM   5996  C  CA     . ASP B  1 29  ? 30.316  -30.458 -28.453 1.00 78.73  ? 28  ASP B CA     1 
ATOM   5997  C  C      . ASP B  1 29  ? 30.693  -30.297 -26.987 1.00 77.40  ? 28  ASP B C      1 
ATOM   5998  O  O      . ASP B  1 29  ? 30.461  -29.246 -26.395 1.00 98.66  ? 28  ASP B O      1 
ATOM   5999  C  CB     . ASP B  1 29  ? 31.050  -29.409 -29.286 1.00 102.07 ? 28  ASP B CB     1 
ATOM   6000  C  CG     . ASP B  1 29  ? 31.246  -29.835 -30.725 1.00 129.96 ? 28  ASP B CG     1 
ATOM   6001  O  OD1    . ASP B  1 29  ? 31.407  -31.049 -30.972 1.00 148.36 ? 28  ASP B OD1    1 
ATOM   6002  O  OD2    . ASP B  1 29  ? 31.245  -28.953 -31.611 1.00 138.21 ? 28  ASP B OD2    1 
ATOM   6003  H  H      . ASP B  1 29  ? 28.614  -29.480 -28.544 1.00 96.30  ? 28  ASP B H      1 
ATOM   6004  H  HA     . ASP B  1 29  ? 30.583  -31.351 -28.755 1.00 94.48  ? 28  ASP B HA     1 
ATOM   6005  H  HB2    . ASP B  1 29  ? 30.535  -28.587 -29.284 1.00 122.48 ? 28  ASP B HB2    1 
ATOM   6006  H  HB3    . ASP B  1 29  ? 31.925  -29.252 -28.898 1.00 122.48 ? 28  ASP B HB3    1 
ATOM   6007  N  N      . VAL B  1 30  ? 31.266  -31.340 -26.399 1.00 80.91  ? 29  VAL B N      1 
ATOM   6008  C  CA     . VAL B  1 30  ? 31.620  -31.317 -24.984 1.00 78.01  ? 29  VAL B CA     1 
ATOM   6009  C  C      . VAL B  1 30  ? 33.045  -30.804 -24.775 1.00 85.89  ? 29  VAL B C      1 
ATOM   6010  O  O      . VAL B  1 30  ? 34.005  -31.387 -25.277 1.00 106.55 ? 29  VAL B O      1 
ATOM   6011  C  CB     . VAL B  1 30  ? 31.489  -32.718 -24.360 1.00 80.14  ? 29  VAL B CB     1 
ATOM   6012  C  CG1    . VAL B  1 30  ? 31.912  -32.692 -22.901 1.00 79.33  ? 29  VAL B CG1    1 
ATOM   6013  C  CG2    . VAL B  1 30  ? 30.060  -33.226 -24.498 1.00 60.34  ? 29  VAL B CG2    1 
ATOM   6014  H  H      . VAL B  1 30  ? 31.462  -32.076 -26.798 1.00 97.09  ? 29  VAL B H      1 
ATOM   6015  H  HA     . VAL B  1 30  ? 31.008  -30.715 -24.511 1.00 93.61  ? 29  VAL B HA     1 
ATOM   6016  H  HB     . VAL B  1 30  ? 32.080  -33.338 -24.837 1.00 96.17  ? 29  VAL B HB     1 
ATOM   6017  H  HG11   . VAL B  1 30  ? 31.822  -33.575 -22.534 1.00 95.20  ? 29  VAL B HG11   1 
ATOM   6018  H  HG12   . VAL B  1 30  ? 32.827  -32.406 -22.846 1.00 95.20  ? 29  VAL B HG12   1 
ATOM   6019  H  HG13   . VAL B  1 30  ? 31.348  -32.079 -22.423 1.00 95.20  ? 29  VAL B HG13   1 
ATOM   6020  H  HG21   . VAL B  1 30  ? 30.000  -34.099 -24.104 1.00 72.41  ? 29  VAL B HG21   1 
ATOM   6021  H  HG22   . VAL B  1 30  ? 29.469  -32.620 -24.045 1.00 72.41  ? 29  VAL B HG22   1 
ATOM   6022  H  HG23   . VAL B  1 30  ? 29.833  -33.270 -25.430 1.00 72.41  ? 29  VAL B HG23   1 
ATOM   6023  N  N      . LEU B  1 31  ? 33.172  -29.714 -24.025 1.00 92.72  ? 30  LEU B N      1 
ATOM   6024  C  CA     . LEU B  1 31  ? 34.473  -29.102 -23.769 1.00 96.97  ? 30  LEU B CA     1 
ATOM   6025  C  C      . LEU B  1 31  ? 34.978  -29.464 -22.369 1.00 85.42  ? 30  LEU B C      1 
ATOM   6026  O  O      . LEU B  1 31  ? 34.660  -30.532 -21.848 1.00 85.24  ? 30  LEU B O      1 
ATOM   6027  C  CB     . LEU B  1 31  ? 34.400  -27.580 -23.948 1.00 105.31 ? 30  LEU B CB     1 
ATOM   6028  C  CG     . LEU B  1 31  ? 34.069  -27.067 -25.351 1.00 109.01 ? 30  LEU B CG     1 
ATOM   6029  C  CD1    . LEU B  1 31  ? 32.646  -27.397 -25.761 1.00 110.93 ? 30  LEU B CD1    1 
ATOM   6030  C  CD2    . LEU B  1 31  ? 34.307  -25.570 -25.409 1.00 124.77 ? 30  LEU B CD2    1 
ATOM   6031  H  H      . LEU B  1 31  ? 32.515  -29.306 -23.649 1.00 111.26 ? 30  LEU B H      1 
ATOM   6032  H  HA     . LEU B  1 31  ? 35.119  -29.449 -24.419 1.00 116.37 ? 30  LEU B HA     1 
ATOM   6033  H  HB2    . LEU B  1 31  ? 33.718  -27.237 -23.349 1.00 126.37 ? 30  LEU B HB2    1 
ATOM   6034  H  HB3    . LEU B  1 31  ? 35.260  -27.205 -23.701 1.00 126.37 ? 30  LEU B HB3    1 
ATOM   6035  H  HG     . LEU B  1 31  ? 34.668  -27.488 -25.988 1.00 130.81 ? 30  LEU B HG     1 
ATOM   6036  H  HD11   . LEU B  1 31  ? 32.489  -27.056 -26.644 1.00 133.12 ? 30  LEU B HD11   1 
ATOM   6037  H  HD12   . LEU B  1 31  ? 32.532  -28.351 -25.752 1.00 133.12 ? 30  LEU B HD12   1 
ATOM   6038  H  HD13   . LEU B  1 31  ? 32.040  -26.989 -25.139 1.00 133.12 ? 30  LEU B HD13   1 
ATOM   6039  H  HD21   . LEU B  1 31  ? 34.097  -25.254 -26.291 1.00 149.72 ? 30  LEU B HD21   1 
ATOM   6040  H  HD22   . LEU B  1 31  ? 33.741  -25.139 -24.764 1.00 149.72 ? 30  LEU B HD22   1 
ATOM   6041  H  HD23   . LEU B  1 31  ? 35.228  -25.392 -25.207 1.00 149.72 ? 30  LEU B HD23   1 
ATOM   6042  N  N      . GLU B  1 32  ? 35.757  -28.574 -21.760 1.00 107.17 ? 31  GLU B N      1 
ATOM   6043  C  CA     . GLU B  1 32  ? 36.421  -28.871 -20.493 1.00 116.26 ? 31  GLU B CA     1 
ATOM   6044  C  C      . GLU B  1 32  ? 35.459  -29.260 -19.376 1.00 104.11 ? 31  GLU B C      1 
ATOM   6045  O  O      . GLU B  1 32  ? 34.280  -28.902 -19.390 1.00 103.82 ? 31  GLU B O      1 
ATOM   6046  C  CB     . GLU B  1 32  ? 37.272  -27.680 -20.037 1.00 118.32 ? 31  GLU B CB     1 
ATOM   6047  C  CG     . GLU B  1 32  ? 36.482  -26.447 -19.609 1.00 124.82 ? 31  GLU B CG     1 
ATOM   6048  C  CD     . GLU B  1 32  ? 36.196  -25.491 -20.754 1.00 140.93 ? 31  GLU B CD     1 
ATOM   6049  O  OE1    . GLU B  1 32  ? 36.476  -25.842 -21.920 1.00 155.60 ? 31  GLU B OE1    1 
ATOM   6050  O  OE2    . GLU B  1 32  ? 35.695  -24.379 -20.485 1.00 138.38 ? 31  GLU B OE2    1 
ATOM   6051  H  H      . GLU B  1 32  ? 35.918  -27.785 -22.062 1.00 128.60 ? 31  GLU B H      1 
ATOM   6052  H  HA     . GLU B  1 32  ? 37.027  -29.628 -20.634 1.00 139.51 ? 31  GLU B HA     1 
ATOM   6053  H  HB2    . GLU B  1 32  ? 37.812  -27.959 -19.281 1.00 141.98 ? 31  GLU B HB2    1 
ATOM   6054  H  HB3    . GLU B  1 32  ? 37.851  -27.417 -20.770 1.00 141.98 ? 31  GLU B HB3    1 
ATOM   6055  H  HG2    . GLU B  1 32  ? 35.632  -26.731 -19.238 1.00 149.78 ? 31  GLU B HG2    1 
ATOM   6056  H  HG3    . GLU B  1 32  ? 36.990  -25.965 -18.938 1.00 149.78 ? 31  GLU B HG3    1 
ATOM   6057  N  N      . LYS B  1 33  ? 35.986  -30.002 -18.408 1.00 86.32  ? 32  LYS B N      1 
ATOM   6058  C  CA     . LYS B  1 33  ? 35.240  -30.387 -17.220 1.00 86.46  ? 32  LYS B CA     1 
ATOM   6059  C  C      . LYS B  1 33  ? 35.192  -29.216 -16.243 1.00 83.41  ? 32  LYS B C      1 
ATOM   6060  O  O      . LYS B  1 33  ? 36.206  -28.559 -16.007 1.00 89.24  ? 32  LYS B O      1 
ATOM   6061  C  CB     . LYS B  1 33  ? 35.916  -31.598 -16.576 1.00 102.73 ? 32  LYS B CB     1 
ATOM   6062  C  CG     . LYS B  1 33  ? 35.386  -31.984 -15.212 1.00 111.18 ? 32  LYS B CG     1 
ATOM   6063  C  CD     . LYS B  1 33  ? 35.908  -33.353 -14.811 1.00 109.20 ? 32  LYS B CD     1 
ATOM   6064  C  CE     . LYS B  1 33  ? 35.646  -33.654 -13.348 1.00 96.32  ? 32  LYS B CE     1 
ATOM   6065  N  NZ     . LYS B  1 33  ? 35.993  -35.062 -13.014 1.00 90.84  ? 32  LYS B NZ     1 
ATOM   6066  H  H      . LYS B  1 33  ? 36.793  -30.299 -18.418 1.00 103.58 ? 32  LYS B H      1 
ATOM   6067  H  HA     . LYS B  1 33  ? 34.324  -30.631 -17.468 1.00 103.75 ? 32  LYS B HA     1 
ATOM   6068  H  HB2    . LYS B  1 33  ? 35.798  -32.363 -17.161 1.00 123.28 ? 32  LYS B HB2    1 
ATOM   6069  H  HB3    . LYS B  1 33  ? 36.861  -31.407 -16.478 1.00 123.28 ? 32  LYS B HB3    1 
ATOM   6070  H  HG2    . LYS B  1 33  ? 35.683  -31.336 -14.554 1.00 133.42 ? 32  LYS B HG2    1 
ATOM   6071  H  HG3    . LYS B  1 33  ? 34.417  -32.021 -15.239 1.00 133.42 ? 32  LYS B HG3    1 
ATOM   6072  H  HD2    . LYS B  1 33  ? 35.465  -34.032 -15.343 1.00 131.04 ? 32  LYS B HD2    1 
ATOM   6073  H  HD3    . LYS B  1 33  ? 36.867  -33.384 -14.959 1.00 131.04 ? 32  LYS B HD3    1 
ATOM   6074  H  HE2    . LYS B  1 33  ? 36.190  -33.068 -12.798 1.00 115.58 ? 32  LYS B HE2    1 
ATOM   6075  H  HE3    . LYS B  1 33  ? 34.705  -33.518 -13.156 1.00 115.58 ? 32  LYS B HE3    1 
ATOM   6076  H  HZ1    . LYS B  1 33  ? 35.832  -35.219 -12.152 1.00 109.01 ? 32  LYS B HZ1    1 
ATOM   6077  H  HZ2    . LYS B  1 33  ? 35.504  -35.620 -13.505 1.00 109.01 ? 32  LYS B HZ2    1 
ATOM   6078  H  HZ3    . LYS B  1 33  ? 36.855  -35.211 -13.179 1.00 109.01 ? 32  LYS B HZ3    1 
ATOM   6079  N  N      . LEU B  1 34  ? 34.015  -28.958 -15.678 1.00 84.20  ? 33  LEU B N      1 
ATOM   6080  C  CA     . LEU B  1 34  ? 33.821  -27.804 -14.800 1.00 86.55  ? 33  LEU B CA     1 
ATOM   6081  C  C      . LEU B  1 34  ? 33.901  -28.172 -13.322 1.00 98.66  ? 33  LEU B C      1 
ATOM   6082  O  O      . LEU B  1 34  ? 33.810  -27.304 -12.453 1.00 102.50 ? 33  LEU B O      1 
ATOM   6083  C  CB     . LEU B  1 34  ? 32.472  -27.141 -15.086 1.00 72.80  ? 33  LEU B CB     1 
ATOM   6084  C  CG     . LEU B  1 34  ? 32.326  -26.503 -16.468 1.00 80.58  ? 33  LEU B CG     1 
ATOM   6085  C  CD1    . LEU B  1 34  ? 30.966  -25.840 -16.611 1.00 68.41  ? 33  LEU B CD1    1 
ATOM   6086  C  CD2    . LEU B  1 34  ? 33.443  -25.498 -16.718 1.00 88.47  ? 33  LEU B CD2    1 
ATOM   6087  H  H      . LEU B  1 34  ? 33.310  -29.437 -15.787 1.00 101.04 ? 33  LEU B H      1 
ATOM   6088  H  HA     . LEU B  1 34  ? 34.524  -27.147 -14.984 1.00 103.85 ? 33  LEU B HA     1 
ATOM   6089  H  HB2    . LEU B  1 34  ? 31.777  -27.812 -15.002 1.00 87.36  ? 33  LEU B HB2    1 
ATOM   6090  H  HB3    . LEU B  1 34  ? 32.329  -26.443 -14.428 1.00 87.36  ? 33  LEU B HB3    1 
ATOM   6091  H  HG     . LEU B  1 34  ? 32.393  -27.196 -17.143 1.00 96.70  ? 33  LEU B HG     1 
ATOM   6092  H  HD11   . LEU B  1 34  ? 30.900  -25.448 -17.485 1.00 82.10  ? 33  LEU B HD11   1 
ATOM   6093  H  HD12   . LEU B  1 34  ? 30.282  -26.504 -16.497 1.00 82.10  ? 33  LEU B HD12   1 
ATOM   6094  H  HD13   . LEU B  1 34  ? 30.877  -25.160 -15.939 1.00 82.10  ? 33  LEU B HD13   1 
ATOM   6095  H  HD21   . LEU B  1 34  ? 33.327  -25.114 -17.590 1.00 106.17 ? 33  LEU B HD21   1 
ATOM   6096  H  HD22   . LEU B  1 34  ? 33.400  -24.811 -16.049 1.00 106.17 ? 33  LEU B HD22   1 
ATOM   6097  H  HD23   . LEU B  1 34  ? 34.287  -25.952 -16.669 1.00 106.17 ? 33  LEU B HD23   1 
ATOM   6098  N  N      . GLY B  1 35  ? 34.070  -29.459 -13.043 1.00 115.44 ? 34  GLY B N      1 
ATOM   6099  C  CA     . GLY B  1 35  ? 34.152  -29.937 -11.677 1.00 115.30 ? 34  GLY B CA     1 
ATOM   6100  C  C      . GLY B  1 35  ? 33.194  -31.086 -11.448 1.00 118.93 ? 34  GLY B C      1 
ATOM   6101  O  O      . GLY B  1 35  ? 32.811  -31.781 -12.389 1.00 131.13 ? 34  GLY B O      1 
ATOM   6102  H  H      . GLY B  1 35  ? 34.140  -30.078 -13.635 1.00 138.53 ? 34  GLY B H      1 
ATOM   6103  H  HA2    . GLY B  1 35  ? 35.054  -30.240 -11.489 1.00 138.37 ? 34  GLY B HA2    1 
ATOM   6104  H  HA3    . GLY B  1 35  ? 33.929  -29.219 -11.064 1.00 138.37 ? 34  GLY B HA3    1 
ATOM   6105  N  N      . GLU B  1 36  ? 32.803  -31.287 -10.196 1.00 123.44 ? 35  GLU B N      1 
ATOM   6106  C  CA     . GLU B  1 36  ? 31.894  -32.371 -9.851  1.00 126.15 ? 35  GLU B CA     1 
ATOM   6107  C  C      . GLU B  1 36  ? 31.485  -32.291 -8.388  1.00 120.69 ? 35  GLU B C      1 
ATOM   6108  O  O      . GLU B  1 36  ? 31.996  -31.465 -7.631  1.00 115.44 ? 35  GLU B O      1 
ATOM   6109  C  CB     . GLU B  1 36  ? 32.545  -33.727 -10.135 1.00 122.67 ? 35  GLU B CB     1 
ATOM   6110  C  CG     . GLU B  1 36  ? 33.896  -33.916 -9.463  1.00 128.08 ? 35  GLU B CG     1 
ATOM   6111  C  CD     . GLU B  1 36  ? 34.538  -35.249 -9.799  1.00 144.36 ? 35  GLU B CD     1 
ATOM   6112  O  OE1    . GLU B  1 36  ? 33.801  -36.241 -9.982  1.00 148.47 ? 35  GLU B OE1    1 
ATOM   6113  O  OE2    . GLU B  1 36  ? 35.784  -35.303 -9.884  1.00 149.34 ? 35  GLU B OE2    1 
ATOM   6114  H  H      . GLU B  1 36  ? 33.051  -30.809 -9.525  1.00 148.12 ? 35  GLU B H      1 
ATOM   6115  H  HA     . GLU B  1 36  ? 31.085  -32.299 -10.399 1.00 151.38 ? 35  GLU B HA     1 
ATOM   6116  H  HB2    . GLU B  1 36  ? 31.955  -34.428 -9.817  1.00 147.20 ? 35  GLU B HB2    1 
ATOM   6117  H  HB3    . GLU B  1 36  ? 32.675  -33.816 -11.092 1.00 147.20 ? 35  GLU B HB3    1 
ATOM   6118  H  HG2    . GLU B  1 36  ? 34.496  -33.213 -9.755  1.00 153.70 ? 35  GLU B HG2    1 
ATOM   6119  H  HG3    . GLU B  1 36  ? 33.779  -33.874 -8.501  1.00 153.70 ? 35  GLU B HG3    1 
ATOM   6120  N  N      . GLY B  1 37  ? 30.557  -33.156 -7.999  1.00 114.72 ? 36  GLY B N      1 
ATOM   6121  C  CA     . GLY B  1 37  ? 30.055  -33.167 -6.642  1.00 112.83 ? 36  GLY B CA     1 
ATOM   6122  C  C      . GLY B  1 37  ? 29.847  -34.570 -6.112  1.00 121.60 ? 36  GLY B C      1 
ATOM   6123  O  O      . GLY B  1 37  ? 30.805  -35.299 -5.856  1.00 129.16 ? 36  GLY B O      1 
ATOM   6124  H  H      . GLY B  1 37  ? 30.202  -33.750 -8.510  1.00 137.66 ? 36  GLY B H      1 
ATOM   6125  H  HA2    . GLY B  1 37  ? 30.683  -32.710 -6.061  1.00 135.39 ? 36  GLY B HA2    1 
ATOM   6126  H  HA3    . GLY B  1 37  ? 29.207  -32.697 -6.607  1.00 135.39 ? 36  GLY B HA3    1 
ATOM   6127  N  N      . SER B  1 38  ? 28.584  -34.948 -5.953  1.00 123.75 ? 37  SER B N      1 
ATOM   6128  C  CA     . SER B  1 38  ? 28.242  -36.215 -5.323  1.00 108.84 ? 37  SER B CA     1 
ATOM   6129  C  C      . SER B  1 38  ? 27.443  -37.130 -6.245  1.00 113.80 ? 37  SER B C      1 
ATOM   6130  O  O      . SER B  1 38  ? 27.361  -38.334 -6.006  1.00 141.70 ? 37  SER B O      1 
ATOM   6131  C  CB     . SER B  1 38  ? 27.441  -35.958 -4.044  1.00 88.69  ? 37  SER B CB     1 
ATOM   6132  O  OG     . SER B  1 38  ? 28.086  -35.006 -3.213  1.00 92.93  ? 37  SER B OG     1 
ATOM   6133  H  H      . SER B  1 38  ? 27.903  -34.486 -6.203  1.00 148.50 ? 37  SER B H      1 
ATOM   6134  H  HA     . SER B  1 38  ? 29.068  -36.681 -5.075  1.00 130.61 ? 37  SER B HA     1 
ATOM   6135  H  HB2    . SER B  1 38  ? 26.564  -35.620 -4.286  1.00 106.43 ? 37  SER B HB2    1 
ATOM   6136  H  HB3    . SER B  1 38  ? 27.351  -36.791 -3.556  1.00 106.43 ? 37  SER B HB3    1 
ATOM   6137  H  HG     . SER B  1 38  ? 28.784  -34.755 -3.563  1.00 111.52 ? 37  SER B HG     1 
ATOM   6138  N  N      . TYR B  1 39  ? 26.860  -36.567 -7.299  1.00 103.84 ? 38  TYR B N      1 
ATOM   6139  C  CA     . TYR B  1 39  ? 25.972  -37.332 -8.166  1.00 109.76 ? 38  TYR B CA     1 
ATOM   6140  C  C      . TYR B  1 39  ? 26.482  -37.404 -9.601  1.00 111.47 ? 38  TYR B C      1 
ATOM   6141  O  O      . TYR B  1 39  ? 25.839  -38.005 -10.459 1.00 122.55 ? 38  TYR B O      1 
ATOM   6142  C  CB     . TYR B  1 39  ? 24.567  -36.728 -8.145  1.00 132.53 ? 38  TYR B CB     1 
ATOM   6143  C  CG     . TYR B  1 39  ? 23.970  -36.623 -6.759  1.00 162.84 ? 38  TYR B CG     1 
ATOM   6144  C  CD1    . TYR B  1 39  ? 23.128  -37.611 -6.266  1.00 171.15 ? 38  TYR B CD1    1 
ATOM   6145  C  CD2    . TYR B  1 39  ? 24.252  -35.536 -5.942  1.00 177.25 ? 38  TYR B CD2    1 
ATOM   6146  C  CE1    . TYR B  1 39  ? 22.581  -37.517 -4.999  1.00 178.18 ? 38  TYR B CE1    1 
ATOM   6147  C  CE2    . TYR B  1 39  ? 23.711  -35.433 -4.675  1.00 179.99 ? 38  TYR B CE2    1 
ATOM   6148  C  CZ     . TYR B  1 39  ? 22.876  -36.426 -4.208  1.00 181.17 ? 38  TYR B CZ     1 
ATOM   6149  O  OH     . TYR B  1 39  ? 22.337  -36.323 -2.946  1.00 184.35 ? 38  TYR B OH     1 
ATOM   6150  H  H      . TYR B  1 39  ? 26.961  -35.745 -7.533  1.00 124.61 ? 38  TYR B H      1 
ATOM   6151  H  HA     . TYR B  1 39  ? 25.910  -38.249 -7.824  1.00 131.71 ? 38  TYR B HA     1 
ATOM   6152  H  HB2    . TYR B  1 39  ? 24.606  -35.834 -8.520  1.00 159.03 ? 38  TYR B HB2    1 
ATOM   6153  H  HB3    . TYR B  1 39  ? 23.980  -37.284 -8.680  1.00 159.03 ? 38  TYR B HB3    1 
ATOM   6154  H  HD1    . TYR B  1 39  ? 22.926  -38.347 -6.798  1.00 205.38 ? 38  TYR B HD1    1 
ATOM   6155  H  HD2    . TYR B  1 39  ? 24.815  -34.864 -6.254  1.00 212.70 ? 38  TYR B HD2    1 
ATOM   6156  H  HE1    . TYR B  1 39  ? 22.017  -38.185 -4.682  1.00 213.82 ? 38  TYR B HE1    1 
ATOM   6157  H  HE2    . TYR B  1 39  ? 23.908  -34.699 -4.140  1.00 215.99 ? 38  TYR B HE2    1 
ATOM   6158  H  HH     . TYR B  1 39  ? 21.884  -35.642 -2.889  1.00 221.22 ? 38  TYR B HH     1 
ATOM   6159  N  N      . GLY B  1 40  ? 27.635  -36.798 -9.864  1.00 121.73 ? 39  GLY B N      1 
ATOM   6160  C  CA     . GLY B  1 40  ? 28.198  -36.818 -11.201 1.00 87.09  ? 39  GLY B CA     1 
ATOM   6161  C  C      . GLY B  1 40  ? 29.030  -35.593 -11.514 1.00 80.25  ? 39  GLY B C      1 
ATOM   6162  O  O      . GLY B  1 40  ? 29.238  -34.738 -10.652 1.00 96.84  ? 39  GLY B O      1 
ATOM   6163  H  H      . GLY B  1 40  ? 28.107  -36.371 -9.286  1.00 146.07 ? 39  GLY B H      1 
ATOM   6164  H  HA2    . GLY B  1 40  ? 28.759  -37.603 -11.301 1.00 104.51 ? 39  GLY B HA2    1 
ATOM   6165  H  HA3    . GLY B  1 40  ? 27.479  -36.873 -11.851 1.00 104.51 ? 39  GLY B HA3    1 
ATOM   6166  N  N      . SER B  1 41  ? 29.508  -35.512 -12.752 1.00 90.20  ? 40  SER B N      1 
ATOM   6167  C  CA     . SER B  1 41  ? 30.336  -34.391 -13.184 1.00 89.83  ? 40  SER B CA     1 
ATOM   6168  C  C      . SER B  1 41  ? 29.554  -33.428 -14.072 1.00 85.83  ? 40  SER B C      1 
ATOM   6169  O  O      . SER B  1 41  ? 28.645  -33.833 -14.794 1.00 83.05  ? 40  SER B O      1 
ATOM   6170  C  CB     . SER B  1 41  ? 31.566  -34.897 -13.940 1.00 84.29  ? 40  SER B CB     1 
ATOM   6171  O  OG     . SER B  1 41  ? 32.446  -35.594 -13.077 1.00 88.95  ? 40  SER B OG     1 
ATOM   6172  H  H      . SER B  1 41  ? 29.366  -36.097 -13.366 1.00 108.24 ? 40  SER B H      1 
ATOM   6173  H  HA     . SER B  1 41  ? 30.644  -33.896 -12.396 1.00 107.80 ? 40  SER B HA     1 
ATOM   6174  H  HB2    . SER B  1 41  ? 31.276  -35.496 -14.646 1.00 101.14 ? 40  SER B HB2    1 
ATOM   6175  H  HB3    . SER B  1 41  ? 32.034  -34.138 -14.322 1.00 101.14 ? 40  SER B HB3    1 
ATOM   6176  H  HG     . SER B  1 41  ? 33.099  -35.858 -13.497 1.00 106.74 ? 40  SER B HG     1 
ATOM   6177  N  N      . VAL B  1 42  ? 29.910  -32.150 -14.008 1.00 82.51  ? 41  VAL B N      1 
ATOM   6178  C  CA     . VAL B  1 42  ? 29.333  -31.148 -14.893 1.00 85.34  ? 41  VAL B CA     1 
ATOM   6179  C  C      . VAL B  1 42  ? 30.335  -30.776 -15.980 1.00 90.96  ? 41  VAL B C      1 
ATOM   6180  O  O      . VAL B  1 42  ? 31.537  -30.703 -15.725 1.00 94.68  ? 41  VAL B O      1 
ATOM   6181  C  CB     . VAL B  1 42  ? 28.934  -29.883 -14.120 1.00 74.15  ? 41  VAL B CB     1 
ATOM   6182  C  CG1    . VAL B  1 42  ? 28.714  -28.722 -15.071 1.00 83.59  ? 41  VAL B CG1    1 
ATOM   6183  C  CG2    . VAL B  1 42  ? 27.686  -30.141 -13.301 1.00 75.88  ? 41  VAL B CG2    1 
ATOM   6184  H  H      . VAL B  1 42  ? 30.490  -31.836 -13.455 1.00 99.02  ? 41  VAL B H      1 
ATOM   6185  H  HA     . VAL B  1 42  ? 28.531  -31.514 -15.322 1.00 102.40 ? 41  VAL B HA     1 
ATOM   6186  H  HB     . VAL B  1 42  ? 29.658  -29.640 -13.505 1.00 88.98  ? 41  VAL B HB     1 
ATOM   6187  H  HG11   . VAL B  1 42  ? 28.466  -27.946 -14.564 1.00 100.31 ? 41  VAL B HG11   1 
ATOM   6188  H  HG12   . VAL B  1 42  ? 29.527  -28.554 -15.552 1.00 100.31 ? 41  VAL B HG12   1 
ATOM   6189  H  HG13   . VAL B  1 42  ? 28.011  -28.951 -15.684 1.00 100.31 ? 41  VAL B HG13   1 
ATOM   6190  H  HG21   . VAL B  1 42  ? 27.453  -29.341 -12.825 1.00 91.06  ? 41  VAL B HG21   1 
ATOM   6191  H  HG22   . VAL B  1 42  ? 26.971  -30.391 -13.892 1.00 91.06  ? 41  VAL B HG22   1 
ATOM   6192  H  HG23   . VAL B  1 42  ? 27.861  -30.852 -12.680 1.00 91.06  ? 41  VAL B HG23   1 
ATOM   6193  N  N      . PHE B  1 43  ? 29.839  -30.535 -17.189 1.00 91.19  ? 42  PHE B N      1 
ATOM   6194  C  CA     . PHE B  1 43  ? 30.707  -30.198 -18.310 1.00 85.52  ? 42  PHE B CA     1 
ATOM   6195  C  C      . PHE B  1 43  ? 30.232  -28.949 -19.043 1.00 85.72  ? 42  PHE B C      1 
ATOM   6196  O  O      . PHE B  1 43  ? 29.049  -28.611 -19.027 1.00 81.42  ? 42  PHE B O      1 
ATOM   6197  C  CB     . PHE B  1 43  ? 30.791  -31.370 -19.291 1.00 75.81  ? 42  PHE B CB     1 
ATOM   6198  C  CG     . PHE B  1 43  ? 31.603  -32.529 -18.783 1.00 85.72  ? 42  PHE B CG     1 
ATOM   6199  C  CD1    . PHE B  1 43  ? 32.984  -32.532 -18.904 1.00 86.93  ? 42  PHE B CD1    1 
ATOM   6200  C  CD2    . PHE B  1 43  ? 30.987  -33.617 -18.186 1.00 93.44  ? 42  PHE B CD2    1 
ATOM   6201  C  CE1    . PHE B  1 43  ? 33.734  -33.597 -18.437 1.00 86.12  ? 42  PHE B CE1    1 
ATOM   6202  C  CE2    . PHE B  1 43  ? 31.734  -34.685 -17.718 1.00 88.71  ? 42  PHE B CE2    1 
ATOM   6203  C  CZ     . PHE B  1 43  ? 33.108  -34.673 -17.845 1.00 83.30  ? 42  PHE B CZ     1 
ATOM   6204  H  H      . PHE B  1 43  ? 29.002  -30.561 -17.387 1.00 109.43 ? 42  PHE B H      1 
ATOM   6205  H  HA     . PHE B  1 43  ? 31.609  -30.024 -17.971 1.00 102.62 ? 42  PHE B HA     1 
ATOM   6206  H  HB2    . PHE B  1 43  ? 29.894  -31.693 -19.470 1.00 90.97  ? 42  PHE B HB2    1 
ATOM   6207  H  HB3    . PHE B  1 43  ? 31.200  -31.060 -20.114 1.00 90.97  ? 42  PHE B HB3    1 
ATOM   6208  H  HD1    . PHE B  1 43  ? 33.411  -31.808 -19.303 1.00 104.31 ? 42  PHE B HD1    1 
ATOM   6209  H  HD2    . PHE B  1 43  ? 30.061  -33.630 -18.098 1.00 112.13 ? 42  PHE B HD2    1 
ATOM   6210  H  HE1    . PHE B  1 43  ? 34.660  -33.587 -18.524 1.00 103.34 ? 42  PHE B HE1    1 
ATOM   6211  H  HE2    . PHE B  1 43  ? 31.309  -35.410 -17.319 1.00 106.45 ? 42  PHE B HE2    1 
ATOM   6212  H  HZ     . PHE B  1 43  ? 33.611  -35.390 -17.531 1.00 99.97  ? 42  PHE B HZ     1 
ATOM   6213  N  N      . LYS B  1 44  ? 31.176  -28.262 -19.675 1.00 77.53  ? 43  LYS B N      1 
ATOM   6214  C  CA     . LYS B  1 44  ? 30.857  -27.141 -20.542 1.00 71.28  ? 43  LYS B CA     1 
ATOM   6215  C  C      . LYS B  1 44  ? 30.711  -27.678 -21.957 1.00 80.75  ? 43  LYS B C      1 
ATOM   6216  O  O      . LYS B  1 44  ? 31.644  -28.271 -22.494 1.00 75.13  ? 43  LYS B O      1 
ATOM   6217  C  CB     . LYS B  1 44  ? 31.972  -26.101 -20.490 1.00 61.74  ? 43  LYS B CB     1 
ATOM   6218  C  CG     . LYS B  1 44  ? 31.718  -24.875 -21.345 1.00 66.80  ? 43  LYS B CG     1 
ATOM   6219  C  CD     . LYS B  1 44  ? 32.951  -23.995 -21.388 1.00 67.31  ? 43  LYS B CD     1 
ATOM   6220  C  CE     . LYS B  1 44  ? 32.706  -22.727 -22.173 1.00 78.71  ? 43  LYS B CE     1 
ATOM   6221  N  NZ     . LYS B  1 44  ? 33.951  -21.927 -22.302 1.00 111.12 ? 43  LYS B NZ     1 
ATOM   6222  H  H      . LYS B  1 44  ? 32.017  -28.429 -19.616 1.00 93.03  ? 43  LYS B H      1 
ATOM   6223  H  HA     . LYS B  1 44  ? 30.014  -26.726 -20.264 1.00 85.54  ? 43  LYS B HA     1 
ATOM   6224  H  HB2    . LYS B  1 44  ? 32.079  -25.805 -19.573 1.00 74.09  ? 43  LYS B HB2    1 
ATOM   6225  H  HB3    . LYS B  1 44  ? 32.795  -26.511 -20.800 1.00 74.09  ? 43  LYS B HB3    1 
ATOM   6226  H  HG2    . LYS B  1 44  ? 31.505  -25.150 -22.250 1.00 80.17  ? 43  LYS B HG2    1 
ATOM   6227  H  HG3    . LYS B  1 44  ? 30.988  -24.362 -20.965 1.00 80.17  ? 43  LYS B HG3    1 
ATOM   6228  H  HD2    . LYS B  1 44  ? 33.199  -23.748 -20.483 1.00 80.78  ? 43  LYS B HD2    1 
ATOM   6229  H  HD3    . LYS B  1 44  ? 33.675  -24.480 -21.814 1.00 80.78  ? 43  LYS B HD3    1 
ATOM   6230  H  HE2    . LYS B  1 44  ? 32.396  -22.955 -23.063 1.00 94.46  ? 43  LYS B HE2    1 
ATOM   6231  H  HE3    . LYS B  1 44  ? 32.043  -22.188 -21.714 1.00 94.46  ? 43  LYS B HE3    1 
ATOM   6232  H  HZ1    . LYS B  1 44  ? 33.789  -21.185 -22.767 1.00 133.35 ? 43  LYS B HZ1    1 
ATOM   6233  H  HZ2    . LYS B  1 44  ? 34.254  -21.703 -21.496 1.00 133.35 ? 43  LYS B HZ2    1 
ATOM   6234  H  HZ3    . LYS B  1 44  ? 34.575  -22.401 -22.724 1.00 133.35 ? 43  LYS B HZ3    1 
ATOM   6235  N  N      . ALA B  1 45  ? 29.538  -27.490 -22.553 1.00 79.10  ? 44  ALA B N      1 
ATOM   6236  C  CA     . ALA B  1 45  ? 29.275  -28.023 -23.884 1.00 80.76  ? 44  ALA B CA     1 
ATOM   6237  C  C      . ALA B  1 45  ? 28.610  -26.979 -24.768 1.00 80.35  ? 44  ALA B C      1 
ATOM   6238  O  O      . ALA B  1 45  ? 28.109  -25.968 -24.277 1.00 74.50  ? 44  ALA B O      1 
ATOM   6239  C  CB     . ALA B  1 45  ? 28.411  -29.273 -23.795 1.00 96.92  ? 44  ALA B CB     1 
ATOM   6240  H  H      . ALA B  1 45  ? 28.879  -27.057 -22.208 1.00 94.92  ? 44  ALA B H      1 
ATOM   6241  H  HA     . ALA B  1 45  ? 30.126  -28.273 -24.300 1.00 96.91  ? 44  ALA B HA     1 
ATOM   6242  H  HB1    . ALA B  1 45  ? 28.251  -29.606 -24.681 1.00 116.30 ? 44  ALA B HB1    1 
ATOM   6243  H  HB2    . ALA B  1 45  ? 28.872  -29.935 -23.274 1.00 116.30 ? 44  ALA B HB2    1 
ATOM   6244  H  HB3    . ALA B  1 45  ? 27.578  -29.048 -23.374 1.00 116.30 ? 44  ALA B HB3    1 
ATOM   6245  N  N      . ILE B  1 46  ? 28.601  -27.237 -26.073 1.00 94.32  ? 45  ILE B N      1 
ATOM   6246  C  CA     . ILE B  1 46  ? 28.089  -26.280 -27.048 1.00 84.42  ? 45  ILE B CA     1 
ATOM   6247  C  C      . ILE B  1 46  ? 26.998  -26.874 -27.927 1.00 79.88  ? 45  ILE B C      1 
ATOM   6248  O  O      . ILE B  1 46  ? 27.192  -27.914 -28.555 1.00 73.28  ? 45  ILE B O      1 
ATOM   6249  C  CB     . ILE B  1 46  ? 29.211  -25.776 -27.965 1.00 83.44  ? 45  ILE B CB     1 
ATOM   6250  C  CG1    . ILE B  1 46  ? 30.218  -24.961 -27.153 1.00 110.22 ? 45  ILE B CG1    1 
ATOM   6251  C  CG2    . ILE B  1 46  ? 28.630  -24.933 -29.098 1.00 94.83  ? 45  ILE B CG2    1 
ATOM   6252  C  CD1    . ILE B  1 46  ? 31.409  -24.498 -27.948 1.00 129.20 ? 45  ILE B CD1    1 
ATOM   6253  H  H      . ILE B  1 46  ? 28.888  -27.969 -26.423 1.00 113.19 ? 45  ILE B H      1 
ATOM   6254  H  HA     . ILE B  1 46  ? 27.713  -25.509 -26.574 1.00 101.31 ? 45  ILE B HA     1 
ATOM   6255  H  HB     . ILE B  1 46  ? 29.667  -26.541 -28.349 1.00 100.13 ? 45  ILE B HB     1 
ATOM   6256  H  HG12   . ILE B  1 46  ? 29.772  -24.174 -26.802 1.00 132.26 ? 45  ILE B HG12   1 
ATOM   6257  H  HG13   . ILE B  1 46  ? 30.544  -25.508 -26.421 1.00 132.26 ? 45  ILE B HG13   1 
ATOM   6258  H  HG21   . ILE B  1 46  ? 29.347  -24.628 -29.659 1.00 113.80 ? 45  ILE B HG21   1 
ATOM   6259  H  HG22   . ILE B  1 46  ? 28.022  -25.472 -29.608 1.00 113.80 ? 45  ILE B HG22   1 
ATOM   6260  H  HG23   . ILE B  1 46  ? 28.166  -24.181 -28.721 1.00 113.80 ? 45  ILE B HG23   1 
ATOM   6261  H  HD11   . ILE B  1 46  ? 31.992  -23.997 -27.373 1.00 155.04 ? 45  ILE B HD11   1 
ATOM   6262  H  HD12   . ILE B  1 46  ? 31.871  -25.266 -28.294 1.00 155.04 ? 45  ILE B HD12   1 
ATOM   6263  H  HD13   . ILE B  1 46  ? 31.106  -23.945 -28.671 1.00 155.04 ? 45  ILE B HD13   1 
ATOM   6264  N  N      . HIS B  1 47  ? 25.854  -26.200 -27.972 1.00 70.30  ? 46  HIS B N      1 
ATOM   6265  C  CA     . HIS B  1 47  ? 24.768  -26.596 -28.858 1.00 76.60  ? 46  HIS B CA     1 
ATOM   6266  C  C      . HIS B  1 47  ? 25.185  -26.293 -30.292 1.00 85.94  ? 46  HIS B C      1 
ATOM   6267  O  O      . HIS B  1 47  ? 25.210  -25.133 -30.703 1.00 79.94  ? 46  HIS B O      1 
ATOM   6268  C  CB     . HIS B  1 47  ? 23.490  -25.839 -28.498 1.00 77.43  ? 46  HIS B CB     1 
ATOM   6269  C  CG     . HIS B  1 47  ? 22.278  -26.309 -29.243 1.00 78.65  ? 46  HIS B CG     1 
ATOM   6270  N  ND1    . HIS B  1 47  ? 21.961  -27.638 -29.379 1.00 96.88  ? 46  HIS B ND1    1 
ATOM   6271  C  CD2    . HIS B  1 47  ? 21.306  -25.617 -29.886 1.00 76.32  ? 46  HIS B CD2    1 
ATOM   6272  C  CE1    . HIS B  1 47  ? 20.843  -27.753 -30.082 1.00 98.13  ? 46  HIS B CE1    1 
ATOM   6273  N  NE2    . HIS B  1 47  ? 20.428  -26.542 -30.396 1.00 79.23  ? 46  HIS B NE2    1 
ATOM   6274  H  H      . HIS B  1 47  ? 25.681  -25.505 -27.496 1.00 84.36  ? 46  HIS B H      1 
ATOM   6275  H  HA     . HIS B  1 47  ? 24.602  -27.558 -28.773 1.00 91.92  ? 46  HIS B HA     1 
ATOM   6276  H  HB2    . HIS B  1 47  ? 23.317  -25.951 -27.550 1.00 92.91  ? 46  HIS B HB2    1 
ATOM   6277  H  HB3    . HIS B  1 47  ? 23.616  -24.898 -28.700 1.00 92.91  ? 46  HIS B HB3    1 
ATOM   6278  H  HD1    . HIS B  1 47  ? 22.419  -28.293 -29.061 1.00 116.25 ? 46  HIS B HD1    1 
ATOM   6279  H  HD2    . HIS B  1 47  ? 21.245  -24.692 -29.967 1.00 91.58  ? 46  HIS B HD2    1 
ATOM   6280  H  HE1    . HIS B  1 47  ? 20.421  -28.550 -30.310 1.00 117.76 ? 46  HIS B HE1    1 
ATOM   6281  H  HE2    . HIS B  1 47  ? 19.722  -26.360 -30.851 1.00 95.07  ? 46  HIS B HE2    1 
ATOM   6282  N  N      . LYS B  1 48  ? 25.517  -27.339 -31.045 1.00 83.48  ? 47  LYS B N      1 
ATOM   6283  C  CA     . LYS B  1 48  ? 26.106  -27.184 -32.375 1.00 62.76  ? 47  LYS B CA     1 
ATOM   6284  C  C      . LYS B  1 48  ? 25.315  -26.240 -33.277 1.00 68.12  ? 47  LYS B C      1 
ATOM   6285  O  O      . LYS B  1 48  ? 25.899  -25.406 -33.969 1.00 65.07  ? 47  LYS B O      1 
ATOM   6286  C  CB     . LYS B  1 48  ? 26.246  -28.545 -33.059 1.00 65.77  ? 47  LYS B CB     1 
ATOM   6287  C  CG     . LYS B  1 48  ? 27.262  -29.466 -32.401 1.00 88.61  ? 47  LYS B CG     1 
ATOM   6288  C  CD     . LYS B  1 48  ? 27.557  -30.685 -33.258 1.00 81.44  ? 47  LYS B CD     1 
ATOM   6289  C  CE     . LYS B  1 48  ? 28.584  -31.583 -32.595 1.00 91.42  ? 47  LYS B CE     1 
ATOM   6290  N  NZ     . LYS B  1 48  ? 28.991  -32.712 -33.472 1.00 96.70  ? 47  LYS B NZ     1 
ATOM   6291  H  H      . LYS B  1 48  ? 25.411  -28.158 -30.806 1.00 100.18 ? 47  LYS B H      1 
ATOM   6292  H  HA     . LYS B  1 48  ? 27.006  -26.810 -32.275 1.00 75.32  ? 47  LYS B HA     1 
ATOM   6293  H  HB2    . LYS B  1 48  ? 25.386  -28.993 -33.041 1.00 78.93  ? 47  LYS B HB2    1 
ATOM   6294  H  HB3    . LYS B  1 48  ? 26.525  -28.406 -33.978 1.00 78.93  ? 47  LYS B HB3    1 
ATOM   6295  H  HG2    . LYS B  1 48  ? 28.091  -28.981 -32.267 1.00 106.33 ? 47  LYS B HG2    1 
ATOM   6296  H  HG3    . LYS B  1 48  ? 26.911  -29.771 -31.550 1.00 106.33 ? 47  LYS B HG3    1 
ATOM   6297  H  HD2    . LYS B  1 48  ? 26.741  -31.194 -33.384 1.00 97.73  ? 47  LYS B HD2    1 
ATOM   6298  H  HD3    . LYS B  1 48  ? 27.910  -30.397 -34.115 1.00 97.73  ? 47  LYS B HD3    1 
ATOM   6299  H  HE2    . LYS B  1 48  ? 29.375  -31.062 -32.387 1.00 109.70 ? 47  LYS B HE2    1 
ATOM   6300  H  HE3    . LYS B  1 48  ? 28.205  -31.954 -31.782 1.00 109.70 ? 47  LYS B HE3    1 
ATOM   6301  H  HZ1    . LYS B  1 48  ? 29.592  -33.219 -33.056 1.00 116.04 ? 47  LYS B HZ1    1 
ATOM   6302  H  HZ2    . LYS B  1 48  ? 28.282  -33.210 -33.674 1.00 116.04 ? 47  LYS B HZ2    1 
ATOM   6303  H  HZ3    . LYS B  1 48  ? 29.348  -32.398 -34.225 1.00 116.04 ? 47  LYS B HZ3    1 
ATOM   6304  N  N      . GLU B  1 49  ? 23.992  -26.373 -33.268 1.00 85.99  ? 48  GLU B N      1 
ATOM   6305  C  CA     . GLU B  1 49  ? 23.132  -25.551 -34.118 1.00 84.61  ? 48  GLU B CA     1 
ATOM   6306  C  C      . GLU B  1 49  ? 23.209  -24.070 -33.757 1.00 80.29  ? 48  GLU B C      1 
ATOM   6307  O  O      . GLU B  1 49  ? 23.295  -23.216 -34.636 1.00 90.51  ? 48  GLU B O      1 
ATOM   6308  C  CB     . GLU B  1 49  ? 21.677  -26.023 -34.023 1.00 120.73 ? 48  GLU B CB     1 
ATOM   6309  C  CG     . GLU B  1 49  ? 21.391  -27.332 -34.749 1.00 153.48 ? 48  GLU B CG     1 
ATOM   6310  C  CD     . GLU B  1 49  ? 19.957  -27.804 -34.573 1.00 177.52 ? 48  GLU B CD     1 
ATOM   6311  O  OE1    . GLU B  1 49  ? 19.263  -27.284 -33.675 1.00 186.26 ? 48  GLU B OE1    1 
ATOM   6312  O  OE2    . GLU B  1 49  ? 19.525  -28.695 -35.334 1.00 184.78 ? 48  GLU B OE2    1 
ATOM   6313  H  H      . GLU B  1 49  ? 23.565  -26.934 -32.777 1.00 103.19 ? 48  GLU B H      1 
ATOM   6314  H  HA     . GLU B  1 49  ? 23.420  -25.649 -35.050 1.00 101.53 ? 48  GLU B HA     1 
ATOM   6315  H  HB2    . GLU B  1 49  ? 21.452  -26.150 -33.088 1.00 144.87 ? 48  GLU B HB2    1 
ATOM   6316  H  HB3    . GLU B  1 49  ? 21.104  -25.342 -34.407 1.00 144.87 ? 48  GLU B HB3    1 
ATOM   6317  H  HG2    . GLU B  1 49  ? 21.550  -27.208 -35.698 1.00 184.18 ? 48  GLU B HG2    1 
ATOM   6318  H  HG3    . GLU B  1 49  ? 21.978  -28.022 -34.401 1.00 184.18 ? 48  GLU B HG3    1 
ATOM   6319  N  N      . SER B  1 50  ? 23.186  -23.769 -32.462 1.00 105.11 ? 49  SER B N      1 
ATOM   6320  C  CA     . SER B  1 50  ? 23.077  -22.387 -32.004 1.00 96.50  ? 49  SER B CA     1 
ATOM   6321  C  C      . SER B  1 50  ? 24.406  -21.799 -31.524 1.00 85.05  ? 49  SER B C      1 
ATOM   6322  O  O      . SER B  1 50  ? 24.508  -20.597 -31.296 1.00 88.41  ? 49  SER B O      1 
ATOM   6323  C  CB     . SER B  1 50  ? 22.034  -22.290 -30.886 1.00 98.54  ? 49  SER B CB     1 
ATOM   6324  O  OG     . SER B  1 50  ? 20.783  -22.797 -31.320 1.00 111.28 ? 49  SER B OG     1 
ATOM   6325  H  H      . SER B  1 50  ? 23.231  -24.348 -31.827 1.00 126.13 ? 49  SER B H      1 
ATOM   6326  H  HA     . SER B  1 50  ? 22.763  -21.835 -32.751 1.00 115.80 ? 49  SER B HA     1 
ATOM   6327  H  HB2    . SER B  1 50  ? 22.338  -22.809 -30.125 1.00 118.25 ? 49  SER B HB2    1 
ATOM   6328  H  HB3    . SER B  1 50  ? 21.928  -21.360 -30.632 1.00 118.25 ? 49  SER B HB3    1 
ATOM   6329  H  HG     . SER B  1 50  ? 20.233  -22.741 -30.715 1.00 133.53 ? 49  SER B HG     1 
ATOM   6330  N  N      . GLY B  1 51  ? 25.424  -22.640 -31.374 1.00 83.87  ? 50  GLY B N      1 
ATOM   6331  C  CA     . GLY B  1 51  ? 26.683  -22.199 -30.798 1.00 66.87  ? 50  GLY B CA     1 
ATOM   6332  C  C      . GLY B  1 51  ? 26.506  -21.661 -29.388 1.00 80.12  ? 50  GLY B C      1 
ATOM   6333  O  O      . GLY B  1 51  ? 27.394  -20.996 -28.852 1.00 72.48  ? 50  GLY B O      1 
ATOM   6334  H  H      . GLY B  1 51  ? 25.410  -23.470 -31.599 1.00 100.64 ? 50  GLY B H      1 
ATOM   6335  H  HA2    . GLY B  1 51  ? 27.305  -22.942 -30.769 1.00 80.25  ? 50  GLY B HA2    1 
ATOM   6336  H  HA3    . GLY B  1 51  ? 27.065  -21.498 -31.350 1.00 80.25  ? 50  GLY B HA3    1 
ATOM   6337  N  N      . GLN B  1 52  ? 25.358  -21.960 -28.785 1.00 81.29  ? 51  GLN B N      1 
ATOM   6338  C  CA     . GLN B  1 52  ? 25.045  -21.502 -27.438 1.00 77.78  ? 51  GLN B CA     1 
ATOM   6339  C  C      . GLN B  1 52  ? 25.734  -22.414 -26.428 1.00 89.98  ? 51  GLN B C      1 
ATOM   6340  O  O      . GLN B  1 52  ? 25.606  -23.636 -26.504 1.00 98.89  ? 51  GLN B O      1 
ATOM   6341  C  CB     . GLN B  1 52  ? 23.532  -21.538 -27.215 1.00 103.60 ? 51  GLN B CB     1 
ATOM   6342  C  CG     . GLN B  1 52  ? 23.013  -20.497 -26.238 1.00 124.68 ? 51  GLN B CG     1 
ATOM   6343  C  CD     . GLN B  1 52  ? 22.768  -19.151 -26.895 1.00 135.50 ? 51  GLN B CD     1 
ATOM   6344  O  OE1    . GLN B  1 52  ? 22.994  -18.980 -28.094 1.00 126.31 ? 51  GLN B OE1    1 
ATOM   6345  N  NE2    . GLN B  1 52  ? 22.297  -18.188 -26.112 1.00 144.12 ? 51  GLN B NE2    1 
ATOM   6346  H  H      . GLN B  1 52  ? 24.736  -22.433 -29.143 1.00 97.55  ? 51  GLN B H      1 
ATOM   6347  H  HA     . GLN B  1 52  ? 25.366  -20.585 -27.312 1.00 93.33  ? 51  GLN B HA     1 
ATOM   6348  H  HB2    . GLN B  1 52  ? 23.090  -21.389 -28.066 1.00 124.33 ? 51  GLN B HB2    1 
ATOM   6349  H  HB3    . GLN B  1 52  ? 23.290  -22.411 -26.870 1.00 124.33 ? 51  GLN B HB3    1 
ATOM   6350  H  HG2    . GLN B  1 52  ? 22.174  -20.806 -25.863 1.00 149.62 ? 51  GLN B HG2    1 
ATOM   6351  H  HG3    . GLN B  1 52  ? 23.667  -20.372 -25.532 1.00 149.62 ? 51  GLN B HG3    1 
ATOM   6352  H  HE21   . GLN B  1 52  ? 22.148  -18.345 -25.280 1.00 172.94 ? 51  GLN B HE21   1 
ATOM   6353  H  HE22   . GLN B  1 52  ? 22.142  -17.407 -26.437 1.00 172.94 ? 51  GLN B HE22   1 
ATOM   6354  N  N      . VAL B  1 53  ? 26.467  -21.827 -25.487 1.00 83.11  ? 52  VAL B N      1 
ATOM   6355  C  CA     . VAL B  1 53  ? 27.159  -22.612 -24.468 1.00 72.72  ? 52  VAL B CA     1 
ATOM   6356  C  C      . VAL B  1 53  ? 26.180  -23.094 -23.401 1.00 69.08  ? 52  VAL B C      1 
ATOM   6357  O  O      . VAL B  1 53  ? 25.331  -22.337 -22.932 1.00 81.55  ? 52  VAL B O      1 
ATOM   6358  C  CB     . VAL B  1 53  ? 28.283  -21.801 -23.793 1.00 63.69  ? 52  VAL B CB     1 
ATOM   6359  C  CG1    . VAL B  1 53  ? 28.986  -22.638 -22.729 1.00 53.26  ? 52  VAL B CG1    1 
ATOM   6360  C  CG2    . VAL B  1 53  ? 29.278  -21.313 -24.831 1.00 76.00  ? 52  VAL B CG2    1 
ATOM   6361  H  H      . VAL B  1 53  ? 26.580  -20.977 -25.416 1.00 99.74  ? 52  VAL B H      1 
ATOM   6362  H  HA     . VAL B  1 53  ? 27.562  -23.399 -24.890 1.00 87.26  ? 52  VAL B HA     1 
ATOM   6363  H  HB     . VAL B  1 53  ? 27.893  -21.016 -23.354 1.00 76.43  ? 52  VAL B HB     1 
ATOM   6364  H  HG11   . VAL B  1 53  ? 29.680  -22.111 -22.325 1.00 63.91  ? 52  VAL B HG11   1 
ATOM   6365  H  HG12   . VAL B  1 53  ? 28.345  -22.901 -22.065 1.00 63.91  ? 52  VAL B HG12   1 
ATOM   6366  H  HG13   . VAL B  1 53  ? 29.365  -23.416 -23.145 1.00 63.91  ? 52  VAL B HG13   1 
ATOM   6367  H  HG21   . VAL B  1 53  ? 29.968  -20.811 -24.390 1.00 91.21  ? 52  VAL B HG21   1 
ATOM   6368  H  HG22   . VAL B  1 53  ? 29.659  -22.072 -25.279 1.00 91.21  ? 52  VAL B HG22   1 
ATOM   6369  H  HG23   . VAL B  1 53  ? 28.820  -20.755 -25.464 1.00 91.21  ? 52  VAL B HG23   1 
ATOM   6370  N  N      . VAL B  1 54  ? 26.305  -24.361 -23.021 1.00 64.41  ? 53  VAL B N      1 
ATOM   6371  C  CA     . VAL B  1 54  ? 25.443  -24.945 -22.002 1.00 63.99  ? 53  VAL B CA     1 
ATOM   6372  C  C      . VAL B  1 54  ? 26.273  -25.795 -21.046 1.00 72.96  ? 53  VAL B C      1 
ATOM   6373  O  O      . VAL B  1 54  ? 27.450  -26.056 -21.299 1.00 78.37  ? 53  VAL B O      1 
ATOM   6374  C  CB     . VAL B  1 54  ? 24.340  -25.821 -22.628 1.00 58.14  ? 53  VAL B CB     1 
ATOM   6375  C  CG1    . VAL B  1 54  ? 23.436  -24.981 -23.524 1.00 61.98  ? 53  VAL B CG1    1 
ATOM   6376  C  CG2    . VAL B  1 54  ? 24.952  -26.973 -23.408 1.00 51.42  ? 53  VAL B CG2    1 
ATOM   6377  H  H      . VAL B  1 54  ? 26.886  -24.907 -23.342 1.00 77.30  ? 53  VAL B H      1 
ATOM   6378  H  HA     . VAL B  1 54  ? 25.015  -24.229 -21.488 1.00 76.79  ? 53  VAL B HA     1 
ATOM   6379  H  HB     . VAL B  1 54  ? 23.788  -26.199 -21.912 1.00 69.77  ? 53  VAL B HB     1 
ATOM   6380  H  HG11   . VAL B  1 54  ? 22.759  -25.546 -23.902 1.00 74.37  ? 53  VAL B HG11   1 
ATOM   6381  H  HG12   . VAL B  1 54  ? 23.030  -24.289 -22.997 1.00 74.37  ? 53  VAL B HG12   1 
ATOM   6382  H  HG13   . VAL B  1 54  ? 23.966  -24.592 -24.224 1.00 74.37  ? 53  VAL B HG13   1 
ATOM   6383  H  HG21   . VAL B  1 54  ? 24.246  -27.502 -23.788 1.00 61.71  ? 53  VAL B HG21   1 
ATOM   6384  H  HG22   . VAL B  1 54  ? 25.506  -26.617 -24.107 1.00 61.71  ? 53  VAL B HG22   1 
ATOM   6385  H  HG23   . VAL B  1 54  ? 25.479  -27.509 -22.811 1.00 61.71  ? 53  VAL B HG23   1 
ATOM   6386  N  N      . ALA B  1 55  ? 25.658  -26.210 -19.943 1.00 83.19  ? 54  ALA B N      1 
ATOM   6387  C  CA     . ALA B  1 55  ? 26.302  -27.117 -19.000 1.00 71.30  ? 54  ALA B CA     1 
ATOM   6388  C  C      . ALA B  1 55  ? 25.614  -28.469 -19.062 1.00 70.42  ? 54  ALA B C      1 
ATOM   6389  O  O      . ALA B  1 55  ? 24.394  -28.542 -19.194 1.00 79.83  ? 54  ALA B O      1 
ATOM   6390  C  CB     . ALA B  1 55  ? 26.233  -26.559 -17.594 1.00 71.86  ? 54  ALA B CB     1 
ATOM   6391  H  H      . ALA B  1 55  ? 24.861  -25.979 -19.717 1.00 99.83  ? 54  ALA B H      1 
ATOM   6392  H  HA     . ALA B  1 55  ? 27.244  -27.232 -19.245 1.00 85.56  ? 54  ALA B HA     1 
ATOM   6393  H  HB1    . ALA B  1 55  ? 26.663  -27.173 -16.994 1.00 86.23  ? 54  ALA B HB1    1 
ATOM   6394  H  HB2    . ALA B  1 55  ? 26.682  -25.711 -17.573 1.00 86.23  ? 54  ALA B HB2    1 
ATOM   6395  H  HB3    . ALA B  1 55  ? 25.312  -26.449 -17.347 1.00 86.23  ? 54  ALA B HB3    1 
ATOM   6396  N  N      . ILE B  1 56  ? 26.396  -29.538 -18.972 1.00 74.30  ? 55  ILE B N      1 
ATOM   6397  C  CA     . ILE B  1 56  ? 25.844  -30.887 -19.011 1.00 69.03  ? 55  ILE B CA     1 
ATOM   6398  C  C      . ILE B  1 56  ? 26.338  -31.719 -17.839 1.00 78.07  ? 55  ILE B C      1 
ATOM   6399  O  O      . ILE B  1 56  ? 27.524  -32.041 -17.748 1.00 81.34  ? 55  ILE B O      1 
ATOM   6400  C  CB     . ILE B  1 56  ? 26.206  -31.609 -20.316 1.00 75.47  ? 55  ILE B CB     1 
ATOM   6401  C  CG1    . ILE B  1 56  ? 25.513  -30.930 -21.497 1.00 72.26  ? 55  ILE B CG1    1 
ATOM   6402  C  CG2    . ILE B  1 56  ? 25.805  -33.079 -20.239 1.00 83.56  ? 55  ILE B CG2    1 
ATOM   6403  C  CD1    . ILE B  1 56  ? 25.867  -31.526 -22.843 1.00 85.89  ? 55  ILE B CD1    1 
ATOM   6404  H  H      . ILE B  1 56  ? 27.252  -29.510 -18.887 1.00 89.16  ? 55  ILE B H      1 
ATOM   6405  H  HA     . ILE B  1 56  ? 24.867  -30.834 -18.955 1.00 82.84  ? 55  ILE B HA     1 
ATOM   6406  H  HB     . ILE B  1 56  ? 27.166  -31.555 -20.446 1.00 90.57  ? 55  ILE B HB     1 
ATOM   6407  H  HG12   . ILE B  1 56  ? 24.553  -31.007 -21.382 1.00 86.71  ? 55  ILE B HG12   1 
ATOM   6408  H  HG13   . ILE B  1 56  ? 25.768  -29.994 -21.512 1.00 86.71  ? 55  ILE B HG13   1 
ATOM   6409  H  HG21   . ILE B  1 56  ? 26.040  -33.510 -21.064 1.00 100.27 ? 55  ILE B HG21   1 
ATOM   6410  H  HG22   . ILE B  1 56  ? 26.271  -33.492 -19.508 1.00 100.27 ? 55  ILE B HG22   1 
ATOM   6411  H  HG23   . ILE B  1 56  ? 24.857  -33.137 -20.097 1.00 100.27 ? 55  ILE B HG23   1 
ATOM   6412  H  HD11   . ILE B  1 56  ? 25.396  -31.048 -23.529 1.00 103.06 ? 55  ILE B HD11   1 
ATOM   6413  H  HD12   . ILE B  1 56  ? 26.814  -31.447 -22.980 1.00 103.06 ? 55  ILE B HD12   1 
ATOM   6414  H  HD13   . ILE B  1 56  ? 25.611  -32.451 -22.851 1.00 103.06 ? 55  ILE B HD13   1 
ATOM   6415  N  N      . LYS B  1 57  ? 25.417  -32.066 -16.946 1.00 84.60  ? 56  LYS B N      1 
ATOM   6416  C  CA     . LYS B  1 57  ? 25.735  -32.906 -15.803 1.00 83.64  ? 56  LYS B CA     1 
ATOM   6417  C  C      . LYS B  1 57  ? 25.560  -34.361 -16.208 1.00 84.28  ? 56  LYS B C      1 
ATOM   6418  O  O      . LYS B  1 57  ? 24.510  -34.741 -16.722 1.00 87.72  ? 56  LYS B O      1 
ATOM   6419  C  CB     . LYS B  1 57  ? 24.814  -32.574 -14.629 1.00 93.42  ? 56  LYS B CB     1 
ATOM   6420  C  CG     . LYS B  1 57  ? 25.294  -33.091 -13.278 1.00 86.76  ? 56  LYS B CG     1 
ATOM   6421  C  CD     . LYS B  1 57  ? 24.330  -32.697 -12.164 1.00 96.83  ? 56  LYS B CD     1 
ATOM   6422  C  CE     . LYS B  1 57  ? 24.871  -33.063 -10.789 1.00 107.73 ? 56  LYS B CE     1 
ATOM   6423  N  NZ     . LYS B  1 57  ? 23.876  -32.799 -9.710  1.00 113.07 ? 56  LYS B NZ     1 
ATOM   6424  H  H      . LYS B  1 57  ? 24.593  -31.823 -16.982 1.00 101.52 ? 56  LYS B H      1 
ATOM   6425  H  HA     . LYS B  1 57  ? 26.665  -32.762 -15.529 1.00 100.37 ? 56  LYS B HA     1 
ATOM   6426  H  HB2    . LYS B  1 57  ? 24.733  -31.609 -14.562 1.00 112.10 ? 56  LYS B HB2    1 
ATOM   6427  H  HB3    . LYS B  1 57  ? 23.942  -32.963 -14.799 1.00 112.10 ? 56  LYS B HB3    1 
ATOM   6428  H  HG2    . LYS B  1 57  ? 25.349  -34.059 -13.306 1.00 104.12 ? 56  LYS B HG2    1 
ATOM   6429  H  HG3    . LYS B  1 57  ? 26.163  -32.709 -13.079 1.00 104.12 ? 56  LYS B HG3    1 
ATOM   6430  H  HD2    . LYS B  1 57  ? 24.190  -31.737 -12.188 1.00 116.20 ? 56  LYS B HD2    1 
ATOM   6431  H  HD3    . LYS B  1 57  ? 23.488  -33.161 -12.292 1.00 116.20 ? 56  LYS B HD3    1 
ATOM   6432  H  HE2    . LYS B  1 57  ? 25.090  -34.008 -10.775 1.00 129.28 ? 56  LYS B HE2    1 
ATOM   6433  H  HE3    . LYS B  1 57  ? 25.662  -32.533 -10.607 1.00 129.28 ? 56  LYS B HE3    1 
ATOM   6434  H  HZ1    . LYS B  1 57  ? 24.218  -33.022 -8.920  1.00 135.68 ? 56  LYS B HZ1    1 
ATOM   6435  H  HZ2    . LYS B  1 57  ? 23.661  -31.936 -9.700  1.00 135.68 ? 56  LYS B HZ2    1 
ATOM   6436  H  HZ3    . LYS B  1 57  ? 23.139  -33.279 -9.852  1.00 135.68 ? 56  LYS B HZ3    1 
ATOM   6437  N  N      . GLN B  1 58  ? 26.597  -35.165 -15.995 1.00 88.00  ? 57  GLN B N      1 
ATOM   6438  C  CA     . GLN B  1 58  ? 26.534  -36.598 -16.267 1.00 92.37  ? 57  GLN B CA     1 
ATOM   6439  C  C      . GLN B  1 58  ? 26.408  -37.373 -14.961 1.00 95.68  ? 57  GLN B C      1 
ATOM   6440  O  O      . GLN B  1 58  ? 27.324  -37.367 -14.138 1.00 83.49  ? 57  GLN B O      1 
ATOM   6441  C  CB     . GLN B  1 58  ? 27.782  -37.055 -17.023 1.00 86.51  ? 57  GLN B CB     1 
ATOM   6442  C  CG     . GLN B  1 58  ? 27.855  -36.568 -18.458 1.00 89.76  ? 57  GLN B CG     1 
ATOM   6443  C  CD     . GLN B  1 58  ? 29.179  -36.900 -19.115 1.00 98.65  ? 57  GLN B CD     1 
ATOM   6444  O  OE1    . GLN B  1 58  ? 30.076  -37.454 -18.481 1.00 115.05 ? 57  GLN B OE1    1 
ATOM   6445  N  NE2    . GLN B  1 58  ? 29.309  -36.560 -20.392 1.00 92.64  ? 57  GLN B NE2    1 
ATOM   6446  H  H      . GLN B  1 58  ? 27.358  -34.902 -15.691 1.00 105.60 ? 57  GLN B H      1 
ATOM   6447  H  HA     . GLN B  1 58  ? 25.748  -36.791 -16.820 1.00 110.84 ? 57  GLN B HA     1 
ATOM   6448  H  HB2    . GLN B  1 58  ? 28.566  -36.722 -16.558 1.00 103.81 ? 57  GLN B HB2    1 
ATOM   6449  H  HB3    . GLN B  1 58  ? 27.799  -38.025 -17.038 1.00 103.81 ? 57  GLN B HB3    1 
ATOM   6450  H  HG2    . GLN B  1 58  ? 27.150  -36.992 -18.973 1.00 107.71 ? 57  GLN B HG2    1 
ATOM   6451  H  HG3    . GLN B  1 58  ? 27.744  -35.605 -18.473 1.00 107.71 ? 57  GLN B HG3    1 
ATOM   6452  H  HE21   . GLN B  1 58  ? 28.660  -36.173 -20.802 1.00 111.17 ? 57  GLN B HE21   1 
ATOM   6453  H  HE22   . GLN B  1 58  ? 30.043  -36.727 -20.808 1.00 111.17 ? 57  GLN B HE22   1 
ATOM   6454  N  N      . VAL B  1 59  ? 25.272  -38.038 -14.778 1.00 102.78 ? 58  VAL B N      1 
ATOM   6455  C  CA     . VAL B  1 59  ? 25.015  -38.797 -13.560 1.00 105.91 ? 58  VAL B CA     1 
ATOM   6456  C  C      . VAL B  1 59  ? 24.754  -40.263 -13.894 1.00 118.01 ? 58  VAL B C      1 
ATOM   6457  O  O      . VAL B  1 59  ? 23.923  -40.567 -14.747 1.00 126.78 ? 58  VAL B O      1 
ATOM   6458  C  CB     . VAL B  1 59  ? 23.811  -38.222 -12.783 1.00 109.56 ? 58  VAL B CB     1 
ATOM   6459  C  CG1    . VAL B  1 59  ? 24.015  -36.740 -12.521 1.00 108.65 ? 58  VAL B CG1    1 
ATOM   6460  C  CG2    . VAL B  1 59  ? 22.509  -38.439 -13.546 1.00 119.00 ? 58  VAL B CG2    1 
ATOM   6461  H  H      . VAL B  1 59  ? 24.629  -38.066 -15.348 1.00 123.34 ? 58  VAL B H      1 
ATOM   6462  H  HA     . VAL B  1 59  ? 25.803  -38.751 -12.979 1.00 127.09 ? 58  VAL B HA     1 
ATOM   6463  H  HB     . VAL B  1 59  ? 23.738  -38.678 -11.919 1.00 131.47 ? 58  VAL B HB     1 
ATOM   6464  H  HG11   . VAL B  1 59  ? 23.257  -36.401 -12.038 1.00 130.38 ? 58  VAL B HG11   1 
ATOM   6465  H  HG12   . VAL B  1 59  ? 24.813  -36.622 -12.001 1.00 130.38 ? 58  VAL B HG12   1 
ATOM   6466  H  HG13   . VAL B  1 59  ? 24.099  -36.283 -13.361 1.00 130.38 ? 58  VAL B HG13   1 
ATOM   6467  H  HG21   . VAL B  1 59  ? 21.784  -38.070 -13.036 1.00 142.80 ? 58  VAL B HG21   1 
ATOM   6468  H  HG22   . VAL B  1 59  ? 22.569  -37.999 -14.397 1.00 142.80 ? 58  VAL B HG22   1 
ATOM   6469  H  HG23   . VAL B  1 59  ? 22.375  -39.381 -13.673 1.00 142.80 ? 58  VAL B HG23   1 
ATOM   6470  N  N      . PRO B  1 60  ? 25.479  -41.181 -13.234 1.00 129.24 ? 59  PRO B N      1 
ATOM   6471  C  CA     . PRO B  1 60  ? 25.236  -42.613 -13.440 1.00 131.97 ? 59  PRO B CA     1 
ATOM   6472  C  C      . PRO B  1 60  ? 23.821  -43.023 -13.039 1.00 115.85 ? 59  PRO B C      1 
ATOM   6473  O  O      . PRO B  1 60  ? 23.300  -42.529 -12.039 1.00 86.12  ? 59  PRO B O      1 
ATOM   6474  C  CB     . PRO B  1 60  ? 26.266  -43.278 -12.523 1.00 135.11 ? 59  PRO B CB     1 
ATOM   6475  C  CG     . PRO B  1 60  ? 27.349  -42.271 -12.382 1.00 133.08 ? 59  PRO B CG     1 
ATOM   6476  C  CD     . PRO B  1 60  ? 26.666  -40.939 -12.397 1.00 127.97 ? 59  PRO B CD     1 
ATOM   6477  H  HA     . PRO B  1 60  ? 25.406  -42.867 -14.371 1.00 158.37 ? 59  PRO B HA     1 
ATOM   6478  H  HB2    . PRO B  1 60  ? 25.862  -43.472 -11.663 1.00 162.13 ? 59  PRO B HB2    1 
ATOM   6479  H  HB3    . PRO B  1 60  ? 26.601  -44.088 -12.938 1.00 162.13 ? 59  PRO B HB3    1 
ATOM   6480  H  HG2    . PRO B  1 60  ? 27.813  -42.408 -11.541 1.00 159.70 ? 59  PRO B HG2    1 
ATOM   6481  H  HG3    . PRO B  1 60  ? 27.964  -42.348 -13.128 1.00 159.70 ? 59  PRO B HG3    1 
ATOM   6482  H  HD2    . PRO B  1 60  ? 26.402  -40.684 -11.499 1.00 153.57 ? 59  PRO B HD2    1 
ATOM   6483  H  HD3    . PRO B  1 60  ? 27.238  -40.270 -12.804 1.00 153.57 ? 59  PRO B HD3    1 
ATOM   6484  N  N      . VAL B  1 61  ? 23.217  -43.918 -13.815 1.00 128.37 ? 60  VAL B N      1 
ATOM   6485  C  CA     . VAL B  1 61  ? 21.850  -44.364 -13.560 1.00 137.00 ? 60  VAL B CA     1 
ATOM   6486  C  C      . VAL B  1 61  ? 21.775  -45.337 -12.387 1.00 146.32 ? 60  VAL B C      1 
ATOM   6487  O  O      . VAL B  1 61  ? 20.744  -45.441 -11.722 1.00 153.31 ? 60  VAL B O      1 
ATOM   6488  C  CB     . VAL B  1 61  ? 21.234  -45.054 -14.797 1.00 141.34 ? 60  VAL B CB     1 
ATOM   6489  C  CG1    . VAL B  1 61  ? 21.199  -44.098 -15.982 1.00 150.12 ? 60  VAL B CG1    1 
ATOM   6490  C  CG2    . VAL B  1 61  ? 21.997  -46.327 -15.145 1.00 141.89 ? 60  VAL B CG2    1 
ATOM   6491  H  H      . VAL B  1 61  ? 23.580  -44.285 -14.503 1.00 154.04 ? 60  VAL B H      1 
ATOM   6492  H  HA     . VAL B  1 61  ? 21.297  -43.585 -13.341 1.00 164.40 ? 60  VAL B HA     1 
ATOM   6493  H  HB     . VAL B  1 61  ? 20.311  -45.306 -14.589 1.00 169.61 ? 60  VAL B HB     1 
ATOM   6494  H  HG11   . VAL B  1 61  ? 20.813  -44.550 -16.736 1.00 180.14 ? 60  VAL B HG11   1 
ATOM   6495  H  HG12   . VAL B  1 61  ? 20.667  -43.333 -15.750 1.00 180.14 ? 60  VAL B HG12   1 
ATOM   6496  H  HG13   . VAL B  1 61  ? 22.095  -43.823 -16.188 1.00 180.14 ? 60  VAL B HG13   1 
ATOM   6497  H  HG21   . VAL B  1 61  ? 21.593  -46.732 -15.915 1.00 170.27 ? 60  VAL B HG21   1 
ATOM   6498  H  HG22   . VAL B  1 61  ? 22.911  -46.102 -15.334 1.00 170.27 ? 60  VAL B HG22   1 
ATOM   6499  H  HG23   . VAL B  1 61  ? 21.956  -46.929 -14.398 1.00 170.27 ? 60  VAL B HG23   1 
ATOM   6500  N  N      . GLU B  1 62  ? 22.867  -46.052 -12.141 1.00 143.51 ? 61  GLU B N      1 
ATOM   6501  C  CA     . GLU B  1 62  ? 22.909  -47.051 -11.079 1.00 144.63 ? 61  GLU B CA     1 
ATOM   6502  C  C      . GLU B  1 62  ? 22.422  -46.504 -9.738  1.00 145.46 ? 61  GLU B C      1 
ATOM   6503  O  O      . GLU B  1 62  ? 21.575  -47.111 -9.082  1.00 147.60 ? 61  GLU B O      1 
ATOM   6504  C  CB     . GLU B  1 62  ? 24.331  -47.601 -10.926 1.00 150.77 ? 61  GLU B CB     1 
ATOM   6505  C  CG     . GLU B  1 62  ? 25.395  -46.536 -10.689 1.00 160.63 ? 61  GLU B CG     1 
ATOM   6506  C  CD     . GLU B  1 62  ? 26.768  -47.128 -10.448 1.00 177.85 ? 61  GLU B CD     1 
ATOM   6507  O  OE1    . GLU B  1 62  ? 26.863  -48.362 -10.271 1.00 193.14 ? 61  GLU B OE1    1 
ATOM   6508  O  OE2    . GLU B  1 62  ? 27.754  -46.360 -10.430 1.00 174.62 ? 61  GLU B OE2    1 
ATOM   6509  H  H      . GLU B  1 62  ? 23.604  -45.977 -12.579 1.00 172.21 ? 61  GLU B H      1 
ATOM   6510  H  HA     . GLU B  1 62  ? 22.325  -47.798 -11.327 1.00 173.55 ? 61  GLU B HA     1 
ATOM   6511  H  HB2    . GLU B  1 62  ? 24.349  -48.208 -10.170 1.00 180.93 ? 61  GLU B HB2    1 
ATOM   6512  H  HB3    . GLU B  1 62  ? 24.568  -48.079 -11.735 1.00 180.93 ? 61  GLU B HB3    1 
ATOM   6513  H  HG2    . GLU B  1 62  ? 25.449  -45.963 -11.470 1.00 192.76 ? 61  GLU B HG2    1 
ATOM   6514  H  HG3    . GLU B  1 62  ? 25.152  -46.013 -9.909  1.00 192.76 ? 61  GLU B HG3    1 
ATOM   6515  N  N      . SER B  1 63  ? 22.954  -45.353 -9.338  1.00 145.59 ? 62  SER B N      1 
ATOM   6516  C  CA     . SER B  1 63  ? 22.716  -44.827 -7.999  1.00 151.56 ? 62  SER B CA     1 
ATOM   6517  C  C      . SER B  1 63  ? 21.409  -44.047 -7.887  1.00 160.57 ? 62  SER B C      1 
ATOM   6518  O  O      . SER B  1 63  ? 21.352  -42.859 -8.208  1.00 159.19 ? 62  SER B O      1 
ATOM   6519  C  CB     . SER B  1 63  ? 23.887  -43.942 -7.565  1.00 145.10 ? 62  SER B CB     1 
ATOM   6520  O  OG     . SER B  1 63  ? 24.062  -42.845 -8.447  1.00 139.67 ? 62  SER B OG     1 
ATOM   6521  H  H      . SER B  1 63  ? 23.458  -44.856 -9.826  1.00 174.71 ? 62  SER B H      1 
ATOM   6522  H  HA     . SER B  1 63  ? 22.666  -45.579 -7.373  1.00 181.87 ? 62  SER B HA     1 
ATOM   6523  H  HB2    . SER B  1 63  ? 23.711  -43.603 -6.674  1.00 174.12 ? 62  SER B HB2    1 
ATOM   6524  H  HB3    . SER B  1 63  ? 24.698  -44.474 -7.562  1.00 174.12 ? 62  SER B HB3    1 
ATOM   6525  H  HG     . SER B  1 63  ? 23.500  -42.873 -9.043  1.00 167.61 ? 62  SER B HG     1 
ATOM   6526  N  N      . ASP B  1 64  ? 20.368  -44.730 -7.419  1.00 166.64 ? 63  ASP B N      1 
ATOM   6527  C  CA     . ASP B  1 64  ? 19.077  -44.105 -7.146  1.00 165.62 ? 63  ASP B CA     1 
ATOM   6528  C  C      . ASP B  1 64  ? 18.715  -43.036 -8.169  1.00 148.91 ? 63  ASP B C      1 
ATOM   6529  O  O      . ASP B  1 64  ? 18.843  -41.842 -7.900  1.00 123.92 ? 63  ASP B O      1 
ATOM   6530  C  CB     . ASP B  1 64  ? 19.076  -43.485 -5.746  1.00 180.16 ? 63  ASP B CB     1 
ATOM   6531  C  CG     . ASP B  1 64  ? 19.119  -44.528 -4.645  1.00 193.42 ? 63  ASP B CG     1 
ATOM   6532  O  OD1    . ASP B  1 64  ? 18.723  -44.205 -3.504  1.00 189.37 ? 63  ASP B OD1    1 
ATOM   6533  O  OD2    . ASP B  1 64  ? 19.543  -45.670 -4.920  1.00 201.45 ? 63  ASP B OD2    1 
ATOM   6534  H  H      . ASP B  1 64  ? 20.385  -45.573 -7.250  1.00 199.97 ? 63  ASP B H      1 
ATOM   6535  H  HA     . ASP B  1 64  ? 18.380  -44.793 -7.171  1.00 198.74 ? 63  ASP B HA     1 
ATOM   6536  H  HB2    . ASP B  1 64  ? 19.856  -42.917 -5.652  1.00 216.20 ? 63  ASP B HB2    1 
ATOM   6537  H  HB3    . ASP B  1 64  ? 18.268  -42.961 -5.633  1.00 216.20 ? 63  ASP B HB3    1 
ATOM   6538  N  N      . LEU B  1 65  ? 18.262  -43.468 -9.340  1.00 156.20 ? 64  LEU B N      1 
ATOM   6539  C  CA     . LEU B  1 65  ? 17.802  -42.537 -10.360 1.00 150.52 ? 64  LEU B CA     1 
ATOM   6540  C  C      . LEU B  1 65  ? 16.559  -41.800 -9.884  1.00 139.37 ? 64  LEU B C      1 
ATOM   6541  O  O      . LEU B  1 65  ? 16.436  -40.592 -10.070 1.00 138.10 ? 64  LEU B O      1 
ATOM   6542  C  CB     . LEU B  1 65  ? 17.484  -43.271 -11.665 1.00 156.86 ? 64  LEU B CB     1 
ATOM   6543  C  CG     . LEU B  1 65  ? 18.535  -43.233 -12.776 1.00 162.86 ? 64  LEU B CG     1 
ATOM   6544  C  CD1    . LEU B  1 65  ? 17.999  -43.932 -14.015 1.00 167.82 ? 64  LEU B CD1    1 
ATOM   6545  C  CD2    . LEU B  1 65  ? 18.951  -41.809 -13.110 1.00 159.41 ? 64  LEU B CD2    1 
ATOM   6546  H  H      . LEU B  1 65  ? 18.210  -44.296 -9.568  1.00 187.44 ? 64  LEU B H      1 
ATOM   6547  H  HA     . LEU B  1 65  ? 18.504  -41.877 -10.539 1.00 180.62 ? 64  LEU B HA     1 
ATOM   6548  H  HB2    . LEU B  1 65  ? 17.330  -44.205 -11.452 1.00 188.23 ? 64  LEU B HB2    1 
ATOM   6549  H  HB3    . LEU B  1 65  ? 16.671  -42.891 -12.031 1.00 188.23 ? 64  LEU B HB3    1 
ATOM   6550  H  HG     . LEU B  1 65  ? 19.324  -43.713 -12.480 1.00 195.44 ? 64  LEU B HG     1 
ATOM   6551  H  HD11   . LEU B  1 65  ? 18.667  -43.902 -14.704 1.00 201.38 ? 64  LEU B HD11   1 
ATOM   6552  H  HD12   . LEU B  1 65  ? 17.796  -44.845 -13.796 1.00 201.38 ? 64  LEU B HD12   1 
ATOM   6553  H  HD13   . LEU B  1 65  ? 17.204  -43.481 -14.309 1.00 201.38 ? 64  LEU B HD13   1 
ATOM   6554  H  HD21   . LEU B  1 65  ? 19.608  -41.831 -13.809 1.00 191.29 ? 64  LEU B HD21   1 
ATOM   6555  H  HD22   . LEU B  1 65  ? 18.179  -41.318 -13.402 1.00 191.29 ? 64  LEU B HD22   1 
ATOM   6556  H  HD23   . LEU B  1 65  ? 19.321  -41.400 -12.324 1.00 191.29 ? 64  LEU B HD23   1 
ATOM   6557  N  N      . GLN B  1 66  ? 15.644  -42.536 -9.263  1.00 135.28 ? 65  GLN B N      1 
ATOM   6558  C  CA     . GLN B  1 66  ? 14.354  -41.984 -8.866  1.00 132.92 ? 65  GLN B CA     1 
ATOM   6559  C  C      . GLN B  1 66  ? 14.504  -40.694 -8.063  1.00 127.86 ? 65  GLN B C      1 
ATOM   6560  O  O      . GLN B  1 66  ? 13.629  -39.829 -8.100  1.00 120.83 ? 65  GLN B O      1 
ATOM   6561  C  CB     . GLN B  1 66  ? 13.567  -43.010 -8.053  1.00 135.18 ? 65  GLN B CB     1 
ATOM   6562  C  CG     . GLN B  1 66  ? 12.105  -42.648 -7.870  1.00 153.44 ? 65  GLN B CG     1 
ATOM   6563  C  CD     . GLN B  1 66  ? 11.646  -42.792 -6.435  1.00 178.61 ? 65  GLN B CD     1 
ATOM   6564  O  OE1    . GLN B  1 66  ? 12.276  -42.270 -5.514  1.00 190.28 ? 65  GLN B OE1    1 
ATOM   6565  N  NE2    . GLN B  1 66  ? 10.545  -43.506 -6.234  1.00 186.48 ? 65  GLN B NE2    1 
ATOM   6566  H  H      . GLN B  1 66  ? 15.746  -43.365 -9.059  1.00 162.33 ? 65  GLN B H      1 
ATOM   6567  H  HA     . GLN B  1 66  ? 13.837  -41.778 -9.673  1.00 159.51 ? 65  GLN B HA     1 
ATOM   6568  H  HB2    . GLN B  1 66  ? 13.606  -43.866 -8.507  1.00 162.22 ? 65  GLN B HB2    1 
ATOM   6569  H  HB3    . GLN B  1 66  ? 13.967  -43.085 -7.172  1.00 162.22 ? 65  GLN B HB3    1 
ATOM   6570  H  HG2    . GLN B  1 66  ? 11.971  -41.725 -8.137  1.00 184.13 ? 65  GLN B HG2    1 
ATOM   6571  H  HG3    . GLN B  1 66  ? 11.562  -43.235 -8.419  1.00 184.13 ? 65  GLN B HG3    1 
ATOM   6572  H  HE21   . GLN B  1 66  ? 10.133  -43.858 -6.902  1.00 223.77 ? 65  GLN B HE21   1 
ATOM   6573  H  HE22   . GLN B  1 66  ? 10.244  -43.617 -5.436  1.00 223.77 ? 65  GLN B HE22   1 
ATOM   6574  N  N      . GLU B  1 67  ? 15.610  -40.566 -7.337  1.00 120.16 ? 66  GLU B N      1 
ATOM   6575  C  CA     . GLU B  1 67  ? 15.860  -39.364 -6.553  1.00 104.54 ? 66  GLU B CA     1 
ATOM   6576  C  C      . GLU B  1 67  ? 16.274  -38.220 -7.471  1.00 106.87 ? 66  GLU B C      1 
ATOM   6577  O  O      . GLU B  1 67  ? 15.764  -37.106 -7.356  1.00 110.88 ? 66  GLU B O      1 
ATOM   6578  C  CB     . GLU B  1 67  ? 16.947  -39.617 -5.508  1.00 113.49 ? 66  GLU B CB     1 
ATOM   6579  C  CG     . GLU B  1 67  ? 16.931  -38.622 -4.362  1.00 140.19 ? 66  GLU B CG     1 
ATOM   6580  C  CD     . GLU B  1 67  ? 15.649  -38.691 -3.554  1.00 158.62 ? 66  GLU B CD     1 
ATOM   6581  O  OE1    . GLU B  1 67  ? 15.076  -37.624 -3.248  1.00 157.76 ? 66  GLU B OE1    1 
ATOM   6582  O  OE2    . GLU B  1 67  ? 15.216  -39.816 -3.224  1.00 166.10 ? 66  GLU B OE2    1 
ATOM   6583  H  H      . GLU B  1 67  ? 16.229  -41.160 -7.282  1.00 144.20 ? 66  GLU B H      1 
ATOM   6584  H  HA     . GLU B  1 67  ? 15.038  -39.104 -6.086  1.00 125.44 ? 66  GLU B HA     1 
ATOM   6585  H  HB2    . GLU B  1 67  ? 16.821  -40.503 -5.134  1.00 136.19 ? 66  GLU B HB2    1 
ATOM   6586  H  HB3    . GLU B  1 67  ? 17.814  -39.561 -5.939  1.00 136.19 ? 66  GLU B HB3    1 
ATOM   6587  H  HG2    . GLU B  1 67  ? 17.673  -38.812 -3.767  1.00 168.22 ? 66  GLU B HG2    1 
ATOM   6588  H  HG3    . GLU B  1 67  ? 17.013  -37.724 -4.721  1.00 168.22 ? 66  GLU B HG3    1 
ATOM   6589  N  N      . ILE B  1 68  ? 17.202  -38.506 -8.380  1.00 110.69 ? 67  ILE B N      1 
ATOM   6590  C  CA     . ILE B  1 68  ? 17.647  -37.527 -9.367  1.00 99.27  ? 67  ILE B CA     1 
ATOM   6591  C  C      . ILE B  1 68  ? 16.494  -37.093 -10.264 1.00 87.28  ? 67  ILE B C      1 
ATOM   6592  O  O      . ILE B  1 68  ? 16.351  -35.914 -10.580 1.00 100.83 ? 67  ILE B O      1 
ATOM   6593  C  CB     . ILE B  1 68  ? 18.763  -38.105 -10.261 1.00 112.19 ? 67  ILE B CB     1 
ATOM   6594  C  CG1    . ILE B  1 68  ? 20.088  -38.168 -9.497  1.00 120.60 ? 67  ILE B CG1    1 
ATOM   6595  C  CG2    . ILE B  1 68  ? 18.925  -37.272 -11.527 1.00 104.81 ? 67  ILE B CG2    1 
ATOM   6596  C  CD1    . ILE B  1 68  ? 20.683  -36.810 -9.160  1.00 122.07 ? 67  ILE B CD1    1 
ATOM   6597  H  H      . ILE B  1 68  ? 17.594  -39.269 -8.446  1.00 132.83 ? 67  ILE B H      1 
ATOM   6598  H  HA     . ILE B  1 68  ? 17.997  -36.736 -8.907  1.00 119.13 ? 67  ILE B HA     1 
ATOM   6599  H  HB     . ILE B  1 68  ? 18.514  -39.007 -10.518 1.00 134.63 ? 67  ILE B HB     1 
ATOM   6600  H  HG12   . ILE B  1 68  ? 19.943  -38.641 -8.662  1.00 144.72 ? 67  ILE B HG12   1 
ATOM   6601  H  HG13   . ILE B  1 68  ? 20.735  -38.647 -10.036 1.00 144.72 ? 67  ILE B HG13   1 
ATOM   6602  H  HG21   . ILE B  1 68  ? 19.625  -37.653 -12.064 1.00 125.77 ? 67  ILE B HG21   1 
ATOM   6603  H  HG22   . ILE B  1 68  ? 18.098  -37.279 -12.014 1.00 125.77 ? 67  ILE B HG22   1 
ATOM   6604  H  HG23   . ILE B  1 68  ? 19.154  -36.372 -11.281 1.00 125.77 ? 67  ILE B HG23   1 
ATOM   6605  H  HD11   . ILE B  1 68  ? 21.506  -36.939 -8.684  1.00 146.48 ? 67  ILE B HD11   1 
ATOM   6606  H  HD12   . ILE B  1 68  ? 20.847  -36.330 -9.975  1.00 146.48 ? 67  ILE B HD12   1 
ATOM   6607  H  HD13   . ILE B  1 68  ? 20.061  -36.324 -8.613  1.00 146.48 ? 67  ILE B HD13   1 
ATOM   6608  N  N      . ILE B  1 69  ? 15.676  -38.055 -10.671 1.00 88.46  ? 68  ILE B N      1 
ATOM   6609  C  CA     . ILE B  1 69  ? 14.579  -37.792 -11.590 1.00 91.27  ? 68  ILE B CA     1 
ATOM   6610  C  C      . ILE B  1 69  ? 13.495  -36.955 -10.923 1.00 91.81  ? 68  ILE B C      1 
ATOM   6611  O  O      . ILE B  1 69  ? 12.885  -36.094 -11.558 1.00 80.11  ? 68  ILE B O      1 
ATOM   6612  C  CB     . ILE B  1 69  ? 13.973  -39.104 -12.099 1.00 96.26  ? 68  ILE B CB     1 
ATOM   6613  C  CG1    . ILE B  1 69  ? 15.038  -39.901 -12.857 1.00 116.55 ? 68  ILE B CG1    1 
ATOM   6614  C  CG2    . ILE B  1 69  ? 12.769  -38.826 -12.988 1.00 74.03  ? 68  ILE B CG2    1 
ATOM   6615  C  CD1    . ILE B  1 69  ? 14.605  -41.298 -13.249 1.00 126.06 ? 68  ILE B CD1    1 
ATOM   6616  H  H      . ILE B  1 69  ? 15.737  -38.877 -10.427 1.00 106.16 ? 68  ILE B H      1 
ATOM   6617  H  HA     . ILE B  1 69  ? 14.919  -37.292 -12.362 1.00 109.52 ? 68  ILE B HA     1 
ATOM   6618  H  HB     . ILE B  1 69  ? 13.681  -39.627 -11.336 1.00 115.52 ? 68  ILE B HB     1 
ATOM   6619  H  HG12   . ILE B  1 69  ? 15.265  -39.423 -13.670 1.00 139.86 ? 68  ILE B HG12   1 
ATOM   6620  H  HG13   . ILE B  1 69  ? 15.824  -39.983 -12.295 1.00 139.86 ? 68  ILE B HG13   1 
ATOM   6621  H  HG21   . ILE B  1 69  ? 12.408  -39.661 -13.294 1.00 88.84  ? 68  ILE B HG21   1 
ATOM   6622  H  HG22   . ILE B  1 69  ? 12.109  -38.350 -12.479 1.00 88.84  ? 68  ILE B HG22   1 
ATOM   6623  H  HG23   . ILE B  1 69  ? 13.050  -38.296 -13.737 1.00 88.84  ? 68  ILE B HG23   1 
ATOM   6624  H  HD11   . ILE B  1 69  ? 15.324  -41.728 -13.717 1.00 151.27 ? 68  ILE B HD11   1 
ATOM   6625  H  HD12   . ILE B  1 69  ? 14.388  -41.792 -12.455 1.00 151.27 ? 68  ILE B HD12   1 
ATOM   6626  H  HD13   . ILE B  1 69  ? 13.833  -41.237 -13.818 1.00 151.27 ? 68  ILE B HD13   1 
ATOM   6627  N  N      . LYS B  1 70  ? 13.254  -37.213 -9.643  1.00 106.06 ? 69  LYS B N      1 
ATOM   6628  C  CA     . LYS B  1 70  ? 12.309  -36.415 -8.877  1.00 113.25 ? 69  LYS B CA     1 
ATOM   6629  C  C      . LYS B  1 70  ? 12.807  -34.978 -8.850  1.00 113.53 ? 69  LYS B C      1 
ATOM   6630  O  O      . LYS B  1 70  ? 12.021  -34.033 -8.891  1.00 122.16 ? 69  LYS B O      1 
ATOM   6631  C  CB     . LYS B  1 70  ? 12.180  -36.952 -7.449  1.00 110.11 ? 69  LYS B CB     1 
ATOM   6632  C  CG     . LYS B  1 70  ? 10.865  -36.603 -6.769  1.00 106.27 ? 69  LYS B CG     1 
ATOM   6633  C  CD     . LYS B  1 70  ? 10.899  -36.913 -5.277  1.00 118.92 ? 69  LYS B CD     1 
ATOM   6634  C  CE     . LYS B  1 70  ? 11.265  -38.364 -5.002  1.00 129.66 ? 69  LYS B CE     1 
ATOM   6635  N  NZ     . LYS B  1 70  ? 11.207  -38.685 -3.548  1.00 125.25 ? 69  LYS B NZ     1 
ATOM   6636  H  H      . LYS B  1 70  ? 13.626  -37.846 -9.195  1.00 127.27 ? 69  LYS B H      1 
ATOM   6637  H  HA     . LYS B  1 70  ? 11.428  -36.438 -9.305  1.00 135.90 ? 69  LYS B HA     1 
ATOM   6638  H  HB2    . LYS B  1 70  ? 12.253  -37.919 -7.473  1.00 132.13 ? 69  LYS B HB2    1 
ATOM   6639  H  HB3    . LYS B  1 70  ? 12.898  -36.583 -6.911  1.00 132.13 ? 69  LYS B HB3    1 
ATOM   6640  H  HG2    . LYS B  1 70  ? 10.691  -35.655 -6.878  1.00 127.52 ? 69  LYS B HG2    1 
ATOM   6641  H  HG3    . LYS B  1 70  ? 10.151  -37.123 -7.169  1.00 127.52 ? 69  LYS B HG3    1 
ATOM   6642  H  HD2    . LYS B  1 70  ? 11.562  -36.348 -4.850  1.00 142.71 ? 69  LYS B HD2    1 
ATOM   6643  H  HD3    . LYS B  1 70  ? 10.022  -36.745 -4.897  1.00 142.71 ? 69  LYS B HD3    1 
ATOM   6644  H  HE2    . LYS B  1 70  ? 10.641  -38.943 -5.466  1.00 155.59 ? 69  LYS B HE2    1 
ATOM   6645  H  HE3    . LYS B  1 70  ? 12.169  -38.529 -5.312  1.00 155.59 ? 69  LYS B HE3    1 
ATOM   6646  H  HZ1    . LYS B  1 70  ? 11.425  -39.538 -3.417  1.00 150.30 ? 69  LYS B HZ1    1 
ATOM   6647  H  HZ2    . LYS B  1 70  ? 11.776  -38.169 -3.099  1.00 150.30 ? 69  LYS B HZ2    1 
ATOM   6648  H  HZ3    . LYS B  1 70  ? 10.384  -38.546 -3.239  1.00 150.30 ? 69  LYS B HZ3    1 
ATOM   6649  N  N      . GLU B  1 71  ? 14.126  -34.826 -8.794  1.00 108.78 ? 70  GLU B N      1 
ATOM   6650  C  CA     . GLU B  1 71  ? 14.752  -33.514 -8.720  1.00 89.86  ? 70  GLU B CA     1 
ATOM   6651  C  C      . GLU B  1 71  ? 14.659  -32.785 -10.057 1.00 78.17  ? 70  GLU B C      1 
ATOM   6652  O  O      . GLU B  1 71  ? 14.288  -31.614 -10.109 1.00 96.42  ? 70  GLU B O      1 
ATOM   6653  C  CB     . GLU B  1 71  ? 16.213  -33.663 -8.297  1.00 114.91 ? 70  GLU B CB     1 
ATOM   6654  C  CG     . GLU B  1 71  ? 16.782  -32.459 -7.571  1.00 146.41 ? 70  GLU B CG     1 
ATOM   6655  C  CD     . GLU B  1 71  ? 18.118  -32.760 -6.919  1.00 155.79 ? 70  GLU B CD     1 
ATOM   6656  O  OE1    . GLU B  1 71  ? 18.838  -31.801 -6.566  1.00 166.97 ? 70  GLU B OE1    1 
ATOM   6657  O  OE2    . GLU B  1 71  ? 18.443  -33.957 -6.754  1.00 132.74 ? 70  GLU B OE2    1 
ATOM   6658  H  H      . GLU B  1 71  ? 14.687  -35.478 -8.799  1.00 130.54 ? 70  GLU B H      1 
ATOM   6659  H  HA     . GLU B  1 71  ? 14.290  -32.975 -8.044  1.00 107.83 ? 70  GLU B HA     1 
ATOM   6660  H  HB2    . GLU B  1 71  ? 16.288  -34.427 -7.703  1.00 137.89 ? 70  GLU B HB2    1 
ATOM   6661  H  HB3    . GLU B  1 71  ? 16.752  -33.811 -9.089  1.00 137.89 ? 70  GLU B HB3    1 
ATOM   6662  H  HG2    . GLU B  1 71  ? 16.913  -31.738 -8.207  1.00 175.69 ? 70  GLU B HG2    1 
ATOM   6663  H  HG3    . GLU B  1 71  ? 16.162  -32.184 -6.878  1.00 175.69 ? 70  GLU B HG3    1 
ATOM   6664  N  N      . ILE B  1 72  ? 14.996  -33.480 -11.137 1.00 88.57  ? 71  ILE B N      1 
ATOM   6665  C  CA     . ILE B  1 72  ? 14.921  -32.900 -12.473 1.00 77.22  ? 71  ILE B CA     1 
ATOM   6666  C  C      . ILE B  1 72  ? 13.537  -32.323 -12.753 1.00 96.15  ? 71  ILE B C      1 
ATOM   6667  O  O      . ILE B  1 72  ? 13.414  -31.210 -13.261 1.00 125.80 ? 71  ILE B O      1 
ATOM   6668  C  CB     . ILE B  1 72  ? 15.254  -33.945 -13.552 1.00 92.15  ? 71  ILE B CB     1 
ATOM   6669  C  CG1    . ILE B  1 72  ? 16.768  -34.029 -13.755 1.00 95.06  ? 71  ILE B CG1    1 
ATOM   6670  C  CG2    . ILE B  1 72  ? 14.572  -33.594 -14.869 1.00 98.19  ? 71  ILE B CG2    1 
ATOM   6671  C  CD1    . ILE B  1 72  ? 17.194  -35.078 -14.761 1.00 105.75 ? 71  ILE B CD1    1 
ATOM   6672  H  H      . ILE B  1 72  ? 15.272  -34.294 -11.123 1.00 106.28 ? 71  ILE B H      1 
ATOM   6673  H  HA     . ILE B  1 72  ? 15.573  -32.172 -12.543 1.00 92.66  ? 71  ILE B HA     1 
ATOM   6674  H  HB     . ILE B  1 72  ? 14.932  -34.811 -13.256 1.00 110.58 ? 71  ILE B HB     1 
ATOM   6675  H  HG12   . ILE B  1 72  ? 17.089  -33.169 -14.069 1.00 114.07 ? 71  ILE B HG12   1 
ATOM   6676  H  HG13   . ILE B  1 72  ? 17.186  -34.246 -12.907 1.00 114.07 ? 71  ILE B HG13   1 
ATOM   6677  H  HG21   . ILE B  1 72  ? 14.795  -34.259 -15.523 1.00 117.83 ? 71  ILE B HG21   1 
ATOM   6678  H  HG22   . ILE B  1 72  ? 13.622  -33.574 -14.732 1.00 117.83 ? 71  ILE B HG22   1 
ATOM   6679  H  HG23   . ILE B  1 72  ? 14.879  -32.732 -15.159 1.00 117.83 ? 71  ILE B HG23   1 
ATOM   6680  H  HD11   . ILE B  1 72  ? 18.151  -35.070 -14.834 1.00 126.90 ? 71  ILE B HD11   1 
ATOM   6681  H  HD12   . ILE B  1 72  ? 16.895  -35.939 -14.460 1.00 126.90 ? 71  ILE B HD12   1 
ATOM   6682  H  HD13   . ILE B  1 72  ? 16.799  -34.873 -15.612 1.00 126.90 ? 71  ILE B HD13   1 
ATOM   6683  N  N      . SER B  1 73  ? 12.499  -33.087 -12.426 1.00 95.01  ? 72  SER B N      1 
ATOM   6684  C  CA     . SER B  1 73  ? 11.126  -32.659 -12.679 1.00 97.66  ? 72  SER B CA     1 
ATOM   6685  C  C      . SER B  1 73  ? 10.814  -31.333 -11.987 1.00 110.30 ? 72  SER B C      1 
ATOM   6686  O  O      . SER B  1 73  ? 9.957   -30.576 -12.444 1.00 116.35 ? 72  SER B O      1 
ATOM   6687  C  CB     . SER B  1 73  ? 10.133  -33.740 -12.239 1.00 99.14  ? 72  SER B CB     1 
ATOM   6688  O  OG     . SER B  1 73  ? 10.350  -34.136 -10.896 1.00 101.46 ? 72  SER B OG     1 
ATOM   6689  H  H      . SER B  1 73  ? 12.563  -33.860 -12.054 1.00 114.02 ? 72  SER B H      1 
ATOM   6690  H  HA     . SER B  1 73  ? 11.013  -32.526 -13.643 1.00 117.19 ? 72  SER B HA     1 
ATOM   6691  H  HB2    . SER B  1 73  ? 9.232   -33.390 -12.320 1.00 118.97 ? 72  SER B HB2    1 
ATOM   6692  H  HB3    . SER B  1 73  ? 10.238  -34.514 -12.814 1.00 118.97 ? 72  SER B HB3    1 
ATOM   6693  H  HG     . SER B  1 73  ? 10.978  -33.715 -10.577 1.00 121.76 ? 72  SER B HG     1 
ATOM   6694  N  N      . ILE B  1 74  ? 11.514  -31.051 -10.892 1.00 115.17 ? 73  ILE B N      1 
ATOM   6695  C  CA     . ILE B  1 74  ? 11.355  -29.780 -10.193 1.00 115.64 ? 73  ILE B CA     1 
ATOM   6696  C  C      . ILE B  1 74  ? 11.887  -28.644 -11.056 1.00 117.92 ? 73  ILE B C      1 
ATOM   6697  O  O      . ILE B  1 74  ? 11.210  -27.638 -11.263 1.00 131.94 ? 73  ILE B O      1 
ATOM   6698  C  CB     . ILE B  1 74  ? 12.111  -29.765 -8.847  1.00 101.30 ? 73  ILE B CB     1 
ATOM   6699  C  CG1    . ILE B  1 74  ? 11.576  -30.851 -7.913  1.00 94.40  ? 73  ILE B CG1    1 
ATOM   6700  C  CG2    . ILE B  1 74  ? 11.984  -28.406 -8.182  1.00 97.68  ? 73  ILE B CG2    1 
ATOM   6701  C  CD1    . ILE B  1 74  ? 12.374  -31.001 -6.631  1.00 99.24  ? 73  ILE B CD1    1 
ATOM   6702  H  H      . ILE B  1 74  ? 12.089  -31.580 -10.533 1.00 138.21 ? 73  ILE B H      1 
ATOM   6703  H  HA     . ILE B  1 74  ? 10.404  -29.620 -10.018 1.00 138.77 ? 73  ILE B HA     1 
ATOM   6704  H  HB     . ILE B  1 74  ? 13.050  -29.939 -9.018  1.00 121.56 ? 73  ILE B HB     1 
ATOM   6705  H  HG12   . ILE B  1 74  ? 10.662  -30.633 -7.671  1.00 113.28 ? 73  ILE B HG12   1 
ATOM   6706  H  HG13   . ILE B  1 74  ? 11.598  -31.702 -8.378  1.00 113.28 ? 73  ILE B HG13   1 
ATOM   6707  H  HG21   . ILE B  1 74  ? 12.460  -28.420 -7.348  1.00 117.22 ? 73  ILE B HG21   1 
ATOM   6708  H  HG22   . ILE B  1 74  ? 12.357  -27.738 -8.762  1.00 117.22 ? 73  ILE B HG22   1 
ATOM   6709  H  HG23   . ILE B  1 74  ? 11.055  -28.221 -8.025  1.00 117.22 ? 73  ILE B HG23   1 
ATOM   6710  H  HD11   . ILE B  1 74  ? 11.982  -31.697 -6.098  1.00 119.09 ? 73  ILE B HD11   1 
ATOM   6711  H  HD12   . ILE B  1 74  ? 13.280  -31.228 -6.852  1.00 119.09 ? 73  ILE B HD12   1 
ATOM   6712  H  HD13   . ILE B  1 74  ? 12.353  -30.169 -6.151  1.00 119.09 ? 73  ILE B HD13   1 
ATOM   6713  N  N      . MET B  1 75  ? 13.104  -28.814 -11.561 1.00 103.14 ? 74  MET B N      1 
ATOM   6714  C  CA     . MET B  1 75  ? 13.761  -27.772 -12.338 1.00 89.08  ? 74  MET B CA     1 
ATOM   6715  C  C      . MET B  1 75  ? 13.014  -27.512 -13.639 1.00 89.70  ? 74  MET B C      1 
ATOM   6716  O  O      . MET B  1 75  ? 13.021  -26.392 -14.152 1.00 105.53 ? 74  MET B O      1 
ATOM   6717  C  CB     . MET B  1 75  ? 15.208  -28.165 -12.648 1.00 98.95  ? 74  MET B CB     1 
ATOM   6718  C  CG     . MET B  1 75  ? 16.044  -28.498 -11.419 1.00 120.82 ? 74  MET B CG     1 
ATOM   6719  S  SD     . MET B  1 75  ? 16.060  -27.193 -10.170 1.00 137.76 ? 74  MET B SD     1 
ATOM   6720  C  CE     . MET B  1 75  ? 16.917  -25.885 -11.045 1.00 119.50 ? 74  MET B CE     1 
ATOM   6721  H  H      . MET B  1 75  ? 13.573  -29.529 -11.467 1.00 123.77 ? 74  MET B H      1 
ATOM   6722  H  HA     . MET B  1 75  ? 13.778  -26.946 -11.812 1.00 106.89 ? 74  MET B HA     1 
ATOM   6723  H  HB2    . MET B  1 75  ? 15.202  -28.947 -13.222 1.00 118.74 ? 74  MET B HB2    1 
ATOM   6724  H  HB3    . MET B  1 75  ? 15.639  -27.426 -13.106 1.00 118.74 ? 74  MET B HB3    1 
ATOM   6725  H  HG2    . MET B  1 75  ? 15.686  -29.299 -11.005 1.00 144.99 ? 74  MET B HG2    1 
ATOM   6726  H  HG3    . MET B  1 75  ? 16.960  -28.654 -11.697 1.00 144.99 ? 74  MET B HG3    1 
ATOM   6727  H  HE1    . MET B  1 75  ? 16.988  -25.119 -10.470 1.00 143.41 ? 74  MET B HE1    1 
ATOM   6728  H  HE2    . MET B  1 75  ? 17.792  -26.194 -11.289 1.00 143.41 ? 74  MET B HE2    1 
ATOM   6729  H  HE3    . MET B  1 75  ? 16.418  -25.658 -11.833 1.00 143.41 ? 74  MET B HE3    1 
ATOM   6730  N  N      . GLN B  1 76  ? 12.366  -28.546 -14.168 1.00 76.99  ? 75  GLN B N      1 
ATOM   6731  C  CA     . GLN B  1 76  ? 11.710  -28.444 -15.468 1.00 94.78  ? 75  GLN B CA     1 
ATOM   6732  C  C      . GLN B  1 76  ? 10.362  -27.736 -15.377 1.00 117.44 ? 75  GLN B C      1 
ATOM   6733  O  O      . GLN B  1 76  ? 9.889   -27.168 -16.360 1.00 134.52 ? 75  GLN B O      1 
ATOM   6734  C  CB     . GLN B  1 76  ? 11.531  -29.830 -16.089 1.00 103.54 ? 75  GLN B CB     1 
ATOM   6735  C  CG     . GLN B  1 76  ? 11.422  -29.811 -17.608 1.00 135.09 ? 75  GLN B CG     1 
ATOM   6736  C  CD     . GLN B  1 76  ? 11.584  -31.189 -18.226 1.00 156.19 ? 75  GLN B CD     1 
ATOM   6737  O  OE1    . GLN B  1 76  ? 11.226  -32.199 -17.621 1.00 168.54 ? 75  GLN B OE1    1 
ATOM   6738  N  NE2    . GLN B  1 76  ? 12.136  -31.235 -19.434 1.00 156.93 ? 75  GLN B NE2    1 
ATOM   6739  H  H      . GLN B  1 76  ? 12.290  -29.317 -13.795 1.00 92.39  ? 75  GLN B H      1 
ATOM   6740  H  HA     . GLN B  1 76  ? 12.282  -27.920 -16.067 1.00 113.74 ? 75  GLN B HA     1 
ATOM   6741  H  HB2    . GLN B  1 76  ? 12.295  -30.379 -15.853 1.00 124.24 ? 75  GLN B HB2    1 
ATOM   6742  H  HB3    . GLN B  1 76  ? 10.719  -30.227 -15.738 1.00 124.24 ? 75  GLN B HB3    1 
ATOM   6743  H  HG2    . GLN B  1 76  ? 10.548  -29.471 -17.858 1.00 162.11 ? 75  GLN B HG2    1 
ATOM   6744  H  HG3    . GLN B  1 76  ? 12.117  -29.238 -17.968 1.00 162.11 ? 75  GLN B HG3    1 
ATOM   6745  H  HE21   . GLN B  1 76  ? 12.380  -30.508 -19.823 1.00 188.32 ? 75  GLN B HE21   1 
ATOM   6746  H  HE22   . GLN B  1 76  ? 12.250  -31.992 -19.826 1.00 188.32 ? 75  GLN B HE22   1 
ATOM   6747  N  N      . GLN B  1 77  ? 9.742   -27.769 -14.202 1.00 126.25 ? 76  GLN B N      1 
ATOM   6748  C  CA     . GLN B  1 77  ? 8.460   -27.099 -14.012 1.00 138.33 ? 76  GLN B CA     1 
ATOM   6749  C  C      . GLN B  1 77  ? 8.643   -25.661 -13.518 1.00 131.04 ? 76  GLN B C      1 
ATOM   6750  O  O      . GLN B  1 77  ? 7.686   -25.021 -13.080 1.00 125.19 ? 76  GLN B O      1 
ATOM   6751  C  CB     . GLN B  1 77  ? 7.569   -27.890 -13.049 1.00 153.18 ? 76  GLN B CB     1 
ATOM   6752  C  CG     . GLN B  1 77  ? 8.097   -27.978 -11.630 1.00 166.97 ? 76  GLN B CG     1 
ATOM   6753  C  CD     . GLN B  1 77  ? 7.159   -28.730 -10.708 1.00 168.61 ? 76  GLN B CD     1 
ATOM   6754  O  OE1    . GLN B  1 77  ? 6.108   -29.213 -11.131 1.00 172.15 ? 76  GLN B OE1    1 
ATOM   6755  N  NE2    . GLN B  1 77  ? 7.535   -28.834 -9.439  1.00 163.11 ? 76  GLN B NE2    1 
ATOM   6756  H  H      . GLN B  1 77  ? 10.041  -28.170 -13.502 1.00 151.50 ? 76  GLN B H      1 
ATOM   6757  H  HA     . GLN B  1 77  ? 7.998   -27.058 -14.875 1.00 165.99 ? 76  GLN B HA     1 
ATOM   6758  H  HB2    . GLN B  1 77  ? 6.698   -27.466 -13.012 1.00 183.82 ? 76  GLN B HB2    1 
ATOM   6759  H  HB3    . GLN B  1 77  ? 7.478   -28.796 -13.384 1.00 183.82 ? 76  GLN B HB3    1 
ATOM   6760  H  HG2    . GLN B  1 77  ? 8.948   -28.442 -11.637 1.00 200.37 ? 76  GLN B HG2    1 
ATOM   6761  H  HG3    . GLN B  1 77  ? 8.209   -27.081 -11.278 1.00 200.37 ? 76  GLN B HG3    1 
ATOM   6762  H  HE21   . GLN B  1 77  ? 8.276   -28.484 -9.180  1.00 195.73 ? 76  GLN B HE21   1 
ATOM   6763  H  HE22   . GLN B  1 77  ? 7.037   -29.252 -8.876  1.00 195.73 ? 76  GLN B HE22   1 
ATOM   6764  N  N      . CYS B  1 78  ? 9.875   -25.162 -13.589 1.00 126.16 ? 77  CYS B N      1 
ATOM   6765  C  CA     . CYS B  1 78  ? 10.159  -23.762 -13.286 1.00 112.47 ? 77  CYS B CA     1 
ATOM   6766  C  C      . CYS B  1 78  ? 10.621  -23.041 -14.541 1.00 109.81 ? 77  CYS B C      1 
ATOM   6767  O  O      . CYS B  1 78  ? 11.486  -23.531 -15.265 1.00 115.54 ? 77  CYS B O      1 
ATOM   6768  C  CB     . CYS B  1 78  ? 11.240  -23.641 -12.212 1.00 100.28 ? 77  CYS B CB     1 
ATOM   6769  S  SG     . CYS B  1 78  ? 10.729  -24.210 -10.598 1.00 113.85 ? 77  CYS B SG     1 
ATOM   6770  H  H      . CYS B  1 78  ? 10.569  -25.618 -13.811 1.00 151.40 ? 77  CYS B H      1 
ATOM   6771  H  HA     . CYS B  1 78  ? 9.345   -23.326 -12.958 1.00 134.96 ? 77  CYS B HA     1 
ATOM   6772  H  HB2    . CYS B  1 78  ? 12.008  -24.169 -12.483 1.00 120.33 ? 77  CYS B HB2    1 
ATOM   6773  H  HB3    . CYS B  1 78  ? 11.496  -22.709 -12.130 1.00 120.33 ? 77  CYS B HB3    1 
ATOM   6774  H  HG     . CYS B  1 78  ? 10.423  -25.368 -10.671 1.00 136.62 ? 77  CYS B HG     1 
ATOM   6775  N  N      . ASP B  1 79  ? 10.044  -21.871 -14.790 1.00 105.97 ? 78  ASP B N      1 
ATOM   6776  C  CA     . ASP B  1 79  ? 10.418  -21.065 -15.943 1.00 117.90 ? 78  ASP B CA     1 
ATOM   6777  C  C      . ASP B  1 79  ? 10.614  -19.617 -15.515 1.00 119.72 ? 78  ASP B C      1 
ATOM   6778  O  O      . ASP B  1 79  ? 9.697   -18.801 -15.605 1.00 132.70 ? 78  ASP B O      1 
ATOM   6779  C  CB     . ASP B  1 79  ? 9.348   -21.156 -17.030 1.00 123.37 ? 78  ASP B CB     1 
ATOM   6780  C  CG     . ASP B  1 79  ? 9.700   -20.347 -18.261 1.00 126.35 ? 78  ASP B CG     1 
ATOM   6781  O  OD1    . ASP B  1 79  ? 9.196   -19.211 -18.390 1.00 135.76 ? 78  ASP B OD1    1 
ATOM   6782  O  OD2    . ASP B  1 79  ? 10.485  -20.844 -19.096 1.00 120.23 ? 78  ASP B OD2    1 
ATOM   6783  H  H      . ASP B  1 79  ? 9.428   -21.521 -14.303 1.00 127.16 ? 78  ASP B H      1 
ATOM   6784  H  HA     . ASP B  1 79  ? 11.264  -21.396 -16.311 1.00 141.48 ? 78  ASP B HA     1 
ATOM   6785  H  HB2    . ASP B  1 79  ? 9.248   -22.083 -17.299 1.00 148.04 ? 78  ASP B HB2    1 
ATOM   6786  H  HB3    . ASP B  1 79  ? 8.509   -20.820 -16.679 1.00 148.04 ? 78  ASP B HB3    1 
ATOM   6787  N  N      . SER B  1 80  ? 11.818  -19.310 -15.047 1.00 109.07 ? 79  SER B N      1 
ATOM   6788  C  CA     . SER B  1 80  ? 12.132  -17.980 -14.546 1.00 99.91  ? 79  SER B CA     1 
ATOM   6789  C  C      . SER B  1 80  ? 13.583  -17.635 -14.857 1.00 86.05  ? 79  SER B C      1 
ATOM   6790  O  O      . SER B  1 80  ? 14.435  -18.522 -14.927 1.00 94.00  ? 79  SER B O      1 
ATOM   6791  C  CB     . SER B  1 80  ? 11.887  -17.921 -13.033 1.00 103.12 ? 79  SER B CB     1 
ATOM   6792  O  OG     . SER B  1 80  ? 12.331  -16.697 -12.475 1.00 89.16  ? 79  SER B OG     1 
ATOM   6793  H  H      . SER B  1 80  ? 12.477  -19.861 -15.010 1.00 130.88 ? 79  SER B H      1 
ATOM   6794  H  HA     . SER B  1 80  ? 11.554  -17.320 -14.981 1.00 119.89 ? 79  SER B HA     1 
ATOM   6795  H  HB2    . SER B  1 80  ? 10.936  -18.014 -12.867 1.00 123.75 ? 79  SER B HB2    1 
ATOM   6796  H  HB3    . SER B  1 80  ? 12.367  -18.650 -12.610 1.00 123.75 ? 79  SER B HB3    1 
ATOM   6797  H  HG     . SER B  1 80  ? 12.190  -16.689 -11.667 1.00 106.99 ? 79  SER B HG     1 
ATOM   6798  N  N      . PRO B  1 81  ? 13.869  -16.340 -15.054 1.00 75.55  ? 80  PRO B N      1 
ATOM   6799  C  CA     . PRO B  1 81  ? 15.247  -15.884 -15.262 1.00 73.64  ? 80  PRO B CA     1 
ATOM   6800  C  C      . PRO B  1 81  ? 16.066  -15.889 -13.971 1.00 75.50  ? 80  PRO B C      1 
ATOM   6801  O  O      . PRO B  1 81  ? 17.229  -15.483 -13.987 1.00 78.97  ? 80  PRO B O      1 
ATOM   6802  C  CB     . PRO B  1 81  ? 15.066  -14.454 -15.778 1.00 47.37  ? 80  PRO B CB     1 
ATOM   6803  C  CG     . PRO B  1 81  ? 13.772  -14.014 -15.203 1.00 72.43  ? 80  PRO B CG     1 
ATOM   6804  C  CD     . PRO B  1 81  ? 12.901  -15.236 -15.172 1.00 71.60  ? 80  PRO B CD     1 
ATOM   6805  H  HA     . PRO B  1 81  ? 15.695  -16.428 -15.942 1.00 88.37  ? 80  PRO B HA     1 
ATOM   6806  H  HB2    . PRO B  1 81  ? 15.793  -13.895 -15.461 1.00 56.84  ? 80  PRO B HB2    1 
ATOM   6807  H  HB3    . PRO B  1 81  ? 15.030  -14.457 -16.747 1.00 56.84  ? 80  PRO B HB3    1 
ATOM   6808  H  HG2    . PRO B  1 81  ? 13.914  -13.674 -14.306 1.00 86.91  ? 80  PRO B HG2    1 
ATOM   6809  H  HG3    . PRO B  1 81  ? 13.380  -13.330 -15.769 1.00 86.91  ? 80  PRO B HG3    1 
ATOM   6810  H  HD2    . PRO B  1 81  ? 12.316  -15.215 -14.398 1.00 85.92  ? 80  PRO B HD2    1 
ATOM   6811  H  HD3    . PRO B  1 81  ? 12.397  -15.314 -15.997 1.00 85.92  ? 80  PRO B HD3    1 
ATOM   6812  N  N      . TYR B  1 82  ? 15.464  -16.340 -12.873 1.00 76.93  ? 81  TYR B N      1 
ATOM   6813  C  CA     . TYR B  1 82  ? 16.163  -16.421 -11.595 1.00 72.29  ? 81  TYR B CA     1 
ATOM   6814  C  C      . TYR B  1 82  ? 16.331  -17.869 -11.147 1.00 78.51  ? 81  TYR B C      1 
ATOM   6815  O  O      . TYR B  1 82  ? 16.939  -18.139 -10.114 1.00 81.17  ? 81  TYR B O      1 
ATOM   6816  C  CB     . TYR B  1 82  ? 15.407  -15.620 -10.538 1.00 70.81  ? 81  TYR B CB     1 
ATOM   6817  C  CG     . TYR B  1 82  ? 14.987  -14.256 -11.028 1.00 80.84  ? 81  TYR B CG     1 
ATOM   6818  C  CD1    . TYR B  1 82  ? 15.926  -13.257 -11.246 1.00 77.29  ? 81  TYR B CD1    1 
ATOM   6819  C  CD2    . TYR B  1 82  ? 13.653  -13.969 -11.285 1.00 79.39  ? 81  TYR B CD2    1 
ATOM   6820  C  CE1    . TYR B  1 82  ? 15.549  -12.009 -11.702 1.00 81.42  ? 81  TYR B CE1    1 
ATOM   6821  C  CE2    . TYR B  1 82  ? 13.266  -12.724 -11.739 1.00 81.03  ? 81  TYR B CE2    1 
ATOM   6822  C  CZ     . TYR B  1 82  ? 14.217  -11.747 -11.947 1.00 85.82  ? 81  TYR B CZ     1 
ATOM   6823  O  OH     . TYR B  1 82  ? 13.832  -10.505 -12.399 1.00 82.35  ? 81  TYR B OH     1 
ATOM   6824  H  H      . TYR B  1 82  ? 14.647  -16.606 -12.842 1.00 92.31  ? 81  TYR B H      1 
ATOM   6825  H  HA     . TYR B  1 82  ? 17.055  -16.028 -11.693 1.00 86.75  ? 81  TYR B HA     1 
ATOM   6826  H  HB2    . TYR B  1 82  ? 14.607  -16.107 -10.285 1.00 84.97  ? 81  TYR B HB2    1 
ATOM   6827  H  HB3    . TYR B  1 82  ? 15.980  -15.498 -9.765  1.00 84.97  ? 81  TYR B HB3    1 
ATOM   6828  H  HD1    . TYR B  1 82  ? 16.825  -13.431 -11.083 1.00 92.74  ? 81  TYR B HD1    1 
ATOM   6829  H  HD2    . TYR B  1 82  ? 13.009  -14.626 -11.146 1.00 95.26  ? 81  TYR B HD2    1 
ATOM   6830  H  HE1    . TYR B  1 82  ? 16.189  -11.349 -11.841 1.00 97.71  ? 81  TYR B HE1    1 
ATOM   6831  H  HE2    . TYR B  1 82  ? 12.368  -12.546 -11.905 1.00 97.23  ? 81  TYR B HE2    1 
ATOM   6832  H  HH     . TYR B  1 82  ? 13.311  -10.162 -11.867 1.00 98.82  ? 81  TYR B HH     1 
ATOM   6833  N  N      . VAL B  1 83  ? 15.791  -18.795 -11.933 1.00 81.98  ? 82  VAL B N      1 
ATOM   6834  C  CA     . VAL B  1 83  ? 15.938  -20.218 -11.663 1.00 69.46  ? 82  VAL B CA     1 
ATOM   6835  C  C      . VAL B  1 83  ? 16.583  -20.904 -12.863 1.00 79.36  ? 82  VAL B C      1 
ATOM   6836  O  O      . VAL B  1 83  ? 16.048  -20.861 -13.974 1.00 80.75  ? 82  VAL B O      1 
ATOM   6837  C  CB     . VAL B  1 83  ? 14.577  -20.876 -11.383 1.00 71.58  ? 82  VAL B CB     1 
ATOM   6838  C  CG1    . VAL B  1 83  ? 14.756  -22.352 -11.035 1.00 69.68  ? 82  VAL B CG1    1 
ATOM   6839  C  CG2    . VAL B  1 83  ? 13.854  -20.142 -10.263 1.00 72.43  ? 82  VAL B CG2    1 
ATOM   6840  H  H      . VAL B  1 83  ? 15.329  -18.620 -12.637 1.00 98.38  ? 82  VAL B H      1 
ATOM   6841  H  HA     . VAL B  1 83  ? 16.515  -20.347 -10.882 1.00 83.36  ? 82  VAL B HA     1 
ATOM   6842  H  HB     . VAL B  1 83  ? 14.023  -20.820 -12.189 1.00 85.90  ? 82  VAL B HB     1 
ATOM   6843  H  HG11   . VAL B  1 83  ? 13.894  -22.739 -10.864 1.00 83.61  ? 82  VAL B HG11   1 
ATOM   6844  H  HG12   . VAL B  1 83  ? 15.176  -22.798 -11.774 1.00 83.61  ? 82  VAL B HG12   1 
ATOM   6845  H  HG13   . VAL B  1 83  ? 15.308  -22.423 -10.253 1.00 83.61  ? 82  VAL B HG13   1 
ATOM   6846  H  HG21   . VAL B  1 83  ? 13.008  -20.569 -10.105 1.00 86.91  ? 82  VAL B HG21   1 
ATOM   6847  H  HG22   . VAL B  1 83  ? 14.392  -20.176 -9.469  1.00 86.91  ? 82  VAL B HG22   1 
ATOM   6848  H  HG23   . VAL B  1 83  ? 13.716  -19.229 -10.527 1.00 86.91  ? 82  VAL B HG23   1 
ATOM   6849  N  N      . VAL B  1 84  ? 17.730  -21.536 -12.629 1.00 75.41  ? 83  VAL B N      1 
ATOM   6850  C  CA     . VAL B  1 84  ? 18.478  -22.211 -13.688 1.00 76.42  ? 83  VAL B CA     1 
ATOM   6851  C  C      . VAL B  1 84  ? 17.564  -23.120 -14.505 1.00 74.44  ? 83  VAL B C      1 
ATOM   6852  O  O      . VAL B  1 84  ? 16.874  -23.979 -13.952 1.00 65.92  ? 83  VAL B O      1 
ATOM   6853  C  CB     . VAL B  1 84  ? 19.633  -23.057 -13.113 1.00 67.16  ? 83  VAL B CB     1 
ATOM   6854  C  CG1    . VAL B  1 84  ? 20.373  -23.777 -14.235 1.00 62.45  ? 83  VAL B CG1    1 
ATOM   6855  C  CG2    . VAL B  1 84  ? 20.597  -22.185 -12.310 1.00 44.54  ? 83  VAL B CG2    1 
ATOM   6856  H  H      . VAL B  1 84  ? 18.101  -21.588 -11.856 1.00 90.50  ? 83  VAL B H      1 
ATOM   6857  H  HA     . VAL B  1 84  ? 18.861  -21.540 -14.291 1.00 91.71  ? 83  VAL B HA     1 
ATOM   6858  H  HB     . VAL B  1 84  ? 19.263  -23.735 -12.510 1.00 80.59  ? 83  VAL B HB     1 
ATOM   6859  H  HG11   . VAL B  1 84  ? 21.086  -24.296 -13.855 1.00 74.94  ? 83  VAL B HG11   1 
ATOM   6860  H  HG12   . VAL B  1 84  ? 19.758  -24.352 -14.695 1.00 74.94  ? 83  VAL B HG12   1 
ATOM   6861  H  HG13   . VAL B  1 84  ? 20.730  -23.125 -14.842 1.00 74.94  ? 83  VAL B HG13   1 
ATOM   6862  H  HG21   . VAL B  1 84  ? 21.303  -22.737 -11.966 1.00 53.45  ? 83  VAL B HG21   1 
ATOM   6863  H  HG22   . VAL B  1 84  ? 20.960  -21.509 -12.887 1.00 53.45  ? 83  VAL B HG22   1 
ATOM   6864  H  HG23   . VAL B  1 84  ? 20.118  -21.776 -11.586 1.00 53.45  ? 83  VAL B HG23   1 
ATOM   6865  N  N      . LYS B  1 85  ? 17.572  -22.934 -15.822 1.00 73.11  ? 84  LYS B N      1 
ATOM   6866  C  CA     . LYS B  1 85  ? 16.663  -23.662 -16.702 1.00 84.18  ? 84  LYS B CA     1 
ATOM   6867  C  C      . LYS B  1 85  ? 17.214  -25.018 -17.129 1.00 77.10  ? 84  LYS B C      1 
ATOM   6868  O  O      . LYS B  1 85  ? 18.420  -25.184 -17.320 1.00 66.72  ? 84  LYS B O      1 
ATOM   6869  C  CB     . LYS B  1 85  ? 16.331  -22.820 -17.935 1.00 94.13  ? 84  LYS B CB     1 
ATOM   6870  C  CG     . LYS B  1 85  ? 15.508  -21.586 -17.612 1.00 126.09 ? 84  LYS B CG     1 
ATOM   6871  C  CD     . LYS B  1 85  ? 15.264  -20.727 -18.836 1.00 132.14 ? 84  LYS B CD     1 
ATOM   6872  C  CE     . LYS B  1 85  ? 14.533  -19.448 -18.463 1.00 126.13 ? 84  LYS B CE     1 
ATOM   6873  N  NZ     . LYS B  1 85  ? 14.364  -18.548 -19.630 1.00 136.74 ? 84  LYS B NZ     1 
ATOM   6874  H  H      . LYS B  1 85  ? 18.097  -22.390 -16.232 1.00 87.73  ? 84  LYS B H      1 
ATOM   6875  H  HA     . LYS B  1 85  ? 15.825  -23.823 -16.219 1.00 101.02 ? 84  LYS B HA     1 
ATOM   6876  H  HB2    . LYS B  1 85  ? 17.159  -22.527 -18.348 1.00 112.95 ? 84  LYS B HB2    1 
ATOM   6877  H  HB3    . LYS B  1 85  ? 15.824  -23.362 -18.559 1.00 112.95 ? 84  LYS B HB3    1 
ATOM   6878  H  HG2    . LYS B  1 85  ? 14.647  -21.861 -17.260 1.00 151.30 ? 84  LYS B HG2    1 
ATOM   6879  H  HG3    . LYS B  1 85  ? 15.981  -21.050 -16.956 1.00 151.30 ? 84  LYS B HG3    1 
ATOM   6880  H  HD2    . LYS B  1 85  ? 16.114  -20.487 -19.236 1.00 158.57 ? 84  LYS B HD2    1 
ATOM   6881  H  HD3    . LYS B  1 85  ? 14.718  -21.217 -19.470 1.00 158.57 ? 84  LYS B HD3    1 
ATOM   6882  H  HE2    . LYS B  1 85  ? 13.652  -19.672 -18.123 1.00 151.36 ? 84  LYS B HE2    1 
ATOM   6883  H  HE3    . LYS B  1 85  ? 15.042  -18.975 -17.786 1.00 151.36 ? 84  LYS B HE3    1 
ATOM   6884  H  HZ1    . LYS B  1 85  ? 13.934  -17.808 -19.384 1.00 164.08 ? 84  LYS B HZ1    1 
ATOM   6885  H  HZ2    . LYS B  1 85  ? 15.160  -18.323 -19.959 1.00 164.08 ? 84  LYS B HZ2    1 
ATOM   6886  H  HZ3    . LYS B  1 85  ? 13.894  -18.958 -20.265 1.00 164.08 ? 84  LYS B HZ3    1 
ATOM   6887  N  N      . TYR B  1 86  ? 16.310  -25.983 -17.268 1.00 84.64  ? 85  TYR B N      1 
ATOM   6888  C  CA     . TYR B  1 86  ? 16.656  -27.325 -17.720 1.00 77.47  ? 85  TYR B CA     1 
ATOM   6889  C  C      . TYR B  1 86  ? 16.129  -27.533 -19.136 1.00 82.32  ? 85  TYR B C      1 
ATOM   6890  O  O      . TYR B  1 86  ? 14.935  -27.380 -19.398 1.00 80.01  ? 85  TYR B O      1 
ATOM   6891  C  CB     . TYR B  1 86  ? 16.072  -28.367 -16.766 1.00 87.70  ? 85  TYR B CB     1 
ATOM   6892  C  CG     . TYR B  1 86  ? 16.035  -29.776 -17.315 1.00 118.83 ? 85  TYR B CG     1 
ATOM   6893  C  CD1    . TYR B  1 86  ? 17.200  -30.432 -17.688 1.00 144.18 ? 85  TYR B CD1    1 
ATOM   6894  C  CD2    . TYR B  1 86  ? 14.832  -30.459 -17.440 1.00 116.88 ? 85  TYR B CD2    1 
ATOM   6895  C  CE1    . TYR B  1 86  ? 17.165  -31.724 -18.183 1.00 148.56 ? 85  TYR B CE1    1 
ATOM   6896  C  CE2    . TYR B  1 86  ? 14.788  -31.750 -17.932 1.00 111.29 ? 85  TYR B CE2    1 
ATOM   6897  C  CZ     . TYR B  1 86  ? 15.955  -32.377 -18.302 1.00 133.01 ? 85  TYR B CZ     1 
ATOM   6898  O  OH     . TYR B  1 86  ? 15.908  -33.662 -18.791 1.00 137.17 ? 85  TYR B OH     1 
ATOM   6899  H  H      . TYR B  1 86  ? 15.472  -25.881 -17.103 1.00 101.57 ? 85  TYR B H      1 
ATOM   6900  H  HA     . TYR B  1 86  ? 17.631  -27.425 -17.733 1.00 92.96  ? 85  TYR B HA     1 
ATOM   6901  H  HB2    . TYR B  1 86  ? 16.608  -28.381 -15.958 1.00 105.24 ? 85  TYR B HB2    1 
ATOM   6902  H  HB3    . TYR B  1 86  ? 15.162  -28.112 -16.549 1.00 105.24 ? 85  TYR B HB3    1 
ATOM   6903  H  HD1    . TYR B  1 86  ? 18.017  -29.994 -17.610 1.00 173.02 ? 85  TYR B HD1    1 
ATOM   6904  H  HD2    . TYR B  1 86  ? 14.041  -30.038 -17.192 1.00 140.26 ? 85  TYR B HD2    1 
ATOM   6905  H  HE1    . TYR B  1 86  ? 17.953  -32.151 -18.433 1.00 178.27 ? 85  TYR B HE1    1 
ATOM   6906  H  HE2    . TYR B  1 86  ? 13.973  -32.191 -18.013 1.00 133.55 ? 85  TYR B HE2    1 
ATOM   6907  H  HH     . TYR B  1 86  ? 15.447  -33.688 -19.469 1.00 164.60 ? 85  TYR B HH     1 
ATOM   6908  N  N      . TYR B  1 87  ? 17.030  -27.875 -20.049 1.00 74.58  ? 86  TYR B N      1 
ATOM   6909  C  CA     . TYR B  1 87  ? 16.690  -27.976 -21.460 1.00 80.93  ? 86  TYR B CA     1 
ATOM   6910  C  C      . TYR B  1 87  ? 16.164  -29.359 -21.835 1.00 89.14  ? 86  TYR B C      1 
ATOM   6911  O  O      . TYR B  1 87  ? 15.201  -29.481 -22.593 1.00 89.98  ? 86  TYR B O      1 
ATOM   6912  C  CB     . TYR B  1 87  ? 17.917  -27.640 -22.302 1.00 99.10  ? 86  TYR B CB     1 
ATOM   6913  C  CG     . TYR B  1 87  ? 18.445  -26.242 -22.071 1.00 103.21 ? 86  TYR B CG     1 
ATOM   6914  C  CD1    . TYR B  1 87  ? 19.806  -26.008 -21.942 1.00 105.52 ? 86  TYR B CD1    1 
ATOM   6915  C  CD2    . TYR B  1 87  ? 17.583  -25.156 -21.992 1.00 95.27  ? 86  TYR B CD2    1 
ATOM   6916  C  CE1    . TYR B  1 87  ? 20.296  -24.735 -21.736 1.00 96.19  ? 86  TYR B CE1    1 
ATOM   6917  C  CE2    . TYR B  1 87  ? 18.065  -23.878 -21.786 1.00 101.57 ? 86  TYR B CE2    1 
ATOM   6918  C  CZ     . TYR B  1 87  ? 19.423  -23.673 -21.659 1.00 101.10 ? 86  TYR B CZ     1 
ATOM   6919  O  OH     . TYR B  1 87  ? 19.913  -22.403 -21.453 1.00 104.43 ? 86  TYR B OH     1 
ATOM   6920  H  H      . TYR B  1 87  ? 17.852  -28.056 -19.874 1.00 89.49  ? 86  TYR B H      1 
ATOM   6921  H  HA     . TYR B  1 87  ? 15.991  -27.320 -21.667 1.00 97.11  ? 86  TYR B HA     1 
ATOM   6922  H  HB2    . TYR B  1 87  ? 18.627  -28.265 -22.084 1.00 118.92 ? 86  TYR B HB2    1 
ATOM   6923  H  HB3    . TYR B  1 87  ? 17.685  -27.719 -23.240 1.00 118.92 ? 86  TYR B HB3    1 
ATOM   6924  H  HD1    . TYR B  1 87  ? 20.399  -26.722 -21.994 1.00 126.63 ? 86  TYR B HD1    1 
ATOM   6925  H  HD2    . TYR B  1 87  ? 16.667  -25.292 -22.078 1.00 114.33 ? 86  TYR B HD2    1 
ATOM   6926  H  HE1    . TYR B  1 87  ? 21.211  -24.595 -21.650 1.00 115.43 ? 86  TYR B HE1    1 
ATOM   6927  H  HE2    . TYR B  1 87  ? 17.476  -23.159 -21.734 1.00 121.89 ? 86  TYR B HE2    1 
ATOM   6928  H  HH     . TYR B  1 87  ? 19.604  -22.093 -20.759 1.00 125.32 ? 86  TYR B HH     1 
ATOM   6929  N  N      . GLY B  1 88  ? 16.806  -30.397 -21.308 1.00 80.26  ? 87  GLY B N      1 
ATOM   6930  C  CA     . GLY B  1 88  ? 16.414  -31.766 -21.593 1.00 75.63  ? 87  GLY B CA     1 
ATOM   6931  C  C      . GLY B  1 88  ? 17.506  -32.735 -21.191 1.00 85.39  ? 87  GLY B C      1 
ATOM   6932  O  O      . GLY B  1 88  ? 18.559  -32.317 -20.708 1.00 83.18  ? 87  GLY B O      1 
ATOM   6933  H  H      . GLY B  1 88  ? 17.479  -30.331 -20.777 1.00 96.31  ? 87  GLY B H      1 
ATOM   6934  H  HA2    . GLY B  1 88  ? 15.606  -31.985 -21.103 1.00 90.76  ? 87  GLY B HA2    1 
ATOM   6935  H  HA3    . GLY B  1 88  ? 16.240  -31.867 -22.542 1.00 90.76  ? 87  GLY B HA3    1 
ATOM   6936  N  N      . SER B  1 89  ? 17.260  -34.028 -21.390 1.00 89.20  ? 88  SER B N      1 
ATOM   6937  C  CA     . SER B  1 89  ? 18.234  -35.051 -21.025 1.00 87.16  ? 88  SER B CA     1 
ATOM   6938  C  C      . SER B  1 89  ? 18.324  -36.185 -22.045 1.00 90.77  ? 88  SER B C      1 
ATOM   6939  O  O      . SER B  1 89  ? 17.397  -36.418 -22.821 1.00 102.79 ? 88  SER B O      1 
ATOM   6940  C  CB     . SER B  1 89  ? 17.882  -35.642 -19.663 1.00 102.24 ? 88  SER B CB     1 
ATOM   6941  O  OG     . SER B  1 89  ? 16.611  -36.268 -19.710 1.00 125.97 ? 88  SER B OG     1 
ATOM   6942  H  H      . SER B  1 89  ? 16.536  -34.338 -21.734 1.00 107.04 ? 88  SER B H      1 
ATOM   6943  H  HA     . SER B  1 89  ? 19.120  -34.637 -20.955 1.00 104.59 ? 88  SER B HA     1 
ATOM   6944  H  HB2    . SER B  1 89  ? 18.551  -36.302 -19.421 1.00 122.69 ? 88  SER B HB2    1 
ATOM   6945  H  HB3    . SER B  1 89  ? 17.862  -34.931 -19.004 1.00 122.69 ? 88  SER B HB3    1 
ATOM   6946  H  HG     . SER B  1 89  ? 16.427  -36.583 -18.976 1.00 151.17 ? 88  SER B HG     1 
ATOM   6947  N  N      . TYR B  1 90  ? 19.450  -36.893 -22.020 1.00 86.69  ? 89  TYR B N      1 
ATOM   6948  C  CA     . TYR B  1 90  ? 19.668  -38.058 -22.870 1.00 100.44 ? 89  TYR B CA     1 
ATOM   6949  C  C      . TYR B  1 90  ? 20.156  -39.219 -22.017 1.00 112.20 ? 89  TYR B C      1 
ATOM   6950  O  O      . TYR B  1 90  ? 20.775  -39.010 -20.974 1.00 103.61 ? 89  TYR B O      1 
ATOM   6951  C  CB     . TYR B  1 90  ? 20.726  -37.765 -23.935 1.00 103.56 ? 89  TYR B CB     1 
ATOM   6952  C  CG     . TYR B  1 90  ? 20.387  -36.635 -24.875 1.00 105.47 ? 89  TYR B CG     1 
ATOM   6953  C  CD1    . TYR B  1 90  ? 19.737  -36.877 -26.076 1.00 113.09 ? 89  TYR B CD1    1 
ATOM   6954  C  CD2    . TYR B  1 90  ? 20.731  -35.328 -24.569 1.00 97.50  ? 89  TYR B CD2    1 
ATOM   6955  C  CE1    . TYR B  1 90  ? 19.432  -35.847 -26.943 1.00 106.50 ? 89  TYR B CE1    1 
ATOM   6956  C  CE2    . TYR B  1 90  ? 20.430  -34.292 -25.428 1.00 98.57  ? 89  TYR B CE2    1 
ATOM   6957  C  CZ     . TYR B  1 90  ? 19.780  -34.556 -26.613 1.00 100.65 ? 89  TYR B CZ     1 
ATOM   6958  O  OH     . TYR B  1 90  ? 19.482  -33.524 -27.471 1.00 113.44 ? 89  TYR B OH     1 
ATOM   6959  H  H      . TYR B  1 90  ? 20.117  -36.713 -21.507 1.00 104.03 ? 89  TYR B H      1 
ATOM   6960  H  HA     . TYR B  1 90  ? 18.831  -38.314 -23.311 1.00 120.53 ? 89  TYR B HA     1 
ATOM   6961  H  HB2    . TYR B  1 90  ? 21.557  -37.537 -23.489 1.00 124.27 ? 89  TYR B HB2    1 
ATOM   6962  H  HB3    . TYR B  1 90  ? 20.853  -38.564 -24.471 1.00 124.27 ? 89  TYR B HB3    1 
ATOM   6963  H  HD1    . TYR B  1 90  ? 19.501  -37.748 -26.300 1.00 135.71 ? 89  TYR B HD1    1 
ATOM   6964  H  HD2    . TYR B  1 90  ? 21.170  -35.146 -23.769 1.00 117.00 ? 89  TYR B HD2    1 
ATOM   6965  H  HE1    . TYR B  1 90  ? 18.993  -36.023 -27.744 1.00 127.79 ? 89  TYR B HE1    1 
ATOM   6966  H  HE2    . TYR B  1 90  ? 20.665  -33.420 -25.208 1.00 118.28 ? 89  TYR B HE2    1 
ATOM   6967  H  HH     . TYR B  1 90  ? 18.672  -33.482 -27.588 1.00 136.12 ? 89  TYR B HH     1 
ATOM   6968  N  N      . PHE B  1 91  ? 19.876  -40.440 -22.460 1.00 117.93 ? 90  PHE B N      1 
ATOM   6969  C  CA     . PHE B  1 91  ? 20.469  -41.626 -21.856 1.00 103.76 ? 90  PHE B CA     1 
ATOM   6970  C  C      . PHE B  1 91  ? 21.596  -42.095 -22.767 1.00 85.54  ? 90  PHE B C      1 
ATOM   6971  O  O      . PHE B  1 91  ? 21.394  -42.254 -23.970 1.00 89.92  ? 90  PHE B O      1 
ATOM   6972  C  CB     . PHE B  1 91  ? 19.426  -42.732 -21.692 1.00 108.51 ? 90  PHE B CB     1 
ATOM   6973  C  CG     . PHE B  1 91  ? 19.960  -43.978 -21.041 1.00 116.16 ? 90  PHE B CG     1 
ATOM   6974  C  CD1    . PHE B  1 91  ? 20.981  -43.906 -20.108 1.00 115.69 ? 90  PHE B CD1    1 
ATOM   6975  C  CD2    . PHE B  1 91  ? 19.450  -45.223 -21.374 1.00 110.21 ? 90  PHE B CD2    1 
ATOM   6976  C  CE1    . PHE B  1 91  ? 21.475  -45.051 -19.513 1.00 118.21 ? 90  PHE B CE1    1 
ATOM   6977  C  CE2    . PHE B  1 91  ? 19.943  -46.370 -20.783 1.00 102.55 ? 90  PHE B CE2    1 
ATOM   6978  C  CZ     . PHE B  1 91  ? 20.957  -46.283 -19.852 1.00 112.24 ? 90  PHE B CZ     1 
ATOM   6979  H  H      . PHE B  1 91  ? 19.343  -40.608 -23.114 1.00 141.52 ? 90  PHE B H      1 
ATOM   6980  H  HA     . PHE B  1 91  ? 20.840  -41.404 -20.976 1.00 124.51 ? 90  PHE B HA     1 
ATOM   6981  H  HB2    . PHE B  1 91  ? 18.700  -42.398 -21.142 1.00 130.21 ? 90  PHE B HB2    1 
ATOM   6982  H  HB3    . PHE B  1 91  ? 19.089  -42.976 -22.568 1.00 130.21 ? 90  PHE B HB3    1 
ATOM   6983  H  HD1    . PHE B  1 91  ? 21.335  -43.078 -19.875 1.00 138.83 ? 90  PHE B HD1    1 
ATOM   6984  H  HD2    . PHE B  1 91  ? 18.767  -45.286 -22.002 1.00 132.25 ? 90  PHE B HD2    1 
ATOM   6985  H  HE1    . PHE B  1 91  ? 22.160  -44.990 -18.886 1.00 141.85 ? 90  PHE B HE1    1 
ATOM   6986  H  HE2    . PHE B  1 91  ? 19.591  -47.200 -21.013 1.00 123.06 ? 90  PHE B HE2    1 
ATOM   6987  H  HZ     . PHE B  1 91  ? 21.289  -47.055 -19.452 1.00 134.69 ? 90  PHE B HZ     1 
ATOM   6988  N  N      . LYS B  1 92  ? 22.782  -42.304 -22.203 1.00 74.69  ? 91  LYS B N      1 
ATOM   6989  C  CA     . LYS B  1 92  ? 23.952  -42.634 -23.012 1.00 94.68  ? 91  LYS B CA     1 
ATOM   6990  C  C      . LYS B  1 92  ? 25.055  -43.287 -22.186 1.00 102.92 ? 91  LYS B C      1 
ATOM   6991  O  O      . LYS B  1 92  ? 25.590  -42.680 -21.257 1.00 97.96  ? 91  LYS B O      1 
ATOM   6992  C  CB     . LYS B  1 92  ? 24.492  -41.370 -23.691 1.00 98.61  ? 91  LYS B CB     1 
ATOM   6993  C  CG     . LYS B  1 92  ? 25.823  -41.555 -24.412 1.00 104.90 ? 91  LYS B CG     1 
ATOM   6994  C  CD     . LYS B  1 92  ? 25.712  -42.541 -25.565 1.00 120.68 ? 91  LYS B CD     1 
ATOM   6995  C  CE     . LYS B  1 92  ? 27.052  -42.739 -26.259 1.00 130.99 ? 91  LYS B CE     1 
ATOM   6996  N  NZ     . LYS B  1 92  ? 26.986  -43.761 -27.343 1.00 133.81 ? 91  LYS B NZ     1 
ATOM   6997  H  H      . LYS B  1 92  ? 22.936  -42.261 -21.358 1.00 89.63  ? 91  LYS B H      1 
ATOM   6998  H  HA     . LYS B  1 92  ? 23.686  -43.264 -23.714 1.00 113.62 ? 91  LYS B HA     1 
ATOM   6999  H  HB2    . LYS B  1 92  ? 23.843  -41.068 -24.345 1.00 118.34 ? 91  LYS B HB2    1 
ATOM   7000  H  HB3    . LYS B  1 92  ? 24.617  -40.685 -23.016 1.00 118.34 ? 91  LYS B HB3    1 
ATOM   7001  H  HG2    . LYS B  1 92  ? 26.113  -40.702 -24.771 1.00 125.88 ? 91  LYS B HG2    1 
ATOM   7002  H  HG3    . LYS B  1 92  ? 26.480  -41.896 -23.786 1.00 125.88 ? 91  LYS B HG3    1 
ATOM   7003  H  HD2    . LYS B  1 92  ? 25.416  -43.400 -25.224 1.00 144.81 ? 91  LYS B HD2    1 
ATOM   7004  H  HD3    . LYS B  1 92  ? 25.079  -42.202 -26.217 1.00 144.81 ? 91  LYS B HD3    1 
ATOM   7005  H  HE2    . LYS B  1 92  ? 27.332  -41.899 -26.654 1.00 157.19 ? 91  LYS B HE2    1 
ATOM   7006  H  HE3    . LYS B  1 92  ? 27.707  -43.035 -25.607 1.00 157.19 ? 91  LYS B HE3    1 
ATOM   7007  H  HZ1    . LYS B  1 92  ? 27.784  -43.850 -27.726 1.00 160.57 ? 91  LYS B HZ1    1 
ATOM   7008  H  HZ2    . LYS B  1 92  ? 26.737  -44.546 -27.006 1.00 160.57 ? 91  LYS B HZ2    1 
ATOM   7009  H  HZ3    . LYS B  1 92  ? 26.395  -43.511 -27.960 1.00 160.57 ? 91  LYS B HZ3    1 
ATOM   7010  N  N      . ASN B  1 93  ? 25.391  -44.525 -22.539 1.00 112.03 ? 92  ASN B N      1 
ATOM   7011  C  CA     . ASN B  1 93  ? 26.488  -45.248 -21.901 1.00 117.49 ? 92  ASN B CA     1 
ATOM   7012  C  C      . ASN B  1 93  ? 26.387  -45.289 -20.383 1.00 112.03 ? 92  ASN B C      1 
ATOM   7013  O  O      . ASN B  1 93  ? 27.291  -44.838 -19.683 1.00 126.79 ? 92  ASN B O      1 
ATOM   7014  C  CB     . ASN B  1 93  ? 27.826  -44.628 -22.301 1.00 124.18 ? 92  ASN B CB     1 
ATOM   7015  C  CG     . ASN B  1 93  ? 28.224  -44.972 -23.716 1.00 139.57 ? 92  ASN B CG     1 
ATOM   7016  O  OD1    . ASN B  1 93  ? 27.396  -45.397 -24.522 1.00 140.33 ? 92  ASN B OD1    1 
ATOM   7017  N  ND2    . ASN B  1 93  ? 29.502  -44.796 -24.027 1.00 154.28 ? 92  ASN B ND2    1 
ATOM   7018  H  H      . ASN B  1 93  ? 24.993  -44.975 -23.155 1.00 134.44 ? 92  ASN B H      1 
ATOM   7019  H  HA     . ASN B  1 93  ? 26.482  -46.173 -22.224 1.00 140.99 ? 92  ASN B HA     1 
ATOM   7020  H  HB2    . ASN B  1 93  ? 27.761  -43.663 -22.233 1.00 149.02 ? 92  ASN B HB2    1 
ATOM   7021  H  HB3    . ASN B  1 93  ? 28.518  -44.957 -21.705 1.00 149.02 ? 92  ASN B HB3    1 
ATOM   7022  H  HD21   . ASN B  1 93  ? 30.051  -44.500 -23.435 1.00 185.14 ? 92  ASN B HD21   1 
ATOM   7023  H  HD22   . ASN B  1 93  ? 29.780  -44.977 -24.820 1.00 185.14 ? 92  ASN B HD22   1 
ATOM   7024  N  N      . THR B  1 94  ? 25.285  -45.831 -19.880 1.00 102.83 ? 93  THR B N      1 
ATOM   7025  C  CA     . THR B  1 94  ? 25.075  -45.979 -18.440 1.00 126.91 ? 93  THR B CA     1 
ATOM   7026  C  C      . THR B  1 94  ? 24.886  -44.647 -17.696 1.00 120.14 ? 93  THR B C      1 
ATOM   7027  O  O      . THR B  1 94  ? 24.419  -44.636 -16.557 1.00 111.18 ? 93  THR B O      1 
ATOM   7028  C  CB     . THR B  1 94  ? 26.233  -46.760 -17.764 1.00 105.57 ? 93  THR B CB     1 
ATOM   7029  O  OG1    . THR B  1 94  ? 27.294  -45.865 -17.404 1.00 115.32 ? 93  THR B OG1    1 
ATOM   7030  C  CG2    . THR B  1 94  ? 26.762  -47.857 -18.681 1.00 107.11 ? 93  THR B CG2    1 
ATOM   7031  H  H      . THR B  1 94  ? 24.632  -46.126 -20.357 1.00 123.39 ? 93  THR B H      1 
ATOM   7032  H  HA     . THR B  1 94  ? 24.257  -46.502 -18.305 1.00 152.29 ? 93  THR B HA     1 
ATOM   7033  H  HB     . THR B  1 94  ? 25.895  -47.184 -16.960 1.00 126.69 ? 93  THR B HB     1 
ATOM   7034  H  HG1    . THR B  1 94  ? 27.584  -45.490 -18.073 1.00 138.39 ? 93  THR B HG1    1 
ATOM   7035  H  HG21   . THR B  1 94  ? 27.477  -48.329 -18.247 1.00 128.53 ? 93  THR B HG21   1 
ATOM   7036  H  HG22   . THR B  1 94  ? 26.060  -48.477 -18.890 1.00 128.53 ? 93  THR B HG22   1 
ATOM   7037  H  HG23   . THR B  1 94  ? 27.092  -47.472 -19.496 1.00 128.53 ? 93  THR B HG23   1 
ATOM   7038  N  N      . ASP B  1 95  ? 25.242  -43.534 -18.331 1.00 111.53 ? 94  ASP B N      1 
ATOM   7039  C  CA     . ASP B  1 95  ? 25.101  -42.224 -17.705 1.00 112.43 ? 94  ASP B CA     1 
ATOM   7040  C  C      . ASP B  1 95  ? 23.872  -41.494 -18.230 1.00 110.58 ? 94  ASP B C      1 
ATOM   7041  O  O      . ASP B  1 95  ? 23.488  -41.655 -19.389 1.00 102.52 ? 94  ASP B O      1 
ATOM   7042  C  CB     . ASP B  1 95  ? 26.347  -41.373 -17.960 1.00 129.35 ? 94  ASP B CB     1 
ATOM   7043  C  CG     . ASP B  1 95  ? 27.559  -41.867 -17.196 1.00 145.36 ? 94  ASP B CG     1 
ATOM   7044  O  OD1    . ASP B  1 95  ? 27.382  -42.442 -16.101 1.00 144.28 ? 94  ASP B OD1    1 
ATOM   7045  O  OD2    . ASP B  1 95  ? 28.690  -41.675 -17.691 1.00 153.96 ? 94  ASP B OD2    1 
ATOM   7046  H  H      . ASP B  1 95  ? 25.568  -43.510 -19.126 1.00 133.84 ? 94  ASP B H      1 
ATOM   7047  H  HA     . ASP B  1 95  ? 25.000  -42.337 -16.737 1.00 134.91 ? 94  ASP B HA     1 
ATOM   7048  H  HB2    . ASP B  1 95  ? 26.558  -41.397 -18.906 1.00 155.22 ? 94  ASP B HB2    1 
ATOM   7049  H  HB3    . ASP B  1 95  ? 26.169  -40.461 -17.682 1.00 155.22 ? 94  ASP B HB3    1 
ATOM   7050  N  N      . LEU B  1 96  ? 23.257  -40.697 -17.363 1.00 108.49 ? 95  LEU B N      1 
ATOM   7051  C  CA     . LEU B  1 96  ? 22.144  -39.842 -17.753 1.00 103.29 ? 95  LEU B CA     1 
ATOM   7052  C  C      . LEU B  1 96  ? 22.659  -38.420 -17.945 1.00 99.28  ? 95  LEU B C      1 
ATOM   7053  O  O      . LEU B  1 96  ? 23.222  -37.829 -17.025 1.00 107.22 ? 95  LEU B O      1 
ATOM   7054  C  CB     . LEU B  1 96  ? 21.052  -39.864 -16.684 1.00 84.58  ? 95  LEU B CB     1 
ATOM   7055  C  CG     . LEU B  1 96  ? 19.781  -39.087 -17.035 1.00 87.26  ? 95  LEU B CG     1 
ATOM   7056  C  CD1    . LEU B  1 96  ? 18.983  -39.806 -18.112 1.00 88.18  ? 95  LEU B CD1    1 
ATOM   7057  C  CD2    . LEU B  1 96  ? 18.930  -38.864 -15.800 1.00 97.27  ? 95  LEU B CD2    1 
ATOM   7058  H  H      . LEU B  1 96  ? 23.469  -40.632 -16.532 1.00 130.19 ? 95  LEU B H      1 
ATOM   7059  H  HA     . LEU B  1 96  ? 21.764  -40.158 -18.599 1.00 123.95 ? 95  LEU B HA     1 
ATOM   7060  H  HB2    . LEU B  1 96  ? 20.795  -40.786 -16.524 1.00 101.50 ? 95  LEU B HB2    1 
ATOM   7061  H  HB3    . LEU B  1 96  ? 21.411  -39.482 -15.868 1.00 101.50 ? 95  LEU B HB3    1 
ATOM   7062  H  HG     . LEU B  1 96  ? 20.033  -38.217 -17.383 1.00 104.72 ? 95  LEU B HG     1 
ATOM   7063  H  HD11   . LEU B  1 96  ? 18.195  -39.296 -18.310 1.00 105.82 ? 95  LEU B HD11   1 
ATOM   7064  H  HD12   . LEU B  1 96  ? 19.526  -39.890 -18.900 1.00 105.82 ? 95  LEU B HD12   1 
ATOM   7065  H  HD13   . LEU B  1 96  ? 18.738  -40.677 -17.790 1.00 105.82 ? 95  LEU B HD13   1 
ATOM   7066  H  HD21   . LEU B  1 96  ? 18.142  -38.375 -16.049 1.00 116.72 ? 95  LEU B HD21   1 
ATOM   7067  H  HD22   . LEU B  1 96  ? 18.685  -39.716 -15.432 1.00 116.72 ? 95  LEU B HD22   1 
ATOM   7068  H  HD23   . LEU B  1 96  ? 19.437  -38.362 -15.158 1.00 116.72 ? 95  LEU B HD23   1 
ATOM   7069  N  N      . TRP B  1 97  ? 22.469  -37.877 -19.144 1.00 79.75  ? 96  TRP B N      1 
ATOM   7070  C  CA     . TRP B  1 97  ? 22.980  -36.551 -19.478 1.00 73.58  ? 96  TRP B CA     1 
ATOM   7071  C  C      . TRP B  1 97  ? 21.938  -35.461 -19.257 1.00 81.98  ? 96  TRP B C      1 
ATOM   7072  O  O      . TRP B  1 97  ? 20.920  -35.417 -19.944 1.00 88.10  ? 96  TRP B O      1 
ATOM   7073  C  CB     . TRP B  1 97  ? 23.445  -36.516 -20.933 1.00 73.89  ? 96  TRP B CB     1 
ATOM   7074  C  CG     . TRP B  1 97  ? 24.740  -37.218 -21.161 1.00 80.42  ? 96  TRP B CG     1 
ATOM   7075  C  CD1    . TRP B  1 97  ? 25.221  -38.294 -20.475 1.00 90.04  ? 96  TRP B CD1    1 
ATOM   7076  C  CD2    . TRP B  1 97  ? 25.734  -36.887 -22.137 1.00 95.94  ? 96  TRP B CD2    1 
ATOM   7077  N  NE1    . TRP B  1 97  ? 26.450  -38.658 -20.968 1.00 98.00  ? 96  TRP B NE1    1 
ATOM   7078  C  CE2    . TRP B  1 97  ? 26.788  -37.809 -21.989 1.00 94.20  ? 96  TRP B CE2    1 
ATOM   7079  C  CE3    . TRP B  1 97  ? 25.833  -35.900 -23.124 1.00 91.04  ? 96  TRP B CE3    1 
ATOM   7080  C  CZ2    . TRP B  1 97  ? 27.927  -37.775 -22.789 1.00 88.62  ? 96  TRP B CZ2    1 
ATOM   7081  C  CZ3    . TRP B  1 97  ? 26.964  -35.868 -23.918 1.00 85.23  ? 96  TRP B CZ3    1 
ATOM   7082  C  CH2    . TRP B  1 97  ? 27.996  -36.800 -23.746 1.00 95.74  ? 96  TRP B CH2    1 
ATOM   7083  H  H      . TRP B  1 97  ? 22.044  -38.259 -19.787 1.00 95.70  ? 96  TRP B H      1 
ATOM   7084  H  HA     . TRP B  1 97  ? 23.752  -36.354 -18.907 1.00 88.30  ? 96  TRP B HA     1 
ATOM   7085  H  HB2    . TRP B  1 97  ? 22.773  -36.943 -21.487 1.00 88.67  ? 96  TRP B HB2    1 
ATOM   7086  H  HB3    . TRP B  1 97  ? 23.556  -35.591 -21.204 1.00 88.67  ? 96  TRP B HB3    1 
ATOM   7087  H  HD1    . TRP B  1 97  ? 24.779  -38.721 -19.778 1.00 108.05 ? 96  TRP B HD1    1 
ATOM   7088  H  HE1    . TRP B  1 97  ? 26.930  -39.311 -20.682 1.00 117.60 ? 96  TRP B HE1    1 
ATOM   7089  H  HE3    . TRP B  1 97  ? 25.152  -35.279 -23.244 1.00 109.25 ? 96  TRP B HE3    1 
ATOM   7090  H  HZ2    . TRP B  1 97  ? 28.614  -38.392 -22.678 1.00 106.35 ? 96  TRP B HZ2    1 
ATOM   7091  H  HZ3    . TRP B  1 97  ? 27.041  -35.217 -24.578 1.00 102.27 ? 96  TRP B HZ3    1 
ATOM   7092  H  HH2    . TRP B  1 97  ? 28.745  -36.754 -24.295 1.00 114.89 ? 96  TRP B HH2    1 
ATOM   7093  N  N      . ILE B  1 98  ? 22.208  -34.572 -18.307 1.00 68.32  ? 97  ILE B N      1 
ATOM   7094  C  CA     . ILE B  1 98  ? 21.295  -33.480 -17.998 1.00 61.56  ? 97  ILE B CA     1 
ATOM   7095  C  C      . ILE B  1 98  ? 21.856  -32.174 -18.543 1.00 73.78  ? 97  ILE B C      1 
ATOM   7096  O  O      . ILE B  1 98  ? 22.904  -31.709 -18.097 1.00 77.34  ? 97  ILE B O      1 
ATOM   7097  C  CB     . ILE B  1 98  ? 21.088  -33.337 -16.484 1.00 66.93  ? 97  ILE B CB     1 
ATOM   7098  C  CG1    . ILE B  1 98  ? 20.788  -34.700 -15.859 1.00 77.21  ? 97  ILE B CG1    1 
ATOM   7099  C  CG2    . ILE B  1 98  ? 19.961  -32.356 -16.195 1.00 70.94  ? 97  ILE B CG2    1 
ATOM   7100  C  CD1    . ILE B  1 98  ? 20.741  -34.677 -14.346 1.00 92.75  ? 97  ILE B CD1    1 
ATOM   7101  H  H      . ILE B  1 98  ? 22.920  -34.580 -17.824 1.00 81.98  ? 97  ILE B H      1 
ATOM   7102  H  HA     . ILE B  1 98  ? 20.427  -33.648 -18.419 1.00 73.87  ? 97  ILE B HA     1 
ATOM   7103  H  HB     . ILE B  1 98  ? 21.906  -32.992 -16.093 1.00 80.32  ? 97  ILE B HB     1 
ATOM   7104  H  HG12   . ILE B  1 98  ? 19.925  -35.007 -16.178 1.00 92.66  ? 97  ILE B HG12   1 
ATOM   7105  H  HG13   . ILE B  1 98  ? 21.480  -35.326 -16.125 1.00 92.66  ? 97  ILE B HG13   1 
ATOM   7106  H  HG21   . ILE B  1 98  ? 19.849  -32.282 -15.245 1.00 85.12  ? 97  ILE B HG21   1 
ATOM   7107  H  HG22   . ILE B  1 98  ? 20.189  -31.501 -16.567 1.00 85.12  ? 97  ILE B HG22   1 
ATOM   7108  H  HG23   . ILE B  1 98  ? 19.153  -32.683 -16.597 1.00 85.12  ? 97  ILE B HG23   1 
ATOM   7109  H  HD11   . ILE B  1 98  ? 20.548  -35.561 -14.027 1.00 111.31 ? 97  ILE B HD11   1 
ATOM   7110  H  HD12   . ILE B  1 98  ? 21.592  -34.385 -14.012 1.00 111.31 ? 97  ILE B HD12   1 
ATOM   7111  H  HD13   . ILE B  1 98  ? 20.052  -34.070 -14.065 1.00 111.31 ? 97  ILE B HD13   1 
ATOM   7112  N  N      . VAL B  1 99  ? 21.156  -31.587 -19.509 1.00 63.85  ? 98  VAL B N      1 
ATOM   7113  C  CA     . VAL B  1 99  ? 21.603  -30.346 -20.129 1.00 67.45  ? 98  VAL B CA     1 
ATOM   7114  C  C      . VAL B  1 99  ? 20.929  -29.150 -19.460 1.00 73.95  ? 98  VAL B C      1 
ATOM   7115  O  O      . VAL B  1 99  ? 19.708  -29.003 -19.521 1.00 81.95  ? 98  VAL B O      1 
ATOM   7116  C  CB     . VAL B  1 99  ? 21.289  -30.325 -21.637 1.00 78.01  ? 98  VAL B CB     1 
ATOM   7117  C  CG1    . VAL B  1 99  ? 22.040  -29.195 -22.314 1.00 88.63  ? 98  VAL B CG1    1 
ATOM   7118  C  CG2    . VAL B  1 99  ? 21.651  -31.656 -22.278 1.00 64.98  ? 98  VAL B CG2    1 
ATOM   7119  H  H      . VAL B  1 99  ? 20.415  -31.889 -19.824 1.00 76.62  ? 98  VAL B H      1 
ATOM   7120  H  HA     . VAL B  1 99  ? 22.573  -30.257 -20.015 1.00 80.94  ? 98  VAL B HA     1 
ATOM   7121  H  HB     . VAL B  1 99  ? 20.329  -30.175 -21.764 1.00 93.61  ? 98  VAL B HB     1 
ATOM   7122  H  HG11   . VAL B  1 99  ? 21.831  -29.199 -23.251 1.00 106.36 ? 98  VAL B HG11   1 
ATOM   7123  H  HG12   . VAL B  1 99  ? 21.770  -28.361 -21.922 1.00 106.36 ? 98  VAL B HG12   1 
ATOM   7124  H  HG13   . VAL B  1 99  ? 22.982  -29.326 -22.188 1.00 106.36 ? 98  VAL B HG13   1 
ATOM   7125  H  HG21   . VAL B  1 99  ? 21.446  -31.617 -23.215 1.00 77.98  ? 98  VAL B HG21   1 
ATOM   7126  H  HG22   . VAL B  1 99  ? 22.590  -31.817 -22.154 1.00 77.98  ? 98  VAL B HG22   1 
ATOM   7127  H  HG23   . VAL B  1 99  ? 21.141  -32.353 -21.859 1.00 77.98  ? 98  VAL B HG23   1 
ATOM   7128  N  N      . MET B  1 100 ? 21.732  -28.299 -18.827 1.00 77.66  ? 99  MET B N      1 
ATOM   7129  C  CA     . MET B  1 100 ? 21.219  -27.164 -18.068 1.00 76.50  ? 99  MET B CA     1 
ATOM   7130  C  C      . MET B  1 100 ? 21.672  -25.847 -18.672 1.00 81.65  ? 99  MET B C      1 
ATOM   7131  O  O      . MET B  1 100 ? 22.467  -25.820 -19.613 1.00 85.30  ? 99  MET B O      1 
ATOM   7132  C  CB     . MET B  1 100 ? 21.727  -27.220 -16.630 1.00 73.20  ? 99  MET B CB     1 
ATOM   7133  C  CG     . MET B  1 100 ? 21.387  -28.491 -15.891 1.00 82.25  ? 99  MET B CG     1 
ATOM   7134  S  SD     . MET B  1 100 ? 22.235  -28.580 -14.305 1.00 146.75 ? 99  MET B SD     1 
ATOM   7135  C  CE     . MET B  1 100 ? 23.937  -28.775 -14.836 1.00 49.70  ? 99  MET B CE     1 
ATOM   7136  H  H      . MET B  1 100 ? 22.590  -28.359 -18.822 1.00 93.20  ? 99  MET B H      1 
ATOM   7137  H  HA     . MET B  1 100 ? 20.239  -27.197 -18.053 1.00 91.81  ? 99  MET B HA     1 
ATOM   7138  H  HB2    . MET B  1 100 ? 22.693  -27.135 -16.639 1.00 87.84  ? 99  MET B HB2    1 
ATOM   7139  H  HB3    . MET B  1 100 ? 21.340  -26.481 -16.135 1.00 87.84  ? 99  MET B HB3    1 
ATOM   7140  H  HG2    . MET B  1 100 ? 20.431  -28.520 -15.727 1.00 98.70  ? 99  MET B HG2    1 
ATOM   7141  H  HG3    . MET B  1 100 ? 21.660  -29.254 -16.425 1.00 98.70  ? 99  MET B HG3    1 
ATOM   7142  H  HE1    . MET B  1 100 ? 24.501  -28.836 -14.062 1.00 59.65  ? 99  MET B HE1    1 
ATOM   7143  H  HE2    . MET B  1 100 ? 24.011  -29.577 -15.359 1.00 59.65  ? 99  MET B HE2    1 
ATOM   7144  H  HE3    . MET B  1 100 ? 24.188  -28.015 -15.366 1.00 59.65  ? 99  MET B HE3    1 
ATOM   7145  N  N      . GLU B  1 101 ? 21.168  -24.752 -18.110 1.00 62.80  ? 100 GLU B N      1 
ATOM   7146  C  CA     . GLU B  1 101 ? 21.623  -23.423 -18.486 1.00 54.81  ? 100 GLU B CA     1 
ATOM   7147  C  C      . GLU B  1 101 ? 23.034  -23.213 -17.952 1.00 69.03  ? 100 GLU B C      1 
ATOM   7148  O  O      . GLU B  1 101 ? 23.331  -23.564 -16.809 1.00 85.01  ? 100 GLU B O      1 
ATOM   7149  C  CB     . GLU B  1 101 ? 20.674  -22.353 -17.937 1.00 52.23  ? 100 GLU B CB     1 
ATOM   7150  C  CG     . GLU B  1 101 ? 21.223  -20.932 -18.017 1.00 63.38  ? 100 GLU B CG     1 
ATOM   7151  C  CD     . GLU B  1 101 ? 20.270  -19.895 -17.444 1.00 88.12  ? 100 GLU B CD     1 
ATOM   7152  O  OE1    . GLU B  1 101 ? 19.338  -20.278 -16.703 1.00 78.06  ? 100 GLU B OE1    1 
ATOM   7153  O  OE2    . GLU B  1 101 ? 20.455  -18.693 -17.736 1.00 92.16  ? 100 GLU B OE2    1 
ATOM   7154  H  H      . GLU B  1 101 ? 20.558  -24.755 -17.504 1.00 75.36  ? 100 GLU B H      1 
ATOM   7155  H  HA     . GLU B  1 101 ? 21.645  -23.348 -19.463 1.00 65.77  ? 100 GLU B HA     1 
ATOM   7156  H  HB2    . GLU B  1 101 ? 19.848  -22.379 -18.445 1.00 62.67  ? 100 GLU B HB2    1 
ATOM   7157  H  HB3    . GLU B  1 101 ? 20.492  -22.547 -17.005 1.00 62.67  ? 100 GLU B HB3    1 
ATOM   7158  H  HG2    . GLU B  1 101 ? 22.052  -20.886 -17.516 1.00 76.05  ? 100 GLU B HG2    1 
ATOM   7159  H  HG3    . GLU B  1 101 ? 21.385  -20.709 -18.947 1.00 76.05  ? 100 GLU B HG3    1 
ATOM   7160  N  N      . TYR B  1 102 ? 23.904  -22.652 -18.784 1.00 73.14  ? 101 TYR B N      1 
ATOM   7161  C  CA     . TYR B  1 102 ? 25.289  -22.419 -18.394 1.00 64.82  ? 101 TYR B CA     1 
ATOM   7162  C  C      . TYR B  1 102 ? 25.449  -21.107 -17.639 1.00 77.33  ? 101 TYR B C      1 
ATOM   7163  O  O      . TYR B  1 102 ? 25.391  -20.025 -18.223 1.00 78.88  ? 101 TYR B O      1 
ATOM   7164  C  CB     . TYR B  1 102 ? 26.196  -22.421 -19.623 1.00 70.19  ? 101 TYR B CB     1 
ATOM   7165  C  CG     . TYR B  1 102 ? 27.651  -22.142 -19.323 1.00 64.91  ? 101 TYR B CG     1 
ATOM   7166  C  CD1    . TYR B  1 102 ? 28.462  -23.118 -18.760 1.00 73.45  ? 101 TYR B CD1    1 
ATOM   7167  C  CD2    . TYR B  1 102 ? 28.220  -20.912 -19.623 1.00 54.86  ? 101 TYR B CD2    1 
ATOM   7168  C  CE1    . TYR B  1 102 ? 29.797  -22.872 -18.494 1.00 77.82  ? 101 TYR B CE1    1 
ATOM   7169  C  CE2    . TYR B  1 102 ? 29.554  -20.657 -19.360 1.00 48.41  ? 101 TYR B CE2    1 
ATOM   7170  C  CZ     . TYR B  1 102 ? 30.338  -21.643 -18.799 1.00 73.44  ? 101 TYR B CZ     1 
ATOM   7171  O  OH     . TYR B  1 102 ? 31.666  -21.401 -18.533 1.00 90.60  ? 101 TYR B OH     1 
ATOM   7172  H  H      . TYR B  1 102 ? 23.716  -22.396 -19.584 1.00 87.77  ? 101 TYR B H      1 
ATOM   7173  H  HA     . TYR B  1 102 ? 25.580  -23.145 -17.803 1.00 77.78  ? 101 TYR B HA     1 
ATOM   7174  H  HB2    . TYR B  1 102 ? 26.143  -23.292 -20.046 1.00 84.23  ? 101 TYR B HB2    1 
ATOM   7175  H  HB3    . TYR B  1 102 ? 25.886  -21.738 -20.238 1.00 84.23  ? 101 TYR B HB3    1 
ATOM   7176  H  HD1    . TYR B  1 102 ? 28.101  -23.950 -18.556 1.00 88.14  ? 101 TYR B HD1    1 
ATOM   7177  H  HD2    . TYR B  1 102 ? 27.694  -20.246 -20.004 1.00 65.83  ? 101 TYR B HD2    1 
ATOM   7178  H  HE1    . TYR B  1 102 ? 30.327  -23.535 -18.115 1.00 93.38  ? 101 TYR B HE1    1 
ATOM   7179  H  HE2    . TYR B  1 102 ? 29.921  -19.827 -19.564 1.00 58.10  ? 101 TYR B HE2    1 
ATOM   7180  H  HH     . TYR B  1 102 ? 31.737  -20.772 -18.011 1.00 108.72 ? 101 TYR B HH     1 
ATOM   7181  N  N      . CYS B  1 103 ? 25.642  -21.212 -16.331 1.00 94.83  ? 102 CYS B N      1 
ATOM   7182  C  CA     . CYS B  1 103 ? 25.996  -20.060 -15.521 1.00 83.90  ? 102 CYS B CA     1 
ATOM   7183  C  C      . CYS B  1 103 ? 27.507  -20.083 -15.340 1.00 85.02  ? 102 CYS B C      1 
ATOM   7184  O  O      . CYS B  1 103 ? 28.033  -20.779 -14.474 1.00 74.45  ? 102 CYS B O      1 
ATOM   7185  C  CB     . CYS B  1 103 ? 25.259  -20.110 -14.187 1.00 43.90  ? 102 CYS B CB     1 
ATOM   7186  S  SG     . CYS B  1 103 ? 23.464  -20.257 -14.392 1.00 99.34  ? 102 CYS B SG     1 
ATOM   7187  H  H      . CYS B  1 103 ? 25.572  -21.945 -15.888 1.00 113.80 ? 102 CYS B H      1 
ATOM   7188  H  HA     . CYS B  1 103 ? 25.746  -19.236 -15.988 1.00 100.68 ? 102 CYS B HA     1 
ATOM   7189  H  HB2    . CYS B  1 103 ? 25.568  -20.879 -13.683 1.00 52.69  ? 102 CYS B HB2    1 
ATOM   7190  H  HB3    . CYS B  1 103 ? 25.440  -19.295 -13.694 1.00 52.69  ? 102 CYS B HB3    1 
ATOM   7191  H  HG     . CYS B  1 103 ? 22.948  -20.291 -13.309 1.00 119.21 ? 102 CYS B HG     1 
ATOM   7192  N  N      . GLY B  1 104 ? 28.194  -19.320 -16.184 1.00 98.54  ? 103 GLY B N      1 
ATOM   7193  C  CA     . GLY B  1 104 ? 29.633  -19.426 -16.338 1.00 89.81  ? 103 GLY B CA     1 
ATOM   7194  C  C      . GLY B  1 104 ? 30.470  -19.084 -15.121 1.00 73.67  ? 103 GLY B C      1 
ATOM   7195  O  O      . GLY B  1 104 ? 31.562  -19.624 -14.951 1.00 81.89  ? 103 GLY B O      1 
ATOM   7196  H  H      . GLY B  1 104 ? 27.837  -18.722 -16.689 1.00 118.25 ? 103 GLY B H      1 
ATOM   7197  H  HA2    . GLY B  1 104 ? 29.851  -20.335 -16.597 1.00 107.77 ? 103 GLY B HA2    1 
ATOM   7198  H  HA3    . GLY B  1 104 ? 29.911  -18.839 -17.059 1.00 107.77 ? 103 GLY B HA3    1 
ATOM   7199  N  N      . ALA B  1 105 ? 29.975  -18.187 -14.277 1.00 73.73  ? 104 ALA B N      1 
ATOM   7200  C  CA     . ALA B  1 105 ? 30.745  -17.740 -13.122 1.00 79.77  ? 104 ALA B CA     1 
ATOM   7201  C  C      . ALA B  1 105 ? 30.728  -18.761 -11.983 1.00 84.49  ? 104 ALA B C      1 
ATOM   7202  O  O      . ALA B  1 105 ? 31.445  -18.604 -10.995 1.00 100.27 ? 104 ALA B O      1 
ATOM   7203  C  CB     . ALA B  1 105 ? 30.231  -16.389 -12.638 1.00 70.05  ? 104 ALA B CB     1 
ATOM   7204  H  H      . ALA B  1 105 ? 29.199  -17.823 -14.349 1.00 88.47  ? 104 ALA B H      1 
ATOM   7205  H  HA     . ALA B  1 105 ? 31.678  -17.620 -13.398 1.00 95.72  ? 104 ALA B HA     1 
ATOM   7206  H  HB1    . ALA B  1 105 ? 30.749  -16.112 -11.879 1.00 84.06  ? 104 ALA B HB1    1 
ATOM   7207  H  HB2    . ALA B  1 105 ? 30.320  -15.748 -13.347 1.00 84.06  ? 104 ALA B HB2    1 
ATOM   7208  H  HB3    . ALA B  1 105 ? 29.308  -16.477 -12.390 1.00 84.06  ? 104 ALA B HB3    1 
ATOM   7209  N  N      . GLY B  1 106 ? 29.919  -19.808 -12.123 1.00 75.26  ? 105 GLY B N      1 
ATOM   7210  C  CA     . GLY B  1 106 ? 29.788  -20.809 -11.079 1.00 85.30  ? 105 GLY B CA     1 
ATOM   7211  C  C      . GLY B  1 106 ? 28.867  -20.336 -9.970  1.00 87.99  ? 105 GLY B C      1 
ATOM   7212  O  O      . GLY B  1 106 ? 28.017  -19.470 -10.188 1.00 64.65  ? 105 GLY B O      1 
ATOM   7213  H  H      . GLY B  1 106 ? 29.435  -19.959 -12.818 1.00 90.31  ? 105 GLY B H      1 
ATOM   7214  H  HA2    . GLY B  1 106 ? 29.426  -21.627 -11.455 1.00 102.36 ? 105 GLY B HA2    1 
ATOM   7215  H  HA3    . GLY B  1 106 ? 30.659  -21.001 -10.699 1.00 102.36 ? 105 GLY B HA3    1 
ATOM   7216  N  N      . SER B  1 107 ? 29.033  -20.900 -8.777  1.00 94.33  ? 106 SER B N      1 
ATOM   7217  C  CA     . SER B  1 107 ? 28.216  -20.516 -7.631  1.00 80.13  ? 106 SER B CA     1 
ATOM   7218  C  C      . SER B  1 107 ? 28.906  -19.433 -6.809  1.00 73.23  ? 106 SER B C      1 
ATOM   7219  O  O      . SER B  1 107 ? 30.126  -19.283 -6.864  1.00 73.60  ? 106 SER B O      1 
ATOM   7220  C  CB     . SER B  1 107 ? 27.939  -21.726 -6.741  1.00 74.61  ? 106 SER B CB     1 
ATOM   7221  O  OG     . SER B  1 107 ? 29.091  -22.076 -5.993  1.00 84.36  ? 106 SER B OG     1 
ATOM   7222  H  H      . SER B  1 107 ? 29.615  -21.510 -8.606  1.00 113.20 ? 106 SER B H      1 
ATOM   7223  H  HA     . SER B  1 107 ? 27.358  -20.163 -7.947  1.00 96.16  ? 106 SER B HA     1 
ATOM   7224  H  HB2    . SER B  1 107 ? 27.218  -21.509 -6.129  1.00 89.53  ? 106 SER B HB2    1 
ATOM   7225  H  HB3    . SER B  1 107 ? 27.684  -22.477 -7.300  1.00 89.53  ? 106 SER B HB3    1 
ATOM   7226  H  HG     . SER B  1 107 ? 28.931  -22.726 -5.520  1.00 101.23 ? 106 SER B HG     1 
ATOM   7227  N  N      . VAL B  1 108 ? 28.120  -18.683 -6.044  1.00 59.35  ? 107 VAL B N      1 
ATOM   7228  C  CA     . VAL B  1 108 ? 28.665  -17.630 -5.196  1.00 62.56  ? 107 VAL B CA     1 
ATOM   7229  C  C      . VAL B  1 108 ? 29.729  -18.215 -4.270  1.00 72.77  ? 107 VAL B C      1 
ATOM   7230  O  O      . VAL B  1 108 ? 30.740  -17.576 -3.975  1.00 56.25  ? 107 VAL B O      1 
ATOM   7231  C  CB     . VAL B  1 108 ? 27.571  -16.966 -4.348  1.00 60.55  ? 107 VAL B CB     1 
ATOM   7232  C  CG1    . VAL B  1 108 ? 28.180  -15.922 -3.431  1.00 74.91  ? 107 VAL B CG1    1 
ATOM   7233  C  CG2    . VAL B  1 108 ? 26.514  -16.338 -5.240  1.00 52.77  ? 107 VAL B CG2    1 
ATOM   7234  H  H      . VAL B  1 108 ? 27.265  -18.764 -5.997  1.00 71.21  ? 107 VAL B H      1 
ATOM   7235  H  HA     . VAL B  1 108 ? 29.084  -16.944 -5.756  1.00 75.07  ? 107 VAL B HA     1 
ATOM   7236  H  HB     . VAL B  1 108 ? 27.137  -17.646 -3.791  1.00 72.66  ? 107 VAL B HB     1 
ATOM   7237  H  HG11   . VAL B  1 108 ? 27.482  -15.519 -2.910  1.00 89.89  ? 107 VAL B HG11   1 
ATOM   7238  H  HG12   . VAL B  1 108 ? 28.816  -16.349 -2.852  1.00 89.89  ? 107 VAL B HG12   1 
ATOM   7239  H  HG13   . VAL B  1 108 ? 28.617  -15.255 -3.965  1.00 89.89  ? 107 VAL B HG13   1 
ATOM   7240  H  HG21   . VAL B  1 108 ? 25.842  -15.930 -4.689  1.00 63.32  ? 107 VAL B HG21   1 
ATOM   7241  H  HG22   . VAL B  1 108 ? 26.929  -15.674 -5.796  1.00 63.32  ? 107 VAL B HG22   1 
ATOM   7242  H  HG23   . VAL B  1 108 ? 26.119  -17.022 -5.786  1.00 63.32  ? 107 VAL B HG23   1 
ATOM   7243  N  N      . SER B  1 109 ? 29.491  -19.436 -3.808  1.00 77.44  ? 108 SER B N      1 
ATOM   7244  C  CA     . SER B  1 109 ? 30.479  -20.146 -3.014  1.00 73.36  ? 108 SER B CA     1 
ATOM   7245  C  C      . SER B  1 109 ? 31.786  -20.272 -3.799  1.00 75.91  ? 108 SER B C      1 
ATOM   7246  O  O      . SER B  1 109 ? 32.847  -19.863 -3.325  1.00 67.36  ? 108 SER B O      1 
ATOM   7247  C  CB     . SER B  1 109 ? 29.953  -21.530 -2.635  1.00 71.40  ? 108 SER B CB     1 
ATOM   7248  O  OG     . SER B  1 109 ? 30.875  -22.211 -1.802  1.00 92.88  ? 108 SER B OG     1 
ATOM   7249  H  H      . SER B  1 109 ? 28.763  -19.874 -3.942  1.00 92.93  ? 108 SER B H      1 
ATOM   7250  H  HA     . SER B  1 109 ? 30.658  -19.646 -2.191  1.00 88.03  ? 108 SER B HA     1 
ATOM   7251  H  HB2    . SER B  1 109 ? 29.114  -21.430 -2.159  1.00 85.68  ? 108 SER B HB2    1 
ATOM   7252  H  HB3    . SER B  1 109 ? 29.816  -22.048 -3.443  1.00 85.68  ? 108 SER B HB3    1 
ATOM   7253  H  HG     . SER B  1 109 ? 30.582  -22.952 -1.606  1.00 111.46 ? 108 SER B HG     1 
ATOM   7254  N  N      . ASP B  1 110 ? 31.698  -20.826 -5.007  1.00 67.91  ? 109 ASP B N      1 
ATOM   7255  C  CA     . ASP B  1 110 ? 32.873  -21.040 -5.851  1.00 84.13  ? 109 ASP B CA     1 
ATOM   7256  C  C      . ASP B  1 110 ? 33.662  -19.752 -6.080  1.00 84.31  ? 109 ASP B C      1 
ATOM   7257  O  O      . ASP B  1 110 ? 34.889  -19.747 -5.986  1.00 75.09  ? 109 ASP B O      1 
ATOM   7258  C  CB     . ASP B  1 110 ? 32.465  -21.632 -7.204  1.00 111.60 ? 109 ASP B CB     1 
ATOM   7259  C  CG     . ASP B  1 110 ? 31.903  -23.036 -7.086  1.00 139.46 ? 109 ASP B CG     1 
ATOM   7260  O  OD1    . ASP B  1 110 ? 31.016  -23.385 -7.894  1.00 155.32 ? 109 ASP B OD1    1 
ATOM   7261  O  OD2    . ASP B  1 110 ? 32.347  -23.791 -6.194  1.00 137.99 ? 109 ASP B OD2    1 
ATOM   7262  H  H      . ASP B  1 110 ? 30.962  -21.090 -5.364  1.00 81.49  ? 109 ASP B H      1 
ATOM   7263  H  HA     . ASP B  1 110 ? 33.468  -21.682 -5.409  1.00 100.96 ? 109 ASP B HA     1 
ATOM   7264  H  HB2    . ASP B  1 110 ? 31.783  -21.068 -7.602  1.00 133.92 ? 109 ASP B HB2    1 
ATOM   7265  H  HB3    . ASP B  1 110 ? 33.243  -21.668 -7.781  1.00 133.92 ? 109 ASP B HB3    1 
ATOM   7266  N  N      . ILE B  1 111 ? 32.957  -18.668 -6.393  1.00 75.72  ? 110 ILE B N      1 
ATOM   7267  C  CA     . ILE B  1 111 ? 33.603  -17.379 -6.624  1.00 64.87  ? 110 ILE B CA     1 
ATOM   7268  C  C      . ILE B  1 111 ? 34.402  -16.947 -5.400  1.00 82.20  ? 110 ILE B C      1 
ATOM   7269  O  O      . ILE B  1 111 ? 35.581  -16.606 -5.503  1.00 85.92  ? 110 ILE B O      1 
ATOM   7270  C  CB     . ILE B  1 111 ? 32.580  -16.277 -6.942  1.00 62.96  ? 110 ILE B CB     1 
ATOM   7271  C  CG1    . ILE B  1 111 ? 31.927  -16.525 -8.302  1.00 63.88  ? 110 ILE B CG1    1 
ATOM   7272  C  CG2    . ILE B  1 111 ? 33.254  -14.915 -6.936  1.00 72.49  ? 110 ILE B CG2    1 
ATOM   7273  C  CD1    . ILE B  1 111 ? 30.851  -15.512 -8.652  1.00 56.35  ? 110 ILE B CD1    1 
ATOM   7274  H  H      . ILE B  1 111 ? 32.102  -18.652 -6.479  1.00 90.87  ? 110 ILE B H      1 
ATOM   7275  H  HA     . ILE B  1 111 ? 34.219  -17.456 -7.383  1.00 77.84  ? 110 ILE B HA     1 
ATOM   7276  H  HB     . ILE B  1 111 ? 31.890  -16.287 -6.260  1.00 75.56  ? 110 ILE B HB     1 
ATOM   7277  H  HG12   . ILE B  1 111 ? 32.610  -16.483 -8.990  1.00 76.65  ? 110 ILE B HG12   1 
ATOM   7278  H  HG13   . ILE B  1 111 ? 31.517  -17.404 -8.297  1.00 76.65  ? 110 ILE B HG13   1 
ATOM   7279  H  HG21   . ILE B  1 111 ? 32.599  -14.242 -7.136  1.00 86.99  ? 110 ILE B HG21   1 
ATOM   7280  H  HG22   . ILE B  1 111 ? 33.631  -14.757 -6.067  1.00 86.99  ? 110 ILE B HG22   1 
ATOM   7281  H  HG23   . ILE B  1 111 ? 33.947  -14.907 -7.601  1.00 86.99  ? 110 ILE B HG23   1 
ATOM   7282  H  HD11   . ILE B  1 111 ? 30.487  -15.728 -9.514  1.00 67.62  ? 110 ILE B HD11   1 
ATOM   7283  H  HD12   . ILE B  1 111 ? 30.160  -15.548 -7.986  1.00 67.62  ? 110 ILE B HD12   1 
ATOM   7284  H  HD13   . ILE B  1 111 ? 31.242  -14.636 -8.672  1.00 67.62  ? 110 ILE B HD13   1 
ATOM   7285  N  N      . ILE B  1 112 ? 33.749  -16.956 -4.242  1.00 79.41  ? 111 ILE B N      1 
ATOM   7286  C  CA     . ILE B  1 112 ? 34.395  -16.555 -2.998  1.00 72.68  ? 111 ILE B CA     1 
ATOM   7287  C  C      . ILE B  1 112 ? 35.599  -17.444 -2.718  1.00 66.51  ? 111 ILE B C      1 
ATOM   7288  O  O      . ILE B  1 112 ? 36.615  -16.984 -2.200  1.00 66.52  ? 111 ILE B O      1 
ATOM   7289  C  CB     . ILE B  1 112 ? 33.423  -16.613 -1.806  1.00 60.26  ? 111 ILE B CB     1 
ATOM   7290  C  CG1    . ILE B  1 112 ? 32.341  -15.541 -1.960  1.00 70.29  ? 111 ILE B CG1    1 
ATOM   7291  C  CG2    . ILE B  1 112 ? 34.172  -16.398 -0.501  1.00 45.49  ? 111 ILE B CG2    1 
ATOM   7292  C  CD1    . ILE B  1 112 ? 31.203  -15.666 -0.977  1.00 57.17  ? 111 ILE B CD1    1 
ATOM   7293  H  H      . ILE B  1 112 ? 32.927  -17.192 -4.149  1.00 95.29  ? 111 ILE B H      1 
ATOM   7294  H  HA     . ILE B  1 112 ? 34.713  -15.632 -3.087  1.00 87.21  ? 111 ILE B HA     1 
ATOM   7295  H  HB     . ILE B  1 112 ? 33.001  -17.486 -1.787  1.00 72.32  ? 111 ILE B HB     1 
ATOM   7296  H  HG12   . ILE B  1 112 ? 32.747  -14.669 -1.833  1.00 84.35  ? 111 ILE B HG12   1 
ATOM   7297  H  HG13   . ILE B  1 112 ? 31.968  -15.602 -2.853  1.00 84.35  ? 111 ILE B HG13   1 
ATOM   7298  H  HG21   . ILE B  1 112 ? 33.548  -16.437 0.227   1.00 54.58  ? 111 ILE B HG21   1 
ATOM   7299  H  HG22   . ILE B  1 112 ? 34.834  -17.086 -0.404  1.00 54.58  ? 111 ILE B HG22   1 
ATOM   7300  H  HG23   . ILE B  1 112 ? 34.596  -15.537 -0.523  1.00 54.58  ? 111 ILE B HG23   1 
ATOM   7301  H  HD11   . ILE B  1 112 ? 30.572  -14.961 -1.140  1.00 68.61  ? 111 ILE B HD11   1 
ATOM   7302  H  HD12   . ILE B  1 112 ? 30.780  -16.519 -1.096  1.00 68.61  ? 111 ILE B HD12   1 
ATOM   7303  H  HD13   . ILE B  1 112 ? 31.552  -15.595 -0.086  1.00 68.61  ? 111 ILE B HD13   1 
ATOM   7304  N  N      . ARG B  1 113 ? 35.479  -18.720 -3.067  1.00 76.07  ? 112 ARG B N      1 
ATOM   7305  C  CA     . ARG B  1 113 ? 36.578  -19.658 -2.906  1.00 86.87  ? 112 ARG B CA     1 
ATOM   7306  C  C      . ARG B  1 113 ? 37.702  -19.301 -3.876  1.00 91.56  ? 112 ARG B C      1 
ATOM   7307  O  O      . ARG B  1 113 ? 38.867  -19.204 -3.491  1.00 90.43  ? 112 ARG B O      1 
ATOM   7308  C  CB     . ARG B  1 113 ? 36.095  -21.085 -3.169  1.00 106.34 ? 112 ARG B CB     1 
ATOM   7309  C  CG     . ARG B  1 113 ? 36.833  -22.150 -2.374  1.00 124.87 ? 112 ARG B CG     1 
ATOM   7310  C  CD     . ARG B  1 113 ? 36.641  -23.539 -2.969  1.00 133.93 ? 112 ARG B CD     1 
ATOM   7311  N  NE     . ARG B  1 113 ? 37.323  -23.685 -4.256  1.00 136.30 ? 112 ARG B NE     1 
ATOM   7312  C  CZ     . ARG B  1 113 ? 36.723  -23.762 -5.444  1.00 134.40 ? 112 ARG B CZ     1 
ATOM   7313  N  NH1    . ARG B  1 113 ? 35.400  -23.723 -5.556  1.00 130.07 ? 112 ARG B NH1    1 
ATOM   7314  N  NH2    . ARG B  1 113 ? 37.458  -23.887 -6.539  1.00 132.45 ? 112 ARG B NH2    1 
ATOM   7315  H  H      . ARG B  1 113 ? 34.767  -19.067 -3.401  1.00 91.28  ? 112 ARG B H      1 
ATOM   7316  H  HA     . ARG B  1 113 ? 36.925  -19.607 -1.990  1.00 104.24 ? 112 ARG B HA     1 
ATOM   7317  H  HB2    . ARG B  1 113 ? 35.155  -21.143 -2.939  1.00 127.61 ? 112 ARG B HB2    1 
ATOM   7318  H  HB3    . ARG B  1 113 ? 36.214  -21.285 -4.111  1.00 127.61 ? 112 ARG B HB3    1 
ATOM   7319  H  HG2    . ARG B  1 113 ? 37.782  -21.948 -2.375  1.00 149.85 ? 112 ARG B HG2    1 
ATOM   7320  H  HG3    . ARG B  1 113 ? 36.495  -22.160 -1.465  1.00 149.85 ? 112 ARG B HG3    1 
ATOM   7321  H  HD2    . ARG B  1 113 ? 37.005  -24.200 -2.358  1.00 160.72 ? 112 ARG B HD2    1 
ATOM   7322  H  HD3    . ARG B  1 113 ? 35.695  -23.698 -3.108  1.00 160.72 ? 112 ARG B HD3    1 
ATOM   7323  H  HE     . ARG B  1 113 ? 38.182  -23.725 -4.245  1.00 163.56 ? 112 ARG B HE     1 
ATOM   7324  H  HH11   . ARG B  1 113 ? 34.911  -23.640 -4.853  1.00 156.09 ? 112 ARG B HH11   1 
ATOM   7325  H  HH12   . ARG B  1 113 ? 35.032  -23.776 -6.331  1.00 156.09 ? 112 ARG B HH12   1 
ATOM   7326  H  HH21   . ARG B  1 113 ? 38.315  -23.916 -6.480  1.00 158.94 ? 112 ARG B HH21   1 
ATOM   7327  H  HH22   . ARG B  1 113 ? 37.077  -23.941 -7.308  1.00 158.94 ? 112 ARG B HH22   1 
ATOM   7328  N  N      . LEU B  1 114 ? 37.331  -19.090 -5.136  1.00 92.38  ? 113 LEU B N      1 
ATOM   7329  C  CA     . LEU B  1 114 ? 38.293  -18.849 -6.208  1.00 98.77  ? 113 LEU B CA     1 
ATOM   7330  C  C      . LEU B  1 114 ? 39.165  -17.624 -5.961  1.00 100.08 ? 113 LEU B C      1 
ATOM   7331  O  O      . LEU B  1 114 ? 40.393  -17.716 -5.960  1.00 91.87  ? 113 LEU B O      1 
ATOM   7332  C  CB     . LEU B  1 114 ? 37.559  -18.688 -7.541  1.00 101.64 ? 113 LEU B CB     1 
ATOM   7333  C  CG     . LEU B  1 114 ? 37.083  -19.981 -8.205  1.00 105.61 ? 113 LEU B CG     1 
ATOM   7334  C  CD1    . LEU B  1 114 ? 36.131  -19.670 -9.349  1.00 110.70 ? 113 LEU B CD1    1 
ATOM   7335  C  CD2    . LEU B  1 114 ? 38.269  -20.797 -8.703  1.00 83.89  ? 113 LEU B CD2    1 
ATOM   7336  H  H      . LEU B  1 114 ? 36.513  -19.082 -5.400  1.00 110.85 ? 113 LEU B H      1 
ATOM   7337  H  HA     . LEU B  1 114 ? 38.883  -19.628 -6.283  1.00 118.53 ? 113 LEU B HA     1 
ATOM   7338  H  HB2    . LEU B  1 114 ? 36.777  -18.134 -7.394  1.00 121.97 ? 113 LEU B HB2    1 
ATOM   7339  H  HB3    . LEU B  1 114 ? 38.155  -18.245 -8.165  1.00 121.97 ? 113 LEU B HB3    1 
ATOM   7340  H  HG     . LEU B  1 114 ? 36.604  -20.515 -7.552  1.00 126.73 ? 113 LEU B HG     1 
ATOM   7341  H  HD11   . LEU B  1 114 ? 35.845  -20.494 -9.751  1.00 132.83 ? 113 LEU B HD11   1 
ATOM   7342  H  HD12   . LEU B  1 114 ? 35.372  -19.194 -9.003  1.00 132.83 ? 113 LEU B HD12   1 
ATOM   7343  H  HD13   . LEU B  1 114 ? 36.588  -19.130 -9.998  1.00 132.83 ? 113 LEU B HD13   1 
ATOM   7344  H  HD21   . LEU B  1 114 ? 37.943  -21.601 -9.114  1.00 100.67 ? 113 LEU B HD21   1 
ATOM   7345  H  HD22   . LEU B  1 114 ? 38.759  -20.277 -9.343  1.00 100.67 ? 113 LEU B HD22   1 
ATOM   7346  H  HD23   . LEU B  1 114 ? 38.832  -21.016 -7.957  1.00 100.67 ? 113 LEU B HD23   1 
ATOM   7347  N  N      . ARG B  1 115 ? 38.528  -16.476 -5.763  1.00 112.40 ? 114 ARG B N      1 
ATOM   7348  C  CA     . ARG B  1 115 ? 39.251  -15.225 -5.584  1.00 111.53 ? 114 ARG B CA     1 
ATOM   7349  C  C      . ARG B  1 115 ? 39.916  -15.148 -4.214  1.00 105.74 ? 114 ARG B C      1 
ATOM   7350  O  O      . ARG B  1 115 ? 40.758  -14.282 -3.976  1.00 99.57  ? 114 ARG B O      1 
ATOM   7351  C  CB     . ARG B  1 115 ? 38.304  -14.039 -5.742  1.00 116.38 ? 114 ARG B CB     1 
ATOM   7352  C  CG     . ARG B  1 115 ? 37.438  -14.079 -6.991  1.00 127.01 ? 114 ARG B CG     1 
ATOM   7353  C  CD     . ARG B  1 115 ? 36.836  -12.714 -7.264  1.00 134.93 ? 114 ARG B CD     1 
ATOM   7354  N  NE     . ARG B  1 115 ? 36.415  -12.051 -6.032  1.00 138.62 ? 114 ARG B NE     1 
ATOM   7355  C  CZ     . ARG B  1 115 ? 36.102  -10.763 -5.942  1.00 132.87 ? 114 ARG B CZ     1 
ATOM   7356  N  NH1    . ARG B  1 115 ? 36.163  -9.982  -7.011  1.00 112.96 ? 114 ARG B NH1    1 
ATOM   7357  N  NH2    . ARG B  1 115 ? 35.732  -10.253 -4.776  1.00 153.51 ? 114 ARG B NH2    1 
ATOM   7358  H  H      . ARG B  1 115 ? 37.672  -16.395 -5.727  1.00 134.87 ? 114 ARG B H      1 
ATOM   7359  H  HA     . ARG B  1 115 ? 39.949  -15.155 -6.269  1.00 133.84 ? 114 ARG B HA     1 
ATOM   7360  H  HB2    . ARG B  1 115 ? 37.712  -14.012 -4.975  1.00 139.65 ? 114 ARG B HB2    1 
ATOM   7361  H  HB3    . ARG B  1 115 ? 38.831  -13.225 -5.776  1.00 139.65 ? 114 ARG B HB3    1 
ATOM   7362  H  HG2    . ARG B  1 115 ? 37.982  -14.333 -7.753  1.00 152.42 ? 114 ARG B HG2    1 
ATOM   7363  H  HG3    . ARG B  1 115 ? 36.716  -14.714 -6.863  1.00 152.42 ? 114 ARG B HG3    1 
ATOM   7364  H  HD2    . ARG B  1 115 ? 37.498  -12.154 -7.698  1.00 161.91 ? 114 ARG B HD2    1 
ATOM   7365  H  HD3    . ARG B  1 115 ? 36.058  -12.817 -7.833  1.00 161.91 ? 114 ARG B HD3    1 
ATOM   7366  H  HE     . ARG B  1 115 ? 36.367  -12.527 -5.317  1.00 166.34 ? 114 ARG B HE     1 
ATOM   7367  H  HH11   . ARG B  1 115 ? 36.403  -10.309 -7.769  1.00 135.55 ? 114 ARG B HH11   1 
ATOM   7368  H  HH12   . ARG B  1 115 ? 35.960  -9.149  -6.947  1.00 135.55 ? 114 ARG B HH12   1 
ATOM   7369  H  HH21   . ARG B  1 115 ? 35.693  -10.757 -4.079  1.00 184.21 ? 114 ARG B HH21   1 
ATOM   7370  H  HH22   . ARG B  1 115 ? 35.530  -9.420  -4.715  1.00 184.21 ? 114 ARG B HH22   1 
ATOM   7371  N  N      . ASN B  1 116 ? 39.532  -16.049 -3.315  1.00 101.76 ? 115 ASN B N      1 
ATOM   7372  C  CA     . ASN B  1 116 ? 40.051  -16.036 -1.953  1.00 106.70 ? 115 ASN B CA     1 
ATOM   7373  C  C      . ASN B  1 116 ? 39.691  -14.725 -1.256  1.00 94.30  ? 115 ASN B C      1 
ATOM   7374  O  O      . ASN B  1 116 ? 40.476  -14.178 -0.481  1.00 87.10  ? 115 ASN B O      1 
ATOM   7375  C  CB     . ASN B  1 116 ? 41.568  -16.247 -1.960  1.00 103.17 ? 115 ASN B CB     1 
ATOM   7376  C  CG     . ASN B  1 116 ? 42.142  -16.405 -0.566  1.00 107.04 ? 115 ASN B CG     1 
ATOM   7377  O  OD1    . ASN B  1 116 ? 42.818  -15.511 -0.056  1.00 124.39 ? 115 ASN B OD1    1 
ATOM   7378  N  ND2    . ASN B  1 116 ? 41.874  -17.545 0.060   1.00 105.03 ? 115 ASN B ND2    1 
ATOM   7379  H  H      . ASN B  1 116 ? 38.969  -16.681 -3.470  1.00 122.11 ? 115 ASN B H      1 
ATOM   7380  H  HA     . ASN B  1 116 ? 39.644  -16.771 -1.448  1.00 128.04 ? 115 ASN B HA     1 
ATOM   7381  H  HB2    . ASN B  1 116 ? 41.773  -17.051 -2.462  1.00 123.81 ? 115 ASN B HB2    1 
ATOM   7382  H  HB3    . ASN B  1 116 ? 41.992  -15.479 -2.374  1.00 123.81 ? 115 ASN B HB3    1 
ATOM   7383  H  HD21   . ASN B  1 116 ? 41.397  -18.146 -0.327  1.00 126.03 ? 115 ASN B HD21   1 
ATOM   7384  H  HD22   . ASN B  1 116 ? 42.177  -17.682 0.853   1.00 126.03 ? 115 ASN B HD22   1 
ATOM   7385  N  N      . LYS B  1 117 ? 38.492  -14.229 -1.540  1.00 78.29  ? 116 LYS B N      1 
ATOM   7386  C  CA     . LYS B  1 117 ? 38.019  -12.975 -0.972  1.00 74.01  ? 116 LYS B CA     1 
ATOM   7387  C  C      . LYS B  1 117 ? 36.507  -13.030 -0.802  1.00 86.71  ? 116 LYS B C      1 
ATOM   7388  O  O      . LYS B  1 117 ? 35.804  -13.635 -1.612  1.00 89.78  ? 116 LYS B O      1 
ATOM   7389  C  CB     . LYS B  1 117 ? 38.402  -11.799 -1.877  1.00 67.45  ? 116 LYS B CB     1 
ATOM   7390  C  CG     . LYS B  1 117 ? 39.902  -11.545 -1.963  1.00 91.58  ? 116 LYS B CG     1 
ATOM   7391  C  CD     . LYS B  1 117 ? 40.253  -10.589 -3.095  1.00 114.19 ? 116 LYS B CD     1 
ATOM   7392  C  CE     . LYS B  1 117 ? 39.756  -9.180  -2.822  1.00 124.88 ? 116 LYS B CE     1 
ATOM   7393  N  NZ     . LYS B  1 117 ? 40.256  -8.218  -3.842  1.00 124.08 ? 116 LYS B NZ     1 
ATOM   7394  H  H      . LYS B  1 117 ? 37.926  -14.606 -2.067  1.00 93.94  ? 116 LYS B H      1 
ATOM   7395  H  HA     . LYS B  1 117 ? 38.428  -12.838 -0.092  1.00 88.81  ? 116 LYS B HA     1 
ATOM   7396  H  HB2    . LYS B  1 117 ? 38.080  -11.978 -2.774  1.00 80.94  ? 116 LYS B HB2    1 
ATOM   7397  H  HB3    . LYS B  1 117 ? 37.985  -10.993 -1.533  1.00 80.94  ? 116 LYS B HB3    1 
ATOM   7398  H  HG2    . LYS B  1 117 ? 40.208  -11.153 -1.130  1.00 109.89 ? 116 LYS B HG2    1 
ATOM   7399  H  HG3    . LYS B  1 117 ? 40.359  -12.386 -2.125  1.00 109.89 ? 116 LYS B HG3    1 
ATOM   7400  H  HD2    . LYS B  1 117 ? 41.217  -10.555 -3.196  1.00 137.03 ? 116 LYS B HD2    1 
ATOM   7401  H  HD3    . LYS B  1 117 ? 39.841  -10.901 -3.915  1.00 137.03 ? 116 LYS B HD3    1 
ATOM   7402  H  HE2    . LYS B  1 117 ? 38.786  -9.172  -2.846  1.00 149.85 ? 116 LYS B HE2    1 
ATOM   7403  H  HE3    . LYS B  1 117 ? 40.073  -8.892  -1.951  1.00 149.85 ? 116 LYS B HE3    1 
ATOM   7404  H  HZ1    . LYS B  1 117 ? 39.953  -7.400  -3.663  1.00 148.90 ? 116 LYS B HZ1    1 
ATOM   7405  H  HZ2    . LYS B  1 117 ? 41.146  -8.204  -3.837  1.00 148.90 ? 116 LYS B HZ2    1 
ATOM   7406  H  HZ3    . LYS B  1 117 ? 39.975  -8.459  -4.651  1.00 148.90 ? 116 LYS B HZ3    1 
ATOM   7407  N  N      . THR B  1 118 ? 36.010  -12.406 0.260   1.00 87.71  ? 117 THR B N      1 
ATOM   7408  C  CA     . THR B  1 118 ? 34.577  -12.349 0.500   1.00 83.00  ? 117 THR B CA     1 
ATOM   7409  C  C      . THR B  1 118 ? 33.972  -11.201 -0.298  1.00 89.37  ? 117 THR B C      1 
ATOM   7410  O  O      . THR B  1 118 ? 34.694  -10.347 -0.812  1.00 102.90 ? 117 THR B O      1 
ATOM   7411  C  CB     . THR B  1 118 ? 34.272  -12.156 1.989   1.00 85.54  ? 117 THR B CB     1 
ATOM   7412  O  OG1    . THR B  1 118 ? 34.934  -10.978 2.464   1.00 109.65 ? 117 THR B OG1    1 
ATOM   7413  C  CG2    . THR B  1 118 ? 34.750  -13.357 2.785   1.00 73.30  ? 117 THR B CG2    1 
ATOM   7414  H  H      . THR B  1 118 ? 36.483  -12.008 0.857   1.00 105.25 ? 117 THR B H      1 
ATOM   7415  H  HA     . THR B  1 118 ? 34.162  -13.187 0.204   1.00 99.60  ? 117 THR B HA     1 
ATOM   7416  H  HB     . THR B  1 118 ? 33.314  -12.063 2.115   1.00 102.65 ? 117 THR B HB     1 
ATOM   7417  H  HG1    . THR B  1 118 ? 34.774  -10.868 3.261   1.00 131.58 ? 117 THR B HG1    1 
ATOM   7418  H  HG21   . THR B  1 118 ? 34.557  -13.231 3.717   1.00 87.96  ? 117 THR B HG21   1 
ATOM   7419  H  HG22   . THR B  1 118 ? 34.306  -14.151 2.479   1.00 87.96  ? 117 THR B HG22   1 
ATOM   7420  H  HG23   . THR B  1 118 ? 35.697  -13.467 2.675   1.00 87.96  ? 117 THR B HG23   1 
ATOM   7421  N  N      . LEU B  1 119 ? 32.648  -11.186 -0.402  1.00 77.10  ? 118 LEU B N      1 
ATOM   7422  C  CA     . LEU B  1 119 ? 31.960  -10.173 -1.192  1.00 72.05  ? 118 LEU B CA     1 
ATOM   7423  C  C      . LEU B  1 119 ? 31.687  -8.917  -0.373  1.00 75.39  ? 118 LEU B C      1 
ATOM   7424  O  O      . LEU B  1 119 ? 31.400  -8.995  0.821   1.00 96.72  ? 118 LEU B O      1 
ATOM   7425  C  CB     . LEU B  1 119 ? 30.645  -10.732 -1.732  1.00 76.19  ? 118 LEU B CB     1 
ATOM   7426  C  CG     . LEU B  1 119 ? 30.766  -12.034 -2.526  1.00 70.60  ? 118 LEU B CG     1 
ATOM   7427  C  CD1    . LEU B  1 119 ? 29.412  -12.450 -3.077  1.00 73.88  ? 118 LEU B CD1    1 
ATOM   7428  C  CD2    . LEU B  1 119 ? 31.782  -11.888 -3.647  1.00 47.50  ? 118 LEU B CD2    1 
ATOM   7429  H  H      . LEU B  1 119 ? 32.124  -11.753 -0.023  1.00 92.52  ? 118 LEU B H      1 
ATOM   7430  H  HA     . LEU B  1 119 ? 32.523  -9.923  -1.955  1.00 86.46  ? 118 LEU B HA     1 
ATOM   7431  H  HB2    . LEU B  1 119 ? 30.052  -10.901 -0.984  1.00 91.43  ? 118 LEU B HB2    1 
ATOM   7432  H  HB3    . LEU B  1 119 ? 30.246  -10.069 -2.318  1.00 91.43  ? 118 LEU B HB3    1 
ATOM   7433  H  HG     . LEU B  1 119 ? 31.075  -12.736 -1.933  1.00 84.72  ? 118 LEU B HG     1 
ATOM   7434  H  HD11   . LEU B  1 119 ? 29.514  -13.268 -3.570  1.00 88.66  ? 118 LEU B HD11   1 
ATOM   7435  H  HD12   . LEU B  1 119 ? 28.805  -12.582 -2.346  1.00 88.66  ? 118 LEU B HD12   1 
ATOM   7436  H  HD13   . LEU B  1 119 ? 29.083  -11.758 -3.655  1.00 88.66  ? 118 LEU B HD13   1 
ATOM   7437  H  HD21   . LEU B  1 119 ? 31.838  -12.717 -4.127  1.00 57.00  ? 118 LEU B HD21   1 
ATOM   7438  H  HD22   . LEU B  1 119 ? 31.499  -11.186 -4.236  1.00 57.00  ? 118 LEU B HD22   1 
ATOM   7439  H  HD23   . LEU B  1 119 ? 32.637  -11.672 -3.266  1.00 57.00  ? 118 LEU B HD23   1 
ATOM   7440  N  N      . ILE B  1 120 ? 31.778  -7.762  -1.024  1.00 66.61  ? 119 ILE B N      1 
ATOM   7441  C  CA     . ILE B  1 120 ? 31.468  -6.491  -0.380  1.00 59.83  ? 119 ILE B CA     1 
ATOM   7442  C  C      . ILE B  1 120 ? 29.958  -6.254  -0.411  1.00 70.12  ? 119 ILE B C      1 
ATOM   7443  O  O      . ILE B  1 120 ? 29.226  -6.978  -1.085  1.00 68.04  ? 119 ILE B O      1 
ATOM   7444  C  CB     . ILE B  1 120 ? 32.195  -5.319  -1.064  1.00 73.02  ? 119 ILE B CB     1 
ATOM   7445  C  CG1    . ILE B  1 120 ? 31.651  -5.100  -2.478  1.00 73.84  ? 119 ILE B CG1    1 
ATOM   7446  C  CG2    . ILE B  1 120 ? 33.696  -5.580  -1.098  1.00 59.33  ? 119 ILE B CG2    1 
ATOM   7447  C  CD1    . ILE B  1 120 ? 32.160  -3.841  -3.135  1.00 88.25  ? 119 ILE B CD1    1 
ATOM   7448  H  H      . ILE B  1 120 ? 32.019  -7.687  -1.846  1.00 79.93  ? 119 ILE B H      1 
ATOM   7449  H  HA     . ILE B  1 120 ? 31.754  -6.525  0.556   1.00 71.79  ? 119 ILE B HA     1 
ATOM   7450  H  HB     . ILE B  1 120 ? 32.034  -4.515  -0.546  1.00 87.62  ? 119 ILE B HB     1 
ATOM   7451  H  HG12   . ILE B  1 120 ? 31.914  -5.851  -3.033  1.00 88.61  ? 119 ILE B HG12   1 
ATOM   7452  H  HG13   . ILE B  1 120 ? 30.684  -5.044  -2.436  1.00 88.61  ? 119 ILE B HG13   1 
ATOM   7453  H  HG21   . ILE B  1 120 ? 34.132  -4.840  -1.527  1.00 71.19  ? 119 ILE B HG21   1 
ATOM   7454  H  HG22   . ILE B  1 120 ? 34.017  -5.672  -0.198  1.00 71.19  ? 119 ILE B HG22   1 
ATOM   7455  H  HG23   . ILE B  1 120 ? 33.862  -6.387  -1.589  1.00 71.19  ? 119 ILE B HG23   1 
ATOM   7456  H  HD11   . ILE B  1 120 ? 31.778  -3.771  -4.013  1.00 105.90 ? 119 ILE B HD11   1 
ATOM   7457  H  HD12   . ILE B  1 120 ? 31.899  -3.085  -2.603  1.00 105.90 ? 119 ILE B HD12   1 
ATOM   7458  H  HD13   . ILE B  1 120 ? 33.117  -3.884  -3.195  1.00 105.90 ? 119 ILE B HD13   1 
ATOM   7459  N  N      . GLU B  1 121 ? 29.495  -5.240  0.313   1.00 74.42  ? 120 GLU B N      1 
ATOM   7460  C  CA     . GLU B  1 121 ? 28.060  -5.003  0.460   1.00 76.93  ? 120 GLU B CA     1 
ATOM   7461  C  C      . GLU B  1 121 ? 27.338  -4.782  -0.872  1.00 76.91  ? 120 GLU B C      1 
ATOM   7462  O  O      . GLU B  1 121 ? 26.265  -5.343  -1.095  1.00 55.30  ? 120 GLU B O      1 
ATOM   7463  C  CB     . GLU B  1 121 ? 27.803  -3.815  1.386   1.00 70.27  ? 120 GLU B CB     1 
ATOM   7464  C  CG     . GLU B  1 121 ? 28.264  -4.032  2.812   1.00 86.10  ? 120 GLU B CG     1 
ATOM   7465  C  CD     . GLU B  1 121 ? 27.653  -3.029  3.775   1.00 105.91 ? 120 GLU B CD     1 
ATOM   7466  O  OE1    . GLU B  1 121 ? 28.229  -2.816  4.863   1.00 106.81 ? 120 GLU B OE1    1 
ATOM   7467  O  OE2    . GLU B  1 121 ? 26.592  -2.456  3.443   1.00 98.64  ? 120 GLU B OE2    1 
ATOM   7468  H  H      . GLU B  1 121 ? 29.990  -4.673  0.730   1.00 89.30  ? 120 GLU B H      1 
ATOM   7469  H  HA     . GLU B  1 121 ? 27.660  -5.793  0.880   1.00 92.32  ? 120 GLU B HA     1 
ATOM   7470  H  HB2    . GLU B  1 121 ? 28.273  -3.042  1.037   1.00 84.33  ? 120 GLU B HB2    1 
ATOM   7471  H  HB3    . GLU B  1 121 ? 26.849  -3.638  1.407   1.00 84.33  ? 120 GLU B HB3    1 
ATOM   7472  H  HG2    . GLU B  1 121 ? 28.003  -4.921  3.099   1.00 103.32 ? 120 GLU B HG2    1 
ATOM   7473  H  HG3    . GLU B  1 121 ? 29.228  -3.938  2.852   1.00 103.32 ? 120 GLU B HG3    1 
ATOM   7474  N  N      . ASP B  1 122 ? 27.911  -3.959  -1.748  1.00 86.51  ? 121 ASP B N      1 
ATOM   7475  C  CA     . ASP B  1 122 ? 27.296  -3.693  -3.048  1.00 90.88  ? 121 ASP B CA     1 
ATOM   7476  C  C      . ASP B  1 122 ? 27.075  -4.995  -3.809  1.00 75.05  ? 121 ASP B C      1 
ATOM   7477  O  O      . ASP B  1 122 ? 25.945  -5.347  -4.149  1.00 72.94  ? 121 ASP B O      1 
ATOM   7478  C  CB     . ASP B  1 122 ? 28.163  -2.745  -3.881  1.00 98.26  ? 121 ASP B CB     1 
ATOM   7479  C  CG     . ASP B  1 122 ? 28.116  -1.315  -3.380  1.00 128.31 ? 121 ASP B CG     1 
ATOM   7480  O  OD1    . ASP B  1 122 ? 29.158  -0.630  -3.439  1.00 138.18 ? 121 ASP B OD1    1 
ATOM   7481  O  OD2    . ASP B  1 122 ? 27.036  -0.873  -2.933  1.00 142.04 ? 121 ASP B OD2    1 
ATOM   7482  H  H      . ASP B  1 122 ? 28.652  -3.544  -1.616  1.00 103.81 ? 121 ASP B H      1 
ATOM   7483  H  HA     . ASP B  1 122 ? 26.423  -3.268  -2.911  1.00 109.06 ? 121 ASP B HA     1 
ATOM   7484  H  HB2    . ASP B  1 122 ? 29.085  -3.045  -3.844  1.00 117.91 ? 121 ASP B HB2    1 
ATOM   7485  H  HB3    . ASP B  1 122 ? 27.848  -2.752  -4.799  1.00 117.91 ? 121 ASP B HB3    1 
ATOM   7486  N  N      . GLU B  1 123 ? 28.167  -5.704  -4.072  1.00 56.32  ? 122 GLU B N      1 
ATOM   7487  C  CA     . GLU B  1 123 ? 28.107  -6.992  -4.747  1.00 57.89  ? 122 GLU B CA     1 
ATOM   7488  C  C      . GLU B  1 123 ? 27.023  -7.860  -4.115  1.00 72.61  ? 122 GLU B C      1 
ATOM   7489  O  O      . GLU B  1 123 ? 26.212  -8.469  -4.812  1.00 72.52  ? 122 GLU B O      1 
ATOM   7490  C  CB     . GLU B  1 123 ? 29.465  -7.697  -4.656  1.00 54.12  ? 122 GLU B CB     1 
ATOM   7491  C  CG     . GLU B  1 123 ? 30.604  -6.951  -5.353  1.00 72.97  ? 122 GLU B CG     1 
ATOM   7492  C  CD     . GLU B  1 123 ? 31.968  -7.573  -5.092  1.00 93.27  ? 122 GLU B CD     1 
ATOM   7493  O  OE1    . GLU B  1 123 ? 32.062  -8.470  -4.227  1.00 86.09  ? 122 GLU B OE1    1 
ATOM   7494  O  OE2    . GLU B  1 123 ? 32.946  -7.161  -5.753  1.00 91.21  ? 122 GLU B OE2    1 
ATOM   7495  H  H      . GLU B  1 123 ? 28.965  -5.456  -3.866  1.00 67.58  ? 122 GLU B H      1 
ATOM   7496  H  HA     . GLU B  1 123 ? 27.888  -6.858  -5.693  1.00 69.46  ? 122 GLU B HA     1 
ATOM   7497  H  HB2    . GLU B  1 123 ? 29.704  -7.793  -3.721  1.00 64.94  ? 122 GLU B HB2    1 
ATOM   7498  H  HB3    . GLU B  1 123 ? 29.389  -8.572  -5.067  1.00 64.94  ? 122 GLU B HB3    1 
ATOM   7499  H  HG2    . GLU B  1 123 ? 30.448  -6.962  -6.310  1.00 87.56  ? 122 GLU B HG2    1 
ATOM   7500  H  HG3    . GLU B  1 123 ? 30.625  -6.037  -5.031  1.00 87.56  ? 122 GLU B HG3    1 
ATOM   7501  N  N      . ILE B  1 124 ? 27.005  -7.896  -2.787  1.00 76.00  ? 123 ILE B N      1 
ATOM   7502  C  CA     . ILE B  1 124 ? 26.060  -8.730  -2.052  1.00 65.95  ? 123 ILE B CA     1 
ATOM   7503  C  C      . ILE B  1 124 ? 24.615  -8.294  -2.276  1.00 55.86  ? 123 ILE B C      1 
ATOM   7504  O  O      . ILE B  1 124 ? 23.747  -9.117  -2.563  1.00 68.28  ? 123 ILE B O      1 
ATOM   7505  C  CB     . ILE B  1 124 ? 26.362  -8.717  -0.542  1.00 62.33  ? 123 ILE B CB     1 
ATOM   7506  C  CG1    . ILE B  1 124 ? 27.625  -9.531  -0.259  1.00 72.97  ? 123 ILE B CG1    1 
ATOM   7507  C  CG2    . ILE B  1 124 ? 25.190  -9.292  0.241   1.00 56.55  ? 123 ILE B CG2    1 
ATOM   7508  C  CD1    . ILE B  1 124 ? 28.096  -9.466  1.172   1.00 62.08  ? 123 ILE B CD1    1 
ATOM   7509  H  H      . ILE B  1 124 ? 27.536  -7.444  -2.283  1.00 91.21  ? 123 ILE B H      1 
ATOM   7510  H  HA     . ILE B  1 124 ? 26.145  -9.654  -2.366  1.00 79.14  ? 123 ILE B HA     1 
ATOM   7511  H  HB     . ILE B  1 124 ? 26.508  -7.801  -0.259  1.00 74.79  ? 123 ILE B HB     1 
ATOM   7512  H  HG12   . ILE B  1 124 ? 27.450  -10.461 -0.470  1.00 87.57  ? 123 ILE B HG12   1 
ATOM   7513  H  HG13   . ILE B  1 124 ? 28.342  -9.197  -0.821  1.00 87.57  ? 123 ILE B HG13   1 
ATOM   7514  H  HG21   . ILE B  1 124 ? 25.400  -9.274  1.177   1.00 67.86  ? 123 ILE B HG21   1 
ATOM   7515  H  HG22   . ILE B  1 124 ? 24.409  -8.760  0.070   1.00 67.86  ? 123 ILE B HG22   1 
ATOM   7516  H  HG23   . ILE B  1 124 ? 25.039  -10.197 -0.044  1.00 67.86  ? 123 ILE B HG23   1 
ATOM   7517  H  HD11   . ILE B  1 124 ? 28.888  -10.000 1.265   1.00 74.50  ? 123 ILE B HD11   1 
ATOM   7518  H  HD12   . ILE B  1 124 ? 28.288  -8.552  1.396   1.00 74.50  ? 123 ILE B HD12   1 
ATOM   7519  H  HD13   . ILE B  1 124 ? 27.403  -9.805  1.744   1.00 74.50  ? 123 ILE B HD13   1 
ATOM   7520  N  N      . ALA B  1 125 ? 24.357  -7.001  -2.140  1.00 48.97  ? 124 ALA B N      1 
ATOM   7521  C  CA     . ALA B  1 125 ? 23.003  -6.488  -2.284  1.00 57.86  ? 124 ALA B CA     1 
ATOM   7522  C  C      . ALA B  1 125 ? 22.449  -6.814  -3.668  1.00 66.55  ? 124 ALA B C      1 
ATOM   7523  O  O      . ALA B  1 125 ? 21.283  -7.188  -3.805  1.00 69.93  ? 124 ALA B O      1 
ATOM   7524  C  CB     . ALA B  1 125 ? 22.977  -4.990  -2.036  1.00 42.12  ? 124 ALA B CB     1 
ATOM   7525  H  H      . ALA B  1 125 ? 24.947  -6.400  -1.964  1.00 58.76  ? 124 ALA B H      1 
ATOM   7526  H  HA     . ALA B  1 125 ? 22.426  -6.916  -1.618  1.00 69.44  ? 124 ALA B HA     1 
ATOM   7527  H  HB1    . ALA B  1 125 ? 22.076  -4.673  -2.136  1.00 50.55  ? 124 ALA B HB1    1 
ATOM   7528  H  HB2    . ALA B  1 125 ? 23.289  -4.816  -1.145  1.00 50.55  ? 124 ALA B HB2    1 
ATOM   7529  H  HB3    . ALA B  1 125 ? 23.549  -4.558  -2.674  1.00 50.55  ? 124 ALA B HB3    1 
ATOM   7530  N  N      . THR B  1 126 ? 23.291  -6.678  -4.687  1.00 68.52  ? 125 THR B N      1 
ATOM   7531  C  CA     . THR B  1 126 ? 22.885  -6.942  -6.064  1.00 70.40  ? 125 THR B CA     1 
ATOM   7532  C  C      . THR B  1 126 ? 22.524  -8.410  -6.276  1.00 75.74  ? 125 THR B C      1 
ATOM   7533  O  O      . THR B  1 126 ? 21.488  -8.728  -6.863  1.00 74.81  ? 125 THR B O      1 
ATOM   7534  C  CB     . THR B  1 126 ? 24.004  -6.565  -7.049  1.00 84.02  ? 125 THR B CB     1 
ATOM   7535  O  OG1    . THR B  1 126 ? 24.188  -5.144  -7.043  1.00 102.89 ? 125 THR B OG1    1 
ATOM   7536  C  CG2    . THR B  1 126 ? 23.656  -7.013  -8.457  1.00 83.26  ? 125 THR B CG2    1 
ATOM   7537  H  H      . THR B  1 126 ? 24.112  -6.432  -4.607  1.00 82.22  ? 125 THR B H      1 
ATOM   7538  H  HA     . THR B  1 126 ? 22.097  -6.400  -6.276  1.00 84.48  ? 125 THR B HA     1 
ATOM   7539  H  HB     . THR B  1 126 ? 24.829  -6.999  -6.783  1.00 100.83 ? 125 THR B HB     1 
ATOM   7540  H  HG1    . THR B  1 126 ? 23.493  -4.771  -7.268  1.00 123.46 ? 125 THR B HG1    1 
ATOM   7541  H  HG21   . THR B  1 126 ? 24.362  -6.772  -9.062  1.00 99.92  ? 125 THR B HG21   1 
ATOM   7542  H  HG22   . THR B  1 126 ? 23.539  -7.965  -8.479  1.00 99.92  ? 125 THR B HG22   1 
ATOM   7543  H  HG23   . THR B  1 126 ? 22.842  -6.592  -8.744  1.00 99.92  ? 125 THR B HG23   1 
ATOM   7544  N  N      . ILE B  1 127 ? 23.390  -9.300  -5.800  1.00 70.82  ? 126 ILE B N      1 
ATOM   7545  C  CA     . ILE B  1 127 ? 23.175  -10.737 -5.931  1.00 56.15  ? 126 ILE B CA     1 
ATOM   7546  C  C      . ILE B  1 127 ? 21.919  -11.181 -5.185  1.00 67.48  ? 126 ILE B C      1 
ATOM   7547  O  O      . ILE B  1 127 ? 21.118  -11.957 -5.708  1.00 54.96  ? 126 ILE B O      1 
ATOM   7548  C  CB     . ILE B  1 127 ? 24.390  -11.529 -5.403  1.00 62.90  ? 126 ILE B CB     1 
ATOM   7549  C  CG1    . ILE B  1 127 ? 25.580  -11.366 -6.356  1.00 62.83  ? 126 ILE B CG1    1 
ATOM   7550  C  CG2    . ILE B  1 127 ? 24.041  -13.002 -5.245  1.00 62.79  ? 126 ILE B CG2    1 
ATOM   7551  C  CD1    . ILE B  1 127 ? 26.888  -11.938 -5.832  1.00 62.16  ? 126 ILE B CD1    1 
ATOM   7552  H  H      . ILE B  1 127 ? 24.118  -9.093  -5.393  1.00 84.98  ? 126 ILE B H      1 
ATOM   7553  H  HA     . ILE B  1 127 ? 23.058  -10.957 -6.879  1.00 67.38  ? 126 ILE B HA     1 
ATOM   7554  H  HB     . ILE B  1 127 ? 24.638  -11.174 -4.535  1.00 75.48  ? 126 ILE B HB     1 
ATOM   7555  H  HG12   . ILE B  1 127 ? 25.374  -11.818 -7.190  1.00 75.40  ? 126 ILE B HG12   1 
ATOM   7556  H  HG13   . ILE B  1 127 ? 25.718  -10.421 -6.523  1.00 75.40  ? 126 ILE B HG13   1 
ATOM   7557  H  HG21   . ILE B  1 127 ? 24.811  -13.472 -4.916  1.00 75.34  ? 126 ILE B HG21   1 
ATOM   7558  H  HG22   . ILE B  1 127 ? 23.315  -13.086 -4.622  1.00 75.34  ? 126 ILE B HG22   1 
ATOM   7559  H  HG23   . ILE B  1 127 ? 23.781  -13.355 -6.099  1.00 75.34  ? 126 ILE B HG23   1 
ATOM   7560  H  HD11   . ILE B  1 127 ? 27.576  -11.795 -6.486  1.00 74.59  ? 126 ILE B HD11   1 
ATOM   7561  H  HD12   . ILE B  1 127 ? 27.117  -11.493 -5.013  1.00 74.59  ? 126 ILE B HD12   1 
ATOM   7562  H  HD13   . ILE B  1 127 ? 26.777  -12.878 -5.674  1.00 74.59  ? 126 ILE B HD13   1 
ATOM   7563  N  N      . LEU B  1 128 ? 21.750  -10.683 -3.964  1.00 77.08  ? 127 LEU B N      1 
ATOM   7564  C  CA     . LEU B  1 128 ? 20.608  -11.057 -3.134  1.00 84.38  ? 127 LEU B CA     1 
ATOM   7565  C  C      . LEU B  1 128 ? 19.294  -10.561 -3.724  1.00 71.03  ? 127 LEU B C      1 
ATOM   7566  O  O      . LEU B  1 128 ? 18.243  -11.168 -3.511  1.00 74.50  ? 127 LEU B O      1 
ATOM   7567  C  CB     . LEU B  1 128 ? 20.770  -10.514 -1.713  1.00 85.20  ? 127 LEU B CB     1 
ATOM   7568  C  CG     . LEU B  1 128 ? 21.898  -11.135 -0.887  1.00 87.46  ? 127 LEU B CG     1 
ATOM   7569  C  CD1    . LEU B  1 128 ? 22.045  -10.405 0.435   1.00 83.52  ? 127 LEU B CD1    1 
ATOM   7570  C  CD2    . LEU B  1 128 ? 21.648  -12.616 -0.654  1.00 82.28  ? 127 LEU B CD2    1 
ATOM   7571  H  H      . LEU B  1 128 ? 22.286  -10.123 -3.590  1.00 92.50  ? 127 LEU B H      1 
ATOM   7572  H  HA     . LEU B  1 128 ? 20.563  -12.034 -3.080  1.00 101.26 ? 127 LEU B HA     1 
ATOM   7573  H  HB2    . LEU B  1 128 ? 20.943  -9.561  -1.768  1.00 102.24 ? 127 LEU B HB2    1 
ATOM   7574  H  HB3    . LEU B  1 128 ? 19.942  -10.664 -1.232  1.00 102.24 ? 127 LEU B HB3    1 
ATOM   7575  H  HG     . LEU B  1 128 ? 22.732  -11.045 -1.373  1.00 104.95 ? 127 LEU B HG     1 
ATOM   7576  H  HD11   . LEU B  1 128 ? 22.755  -10.809 0.938   1.00 100.23 ? 127 LEU B HD11   1 
ATOM   7577  H  HD12   . LEU B  1 128 ? 22.249  -9.483  0.261   1.00 100.23 ? 127 LEU B HD12   1 
ATOM   7578  H  HD13   . LEU B  1 128 ? 21.220  -10.472 0.922   1.00 100.23 ? 127 LEU B HD13   1 
ATOM   7579  H  HD21   . LEU B  1 128 ? 22.370  -12.976 -0.134  1.00 98.74  ? 127 LEU B HD21   1 
ATOM   7580  H  HD22   . LEU B  1 128 ? 20.819  -12.722 -0.181  1.00 98.74  ? 127 LEU B HD22   1 
ATOM   7581  H  HD23   . LEU B  1 128 ? 21.600  -13.061 -1.503  1.00 98.74  ? 127 LEU B HD23   1 
ATOM   7582  N  N      . LYS B  1 129 ? 19.350  -9.454  -4.458  1.00 58.78  ? 128 LYS B N      1 
ATOM   7583  C  CA     . LYS B  1 129 ? 18.154  -8.914  -5.090  1.00 73.58  ? 128 LYS B CA     1 
ATOM   7584  C  C      . LYS B  1 129 ? 17.631  -9.891  -6.137  1.00 82.38  ? 128 LYS B C      1 
ATOM   7585  O  O      . LYS B  1 129 ? 16.425  -10.116 -6.241  1.00 79.95  ? 128 LYS B O      1 
ATOM   7586  C  CB     . LYS B  1 129 ? 18.439  -7.557  -5.731  1.00 67.32  ? 128 LYS B CB     1 
ATOM   7587  C  CG     . LYS B  1 129 ? 17.217  -6.928  -6.382  1.00 62.80  ? 128 LYS B CG     1 
ATOM   7588  C  CD     . LYS B  1 129 ? 17.523  -5.546  -6.931  1.00 73.28  ? 128 LYS B CD     1 
ATOM   7589  C  CE     . LYS B  1 129 ? 16.287  -4.903  -7.541  1.00 87.71  ? 128 LYS B CE     1 
ATOM   7590  N  NZ     . LYS B  1 129 ? 16.581  -3.554  -8.103  1.00 110.64 ? 128 LYS B NZ     1 
ATOM   7591  H  H      . LYS B  1 129 ? 20.065  -8.999  -4.604  1.00 70.53  ? 128 LYS B H      1 
ATOM   7592  H  HA     . LYS B  1 129 ? 17.458  -8.792  -4.411  1.00 88.30  ? 128 LYS B HA     1 
ATOM   7593  H  HB2    . LYS B  1 129 ? 18.759  -6.948  -5.048  1.00 80.79  ? 128 LYS B HB2    1 
ATOM   7594  H  HB3    . LYS B  1 129 ? 19.117  -7.670  -6.416  1.00 80.79  ? 128 LYS B HB3    1 
ATOM   7595  H  HG2    . LYS B  1 129 ? 16.922  -7.488  -7.117  1.00 75.36  ? 128 LYS B HG2    1 
ATOM   7596  H  HG3    . LYS B  1 129 ? 16.511  -6.843  -5.722  1.00 75.36  ? 128 LYS B HG3    1 
ATOM   7597  H  HD2    . LYS B  1 129 ? 17.837  -4.978  -6.211  1.00 87.94  ? 128 LYS B HD2    1 
ATOM   7598  H  HD3    . LYS B  1 129 ? 18.200  -5.619  -7.622  1.00 87.94  ? 128 LYS B HD3    1 
ATOM   7599  H  HE2    . LYS B  1 129 ? 15.957  -5.464  -8.259  1.00 105.25 ? 128 LYS B HE2    1 
ATOM   7600  H  HE3    . LYS B  1 129 ? 15.609  -4.803  -6.855  1.00 105.25 ? 128 LYS B HE3    1 
ATOM   7601  H  HZ1    . LYS B  1 129 ? 15.842  -3.202  -8.452  1.00 132.76 ? 128 LYS B HZ1    1 
ATOM   7602  H  HZ2    . LYS B  1 129 ? 16.882  -3.016  -7.461  1.00 132.76 ? 128 LYS B HZ2    1 
ATOM   7603  H  HZ3    . LYS B  1 129 ? 17.199  -3.618  -8.740  1.00 132.76 ? 128 LYS B HZ3    1 
ATOM   7604  N  N      . SER B  1 130 ? 18.547  -10.470 -6.907  1.00 89.32  ? 129 SER B N      1 
ATOM   7605  C  CA     . SER B  1 130 ? 18.184  -11.460 -7.913  1.00 85.24  ? 129 SER B CA     1 
ATOM   7606  C  C      . SER B  1 130 ? 17.652  -12.710 -7.226  1.00 83.90  ? 129 SER B C      1 
ATOM   7607  O  O      . SER B  1 130 ? 16.660  -13.296 -7.659  1.00 81.78  ? 129 SER B O      1 
ATOM   7608  C  CB     . SER B  1 130 ? 19.395  -11.815 -8.778  1.00 81.58  ? 129 SER B CB     1 
ATOM   7609  O  OG     . SER B  1 130 ? 19.877  -10.681 -9.478  1.00 99.11  ? 129 SER B OG     1 
ATOM   7610  H  H      . SER B  1 130 ? 19.390  -10.305 -6.866  1.00 107.18 ? 129 SER B H      1 
ATOM   7611  H  HA     . SER B  1 130 ? 17.481  -11.098 -8.492  1.00 102.29 ? 129 SER B HA     1 
ATOM   7612  H  HB2    . SER B  1 130 ? 20.102  -12.154 -8.206  1.00 97.90  ? 129 SER B HB2    1 
ATOM   7613  H  HB3    . SER B  1 130 ? 19.135  -12.494 -9.420  1.00 97.90  ? 129 SER B HB3    1 
ATOM   7614  H  HG     . SER B  1 130 ? 20.525  -10.888 -9.936  1.00 118.93 ? 129 SER B HG     1 
ATOM   7615  N  N      . THR B  1 131 ? 18.315  -13.108 -6.145  1.00 69.23  ? 130 THR B N      1 
ATOM   7616  C  CA     . THR B  1 131 ? 17.924  -14.299 -5.404  1.00 58.48  ? 130 THR B CA     1 
ATOM   7617  C  C      . THR B  1 131 ? 16.534  -14.110 -4.808  1.00 72.19  ? 130 THR B C      1 
ATOM   7618  O  O      . THR B  1 131 ? 15.727  -15.040 -4.780  1.00 71.46  ? 130 THR B O      1 
ATOM   7619  C  CB     . THR B  1 131 ? 18.919  -14.614 -4.271  1.00 47.04  ? 130 THR B CB     1 
ATOM   7620  O  OG1    . THR B  1 131 ? 20.236  -14.784 -4.811  1.00 80.16  ? 130 THR B OG1    1 
ATOM   7621  C  CG2    . THR B  1 131 ? 18.515  -15.889 -3.550  1.00 62.42  ? 130 THR B CG2    1 
ATOM   7622  H  H      . THR B  1 131 ? 18.999  -12.701 -5.818  1.00 83.07  ? 130 THR B H      1 
ATOM   7623  H  HA     . THR B  1 131 ? 17.897  -15.066 -6.014  1.00 70.18  ? 130 THR B HA     1 
ATOM   7624  H  HB     . THR B  1 131 ? 18.923  -13.885 -3.631  1.00 56.45  ? 130 THR B HB     1 
ATOM   7625  H  HG1    . THR B  1 131 ? 20.474  -14.098 -5.192  1.00 96.19  ? 130 THR B HG1    1 
ATOM   7626  H  HG21   . THR B  1 131 ? 19.139  -16.079 -2.846  1.00 74.91  ? 130 THR B HG21   1 
ATOM   7627  H  HG22   . THR B  1 131 ? 17.639  -15.788 -3.172  1.00 74.91  ? 130 THR B HG22   1 
ATOM   7628  H  HG23   . THR B  1 131 ? 18.506  -16.625 -4.167  1.00 74.91  ? 130 THR B HG23   1 
ATOM   7629  N  N      . LEU B  1 132 ? 16.264  -12.896 -4.334  1.00 67.71  ? 131 LEU B N      1 
ATOM   7630  C  CA     . LEU B  1 132 ? 14.975  -12.567 -3.734  1.00 56.45  ? 131 LEU B CA     1 
ATOM   7631  C  C      . LEU B  1 132 ? 13.854  -12.642 -4.765  1.00 76.67  ? 131 LEU B C      1 
ATOM   7632  O  O      . LEU B  1 132 ? 12.781  -13.181 -4.487  1.00 69.77  ? 131 LEU B O      1 
ATOM   7633  C  CB     . LEU B  1 132 ? 15.023  -11.170 -3.117  1.00 52.90  ? 131 LEU B CB     1 
ATOM   7634  C  CG     . LEU B  1 132 ? 15.583  -11.095 -1.696  1.00 69.45  ? 131 LEU B CG     1 
ATOM   7635  C  CD1    . LEU B  1 132 ? 15.969  -9.664  -1.340  1.00 73.08  ? 131 LEU B CD1    1 
ATOM   7636  C  CD2    . LEU B  1 132 ? 14.564  -11.641 -0.704  1.00 69.57  ? 131 LEU B CD2    1 
ATOM   7637  H  H      . LEU B  1 132 ? 16.818  -12.239 -4.349  1.00 81.25  ? 131 LEU B H      1 
ATOM   7638  H  HA     . LEU B  1 132 ? 14.778  -13.210 -3.021  1.00 67.74  ? 131 LEU B HA     1 
ATOM   7639  H  HB2    . LEU B  1 132 ? 15.577  -10.606 -3.678  1.00 63.48  ? 131 LEU B HB2    1 
ATOM   7640  H  HB3    . LEU B  1 132 ? 14.120  -10.815 -3.092  1.00 63.48  ? 131 LEU B HB3    1 
ATOM   7641  H  HG     . LEU B  1 132 ? 16.381  -11.645 -1.641  1.00 83.34  ? 131 LEU B HG     1 
ATOM   7642  H  HD11   . LEU B  1 132 ? 16.317  -9.647  -0.445  1.00 87.70  ? 131 LEU B HD11   1 
ATOM   7643  H  HD12   . LEU B  1 132 ? 16.638  -9.358  -1.957  1.00 87.70  ? 131 LEU B HD12   1 
ATOM   7644  H  HD13   . LEU B  1 132 ? 15.190  -9.106  -1.399  1.00 87.70  ? 131 LEU B HD13   1 
ATOM   7645  H  HD21   . LEU B  1 132 ? 14.931  -11.587 0.182   1.00 83.49  ? 131 LEU B HD21   1 
ATOM   7646  H  HD22   . LEU B  1 132 ? 13.763  -11.116 -0.759  1.00 83.49  ? 131 LEU B HD22   1 
ATOM   7647  H  HD23   . LEU B  1 132 ? 14.373  -12.556 -0.924  1.00 83.49  ? 131 LEU B HD23   1 
ATOM   7648  N  N      . LYS B  1 133 ? 14.105  -12.088 -5.949  1.00 78.86  ? 132 LYS B N      1 
ATOM   7649  C  CA     . LYS B  1 133 ? 13.162  -12.190 -7.056  1.00 78.95  ? 132 LYS B CA     1 
ATOM   7650  C  C      . LYS B  1 133 ? 12.853  -13.658 -7.318  1.00 89.47  ? 132 LYS B C      1 
ATOM   7651  O  O      . LYS B  1 133 ? 11.715  -14.027 -7.614  1.00 85.59  ? 132 LYS B O      1 
ATOM   7652  C  CB     . LYS B  1 133 ? 13.749  -11.561 -8.321  1.00 76.69  ? 132 LYS B CB     1 
ATOM   7653  C  CG     . LYS B  1 133 ? 13.954  -10.055 -8.257  1.00 83.57  ? 132 LYS B CG     1 
ATOM   7654  C  CD     . LYS B  1 133 ? 12.733  -9.294  -8.758  1.00 89.59  ? 132 LYS B CD     1 
ATOM   7655  C  CE     . LYS B  1 133 ? 13.073  -7.848  -9.100  1.00 106.27 ? 132 LYS B CE     1 
ATOM   7656  N  NZ     . LYS B  1 133 ? 13.954  -7.727  -10.302 1.00 117.61 ? 132 LYS B NZ     1 
ATOM   7657  H  H      . LYS B  1 133 ? 14.819  -11.646 -6.136  1.00 94.63  ? 132 LYS B H      1 
ATOM   7658  H  HA     . LYS B  1 133 ? 12.330  -11.726 -6.828  1.00 94.74  ? 132 LYS B HA     1 
ATOM   7659  H  HB2    . LYS B  1 133 ? 14.613  -11.966 -8.495  1.00 92.03  ? 132 LYS B HB2    1 
ATOM   7660  H  HB3    . LYS B  1 133 ? 13.150  -11.743 -9.062  1.00 92.03  ? 132 LYS B HB3    1 
ATOM   7661  H  HG2    . LYS B  1 133 ? 14.117  -9.794  -7.337  1.00 100.29 ? 132 LYS B HG2    1 
ATOM   7662  H  HG3    . LYS B  1 133 ? 14.711  -9.812  -8.812  1.00 100.29 ? 132 LYS B HG3    1 
ATOM   7663  H  HD2    . LYS B  1 133 ? 12.395  -9.724  -9.559  1.00 107.50 ? 132 LYS B HD2    1 
ATOM   7664  H  HD3    . LYS B  1 133 ? 12.053  -9.290  -8.066  1.00 107.50 ? 132 LYS B HD3    1 
ATOM   7665  H  HE2    . LYS B  1 133 ? 12.252  -7.365  -9.281  1.00 127.52 ? 132 LYS B HE2    1 
ATOM   7666  H  HE3    . LYS B  1 133 ? 13.536  -7.446  -8.348  1.00 127.52 ? 132 LYS B HE3    1 
ATOM   7667  H  HZ1    . LYS B  1 133 ? 14.128  -6.870  -10.466 1.00 141.13 ? 132 LYS B HZ1    1 
ATOM   7668  H  HZ2    . LYS B  1 133 ? 14.721  -8.156  -10.161 1.00 141.13 ? 132 LYS B HZ2    1 
ATOM   7669  H  HZ3    . LYS B  1 133 ? 13.550  -8.082  -11.011 1.00 141.13 ? 132 LYS B HZ3    1 
ATOM   7670  N  N      . GLY B  1 134 ? 13.881  -14.494 -7.208  1.00 81.79  ? 133 GLY B N      1 
ATOM   7671  C  CA     . GLY B  1 134 ? 13.730  -15.920 -7.415  1.00 78.98  ? 133 GLY B CA     1 
ATOM   7672  C  C      . GLY B  1 134 ? 12.855  -16.558 -6.355  1.00 85.72  ? 133 GLY B C      1 
ATOM   7673  O  O      . GLY B  1 134 ? 11.898  -17.262 -6.674  1.00 88.97  ? 133 GLY B O      1 
ATOM   7674  H  H      . GLY B  1 134 ? 14.682  -14.252 -7.013  1.00 98.15  ? 133 GLY B H      1 
ATOM   7675  H  HA2    . GLY B  1 134 ? 13.330  -16.082 -8.284  1.00 94.77  ? 133 GLY B HA2    1 
ATOM   7676  H  HA3    . GLY B  1 134 ? 14.602  -16.345 -7.393  1.00 94.77  ? 133 GLY B HA3    1 
ATOM   7677  N  N      . LEU B  1 135 ? 13.185  -16.311 -5.089  1.00 94.67  ? 134 LEU B N      1 
ATOM   7678  C  CA     . LEU B  1 135 ? 12.416  -16.858 -3.976  1.00 91.37  ? 134 LEU B CA     1 
ATOM   7679  C  C      . LEU B  1 135 ? 10.965  -16.399 -4.048  1.00 82.18  ? 134 LEU B C      1 
ATOM   7680  O  O      . LEU B  1 135 ? 10.048  -17.159 -3.738  1.00 71.26  ? 134 LEU B O      1 
ATOM   7681  C  CB     . LEU B  1 135 ? 13.034  -16.444 -2.639  1.00 70.89  ? 134 LEU B CB     1 
ATOM   7682  C  CG     . LEU B  1 135 ? 14.376  -17.099 -2.312  1.00 60.58  ? 134 LEU B CG     1 
ATOM   7683  C  CD1    . LEU B  1 135 ? 15.007  -16.454 -1.087  1.00 64.04  ? 134 LEU B CD1    1 
ATOM   7684  C  CD2    . LEU B  1 135 ? 14.200  -18.594 -2.100  1.00 51.16  ? 134 LEU B CD2    1 
ATOM   7685  H  H      . LEU B  1 135 ? 13.854  -15.827 -4.848  1.00 113.60 ? 134 LEU B H      1 
ATOM   7686  H  HA     . LEU B  1 135 ? 12.428  -17.837 -4.027  1.00 109.64 ? 134 LEU B HA     1 
ATOM   7687  H  HB2    . LEU B  1 135 ? 13.172  -15.484 -2.648  1.00 85.07  ? 134 LEU B HB2    1 
ATOM   7688  H  HB3    . LEU B  1 135 ? 12.415  -16.675 -1.929  1.00 85.07  ? 134 LEU B HB3    1 
ATOM   7689  H  HG     . LEU B  1 135 ? 14.980  -16.973 -3.061  1.00 72.70  ? 134 LEU B HG     1 
ATOM   7690  H  HD11   . LEU B  1 135 ? 15.846  -16.883 -0.905  1.00 76.85  ? 134 LEU B HD11   1 
ATOM   7691  H  HD12   . LEU B  1 135 ? 15.148  -15.521 -1.263  1.00 76.85  ? 134 LEU B HD12   1 
ATOM   7692  H  HD13   . LEU B  1 135 ? 14.415  -16.560 -0.338  1.00 76.85  ? 134 LEU B HD13   1 
ATOM   7693  H  HD21   . LEU B  1 135 ? 15.054  -18.983 -1.897  1.00 61.39  ? 134 LEU B HD21   1 
ATOM   7694  H  HD22   . LEU B  1 135 ? 13.593  -18.736 -1.370  1.00 61.39  ? 134 LEU B HD22   1 
ATOM   7695  H  HD23   . LEU B  1 135 ? 13.845  -18.983 -2.903  1.00 61.39  ? 134 LEU B HD23   1 
ATOM   7696  N  N      . GLU B  1 136 ? 10.764  -15.153 -4.462  1.00 73.97  ? 135 GLU B N      1 
ATOM   7697  C  CA     . GLU B  1 136 ? 9.422   -14.622 -4.645  1.00 73.00  ? 135 GLU B CA     1 
ATOM   7698  C  C      . GLU B  1 136 ? 8.655   -15.468 -5.660  1.00 80.89  ? 135 GLU B C      1 
ATOM   7699  O  O      . GLU B  1 136 ? 7.515   -15.865 -5.415  1.00 80.65  ? 135 GLU B O      1 
ATOM   7700  C  CB     . GLU B  1 136 ? 9.486   -13.171 -5.113  1.00 70.57  ? 135 GLU B CB     1 
ATOM   7701  C  CG     . GLU B  1 136 ? 8.134   -12.567 -5.420  1.00 89.58  ? 135 GLU B CG     1 
ATOM   7702  C  CD     . GLU B  1 136 ? 8.244   -11.137 -5.901  1.00 115.69 ? 135 GLU B CD     1 
ATOM   7703  O  OE1    . GLU B  1 136 ? 7.702   -10.237 -5.225  1.00 115.78 ? 135 GLU B OE1    1 
ATOM   7704  O  OE2    . GLU B  1 136 ? 8.877   -10.914 -6.956  1.00 133.89 ? 135 GLU B OE2    1 
ATOM   7705  H  H      . GLU B  1 136 ? 11.391  -14.593 -4.643  1.00 88.76  ? 135 GLU B H      1 
ATOM   7706  H  HA     . GLU B  1 136 ? 8.941   -14.651 -3.792  1.00 87.61  ? 135 GLU B HA     1 
ATOM   7707  H  HB2    . GLU B  1 136 ? 9.898   -12.636 -4.417  1.00 84.69  ? 135 GLU B HB2    1 
ATOM   7708  H  HB3    . GLU B  1 136 ? 10.020  -13.127 -5.921  1.00 84.69  ? 135 GLU B HB3    1 
ATOM   7709  H  HG2    . GLU B  1 136 ? 7.703   -13.087 -6.116  1.00 107.50 ? 135 GLU B HG2    1 
ATOM   7710  H  HG3    . GLU B  1 136 ? 7.592   -12.573 -4.615  1.00 107.50 ? 135 GLU B HG3    1 
ATOM   7711  N  N      . TYR B  1 137 ? 9.288   -15.742 -6.797  1.00 74.60  ? 136 TYR B N      1 
ATOM   7712  C  CA     . TYR B  1 137 ? 8.680   -16.574 -7.831  1.00 71.67  ? 136 TYR B CA     1 
ATOM   7713  C  C      . TYR B  1 137 ? 8.272   -17.934 -7.277  1.00 82.04  ? 136 TYR B C      1 
ATOM   7714  O  O      . TYR B  1 137 ? 7.114   -18.334 -7.393  1.00 88.86  ? 136 TYR B O      1 
ATOM   7715  C  CB     . TYR B  1 137 ? 9.644   -16.760 -9.003  1.00 82.71  ? 136 TYR B CB     1 
ATOM   7716  C  CG     . TYR B  1 137 ? 9.182   -17.779 -10.021 1.00 86.28  ? 136 TYR B CG     1 
ATOM   7717  C  CD1    . TYR B  1 137 ? 8.048   -17.557 -10.790 1.00 84.74  ? 136 TYR B CD1    1 
ATOM   7718  C  CD2    . TYR B  1 137 ? 9.885   -18.961 -10.219 1.00 96.54  ? 136 TYR B CD2    1 
ATOM   7719  C  CE1    . TYR B  1 137 ? 7.623   -18.486 -11.723 1.00 93.66  ? 136 TYR B CE1    1 
ATOM   7720  C  CE2    . TYR B  1 137 ? 9.468   -19.895 -11.150 1.00 94.94  ? 136 TYR B CE2    1 
ATOM   7721  C  CZ     . TYR B  1 137 ? 8.337   -19.652 -11.899 1.00 97.42  ? 136 TYR B CZ     1 
ATOM   7722  O  OH     . TYR B  1 137 ? 7.918   -20.577 -12.828 1.00 112.34 ? 136 TYR B OH     1 
ATOM   7723  H  H      . TYR B  1 137 ? 10.075  -15.457 -6.995  1.00 89.52  ? 136 TYR B H      1 
ATOM   7724  H  HA     . TYR B  1 137 ? 7.875   -16.129 -8.168  1.00 86.00  ? 136 TYR B HA     1 
ATOM   7725  H  HB2    . TYR B  1 137 ? 9.747   -15.911 -9.461  1.00 99.25  ? 136 TYR B HB2    1 
ATOM   7726  H  HB3    . TYR B  1 137 ? 10.502  -17.054 -8.659  1.00 99.25  ? 136 TYR B HB3    1 
ATOM   7727  H  HD1    . TYR B  1 137 ? 7.563   -16.772 -10.673 1.00 101.69 ? 136 TYR B HD1    1 
ATOM   7728  H  HD2    . TYR B  1 137 ? 10.649  -19.128 -9.714  1.00 115.84 ? 136 TYR B HD2    1 
ATOM   7729  H  HE1    . TYR B  1 137 ? 6.860   -18.324 -12.230 1.00 112.39 ? 136 TYR B HE1    1 
ATOM   7730  H  HE2    . TYR B  1 137 ? 9.949   -20.682 -11.270 1.00 113.92 ? 136 TYR B HE2    1 
ATOM   7731  H  HH     . TYR B  1 137 ? 7.757   -21.292 -12.459 1.00 134.81 ? 136 TYR B HH     1 
ATOM   7732  N  N      . LEU B  1 138 ? 9.226   -18.642 -6.678  1.00 86.36  ? 137 LEU B N      1 
ATOM   7733  C  CA     . LEU B  1 138 ? 8.950   -19.945 -6.083  1.00 91.40  ? 137 LEU B CA     1 
ATOM   7734  C  C      . LEU B  1 138 ? 7.788   -19.853 -5.101  1.00 101.96 ? 137 LEU B C      1 
ATOM   7735  O  O      . LEU B  1 138 ? 6.830   -20.621 -5.180  1.00 101.99 ? 137 LEU B O      1 
ATOM   7736  C  CB     . LEU B  1 138 ? 10.189  -20.484 -5.361  1.00 83.73  ? 137 LEU B CB     1 
ATOM   7737  C  CG     . LEU B  1 138 ? 11.374  -20.911 -6.229  1.00 95.06  ? 137 LEU B CG     1 
ATOM   7738  C  CD1    . LEU B  1 138 ? 12.459  -21.536 -5.363  1.00 97.28  ? 137 LEU B CD1    1 
ATOM   7739  C  CD2    . LEU B  1 138 ? 10.936  -21.878 -7.321  1.00 98.15  ? 137 LEU B CD2    1 
ATOM   7740  H  H      . LEU B  1 138 ? 10.044  -18.388 -6.602  1.00 103.63 ? 137 LEU B H      1 
ATOM   7741  H  HA     . LEU B  1 138 ? 8.706   -20.578 -6.790  1.00 109.68 ? 137 LEU B HA     1 
ATOM   7742  H  HB2    . LEU B  1 138 ? 10.510  -19.794 -4.759  1.00 100.47 ? 137 LEU B HB2    1 
ATOM   7743  H  HB3    . LEU B  1 138 ? 9.921   -21.259 -4.842  1.00 100.47 ? 137 LEU B HB3    1 
ATOM   7744  H  HG     . LEU B  1 138 ? 11.749  -20.126 -6.658  1.00 114.07 ? 137 LEU B HG     1 
ATOM   7745  H  HD11   . LEU B  1 138 ? 13.193  -21.797 -5.924  1.00 116.74 ? 137 LEU B HD11   1 
ATOM   7746  H  HD12   . LEU B  1 138 ? 12.754  -20.889 -4.717  1.00 116.74 ? 137 LEU B HD12   1 
ATOM   7747  H  HD13   . LEU B  1 138 ? 12.098  -22.305 -4.916  1.00 116.74 ? 137 LEU B HD13   1 
ATOM   7748  H  HD21   . LEU B  1 138 ? 11.702  -22.124 -7.845  1.00 117.78 ? 137 LEU B HD21   1 
ATOM   7749  H  HD22   . LEU B  1 138 ? 10.554  -22.658 -6.912  1.00 117.78 ? 137 LEU B HD22   1 
ATOM   7750  H  HD23   . LEU B  1 138 ? 10.284  -21.446 -7.877  1.00 117.78 ? 137 LEU B HD23   1 
ATOM   7751  N  N      . HIS B  1 139 ? 7.877   -18.901 -4.179  1.00 99.90  ? 138 HIS B N      1 
ATOM   7752  C  CA     . HIS B  1 139 ? 6.878   -18.759 -3.130  1.00 104.02 ? 138 HIS B CA     1 
ATOM   7753  C  C      . HIS B  1 139 ? 5.503   -18.411 -3.694  1.00 120.02 ? 138 HIS B C      1 
ATOM   7754  O  O      . HIS B  1 139 ? 4.481   -18.779 -3.116  1.00 135.83 ? 138 HIS B O      1 
ATOM   7755  C  CB     . HIS B  1 139 ? 7.322   -17.704 -2.116  1.00 98.20  ? 138 HIS B CB     1 
ATOM   7756  C  CG     . HIS B  1 139 ? 8.525   -18.107 -1.319  1.00 94.30  ? 138 HIS B CG     1 
ATOM   7757  N  ND1    . HIS B  1 139 ? 9.144   -17.261 -0.424  1.00 96.18  ? 138 HIS B ND1    1 
ATOM   7758  C  CD2    . HIS B  1 139 ? 9.219   -19.268 -1.283  1.00 77.22  ? 138 HIS B CD2    1 
ATOM   7759  C  CE1    . HIS B  1 139 ? 10.170  -17.885 0.129   1.00 96.98  ? 138 HIS B CE1    1 
ATOM   7760  N  NE2    . HIS B  1 139 ? 10.237  -19.103 -0.374  1.00 86.67  ? 138 HIS B NE2    1 
ATOM   7761  H  H      . HIS B  1 139 ? 8.511   -18.322 -4.140  1.00 119.88 ? 138 HIS B H      1 
ATOM   7762  H  HA     . HIS B  1 139 ? 6.797   -19.612 -2.656  1.00 124.82 ? 138 HIS B HA     1 
ATOM   7763  H  HB2    . HIS B  1 139 ? 7.540   -16.886 -2.590  1.00 117.84 ? 138 HIS B HB2    1 
ATOM   7764  H  HB3    . HIS B  1 139 ? 6.595   -17.540 -1.495  1.00 117.84 ? 138 HIS B HB3    1 
ATOM   7765  H  HD1    . HIS B  1 139 ? 8.901   -16.454 -0.253  1.00 115.41 ? 138 HIS B HD1    1 
ATOM   7766  H  HD2    . HIS B  1 139 ? 9.040   -20.034 -1.780  1.00 92.66  ? 138 HIS B HD2    1 
ATOM   7767  H  HE1    . HIS B  1 139 ? 10.746  -17.526 0.764   1.00 116.37 ? 138 HIS B HE1    1 
ATOM   7768  H  HE2    . HIS B  1 139 ? 10.824  -19.697 -0.167  1.00 104.00 ? 138 HIS B HE2    1 
ATOM   7769  N  N      . PHE B  1 140 ? 5.472   -17.712 -4.824  1.00 124.30 ? 139 PHE B N      1 
ATOM   7770  C  CA     . PHE B  1 140 ? 4.202   -17.360 -5.450  1.00 101.48 ? 139 PHE B CA     1 
ATOM   7771  C  C      . PHE B  1 140 ? 3.537   -18.585 -6.072  1.00 108.15 ? 139 PHE B C      1 
ATOM   7772  O  O      . PHE B  1 140 ? 2.313   -18.715 -6.043  1.00 119.08 ? 139 PHE B O      1 
ATOM   7773  C  CB     . PHE B  1 140 ? 4.389   -16.279 -6.513  1.00 120.43 ? 139 PHE B CB     1 
ATOM   7774  C  CG     . PHE B  1 140 ? 3.143   -15.993 -7.300  1.00 135.44 ? 139 PHE B CG     1 
ATOM   7775  C  CD1    . PHE B  1 140 ? 2.950   -16.561 -8.550  1.00 122.83 ? 139 PHE B CD1    1 
ATOM   7776  C  CD2    . PHE B  1 140 ? 2.156   -15.167 -6.784  1.00 150.66 ? 139 PHE B CD2    1 
ATOM   7777  C  CE1    . PHE B  1 140 ? 1.802   -16.303 -9.276  1.00 119.44 ? 139 PHE B CE1    1 
ATOM   7778  C  CE2    . PHE B  1 140 ? 1.004   -14.906 -7.505  1.00 151.23 ? 139 PHE B CE2    1 
ATOM   7779  C  CZ     . PHE B  1 140 ? 0.827   -15.475 -8.752  1.00 137.08 ? 139 PHE B CZ     1 
ATOM   7780  H  H      . PHE B  1 140 ? 6.167   -17.432 -5.247  1.00 149.17 ? 139 PHE B H      1 
ATOM   7781  H  HA     . PHE B  1 140 ? 3.599   -17.006 -4.764  1.00 121.77 ? 139 PHE B HA     1 
ATOM   7782  H  HB2    . PHE B  1 140 ? 4.663   -15.456 -6.079  1.00 144.52 ? 139 PHE B HB2    1 
ATOM   7783  H  HB3    . PHE B  1 140 ? 5.075   -16.567 -7.136  1.00 144.52 ? 139 PHE B HB3    1 
ATOM   7784  H  HD1    . PHE B  1 140 ? 3.604   -17.118 -8.907  1.00 147.40 ? 139 PHE B HD1    1 
ATOM   7785  H  HD2    . PHE B  1 140 ? 2.271   -14.781 -5.946  1.00 180.80 ? 139 PHE B HD2    1 
ATOM   7786  H  HE1    . PHE B  1 140 ? 1.684   -16.687 -10.115 1.00 143.33 ? 139 PHE B HE1    1 
ATOM   7787  H  HE2    . PHE B  1 140 ? 0.350   -14.348 -7.150  1.00 181.48 ? 139 PHE B HE2    1 
ATOM   7788  H  HZ     . PHE B  1 140 ? 0.054   -15.300 -9.238  1.00 164.49 ? 139 PHE B HZ     1 
ATOM   7789  N  N      . MET B  1 141 ? 4.344   -19.483 -6.629  1.00 133.18 ? 140 MET B N      1 
ATOM   7790  C  CA     . MET B  1 141 ? 3.824   -20.729 -7.181  1.00 117.86 ? 140 MET B CA     1 
ATOM   7791  C  C      . MET B  1 141 ? 3.647   -21.755 -6.067  1.00 125.97 ? 140 MET B C      1 
ATOM   7792  O  O      . MET B  1 141 ? 3.452   -22.944 -6.325  1.00 125.27 ? 140 MET B O      1 
ATOM   7793  C  CB     . MET B  1 141 ? 4.758   -21.277 -8.262  1.00 104.68 ? 140 MET B CB     1 
ATOM   7794  C  CG     . MET B  1 141 ? 4.876   -20.382 -9.487  1.00 99.51  ? 140 MET B CG     1 
ATOM   7795  S  SD     . MET B  1 141 ? 5.682   -21.194 -10.881 1.00 171.87 ? 140 MET B SD     1 
ATOM   7796  C  CE     . MET B  1 141 ? 4.411   -22.348 -11.395 1.00 143.35 ? 140 MET B CE     1 
ATOM   7797  H  H      . MET B  1 141 ? 5.197   -19.394 -6.701  1.00 159.81 ? 140 MET B H      1 
ATOM   7798  H  HA     . MET B  1 141 ? 2.953   -20.554 -7.595  1.00 141.43 ? 140 MET B HA     1 
ATOM   7799  H  HB2    . MET B  1 141 ? 5.646   -21.381 -7.885  1.00 125.61 ? 140 MET B HB2    1 
ATOM   7800  H  HB3    . MET B  1 141 ? 4.423   -22.139 -8.556  1.00 125.61 ? 140 MET B HB3    1 
ATOM   7801  H  HG2    . MET B  1 141 ? 3.986   -20.117 -9.769  1.00 119.42 ? 140 MET B HG2    1 
ATOM   7802  H  HG3    . MET B  1 141 ? 5.397   -19.598 -9.255  1.00 119.42 ? 140 MET B HG3    1 
ATOM   7803  H  HE1    . MET B  1 141 ? 4.730   -22.849 -12.148 1.00 172.02 ? 140 MET B HE1    1 
ATOM   7804  H  HE2    . MET B  1 141 ? 4.214   -22.940 -10.665 1.00 172.02 ? 140 MET B HE2    1 
ATOM   7805  H  HE3    . MET B  1 141 ? 3.623   -21.856 -11.638 1.00 172.02 ? 140 MET B HE3    1 
ATOM   7806  N  N      . ARG B  1 142 ? 3.718   -21.285 -4.826  1.00 128.12 ? 141 ARG B N      1 
ATOM   7807  C  CA     . ARG B  1 142 ? 3.512   -22.138 -3.666  1.00 123.30 ? 141 ARG B CA     1 
ATOM   7808  C  C      . ARG B  1 142 ? 4.505   -23.295 -3.672  1.00 101.07 ? 141 ARG B C      1 
ATOM   7809  O  O      . ARG B  1 142 ? 4.152   -24.442 -3.399  1.00 104.81 ? 141 ARG B O      1 
ATOM   7810  C  CB     . ARG B  1 142 ? 2.071   -22.648 -3.630  1.00 135.73 ? 141 ARG B CB     1 
ATOM   7811  C  CG     . ARG B  1 142 ? 1.037   -21.543 -3.816  1.00 155.28 ? 141 ARG B CG     1 
ATOM   7812  C  CD     . ARG B  1 142 ? -0.349  -21.982 -3.377  1.00 180.56 ? 141 ARG B CD     1 
ATOM   7813  N  NE     . ARG B  1 142 ? -0.598  -23.394 -3.664  1.00 206.24 ? 141 ARG B NE     1 
ATOM   7814  C  CZ     . ARG B  1 142 ? -1.471  -23.860 -4.555  1.00 218.83 ? 141 ARG B CZ     1 
ATOM   7815  N  NH1    . ARG B  1 142 ? -2.224  -23.042 -5.282  1.00 223.52 ? 141 ARG B NH1    1 
ATOM   7816  N  NH2    . ARG B  1 142 ? -1.598  -25.168 -4.718  1.00 220.83 ? 141 ARG B NH2    1 
ATOM   7817  H  H      . ARG B  1 142 ? 3.886   -20.465 -4.629  1.00 153.75 ? 141 ARG B H      1 
ATOM   7818  H  HA     . ARG B  1 142 ? 3.666   -21.612 -2.853  1.00 147.96 ? 141 ARG B HA     1 
ATOM   7819  H  HB2    . ARG B  1 142 ? 1.949   -23.294 -4.343  1.00 162.88 ? 141 ARG B HB2    1 
ATOM   7820  H  HB3    . ARG B  1 142 ? 1.908   -23.068 -2.772  1.00 162.88 ? 141 ARG B HB3    1 
ATOM   7821  H  HG2    . ARG B  1 142 ? 1.293   -20.774 -3.284  1.00 186.33 ? 141 ARG B HG2    1 
ATOM   7822  H  HG3    . ARG B  1 142 ? 0.994   -21.301 -4.754  1.00 186.33 ? 141 ARG B HG3    1 
ATOM   7823  H  HD2    . ARG B  1 142 ? -0.437  -21.848 -2.420  1.00 216.68 ? 141 ARG B HD2    1 
ATOM   7824  H  HD3    . ARG B  1 142 ? -1.013  -21.456 -3.850  1.00 216.68 ? 141 ARG B HD3    1 
ATOM   7825  H  HE     . ARG B  1 142 ? -0.142  -23.973 -3.219  1.00 247.49 ? 141 ARG B HE     1 
ATOM   7826  H  HH11   . ARG B  1 142 ? -2.151  -22.191 -5.185  1.00 268.22 ? 141 ARG B HH11   1 
ATOM   7827  H  HH12   . ARG B  1 142 ? -2.782  -23.364 -5.851  1.00 268.22 ? 141 ARG B HH12   1 
ATOM   7828  H  HH21   . ARG B  1 142 ? -1.117  -25.708 -4.252  1.00 264.99 ? 141 ARG B HH21   1 
ATOM   7829  H  HH22   . ARG B  1 142 ? -2.161  -25.477 -5.290  1.00 264.99 ? 141 ARG B HH22   1 
ATOM   7830  N  N      . LYS B  1 143 ? 5.753   -22.973 -3.995  1.00 86.75  ? 142 LYS B N      1 
ATOM   7831  C  CA     . LYS B  1 143 ? 6.850   -23.927 -3.920  1.00 82.26  ? 142 LYS B CA     1 
ATOM   7832  C  C      . LYS B  1 143 ? 7.883   -23.441 -2.912  1.00 83.68  ? 142 LYS B C      1 
ATOM   7833  O  O      . LYS B  1 143 ? 7.852   -22.287 -2.488  1.00 95.72  ? 142 LYS B O      1 
ATOM   7834  C  CB     . LYS B  1 143 ? 7.511   -24.097 -5.287  1.00 72.32  ? 142 LYS B CB     1 
ATOM   7835  C  CG     . LYS B  1 143 ? 6.628   -24.751 -6.337  1.00 85.05  ? 142 LYS B CG     1 
ATOM   7836  C  CD     . LYS B  1 143 ? 7.362   -24.880 -7.662  1.00 98.48  ? 142 LYS B CD     1 
ATOM   7837  C  CE     . LYS B  1 143 ? 8.537   -25.843 -7.565  1.00 101.91 ? 142 LYS B CE     1 
ATOM   7838  N  NZ     . LYS B  1 143 ? 9.432   -25.723 -8.739  1.00 93.03  ? 142 LYS B NZ     1 
ATOM   7839  H  H      . LYS B  1 143 ? 5.993   -22.192 -4.265  1.00 104.10 ? 142 LYS B H      1 
ATOM   7840  H  HA     . LYS B  1 143 ? 6.509   -24.798 -3.626  1.00 98.71  ? 142 LYS B HA     1 
ATOM   7841  H  HB2    . LYS B  1 143 ? 7.765   -23.222 -5.619  1.00 86.79  ? 142 LYS B HB2    1 
ATOM   7842  H  HB3    . LYS B  1 143 ? 8.302   -24.648 -5.182  1.00 86.79  ? 142 LYS B HB3    1 
ATOM   7843  H  HG2    . LYS B  1 143 ? 6.377   -25.639 -6.039  1.00 102.06 ? 142 LYS B HG2    1 
ATOM   7844  H  HG3    . LYS B  1 143 ? 5.837   -24.207 -6.477  1.00 102.06 ? 142 LYS B HG3    1 
ATOM   7845  H  HD2    . LYS B  1 143 ? 6.749   -25.215 -8.335  1.00 118.18 ? 142 LYS B HD2    1 
ATOM   7846  H  HD3    . LYS B  1 143 ? 7.703   -24.010 -7.923  1.00 118.18 ? 142 LYS B HD3    1 
ATOM   7847  H  HE2    . LYS B  1 143 ? 9.051   -25.641 -6.768  1.00 122.30 ? 142 LYS B HE2    1 
ATOM   7848  H  HE3    . LYS B  1 143 ? 8.203   -26.753 -7.529  1.00 122.30 ? 142 LYS B HE3    1 
ATOM   7849  H  HZ1    . LYS B  1 143 ? 10.111  -26.293 -8.662  1.00 111.63 ? 142 LYS B HZ1    1 
ATOM   7850  H  HZ2    . LYS B  1 143 ? 8.983   -25.906 -9.484  1.00 111.63 ? 142 LYS B HZ2    1 
ATOM   7851  H  HZ3    . LYS B  1 143 ? 9.755   -24.895 -8.792  1.00 111.63 ? 142 LYS B HZ3    1 
ATOM   7852  N  N      . ILE B  1 144 ? 8.798   -24.327 -2.534  1.00 86.98  ? 143 ILE B N      1 
ATOM   7853  C  CA     . ILE B  1 144 ? 9.826   -24.006 -1.552  1.00 71.46  ? 143 ILE B CA     1 
ATOM   7854  C  C      . ILE B  1 144 ? 11.163  -24.603 -1.980  1.00 74.92  ? 143 ILE B C      1 
ATOM   7855  O  O      . ILE B  1 144 ? 11.213  -25.722 -2.494  1.00 91.18  ? 143 ILE B O      1 
ATOM   7856  C  CB     . ILE B  1 144 ? 9.463   -24.573 -0.169  1.00 74.49  ? 143 ILE B CB     1 
ATOM   7857  C  CG1    . ILE B  1 144 ? 8.057   -24.127 0.240   1.00 76.84  ? 143 ILE B CG1    1 
ATOM   7858  C  CG2    . ILE B  1 144 ? 10.484  -24.130 0.865   1.00 68.50  ? 143 ILE B CG2    1 
ATOM   7859  C  CD1    . ILE B  1 144 ? 7.486   -24.889 1.417   1.00 64.56  ? 143 ILE B CD1    1 
ATOM   7860  H  H      . ILE B  1 144 ? 8.845   -25.131 -2.836  1.00 104.37 ? 143 ILE B H      1 
ATOM   7861  H  HA     . ILE B  1 144 ? 9.924   -23.034 -1.479  1.00 85.76  ? 143 ILE B HA     1 
ATOM   7862  H  HB     . ILE B  1 144 ? 9.477   -25.541 -0.220  1.00 89.39  ? 143 ILE B HB     1 
ATOM   7863  H  HG12   . ILE B  1 144 ? 8.086   -23.188 0.481   1.00 92.21  ? 143 ILE B HG12   1 
ATOM   7864  H  HG13   . ILE B  1 144 ? 7.459   -24.254 -0.513  1.00 92.21  ? 143 ILE B HG13   1 
ATOM   7865  H  HG21   . ILE B  1 144 ? 10.240  -24.493 1.720   1.00 82.20  ? 143 ILE B HG21   1 
ATOM   7866  H  HG22   . ILE B  1 144 ? 11.350  -24.453 0.606   1.00 82.20  ? 143 ILE B HG22   1 
ATOM   7867  H  HG23   . ILE B  1 144 ? 10.491  -23.171 0.906   1.00 82.20  ? 143 ILE B HG23   1 
ATOM   7868  H  HD11   . ILE B  1 144 ? 6.608   -24.553 1.610   1.00 77.47  ? 143 ILE B HD11   1 
ATOM   7869  H  HD12   . ILE B  1 144 ? 7.438   -25.821 1.192   1.00 77.47  ? 143 ILE B HD12   1 
ATOM   7870  H  HD13   . ILE B  1 144 ? 8.059   -24.765 2.177   1.00 77.47  ? 143 ILE B HD13   1 
ATOM   7871  N  N      . HIS B  1 145 ? 12.244  -23.864 -1.755  1.00 65.46  ? 144 HIS B N      1 
ATOM   7872  C  CA     . HIS B  1 145 ? 13.576  -24.325 -2.139  1.00 74.34  ? 144 HIS B CA     1 
ATOM   7873  C  C      . HIS B  1 145 ? 14.116  -25.365 -1.155  1.00 74.57  ? 144 HIS B C      1 
ATOM   7874  O  O      . HIS B  1 145 ? 14.734  -26.347 -1.560  1.00 67.82  ? 144 HIS B O      1 
ATOM   7875  C  CB     . HIS B  1 145 ? 14.541  -23.144 -2.227  1.00 71.97  ? 144 HIS B CB     1 
ATOM   7876  C  CG     . HIS B  1 145 ? 15.802  -23.448 -2.976  1.00 71.04  ? 144 HIS B CG     1 
ATOM   7877  N  ND1    . HIS B  1 145 ? 16.716  -24.388 -2.550  1.00 58.20  ? 144 HIS B ND1    1 
ATOM   7878  C  CD2    . HIS B  1 145 ? 16.305  -22.928 -4.121  1.00 70.78  ? 144 HIS B CD2    1 
ATOM   7879  C  CE1    . HIS B  1 145 ? 17.725  -24.437 -3.402  1.00 66.03  ? 144 HIS B CE1    1 
ATOM   7880  N  NE2    . HIS B  1 145 ? 17.500  -23.560 -4.364  1.00 64.21  ? 144 HIS B NE2    1 
ATOM   7881  H  H      . HIS B  1 145 ? 12.235  -23.089 -1.381  1.00 78.55  ? 144 HIS B H      1 
ATOM   7882  H  HA     . HIS B  1 145 ? 13.526  -24.742 -3.024  1.00 89.21  ? 144 HIS B HA     1 
ATOM   7883  H  HB2    . HIS B  1 145 ? 14.097  -22.410 -2.681  1.00 86.37  ? 144 HIS B HB2    1 
ATOM   7884  H  HB3    . HIS B  1 145 ? 14.788  -22.874 -1.329  1.00 86.37  ? 144 HIS B HB3    1 
ATOM   7885  H  HD1    . HIS B  1 145 ? 16.640  -24.869 -1.841  1.00 69.84  ? 144 HIS B HD1    1 
ATOM   7886  H  HD2    . HIS B  1 145 ? 15.914  -22.267 -4.646  1.00 84.94  ? 144 HIS B HD2    1 
ATOM   7887  H  HE1    . HIS B  1 145 ? 18.467  -24.994 -3.335  1.00 79.24  ? 144 HIS B HE1    1 
ATOM   7888  H  HE2    . HIS B  1 145 ? 18.018  -23.410 -5.034  1.00 77.05  ? 144 HIS B HE2    1 
ATOM   7889  N  N      . ARG B  1 146 ? 13.897  -25.134 0.137   1.00 78.97  ? 145 ARG B N      1 
ATOM   7890  C  CA     . ARG B  1 146 ? 14.260  -26.099 1.177   1.00 85.92  ? 145 ARG B CA     1 
ATOM   7891  C  C      . ARG B  1 146 ? 15.767  -26.338 1.270   1.00 79.86  ? 145 ARG B C      1 
ATOM   7892  O  O      . ARG B  1 146 ? 16.202  -27.271 1.943   1.00 92.84  ? 145 ARG B O      1 
ATOM   7893  C  CB     . ARG B  1 146 ? 13.571  -27.448 0.933   1.00 80.74  ? 145 ARG B CB     1 
ATOM   7894  C  CG     . ARG B  1 146 ? 12.062  -27.394 0.773   1.00 80.74  ? 145 ARG B CG     1 
ATOM   7895  C  CD     . ARG B  1 146 ? 11.527  -28.764 0.383   1.00 66.84  ? 145 ARG B CD     1 
ATOM   7896  N  NE     . ARG B  1 146 ? 10.195  -28.695 -0.213  1.00 80.94  ? 145 ARG B NE     1 
ATOM   7897  C  CZ     . ARG B  1 146 ? 9.051   -28.857 0.449   1.00 104.29 ? 145 ARG B CZ     1 
ATOM   7898  N  NH1    . ARG B  1 146 ? 9.045   -29.101 1.753   1.00 128.45 ? 145 ARG B NH1    1 
ATOM   7899  N  NH2    . ARG B  1 146 ? 7.900   -28.774 -0.202  1.00 101.82 ? 145 ARG B NH2    1 
ATOM   7900  H  H      . ARG B  1 146 ? 13.535  -24.416 0.443   1.00 94.77  ? 145 ARG B H      1 
ATOM   7901  H  HA     . ARG B  1 146 ? 13.956  -25.758 2.044   1.00 103.10 ? 145 ARG B HA     1 
ATOM   7902  H  HB2    . ARG B  1 146 ? 13.935  -27.835 0.122   1.00 96.89  ? 145 ARG B HB2    1 
ATOM   7903  H  HB3    . ARG B  1 146 ? 13.763  -28.030 1.684   1.00 96.89  ? 145 ARG B HB3    1 
ATOM   7904  H  HG2    . ARG B  1 146 ? 11.656  -27.132 1.615   1.00 96.89  ? 145 ARG B HG2    1 
ATOM   7905  H  HG3    . ARG B  1 146 ? 11.833  -26.762 0.074   1.00 96.89  ? 145 ARG B HG3    1 
ATOM   7906  H  HD2    . ARG B  1 146 ? 12.127  -29.165 -0.265  1.00 80.20  ? 145 ARG B HD2    1 
ATOM   7907  H  HD3    . ARG B  1 146 ? 11.474  -29.320 1.176   1.00 80.20  ? 145 ARG B HD3    1 
ATOM   7908  H  HE     . ARG B  1 146 ? 10.146  -28.537 -1.057  1.00 97.12  ? 145 ARG B HE     1 
ATOM   7909  H  HH11   . ARG B  1 146 ? 9.788   -29.157 2.184   1.00 154.14 ? 145 ARG B HH11   1 
ATOM   7910  H  HH12   . ARG B  1 146 ? 8.299   -29.203 2.168   1.00 154.14 ? 145 ARG B HH12   1 
ATOM   7911  H  HH21   . ARG B  1 146 ? 7.894   -28.616 -1.047  1.00 122.18 ? 145 ARG B HH21   1 
ATOM   7912  H  HH22   . ARG B  1 146 ? 7.158   -28.877 0.222   1.00 122.18 ? 145 ARG B HH22   1 
ATOM   7913  N  N      . ASN B  1 147 ? 16.565  -25.503 0.613   1.00 73.64  ? 146 ASN B N      1 
ATOM   7914  C  CA     . ASN B  1 147 ? 17.999  -25.766 0.522   1.00 74.54  ? 146 ASN B CA     1 
ATOM   7915  C  C      . ASN B  1 147 ? 18.793  -24.587 -0.044  1.00 81.38  ? 146 ASN B C      1 
ATOM   7916  O  O      . ASN B  1 147 ? 19.644  -24.758 -0.918  1.00 54.83  ? 146 ASN B O      1 
ATOM   7917  C  CB     . ASN B  1 147 ? 18.240  -27.015 -0.328  1.00 85.91  ? 146 ASN B CB     1 
ATOM   7918  C  CG     . ASN B  1 147 ? 19.653  -27.543 -0.201  1.00 103.46 ? 146 ASN B CG     1 
ATOM   7919  O  OD1    . ASN B  1 147 ? 20.367  -27.218 0.748   1.00 108.32 ? 146 ASN B OD1    1 
ATOM   7920  N  ND2    . ASN B  1 147 ? 20.065  -28.364 -1.159  1.00 106.16 ? 146 ASN B ND2    1 
ATOM   7921  H  H      . ASN B  1 147 ? 16.307  -24.785 0.216   1.00 88.36  ? 146 ASN B H      1 
ATOM   7922  H  HA     . ASN B  1 147 ? 18.341  -25.948 1.422   1.00 89.45  ? 146 ASN B HA     1 
ATOM   7923  H  HB2    . ASN B  1 147 ? 17.631  -27.714 -0.043  1.00 103.10 ? 146 ASN B HB2    1 
ATOM   7924  H  HB3    . ASN B  1 147 ? 18.084  -26.797 -1.261  1.00 103.10 ? 146 ASN B HB3    1 
ATOM   7925  H  HD21   . ASN B  1 147 ? 19.538  -28.568 -1.807  1.00 127.39 ? 146 ASN B HD21   1 
ATOM   7926  H  HD22   . ASN B  1 147 ? 20.860  -28.691 -1.133  1.00 127.39 ? 146 ASN B HD22   1 
ATOM   7927  N  N      . ILE B  1 148 ? 18.515  -23.395 0.470   1.00 91.92  ? 147 ILE B N      1 
ATOM   7928  C  CA     . ILE B  1 148 ? 19.200  -22.185 0.033   1.00 60.78  ? 147 ILE B CA     1 
ATOM   7929  C  C      . ILE B  1 148 ? 20.580  -22.071 0.671   1.00 59.47  ? 147 ILE B C      1 
ATOM   7930  O  O      . ILE B  1 148 ? 20.777  -22.449 1.823   1.00 92.09  ? 147 ILE B O      1 
ATOM   7931  C  CB     . ILE B  1 148 ? 18.388  -20.934 0.407   1.00 70.08  ? 147 ILE B CB     1 
ATOM   7932  C  CG1    . ILE B  1 148 ? 17.100  -20.867 -0.415  1.00 79.82  ? 147 ILE B CG1    1 
ATOM   7933  C  CG2    . ILE B  1 148 ? 19.218  -19.671 0.210   1.00 55.29  ? 147 ILE B CG2    1 
ATOM   7934  C  CD1    . ILE B  1 148 ? 17.329  -20.697 -1.892  1.00 84.12  ? 147 ILE B CD1    1 
ATOM   7935  H  H      . ILE B  1 148 ? 17.927  -23.259 1.082   1.00 110.31 ? 147 ILE B H      1 
ATOM   7936  H  HA     . ILE B  1 148 ? 19.308  -22.205 -0.941  1.00 72.93  ? 147 ILE B HA     1 
ATOM   7937  H  HB     . ILE B  1 148 ? 18.148  -20.996 1.345   1.00 84.09  ? 147 ILE B HB     1 
ATOM   7938  H  HG12   . ILE B  1 148 ? 16.603  -21.690 -0.285  1.00 95.79  ? 147 ILE B HG12   1 
ATOM   7939  H  HG13   . ILE B  1 148 ? 16.572  -20.113 -0.108  1.00 95.79  ? 147 ILE B HG13   1 
ATOM   7940  H  HG21   . ILE B  1 148 ? 18.688  -18.908 0.451   1.00 66.34  ? 147 ILE B HG21   1 
ATOM   7941  H  HG22   . ILE B  1 148 ? 19.997  -19.719 0.770   1.00 66.34  ? 147 ILE B HG22   1 
ATOM   7942  H  HG23   . ILE B  1 148 ? 19.480  -19.611 -0.712  1.00 66.34  ? 147 ILE B HG23   1 
ATOM   7943  H  HD11   . ILE B  1 148 ? 16.480  -20.664 -2.338  1.00 100.94 ? 147 ILE B HD11   1 
ATOM   7944  H  HD12   . ILE B  1 148 ? 17.810  -19.880 -2.041  1.00 100.94 ? 147 ILE B HD12   1 
ATOM   7945  H  HD13   . ILE B  1 148 ? 17.841  -21.442 -2.216  1.00 100.94 ? 147 ILE B HD13   1 
ATOM   7946  N  N      . LYS B  1 149 ? 21.528  -21.533 -0.088  1.00 64.14  ? 148 LYS B N      1 
ATOM   7947  C  CA     . LYS B  1 149 ? 22.893  -21.331 0.386   1.00 65.71  ? 148 LYS B CA     1 
ATOM   7948  C  C      . LYS B  1 149 ? 23.752  -20.823 -0.769  1.00 74.04  ? 148 LYS B C      1 
ATOM   7949  O  O      . LYS B  1 149 ? 23.400  -21.004 -1.935  1.00 66.73  ? 148 LYS B O      1 
ATOM   7950  C  CB     . LYS B  1 149 ? 23.475  -22.627 0.959   1.00 65.49  ? 148 LYS B CB     1 
ATOM   7951  C  CG     . LYS B  1 149 ? 23.334  -23.837 0.047   1.00 74.28  ? 148 LYS B CG     1 
ATOM   7952  C  CD     . LYS B  1 149 ? 23.759  -25.122 0.748   1.00 81.49  ? 148 LYS B CD     1 
ATOM   7953  C  CE     . LYS B  1 149 ? 25.198  -25.049 1.236   1.00 86.39  ? 148 LYS B CE     1 
ATOM   7954  N  NZ     . LYS B  1 149 ? 25.645  -26.330 1.848   1.00 91.48  ? 148 LYS B NZ     1 
ATOM   7955  H  H      . LYS B  1 149 ? 21.403  -21.272 -0.898  1.00 76.97  ? 148 LYS B H      1 
ATOM   7956  H  HA     . LYS B  1 149 ? 22.894  -20.653 1.093   1.00 78.86  ? 148 LYS B HA     1 
ATOM   7957  H  HB2    . LYS B  1 149 ? 24.420  -22.494 1.129   1.00 78.59  ? 148 LYS B HB2    1 
ATOM   7958  H  HB3    . LYS B  1 149 ? 23.019  -22.831 1.791   1.00 78.59  ? 148 LYS B HB3    1 
ATOM   7959  H  HG2    . LYS B  1 149 ? 22.407  -23.930 -0.220  1.00 89.13  ? 148 LYS B HG2    1 
ATOM   7960  H  HG3    . LYS B  1 149 ? 23.898  -23.717 -0.733  1.00 89.13  ? 148 LYS B HG3    1 
ATOM   7961  H  HD2    . LYS B  1 149 ? 23.185  -25.271 1.516   1.00 97.79  ? 148 LYS B HD2    1 
ATOM   7962  H  HD3    . LYS B  1 149 ? 23.686  -25.864 0.127   1.00 97.79  ? 148 LYS B HD3    1 
ATOM   7963  H  HE2    . LYS B  1 149 ? 25.779  -24.854 0.484   1.00 103.67 ? 148 LYS B HE2    1 
ATOM   7964  H  HE3    . LYS B  1 149 ? 25.272  -24.351 1.905   1.00 103.67 ? 148 LYS B HE3    1 
ATOM   7965  H  HZ1    . LYS B  1 149 ? 26.489  -26.257 2.123   1.00 109.77 ? 148 LYS B HZ1    1 
ATOM   7966  H  HZ2    . LYS B  1 149 ? 25.130  -26.530 2.546   1.00 109.77 ? 148 LYS B HZ2    1 
ATOM   7967  H  HZ3    . LYS B  1 149 ? 25.592  -26.988 1.251   1.00 109.77 ? 148 LYS B HZ3    1 
ATOM   7968  N  N      . ALA B  1 150 ? 24.870  -20.182 -0.445  1.00 78.72  ? 149 ALA B N      1 
ATOM   7969  C  CA     . ALA B  1 150 ? 25.720  -19.555 -1.456  1.00 73.70  ? 149 ALA B CA     1 
ATOM   7970  C  C      . ALA B  1 150 ? 26.156  -20.526 -2.555  1.00 72.13  ? 149 ALA B C      1 
ATOM   7971  O  O      . ALA B  1 150 ? 26.331  -20.130 -3.706  1.00 86.97  ? 149 ALA B O      1 
ATOM   7972  C  CB     . ALA B  1 150 ? 26.938  -18.925 -0.799  1.00 70.20  ? 149 ALA B CB     1 
ATOM   7973  H  H      . ALA B  1 150 ? 25.162  -20.095 0.359   1.00 94.47  ? 149 ALA B H      1 
ATOM   7974  H  HA     . ALA B  1 150 ? 25.211  -18.835 -1.885  1.00 88.44  ? 149 ALA B HA     1 
ATOM   7975  H  HB1    . ALA B  1 150 ? 27.483  -18.519 -1.477  1.00 84.24  ? 149 ALA B HB1    1 
ATOM   7976  H  HB2    . ALA B  1 150 ? 26.646  -18.260 -0.172  1.00 84.24  ? 149 ALA B HB2    1 
ATOM   7977  H  HB3    . ALA B  1 150 ? 27.436  -19.609 -0.345  1.00 84.24  ? 149 ALA B HB3    1 
ATOM   7978  N  N      . GLY B  1 151 ? 26.332  -21.793 -2.200  1.00 71.46  ? 150 GLY B N      1 
ATOM   7979  C  CA     . GLY B  1 151 ? 26.756  -22.796 -3.162  1.00 59.50  ? 150 GLY B CA     1 
ATOM   7980  C  C      . GLY B  1 151 ? 25.684  -23.157 -4.175  1.00 53.25  ? 150 GLY B C      1 
ATOM   7981  O  O      . GLY B  1 151 ? 25.983  -23.734 -5.220  1.00 86.19  ? 150 GLY B O      1 
ATOM   7982  H  H      . GLY B  1 151 ? 26.213  -22.097 -1.404  1.00 85.75  ? 150 GLY B H      1 
ATOM   7983  H  HA2    . GLY B  1 151 ? 27.531  -22.468 -3.645  1.00 71.40  ? 150 GLY B HA2    1 
ATOM   7984  H  HA3    . GLY B  1 151 ? 27.012  -23.604 -2.690  1.00 71.40  ? 150 GLY B HA3    1 
ATOM   7985  N  N      . ASN B  1 152 ? 24.434  -22.829 -3.862  1.00 53.71  ? 151 ASN B N      1 
ATOM   7986  C  CA     . ASN B  1 152 ? 23.322  -23.077 -4.773  1.00 57.24  ? 151 ASN B CA     1 
ATOM   7987  C  C      . ASN B  1 152 ? 22.778  -21.788 -5.386  1.00 58.75  ? 151 ASN B C      1 
ATOM   7988  O  O      . ASN B  1 152 ? 21.631  -21.733 -5.833  1.00 54.02  ? 151 ASN B O      1 
ATOM   7989  C  CB     . ASN B  1 152 ? 22.202  -23.823 -4.050  1.00 60.95  ? 151 ASN B CB     1 
ATOM   7990  C  CG     . ASN B  1 152 ? 22.613  -25.217 -3.627  1.00 73.24  ? 151 ASN B CG     1 
ATOM   7991  O  OD1    . ASN B  1 152 ? 23.481  -25.836 -4.245  1.00 80.95  ? 151 ASN B OD1    1 
ATOM   7992  N  ND2    . ASN B  1 152 ? 21.992  -25.719 -2.567  1.00 88.60  ? 151 ASN B ND2    1 
ATOM   7993  H  H      . ASN B  1 152 ? 24.202  -22.459 -3.121  1.00 64.45  ? 151 ASN B H      1 
ATOM   7994  H  HA     . ASN B  1 152 ? 23.636  -23.647 -5.505  1.00 68.69  ? 151 ASN B HA     1 
ATOM   7995  H  HB2    . ASN B  1 152 ? 21.955  -23.328 -3.253  1.00 73.15  ? 151 ASN B HB2    1 
ATOM   7996  H  HB3    . ASN B  1 152 ? 21.439  -23.902 -4.643  1.00 73.15  ? 151 ASN B HB3    1 
ATOM   7997  H  HD21   . ASN B  1 152 ? 21.392  -25.255 -2.161  1.00 106.32 ? 151 ASN B HD21   1 
ATOM   7998  H  HD22   . ASN B  1 152 ? 22.189  -26.507 -2.287  1.00 106.32 ? 151 ASN B HD22   1 
ATOM   7999  N  N      . ILE B  1 153 ? 23.605  -20.749 -5.394  1.00 52.60  ? 152 ILE B N      1 
ATOM   8000  C  CA     . ILE B  1 153 ? 23.284  -19.533 -6.126  1.00 74.06  ? 152 ILE B CA     1 
ATOM   8001  C  C      . ILE B  1 153 ? 24.300  -19.377 -7.250  1.00 74.51  ? 152 ILE B C      1 
ATOM   8002  O  O      . ILE B  1 153 ? 25.468  -19.075 -7.004  1.00 67.67  ? 152 ILE B O      1 
ATOM   8003  C  CB     . ILE B  1 153 ? 23.289  -18.292 -5.209  1.00 80.38  ? 152 ILE B CB     1 
ATOM   8004  C  CG1    . ILE B  1 153 ? 22.082  -18.334 -4.267  1.00 77.94  ? 152 ILE B CG1    1 
ATOM   8005  C  CG2    . ILE B  1 153 ? 23.255  -17.015 -6.035  1.00 76.80  ? 152 ILE B CG2    1 
ATOM   8006  C  CD1    . ILE B  1 153 ? 22.003  -17.160 -3.321  1.00 67.53  ? 152 ILE B CD1    1 
ATOM   8007  H  H      . ILE B  1 153 ? 24.360  -20.724 -4.983  1.00 63.12  ? 152 ILE B H      1 
ATOM   8008  H  HA     . ILE B  1 153 ? 22.393  -19.619 -6.524  1.00 88.88  ? 152 ILE B HA     1 
ATOM   8009  H  HB     . ILE B  1 153 ? 24.100  -18.299 -4.677  1.00 96.46  ? 152 ILE B HB     1 
ATOM   8010  H  HG12   . ILE B  1 153 ? 21.271  -18.340 -4.799  1.00 93.53  ? 152 ILE B HG12   1 
ATOM   8011  H  HG13   . ILE B  1 153 ? 22.131  -19.142 -3.733  1.00 93.53  ? 152 ILE B HG13   1 
ATOM   8012  H  HG21   . ILE B  1 153 ? 23.258  -16.260 -5.442  1.00 92.15  ? 152 ILE B HG21   1 
ATOM   8013  H  HG22   . ILE B  1 153 ? 24.028  -16.989 -6.603  1.00 92.15  ? 152 ILE B HG22   1 
ATOM   8014  H  HG23   . ILE B  1 153 ? 22.456  -17.009 -6.568  1.00 92.15  ? 152 ILE B HG23   1 
ATOM   8015  H  HD11   . ILE B  1 153 ? 21.225  -17.258 -2.767  1.00 81.03  ? 152 ILE B HD11   1 
ATOM   8016  H  HD12   . ILE B  1 153 ? 22.793  -17.145 -2.776  1.00 81.03  ? 152 ILE B HD12   1 
ATOM   8017  H  HD13   . ILE B  1 153 ? 21.942  -16.350 -3.832  1.00 81.03  ? 152 ILE B HD13   1 
ATOM   8018  N  N      . LEU B  1 154 ? 23.854  -19.608 -8.481  1.00 71.01  ? 153 LEU B N      1 
ATOM   8019  C  CA     . LEU B  1 154 ? 24.744  -19.563 -9.638  1.00 81.66  ? 153 LEU B CA     1 
ATOM   8020  C  C      . LEU B  1 154 ? 24.682  -18.217 -10.351 1.00 70.79  ? 153 LEU B C      1 
ATOM   8021  O  O      . LEU B  1 154 ? 23.603  -17.657 -10.555 1.00 49.91  ? 153 LEU B O      1 
ATOM   8022  C  CB     . LEU B  1 154 ? 24.410  -20.688 -10.625 1.00 74.86  ? 153 LEU B CB     1 
ATOM   8023  C  CG     . LEU B  1 154 ? 24.508  -22.118 -10.085 1.00 77.00  ? 153 LEU B CG     1 
ATOM   8024  C  CD1    . LEU B  1 154 ? 24.255  -23.117 -11.203 1.00 64.53  ? 153 LEU B CD1    1 
ATOM   8025  C  CD2    . LEU B  1 154 ? 25.858  -22.382 -9.423  1.00 76.47  ? 153 LEU B CD2    1 
ATOM   8026  H  H      . LEU B  1 154 ? 23.037  -19.794 -8.675  1.00 85.21  ? 153 LEU B H      1 
ATOM   8027  H  HA     . LEU B  1 154 ? 25.665  -19.698 -9.332  1.00 97.99  ? 153 LEU B HA     1 
ATOM   8028  H  HB2    . LEU B  1 154 ? 23.500  -20.559 -10.936 1.00 89.83  ? 153 LEU B HB2    1 
ATOM   8029  H  HB3    . LEU B  1 154 ? 25.018  -20.622 -11.378 1.00 89.83  ? 153 LEU B HB3    1 
ATOM   8030  H  HG     . LEU B  1 154 ? 23.820  -22.245 -9.413  1.00 92.39  ? 153 LEU B HG     1 
ATOM   8031  H  HD11   . LEU B  1 154 ? 24.320  -24.006 -10.847 1.00 77.44  ? 153 LEU B HD11   1 
ATOM   8032  H  HD12   . LEU B  1 154 ? 23.375  -22.970 -11.559 1.00 77.44  ? 153 LEU B HD12   1 
ATOM   8033  H  HD13   . LEU B  1 154 ? 24.912  -22.990 -11.890 1.00 77.44  ? 153 LEU B HD13   1 
ATOM   8034  H  HD21   . LEU B  1 154 ? 25.876  -23.286 -9.100  1.00 91.77  ? 153 LEU B HD21   1 
ATOM   8035  H  HD22   . LEU B  1 154 ? 26.554  -22.252 -10.071 1.00 91.77  ? 153 LEU B HD22   1 
ATOM   8036  H  HD23   . LEU B  1 154 ? 25.972  -21.771 -8.691  1.00 91.77  ? 153 LEU B HD23   1 
ATOM   8037  N  N      . LEU B  1 155 ? 25.853  -17.705 -10.718 1.00 56.99  ? 154 LEU B N      1 
ATOM   8038  C  CA     . LEU B  1 155 ? 25.959  -16.485 -11.509 1.00 67.32  ? 154 LEU B CA     1 
ATOM   8039  C  C      . LEU B  1 155 ? 26.367  -16.809 -12.941 1.00 72.16  ? 154 LEU B C      1 
ATOM   8040  O  O      . LEU B  1 155 ? 27.327  -17.547 -13.165 1.00 70.66  ? 154 LEU B O      1 
ATOM   8041  C  CB     . LEU B  1 155 ? 26.993  -15.540 -10.893 1.00 79.09  ? 154 LEU B CB     1 
ATOM   8042  C  CG     . LEU B  1 155 ? 26.547  -14.693 -9.702  1.00 84.20  ? 154 LEU B CG     1 
ATOM   8043  C  CD1    . LEU B  1 155 ? 27.749  -13.978 -9.110  1.00 73.93  ? 154 LEU B CD1    1 
ATOM   8044  C  CD2    . LEU B  1 155 ? 25.479  -13.695 -10.123 1.00 84.69  ? 154 LEU B CD2    1 
ATOM   8045  H  H      . LEU B  1 155 ? 26.614  -18.053 -10.518 1.00 68.39  ? 154 LEU B H      1 
ATOM   8046  H  HA     . LEU B  1 155 ? 25.091  -16.029 -11.527 1.00 80.78  ? 154 LEU B HA     1 
ATOM   8047  H  HB2    . LEU B  1 155 ? 27.748  -16.073 -10.597 1.00 94.90  ? 154 LEU B HB2    1 
ATOM   8048  H  HB3    . LEU B  1 155 ? 27.289  -14.926 -11.584 1.00 94.90  ? 154 LEU B HB3    1 
ATOM   8049  H  HG     . LEU B  1 155 ? 26.172  -15.272 -9.020  1.00 101.04 ? 154 LEU B HG     1 
ATOM   8050  H  HD11   . LEU B  1 155 ? 27.461  -13.449 -8.363  1.00 88.72  ? 154 LEU B HD11   1 
ATOM   8051  H  HD12   . LEU B  1 155 ? 28.390  -14.632 -8.821  1.00 88.72  ? 154 LEU B HD12   1 
ATOM   8052  H  HD13   . LEU B  1 155 ? 28.137  -13.413 -9.782  1.00 88.72  ? 154 LEU B HD13   1 
ATOM   8053  H  HD21   . LEU B  1 155 ? 25.217  -13.177 -9.358  1.00 101.63 ? 154 LEU B HD21   1 
ATOM   8054  H  HD22   . LEU B  1 155 ? 25.840  -13.120 -10.801 1.00 101.63 ? 154 LEU B HD22   1 
ATOM   8055  H  HD23   . LEU B  1 155 ? 24.723  -14.175 -10.468 1.00 101.63 ? 154 LEU B HD23   1 
ATOM   8056  N  N      . ASN B  1 156 ? 25.634  -16.270 -13.912 1.00 63.85  ? 155 ASN B N      1 
ATOM   8057  C  CA     . ASN B  1 156 ? 26.051  -16.379 -15.305 1.00 79.02  ? 155 ASN B CA     1 
ATOM   8058  C  C      . ASN B  1 156 ? 27.029  -15.254 -15.630 1.00 75.16  ? 155 ASN B C      1 
ATOM   8059  O  O      . ASN B  1 156 ? 27.427  -14.501 -14.744 1.00 68.90  ? 155 ASN B O      1 
ATOM   8060  C  CB     . ASN B  1 156 ? 24.849  -16.387 -16.260 1.00 73.55  ? 155 ASN B CB     1 
ATOM   8061  C  CG     . ASN B  1 156 ? 24.154  -15.042 -16.352 1.00 60.90  ? 155 ASN B CG     1 
ATOM   8062  O  OD1    . ASN B  1 156 ? 24.760  -13.994 -16.134 1.00 58.05  ? 155 ASN B OD1    1 
ATOM   8063  N  ND2    . ASN B  1 156 ? 22.870  -15.069 -16.698 1.00 58.97  ? 155 ASN B ND2    1 
ATOM   8064  H  H      . ASN B  1 156 ? 24.899  -15.839 -13.791 1.00 76.62  ? 155 ASN B H      1 
ATOM   8065  H  HA     . ASN B  1 156 ? 26.527  -17.228 -15.422 1.00 94.82  ? 155 ASN B HA     1 
ATOM   8066  H  HB2    . ASN B  1 156 ? 25.155  -16.626 -17.149 1.00 88.26  ? 155 ASN B HB2    1 
ATOM   8067  H  HB3    . ASN B  1 156 ? 24.201  -17.037 -15.946 1.00 88.26  ? 155 ASN B HB3    1 
ATOM   8068  H  HD21   . ASN B  1 156 ? 22.482  -15.820 -16.854 1.00 70.76  ? 155 ASN B HD21   1 
ATOM   8069  H  HD22   . ASN B  1 156 ? 22.427  -14.334 -16.765 1.00 70.76  ? 155 ASN B HD22   1 
ATOM   8070  N  N      . THR B  1 157 ? 27.422  -15.143 -16.893 1.00 84.77  ? 156 THR B N      1 
ATOM   8071  C  CA     . THR B  1 157 ? 28.452  -14.186 -17.278 1.00 78.13  ? 156 THR B CA     1 
ATOM   8072  C  C      . THR B  1 157 ? 27.943  -12.748 -17.281 1.00 70.96  ? 156 THR B C      1 
ATOM   8073  O  O      . THR B  1 157 ? 28.720  -11.816 -17.085 1.00 55.57  ? 156 THR B O      1 
ATOM   8074  C  CB     . THR B  1 157 ? 29.030  -14.524 -18.659 1.00 75.91  ? 156 THR B CB     1 
ATOM   8075  O  OG1    . THR B  1 157 ? 27.960  -14.791 -19.574 1.00 88.27  ? 156 THR B OG1    1 
ATOM   8076  C  CG2    . THR B  1 157 ? 29.930  -15.744 -18.566 1.00 71.24  ? 156 THR B CG2    1 
ATOM   8077  H  H      . THR B  1 157 ? 27.109  -15.608 -17.545 1.00 101.73 ? 156 THR B H      1 
ATOM   8078  H  HA     . THR B  1 157 ? 29.185  -14.239 -16.629 1.00 93.76  ? 156 THR B HA     1 
ATOM   8079  H  HB     . THR B  1 157 ? 29.556  -13.777 -18.983 1.00 91.09  ? 156 THR B HB     1 
ATOM   8080  H  HG1    . THR B  1 157 ? 27.476  -14.132 -19.639 1.00 105.92 ? 156 THR B HG1    1 
ATOM   8081  H  HG21   . THR B  1 157 ? 30.290  -15.953 -19.432 1.00 85.48  ? 156 THR B HG21   1 
ATOM   8082  H  HG22   . THR B  1 157 ? 30.655  -15.572 -17.960 1.00 85.48  ? 156 THR B HG22   1 
ATOM   8083  H  HG23   . THR B  1 157 ? 29.429  -16.498 -18.247 1.00 85.48  ? 156 THR B HG23   1 
ATOM   8084  N  N      . GLU B  1 158 ? 26.643  -12.566 -17.495 1.00 77.67  ? 157 GLU B N      1 
ATOM   8085  C  CA     . GLU B  1 158 ? 26.069  -11.223 -17.513 1.00 79.61  ? 157 GLU B CA     1 
ATOM   8086  C  C      . GLU B  1 158 ? 25.829  -10.706 -16.095 1.00 87.41  ? 157 GLU B C      1 
ATOM   8087  O  O      . GLU B  1 158 ? 25.624  -9.508  -15.891 1.00 97.43  ? 157 GLU B O      1 
ATOM   8088  C  CB     . GLU B  1 158 ? 24.768  -11.186 -18.320 1.00 86.65  ? 157 GLU B CB     1 
ATOM   8089  C  CG     . GLU B  1 158 ? 24.930  -11.587 -19.774 1.00 84.41  ? 157 GLU B CG     1 
ATOM   8090  C  CD     . GLU B  1 158 ? 24.728  -13.075 -19.992 1.00 118.34 ? 157 GLU B CD     1 
ATOM   8091  O  OE1    . GLU B  1 158 ? 25.465  -13.663 -20.811 1.00 127.11 ? 157 GLU B OE1    1 
ATOM   8092  O  OE2    . GLU B  1 158 ? 23.828  -13.656 -19.347 1.00 122.70 ? 157 GLU B OE2    1 
ATOM   8093  H  H      . GLU B  1 158 ? 26.076  -13.198 -17.632 1.00 93.20  ? 157 GLU B H      1 
ATOM   8094  H  HA     . GLU B  1 158 ? 26.704  -10.617 -17.947 1.00 95.53  ? 157 GLU B HA     1 
ATOM   8095  H  HB2    . GLU B  1 158 ? 24.132  -11.796 -17.914 1.00 103.98 ? 157 GLU B HB2    1 
ATOM   8096  H  HB3    . GLU B  1 158 ? 24.414  -10.283 -18.300 1.00 103.98 ? 157 GLU B HB3    1 
ATOM   8097  H  HG2    . GLU B  1 158 ? 24.275  -11.112 -20.309 1.00 101.29 ? 157 GLU B HG2    1 
ATOM   8098  H  HG3    . GLU B  1 158 ? 25.827  -11.359 -20.067 1.00 101.29 ? 157 GLU B HG3    1 
ATOM   8099  N  N      . GLY B  1 159 ? 25.849  -11.613 -15.120 1.00 78.99  ? 158 GLY B N      1 
ATOM   8100  C  CA     . GLY B  1 159 ? 25.781  -11.232 -13.720 1.00 65.19  ? 158 GLY B CA     1 
ATOM   8101  C  C      . GLY B  1 159 ? 24.469  -11.553 -13.027 1.00 75.99  ? 158 GLY B C      1 
ATOM   8102  O  O      . GLY B  1 159 ? 24.193  -11.022 -11.950 1.00 99.39  ? 158 GLY B O      1 
ATOM   8103  H  H      . GLY B  1 159 ? 25.903  -12.461 -15.250 1.00 94.79  ? 158 GLY B H      1 
ATOM   8104  H  HA2    . GLY B  1 159 ? 26.491  -11.684 -13.238 1.00 78.23  ? 158 GLY B HA2    1 
ATOM   8105  H  HA3    . GLY B  1 159 ? 25.930  -10.277 -13.648 1.00 78.23  ? 158 GLY B HA3    1 
ATOM   8106  N  N      . HIS B  1 160 ? 23.660  -12.422 -13.628 1.00 56.35  ? 159 HIS B N      1 
ATOM   8107  C  CA     . HIS B  1 160 ? 22.379  -12.792 -13.033 1.00 72.51  ? 159 HIS B CA     1 
ATOM   8108  C  C      . HIS B  1 160 ? 22.497  -14.027 -12.153 1.00 85.49  ? 159 HIS B C      1 
ATOM   8109  O  O      . HIS B  1 160 ? 22.855  -15.107 -12.626 1.00 88.27  ? 159 HIS B O      1 
ATOM   8110  C  CB     . HIS B  1 160 ? 21.332  -13.041 -14.113 1.00 84.80  ? 159 HIS B CB     1 
ATOM   8111  C  CG     . HIS B  1 160 ? 21.042  -11.840 -14.954 1.00 90.16  ? 159 HIS B CG     1 
ATOM   8112  N  ND1    . HIS B  1 160 ? 21.935  -11.354 -15.883 1.00 84.37  ? 159 HIS B ND1    1 
ATOM   8113  C  CD2    . HIS B  1 160 ? 19.964  -11.023 -15.002 1.00 86.84  ? 159 HIS B CD2    1 
ATOM   8114  C  CE1    . HIS B  1 160 ? 21.418  -10.292 -16.469 1.00 100.03 ? 159 HIS B CE1    1 
ATOM   8115  N  NE2    . HIS B  1 160 ? 20.223  -10.067 -15.955 1.00 95.51  ? 159 HIS B NE2    1 
ATOM   8116  H  H      . HIS B  1 160 ? 23.829  -12.810 -14.376 1.00 67.62  ? 159 HIS B H      1 
ATOM   8117  H  HA     . HIS B  1 160 ? 22.064  -12.052 -12.472 1.00 87.02  ? 159 HIS B HA     1 
ATOM   8118  H  HB2    . HIS B  1 160 ? 21.648  -13.745 -14.700 1.00 101.76 ? 159 HIS B HB2    1 
ATOM   8119  H  HB3    . HIS B  1 160 ? 20.503  -13.313 -13.688 1.00 101.76 ? 159 HIS B HB3    1 
ATOM   8120  H  HD1    . HIS B  1 160 ? 22.708  -11.691 -16.055 1.00 101.24 ? 159 HIS B HD1    1 
ATOM   8121  H  HD2    . HIS B  1 160 ? 19.193  -11.096 -14.487 1.00 104.21 ? 159 HIS B HD2    1 
ATOM   8122  H  HE1    . HIS B  1 160 ? 21.827  -9.786  -17.134 1.00 120.04 ? 159 HIS B HE1    1 
ATOM   8123  H  HE2    . HIS B  1 160 ? 19.694  -9.428  -16.179 1.00 114.61 ? 159 HIS B HE2    1 
ATOM   8124  N  N      . ALA B  1 161 ? 22.190  -13.857 -10.872 1.00 77.40  ? 160 ALA B N      1 
ATOM   8125  C  CA     . ALA B  1 161 ? 22.196  -14.966 -9.931  1.00 61.15  ? 160 ALA B CA     1 
ATOM   8126  C  C      . ALA B  1 161 ? 20.983  -15.856 -10.178 1.00 65.65  ? 160 ALA B C      1 
ATOM   8127  O  O      . ALA B  1 161 ? 19.909  -15.370 -10.539 1.00 52.87  ? 160 ALA B O      1 
ATOM   8128  C  CB     . ALA B  1 161 ? 22.194  -14.450 -8.512  1.00 84.17  ? 160 ALA B CB     1 
ATOM   8129  H  H      . ALA B  1 161 ? 21.972  -13.103 -10.521 1.00 92.88  ? 160 ALA B H      1 
ATOM   8130  H  HA     . ALA B  1 161 ? 23.006  -15.502 -10.065 1.00 73.38  ? 160 ALA B HA     1 
ATOM   8131  H  HB1    . ALA B  1 161 ? 22.198  -15.196 -7.908  1.00 101.00 ? 160 ALA B HB1    1 
ATOM   8132  H  HB2    . ALA B  1 161 ? 22.977  -13.912 -8.374  1.00 101.00 ? 160 ALA B HB2    1 
ATOM   8133  H  HB3    . ALA B  1 161 ? 21.404  -13.921 -8.374  1.00 101.00 ? 160 ALA B HB3    1 
ATOM   8134  N  N      . LYS B  1 162 ? 21.156  -17.160 -9.981  1.00 54.82  ? 161 LYS B N      1 
ATOM   8135  C  CA     . LYS B  1 162 ? 20.095  -18.116 -10.271 1.00 49.67  ? 161 LYS B CA     1 
ATOM   8136  C  C      . LYS B  1 162 ? 20.044  -19.251 -9.248  1.00 70.68  ? 161 LYS B C      1 
ATOM   8137  O  O      . LYS B  1 162 ? 21.077  -19.747 -8.793  1.00 61.21  ? 161 LYS B O      1 
ATOM   8138  C  CB     . LYS B  1 162 ? 20.272  -18.672 -11.685 1.00 56.76  ? 161 LYS B CB     1 
ATOM   8139  C  CG     . LYS B  1 162 ? 19.920  -17.673 -12.781 1.00 61.66  ? 161 LYS B CG     1 
ATOM   8140  C  CD     . LYS B  1 162 ? 20.684  -17.950 -14.064 1.00 71.86  ? 161 LYS B CD     1 
ATOM   8141  C  CE     . LYS B  1 162 ? 20.346  -16.937 -15.145 1.00 79.54  ? 161 LYS B CE     1 
ATOM   8142  N  NZ     . LYS B  1 162 ? 18.947  -17.081 -15.631 1.00 85.33  ? 161 LYS B NZ     1 
ATOM   8143  H  H      . LYS B  1 162 ? 21.879  -17.516 -9.681  1.00 65.78  ? 161 LYS B H      1 
ATOM   8144  H  HA     . LYS B  1 162 ? 19.234  -17.648 -10.240 1.00 59.61  ? 161 LYS B HA     1 
ATOM   8145  H  HB2    . LYS B  1 162 ? 21.198  -18.932 -11.806 1.00 68.11  ? 161 LYS B HB2    1 
ATOM   8146  H  HB3    . LYS B  1 162 ? 19.696  -19.445 -11.792 1.00 68.11  ? 161 LYS B HB3    1 
ATOM   8147  H  HG2    . LYS B  1 162 ? 18.971  -17.732 -12.974 1.00 74.00  ? 161 LYS B HG2    1 
ATOM   8148  H  HG3    . LYS B  1 162 ? 20.145  -16.778 -12.481 1.00 74.00  ? 161 LYS B HG3    1 
ATOM   8149  H  HD2    . LYS B  1 162 ? 21.636  -17.899 -13.886 1.00 86.23  ? 161 LYS B HD2    1 
ATOM   8150  H  HD3    . LYS B  1 162 ? 20.450  -18.832 -14.391 1.00 86.23  ? 161 LYS B HD3    1 
ATOM   8151  H  HE2    . LYS B  1 162 ? 20.451  -16.041 -14.787 1.00 95.44  ? 161 LYS B HE2    1 
ATOM   8152  H  HE3    . LYS B  1 162 ? 20.943  -17.066 -15.899 1.00 95.44  ? 161 LYS B HE3    1 
ATOM   8153  H  HZ1    . LYS B  1 162 ? 18.780  -16.476 -16.262 1.00 102.39 ? 161 LYS B HZ1    1 
ATOM   8154  H  HZ2    . LYS B  1 162 ? 18.826  -17.895 -15.971 1.00 102.39 ? 161 LYS B HZ2    1 
ATOM   8155  H  HZ3    . LYS B  1 162 ? 18.378  -16.962 -14.958 1.00 102.39 ? 161 LYS B HZ3    1 
ATOM   8156  N  N      . LEU B  1 163 ? 18.827  -19.652 -8.892  1.00 65.98  ? 162 LEU B N      1 
ATOM   8157  C  CA     . LEU B  1 163 ? 18.612  -20.706 -7.910  1.00 64.15  ? 162 LEU B CA     1 
ATOM   8158  C  C      . LEU B  1 163 ? 18.889  -22.073 -8.520  1.00 76.79  ? 162 LEU B C      1 
ATOM   8159  O  O      . LEU B  1 163 ? 18.443  -22.371 -9.628  1.00 86.81  ? 162 LEU B O      1 
ATOM   8160  C  CB     . LEU B  1 163 ? 17.176  -20.648 -7.387  1.00 69.23  ? 162 LEU B CB     1 
ATOM   8161  C  CG     . LEU B  1 163 ? 16.794  -19.330 -6.715  1.00 62.42  ? 162 LEU B CG     1 
ATOM   8162  C  CD1    . LEU B  1 163 ? 15.315  -19.308 -6.363  1.00 52.97  ? 162 LEU B CD1    1 
ATOM   8163  C  CD2    . LEU B  1 163 ? 17.645  -19.106 -5.479  1.00 60.01  ? 162 LEU B CD2    1 
ATOM   8164  H  H      . LEU B  1 163 ? 18.099  -19.322 -9.210  1.00 79.18  ? 162 LEU B H      1 
ATOM   8165  H  HA     . LEU B  1 163 ? 19.222  -20.575 -7.154  1.00 76.98  ? 162 LEU B HA     1 
ATOM   8166  H  HB2    . LEU B  1 163 ? 16.570  -20.784 -8.132  1.00 83.08  ? 162 LEU B HB2    1 
ATOM   8167  H  HB3    . LEU B  1 163 ? 17.056  -21.356 -6.735  1.00 83.08  ? 162 LEU B HB3    1 
ATOM   8168  H  HG     . LEU B  1 163 ? 16.965  -18.601 -7.331  1.00 74.90  ? 162 LEU B HG     1 
ATOM   8169  H  HD11   . LEU B  1 163 ? 15.106  -18.470 -5.944  1.00 63.56  ? 162 LEU B HD11   1 
ATOM   8170  H  HD12   . LEU B  1 163 ? 14.801  -19.409 -7.168  1.00 63.56  ? 162 LEU B HD12   1 
ATOM   8171  H  HD13   . LEU B  1 163 ? 15.126  -20.032 -5.762  1.00 63.56  ? 162 LEU B HD13   1 
ATOM   8172  H  HD21   . LEU B  1 163 ? 17.391  -18.275 -5.071  1.00 72.01  ? 162 LEU B HD21   1 
ATOM   8173  H  HD22   . LEU B  1 163 ? 17.500  -19.830 -4.865  1.00 72.01  ? 162 LEU B HD22   1 
ATOM   8174  H  HD23   . LEU B  1 163 ? 18.569  -19.076 -5.737  1.00 72.01  ? 162 LEU B HD23   1 
ATOM   8175  N  N      . ALA B  1 164 ? 19.622  -22.903 -7.784  1.00 81.85  ? 163 ALA B N      1 
ATOM   8176  C  CA     . ALA B  1 164 ? 20.004  -24.226 -8.262  1.00 72.81  ? 163 ALA B CA     1 
ATOM   8177  C  C      . ALA B  1 164 ? 19.885  -25.272 -7.155  1.00 88.52  ? 163 ALA B C      1 
ATOM   8178  O  O      . ALA B  1 164 ? 19.684  -24.937 -5.986  1.00 83.03  ? 163 ALA B O      1 
ATOM   8179  C  CB     . ALA B  1 164 ? 21.427  -24.191 -8.805  1.00 50.96  ? 163 ALA B CB     1 
ATOM   8180  H  H      . ALA B  1 164 ? 19.913  -22.721 -6.996  1.00 98.22  ? 163 ALA B H      1 
ATOM   8181  H  HA     . ALA B  1 164 ? 19.405  -24.487 -8.993  1.00 87.37  ? 163 ALA B HA     1 
ATOM   8182  H  HB1    . ALA B  1 164 ? 21.664  -25.068 -9.116  1.00 61.15  ? 163 ALA B HB1    1 
ATOM   8183  H  HB2    . ALA B  1 164 ? 21.470  -23.564 -9.530  1.00 61.15  ? 163 ALA B HB2    1 
ATOM   8184  H  HB3    . ALA B  1 164 ? 22.022  -23.921 -8.102  1.00 61.15  ? 163 ALA B HB3    1 
ATOM   8185  N  N      . ASP B  1 165 ? 20.008  -26.539 -7.543  1.00 85.42  ? 164 ASP B N      1 
ATOM   8186  C  CA     . ASP B  1 165 ? 19.994  -27.656 -6.603  1.00 67.89  ? 164 ASP B CA     1 
ATOM   8187  C  C      . ASP B  1 165 ? 18.881  -27.523 -5.560  1.00 70.57  ? 164 ASP B C      1 
ATOM   8188  O  O      . ASP B  1 165 ? 19.144  -27.442 -4.357  1.00 67.70  ? 164 ASP B O      1 
ATOM   8189  C  CB     . ASP B  1 165 ? 21.358  -27.787 -5.910  1.00 81.17  ? 164 ASP B CB     1 
ATOM   8190  C  CG     . ASP B  1 165 ? 22.426  -28.390 -6.814  1.00 101.92 ? 164 ASP B CG     1 
ATOM   8191  O  OD1    . ASP B  1 165 ? 23.585  -27.924 -6.765  1.00 106.41 ? 164 ASP B OD1    1 
ATOM   8192  O  OD2    . ASP B  1 165 ? 22.117  -29.333 -7.569  1.00 119.61 ? 164 ASP B OD2    1 
ATOM   8193  H  H      . ASP B  1 165 ? 20.102  -26.782 -8.363  1.00 102.51 ? 164 ASP B H      1 
ATOM   8194  H  HA     . ASP B  1 165 ? 19.835  -28.483 -7.103  1.00 81.46  ? 164 ASP B HA     1 
ATOM   8195  H  HB2    . ASP B  1 165 ? 21.660  -26.907 -5.637  1.00 97.41  ? 164 ASP B HB2    1 
ATOM   8196  H  HB3    . ASP B  1 165 ? 21.264  -28.361 -5.134  1.00 97.41  ? 164 ASP B HB3    1 
ATOM   8197  N  N      . PHE B  1 166 ? 17.637  -27.517 -6.029  1.00 61.41  ? 165 PHE B N      1 
ATOM   8198  C  CA     . PHE B  1 166 ? 16.483  -27.453 -5.140  1.00 57.58  ? 165 PHE B CA     1 
ATOM   8199  C  C      . PHE B  1 166 ? 16.421  -28.671 -4.226  1.00 68.11  ? 165 PHE B C      1 
ATOM   8200  O  O      . PHE B  1 166 ? 16.891  -29.753 -4.578  1.00 90.93  ? 165 PHE B O      1 
ATOM   8201  C  CB     . PHE B  1 166 ? 15.184  -27.401 -5.945  1.00 76.69  ? 165 PHE B CB     1 
ATOM   8202  C  CG     . PHE B  1 166 ? 14.916  -26.076 -6.597  1.00 78.41  ? 165 PHE B CG     1 
ATOM   8203  C  CD1    . PHE B  1 166 ? 13.614  -25.690 -6.870  1.00 79.96  ? 165 PHE B CD1    1 
ATOM   8204  C  CD2    . PHE B  1 166 ? 15.952  -25.226 -6.951  1.00 83.44  ? 165 PHE B CD2    1 
ATOM   8205  C  CE1    . PHE B  1 166 ? 13.346  -24.479 -7.470  1.00 84.86  ? 165 PHE B CE1    1 
ATOM   8206  C  CE2    . PHE B  1 166 ? 15.687  -24.009 -7.555  1.00 96.25  ? 165 PHE B CE2    1 
ATOM   8207  C  CZ     . PHE B  1 166 ? 14.382  -23.637 -7.815  1.00 94.83  ? 165 PHE B CZ     1 
ATOM   8208  H  H      . PHE B  1 166 ? 17.433  -27.550 -6.864  1.00 73.69  ? 165 PHE B H      1 
ATOM   8209  H  HA     . PHE B  1 166 ? 16.539  -26.648 -4.584  1.00 69.10  ? 165 PHE B HA     1 
ATOM   8210  H  HB2    . PHE B  1 166 ? 15.224  -28.072 -6.644  1.00 92.03  ? 165 PHE B HB2    1 
ATOM   8211  H  HB3    . PHE B  1 166 ? 14.442  -27.592 -5.350  1.00 92.03  ? 165 PHE B HB3    1 
ATOM   8212  H  HD1    . PHE B  1 166 ? 12.911  -26.253 -6.639  1.00 95.95  ? 165 PHE B HD1    1 
ATOM   8213  H  HD2    . PHE B  1 166 ? 16.831  -25.472 -6.776  1.00 100.13 ? 165 PHE B HD2    1 
ATOM   8214  H  HE1    . PHE B  1 166 ? 12.467  -24.231 -7.645  1.00 101.83 ? 165 PHE B HE1    1 
ATOM   8215  H  HE2    . PHE B  1 166 ? 16.388  -23.443 -7.786  1.00 115.50 ? 165 PHE B HE2    1 
ATOM   8216  H  HZ     . PHE B  1 166 ? 14.203  -22.820 -8.221  1.00 113.79 ? 165 PHE B HZ     1 
ATOM   8217  N  N      . GLY B  1 167 ? 15.830  -28.485 -3.053  1.00 81.93  ? 166 GLY B N      1 
ATOM   8218  C  CA     . GLY B  1 167 ? 15.502  -29.594 -2.178  1.00 83.24  ? 166 GLY B CA     1 
ATOM   8219  C  C      . GLY B  1 167 ? 14.117  -30.103 -2.529  1.00 84.24  ? 166 GLY B C      1 
ATOM   8220  O  O      . GLY B  1 167 ? 13.337  -29.386 -3.159  1.00 82.51  ? 166 GLY B O      1 
ATOM   8221  H  H      . GLY B  1 167 ? 15.606  -27.716 -2.740  1.00 98.31  ? 166 GLY B H      1 
ATOM   8222  H  HA2    . GLY B  1 167 ? 16.144  -30.312 -2.293  1.00 99.89  ? 166 GLY B HA2    1 
ATOM   8223  H  HA3    . GLY B  1 167 ? 15.510  -29.304 -1.253  1.00 99.89  ? 166 GLY B HA3    1 
ATOM   8224  N  N      . VAL B  1 168 ? 13.804  -31.331 -2.124  1.00 77.05  ? 167 VAL B N      1 
ATOM   8225  C  CA     . VAL B  1 168 ? 12.531  -31.946 -2.489  1.00 67.47  ? 167 VAL B CA     1 
ATOM   8226  C  C      . VAL B  1 168 ? 11.657  -32.216 -1.268  1.00 80.28  ? 167 VAL B C      1 
ATOM   8227  O  O      . VAL B  1 168 ? 12.156  -32.535 -0.188  1.00 78.91  ? 167 VAL B O      1 
ATOM   8228  C  CB     . VAL B  1 168 ? 12.743  -33.261 -3.263  1.00 79.78  ? 167 VAL B CB     1 
ATOM   8229  C  CG1    . VAL B  1 168 ? 14.169  -33.342 -3.792  1.00 94.05  ? 167 VAL B CG1    1 
ATOM   8230  C  CG2    . VAL B  1 168 ? 12.420  -34.463 -2.388  1.00 72.10  ? 167 VAL B CG2    1 
ATOM   8231  H  H      . VAL B  1 168 ? 14.311  -31.828 -1.639  1.00 92.46  ? 167 VAL B H      1 
ATOM   8232  H  HA     . VAL B  1 168 ? 12.042  -31.331 -3.075  1.00 80.97  ? 167 VAL B HA     1 
ATOM   8233  H  HB     . VAL B  1 168 ? 12.135  -33.278 -4.032  1.00 95.74  ? 167 VAL B HB     1 
ATOM   8234  H  HG11   . VAL B  1 168 ? 14.278  -34.168 -4.270  1.00 112.86 ? 167 VAL B HG11   1 
ATOM   8235  H  HG12   . VAL B  1 168 ? 14.326  -32.600 -4.380  1.00 112.86 ? 167 VAL B HG12   1 
ATOM   8236  H  HG13   . VAL B  1 168 ? 14.779  -33.309 -3.052  1.00 112.86 ? 167 VAL B HG13   1 
ATOM   8237  H  HG21   . VAL B  1 168 ? 12.561  -35.265 -2.896  1.00 86.52  ? 167 VAL B HG21   1 
ATOM   8238  H  HG22   . VAL B  1 168 ? 12.998  -34.455 -1.621  1.00 86.52  ? 167 VAL B HG22   1 
ATOM   8239  H  HG23   . VAL B  1 168 ? 11.503  -34.409 -2.109  1.00 86.52  ? 167 VAL B HG23   1 
ATOM   8240  N  N      . ALA B  1 169 ? 10.346  -32.097 -1.458  1.00 87.63  ? 168 ALA B N      1 
ATOM   8241  C  CA     . ALA B  1 169 ? 9.389   -32.255 -0.368  1.00 76.41  ? 168 ALA B CA     1 
ATOM   8242  C  C      . ALA B  1 169 ? 9.571   -33.586 0.353   1.00 73.21  ? 168 ALA B C      1 
ATOM   8243  O  O      . ALA B  1 169 ? 9.704   -34.634 -0.277  1.00 100.73 ? 168 ALA B O      1 
ATOM   8244  C  CB     . ALA B  1 169 ? 7.965   -32.132 -0.896  1.00 81.74  ? 168 ALA B CB     1 
ATOM   8245  H  H      . ALA B  1 169 ? 9.983   -31.923 -2.217  1.00 105.16 ? 168 ALA B H      1 
ATOM   8246  H  HA     . ALA B  1 169 ? 9.531   -31.538 0.285   1.00 91.69  ? 168 ALA B HA     1 
ATOM   8247  H  HB1    . ALA B  1 169 ? 7.351   -32.239 -0.166  1.00 98.09  ? 168 ALA B HB1    1 
ATOM   8248  H  HB2    . ALA B  1 169 ? 7.854   -31.266 -1.295  1.00 98.09  ? 168 ALA B HB2    1 
ATOM   8249  H  HB3    . ALA B  1 169 ? 7.816   -32.816 -1.553  1.00 98.09  ? 168 ALA B HB3    1 
ATOM   8250  N  N      . GLY B  1 170 ? 9.578   -33.533 1.680   1.00 97.56  ? 169 GLY B N      1 
ATOM   8251  C  CA     . GLY B  1 170 ? 9.685   -34.727 2.496   1.00 93.85  ? 169 GLY B CA     1 
ATOM   8252  C  C      . GLY B  1 170 ? 11.101  -35.264 2.572   1.00 102.84 ? 169 GLY B C      1 
ATOM   8253  O  O      . GLY B  1 170 ? 11.312  -36.401 2.991   1.00 114.56 ? 169 GLY B O      1 
ATOM   8254  H  H      . GLY B  1 170 ? 9.522   -32.805 2.134   1.00 117.07 ? 169 GLY B H      1 
ATOM   8255  H  HA2    . GLY B  1 170 ? 9.385   -34.528 3.396   1.00 112.62 ? 169 GLY B HA2    1 
ATOM   8256  H  HA3    . GLY B  1 170 ? 9.115   -35.419 2.128   1.00 112.62 ? 169 GLY B HA3    1 
ATOM   8257  N  N      . GLN B  1 171 ? 12.077  -34.452 2.175   1.00 101.25 ? 170 GLN B N      1 
ATOM   8258  C  CA     . GLN B  1 171 ? 13.468  -34.893 2.183   1.00 104.52 ? 170 GLN B CA     1 
ATOM   8259  C  C      . GLN B  1 171 ? 13.994  -35.072 3.608   1.00 114.26 ? 170 GLN B C      1 
ATOM   8260  O  O      . GLN B  1 171 ? 15.085  -35.603 3.811   1.00 123.59 ? 170 GLN B O      1 
ATOM   8261  C  CB     . GLN B  1 171 ? 14.362  -33.922 1.401   1.00 91.64  ? 170 GLN B CB     1 
ATOM   8262  C  CG     . GLN B  1 171 ? 14.481  -32.537 2.003   1.00 99.21  ? 170 GLN B CG     1 
ATOM   8263  C  CD     . GLN B  1 171 ? 15.482  -31.671 1.262   1.00 109.57 ? 170 GLN B CD     1 
ATOM   8264  O  OE1    . GLN B  1 171 ? 15.559  -31.701 0.033   1.00 125.18 ? 170 GLN B OE1    1 
ATOM   8265  N  NE2    . GLN B  1 171 ? 16.267  -30.905 2.010   1.00 99.95  ? 170 GLN B NE2    1 
ATOM   8266  H  H      . GLN B  1 171 ? 11.961  -33.646 1.897   1.00 121.50 ? 170 GLN B H      1 
ATOM   8267  H  HA     . GLN B  1 171 ? 13.520  -35.764 1.738   1.00 125.43 ? 170 GLN B HA     1 
ATOM   8268  H  HB2    . GLN B  1 171 ? 15.255  -34.297 1.351   1.00 109.97 ? 170 GLN B HB2    1 
ATOM   8269  H  HB3    . GLN B  1 171 ? 14.000  -33.823 0.507   1.00 109.97 ? 170 GLN B HB3    1 
ATOM   8270  H  HG2    . GLN B  1 171 ? 13.616  -32.098 1.965   1.00 119.05 ? 170 GLN B HG2    1 
ATOM   8271  H  HG3    . GLN B  1 171 ? 14.774  -32.615 2.925   1.00 119.05 ? 170 GLN B HG3    1 
ATOM   8272  H  HE21   . GLN B  1 171 ? 16.191  -30.919 2.867   1.00 119.94 ? 170 GLN B HE21   1 
ATOM   8273  H  HE22   . GLN B  1 171 ? 16.852  -30.396 1.639   1.00 119.94 ? 170 GLN B HE22   1 
ATOM   8274  N  N      . LEU B  1 172 ? 13.215  -34.628 4.591   1.00 117.01 ? 171 LEU B N      1 
ATOM   8275  C  CA     . LEU B  1 172 ? 13.558  -34.829 5.995   1.00 117.64 ? 171 LEU B CA     1 
ATOM   8276  C  C      . LEU B  1 172 ? 12.878  -36.079 6.556   1.00 117.01 ? 171 LEU B C      1 
ATOM   8277  O  O      . LEU B  1 172 ? 13.120  -36.463 7.699   1.00 119.67 ? 171 LEU B O      1 
ATOM   8278  C  CB     . LEU B  1 172 ? 13.140  -33.609 6.819   1.00 113.07 ? 171 LEU B CB     1 
ATOM   8279  C  CG     . LEU B  1 172 ? 13.962  -32.336 6.626   1.00 107.99 ? 171 LEU B CG     1 
ATOM   8280  C  CD1    . LEU B  1 172 ? 13.254  -31.156 7.267   1.00 109.63 ? 171 LEU B CD1    1 
ATOM   8281  C  CD2    . LEU B  1 172 ? 15.354  -32.502 7.211   1.00 102.99 ? 171 LEU B CD2    1 
ATOM   8282  H  H      . LEU B  1 172 ? 12.476  -34.204 4.469   1.00 140.41 ? 171 LEU B H      1 
ATOM   8283  H  HA     . LEU B  1 172 ? 14.528  -34.941 6.080   1.00 141.17 ? 171 LEU B HA     1 
ATOM   8284  H  HB2    . LEU B  1 172 ? 12.221  -33.394 6.596   1.00 135.68 ? 171 LEU B HB2    1 
ATOM   8285  H  HB3    . LEU B  1 172 ? 13.194  -33.846 7.758   1.00 135.68 ? 171 LEU B HB3    1 
ATOM   8286  H  HG     . LEU B  1 172 ? 14.052  -32.155 5.677   1.00 129.58 ? 171 LEU B HG     1 
ATOM   8287  H  HD11   . LEU B  1 172 ? 13.784  -30.366 7.136   1.00 131.56 ? 171 LEU B HD11   1 
ATOM   8288  H  HD12   . LEU B  1 172 ? 12.394  -31.047 6.854   1.00 131.56 ? 171 LEU B HD12   1 
ATOM   8289  H  HD13   . LEU B  1 172 ? 13.149  -31.329 8.205   1.00 131.56 ? 171 LEU B HD13   1 
ATOM   8290  H  HD21   . LEU B  1 172 ? 15.848  -31.691 7.077   1.00 123.59 ? 171 LEU B HD21   1 
ATOM   8291  H  HD22   . LEU B  1 172 ? 15.277  -32.688 8.150   1.00 123.59 ? 171 LEU B HD22   1 
ATOM   8292  H  HD23   . LEU B  1 172 ? 15.793  -33.231 6.768   1.00 123.59 ? 171 LEU B HD23   1 
ATOM   8293  N  N      . THR B  1 173 ? 12.031  -36.709 5.747   1.00 122.61 ? 172 THR B N      1 
ATOM   8294  C  CA     . THR B  1 173 ? 11.199  -37.815 6.211   1.00 114.82 ? 172 THR B CA     1 
ATOM   8295  C  C      . THR B  1 173 ? 11.386  -39.110 5.404   1.00 130.88 ? 172 THR B C      1 
ATOM   8296  O  O      . THR B  1 173 ? 10.854  -40.156 5.776   1.00 137.13 ? 172 THR B O      1 
ATOM   8297  C  CB     . THR B  1 173 ? 9.709   -37.413 6.159   1.00 111.59 ? 172 THR B CB     1 
ATOM   8298  O  OG1    . THR B  1 173 ? 9.537   -36.129 6.769   1.00 107.09 ? 172 THR B OG1    1 
ATOM   8299  C  CG2    . THR B  1 173 ? 8.845   -38.426 6.884   1.00 131.29 ? 172 THR B CG2    1 
ATOM   8300  H  H      . THR B  1 173 ? 11.919  -36.513 4.917   1.00 147.13 ? 172 THR B H      1 
ATOM   8301  H  HA     . THR B  1 173 ? 11.425  -38.009 7.145   1.00 137.79 ? 172 THR B HA     1 
ATOM   8302  H  HB     . THR B  1 173 ? 9.420   -37.371 5.234   1.00 133.91 ? 172 THR B HB     1 
ATOM   8303  H  HG1    . THR B  1 173 ? 8.747   -35.910 6.744   1.00 128.50 ? 172 THR B HG1    1 
ATOM   8304  H  HG21   . THR B  1 173 ? 7.924   -38.161 6.842   1.00 157.55 ? 172 THR B HG21   1 
ATOM   8305  H  HG22   . THR B  1 173 ? 8.940   -39.290 6.476   1.00 157.55 ? 172 THR B HG22   1 
ATOM   8306  H  HG23   . THR B  1 173 ? 9.111   -38.485 7.805   1.00 157.55 ? 172 THR B HG23   1 
ATOM   8307  N  N      . ASP B  1 174 ? 12.141  -39.043 4.309   1.00 145.32 ? 173 ASP B N      1 
ATOM   8308  C  CA     . ASP B  1 174 ? 12.307  -40.194 3.419   1.00 162.46 ? 173 ASP B CA     1 
ATOM   8309  C  C      . ASP B  1 174 ? 13.483  -41.087 3.807   1.00 176.78 ? 173 ASP B C      1 
ATOM   8310  O  O      . ASP B  1 174 ? 14.505  -41.134 3.119   1.00 145.97 ? 173 ASP B O      1 
ATOM   8311  C  CB     . ASP B  1 174 ? 12.458  -39.731 1.971   1.00 171.83 ? 173 ASP B CB     1 
ATOM   8312  C  CG     . ASP B  1 174 ? 11.168  -39.177 1.402   1.00 169.12 ? 173 ASP B CG     1 
ATOM   8313  O  OD1    . ASP B  1 174 ? 10.089  -39.518 1.932   1.00 146.89 ? 173 ASP B OD1    1 
ATOM   8314  O  OD2    . ASP B  1 174 ? 11.233  -38.403 0.423   1.00 174.18 ? 173 ASP B OD2    1 
ATOM   8315  H  H      . ASP B  1 174 ? 12.569  -38.341 4.058   1.00 174.39 ? 173 ASP B H      1 
ATOM   8316  H  HA     . ASP B  1 174 ? 11.496  -40.742 3.468   1.00 194.96 ? 173 ASP B HA     1 
ATOM   8317  H  HB2    . ASP B  1 174 ? 13.129  -39.031 1.931   1.00 206.20 ? 173 ASP B HB2    1 
ATOM   8318  H  HB3    . ASP B  1 174 ? 12.730  -40.484 1.424   1.00 206.20 ? 173 ASP B HB3    1 
ATOM   8319  N  N      . THR B  1 175 ? 13.311  -41.792 4.919   1.00 229.33 ? 174 THR B N      1 
ATOM   8320  C  CA     . THR B  1 175 ? 14.234  -42.836 5.359   1.00 260.37 ? 174 THR B CA     1 
ATOM   8321  C  C      . THR B  1 175 ? 15.583  -42.323 5.878   1.00 252.88 ? 174 THR B C      1 
ATOM   8322  O  O      . THR B  1 175 ? 15.617  -41.464 6.759   1.00 265.13 ? 174 THR B O      1 
ATOM   8323  C  CB     . THR B  1 175 ? 14.445  -43.890 4.266   1.00 281.04 ? 174 THR B CB     1 
ATOM   8324  O  OG1    . THR B  1 175 ? 13.191  -44.175 3.635   1.00 281.43 ? 174 THR B OG1    1 
ATOM   8325  C  CG2    . THR B  1 175 ? 15.002  -45.174 4.875   1.00 282.12 ? 174 THR B CG2    1 
ATOM   8326  H  H      . THR B  1 175 ? 12.646  -41.682 5.452   1.00 275.20 ? 174 THR B H      1 
ATOM   8327  H  HA     . THR B  1 175 ? 13.810  -43.299 6.111   1.00 312.44 ? 174 THR B HA     1 
ATOM   8328  H  HB     . THR B  1 175 ? 15.075  -43.559 3.607   1.00 337.24 ? 174 THR B HB     1 
ATOM   8329  H  HG1    . THR B  1 175 ? 13.293  -44.739 3.049   1.00 337.72 ? 174 THR B HG1    1 
ATOM   8330  H  HG21   . THR B  1 175 ? 15.133  -45.832 4.189   1.00 338.54 ? 174 THR B HG21   1 
ATOM   8331  H  HG22   . THR B  1 175 ? 15.844  -44.995 5.301   1.00 338.54 ? 174 THR B HG22   1 
ATOM   8332  H  HG23   . THR B  1 175 ? 14.389  -45.520 5.527   1.00 338.54 ? 174 THR B HG23   1 
ATOM   8333  N  N      . MET B  1 176 ? 16.689  -42.850 5.355   1.00 240.51 ? 175 MET B N      1 
ATOM   8334  C  CA     . MET B  1 176 ? 17.956  -42.731 6.063   1.00 221.99 ? 175 MET B CA     1 
ATOM   8335  C  C      . MET B  1 176 ? 19.140  -42.283 5.210   1.00 187.94 ? 175 MET B C      1 
ATOM   8336  O  O      . MET B  1 176 ? 20.289  -42.453 5.616   1.00 183.49 ? 175 MET B O      1 
ATOM   8337  C  CB     . MET B  1 176 ? 18.292  -44.078 6.700   1.00 233.96 ? 175 MET B CB     1 
ATOM   8338  C  CG     . MET B  1 176 ? 18.672  -45.146 5.688   1.00 239.89 ? 175 MET B CG     1 
ATOM   8339  S  SD     . MET B  1 176 ? 19.075  -46.736 6.434   1.00 263.04 ? 175 MET B SD     1 
ATOM   8340  C  CE     . MET B  1 176 ? 17.489  -47.224 7.105   1.00 244.03 ? 175 MET B CE     1 
ATOM   8341  H  H      . MET B  1 176 ? 16.730  -43.273 4.607   1.00 288.61 ? 175 MET B H      1 
ATOM   8342  H  HA     . MET B  1 176 ? 17.840  -42.085 6.790   1.00 266.38 ? 175 MET B HA     1 
ATOM   8343  H  HB2    . MET B  1 176 ? 19.041  -43.961 7.305   1.00 280.75 ? 175 MET B HB2    1 
ATOM   8344  H  HB3    . MET B  1 176 ? 17.517  -44.395 7.191   1.00 280.75 ? 175 MET B HB3    1 
ATOM   8345  H  HG2    . MET B  1 176 ? 17.927  -45.283 5.082   1.00 287.87 ? 175 MET B HG2    1 
ATOM   8346  H  HG3    . MET B  1 176 ? 19.449  -44.845 5.192   1.00 287.87 ? 175 MET B HG3    1 
ATOM   8347  H  HE1    . MET B  1 176 ? 17.582  -48.077 7.537   1.00 292.84 ? 175 MET B HE1    1 
ATOM   8348  H  HE2    . MET B  1 176 ? 17.202  -46.565 7.741   1.00 292.84 ? 175 MET B HE2    1 
ATOM   8349  H  HE3    . MET B  1 176 ? 16.853  -47.288 6.389   1.00 292.84 ? 175 MET B HE3    1 
ATOM   8350  N  N      . ALA B  1 177 ? 18.878  -41.712 4.041   1.00 162.71 ? 176 ALA B N      1 
ATOM   8351  C  CA     . ALA B  1 177 ? 19.966  -41.257 3.180   1.00 165.27 ? 176 ALA B CA     1 
ATOM   8352  C  C      . ALA B  1 177 ? 19.974  -39.740 3.056   1.00 163.47 ? 176 ALA B C      1 
ATOM   8353  O  O      . ALA B  1 177 ? 21.035  -39.116 3.045   1.00 155.73 ? 176 ALA B O      1 
ATOM   8354  C  CB     . ALA B  1 177 ? 19.869  -41.901 1.813   1.00 172.63 ? 176 ALA B CB     1 
ATOM   8355  H  H      . ALA B  1 177 ? 18.090  -41.576 3.725   1.00 195.25 ? 176 ALA B H      1 
ATOM   8356  H  HA     . ALA B  1 177 ? 20.818  -41.528 3.579   1.00 198.32 ? 176 ALA B HA     1 
ATOM   8357  H  HB1    . ALA B  1 177 ? 20.593  -41.586 1.268   1.00 207.15 ? 176 ALA B HB1    1 
ATOM   8358  H  HB2    . ALA B  1 177 ? 19.924  -42.854 1.913   1.00 207.15 ? 176 ALA B HB2    1 
ATOM   8359  H  HB3    . ALA B  1 177 ? 19.029  -41.661 1.414   1.00 207.15 ? 176 ALA B HB3    1 
ATOM   8360  N  N      . LYS B  1 178 ? 18.788  -39.150 2.957   1.00 169.74 ? 177 LYS B N      1 
ATOM   8361  C  CA     . LYS B  1 178 ? 18.661  -37.701 2.929   1.00 166.12 ? 177 LYS B CA     1 
ATOM   8362  C  C      . LYS B  1 178 ? 18.151  -37.189 4.273   1.00 164.64 ? 177 LYS B C      1 
ATOM   8363  O  O      . LYS B  1 178 ? 17.750  -36.032 4.401   1.00 165.22 ? 177 LYS B O      1 
ATOM   8364  C  CB     . LYS B  1 178 ? 17.741  -37.270 1.790   1.00 160.90 ? 177 LYS B CB     1 
ATOM   8365  C  CG     . LYS B  1 178 ? 18.378  -37.426 0.419   1.00 165.80 ? 177 LYS B CG     1 
ATOM   8366  C  CD     . LYS B  1 178 ? 17.374  -37.231 -0.701  1.00 166.38 ? 177 LYS B CD     1 
ATOM   8367  C  CE     . LYS B  1 178 ? 16.744  -35.853 -0.652  1.00 159.60 ? 177 LYS B CE     1 
ATOM   8368  N  NZ     . LYS B  1 178 ? 15.797  -35.637 -1.775  1.00 154.15 ? 177 LYS B NZ     1 
ATOM   8369  H  H      . LYS B  1 178 ? 18.039  -39.570 2.904   1.00 203.68 ? 177 LYS B H      1 
ATOM   8370  H  HA     . LYS B  1 178 ? 19.544  -37.307 2.771   1.00 199.35 ? 177 LYS B HA     1 
ATOM   8371  H  HB2    . LYS B  1 178 ? 16.938  -37.814 1.810   1.00 193.08 ? 177 LYS B HB2    1 
ATOM   8372  H  HB3    . LYS B  1 178 ? 17.510  -36.335 1.908   1.00 193.08 ? 177 LYS B HB3    1 
ATOM   8373  H  HG2    . LYS B  1 178 ? 19.079  -36.763 0.316   1.00 198.97 ? 177 LYS B HG2    1 
ATOM   8374  H  HG3    . LYS B  1 178 ? 18.749  -38.319 0.341   1.00 198.97 ? 177 LYS B HG3    1 
ATOM   8375  H  HD2    . LYS B  1 178 ? 17.824  -37.329 -1.555  1.00 199.66 ? 177 LYS B HD2    1 
ATOM   8376  H  HD3    . LYS B  1 178 ? 16.668  -37.891 -0.616  1.00 199.66 ? 177 LYS B HD3    1 
ATOM   8377  H  HE2    . LYS B  1 178 ? 16.254  -35.756 0.180   1.00 191.52 ? 177 LYS B HE2    1 
ATOM   8378  H  HE3    . LYS B  1 178 ? 17.441  -35.181 -0.711  1.00 191.52 ? 177 LYS B HE3    1 
ATOM   8379  H  HZ1    . LYS B  1 178 ? 15.442  -34.823 -1.722  1.00 184.98 ? 177 LYS B HZ1    1 
ATOM   8380  H  HZ2    . LYS B  1 178 ? 16.223  -35.717 -2.552  1.00 184.98 ? 177 LYS B HZ2    1 
ATOM   8381  H  HZ3    . LYS B  1 178 ? 15.142  -36.240 -1.741  1.00 184.98 ? 177 LYS B HZ3    1 
ATOM   8382  N  N      . ARG B  1 179 ? 18.175  -38.065 5.273   1.00 161.30 ? 178 ARG B N      1 
ATOM   8383  C  CA     . ARG B  1 179 ? 17.821  -37.696 6.635   1.00 164.84 ? 178 ARG B CA     1 
ATOM   8384  C  C      . ARG B  1 179 ? 19.094  -37.467 7.440   1.00 177.85 ? 178 ARG B C      1 
ATOM   8385  O  O      . ARG B  1 179 ? 19.087  -36.753 8.442   1.00 189.94 ? 178 ARG B O      1 
ATOM   8386  C  CB     . ARG B  1 179 ? 16.976  -38.795 7.284   1.00 160.04 ? 178 ARG B CB     1 
ATOM   8387  C  CG     . ARG B  1 179 ? 16.531  -38.488 8.708   1.00 135.24 ? 178 ARG B CG     1 
ATOM   8388  C  CD     . ARG B  1 179 ? 15.554  -39.535 9.231   1.00 135.56 ? 178 ARG B CD     1 
ATOM   8389  N  NE     . ARG B  1 179 ? 16.164  -40.857 9.361   1.00 153.03 ? 178 ARG B NE     1 
ATOM   8390  C  CZ     . ARG B  1 179 ? 16.975  -41.218 10.352  1.00 156.60 ? 178 ARG B CZ     1 
ATOM   8391  N  NH1    . ARG B  1 179 ? 17.293  -40.356 11.305  1.00 142.27 ? 178 ARG B NH1    1 
ATOM   8392  N  NH2    . ARG B  1 179 ? 17.479  -42.444 10.388  1.00 170.23 ? 178 ARG B NH2    1 
ATOM   8393  H  H      . ARG B  1 179 ? 18.396  -38.892 5.184   1.00 193.56 ? 178 ARG B H      1 
ATOM   8394  H  HA     . ARG B  1 179 ? 17.302  -36.865 6.627   1.00 197.81 ? 178 ARG B HA     1 
ATOM   8395  H  HB2    . ARG B  1 179 ? 16.179  -38.931 6.749   1.00 192.05 ? 178 ARG B HB2    1 
ATOM   8396  H  HB3    . ARG B  1 179 ? 17.497  -39.614 7.308   1.00 192.05 ? 178 ARG B HB3    1 
ATOM   8397  H  HG2    . ARG B  1 179 ? 17.306  -38.478 9.290   1.00 162.28 ? 178 ARG B HG2    1 
ATOM   8398  H  HG3    . ARG B  1 179 ? 16.088  -37.625 8.724   1.00 162.28 ? 178 ARG B HG3    1 
ATOM   8399  H  HD2    . ARG B  1 179 ? 15.237  -39.263 10.107  1.00 162.67 ? 178 ARG B HD2    1 
ATOM   8400  H  HD3    . ARG B  1 179 ? 14.808  -39.608 8.616   1.00 162.67 ? 178 ARG B HD3    1 
ATOM   8401  H  HE     . ARG B  1 179 ? 15.987  -41.441 8.756   1.00 183.63 ? 178 ARG B HE     1 
ATOM   8402  H  HH11   . ARG B  1 179 ? 16.970  -39.559 11.290  1.00 170.73 ? 178 ARG B HH11   1 
ATOM   8403  H  HH12   . ARG B  1 179 ? 17.819  -40.594 11.942  1.00 170.73 ? 178 ARG B HH12   1 
ATOM   8404  H  HH21   . ARG B  1 179 ? 17.279  -43.009 9.771   1.00 204.28 ? 178 ARG B HH21   1 
ATOM   8405  H  HH22   . ARG B  1 179 ? 18.006  -42.674 11.028  1.00 204.28 ? 178 ARG B HH22   1 
ATOM   8406  N  N      . ASN B  1 180 ? 20.189  -38.073 6.989   1.00 170.96 ? 179 ASN B N      1 
ATOM   8407  C  CA     . ASN B  1 180 ? 21.474  -37.939 7.663   1.00 161.75 ? 179 ASN B CA     1 
ATOM   8408  C  C      . ASN B  1 180 ? 22.462  -37.091 6.867   1.00 142.23 ? 179 ASN B C      1 
ATOM   8409  O  O      . ASN B  1 180 ? 23.535  -36.752 7.364   1.00 142.82 ? 179 ASN B O      1 
ATOM   8410  C  CB     . ASN B  1 180 ? 22.068  -39.322 7.944   1.00 162.63 ? 179 ASN B CB     1 
ATOM   8411  C  CG     . ASN B  1 180 ? 21.289  -40.085 8.997   1.00 165.61 ? 179 ASN B CG     1 
ATOM   8412  O  OD1    . ASN B  1 180 ? 20.591  -41.051 8.692   1.00 170.71 ? 179 ASN B OD1    1 
ATOM   8413  N  ND2    . ASN B  1 180 ? 21.407  -39.653 10.247  1.00 159.86 ? 179 ASN B ND2    1 
ATOM   8414  H  H      . ASN B  1 180 ? 20.213  -38.571 6.288   1.00 205.15 ? 179 ASN B H      1 
ATOM   8415  H  HA     . ASN B  1 180 ? 21.330  -37.496 8.525   1.00 194.10 ? 179 ASN B HA     1 
ATOM   8416  H  HB2    . ASN B  1 180 ? 22.059  -39.843 7.126   1.00 195.15 ? 179 ASN B HB2    1 
ATOM   8417  H  HB3    . ASN B  1 180 ? 22.979  -39.217 8.261   1.00 195.15 ? 179 ASN B HB3    1 
ATOM   8418  H  HD21   . ASN B  1 180 ? 21.905  -38.974 10.422  1.00 191.83 ? 179 ASN B HD21   1 
ATOM   8419  H  HD22   . ASN B  1 180 ? 20.985  -40.052 10.881  1.00 191.83 ? 179 ASN B HD22   1 
ATOM   8420  N  N      . THR B  1 181 ? 22.099  -36.742 5.636   1.00 140.23 ? 180 THR B N      1 
ATOM   8421  C  CA     . THR B  1 181 ? 22.952  -35.894 4.810   1.00 143.41 ? 180 THR B CA     1 
ATOM   8422  C  C      . THR B  1 181 ? 22.563  -34.435 5.019   1.00 125.26 ? 180 THR B C      1 
ATOM   8423  O  O      . THR B  1 181 ? 23.421  -33.556 5.112   1.00 107.15 ? 180 THR B O      1 
ATOM   8424  C  CB     . THR B  1 181 ? 22.847  -36.257 3.311   1.00 139.48 ? 180 THR B CB     1 
ATOM   8425  O  OG1    . THR B  1 181 ? 24.080  -35.944 2.651   1.00 139.91 ? 180 THR B OG1    1 
ATOM   8426  C  CG2    . THR B  1 181 ? 21.710  -35.501 2.642   1.00 122.57 ? 180 THR B CG2    1 
ATOM   8427  H  H      . THR B  1 181 ? 21.366  -36.983 5.256   1.00 168.28 ? 180 THR B H      1 
ATOM   8428  H  HA     . THR B  1 181 ? 23.885  -36.006 5.088   1.00 172.09 ? 180 THR B HA     1 
ATOM   8429  H  HB     . THR B  1 181 ? 22.672  -37.207 3.225   1.00 167.37 ? 180 THR B HB     1 
ATOM   8430  H  HG1    . THR B  1 181 ? 24.028  -36.135 1.855   1.00 167.90 ? 180 THR B HG1    1 
ATOM   8431  H  HG21   . THR B  1 181 ? 21.660  -35.739 1.713   1.00 147.08 ? 180 THR B HG21   1 
ATOM   8432  H  HG22   . THR B  1 181 ? 20.877  -35.721 3.065   1.00 147.08 ? 180 THR B HG22   1 
ATOM   8433  H  HG23   . THR B  1 181 ? 21.857  -34.556 2.714   1.00 147.08 ? 180 THR B HG23   1 
ATOM   8434  N  N      . VAL B  1 182 ? 21.259  -34.189 5.097   1.00 126.32 ? 181 VAL B N      1 
ATOM   8435  C  CA     . VAL B  1 182 ? 20.737  -32.860 5.379   1.00 112.23 ? 181 VAL B CA     1 
ATOM   8436  C  C      . VAL B  1 182 ? 21.108  -32.456 6.798   1.00 107.69 ? 181 VAL B C      1 
ATOM   8437  O  O      . VAL B  1 182 ? 21.496  -31.317 7.054   1.00 116.67 ? 181 VAL B O      1 
ATOM   8438  C  CB     . VAL B  1 182 ? 19.203  -32.830 5.246   1.00 101.03 ? 181 VAL B CB     1 
ATOM   8439  C  CG1    . VAL B  1 182 ? 18.636  -31.540 5.825   1.00 93.84  ? 181 VAL B CG1    1 
ATOM   8440  C  CG2    . VAL B  1 182 ? 18.794  -33.000 3.789   1.00 90.20  ? 181 VAL B CG2    1 
ATOM   8441  H  H      . VAL B  1 182 ? 20.649  -34.786 4.989   1.00 151.58 ? 181 VAL B H      1 
ATOM   8442  H  HA     . VAL B  1 182 ? 21.123  -32.211 4.754   1.00 134.68 ? 181 VAL B HA     1 
ATOM   8443  H  HB     . VAL B  1 182 ? 18.827  -33.578 5.753   1.00 121.24 ? 181 VAL B HB     1 
ATOM   8444  H  HG11   . VAL B  1 182 ? 17.681  -31.549 5.728   1.00 112.61 ? 181 VAL B HG11   1 
ATOM   8445  H  HG12   . VAL B  1 182 ? 18.871  -31.486 6.754   1.00 112.61 ? 181 VAL B HG12   1 
ATOM   8446  H  HG13   . VAL B  1 182 ? 19.007  -30.794 5.348   1.00 112.61 ? 181 VAL B HG13   1 
ATOM   8447  H  HG21   . VAL B  1 182 ? 17.836  -32.978 3.730   1.00 108.23 ? 181 VAL B HG21   1 
ATOM   8448  H  HG22   . VAL B  1 182 ? 19.171  -32.284 3.273   1.00 108.23 ? 181 VAL B HG22   1 
ATOM   8449  H  HG23   . VAL B  1 182 ? 19.123  -33.843 3.469   1.00 108.23 ? 181 VAL B HG23   1 
ATOM   8450  N  N      . ILE B  1 183 ? 20.983  -33.408 7.715   1.00 114.84 ? 182 ILE B N      1 
ATOM   8451  C  CA     . ILE B  1 183 ? 21.256  -33.172 9.127   1.00 121.96 ? 182 ILE B CA     1 
ATOM   8452  C  C      . ILE B  1 183 ? 22.753  -33.077 9.410   1.00 129.80 ? 182 ILE B C      1 
ATOM   8453  O  O      . ILE B  1 183 ? 23.166  -32.487 10.407  1.00 144.05 ? 182 ILE B O      1 
ATOM   8454  C  CB     . ILE B  1 183 ? 20.610  -34.275 9.989   1.00 137.62 ? 182 ILE B CB     1 
ATOM   8455  C  CG1    . ILE B  1 183 ? 19.102  -34.037 10.058  1.00 145.24 ? 182 ILE B CG1    1 
ATOM   8456  C  CG2    . ILE B  1 183 ? 21.205  -34.303 11.392  1.00 138.60 ? 182 ILE B CG2    1 
ATOM   8457  C  CD1    . ILE B  1 183 ? 18.350  -35.021 10.902  1.00 150.23 ? 182 ILE B CD1    1 
ATOM   8458  H  H      . ILE B  1 183 ? 20.738  -34.213 7.541   1.00 137.81 ? 182 ILE B H      1 
ATOM   8459  H  HA     . ILE B  1 183 ? 20.850  -32.318 9.385   1.00 146.35 ? 182 ILE B HA     1 
ATOM   8460  H  HB     . ILE B  1 183 ? 20.770  -35.133 9.566   1.00 165.14 ? 182 ILE B HB     1 
ATOM   8461  H  HG12   . ILE B  1 183 ? 18.945  -33.154 10.428  1.00 174.29 ? 182 ILE B HG12   1 
ATOM   8462  H  HG13   . ILE B  1 183 ? 18.739  -34.084 9.160   1.00 174.29 ? 182 ILE B HG13   1 
ATOM   8463  H  HG21   . ILE B  1 183 ? 20.780  -35.000 11.897  1.00 166.32 ? 182 ILE B HG21   1 
ATOM   8464  H  HG22   . ILE B  1 183 ? 22.148  -34.473 11.328  1.00 166.32 ? 182 ILE B HG22   1 
ATOM   8465  H  HG23   . ILE B  1 183 ? 21.053  -33.454 11.812  1.00 166.32 ? 182 ILE B HG23   1 
ATOM   8466  H  HD11   . ILE B  1 183 ? 17.417  -34.796 10.888  1.00 180.27 ? 182 ILE B HD11   1 
ATOM   8467  H  HD12   . ILE B  1 183 ? 18.480  -35.902 10.544  1.00 180.27 ? 182 ILE B HD12   1 
ATOM   8468  H  HD13   . ILE B  1 183 ? 18.684  -34.980 11.801  1.00 180.27 ? 182 ILE B HD13   1 
ATOM   8469  N  N      . GLY B  1 184 ? 23.563  -33.646 8.525   1.00 133.85 ? 183 GLY B N      1 
ATOM   8470  C  CA     . GLY B  1 184 ? 25.006  -33.545 8.649   1.00 131.71 ? 183 GLY B CA     1 
ATOM   8471  C  C      . GLY B  1 184 ? 25.479  -32.111 8.496   1.00 129.58 ? 183 GLY B C      1 
ATOM   8472  O  O      . GLY B  1 184 ? 26.587  -31.765 8.910   1.00 123.63 ? 183 GLY B O      1 
ATOM   8473  H  H      . GLY B  1 184 ? 23.299  -34.096 7.842   1.00 160.62 ? 183 GLY B H      1 
ATOM   8474  H  HA2    . GLY B  1 184 ? 25.282  -33.872 9.520   1.00 158.05 ? 183 GLY B HA2    1 
ATOM   8475  H  HA3    . GLY B  1 184 ? 25.430  -34.087 7.965   1.00 158.05 ? 183 GLY B HA3    1 
ATOM   8476  N  N      . THR B  1 185 ? 24.634  -31.275 7.898   1.00 125.72 ? 184 THR B N      1 
ATOM   8477  C  CA     . THR B  1 185 ? 24.956  -29.869 7.678   1.00 111.08 ? 184 THR B CA     1 
ATOM   8478  C  C      . THR B  1 185 ? 23.699  -29.014 7.829   1.00 102.61 ? 184 THR B C      1 
ATOM   8479  O  O      . THR B  1 185 ? 23.042  -28.690 6.841   1.00 118.05 ? 184 THR B O      1 
ATOM   8480  C  CB     . THR B  1 185 ? 25.552  -29.658 6.276   1.00 97.16  ? 184 THR B CB     1 
ATOM   8481  O  OG1    . THR B  1 185 ? 26.682  -30.522 6.103   1.00 95.84  ? 184 THR B OG1    1 
ATOM   8482  C  CG2    . THR B  1 185 ? 25.989  -28.214 6.084   1.00 94.49  ? 184 THR B CG2    1 
ATOM   8483  H  H      . THR B  1 185 ? 23.858  -31.502 7.606   1.00 150.87 ? 184 THR B H      1 
ATOM   8484  H  HA     . THR B  1 185 ? 25.614  -29.576 8.343   1.00 133.29 ? 184 THR B HA     1 
ATOM   8485  H  HB     . THR B  1 185 ? 24.882  -29.866 5.606   1.00 116.59 ? 184 THR B HB     1 
ATOM   8486  H  HG1    . THR B  1 185 ? 27.005  -30.415 5.357   1.00 115.00 ? 184 THR B HG1    1 
ATOM   8487  H  HG21   . THR B  1 185 ? 26.359  -28.098 5.205   1.00 113.39 ? 184 THR B HG21   1 
ATOM   8488  H  HG22   . THR B  1 185 ? 25.236  -27.627 6.186   1.00 113.39 ? 184 THR B HG22   1 
ATOM   8489  H  HG23   . THR B  1 185 ? 26.655  -27.984 6.736   1.00 113.39 ? 184 THR B HG23   1 
ATOM   8490  N  N      . PRO B  1 186 ? 23.362  -28.646 9.074   1.00 90.04  ? 185 PRO B N      1 
ATOM   8491  C  CA     . PRO B  1 186 ? 22.120  -27.939 9.393   1.00 88.50  ? 185 PRO B CA     1 
ATOM   8492  C  C      . PRO B  1 186 ? 22.313  -26.441 9.594   1.00 86.20  ? 185 PRO B C      1 
ATOM   8493  O  O      . PRO B  1 186 ? 21.425  -25.780 10.130  1.00 80.48  ? 185 PRO B O      1 
ATOM   8494  C  CB     . PRO B  1 186 ? 21.714  -28.579 10.719  1.00 84.40  ? 185 PRO B CB     1 
ATOM   8495  C  CG     . PRO B  1 186 ? 23.041  -29.015 11.361  1.00 98.77  ? 185 PRO B CG     1 
ATOM   8496  C  CD     . PRO B  1 186 ? 24.119  -28.948 10.298  1.00 96.86  ? 185 PRO B CD     1 
ATOM   8497  H  HA     . PRO B  1 186 ? 21.434  -28.106 8.714   1.00 106.19 ? 185 PRO B HA     1 
ATOM   8498  H  HB2    . PRO B  1 186 ? 21.261  -27.925 11.275  1.00 101.29 ? 185 PRO B HB2    1 
ATOM   8499  H  HB3    . PRO B  1 186 ? 21.143  -29.346 10.553  1.00 101.29 ? 185 PRO B HB3    1 
ATOM   8500  H  HG2    . PRO B  1 186 ? 23.254  -28.414 12.091  1.00 118.52 ? 185 PRO B HG2    1 
ATOM   8501  H  HG3    . PRO B  1 186 ? 22.952  -29.923 11.690  1.00 118.52 ? 185 PRO B HG3    1 
ATOM   8502  H  HD2    . PRO B  1 186 ? 24.745  -28.234 10.495  1.00 116.23 ? 185 PRO B HD2    1 
ATOM   8503  H  HD3    . PRO B  1 186 ? 24.568  -29.804 10.216  1.00 116.23 ? 185 PRO B HD3    1 
ATOM   8504  N  N      . PHE B  1 187 ? 23.451  -25.915 9.157   1.00 72.39  ? 186 PHE B N      1 
ATOM   8505  C  CA     . PHE B  1 187 ? 23.823  -24.537 9.455   1.00 64.90  ? 186 PHE B CA     1 
ATOM   8506  C  C      . PHE B  1 187 ? 22.871  -23.511 8.846   1.00 87.97  ? 186 PHE B C      1 
ATOM   8507  O  O      . PHE B  1 187 ? 22.613  -22.465 9.445   1.00 111.20 ? 186 PHE B O      1 
ATOM   8508  C  CB     . PHE B  1 187 ? 25.252  -24.277 8.981   1.00 50.73  ? 186 PHE B CB     1 
ATOM   8509  C  CG     . PHE B  1 187 ? 26.265  -25.193 9.601   1.00 64.00  ? 186 PHE B CG     1 
ATOM   8510  C  CD1    . PHE B  1 187 ? 27.218  -25.823 8.820   1.00 79.92  ? 186 PHE B CD1    1 
ATOM   8511  C  CD2    . PHE B  1 187 ? 26.266  -25.423 10.965  1.00 74.48  ? 186 PHE B CD2    1 
ATOM   8512  C  CE1    . PHE B  1 187 ? 28.150  -26.666 9.388   1.00 68.45  ? 186 PHE B CE1    1 
ATOM   8513  C  CE2    . PHE B  1 187 ? 27.196  -26.265 11.537  1.00 93.43  ? 186 PHE B CE2    1 
ATOM   8514  C  CZ     . PHE B  1 187 ? 28.140  -26.886 10.747  1.00 83.37  ? 186 PHE B CZ     1 
ATOM   8515  H  H      . PHE B  1 187 ? 24.030  -26.339 8.683   1.00 86.87  ? 186 PHE B H      1 
ATOM   8516  H  HA     . PHE B  1 187 ? 23.807  -24.413 10.427  1.00 77.89  ? 186 PHE B HA     1 
ATOM   8517  H  HB2    . PHE B  1 187 ? 25.290  -24.398 8.019   1.00 60.87  ? 186 PHE B HB2    1 
ATOM   8518  H  HB3    . PHE B  1 187 ? 25.496  -23.366 9.208   1.00 60.87  ? 186 PHE B HB3    1 
ATOM   8519  H  HD1    . PHE B  1 187 ? 27.229  -25.678 7.902   1.00 95.91  ? 186 PHE B HD1    1 
ATOM   8520  H  HD2    . PHE B  1 187 ? 25.632  -25.006 11.502  1.00 89.37  ? 186 PHE B HD2    1 
ATOM   8521  H  HE1    . PHE B  1 187 ? 28.786  -27.084 8.853   1.00 82.14  ? 186 PHE B HE1    1 
ATOM   8522  H  HE2    . PHE B  1 187 ? 27.187  -26.412 12.455  1.00 112.11 ? 186 PHE B HE2    1 
ATOM   8523  H  HZ     . PHE B  1 187 ? 28.768  -27.454 11.132  1.00 100.05 ? 186 PHE B HZ     1 
ATOM   8524  N  N      . TRP B  1 188 ? 22.345  -23.808 7.662   1.00 75.20  ? 187 TRP B N      1 
ATOM   8525  C  CA     . TRP B  1 188 ? 21.463  -22.874 6.972   1.00 67.89  ? 187 TRP B CA     1 
ATOM   8526  C  C      . TRP B  1 188 ? 19.999  -23.103 7.345   1.00 62.55  ? 187 TRP B C      1 
ATOM   8527  O  O      . TRP B  1 188 ? 19.117  -22.374 6.888   1.00 49.12  ? 187 TRP B O      1 
ATOM   8528  C  CB     . TRP B  1 188 ? 21.642  -22.988 5.454   1.00 72.77  ? 187 TRP B CB     1 
ATOM   8529  C  CG     . TRP B  1 188 ? 22.946  -22.429 4.955   1.00 65.65  ? 187 TRP B CG     1 
ATOM   8530  C  CD1    . TRP B  1 188 ? 23.159  -21.185 4.438   1.00 67.66  ? 187 TRP B CD1    1 
ATOM   8531  C  CD2    . TRP B  1 188 ? 24.217  -23.097 4.930   1.00 65.23  ? 187 TRP B CD2    1 
ATOM   8532  N  NE1    . TRP B  1 188 ? 24.482  -21.036 4.090   1.00 65.92  ? 187 TRP B NE1    1 
ATOM   8533  C  CE2    . TRP B  1 188 ? 25.150  -22.191 4.382   1.00 66.25  ? 187 TRP B CE2    1 
ATOM   8534  C  CE3    . TRP B  1 188 ? 24.654  -24.367 5.315   1.00 55.84  ? 187 TRP B CE3    1 
ATOM   8535  C  CZ2    . TRP B  1 188 ? 26.496  -22.522 4.211   1.00 61.02  ? 187 TRP B CZ2    1 
ATOM   8536  C  CZ3    . TRP B  1 188 ? 25.991  -24.690 5.144   1.00 62.28  ? 187 TRP B CZ3    1 
ATOM   8537  C  CH2    . TRP B  1 188 ? 26.895  -23.771 4.597   1.00 65.05  ? 187 TRP B CH2    1 
ATOM   8538  H  H      . TRP B  1 188 ? 22.483  -24.543 7.238   1.00 90.24  ? 187 TRP B H      1 
ATOM   8539  H  HA     . TRP B  1 188 ? 21.701  -21.960 7.236   1.00 81.47  ? 187 TRP B HA     1 
ATOM   8540  H  HB2    . TRP B  1 188 ? 21.605  -23.924 5.204   1.00 87.33  ? 187 TRP B HB2    1 
ATOM   8541  H  HB3    . TRP B  1 188 ? 20.924  -22.502 5.017   1.00 87.33  ? 187 TRP B HB3    1 
ATOM   8542  H  HD1    . TRP B  1 188 ? 22.504  -20.532 4.334   1.00 81.19  ? 187 TRP B HD1    1 
ATOM   8543  H  HE1    . TRP B  1 188 ? 24.831  -20.330 3.746   1.00 79.10  ? 187 TRP B HE1    1 
ATOM   8544  H  HE3    . TRP B  1 188 ? 24.059  -24.983 5.679   1.00 67.01  ? 187 TRP B HE3    1 
ATOM   8545  H  HZ2    . TRP B  1 188 ? 27.099  -21.914 3.848   1.00 73.23  ? 187 TRP B HZ2    1 
ATOM   8546  H  HZ3    . TRP B  1 188 ? 26.293  -25.532 5.397   1.00 74.73  ? 187 TRP B HZ3    1 
ATOM   8547  H  HH2    . TRP B  1 188 ? 27.786  -24.016 4.494   1.00 78.06  ? 187 TRP B HH2    1 
ATOM   8548  N  N      . MET B  1 189 ? 19.737  -24.101 8.184   1.00 53.92  ? 188 MET B N      1 
ATOM   8549  C  CA     . MET B  1 189 ? 18.364  -24.435 8.539   1.00 66.24  ? 188 MET B CA     1 
ATOM   8550  C  C      . MET B  1 189 ? 17.743  -23.383 9.454   1.00 71.72  ? 188 MET B C      1 
ATOM   8551  O  O      . MET B  1 189 ? 18.431  -22.761 10.270  1.00 42.76  ? 188 MET B O      1 
ATOM   8552  C  CB     . MET B  1 189 ? 18.309  -25.811 9.203   1.00 77.44  ? 188 MET B CB     1 
ATOM   8553  C  CG     . MET B  1 189 ? 18.840  -26.931 8.319   1.00 116.43 ? 188 MET B CG     1 
ATOM   8554  S  SD     . MET B  1 189 ? 18.549  -28.568 9.009   1.00 101.77 ? 188 MET B SD     1 
ATOM   8555  C  CE     . MET B  1 189 ? 16.763  -28.638 8.938   1.00 99.84  ? 188 MET B CE     1 
ATOM   8556  H  H      . MET B  1 189 ? 20.332  -24.597 8.558   1.00 64.71  ? 188 MET B H      1 
ATOM   8557  H  HA     . MET B  1 189 ? 17.834  -24.483 7.716   1.00 79.49  ? 188 MET B HA     1 
ATOM   8558  H  HB2    . MET B  1 189 ? 18.843  -25.791 10.012  1.00 92.93  ? 188 MET B HB2    1 
ATOM   8559  H  HB3    . MET B  1 189 ? 17.386  -26.017 9.422   1.00 92.93  ? 188 MET B HB3    1 
ATOM   8560  H  HG2    . MET B  1 189 ? 18.400  -26.887 7.456   1.00 139.72 ? 188 MET B HG2    1 
ATOM   8561  H  HG3    . MET B  1 189 ? 19.797  -26.818 8.209   1.00 139.72 ? 188 MET B HG3    1 
ATOM   8562  H  HE1    . MET B  1 189 ? 16.470  -29.483 9.286   1.00 119.81 ? 188 MET B HE1    1 
ATOM   8563  H  HE2    . MET B  1 189 ? 16.401  -27.923 9.467   1.00 119.81 ? 188 MET B HE2    1 
ATOM   8564  H  HE3    . MET B  1 189 ? 16.482  -28.545 8.025   1.00 119.81 ? 188 MET B HE3    1 
ATOM   8565  N  N      . ALA B  1 190 ? 16.436  -23.184 9.303   1.00 67.62  ? 189 ALA B N      1 
ATOM   8566  C  CA     . ALA B  1 190 ? 15.693  -22.272 10.161  1.00 64.50  ? 189 ALA B CA     1 
ATOM   8567  C  C      . ALA B  1 190 ? 15.319  -22.989 11.455  1.00 73.60  ? 189 ALA B C      1 
ATOM   8568  O  O      . ALA B  1 190 ? 15.270  -24.216 11.495  1.00 66.19  ? 189 ALA B O      1 
ATOM   8569  C  CB     . ALA B  1 190 ? 14.444  -21.768 9.449   1.00 64.25  ? 189 ALA B CB     1 
ATOM   8570  H  H      . ALA B  1 190 ? 15.955  -23.571 8.704   1.00 81.14  ? 189 ALA B H      1 
ATOM   8571  H  HA     . ALA B  1 190 ? 16.255  -21.502 10.385  1.00 77.40  ? 189 ALA B HA     1 
ATOM   8572  H  HB1    . ALA B  1 190 ? 13.972  -21.170 10.033  1.00 77.10  ? 189 ALA B HB1    1 
ATOM   8573  H  HB2    . ALA B  1 190 ? 14.706  -21.306 8.650   1.00 77.10  ? 189 ALA B HB2    1 
ATOM   8574  H  HB3    . ALA B  1 190 ? 13.887  -22.517 9.227   1.00 77.10  ? 189 ALA B HB3    1 
ATOM   8575  N  N      . PRO B  1 191 ? 15.055  -22.222 12.522  1.00 86.72  ? 190 PRO B N      1 
ATOM   8576  C  CA     . PRO B  1 191 ? 14.733  -22.793 13.833  1.00 91.27  ? 190 PRO B CA     1 
ATOM   8577  C  C      . PRO B  1 191 ? 13.517  -23.713 13.798  1.00 93.24  ? 190 PRO B C      1 
ATOM   8578  O  O      . PRO B  1 191 ? 13.574  -24.833 14.310  1.00 85.08  ? 190 PRO B O      1 
ATOM   8579  C  CB     . PRO B  1 191 ? 14.427  -21.558 14.685  1.00 93.33  ? 190 PRO B CB     1 
ATOM   8580  C  CG     . PRO B  1 191 ? 15.120  -20.441 14.007  1.00 86.93  ? 190 PRO B CG     1 
ATOM   8581  C  CD     . PRO B  1 191 ? 15.049  -20.750 12.551  1.00 97.97  ? 190 PRO B CD     1 
ATOM   8582  H  HA     . PRO B  1 191 ? 15.503  -23.271 14.205  1.00 109.52 ? 190 PRO B HA     1 
ATOM   8583  H  HB2    . PRO B  1 191 ? 13.469  -21.404 14.706  1.00 112.00 ? 190 PRO B HB2    1 
ATOM   8584  H  HB3    . PRO B  1 191 ? 14.775  -21.684 15.581  1.00 112.00 ? 190 PRO B HB3    1 
ATOM   8585  H  HG2    . PRO B  1 191 ? 14.663  -19.608 14.202  1.00 104.31 ? 190 PRO B HG2    1 
ATOM   8586  H  HG3    . PRO B  1 191 ? 16.043  -20.402 14.304  1.00 104.31 ? 190 PRO B HG3    1 
ATOM   8587  H  HD2    . PRO B  1 191 ? 14.226  -20.407 12.171  1.00 117.57 ? 190 PRO B HD2    1 
ATOM   8588  H  HD3    . PRO B  1 191 ? 15.828  -20.399 12.091  1.00 117.57 ? 190 PRO B HD3    1 
ATOM   8589  N  N      . GLU B  1 192 ? 12.427  -23.239 13.205  1.00 85.40  ? 191 GLU B N      1 
ATOM   8590  C  CA     . GLU B  1 192 ? 11.187  -24.005 13.185  1.00 85.34  ? 191 GLU B CA     1 
ATOM   8591  C  C      . GLU B  1 192 ? 11.304  -25.260 12.327  1.00 92.79  ? 191 GLU B C      1 
ATOM   8592  O  O      . GLU B  1 192 ? 10.499  -26.178 12.459  1.00 110.30 ? 191 GLU B O      1 
ATOM   8593  C  CB     . GLU B  1 192 ? 10.015  -23.143 12.703  1.00 92.90  ? 191 GLU B CB     1 
ATOM   8594  C  CG     . GLU B  1 192 ? 9.957   -22.912 11.196  1.00 103.24 ? 191 GLU B CG     1 
ATOM   8595  C  CD     . GLU B  1 192 ? 10.884  -21.809 10.727  1.00 101.03 ? 191 GLU B CD     1 
ATOM   8596  O  OE1    . GLU B  1 192 ? 10.785  -21.414 9.546   1.00 86.73  ? 191 GLU B OE1    1 
ATOM   8597  O  OE2    . GLU B  1 192 ? 11.708  -21.334 11.536  1.00 107.92 ? 191 GLU B OE2    1 
ATOM   8598  H  H      . GLU B  1 192 ? 12.379  -22.478 12.808  1.00 102.49 ? 191 GLU B H      1 
ATOM   8599  H  HA     . GLU B  1 192 ? 10.984  -24.292 14.100  1.00 102.40 ? 191 GLU B HA     1 
ATOM   8600  H  HB2    . GLU B  1 192 ? 9.187   -23.576 12.963  1.00 111.48 ? 191 GLU B HB2    1 
ATOM   8601  H  HB3    . GLU B  1 192 ? 10.075  -22.274 13.129  1.00 111.48 ? 191 GLU B HB3    1 
ATOM   8602  H  HG2    . GLU B  1 192 ? 10.212  -23.730 10.742  1.00 123.89 ? 191 GLU B HG2    1 
ATOM   8603  H  HG3    . GLU B  1 192 ? 9.051   -22.666 10.950  1.00 123.89 ? 191 GLU B HG3    1 
ATOM   8604  N  N      . VAL B  1 193 ? 12.299  -25.298 11.447  1.00 89.60  ? 192 VAL B N      1 
ATOM   8605  C  CA     . VAL B  1 193 ? 12.524  -26.474 10.610  1.00 91.20  ? 192 VAL B CA     1 
ATOM   8606  C  C      . VAL B  1 193 ? 13.125  -27.605 11.442  1.00 90.06  ? 192 VAL B C      1 
ATOM   8607  O  O      . VAL B  1 193 ? 12.857  -28.781 11.196  1.00 90.42  ? 192 VAL B O      1 
ATOM   8608  C  CB     . VAL B  1 193 ? 13.441  -26.146 9.412   1.00 82.75  ? 192 VAL B CB     1 
ATOM   8609  C  CG1    . VAL B  1 193 ? 13.748  -27.397 8.600   1.00 51.19  ? 192 VAL B CG1    1 
ATOM   8610  C  CG2    . VAL B  1 193 ? 12.790  -25.092 8.534   1.00 93.39  ? 192 VAL B CG2    1 
ATOM   8611  H  H      . VAL B  1 193 ? 12.858  -24.658 11.315  1.00 107.52 ? 192 VAL B H      1 
ATOM   8612  H  HA     . VAL B  1 193 ? 11.664  -26.782 10.257  1.00 109.44 ? 192 VAL B HA     1 
ATOM   8613  H  HB     . VAL B  1 193 ? 14.288  -25.783 9.746   1.00 99.30  ? 192 VAL B HB     1 
ATOM   8614  H  HG11   . VAL B  1 193 ? 14.318  -27.161 7.865   1.00 61.42  ? 192 VAL B HG11   1 
ATOM   8615  H  HG12   . VAL B  1 193 ? 14.189  -28.036 9.165   1.00 61.42  ? 192 VAL B HG12   1 
ATOM   8616  H  HG13   . VAL B  1 193 ? 12.924  -27.765 8.271   1.00 61.42  ? 192 VAL B HG13   1 
ATOM   8617  H  HG21   . VAL B  1 193 ? 13.371  -24.899 7.795   1.00 112.07 ? 192 VAL B HG21   1 
ATOM   8618  H  HG22   . VAL B  1 193 ? 11.951  -25.429 8.212   1.00 112.07 ? 192 VAL B HG22   1 
ATOM   8619  H  HG23   . VAL B  1 193 ? 12.646  -24.298 9.054   1.00 112.07 ? 192 VAL B HG23   1 
ATOM   8620  N  N      . ILE B  1 194 ? 13.931  -27.239 12.432  1.00 91.63  ? 193 ILE B N      1 
ATOM   8621  C  CA     . ILE B  1 194 ? 14.515  -28.212 13.347  1.00 89.86  ? 193 ILE B CA     1 
ATOM   8622  C  C      . ILE B  1 194 ? 13.470  -28.706 14.344  1.00 83.70  ? 193 ILE B C      1 
ATOM   8623  O  O      . ILE B  1 194 ? 13.500  -29.862 14.763  1.00 93.89  ? 193 ILE B O      1 
ATOM   8624  C  CB     . ILE B  1 194 ? 15.711  -27.608 14.112  1.00 91.25  ? 193 ILE B CB     1 
ATOM   8625  C  CG1    . ILE B  1 194 ? 16.891  -27.396 13.161  1.00 88.93  ? 193 ILE B CG1    1 
ATOM   8626  C  CG2    . ILE B  1 194 ? 16.122  -28.510 15.264  1.00 88.68  ? 193 ILE B CG2    1 
ATOM   8627  C  CD1    . ILE B  1 194 ? 18.119  -26.784 13.815  1.00 90.78  ? 193 ILE B CD1    1 
ATOM   8628  H  H      . ILE B  1 194 ? 14.158  -26.426 12.597  1.00 109.96 ? 193 ILE B H      1 
ATOM   8629  H  HA     . ILE B  1 194 ? 14.837  -28.983 12.834  1.00 107.83 ? 193 ILE B HA     1 
ATOM   8630  H  HB     . ILE B  1 194 ? 15.445  -26.747 14.473  1.00 109.49 ? 193 ILE B HB     1 
ATOM   8631  H  HG12   . ILE B  1 194 ? 17.151  -28.254 12.792  1.00 106.72 ? 193 ILE B HG12   1 
ATOM   8632  H  HG13   . ILE B  1 194 ? 16.612  -26.803 12.446  1.00 106.72 ? 193 ILE B HG13   1 
ATOM   8633  H  HG21   . ILE B  1 194 ? 16.866  -28.111 15.722  1.00 106.42 ? 193 ILE B HG21   1 
ATOM   8634  H  HG22   . ILE B  1 194 ? 15.380  -28.606 15.866  1.00 106.42 ? 193 ILE B HG22   1 
ATOM   8635  H  HG23   . ILE B  1 194 ? 16.374  -29.368 14.915  1.00 106.42 ? 193 ILE B HG23   1 
ATOM   8636  H  HD11   . ILE B  1 194 ? 18.808  -26.685 13.154  1.00 108.94 ? 193 ILE B HD11   1 
ATOM   8637  H  HD12   . ILE B  1 194 ? 17.885  -25.926 14.175  1.00 108.94 ? 193 ILE B HD12   1 
ATOM   8638  H  HD13   . ILE B  1 194 ? 18.420  -27.364 14.518  1.00 108.94 ? 193 ILE B HD13   1 
ATOM   8639  N  N      . GLN B  1 195 ? 12.540  -27.827 14.708  1.00 89.78  ? 194 GLN B N      1 
ATOM   8640  C  CA     . GLN B  1 195 ? 11.530  -28.141 15.714  1.00 90.01  ? 194 GLN B CA     1 
ATOM   8641  C  C      . GLN B  1 195 ? 10.287  -28.789 15.109  1.00 108.70 ? 194 GLN B C      1 
ATOM   8642  O  O      . GLN B  1 195 ? 9.743   -29.740 15.667  1.00 136.19 ? 194 GLN B O      1 
ATOM   8643  C  CB     . GLN B  1 195 ? 11.127  -26.874 16.469  1.00 94.00  ? 194 GLN B CB     1 
ATOM   8644  C  CG     . GLN B  1 195 ? 12.278  -26.185 17.185  1.00 107.42 ? 194 GLN B CG     1 
ATOM   8645  C  CD     . GLN B  1 195 ? 11.847  -24.914 17.891  1.00 106.78 ? 194 GLN B CD     1 
ATOM   8646  O  OE1    . GLN B  1 195 ? 12.410  -23.842 17.663  1.00 102.62 ? 194 GLN B OE1    1 
ATOM   8647  N  NE2    . GLN B  1 195 ? 10.846  -25.026 18.755  1.00 111.32 ? 194 GLN B NE2    1 
ATOM   8648  H  H      . GLN B  1 195 ? 12.473  -27.033 14.383  1.00 107.74 ? 194 GLN B H      1 
ATOM   8649  H  HA     . GLN B  1 195 ? 11.913  -28.769 16.362  1.00 108.01 ? 194 GLN B HA     1 
ATOM   8650  H  HB2    . GLN B  1 195 ? 10.751  -26.242 15.837  1.00 112.80 ? 194 GLN B HB2    1 
ATOM   8651  H  HB3    . GLN B  1 195 ? 10.462  -27.107 17.135  1.00 112.80 ? 194 GLN B HB3    1 
ATOM   8652  H  HG2    . GLN B  1 195 ? 12.644  -26.789 17.850  1.00 128.90 ? 194 GLN B HG2    1 
ATOM   8653  H  HG3    . GLN B  1 195 ? 12.960  -25.953 16.536  1.00 128.90 ? 194 GLN B HG3    1 
ATOM   8654  H  HE21   . GLN B  1 195 ? 10.478  -25.792 18.890  1.00 133.58 ? 194 GLN B HE21   1 
ATOM   8655  H  HE22   . GLN B  1 195 ? 10.565  -24.334 19.181  1.00 133.58 ? 194 GLN B HE22   1 
ATOM   8656  N  N      . GLU B  1 196 ? 9.837   -28.272 13.971  1.00 104.61 ? 195 GLU B N      1 
ATOM   8657  C  CA     . GLU B  1 196 ? 8.640   -28.792 13.319  1.00 116.54 ? 195 GLU B CA     1 
ATOM   8658  C  C      . GLU B  1 196 ? 8.962   -29.972 12.405  1.00 114.64 ? 195 GLU B C      1 
ATOM   8659  O  O      . GLU B  1 196 ? 8.058   -30.685 11.966  1.00 115.17 ? 195 GLU B O      1 
ATOM   8660  C  CB     . GLU B  1 196 ? 7.964   -27.700 12.490  1.00 135.32 ? 195 GLU B CB     1 
ATOM   8661  C  CG     . GLU B  1 196 ? 7.605   -26.445 13.260  1.00 141.50 ? 195 GLU B CG     1 
ATOM   8662  C  CD     . GLU B  1 196 ? 7.099   -25.342 12.351  1.00 163.95 ? 195 GLU B CD     1 
ATOM   8663  O  OE1    . GLU B  1 196 ? 6.682   -24.284 12.868  1.00 174.20 ? 195 GLU B OE1    1 
ATOM   8664  O  OE2    . GLU B  1 196 ? 7.118   -25.533 11.116  1.00 172.16 ? 195 GLU B OE2    1 
ATOM   8665  H  H      . GLU B  1 196 ? 10.208  -27.617 13.555  1.00 125.54 ? 195 GLU B H      1 
ATOM   8666  H  HA     . GLU B  1 196 ? 8.007   -29.096 14.002  1.00 139.84 ? 195 GLU B HA     1 
ATOM   8667  H  HB2    . GLU B  1 196 ? 8.563   -27.442 11.772  1.00 162.39 ? 195 GLU B HB2    1 
ATOM   8668  H  HB3    . GLU B  1 196 ? 7.144   -28.059 12.117  1.00 162.39 ? 195 GLU B HB3    1 
ATOM   8669  H  HG2    . GLU B  1 196 ? 6.906   -26.654 13.900  1.00 169.80 ? 195 GLU B HG2    1 
ATOM   8670  H  HG3    . GLU B  1 196 ? 8.394   -26.119 13.721  1.00 169.80 ? 195 GLU B HG3    1 
ATOM   8671  N  N      . ILE B  1 197 ? 10.245  -30.171 12.115  1.00 113.13 ? 196 ILE B N      1 
ATOM   8672  C  CA     . ILE B  1 197 ? 10.660  -31.178 11.144  1.00 120.35 ? 196 ILE B CA     1 
ATOM   8673  C  C      . ILE B  1 197 ? 9.850   -30.997 9.865   1.00 122.61 ? 196 ILE B C      1 
ATOM   8674  O  O      . ILE B  1 197 ? 9.078   -31.871 9.472   1.00 114.15 ? 196 ILE B O      1 
ATOM   8675  C  CB     . ILE B  1 197 ? 10.467  -32.611 11.683  1.00 119.66 ? 196 ILE B CB     1 
ATOM   8676  C  CG1    . ILE B  1 197 ? 11.152  -32.767 13.043  1.00 113.11 ? 196 ILE B CG1    1 
ATOM   8677  C  CG2    . ILE B  1 197 ? 11.024  -33.636 10.699  1.00 115.58 ? 196 ILE B CG2    1 
ATOM   8678  C  CD1    . ILE B  1 197 ? 12.662  -32.588 12.999  1.00 103.72 ? 196 ILE B CD1    1 
ATOM   8679  H  H      . ILE B  1 197 ? 10.896  -29.734 12.469  1.00 135.76 ? 196 ILE B H      1 
ATOM   8680  H  HA     . ILE B  1 197 ? 11.608  -31.053 10.930  1.00 144.42 ? 196 ILE B HA     1 
ATOM   8681  H  HB     . ILE B  1 197 ? 9.517   -32.773 11.794  1.00 143.59 ? 196 ILE B HB     1 
ATOM   8682  H  HG12   . ILE B  1 197 ? 10.793  -32.102 13.651  1.00 135.73 ? 196 ILE B HG12   1 
ATOM   8683  H  HG13   . ILE B  1 197 ? 10.969  -33.657 13.384  1.00 135.73 ? 196 ILE B HG13   1 
ATOM   8684  H  HG21   . ILE B  1 197 ? 10.891  -34.517 11.057  1.00 138.70 ? 196 ILE B HG21   1 
ATOM   8685  H  HG22   . ILE B  1 197 ? 10.560  -33.550 9.862   1.00 138.70 ? 196 ILE B HG22   1 
ATOM   8686  H  HG23   . ILE B  1 197 ? 11.961  -33.471 10.573  1.00 138.70 ? 196 ILE B HG23   1 
ATOM   8687  H  HD11   . ILE B  1 197 ? 13.015  -32.700 13.884  1.00 124.47 ? 196 ILE B HD11   1 
ATOM   8688  H  HD12   . ILE B  1 197 ? 13.037  -33.247 12.410  1.00 124.47 ? 196 ILE B HD12   1 
ATOM   8689  H  HD13   . ILE B  1 197 ? 12.862  -31.707 12.675  1.00 124.47 ? 196 ILE B HD13   1 
ATOM   8690  N  N      . GLY B  1 198 ? 10.024  -29.845 9.228   1.00 139.24 ? 197 GLY B N      1 
ATOM   8691  C  CA     . GLY B  1 198 ? 9.281   -29.517 8.026   1.00 137.17 ? 197 GLY B CA     1 
ATOM   8692  C  C      . GLY B  1 198 ? 9.551   -28.095 7.577   1.00 129.99 ? 197 GLY B C      1 
ATOM   8693  O  O      . GLY B  1 198 ? 10.050  -27.273 8.348   1.00 123.49 ? 197 GLY B O      1 
ATOM   8694  H  H      . GLY B  1 198 ? 10.573  -29.232 9.477   1.00 167.09 ? 197 GLY B H      1 
ATOM   8695  H  HA2    . GLY B  1 198 ? 9.533   -30.122 7.311   1.00 164.60 ? 197 GLY B HA2    1 
ATOM   8696  H  HA3    . GLY B  1 198 ? 8.330   -29.614 8.194   1.00 164.60 ? 197 GLY B HA3    1 
ATOM   8697  N  N      . TYR B  1 199 ? 9.211   -27.801 6.327   1.00 123.56 ? 198 TYR B N      1 
ATOM   8698  C  CA     . TYR B  1 199 ? 9.502   -26.499 5.746   1.00 108.64 ? 198 TYR B CA     1 
ATOM   8699  C  C      . TYR B  1 199 ? 8.238   -25.698 5.460   1.00 115.20 ? 198 TYR B C      1 
ATOM   8700  O  O      . TYR B  1 199 ? 7.180   -26.258 5.169   1.00 123.93 ? 198 TYR B O      1 
ATOM   8701  C  CB     . TYR B  1 199 ? 10.280  -26.662 4.440   1.00 94.13  ? 198 TYR B CB     1 
ATOM   8702  C  CG     . TYR B  1 199 ? 11.665  -27.251 4.592   1.00 94.65  ? 198 TYR B CG     1 
ATOM   8703  C  CD1    . TYR B  1 199 ? 12.763  -26.439 4.842   1.00 87.55  ? 198 TYR B CD1    1 
ATOM   8704  C  CD2    . TYR B  1 199 ? 11.878  -28.619 4.464   1.00 93.88  ? 198 TYR B CD2    1 
ATOM   8705  C  CE1    . TYR B  1 199 ? 14.032  -26.972 4.971   1.00 84.90  ? 198 TYR B CE1    1 
ATOM   8706  C  CE2    . TYR B  1 199 ? 13.142  -29.161 4.591   1.00 79.25  ? 198 TYR B CE2    1 
ATOM   8707  C  CZ     . TYR B  1 199 ? 14.215  -28.333 4.846   1.00 80.31  ? 198 TYR B CZ     1 
ATOM   8708  O  OH     . TYR B  1 199 ? 15.476  -28.868 4.973   1.00 80.26  ? 198 TYR B OH     1 
ATOM   8709  H  H      . TYR B  1 199 ? 8.808   -28.342 5.793   1.00 148.27 ? 198 TYR B H      1 
ATOM   8710  H  HA     . TYR B  1 199 ? 10.055  -25.984 6.370   1.00 130.37 ? 198 TYR B HA     1 
ATOM   8711  H  HB2    . TYR B  1 199 ? 9.776   -27.246 3.851   1.00 112.96 ? 198 TYR B HB2    1 
ATOM   8712  H  HB3    . TYR B  1 199 ? 10.377  -25.790 4.027   1.00 112.96 ? 198 TYR B HB3    1 
ATOM   8713  H  HD1    . TYR B  1 199 ? 12.642  -25.520 4.928   1.00 105.05 ? 198 TYR B HD1    1 
ATOM   8714  H  HD2    . TYR B  1 199 ? 11.156  -29.180 4.292   1.00 112.66 ? 198 TYR B HD2    1 
ATOM   8715  H  HE1    . TYR B  1 199 ? 14.757  -26.417 5.143   1.00 101.87 ? 198 TYR B HE1    1 
ATOM   8716  H  HE2    . TYR B  1 199 ? 13.269  -30.079 4.507   1.00 95.10  ? 198 TYR B HE2    1 
ATOM   8717  H  HH     . TYR B  1 199 ? 15.688  -29.256 4.282   1.00 96.31  ? 198 TYR B HH     1 
ATOM   8718  N  N      . ASN B  1 200 ? 8.366   -24.379 5.556   1.00 113.93 ? 199 ASN B N      1 
ATOM   8719  C  CA     . ASN B  1 200 ? 7.367   -23.456 5.036   1.00 112.90 ? 199 ASN B CA     1 
ATOM   8720  C  C      . ASN B  1 200 ? 8.067   -22.370 4.227   1.00 109.32 ? 199 ASN B C      1 
ATOM   8721  O  O      . ASN B  1 200 ? 9.293   -22.253 4.266   1.00 94.16  ? 199 ASN B O      1 
ATOM   8722  C  CB     . ASN B  1 200 ? 6.528   -22.851 6.165   1.00 120.15 ? 199 ASN B CB     1 
ATOM   8723  C  CG     . ASN B  1 200 ? 7.366   -22.414 7.350   1.00 126.64 ? 199 ASN B CG     1 
ATOM   8724  O  OD1    . ASN B  1 200 ? 8.509   -21.981 7.197   1.00 115.62 ? 199 ASN B OD1    1 
ATOM   8725  N  ND2    . ASN B  1 200 ? 6.799   -22.531 8.546   1.00 140.13 ? 199 ASN B ND2    1 
ATOM   8726  H  H      . ASN B  1 200 ? 9.037   -23.988 5.926   1.00 136.71 ? 199 ASN B H      1 
ATOM   8727  H  HA     . ASN B  1 200 ? 6.763   -23.942 4.436   1.00 135.48 ? 199 ASN B HA     1 
ATOM   8728  H  HB2    . ASN B  1 200 ? 6.059   -22.072 5.827   1.00 144.18 ? 199 ASN B HB2    1 
ATOM   8729  H  HB3    . ASN B  1 200 ? 5.892   -23.513 6.476   1.00 144.18 ? 199 ASN B HB3    1 
ATOM   8730  H  HD21   . ASN B  1 200 ? 6.000   -22.841 8.614   1.00 168.16 ? 199 ASN B HD21   1 
ATOM   8731  H  HD22   . ASN B  1 200 ? 7.232   -22.297 9.252   1.00 168.16 ? 199 ASN B HD22   1 
ATOM   8732  N  N      . CYS B  1 201 ? 7.290   -21.583 3.492   1.00 123.83 ? 200 CYS B N      1 
ATOM   8733  C  CA     . CYS B  1 201 ? 7.846   -20.594 2.571   1.00 114.62 ? 200 CYS B CA     1 
ATOM   8734  C  C      . CYS B  1 201 ? 8.989   -19.784 3.177   1.00 101.97 ? 200 CYS B C      1 
ATOM   8735  O  O      . CYS B  1 201 ? 10.084  -19.729 2.616   1.00 107.38 ? 200 CYS B O      1 
ATOM   8736  C  CB     . CYS B  1 201 ? 6.747   -19.647 2.087   1.00 106.17 ? 200 CYS B CB     1 
ATOM   8737  S  SG     . CYS B  1 201 ? 5.484   -20.448 1.070   1.00 188.87 ? 200 CYS B SG     1 
ATOM   8738  H  H      . CYS B  1 201 ? 6.431   -21.602 3.506   1.00 148.59 ? 200 CYS B H      1 
ATOM   8739  H  HA     . CYS B  1 201 ? 8.200   -21.064 1.787   1.00 137.55 ? 200 CYS B HA     1 
ATOM   8740  H  HB2    . CYS B  1 201 ? 6.304   -19.261 2.859   1.00 127.41 ? 200 CYS B HB2    1 
ATOM   8741  H  HB3    . CYS B  1 201 ? 7.152   -18.944 1.555   1.00 127.41 ? 200 CYS B HB3    1 
ATOM   8742  H  HG     . CYS B  1 201 ? 4.671   -19.629 0.741   1.00 226.65 ? 200 CYS B HG     1 
ATOM   8743  N  N      . VAL B  1 202 ? 8.735   -19.158 4.321   1.00 86.28  ? 201 VAL B N      1 
ATOM   8744  C  CA     . VAL B  1 202 ? 9.700   -18.231 4.906   1.00 93.78  ? 201 VAL B CA     1 
ATOM   8745  C  C      . VAL B  1 202 ? 10.947  -18.909 5.481   1.00 94.14  ? 201 VAL B C      1 
ATOM   8746  O  O      . VAL B  1 202 ? 11.859  -18.230 5.954   1.00 94.15  ? 201 VAL B O      1 
ATOM   8747  C  CB     . VAL B  1 202 ? 9.057   -17.359 6.003   1.00 87.08  ? 201 VAL B CB     1 
ATOM   8748  C  CG1    . VAL B  1 202 ? 7.928   -16.522 5.415   1.00 87.76  ? 201 VAL B CG1    1 
ATOM   8749  C  CG2    . VAL B  1 202 ? 8.562   -18.218 7.160   1.00 71.83  ? 201 VAL B CG2    1 
ATOM   8750  H  H      . VAL B  1 202 ? 8.013   -19.252 4.778   1.00 103.53 ? 201 VAL B H      1 
ATOM   8751  H  HA     . VAL B  1 202 ? 10.004  -17.625 4.198   1.00 112.54 ? 201 VAL B HA     1 
ATOM   8752  H  HB     . VAL B  1 202 ? 9.733   -16.744 6.355   1.00 104.50 ? 201 VAL B HB     1 
ATOM   8753  H  HG11   . VAL B  1 202 ? 7.541   -15.987 6.112   1.00 105.31 ? 201 VAL B HG11   1 
ATOM   8754  H  HG12   . VAL B  1 202 ? 8.285   -15.956 4.727   1.00 105.31 ? 201 VAL B HG12   1 
ATOM   8755  H  HG13   . VAL B  1 202 ? 7.265   -17.109 5.045   1.00 105.31 ? 201 VAL B HG13   1 
ATOM   8756  H  HG21   . VAL B  1 202 ? 8.167   -17.648 7.824   1.00 86.19  ? 201 VAL B HG21   1 
ATOM   8757  H  HG22   . VAL B  1 202 ? 7.908   -18.839 6.830   1.00 86.19  ? 201 VAL B HG22   1 
ATOM   8758  H  HG23   . VAL B  1 202 ? 9.306   -18.694 7.536   1.00 86.19  ? 201 VAL B HG23   1 
ATOM   8759  N  N      . ALA B  1 203 ? 10.994  -20.236 5.440   1.00 82.33  ? 202 ALA B N      1 
ATOM   8760  C  CA     . ALA B  1 203 ? 12.174  -20.957 5.905   1.00 72.13  ? 202 ALA B CA     1 
ATOM   8761  C  C      . ALA B  1 203 ? 13.378  -20.625 5.028   1.00 78.30  ? 202 ALA B C      1 
ATOM   8762  O  O      . ALA B  1 203 ? 14.517  -20.620 5.496   1.00 71.59  ? 202 ALA B O      1 
ATOM   8763  C  CB     . ALA B  1 203 ? 11.919  -22.447 5.908   1.00 70.41  ? 202 ALA B CB     1 
ATOM   8764  H  H      . ALA B  1 203 ? 10.360  -20.741 5.150   1.00 98.79  ? 202 ALA B H      1 
ATOM   8765  H  HA     . ALA B  1 203 ? 12.379  -20.680 6.823   1.00 86.55  ? 202 ALA B HA     1 
ATOM   8766  H  HB1    . ALA B  1 203 ? 12.709  -22.898 6.217   1.00 84.49  ? 202 ALA B HB1    1 
ATOM   8767  H  HB2    . ALA B  1 203 ? 11.183  -22.637 6.494   1.00 84.49  ? 202 ALA B HB2    1 
ATOM   8768  H  HB3    . ALA B  1 203 ? 11.709  -22.729 5.015   1.00 84.49  ? 202 ALA B HB3    1 
ATOM   8769  N  N      . ASP B  1 204 ? 13.121  -20.355 3.752   1.00 82.88  ? 203 ASP B N      1 
ATOM   8770  C  CA     . ASP B  1 204 ? 14.181  -19.969 2.830   1.00 84.91  ? 203 ASP B CA     1 
ATOM   8771  C  C      . ASP B  1 204 ? 14.718  -18.584 3.182   1.00 85.15  ? 203 ASP B C      1 
ATOM   8772  O  O      . ASP B  1 204 ? 15.910  -18.314 3.039   1.00 80.13  ? 203 ASP B O      1 
ATOM   8773  C  CB     . ASP B  1 204 ? 13.671  -19.988 1.386   1.00 93.22  ? 203 ASP B CB     1 
ATOM   8774  C  CG     . ASP B  1 204 ? 13.414  -21.395 0.874   1.00 104.21 ? 203 ASP B CG     1 
ATOM   8775  O  OD1    . ASP B  1 204 ? 12.446  -21.582 0.107   1.00 93.57  ? 203 ASP B OD1    1 
ATOM   8776  O  OD2    . ASP B  1 204 ? 14.181  -22.314 1.238   1.00 104.35 ? 203 ASP B OD2    1 
ATOM   8777  H  H      . ASP B  1 204 ? 12.339  -20.387 3.396   1.00 99.46  ? 203 ASP B H      1 
ATOM   8778  H  HA     . ASP B  1 204 ? 14.919  -20.610 2.902   1.00 101.89 ? 203 ASP B HA     1 
ATOM   8779  H  HB2    . ASP B  1 204 ? 12.838  -19.494 1.339   1.00 111.86 ? 203 ASP B HB2    1 
ATOM   8780  H  HB3    . ASP B  1 204 ? 14.335  -19.576 0.811   1.00 111.86 ? 203 ASP B HB3    1 
ATOM   8781  N  N      . ILE B  1 205 ? 13.832  -17.709 3.647   1.00 84.08  ? 204 ILE B N      1 
ATOM   8782  C  CA     . ILE B  1 205 ? 14.222  -16.353 4.018   1.00 70.71  ? 204 ILE B CA     1 
ATOM   8783  C  C      . ILE B  1 205 ? 15.283  -16.384 5.112   1.00 68.50  ? 204 ILE B C      1 
ATOM   8784  O  O      . ILE B  1 205 ? 16.269  -15.646 5.057   1.00 64.02  ? 204 ILE B O      1 
ATOM   8785  C  CB     . ILE B  1 205 ? 13.022  -15.535 4.516   1.00 65.73  ? 204 ILE B CB     1 
ATOM   8786  C  CG1    . ILE B  1 205 ? 11.949  -15.442 3.429   1.00 64.44  ? 204 ILE B CG1    1 
ATOM   8787  C  CG2    . ILE B  1 205 ? 13.473  -14.146 4.939   1.00 70.31  ? 204 ILE B CG2    1 
ATOM   8788  C  CD1    . ILE B  1 205 ? 12.417  -14.771 2.154   1.00 73.47  ? 204 ILE B CD1    1 
ATOM   8789  H  H      . ILE B  1 205 ? 12.996  -17.876 3.758   1.00 100.90 ? 204 ILE B H      1 
ATOM   8790  H  HA     . ILE B  1 205 ? 14.600  -15.900 3.236   1.00 84.85  ? 204 ILE B HA     1 
ATOM   8791  H  HB     . ILE B  1 205 ? 12.642  -15.984 5.287   1.00 78.87  ? 204 ILE B HB     1 
ATOM   8792  H  HG12   . ILE B  1 205 ? 11.658  -16.339 3.201   1.00 77.33  ? 204 ILE B HG12   1 
ATOM   8793  H  HG13   . ILE B  1 205 ? 11.200  -14.932 3.773   1.00 77.33  ? 204 ILE B HG13   1 
ATOM   8794  H  HG21   . ILE B  1 205 ? 12.711  -13.651 5.247   1.00 84.37  ? 204 ILE B HG21   1 
ATOM   8795  H  HG22   . ILE B  1 205 ? 14.118  -14.229 5.646   1.00 84.37  ? 204 ILE B HG22   1 
ATOM   8796  H  HG23   . ILE B  1 205 ? 13.869  -13.704 4.185   1.00 84.37  ? 204 ILE B HG23   1 
ATOM   8797  H  HD11   . ILE B  1 205 ? 11.691  -14.752 1.526   1.00 88.16  ? 204 ILE B HD11   1 
ATOM   8798  H  HD12   . ILE B  1 205 ? 12.698  -13.876 2.358   1.00 88.16  ? 204 ILE B HD12   1 
ATOM   8799  H  HD13   . ILE B  1 205 ? 13.152  -15.270 1.790   1.00 88.16  ? 204 ILE B HD13   1 
ATOM   8800  N  N      . TRP B  1 206 ? 15.070  -17.232 6.113   1.00 62.74  ? 205 TRP B N      1 
ATOM   8801  C  CA     . TRP B  1 206 ? 16.072  -17.447 7.145   1.00 67.74  ? 205 TRP B CA     1 
ATOM   8802  C  C      . TRP B  1 206 ? 17.395  -17.842 6.492   1.00 72.71  ? 205 TRP B C      1 
ATOM   8803  O  O      . TRP B  1 206 ? 18.426  -17.197 6.706   1.00 51.59  ? 205 TRP B O      1 
ATOM   8804  C  CB     . TRP B  1 206 ? 15.618  -18.538 8.113   1.00 72.72  ? 205 TRP B CB     1 
ATOM   8805  C  CG     . TRP B  1 206 ? 16.660  -18.900 9.129   1.00 83.10  ? 205 TRP B CG     1 
ATOM   8806  C  CD1    . TRP B  1 206 ? 17.681  -19.796 8.976   1.00 71.70  ? 205 TRP B CD1    1 
ATOM   8807  C  CD2    . TRP B  1 206 ? 16.785  -18.371 10.455  1.00 85.46  ? 205 TRP B CD2    1 
ATOM   8808  N  NE1    . TRP B  1 206 ? 18.432  -19.857 10.126  1.00 75.52  ? 205 TRP B NE1    1 
ATOM   8809  C  CE2    . TRP B  1 206 ? 17.904  -18.992 11.047  1.00 78.33  ? 205 TRP B CE2    1 
ATOM   8810  C  CE3    . TRP B  1 206 ? 16.060  -17.433 11.197  1.00 79.84  ? 205 TRP B CE3    1 
ATOM   8811  C  CZ2    . TRP B  1 206 ? 18.313  -18.703 12.347  1.00 62.03  ? 205 TRP B CZ2    1 
ATOM   8812  C  CZ3    . TRP B  1 206 ? 16.469  -17.149 12.488  1.00 69.12  ? 205 TRP B CZ3    1 
ATOM   8813  C  CH2    . TRP B  1 206 ? 17.585  -17.782 13.049  1.00 67.79  ? 205 TRP B CH2    1 
ATOM   8814  H  H      . TRP B  1 206 ? 14.352  -17.695 6.216   1.00 75.28  ? 205 TRP B H      1 
ATOM   8815  H  HA     . TRP B  1 206 ? 16.208  -16.617 7.649   1.00 81.28  ? 205 TRP B HA     1 
ATOM   8816  H  HB2    . TRP B  1 206 ? 14.832  -18.228 8.590   1.00 87.26  ? 205 TRP B HB2    1 
ATOM   8817  H  HB3    . TRP B  1 206 ? 15.404  -19.337 7.608   1.00 87.26  ? 205 TRP B HB3    1 
ATOM   8818  H  HD1    . TRP B  1 206 ? 17.843  -20.293 8.207   1.00 86.04  ? 205 TRP B HD1    1 
ATOM   8819  H  HE1    . TRP B  1 206 ? 19.122  -20.356 10.246  1.00 90.62  ? 205 TRP B HE1    1 
ATOM   8820  H  HE3    . TRP B  1 206 ? 15.319  -17.008 10.830  1.00 95.81  ? 205 TRP B HE3    1 
ATOM   8821  H  HZ2    . TRP B  1 206 ? 19.053  -19.123 12.724  1.00 74.44  ? 205 TRP B HZ2    1 
ATOM   8822  H  HZ3    . TRP B  1 206 ? 15.995  -16.527 12.991  1.00 82.94  ? 205 TRP B HZ3    1 
ATOM   8823  H  HH2    . TRP B  1 206 ? 17.836  -17.572 13.920  1.00 81.35  ? 205 TRP B HH2    1 
ATOM   8824  N  N      . SER B  1 207 ? 17.347  -18.899 5.684   1.00 68.38  ? 206 SER B N      1 
ATOM   8825  C  CA     . SER B  1 207 ? 18.527  -19.407 4.996   1.00 55.57  ? 206 SER B CA     1 
ATOM   8826  C  C      . SER B  1 207 ? 19.229  -18.276 4.257   1.00 75.04  ? 206 SER B C      1 
ATOM   8827  O  O      . SER B  1 207 ? 20.455  -18.161 4.295   1.00 67.63  ? 206 SER B O      1 
ATOM   8828  C  CB     . SER B  1 207 ? 18.133  -20.499 3.999   1.00 65.01  ? 206 SER B CB     1 
ATOM   8829  O  OG     . SER B  1 207 ? 17.360  -21.513 4.614   1.00 93.82  ? 206 SER B OG     1 
ATOM   8830  H  H      . SER B  1 207 ? 16.630  -19.344 5.516   1.00 82.06  ? 206 SER B H      1 
ATOM   8831  H  HA     . SER B  1 207 ? 19.150  -19.789 5.648   1.00 66.68  ? 206 SER B HA     1 
ATOM   8832  H  HB2    . SER B  1 207 ? 17.612  -20.098 3.285   1.00 78.01  ? 206 SER B HB2    1 
ATOM   8833  H  HB3    . SER B  1 207 ? 18.939  -20.896 3.635   1.00 78.01  ? 206 SER B HB3    1 
ATOM   8834  H  HG     . SER B  1 207 ? 17.253  -21.342 5.409   1.00 112.58 ? 206 SER B HG     1 
ATOM   8835  N  N      . LEU B  1 208 ? 18.440  -17.442 3.585   1.00 70.64  ? 207 LEU B N      1 
ATOM   8836  C  CA     . LEU B  1 208 ? 18.980  -16.313 2.842   1.00 67.25  ? 207 LEU B CA     1 
ATOM   8837  C  C      . LEU B  1 208 ? 19.791  -15.420 3.773   1.00 81.00  ? 207 LEU B C      1 
ATOM   8838  O  O      . LEU B  1 208 ? 20.910  -15.017 3.447   1.00 75.91  ? 207 LEU B O      1 
ATOM   8839  C  CB     . LEU B  1 208 ? 17.852  -15.507 2.197   1.00 59.90  ? 207 LEU B CB     1 
ATOM   8840  C  CG     . LEU B  1 208 ? 18.310  -14.421 1.219   1.00 63.95  ? 207 LEU B CG     1 
ATOM   8841  C  CD1    . LEU B  1 208 ? 18.933  -15.047 -0.023  1.00 51.19  ? 207 LEU B CD1    1 
ATOM   8842  C  CD2    . LEU B  1 208 ? 17.152  -13.510 0.842   1.00 72.41  ? 207 LEU B CD2    1 
ATOM   8843  H  H      . LEU B  1 208 ? 17.584  -17.511 3.544   1.00 84.76  ? 207 LEU B H      1 
ATOM   8844  H  HA     . LEU B  1 208 ? 19.572  -16.641 2.133   1.00 80.70  ? 207 LEU B HA     1 
ATOM   8845  H  HB2    . LEU B  1 208 ? 17.277  -16.117 1.708   1.00 71.88  ? 207 LEU B HB2    1 
ATOM   8846  H  HB3    . LEU B  1 208 ? 17.343  -15.072 2.899   1.00 71.88  ? 207 LEU B HB3    1 
ATOM   8847  H  HG     . LEU B  1 208 ? 18.988  -13.878 1.649   1.00 76.74  ? 207 LEU B HG     1 
ATOM   8848  H  HD11   . LEU B  1 208 ? 19.211  -14.347 -0.619  1.00 61.42  ? 207 LEU B HD11   1 
ATOM   8849  H  HD12   . LEU B  1 208 ? 19.691  -15.574 0.240   1.00 61.42  ? 207 LEU B HD12   1 
ATOM   8850  H  HD13   . LEU B  1 208 ? 18.279  -15.604 -0.453  1.00 61.42  ? 207 LEU B HD13   1 
ATOM   8851  H  HD21   . LEU B  1 208 ? 17.468  -12.841 0.230   1.00 86.89  ? 207 LEU B HD21   1 
ATOM   8852  H  HD22   . LEU B  1 208 ? 16.464  -14.035 0.428   1.00 86.89  ? 207 LEU B HD22   1 
ATOM   8853  H  HD23   . LEU B  1 208 ? 16.812  -13.093 1.637   1.00 86.89  ? 207 LEU B HD23   1 
ATOM   8854  N  N      . GLY B  1 209 ? 19.222  -15.114 4.935   1.00 72.44  ? 208 GLY B N      1 
ATOM   8855  C  CA     . GLY B  1 209 ? 19.919  -14.326 5.932   1.00 66.90  ? 208 GLY B CA     1 
ATOM   8856  C  C      . GLY B  1 209 ? 21.270  -14.937 6.254   1.00 66.68  ? 208 GLY B C      1 
ATOM   8857  O  O      . GLY B  1 209 ? 22.293  -14.252 6.220   1.00 66.35  ? 208 GLY B O      1 
ATOM   8858  H  H      . GLY B  1 209 ? 18.430  -15.355 5.167   1.00 86.92  ? 208 GLY B H      1 
ATOM   8859  H  HA2    . GLY B  1 209 ? 20.054  -13.424 5.602   1.00 80.28  ? 208 GLY B HA2    1 
ATOM   8860  H  HA3    . GLY B  1 209 ? 19.392  -14.285 6.746   1.00 80.28  ? 208 GLY B HA3    1 
ATOM   8861  N  N      . ILE B  1 210 ? 21.274  -16.232 6.560   1.00 52.73  ? 209 ILE B N      1 
ATOM   8862  C  CA     . ILE B  1 210 ? 22.516  -16.947 6.836   1.00 72.91  ? 209 ILE B CA     1 
ATOM   8863  C  C      . ILE B  1 210 ? 23.474  -16.844 5.652   1.00 72.95  ? 209 ILE B C      1 
ATOM   8864  O  O      . ILE B  1 210 ? 24.676  -16.636 5.825   1.00 59.60  ? 209 ILE B O      1 
ATOM   8865  C  CB     . ILE B  1 210 ? 22.265  -18.437 7.128   1.00 63.92  ? 209 ILE B CB     1 
ATOM   8866  C  CG1    . ILE B  1 210 ? 21.361  -18.597 8.349   1.00 55.63  ? 209 ILE B CG1    1 
ATOM   8867  C  CG2    . ILE B  1 210 ? 23.588  -19.166 7.354   1.00 53.23  ? 209 ILE B CG2    1 
ATOM   8868  C  CD1    . ILE B  1 210 ? 21.962  -18.058 9.622   1.00 71.47  ? 209 ILE B CD1    1 
ATOM   8869  H  H      . ILE B  1 210 ? 20.568  -16.720 6.615   1.00 63.27  ? 209 ILE B H      1 
ATOM   8870  H  HA     . ILE B  1 210 ? 22.951  -16.549 7.619   1.00 87.49  ? 209 ILE B HA     1 
ATOM   8871  H  HB     . ILE B  1 210 ? 21.822  -18.832 6.361   1.00 76.71  ? 209 ILE B HB     1 
ATOM   8872  H  HG12   . ILE B  1 210 ? 20.531  -18.122 8.188   1.00 66.76  ? 209 ILE B HG12   1 
ATOM   8873  H  HG13   . ILE B  1 210 ? 21.179  -19.541 8.482   1.00 66.76  ? 209 ILE B HG13   1 
ATOM   8874  H  HG21   . ILE B  1 210 ? 23.407  -20.091 7.534   1.00 63.88  ? 209 ILE B HG21   1 
ATOM   8875  H  HG22   . ILE B  1 210 ? 24.127  -19.084 6.564   1.00 63.88  ? 209 ILE B HG22   1 
ATOM   8876  H  HG23   . ILE B  1 210 ? 24.039  -18.768 8.102   1.00 63.88  ? 209 ILE B HG23   1 
ATOM   8877  H  HD11   . ILE B  1 210 ? 21.340  -18.193 10.341  1.00 85.77  ? 209 ILE B HD11   1 
ATOM   8878  H  HD12   . ILE B  1 210 ? 22.780  -18.527 9.803   1.00 85.77  ? 209 ILE B HD12   1 
ATOM   8879  H  HD13   . ILE B  1 210 ? 22.138  -17.121 9.512   1.00 85.77  ? 209 ILE B HD13   1 
ATOM   8880  N  N      . THR B  1 211 ? 22.934  -16.989 4.447   1.00 65.15  ? 210 THR B N      1 
ATOM   8881  C  CA     . THR B  1 211 ? 23.745  -16.914 3.242   1.00 69.05  ? 210 THR B CA     1 
ATOM   8882  C  C      . THR B  1 211 ? 24.373  -15.527 3.119   1.00 80.47  ? 210 THR B C      1 
ATOM   8883  O  O      . THR B  1 211 ? 25.515  -15.390 2.677   1.00 70.93  ? 210 THR B O      1 
ATOM   8884  C  CB     . THR B  1 211 ? 22.916  -17.203 1.982   1.00 65.62  ? 210 THR B CB     1 
ATOM   8885  O  OG1    . THR B  1 211 ? 22.258  -18.469 2.110   1.00 83.43  ? 210 THR B OG1    1 
ATOM   8886  C  CG2    . THR B  1 211 ? 23.815  -17.235 0.767   1.00 67.20  ? 210 THR B CG2    1 
ATOM   8887  H  H      . THR B  1 211 ? 22.099  -17.132 4.301   1.00 78.18  ? 210 THR B H      1 
ATOM   8888  H  HA     . THR B  1 211 ? 24.467  -17.576 3.294   1.00 82.86  ? 210 THR B HA     1 
ATOM   8889  H  HB     . THR B  1 211 ? 22.255  -16.504 1.860   1.00 78.74  ? 210 THR B HB     1 
ATOM   8890  H  HG1    . THR B  1 211 ? 21.760  -18.462 2.761   1.00 100.11 ? 210 THR B HG1    1 
ATOM   8891  H  HG21   . THR B  1 211 ? 23.296  -17.416 -0.020  1.00 80.64  ? 210 THR B HG21   1 
ATOM   8892  H  HG22   . THR B  1 211 ? 24.256  -16.389 0.662   1.00 80.64  ? 210 THR B HG22   1 
ATOM   8893  H  HG23   . THR B  1 211 ? 24.478  -17.922 0.867   1.00 80.64  ? 210 THR B HG23   1 
ATOM   8894  N  N      . SER B  1 212 ? 23.624  -14.500 3.513   1.00 60.11  ? 211 SER B N      1 
ATOM   8895  C  CA     . SER B  1 212 ? 24.134  -13.134 3.497   1.00 61.34  ? 211 SER B CA     1 
ATOM   8896  C  C      . SER B  1 212 ? 25.393  -13.040 4.352   1.00 66.95  ? 211 SER B C      1 
ATOM   8897  O  O      . SER B  1 212 ? 26.384  -12.427 3.954   1.00 66.19  ? 211 SER B O      1 
ATOM   8898  C  CB     . SER B  1 212 ? 23.077  -12.160 4.016   1.00 73.98  ? 211 SER B CB     1 
ATOM   8899  O  OG     . SER B  1 212 ? 21.864  -12.292 3.294   1.00 90.65  ? 211 SER B OG     1 
ATOM   8900  H  H      . SER B  1 212 ? 22.814  -14.570 3.795   1.00 72.13  ? 211 SER B H      1 
ATOM   8901  H  HA     . SER B  1 212 ? 24.363  -12.882 2.578   1.00 73.61  ? 211 SER B HA     1 
ATOM   8902  H  HB2    . SER B  1 212 ? 22.908  -12.347 4.952   1.00 88.77  ? 211 SER B HB2    1 
ATOM   8903  H  HB3    . SER B  1 212 ? 23.406  -11.254 3.914   1.00 88.77  ? 211 SER B HB3    1 
ATOM   8904  H  HG     . SER B  1 212 ? 21.941  -12.873 2.720   1.00 108.78 ? 211 SER B HG     1 
ATOM   8905  N  N      . ILE B  1 213 ? 25.351  -13.655 5.528   1.00 63.39  ? 212 ILE B N      1 
ATOM   8906  C  CA     . ILE B  1 213 ? 26.516  -13.693 6.400   1.00 67.62  ? 212 ILE B CA     1 
ATOM   8907  C  C      . ILE B  1 213 ? 27.621  -14.519 5.745   1.00 72.00  ? 212 ILE B C      1 
ATOM   8908  O  O      . ILE B  1 213 ? 28.790  -14.131 5.771   1.00 60.01  ? 212 ILE B O      1 
ATOM   8909  C  CB     . ILE B  1 213 ? 26.169  -14.271 7.788   1.00 72.22  ? 212 ILE B CB     1 
ATOM   8910  C  CG1    . ILE B  1 213 ? 25.069  -13.431 8.443   1.00 76.88  ? 212 ILE B CG1    1 
ATOM   8911  C  CG2    . ILE B  1 213 ? 27.411  -14.314 8.674   1.00 62.34  ? 212 ILE B CG2    1 
ATOM   8912  C  CD1    . ILE B  1 213 ? 24.757  -13.820 9.864   1.00 74.61  ? 212 ILE B CD1    1 
ATOM   8913  H  H      . ILE B  1 213 ? 24.660  -14.057 5.844   1.00 76.07  ? 212 ILE B H      1 
ATOM   8914  H  HA     . ILE B  1 213 ? 26.851  -12.781 6.526   1.00 81.14  ? 212 ILE B HA     1 
ATOM   8915  H  HB     . ILE B  1 213 ? 25.840  -15.176 7.673   1.00 86.66  ? 212 ILE B HB     1 
ATOM   8916  H  HG12   . ILE B  1 213 ? 25.348  -12.502 8.446   1.00 92.25  ? 212 ILE B HG12   1 
ATOM   8917  H  HG13   . ILE B  1 213 ? 24.255  -13.526 7.925   1.00 92.25  ? 212 ILE B HG13   1 
ATOM   8918  H  HG21   . ILE B  1 213 ? 27.171  -14.676 9.530   1.00 74.81  ? 212 ILE B HG21   1 
ATOM   8919  H  HG22   . ILE B  1 213 ? 28.073  -14.870 8.257   1.00 74.81  ? 212 ILE B HG22   1 
ATOM   8920  H  HG23   . ILE B  1 213 ? 27.751  -13.422 8.779   1.00 74.81  ? 212 ILE B HG23   1 
ATOM   8921  H  HD11   . ILE B  1 213 ? 24.062  -13.249 10.198  1.00 89.54  ? 212 ILE B HD11   1 
ATOM   8922  H  HD12   . ILE B  1 213 ? 24.466  -14.735 9.879   1.00 89.54  ? 212 ILE B HD12   1 
ATOM   8923  H  HD13   . ILE B  1 213 ? 25.549  -13.719 10.396  1.00 89.54  ? 212 ILE B HD13   1 
ATOM   8924  N  N      . GLU B  1 214 ? 27.242  -15.645 5.145   1.00 79.05  ? 213 GLU B N      1 
ATOM   8925  C  CA     . GLU B  1 214 ? 28.194  -16.518 4.460   1.00 84.28  ? 213 GLU B CA     1 
ATOM   8926  C  C      . GLU B  1 214 ? 28.989  -15.763 3.396   1.00 85.15  ? 213 GLU B C      1 
ATOM   8927  O  O      . GLU B  1 214 ? 30.205  -15.930 3.287   1.00 65.56  ? 213 GLU B O      1 
ATOM   8928  C  CB     . GLU B  1 214 ? 27.468  -17.695 3.807   1.00 92.04  ? 213 GLU B CB     1 
ATOM   8929  C  CG     . GLU B  1 214 ? 28.402  -18.672 3.106   1.00 99.03  ? 213 GLU B CG     1 
ATOM   8930  C  CD     . GLU B  1 214 ? 27.662  -19.772 2.368   1.00 93.63  ? 213 GLU B CD     1 
ATOM   8931  O  OE1    . GLU B  1 214 ? 28.322  -20.735 1.922   1.00 95.96  ? 213 GLU B OE1    1 
ATOM   8932  O  OE2    . GLU B  1 214 ? 26.424  -19.672 2.232   1.00 83.83  ? 213 GLU B OE2    1 
ATOM   8933  H  H      . GLU B  1 214 ? 26.431  -15.930 5.121   1.00 94.85  ? 213 GLU B H      1 
ATOM   8934  H  HA     . GLU B  1 214 ? 28.828  -16.877 5.115   1.00 101.14 ? 213 GLU B HA     1 
ATOM   8935  H  HB2    . GLU B  1 214 ? 26.986  -18.184 4.492   1.00 110.45 ? 213 GLU B HB2    1 
ATOM   8936  H  HB3    . GLU B  1 214 ? 26.846  -17.352 3.147   1.00 110.45 ? 213 GLU B HB3    1 
ATOM   8937  H  HG2    . GLU B  1 214 ? 28.939  -18.187 2.460   1.00 118.84 ? 213 GLU B HG2    1 
ATOM   8938  H  HG3    . GLU B  1 214 ? 28.977  -19.089 3.767   1.00 118.84 ? 213 GLU B HG3    1 
ATOM   8939  N  N      . MET B  1 215 ? 28.299  -14.944 2.607   1.00 74.56  ? 214 MET B N      1 
ATOM   8940  C  CA     . MET B  1 215 ? 28.956  -14.142 1.580   1.00 71.32  ? 214 MET B CA     1 
ATOM   8941  C  C      . MET B  1 215 ? 29.841  -13.069 2.207   1.00 78.39  ? 214 MET B C      1 
ATOM   8942  O  O      . MET B  1 215 ? 30.903  -12.735 1.678   1.00 61.14  ? 214 MET B O      1 
ATOM   8943  C  CB     . MET B  1 215 ? 27.920  -13.465 0.683   1.00 68.92  ? 214 MET B CB     1 
ATOM   8944  C  CG     . MET B  1 215 ? 27.049  -14.413 -0.118  1.00 55.75  ? 214 MET B CG     1 
ATOM   8945  S  SD     . MET B  1 215 ? 25.839  -13.499 -1.095  1.00 90.03  ? 214 MET B SD     1 
ATOM   8946  C  CE     . MET B  1 215 ? 24.859  -14.828 -1.791  1.00 123.06 ? 214 MET B CE     1 
ATOM   8947  H  H      . MET B  1 215 ? 27.447  -14.834 2.647   1.00 89.47  ? 214 MET B H      1 
ATOM   8948  H  HA     . MET B  1 215 ? 29.508  -14.727 1.020   1.00 85.59  ? 214 MET B HA     1 
ATOM   8949  H  HB2    . MET B  1 215 ? 27.333  -12.929 1.240   1.00 82.70  ? 214 MET B HB2    1 
ATOM   8950  H  HB3    . MET B  1 215 ? 28.384  -12.891 0.054   1.00 82.70  ? 214 MET B HB3    1 
ATOM   8951  H  HG2    . MET B  1 215 ? 27.605  -14.928 -0.724  1.00 66.90  ? 214 MET B HG2    1 
ATOM   8952  H  HG3    . MET B  1 215 ? 26.572  -15.003 0.487   1.00 66.90  ? 214 MET B HG3    1 
ATOM   8953  H  HE1    . MET B  1 215 ? 24.169  -14.452 -2.341  1.00 147.67 ? 214 MET B HE1    1 
ATOM   8954  H  HE2    . MET B  1 215 ? 25.429  -15.392 -2.319  1.00 147.67 ? 214 MET B HE2    1 
ATOM   8955  H  HE3    . MET B  1 215 ? 24.468  -15.335 -1.076  1.00 147.67 ? 214 MET B HE3    1 
ATOM   8956  N  N      . ALA B  1 216 ? 29.394  -12.527 3.335   1.00 80.40  ? 215 ALA B N      1 
ATOM   8957  C  CA     . ALA B  1 216 ? 30.081  -11.412 3.976   1.00 70.14  ? 215 ALA B CA     1 
ATOM   8958  C  C      . ALA B  1 216 ? 31.330  -11.857 4.731   1.00 76.33  ? 215 ALA B C      1 
ATOM   8959  O  O      . ALA B  1 216 ? 32.333  -11.143 4.760   1.00 75.97  ? 215 ALA B O      1 
ATOM   8960  C  CB     . ALA B  1 216 ? 29.130  -10.690 4.918   1.00 60.92  ? 215 ALA B CB     1 
ATOM   8961  H  H      . ALA B  1 216 ? 28.689  -12.789 3.752   1.00 96.48  ? 215 ALA B H      1 
ATOM   8962  H  HA     . ALA B  1 216 ? 30.360  -10.775 3.285   1.00 84.16  ? 215 ALA B HA     1 
ATOM   8963  H  HB1    . ALA B  1 216 ? 29.596  -9.960  5.332   1.00 73.10  ? 215 ALA B HB1    1 
ATOM   8964  H  HB2    . ALA B  1 216 ? 28.383  -10.359 4.414   1.00 73.10  ? 215 ALA B HB2    1 
ATOM   8965  H  HB3    . ALA B  1 216 ? 28.826  -11.307 5.587   1.00 73.10  ? 215 ALA B HB3    1 
ATOM   8966  N  N      . GLU B  1 217 ? 31.270  -13.040 5.334   1.00 96.48  ? 216 GLU B N      1 
ATOM   8967  C  CA     . GLU B  1 217 ? 32.341  -13.500 6.211   1.00 84.15  ? 216 GLU B CA     1 
ATOM   8968  C  C      . GLU B  1 217 ? 33.009  -14.786 5.716   1.00 76.94  ? 216 GLU B C      1 
ATOM   8969  O  O      . GLU B  1 217 ? 34.044  -15.196 6.242   1.00 86.30  ? 216 GLU B O      1 
ATOM   8970  C  CB     . GLU B  1 217 ? 31.794  -13.687 7.629   1.00 101.93 ? 216 GLU B CB     1 
ATOM   8971  C  CG     . GLU B  1 217 ? 30.837  -12.574 8.042   1.00 110.92 ? 216 GLU B CG     1 
ATOM   8972  C  CD     . GLU B  1 217 ? 30.671  -12.449 9.544   1.00 119.28 ? 216 GLU B CD     1 
ATOM   8973  O  OE1    . GLU B  1 217 ? 30.432  -13.478 10.209  1.00 122.43 ? 216 GLU B OE1    1 
ATOM   8974  O  OE2    . GLU B  1 217 ? 30.775  -11.313 10.058  1.00 120.79 ? 216 GLU B OE2    1 
ATOM   8975  H  H      . GLU B  1 217 ? 30.619  -13.595 5.252   1.00 115.78 ? 216 GLU B H      1 
ATOM   8976  H  HA     . GLU B  1 217 ? 33.031  -12.805 6.250   1.00 100.98 ? 216 GLU B HA     1 
ATOM   8977  H  HB2    . GLU B  1 217 ? 31.313  -14.529 7.674   1.00 122.32 ? 216 GLU B HB2    1 
ATOM   8978  H  HB3    . GLU B  1 217 ? 32.534  -13.694 8.256   1.00 122.32 ? 216 GLU B HB3    1 
ATOM   8979  H  HG2    . GLU B  1 217 ? 31.176  -11.729 7.708   1.00 133.10 ? 216 GLU B HG2    1 
ATOM   8980  H  HG3    . GLU B  1 217 ? 29.963  -12.754 7.660   1.00 133.10 ? 216 GLU B HG3    1 
ATOM   8981  N  N      . GLY B  1 218 ? 32.422  -15.417 4.704   1.00 114.73 ? 217 GLY B N      1 
ATOM   8982  C  CA     . GLY B  1 218 ? 33.027  -16.588 4.097   1.00 117.41 ? 217 GLY B CA     1 
ATOM   8983  C  C      . GLY B  1 218 ? 32.367  -17.889 4.507   1.00 111.89 ? 217 GLY B C      1 
ATOM   8984  O  O      . GLY B  1 218 ? 32.258  -18.817 3.706   1.00 132.26 ? 217 GLY B O      1 
ATOM   8985  H  H      . GLY B  1 218 ? 31.673  -15.185 4.353   1.00 137.68 ? 217 GLY B H      1 
ATOM   8986  H  HA2    . GLY B  1 218 ? 32.972  -16.512 3.131   1.00 140.89 ? 217 GLY B HA2    1 
ATOM   8987  H  HA3    . GLY B  1 218 ? 33.963  -16.631 4.346   1.00 140.89 ? 217 GLY B HA3    1 
ATOM   8988  N  N      . LYS B  1 219 ? 31.930  -17.959 5.758   1.00 90.23  ? 218 LYS B N      1 
ATOM   8989  C  CA     . LYS B  1 219 ? 31.296  -19.162 6.279   1.00 84.71  ? 218 LYS B CA     1 
ATOM   8990  C  C      . LYS B  1 219 ? 30.156  -18.773 7.210   1.00 107.12 ? 218 LYS B C      1 
ATOM   8991  O  O      . LYS B  1 219 ? 30.221  -17.737 7.872   1.00 140.78 ? 218 LYS B O      1 
ATOM   8992  C  CB     . LYS B  1 219 ? 32.321  -20.017 7.025   1.00 75.86  ? 218 LYS B CB     1 
ATOM   8993  C  CG     . LYS B  1 219 ? 33.010  -19.285 8.163   1.00 101.03 ? 218 LYS B CG     1 
ATOM   8994  C  CD     . LYS B  1 219 ? 34.216  -20.051 8.681   1.00 128.44 ? 218 LYS B CD     1 
ATOM   8995  C  CE     . LYS B  1 219 ? 34.964  -19.248 9.735   1.00 146.67 ? 218 LYS B CE     1 
ATOM   8996  N  NZ     . LYS B  1 219 ? 36.210  -19.925 10.188  1.00 150.05 ? 218 LYS B NZ     1 
ATOM   8997  H  H      . LYS B  1 219 ? 31.989  -17.319 6.330   1.00 108.27 ? 218 LYS B H      1 
ATOM   8998  H  HA     . LYS B  1 219 ? 30.929  -19.688 5.538   1.00 101.65 ? 218 LYS B HA     1 
ATOM   8999  H  HB2    . LYS B  1 219 ? 31.871  -20.791 7.399   1.00 91.03  ? 218 LYS B HB2    1 
ATOM   9000  H  HB3    . LYS B  1 219 ? 33.004  -20.304 6.399   1.00 91.03  ? 218 LYS B HB3    1 
ATOM   9001  H  HG2    . LYS B  1 219 ? 33.314  -18.420 7.847   1.00 121.24 ? 218 LYS B HG2    1 
ATOM   9002  H  HG3    . LYS B  1 219 ? 32.385  -19.173 8.896   1.00 121.24 ? 218 LYS B HG3    1 
ATOM   9003  H  HD2    . LYS B  1 219 ? 33.920  -20.882 9.084   1.00 154.13 ? 218 LYS B HD2    1 
ATOM   9004  H  HD3    . LYS B  1 219 ? 34.823  -20.230 7.946   1.00 154.13 ? 218 LYS B HD3    1 
ATOM   9005  H  HE2    . LYS B  1 219 ? 35.207  -18.386 9.363   1.00 176.00 ? 218 LYS B HE2    1 
ATOM   9006  H  HE3    . LYS B  1 219 ? 34.390  -19.126 10.508  1.00 176.00 ? 218 LYS B HE3    1 
ATOM   9007  H  HZ1    . LYS B  1 219 ? 36.620  -19.428 10.802  1.00 180.07 ? 218 LYS B HZ1    1 
ATOM   9008  H  HZ2    . LYS B  1 219 ? 36.014  -20.718 10.541  1.00 180.07 ? 218 LYS B HZ2    1 
ATOM   9009  H  HZ3    . LYS B  1 219 ? 36.760  -20.043 9.497   1.00 180.07 ? 218 LYS B HZ3    1 
ATOM   9010  N  N      . PRO B  1 220 ? 29.104  -19.602 7.265   1.00 84.36  ? 219 PRO B N      1 
ATOM   9011  C  CA     . PRO B  1 220 ? 27.953  -19.263 8.107   1.00 85.25  ? 219 PRO B CA     1 
ATOM   9012  C  C      . PRO B  1 220 ? 28.280  -19.422 9.585   1.00 91.89  ? 219 PRO B C      1 
ATOM   9013  O  O      . PRO B  1 220 ? 29.276  -20.059 9.921   1.00 105.13 ? 219 PRO B O      1 
ATOM   9014  C  CB     . PRO B  1 220 ? 26.901  -20.286 7.679   1.00 75.45  ? 219 PRO B CB     1 
ATOM   9015  C  CG     . PRO B  1 220 ? 27.693  -21.467 7.250   1.00 72.68  ? 219 PRO B CG     1 
ATOM   9016  C  CD     . PRO B  1 220 ? 28.950  -20.920 6.625   1.00 72.02  ? 219 PRO B CD     1 
ATOM   9017  H  HA     . PRO B  1 220 ? 27.635  -18.355 7.924   1.00 102.30 ? 219 PRO B HA     1 
ATOM   9018  H  HB2    . PRO B  1 220 ? 26.331  -20.508 8.432   1.00 90.53  ? 219 PRO B HB2    1 
ATOM   9019  H  HB3    . PRO B  1 220 ? 26.380  -19.934 6.941   1.00 90.53  ? 219 PRO B HB3    1 
ATOM   9020  H  HG2    . PRO B  1 220 ? 27.906  -22.012 8.023   1.00 87.22  ? 219 PRO B HG2    1 
ATOM   9021  H  HG3    . PRO B  1 220 ? 27.185  -21.979 6.601   1.00 87.22  ? 219 PRO B HG3    1 
ATOM   9022  H  HD2    . PRO B  1 220 ? 29.708  -21.488 6.836   1.00 86.42  ? 219 PRO B HD2    1 
ATOM   9023  H  HD3    . PRO B  1 220 ? 28.836  -20.819 5.667   1.00 86.42  ? 219 PRO B HD3    1 
ATOM   9024  N  N      . PRO B  1 221 ? 27.456  -18.835 10.463  1.00 96.95  ? 220 PRO B N      1 
ATOM   9025  C  CA     . PRO B  1 221 ? 27.622  -19.032 11.907  1.00 100.36 ? 220 PRO B CA     1 
ATOM   9026  C  C      . PRO B  1 221 ? 27.461  -20.499 12.302  1.00 106.29 ? 220 PRO B C      1 
ATOM   9027  O  O      . PRO B  1 221 ? 26.605  -21.193 11.751  1.00 106.16 ? 220 PRO B O      1 
ATOM   9028  C  CB     . PRO B  1 221 ? 26.504  -18.175 12.513  1.00 102.62 ? 220 PRO B CB     1 
ATOM   9029  C  CG     . PRO B  1 221 ? 25.527  -17.956 11.403  1.00 106.38 ? 220 PRO B CG     1 
ATOM   9030  C  CD     . PRO B  1 221 ? 26.335  -17.935 10.149  1.00 94.68  ? 220 PRO B CD     1 
ATOM   9031  H  HA     . PRO B  1 221 ? 28.494  -18.699 12.206  1.00 120.43 ? 220 PRO B HA     1 
ATOM   9032  H  HB2    . PRO B  1 221 ? 26.087  -18.653 13.247  1.00 123.14 ? 220 PRO B HB2    1 
ATOM   9033  H  HB3    . PRO B  1 221 ? 26.870  -17.330 12.819  1.00 123.14 ? 220 PRO B HB3    1 
ATOM   9034  H  HG2    . PRO B  1 221 ? 24.887  -18.684 11.385  1.00 127.65 ? 220 PRO B HG2    1 
ATOM   9035  H  HG3    . PRO B  1 221 ? 25.074  -17.107 11.531  1.00 127.65 ? 220 PRO B HG3    1 
ATOM   9036  H  HD2    . PRO B  1 221 ? 25.817  -18.284 9.406   1.00 113.62 ? 220 PRO B HD2    1 
ATOM   9037  H  HD3    . PRO B  1 221 ? 26.659  -17.039 9.969   1.00 113.62 ? 220 PRO B HD3    1 
ATOM   9038  N  N      . TYR B  1 222 ? 28.291  -20.953 13.238  1.00 107.85 ? 221 TYR B N      1 
ATOM   9039  C  CA     . TYR B  1 222 ? 28.290  -22.340 13.714  1.00 100.72 ? 221 TYR B CA     1 
ATOM   9040  C  C      . TYR B  1 222 ? 28.986  -23.284 12.734  1.00 96.05  ? 221 TYR B C      1 
ATOM   9041  O  O      . TYR B  1 222 ? 29.026  -24.492 12.957  1.00 114.33 ? 221 TYR B O      1 
ATOM   9042  C  CB     . TYR B  1 222 ? 26.866  -22.851 13.976  1.00 97.85  ? 221 TYR B CB     1 
ATOM   9043  C  CG     . TYR B  1 222 ? 26.016  -21.973 14.870  1.00 99.40  ? 221 TYR B CG     1 
ATOM   9044  C  CD1    . TYR B  1 222 ? 26.575  -20.937 15.609  1.00 88.08  ? 221 TYR B CD1    1 
ATOM   9045  C  CD2    . TYR B  1 222 ? 24.647  -22.189 14.978  1.00 94.44  ? 221 TYR B CD2    1 
ATOM   9046  C  CE1    . TYR B  1 222 ? 25.793  -20.139 16.421  1.00 87.78  ? 221 TYR B CE1    1 
ATOM   9047  C  CE2    . TYR B  1 222 ? 23.859  -21.397 15.788  1.00 85.14  ? 221 TYR B CE2    1 
ATOM   9048  C  CZ     . TYR B  1 222 ? 24.436  -20.374 16.505  1.00 96.44  ? 221 TYR B CZ     1 
ATOM   9049  O  OH     . TYR B  1 222 ? 23.649  -19.586 17.314  1.00 114.48 ? 221 TYR B OH     1 
ATOM   9050  H  H      . TYR B  1 222 ? 28.883  -20.463 13.625  1.00 129.42 ? 221 TYR B H      1 
ATOM   9051  H  HA     . TYR B  1 222 ? 28.779  -22.379 14.562  1.00 120.86 ? 221 TYR B HA     1 
ATOM   9052  H  HB2    . TYR B  1 222 ? 26.407  -22.931 13.125  1.00 117.42 ? 221 TYR B HB2    1 
ATOM   9053  H  HB3    . TYR B  1 222 ? 26.926  -23.724 14.395  1.00 117.42 ? 221 TYR B HB3    1 
ATOM   9054  H  HD1    . TYR B  1 222 ? 27.489  -20.775 15.551  1.00 105.70 ? 221 TYR B HD1    1 
ATOM   9055  H  HD2    . TYR B  1 222 ? 24.254  -22.878 14.492  1.00 113.32 ? 221 TYR B HD2    1 
ATOM   9056  H  HE1    . TYR B  1 222 ? 26.179  -19.448 16.908  1.00 105.33 ? 221 TYR B HE1    1 
ATOM   9057  H  HE2    . TYR B  1 222 ? 22.944  -21.552 15.848  1.00 102.17 ? 221 TYR B HE2    1 
ATOM   9058  H  HH     . TYR B  1 222 ? 23.282  -20.048 17.884  1.00 137.37 ? 221 TYR B HH     1 
ATOM   9059  N  N      . ALA B  1 223 ? 29.539  -22.735 11.658  1.00 100.76 ? 222 ALA B N      1 
ATOM   9060  C  CA     . ALA B  1 223 ? 30.126  -23.555 10.601  1.00 95.84  ? 222 ALA B CA     1 
ATOM   9061  C  C      . ALA B  1 223 ? 31.318  -24.374 11.088  1.00 101.76 ? 222 ALA B C      1 
ATOM   9062  O  O      . ALA B  1 223 ? 31.634  -25.415 10.515  1.00 110.86 ? 222 ALA B O      1 
ATOM   9063  C  CB     . ALA B  1 223 ? 30.542  -22.682 9.429   1.00 90.55  ? 222 ALA B CB     1 
ATOM   9064  H  H      . ALA B  1 223 ? 29.588  -21.889 11.514  1.00 120.91 ? 222 ALA B H      1 
ATOM   9065  H  HA     . ALA B  1 223 ? 29.446  -24.183 10.278  1.00 115.00 ? 222 ALA B HA     1 
ATOM   9066  H  HB1    . ALA B  1 223 ? 30.924  -23.237 8.746   1.00 108.66 ? 222 ALA B HB1    1 
ATOM   9067  H  HB2    . ALA B  1 223 ? 29.767  -22.229 9.087   1.00 108.66 ? 222 ALA B HB2    1 
ATOM   9068  H  HB3    . ALA B  1 223 ? 31.189  -22.041 9.731   1.00 108.66 ? 222 ALA B HB3    1 
ATOM   9069  N  N      . ASP B  1 224 ? 31.981  -23.900 12.139  1.00 111.44 ? 223 ASP B N      1 
ATOM   9070  C  CA     . ASP B  1 224 ? 33.173  -24.568 12.651  1.00 118.48 ? 223 ASP B CA     1 
ATOM   9071  C  C      . ASP B  1 224 ? 32.852  -25.526 13.794  1.00 118.78 ? 223 ASP B C      1 
ATOM   9072  O  O      . ASP B  1 224 ? 33.731  -26.240 14.277  1.00 124.61 ? 223 ASP B O      1 
ATOM   9073  C  CB     . ASP B  1 224 ? 34.198  -23.533 13.120  1.00 138.69 ? 223 ASP B CB     1 
ATOM   9074  C  CG     . ASP B  1 224 ? 34.782  -22.731 11.975  1.00 166.43 ? 223 ASP B CG     1 
ATOM   9075  O  OD1    . ASP B  1 224 ? 34.925  -21.499 12.122  1.00 174.79 ? 223 ASP B OD1    1 
ATOM   9076  O  OD2    . ASP B  1 224 ? 35.099  -23.332 10.927  1.00 172.52 ? 223 ASP B OD2    1 
ATOM   9077  H  H      . ASP B  1 224 ? 31.760  -23.192 12.574  1.00 133.72 ? 223 ASP B H      1 
ATOM   9078  H  HA     . ASP B  1 224 ? 33.580  -25.088 11.927  1.00 142.17 ? 223 ASP B HA     1 
ATOM   9079  H  HB2    . ASP B  1 224 ? 33.767  -22.915 13.731  1.00 166.42 ? 223 ASP B HB2    1 
ATOM   9080  H  HB3    . ASP B  1 224 ? 34.926  -23.990 13.569  1.00 166.42 ? 223 ASP B HB3    1 
ATOM   9081  N  N      . ILE B  1 225 ? 31.594  -25.545 14.220  1.00 112.89 ? 224 ILE B N      1 
ATOM   9082  C  CA     . ILE B  1 225 ? 31.183  -26.376 15.345  1.00 102.49 ? 224 ILE B CA     1 
ATOM   9083  C  C      . ILE B  1 225 ? 30.448  -27.630 14.880  1.00 104.74 ? 224 ILE B C      1 
ATOM   9084  O  O      . ILE B  1 225 ? 29.769  -27.624 13.854  1.00 107.70 ? 224 ILE B O      1 
ATOM   9085  C  CB     . ILE B  1 225 ? 30.298  -25.584 16.326  1.00 92.98  ? 224 ILE B CB     1 
ATOM   9086  C  CG1    . ILE B  1 225 ? 31.120  -24.471 16.980  1.00 108.20 ? 224 ILE B CG1    1 
ATOM   9087  C  CG2    . ILE B  1 225 ? 29.725  -26.504 17.394  1.00 111.04 ? 224 ILE B CG2    1 
ATOM   9088  C  CD1    . ILE B  1 225 ? 30.340  -23.607 17.952  1.00 135.27 ? 224 ILE B CD1    1 
ATOM   9089  H  H      . ILE B  1 225 ? 30.956  -25.083 13.873  1.00 135.46 ? 224 ILE B H      1 
ATOM   9090  H  HA     . ILE B  1 225 ? 31.984  -26.664 15.831  1.00 122.99 ? 224 ILE B HA     1 
ATOM   9091  H  HB     . ILE B  1 225 ? 29.566  -25.183 15.832  1.00 111.58 ? 224 ILE B HB     1 
ATOM   9092  H  HG12   . ILE B  1 225 ? 31.855  -24.873 17.467  1.00 129.85 ? 224 ILE B HG12   1 
ATOM   9093  H  HG13   . ILE B  1 225 ? 31.467  -23.891 16.284  1.00 129.85 ? 224 ILE B HG13   1 
ATOM   9094  H  HG21   . ILE B  1 225 ? 29.179  -25.986 17.991  1.00 133.25 ? 224 ILE B HG21   1 
ATOM   9095  H  HG22   . ILE B  1 225 ? 29.195  -27.182 16.970  1.00 133.25 ? 224 ILE B HG22   1 
ATOM   9096  H  HG23   . ILE B  1 225 ? 30.448  -26.908 17.879  1.00 133.25 ? 224 ILE B HG23   1 
ATOM   9097  H  HD11   . ILE B  1 225 ? 30.926  -22.938 18.315  1.00 162.32 ? 224 ILE B HD11   1 
ATOM   9098  H  HD12   . ILE B  1 225 ? 29.614  -23.188 17.484  1.00 162.32 ? 224 ILE B HD12   1 
ATOM   9099  H  HD13   . ILE B  1 225 ? 29.999  -24.161 18.658  1.00 162.32 ? 224 ILE B HD13   1 
ATOM   9100  N  N      . HIS B  1 226 ? 30.601  -28.705 15.646  1.00 98.83  ? 225 HIS B N      1 
ATOM   9101  C  CA     . HIS B  1 226 ? 29.960  -29.978 15.345  1.00 104.08 ? 225 HIS B CA     1 
ATOM   9102  C  C      . HIS B  1 226 ? 28.456  -29.804 15.139  1.00 110.40 ? 225 HIS B C      1 
ATOM   9103  O  O      . HIS B  1 226 ? 27.810  -29.057 15.872  1.00 116.94 ? 225 HIS B O      1 
ATOM   9104  C  CB     . HIS B  1 226 ? 30.216  -30.961 16.486  1.00 113.52 ? 225 HIS B CB     1 
ATOM   9105  C  CG     . HIS B  1 226 ? 29.649  -32.324 16.249  1.00 109.09 ? 225 HIS B CG     1 
ATOM   9106  N  ND1    . HIS B  1 226 ? 28.297  -32.581 16.268  1.00 112.59 ? 225 HIS B ND1    1 
ATOM   9107  C  CD2    . HIS B  1 226 ? 30.254  -33.510 16.000  1.00 109.48 ? 225 HIS B CD2    1 
ATOM   9108  C  CE1    . HIS B  1 226 ? 28.090  -33.865 16.036  1.00 122.95 ? 225 HIS B CE1    1 
ATOM   9109  N  NE2    . HIS B  1 226 ? 29.262  -34.452 15.868  1.00 114.76 ? 225 HIS B NE2    1 
ATOM   9110  H  H      . HIS B  1 226 ? 31.081  -28.721 16.360  1.00 118.59 ? 225 HIS B H      1 
ATOM   9111  H  HA     . HIS B  1 226 ? 30.344  -30.350 14.524  1.00 124.89 ? 225 HIS B HA     1 
ATOM   9112  H  HB2    . HIS B  1 226 ? 31.173  -31.055 16.609  1.00 136.22 ? 225 HIS B HB2    1 
ATOM   9113  H  HB3    . HIS B  1 226 ? 29.814  -30.609 17.296  1.00 136.22 ? 225 HIS B HB3    1 
ATOM   9114  H  HD1    . HIS B  1 226 ? 27.682  -31.996 16.408  1.00 135.11 ? 225 HIS B HD1    1 
ATOM   9115  H  HD2    . HIS B  1 226 ? 31.170  -33.659 15.928  1.00 131.38 ? 225 HIS B HD2    1 
ATOM   9116  H  HE1    . HIS B  1 226 ? 27.261  -34.284 15.995  1.00 147.54 ? 225 HIS B HE1    1 
ATOM   9117  H  HE2    . HIS B  1 226 ? 29.383  -35.287 15.704  1.00 137.71 ? 225 HIS B HE2    1 
ATOM   9118  N  N      . PRO B  1 227 ? 27.894  -30.501 14.138  1.00 102.88 ? 226 PRO B N      1 
ATOM   9119  C  CA     . PRO B  1 227 ? 26.482  -30.381 13.751  1.00 93.00  ? 226 PRO B CA     1 
ATOM   9120  C  C      . PRO B  1 227 ? 25.475  -30.489 14.899  1.00 91.29  ? 226 PRO B C      1 
ATOM   9121  O  O      . PRO B  1 227 ? 24.801  -29.506 15.193  1.00 117.95 ? 226 PRO B O      1 
ATOM   9122  C  CB     . PRO B  1 227 ? 26.295  -31.541 12.772  1.00 81.45  ? 226 PRO B CB     1 
ATOM   9123  C  CG     . PRO B  1 227 ? 27.628  -31.714 12.160  1.00 93.02  ? 226 PRO B CG     1 
ATOM   9124  C  CD     . PRO B  1 227 ? 28.629  -31.402 13.233  1.00 90.34  ? 226 PRO B CD     1 
ATOM   9125  H  HA     . PRO B  1 227 ? 26.335  -29.536 13.276  1.00 111.60 ? 226 PRO B HA     1 
ATOM   9126  H  HB2    . PRO B  1 227 ? 26.029  -32.339 13.254  1.00 97.74  ? 226 PRO B HB2    1 
ATOM   9127  H  HB3    . PRO B  1 227 ? 25.635  -31.304 12.102  1.00 97.74  ? 226 PRO B HB3    1 
ATOM   9128  H  HG2    . PRO B  1 227 ? 27.728  -32.631 11.859  1.00 111.63 ? 226 PRO B HG2    1 
ATOM   9129  H  HG3    . PRO B  1 227 ? 27.724  -31.100 11.416  1.00 111.63 ? 226 PRO B HG3    1 
ATOM   9130  H  HD2    . PRO B  1 227 ? 28.888  -32.212 13.700  1.00 108.40 ? 226 PRO B HD2    1 
ATOM   9131  H  HD3    . PRO B  1 227 ? 29.398  -30.948 12.856  1.00 108.40 ? 226 PRO B HD3    1 
ATOM   9132  N  N      . MET B  1 228 ? 25.366  -31.655 15.526  1.00 84.87  ? 227 MET B N      1 
ATOM   9133  C  CA     . MET B  1 228 ? 24.323  -31.882 16.528  1.00 102.05 ? 227 MET B CA     1 
ATOM   9134  C  C      . MET B  1 228 ? 24.301  -30.802 17.613  1.00 102.53 ? 227 MET B C      1 
ATOM   9135  O  O      . MET B  1 228 ? 23.248  -30.505 18.177  1.00 97.05  ? 227 MET B O      1 
ATOM   9136  C  CB     . MET B  1 228 ? 24.467  -33.269 17.158  1.00 102.43 ? 227 MET B CB     1 
ATOM   9137  C  CG     . MET B  1 228 ? 25.297  -33.307 18.426  1.00 107.43 ? 227 MET B CG     1 
ATOM   9138  S  SD     . MET B  1 228 ? 25.622  -34.996 18.974  1.00 146.17 ? 227 MET B SD     1 
ATOM   9139  C  CE     . MET B  1 228 ? 24.013  -35.753 18.736  1.00 115.36 ? 227 MET B CE     1 
ATOM   9140  H  H      . MET B  1 228 ? 25.880  -32.331 15.392  1.00 101.84 ? 227 MET B H      1 
ATOM   9141  H  HA     . MET B  1 228 ? 23.457  -31.865 16.069  1.00 122.45 ? 227 MET B HA     1 
ATOM   9142  H  HB2    . MET B  1 228 ? 23.583  -33.603 17.376  1.00 122.92 ? 227 MET B HB2    1 
ATOM   9143  H  HB3    . MET B  1 228 ? 24.888  -33.860 16.514  1.00 122.92 ? 227 MET B HB3    1 
ATOM   9144  H  HG2    . MET B  1 228 ? 26.149  -32.873 18.261  1.00 128.92 ? 227 MET B HG2    1 
ATOM   9145  H  HG3    . MET B  1 228 ? 24.819  -32.847 19.133  1.00 128.92 ? 227 MET B HG3    1 
ATOM   9146  H  HE1    . MET B  1 228 ? 24.060  -36.675 18.999  1.00 138.44 ? 227 MET B HE1    1 
ATOM   9147  H  HE2    . MET B  1 228 ? 23.368  -35.291 19.276  1.00 138.44 ? 227 MET B HE2    1 
ATOM   9148  H  HE3    . MET B  1 228 ? 23.772  -35.689 17.809  1.00 138.44 ? 227 MET B HE3    1 
ATOM   9149  N  N      . ARG B  1 229 ? 25.458  -30.215 17.904  1.00 102.60 ? 228 ARG B N      1 
ATOM   9150  C  CA     . ARG B  1 229 ? 25.522  -29.092 18.832  1.00 99.02  ? 228 ARG B CA     1 
ATOM   9151  C  C      . ARG B  1 229 ? 24.935  -27.841 18.181  1.00 99.12  ? 228 ARG B C      1 
ATOM   9152  O  O      . ARG B  1 229 ? 24.296  -27.024 18.844  1.00 97.68  ? 228 ARG B O      1 
ATOM   9153  C  CB     . ARG B  1 229 ? 26.965  -28.836 19.268  1.00 98.09  ? 228 ARG B CB     1 
ATOM   9154  C  CG     . ARG B  1 229 ? 27.185  -27.478 19.911  1.00 113.35 ? 228 ARG B CG     1 
ATOM   9155  C  CD     . ARG B  1 229 ? 28.508  -27.430 20.656  1.00 116.34 ? 228 ARG B CD     1 
ATOM   9156  N  NE     . ARG B  1 229 ? 28.773  -26.114 21.229  1.00 116.62 ? 228 ARG B NE     1 
ATOM   9157  C  CZ     . ARG B  1 229 ? 28.174  -25.630 22.314  1.00 144.08 ? 228 ARG B CZ     1 
ATOM   9158  N  NH1    . ARG B  1 229 ? 27.257  -26.344 22.954  1.00 152.70 ? 228 ARG B NH1    1 
ATOM   9159  N  NH2    . ARG B  1 229 ? 28.488  -24.422 22.758  1.00 160.29 ? 228 ARG B NH2    1 
ATOM   9160  H  H      . ARG B  1 229 ? 26.219  -30.449 17.578  1.00 123.12 ? 228 ARG B H      1 
ATOM   9161  H  HA     . ARG B  1 229 ? 24.992  -29.301 19.629  1.00 118.82 ? 228 ARG B HA     1 
ATOM   9162  H  HB2    . ARG B  1 229 ? 27.220  -29.513 19.913  1.00 117.71 ? 228 ARG B HB2    1 
ATOM   9163  H  HB3    . ARG B  1 229 ? 27.541  -28.891 18.489  1.00 117.71 ? 228 ARG B HB3    1 
ATOM   9164  H  HG2    . ARG B  1 229 ? 27.199  -26.795 19.222  1.00 136.02 ? 228 ARG B HG2    1 
ATOM   9165  H  HG3    . ARG B  1 229 ? 26.472  -27.303 20.544  1.00 136.02 ? 228 ARG B HG3    1 
ATOM   9166  H  HD2    . ARG B  1 229 ? 28.488  -28.076 21.380  1.00 139.61 ? 228 ARG B HD2    1 
ATOM   9167  H  HD3    . ARG B  1 229 ? 29.227  -27.642 20.040  1.00 139.61 ? 228 ARG B HD3    1 
ATOM   9168  H  HE     . ARG B  1 229 ? 29.356  -25.617 20.838  1.00 139.95 ? 228 ARG B HE     1 
ATOM   9169  H  HH11   . ARG B  1 229 ? 27.048  -27.129 22.671  1.00 183.24 ? 228 ARG B HH11   1 
ATOM   9170  H  HH12   . ARG B  1 229 ? 26.873  -26.022 23.653  1.00 183.24 ? 228 ARG B HH12   1 
ATOM   9171  H  HH21   . ARG B  1 229 ? 29.080  -23.953 22.346  1.00 192.34 ? 228 ARG B HH21   1 
ATOM   9172  H  HH22   . ARG B  1 229 ? 28.100  -24.106 23.457  1.00 192.34 ? 228 ARG B HH22   1 
ATOM   9173  N  N      . ALA B  1 230 ? 25.158  -27.700 16.879  1.00 96.26  ? 229 ALA B N      1 
ATOM   9174  C  CA     . ALA B  1 230 ? 24.600  -26.587 16.120  1.00 84.58  ? 229 ALA B CA     1 
ATOM   9175  C  C      . ALA B  1 230 ? 23.087  -26.737 15.975  1.00 81.98  ? 229 ALA B C      1 
ATOM   9176  O  O      . ALA B  1 230 ? 22.344  -25.761 16.087  1.00 86.83  ? 229 ALA B O      1 
ATOM   9177  C  CB     . ALA B  1 230 ? 25.261  -26.498 14.751  1.00 81.81  ? 229 ALA B CB     1 
ATOM   9178  H  H      . ALA B  1 230 ? 25.633  -28.240 16.407  1.00 115.52 ? 229 ALA B H      1 
ATOM   9179  H  HA     . ALA B  1 230 ? 24.779  -25.751 16.599  1.00 101.49 ? 229 ALA B HA     1 
ATOM   9180  H  HB1    . ALA B  1 230 ? 24.881  -25.761 14.268  1.00 98.17  ? 229 ALA B HB1    1 
ATOM   9181  H  HB2    . ALA B  1 230 ? 26.204  -26.362 14.869  1.00 98.17  ? 229 ALA B HB2    1 
ATOM   9182  H  HB3    . ALA B  1 230 ? 25.105  -27.317 14.276  1.00 98.17  ? 229 ALA B HB3    1 
ATOM   9183  N  N      . ILE B  1 231 ? 22.637  -27.964 15.728  1.00 84.84  ? 230 ILE B N      1 
ATOM   9184  C  CA     . ILE B  1 231 ? 21.212  -28.260 15.623  1.00 88.69  ? 230 ILE B CA     1 
ATOM   9185  C  C      . ILE B  1 231 ? 20.497  -27.853 16.906  1.00 95.86  ? 230 ILE B C      1 
ATOM   9186  O  O      . ILE B  1 231 ? 19.325  -27.472 16.887  1.00 94.04  ? 230 ILE B O      1 
ATOM   9187  C  CB     . ILE B  1 231 ? 20.979  -29.760 15.368  1.00 98.42  ? 230 ILE B CB     1 
ATOM   9188  C  CG1    . ILE B  1 231 ? 21.514  -30.145 13.988  1.00 101.17 ? 230 ILE B CG1    1 
ATOM   9189  C  CG2    . ILE B  1 231 ? 19.498  -30.101 15.471  1.00 95.82  ? 230 ILE B CG2    1 
ATOM   9190  C  CD1    . ILE B  1 231 ? 21.522  -31.629 13.720  1.00 90.54  ? 230 ILE B CD1    1 
ATOM   9191  H  H      . ILE B  1 231 ? 23.144  -28.650 15.615  1.00 101.81 ? 230 ILE B H      1 
ATOM   9192  H  HA     . ILE B  1 231 ? 20.827  -27.755 14.878  1.00 106.43 ? 230 ILE B HA     1 
ATOM   9193  H  HB     . ILE B  1 231 ? 21.461  -30.268 16.040  1.00 118.10 ? 230 ILE B HB     1 
ATOM   9194  H  HG12   . ILE B  1 231 ? 20.960  -29.726 13.312  1.00 121.41 ? 230 ILE B HG12   1 
ATOM   9195  H  HG13   . ILE B  1 231 ? 22.426  -29.826 13.908  1.00 121.41 ? 230 ILE B HG13   1 
ATOM   9196  H  HG21   . ILE B  1 231 ? 19.382  -31.039 15.308  1.00 114.98 ? 230 ILE B HG21   1 
ATOM   9197  H  HG22   . ILE B  1 231 ? 19.188  -29.879 16.352  1.00 114.98 ? 230 ILE B HG22   1 
ATOM   9198  H  HG23   . ILE B  1 231 ? 19.015  -29.592 14.816  1.00 114.98 ? 230 ILE B HG23   1 
ATOM   9199  H  HD11   . ILE B  1 231 ? 21.870  -31.785 12.838  1.00 108.65 ? 230 ILE B HD11   1 
ATOM   9200  H  HD12   . ILE B  1 231 ? 22.077  -32.062 14.372  1.00 108.65 ? 230 ILE B HD12   1 
ATOM   9201  H  HD13   . ILE B  1 231 ? 20.623  -31.962 13.781  1.00 108.65 ? 230 ILE B HD13   1 
ATOM   9202  N  N      . PHE B  1 232 ? 21.215  -27.932 18.020  1.00 97.26  ? 231 PHE B N      1 
ATOM   9203  C  CA     . PHE B  1 232 ? 20.659  -27.571 19.316  1.00 99.66  ? 231 PHE B CA     1 
ATOM   9204  C  C      . PHE B  1 232 ? 20.736  -26.066 19.566  1.00 99.18  ? 231 PHE B C      1 
ATOM   9205  O  O      . PHE B  1 232 ? 19.862  -25.494 20.219  1.00 103.91 ? 231 PHE B O      1 
ATOM   9206  C  CB     . PHE B  1 232 ? 21.391  -28.317 20.432  1.00 99.40  ? 231 PHE B CB     1 
ATOM   9207  C  CG     . PHE B  1 232 ? 21.346  -27.611 21.755  1.00 101.53 ? 231 PHE B CG     1 
ATOM   9208  C  CD1    . PHE B  1 232 ? 20.180  -27.583 22.500  1.00 103.30 ? 231 PHE B CD1    1 
ATOM   9209  C  CD2    . PHE B  1 232 ? 22.469  -26.970 22.250  1.00 90.89  ? 231 PHE B CD2    1 
ATOM   9210  C  CE1    . PHE B  1 232 ? 20.135  -26.929 23.717  1.00 107.71 ? 231 PHE B CE1    1 
ATOM   9211  C  CE2    . PHE B  1 232 ? 22.430  -26.317 23.466  1.00 88.36  ? 231 PHE B CE2    1 
ATOM   9212  C  CZ     . PHE B  1 232 ? 21.262  -26.296 24.200  1.00 87.36  ? 231 PHE B CZ     1 
ATOM   9213  H  H      . PHE B  1 232 ? 22.034  -28.193 18.052  1.00 116.71 ? 231 PHE B H      1 
ATOM   9214  H  HA     . PHE B  1 232 ? 19.715  -27.836 19.343  1.00 119.59 ? 231 PHE B HA     1 
ATOM   9215  H  HB2    . PHE B  1 232 ? 20.983  -29.189 20.547  1.00 119.28 ? 231 PHE B HB2    1 
ATOM   9216  H  HB3    . PHE B  1 232 ? 22.323  -28.419 20.182  1.00 119.28 ? 231 PHE B HB3    1 
ATOM   9217  H  HD1    . PHE B  1 232 ? 19.418  -28.008 22.179  1.00 123.96 ? 231 PHE B HD1    1 
ATOM   9218  H  HD2    . PHE B  1 232 ? 23.258  -26.981 21.759  1.00 109.07 ? 231 PHE B HD2    1 
ATOM   9219  H  HE1    . PHE B  1 232 ? 19.347  -26.918 24.211  1.00 129.26 ? 231 PHE B HE1    1 
ATOM   9220  H  HE2    . PHE B  1 232 ? 23.191  -25.891 23.789  1.00 106.03 ? 231 PHE B HE2    1 
ATOM   9221  H  HZ     . PHE B  1 232 ? 21.234  -25.857 25.020  1.00 104.84 ? 231 PHE B HZ     1 
ATOM   9222  N  N      . MET B  1 233 ? 21.787  -25.433 19.052  1.00 94.15  ? 232 MET B N      1 
ATOM   9223  C  CA     . MET B  1 233 ? 21.996  -24.000 19.247  1.00 97.72  ? 232 MET B CA     1 
ATOM   9224  C  C      . MET B  1 233 ? 21.011  -23.153 18.447  1.00 97.26  ? 232 MET B C      1 
ATOM   9225  O  O      . MET B  1 233 ? 20.491  -22.154 18.947  1.00 85.16  ? 232 MET B O      1 
ATOM   9226  C  CB     . MET B  1 233 ? 23.416  -23.609 18.833  1.00 93.99  ? 232 MET B CB     1 
ATOM   9227  C  CG     . MET B  1 233 ? 24.471  -23.780 19.911  1.00 89.96  ? 232 MET B CG     1 
ATOM   9228  S  SD     . MET B  1 233 ? 26.058  -23.096 19.387  1.00 123.80 ? 232 MET B SD     1 
ATOM   9229  C  CE     . MET B  1 233 ? 26.775  -22.644 20.963  1.00 234.63 ? 232 MET B CE     1 
ATOM   9230  H  H      . MET B  1 233 ? 22.399  -25.814 18.583  1.00 112.97 ? 232 MET B H      1 
ATOM   9231  H  HA     . MET B  1 233 ? 21.892  -23.792 20.199  1.00 117.26 ? 232 MET B HA     1 
ATOM   9232  H  HB2    . MET B  1 233 ? 23.679  -24.157 18.077  1.00 112.79 ? 232 MET B HB2    1 
ATOM   9233  H  HB3    . MET B  1 233 ? 23.415  -22.675 18.572  1.00 112.79 ? 232 MET B HB3    1 
ATOM   9234  H  HG2    . MET B  1 233 ? 24.188  -23.315 20.714  1.00 107.95 ? 232 MET B HG2    1 
ATOM   9235  H  HG3    . MET B  1 233 ? 24.592  -24.725 20.094  1.00 107.95 ? 232 MET B HG3    1 
ATOM   9236  H  HE1    . MET B  1 233 ? 27.642  -22.259 20.812  1.00 281.56 ? 232 MET B HE1    1 
ATOM   9237  H  HE2    . MET B  1 233 ? 26.203  -22.005 21.394  1.00 281.56 ? 232 MET B HE2    1 
ATOM   9238  H  HE3    . MET B  1 233 ? 26.856  -23.431 21.506  1.00 281.56 ? 232 MET B HE3    1 
ATOM   9239  N  N      . ILE B  1 234 ? 20.765  -23.554 17.204  1.00 111.66 ? 233 ILE B N      1 
ATOM   9240  C  CA     . ILE B  1 234 ? 20.006  -22.737 16.260  1.00 73.41  ? 233 ILE B CA     1 
ATOM   9241  C  C      . ILE B  1 234 ? 18.629  -22.320 16.773  1.00 74.20  ? 233 ILE B C      1 
ATOM   9242  O  O      . ILE B  1 234 ? 18.272  -21.145 16.692  1.00 103.82 ? 233 ILE B O      1 
ATOM   9243  C  CB     . ILE B  1 234 ? 19.855  -23.455 14.904  1.00 79.59  ? 233 ILE B CB     1 
ATOM   9244  C  CG1    . ILE B  1 234 ? 21.211  -23.522 14.202  1.00 58.00  ? 233 ILE B CG1    1 
ATOM   9245  C  CG2    . ILE B  1 234 ? 18.846  -22.732 14.026  1.00 76.52  ? 233 ILE B CG2    1 
ATOM   9246  C  CD1    . ILE B  1 234 ? 21.341  -24.684 13.254  1.00 59.15  ? 233 ILE B CD1    1 
ATOM   9247  H  H      . ILE B  1 234 ? 21.030  -24.305 16.879  1.00 133.99 ? 233 ILE B H      1 
ATOM   9248  H  HA     . ILE B  1 234 ? 20.513  -21.915 16.096  1.00 88.09  ? 233 ILE B HA     1 
ATOM   9249  H  HB     . ILE B  1 234 ? 19.541  -24.359 15.063  1.00 95.50  ? 233 ILE B HB     1 
ATOM   9250  H  HG12   . ILE B  1 234 ? 21.341  -22.707 13.693  1.00 69.60  ? 233 ILE B HG12   1 
ATOM   9251  H  HG13   . ILE B  1 234 ? 21.907  -23.606 14.873  1.00 69.60  ? 233 ILE B HG13   1 
ATOM   9252  H  HG21   . ILE B  1 234 ? 18.770  -23.197 13.190  1.00 91.83  ? 233 ILE B HG21   1 
ATOM   9253  H  HG22   . ILE B  1 234 ? 17.996  -22.720 14.472  1.00 91.83  ? 233 ILE B HG22   1 
ATOM   9254  H  HG23   . ILE B  1 234 ? 19.150  -21.834 13.875  1.00 91.83  ? 233 ILE B HG23   1 
ATOM   9255  H  HD11   . ILE B  1 234 ? 22.213  -24.663 12.852  1.00 70.97  ? 233 ILE B HD11   1 
ATOM   9256  H  HD12   . ILE B  1 234 ? 21.226  -25.502 13.744  1.00 70.97  ? 233 ILE B HD12   1 
ATOM   9257  H  HD13   . ILE B  1 234 ? 20.666  -24.611 12.576  1.00 70.97  ? 233 ILE B HD13   1 
ATOM   9258  N  N      . PRO B  1 235 ? 17.844  -23.277 17.291  1.00 82.90  ? 234 PRO B N      1 
ATOM   9259  C  CA     . PRO B  1 235 ? 16.535  -22.901 17.833  1.00 80.69  ? 234 PRO B CA     1 
ATOM   9260  C  C      . PRO B  1 235 ? 16.649  -22.288 19.229  1.00 89.72  ? 234 PRO B C      1 
ATOM   9261  O  O      . PRO B  1 235 ? 15.707  -21.647 19.698  1.00 72.46  ? 234 PRO B O      1 
ATOM   9262  C  CB     . PRO B  1 235 ? 15.780  -24.240 17.899  1.00 85.58  ? 234 PRO B CB     1 
ATOM   9263  C  CG     . PRO B  1 235 ? 16.674  -25.263 17.222  1.00 85.47  ? 234 PRO B CG     1 
ATOM   9264  C  CD     . PRO B  1 235 ? 18.057  -24.731 17.354  1.00 78.65  ? 234 PRO B CD     1 
ATOM   9265  H  HA     . PRO B  1 235 ? 16.070  -22.284 17.231  1.00 96.83  ? 234 PRO B HA     1 
ATOM   9266  H  HB2    . PRO B  1 235 ? 15.628  -24.481 18.826  1.00 102.70 ? 234 PRO B HB2    1 
ATOM   9267  H  HB3    . PRO B  1 235 ? 14.937  -24.159 17.426  1.00 102.70 ? 234 PRO B HB3    1 
ATOM   9268  H  HG2    . PRO B  1 235 ? 16.592  -26.118 17.674  1.00 102.56 ? 234 PRO B HG2    1 
ATOM   9269  H  HG3    . PRO B  1 235 ? 16.427  -25.345 16.288  1.00 102.56 ? 234 PRO B HG3    1 
ATOM   9270  H  HD2    . PRO B  1 235 ? 18.439  -24.983 18.209  1.00 94.37  ? 234 PRO B HD2    1 
ATOM   9271  H  HD3    . PRO B  1 235 ? 18.608  -25.027 16.612  1.00 94.37  ? 234 PRO B HD3    1 
ATOM   9272  N  N      . THR B  1 236 ? 17.799  -22.474 19.872  1.00 89.23  ? 235 THR B N      1 
ATOM   9273  C  CA     . THR B  1 236 ? 18.000  -22.042 21.253  1.00 99.30  ? 235 THR B CA     1 
ATOM   9274  C  C      . THR B  1 236 ? 18.496  -20.604 21.346  1.00 100.42 ? 235 THR B C      1 
ATOM   9275  O  O      . THR B  1 236 ? 17.832  -19.742 21.921  1.00 118.93 ? 235 THR B O      1 
ATOM   9276  C  CB     . THR B  1 236 ? 19.023  -22.950 21.967  1.00 103.60 ? 235 THR B CB     1 
ATOM   9277  O  OG1    . THR B  1 236 ? 18.471  -24.262 22.133  1.00 112.71 ? 235 THR B OG1    1 
ATOM   9278  C  CG2    . THR B  1 236 ? 19.403  -22.382 23.333  1.00 87.74  ? 235 THR B CG2    1 
ATOM   9279  H  H      . THR B  1 236 ? 18.488  -22.854 19.525  1.00 107.07 ? 235 THR B H      1 
ATOM   9280  H  HA     . THR B  1 236 ? 17.149  -22.103 21.735  1.00 119.16 ? 235 THR B HA     1 
ATOM   9281  H  HB     . THR B  1 236 ? 19.828  -23.008 21.429  1.00 124.32 ? 235 THR B HB     1 
ATOM   9282  H  HG1    . THR B  1 236 ? 18.291  -24.585 21.401  1.00 135.25 ? 235 THR B HG1    1 
ATOM   9283  H  HG21   . THR B  1 236 ? 20.039  -22.959 23.762  1.00 105.29 ? 235 THR B HG21   1 
ATOM   9284  H  HG22   . THR B  1 236 ? 19.792  -21.511 23.229  1.00 105.29 ? 235 THR B HG22   1 
ATOM   9285  H  HG23   . THR B  1 236 ? 18.622  -22.312 23.887  1.00 105.29 ? 235 THR B HG23   1 
ATOM   9286  N  N      . ASN B  1 237 ? 19.672  -20.359 20.780  1.00 75.25  ? 236 ASN B N      1 
ATOM   9287  C  CA     . ASN B  1 237 ? 20.342  -19.071 20.909  1.00 79.66  ? 236 ASN B CA     1 
ATOM   9288  C  C      . ASN B  1 237 ? 19.638  -17.946 20.159  1.00 90.12  ? 236 ASN B C      1 
ATOM   9289  O  O      . ASN B  1 237 ? 18.714  -18.190 19.381  1.00 81.21  ? 236 ASN B O      1 
ATOM   9290  C  CB     . ASN B  1 237 ? 21.782  -19.193 20.411  1.00 72.46  ? 236 ASN B CB     1 
ATOM   9291  C  CG     . ASN B  1 237 ? 22.634  -20.057 21.310  1.00 95.48  ? 236 ASN B CG     1 
ATOM   9292  O  OD1    . ASN B  1 237 ? 22.349  -20.204 22.499  1.00 123.29 ? 236 ASN B OD1    1 
ATOM   9293  N  ND2    . ASN B  1 237 ? 23.690  -20.635 20.748  1.00 79.96  ? 236 ASN B ND2    1 
ATOM   9294  H  H      . ASN B  1 237 ? 20.109  -20.931 20.310  1.00 90.30  ? 236 ASN B H      1 
ATOM   9295  H  HA     . ASN B  1 237 ? 20.372  -18.825 21.857  1.00 95.59  ? 236 ASN B HA     1 
ATOM   9296  H  HB2    . ASN B  1 237 ? 21.779  -19.591 19.526  1.00 86.95  ? 236 ASN B HB2    1 
ATOM   9297  H  HB3    . ASN B  1 237 ? 22.182  -18.310 20.377  1.00 86.95  ? 236 ASN B HB3    1 
ATOM   9298  H  HD21   . ASN B  1 237 ? 23.858  -20.507 19.914  1.00 95.96  ? 236 ASN B HD21   1 
ATOM   9299  H  HD22   . ASN B  1 237 ? 24.207  -21.137 21.218  1.00 95.96  ? 236 ASN B HD22   1 
ATOM   9300  N  N      . PRO B  1 238 ? 20.077  -16.701 20.392  1.00 94.14  ? 237 PRO B N      1 
ATOM   9301  C  CA     . PRO B  1 238 ? 19.504  -15.576 19.655  1.00 97.85  ? 237 PRO B CA     1 
ATOM   9302  C  C      . PRO B  1 238 ? 20.018  -15.580 18.225  1.00 100.92 ? 237 PRO B C      1 
ATOM   9303  O  O      . PRO B  1 238 ? 21.093  -16.128 17.976  1.00 102.81 ? 237 PRO B O      1 
ATOM   9304  C  CB     . PRO B  1 238 ? 20.022  -14.346 20.417  1.00 109.43 ? 237 PRO B CB     1 
ATOM   9305  C  CG     . PRO B  1 238 ? 20.883  -14.873 21.548  1.00 57.34  ? 237 PRO B CG     1 
ATOM   9306  C  CD     . PRO B  1 238 ? 21.213  -16.281 21.226  1.00 102.56 ? 237 PRO B CD     1 
ATOM   9307  H  HA     . PRO B  1 238 ? 18.524  -15.600 19.670  1.00 117.42 ? 237 PRO B HA     1 
ATOM   9308  H  HB2    . PRO B  1 238 ? 20.549  -13.794 19.818  1.00 131.32 ? 237 PRO B HB2    1 
ATOM   9309  H  HB3    . PRO B  1 238 ? 19.270  -13.844 20.768  1.00 131.32 ? 237 PRO B HB3    1 
ATOM   9310  H  HG2    . PRO B  1 238 ? 21.693  -14.342 21.609  1.00 68.81  ? 237 PRO B HG2    1 
ATOM   9311  H  HG3    . PRO B  1 238 ? 20.385  -14.825 22.380  1.00 68.81  ? 237 PRO B HG3    1 
ATOM   9312  H  HD2    . PRO B  1 238 ? 22.041  -16.329 20.722  1.00 123.07 ? 237 PRO B HD2    1 
ATOM   9313  H  HD3    . PRO B  1 238 ? 21.255  -16.814 22.036  1.00 123.07 ? 237 PRO B HD3    1 
ATOM   9314  N  N      . PRO B  1 239 ? 19.261  -14.985 17.292  1.00 85.90  ? 238 PRO B N      1 
ATOM   9315  C  CA     . PRO B  1 239 ? 19.698  -14.991 15.893  1.00 77.21  ? 238 PRO B CA     1 
ATOM   9316  C  C      . PRO B  1 239 ? 21.122  -14.459 15.757  1.00 73.28  ? 238 PRO B C      1 
ATOM   9317  O  O      . PRO B  1 239 ? 21.496  -13.538 16.484  1.00 101.15 ? 238 PRO B O      1 
ATOM   9318  C  CB     . PRO B  1 239 ? 18.694  -14.060 15.211  1.00 84.46  ? 238 PRO B CB     1 
ATOM   9319  C  CG     . PRO B  1 239 ? 17.474  -14.134 16.073  1.00 71.80  ? 238 PRO B CG     1 
ATOM   9320  C  CD     . PRO B  1 239 ? 17.982  -14.276 17.472  1.00 75.20  ? 238 PRO B CD     1 
ATOM   9321  H  HA     . PRO B  1 239 ? 19.636  -15.890 15.509  1.00 92.66  ? 238 PRO B HA     1 
ATOM   9322  H  HB2    . PRO B  1 239 ? 19.046  -13.157 15.188  1.00 101.35 ? 238 PRO B HB2    1 
ATOM   9323  H  HB3    . PRO B  1 239 ? 18.504  -14.381 14.316  1.00 101.35 ? 238 PRO B HB3    1 
ATOM   9324  H  HG2    . PRO B  1 239 ? 16.958  -13.318 15.977  1.00 86.17  ? 238 PRO B HG2    1 
ATOM   9325  H  HG3    . PRO B  1 239 ? 16.944  -14.906 15.821  1.00 86.17  ? 238 PRO B HG3    1 
ATOM   9326  H  HD2    . PRO B  1 239 ? 18.132  -13.403 17.869  1.00 90.24  ? 238 PRO B HD2    1 
ATOM   9327  H  HD3    . PRO B  1 239 ? 17.370  -14.809 18.003  1.00 90.24  ? 238 PRO B HD3    1 
ATOM   9328  N  N      . PRO B  1 240 ? 21.913  -15.042 14.846  1.00 65.72  ? 239 PRO B N      1 
ATOM   9329  C  CA     . PRO B  1 240 ? 23.323  -14.667 14.693  1.00 74.25  ? 239 PRO B CA     1 
ATOM   9330  C  C      . PRO B  1 240 ? 23.518  -13.281 14.086  1.00 95.83  ? 239 PRO B C      1 
ATOM   9331  O  O      . PRO B  1 240 ? 22.593  -12.708 13.505  1.00 79.28  ? 239 PRO B O      1 
ATOM   9332  C  CB     . PRO B  1 240 ? 23.869  -15.739 13.745  1.00 56.73  ? 239 PRO B CB     1 
ATOM   9333  C  CG     . PRO B  1 240 ? 22.690  -16.181 12.963  1.00 66.50  ? 239 PRO B CG     1 
ATOM   9334  C  CD     . PRO B  1 240 ? 21.518  -16.100 13.899  1.00 64.31  ? 239 PRO B CD     1 
ATOM   9335  H  HA     . PRO B  1 240 ? 23.789  -14.719 15.554  1.00 89.10  ? 239 PRO B HA     1 
ATOM   9336  H  HB2    . PRO B  1 240 ? 24.542  -15.351 13.164  1.00 68.07  ? 239 PRO B HB2    1 
ATOM   9337  H  HB3    . PRO B  1 240 ? 24.238  -16.474 14.259  1.00 68.07  ? 239 PRO B HB3    1 
ATOM   9338  H  HG2    . PRO B  1 240 ? 22.562  -15.589 12.205  1.00 79.80  ? 239 PRO B HG2    1 
ATOM   9339  H  HG3    . PRO B  1 240 ? 22.823  -17.094 12.663  1.00 79.80  ? 239 PRO B HG3    1 
ATOM   9340  H  HD2    . PRO B  1 240 ? 20.717  -15.842 13.417  1.00 77.17  ? 239 PRO B HD2    1 
ATOM   9341  H  HD3    . PRO B  1 240 ? 21.398  -16.943 14.365  1.00 77.17  ? 239 PRO B HD3    1 
ATOM   9342  N  N      . THR B  1 241 ? 24.730  -12.757 14.234  1.00 108.27 ? 240 THR B N      1 
ATOM   9343  C  CA     . THR B  1 241 ? 25.103  -11.476 13.654  1.00 95.96  ? 240 THR B CA     1 
ATOM   9344  C  C      . THR B  1 241 ? 26.498  -11.589 13.052  1.00 74.13  ? 240 THR B C      1 
ATOM   9345  O  O      . THR B  1 241 ? 27.034  -12.688 12.915  1.00 84.15  ? 240 THR B O      1 
ATOM   9346  C  CB     . THR B  1 241 ? 25.092  -10.364 14.710  1.00 114.69 ? 240 THR B CB     1 
ATOM   9347  O  OG1    . THR B  1 241 ? 25.613  -9.156  14.140  1.00 136.40 ? 240 THR B OG1    1 
ATOM   9348  C  CG2    . THR B  1 241 ? 25.928  -10.767 15.922  1.00 102.51 ? 240 THR B CG2    1 
ATOM   9349  H  H      . THR B  1 241 ? 25.365  -13.134 14.675  1.00 129.92 ? 240 THR B H      1 
ATOM   9350  H  HA     . THR B  1 241 ? 24.472  -11.239 12.943  1.00 115.15 ? 240 THR B HA     1 
ATOM   9351  H  HB     . THR B  1 241 ? 24.181  -10.211 15.006  1.00 137.62 ? 240 THR B HB     1 
ATOM   9352  H  HG1    . THR B  1 241 ? 25.152  -8.926  13.502  1.00 163.67 ? 240 THR B HG1    1 
ATOM   9353  H  HG21   . THR B  1 241 ? 25.916  -10.065 16.577  1.00 123.02 ? 240 THR B HG21   1 
ATOM   9354  H  HG22   . THR B  1 241 ? 25.571  -11.567 16.315  1.00 123.02 ? 240 THR B HG22   1 
ATOM   9355  H  HG23   . THR B  1 241 ? 26.836  -10.928 15.655  1.00 123.02 ? 240 THR B HG23   1 
ATOM   9356  N  N      . PHE B  1 242 ? 27.087  -10.456 12.687  1.00 73.76  ? 241 PHE B N      1 
ATOM   9357  C  CA     . PHE B  1 242 ? 28.422  -10.466 12.107  1.00 86.13  ? 241 PHE B CA     1 
ATOM   9358  C  C      . PHE B  1 242 ? 29.467  -10.601 13.209  1.00 86.32  ? 241 PHE B C      1 
ATOM   9359  O  O      . PHE B  1 242 ? 29.276  -10.120 14.326  1.00 76.94  ? 241 PHE B O      1 
ATOM   9360  C  CB     . PHE B  1 242 ? 28.672  -9.191  11.297  1.00 82.41  ? 241 PHE B CB     1 
ATOM   9361  C  CG     . PHE B  1 242 ? 27.573  -8.863  10.322  1.00 87.72  ? 241 PHE B CG     1 
ATOM   9362  C  CD1    . PHE B  1 242 ? 27.583  -9.382  9.035   1.00 89.63  ? 241 PHE B CD1    1 
ATOM   9363  C  CD2    . PHE B  1 242 ? 26.533  -8.027  10.692  1.00 89.24  ? 241 PHE B CD2    1 
ATOM   9364  C  CE1    . PHE B  1 242 ? 26.571  -9.074  8.140   1.00 74.39  ? 241 PHE B CE1    1 
ATOM   9365  C  CE2    . PHE B  1 242 ? 25.523  -7.717  9.804   1.00 96.50  ? 241 PHE B CE2    1 
ATOM   9366  C  CZ     . PHE B  1 242 ? 25.541  -8.241  8.526   1.00 83.89  ? 241 PHE B CZ     1 
ATOM   9367  H  H      . PHE B  1 242 ? 26.737  -9.674  12.765  1.00 88.51  ? 241 PHE B H      1 
ATOM   9368  H  HA     . PHE B  1 242 ? 28.508  -11.234 11.506  1.00 103.35 ? 241 PHE B HA     1 
ATOM   9369  H  HB2    . PHE B  1 242 ? 28.757  -8.444  11.909  1.00 98.89  ? 241 PHE B HB2    1 
ATOM   9370  H  HB3    . PHE B  1 242 ? 29.493  -9.298  10.792  1.00 98.89  ? 241 PHE B HB3    1 
ATOM   9371  H  HD1    . PHE B  1 242 ? 28.275  -9.944  8.771   1.00 107.56 ? 241 PHE B HD1    1 
ATOM   9372  H  HD2    . PHE B  1 242 ? 26.515  -7.671  11.551  1.00 107.08 ? 241 PHE B HD2    1 
ATOM   9373  H  HE1    . PHE B  1 242 ? 26.586  -9.429  7.280   1.00 89.27  ? 241 PHE B HE1    1 
ATOM   9374  H  HE2    . PHE B  1 242 ? 24.829  -7.156  10.066  1.00 115.80 ? 241 PHE B HE2    1 
ATOM   9375  H  HZ     . PHE B  1 242 ? 24.860  -8.033  7.928   1.00 100.67 ? 241 PHE B HZ     1 
ATOM   9376  N  N      . ARG B  1 243 ? 30.569  -11.268 12.887  1.00 94.55  ? 242 ARG B N      1 
ATOM   9377  C  CA     . ARG B  1 243 ? 31.684  -11.413 13.812  1.00 86.35  ? 242 ARG B CA     1 
ATOM   9378  C  C      . ARG B  1 243 ? 32.350  -10.057 14.068  1.00 95.45  ? 242 ARG B C      1 
ATOM   9379  O  O      . ARG B  1 243 ? 33.092  -9.896  15.036  1.00 100.87 ? 242 ARG B O      1 
ATOM   9380  C  CB     . ARG B  1 243 ? 32.692  -12.420 13.250  1.00 94.39  ? 242 ARG B CB     1 
ATOM   9381  C  CG     . ARG B  1 243 ? 32.119  -13.824 13.064  1.00 105.28 ? 242 ARG B CG     1 
ATOM   9382  C  CD     . ARG B  1 243 ? 32.999  -14.688 12.170  1.00 129.36 ? 242 ARG B CD     1 
ATOM   9383  N  NE     . ARG B  1 243 ? 32.616  -16.099 12.215  1.00 151.44 ? 242 ARG B NE     1 
ATOM   9384  C  CZ     . ARG B  1 243 ? 31.730  -16.678 11.406  1.00 151.86 ? 242 ARG B CZ     1 
ATOM   9385  N  NH1    . ARG B  1 243 ? 31.461  -17.969 11.540  1.00 150.02 ? 242 ARG B NH1    1 
ATOM   9386  N  NH2    . ARG B  1 243 ? 31.108  -15.980 10.465  1.00 148.05 ? 242 ARG B NH2    1 
ATOM   9387  H  H      . ARG B  1 243 ? 30.696  -11.652 12.127  1.00 113.46 ? 242 ARG B H      1 
ATOM   9388  H  HA     . ARG B  1 243 ? 31.351  -11.757 14.667  1.00 103.62 ? 242 ARG B HA     1 
ATOM   9389  H  HB2    . ARG B  1 243 ? 32.998  -12.107 12.385  1.00 113.27 ? 242 ARG B HB2    1 
ATOM   9390  H  HB3    . ARG B  1 243 ? 33.443  -12.485 13.861  1.00 113.27 ? 242 ARG B HB3    1 
ATOM   9391  H  HG2    . ARG B  1 243 ? 32.050  -14.257 13.929  1.00 126.34 ? 242 ARG B HG2    1 
ATOM   9392  H  HG3    . ARG B  1 243 ? 31.243  -13.758 12.653  1.00 126.34 ? 242 ARG B HG3    1 
ATOM   9393  H  HD2    . ARG B  1 243 ? 32.918  -14.382 11.253  1.00 155.23 ? 242 ARG B HD2    1 
ATOM   9394  H  HD3    . ARG B  1 243 ? 33.920  -14.615 12.466  1.00 155.23 ? 242 ARG B HD3    1 
ATOM   9395  H  HE     . ARG B  1 243 ? 32.993  -16.594 12.809  1.00 181.73 ? 242 ARG B HE     1 
ATOM   9396  H  HH11   . ARG B  1 243 ? 31.859  -18.430 12.147  1.00 180.02 ? 242 ARG B HH11   1 
ATOM   9397  H  HH12   . ARG B  1 243 ? 30.890  -18.345 11.019  1.00 180.02 ? 242 ARG B HH12   1 
ATOM   9398  H  HH21   . ARG B  1 243 ? 31.275  -15.142 10.370  1.00 177.66 ? 242 ARG B HH21   1 
ATOM   9399  H  HH22   . ARG B  1 243 ? 30.538  -16.366 9.949   1.00 177.66 ? 242 ARG B HH22   1 
ATOM   9400  N  N      . LYS B  1 244 ? 32.073  -9.090  13.194  1.00 113.20 ? 243 LYS B N      1 
ATOM   9401  C  CA     . LYS B  1 244 ? 32.577  -7.724  13.339  1.00 105.63 ? 243 LYS B CA     1 
ATOM   9402  C  C      . LYS B  1 244 ? 31.566  -6.728  12.771  1.00 110.70 ? 243 LYS B C      1 
ATOM   9403  O  O      . LYS B  1 244 ? 31.702  -6.285  11.629  1.00 113.25 ? 243 LYS B O      1 
ATOM   9404  C  CB     . LYS B  1 244 ? 33.911  -7.563  12.608  1.00 104.05 ? 243 LYS B CB     1 
ATOM   9405  C  CG     . LYS B  1 244 ? 35.107  -8.135  13.347  1.00 109.02 ? 243 LYS B CG     1 
ATOM   9406  C  CD     . LYS B  1 244 ? 36.397  -7.893  12.577  1.00 112.15 ? 243 LYS B CD     1 
ATOM   9407  C  CE     . LYS B  1 244 ? 37.620  -8.244  13.409  1.00 133.10 ? 243 LYS B CE     1 
ATOM   9408  N  NZ     . LYS B  1 244 ? 38.891  -7.986  12.675  1.00 139.91 ? 243 LYS B NZ     1 
ATOM   9409  H  H      . LYS B  1 244 ? 31.585  -9.203  12.495  1.00 135.84 ? 243 LYS B H      1 
ATOM   9410  H  HA     . LYS B  1 244 ? 32.715  -7.523  14.288  1.00 126.76 ? 243 LYS B HA     1 
ATOM   9411  H  HB2    . LYS B  1 244 ? 33.851  -8.015  11.751  1.00 124.86 ? 243 LYS B HB2    1 
ATOM   9412  H  HB3    . LYS B  1 244 ? 34.076  -6.618  12.468  1.00 124.86 ? 243 LYS B HB3    1 
ATOM   9413  H  HG2    . LYS B  1 244 ? 35.184  -7.706  14.213  1.00 130.83 ? 243 LYS B HG2    1 
ATOM   9414  H  HG3    . LYS B  1 244 ? 34.991  -9.092  13.454  1.00 130.83 ? 243 LYS B HG3    1 
ATOM   9415  H  HD2    . LYS B  1 244 ? 36.402  -8.447  11.780  1.00 134.59 ? 243 LYS B HD2    1 
ATOM   9416  H  HD3    . LYS B  1 244 ? 36.453  -6.956  12.335  1.00 134.59 ? 243 LYS B HD3    1 
ATOM   9417  H  HE2    . LYS B  1 244 ? 37.622  -7.705  14.216  1.00 159.73 ? 243 LYS B HE2    1 
ATOM   9418  H  HE3    . LYS B  1 244 ? 37.590  -9.186  13.638  1.00 159.73 ? 243 LYS B HE3    1 
ATOM   9419  H  HZ1    . LYS B  1 244 ? 39.587  -8.200  13.187  1.00 167.89 ? 243 LYS B HZ1    1 
ATOM   9420  H  HZ2    . LYS B  1 244 ? 38.917  -8.474  11.932  1.00 167.89 ? 243 LYS B HZ2    1 
ATOM   9421  H  HZ3    . LYS B  1 244 ? 38.946  -7.124  12.458  1.00 167.89 ? 243 LYS B HZ3    1 
ATOM   9422  N  N      . PRO B  1 245 ? 30.552  -6.364  13.572  1.00 103.39 ? 244 PRO B N      1 
ATOM   9423  C  CA     . PRO B  1 245 ? 29.418  -5.546  13.115  1.00 104.92 ? 244 PRO B CA     1 
ATOM   9424  C  C      . PRO B  1 245 ? 29.772  -4.115  12.707  1.00 100.10 ? 244 PRO B C      1 
ATOM   9425  O  O      . PRO B  1 245 ? 28.932  -3.444  12.106  1.00 85.11  ? 244 PRO B O      1 
ATOM   9426  C  CB     . PRO B  1 245 ? 28.487  -5.530  14.332  1.00 90.56  ? 244 PRO B CB     1 
ATOM   9427  C  CG     . PRO B  1 245 ? 29.371  -5.795  15.491  1.00 86.17  ? 244 PRO B CG     1 
ATOM   9428  C  CD     . PRO B  1 245 ? 30.430  -6.725  14.993  1.00 88.08  ? 244 PRO B CD     1 
ATOM   9429  H  HA     . PRO B  1 245 ? 28.963  -5.989  12.369  1.00 125.91 ? 244 PRO B HA     1 
ATOM   9430  H  HB2    . PRO B  1 245 ? 28.068  -4.659  14.412  1.00 108.67 ? 244 PRO B HB2    1 
ATOM   9431  H  HB3    . PRO B  1 245 ? 27.819  -6.227  14.243  1.00 108.67 ? 244 PRO B HB3    1 
ATOM   9432  H  HG2    . PRO B  1 245 ? 29.765  -4.963  15.796  1.00 103.40 ? 244 PRO B HG2    1 
ATOM   9433  H  HG3    . PRO B  1 245 ? 28.859  -6.211  16.202  1.00 103.40 ? 244 PRO B HG3    1 
ATOM   9434  H  HD2    . PRO B  1 245 ? 31.267  -6.565  15.457  1.00 105.70 ? 244 PRO B HD2    1 
ATOM   9435  H  HD3    . PRO B  1 245 ? 30.142  -7.647  15.085  1.00 105.70 ? 244 PRO B HD3    1 
ATOM   9436  N  N      . GLU B  1 246 ? 30.978  -3.656  13.024  1.00 102.79 ? 245 GLU B N      1 
ATOM   9437  C  CA     . GLU B  1 246 ? 31.384  -2.296  12.673  1.00 90.21  ? 245 GLU B CA     1 
ATOM   9438  C  C      . GLU B  1 246 ? 31.744  -2.181  11.193  1.00 94.27  ? 245 GLU B C      1 
ATOM   9439  O  O      . GLU B  1 246 ? 31.730  -1.089  10.626  1.00 110.64 ? 245 GLU B O      1 
ATOM   9440  C  CB     . GLU B  1 246 ? 32.562  -1.829  13.538  1.00 91.50  ? 245 GLU B CB     1 
ATOM   9441  C  CG     . GLU B  1 246 ? 33.900  -2.503  13.240  1.00 108.40 ? 245 GLU B CG     1 
ATOM   9442  C  CD     . GLU B  1 246 ? 34.099  -3.809  13.991  1.00 127.28 ? 245 GLU B CD     1 
ATOM   9443  O  OE1    . GLU B  1 246 ? 35.180  -4.419  13.843  1.00 125.28 ? 245 GLU B OE1    1 
ATOM   9444  O  OE2    . GLU B  1 246 ? 33.182  -4.226  14.731  1.00 130.10 ? 245 GLU B OE2    1 
ATOM   9445  H  H      . GLU B  1 246 ? 31.579  -4.108  13.440  1.00 123.35 ? 245 GLU B H      1 
ATOM   9446  H  HA     . GLU B  1 246 ? 30.632  -1.691  12.843  1.00 108.25 ? 245 GLU B HA     1 
ATOM   9447  H  HB2    . GLU B  1 246 ? 32.680  -0.875  13.407  1.00 109.80 ? 245 GLU B HB2    1 
ATOM   9448  H  HB3    . GLU B  1 246 ? 32.349  -2.005  14.468  1.00 109.80 ? 245 GLU B HB3    1 
ATOM   9449  H  HG2    . GLU B  1 246 ? 33.949  -2.695  12.290  1.00 130.08 ? 245 GLU B HG2    1 
ATOM   9450  H  HG3    . GLU B  1 246 ? 34.617  -1.901  13.493  1.00 130.08 ? 245 GLU B HG3    1 
ATOM   9451  N  N      . LEU B  1 247 ? 32.059  -3.312  10.572  1.00 90.96  ? 246 LEU B N      1 
ATOM   9452  C  CA     . LEU B  1 247 ? 32.444  -3.336  9.163   1.00 77.93  ? 246 LEU B CA     1 
ATOM   9453  C  C      . LEU B  1 247 ? 31.255  -3.159  8.221   1.00 69.91  ? 246 LEU B C      1 
ATOM   9454  O  O      . LEU B  1 247 ? 31.437  -2.926  7.026   1.00 81.91  ? 246 LEU B O      1 
ATOM   9455  C  CB     . LEU B  1 247 ? 33.141  -4.658  8.833   1.00 66.28  ? 246 LEU B CB     1 
ATOM   9456  C  CG     . LEU B  1 247 ? 34.650  -4.743  9.072   1.00 61.25  ? 246 LEU B CG     1 
ATOM   9457  C  CD1    . LEU B  1 247 ? 35.035  -4.111  10.390  1.00 81.46  ? 246 LEU B CD1    1 
ATOM   9458  C  CD2    . LEU B  1 247 ? 35.092  -6.196  9.037   1.00 75.27  ? 246 LEU B CD2    1 
ATOM   9459  H  H      . LEU B  1 247 ? 32.059  -4.086  10.946  1.00 109.16 ? 246 LEU B H      1 
ATOM   9460  H  HA     . LEU B  1 247 ? 33.077  -2.608  8.993   1.00 93.51  ? 246 LEU B HA     1 
ATOM   9461  H  HB2    . LEU B  1 247 ? 32.730  -5.355  9.367   1.00 79.54  ? 246 LEU B HB2    1 
ATOM   9462  H  HB3    . LEU B  1 247 ? 32.992  -4.849  7.893   1.00 79.54  ? 246 LEU B HB3    1 
ATOM   9463  H  HG     . LEU B  1 247 ? 35.112  -4.269  8.363   1.00 73.51  ? 246 LEU B HG     1 
ATOM   9464  H  HD11   . LEU B  1 247 ? 35.985  -4.184  10.505  1.00 97.75  ? 246 LEU B HD11   1 
ATOM   9465  H  HD12   . LEU B  1 247 ? 34.775  -3.187  10.381  1.00 97.75  ? 246 LEU B HD12   1 
ATOM   9466  H  HD13   . LEU B  1 247 ? 34.583  -4.572  11.101  1.00 97.75  ? 246 LEU B HD13   1 
ATOM   9467  H  HD21   . LEU B  1 247 ? 36.039  -6.238  9.188   1.00 90.33  ? 246 LEU B HD21   1 
ATOM   9468  H  HD22   . LEU B  1 247 ? 34.628  -6.680  9.724   1.00 90.33  ? 246 LEU B HD22   1 
ATOM   9469  H  HD23   . LEU B  1 247 ? 34.880  -6.565  8.176   1.00 90.33  ? 246 LEU B HD23   1 
ATOM   9470  N  N      . TRP B  1 248 ? 30.042  -3.266  8.754   1.00 67.60  ? 247 TRP B N      1 
ATOM   9471  C  CA     . TRP B  1 248 ? 28.853  -3.350  7.912   1.00 79.66  ? 247 TRP B CA     1 
ATOM   9472  C  C      . TRP B  1 248 ? 27.896  -2.183  8.132   1.00 70.45  ? 247 TRP B C      1 
ATOM   9473  O  O      . TRP B  1 248 ? 27.926  -1.531  9.174   1.00 97.71  ? 247 TRP B O      1 
ATOM   9474  C  CB     . TRP B  1 248 ? 28.145  -4.684  8.154   1.00 105.32 ? 247 TRP B CB     1 
ATOM   9475  C  CG     . TRP B  1 248 ? 29.095  -5.842  8.122   1.00 106.33 ? 247 TRP B CG     1 
ATOM   9476  C  CD1    . TRP B  1 248 ? 29.472  -6.624  9.174   1.00 110.13 ? 247 TRP B CD1    1 
ATOM   9477  C  CD2    . TRP B  1 248 ? 29.808  -6.334  6.980   1.00 98.76  ? 247 TRP B CD2    1 
ATOM   9478  N  NE1    . TRP B  1 248 ? 30.369  -7.578  8.757   1.00 111.83 ? 247 TRP B NE1    1 
ATOM   9479  C  CE2    . TRP B  1 248 ? 30.592  -7.421  7.415   1.00 101.63 ? 247 TRP B CE2    1 
ATOM   9480  C  CE3    . TRP B  1 248 ? 29.856  -5.962  5.633   1.00 85.99  ? 247 TRP B CE3    1 
ATOM   9481  C  CZ2    . TRP B  1 248 ? 31.413  -8.141  6.550   1.00 104.85 ? 247 TRP B CZ2    1 
ATOM   9482  C  CZ3    . TRP B  1 248 ? 30.671  -6.677  4.776   1.00 91.23  ? 247 TRP B CZ3    1 
ATOM   9483  C  CH2    . TRP B  1 248 ? 31.439  -7.755  5.238   1.00 106.58 ? 247 TRP B CH2    1 
ATOM   9484  H  H      . TRP B  1 248 ? 29.880  -3.292  9.598   1.00 81.12  ? 247 TRP B H      1 
ATOM   9485  H  HA     . TRP B  1 248 ? 29.133  -3.329  6.973   1.00 95.59  ? 247 TRP B HA     1 
ATOM   9486  H  HB2    . TRP B  1 248 ? 27.721  -4.665  9.026   1.00 126.39 ? 247 TRP B HB2    1 
ATOM   9487  H  HB3    . TRP B  1 248 ? 27.479  -4.821  7.462   1.00 126.39 ? 247 TRP B HB3    1 
ATOM   9488  H  HD1    . TRP B  1 248 ? 29.165  -6.527  10.047  1.00 132.16 ? 247 TRP B HD1    1 
ATOM   9489  H  HE1    . TRP B  1 248 ? 30.732  -8.176  9.257   1.00 134.19 ? 247 TRP B HE1    1 
ATOM   9490  H  HE3    . TRP B  1 248 ? 29.348  -5.248  5.320   1.00 103.19 ? 247 TRP B HE3    1 
ATOM   9491  H  HZ2    . TRP B  1 248 ? 31.924  -8.857  6.853   1.00 125.82 ? 247 TRP B HZ2    1 
ATOM   9492  H  HZ3    . TRP B  1 248 ? 30.711  -6.440  3.878   1.00 109.48 ? 247 TRP B HZ3    1 
ATOM   9493  H  HH2    . TRP B  1 248 ? 31.978  -8.218  4.638   1.00 127.89 ? 247 TRP B HH2    1 
ATOM   9494  N  N      . SER B  1 249 ? 27.047  -1.936  7.139   1.00 69.77  ? 248 SER B N      1 
ATOM   9495  C  CA     . SER B  1 249 ? 26.168  -0.772  7.133   1.00 65.38  ? 248 SER B CA     1 
ATOM   9496  C  C      . SER B  1 249 ? 24.866  -1.005  7.881   1.00 64.57  ? 248 SER B C      1 
ATOM   9497  O  O      . SER B  1 249 ? 24.479  -2.144  8.142   1.00 74.76  ? 248 SER B O      1 
ATOM   9498  C  CB     . SER B  1 249 ? 25.826  -0.401  5.695   1.00 78.72  ? 248 SER B CB     1 
ATOM   9499  O  OG     . SER B  1 249 ? 24.875  -1.307  5.166   1.00 74.06  ? 248 SER B OG     1 
ATOM   9500  H  H      . SER B  1 249 ? 26.959  -2.438  6.446   1.00 83.73  ? 248 SER B H      1 
ATOM   9501  H  HA     . SER B  1 249 ? 26.631  -0.013  7.546   1.00 78.45  ? 248 SER B HA     1 
ATOM   9502  H  HB2    . SER B  1 249 ? 25.454  0.495   5.679   1.00 94.47  ? 248 SER B HB2    1 
ATOM   9503  H  HB3    . SER B  1 249 ? 26.632  -0.437  5.157   1.00 94.47  ? 248 SER B HB3    1 
ATOM   9504  H  HG     . SER B  1 249 ? 24.693  -1.103  4.393   1.00 88.88  ? 248 SER B HG     1 
ATOM   9505  N  N      . ASP B  1 250 ? 24.183  0.089   8.205   1.00 69.49  ? 249 ASP B N      1 
ATOM   9506  C  CA     . ASP B  1 250 ? 22.884  0.010   8.858   1.00 78.00  ? 249 ASP B CA     1 
ATOM   9507  C  C      . ASP B  1 250 ? 21.903  -0.787  8.004   1.00 84.44  ? 249 ASP B C      1 
ATOM   9508  O  O      . ASP B  1 250 ? 21.243  -1.702  8.493   1.00 70.12  ? 249 ASP B O      1 
ATOM   9509  C  CB     . ASP B  1 250 ? 22.326  1.410   9.120   1.00 89.13  ? 249 ASP B CB     1 
ATOM   9510  C  CG     . ASP B  1 250 ? 23.066  2.135   10.229  1.00 111.55 ? 249 ASP B CG     1 
ATOM   9511  O  OD1    . ASP B  1 250 ? 22.467  3.033   10.861  1.00 92.59  ? 249 ASP B OD1    1 
ATOM   9512  O  OD2    . ASP B  1 250 ? 24.246  1.805   10.471  1.00 133.39 ? 249 ASP B OD2    1 
ATOM   9513  H  H      . ASP B  1 250 ? 24.453  0.892   8.056   1.00 83.39  ? 249 ASP B H      1 
ATOM   9514  H  HA     . ASP B  1 250 ? 22.982  -0.447  9.719   1.00 93.61  ? 249 ASP B HA     1 
ATOM   9515  H  HB2    . ASP B  1 250 ? 22.405  1.939   8.311   1.00 106.95 ? 249 ASP B HB2    1 
ATOM   9516  H  HB3    . ASP B  1 250 ? 21.394  1.336   9.379   1.00 106.95 ? 249 ASP B HB3    1 
ATOM   9517  N  N      . ASP B  1 251 ? 21.813  -0.436  6.724   1.00 95.19  ? 250 ASP B N      1 
ATOM   9518  C  CA     . ASP B  1 251 ? 20.908  -1.121  5.810   1.00 80.84  ? 250 ASP B CA     1 
ATOM   9519  C  C      . ASP B  1 251 ? 21.188  -2.616  5.796   1.00 69.67  ? 250 ASP B C      1 
ATOM   9520  O  O      . ASP B  1 251 ? 20.299  -3.423  6.066   1.00 71.20  ? 250 ASP B O      1 
ATOM   9521  C  CB     . ASP B  1 251 ? 21.042  -0.552  4.397   1.00 96.96  ? 250 ASP B CB     1 
ATOM   9522  C  CG     . ASP B  1 251 ? 20.468  0.844   4.274   1.00 107.12 ? 250 ASP B CG     1 
ATOM   9523  O  OD1    . ASP B  1 251 ? 19.639  1.221   5.128   1.00 114.25 ? 250 ASP B OD1    1 
ATOM   9524  O  OD2    . ASP B  1 251 ? 20.839  1.559   3.320   1.00 114.84 ? 250 ASP B OD2    1 
ATOM   9525  H  H      . ASP B  1 251 ? 22.267  0.197   6.361   1.00 114.23 ? 250 ASP B H      1 
ATOM   9526  H  HA     . ASP B  1 251 ? 19.985  -0.984  6.108   1.00 97.01  ? 250 ASP B HA     1 
ATOM   9527  H  HB2    . ASP B  1 251 ? 21.982  -0.513  4.159   1.00 116.35 ? 250 ASP B HB2    1 
ATOM   9528  H  HB3    . ASP B  1 251 ? 20.566  -1.128  3.778   1.00 116.35 ? 250 ASP B HB3    1 
ATOM   9529  N  N      . PHE B  1 252 ? 22.428  -2.984  5.494   1.00 72.69  ? 251 PHE B N      1 
ATOM   9530  C  CA     . PHE B  1 252 ? 22.806  -4.392  5.430   1.00 67.39  ? 251 PHE B CA     1 
ATOM   9531  C  C      . PHE B  1 252 ? 22.499  -5.078  6.754   1.00 73.11  ? 251 PHE B C      1 
ATOM   9532  O  O      . PHE B  1 252 ? 21.804  -6.092  6.796   1.00 73.49  ? 251 PHE B O      1 
ATOM   9533  C  CB     . PHE B  1 252 ? 24.296  -4.536  5.107   1.00 50.96  ? 251 PHE B CB     1 
ATOM   9534  C  CG     . PHE B  1 252 ? 24.733  -5.955  4.842   1.00 59.73  ? 251 PHE B CG     1 
ATOM   9535  C  CD1    . PHE B  1 252 ? 26.078  -6.295  4.883   1.00 57.61  ? 251 PHE B CD1    1 
ATOM   9536  C  CD2    . PHE B  1 252 ? 23.808  -6.945  4.534   1.00 60.69  ? 251 PHE B CD2    1 
ATOM   9537  C  CE1    . PHE B  1 252 ? 26.492  -7.595  4.636   1.00 56.16  ? 251 PHE B CE1    1 
ATOM   9538  C  CE2    . PHE B  1 252 ? 24.217  -8.245  4.283   1.00 61.71  ? 251 PHE B CE2    1 
ATOM   9539  C  CZ     . PHE B  1 252 ? 25.561  -8.570  4.335   1.00 59.93  ? 251 PHE B CZ     1 
ATOM   9540  H  H      . PHE B  1 252 ? 23.070  -2.438  5.322   1.00 87.23  ? 251 PHE B H      1 
ATOM   9541  H  HA     . PHE B  1 252 ? 22.291  -4.836  4.724   1.00 80.87  ? 251 PHE B HA     1 
ATOM   9542  H  HB2    . PHE B  1 252 ? 24.495  -4.012  4.316   1.00 61.15  ? 251 PHE B HB2    1 
ATOM   9543  H  HB3    . PHE B  1 252 ? 24.811  -4.203  5.859   1.00 61.15  ? 251 PHE B HB3    1 
ATOM   9544  H  HD1    . PHE B  1 252 ? 26.709  -5.643  5.086   1.00 69.13  ? 251 PHE B HD1    1 
ATOM   9545  H  HD2    . PHE B  1 252 ? 22.903  -6.733  4.498   1.00 72.82  ? 251 PHE B HD2    1 
ATOM   9546  H  HE1    . PHE B  1 252 ? 27.396  -7.810  4.670   1.00 67.40  ? 251 PHE B HE1    1 
ATOM   9547  H  HE2    . PHE B  1 252 ? 23.588  -8.900  4.082   1.00 74.05  ? 251 PHE B HE2    1 
ATOM   9548  H  HZ     . PHE B  1 252 ? 25.837  -9.442  4.168   1.00 71.92  ? 251 PHE B HZ     1 
ATOM   9549  N  N      . THR B  1 253 ? 23.018  -4.509  7.835   1.00 78.77  ? 252 THR B N      1 
ATOM   9550  C  CA     . THR B  1 253 ? 22.841  -5.078  9.162   1.00 70.81  ? 252 THR B CA     1 
ATOM   9551  C  C      . THR B  1 253 ? 21.366  -5.331  9.467   1.00 64.11  ? 252 THR B C      1 
ATOM   9552  O  O      . THR B  1 253 ? 20.991  -6.423  9.893   1.00 83.95  ? 252 THR B O      1 
ATOM   9553  C  CB     . THR B  1 253 ? 23.439  -4.156  10.240  1.00 72.00  ? 252 THR B CB     1 
ATOM   9554  O  OG1    . THR B  1 253 ? 24.870  -4.172  10.145  1.00 86.09  ? 252 THR B OG1    1 
ATOM   9555  C  CG2    . THR B  1 253 ? 23.028  -4.611  11.624  1.00 46.61  ? 252 THR B CG2    1 
ATOM   9556  H  H      . THR B  1 253 ? 23.481  -3.784  7.825   1.00 94.52  ? 252 THR B H      1 
ATOM   9557  H  HA     . THR B  1 253 ? 23.310  -5.937  9.205   1.00 84.97  ? 252 THR B HA     1 
ATOM   9558  H  HB     . THR B  1 253 ? 23.117  -3.251  10.106  1.00 86.40  ? 252 THR B HB     1 
ATOM   9559  H  HG1    . THR B  1 253 ? 25.105  -3.908  9.405   1.00 103.31 ? 252 THR B HG1    1 
ATOM   9560  H  HG21   . THR B  1 253 ? 23.407  -4.029  12.287  1.00 55.93  ? 252 THR B HG21   1 
ATOM   9561  H  HG22   . THR B  1 253 ? 22.072  -4.595  11.704  1.00 55.93  ? 252 THR B HG22   1 
ATOM   9562  H  HG23   . THR B  1 253 ? 23.339  -5.506  11.781  1.00 55.93  ? 252 THR B HG23   1 
ATOM   9563  N  N      . ASP B  1 254 ? 20.532  -4.323  9.237   1.00 57.92  ? 253 ASP B N      1 
ATOM   9564  C  CA     . ASP B  1 254 ? 19.102  -4.445  9.489   1.00 58.04  ? 253 ASP B CA     1 
ATOM   9565  C  C      . ASP B  1 254 ? 18.483  -5.511  8.590   1.00 69.90  ? 253 ASP B C      1 
ATOM   9566  O  O      . ASP B  1 254 ? 17.659  -6.307  9.039   1.00 64.87  ? 253 ASP B O      1 
ATOM   9567  C  CB     . ASP B  1 254 ? 18.400  -3.104  9.264   1.00 60.52  ? 253 ASP B CB     1 
ATOM   9568  C  CG     . ASP B  1 254 ? 16.936  -3.136  9.664   1.00 88.82  ? 253 ASP B CG     1 
ATOM   9569  O  OD1    . ASP B  1 254 ? 16.641  -2.973  10.868  1.00 109.24 ? 253 ASP B OD1    1 
ATOM   9570  O  OD2    . ASP B  1 254 ? 16.080  -3.322  8.773   1.00 86.09  ? 253 ASP B OD2    1 
ATOM   9571  H  H      . ASP B  1 254 ? 20.771  -3.555  8.934   1.00 69.51  ? 253 ASP B H      1 
ATOM   9572  H  HA     . ASP B  1 254 ? 18.960  -4.711  10.422  1.00 69.65  ? 253 ASP B HA     1 
ATOM   9573  H  HB2    . ASP B  1 254 ? 18.842  -2.422  9.794   1.00 72.62  ? 253 ASP B HB2    1 
ATOM   9574  H  HB3    . ASP B  1 254 ? 18.449  -2.876  8.322   1.00 72.62  ? 253 ASP B HB3    1 
ATOM   9575  N  N      . PHE B  1 255 ? 18.882  -5.529  7.321   1.00 61.98  ? 254 PHE B N      1 
ATOM   9576  C  CA     . PHE B  1 255 ? 18.379  -6.530  6.387   1.00 78.20  ? 254 PHE B CA     1 
ATOM   9577  C  C      . PHE B  1 255 ? 18.582  -7.933  6.954   1.00 76.57  ? 254 PHE B C      1 
ATOM   9578  O  O      . PHE B  1 255 ? 17.661  -8.749  6.965   1.00 73.15  ? 254 PHE B O      1 
ATOM   9579  C  CB     . PHE B  1 255 ? 19.073  -6.407  5.028   1.00 89.16  ? 254 PHE B CB     1 
ATOM   9580  C  CG     . PHE B  1 255 ? 18.785  -7.552  4.098   1.00 71.70  ? 254 PHE B CG     1 
ATOM   9581  C  CD1    . PHE B  1 255 ? 17.613  -7.585  3.362   1.00 60.91  ? 254 PHE B CD1    1 
ATOM   9582  C  CD2    . PHE B  1 255 ? 19.686  -8.596  3.962   1.00 66.06  ? 254 PHE B CD2    1 
ATOM   9583  C  CE1    . PHE B  1 255 ? 17.342  -8.637  2.509   1.00 59.05  ? 254 PHE B CE1    1 
ATOM   9584  C  CE2    . PHE B  1 255 ? 19.421  -9.651  3.108   1.00 63.21  ? 254 PHE B CE2    1 
ATOM   9585  C  CZ     . PHE B  1 255 ? 18.247  -9.672  2.382   1.00 62.67  ? 254 PHE B CZ     1 
ATOM   9586  H  H      . PHE B  1 255 ? 19.441  -4.973  6.977   1.00 74.38  ? 254 PHE B H      1 
ATOM   9587  H  HA     . PHE B  1 255 ? 17.418  -6.390  6.253   1.00 93.84  ? 254 PHE B HA     1 
ATOM   9588  H  HB2    . PHE B  1 255 ? 18.775  -5.592  4.596   1.00 107.00 ? 254 PHE B HB2    1 
ATOM   9589  H  HB3    . PHE B  1 255 ? 20.033  -6.373  5.169   1.00 107.00 ? 254 PHE B HB3    1 
ATOM   9590  H  HD1    . PHE B  1 255 ? 16.999  -6.891  3.445   1.00 73.09  ? 254 PHE B HD1    1 
ATOM   9591  H  HD2    . PHE B  1 255 ? 20.478  -8.587  4.450   1.00 79.27  ? 254 PHE B HD2    1 
ATOM   9592  H  HE1    . PHE B  1 255 ? 16.551  -8.648  2.020   1.00 70.86  ? 254 PHE B HE1    1 
ATOM   9593  H  HE2    . PHE B  1 255 ? 20.032  -10.347 3.025   1.00 75.85  ? 254 PHE B HE2    1 
ATOM   9594  H  HZ     . PHE B  1 255 ? 18.068  -10.380 1.807   1.00 75.20  ? 254 PHE B HZ     1 
ATOM   9595  N  N      . VAL B  1 256 ? 19.794  -8.202  7.430   1.00 71.76  ? 255 VAL B N      1 
ATOM   9596  C  CA     . VAL B  1 256 ? 20.123  -9.494  8.021   1.00 64.58  ? 255 VAL B CA     1 
ATOM   9597  C  C      . VAL B  1 256 ? 19.260  -9.754  9.252   1.00 69.04  ? 255 VAL B C      1 
ATOM   9598  O  O      . VAL B  1 256 ? 18.914  -10.895 9.551   1.00 64.85  ? 255 VAL B O      1 
ATOM   9599  C  CB     . VAL B  1 256 ? 21.613  -9.562  8.423   1.00 56.02  ? 255 VAL B CB     1 
ATOM   9600  C  CG1    . VAL B  1 256 ? 21.908  -10.835 9.210   1.00 45.44  ? 255 VAL B CG1    1 
ATOM   9601  C  CG2    . VAL B  1 256 ? 22.502  -9.482  7.188   1.00 45.96  ? 255 VAL B CG2    1 
ATOM   9602  H  H      . VAL B  1 256 ? 20.451  -7.646  7.422   1.00 86.11  ? 255 VAL B H      1 
ATOM   9603  H  HA     . VAL B  1 256 ? 19.948  -10.202 7.367   1.00 77.50  ? 255 VAL B HA     1 
ATOM   9604  H  HB     . VAL B  1 256 ? 21.823  -8.796  8.997   1.00 67.23  ? 255 VAL B HB     1 
ATOM   9605  H  HG11   . VAL B  1 256 ? 22.839  -10.848 9.445   1.00 54.53  ? 255 VAL B HG11   1 
ATOM   9606  H  HG12   . VAL B  1 256 ? 21.369  -10.841 10.005  1.00 54.53  ? 255 VAL B HG12   1 
ATOM   9607  H  HG13   . VAL B  1 256 ? 21.696  -11.596 8.665   1.00 54.53  ? 255 VAL B HG13   1 
ATOM   9608  H  HG21   . VAL B  1 256 ? 23.421  -9.526  7.462   1.00 55.15  ? 255 VAL B HG21   1 
ATOM   9609  H  HG22   . VAL B  1 256 ? 22.297  -10.218 6.608   1.00 55.15  ? 255 VAL B HG22   1 
ATOM   9610  H  HG23   . VAL B  1 256 ? 22.334  -8.651  6.737   1.00 55.15  ? 255 VAL B HG23   1 
ATOM   9611  N  N      . LYS B  1 257 ? 18.914  -8.687  9.963   1.00 67.57  ? 256 LYS B N      1 
ATOM   9612  C  CA     . LYS B  1 257 ? 18.091  -8.802  11.161  1.00 66.20  ? 256 LYS B CA     1 
ATOM   9613  C  C      . LYS B  1 257 ? 16.641  -9.150  10.826  1.00 77.57  ? 256 LYS B C      1 
ATOM   9614  O  O      . LYS B  1 257 ? 15.975  -9.848  11.588  1.00 109.30 ? 256 LYS B O      1 
ATOM   9615  C  CB     . LYS B  1 257 ? 18.154  -7.503  11.968  1.00 76.81  ? 256 LYS B CB     1 
ATOM   9616  C  CG     . LYS B  1 257 ? 17.002  -7.302  12.937  1.00 83.67  ? 256 LYS B CG     1 
ATOM   9617  C  CD     . LYS B  1 257 ? 17.252  -6.099  13.833  1.00 97.44  ? 256 LYS B CD     1 
ATOM   9618  C  CE     . LYS B  1 257 ? 16.028  -5.750  14.661  1.00 116.24 ? 256 LYS B CE     1 
ATOM   9619  N  NZ     . LYS B  1 257 ? 16.304  -4.646  15.622  1.00 125.71 ? 256 LYS B NZ     1 
ATOM   9620  H  H      . LYS B  1 257 ? 19.145  -7.881  9.773   1.00 81.08  ? 256 LYS B H      1 
ATOM   9621  H  HA     . LYS B  1 257 ? 18.449  -9.521  11.722  1.00 79.44  ? 256 LYS B HA     1 
ATOM   9622  H  HB2    . LYS B  1 257 ? 18.976  -7.498  12.483  1.00 92.17  ? 256 LYS B HB2    1 
ATOM   9623  H  HB3    . LYS B  1 257 ? 18.152  -6.755  11.350  1.00 92.17  ? 256 LYS B HB3    1 
ATOM   9624  H  HG2    . LYS B  1 257 ? 16.185  -7.148  12.438  1.00 100.40 ? 256 LYS B HG2    1 
ATOM   9625  H  HG3    . LYS B  1 257 ? 16.912  -8.088  13.498  1.00 100.40 ? 256 LYS B HG3    1 
ATOM   9626  H  HD2    . LYS B  1 257 ? 17.982  -6.298  14.440  1.00 116.92 ? 256 LYS B HD2    1 
ATOM   9627  H  HD3    . LYS B  1 257 ? 17.474  -5.331  13.283  1.00 116.92 ? 256 LYS B HD3    1 
ATOM   9628  H  HE2    . LYS B  1 257 ? 15.314  -5.465  14.070  1.00 139.49 ? 256 LYS B HE2    1 
ATOM   9629  H  HE3    . LYS B  1 257 ? 15.753  -6.531  15.167  1.00 139.49 ? 256 LYS B HE3    1 
ATOM   9630  H  HZ1    . LYS B  1 257 ? 15.572  -4.463  16.093  1.00 150.85 ? 256 LYS B HZ1    1 
ATOM   9631  H  HZ2    . LYS B  1 257 ? 16.955  -4.885  16.181  1.00 150.85 ? 256 LYS B HZ2    1 
ATOM   9632  H  HZ3    . LYS B  1 257 ? 16.555  -3.915  15.181  1.00 150.85 ? 256 LYS B HZ3    1 
ATOM   9633  N  N      . LYS B  1 258 ? 16.158  -8.670  9.685   1.00 83.88  ? 257 LYS B N      1 
ATOM   9634  C  CA     . LYS B  1 258 ? 14.779  -8.920  9.276   1.00 82.80  ? 257 LYS B CA     1 
ATOM   9635  C  C      . LYS B  1 258 ? 14.581  -10.366 8.825   1.00 81.35  ? 257 LYS B C      1 
ATOM   9636  O  O      . LYS B  1 258 ? 13.494  -10.926 8.969   1.00 86.52  ? 257 LYS B O      1 
ATOM   9637  C  CB     . LYS B  1 258 ? 14.379  -7.964  8.147   1.00 80.32  ? 257 LYS B CB     1 
ATOM   9638  C  CG     . LYS B  1 258 ? 14.311  -6.501  8.560   1.00 65.89  ? 257 LYS B CG     1 
ATOM   9639  C  CD     . LYS B  1 258 ? 13.180  -6.246  9.545   1.00 94.25  ? 257 LYS B CD     1 
ATOM   9640  C  CE     . LYS B  1 258 ? 13.203  -4.818  10.069  1.00 111.07 ? 257 LYS B CE     1 
ATOM   9641  N  NZ     . LYS B  1 258 ? 13.058  -3.811  8.981   1.00 115.47 ? 257 LYS B NZ     1 
ATOM   9642  H  H      . LYS B  1 258 ? 16.609  -8.196  9.127   1.00 100.65 ? 257 LYS B H      1 
ATOM   9643  H  HA     . LYS B  1 258 ? 14.185  -8.755  10.038  1.00 99.36  ? 257 LYS B HA     1 
ATOM   9644  H  HB2    . LYS B  1 258 ? 15.029  -8.039  7.431   1.00 96.39  ? 257 LYS B HB2    1 
ATOM   9645  H  HB3    . LYS B  1 258 ? 13.502  -8.219  7.820   1.00 96.39  ? 257 LYS B HB3    1 
ATOM   9646  H  HG2    . LYS B  1 258 ? 15.146  -6.250  8.985   1.00 79.07  ? 257 LYS B HG2    1 
ATOM   9647  H  HG3    . LYS B  1 258 ? 14.158  -5.954  7.773   1.00 79.07  ? 257 LYS B HG3    1 
ATOM   9648  H  HD2    . LYS B  1 258 ? 12.330  -6.393  9.101   1.00 113.11 ? 257 LYS B HD2    1 
ATOM   9649  H  HD3    . LYS B  1 258 ? 13.272  -6.848  10.300  1.00 113.11 ? 257 LYS B HD3    1 
ATOM   9650  H  HE2    . LYS B  1 258 ? 12.468  -4.696  10.691  1.00 133.29 ? 257 LYS B HE2    1 
ATOM   9651  H  HE3    . LYS B  1 258 ? 14.048  -4.658  10.517  1.00 133.29 ? 257 LYS B HE3    1 
ATOM   9652  H  HZ1    . LYS B  1 258 ? 13.076  -2.990  9.323   1.00 138.57 ? 257 LYS B HZ1    1 
ATOM   9653  H  HZ2    . LYS B  1 258 ? 13.725  -3.896  8.398   1.00 138.57 ? 257 LYS B HZ2    1 
ATOM   9654  H  HZ3    . LYS B  1 258 ? 12.286  -3.931  8.557   1.00 138.57 ? 257 LYS B HZ3    1 
ATOM   9655  N  N      . CYS B  1 259 ? 15.635  -10.966 8.283   1.00 69.55  ? 258 CYS B N      1 
ATOM   9656  C  CA     . CYS B  1 259 ? 15.559  -12.333 7.781   1.00 85.81  ? 258 CYS B CA     1 
ATOM   9657  C  C      . CYS B  1 259 ? 15.621  -13.336 8.921   1.00 75.11  ? 258 CYS B C      1 
ATOM   9658  O  O      . CYS B  1 259 ? 14.902  -14.336 8.929   1.00 62.79  ? 258 CYS B O      1 
ATOM   9659  C  CB     . CYS B  1 259 ? 16.709  -12.608 6.810   1.00 86.27  ? 258 CYS B CB     1 
ATOM   9660  S  SG     . CYS B  1 259 ? 16.705  -11.577 5.339   1.00 77.62  ? 258 CYS B SG     1 
ATOM   9661  H  H      . CYS B  1 259 ? 16.409  -10.603 8.194   1.00 83.46  ? 258 CYS B H      1 
ATOM   9662  H  HA     . CYS B  1 259 ? 14.713  -12.458 7.303   1.00 102.97 ? 258 CYS B HA     1 
ATOM   9663  H  HB2    . CYS B  1 259 ? 17.548  -12.457 7.273   1.00 103.52 ? 258 CYS B HB2    1 
ATOM   9664  H  HB3    . CYS B  1 259 ? 16.657  -13.533 6.522   1.00 103.52 ? 258 CYS B HB3    1 
ATOM   9665  H  HG     . CYS B  1 259 ? 16.787  -10.426 5.668   1.00 93.14  ? 258 CYS B HG     1 
ATOM   9666  N  N      . LEU B  1 260 ? 16.489  -13.061 9.886   1.00 70.22  ? 259 LEU B N      1 
ATOM   9667  C  CA     . LEU B  1 260 ? 16.746  -13.997 10.967  1.00 78.48  ? 259 LEU B CA     1 
ATOM   9668  C  C      . LEU B  1 260 ? 15.807  -13.773 12.153  1.00 77.59  ? 259 LEU B C      1 
ATOM   9669  O  O      . LEU B  1 260 ? 16.240  -13.715 13.302  1.00 79.84  ? 259 LEU B O      1 
ATOM   9670  C  CB     . LEU B  1 260 ? 18.209  -13.896 11.396  1.00 63.47  ? 259 LEU B CB     1 
ATOM   9671  C  CG     . LEU B  1 260 ? 19.178  -14.001 10.216  1.00 48.76  ? 259 LEU B CG     1 
ATOM   9672  C  CD1    . LEU B  1 260 ? 20.622  -14.009 10.687  1.00 68.05  ? 259 LEU B CD1    1 
ATOM   9673  C  CD2    . LEU B  1 260 ? 18.881  -15.245 9.403   1.00 56.85  ? 259 LEU B CD2    1 
ATOM   9674  H  H      . LEU B  1 260 ? 16.944  -12.333 9.937   1.00 84.26  ? 259 LEU B H      1 
ATOM   9675  H  HA     . LEU B  1 260 ? 16.595  -14.907 10.636  1.00 94.18  ? 259 LEU B HA     1 
ATOM   9676  H  HB2    . LEU B  1 260 ? 18.353  -13.039 11.827  1.00 76.16  ? 259 LEU B HB2    1 
ATOM   9677  H  HB3    . LEU B  1 260 ? 18.408  -14.617 12.013  1.00 76.16  ? 259 LEU B HB3    1 
ATOM   9678  H  HG     . LEU B  1 260 ? 19.056  -13.231 9.638   1.00 58.52  ? 259 LEU B HG     1 
ATOM   9679  H  HD11   . LEU B  1 260 ? 21.200  -14.075 9.923   1.00 81.66  ? 259 LEU B HD11   1 
ATOM   9680  H  HD12   . LEU B  1 260 ? 20.800  -13.193 11.162  1.00 81.66  ? 259 LEU B HD12   1 
ATOM   9681  H  HD13   . LEU B  1 260 ? 20.757  -14.762 11.267  1.00 81.66  ? 259 LEU B HD13   1 
ATOM   9682  H  HD21   . LEU B  1 260 ? 19.498  -15.293 8.669   1.00 68.22  ? 259 LEU B HD21   1 
ATOM   9683  H  HD22   . LEU B  1 260 ? 18.980  -16.016 9.966   1.00 68.22  ? 259 LEU B HD22   1 
ATOM   9684  H  HD23   . LEU B  1 260 ? 17.981  -15.194 9.072   1.00 68.22  ? 259 LEU B HD23   1 
ATOM   9685  N  N      . VAL B  1 261 ? 14.517  -13.654 11.855  1.00 68.10  ? 260 VAL B N      1 
ATOM   9686  C  CA     . VAL B  1 261 ? 13.480  -13.611 12.877  1.00 61.82  ? 260 VAL B CA     1 
ATOM   9687  C  C      . VAL B  1 261 ? 13.028  -15.039 13.178  1.00 77.52  ? 260 VAL B C      1 
ATOM   9688  O  O      . VAL B  1 261 ? 12.540  -15.740 12.292  1.00 89.18  ? 260 VAL B O      1 
ATOM   9689  C  CB     . VAL B  1 261 ? 12.278  -12.779 12.400  1.00 58.59  ? 260 VAL B CB     1 
ATOM   9690  C  CG1    . VAL B  1 261 ? 11.169  -12.793 13.433  1.00 84.02  ? 260 VAL B CG1    1 
ATOM   9691  C  CG2    . VAL B  1 261 ? 12.711  -11.358 12.109  1.00 75.48  ? 260 VAL B CG2    1 
ATOM   9692  H  H      . VAL B  1 261 ? 14.213  -13.596 11.053  1.00 81.73  ? 260 VAL B H      1 
ATOM   9693  H  HA     . VAL B  1 261 ? 13.837  -13.211 13.697  1.00 74.19  ? 260 VAL B HA     1 
ATOM   9694  H  HB     . VAL B  1 261 ? 11.927  -13.166 11.571  1.00 70.31  ? 260 VAL B HB     1 
ATOM   9695  H  HG11   . VAL B  1 261 ? 10.434  -12.267 13.109  1.00 100.82 ? 260 VAL B HG11   1 
ATOM   9696  H  HG12   . VAL B  1 261 ? 10.886  -13.699 13.575  1.00 100.82 ? 260 VAL B HG12   1 
ATOM   9697  H  HG13   . VAL B  1 261 ? 11.502  -12.421 14.253  1.00 100.82 ? 260 VAL B HG13   1 
ATOM   9698  H  HG21   . VAL B  1 261 ? 11.950  -10.854 11.813  1.00 90.57  ? 260 VAL B HG21   1 
ATOM   9699  H  HG22   . VAL B  1 261 ? 13.069  -10.970 12.911  1.00 90.57  ? 260 VAL B HG22   1 
ATOM   9700  H  HG23   . VAL B  1 261 ? 13.383  -11.370 11.423  1.00 90.57  ? 260 VAL B HG23   1 
ATOM   9701  N  N      . LYS B  1 262 ? 13.191  -15.468 14.426  1.00 96.40  ? 261 LYS B N      1 
ATOM   9702  C  CA     . LYS B  1 262 ? 12.953  -16.866 14.787  1.00 89.76  ? 261 LYS B CA     1 
ATOM   9703  C  C      . LYS B  1 262 ? 11.488  -17.280 14.634  1.00 79.67  ? 261 LYS B C      1 
ATOM   9704  O  O      . LYS B  1 262 ? 11.200  -18.418 14.270  1.00 67.59  ? 261 LYS B O      1 
ATOM   9705  C  CB     . LYS B  1 262 ? 13.458  -17.147 16.205  1.00 56.67  ? 261 LYS B CB     1 
ATOM   9706  C  CG     . LYS B  1 262 ? 14.957  -16.926 16.347  1.00 52.52  ? 261 LYS B CG     1 
ATOM   9707  C  CD     . LYS B  1 262 ? 15.463  -17.223 17.742  1.00 66.77  ? 261 LYS B CD     1 
ATOM   9708  C  CE     . LYS B  1 262 ? 15.377  -18.696 18.085  1.00 75.80  ? 261 LYS B CE     1 
ATOM   9709  N  NZ     . LYS B  1 262 ? 15.820  -18.939 19.485  1.00 84.25  ? 261 LYS B NZ     1 
ATOM   9710  H  H      . LYS B  1 262 ? 13.438  -14.972 15.083  1.00 115.69 ? 261 LYS B H      1 
ATOM   9711  H  HA     . LYS B  1 262 ? 13.475  -17.429 14.178  1.00 107.71 ? 261 LYS B HA     1 
ATOM   9712  H  HB2    . LYS B  1 262 ? 13.007  -16.553 16.825  1.00 68.00  ? 261 LYS B HB2    1 
ATOM   9713  H  HB3    . LYS B  1 262 ? 13.268  -18.071 16.431  1.00 68.00  ? 261 LYS B HB3    1 
ATOM   9714  H  HG2    . LYS B  1 262 ? 15.423  -17.510 15.728  1.00 63.03  ? 261 LYS B HG2    1 
ATOM   9715  H  HG3    . LYS B  1 262 ? 15.160  -15.999 16.145  1.00 63.03  ? 261 LYS B HG3    1 
ATOM   9716  H  HD2    . LYS B  1 262 ? 16.392  -16.952 17.807  1.00 80.12  ? 261 LYS B HD2    1 
ATOM   9717  H  HD3    . LYS B  1 262 ? 14.927  -16.733 18.385  1.00 80.12  ? 261 LYS B HD3    1 
ATOM   9718  H  HE2    . LYS B  1 262 ? 14.458  -18.995 17.998  1.00 90.96  ? 261 LYS B HE2    1 
ATOM   9719  H  HE3    . LYS B  1 262 ? 15.954  -19.200 17.489  1.00 90.96  ? 261 LYS B HE3    1 
ATOM   9720  H  HZ1    . LYS B  1 262 ? 15.766  -19.807 19.675  1.00 101.10 ? 261 LYS B HZ1    1 
ATOM   9721  H  HZ2    . LYS B  1 262 ? 16.664  -18.673 19.588  1.00 101.10 ? 261 LYS B HZ2    1 
ATOM   9722  H  HZ3    . LYS B  1 262 ? 15.303  -18.486 20.051  1.00 101.10 ? 261 LYS B HZ3    1 
ATOM   9723  N  N      . ASN B  1 263 ? 10.567  -16.360 14.900  1.00 73.45  ? 262 ASN B N      1 
ATOM   9724  C  CA     . ASN B  1 263 ? 9.155   -16.625 14.650  1.00 72.32  ? 262 ASN B CA     1 
ATOM   9725  C  C      . ASN B  1 263 ? 8.835   -16.474 13.163  1.00 92.88  ? 262 ASN B C      1 
ATOM   9726  O  O      . ASN B  1 263 ? 8.955   -15.381 12.608  1.00 87.07  ? 262 ASN B O      1 
ATOM   9727  C  CB     . ASN B  1 263 ? 8.275   -15.688 15.475  1.00 81.93  ? 262 ASN B CB     1 
ATOM   9728  C  CG     . ASN B  1 263 ? 8.298   -16.022 16.954  1.00 144.38 ? 262 ASN B CG     1 
ATOM   9729  O  OD1    . ASN B  1 263 ? 8.620   -17.145 17.343  1.00 167.02 ? 262 ASN B OD1    1 
ATOM   9730  N  ND2    . ASN B  1 263 ? 7.952   -15.049 17.787  1.00 161.08 ? 262 ASN B ND2    1 
ATOM   9731  H  H      . ASN B  1 263 ? 10.731  -15.581 15.224  1.00 88.14  ? 262 ASN B H      1 
ATOM   9732  H  HA     . ASN B  1 263 ? 8.950   -17.546 14.913  1.00 86.79  ? 262 ASN B HA     1 
ATOM   9733  H  HB2    . ASN B  1 263 ? 8.593   -14.778 15.368  1.00 98.31  ? 262 ASN B HB2    1 
ATOM   9734  H  HB3    . ASN B  1 263 ? 7.358   -15.759 15.166  1.00 98.31  ? 262 ASN B HB3    1 
ATOM   9735  H  HD21   . ASN B  1 263 ? 7.730   -14.277 17.479  1.00 193.30 ? 262 ASN B HD21   1 
ATOM   9736  H  HD22   . ASN B  1 263 ? 7.949   -15.189 18.635  1.00 193.30 ? 262 ASN B HD22   1 
ATOM   9737  N  N      . PRO B  1 264 ? 8.432   -17.576 12.509  1.00 94.68  ? 263 PRO B N      1 
ATOM   9738  C  CA     . PRO B  1 264 ? 8.130   -17.527 11.073  1.00 112.72 ? 263 PRO B CA     1 
ATOM   9739  C  C      . PRO B  1 264 ? 6.926   -16.646 10.746  1.00 120.51 ? 263 PRO B C      1 
ATOM   9740  O  O      . PRO B  1 264 ? 6.724   -16.299 9.581   1.00 127.29 ? 263 PRO B O      1 
ATOM   9741  C  CB     . PRO B  1 264 ? 7.841   -18.991 10.723  1.00 109.44 ? 263 PRO B CB     1 
ATOM   9742  C  CG     . PRO B  1 264 ? 7.447   -19.623 12.006  1.00 105.37 ? 263 PRO B CG     1 
ATOM   9743  C  CD     . PRO B  1 264 ? 8.242   -18.926 13.064  1.00 95.11  ? 263 PRO B CD     1 
ATOM   9744  H  HA     . PRO B  1 264 ? 8.911   -17.218 10.568  1.00 135.26 ? 263 PRO B HA     1 
ATOM   9745  H  HB2    . PRO B  1 264 ? 7.115   -19.037 10.081  1.00 131.33 ? 263 PRO B HB2    1 
ATOM   9746  H  HB3    . PRO B  1 264 ? 8.641   -19.407 10.367  1.00 131.33 ? 263 PRO B HB3    1 
ATOM   9747  H  HG2    . PRO B  1 264 ? 6.497   -19.495 12.153  1.00 126.44 ? 263 PRO B HG2    1 
ATOM   9748  H  HG3    . PRO B  1 264 ? 7.664   -20.568 11.983  1.00 126.44 ? 263 PRO B HG3    1 
ATOM   9749  H  HD2    . PRO B  1 264 ? 7.739   -18.884 13.893  1.00 114.13 ? 263 PRO B HD2    1 
ATOM   9750  H  HD3    . PRO B  1 264 ? 9.098   -19.365 13.189  1.00 114.13 ? 263 PRO B HD3    1 
ATOM   9751  N  N      . GLU B  1 265 ? 6.142   -16.287 11.758  1.00 112.94 ? 264 GLU B N      1 
ATOM   9752  C  CA     . GLU B  1 265 ? 4.997   -15.406 11.556  1.00 107.61 ? 264 GLU B CA     1 
ATOM   9753  C  C      . GLU B  1 265 ? 5.459   -13.953 11.513  1.00 100.87 ? 264 GLU B C      1 
ATOM   9754  O  O      . GLU B  1 265 ? 4.823   -13.108 10.883  1.00 112.59 ? 264 GLU B O      1 
ATOM   9755  C  CB     . GLU B  1 265 ? 3.960   -15.587 12.667  1.00 123.79 ? 264 GLU B CB     1 
ATOM   9756  C  CG     . GLU B  1 265 ? 3.566   -17.034 12.931  1.00 141.57 ? 264 GLU B CG     1 
ATOM   9757  C  CD     . GLU B  1 265 ? 4.479   -17.720 13.932  1.00 150.01 ? 264 GLU B CD     1 
ATOM   9758  O  OE1    . GLU B  1 265 ? 5.313   -17.027 14.555  1.00 132.22 ? 264 GLU B OE1    1 
ATOM   9759  O  OE2    . GLU B  1 265 ? 4.361   -18.953 14.095  1.00 165.85 ? 264 GLU B OE2    1 
ATOM   9760  H  H      . GLU B  1 265 ? 6.252   -16.541 12.573  1.00 135.53 ? 264 GLU B H      1 
ATOM   9761  H  HA     . GLU B  1 265 ? 4.571   -15.620 10.700  1.00 129.14 ? 264 GLU B HA     1 
ATOM   9762  H  HB2    . GLU B  1 265 ? 4.322   -15.225 13.491  1.00 148.55 ? 264 GLU B HB2    1 
ATOM   9763  H  HB3    . GLU B  1 265 ? 3.156   -15.103 12.423  1.00 148.55 ? 264 GLU B HB3    1 
ATOM   9764  H  HG2    . GLU B  1 265 ? 2.663   -17.055 13.286  1.00 169.88 ? 264 GLU B HG2    1 
ATOM   9765  H  HG3    . GLU B  1 265 ? 3.608   -17.530 12.099  1.00 169.88 ? 264 GLU B HG3    1 
ATOM   9766  N  N      . GLN B  1 266 ? 6.570   -13.673 12.188  1.00 104.18 ? 265 GLN B N      1 
ATOM   9767  C  CA     . GLN B  1 266 ? 7.133   -12.327 12.230  1.00 108.13 ? 265 GLN B CA     1 
ATOM   9768  C  C      . GLN B  1 266 ? 8.179   -12.124 11.142  1.00 84.56  ? 265 GLN B C      1 
ATOM   9769  O  O      . GLN B  1 266 ? 8.601   -10.998 10.882  1.00 81.06  ? 265 GLN B O      1 
ATOM   9770  C  CB     . GLN B  1 266 ? 7.776   -12.063 13.592  1.00 124.66 ? 265 GLN B CB     1 
ATOM   9771  C  CG     . GLN B  1 266 ? 6.798   -11.951 14.749  1.00 128.69 ? 265 GLN B CG     1 
ATOM   9772  C  CD     . GLN B  1 266 ? 7.502   -11.783 16.084  1.00 139.81 ? 265 GLN B CD     1 
ATOM   9773  O  OE1    . GLN B  1 266 ? 8.732   -11.781 16.151  1.00 131.05 ? 265 GLN B OE1    1 
ATOM   9774  N  NE2    . GLN B  1 266 ? 6.726   -11.642 17.153  1.00 151.79 ? 265 GLN B NE2    1 
ATOM   9775  H  H      . GLN B  1 266 ? 7.022   -14.252 12.634  1.00 125.02 ? 265 GLN B H      1 
ATOM   9776  H  HA     . GLN B  1 266 ? 6.416   -11.672 12.095  1.00 129.75 ? 265 GLN B HA     1 
ATOM   9777  H  HB2    . GLN B  1 266 ? 8.385   -12.792 13.793  1.00 149.59 ? 265 GLN B HB2    1 
ATOM   9778  H  HB3    . GLN B  1 266 ? 8.270   -11.230 13.544  1.00 149.59 ? 265 GLN B HB3    1 
ATOM   9779  H  HG2    . GLN B  1 266 ? 6.228   -11.178 14.610  1.00 154.43 ? 265 GLN B HG2    1 
ATOM   9780  H  HG3    . GLN B  1 266 ? 6.261   -12.757 14.791  1.00 154.43 ? 265 GLN B HG3    1 
ATOM   9781  H  HE21   . GLN B  1 266 ? 5.870   -11.648 17.067  1.00 182.15 ? 265 GLN B HE21   1 
ATOM   9782  H  HE22   . GLN B  1 266 ? 7.079   -11.543 17.931  1.00 182.15 ? 265 GLN B HE22   1 
ATOM   9783  N  N      . ARG B  1 267 ? 8.603   -13.214 10.511  1.00 99.84  ? 266 ARG B N      1 
ATOM   9784  C  CA     . ARG B  1 267 ? 9.648   -13.148 9.499   1.00 90.20  ? 266 ARG B CA     1 
ATOM   9785  C  C      . ARG B  1 267 ? 9.115   -12.529 8.212   1.00 91.15  ? 266 ARG B C      1 
ATOM   9786  O  O      . ARG B  1 267 ? 7.966   -12.757 7.833   1.00 100.69 ? 266 ARG B O      1 
ATOM   9787  C  CB     . ARG B  1 267 ? 10.196  -14.544 9.221   1.00 82.23  ? 266 ARG B CB     1 
ATOM   9788  C  CG     . ARG B  1 267 ? 11.558  -14.557 8.554   1.00 71.33  ? 266 ARG B CG     1 
ATOM   9789  C  CD     . ARG B  1 267 ? 12.078  -15.977 8.435   1.00 72.77  ? 266 ARG B CD     1 
ATOM   9790  N  NE     . ARG B  1 267 ? 12.114  -16.646 9.732   1.00 79.57  ? 266 ARG B NE     1 
ATOM   9791  C  CZ     . ARG B  1 267 ? 12.263  -17.956 9.900   1.00 94.86  ? 266 ARG B CZ     1 
ATOM   9792  N  NH1    . ARG B  1 267 ? 12.281  -18.468 11.121  1.00 100.85 ? 266 ARG B NH1    1 
ATOM   9793  N  NH2    . ARG B  1 267 ? 12.388  -18.758 8.851   1.00 109.64 ? 266 ARG B NH2    1 
ATOM   9794  H  H      . ARG B  1 267 ? 8.299   -14.006 10.653  1.00 119.81 ? 266 ARG B H      1 
ATOM   9795  H  HA     . ARG B  1 267 ? 10.383  -12.589 9.828   1.00 108.24 ? 266 ARG B HA     1 
ATOM   9796  H  HB2    . ARG B  1 267 ? 10.276  -15.020 10.063  1.00 98.68  ? 266 ARG B HB2    1 
ATOM   9797  H  HB3    . ARG B  1 267 ? 9.577   -15.011 8.638   1.00 98.68  ? 266 ARG B HB3    1 
ATOM   9798  H  HG2    . ARG B  1 267 ? 11.484  -14.182 7.662   1.00 85.60  ? 266 ARG B HG2    1 
ATOM   9799  H  HG3    . ARG B  1 267 ? 12.184  -14.044 9.087   1.00 85.60  ? 266 ARG B HG3    1 
ATOM   9800  H  HD2    . ARG B  1 267 ? 11.495  -16.483 7.848   1.00 87.32  ? 266 ARG B HD2    1 
ATOM   9801  H  HD3    . ARG B  1 267 ? 12.980  -15.958 8.078   1.00 87.32  ? 266 ARG B HD3    1 
ATOM   9802  H  HE     . ARG B  1 267 ? 12.033  -16.159 10.436  1.00 95.49  ? 266 ARG B HE     1 
ATOM   9803  H  HH11   . ARG B  1 267 ? 12.199  -17.953 11.805  1.00 121.02 ? 266 ARG B HH11   1 
ATOM   9804  H  HH12   . ARG B  1 267 ? 12.376  -19.316 11.230  1.00 121.02 ? 266 ARG B HH12   1 
ATOM   9805  H  HH21   . ARG B  1 267 ? 12.376  -18.431 8.056   1.00 131.57 ? 266 ARG B HH21   1 
ATOM   9806  H  HH22   . ARG B  1 267 ? 12.484  -19.605 8.966   1.00 131.57 ? 266 ARG B HH22   1 
ATOM   9807  N  N      . ALA B  1 268 ? 9.959   -11.747 7.546   1.00 87.17  ? 267 ALA B N      1 
ATOM   9808  C  CA     . ALA B  1 268 ? 9.568   -11.047 6.326   1.00 79.64  ? 267 ALA B CA     1 
ATOM   9809  C  C      . ALA B  1 268 ? 9.420   -11.991 5.139   1.00 83.77  ? 267 ALA B C      1 
ATOM   9810  O  O      . ALA B  1 268 ? 10.160  -12.967 5.009   1.00 81.70  ? 267 ALA B O      1 
ATOM   9811  C  CB     . ALA B  1 268 ? 10.585  -9.973  6.002   1.00 74.07  ? 267 ALA B CB     1 
ATOM   9812  H  H      . ALA B  1 268 ? 10.773  -11.604 7.784   1.00 104.61 ? 267 ALA B H      1 
ATOM   9813  H  HA     . ALA B  1 268 ? 8.704   -10.609 6.474   1.00 95.57  ? 267 ALA B HA     1 
ATOM   9814  H  HB1    . ALA B  1 268 ? 10.317  -9.521  5.199   1.00 88.88  ? 267 ALA B HB1    1 
ATOM   9815  H  HB2    . ALA B  1 268 ? 10.625  -9.350  6.731   1.00 88.88  ? 267 ALA B HB2    1 
ATOM   9816  H  HB3    . ALA B  1 268 ? 11.444  -10.384 5.876   1.00 88.88  ? 267 ALA B HB3    1 
ATOM   9817  N  N      . THR B  1 269 ? 8.458   -11.692 4.271   1.00 78.61  ? 268 THR B N      1 
ATOM   9818  C  CA     . THR B  1 269 ? 8.311   -12.422 3.018   1.00 91.21  ? 268 THR B CA     1 
ATOM   9819  C  C      . THR B  1 269 ? 9.280   -11.849 1.987   1.00 93.48  ? 268 THR B C      1 
ATOM   9820  O  O      . THR B  1 269 ? 9.755   -10.721 2.131   1.00 88.63  ? 268 THR B O      1 
ATOM   9821  C  CB     . THR B  1 269 ? 6.869   -12.341 2.465   1.00 84.10  ? 268 THR B CB     1 
ATOM   9822  O  OG1    . THR B  1 269 ? 6.562   -10.993 2.089   1.00 85.36  ? 268 THR B OG1    1 
ATOM   9823  C  CG2    . THR B  1 269 ? 5.863   -12.825 3.501   1.00 83.15  ? 268 THR B CG2    1 
ATOM   9824  H  H      . THR B  1 269 ? 7.877   -11.069 4.386   1.00 94.34  ? 268 THR B H      1 
ATOM   9825  H  HA     . THR B  1 269 ? 8.534   -13.365 3.162   1.00 109.45 ? 268 THR B HA     1 
ATOM   9826  H  HB     . THR B  1 269 ? 6.796   -12.913 1.684   1.00 100.92 ? 268 THR B HB     1 
ATOM   9827  H  HG1    . THR B  1 269 ? 6.625   -10.499 2.741   1.00 102.43 ? 268 THR B HG1    1 
ATOM   9828  H  HG21   . THR B  1 269 ? 4.973   -12.769 3.145   1.00 99.78  ? 268 THR B HG21   1 
ATOM   9829  H  HG22   . THR B  1 269 ? 6.048   -13.736 3.738   1.00 99.78  ? 268 THR B HG22   1 
ATOM   9830  H  HG23   . THR B  1 269 ? 5.917   -12.280 4.290   1.00 99.78  ? 268 THR B HG23   1 
ATOM   9831  N  N      . ALA B  1 270 ? 9.581   -12.629 0.955   1.00 88.49  ? 269 ALA B N      1 
ATOM   9832  C  CA     . ALA B  1 270 ? 10.500  -12.186 -0.087  1.00 91.85  ? 269 ALA B CA     1 
ATOM   9833  C  C      . ALA B  1 270 ? 9.980   -10.913 -0.746  1.00 88.47  ? 269 ALA B C      1 
ATOM   9834  O  O      . ALA B  1 270 ? 10.747  -9.992  -1.032  1.00 90.12  ? 269 ALA B O      1 
ATOM   9835  C  CB     . ALA B  1 270 ? 10.688  -13.278 -1.125  1.00 99.48  ? 269 ALA B CB     1 
ATOM   9836  H  H      . ALA B  1 270 ? 9.267   -13.421 0.835   1.00 106.19 ? 269 ALA B H      1 
ATOM   9837  H  HA     . ALA B  1 270 ? 11.372  -11.990 0.313   1.00 110.22 ? 269 ALA B HA     1 
ATOM   9838  H  HB1    . ALA B  1 270 ? 11.295  -12.966 -1.800  1.00 119.38 ? 269 ALA B HB1    1 
ATOM   9839  H  HB2    . ALA B  1 270 ? 11.048  -14.058 -0.695  1.00 119.38 ? 269 ALA B HB2    1 
ATOM   9840  H  HB3    . ALA B  1 270 ? 9.837   -13.485 -1.519  1.00 119.38 ? 269 ALA B HB3    1 
ATOM   9841  N  N      . THR B  1 271 ? 8.673   -10.870 -0.984  1.00 82.17  ? 270 THR B N      1 
ATOM   9842  C  CA     . THR B  1 271 ? 8.036   -9.715  -1.608  1.00 80.26  ? 270 THR B CA     1 
ATOM   9843  C  C      . THR B  1 271 ? 8.396   -8.431  -0.873  1.00 77.18  ? 270 THR B C      1 
ATOM   9844  O  O      . THR B  1 271 ? 8.674   -7.403  -1.492  1.00 95.23  ? 270 THR B O      1 
ATOM   9845  C  CB     . THR B  1 271 ? 6.500   -9.864  -1.616  1.00 85.99  ? 270 THR B CB     1 
ATOM   9846  O  OG1    . THR B  1 271 ? 6.137   -11.084 -2.275  1.00 98.56  ? 270 THR B OG1    1 
ATOM   9847  C  CG2    . THR B  1 271 ? 5.845   -8.686  -2.326  1.00 74.46  ? 270 THR B CG2    1 
ATOM   9848  H  H      . THR B  1 271 ? 8.126   -11.506 -0.791  1.00 98.60  ? 270 THR B H      1 
ATOM   9849  H  HA     . THR B  1 271 ? 8.343   -9.637  -2.536  1.00 96.31  ? 270 THR B HA     1 
ATOM   9850  H  HB     . THR B  1 271 ? 6.177   -9.886  -0.702  1.00 103.19 ? 270 THR B HB     1 
ATOM   9851  H  HG1    . THR B  1 271 ? 5.321   -11.168 -2.281  1.00 118.27 ? 270 THR B HG1    1 
ATOM   9852  H  HG21   . THR B  1 271 ? 4.891   -8.791  -2.323  1.00 89.36  ? 270 THR B HG21   1 
ATOM   9853  H  HG22   . THR B  1 271 ? 6.070   -7.867  -1.878  1.00 89.36  ? 270 THR B HG22   1 
ATOM   9854  H  HG23   . THR B  1 271 ? 6.152   -8.639  -3.234  1.00 89.36  ? 270 THR B HG23   1 
ATOM   9855  N  N      . GLN B  1 272 ? 8.394   -8.500  0.452   1.00 73.84  ? 271 GLN B N      1 
ATOM   9856  C  CA     . GLN B  1 272 ? 8.672   -7.336  1.282   1.00 67.91  ? 271 GLN B CA     1 
ATOM   9857  C  C      . GLN B  1 272 ? 10.159  -6.999  1.299   1.00 75.57  ? 271 GLN B C      1 
ATOM   9858  O  O      . GLN B  1 272 ? 10.537  -5.835  1.194   1.00 87.87  ? 271 GLN B O      1 
ATOM   9859  C  CB     . GLN B  1 272 ? 8.179   -7.582  2.706   1.00 70.90  ? 271 GLN B CB     1 
ATOM   9860  C  CG     . GLN B  1 272 ? 6.669   -7.693  2.817   1.00 95.74  ? 271 GLN B CG     1 
ATOM   9861  C  CD     . GLN B  1 272 ? 6.221   -8.129  4.196   1.00 99.08  ? 271 GLN B CD     1 
ATOM   9862  O  OE1    . GLN B  1 272 ? 6.729   -9.107  4.743   1.00 90.77  ? 271 GLN B OE1    1 
ATOM   9863  N  NE2    . GLN B  1 272 ? 5.270   -7.399  4.769   1.00 112.10 ? 271 GLN B NE2    1 
ATOM   9864  H  H      . GLN B  1 272 ? 8.232   -9.216  0.899   1.00 88.61  ? 271 GLN B H      1 
ATOM   9865  H  HA     . GLN B  1 272 ? 8.190   -6.563  0.922   1.00 81.50  ? 271 GLN B HA     1 
ATOM   9866  H  HB2    . GLN B  1 272 ? 8.562   -8.412  3.031   1.00 85.07  ? 271 GLN B HB2    1 
ATOM   9867  H  HB3    . GLN B  1 272 ? 8.465   -6.845  3.268   1.00 85.07  ? 271 GLN B HB3    1 
ATOM   9868  H  HG2    . GLN B  1 272 ? 6.274   -6.827  2.632   1.00 114.89 ? 271 GLN B HG2    1 
ATOM   9869  H  HG3    . GLN B  1 272 ? 6.351   -8.348  2.176   1.00 114.89 ? 271 GLN B HG3    1 
ATOM   9870  H  HE21   . GLN B  1 272 ? 4.943   -6.719  4.357   1.00 134.52 ? 271 GLN B HE21   1 
ATOM   9871  H  HE22   . GLN B  1 272 ? 4.982   -7.607  5.552   1.00 134.52 ? 271 GLN B HE22   1 
ATOM   9872  N  N      . LEU B  1 273 ? 11.001  -8.017  1.428   1.00 79.82  ? 272 LEU B N      1 
ATOM   9873  C  CA     . LEU B  1 273 ? 12.441  -7.800  1.513   1.00 85.07  ? 272 LEU B CA     1 
ATOM   9874  C  C      . LEU B  1 273 ? 13.009  -7.106  0.272   1.00 93.64  ? 272 LEU B C      1 
ATOM   9875  O  O      . LEU B  1 273 ? 14.108  -6.553  0.317   1.00 100.15 ? 272 LEU B O      1 
ATOM   9876  C  CB     . LEU B  1 273 ? 13.165  -9.124  1.764   1.00 77.63  ? 272 LEU B CB     1 
ATOM   9877  C  CG     . LEU B  1 273 ? 13.073  -9.631  3.204   1.00 79.12  ? 272 LEU B CG     1 
ATOM   9878  C  CD1    . LEU B  1 273 ? 13.591  -11.052 3.308   1.00 89.30  ? 272 LEU B CD1    1 
ATOM   9879  C  CD2    . LEU B  1 273 ? 13.845  -8.716  4.144   1.00 88.48  ? 272 LEU B CD2    1 
ATOM   9880  H  H      . LEU B  1 273 ? 10.765  -8.843  1.469   1.00 95.79  ? 272 LEU B H      1 
ATOM   9881  H  HA     . LEU B  1 273 ? 12.620  -7.218  2.281   1.00 102.08 ? 272 LEU B HA     1 
ATOM   9882  H  HB2    . LEU B  1 273 ? 12.780  -9.802  1.187   1.00 93.15  ? 272 LEU B HB2    1 
ATOM   9883  H  HB3    . LEU B  1 273 ? 14.104  -9.009  1.551   1.00 93.15  ? 272 LEU B HB3    1 
ATOM   9884  H  HG     . LEU B  1 273 ? 12.143  -9.629  3.480   1.00 94.94  ? 272 LEU B HG     1 
ATOM   9885  H  HD11   . LEU B  1 273 ? 13.521  -11.343 4.220   1.00 107.16 ? 272 LEU B HD11   1 
ATOM   9886  H  HD12   . LEU B  1 273 ? 13.062  -11.619 2.742   1.00 107.16 ? 272 LEU B HD12   1 
ATOM   9887  H  HD13   . LEU B  1 273 ? 14.508  -11.071 3.027   1.00 107.16 ? 272 LEU B HD13   1 
ATOM   9888  H  HD21   . LEU B  1 273 ? 13.772  -9.055  5.039   1.00 106.17 ? 272 LEU B HD21   1 
ATOM   9889  H  HD22   . LEU B  1 273 ? 14.766  -8.697  3.875   1.00 106.17 ? 272 LEU B HD22   1 
ATOM   9890  H  HD23   . LEU B  1 273 ? 13.471  -7.833  4.097   1.00 106.17 ? 272 LEU B HD23   1 
ATOM   9891  N  N      . LEU B  1 274 ? 12.261  -7.130  -0.828  1.00 95.34  ? 273 LEU B N      1 
ATOM   9892  C  CA     . LEU B  1 274 ? 12.667  -6.417  -2.037  1.00 88.53  ? 273 LEU B CA     1 
ATOM   9893  C  C      . LEU B  1 274 ? 12.514  -4.906  -1.864  1.00 97.92  ? 273 LEU B C      1 
ATOM   9894  O  O      . LEU B  1 274 ? 13.095  -4.130  -2.620  1.00 105.71 ? 273 LEU B O      1 
ATOM   9895  C  CB     . LEU B  1 274 ? 11.841  -6.880  -3.238  1.00 71.20  ? 273 LEU B CB     1 
ATOM   9896  C  CG     . LEU B  1 274 ? 12.170  -8.261  -3.810  1.00 70.33  ? 273 LEU B CG     1 
ATOM   9897  C  CD1    . LEU B  1 274 ? 11.073  -8.711  -4.760  1.00 68.62  ? 273 LEU B CD1    1 
ATOM   9898  C  CD2    . LEU B  1 274 ? 13.521  -8.262  -4.521  1.00 42.35  ? 273 LEU B CD2    1 
ATOM   9899  H  H      . LEU B  1 274 ? 11.515  -7.551  -0.901  1.00 114.41 ? 273 LEU B H      1 
ATOM   9900  H  HA     . LEU B  1 274 ? 13.610  -6.609  -2.222  1.00 106.23 ? 273 LEU B HA     1 
ATOM   9901  H  HB2    . LEU B  1 274 ? 10.907  -6.895  -2.975  1.00 85.44  ? 273 LEU B HB2    1 
ATOM   9902  H  HB3    . LEU B  1 274 ? 11.962  -6.238  -3.954  1.00 85.44  ? 273 LEU B HB3    1 
ATOM   9903  H  HG     . LEU B  1 274 ? 12.215  -8.901  -3.082  1.00 84.40  ? 273 LEU B HG     1 
ATOM   9904  H  HD11   . LEU B  1 274 ? 11.297  -9.577  -5.108  1.00 82.34  ? 273 LEU B HD11   1 
ATOM   9905  H  HD12   . LEU B  1 274 ? 10.243  -8.755  -4.280  1.00 82.34  ? 273 LEU B HD12   1 
ATOM   9906  H  HD13   . LEU B  1 274 ? 11.003  -8.077  -5.478  1.00 82.34  ? 273 LEU B HD13   1 
ATOM   9907  H  HD21   . LEU B  1 274 ? 13.692  -9.142  -4.865  1.00 50.83  ? 273 LEU B HD21   1 
ATOM   9908  H  HD22   . LEU B  1 274 ? 13.495  -7.628  -5.241  1.00 50.83  ? 273 LEU B HD22   1 
ATOM   9909  H  HD23   . LEU B  1 274 ? 14.204  -8.017  -3.893  1.00 50.83  ? 273 LEU B HD23   1 
ATOM   9910  N  N      . GLN B  1 275 ? 11.731  -4.498  -0.866  1.00 93.13  ? 274 GLN B N      1 
ATOM   9911  C  CA     . GLN B  1 275 ? 11.467  -3.083  -0.612  1.00 82.29  ? 274 GLN B CA     1 
ATOM   9912  C  C      . GLN B  1 275 ? 12.426  -2.510  0.428   1.00 84.95  ? 274 GLN B C      1 
ATOM   9913  O  O      . GLN B  1 275 ? 12.534  -1.295  0.584   1.00 104.93 ? 274 GLN B O      1 
ATOM   9914  C  CB     . GLN B  1 275 ? 10.030  -2.894  -0.128  1.00 72.66  ? 274 GLN B CB     1 
ATOM   9915  C  CG     . GLN B  1 275 ? 8.999   -3.654  -0.941  1.00 88.99  ? 274 GLN B CG     1 
ATOM   9916  C  CD     . GLN B  1 275 ? 8.988   -3.246  -2.399  1.00 99.64  ? 274 GLN B CD     1 
ATOM   9917  O  OE1    . GLN B  1 275 ? 9.290   -2.102  -2.740  1.00 87.97  ? 274 GLN B OE1    1 
ATOM   9918  N  NE2    . GLN B  1 275 ? 8.644   -4.187  -3.271  1.00 115.79 ? 274 GLN B NE2    1 
ATOM   9919  H  H      . GLN B  1 275 ? 11.337  -5.029  -0.316  1.00 111.75 ? 274 GLN B H      1 
ATOM   9920  H  HA     . GLN B  1 275 ? 11.580  -2.579  -1.445  1.00 98.75  ? 274 GLN B HA     1 
ATOM   9921  H  HB2    . GLN B  1 275 ? 9.967   -3.201  0.790   1.00 87.19  ? 274 GLN B HB2    1 
ATOM   9922  H  HB3    . GLN B  1 275 ? 9.807   -1.951  -0.175  1.00 87.19  ? 274 GLN B HB3    1 
ATOM   9923  H  HG2    . GLN B  1 275 ? 9.198   -4.602  -0.896  1.00 106.79 ? 274 GLN B HG2    1 
ATOM   9924  H  HG3    . GLN B  1 275 ? 8.118   -3.482  -0.575  1.00 106.79 ? 274 GLN B HG3    1 
ATOM   9925  H  HE21   . GLN B  1 275 ? 8.443   -4.976  -2.995  1.00 138.95 ? 274 GLN B HE21   1 
ATOM   9926  H  HE22   . GLN B  1 275 ? 8.621   -4.007  -4.111  1.00 138.95 ? 274 GLN B HE22   1 
ATOM   9927  N  N      . HIS B  1 276 ? 13.108  -3.392  1.147   1.00 86.02  ? 275 HIS B N      1 
ATOM   9928  C  CA     . HIS B  1 276 ? 14.091  -2.982  2.140   1.00 81.94  ? 275 HIS B CA     1 
ATOM   9929  C  C      . HIS B  1 276 ? 15.225  -2.222  1.453   1.00 65.51  ? 275 HIS B C      1 
ATOM   9930  O  O      . HIS B  1 276 ? 15.751  -2.681  0.438   1.00 83.36  ? 275 HIS B O      1 
ATOM   9931  C  CB     . HIS B  1 276 ? 14.635  -4.224  2.846   1.00 95.52  ? 275 HIS B CB     1 
ATOM   9932  C  CG     . HIS B  1 276 ? 15.473  -3.923  4.047   1.00 80.97  ? 275 HIS B CG     1 
ATOM   9933  N  ND1    . HIS B  1 276 ? 16.736  -3.380  3.957   1.00 72.90  ? 275 HIS B ND1    1 
ATOM   9934  C  CD2    . HIS B  1 276 ? 15.235  -4.106  5.368   1.00 78.81  ? 275 HIS B CD2    1 
ATOM   9935  C  CE1    . HIS B  1 276 ? 17.237  -3.232  5.169   1.00 85.62  ? 275 HIS B CE1    1 
ATOM   9936  N  NE2    . HIS B  1 276 ? 16.347  -3.665  6.044   1.00 93.42  ? 275 HIS B NE2    1 
ATOM   9937  H  H      . HIS B  1 276 ? 13.019  -4.244  1.078   1.00 103.23 ? 275 HIS B H      1 
ATOM   9938  H  HA     . HIS B  1 276 ? 13.671  -2.396  2.804   1.00 98.33  ? 275 HIS B HA     1 
ATOM   9939  H  HB2    . HIS B  1 276 ? 13.888  -4.770  3.136   1.00 114.63 ? 275 HIS B HB2    1 
ATOM   9940  H  HB3    . HIS B  1 276 ? 15.183  -4.723  2.221   1.00 114.63 ? 275 HIS B HB3    1 
ATOM   9941  H  HD1    . HIS B  1 276 ? 17.134  -3.167  3.225   1.00 87.48  ? 275 HIS B HD1    1 
ATOM   9942  H  HD2    . HIS B  1 276 ? 14.462  -4.459  5.746   1.00 94.57  ? 275 HIS B HD2    1 
ATOM   9943  H  HE1    . HIS B  1 276 ? 18.075  -2.883  5.372   1.00 102.75 ? 275 HIS B HE1    1 
ATOM   9944  H  HE2    . HIS B  1 276 ? 16.447  -3.670  6.898   1.00 112.10 ? 275 HIS B HE2    1 
ATOM   9945  N  N      . PRO B  1 277 ? 15.601  -1.052  1.994   1.00 68.48  ? 276 PRO B N      1 
ATOM   9946  C  CA     . PRO B  1 277 ? 16.618  -0.193  1.371   1.00 72.83  ? 276 PRO B CA     1 
ATOM   9947  C  C      . PRO B  1 277 ? 17.827  -0.952  0.829   1.00 63.01  ? 276 PRO B C      1 
ATOM   9948  O  O      . PRO B  1 277 ? 18.120  -0.856  -0.360  1.00 97.13  ? 276 PRO B O      1 
ATOM   9949  C  CB     . PRO B  1 277 ? 17.049  0.744   2.513   1.00 62.71  ? 276 PRO B CB     1 
ATOM   9950  C  CG     . PRO B  1 277 ? 16.128  0.450   3.679   1.00 66.37  ? 276 PRO B CG     1 
ATOM   9951  C  CD     . PRO B  1 277 ? 15.016  -0.413  3.182   1.00 77.35  ? 276 PRO B CD     1 
ATOM   9952  H  HA     . PRO B  1 277 ? 16.219  0.338   0.650   1.00 87.39  ? 276 PRO B HA     1 
ATOM   9953  H  HB2    . PRO B  1 277 ? 17.970  0.558   2.753   1.00 75.25  ? 276 PRO B HB2    1 
ATOM   9954  H  HB3    . PRO B  1 277 ? 16.952  1.666   2.228   1.00 75.25  ? 276 PRO B HB3    1 
ATOM   9955  H  HG2    . PRO B  1 277 ? 16.627  -0.013  4.369   1.00 79.65  ? 276 PRO B HG2    1 
ATOM   9956  H  HG3    . PRO B  1 277 ? 15.775  1.284   4.024   1.00 79.65  ? 276 PRO B HG3    1 
ATOM   9957  H  HD2    . PRO B  1 277 ? 14.782  -1.081  3.846   1.00 92.81  ? 276 PRO B HD2    1 
ATOM   9958  H  HD3    . PRO B  1 277 ? 14.251  0.129   2.934   1.00 92.81  ? 276 PRO B HD3    1 
ATOM   9959  N  N      . PHE B  1 278 ? 18.525  -1.675  1.698   1.00 61.72  ? 277 PHE B N      1 
ATOM   9960  C  CA     . PHE B  1 278 ? 19.667  -2.491  1.292   1.00 67.93  ? 277 PHE B CA     1 
ATOM   9961  C  C      . PHE B  1 278 ? 19.457  -3.136  -0.078  1.00 76.99  ? 277 PHE B C      1 
ATOM   9962  O  O      . PHE B  1 278 ? 20.401  -3.263  -0.858  1.00 71.41  ? 277 PHE B O      1 
ATOM   9963  C  CB     . PHE B  1 278 ? 19.948  -3.571  2.344   1.00 59.17  ? 277 PHE B CB     1 
ATOM   9964  C  CG     . PHE B  1 278 ? 21.133  -4.438  2.021   1.00 53.18  ? 277 PHE B CG     1 
ATOM   9965  C  CD1    . PHE B  1 278 ? 22.419  -3.919  2.054   1.00 48.68  ? 277 PHE B CD1    1 
ATOM   9966  C  CD2    . PHE B  1 278 ? 20.962  -5.773  1.692   1.00 53.45  ? 277 PHE B CD2    1 
ATOM   9967  C  CE1    . PHE B  1 278 ? 23.512  -4.714  1.756   1.00 52.78  ? 277 PHE B CE1    1 
ATOM   9968  C  CE2    . PHE B  1 278 ? 22.050  -6.573  1.396   1.00 62.04  ? 277 PHE B CE2    1 
ATOM   9969  C  CZ     . PHE B  1 278 ? 23.328  -6.043  1.429   1.00 57.25  ? 277 PHE B CZ     1 
ATOM   9970  H  H      . PHE B  1 278 ? 18.356  -1.710  2.541   1.00 74.06  ? 277 PHE B H      1 
ATOM   9971  H  HA     . PHE B  1 278 ? 20.459  -1.917  1.234   1.00 81.51  ? 277 PHE B HA     1 
ATOM   9972  H  HB2    . PHE B  1 278 ? 20.119  -3.140  3.196   1.00 71.00  ? 277 PHE B HB2    1 
ATOM   9973  H  HB3    . PHE B  1 278 ? 19.171  -4.147  2.417   1.00 71.00  ? 277 PHE B HB3    1 
ATOM   9974  H  HD1    . PHE B  1 278 ? 22.548  -3.024  2.273   1.00 58.42  ? 277 PHE B HD1    1 
ATOM   9975  H  HD2    . PHE B  1 278 ? 20.106  -6.134  1.668   1.00 64.14  ? 277 PHE B HD2    1 
ATOM   9976  H  HE1    . PHE B  1 278 ? 24.370  -4.355  1.780   1.00 63.34  ? 277 PHE B HE1    1 
ATOM   9977  H  HE2    . PHE B  1 278 ? 21.923  -7.467  1.175   1.00 74.45  ? 277 PHE B HE2    1 
ATOM   9978  H  HZ     . PHE B  1 278 ? 24.060  -6.580  1.229   1.00 68.70  ? 277 PHE B HZ     1 
ATOM   9979  N  N      . ILE B  1 279 ? 18.222  -3.540  -0.365  1.00 73.67  ? 278 ILE B N      1 
ATOM   9980  C  CA     . ILE B  1 279 ? 17.892  -4.175  -1.639  1.00 75.81  ? 278 ILE B CA     1 
ATOM   9981  C  C      . ILE B  1 279 ? 17.373  -3.157  -2.651  1.00 83.82  ? 278 ILE B C      1 
ATOM   9982  O  O      . ILE B  1 279 ? 17.846  -3.092  -3.786  1.00 70.22  ? 278 ILE B O      1 
ATOM   9983  C  CB     . ILE B  1 279 ? 16.820  -5.264  -1.453  1.00 61.22  ? 278 ILE B CB     1 
ATOM   9984  C  CG1    . ILE B  1 279 ? 17.290  -6.308  -0.440  1.00 70.02  ? 278 ILE B CG1    1 
ATOM   9985  C  CG2    . ILE B  1 279 ? 16.493  -5.926  -2.785  1.00 57.23  ? 278 ILE B CG2    1 
ATOM   9986  C  CD1    . ILE B  1 279 ? 18.604  -6.968  -0.801  1.00 60.90  ? 278 ILE B CD1    1 
ATOM   9987  H  H      . ILE B  1 279 ? 17.551  -3.457  0.166   1.00 88.40  ? 278 ILE B H      1 
ATOM   9988  H  HA     . ILE B  1 279 ? 18.697  -4.594  -2.009  1.00 90.97  ? 278 ILE B HA     1 
ATOM   9989  H  HB     . ILE B  1 279 ? 16.013  -4.846  -1.112  1.00 73.47  ? 278 ILE B HB     1 
ATOM   9990  H  HG12   . ILE B  1 279 ? 17.402  -5.878  0.422   1.00 84.03  ? 278 ILE B HG12   1 
ATOM   9991  H  HG13   . ILE B  1 279 ? 16.618  -7.004  -0.375  1.00 84.03  ? 278 ILE B HG13   1 
ATOM   9992  H  HG21   . ILE B  1 279 ? 15.824  -6.599  -2.643  1.00 68.68  ? 278 ILE B HG21   1 
ATOM   9993  H  HG22   . ILE B  1 279 ? 16.164  -5.259  -3.392  1.00 68.68  ? 278 ILE B HG22   1 
ATOM   9994  H  HG23   . ILE B  1 279 ? 17.291  -6.326  -3.138  1.00 68.68  ? 278 ILE B HG23   1 
ATOM   9995  H  HD11   . ILE B  1 279 ? 18.830  -7.607  -0.121  1.00 73.08  ? 278 ILE B HD11   1 
ATOM   9996  H  HD12   . ILE B  1 279 ? 18.509  -7.411  -1.648  1.00 73.08  ? 278 ILE B HD12   1 
ATOM   9997  H  HD13   . ILE B  1 279 ? 19.286  -6.295  -0.858  1.00 73.08  ? 278 ILE B HD13   1 
ATOM   9998  N  N      . LYS B  1 280 ? 16.395  -2.364  -2.231  1.00 89.05  ? 279 LYS B N      1 
ATOM   9999  C  CA     . LYS B  1 280 ? 15.769  -1.380  -3.105  1.00 67.73  ? 279 LYS B CA     1 
ATOM   10000 C  C      . LYS B  1 280 ? 16.803  -0.433  -3.715  1.00 74.10  ? 279 LYS B C      1 
ATOM   10001 O  O      . LYS B  1 280 ? 16.558  0.174   -4.757  1.00 105.65 ? 279 LYS B O      1 
ATOM   10002 C  CB     . LYS B  1 280 ? 14.723  -0.586  -2.320  1.00 60.49  ? 279 LYS B CB     1 
ATOM   10003 C  CG     . LYS B  1 280 ? 13.543  -0.101  -3.143  1.00 66.23  ? 279 LYS B CG     1 
ATOM   10004 C  CD     . LYS B  1 280 ? 12.480  0.494   -2.234  1.00 109.02 ? 279 LYS B CD     1 
ATOM   10005 C  CE     . LYS B  1 280 ? 11.270  0.980   -3.010  1.00 133.98 ? 279 LYS B CE     1 
ATOM   10006 N  NZ     . LYS B  1 280 ? 10.223  1.526   -2.100  1.00 140.26 ? 279 LYS B NZ     1 
ATOM   10007 H  H      . LYS B  1 280 ? 16.073  -2.376  -1.434  1.00 106.86 ? 279 LYS B H      1 
ATOM   10008 H  HA     . LYS B  1 280 ? 15.312  -1.846  -3.837  1.00 81.28  ? 279 LYS B HA     1 
ATOM   10009 H  HB2    . LYS B  1 280 ? 14.375  -1.150  -1.611  1.00 72.59  ? 279 LYS B HB2    1 
ATOM   10010 H  HB3    . LYS B  1 280 ? 15.152  0.194   -1.935  1.00 72.59  ? 279 LYS B HB3    1 
ATOM   10011 H  HG2    . LYS B  1 280 ? 13.839  0.585   -3.761  1.00 79.47  ? 279 LYS B HG2    1 
ATOM   10012 H  HG3    . LYS B  1 280 ? 13.154  -0.849  -3.624  1.00 79.47  ? 279 LYS B HG3    1 
ATOM   10013 H  HD2    . LYS B  1 280 ? 12.183  -0.183  -1.606  1.00 130.83 ? 279 LYS B HD2    1 
ATOM   10014 H  HD3    . LYS B  1 280 ? 12.856  1.250   -1.757  1.00 130.83 ? 279 LYS B HD3    1 
ATOM   10015 H  HE2    . LYS B  1 280 ? 11.542  1.685   -3.619  1.00 160.77 ? 279 LYS B HE2    1 
ATOM   10016 H  HE3    . LYS B  1 280 ? 10.887  0.238   -3.505  1.00 160.77 ? 279 LYS B HE3    1 
ATOM   10017 H  HZ1    . LYS B  1 280 ? 9.523   1.805   -2.575  1.00 168.32 ? 279 LYS B HZ1    1 
ATOM   10018 H  HZ2    . LYS B  1 280 ? 9.954   0.895   -1.533  1.00 168.32 ? 279 LYS B HZ2    1 
ATOM   10019 H  HZ3    . LYS B  1 280 ? 10.550  2.211   -1.637  1.00 168.32 ? 279 LYS B HZ3    1 
ATOM   10020 N  N      . ASN B  1 281 ? 17.959  -0.315  -3.065  1.00 60.87  ? 280 ASN B N      1 
ATOM   10021 C  CA     . ASN B  1 281 ? 19.021  0.577   -3.526  1.00 53.79  ? 280 ASN B CA     1 
ATOM   10022 C  C      . ASN B  1 281 ? 20.228  -0.166  -4.092  1.00 60.19  ? 280 ASN B C      1 
ATOM   10023 O  O      . ASN B  1 281 ? 21.309  0.408   -4.227  1.00 63.09  ? 280 ASN B O      1 
ATOM   10024 C  CB     . ASN B  1 281 ? 19.487  1.470   -2.378  1.00 68.42  ? 280 ASN B CB     1 
ATOM   10025 C  CG     . ASN B  1 281 ? 18.399  2.394   -1.884  1.00 83.32  ? 280 ASN B CG     1 
ATOM   10026 O  OD1    . ASN B  1 281 ? 17.653  2.971   -2.675  1.00 92.06  ? 280 ASN B OD1    1 
ATOM   10027 N  ND2    . ASN B  1 281 ? 18.298  2.537   -0.569  1.00 105.88 ? 280 ASN B ND2    1 
ATOM   10028 H  H      . ASN B  1 281 ? 18.155  -0.746  -2.347  1.00 73.05  ? 280 ASN B H      1 
ATOM   10029 H  HA     . ASN B  1 281 ? 18.665  1.155   -4.233  1.00 64.55  ? 280 ASN B HA     1 
ATOM   10030 H  HB2    . ASN B  1 281 ? 19.766  0.911   -1.635  1.00 82.11  ? 280 ASN B HB2    1 
ATOM   10031 H  HB3    . ASN B  1 281 ? 20.230  2.015   -2.681  1.00 82.11  ? 280 ASN B HB3    1 
ATOM   10032 H  HD21   . ASN B  1 281 ? 18.835  2.114   -0.048  1.00 127.06 ? 280 ASN B HD21   1 
ATOM   10033 H  HD22   . ASN B  1 281 ? 17.694  3.052   -0.238  1.00 127.06 ? 280 ASN B HD22   1 
ATOM   10034 N  N      . ALA B  1 282 ? 20.047  -1.441  -4.416  1.00 75.22  ? 281 ALA B N      1 
ATOM   10035 C  CA     . ALA B  1 282 ? 21.136  -2.241  -4.965  1.00 63.54  ? 281 ALA B CA     1 
ATOM   10036 C  C      . ALA B  1 282 ? 21.517  -1.722  -6.340  1.00 59.99  ? 281 ALA B C      1 
ATOM   10037 O  O      . ALA B  1 282 ? 20.672  -1.216  -7.073  1.00 68.24  ? 281 ALA B O      1 
ATOM   10038 C  CB     . ALA B  1 282 ? 20.735  -3.699  -5.049  1.00 57.72  ? 281 ALA B CB     1 
ATOM   10039 H  H      . ALA B  1 282 ? 19.305  -1.867  -4.329  1.00 90.26  ? 281 ALA B H      1 
ATOM   10040 H  HA     . ALA B  1 282 ? 21.919  -2.169  -4.380  1.00 76.25  ? 281 ALA B HA     1 
ATOM   10041 H  HB1    . ALA B  1 282 ? 21.466  -4.204  -5.413  1.00 69.26  ? 281 ALA B HB1    1 
ATOM   10042 H  HB2    . ALA B  1 282 ? 20.523  -4.016  -4.168  1.00 69.26  ? 281 ALA B HB2    1 
ATOM   10043 H  HB3    . ALA B  1 282 ? 19.966  -3.779  -5.619  1.00 69.26  ? 281 ALA B HB3    1 
ATOM   10044 N  N      . LYS B  1 283 ? 22.793  -1.855  -6.684  1.00 67.76  ? 282 LYS B N      1 
ATOM   10045 C  CA     . LYS B  1 283 ? 23.297  -1.398  -7.972  1.00 71.76  ? 282 LYS B CA     1 
ATOM   10046 C  C      . LYS B  1 283 ? 22.844  -2.353  -9.076  1.00 78.68  ? 282 LYS B C      1 
ATOM   10047 O  O      . LYS B  1 283 ? 22.393  -3.465  -8.793  1.00 64.42  ? 282 LYS B O      1 
ATOM   10048 C  CB     . LYS B  1 283 ? 24.824  -1.358  -7.951  1.00 71.28  ? 282 LYS B CB     1 
ATOM   10049 C  CG     . LYS B  1 283 ? 25.437  -0.674  -6.740  1.00 65.79  ? 282 LYS B CG     1 
ATOM   10050 C  CD     . LYS B  1 283 ? 25.352  0.832   -6.834  1.00 76.19  ? 282 LYS B CD     1 
ATOM   10051 C  CE     . LYS B  1 283 ? 26.026  1.491   -5.640  1.00 104.87 ? 282 LYS B CE     1 
ATOM   10052 N  NZ     . LYS B  1 283 ? 27.485  1.192   -5.566  1.00 108.34 ? 282 LYS B NZ     1 
ATOM   10053 H  H      . LYS B  1 283 ? 23.393  -2.210  -6.181  1.00 81.32  ? 282 LYS B H      1 
ATOM   10054 H  HA     . LYS B  1 283 ? 22.956  -0.500  -8.167  1.00 86.12  ? 282 LYS B HA     1 
ATOM   10055 H  HB2    . LYS B  1 283 ? 25.157  -2.269  -7.971  1.00 85.53  ? 282 LYS B HB2    1 
ATOM   10056 H  HB3    . LYS B  1 283 ? 25.130  -0.883  -8.740  1.00 85.53  ? 282 LYS B HB3    1 
ATOM   10057 H  HG2    . LYS B  1 283 ? 24.962  -0.954  -5.942  1.00 78.95  ? 282 LYS B HG2    1 
ATOM   10058 H  HG3    . LYS B  1 283 ? 26.373  -0.920  -6.676  1.00 78.95  ? 282 LYS B HG3    1 
ATOM   10059 H  HD2    . LYS B  1 283 ? 25.800  1.130   -7.641  1.00 91.42  ? 282 LYS B HD2    1 
ATOM   10060 H  HD3    . LYS B  1 283 ? 24.420  1.101   -6.846  1.00 91.42  ? 282 LYS B HD3    1 
ATOM   10061 H  HE2    . LYS B  1 283 ? 25.920  2.453   -5.708  1.00 125.84 ? 282 LYS B HE2    1 
ATOM   10062 H  HE3    . LYS B  1 283 ? 25.611  1.168   -4.824  1.00 125.84 ? 282 LYS B HE3    1 
ATOM   10063 H  HZ1    . LYS B  1 283 ? 27.843  1.594   -4.857  1.00 130.01 ? 282 LYS B HZ1    1 
ATOM   10064 H  HZ2    . LYS B  1 283 ? 27.612  0.314   -5.496  1.00 130.01 ? 282 LYS B HZ2    1 
ATOM   10065 H  HZ3    . LYS B  1 283 ? 27.893  1.485   -6.301  1.00 130.01 ? 282 LYS B HZ3    1 
ATOM   10066 N  N      . PRO B  1 284 ? 22.962  -1.926  -10.344 1.00 87.46  ? 283 PRO B N      1 
ATOM   10067 C  CA     . PRO B  1 284 ? 22.658  -2.822  -11.464 1.00 71.14  ? 283 PRO B CA     1 
ATOM   10068 C  C      . PRO B  1 284 ? 23.662  -3.968  -11.551 1.00 61.17  ? 283 PRO B C      1 
ATOM   10069 O  O      . PRO B  1 284 ? 24.785  -3.822  -11.068 1.00 73.45  ? 283 PRO B O      1 
ATOM   10070 C  CB     . PRO B  1 284 ? 22.777  -1.908  -12.686 1.00 85.57  ? 283 PRO B CB     1 
ATOM   10071 C  CG     . PRO B  1 284 ? 23.655  -0.794  -12.247 1.00 78.33  ? 283 PRO B CG     1 
ATOM   10072 C  CD     . PRO B  1 284 ? 23.336  -0.580  -10.807 1.00 71.11  ? 283 PRO B CD     1 
ATOM   10073 H  HA     . PRO B  1 284 ? 21.747  -3.175  -11.396 1.00 85.37  ? 283 PRO B HA     1 
ATOM   10074 H  HB2    . PRO B  1 284 ? 23.182  -2.395  -13.421 1.00 102.68 ? 283 PRO B HB2    1 
ATOM   10075 H  HB3    . PRO B  1 284 ? 21.900  -1.577  -12.934 1.00 102.68 ? 283 PRO B HB3    1 
ATOM   10076 H  HG2    . PRO B  1 284 ? 24.585  -1.048  -12.358 1.00 93.99  ? 283 PRO B HG2    1 
ATOM   10077 H  HG3    . PRO B  1 284 ? 23.454  0.003   -12.764 1.00 93.99  ? 283 PRO B HG3    1 
ATOM   10078 H  HD2    . PRO B  1 284 ? 24.119  -0.263  -10.329 1.00 85.33  ? 283 PRO B HD2    1 
ATOM   10079 H  HD3    . PRO B  1 284 ? 22.588  0.031   -10.712 1.00 85.33  ? 283 PRO B HD3    1 
ATOM   10080 N  N      . VAL B  1 285 ? 23.268  -5.084  -12.162 1.00 63.41  ? 284 VAL B N      1 
ATOM   10081 C  CA     . VAL B  1 285 ? 24.115  -6.277  -12.189 1.00 64.11  ? 284 VAL B CA     1 
ATOM   10082 C  C      . VAL B  1 285 ? 25.485  -5.987  -12.793 1.00 75.86  ? 284 VAL B C      1 
ATOM   10083 O  O      . VAL B  1 285 ? 26.441  -6.724  -12.557 1.00 76.60  ? 284 VAL B O      1 
ATOM   10084 C  CB     . VAL B  1 285 ? 23.473  -7.434  -12.988 1.00 48.32  ? 284 VAL B CB     1 
ATOM   10085 C  CG1    . VAL B  1 285 ? 22.091  -7.760  -12.451 1.00 68.82  ? 284 VAL B CG1    1 
ATOM   10086 C  CG2    . VAL B  1 285 ? 23.404  -7.090  -14.462 1.00 60.74  ? 284 VAL B CG2    1 
ATOM   10087 H  H      . VAL B  1 285 ? 22.516  -5.176  -12.569 1.00 76.09  ? 284 VAL B H      1 
ATOM   10088 H  HA     . VAL B  1 285 ? 24.252  -6.588  -11.270 1.00 76.93  ? 284 VAL B HA     1 
ATOM   10089 H  HB     . VAL B  1 285 ? 24.031  -8.235  -12.891 1.00 57.98  ? 284 VAL B HB     1 
ATOM   10090 H  HG11   . VAL B  1 285 ? 21.718  -8.480  -12.965 1.00 82.58  ? 284 VAL B HG11   1 
ATOM   10091 H  HG12   . VAL B  1 285 ? 22.167  -8.019  -11.530 1.00 82.58  ? 284 VAL B HG12   1 
ATOM   10092 H  HG13   . VAL B  1 285 ? 21.535  -6.981  -12.528 1.00 82.58  ? 284 VAL B HG13   1 
ATOM   10093 H  HG21   . VAL B  1 285 ? 23.003  -7.822  -14.935 1.00 72.89  ? 284 VAL B HG21   1 
ATOM   10094 H  HG22   . VAL B  1 285 ? 22.873  -6.298  -14.573 1.00 72.89  ? 284 VAL B HG22   1 
ATOM   10095 H  HG23   . VAL B  1 285 ? 24.294  -6.936  -14.789 1.00 72.89  ? 284 VAL B HG23   1 
ATOM   10096 N  N      . SER B  1 286 ? 25.575  -4.916  -13.575 1.00 84.86  ? 285 SER B N      1 
ATOM   10097 C  CA     . SER B  1 286 ? 26.812  -4.573  -14.268 1.00 78.29  ? 285 SER B CA     1 
ATOM   10098 C  C      . SER B  1 286 ? 27.989  -4.322  -13.320 1.00 93.21  ? 285 SER B C      1 
ATOM   10099 O  O      . SER B  1 286 ? 29.142  -4.358  -13.747 1.00 99.82  ? 285 SER B O      1 
ATOM   10100 C  CB     . SER B  1 286 ? 26.595  -3.351  -15.161 1.00 73.74  ? 285 SER B CB     1 
ATOM   10101 O  OG     . SER B  1 286 ? 26.080  -2.264  -14.414 1.00 85.60  ? 285 SER B OG     1 
ATOM   10102 H  H      . SER B  1 286 ? 24.929  -4.368  -13.721 1.00 101.83 ? 285 SER B H      1 
ATOM   10103 H  HA     . SER B  1 286 ? 27.059  -5.322  -14.850 1.00 93.94  ? 285 SER B HA     1 
ATOM   10104 H  HB2    . SER B  1 286 ? 27.443  -3.091  -15.552 1.00 88.49  ? 285 SER B HB2    1 
ATOM   10105 H  HB3    . SER B  1 286 ? 25.963  -3.580  -15.861 1.00 88.49  ? 285 SER B HB3    1 
ATOM   10106 H  HG     . SER B  1 286 ? 25.967  -1.616  -14.904 1.00 102.72 ? 285 SER B HG     1 
ATOM   10107 N  N      . ILE B  1 287 ? 27.709  -4.071  -12.043 1.00 83.99  ? 286 ILE B N      1 
ATOM   10108 C  CA     . ILE B  1 287 ? 28.781  -3.861  -11.072 1.00 91.64  ? 286 ILE B CA     1 
ATOM   10109 C  C      . ILE B  1 287 ? 29.525  -5.166  -10.787 1.00 88.25  ? 286 ILE B C      1 
ATOM   10110 O  O      . ILE B  1 287 ? 30.621  -5.159  -10.225 1.00 83.97  ? 286 ILE B O      1 
ATOM   10111 C  CB     . ILE B  1 287 ? 28.262  -3.292  -9.734  1.00 93.05  ? 286 ILE B CB     1 
ATOM   10112 C  CG1    . ILE B  1 287 ? 27.343  -4.296  -9.039  1.00 98.50  ? 286 ILE B CG1    1 
ATOM   10113 C  CG2    . ILE B  1 287 ? 27.533  -1.979  -9.956  1.00 89.28  ? 286 ILE B CG2    1 
ATOM   10114 C  CD1    . ILE B  1 287 ? 27.250  -4.087  -7.553  1.00 93.07  ? 286 ILE B CD1    1 
ATOM   10115 H  H      . ILE B  1 287 ? 26.915  -4.017  -11.715 1.00 100.78 ? 286 ILE B H      1 
ATOM   10116 H  HA     . ILE B  1 287 ? 29.424  -3.222  -11.443 1.00 109.96 ? 286 ILE B HA     1 
ATOM   10117 H  HB     . ILE B  1 287 ? 29.023  -3.124  -9.157  1.00 111.66 ? 286 ILE B HB     1 
ATOM   10118 H  HG12   . ILE B  1 287 ? 26.450  -4.213  -9.408  1.00 118.20 ? 286 ILE B HG12   1 
ATOM   10119 H  HG13   . ILE B  1 287 ? 27.683  -5.191  -9.193  1.00 118.20 ? 286 ILE B HG13   1 
ATOM   10120 H  HG21   . ILE B  1 287 ? 27.222  -1.649  -9.110  1.00 107.14 ? 286 ILE B HG21   1 
ATOM   10121 H  HG22   . ILE B  1 287 ? 28.139  -1.348  -10.351 1.00 107.14 ? 286 ILE B HG22   1 
ATOM   10122 H  HG23   . ILE B  1 287 ? 26.789  -2.130  -10.542 1.00 107.14 ? 286 ILE B HG23   1 
ATOM   10123 H  HD11   . ILE B  1 287 ? 26.661  -4.748  -7.181  1.00 111.68 ? 286 ILE B HD11   1 
ATOM   10124 H  HD12   . ILE B  1 287 ? 28.126  -4.176  -7.170  1.00 111.68 ? 286 ILE B HD12   1 
ATOM   10125 H  HD13   . ILE B  1 287 ? 26.905  -3.207  -7.383  1.00 111.68 ? 286 ILE B HD13   1 
ATOM   10126 N  N      . LEU B  1 288 ? 28.922  -6.284  -11.173 1.00 85.16  ? 287 LEU B N      1 
ATOM   10127 C  CA     . LEU B  1 288 ? 29.512  -7.593  -10.924 1.00 87.93  ? 287 LEU B CA     1 
ATOM   10128 C  C      . LEU B  1 288 ? 30.475  -8.009  -12.034 1.00 86.43  ? 287 LEU B C      1 
ATOM   10129 O  O      . LEU B  1 288 ? 31.136  -9.044  -11.928 1.00 80.61  ? 287 LEU B O      1 
ATOM   10130 C  CB     . LEU B  1 288 ? 28.408  -8.643  -10.781 1.00 70.98  ? 287 LEU B CB     1 
ATOM   10131 C  CG     . LEU B  1 288 ? 27.385  -8.367  -9.675  1.00 65.46  ? 287 LEU B CG     1 
ATOM   10132 C  CD1    . LEU B  1 288 ? 26.196  -9.308  -