data_4LL1
# 
_entry.id   4LL1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4LL1         
RCSB  RCSB080762   
WWPDB D_1000080762 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4GFX 'Crystal structure of the N-terminal domain of TXNIP' unspecified 
PDB 4LL4 .                                                     unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4LL1 
_pdbx_database_status.recvd_initial_deposition_date   2013-07-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hwang, J.' 1 
'Kim, M.H.' 2 
# 
_citation.id                        primary 
_citation.title                     
'The structural basis for the negative regulation of thioredoxin by thioredoxin-interacting protein' 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_volume            5 
_citation.page_first                2958 
_citation.page_last                 2958 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24389582 
_citation.pdbx_database_id_DOI      10.1038/ncomms3958 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hwang, J.'    1  
primary 'Suh, H.W.'    2  
primary 'Jeon, Y.H.'   3  
primary 'Hwang, E.'    4  
primary 'Nguyen, L.T.' 5  
primary 'Yeom, J.'     6  
primary 'Lee, S.G.'    7  
primary 'Lee, C.'      8  
primary 'Kim, K.J.'    9  
primary 'Kang, B.S.'   10 
primary 'Jeong, J.O.'  11 
primary 'Oh, T.K.'     12 
primary 'Choi, I.'     13 
primary 'Lee, J.O.'    14 
primary 'Kim, M.H.'    15 
# 
_cell.entry_id           4LL1 
_cell.length_a           80.135 
_cell.length_b           64.022 
_cell.length_c           88.295 
_cell.angle_alpha        90.00 
_cell.angle_beta         91.28 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4LL1 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Thioredoxin-interacting protein' 35021.430 2   ? 'C120S, C170S, C205S, C267S' 'UNP residues 3-317' ? 
2 polymer man Thioredoxin                       11718.413 2   ? C35A                         ?                    ? 
3 water   nat water                             18.015    248 ? ?                            ?                    ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Thioredoxin-binding protein 2, Vitamin D3 up-regulated protein 1'          
2 'Trx, ATL-derived factor, ADF, Surface-associated sulphydryl protein, SASP' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQP
TGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGSVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSA
KKEKKVSSMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTSSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHI
ISGTCASWRGKSLRVQKIRPSILGSNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEM
;
;MFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQP
TGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGSVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSA
KKEKKVSSMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTSSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHI
ISGTCASWRGKSLRVQKIRPSILGSNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEM
;
A,C ? 
2 'polypeptide(L)' no no 
;MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFF
KKGQKVGEFSGANKEKLEATINELV
;
;MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFF
KKGQKVGEFSGANKEKLEATINELV
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PHE n 
1 3   LYS n 
1 4   LYS n 
1 5   ILE n 
1 6   LYS n 
1 7   SER n 
1 8   PHE n 
1 9   GLU n 
1 10  VAL n 
1 11  VAL n 
1 12  PHE n 
1 13  ASN n 
1 14  ASP n 
1 15  PRO n 
1 16  GLU n 
1 17  LYS n 
1 18  VAL n 
1 19  TYR n 
1 20  GLY n 
1 21  SER n 
1 22  GLY n 
1 23  GLU n 
1 24  LYS n 
1 25  VAL n 
1 26  ALA n 
1 27  GLY n 
1 28  ARG n 
1 29  VAL n 
1 30  ILE n 
1 31  VAL n 
1 32  GLU n 
1 33  VAL n 
1 34  CYS n 
1 35  GLU n 
1 36  VAL n 
1 37  THR n 
1 38  ARG n 
1 39  VAL n 
1 40  LYS n 
1 41  ALA n 
1 42  VAL n 
1 43  ARG n 
1 44  ILE n 
1 45  LEU n 
1 46  ALA n 
1 47  CYS n 
1 48  GLY n 
1 49  VAL n 
1 50  ALA n 
1 51  LYS n 
1 52  VAL n 
1 53  LEU n 
1 54  TRP n 
1 55  MET n 
1 56  GLN n 
1 57  GLY n 
1 58  SER n 
1 59  GLN n 
1 60  GLN n 
1 61  CYS n 
1 62  LYS n 
1 63  GLN n 
1 64  THR n 
1 65  SER n 
1 66  GLU n 
1 67  TYR n 
1 68  LEU n 
1 69  ARG n 
1 70  TYR n 
1 71  GLU n 
1 72  ASP n 
1 73  THR n 
1 74  LEU n 
1 75  LEU n 
1 76  LEU n 
1 77  GLU n 
1 78  ASP n 
1 79  GLN n 
1 80  PRO n 
1 81  THR n 
1 82  GLY n 
1 83  GLU n 
1 84  ASN n 
1 85  GLU n 
1 86  MET n 
1 87  VAL n 
1 88  ILE n 
1 89  MET n 
1 90  ARG n 
1 91  PRO n 
1 92  GLY n 
1 93  ASN n 
1 94  LYS n 
1 95  TYR n 
1 96  GLU n 
1 97  TYR n 
1 98  LYS n 
1 99  PHE n 
1 100 GLY n 
1 101 PHE n 
1 102 GLU n 
1 103 LEU n 
1 104 PRO n 
1 105 GLN n 
1 106 GLY n 
1 107 PRO n 
1 108 LEU n 
1 109 GLY n 
1 110 THR n 
1 111 SER n 
1 112 PHE n 
1 113 LYS n 
1 114 GLY n 
1 115 LYS n 
1 116 TYR n 
1 117 GLY n 
1 118 SER n 
1 119 VAL n 
1 120 ASP n 
1 121 TYR n 
1 122 TRP n 
1 123 VAL n 
1 124 LYS n 
1 125 ALA n 
1 126 PHE n 
1 127 LEU n 
1 128 ASP n 
1 129 ARG n 
1 130 PRO n 
1 131 SER n 
1 132 GLN n 
1 133 PRO n 
1 134 THR n 
1 135 GLN n 
1 136 GLU n 
1 137 THR n 
1 138 LYS n 
1 139 LYS n 
1 140 ASN n 
1 141 PHE n 
1 142 GLU n 
1 143 VAL n 
1 144 VAL n 
1 145 ASP n 
1 146 LEU n 
1 147 VAL n 
1 148 ASP n 
1 149 VAL n 
1 150 ASN n 
1 151 THR n 
1 152 PRO n 
1 153 ASP n 
1 154 LEU n 
1 155 MET n 
1 156 ALA n 
1 157 PRO n 
1 158 VAL n 
1 159 SER n 
1 160 ALA n 
1 161 LYS n 
1 162 LYS n 
1 163 GLU n 
1 164 LYS n 
1 165 LYS n 
1 166 VAL n 
1 167 SER n 
1 168 SER n 
1 169 MET n 
1 170 PHE n 
1 171 ILE n 
1 172 PRO n 
1 173 ASP n 
1 174 GLY n 
1 175 ARG n 
1 176 VAL n 
1 177 SER n 
1 178 VAL n 
1 179 SER n 
1 180 ALA n 
1 181 ARG n 
1 182 ILE n 
1 183 ASP n 
1 184 ARG n 
1 185 LYS n 
1 186 GLY n 
1 187 PHE n 
1 188 CYS n 
1 189 GLU n 
1 190 GLY n 
1 191 ASP n 
1 192 GLU n 
1 193 ILE n 
1 194 SER n 
1 195 ILE n 
1 196 HIS n 
1 197 ALA n 
1 198 ASP n 
1 199 PHE n 
1 200 GLU n 
1 201 ASN n 
1 202 THR n 
1 203 SER n 
1 204 SER n 
1 205 ARG n 
1 206 ILE n 
1 207 VAL n 
1 208 VAL n 
1 209 PRO n 
1 210 LYS n 
1 211 ALA n 
1 212 ALA n 
1 213 ILE n 
1 214 VAL n 
1 215 ALA n 
1 216 ARG n 
1 217 HIS n 
1 218 THR n 
1 219 TYR n 
1 220 LEU n 
1 221 ALA n 
1 222 ASN n 
1 223 GLY n 
1 224 GLN n 
1 225 THR n 
1 226 LYS n 
1 227 VAL n 
1 228 LEU n 
1 229 THR n 
1 230 GLN n 
1 231 LYS n 
1 232 LEU n 
1 233 SER n 
1 234 SER n 
1 235 VAL n 
1 236 ARG n 
1 237 GLY n 
1 238 ASN n 
1 239 HIS n 
1 240 ILE n 
1 241 ILE n 
1 242 SER n 
1 243 GLY n 
1 244 THR n 
1 245 CYS n 
1 246 ALA n 
1 247 SER n 
1 248 TRP n 
1 249 ARG n 
1 250 GLY n 
1 251 LYS n 
1 252 SER n 
1 253 LEU n 
1 254 ARG n 
1 255 VAL n 
1 256 GLN n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 PRO n 
1 261 SER n 
1 262 ILE n 
1 263 LEU n 
1 264 GLY n 
1 265 SER n 
1 266 ASN n 
1 267 ILE n 
1 268 LEU n 
1 269 ARG n 
1 270 VAL n 
1 271 GLU n 
1 272 TYR n 
1 273 SER n 
1 274 LEU n 
1 275 LEU n 
1 276 ILE n 
1 277 TYR n 
1 278 VAL n 
1 279 SER n 
1 280 VAL n 
1 281 PRO n 
1 282 GLY n 
1 283 SER n 
1 284 LYS n 
1 285 LYS n 
1 286 VAL n 
1 287 ILE n 
1 288 LEU n 
1 289 ASP n 
1 290 LEU n 
1 291 PRO n 
1 292 LEU n 
1 293 VAL n 
1 294 ILE n 
1 295 GLY n 
1 296 SER n 
1 297 ARG n 
1 298 SER n 
1 299 GLY n 
1 300 LEU n 
1 301 SER n 
1 302 SER n 
1 303 ARG n 
1 304 THR n 
1 305 SER n 
1 306 SER n 
1 307 MET n 
1 308 ALA n 
1 309 SER n 
1 310 ARG n 
1 311 THR n 
1 312 SER n 
1 313 SER n 
1 314 GLU n 
1 315 MET n 
2 1   MET n 
2 2   VAL n 
2 3   LYS n 
2 4   GLN n 
2 5   ILE n 
2 6   GLU n 
2 7   SER n 
2 8   LYS n 
2 9   THR n 
2 10  ALA n 
2 11  PHE n 
2 12  GLN n 
2 13  GLU n 
2 14  ALA n 
2 15  LEU n 
2 16  ASP n 
2 17  ALA n 
2 18  ALA n 
2 19  GLY n 
2 20  ASP n 
2 21  LYS n 
2 22  LEU n 
2 23  VAL n 
2 24  VAL n 
2 25  VAL n 
2 26  ASP n 
2 27  PHE n 
2 28  SER n 
2 29  ALA n 
2 30  THR n 
2 31  TRP n 
2 32  CYS n 
2 33  GLY n 
2 34  PRO n 
2 35  ALA n 
2 36  LYS n 
2 37  MET n 
2 38  ILE n 
2 39  LYS n 
2 40  PRO n 
2 41  PHE n 
2 42  PHE n 
2 43  HIS n 
2 44  SER n 
2 45  LEU n 
2 46  SER n 
2 47  GLU n 
2 48  LYS n 
2 49  TYR n 
2 50  SER n 
2 51  ASN n 
2 52  VAL n 
2 53  ILE n 
2 54  PHE n 
2 55  LEU n 
2 56  GLU n 
2 57  VAL n 
2 58  ASP n 
2 59  VAL n 
2 60  ASP n 
2 61  ASP n 
2 62  CYS n 
2 63  GLN n 
2 64  ASP n 
2 65  VAL n 
2 66  ALA n 
2 67  SER n 
2 68  GLU n 
2 69  CYS n 
2 70  GLU n 
2 71  VAL n 
2 72  LYS n 
2 73  CYS n 
2 74  MET n 
2 75  PRO n 
2 76  THR n 
2 77  PHE n 
2 78  GLN n 
2 79  PHE n 
2 80  PHE n 
2 81  LYS n 
2 82  LYS n 
2 83  GLY n 
2 84  GLN n 
2 85  LYS n 
2 86  VAL n 
2 87  GLY n 
2 88  GLU n 
2 89  PHE n 
2 90  SER n 
2 91  GLY n 
2 92  ALA n 
2 93  ASN n 
2 94  LYS n 
2 95  GLU n 
2 96  LYS n 
2 97  LEU n 
2 98  GLU n 
2 99  ALA n 
2 100 THR n 
2 101 ILE n 
2 102 ASN n 
2 103 GLU n 
2 104 LEU n 
2 105 VAL n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? TXNIP ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? 
2 1 sample ? ? ? human ? TRX   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TXNIP_HUMAN Q9H3M7 1 
;MFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQP
TGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSA
KKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHI
ISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEM
;
3 ? 
2 UNP THIO_HUMAN  P10599 2 
;MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFF
KKGQKVGEFSGANKEKLEATINELV
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4LL1 A 1 ? 315 ? Q9H3M7 3 ? 317 ? 3 317 
2 2 4LL1 B 1 ? 105 ? P10599 1 ? 105 ? 1 105 
3 1 4LL1 C 1 ? 315 ? Q9H3M7 3 ? 317 ? 3 317 
4 2 4LL1 D 1 ? 105 ? P10599 1 ? 105 ? 1 105 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4LL1 SER A 118 ? UNP Q9H3M7 CYS 120 'ENGINEERED MUTATION' 120 1  
1 4LL1 SER A 168 ? UNP Q9H3M7 CYS 170 'ENGINEERED MUTATION' 170 2  
1 4LL1 SER A 203 ? UNP Q9H3M7 CYS 205 'ENGINEERED MUTATION' 205 3  
1 4LL1 SER A 265 ? UNP Q9H3M7 CYS 267 'ENGINEERED MUTATION' 267 4  
2 4LL1 ALA B 35  ? UNP P10599 CYS 35  'ENGINEERED MUTATION' 35  5  
3 4LL1 SER C 118 ? UNP Q9H3M7 CYS 120 'ENGINEERED MUTATION' 120 6  
3 4LL1 SER C 168 ? UNP Q9H3M7 CYS 170 'ENGINEERED MUTATION' 170 7  
3 4LL1 SER C 203 ? UNP Q9H3M7 CYS 205 'ENGINEERED MUTATION' 205 8  
3 4LL1 SER C 265 ? UNP Q9H3M7 CYS 267 'ENGINEERED MUTATION' 267 9  
4 4LL1 ALA D 35  ? UNP P10599 CYS 35  'ENGINEERED MUTATION' 35  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4LL1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.42 
_exptl_crystal.density_percent_sol   49.22 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            294.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'0.16M tri-sodium citrate, 16% PEG3350, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 294.15K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           173 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2009-07-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.100 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PAL/PLS BEAMLINE 7A (6B, 6C1)' 
_diffrn_source.pdbx_synchrotron_site       PAL/PLS 
_diffrn_source.pdbx_synchrotron_beamline   '7A (6B, 6C1)' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.100 
# 
_reflns.entry_id                     4LL1 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   58935 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.0 
_reflns_shell.d_res_low                   2.07 
_reflns_shell.percent_possible_all        96.6 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4LL1 
_refine.ls_number_reflns_obs                     55914 
_refine.ls_number_reflns_all                     58935 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    96.40 
_refine.ls_R_factor_obs                          0.22399 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22048 
_refine.ls_R_factor_R_free                       0.28806 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2997 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.923 
_refine.B_iso_mean                               51.648 
_refine.aniso_B[1][1]                            -1.35 
_refine.aniso_B[2][2]                            1.66 
_refine.aniso_B[3][3]                            -0.33 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.45 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'Partially refined SeMet-substituted TRX-TXNIP complex structure' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.204 
_refine.pdbx_overall_ESU_R_Free                  0.198 
_refine.overall_SU_ML                            0.185 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             13.619 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6007 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             248 
_refine_hist.number_atoms_total               6255 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d         0.015  0.022  ? 6122 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg      1.594  1.967  ? 8246 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg   7.206  5.000  ? 760  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg   32.450 24.496 ? 258  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg   18.895 15.000 ? 1133 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg   17.581 15.000 ? 33   ? 'X-RAY DIFFRACTION' 
r_chiral_restr           0.107  0.200  ? 925  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined     0.006  0.020  ? 4499 ? 'X-RAY DIFFRACTION' 
r_nbd_refined            0.218  0.200  ? 2355 ? 'X-RAY DIFFRACTION' 
r_nbtor_refined          0.308  0.200  ? 4082 ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined    0.152  0.200  ? 326  ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined   0.245  0.200  ? 54   ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined 0.164  0.200  ? 12   ? 'X-RAY DIFFRACTION' 
r_mcbond_it              2.633  3.000  ? 3914 ? 'X-RAY DIFFRACTION' 
r_mcangle_it             3.683  5.000  ? 6171 ? 'X-RAY DIFFRACTION' 
r_scbond_it              6.144  8.000  ? 2476 ? 'X-RAY DIFFRACTION' 
r_scangle_it             8.258  11.000 ? 2075 ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.995 
_refine_ls_shell.d_res_low                        2.047 
_refine_ls_shell.number_reflns_R_work             3204 
_refine_ls_shell.R_factor_R_work                  0.264 
_refine_ls_shell.percent_reflns_obs               75.31 
_refine_ls_shell.R_factor_R_free                  0.340 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             179 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  4LL1 
_struct.title                     'The structure of the TRX and TXNIP complex' 
_struct.pdbx_descriptor           'Thioredoxin-interacting protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4LL1 
_struct_keywords.pdbx_keywords   'ANTITUMOR PROTEIN/PROTEIN BINDING' 
_struct_keywords.text            'Arrestin-like domain, ANTITUMOR PROTEIN-PROTEIN BINDING complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PHE B 11 ? ASP B 16  ? PHE B 11 ASP B 16  1 ? 6  
HELX_P HELX_P2 2 CYS B 32 ? TYR B 49  ? CYS B 32 TYR B 49  1 ? 18 
HELX_P HELX_P3 3 CYS B 62 ? GLU B 70  ? CYS B 62 GLU B 70  1 ? 9  
HELX_P HELX_P4 4 ASN B 93 ? VAL B 105 ? ASN B 93 VAL B 105 1 ? 13 
HELX_P HELX_P5 5 SER D 7  ? ALA D 18  ? SER D 7  ALA D 18  1 ? 12 
HELX_P HELX_P6 6 CYS D 32 ? TYR D 49  ? CYS D 32 TYR D 49  1 ? 18 
HELX_P HELX_P7 7 CYS D 62 ? CYS D 69  ? CYS D 62 CYS D 69  1 ? 8  
HELX_P HELX_P8 8 ASN D 93 ? VAL D 105 ? ASN D 93 VAL D 105 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 61  SG ? ? ? 1_555 A CYS 188 SG ? ? A CYS 63  A CYS 190 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf2 disulf ? ? A CYS 245 SG ? ? ? 1_555 B CYS 32  SG ? ? A CYS 247 B CYS 32  1_555 ? ? ? ? ? ? ? 2.714 ? 
disulf3 disulf ? ? C CYS 61  SG ? ? ? 1_555 C CYS 188 SG ? ? C CYS 63  C CYS 190 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf4 disulf ? ? C CYS 245 SG ? ? ? 1_555 D CYS 32  SG ? ? C CYS 247 D CYS 32  1_555 ? ? ? ? ? ? ? 2.163 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 MET 74 B . ? MET 74 B PRO 75 B ? PRO 75 B 1 -9.51 
2 MET 74 D . ? MET 74 D PRO 75 D ? PRO 75 D 1 -7.33 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 2 ? 
D ? 4 ? 
E ? 4 ? 
F ? 5 ? 
G ? 5 ? 
H ? 3 ? 
I ? 5 ? 
J ? 4 ? 
K ? 2 ? 
L ? 4 ? 
M ? 5 ? 
N ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? parallel      
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
M 4 5 ? anti-parallel 
N 1 2 ? parallel      
N 2 3 ? parallel      
N 3 4 ? anti-parallel 
N 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 7   ? PHE A 12  ? SER A 9   PHE A 14  
A 2 LYS A 24  ? GLU A 32  ? LYS A 26  GLU A 34  
A 3 TYR A 95  ? GLU A 102 ? TYR A 97  GLU A 104 
B 1 VAL A 18  ? TYR A 19  ? VAL A 20  TYR A 21  
B 2 GLU A 142 ? VAL A 143 ? GLU A 144 VAL A 145 
C 1 THR A 37  ? VAL A 39  ? THR A 39  VAL A 41  
C 2 VAL A 87  ? MET A 89  ? VAL A 89  MET A 91  
D 1 GLN A 59  ? LEU A 74  ? GLN A 61  LEU A 76  
D 2 ALA A 41  ? GLN A 56  ? ALA A 43  GLN A 58  
D 3 GLY A 117 ? ASP A 128 ? GLY A 119 ASP A 130 
D 4 GLN A 135 ? ASN A 140 ? GLN A 137 ASN A 142 
E 1 VAL A 158 ? LYS A 165 ? VAL A 160 LYS A 167 
E 2 ARG A 175 ? ILE A 182 ? ARG A 177 ILE A 184 
E 3 GLU A 192 ? ASN A 201 ? GLU A 194 ASN A 203 
E 4 THR A 244 ? ARG A 254 ? THR A 246 ARG A 256 
F 1 GLY A 186 ? CYS A 188 ? GLY A 188 CYS A 190 
F 2 VAL A 286 ? GLY A 295 ? VAL A 288 GLY A 297 
F 3 ILE A 267 ? SER A 279 ? ILE A 269 SER A 281 
F 4 VAL A 208 ? ALA A 221 ? VAL A 210 ALA A 223 
F 5 GLN A 224 ? ARG A 236 ? GLN A 226 ARG A 238 
G 1 LYS B 3   ? GLN B 4   ? LYS B 3   GLN B 4   
G 2 ILE B 53  ? ASP B 58  ? ILE B 53  ASP B 58  
G 3 VAL B 23  ? SER B 28  ? VAL B 23  SER B 28  
G 4 THR B 76  ? PHE B 80  ? THR B 76  PHE B 80  
G 5 LYS B 85  ? SER B 90  ? LYS B 85  SER B 90  
H 1 SER C 7   ? PHE C 12  ? SER C 9   PHE C 14  
H 2 LYS C 24  ? GLU C 32  ? LYS C 26  GLU C 34  
H 3 TYR C 95  ? GLU C 102 ? TYR C 97  GLU C 104 
I 1 VAL C 18  ? TYR C 19  ? VAL C 20  TYR C 21  
I 2 GLN C 135 ? VAL C 143 ? GLN C 137 VAL C 145 
I 3 GLY C 117 ? ASP C 128 ? GLY C 119 ASP C 130 
I 4 ALA C 41  ? GLN C 56  ? ALA C 43  GLN C 58  
I 5 GLN C 59  ? THR C 73  ? GLN C 61  THR C 75  
J 1 VAL C 18  ? TYR C 19  ? VAL C 20  TYR C 21  
J 2 GLN C 135 ? VAL C 143 ? GLN C 137 VAL C 145 
J 3 GLY C 117 ? ASP C 128 ? GLY C 119 ASP C 130 
J 4 PHE C 112 ? GLY C 114 ? PHE C 114 GLY C 116 
K 1 THR C 37  ? VAL C 39  ? THR C 39  VAL C 41  
K 2 VAL C 87  ? MET C 89  ? VAL C 89  MET C 91  
L 1 VAL C 158 ? LYS C 165 ? VAL C 160 LYS C 167 
L 2 ARG C 175 ? ILE C 182 ? ARG C 177 ILE C 184 
L 3 GLU C 192 ? ASN C 201 ? GLU C 194 ASN C 203 
L 4 THR C 244 ? ARG C 254 ? THR C 246 ARG C 256 
M 1 GLY C 186 ? CYS C 188 ? GLY C 188 CYS C 190 
M 2 VAL C 286 ? GLY C 295 ? VAL C 288 GLY C 297 
M 3 ILE C 267 ? SER C 279 ? ILE C 269 SER C 281 
M 4 VAL C 208 ? ALA C 221 ? VAL C 210 ALA C 223 
M 5 GLN C 224 ? ARG C 236 ? GLN C 226 ARG C 238 
N 1 LYS D 3   ? ILE D 5   ? LYS D 3   ILE D 5   
N 2 ILE D 53  ? ASP D 58  ? ILE D 53  ASP D 58  
N 3 VAL D 23  ? SER D 28  ? VAL D 23  SER D 28  
N 4 THR D 76  ? LYS D 81  ? THR D 76  LYS D 81  
N 5 GLN D 84  ? SER D 90  ? GLN D 84  SER D 90  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 11  ? N VAL A 13  O ARG A 28  ? O ARG A 30  
A 2 3 N VAL A 31  ? N VAL A 33  O TYR A 95  ? O TYR A 97  
B 1 2 N TYR A 19  ? N TYR A 21  O GLU A 142 ? O GLU A 144 
C 1 2 N THR A 37  ? N THR A 39  O MET A 89  ? O MET A 91  
D 1 2 O GLN A 63  ? O GLN A 65  N VAL A 52  ? N VAL A 54  
D 2 3 N CYS A 47  ? N CYS A 49  O TRP A 122 ? O TRP A 124 
D 3 4 N LEU A 127 ? N LEU A 129 O GLN A 135 ? O GLN A 137 
E 1 2 N ALA A 160 ? N ALA A 162 O ALA A 180 ? O ALA A 182 
E 2 3 N SER A 179 ? N SER A 181 O ASP A 198 ? O ASP A 200 
E 3 4 N ILE A 195 ? N ILE A 197 O LYS A 251 ? O LYS A 253 
F 1 2 N PHE A 187 ? N PHE A 189 O VAL A 293 ? O VAL A 295 
F 2 3 O LEU A 288 ? O LEU A 290 N ILE A 276 ? N ILE A 278 
F 3 4 O LEU A 275 ? O LEU A 277 N ALA A 212 ? N ALA A 214 
F 4 5 N ILE A 213 ? N ILE A 215 O LEU A 232 ? O LEU A 234 
G 1 2 N LYS B 3   ? N LYS B 3   O GLU B 56  ? O GLU B 56  
G 2 3 O LEU B 55  ? O LEU B 55  N ASP B 26  ? N ASP B 26  
G 3 4 N VAL B 23  ? N VAL B 23  O PHE B 80  ? O PHE B 80  
G 4 5 N PHE B 79  ? N PHE B 79  O VAL B 86  ? O VAL B 86  
H 1 2 N VAL C 11  ? N VAL C 13  O ARG C 28  ? O ARG C 30  
H 2 3 N VAL C 25  ? N VAL C 27  O PHE C 101 ? O PHE C 103 
I 1 2 N TYR C 19  ? N TYR C 21  O GLU C 142 ? O GLU C 144 
I 2 3 O LYS C 139 ? O LYS C 141 N VAL C 123 ? N VAL C 125 
I 3 4 O LYS C 124 ? O LYS C 126 N LEU C 45  ? N LEU C 47  
I 4 5 N GLN C 56  ? N GLN C 58  O GLN C 59  ? O GLN C 61  
J 1 2 N TYR C 19  ? N TYR C 21  O GLU C 142 ? O GLU C 144 
J 2 3 O LYS C 139 ? O LYS C 141 N VAL C 123 ? N VAL C 125 
J 3 4 O VAL C 119 ? O VAL C 121 N PHE C 112 ? N PHE C 114 
K 1 2 N THR C 37  ? N THR C 39  O MET C 89  ? O MET C 91  
L 1 2 N LYS C 164 ? N LYS C 166 O VAL C 176 ? O VAL C 178 
L 2 3 N ARG C 181 ? N ARG C 183 O HIS C 196 ? O HIS C 198 
L 3 4 N ILE C 195 ? N ILE C 197 O LYS C 251 ? O LYS C 253 
M 1 2 N PHE C 187 ? N PHE C 189 O VAL C 293 ? O VAL C 295 
M 2 3 O LEU C 288 ? O LEU C 290 N ILE C 276 ? N ILE C 278 
M 3 4 O LEU C 275 ? O LEU C 277 N ALA C 212 ? N ALA C 214 
M 4 5 N ALA C 221 ? N ALA C 223 O GLN C 224 ? O GLN C 226 
N 1 2 N ILE D 5   ? N ILE D 5   O GLU D 56  ? O GLU D 56  
N 2 3 O LEU D 55  ? O LEU D 55  N ASP D 26  ? N ASP D 26  
N 3 4 N VAL D 23  ? N VAL D 23  O PHE D 80  ? O PHE D 80  
N 4 5 N PHE D 79  ? N PHE D 79  O VAL D 86  ? O VAL D 86  
# 
_database_PDB_matrix.entry_id          4LL1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4LL1 
_atom_sites.fract_transf_matrix[1][1]   0.012479 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000278 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015620 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011328 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 5   ? -11.353 -8.077  73.631 1.00 85.07  ? 7   ILE A N   1 
ATOM   2    C CA  . ILE A 1 5   ? -11.103 -6.775  72.926 1.00 82.68  ? 7   ILE A CA  1 
ATOM   3    C C   . ILE A 1 5   ? -11.933 -5.666  73.544 1.00 85.56  ? 7   ILE A C   1 
ATOM   4    O O   . ILE A 1 5   ? -13.167 -5.731  73.557 1.00 90.38  ? 7   ILE A O   1 
ATOM   5    C CB  . ILE A 1 5   ? -11.345 -6.859  71.396 1.00 77.50  ? 7   ILE A CB  1 
ATOM   6    C CG1 . ILE A 1 5   ? -10.312 -7.774  70.728 1.00 77.34  ? 7   ILE A CG1 1 
ATOM   7    C CG2 . ILE A 1 5   ? -11.259 -5.481  70.748 1.00 69.91  ? 7   ILE A CG2 1 
ATOM   8    C CD1 . ILE A 1 5   ? -8.892  -7.180  70.587 1.00 74.47  ? 7   ILE A CD1 1 
ATOM   9    N N   . LYS A 1 6   ? -11.239 -4.641  74.032 1.00 85.04  ? 8   LYS A N   1 
ATOM   10   C CA  . LYS A 1 6   ? -11.836 -3.567  74.832 1.00 89.24  ? 8   LYS A CA  1 
ATOM   11   C C   . LYS A 1 6   ? -12.931 -2.791  74.103 1.00 88.26  ? 8   LYS A C   1 
ATOM   12   O O   . LYS A 1 6   ? -14.047 -2.658  74.602 1.00 94.90  ? 8   LYS A O   1 
ATOM   13   C CB  . LYS A 1 6   ? -10.738 -2.613  75.313 1.00 90.71  ? 8   LYS A CB  1 
ATOM   14   C CG  . LYS A 1 6   ? -11.056 -1.932  76.619 1.00 100.48 ? 8   LYS A CG  1 
ATOM   15   C CD  . LYS A 1 6   ? -9.897  -1.092  77.111 1.00 106.23 ? 8   LYS A CD  1 
ATOM   16   C CE  . LYS A 1 6   ? -9.879  0.267   76.441 1.00 104.27 ? 8   LYS A CE  1 
ATOM   17   N NZ  . LYS A 1 6   ? -8.838  1.128   77.063 1.00 122.80 ? 8   LYS A NZ  1 
ATOM   18   N N   . SER A 1 7   ? -12.585 -2.256  72.943 1.00 82.78  ? 9   SER A N   1 
ATOM   19   C CA  . SER A 1 7   ? -13.513 -1.588  72.052 1.00 79.47  ? 9   SER A CA  1 
ATOM   20   C C   . SER A 1 7   ? -13.079 -1.745  70.601 1.00 74.57  ? 9   SER A C   1 
ATOM   21   O O   . SER A 1 7   ? -11.879 -1.839  70.292 1.00 73.32  ? 9   SER A O   1 
ATOM   22   C CB  . SER A 1 7   ? -13.592 -0.097  72.355 1.00 84.16  ? 9   SER A CB  1 
ATOM   23   O OG  . SER A 1 7   ? -12.345 0.521   72.090 1.00 86.90  ? 9   SER A OG  1 
ATOM   24   N N   . PHE A 1 8   ? -14.076 -1.728  69.724 1.00 74.18  ? 10  PHE A N   1 
ATOM   25   C CA  . PHE A 1 8   ? -13.926 -1.909  68.282 1.00 70.13  ? 10  PHE A CA  1 
ATOM   26   C C   . PHE A 1 8   ? -15.191 -1.305  67.713 1.00 70.23  ? 10  PHE A C   1 
ATOM   27   O O   . PHE A 1 8   ? -16.292 -1.829  67.920 1.00 71.50  ? 10  PHE A O   1 
ATOM   28   C CB  . PHE A 1 8   ? -13.812 -3.403  67.941 1.00 65.60  ? 10  PHE A CB  1 
ATOM   29   C CG  . PHE A 1 8   ? -13.514 -3.680  66.502 1.00 62.97  ? 10  PHE A CG  1 
ATOM   30   C CD1 . PHE A 1 8   ? -12.469 -3.053  65.864 1.00 62.59  ? 10  PHE A CD1 1 
ATOM   31   C CD2 . PHE A 1 8   ? -14.288 -4.581  65.783 1.00 51.86  ? 10  PHE A CD2 1 
ATOM   32   C CE1 . PHE A 1 8   ? -12.199 -3.329  64.526 1.00 56.48  ? 10  PHE A CE1 1 
ATOM   33   C CE2 . PHE A 1 8   ? -14.026 -4.846  64.464 1.00 58.32  ? 10  PHE A CE2 1 
ATOM   34   C CZ  . PHE A 1 8   ? -12.998 -4.213  63.831 1.00 53.90  ? 10  PHE A CZ  1 
ATOM   35   N N   . GLU A 1 9   ? -15.039 -0.157  67.056 1.00 69.63  ? 11  GLU A N   1 
ATOM   36   C CA  . GLU A 1 9   ? -16.169 0.640   66.645 1.00 71.64  ? 11  GLU A CA  1 
ATOM   37   C C   . GLU A 1 9   ? -15.879 1.447   65.376 1.00 67.82  ? 11  GLU A C   1 
ATOM   38   O O   . GLU A 1 9   ? -14.760 1.920   65.174 1.00 67.21  ? 11  GLU A O   1 
ATOM   39   C CB  . GLU A 1 9   ? -16.591 1.619   67.769 1.00 77.25  ? 11  GLU A CB  1 
ATOM   40   C CG  . GLU A 1 9   ? -17.170 0.992   69.078 1.00 90.80  ? 11  GLU A CG  1 
ATOM   41   C CD  . GLU A 1 9   ? -18.509 0.261   68.904 1.00 99.93  ? 11  GLU A CD  1 
ATOM   42   O OE1 . GLU A 1 9   ? -19.303 0.626   68.006 1.00 101.29 ? 11  GLU A OE1 1 
ATOM   43   O OE2 . GLU A 1 9   ? -18.770 -0.679  69.690 1.00 101.28 ? 11  GLU A OE2 1 
ATOM   44   N N   . VAL A 1 10  ? -16.909 1.609   64.549 1.00 67.17  ? 12  VAL A N   1 
ATOM   45   C CA  . VAL A 1 10  ? -16.891 2.527   63.396 1.00 67.61  ? 12  VAL A CA  1 
ATOM   46   C C   . VAL A 1 10  ? -17.396 3.908   63.866 1.00 74.14  ? 12  VAL A C   1 
ATOM   47   O O   . VAL A 1 10  ? -18.530 4.013   64.326 1.00 76.87  ? 12  VAL A O   1 
ATOM   48   C CB  . VAL A 1 10  ? -17.813 1.975   62.274 1.00 67.38  ? 12  VAL A CB  1 
ATOM   49   C CG1 . VAL A 1 10  ? -17.854 2.901   61.027 1.00 60.01  ? 12  VAL A CG1 1 
ATOM   50   C CG2 . VAL A 1 10  ? -17.367 0.545   61.856 1.00 62.25  ? 12  VAL A CG2 1 
ATOM   51   N N   . VAL A 1 11  ? -16.566 4.953   63.788 1.00 76.01  ? 13  VAL A N   1 
ATOM   52   C CA  . VAL A 1 11  ? -17.013 6.302   64.151 1.00 81.58  ? 13  VAL A CA  1 
ATOM   53   C C   . VAL A 1 11  ? -16.863 7.263   62.968 1.00 81.50  ? 13  VAL A C   1 
ATOM   54   O O   . VAL A 1 11  ? -15.756 7.692   62.636 1.00 82.12  ? 13  VAL A O   1 
ATOM   55   C CB  . VAL A 1 11  ? -16.313 6.874   65.432 1.00 86.09  ? 13  VAL A CB  1 
ATOM   56   C CG1 . VAL A 1 11  ? -17.005 8.186   65.927 1.00 94.47  ? 13  VAL A CG1 1 
ATOM   57   C CG2 . VAL A 1 11  ? -16.296 5.837   66.583 1.00 89.24  ? 13  VAL A CG2 1 
ATOM   58   N N   . PHE A 1 12  ? -17.991 7.583   62.337 1.00 81.12  ? 14  PHE A N   1 
ATOM   59   C CA  . PHE A 1 12  ? -18.049 8.552   61.227 1.00 84.35  ? 14  PHE A CA  1 
ATOM   60   C C   . PHE A 1 12  ? -17.662 9.929   61.736 1.00 90.45  ? 14  PHE A C   1 
ATOM   61   O O   . PHE A 1 12  ? -17.846 10.211  62.922 1.00 93.96  ? 14  PHE A O   1 
ATOM   62   C CB  . PHE A 1 12  ? -19.457 8.600   60.616 1.00 82.35  ? 14  PHE A CB  1 
ATOM   63   C CG  . PHE A 1 12  ? -19.930 7.274   60.065 1.00 77.76  ? 14  PHE A CG  1 
ATOM   64   C CD1 . PHE A 1 12  ? -19.450 6.799   58.845 1.00 72.84  ? 14  PHE A CD1 1 
ATOM   65   C CD2 . PHE A 1 12  ? -20.855 6.508   60.766 1.00 73.46  ? 14  PHE A CD2 1 
ATOM   66   C CE1 . PHE A 1 12  ? -19.871 5.573   58.339 1.00 70.81  ? 14  PHE A CE1 1 
ATOM   67   C CE2 . PHE A 1 12  ? -21.289 5.293   60.269 1.00 71.27  ? 14  PHE A CE2 1 
ATOM   68   C CZ  . PHE A 1 12  ? -20.789 4.810   59.047 1.00 70.45  ? 14  PHE A CZ  1 
ATOM   69   N N   . ASN A 1 13  ? -17.096 10.763  60.863 1.00 93.81  ? 15  ASN A N   1 
ATOM   70   C CA  . ASN A 1 13  ? -16.657 12.112  61.257 1.00 101.27 ? 15  ASN A CA  1 
ATOM   71   C C   . ASN A 1 13  ? -17.827 13.025  61.625 1.00 107.03 ? 15  ASN A C   1 
ATOM   72   O O   . ASN A 1 13  ? -17.717 13.850  62.538 1.00 111.91 ? 15  ASN A O   1 
ATOM   73   C CB  . ASN A 1 13  ? -15.792 12.755  60.168 1.00 101.79 ? 15  ASN A CB  1 
ATOM   74   C CG  . ASN A 1 13  ? -14.440 12.061  59.990 1.00 102.44 ? 15  ASN A CG  1 
ATOM   75   O OD1 . ASN A 1 13  ? -13.847 11.540  60.945 1.00 105.06 ? 15  ASN A OD1 1 
ATOM   76   N ND2 . ASN A 1 13  ? -13.944 12.060  58.756 1.00 98.61  ? 15  ASN A ND2 1 
ATOM   77   N N   . ASP A 1 14  ? -18.936 12.866  60.907 1.00 107.75 ? 16  ASP A N   1 
ATOM   78   C CA  . ASP A 1 14  ? -20.215 13.489  61.250 1.00 113.62 ? 16  ASP A CA  1 
ATOM   79   C C   . ASP A 1 14  ? -21.232 12.384  61.564 1.00 112.90 ? 16  ASP A C   1 
ATOM   80   O O   . ASP A 1 14  ? -21.906 11.872  60.656 1.00 110.14 ? 16  ASP A O   1 
ATOM   81   C CB  . ASP A 1 14  ? -20.717 14.383  60.099 1.00 114.75 ? 16  ASP A CB  1 
ATOM   82   C CG  . ASP A 1 14  ? -21.948 15.220  60.483 1.00 121.27 ? 16  ASP A CG  1 
ATOM   83   O OD1 . ASP A 1 14  ? -22.343 15.216  61.669 1.00 120.14 ? 16  ASP A OD1 1 
ATOM   84   O OD2 . ASP A 1 14  ? -22.523 15.889  59.591 1.00 123.60 ? 16  ASP A OD2 1 
ATOM   85   N N   . PRO A 1 15  ? -21.332 12.000  62.850 1.00 115.91 ? 17  PRO A N   1 
ATOM   86   C CA  . PRO A 1 15  ? -22.145 10.867  63.325 1.00 117.08 ? 17  PRO A CA  1 
ATOM   87   C C   . PRO A 1 15  ? -23.666 11.024  63.192 1.00 120.72 ? 17  PRO A C   1 
ATOM   88   O O   . PRO A 1 15  ? -24.405 10.049  63.367 1.00 119.09 ? 17  PRO A O   1 
ATOM   89   C CB  . PRO A 1 15  ? -21.737 10.743  64.804 1.00 120.06 ? 17  PRO A CB  1 
ATOM   90   C CG  . PRO A 1 15  ? -20.425 11.471  64.905 1.00 121.36 ? 17  PRO A CG  1 
ATOM   91   C CD  . PRO A 1 15  ? -20.597 12.621  63.963 1.00 120.41 ? 17  PRO A CD  1 
ATOM   92   N N   . GLU A 1 16  ? -24.122 12.239  62.905 1.00 126.77 ? 18  GLU A N   1 
ATOM   93   C CA  . GLU A 1 16  ? -25.530 12.490  62.619 1.00 129.40 ? 18  GLU A CA  1 
ATOM   94   C C   . GLU A 1 16  ? -25.650 13.180  61.269 1.00 129.34 ? 18  GLU A C   1 
ATOM   95   O O   . GLU A 1 16  ? -25.949 14.376  61.203 1.00 134.84 ? 18  GLU A O   1 
ATOM   96   C CB  . GLU A 1 16  ? -26.185 13.339  63.724 1.00 135.94 ? 18  GLU A CB  1 
ATOM   97   C CG  . GLU A 1 16  ? -26.421 12.609  65.050 1.00 136.51 ? 18  GLU A CG  1 
ATOM   98   C CD  . GLU A 1 16  ? -27.628 13.138  65.827 1.00 143.71 ? 18  GLU A CD  1 
ATOM   99   O OE1 . GLU A 1 16  ? -28.330 14.057  65.336 1.00 140.89 ? 18  GLU A OE1 1 
ATOM   100  O OE2 . GLU A 1 16  ? -27.879 12.619  66.938 1.00 145.12 ? 18  GLU A OE2 1 
ATOM   101  N N   . LYS A 1 17  ? -25.400 12.431  60.197 1.00 124.68 ? 19  LYS A N   1 
ATOM   102  C CA  . LYS A 1 17  ? -25.530 12.972  58.848 1.00 123.19 ? 19  LYS A CA  1 
ATOM   103  C C   . LYS A 1 17  ? -26.271 12.064  57.890 1.00 120.07 ? 19  LYS A C   1 
ATOM   104  O O   . LYS A 1 17  ? -26.099 10.843  57.910 1.00 116.55 ? 19  LYS A O   1 
ATOM   105  C CB  . LYS A 1 17  ? -24.175 13.335  58.232 1.00 121.49 ? 19  LYS A CB  1 
ATOM   106  C CG  . LYS A 1 17  ? -24.330 14.156  56.950 1.00 118.53 ? 19  LYS A CG  1 
ATOM   107  C CD  . LYS A 1 17  ? -23.012 14.543  56.320 1.00 119.01 ? 19  LYS A CD  1 
ATOM   108  C CE  . LYS A 1 17  ? -23.239 15.121  54.926 1.00 116.26 ? 19  LYS A CE  1 
ATOM   109  N NZ  . LYS A 1 17  ? -21.971 15.547  54.271 1.00 111.52 ? 19  LYS A NZ  1 
ATOM   110  N N   . VAL A 1 18  ? -27.102 12.703  57.068 1.00 121.80 ? 20  VAL A N   1 
ATOM   111  C CA  . VAL A 1 18  ? -27.692 12.129  55.872 1.00 119.11 ? 20  VAL A CA  1 
ATOM   112  C C   . VAL A 1 18  ? -26.743 12.494  54.731 1.00 117.85 ? 20  VAL A C   1 
ATOM   113  O O   . VAL A 1 18  ? -26.622 13.670  54.364 1.00 120.91 ? 20  VAL A O   1 
ATOM   114  C CB  . VAL A 1 18  ? -29.101 12.745  55.597 1.00 121.81 ? 20  VAL A CB  1 
ATOM   115  C CG1 . VAL A 1 18  ? -29.579 12.468  54.175 1.00 118.88 ? 20  VAL A CG1 1 
ATOM   116  C CG2 . VAL A 1 18  ? -30.124 12.254  56.611 1.00 125.57 ? 20  VAL A CG2 1 
ATOM   117  N N   . TYR A 1 19  ? -26.060 11.487  54.186 1.00 112.70 ? 21  TYR A N   1 
ATOM   118  C CA  . TYR A 1 19  ? -25.133 11.696  53.079 1.00 109.95 ? 21  TYR A CA  1 
ATOM   119  C C   . TYR A 1 19  ? -25.894 11.669  51.751 1.00 109.32 ? 21  TYR A C   1 
ATOM   120  O O   . TYR A 1 19  ? -26.881 10.935  51.610 1.00 108.64 ? 21  TYR A O   1 
ATOM   121  C CB  . TYR A 1 19  ? -24.005 10.644  53.099 1.00 106.30 ? 21  TYR A CB  1 
ATOM   122  C CG  . TYR A 1 19  ? -23.113 10.688  54.334 1.00 101.51 ? 21  TYR A CG  1 
ATOM   123  C CD1 . TYR A 1 19  ? -21.996 11.525  54.382 1.00 101.75 ? 21  TYR A CD1 1 
ATOM   124  C CD2 . TYR A 1 19  ? -23.388 9.890   55.455 1.00 101.35 ? 21  TYR A CD2 1 
ATOM   125  C CE1 . TYR A 1 19  ? -21.167 11.571  55.529 1.00 108.03 ? 21  TYR A CE1 1 
ATOM   126  C CE2 . TYR A 1 19  ? -22.566 9.924   56.611 1.00 103.32 ? 21  TYR A CE2 1 
ATOM   127  C CZ  . TYR A 1 19  ? -21.458 10.772  56.643 1.00 104.78 ? 21  TYR A CZ  1 
ATOM   128  O OH  . TYR A 1 19  ? -20.639 10.824  57.769 1.00 101.66 ? 21  TYR A OH  1 
ATOM   129  N N   . GLY A 1 20  ? -25.441 12.467  50.785 1.00 109.57 ? 22  GLY A N   1 
ATOM   130  C CA  . GLY A 1 20  ? -26.093 12.536  49.472 1.00 108.56 ? 22  GLY A CA  1 
ATOM   131  C C   . GLY A 1 20  ? -25.471 11.666  48.389 1.00 105.05 ? 22  GLY A C   1 
ATOM   132  O O   . GLY A 1 20  ? -24.597 10.847  48.666 1.00 103.32 ? 22  GLY A O   1 
ATOM   133  N N   . SER A 1 21  ? -25.941 11.842  47.154 1.00 104.25 ? 23  SER A N   1 
ATOM   134  C CA  . SER A 1 21  ? -25.328 11.228  45.970 1.00 99.99  ? 23  SER A CA  1 
ATOM   135  C C   . SER A 1 21  ? -23.917 11.800  45.753 1.00 99.69  ? 23  SER A C   1 
ATOM   136  O O   . SER A 1 21  ? -23.645 12.961  46.110 1.00 101.47 ? 23  SER A O   1 
ATOM   137  C CB  . SER A 1 21  ? -26.208 11.454  44.730 1.00 99.74  ? 23  SER A CB  1 
ATOM   138  O OG  . SER A 1 21  ? -25.702 10.771  43.592 1.00 95.50  ? 23  SER A OG  1 
ATOM   139  N N   . GLY A 1 22  ? -23.025 10.974  45.199 1.00 94.94  ? 24  GLY A N   1 
ATOM   140  C CA  . GLY A 1 22  ? -21.625 11.356  44.970 1.00 94.63  ? 24  GLY A CA  1 
ATOM   141  C C   . GLY A 1 22  ? -20.938 11.972  46.177 1.00 96.73  ? 24  GLY A C   1 
ATOM   142  O O   . GLY A 1 22  ? -19.983 12.734  46.031 1.00 98.37  ? 24  GLY A O   1 
ATOM   143  N N   . GLU A 1 23  ? -21.454 11.664  47.353 1.00 96.83  ? 25  GLU A N   1 
ATOM   144  C CA  . GLU A 1 23  ? -20.973 12.236  48.594 1.00 100.15 ? 25  GLU A CA  1 
ATOM   145  C C   . GLU A 1 23  ? -19.927 11.354  49.299 1.00 97.70  ? 25  GLU A C   1 
ATOM   146  O O   . GLU A 1 23  ? -19.994 10.137  49.235 1.00 94.77  ? 25  GLU A O   1 
ATOM   147  C CB  . GLU A 1 23  ? -22.170 12.488  49.503 1.00 103.12 ? 25  GLU A CB  1 
ATOM   148  C CG  . GLU A 1 23  ? -21.867 13.291  50.746 1.00 109.65 ? 25  GLU A CG  1 
ATOM   149  C CD  . GLU A 1 23  ? -21.399 14.677  50.455 1.00 116.39 ? 25  GLU A CD  1 
ATOM   150  O OE1 . GLU A 1 23  ? -20.301 14.812  49.899 1.00 116.23 ? 25  GLU A OE1 1 
ATOM   151  O OE2 . GLU A 1 23  ? -22.129 15.626  50.785 1.00 114.99 ? 25  GLU A OE2 1 
ATOM   152  N N   . LYS A 1 24  ? -18.960 11.987  49.949 1.00 97.87  ? 26  LYS A N   1 
ATOM   153  C CA  . LYS A 1 24  ? -17.909 11.288  50.690 1.00 96.06  ? 26  LYS A CA  1 
ATOM   154  C C   . LYS A 1 24  ? -18.306 10.879  52.072 1.00 93.34  ? 26  LYS A C   1 
ATOM   155  O O   . LYS A 1 24  ? -18.632 11.698  52.885 1.00 98.26  ? 26  LYS A O   1 
ATOM   156  C CB  . LYS A 1 24  ? -16.696 12.170  50.858 1.00 35.15  ? 26  LYS A CB  1 
ATOM   157  C CG  . LYS A 1 24  ? -15.577 11.799  49.972 1.00 34.42  ? 26  LYS A CG  1 
ATOM   158  C CD  . LYS A 1 24  ? -14.408 11.278  50.742 1.00 34.25  ? 26  LYS A CD  1 
ATOM   159  C CE  . LYS A 1 24  ? -13.253 11.041  49.788 1.00 33.86  ? 26  LYS A CE  1 
ATOM   160  N NZ  . LYS A 1 24  ? -12.973 9.601   49.608 1.00 32.08  ? 26  LYS A NZ  1 
ATOM   161  N N   . VAL A 1 25  ? -18.230 9.598   52.343 1.00 87.65  ? 27  VAL A N   1 
ATOM   162  C CA  . VAL A 1 25  ? -18.365 9.083   53.702 1.00 81.86  ? 27  VAL A CA  1 
ATOM   163  C C   . VAL A 1 25  ? -16.951 8.773   54.194 1.00 81.70  ? 27  VAL A C   1 
ATOM   164  O O   . VAL A 1 25  ? -16.209 8.031   53.536 1.00 78.86  ? 27  VAL A O   1 
ATOM   165  C CB  . VAL A 1 25  ? -19.241 7.814   53.739 1.00 77.92  ? 27  VAL A CB  1 
ATOM   166  C CG1 . VAL A 1 25  ? -19.525 7.396   55.169 1.00 73.97  ? 27  VAL A CG1 1 
ATOM   167  C CG2 . VAL A 1 25  ? -20.540 8.039   52.985 1.00 73.26  ? 27  VAL A CG2 1 
ATOM   168  N N   . ALA A 1 26  ? -16.583 9.356   55.338 1.00 82.67  ? 28  ALA A N   1 
ATOM   169  C CA  . ALA A 1 26  ? -15.233 9.255   55.905 1.00 82.05  ? 28  ALA A CA  1 
ATOM   170  C C   . ALA A 1 26  ? -15.308 9.117   57.417 1.00 82.58  ? 28  ALA A C   1 
ATOM   171  O O   . ALA A 1 26  ? -16.206 9.676   58.069 1.00 85.64  ? 28  ALA A O   1 
ATOM   172  C CB  . ALA A 1 26  ? -14.389 10.483  55.532 1.00 83.92  ? 28  ALA A CB  1 
ATOM   173  N N   . GLY A 1 27  ? -14.362 8.383   57.984 1.00 78.52  ? 29  GLY A N   1 
ATOM   174  C CA  . GLY A 1 27  ? -14.381 8.154   59.417 1.00 75.78  ? 29  GLY A CA  1 
ATOM   175  C C   . GLY A 1 27  ? -13.162 7.434   59.911 1.00 73.67  ? 29  GLY A C   1 
ATOM   176  O O   . GLY A 1 27  ? -12.099 7.475   59.291 1.00 71.25  ? 29  GLY A O   1 
ATOM   177  N N   . ARG A 1 28  ? -13.329 6.788   61.057 1.00 72.83  ? 30  ARG A N   1 
ATOM   178  C CA  . ARG A 1 28  ? -12.282 5.976   61.658 1.00 68.11  ? 30  ARG A CA  1 
ATOM   179  C C   . ARG A 1 28  ? -12.833 4.683   62.189 1.00 65.19  ? 30  ARG A C   1 
ATOM   180  O O   . ARG A 1 28  ? -13.937 4.647   62.720 1.00 66.80  ? 30  ARG A O   1 
ATOM   181  C CB  . ARG A 1 28  ? -11.638 6.732   62.821 1.00 72.51  ? 30  ARG A CB  1 
ATOM   182  C CG  . ARG A 1 28  ? -10.485 7.632   62.426 1.00 78.12  ? 30  ARG A CG  1 
ATOM   183  C CD  . ARG A 1 28  ? -10.706 9.075   62.899 1.00 88.48  ? 30  ARG A CD  1 
ATOM   184  N NE  . ARG A 1 28  ? -11.467 9.187   64.143 1.00 91.21  ? 30  ARG A NE  1 
ATOM   185  C CZ  . ARG A 1 28  ? -12.733 9.619   64.241 1.00 101.70 ? 30  ARG A CZ  1 
ATOM   186  N NH1 . ARG A 1 28  ? -13.443 9.979   63.164 1.00 90.91  ? 30  ARG A NH1 1 
ATOM   187  N NH2 . ARG A 1 28  ? -13.305 9.676   65.436 1.00 103.76 ? 30  ARG A NH2 1 
ATOM   188  N N   . VAL A 1 29  ? -12.040 3.622   62.073 1.00 61.38  ? 31  VAL A N   1 
ATOM   189  C CA  . VAL A 1 29  ? -12.237 2.425   62.894 1.00 59.70  ? 31  VAL A CA  1 
ATOM   190  C C   . VAL A 1 29  ? -11.268 2.495   64.070 1.00 60.34  ? 31  VAL A C   1 
ATOM   191  O O   . VAL A 1 29  ? -10.041 2.649   63.889 1.00 59.68  ? 31  VAL A O   1 
ATOM   192  C CB  . VAL A 1 29  ? -11.993 1.132   62.104 1.00 54.12  ? 31  VAL A CB  1 
ATOM   193  C CG1 . VAL A 1 29  ? -12.300 -0.076  62.972 1.00 56.36  ? 31  VAL A CG1 1 
ATOM   194  C CG2 . VAL A 1 29  ? -12.839 1.132   60.886 1.00 56.58  ? 31  VAL A CG2 1 
ATOM   195  N N   . ILE A 1 30  ? -11.821 2.390   65.279 1.00 62.30  ? 32  ILE A N   1 
ATOM   196  C CA  . ILE A 1 30  ? -11.058 2.667   66.463 1.00 64.96  ? 32  ILE A CA  1 
ATOM   197  C C   . ILE A 1 30  ? -10.928 1.401   67.308 1.00 64.71  ? 32  ILE A C   1 
ATOM   198  O O   . ILE A 1 30  ? -11.936 0.782   67.694 1.00 62.03  ? 32  ILE A O   1 
ATOM   199  C CB  . ILE A 1 30  ? -11.653 3.875   67.239 1.00 71.24  ? 32  ILE A CB  1 
ATOM   200  C CG1 . ILE A 1 30  ? -11.612 5.132   66.352 1.00 73.35  ? 32  ILE A CG1 1 
ATOM   201  C CG2 . ILE A 1 30  ? -10.870 4.132   68.496 1.00 74.81  ? 32  ILE A CG2 1 
ATOM   202  C CD1 . ILE A 1 30  ? -12.428 6.309   66.890 1.00 84.53  ? 32  ILE A CD1 1 
ATOM   203  N N   . VAL A 1 31  ? -9.677  0.987   67.534 1.00 64.37  ? 33  VAL A N   1 
ATOM   204  C CA  . VAL A 1 31  ? -9.399  -0.217  68.321 1.00 63.56  ? 33  VAL A CA  1 
ATOM   205  C C   . VAL A 1 31  ? -8.620  0.119   69.606 1.00 66.82  ? 33  VAL A C   1 
ATOM   206  O O   . VAL A 1 31  ? -7.650  0.888   69.592 1.00 68.61  ? 33  VAL A O   1 
ATOM   207  C CB  . VAL A 1 31  ? -8.641  -1.331  67.517 1.00 59.50  ? 33  VAL A CB  1 
ATOM   208  C CG1 . VAL A 1 31  ? -8.790  -2.674  68.215 1.00 58.13  ? 33  VAL A CG1 1 
ATOM   209  C CG2 . VAL A 1 31  ? -9.151  -1.460  66.082 1.00 57.77  ? 33  VAL A CG2 1 
ATOM   210  N N   . GLU A 1 32  ? -9.070  -0.456  70.717 1.00 69.55  ? 34  GLU A N   1 
ATOM   211  C CA  . GLU A 1 32  ? -8.362  -0.391  71.982 1.00 71.95  ? 34  GLU A CA  1 
ATOM   212  C C   . GLU A 1 32  ? -8.369  -1.801  72.545 1.00 72.09  ? 34  GLU A C   1 
ATOM   213  O O   . GLU A 1 32  ? -9.311  -2.563  72.298 1.00 69.74  ? 34  GLU A O   1 
ATOM   214  C CB  . GLU A 1 32  ? -9.036  0.593   72.939 1.00 77.79  ? 34  GLU A CB  1 
ATOM   215  C CG  . GLU A 1 32  ? -9.093  2.019   72.352 1.00 88.32  ? 34  GLU A CG  1 
ATOM   216  C CD  . GLU A 1 32  ? -9.910  3.017   73.174 1.00 97.23  ? 34  GLU A CD  1 
ATOM   217  O OE1 . GLU A 1 32  ? -9.948  2.905   74.414 1.00 94.24  ? 34  GLU A OE1 1 
ATOM   218  O OE2 . GLU A 1 32  ? -10.502 3.938   72.567 1.00 103.97 ? 34  GLU A OE2 1 
ATOM   219  N N   . VAL A 1 33  ? -7.316  -2.159  73.273 1.00 71.65  ? 35  VAL A N   1 
ATOM   220  C CA  . VAL A 1 33  ? -7.231  -3.508  73.804 1.00 75.73  ? 35  VAL A CA  1 
ATOM   221  C C   . VAL A 1 33  ? -6.837  -3.502  75.280 1.00 79.36  ? 35  VAL A C   1 
ATOM   222  O O   . VAL A 1 33  ? -6.186  -2.572  75.748 1.00 79.30  ? 35  VAL A O   1 
ATOM   223  C CB  . VAL A 1 33  ? -6.289  -4.382  72.962 1.00 74.34  ? 35  VAL A CB  1 
ATOM   224  C CG1 . VAL A 1 33  ? -4.829  -3.908  73.088 1.00 75.35  ? 35  VAL A CG1 1 
ATOM   225  C CG2 . VAL A 1 33  ? -6.471  -5.876  73.330 1.00 79.47  ? 35  VAL A CG2 1 
ATOM   226  N N   . CYS A 1 34  ? -7.266  -4.537  75.996 1.00 82.49  ? 36  CYS A N   1 
ATOM   227  C CA  . CYS A 1 34  ? -6.954  -4.709  77.414 1.00 87.43  ? 36  CYS A CA  1 
ATOM   228  C C   . CYS A 1 34  ? -5.518  -5.162  77.624 1.00 86.12  ? 36  CYS A C   1 
ATOM   229  O O   . CYS A 1 34  ? -4.876  -4.793  78.611 1.00 89.59  ? 36  CYS A O   1 
ATOM   230  C CB  . CYS A 1 34  ? -7.915  -5.726  78.027 1.00 87.94  ? 36  CYS A CB  1 
ATOM   231  S SG  . CYS A 1 34  ? -9.633  -5.188  77.940 1.00 106.11 ? 36  CYS A SG  1 
ATOM   232  N N   . GLU A 1 35  ? -5.020  -5.965  76.687 1.00 83.44  ? 37  GLU A N   1 
ATOM   233  C CA  . GLU A 1 35  ? -3.683  -6.563  76.787 1.00 81.00  ? 37  GLU A CA  1 
ATOM   234  C C   . GLU A 1 35  ? -2.948  -6.540  75.447 1.00 77.18  ? 37  GLU A C   1 
ATOM   235  O O   . GLU A 1 35  ? -3.569  -6.351  74.405 1.00 75.56  ? 37  GLU A O   1 
ATOM   236  C CB  . GLU A 1 35  ? -3.792  -8.005  77.283 1.00 80.92  ? 37  GLU A CB  1 
ATOM   237  C CG  . GLU A 1 35  ? -4.462  -8.925  76.292 1.00 83.70  ? 37  GLU A CG  1 
ATOM   238  C CD  . GLU A 1 35  ? -4.919  -10.227 76.898 1.00 98.24  ? 37  GLU A CD  1 
ATOM   239  O OE1 . GLU A 1 35  ? -5.209  -10.261 78.120 1.00 102.86 ? 37  GLU A OE1 1 
ATOM   240  O OE2 . GLU A 1 35  ? -5.001  -11.216 76.134 1.00 101.22 ? 37  GLU A OE2 1 
ATOM   241  N N   . VAL A 1 36  ? -1.632  -6.767  75.483 1.00 73.52  ? 38  VAL A N   1 
ATOM   242  C CA  . VAL A 1 36  ? -0.825  -6.843  74.269 1.00 70.21  ? 38  VAL A CA  1 
ATOM   243  C C   . VAL A 1 36  ? -1.429  -7.816  73.240 1.00 69.90  ? 38  VAL A C   1 
ATOM   244  O O   . VAL A 1 36  ? -1.615  -9.019  73.512 1.00 69.43  ? 38  VAL A O   1 
ATOM   245  C CB  . VAL A 1 36  ? 0.639   -7.210  74.576 1.00 70.42  ? 38  VAL A CB  1 
ATOM   246  C CG1 . VAL A 1 36  ? 1.442   -7.299  73.293 1.00 65.81  ? 38  VAL A CG1 1 
ATOM   247  C CG2 . VAL A 1 36  ? 1.245   -6.171  75.497 1.00 68.49  ? 38  VAL A CG2 1 
ATOM   248  N N   . THR A 1 37  ? -1.727  -7.278  72.060 1.00 64.34  ? 39  THR A N   1 
ATOM   249  C CA  . THR A 1 37  ? -2.528  -7.978  71.074 1.00 61.45  ? 39  THR A CA  1 
ATOM   250  C C   . THR A 1 37  ? -1.874  -7.790  69.728 1.00 55.62  ? 39  THR A C   1 
ATOM   251  O O   . THR A 1 37  ? -1.592  -6.668  69.335 1.00 54.91  ? 39  THR A O   1 
ATOM   252  C CB  . THR A 1 37  ? -3.962  -7.407  71.028 1.00 59.77  ? 39  THR A CB  1 
ATOM   253  O OG1 . THR A 1 37  ? -4.621  -7.695  72.258 1.00 71.17  ? 39  THR A OG1 1 
ATOM   254  C CG2 . THR A 1 37  ? -4.797  -8.007  69.880 1.00 60.25  ? 39  THR A CG2 1 
ATOM   255  N N   . ARG A 1 38  ? -1.623  -8.899  69.048 1.00 53.18  ? 40  ARG A N   1 
ATOM   256  C CA  . ARG A 1 38  ? -1.181  -8.855  67.669 1.00 53.25  ? 40  ARG A CA  1 
ATOM   257  C C   . ARG A 1 38  ? -2.364  -8.968  66.737 1.00 50.39  ? 40  ARG A C   1 
ATOM   258  O O   . ARG A 1 38  ? -3.290  -9.739  66.963 1.00 46.67  ? 40  ARG A O   1 
ATOM   259  C CB  . ARG A 1 38  ? -0.124  -9.920  67.401 1.00 54.47  ? 40  ARG A CB  1 
ATOM   260  C CG  . ARG A 1 38  ? 1.120   -9.689  68.261 1.00 61.29  ? 40  ARG A CG  1 
ATOM   261  C CD  . ARG A 1 38  ? 1.665   -10.958 68.867 1.00 64.07  ? 40  ARG A CD  1 
ATOM   262  N NE  . ARG A 1 38  ? 2.048   -11.955 67.868 1.00 73.43  ? 40  ARG A NE  1 
ATOM   263  C CZ  . ARG A 1 38  ? 1.304   -13.008 67.521 1.00 71.57  ? 40  ARG A CZ  1 
ATOM   264  N NH1 . ARG A 1 38  ? 0.106   -13.230 68.085 1.00 69.68  ? 40  ARG A NH1 1 
ATOM   265  N NH2 . ARG A 1 38  ? 1.762   -13.844 66.607 1.00 60.78  ? 40  ARG A NH2 1 
ATOM   266  N N   . VAL A 1 39  ? -2.303  -8.192  65.663 1.00 48.06  ? 41  VAL A N   1 
ATOM   267  C CA  . VAL A 1 39  ? -3.447  -7.964  64.793 1.00 44.97  ? 41  VAL A CA  1 
ATOM   268  C C   . VAL A 1 39  ? -2.952  -8.130  63.386 1.00 43.94  ? 41  VAL A C   1 
ATOM   269  O O   . VAL A 1 39  ? -1.917  -7.552  63.003 1.00 44.61  ? 41  VAL A O   1 
ATOM   270  C CB  . VAL A 1 39  ? -4.013  -6.517  65.049 1.00 44.08  ? 41  VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 39  ? -4.994  -6.059  63.966 1.00 44.14  ? 41  VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 39  ? -4.684  -6.490  66.328 1.00 44.51  ? 41  VAL A CG2 1 
ATOM   273  N N   . LYS A 1 40  ? -3.654  -8.963  62.632 1.00 42.02  ? 42  LYS A N   1 
ATOM   274  C CA  . LYS A 1 40  ? -3.329  -9.231  61.257 1.00 39.35  ? 42  LYS A CA  1 
ATOM   275  C C   . LYS A 1 40  ? -3.862  -8.163  60.325 1.00 39.79  ? 42  LYS A C   1 
ATOM   276  O O   . LYS A 1 40  ? -3.182  -7.809  59.360 1.00 40.81  ? 42  LYS A O   1 
ATOM   277  C CB  . LYS A 1 40  ? -3.942  -10.564 60.812 1.00 38.03  ? 42  LYS A CB  1 
ATOM   278  C CG  . LYS A 1 40  ? -3.045  -11.758 60.807 1.00 51.85  ? 42  LYS A CG  1 
ATOM   279  C CD  . LYS A 1 40  ? -3.867  -13.029 60.931 1.00 55.03  ? 42  LYS A CD  1 
ATOM   280  C CE  . LYS A 1 40  ? -4.294  -13.565 59.595 1.00 50.45  ? 42  LYS A CE  1 
ATOM   281  N NZ  . LYS A 1 40  ? -3.076  -14.081 58.944 1.00 58.02  ? 42  LYS A NZ  1 
ATOM   282  N N   . ALA A 1 41  ? -5.114  -7.735  60.521 1.00 36.44  ? 43  ALA A N   1 
ATOM   283  C CA  . ALA A 1 41  ? -5.734  -6.732  59.645 1.00 37.12  ? 43  ALA A CA  1 
ATOM   284  C C   . ALA A 1 41  ? -6.915  -6.103  60.293 1.00 39.55  ? 43  ALA A C   1 
ATOM   285  O O   . ALA A 1 41  ? -7.538  -6.676  61.187 1.00 39.66  ? 43  ALA A O   1 
ATOM   286  C CB  . ALA A 1 41  ? -6.176  -7.355  58.299 1.00 40.19  ? 43  ALA A CB  1 
ATOM   287  N N   . VAL A 1 42  ? -7.222  -4.904  59.830 1.00 40.74  ? 44  VAL A N   1 
ATOM   288  C CA  . VAL A 1 42  ? -8.527  -4.302  60.046 1.00 40.31  ? 44  VAL A CA  1 
ATOM   289  C C   . VAL A 1 42  ? -9.031  -3.922  58.674 1.00 41.05  ? 44  VAL A C   1 
ATOM   290  O O   . VAL A 1 42  ? -8.306  -3.267  57.901 1.00 39.83  ? 44  VAL A O   1 
ATOM   291  C CB  . VAL A 1 42  ? -8.433  -3.085  60.936 1.00 46.33  ? 44  VAL A CB  1 
ATOM   292  C CG1 . VAL A 1 42  ? -9.691  -2.259  60.841 1.00 42.02  ? 44  VAL A CG1 1 
ATOM   293  C CG2 . VAL A 1 42  ? -8.174  -3.531  62.394 1.00 47.09  ? 44  VAL A CG2 1 
ATOM   294  N N   . ARG A 1 43  ? -10.240 -4.364  58.336 1.00 38.77  ? 45  ARG A N   1 
ATOM   295  C CA  . ARG A 1 43  ? -10.737 -4.125  56.954 1.00 42.86  ? 45  ARG A CA  1 
ATOM   296  C C   . ARG A 1 43  ? -12.127 -3.572  57.054 1.00 44.00  ? 45  ARG A C   1 
ATOM   297  O O   . ARG A 1 43  ? -12.745 -3.676  58.120 1.00 47.74  ? 45  ARG A O   1 
ATOM   298  C CB  . ARG A 1 43  ? -10.784 -5.420  56.144 1.00 40.71  ? 45  ARG A CB  1 
ATOM   299  C CG  . ARG A 1 43  ? -9.689  -6.352  56.440 1.00 45.14  ? 45  ARG A CG  1 
ATOM   300  C CD  . ARG A 1 43  ? -9.888  -7.706  55.769 1.00 55.68  ? 45  ARG A CD  1 
ATOM   301  N NE  . ARG A 1 43  ? -10.413 -8.734  56.680 1.00 55.48  ? 45  ARG A NE  1 
ATOM   302  C CZ  . ARG A 1 43  ? -11.585 -9.344  56.532 1.00 55.33  ? 45  ARG A CZ  1 
ATOM   303  N NH1 . ARG A 1 43  ? -12.373 -9.036  55.518 1.00 48.95  ? 45  ARG A NH1 1 
ATOM   304  N NH2 . ARG A 1 43  ? -11.969 -10.267 57.400 1.00 44.61  ? 45  ARG A NH2 1 
ATOM   305  N N   . ILE A 1 44  ? -12.597 -2.924  55.993 1.00 45.75  ? 46  ILE A N   1 
ATOM   306  C CA  . ILE A 1 44  ? -14.000 -2.516  55.950 1.00 49.78  ? 46  ILE A CA  1 
ATOM   307  C C   . ILE A 1 44  ? -14.743 -3.019  54.718 1.00 49.71  ? 46  ILE A C   1 
ATOM   308  O O   . ILE A 1 44  ? -14.143 -3.333  53.689 1.00 48.61  ? 46  ILE A O   1 
ATOM   309  C CB  . ILE A 1 44  ? -14.237 -0.973  56.134 1.00 52.26  ? 46  ILE A CB  1 
ATOM   310  C CG1 . ILE A 1 44  ? -13.572 -0.140  55.037 1.00 48.07  ? 46  ILE A CG1 1 
ATOM   311  C CG2 . ILE A 1 44  ? -13.817 -0.535  57.532 1.00 54.25  ? 46  ILE A CG2 1 
ATOM   312  C CD1 . ILE A 1 44  ? -14.151 1.257   54.935 1.00 62.61  ? 46  ILE A CD1 1 
ATOM   313  N N   . LEU A 1 45  ? -16.061 -3.117  54.868 1.00 49.01  ? 47  LEU A N   1 
ATOM   314  C CA  . LEU A 1 45  ? -16.969 -3.413  53.772 1.00 50.65  ? 47  LEU A CA  1 
ATOM   315  C C   . LEU A 1 45  ? -18.115 -2.439  53.960 1.00 51.93  ? 47  LEU A C   1 
ATOM   316  O O   . LEU A 1 45  ? -18.762 -2.436  54.992 1.00 54.27  ? 47  LEU A O   1 
ATOM   317  C CB  . LEU A 1 45  ? -17.477 -4.859  53.864 1.00 47.89  ? 47  LEU A CB  1 
ATOM   318  C CG  . LEU A 1 45  ? -18.639 -5.267  52.959 1.00 50.98  ? 47  LEU A CG  1 
ATOM   319  C CD1 . LEU A 1 45  ? -18.190 -5.376  51.504 1.00 47.56  ? 47  LEU A CD1 1 
ATOM   320  C CD2 . LEU A 1 45  ? -19.226 -6.580  53.434 1.00 55.32  ? 47  LEU A CD2 1 
ATOM   321  N N   . ALA A 1 46  ? -18.315 -1.567  52.989 1.00 52.92  ? 48  ALA A N   1 
ATOM   322  C CA  . ALA A 1 46  ? -19.406 -0.648  53.035 1.00 54.15  ? 48  ALA A CA  1 
ATOM   323  C C   . ALA A 1 46  ? -20.411 -1.113  51.982 1.00 55.84  ? 48  ALA A C   1 
ATOM   324  O O   . ALA A 1 46  ? -20.022 -1.556  50.907 1.00 49.50  ? 48  ALA A O   1 
ATOM   325  C CB  . ALA A 1 46  ? -18.922 0.746   52.767 1.00 55.68  ? 48  ALA A CB  1 
ATOM   326  N N   . CYS A 1 47  ? -21.700 -1.037  52.317 1.00 58.85  ? 49  CYS A N   1 
ATOM   327  C CA  . CYS A 1 47  ? -22.746 -1.601  51.471 1.00 61.38  ? 49  CYS A CA  1 
ATOM   328  C C   . CYS A 1 47  ? -24.022 -0.787  51.471 1.00 62.46  ? 49  CYS A C   1 
ATOM   329  O O   . CYS A 1 47  ? -24.432 -0.272  52.509 1.00 62.26  ? 49  CYS A O   1 
ATOM   330  C CB  . CYS A 1 47  ? -23.089 -3.011  51.923 1.00 61.90  ? 49  CYS A CB  1 
ATOM   331  S SG  . CYS A 1 47  ? -21.922 -4.240  51.330 1.00 80.62  ? 49  CYS A SG  1 
ATOM   332  N N   . GLY A 1 48  ? -24.650 -0.701  50.301 1.00 60.39  ? 50  GLY A N   1 
ATOM   333  C CA  . GLY A 1 48  ? -25.998 -0.117  50.172 1.00 63.73  ? 50  GLY A CA  1 
ATOM   334  C C   . GLY A 1 48  ? -26.867 -1.028  49.322 1.00 62.82  ? 50  GLY A C   1 
ATOM   335  O O   . GLY A 1 48  ? -26.540 -1.308  48.171 1.00 59.46  ? 50  GLY A O   1 
ATOM   336  N N   . VAL A 1 49  ? -27.959 -1.511  49.904 1.00 64.75  ? 51  VAL A N   1 
ATOM   337  C CA  . VAL A 1 49  ? -28.828 -2.497  49.271 1.00 64.53  ? 51  VAL A CA  1 
ATOM   338  C C   . VAL A 1 49  ? -30.300 -2.096  49.436 1.00 68.34  ? 51  VAL A C   1 
ATOM   339  O O   . VAL A 1 49  ? -30.778 -1.899  50.573 1.00 72.45  ? 51  VAL A O   1 
ATOM   340  C CB  . VAL A 1 49  ? -28.614 -3.895  49.895 1.00 65.51  ? 51  VAL A CB  1 
ATOM   341  C CG1 . VAL A 1 49  ? -29.533 -4.928  49.265 1.00 64.88  ? 51  VAL A CG1 1 
ATOM   342  C CG2 . VAL A 1 49  ? -27.161 -4.334  49.732 1.00 66.16  ? 51  VAL A CG2 1 
ATOM   343  N N   . ALA A 1 50  ? -31.016 -1.949  48.320 1.00 65.60  ? 52  ALA A N   1 
ATOM   344  C CA  . ALA A 1 50  ? -32.474 -1.833  48.398 1.00 63.85  ? 52  ALA A CA  1 
ATOM   345  C C   . ALA A 1 50  ? -33.136 -3.180  48.123 1.00 63.71  ? 52  ALA A C   1 
ATOM   346  O O   . ALA A 1 50  ? -32.724 -3.930  47.247 1.00 66.06  ? 52  ALA A O   1 
ATOM   347  C CB  . ALA A 1 50  ? -32.977 -0.780  47.462 1.00 63.63  ? 52  ALA A CB  1 
ATOM   348  N N   . LYS A 1 51  ? -34.156 -3.501  48.890 1.00 69.26  ? 53  LYS A N   1 
ATOM   349  C CA  . LYS A 1 51  ? -34.934 -4.701  48.652 1.00 72.87  ? 53  LYS A CA  1 
ATOM   350  C C   . LYS A 1 51  ? -36.377 -4.269  48.338 1.00 77.26  ? 53  LYS A C   1 
ATOM   351  O O   . LYS A 1 51  ? -37.054 -3.660  49.177 1.00 80.87  ? 53  LYS A O   1 
ATOM   352  C CB  . LYS A 1 51  ? -34.839 -5.631  49.865 1.00 75.82  ? 53  LYS A CB  1 
ATOM   353  C CG  . LYS A 1 51  ? -35.676 -6.902  49.801 1.00 81.03  ? 53  LYS A CG  1 
ATOM   354  C CD  . LYS A 1 51  ? -37.038 -6.760  50.539 1.00 92.97  ? 53  LYS A CD  1 
ATOM   355  C CE  . LYS A 1 51  ? -36.945 -6.868  52.084 1.00 92.62  ? 53  LYS A CE  1 
ATOM   356  N NZ  . LYS A 1 51  ? -36.521 -8.215  52.594 1.00 91.55  ? 53  LYS A NZ  1 
ATOM   357  N N   . VAL A 1 52  ? -36.829 -4.555  47.116 1.00 77.05  ? 54  VAL A N   1 
ATOM   358  C CA  . VAL A 1 52  ? -38.220 -4.273  46.737 1.00 79.31  ? 54  VAL A CA  1 
ATOM   359  C C   . VAL A 1 52  ? -39.021 -5.567  46.744 1.00 79.91  ? 54  VAL A C   1 
ATOM   360  O O   . VAL A 1 52  ? -38.707 -6.498  46.018 1.00 79.35  ? 54  VAL A O   1 
ATOM   361  C CB  . VAL A 1 52  ? -38.330 -3.547  45.378 1.00 76.07  ? 54  VAL A CB  1 
ATOM   362  C CG1 . VAL A 1 52  ? -39.784 -3.211  45.071 1.00 79.92  ? 54  VAL A CG1 1 
ATOM   363  C CG2 . VAL A 1 52  ? -37.483 -2.268  45.389 1.00 77.34  ? 54  VAL A CG2 1 
ATOM   364  N N   . LEU A 1 53  ? -40.053 -5.612  47.577 1.00 83.47  ? 55  LEU A N   1 
ATOM   365  C CA  . LEU A 1 53  ? -40.767 -6.851  47.852 1.00 86.21  ? 55  LEU A CA  1 
ATOM   366  C C   . LEU A 1 53  ? -42.274 -6.640  48.016 1.00 88.79  ? 55  LEU A C   1 
ATOM   367  O O   . LEU A 1 53  ? -42.721 -5.608  48.514 1.00 90.37  ? 55  LEU A O   1 
ATOM   368  C CB  . LEU A 1 53  ? -40.133 -7.542  49.076 1.00 88.89  ? 55  LEU A CB  1 
ATOM   369  C CG  . LEU A 1 53  ? -40.890 -8.408  50.085 1.00 91.75  ? 55  LEU A CG  1 
ATOM   370  C CD1 . LEU A 1 53  ? -40.178 -9.741  50.324 1.00 89.53  ? 55  LEU A CD1 1 
ATOM   371  C CD2 . LEU A 1 53  ? -41.061 -7.632  51.373 1.00 96.97  ? 55  LEU A CD2 1 
ATOM   372  N N   . TRP A 1 54  ? -43.044 -7.622  47.562 1.00 90.35  ? 56  TRP A N   1 
ATOM   373  C CA  . TRP A 1 54  ? -44.500 -7.603  47.648 1.00 94.99  ? 56  TRP A CA  1 
ATOM   374  C C   . TRP A 1 54  ? -44.963 -9.039  47.467 1.00 99.21  ? 56  TRP A C   1 
ATOM   375  O O   . TRP A 1 54  ? -44.144 -9.940  47.288 1.00 95.57  ? 56  TRP A O   1 
ATOM   376  C CB  . TRP A 1 54  ? -45.139 -6.660  46.596 1.00 93.16  ? 56  TRP A CB  1 
ATOM   377  C CG  . TRP A 1 54  ? -45.042 -7.155  45.168 1.00 88.20  ? 56  TRP A CG  1 
ATOM   378  C CD1 . TRP A 1 54  ? -46.012 -7.806  44.460 1.00 85.21  ? 56  TRP A CD1 1 
ATOM   379  C CD2 . TRP A 1 54  ? -43.908 -7.051  44.290 1.00 84.59  ? 56  TRP A CD2 1 
ATOM   380  N NE1 . TRP A 1 54  ? -45.557 -8.113  43.200 1.00 86.68  ? 56  TRP A NE1 1 
ATOM   381  C CE2 . TRP A 1 54  ? -44.270 -7.661  43.067 1.00 79.96  ? 56  TRP A CE2 1 
ATOM   382  C CE3 . TRP A 1 54  ? -42.623 -6.500  44.416 1.00 75.41  ? 56  TRP A CE3 1 
ATOM   383  C CZ2 . TRP A 1 54  ? -43.390 -7.746  41.982 1.00 75.46  ? 56  TRP A CZ2 1 
ATOM   384  C CZ3 . TRP A 1 54  ? -41.753 -6.581  43.331 1.00 74.64  ? 56  TRP A CZ3 1 
ATOM   385  C CH2 . TRP A 1 54  ? -42.145 -7.197  42.130 1.00 65.94  ? 56  TRP A CH2 1 
ATOM   386  N N   . MET A 1 55  ? -46.275 -9.243  47.514 1.00 107.67 ? 57  MET A N   1 
ATOM   387  C CA  . MET A 1 55  ? -46.858 -10.569 47.367 1.00 114.33 ? 57  MET A CA  1 
ATOM   388  C C   . MET A 1 55  ? -48.002 -10.572 46.358 1.00 117.52 ? 57  MET A C   1 
ATOM   389  O O   . MET A 1 55  ? -49.058 -9.995  46.617 1.00 121.18 ? 57  MET A O   1 
ATOM   390  C CB  . MET A 1 55  ? -47.339 -11.084 48.724 1.00 119.18 ? 57  MET A CB  1 
ATOM   391  C CG  . MET A 1 55  ? -46.316 -11.922 49.456 1.00 121.17 ? 57  MET A CG  1 
ATOM   392  S SD  . MET A 1 55  ? -47.142 -13.309 50.239 1.00 131.10 ? 57  MET A SD  1 
ATOM   393  C CE  . MET A 1 55  ? -45.885 -14.577 50.171 1.00 118.09 ? 57  MET A CE  1 
ATOM   394  N N   . GLN A 1 56  ? -47.790 -11.212 45.206 1.00 118.59 ? 58  GLN A N   1 
ATOM   395  C CA  . GLN A 1 56  ? -48.800 -11.243 44.132 1.00 120.65 ? 58  GLN A CA  1 
ATOM   396  C C   . GLN A 1 56  ? -49.907 -12.224 44.524 1.00 125.87 ? 58  GLN A C   1 
ATOM   397  O O   . GLN A 1 56  ? -49.665 -13.435 44.595 1.00 127.76 ? 58  GLN A O   1 
ATOM   398  C CB  . GLN A 1 56  ? -48.158 -11.649 42.798 1.00 117.42 ? 58  GLN A CB  1 
ATOM   399  C CG  . GLN A 1 56  ? -48.944 -11.237 41.557 1.00 119.84 ? 58  GLN A CG  1 
ATOM   400  C CD  . GLN A 1 56  ? -48.759 -9.763  41.183 1.00 123.71 ? 58  GLN A CD  1 
ATOM   401  O OE1 . GLN A 1 56  ? -47.628 -9.269  41.063 1.00 123.12 ? 58  GLN A OE1 1 
ATOM   402  N NE2 . GLN A 1 56  ? -49.877 -9.061  40.978 1.00 118.62 ? 58  GLN A NE2 1 
ATOM   403  N N   . GLY A 1 57  ? -51.106 -11.697 44.792 1.00 129.15 ? 59  GLY A N   1 
ATOM   404  C CA  . GLY A 1 57  ? -52.183 -12.479 45.420 1.00 134.00 ? 59  GLY A CA  1 
ATOM   405  C C   . GLY A 1 57  ? -51.741 -12.984 46.789 1.00 136.31 ? 59  GLY A C   1 
ATOM   406  O O   . GLY A 1 57  ? -52.084 -12.396 47.818 1.00 138.24 ? 59  GLY A O   1 
ATOM   407  N N   . SER A 1 58  ? -50.967 -14.074 46.781 1.00 136.22 ? 60  SER A N   1 
ATOM   408  C CA  . SER A 1 58  ? -50.328 -14.646 47.977 1.00 137.82 ? 60  SER A CA  1 
ATOM   409  C C   . SER A 1 58  ? -49.003 -15.361 47.652 1.00 134.36 ? 60  SER A C   1 
ATOM   410  O O   . SER A 1 58  ? -48.595 -16.302 48.356 1.00 135.15 ? 60  SER A O   1 
ATOM   411  C CB  . SER A 1 58  ? -51.282 -15.606 48.692 1.00 143.93 ? 60  SER A CB  1 
ATOM   412  O OG  . SER A 1 58  ? -52.384 -14.912 49.250 1.00 151.42 ? 60  SER A OG  1 
ATOM   413  N N   . GLN A 1 59  ? -48.342 -14.899 46.588 1.00 129.75 ? 61  GLN A N   1 
ATOM   414  C CA  . GLN A 1 59  ? -47.046 -15.432 46.142 1.00 125.74 ? 61  GLN A CA  1 
ATOM   415  C C   . GLN A 1 59  ? -45.916 -14.471 46.551 1.00 120.19 ? 61  GLN A C   1 
ATOM   416  O O   . GLN A 1 59  ? -46.124 -13.257 46.544 1.00 119.41 ? 61  GLN A O   1 
ATOM   417  C CB  . GLN A 1 59  ? -47.075 -15.619 44.621 1.00 124.00 ? 61  GLN A CB  1 
ATOM   418  C CG  . GLN A 1 59  ? -45.998 -16.555 44.053 1.00 124.44 ? 61  GLN A CG  1 
ATOM   419  C CD  . GLN A 1 59  ? -45.834 -16.433 42.534 1.00 124.71 ? 61  GLN A CD  1 
ATOM   420  O OE1 . GLN A 1 59  ? -44.942 -17.050 41.947 1.00 122.44 ? 61  GLN A OE1 1 
ATOM   421  N NE2 . GLN A 1 59  ? -46.691 -15.632 41.896 1.00 123.79 ? 61  GLN A NE2 1 
ATOM   422  N N   . GLN A 1 60  ? -44.734 -15.006 46.883 1.00 115.93 ? 62  GLN A N   1 
ATOM   423  C CA  . GLN A 1 60  ? -43.600 -14.196 47.408 1.00 110.75 ? 62  GLN A CA  1 
ATOM   424  C C   . GLN A 1 60  ? -42.624 -13.612 46.361 1.00 104.60 ? 62  GLN A C   1 
ATOM   425  O O   . GLN A 1 60  ? -41.641 -14.271 45.966 1.00 102.55 ? 62  GLN A O   1 
ATOM   426  C CB  . GLN A 1 60  ? -42.821 -14.953 48.503 1.00 112.14 ? 62  GLN A CB  1 
ATOM   427  C CG  . GLN A 1 60  ? -42.581 -16.465 48.256 1.00 115.94 ? 62  GLN A CG  1 
ATOM   428  C CD  . GLN A 1 60  ? -43.462 -17.384 49.124 1.00 121.71 ? 62  GLN A CD  1 
ATOM   429  O OE1 . GLN A 1 60  ? -43.912 -17.002 50.207 1.00 123.88 ? 62  GLN A OE1 1 
ATOM   430  N NE2 . GLN A 1 60  ? -43.687 -18.607 48.650 1.00 117.47 ? 62  GLN A NE2 1 
ATOM   431  N N   . CYS A 1 61  ? -42.891 -12.364 45.947 1.00 99.71  ? 63  CYS A N   1 
ATOM   432  C CA  . CYS A 1 61  ? -42.077 -11.656 44.940 1.00 91.96  ? 63  CYS A CA  1 
ATOM   433  C C   . CYS A 1 61  ? -41.209 -10.529 45.487 1.00 86.70  ? 63  CYS A C   1 
ATOM   434  O O   . CYS A 1 61  ? -41.694 -9.643  46.192 1.00 86.74  ? 63  CYS A O   1 
ATOM   435  C CB  . CYS A 1 61  ? -42.948 -11.156 43.787 1.00 90.61  ? 63  CYS A CB  1 
ATOM   436  S SG  . CYS A 1 61  ? -43.102 -12.439 42.561 1.00 93.05  ? 63  CYS A SG  1 
ATOM   437  N N   . LYS A 1 62  ? -39.925 -10.571 45.140 1.00 80.51  ? 64  LYS A N   1 
ATOM   438  C CA  . LYS A 1 62  ? -38.945 -9.623  45.652 1.00 77.82  ? 64  LYS A CA  1 
ATOM   439  C C   . LYS A 1 62  ? -37.778 -9.462  44.684 1.00 73.23  ? 64  LYS A C   1 
ATOM   440  O O   . LYS A 1 62  ? -37.321 -10.449 44.123 1.00 73.66  ? 64  LYS A O   1 
ATOM   441  C CB  . LYS A 1 62  ? -38.438 -10.124 47.013 1.00 80.92  ? 64  LYS A CB  1 
ATOM   442  C CG  . LYS A 1 62  ? -37.121 -9.546  47.502 1.00 77.37  ? 64  LYS A CG  1 
ATOM   443  C CD  . LYS A 1 62  ? -36.775 -10.162 48.845 1.00 85.90  ? 64  LYS A CD  1 
ATOM   444  C CE  . LYS A 1 62  ? -35.316 -10.557 48.932 1.00 86.84  ? 64  LYS A CE  1 
ATOM   445  N NZ  . LYS A 1 62  ? -35.049 -11.304 50.206 1.00 94.07  ? 64  LYS A NZ  1 
ATOM   446  N N   . GLN A 1 63  ? -37.313 -8.220  44.503 1.00 71.82  ? 65  GLN A N   1 
ATOM   447  C CA  . GLN A 1 63  ? -36.104 -7.871  43.728 1.00 68.59  ? 65  GLN A CA  1 
ATOM   448  C C   . GLN A 1 63  ? -35.171 -7.164  44.683 1.00 69.11  ? 65  GLN A C   1 
ATOM   449  O O   . GLN A 1 63  ? -35.602 -6.305  45.456 1.00 70.89  ? 65  GLN A O   1 
ATOM   450  C CB  . GLN A 1 63  ? -36.440 -6.929  42.539 1.00 69.61  ? 65  GLN A CB  1 
ATOM   451  C CG  . GLN A 1 63  ? -35.238 -6.178  41.837 1.00 63.11  ? 65  GLN A CG  1 
ATOM   452  C CD  . GLN A 1 63  ? -35.650 -5.276  40.629 1.00 67.67  ? 65  GLN A CD  1 
ATOM   453  O OE1 . GLN A 1 63  ? -36.819 -5.018  40.398 1.00 62.38  ? 65  GLN A OE1 1 
ATOM   454  N NE2 . GLN A 1 63  ? -34.670 -4.802  39.878 1.00 52.85  ? 65  GLN A NE2 1 
ATOM   455  N N   . THR A 1 64  ? -33.894 -7.538  44.621 1.00 68.51  ? 66  THR A N   1 
ATOM   456  C CA  . THR A 1 64  ? -32.816 -7.001  45.473 1.00 64.38  ? 66  THR A CA  1 
ATOM   457  C C   . THR A 1 64  ? -31.755 -6.289  44.642 1.00 60.73  ? 66  THR A C   1 
ATOM   458  O O   . THR A 1 64  ? -31.249 -6.861  43.673 1.00 63.70  ? 66  THR A O   1 
ATOM   459  C CB  . THR A 1 64  ? -32.144 -8.152  46.201 1.00 65.05  ? 66  THR A CB  1 
ATOM   460  O OG1 . THR A 1 64  ? -33.136 -8.858  46.956 1.00 60.45  ? 66  THR A OG1 1 
ATOM   461  C CG2 . THR A 1 64  ? -31.028 -7.650  47.101 1.00 62.55  ? 66  THR A CG2 1 
ATOM   462  N N   . SER A 1 65  ? -31.419 -5.055  45.005 1.00 59.25  ? 67  SER A N   1 
ATOM   463  C CA  . SER A 1 65  ? -30.428 -4.254  44.250 1.00 56.96  ? 67  SER A CA  1 
ATOM   464  C C   . SER A 1 65  ? -29.422 -3.555  45.163 1.00 58.87  ? 67  SER A C   1 
ATOM   465  O O   . SER A 1 65  ? -29.809 -2.696  45.971 1.00 60.23  ? 67  SER A O   1 
ATOM   466  C CB  . SER A 1 65  ? -31.129 -3.184  43.416 1.00 58.29  ? 67  SER A CB  1 
ATOM   467  O OG  . SER A 1 65  ? -32.189 -3.759  42.686 1.00 51.19  ? 67  SER A OG  1 
ATOM   468  N N   . GLU A 1 66  ? -28.141 -3.920  45.029 1.00 55.93  ? 68  GLU A N   1 
ATOM   469  C CA  . GLU A 1 66  ? -27.045 -3.189  45.682 1.00 55.36  ? 68  GLU A CA  1 
ATOM   470  C C   . GLU A 1 66  ? -26.779 -1.935  44.891 1.00 50.57  ? 68  GLU A C   1 
ATOM   471  O O   . GLU A 1 66  ? -26.958 -1.948  43.707 1.00 52.52  ? 68  GLU A O   1 
ATOM   472  C CB  . GLU A 1 66  ? -25.757 -4.023  45.729 1.00 53.41  ? 68  GLU A CB  1 
ATOM   473  C CG  . GLU A 1 66  ? -25.890 -5.418  46.350 1.00 61.14  ? 68  GLU A CG  1 
ATOM   474  C CD  . GLU A 1 66  ? -24.662 -6.274  46.049 1.00 62.57  ? 68  GLU A CD  1 
ATOM   475  O OE1 . GLU A 1 66  ? -23.561 -5.680  45.938 1.00 57.45  ? 68  GLU A OE1 1 
ATOM   476  O OE2 . GLU A 1 66  ? -24.801 -7.516  45.889 1.00 62.39  ? 68  GLU A OE2 1 
ATOM   477  N N   . TYR A 1 67  ? -26.361 -0.863  45.557 1.00 52.16  ? 69  TYR A N   1 
ATOM   478  C CA  . TYR A 1 67  ? -25.933 0.391   44.933 1.00 51.15  ? 69  TYR A CA  1 
ATOM   479  C C   . TYR A 1 67  ? -24.522 0.795   45.382 1.00 54.84  ? 69  TYR A C   1 
ATOM   480  O O   . TYR A 1 67  ? -23.860 1.634   44.750 1.00 54.61  ? 69  TYR A O   1 
ATOM   481  C CB  . TYR A 1 67  ? -26.921 1.487   45.295 1.00 54.89  ? 69  TYR A CB  1 
ATOM   482  C CG  . TYR A 1 67  ? -28.268 1.282   44.622 1.00 57.83  ? 69  TYR A CG  1 
ATOM   483  C CD1 . TYR A 1 67  ? -29.235 0.444   45.183 1.00 57.12  ? 69  TYR A CD1 1 
ATOM   484  C CD2 . TYR A 1 67  ? -28.547 1.886   43.395 1.00 62.17  ? 69  TYR A CD2 1 
ATOM   485  C CE1 . TYR A 1 67  ? -30.455 0.245   44.557 1.00 62.29  ? 69  TYR A CE1 1 
ATOM   486  C CE2 . TYR A 1 67  ? -29.761 1.689   42.751 1.00 56.44  ? 69  TYR A CE2 1 
ATOM   487  C CZ  . TYR A 1 67  ? -30.710 0.872   43.338 1.00 58.97  ? 69  TYR A CZ  1 
ATOM   488  O OH  . TYR A 1 67  ? -31.910 0.681   42.690 1.00 64.76  ? 69  TYR A OH  1 
ATOM   489  N N   . LEU A 1 68  ? -24.083 0.202   46.492 1.00 55.42  ? 70  LEU A N   1 
ATOM   490  C CA  . LEU A 1 68  ? -22.746 0.419   47.068 1.00 56.23  ? 70  LEU A CA  1 
ATOM   491  C C   . LEU A 1 68  ? -22.190 -0.921  47.473 1.00 55.22  ? 70  LEU A C   1 
ATOM   492  O O   . LEU A 1 68  ? -22.874 -1.704  48.129 1.00 53.27  ? 70  LEU A O   1 
ATOM   493  C CB  . LEU A 1 68  ? -22.837 1.304   48.324 1.00 59.10  ? 70  LEU A CB  1 
ATOM   494  C CG  . LEU A 1 68  ? -21.568 1.682   49.083 1.00 56.68  ? 70  LEU A CG  1 
ATOM   495  C CD1 . LEU A 1 68  ? -20.706 2.624   48.264 1.00 59.97  ? 70  LEU A CD1 1 
ATOM   496  C CD2 . LEU A 1 68  ? -21.898 2.310   50.459 1.00 57.23  ? 70  LEU A CD2 1 
ATOM   497  N N   . ARG A 1 69  ? -20.936 -1.172  47.110 1.00 58.08  ? 71  ARG A N   1 
ATOM   498  C CA  . ARG A 1 69  ? -20.223 -2.349  47.562 1.00 59.52  ? 71  ARG A CA  1 
ATOM   499  C C   . ARG A 1 69  ? -18.750 -2.011  47.511 1.00 59.69  ? 71  ARG A C   1 
ATOM   500  O O   . ARG A 1 69  ? -18.130 -2.087  46.454 1.00 59.71  ? 71  ARG A O   1 
ATOM   501  C CB  . ARG A 1 69  ? -20.506 -3.547  46.658 1.00 61.07  ? 71  ARG A CB  1 
ATOM   502  C CG  . ARG A 1 69  ? -19.949 -4.878  47.151 1.00 64.70  ? 71  ARG A CG  1 
ATOM   503  C CD  . ARG A 1 69  ? -20.226 -5.899  46.077 1.00 77.02  ? 71  ARG A CD  1 
ATOM   504  N NE  . ARG A 1 69  ? -20.713 -7.175  46.592 1.00 83.25  ? 71  ARG A NE  1 
ATOM   505  C CZ  . ARG A 1 69  ? -21.447 -8.033  45.886 1.00 89.50  ? 71  ARG A CZ  1 
ATOM   506  N NH1 . ARG A 1 69  ? -21.810 -7.740  44.632 1.00 81.29  ? 71  ARG A NH1 1 
ATOM   507  N NH2 . ARG A 1 69  ? -21.838 -9.178  46.441 1.00 93.69  ? 71  ARG A NH2 1 
ATOM   508  N N   . TYR A 1 70  ? -18.199 -1.645  48.662 1.00 55.80  ? 72  TYR A N   1 
ATOM   509  C CA  . TYR A 1 70  ? -16.859 -1.114  48.724 1.00 54.86  ? 72  TYR A CA  1 
ATOM   510  C C   . TYR A 1 70  ? -16.090 -1.846  49.811 1.00 55.14  ? 72  TYR A C   1 
ATOM   511  O O   . TYR A 1 70  ? -16.572 -1.956  50.938 1.00 55.67  ? 72  TYR A O   1 
ATOM   512  C CB  . TYR A 1 70  ? -16.922 0.380   49.016 1.00 53.68  ? 72  TYR A CB  1 
ATOM   513  C CG  . TYR A 1 70  ? -15.598 0.967   49.428 1.00 60.42  ? 72  TYR A CG  1 
ATOM   514  C CD1 . TYR A 1 70  ? -14.674 1.368   48.471 1.00 58.81  ? 72  TYR A CD1 1 
ATOM   515  C CD2 . TYR A 1 70  ? -15.263 1.111   50.772 1.00 56.03  ? 72  TYR A CD2 1 
ATOM   516  C CE1 . TYR A 1 70  ? -13.458 1.907   48.833 1.00 55.27  ? 72  TYR A CE1 1 
ATOM   517  C CE2 . TYR A 1 70  ? -14.048 1.650   51.146 1.00 52.73  ? 72  TYR A CE2 1 
ATOM   518  C CZ  . TYR A 1 70  ? -13.152 2.049   50.166 1.00 56.29  ? 72  TYR A CZ  1 
ATOM   519  O OH  . TYR A 1 70  ? -11.934 2.577   50.524 1.00 55.76  ? 72  TYR A OH  1 
ATOM   520  N N   . GLU A 1 71  ? -14.916 -2.369  49.479 1.00 54.57  ? 73  GLU A N   1 
ATOM   521  C CA  . GLU A 1 71  ? -14.066 -2.951  50.508 1.00 55.44  ? 73  GLU A CA  1 
ATOM   522  C C   . GLU A 1 71  ? -12.653 -2.415  50.439 1.00 50.90  ? 73  GLU A C   1 
ATOM   523  O O   . GLU A 1 71  ? -12.184 -2.106  49.369 1.00 48.97  ? 73  GLU A O   1 
ATOM   524  C CB  . GLU A 1 71  ? -14.106 -4.474  50.480 1.00 57.60  ? 73  GLU A CB  1 
ATOM   525  C CG  . GLU A 1 71  ? -13.557 -5.087  49.233 1.00 66.03  ? 73  GLU A CG  1 
ATOM   526  C CD  . GLU A 1 71  ? -14.402 -6.249  48.757 1.00 76.83  ? 73  GLU A CD  1 
ATOM   527  O OE1 . GLU A 1 71  ? -14.957 -6.967  49.621 1.00 74.15  ? 73  GLU A OE1 1 
ATOM   528  O OE2 . GLU A 1 71  ? -14.514 -6.433  47.521 1.00 80.08  ? 73  GLU A OE2 1 
ATOM   529  N N   . ASP A 1 72  ? -12.021 -2.254  51.609 1.00 51.44  ? 74  ASP A N   1 
ATOM   530  C CA  . ASP A 1 72  ? -10.652 -1.724  51.748 1.00 51.50  ? 74  ASP A CA  1 
ATOM   531  C C   . ASP A 1 72  ? -9.964  -2.291  53.002 1.00 47.57  ? 74  ASP A C   1 
ATOM   532  O O   . ASP A 1 72  ? -10.610 -2.613  53.977 1.00 42.94  ? 74  ASP A O   1 
ATOM   533  C CB  . ASP A 1 72  ? -10.688 -0.183  51.823 1.00 57.93  ? 74  ASP A CB  1 
ATOM   534  C CG  . ASP A 1 72  ? -9.309  0.474   51.566 1.00 66.49  ? 74  ASP A CG  1 
ATOM   535  O OD1 . ASP A 1 72  ? -8.541  -0.055  50.729 1.00 76.98  ? 74  ASP A OD1 1 
ATOM   536  O OD2 . ASP A 1 72  ? -9.016  1.541   52.180 1.00 67.49  ? 74  ASP A OD2 1 
ATOM   537  N N   . THR A 1 73  ? -8.647  -2.417  52.967 1.00 47.29  ? 75  THR A N   1 
ATOM   538  C CA  . THR A 1 73  ? -7.894  -2.865  54.132 1.00 44.88  ? 75  THR A CA  1 
ATOM   539  C C   . THR A 1 73  ? -7.263  -1.603  54.738 1.00 48.82  ? 75  THR A C   1 
ATOM   540  O O   . THR A 1 73  ? -6.594  -0.856  54.038 1.00 52.50  ? 75  THR A O   1 
ATOM   541  C CB  . THR A 1 73  ? -6.846  -3.914  53.695 1.00 46.85  ? 75  THR A CB  1 
ATOM   542  O OG1 . THR A 1 73  ? -7.525  -5.138  53.385 1.00 47.86  ? 75  THR A OG1 1 
ATOM   543  C CG2 . THR A 1 73  ? -5.892  -4.218  54.791 1.00 38.13  ? 75  THR A CG2 1 
ATOM   544  N N   . LEU A 1 74  ? -7.521  -1.321  56.015 1.00 49.00  ? 76  LEU A N   1 
ATOM   545  C CA  . LEU A 1 74  ? -7.096  -0.066  56.542 1.00 50.78  ? 76  LEU A CA  1 
ATOM   546  C C   . LEU A 1 74  ? -5.701  -0.191  57.142 1.00 55.07  ? 76  LEU A C   1 
ATOM   547  O O   . LEU A 1 74  ? -5.284  -1.281  57.548 1.00 51.79  ? 76  LEU A O   1 
ATOM   548  C CB  . LEU A 1 74  ? -8.113  0.474   57.540 1.00 55.36  ? 76  LEU A CB  1 
ATOM   549  C CG  . LEU A 1 74  ? -9.557  0.410   57.077 1.00 49.16  ? 76  LEU A CG  1 
ATOM   550  C CD1 . LEU A 1 74  ? -10.447 0.932   58.162 1.00 53.97  ? 76  LEU A CD1 1 
ATOM   551  C CD2 . LEU A 1 74  ? -9.779  1.173   55.729 1.00 49.30  ? 76  LEU A CD2 1 
ATOM   552  N N   . LEU A 1 75  ? -4.977  0.928   57.165 1.00 59.49  ? 77  LEU A N   1 
ATOM   553  C CA  . LEU A 1 75  ? -3.585  0.947   57.595 1.00 63.59  ? 77  LEU A CA  1 
ATOM   554  C C   . LEU A 1 75  ? -3.336  2.052   58.600 1.00 66.52  ? 77  LEU A C   1 
ATOM   555  O O   . LEU A 1 75  ? -3.891  3.137   58.483 1.00 70.62  ? 77  LEU A O   1 
ATOM   556  C CB  . LEU A 1 75  ? -2.657  1.166   56.400 1.00 64.65  ? 77  LEU A CB  1 
ATOM   557  C CG  . LEU A 1 75  ? -2.926  0.401   55.110 1.00 69.04  ? 77  LEU A CG  1 
ATOM   558  C CD1 . LEU A 1 75  ? -1.947  0.894   54.066 1.00 69.24  ? 77  LEU A CD1 1 
ATOM   559  C CD2 . LEU A 1 75  ? -2.803  -1.125  55.328 1.00 71.53  ? 77  LEU A CD2 1 
ATOM   560  N N   . LEU A 1 76  ? -2.479  1.757   59.569 1.00 65.86  ? 78  LEU A N   1 
ATOM   561  C CA  . LEU A 1 76  ? -2.021  2.707   60.587 1.00 68.36  ? 78  LEU A CA  1 
ATOM   562  C C   . LEU A 1 76  ? -0.798  3.475   60.084 1.00 71.42  ? 78  LEU A C   1 
ATOM   563  O O   . LEU A 1 76  ? 0.169   2.853   59.572 1.00 69.49  ? 78  LEU A O   1 
ATOM   564  C CB  . LEU A 1 76  ? -1.602  1.941   61.840 1.00 64.48  ? 78  LEU A CB  1 
ATOM   565  C CG  . LEU A 1 76  ? -2.638  1.267   62.723 1.00 63.38  ? 78  LEU A CG  1 
ATOM   566  C CD1 . LEU A 1 76  ? -1.943  0.543   63.832 1.00 59.15  ? 78  LEU A CD1 1 
ATOM   567  C CD2 . LEU A 1 76  ? -3.593  2.289   63.293 1.00 69.84  ? 78  LEU A CD2 1 
ATOM   568  N N   . GLU A 1 77  ? -0.820  4.801   60.254 1.00 73.06  ? 79  GLU A N   1 
ATOM   569  C CA  . GLU A 1 77  ? 0.290   5.658   59.830 1.00 75.43  ? 79  GLU A CA  1 
ATOM   570  C C   . GLU A 1 77  ? 1.615   5.309   60.557 1.00 75.61  ? 79  GLU A C   1 
ATOM   571  O O   . GLU A 1 77  ? 2.715   5.495   60.012 1.00 74.87  ? 79  GLU A O   1 
ATOM   572  C CB  . GLU A 1 77  ? -0.069  7.127   60.033 1.00 80.72  ? 79  GLU A CB  1 
ATOM   573  C CG  . GLU A 1 77  ? -1.264  7.621   59.166 1.00 88.42  ? 79  GLU A CG  1 
ATOM   574  C CD  . GLU A 1 77  ? -1.631  9.099   59.412 1.00 98.09  ? 79  GLU A CD  1 
ATOM   575  O OE1 . GLU A 1 77  ? -2.753  9.515   59.028 1.00 101.70 ? 79  GLU A OE1 1 
ATOM   576  O OE2 . GLU A 1 77  ? -0.803  9.841   59.997 1.00 109.33 ? 79  GLU A OE2 1 
ATOM   577  N N   . ASP A 1 78  ? 1.516   4.778   61.770 1.00 70.50  ? 80  ASP A N   1 
ATOM   578  C CA  . ASP A 1 78  ? 2.747   4.416   62.495 1.00 71.88  ? 80  ASP A CA  1 
ATOM   579  C C   . ASP A 1 78  ? 3.257   3.005   62.164 1.00 69.10  ? 80  ASP A C   1 
ATOM   580  O O   . ASP A 1 78  ? 4.247   2.534   62.740 1.00 71.53  ? 80  ASP A O   1 
ATOM   581  C CB  . ASP A 1 78  ? 2.573   4.592   63.991 1.00 70.62  ? 80  ASP A CB  1 
ATOM   582  C CG  . ASP A 1 78  ? 3.926   4.594   64.742 1.00 78.98  ? 80  ASP A CG  1 
ATOM   583  O OD1 . ASP A 1 78  ? 4.787   5.469   64.473 1.00 71.87  ? 80  ASP A OD1 1 
ATOM   584  O OD2 . ASP A 1 78  ? 4.121   3.707   65.591 1.00 74.71  ? 80  ASP A OD2 1 
ATOM   585  N N   . GLN A 1 79  ? 2.582   2.331   61.235 1.00 63.76  ? 81  GLN A N   1 
ATOM   586  C CA  . GLN A 1 79  ? 3.008   1.010   60.778 1.00 60.74  ? 81  GLN A CA  1 
ATOM   587  C C   . GLN A 1 79  ? 3.234   1.005   59.271 1.00 61.77  ? 81  GLN A C   1 
ATOM   588  O O   . GLN A 1 79  ? 2.413   0.474   58.516 1.00 60.51  ? 81  GLN A O   1 
ATOM   589  C CB  . GLN A 1 79  ? 1.998   -0.062  61.182 1.00 57.15  ? 81  GLN A CB  1 
ATOM   590  C CG  . GLN A 1 79  ? 1.773   -0.129  62.721 1.00 62.61  ? 81  GLN A CG  1 
ATOM   591  C CD  . GLN A 1 79  ? 2.974   -0.682  63.544 1.00 71.83  ? 81  GLN A CD  1 
ATOM   592  O OE1 . GLN A 1 79  ? 3.862   -1.369  63.021 1.00 66.00  ? 81  GLN A OE1 1 
ATOM   593  N NE2 . GLN A 1 79  ? 2.964   -0.402  64.849 1.00 69.36  ? 81  GLN A NE2 1 
ATOM   594  N N   . PRO A 1 80  ? 4.389   1.536   58.823 1.00 64.07  ? 82  PRO A N   1 
ATOM   595  C CA  . PRO A 1 80  ? 4.555   1.840   57.397 1.00 64.16  ? 82  PRO A CA  1 
ATOM   596  C C   . PRO A 1 80  ? 4.970   0.622   56.557 1.00 64.00  ? 82  PRO A C   1 
ATOM   597  O O   . PRO A 1 80  ? 5.126   0.730   55.320 1.00 62.93  ? 82  PRO A O   1 
ATOM   598  C CB  . PRO A 1 80  ? 5.705   2.839   57.415 1.00 64.60  ? 82  PRO A CB  1 
ATOM   599  C CG  . PRO A 1 80  ? 6.584   2.360   58.583 1.00 69.47  ? 82  PRO A CG  1 
ATOM   600  C CD  . PRO A 1 80  ? 5.627   1.776   59.594 1.00 64.57  ? 82  PRO A CD  1 
ATOM   601  N N   . THR A 1 81  ? 5.158   -0.516  57.220 1.00 60.55  ? 83  THR A N   1 
ATOM   602  C CA  . THR A 1 81  ? 5.902   -1.634  56.622 1.00 62.92  ? 83  THR A CA  1 
ATOM   603  C C   . THR A 1 81  ? 5.114   -2.529  55.661 1.00 60.85  ? 83  THR A C   1 
ATOM   604  O O   . THR A 1 81  ? 5.717   -3.214  54.827 1.00 65.38  ? 83  THR A O   1 
ATOM   605  C CB  . THR A 1 81  ? 6.615   -2.465  57.704 1.00 61.90  ? 83  THR A CB  1 
ATOM   606  O OG1 . THR A 1 81  ? 5.779   -2.553  58.861 1.00 65.45  ? 83  THR A OG1 1 
ATOM   607  C CG2 . THR A 1 81  ? 7.915   -1.769  58.094 1.00 69.09  ? 83  THR A CG2 1 
ATOM   608  N N   . GLY A 1 82  ? 3.788   -2.522  55.766 1.00 53.55  ? 84  GLY A N   1 
ATOM   609  C CA  . GLY A 1 82  ? 2.971   -3.368  54.914 1.00 51.10  ? 84  GLY A CA  1 
ATOM   610  C C   . GLY A 1 82  ? 2.161   -4.433  55.619 1.00 47.92  ? 84  GLY A C   1 
ATOM   611  O O   . GLY A 1 82  ? 2.328   -4.660  56.807 1.00 48.23  ? 84  GLY A O   1 
ATOM   612  N N   . GLU A 1 83  ? 1.288   -5.085  54.861 1.00 45.95  ? 85  GLU A N   1 
ATOM   613  C CA  . GLU A 1 83  ? 0.293   -6.034  55.370 1.00 47.13  ? 85  GLU A CA  1 
ATOM   614  C C   . GLU A 1 83  ? 0.821   -7.418  55.729 1.00 46.51  ? 85  GLU A C   1 
ATOM   615  O O   . GLU A 1 83  ? 0.115   -8.198  56.361 1.00 48.56  ? 85  GLU A O   1 
ATOM   616  C CB  . GLU A 1 83  ? -0.771  -6.229  54.299 1.00 50.92  ? 85  GLU A CB  1 
ATOM   617  C CG  . GLU A 1 83  ? -1.690  -5.057  54.130 1.00 46.35  ? 85  GLU A CG  1 
ATOM   618  C CD  . GLU A 1 83  ? -2.438  -5.157  52.809 1.00 64.76  ? 85  GLU A CD  1 
ATOM   619  O OE1 . GLU A 1 83  ? -3.084  -6.223  52.574 1.00 47.00  ? 85  GLU A OE1 1 
ATOM   620  O OE2 . GLU A 1 83  ? -2.363  -4.170  52.026 1.00 55.69  ? 85  GLU A OE2 1 
ATOM   621  N N   . ASN A 1 84  ? 2.032   -7.738  55.302 1.00 43.22  ? 86  ASN A N   1 
ATOM   622  C CA  . ASN A 1 84  ? 2.642   -9.022  55.634 1.00 40.54  ? 86  ASN A CA  1 
ATOM   623  C C   . ASN A 1 84  ? 3.521   -8.891  56.911 1.00 39.78  ? 86  ASN A C   1 
ATOM   624  O O   . ASN A 1 84  ? 4.409   -9.689  57.175 1.00 41.17  ? 86  ASN A O   1 
ATOM   625  C CB  . ASN A 1 84  ? 3.414   -9.554  54.436 1.00 41.22  ? 86  ASN A CB  1 
ATOM   626  C CG  . ASN A 1 84  ? 4.493   -8.596  53.963 1.00 47.91  ? 86  ASN A CG  1 
ATOM   627  O OD1 . ASN A 1 84  ? 4.349   -7.370  54.087 1.00 43.44  ? 86  ASN A OD1 1 
ATOM   628  N ND2 . ASN A 1 84  ? 5.590   -9.149  53.430 1.00 41.60  ? 86  ASN A ND2 1 
ATOM   629  N N   . GLU A 1 85  ? 3.244   -7.857  57.700 1.00 43.77  ? 87  GLU A N   1 
ATOM   630  C CA  . GLU A 1 85  ? 3.829   -7.677  59.030 1.00 46.18  ? 87  GLU A CA  1 
ATOM   631  C C   . GLU A 1 85  ? 2.674   -7.291  59.937 1.00 45.49  ? 87  GLU A C   1 
ATOM   632  O O   . GLU A 1 85  ? 1.932   -6.334  59.663 1.00 45.36  ? 87  GLU A O   1 
ATOM   633  C CB  . GLU A 1 85  ? 4.898   -6.583  58.999 1.00 50.60  ? 87  GLU A CB  1 
ATOM   634  C CG  . GLU A 1 85  ? 5.567   -6.340  60.307 1.00 58.93  ? 87  GLU A CG  1 
ATOM   635  C CD  . GLU A 1 85  ? 7.011   -6.812  60.362 1.00 73.97  ? 87  GLU A CD  1 
ATOM   636  O OE1 . GLU A 1 85  ? 7.786   -6.029  60.956 1.00 75.11  ? 87  GLU A OE1 1 
ATOM   637  O OE2 . GLU A 1 85  ? 7.373   -7.913  59.810 1.00 74.39  ? 87  GLU A OE2 1 
ATOM   638  N N   . MET A 1 86  ? 2.440   -8.081  60.971 1.00 42.32  ? 88  MET A N   1 
ATOM   639  C CA  . MET A 1 86  ? 1.327   -7.788  61.871 1.00 43.97  ? 88  MET A CA  1 
ATOM   640  C C   . MET A 1 86  ? 1.704   -6.657  62.793 1.00 44.84  ? 88  MET A C   1 
ATOM   641  O O   . MET A 1 86  ? 2.880   -6.430  63.034 1.00 47.31  ? 88  MET A O   1 
ATOM   642  C CB  . MET A 1 86  ? 0.964   -9.006  62.710 1.00 40.68  ? 88  MET A CB  1 
ATOM   643  C CG  . MET A 1 86  ? 0.562   -10.208 61.841 1.00 48.55  ? 88  MET A CG  1 
ATOM   644  S SD  . MET A 1 86  ? -0.080  -11.557 62.845 1.00 47.16  ? 88  MET A SD  1 
ATOM   645  C CE  . MET A 1 86  ? 1.407   -12.350 63.378 1.00 47.94  ? 88  MET A CE  1 
ATOM   646  N N   . VAL A 1 87  ? 0.688   -5.991  63.320 1.00 42.83  ? 89  VAL A N   1 
ATOM   647  C CA  . VAL A 1 87  ? 0.808   -4.861  64.238 1.00 48.78  ? 89  VAL A CA  1 
ATOM   648  C C   . VAL A 1 87  ? 0.615   -5.342  65.675 1.00 48.47  ? 89  VAL A C   1 
ATOM   649  O O   . VAL A 1 87  ? -0.250  -6.170  65.930 1.00 45.85  ? 89  VAL A O   1 
ATOM   650  C CB  . VAL A 1 87  ? -0.288  -3.854  63.913 1.00 46.91  ? 89  VAL A CB  1 
ATOM   651  C CG1 . VAL A 1 87  ? -0.500  -2.849  65.058 1.00 57.61  ? 89  VAL A CG1 1 
ATOM   652  C CG2 . VAL A 1 87  ? 0.075   -3.141  62.641 1.00 52.71  ? 89  VAL A CG2 1 
ATOM   653  N N   . ILE A 1 88  ? 1.438   -4.841  66.598 1.00 53.10  ? 90  ILE A N   1 
ATOM   654  C CA  . ILE A 1 88  ? 1.300   -5.158  68.029 1.00 52.73  ? 90  ILE A CA  1 
ATOM   655  C C   . ILE A 1 88  ? 0.612   -3.997  68.687 1.00 53.69  ? 90  ILE A C   1 
ATOM   656  O O   . ILE A 1 88  ? 1.080   -2.862  68.604 1.00 55.31  ? 90  ILE A O   1 
ATOM   657  C CB  . ILE A 1 88  ? 2.653   -5.426  68.724 1.00 56.51  ? 90  ILE A CB  1 
ATOM   658  C CG1 . ILE A 1 88  ? 3.468   -6.463  67.944 1.00 53.25  ? 90  ILE A CG1 1 
ATOM   659  C CG2 . ILE A 1 88  ? 2.421   -5.915  70.167 1.00 58.52  ? 90  ILE A CG2 1 
ATOM   660  C CD1 . ILE A 1 88  ? 4.927   -6.480  68.352 1.00 61.02  ? 90  ILE A CD1 1 
ATOM   661  N N   . MET A 1 89  ? -0.530  -4.288  69.297 1.00 51.82  ? 91  MET A N   1 
ATOM   662  C CA  . MET A 1 89  ? -1.364  -3.288  69.913 1.00 56.25  ? 91  MET A CA  1 
ATOM   663  C C   . MET A 1 89  ? -1.207  -3.458  71.430 1.00 59.87  ? 91  MET A C   1 
ATOM   664  O O   . MET A 1 89  ? -1.114  -4.583  71.921 1.00 58.09  ? 91  MET A O   1 
ATOM   665  C CB  . MET A 1 89  ? -2.825  -3.511  69.519 1.00 53.27  ? 91  MET A CB  1 
ATOM   666  C CG  . MET A 1 89  ? -3.223  -3.095  68.087 1.00 54.66  ? 91  MET A CG  1 
ATOM   667  S SD  . MET A 1 89  ? -5.038  -3.020  67.937 1.00 59.70  ? 91  MET A SD  1 
ATOM   668  C CE  . MET A 1 89  ? -5.302  -2.355  66.287 1.00 51.51  ? 91  MET A CE  1 
ATOM   669  N N   . ARG A 1 90  ? -1.166  -2.349  72.155 1.00 64.95  ? 92  ARG A N   1 
ATOM   670  C CA  . ARG A 1 90  ? -0.945  -2.386  73.622 1.00 69.30  ? 92  ARG A CA  1 
ATOM   671  C C   . ARG A 1 90  ? -1.996  -1.544  74.358 1.00 73.90  ? 92  ARG A C   1 
ATOM   672  O O   . ARG A 1 90  ? -2.490  -0.563  73.788 1.00 73.90  ? 92  ARG A O   1 
ATOM   673  C CB  . ARG A 1 90  ? 0.477   -1.901  73.957 1.00 69.60  ? 92  ARG A CB  1 
ATOM   674  C CG  . ARG A 1 90  ? 1.531   -2.890  73.549 1.00 76.05  ? 92  ARG A CG  1 
ATOM   675  C CD  . ARG A 1 90  ? 2.821   -2.252  73.135 1.00 85.04  ? 92  ARG A CD  1 
ATOM   676  N NE  . ARG A 1 90  ? 3.595   -3.209  72.348 1.00 93.21  ? 92  ARG A NE  1 
ATOM   677  C CZ  . ARG A 1 90  ? 4.888   -3.095  72.054 1.00 96.76  ? 92  ARG A CZ  1 
ATOM   678  N NH1 . ARG A 1 90  ? 5.593   -2.055  72.494 1.00 104.15 ? 92  ARG A NH1 1 
ATOM   679  N NH2 . ARG A 1 90  ? 5.479   -4.034  71.321 1.00 88.54  ? 92  ARG A NH2 1 
ATOM   680  N N   . PRO A 1 91  ? -2.347  -1.920  75.624 1.00 77.66  ? 93  PRO A N   1 
ATOM   681  C CA  . PRO A 1 91  ? -3.340  -1.126  76.369 1.00 84.39  ? 93  PRO A CA  1 
ATOM   682  C C   . PRO A 1 91  ? -2.885  0.313   76.608 1.00 89.85  ? 93  PRO A C   1 
ATOM   683  O O   . PRO A 1 91  ? -1.682  0.575   76.660 1.00 90.63  ? 93  PRO A O   1 
ATOM   684  C CB  . PRO A 1 91  ? -3.477  -1.880  77.698 1.00 84.44  ? 93  PRO A CB  1 
ATOM   685  C CG  . PRO A 1 91  ? -2.261  -2.701  77.800 1.00 80.54  ? 93  PRO A CG  1 
ATOM   686  C CD  . PRO A 1 91  ? -1.883  -3.075  76.414 1.00 75.84  ? 93  PRO A CD  1 
ATOM   687  N N   . GLY A 1 92  ? -3.842  1.232   76.729 1.00 94.43  ? 94  GLY A N   1 
ATOM   688  C CA  . GLY A 1 92  ? -3.539  2.652   76.941 1.00 99.03  ? 94  GLY A CA  1 
ATOM   689  C C   . GLY A 1 92  ? -3.528  3.494   75.670 1.00 100.94 ? 94  GLY A C   1 
ATOM   690  O O   . GLY A 1 92  ? -3.513  4.732   75.736 1.00 105.48 ? 94  GLY A O   1 
ATOM   691  N N   . ASN A 1 93  ? -3.549  2.824   74.515 1.00 96.65  ? 95  ASN A N   1 
ATOM   692  C CA  . ASN A 1 93  ? -3.504  3.486   73.222 1.00 94.14  ? 95  ASN A CA  1 
ATOM   693  C C   . ASN A 1 93  ? -4.803  3.309   72.470 1.00 92.12  ? 95  ASN A C   1 
ATOM   694  O O   . ASN A 1 93  ? -5.478  2.284   72.612 1.00 89.02  ? 95  ASN A O   1 
ATOM   695  C CB  . ASN A 1 93  ? -2.379  2.915   72.351 1.00 92.55  ? 95  ASN A CB  1 
ATOM   696  C CG  . ASN A 1 93  ? -1.060  2.796   73.086 1.00 92.79  ? 95  ASN A CG  1 
ATOM   697  O OD1 . ASN A 1 93  ? -0.398  3.794   73.362 1.00 100.94 ? 95  ASN A OD1 1 
ATOM   698  N ND2 . ASN A 1 93  ? -0.663  1.568   73.385 1.00 88.28  ? 95  ASN A ND2 1 
ATOM   699  N N   . LYS A 1 94  ? -5.132  4.325   71.671 1.00 91.66  ? 96  LYS A N   1 
ATOM   700  C CA  . LYS A 1 94  ? -6.247  4.301   70.731 1.00 89.23  ? 96  LYS A CA  1 
ATOM   701  C C   . LYS A 1 94  ? -5.694  4.193   69.316 1.00 83.53  ? 96  LYS A C   1 
ATOM   702  O O   . LYS A 1 94  ? -5.046  5.119   68.820 1.00 85.88  ? 96  LYS A O   1 
ATOM   703  C CB  . LYS A 1 94  ? -7.072  5.582   70.842 1.00 93.67  ? 96  LYS A CB  1 
ATOM   704  C CG  . LYS A 1 94  ? -7.718  5.809   72.200 1.00 105.02 ? 96  LYS A CG  1 
ATOM   705  C CD  . LYS A 1 94  ? -8.767  6.934   72.131 1.00 111.72 ? 96  LYS A CD  1 
ATOM   706  C CE  . LYS A 1 94  ? -8.147  8.320   72.341 1.00 121.53 ? 96  LYS A CE  1 
ATOM   707  N NZ  . LYS A 1 94  ? -9.193  9.387   72.459 1.00 126.62 ? 96  LYS A NZ  1 
ATOM   708  N N   . TYR A 1 95  ? -5.941  3.055   68.675 1.00 76.52  ? 97  TYR A N   1 
ATOM   709  C CA  . TYR A 1 95  ? -5.465  2.821   67.323 1.00 71.11  ? 97  TYR A CA  1 
ATOM   710  C C   . TYR A 1 95  ? -6.608  3.180   66.396 1.00 71.57  ? 97  TYR A C   1 
ATOM   711  O O   . TYR A 1 95  ? -7.687  2.577   66.462 1.00 70.20  ? 97  TYR A O   1 
ATOM   712  C CB  . TYR A 1 95  ? -5.006  1.370   67.140 1.00 67.65  ? 97  TYR A CB  1 
ATOM   713  C CG  . TYR A 1 95  ? -3.915  0.991   68.112 1.00 63.34  ? 97  TYR A CG  1 
ATOM   714  C CD1 . TYR A 1 95  ? -2.571  1.087   67.758 1.00 64.93  ? 97  TYR A CD1 1 
ATOM   715  C CD2 . TYR A 1 95  ? -4.226  0.569   69.409 1.00 61.64  ? 97  TYR A CD2 1 
ATOM   716  C CE1 . TYR A 1 95  ? -1.564  0.772   68.671 1.00 59.03  ? 97  TYR A CE1 1 
ATOM   717  C CE2 . TYR A 1 95  ? -3.238  0.245   70.313 1.00 58.85  ? 97  TYR A CE2 1 
ATOM   718  C CZ  . TYR A 1 95  ? -1.910  0.341   69.942 1.00 64.01  ? 97  TYR A CZ  1 
ATOM   719  O OH  . TYR A 1 95  ? -0.924  0.000   70.847 1.00 63.53  ? 97  TYR A OH  1 
ATOM   720  N N   . GLU A 1 96  ? -6.375  4.212   65.585 1.00 71.73  ? 98  GLU A N   1 
ATOM   721  C CA  . GLU A 1 96  ? -7.399  4.790   64.718 1.00 74.64  ? 98  GLU A CA  1 
ATOM   722  C C   . GLU A 1 96  ? -6.983  4.576   63.289 1.00 70.35  ? 98  GLU A C   1 
ATOM   723  O O   . GLU A 1 96  ? -5.941  5.071   62.845 1.00 70.31  ? 98  GLU A O   1 
ATOM   724  C CB  . GLU A 1 96  ? -7.605  6.295   65.002 1.00 79.44  ? 98  GLU A CB  1 
ATOM   725  C CG  . GLU A 1 96  ? -7.604  6.649   66.493 1.00 85.01  ? 98  GLU A CG  1 
ATOM   726  C CD  . GLU A 1 96  ? -7.980  8.105   66.790 1.00 98.50  ? 98  GLU A CD  1 
ATOM   727  O OE1 . GLU A 1 96  ? -7.852  8.981   65.903 1.00 96.43  ? 98  GLU A OE1 1 
ATOM   728  O OE2 . GLU A 1 96  ? -8.397  8.370   67.937 1.00 107.29 ? 98  GLU A OE2 1 
ATOM   729  N N   . TYR A 1 97  ? -7.816  3.813   62.586 1.00 67.76  ? 99  TYR A N   1 
ATOM   730  C CA  . TYR A 1 97  ? -7.653  3.519   61.172 1.00 62.72  ? 99  TYR A CA  1 
ATOM   731  C C   . TYR A 1 97  ? -8.581  4.415   60.358 1.00 67.10  ? 99  TYR A C   1 
ATOM   732  O O   . TYR A 1 97  ? -9.792  4.368   60.528 1.00 67.23  ? 99  TYR A O   1 
ATOM   733  C CB  . TYR A 1 97  ? -8.060  2.071   60.909 1.00 57.96  ? 99  TYR A CB  1 
ATOM   734  C CG  . TYR A 1 97  ? -7.176  1.002   61.518 1.00 51.39  ? 99  TYR A CG  1 
ATOM   735  C CD1 . TYR A 1 97  ? -6.224  0.371   60.735 1.00 51.34  ? 99  TYR A CD1 1 
ATOM   736  C CD2 . TYR A 1 97  ? -7.326  0.581   62.841 1.00 49.68  ? 99  TYR A CD2 1 
ATOM   737  C CE1 . TYR A 1 97  ? -5.421  -0.617  61.222 1.00 53.79  ? 99  TYR A CE1 1 
ATOM   738  C CE2 . TYR A 1 97  ? -6.465  -0.429  63.364 1.00 51.79  ? 99  TYR A CE2 1 
ATOM   739  C CZ  . TYR A 1 97  ? -5.526  -1.020  62.520 1.00 54.45  ? 99  TYR A CZ  1 
ATOM   740  O OH  . TYR A 1 97  ? -4.659  -2.031  62.904 1.00 46.11  ? 99  TYR A OH  1 
ATOM   741  N N   . LYS A 1 98  ? -8.013  5.231   59.481 1.00 69.59  ? 100 LYS A N   1 
ATOM   742  C CA  . LYS A 1 98  ? -8.817  6.094   58.604 1.00 73.08  ? 100 LYS A CA  1 
ATOM   743  C C   . LYS A 1 98  ? -9.506  5.287   57.494 1.00 70.01  ? 100 LYS A C   1 
ATOM   744  O O   . LYS A 1 98  ? -8.868  4.456   56.845 1.00 68.02  ? 100 LYS A O   1 
ATOM   745  C CB  . LYS A 1 98  ? -7.927  7.139   57.933 1.00 74.91  ? 100 LYS A CB  1 
ATOM   746  C CG  . LYS A 1 98  ? -7.381  8.217   58.820 1.00 80.20  ? 100 LYS A CG  1 
ATOM   747  C CD  . LYS A 1 98  ? -6.728  9.277   57.940 1.00 95.14  ? 100 LYS A CD  1 
ATOM   748  C CE  . LYS A 1 98  ? -6.681  10.632  58.615 1.00 100.68 ? 100 LYS A CE  1 
ATOM   749  N NZ  . LYS A 1 98  ? -6.672  11.719  57.595 1.00 108.02 ? 100 LYS A NZ  1 
ATOM   750  N N   . PHE A 1 99  ? -10.802 5.532   57.294 1.00 71.63  ? 101 PHE A N   1 
ATOM   751  C CA  . PHE A 1 99  ? -11.522 5.083   56.086 1.00 71.52  ? 101 PHE A CA  1 
ATOM   752  C C   . PHE A 1 99  ? -12.228 6.214   55.331 1.00 73.52  ? 101 PHE A C   1 
ATOM   753  O O   . PHE A 1 99  ? -12.476 7.287   55.871 1.00 78.00  ? 101 PHE A O   1 
ATOM   754  C CB  . PHE A 1 99  ? -12.480 3.922   56.373 1.00 69.02  ? 101 PHE A CB  1 
ATOM   755  C CG  . PHE A 1 99  ? -13.731 4.304   57.103 1.00 70.07  ? 101 PHE A CG  1 
ATOM   756  C CD1 . PHE A 1 99  ? -14.839 4.774   56.411 1.00 67.95  ? 101 PHE A CD1 1 
ATOM   757  C CD2 . PHE A 1 99  ? -13.824 4.128   58.485 1.00 71.99  ? 101 PHE A CD2 1 
ATOM   758  C CE1 . PHE A 1 99  ? -16.019 5.122   57.087 1.00 70.62  ? 101 PHE A CE1 1 
ATOM   759  C CE2 . PHE A 1 99  ? -15.002 4.457   59.179 1.00 78.21  ? 101 PHE A CE2 1 
ATOM   760  C CZ  . PHE A 1 99  ? -16.104 4.950   58.474 1.00 73.75  ? 101 PHE A CZ  1 
ATOM   761  N N   . GLY A 1 100 ? -12.541 5.965   54.067 1.00 72.96  ? 102 GLY A N   1 
ATOM   762  C CA  . GLY A 1 100 ? -13.197 6.962   53.235 1.00 72.27  ? 102 GLY A CA  1 
ATOM   763  C C   . GLY A 1 100 ? -13.583 6.368   51.903 1.00 69.53  ? 102 GLY A C   1 
ATOM   764  O O   . GLY A 1 100 ? -12.762 5.746   51.236 1.00 69.09  ? 102 GLY A O   1 
ATOM   765  N N   . PHE A 1 101 ? -14.847 6.528   51.534 1.00 68.75  ? 103 PHE A N   1 
ATOM   766  C CA  . PHE A 1 101 ? -15.329 6.094   50.224 1.00 68.38  ? 103 PHE A CA  1 
ATOM   767  C C   . PHE A 1 101 ? -16.395 7.082   49.723 1.00 73.29  ? 103 PHE A C   1 
ATOM   768  O O   . PHE A 1 101 ? -17.118 7.685   50.516 1.00 74.60  ? 103 PHE A O   1 
ATOM   769  C CB  . PHE A 1 101 ? -15.889 4.666   50.289 1.00 63.02  ? 103 PHE A CB  1 
ATOM   770  C CG  . PHE A 1 101 ? -17.013 4.496   51.290 1.00 65.34  ? 103 PHE A CG  1 
ATOM   771  C CD1 . PHE A 1 101 ? -18.338 4.615   50.897 1.00 59.54  ? 103 PHE A CD1 1 
ATOM   772  C CD2 . PHE A 1 101 ? -16.734 4.234   52.633 1.00 64.03  ? 103 PHE A CD2 1 
ATOM   773  C CE1 . PHE A 1 101 ? -19.363 4.485   51.821 1.00 58.50  ? 103 PHE A CE1 1 
ATOM   774  C CE2 . PHE A 1 101 ? -17.755 4.088   53.569 1.00 54.55  ? 103 PHE A CE2 1 
ATOM   775  C CZ  . PHE A 1 101 ? -19.075 4.218   53.161 1.00 63.19  ? 103 PHE A CZ  1 
ATOM   776  N N   . GLU A 1 102 ? -16.465 7.242   48.402 1.00 76.20  ? 104 GLU A N   1 
ATOM   777  C CA  . GLU A 1 102 ? -17.434 8.120   47.751 1.00 80.18  ? 104 GLU A CA  1 
ATOM   778  C C   . GLU A 1 102 ? -18.654 7.296   47.337 1.00 78.16  ? 104 GLU A C   1 
ATOM   779  O O   . GLU A 1 102 ? -18.503 6.232   46.711 1.00 74.00  ? 104 GLU A O   1 
ATOM   780  C CB  . GLU A 1 102 ? -16.787 8.777   46.525 1.00 80.22  ? 104 GLU A CB  1 
ATOM   781  C CG  . GLU A 1 102 ? -17.206 10.210  46.297 1.00 90.16  ? 104 GLU A CG  1 
ATOM   782  C CD  . GLU A 1 102 ? -16.127 11.056  45.636 1.00 101.58 ? 104 GLU A CD  1 
ATOM   783  O OE1 . GLU A 1 102 ? -15.995 12.241  46.020 1.00 104.26 ? 104 GLU A OE1 1 
ATOM   784  O OE2 . GLU A 1 102 ? -15.409 10.548  44.743 1.00 101.45 ? 104 GLU A OE2 1 
ATOM   785  N N   . LEU A 1 103 ? -19.847 7.772   47.710 1.00 78.96  ? 105 LEU A N   1 
ATOM   786  C CA  . LEU A 1 103 ? -21.105 7.141   47.294 1.00 78.31  ? 105 LEU A CA  1 
ATOM   787  C C   . LEU A 1 103 ? -21.333 7.372   45.779 1.00 79.34  ? 105 LEU A C   1 
ATOM   788  O O   . LEU A 1 103 ? -20.725 8.280   45.204 1.00 81.40  ? 105 LEU A O   1 
ATOM   789  C CB  . LEU A 1 103 ? -22.281 7.688   48.117 1.00 79.66  ? 105 LEU A CB  1 
ATOM   790  C CG  . LEU A 1 103 ? -22.470 7.338   49.602 1.00 77.71  ? 105 LEU A CG  1 
ATOM   791  C CD1 . LEU A 1 103 ? -23.369 8.387   50.245 1.00 77.30  ? 105 LEU A CD1 1 
ATOM   792  C CD2 . LEU A 1 103 ? -23.037 5.932   49.840 1.00 60.34  ? 105 LEU A CD2 1 
ATOM   793  N N   . PRO A 1 104 ? -22.178 6.540   45.124 1.00 78.01  ? 106 PRO A N   1 
ATOM   794  C CA  . PRO A 1 104 ? -22.394 6.699   43.675 1.00 80.19  ? 106 PRO A CA  1 
ATOM   795  C C   . PRO A 1 104 ? -23.185 7.954   43.284 1.00 84.16  ? 106 PRO A C   1 
ATOM   796  O O   . PRO A 1 104 ? -23.939 8.495   44.103 1.00 85.04  ? 106 PRO A O   1 
ATOM   797  C CB  . PRO A 1 104 ? -23.214 5.458   43.298 1.00 77.28  ? 106 PRO A CB  1 
ATOM   798  C CG  . PRO A 1 104 ? -23.139 4.540   44.477 1.00 75.31  ? 106 PRO A CG  1 
ATOM   799  C CD  . PRO A 1 104 ? -22.958 5.411   45.661 1.00 76.03  ? 106 PRO A CD  1 
ATOM   800  N N   . GLN A 1 105 ? -22.982 8.403   42.042 1.00 86.99  ? 107 GLN A N   1 
ATOM   801  C CA  . GLN A 1 105 ? -23.863 9.373   41.374 1.00 90.34  ? 107 GLN A CA  1 
ATOM   802  C C   . GLN A 1 105 ? -25.130 8.686   40.886 1.00 89.67  ? 107 GLN A C   1 
ATOM   803  O O   . GLN A 1 105 ? -25.067 7.591   40.314 1.00 89.88  ? 107 GLN A O   1 
ATOM   804  C CB  . GLN A 1 105 ? -23.161 10.020  40.178 1.00 90.74  ? 107 GLN A CB  1 
ATOM   805  C CG  . GLN A 1 105 ? -22.902 11.510  40.324 1.00 99.01  ? 107 GLN A CG  1 
ATOM   806  C CD  . GLN A 1 105 ? -21.621 11.828  41.074 1.00 106.07 ? 107 GLN A CD  1 
ATOM   807  O OE1 . GLN A 1 105 ? -21.133 11.027  41.872 1.00 111.26 ? 107 GLN A OE1 1 
ATOM   808  N NE2 . GLN A 1 105 ? -21.071 13.011  40.822 1.00 111.32 ? 107 GLN A NE2 1 
ATOM   809  N N   . GLY A 1 106 ? -26.276 9.325   41.102 1.00 89.92  ? 108 GLY A N   1 
ATOM   810  C CA  . GLY A 1 106 ? -27.542 8.766   40.647 1.00 87.30  ? 108 GLY A CA  1 
ATOM   811  C C   . GLY A 1 106 ? -28.294 7.959   41.695 1.00 86.16  ? 108 GLY A C   1 
ATOM   812  O O   . GLY A 1 106 ? -28.259 8.295   42.888 1.00 86.89  ? 108 GLY A O   1 
ATOM   813  N N   . PRO A 1 107 ? -28.978 6.877   41.262 1.00 84.04  ? 109 PRO A N   1 
ATOM   814  C CA  . PRO A 1 107 ? -29.936 6.239   42.170 1.00 83.87  ? 109 PRO A CA  1 
ATOM   815  C C   . PRO A 1 107 ? -29.224 5.627   43.379 1.00 82.81  ? 109 PRO A C   1 
ATOM   816  O O   . PRO A 1 107 ? -28.201 4.944   43.219 1.00 79.61  ? 109 PRO A O   1 
ATOM   817  C CB  . PRO A 1 107 ? -30.608 5.167   41.294 1.00 81.35  ? 109 PRO A CB  1 
ATOM   818  C CG  . PRO A 1 107 ? -29.608 4.860   40.233 1.00 79.39  ? 109 PRO A CG  1 
ATOM   819  C CD  . PRO A 1 107 ? -28.882 6.165   39.972 1.00 82.72  ? 109 PRO A CD  1 
ATOM   820  N N   . LEU A 1 108 ? -29.741 5.915   44.573 1.00 83.46  ? 110 LEU A N   1 
ATOM   821  C CA  . LEU A 1 108 ? -29.172 5.371   45.795 1.00 83.09  ? 110 LEU A CA  1 
ATOM   822  C C   . LEU A 1 108 ? -30.075 4.284   46.366 1.00 83.39  ? 110 LEU A C   1 
ATOM   823  O O   . LEU A 1 108 ? -29.809 3.736   47.443 1.00 83.22  ? 110 LEU A O   1 
ATOM   824  C CB  . LEU A 1 108 ? -28.857 6.480   46.810 1.00 85.42  ? 110 LEU A CB  1 
ATOM   825  C CG  . LEU A 1 108 ? -27.762 7.479   46.389 1.00 88.62  ? 110 LEU A CG  1 
ATOM   826  C CD1 . LEU A 1 108 ? -27.726 8.689   47.300 1.00 94.97  ? 110 LEU A CD1 1 
ATOM   827  C CD2 . LEU A 1 108 ? -26.366 6.851   46.275 1.00 82.93  ? 110 LEU A CD2 1 
ATOM   828  N N   . GLY A 1 109 ? -31.130 3.961   45.620 1.00 83.23  ? 111 GLY A N   1 
ATOM   829  C CA  . GLY A 1 109 ? -32.045 2.882   45.994 1.00 86.00  ? 111 GLY A CA  1 
ATOM   830  C C   . GLY A 1 109 ? -33.151 3.333   46.920 1.00 91.76  ? 111 GLY A C   1 
ATOM   831  O O   . GLY A 1 109 ? -33.915 2.516   47.448 1.00 92.78  ? 111 GLY A O   1 
ATOM   832  N N   . THR A 1 110 ? -33.238 4.646   47.103 1.00 95.84  ? 112 THR A N   1 
ATOM   833  C CA  . THR A 1 110 ? -34.171 5.257   48.037 1.00 101.10 ? 112 THR A CA  1 
ATOM   834  C C   . THR A 1 110 ? -35.533 5.437   47.330 1.00 103.71 ? 112 THR A C   1 
ATOM   835  O O   . THR A 1 110 ? -36.466 6.030   47.881 1.00 106.67 ? 112 THR A O   1 
ATOM   836  C CB  . THR A 1 110 ? -33.539 6.576   48.642 1.00 103.73 ? 112 THR A CB  1 
ATOM   837  O OG1 . THR A 1 110 ? -34.199 6.958   49.857 1.00 102.38 ? 112 THR A OG1 1 
ATOM   838  C CG2 . THR A 1 110 ? -33.520 7.734   47.627 1.00 103.45 ? 112 THR A CG2 1 
ATOM   839  N N   . SER A 1 111 ? -35.630 4.862   46.123 1.00 102.95 ? 113 SER A N   1 
ATOM   840  C CA  . SER A 1 111 ? -36.783 5.006   45.212 1.00 104.20 ? 113 SER A CA  1 
ATOM   841  C C   . SER A 1 111 ? -38.112 4.530   45.801 1.00 107.43 ? 113 SER A C   1 
ATOM   842  O O   . SER A 1 111 ? -39.057 5.321   45.924 1.00 110.97 ? 113 SER A O   1 
ATOM   843  C CB  . SER A 1 111 ? -36.508 4.322   43.858 1.00 100.62 ? 113 SER A CB  1 
ATOM   844  O OG  . SER A 1 111 ? -35.984 3.010   44.016 1.00 98.47  ? 113 SER A OG  1 
ATOM   845  N N   . PHE A 1 112 ? -38.181 3.247   46.158 1.00 107.94 ? 114 PHE A N   1 
ATOM   846  C CA  . PHE A 1 112 ? -39.373 2.679   46.794 1.00 110.52 ? 114 PHE A CA  1 
ATOM   847  C C   . PHE A 1 112 ? -39.067 2.213   48.208 1.00 112.27 ? 114 PHE A C   1 
ATOM   848  O O   . PHE A 1 112 ? -38.158 1.411   48.438 1.00 111.27 ? 114 PHE A O   1 
ATOM   849  C CB  . PHE A 1 112 ? -39.990 1.554   45.948 1.00 109.26 ? 114 PHE A CB  1 
ATOM   850  C CG  . PHE A 1 112 ? -40.243 1.954   44.528 1.00 109.13 ? 114 PHE A CG  1 
ATOM   851  C CD1 . PHE A 1 112 ? -41.250 2.874   44.221 1.00 112.86 ? 114 PHE A CD1 1 
ATOM   852  C CD2 . PHE A 1 112 ? -39.458 1.445   43.501 1.00 104.00 ? 114 PHE A CD2 1 
ATOM   853  C CE1 . PHE A 1 112 ? -41.477 3.273   42.915 1.00 111.65 ? 114 PHE A CE1 1 
ATOM   854  C CE2 . PHE A 1 112 ? -39.676 1.837   42.188 1.00 108.02 ? 114 PHE A CE2 1 
ATOM   855  C CZ  . PHE A 1 112 ? -40.689 2.757   41.894 1.00 110.56 ? 114 PHE A CZ  1 
ATOM   856  N N   . LYS A 1 113 ? -39.839 2.749   49.145 1.00 115.23 ? 115 LYS A N   1 
ATOM   857  C CA  . LYS A 1 113 ? -39.657 2.503   50.564 1.00 116.06 ? 115 LYS A CA  1 
ATOM   858  C C   . LYS A 1 113 ? -41.011 2.298   51.248 1.00 117.19 ? 115 LYS A C   1 
ATOM   859  O O   . LYS A 1 113 ? -42.070 2.589   50.680 1.00 118.90 ? 115 LYS A O   1 
ATOM   860  C CB  . LYS A 1 113 ? -38.869 3.656   51.216 1.00 118.00 ? 115 LYS A CB  1 
ATOM   861  C CG  . LYS A 1 113 ? -39.597 5.015   51.263 1.00 123.66 ? 115 LYS A CG  1 
ATOM   862  C CD  . LYS A 1 113 ? -39.462 5.813   49.959 1.00 122.92 ? 115 LYS A CD  1 
ATOM   863  C CE  . LYS A 1 113 ? -40.120 7.184   50.066 1.00 128.57 ? 115 LYS A CE  1 
ATOM   864  N NZ  . LYS A 1 113 ? -39.616 8.119   49.021 1.00 127.78 ? 115 LYS A NZ  1 
ATOM   865  N N   . GLY A 1 114 ? -40.960 1.780   52.468 1.00 117.44 ? 116 GLY A N   1 
ATOM   866  C CA  . GLY A 1 114 ? -42.141 1.597   53.290 1.00 118.43 ? 116 GLY A CA  1 
ATOM   867  C C   . GLY A 1 114 ? -42.967 0.417   52.837 1.00 114.93 ? 116 GLY A C   1 
ATOM   868  O O   . GLY A 1 114 ? -42.626 -0.733  53.120 1.00 114.20 ? 116 GLY A O   1 
ATOM   869  N N   . LYS A 1 115 ? -44.053 0.714   52.127 1.00 112.56 ? 117 LYS A N   1 
ATOM   870  C CA  . LYS A 1 115 ? -45.019 -0.290  51.704 1.00 110.23 ? 117 LYS A CA  1 
ATOM   871  C C   . LYS A 1 115 ? -44.302 -1.488  51.075 1.00 104.69 ? 117 LYS A C   1 
ATOM   872  O O   . LYS A 1 115 ? -44.440 -2.624  51.539 1.00 103.38 ? 117 LYS A O   1 
ATOM   873  C CB  . LYS A 1 115 ? -46.009 0.328   50.701 1.00 109.46 ? 117 LYS A CB  1 
ATOM   874  C CG  . LYS A 1 115 ? -47.481 -0.018  50.916 1.00 114.97 ? 117 LYS A CG  1 
ATOM   875  C CD  . LYS A 1 115 ? -47.816 -1.480  50.620 1.00 115.53 ? 117 LYS A CD  1 
ATOM   876  C CE  . LYS A 1 115 ? -49.325 -1.714  50.689 1.00 120.28 ? 117 LYS A CE  1 
ATOM   877  N NZ  . LYS A 1 115 ? -49.649 -3.160  50.821 1.00 120.50 ? 117 LYS A NZ  1 
ATOM   878  N N   . TYR A 1 116 ? -43.515 -1.214  50.035 1.00 98.63  ? 118 TYR A N   1 
ATOM   879  C CA  . TYR A 1 116 ? -42.945 -2.271  49.213 1.00 95.00  ? 118 TYR A CA  1 
ATOM   880  C C   . TYR A 1 116 ? -41.434 -2.343  49.336 1.00 93.00  ? 118 TYR A C   1 
ATOM   881  O O   . TYR A 1 116 ? -40.849 -3.419  49.197 1.00 92.04  ? 118 TYR A O   1 
ATOM   882  C CB  . TYR A 1 116 ? -43.337 -2.075  47.748 1.00 91.16  ? 118 TYR A CB  1 
ATOM   883  C CG  . TYR A 1 116 ? -44.828 -2.015  47.502 1.00 91.39  ? 118 TYR A CG  1 
ATOM   884  C CD1 . TYR A 1 116 ? -45.623 -3.163  47.565 1.00 93.41  ? 118 TYR A CD1 1 
ATOM   885  C CD2 . TYR A 1 116 ? -45.443 -0.808  47.183 1.00 89.96  ? 118 TYR A CD2 1 
ATOM   886  C CE1 . TYR A 1 116 ? -47.012 -3.097  47.320 1.00 96.11  ? 118 TYR A CE1 1 
ATOM   887  C CE2 . TYR A 1 116 ? -46.813 -0.733  46.941 1.00 93.27  ? 118 TYR A CE2 1 
ATOM   888  C CZ  . TYR A 1 116 ? -47.589 -1.874  47.011 1.00 94.69  ? 118 TYR A CZ  1 
ATOM   889  O OH  . TYR A 1 116 ? -48.942 -1.768  46.771 1.00 103.88 ? 118 TYR A OH  1 
ATOM   890  N N   . GLY A 1 117 ? -40.816 -1.195  49.604 1.00 93.17  ? 119 GLY A N   1 
ATOM   891  C CA  . GLY A 1 117 ? -39.365 -1.099  49.664 1.00 92.20  ? 119 GLY A CA  1 
ATOM   892  C C   . GLY A 1 117 ? -38.706 -0.940  51.029 1.00 93.12  ? 119 GLY A C   1 
ATOM   893  O O   . GLY A 1 117 ? -39.315 -0.467  51.994 1.00 95.54  ? 119 GLY A O   1 
ATOM   894  N N   . SER A 1 118 ? -37.440 -1.351  51.081 1.00 90.40  ? 120 SER A N   1 
ATOM   895  C CA  . SER A 1 118 ? -36.532 -1.046  52.179 1.00 91.63  ? 120 SER A CA  1 
ATOM   896  C C   . SER A 1 118 ? -35.114 -0.739  51.645 1.00 88.03  ? 120 SER A C   1 
ATOM   897  O O   . SER A 1 118 ? -34.714 -1.255  50.599 1.00 85.48  ? 120 SER A O   1 
ATOM   898  C CB  . SER A 1 118 ? -36.513 -2.189  53.200 1.00 93.93  ? 120 SER A CB  1 
ATOM   899  O OG  . SER A 1 118 ? -36.959 -3.398  52.616 1.00 94.05  ? 120 SER A OG  1 
ATOM   900  N N   . VAL A 1 119 ? -34.394 0.138   52.343 1.00 87.05  ? 121 VAL A N   1 
ATOM   901  C CA  . VAL A 1 119 ? -33.029 0.531   51.983 1.00 84.48  ? 121 VAL A CA  1 
ATOM   902  C C   . VAL A 1 119 ? -32.090 0.296   53.197 1.00 86.62  ? 121 VAL A C   1 
ATOM   903  O O   . VAL A 1 119 ? -32.525 0.323   54.362 1.00 88.60  ? 121 VAL A O   1 
ATOM   904  C CB  . VAL A 1 119 ? -32.967 1.993   51.407 1.00 83.81  ? 121 VAL A CB  1 
ATOM   905  C CG1 . VAL A 1 119 ? -33.077 3.046   52.515 1.00 91.92  ? 121 VAL A CG1 1 
ATOM   906  C CG2 . VAL A 1 119 ? -31.707 2.216   50.594 1.00 79.66  ? 121 VAL A CG2 1 
ATOM   907  N N   . ASP A 1 120 ? -30.811 0.056   52.921 1.00 81.79  ? 122 ASP A N   1 
ATOM   908  C CA  . ASP A 1 120 ? -29.888 -0.415  53.945 1.00 81.63  ? 122 ASP A CA  1 
ATOM   909  C C   . ASP A 1 120 ? -28.509 0.114   53.591 1.00 76.32  ? 122 ASP A C   1 
ATOM   910  O O   . ASP A 1 120 ? -27.969 -0.254  52.557 1.00 75.60  ? 122 ASP A O   1 
ATOM   911  C CB  . ASP A 1 120 ? -29.837 -1.947  53.877 1.00 83.24  ? 122 ASP A CB  1 
ATOM   912  C CG  . ASP A 1 120 ? -30.083 -2.617  55.208 1.00 88.81  ? 122 ASP A CG  1 
ATOM   913  O OD1 . ASP A 1 120 ? -30.740 -3.678  55.183 1.00 92.08  ? 122 ASP A OD1 1 
ATOM   914  O OD2 . ASP A 1 120 ? -29.622 -2.112  56.258 1.00 99.27  ? 122 ASP A OD2 1 
ATOM   915  N N   . TYR A 1 121 ? -27.946 0.986   54.411 1.00 73.07  ? 123 TYR A N   1 
ATOM   916  C CA  . TYR A 1 121 ? -26.569 1.431   54.193 1.00 69.58  ? 123 TYR A CA  1 
ATOM   917  C C   . TYR A 1 121 ? -25.709 1.230   55.431 1.00 68.47  ? 123 TYR A C   1 
ATOM   918  O O   . TYR A 1 121 ? -26.008 1.770   56.482 1.00 71.85  ? 123 TYR A O   1 
ATOM   919  C CB  . TYR A 1 121 ? -26.511 2.888   53.714 1.00 69.15  ? 123 TYR A CB  1 
ATOM   920  C CG  . TYR A 1 121 ? -26.692 3.018   52.222 1.00 70.93  ? 123 TYR A CG  1 
ATOM   921  C CD1 . TYR A 1 121 ? -25.637 3.412   51.404 1.00 66.67  ? 123 TYR A CD1 1 
ATOM   922  C CD2 . TYR A 1 121 ? -27.925 2.745   51.629 1.00 71.91  ? 123 TYR A CD2 1 
ATOM   923  C CE1 . TYR A 1 121 ? -25.793 3.515   50.041 1.00 66.78  ? 123 TYR A CE1 1 
ATOM   924  C CE2 . TYR A 1 121 ? -28.103 2.856   50.272 1.00 72.69  ? 123 TYR A CE2 1 
ATOM   925  C CZ  . TYR A 1 121 ? -27.035 3.239   49.479 1.00 70.85  ? 123 TYR A CZ  1 
ATOM   926  O OH  . TYR A 1 121 ? -27.222 3.348   48.128 1.00 66.95  ? 123 TYR A OH  1 
ATOM   927  N N   . TRP A 1 122 ? -24.651 0.435   55.316 1.00 62.07  ? 124 TRP A N   1 
ATOM   928  C CA  . TRP A 1 122 ? -23.796 0.235   56.459 1.00 59.77  ? 124 TRP A CA  1 
ATOM   929  C C   . TRP A 1 122 ? -22.349 0.032   56.112 1.00 58.50  ? 124 TRP A C   1 
ATOM   930  O O   . TRP A 1 122 ? -21.999 -0.236  54.948 1.00 53.83  ? 124 TRP A O   1 
ATOM   931  C CB  . TRP A 1 122 ? -24.267 -0.938  57.312 1.00 61.20  ? 124 TRP A CB  1 
ATOM   932  C CG  . TRP A 1 122 ? -24.679 -2.154  56.561 1.00 70.88  ? 124 TRP A CG  1 
ATOM   933  C CD1 . TRP A 1 122 ? -25.957 -2.559  56.316 1.00 73.45  ? 124 TRP A CD1 1 
ATOM   934  C CD2 . TRP A 1 122 ? -23.815 -3.160  55.982 1.00 66.67  ? 124 TRP A CD2 1 
ATOM   935  N NE1 . TRP A 1 122 ? -25.949 -3.744  55.614 1.00 75.54  ? 124 TRP A NE1 1 
ATOM   936  C CE2 . TRP A 1 122 ? -24.651 -4.135  55.394 1.00 69.55  ? 124 TRP A CE2 1 
ATOM   937  C CE3 . TRP A 1 122 ? -22.424 -3.320  55.898 1.00 70.51  ? 124 TRP A CE3 1 
ATOM   938  C CZ2 . TRP A 1 122 ? -24.148 -5.257  54.720 1.00 67.26  ? 124 TRP A CZ2 1 
ATOM   939  C CZ3 . TRP A 1 122 ? -21.913 -4.449  55.226 1.00 65.32  ? 124 TRP A CZ3 1 
ATOM   940  C CH2 . TRP A 1 122 ? -22.778 -5.400  54.648 1.00 69.76  ? 124 TRP A CH2 1 
ATOM   941  N N   . VAL A 1 123 ? -21.532 0.130   57.160 1.00 59.05  ? 125 VAL A N   1 
ATOM   942  C CA  . VAL A 1 123 ? -20.106 -0.267  57.163 1.00 55.52  ? 125 VAL A CA  1 
ATOM   943  C C   . VAL A 1 123 ? -19.907 -1.357  58.204 1.00 56.84  ? 125 VAL A C   1 
ATOM   944  O O   . VAL A 1 123 ? -20.310 -1.161  59.364 1.00 58.81  ? 125 VAL A O   1 
ATOM   945  C CB  . VAL A 1 123 ? -19.199 0.891   57.636 1.00 56.47  ? 125 VAL A CB  1 
ATOM   946  C CG1 . VAL A 1 123 ? -17.767 0.462   57.613 1.00 49.85  ? 125 VAL A CG1 1 
ATOM   947  C CG2 . VAL A 1 123 ? -19.403 2.141   56.787 1.00 52.40  ? 125 VAL A CG2 1 
ATOM   948  N N   . LYS A 1 124 ? -19.329 -2.496  57.796 1.00 53.95  ? 126 LYS A N   1 
ATOM   949  C CA  . LYS A 1 124 ? -18.754 -3.457  58.739 1.00 54.24  ? 126 LYS A CA  1 
ATOM   950  C C   . LYS A 1 124 ? -17.247 -3.311  58.671 1.00 48.37  ? 126 LYS A C   1 
ATOM   951  O O   . LYS A 1 124 ? -16.677 -3.163  57.573 1.00 43.70  ? 126 LYS A O   1 
ATOM   952  C CB  . LYS A 1 124 ? -19.083 -4.905  58.397 1.00 53.57  ? 126 LYS A CB  1 
ATOM   953  C CG  . LYS A 1 124 ? -20.536 -5.263  58.348 1.00 63.25  ? 126 LYS A CG  1 
ATOM   954  C CD  . LYS A 1 124 ? -20.662 -6.760  58.515 1.00 72.39  ? 126 LYS A CD  1 
ATOM   955  C CE  . LYS A 1 124 ? -22.095 -7.245  58.354 1.00 84.56  ? 126 LYS A CE  1 
ATOM   956  N NZ  . LYS A 1 124 ? -22.416 -7.492  56.922 1.00 81.77  ? 126 LYS A NZ  1 
ATOM   957  N N   . ALA A 1 125 ? -16.640 -3.312  59.849 1.00 47.38  ? 127 ALA A N   1 
ATOM   958  C CA  . ALA A 1 125 ? -15.203 -3.412  60.069 1.00 47.67  ? 127 ALA A CA  1 
ATOM   959  C C   . ALA A 1 125 ? -14.981 -4.815  60.555 1.00 49.26  ? 127 ALA A C   1 
ATOM   960  O O   . ALA A 1 125 ? -15.798 -5.373  61.312 1.00 52.20  ? 127 ALA A O   1 
ATOM   961  C CB  . ALA A 1 125 ? -14.750 -2.473  61.144 1.00 45.92  ? 127 ALA A CB  1 
ATOM   962  N N   . PHE A 1 126 ? -13.867 -5.381  60.140 1.00 49.19  ? 128 PHE A N   1 
ATOM   963  C CA  . PHE A 1 126 ? -13.479 -6.707  60.589 1.00 48.14  ? 128 PHE A CA  1 
ATOM   964  C C   . PHE A 1 126 ? -12.121 -6.592  61.216 1.00 48.58  ? 128 PHE A C   1 
ATOM   965  O O   . PHE A 1 126 ? -11.239 -5.937  60.640 1.00 44.54  ? 128 PHE A O   1 
ATOM   966  C CB  . PHE A 1 126 ? -13.430 -7.651  59.392 1.00 48.18  ? 128 PHE A CB  1 
ATOM   967  C CG  . PHE A 1 126 ? -14.669 -7.595  58.516 1.00 45.75  ? 128 PHE A CG  1 
ATOM   968  C CD1 . PHE A 1 126 ? -15.741 -8.440  58.763 1.00 55.22  ? 128 PHE A CD1 1 
ATOM   969  C CD2 . PHE A 1 126 ? -14.747 -6.715  57.418 1.00 40.09  ? 128 PHE A CD2 1 
ATOM   970  C CE1 . PHE A 1 126 ? -16.876 -8.409  57.951 1.00 61.57  ? 128 PHE A CE1 1 
ATOM   971  C CE2 . PHE A 1 126 ? -15.890 -6.673  56.601 1.00 54.16  ? 128 PHE A CE2 1 
ATOM   972  C CZ  . PHE A 1 126 ? -16.949 -7.519  56.860 1.00 58.64  ? 128 PHE A CZ  1 
ATOM   973  N N   . LEU A 1 127 ? -11.954 -7.209  62.397 1.00 48.42  ? 129 LEU A N   1 
ATOM   974  C CA  . LEU A 1 127 ? -10.644 -7.380  63.017 1.00 50.33  ? 129 LEU A CA  1 
ATOM   975  C C   . LEU A 1 127 ? -10.116 -8.798  62.850 1.00 49.09  ? 129 LEU A C   1 
ATOM   976  O O   . LEU A 1 127 ? -10.724 -9.740  63.359 1.00 49.04  ? 129 LEU A O   1 
ATOM   977  C CB  . LEU A 1 127 ? -10.761 -7.094  64.514 1.00 50.11  ? 129 LEU A CB  1 
ATOM   978  C CG  . LEU A 1 127 ? -9.549  -7.095  65.434 1.00 52.94  ? 129 LEU A CG  1 
ATOM   979  C CD1 . LEU A 1 127 ? -8.514  -6.087  64.985 1.00 50.77  ? 129 LEU A CD1 1 
ATOM   980  C CD2 . LEU A 1 127 ? -10.019 -6.802  66.885 1.00 54.41  ? 129 LEU A CD2 1 
ATOM   981  N N   . ASP A 1 128 ? -8.975  -8.960  62.179 1.00 46.07  ? 130 ASP A N   1 
ATOM   982  C CA  . ASP A 1 128 ? -8.416  -10.271 61.983 1.00 44.45  ? 130 ASP A CA  1 
ATOM   983  C C   . ASP A 1 128 ? -7.246  -10.421 62.930 1.00 44.58  ? 130 ASP A C   1 
ATOM   984  O O   . ASP A 1 128 ? -6.435  -9.516  63.075 1.00 45.27  ? 130 ASP A O   1 
ATOM   985  C CB  . ASP A 1 128 ? -7.945  -10.472 60.547 1.00 45.30  ? 130 ASP A CB  1 
ATOM   986  C CG  . ASP A 1 128 ? -9.065  -10.318 59.525 1.00 52.22  ? 130 ASP A CG  1 
ATOM   987  O OD1 . ASP A 1 128 ? -10.227 -10.575 59.859 1.00 51.96  ? 130 ASP A OD1 1 
ATOM   988  O OD2 . ASP A 1 128 ? -8.784  -9.939  58.369 1.00 52.33  ? 130 ASP A OD2 1 
ATOM   989  N N   . ARG A 1 129 ? -7.154  -11.579 63.565 1.00 43.67  ? 131 ARG A N   1 
ATOM   990  C CA  . ARG A 1 129 ? -6.098  -11.852 64.534 1.00 45.06  ? 131 ARG A CA  1 
ATOM   991  C C   . ARG A 1 129 ? -5.613  -13.270 64.282 1.00 49.07  ? 131 ARG A C   1 
ATOM   992  O O   . ARG A 1 129 ? -6.391  -14.089 63.795 1.00 47.86  ? 131 ARG A O   1 
ATOM   993  C CB  . ARG A 1 129 ? -6.642  -11.739 65.945 1.00 46.25  ? 131 ARG A CB  1 
ATOM   994  C CG  . ARG A 1 129 ? -6.943  -10.303 66.410 1.00 47.83  ? 131 ARG A CG  1 
ATOM   995  C CD  . ARG A 1 129 ? -7.788  -10.277 67.689 1.00 47.63  ? 131 ARG A CD  1 
ATOM   996  N NE  . ARG A 1 129 ? -7.067  -10.775 68.841 1.00 61.42  ? 131 ARG A NE  1 
ATOM   997  C CZ  . ARG A 1 129 ? -7.636  -11.283 69.935 1.00 69.59  ? 131 ARG A CZ  1 
ATOM   998  N NH1 . ARG A 1 129 ? -8.955  -11.401 70.022 1.00 59.66  ? 131 ARG A NH1 1 
ATOM   999  N NH2 . ARG A 1 129 ? -6.873  -11.687 70.945 1.00 68.91  ? 131 ARG A NH2 1 
ATOM   1000 N N   . PRO A 1 130 ? -4.326  -13.556 64.592 1.00 51.03  ? 132 PRO A N   1 
ATOM   1001 C CA  . PRO A 1 130 ? -3.758  -14.899 64.497 1.00 53.49  ? 132 PRO A CA  1 
ATOM   1002 C C   . PRO A 1 130 ? -4.533  -15.870 65.404 1.00 57.26  ? 132 PRO A C   1 
ATOM   1003 O O   . PRO A 1 130 ? -4.762  -15.550 66.566 1.00 58.57  ? 132 PRO A O   1 
ATOM   1004 C CB  . PRO A 1 130 ? -2.353  -14.722 65.062 1.00 54.89  ? 132 PRO A CB  1 
ATOM   1005 C CG  . PRO A 1 130 ? -2.072  -13.258 64.974 1.00 54.14  ? 132 PRO A CG  1 
ATOM   1006 C CD  . PRO A 1 130 ? -3.367  -12.582 65.133 1.00 49.26  ? 132 PRO A CD  1 
ATOM   1007 N N   . SER A 1 131 ? -4.944  -17.021 64.870 1.00 59.47  ? 133 SER A N   1 
ATOM   1008 C CA  . SER A 1 131 ? -5.562  -18.093 65.659 1.00 62.73  ? 133 SER A CA  1 
ATOM   1009 C C   . SER A 1 131 ? -6.917  -17.722 66.259 1.00 66.57  ? 133 SER A C   1 
ATOM   1010 O O   . SER A 1 131 ? -7.491  -18.499 67.030 1.00 71.93  ? 133 SER A O   1 
ATOM   1011 C CB  . SER A 1 131 ? -4.612  -18.615 66.754 1.00 64.85  ? 133 SER A CB  1 
ATOM   1012 O OG  . SER A 1 131 ? -3.339  -19.016 66.230 1.00 70.79  ? 133 SER A OG  1 
ATOM   1013 N N   . GLN A 1 132 ? -7.446  -16.556 65.889 1.00 64.81  ? 134 GLN A N   1 
ATOM   1014 C CA  . GLN A 1 132 ? -8.779  -16.161 66.318 1.00 65.67  ? 134 GLN A CA  1 
ATOM   1015 C C   . GLN A 1 132 ? -9.755  -16.100 65.155 1.00 66.01  ? 134 GLN A C   1 
ATOM   1016 O O   . GLN A 1 132 ? -9.340  -15.883 64.013 1.00 66.66  ? 134 GLN A O   1 
ATOM   1017 C CB  . GLN A 1 132 ? -8.745  -14.826 67.068 1.00 63.53  ? 134 GLN A CB  1 
ATOM   1018 C CG  . GLN A 1 132 ? -7.805  -14.804 68.261 1.00 66.12  ? 134 GLN A CG  1 
ATOM   1019 C CD  . GLN A 1 132 ? -8.112  -15.897 69.280 1.00 76.79  ? 134 GLN A CD  1 
ATOM   1020 O OE1 . GLN A 1 132 ? -9.250  -16.383 69.380 1.00 78.16  ? 134 GLN A OE1 1 
ATOM   1021 N NE2 . GLN A 1 132 ? -7.087  -16.294 70.043 1.00 69.51  ? 134 GLN A NE2 1 
ATOM   1022 N N   . PRO A 1 133 ? -11.055 -16.348 65.430 1.00 68.43  ? 135 PRO A N   1 
ATOM   1023 C CA  . PRO A 1 133 ? -12.080 -16.004 64.466 1.00 65.81  ? 135 PRO A CA  1 
ATOM   1024 C C   . PRO A 1 133 ? -12.120 -14.492 64.317 1.00 63.48  ? 135 PRO A C   1 
ATOM   1025 O O   . PRO A 1 133 ? -11.809 -13.752 65.255 1.00 63.67  ? 135 PRO A O   1 
ATOM   1026 C CB  . PRO A 1 133 ? -13.377 -16.518 65.119 1.00 67.91  ? 135 PRO A CB  1 
ATOM   1027 C CG  . PRO A 1 133 ? -12.942 -17.498 66.113 1.00 74.92  ? 135 PRO A CG  1 
ATOM   1028 C CD  . PRO A 1 133 ? -11.642 -16.979 66.629 1.00 72.85  ? 135 PRO A CD  1 
ATOM   1029 N N   . THR A 1 134 ? -12.468 -14.029 63.136 1.00 62.31  ? 136 THR A N   1 
ATOM   1030 C CA  . THR A 1 134 ? -12.447 -12.607 62.917 1.00 63.40  ? 136 THR A CA  1 
ATOM   1031 C C   . THR A 1 134 ? -13.620 -12.001 63.708 1.00 63.74  ? 136 THR A C   1 
ATOM   1032 O O   . THR A 1 134 ? -14.672 -12.613 63.825 1.00 64.33  ? 136 THR A O   1 
ATOM   1033 C CB  . THR A 1 134 ? -12.453 -12.245 61.418 1.00 62.01  ? 136 THR A CB  1 
ATOM   1034 O OG1 . THR A 1 134 ? -13.778 -12.285 60.898 1.00 64.87  ? 136 THR A OG1 1 
ATOM   1035 C CG2 . THR A 1 134 ? -11.548 -13.210 60.595 1.00 66.79  ? 136 THR A CG2 1 
ATOM   1036 N N   . GLN A 1 135 ? -13.395 -10.841 64.309 1.00 62.62  ? 137 GLN A N   1 
ATOM   1037 C CA  . GLN A 1 135 ? -14.435 -10.140 65.036 1.00 62.74  ? 137 GLN A CA  1 
ATOM   1038 C C   . GLN A 1 135 ? -14.967 -9.064  64.122 1.00 62.97  ? 137 GLN A C   1 
ATOM   1039 O O   . GLN A 1 135 ? -14.192 -8.442  63.383 1.00 59.83  ? 137 GLN A O   1 
ATOM   1040 C CB  . GLN A 1 135 ? -13.845 -9.518  66.280 1.00 61.18  ? 137 GLN A CB  1 
ATOM   1041 C CG  . GLN A 1 135 ? -14.719 -8.501  66.967 1.00 70.66  ? 137 GLN A CG  1 
ATOM   1042 C CD  . GLN A 1 135 ? -14.198 -8.142  68.340 1.00 66.21  ? 137 GLN A CD  1 
ATOM   1043 O OE1 . GLN A 1 135 ? -13.259 -8.753  68.825 1.00 70.48  ? 137 GLN A OE1 1 
ATOM   1044 N NE2 . GLN A 1 135 ? -14.809 -7.155  68.973 1.00 68.16  ? 137 GLN A NE2 1 
ATOM   1045 N N   . GLU A 1 136 ? -16.280 -8.830  64.171 1.00 65.28  ? 138 GLU A N   1 
ATOM   1046 C CA  . GLU A 1 136 ? -16.866 -7.754  63.387 1.00 66.12  ? 138 GLU A CA  1 
ATOM   1047 C C   . GLU A 1 136 ? -17.724 -6.759  64.163 1.00 67.73  ? 138 GLU A C   1 
ATOM   1048 O O   . GLU A 1 136 ? -18.344 -7.096  65.173 1.00 67.25  ? 138 GLU A O   1 
ATOM   1049 C CB  . GLU A 1 136 ? -17.607 -8.302  62.163 1.00 68.81  ? 138 GLU A CB  1 
ATOM   1050 C CG  . GLU A 1 136 ? -19.018 -8.831  62.388 1.00 75.44  ? 138 GLU A CG  1 
ATOM   1051 C CD  . GLU A 1 136 ? -19.550 -9.555  61.158 1.00 74.74  ? 138 GLU A CD  1 
ATOM   1052 O OE1 . GLU A 1 136 ? -19.714 -10.791 61.207 1.00 80.03  ? 138 GLU A OE1 1 
ATOM   1053 O OE2 . GLU A 1 136 ? -19.775 -8.894  60.128 1.00 79.84  ? 138 GLU A OE2 1 
ATOM   1054 N N   . THR A 1 137 ? -17.727 -5.520  63.675 1.00 66.90  ? 139 THR A N   1 
ATOM   1055 C CA  . THR A 1 137 ? -18.673 -4.494  64.114 1.00 66.72  ? 139 THR A CA  1 
ATOM   1056 C C   . THR A 1 137 ? -19.360 -3.843  62.905 1.00 65.32  ? 139 THR A C   1 
ATOM   1057 O O   . THR A 1 137 ? -18.730 -3.686  61.858 1.00 59.84  ? 139 THR A O   1 
ATOM   1058 C CB  . THR A 1 137 ? -17.980 -3.422  64.941 1.00 68.02  ? 139 THR A CB  1 
ATOM   1059 O OG1 . THR A 1 137 ? -18.971 -2.543  65.480 1.00 69.07  ? 139 THR A OG1 1 
ATOM   1060 C CG2 . THR A 1 137 ? -17.012 -2.617  64.067 1.00 61.99  ? 139 THR A CG2 1 
ATOM   1061 N N   . LYS A 1 138 ? -20.626 -3.433  63.067 1.00 66.45  ? 140 LYS A N   1 
ATOM   1062 C CA  . LYS A 1 138 ? -21.456 -2.889  61.986 1.00 68.62  ? 140 LYS A CA  1 
ATOM   1063 C C   . LYS A 1 138 ? -22.132 -1.569  62.393 1.00 70.02  ? 140 LYS A C   1 
ATOM   1064 O O   . LYS A 1 138 ? -22.786 -1.529  63.415 1.00 74.84  ? 140 LYS A O   1 
ATOM   1065 C CB  . LYS A 1 138 ? -22.521 -3.930  61.619 1.00 69.87  ? 140 LYS A CB  1 
ATOM   1066 C CG  . LYS A 1 138 ? -23.586 -3.482  60.605 1.00 74.29  ? 140 LYS A CG  1 
ATOM   1067 C CD  . LYS A 1 138 ? -24.434 -4.679  60.223 1.00 79.81  ? 140 LYS A CD  1 
ATOM   1068 C CE  . LYS A 1 138 ? -25.562 -4.316  59.283 1.00 85.88  ? 140 LYS A CE  1 
ATOM   1069 N NZ  . LYS A 1 138 ? -26.682 -5.297  59.401 1.00 87.23  ? 140 LYS A NZ  1 
ATOM   1070 N N   . LYS A 1 139 ? -21.948 -0.506  61.609 1.00 69.60  ? 141 LYS A N   1 
ATOM   1071 C CA  . LYS A 1 139 ? -22.659 0.779   61.810 1.00 73.37  ? 141 LYS A CA  1 
ATOM   1072 C C   . LYS A 1 139 ? -23.425 1.275   60.582 1.00 73.16  ? 141 LYS A C   1 
ATOM   1073 O O   . LYS A 1 139 ? -22.814 1.597   59.535 1.00 66.15  ? 141 LYS A O   1 
ATOM   1074 C CB  . LYS A 1 139 ? -21.715 1.889   62.267 1.00 75.76  ? 141 LYS A CB  1 
ATOM   1075 C CG  . LYS A 1 139 ? -21.759 2.169   63.754 1.00 80.51  ? 141 LYS A CG  1 
ATOM   1076 C CD  . LYS A 1 139 ? -22.685 3.340   64.083 1.00 84.73  ? 141 LYS A CD  1 
ATOM   1077 C CE  . LYS A 1 139 ? -22.613 3.643   65.571 1.00 97.00  ? 141 LYS A CE  1 
ATOM   1078 N NZ  . LYS A 1 139 ? -21.226 3.922   66.075 1.00 90.09  ? 141 LYS A NZ  1 
ATOM   1079 N N   . ASN A 1 140 ? -24.751 1.378   60.729 1.00 73.45  ? 142 ASN A N   1 
ATOM   1080 C CA  . ASN A 1 140 ? -25.594 1.901   59.659 1.00 75.55  ? 142 ASN A CA  1 
ATOM   1081 C C   . ASN A 1 140 ? -25.380 3.399   59.463 1.00 78.73  ? 142 ASN A C   1 
ATOM   1082 O O   . ASN A 1 140 ? -25.023 4.100   60.411 1.00 83.12  ? 142 ASN A O   1 
ATOM   1083 C CB  . ASN A 1 140 ? -27.074 1.604   59.920 1.00 80.32  ? 142 ASN A CB  1 
ATOM   1084 C CG  . ASN A 1 140 ? -27.410 0.138   59.767 1.00 83.30  ? 142 ASN A CG  1 
ATOM   1085 O OD1 . ASN A 1 140 ? -27.254 -0.643  60.703 1.00 90.63  ? 142 ASN A OD1 1 
ATOM   1086 N ND2 . ASN A 1 140 ? -27.898 -0.243  58.583 1.00 92.65  ? 142 ASN A ND2 1 
ATOM   1087 N N   . PHE A 1 141 ? -25.570 3.883   58.234 1.00 74.79  ? 143 PHE A N   1 
ATOM   1088 C CA  . PHE A 1 141 ? -25.611 5.323   57.978 1.00 79.71  ? 143 PHE A CA  1 
ATOM   1089 C C   . PHE A 1 141 ? -26.811 5.684   57.101 1.00 83.86  ? 143 PHE A C   1 
ATOM   1090 O O   . PHE A 1 141 ? -27.484 4.803   56.494 1.00 80.94  ? 143 PHE A O   1 
ATOM   1091 C CB  . PHE A 1 141 ? -24.291 5.909   57.416 1.00 77.01  ? 143 PHE A CB  1 
ATOM   1092 C CG  . PHE A 1 141 ? -23.881 5.341   56.080 1.00 73.11  ? 143 PHE A CG  1 
ATOM   1093 C CD1 . PHE A 1 141 ? -24.309 5.932   54.894 1.00 71.01  ? 143 PHE A CD1 1 
ATOM   1094 C CD2 . PHE A 1 141 ? -23.046 4.215   56.007 1.00 68.46  ? 143 PHE A CD2 1 
ATOM   1095 C CE1 . PHE A 1 141 ? -23.947 5.392   53.645 1.00 56.79  ? 143 PHE A CE1 1 
ATOM   1096 C CE2 . PHE A 1 141 ? -22.679 3.674   54.781 1.00 65.26  ? 143 PHE A CE2 1 
ATOM   1097 C CZ  . PHE A 1 141 ? -23.118 4.258   53.594 1.00 63.61  ? 143 PHE A CZ  1 
ATOM   1098 N N   . GLU A 1 142 ? -27.067 6.987   57.037 1.00 90.10  ? 144 GLU A N   1 
ATOM   1099 C CA  . GLU A 1 142 ? -28.277 7.498   56.409 1.00 93.52  ? 144 GLU A CA  1 
ATOM   1100 C C   . GLU A 1 142 ? -27.996 8.053   55.042 1.00 92.89  ? 144 GLU A C   1 
ATOM   1101 O O   . GLU A 1 142 ? -27.111 8.899   54.861 1.00 92.97  ? 144 GLU A O   1 
ATOM   1102 C CB  . GLU A 1 142 ? -28.938 8.574   57.281 1.00 97.19  ? 144 GLU A CB  1 
ATOM   1103 C CG  . GLU A 1 142 ? -30.390 8.839   56.908 1.00 104.72 ? 144 GLU A CG  1 
ATOM   1104 C CD  . GLU A 1 142 ? -31.376 7.812   57.480 1.00 112.58 ? 144 GLU A CD  1 
ATOM   1105 O OE1 . GLU A 1 142 ? -30.936 6.826   58.137 1.00 100.12 ? 144 GLU A OE1 1 
ATOM   1106 O OE2 . GLU A 1 142 ? -32.603 8.010   57.270 1.00 111.22 ? 144 GLU A OE2 1 
ATOM   1107 N N   . VAL A 1 143 ? -28.778 7.577   54.084 1.00 94.59  ? 145 VAL A N   1 
ATOM   1108 C CA  . VAL A 1 143 ? -28.732 8.100   52.742 1.00 96.55  ? 145 VAL A CA  1 
ATOM   1109 C C   . VAL A 1 143 ? -30.047 8.836   52.447 1.00 100.84 ? 145 VAL A C   1 
ATOM   1110 O O   . VAL A 1 143 ? -31.051 8.643   53.153 1.00 101.90 ? 145 VAL A O   1 
ATOM   1111 C CB  . VAL A 1 143 ? -28.390 7.000   51.726 1.00 91.65  ? 145 VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 143 ? -29.650 6.326   51.179 1.00 91.48  ? 145 VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 143 ? -27.536 7.575   50.620 1.00 94.16  ? 145 VAL A CG2 1 
ATOM   1114 N N   . VAL A 1 144 ? -30.018 9.675   51.412 1.00 102.49 ? 146 VAL A N   1 
ATOM   1115 C CA  . VAL A 1 144 ? -31.051 10.674  51.162 1.00 107.10 ? 146 VAL A CA  1 
ATOM   1116 C C   . VAL A 1 144 ? -32.281 10.096  50.457 1.00 106.99 ? 146 VAL A C   1 
ATOM   1117 O O   . VAL A 1 144 ? -33.385 10.646  50.561 1.00 110.85 ? 146 VAL A O   1 
ATOM   1118 C CB  . VAL A 1 144 ? -30.464 11.853  50.358 1.00 108.15 ? 146 VAL A CB  1 
ATOM   1119 C CG1 . VAL A 1 144 ? -30.563 11.600  48.834 1.00 106.23 ? 146 VAL A CG1 1 
ATOM   1120 C CG2 . VAL A 1 144 ? -31.124 13.157  50.761 1.00 115.70 ? 146 VAL A CG2 1 
ATOM   1121 N N   . PRO A 1 152 ? -43.962 7.099   43.320 1.00 103.01 ? 154 PRO A N   1 
ATOM   1122 C CA  . PRO A 1 152 ? -45.231 6.623   42.748 1.00 103.04 ? 154 PRO A CA  1 
ATOM   1123 C C   . PRO A 1 152 ? -45.514 5.162   43.137 1.00 100.37 ? 154 PRO A C   1 
ATOM   1124 O O   . PRO A 1 152 ? -44.560 4.388   43.330 1.00 99.21  ? 154 PRO A O   1 
ATOM   1125 C CB  . PRO A 1 152 ? -44.998 6.751   41.239 1.00 100.37 ? 154 PRO A CB  1 
ATOM   1126 C CG  . PRO A 1 152 ? -43.504 6.547   41.075 1.00 97.49  ? 154 PRO A CG  1 
ATOM   1127 C CD  . PRO A 1 152 ? -42.858 7.087   42.337 1.00 99.20  ? 154 PRO A CD  1 
ATOM   1128 N N   . ASP A 1 153 ? -46.794 4.783   43.244 1.00 97.44  ? 155 ASP A N   1 
ATOM   1129 C CA  . ASP A 1 153 ? -47.117 3.442   43.741 1.00 92.70  ? 155 ASP A CA  1 
ATOM   1130 C C   . ASP A 1 153 ? -46.714 2.313   42.798 1.00 84.70  ? 155 ASP A C   1 
ATOM   1131 O O   . ASP A 1 153 ? -47.016 2.327   41.610 1.00 82.57  ? 155 ASP A O   1 
ATOM   1132 C CB  . ASP A 1 153 ? -48.577 3.291   44.153 1.00 97.74  ? 155 ASP A CB  1 
ATOM   1133 C CG  . ASP A 1 153 ? -48.801 2.060   45.030 1.00 100.81 ? 155 ASP A CG  1 
ATOM   1134 O OD1 . ASP A 1 153 ? -49.339 1.052   44.529 1.00 101.98 ? 155 ASP A OD1 1 
ATOM   1135 O OD2 . ASP A 1 153 ? -48.421 2.088   46.222 1.00 109.05 ? 155 ASP A OD2 1 
ATOM   1136 N N   . LEU A 1 154 ? -46.031 1.332   43.366 1.00 77.74  ? 156 LEU A N   1 
ATOM   1137 C CA  . LEU A 1 154 ? -45.515 0.189   42.630 1.00 73.09  ? 156 LEU A CA  1 
ATOM   1138 C C   . LEU A 1 154 ? -46.608 -0.604  41.911 1.00 68.35  ? 156 LEU A C   1 
ATOM   1139 O O   . LEU A 1 154 ? -46.392 -1.155  40.834 1.00 65.66  ? 156 LEU A O   1 
ATOM   1140 C CB  . LEU A 1 154 ? -44.767 -0.719  43.610 1.00 72.27  ? 156 LEU A CB  1 
ATOM   1141 C CG  . LEU A 1 154 ? -44.051 -1.917  43.009 1.00 74.32  ? 156 LEU A CG  1 
ATOM   1142 C CD1 . LEU A 1 154 ? -42.802 -1.444  42.271 1.00 68.99  ? 156 LEU A CD1 1 
ATOM   1143 C CD2 . LEU A 1 154 ? -43.721 -2.920  44.097 1.00 77.04  ? 156 LEU A CD2 1 
ATOM   1144 N N   . MET A 1 155 ? -47.784 -0.659  42.514 1.00 68.25  ? 157 MET A N   1 
ATOM   1145 C CA  . MET A 1 155 ? -48.853 -1.480  41.985 1.00 68.78  ? 157 MET A CA  1 
ATOM   1146 C C   . MET A 1 155 ? -49.888 -0.710  41.131 1.00 65.99  ? 157 MET A C   1 
ATOM   1147 O O   . MET A 1 155 ? -50.874 -1.292  40.655 1.00 68.64  ? 157 MET A O   1 
ATOM   1148 C CB  . MET A 1 155 ? -49.503 -2.237  43.136 1.00 72.91  ? 157 MET A CB  1 
ATOM   1149 C CG  . MET A 1 155 ? -48.601 -3.252  43.772 1.00 73.14  ? 157 MET A CG  1 
ATOM   1150 S SD  . MET A 1 155 ? -48.344 -4.638  42.657 1.00 82.24  ? 157 MET A SD  1 
ATOM   1151 C CE  . MET A 1 155 ? -46.606 -4.552  42.235 1.00 70.74  ? 157 MET A CE  1 
ATOM   1152 N N   . ALA A 1 156 ? -49.667 0.597   40.963 1.00 62.41  ? 158 ALA A N   1 
ATOM   1153 C CA  . ALA A 1 156 ? -50.575 1.459   40.236 1.00 64.44  ? 158 ALA A CA  1 
ATOM   1154 C C   . ALA A 1 156 ? -50.254 1.301   38.774 1.00 62.75  ? 158 ALA A C   1 
ATOM   1155 O O   . ALA A 1 156 ? -49.072 1.150   38.432 1.00 61.29  ? 158 ALA A O   1 
ATOM   1156 C CB  . ALA A 1 156 ? -50.389 2.915   40.619 1.00 66.61  ? 158 ALA A CB  1 
ATOM   1157 N N   . PRO A 1 157 ? -51.299 1.341   37.917 1.00 63.29  ? 159 PRO A N   1 
ATOM   1158 C CA  . PRO A 1 157 ? -51.126 1.361   36.471 1.00 61.77  ? 159 PRO A CA  1 
ATOM   1159 C C   . PRO A 1 157 ? -50.178 2.454   36.013 1.00 63.86  ? 159 PRO A C   1 
ATOM   1160 O O   . PRO A 1 157 ? -50.012 3.468   36.692 1.00 63.23  ? 159 PRO A O   1 
ATOM   1161 C CB  . PRO A 1 157 ? -52.532 1.649   35.955 1.00 62.11  ? 159 PRO A CB  1 
ATOM   1162 C CG  . PRO A 1 157 ? -53.419 1.052   36.986 1.00 59.78  ? 159 PRO A CG  1 
ATOM   1163 C CD  . PRO A 1 157 ? -52.728 1.385   38.281 1.00 62.90  ? 159 PRO A CD  1 
ATOM   1164 N N   . VAL A 1 158 ? -49.562 2.227   34.854 1.00 61.71  ? 160 VAL A N   1 
ATOM   1165 C CA  . VAL A 1 158 ? -48.654 3.182   34.253 1.00 62.15  ? 160 VAL A CA  1 
ATOM   1166 C C   . VAL A 1 158 ? -49.182 3.438   32.846 1.00 58.82  ? 160 VAL A C   1 
ATOM   1167 O O   . VAL A 1 158 ? -49.551 2.502   32.154 1.00 57.88  ? 160 VAL A O   1 
ATOM   1168 C CB  . VAL A 1 158 ? -47.232 2.628   34.120 1.00 58.65  ? 160 VAL A CB  1 
ATOM   1169 C CG1 . VAL A 1 158 ? -46.282 3.724   33.612 1.00 60.39  ? 160 VAL A CG1 1 
ATOM   1170 C CG2 . VAL A 1 158 ? -46.733 2.039   35.425 1.00 63.21  ? 160 VAL A CG2 1 
ATOM   1171 N N   . SER A 1 159 ? -49.282 4.710   32.474 1.00 60.63  ? 161 SER A N   1 
ATOM   1172 C CA  . SER A 1 159 ? -49.624 5.107   31.118 1.00 59.04  ? 161 SER A CA  1 
ATOM   1173 C C   . SER A 1 159 ? -48.598 6.154   30.657 1.00 60.85  ? 161 SER A C   1 
ATOM   1174 O O   . SER A 1 159 ? -48.133 6.967   31.483 1.00 62.34  ? 161 SER A O   1 
ATOM   1175 C CB  . SER A 1 159 ? -51.051 5.605   31.045 1.00 62.77  ? 161 SER A CB  1 
ATOM   1176 O OG  . SER A 1 159 ? -51.152 6.976   31.365 1.00 72.52  ? 161 SER A OG  1 
ATOM   1177 N N   . ALA A 1 160 ? -48.190 6.060   29.375 1.00 53.91  ? 162 ALA A N   1 
ATOM   1178 C CA  . ALA A 1 160 ? -47.232 6.972   28.721 1.00 47.22  ? 162 ALA A CA  1 
ATOM   1179 C C   . ALA A 1 160 ? -47.636 7.141   27.242 1.00 45.27  ? 162 ALA A C   1 
ATOM   1180 O O   . ALA A 1 160 ? -48.271 6.245   26.678 1.00 40.88  ? 162 ALA A O   1 
ATOM   1181 C CB  . ALA A 1 160 ? -45.805 6.460   28.806 1.00 42.61  ? 162 ALA A CB  1 
ATOM   1182 N N   . LYS A 1 161 ? -47.278 8.302   26.674 1.00 41.62  ? 163 LYS A N   1 
ATOM   1183 C CA  . LYS A 1 161 ? -47.545 8.663   25.286 1.00 44.61  ? 163 LYS A CA  1 
ATOM   1184 C C   . LYS A 1 161 ? -46.348 9.434   24.744 1.00 45.87  ? 163 LYS A C   1 
ATOM   1185 O O   . LYS A 1 161 ? -45.642 10.106  25.513 1.00 46.51  ? 163 LYS A O   1 
ATOM   1186 C CB  . LYS A 1 161 ? -48.815 9.510   25.191 1.00 46.72  ? 163 LYS A CB  1 
ATOM   1187 C CG  . LYS A 1 161 ? -48.657 10.965  25.634 1.00 63.41  ? 163 LYS A CG  1 
ATOM   1188 C CD  . LYS A 1 161 ? -49.467 11.935  24.758 1.00 73.20  ? 163 LYS A CD  1 
ATOM   1189 C CE  . LYS A 1 161 ? -48.641 12.404  23.525 1.00 83.08  ? 163 LYS A CE  1 
ATOM   1190 N NZ  . LYS A 1 161 ? -49.473 12.848  22.350 1.00 81.80  ? 163 LYS A NZ  1 
ATOM   1191 N N   . LYS A 1 162 ? -46.104 9.312   23.435 1.00 42.96  ? 164 LYS A N   1 
ATOM   1192 C CA  . LYS A 1 162 ? -45.040 10.079  22.726 1.00 43.84  ? 164 LYS A CA  1 
ATOM   1193 C C   . LYS A 1 162 ? -45.478 10.216  21.283 1.00 44.88  ? 164 LYS A C   1 
ATOM   1194 O O   . LYS A 1 162 ? -45.924 9.242   20.680 1.00 43.50  ? 164 LYS A O   1 
ATOM   1195 C CB  . LYS A 1 162 ? -43.710 9.336   22.710 1.00 38.57  ? 164 LYS A CB  1 
ATOM   1196 C CG  . LYS A 1 162 ? -42.497 10.131  22.218 1.00 49.26  ? 164 LYS A CG  1 
ATOM   1197 C CD  . LYS A 1 162 ? -41.570 10.442  23.363 1.00 62.00  ? 164 LYS A CD  1 
ATOM   1198 C CE  . LYS A 1 162 ? -40.116 10.426  22.921 1.00 70.31  ? 164 LYS A CE  1 
ATOM   1199 N NZ  . LYS A 1 162 ? -39.297 9.588   23.853 1.00 51.30  ? 164 LYS A NZ  1 
ATOM   1200 N N   . GLU A 1 163 ? -45.332 11.423  20.753 1.00 46.97  ? 165 GLU A N   1 
ATOM   1201 C CA  . GLU A 1 163 ? -45.603 11.744  19.351 1.00 48.62  ? 165 GLU A CA  1 
ATOM   1202 C C   . GLU A 1 163 ? -44.356 12.381  18.757 1.00 49.85  ? 165 GLU A C   1 
ATOM   1203 O O   . GLU A 1 163 ? -43.640 13.102  19.451 1.00 49.42  ? 165 GLU A O   1 
ATOM   1204 C CB  . GLU A 1 163 ? -46.716 12.770  19.308 1.00 49.75  ? 165 GLU A CB  1 
ATOM   1205 C CG  . GLU A 1 163 ? -47.235 13.075  17.946 1.00 63.85  ? 165 GLU A CG  1 
ATOM   1206 C CD  . GLU A 1 163 ? -47.916 14.410  17.931 1.00 80.52  ? 165 GLU A CD  1 
ATOM   1207 O OE1 . GLU A 1 163 ? -47.252 15.402  18.330 1.00 85.67  ? 165 GLU A OE1 1 
ATOM   1208 O OE2 . GLU A 1 163 ? -49.102 14.462  17.530 1.00 85.18  ? 165 GLU A OE2 1 
ATOM   1209 N N   . LYS A 1 164 ? -44.102 12.107  17.480 1.00 48.55  ? 166 LYS A N   1 
ATOM   1210 C CA  . LYS A 1 164 ? -42.939 12.628  16.762 1.00 46.64  ? 166 LYS A CA  1 
ATOM   1211 C C   . LYS A 1 164 ? -43.385 13.063  15.393 1.00 47.37  ? 166 LYS A C   1 
ATOM   1212 O O   . LYS A 1 164 ? -44.201 12.395  14.765 1.00 38.82  ? 166 LYS A O   1 
ATOM   1213 C CB  . LYS A 1 164 ? -41.904 11.526  16.560 1.00 47.88  ? 166 LYS A CB  1 
ATOM   1214 C CG  . LYS A 1 164 ? -40.470 12.050  16.459 1.00 60.19  ? 166 LYS A CG  1 
ATOM   1215 C CD  . LYS A 1 164 ? -39.449 10.929  16.398 1.00 70.67  ? 166 LYS A CD  1 
ATOM   1216 C CE  . LYS A 1 164 ? -39.434 10.281  15.016 1.00 68.53  ? 166 LYS A CE  1 
ATOM   1217 N NZ  . LYS A 1 164 ? -38.060 10.062  14.513 1.00 57.82  ? 166 LYS A NZ  1 
ATOM   1218 N N   . LYS A 1 165 ? -42.840 14.196  14.952 1.00 48.82  ? 167 LYS A N   1 
ATOM   1219 C CA  . LYS A 1 165 ? -43.094 14.751  13.645 1.00 51.27  ? 167 LYS A CA  1 
ATOM   1220 C C   . LYS A 1 165 ? -42.232 13.964  12.659 1.00 50.32  ? 167 LYS A C   1 
ATOM   1221 O O   . LYS A 1 165 ? -41.007 13.829  12.839 1.00 46.78  ? 167 LYS A O   1 
ATOM   1222 C CB  . LYS A 1 165 ? -42.721 16.248  13.641 1.00 55.56  ? 167 LYS A CB  1 
ATOM   1223 C CG  . LYS A 1 165 ? -43.069 16.956  12.343 1.00 69.07  ? 167 LYS A CG  1 
ATOM   1224 C CD  . LYS A 1 165 ? -42.480 18.367  12.288 1.00 79.59  ? 167 LYS A CD  1 
ATOM   1225 C CE  . LYS A 1 165 ? -43.002 19.170  11.098 1.00 85.26  ? 167 LYS A CE  1 
ATOM   1226 N NZ  . LYS A 1 165 ? -42.126 20.352  10.792 1.00 90.69  ? 167 LYS A NZ  1 
ATOM   1227 N N   . VAL A 1 166 ? -42.885 13.431  11.617 1.00 47.65  ? 168 VAL A N   1 
ATOM   1228 C CA  . VAL A 1 166 ? -42.195 12.752  10.544 1.00 44.54  ? 168 VAL A CA  1 
ATOM   1229 C C   . VAL A 1 166 ? -42.689 13.361  9.223  1.00 49.03  ? 168 VAL A C   1 
ATOM   1230 O O   . VAL A 1 166 ? -43.664 12.855  8.632  1.00 46.09  ? 168 VAL A O   1 
ATOM   1231 C CB  . VAL A 1 166 ? -42.448 11.206  10.574 1.00 41.37  ? 168 VAL A CB  1 
ATOM   1232 C CG1 . VAL A 1 166 ? -41.735 10.522  9.400  1.00 47.46  ? 168 VAL A CG1 1 
ATOM   1233 C CG2 . VAL A 1 166 ? -42.008 10.576  11.888 1.00 43.00  ? 168 VAL A CG2 1 
ATOM   1234 N N   . SER A 1 167 ? -42.046 14.442  8.754  1.00 52.48  ? 169 SER A N   1 
ATOM   1235 C CA  . SER A 1 167 ? -42.576 15.213  7.574  1.00 51.60  ? 169 SER A CA  1 
ATOM   1236 C C   . SER A 1 167 ? -42.148 14.657  6.244  1.00 52.10  ? 169 SER A C   1 
ATOM   1237 O O   . SER A 1 167 ? -41.222 13.877  6.175  1.00 48.66  ? 169 SER A O   1 
ATOM   1238 C CB  . SER A 1 167 ? -42.092 16.664  7.605  1.00 56.58  ? 169 SER A CB  1 
ATOM   1239 O OG  . SER A 1 167 ? -40.680 16.681  7.646  1.00 60.97  ? 169 SER A OG  1 
ATOM   1240 N N   . SER A 1 168 ? -42.855 15.108  5.194  1.00 52.71  ? 170 SER A N   1 
ATOM   1241 C CA  . SER A 1 168 ? -42.672 14.762  3.797  1.00 56.24  ? 170 SER A CA  1 
ATOM   1242 C C   . SER A 1 168 ? -42.885 16.075  3.102  1.00 58.26  ? 170 SER A C   1 
ATOM   1243 O O   . SER A 1 168 ? -43.454 16.987  3.690  1.00 58.00  ? 170 SER A O   1 
ATOM   1244 C CB  . SER A 1 168 ? -43.848 13.883  3.308  1.00 53.96  ? 170 SER A CB  1 
ATOM   1245 O OG  . SER A 1 168 ? -43.705 12.586  3.804  1.00 67.38  ? 170 SER A OG  1 
ATOM   1246 N N   . MET A 1 169 ? -42.521 16.167  1.826  1.00 62.72  ? 171 MET A N   1 
ATOM   1247 C CA  . MET A 1 169 ? -42.899 17.345  1.037  1.00 65.53  ? 171 MET A CA  1 
ATOM   1248 C C   . MET A 1 169 ? -44.421 17.515  0.981  1.00 64.28  ? 171 MET A C   1 
ATOM   1249 O O   . MET A 1 169 ? -44.955 18.642  1.080  1.00 65.39  ? 171 MET A O   1 
ATOM   1250 C CB  . MET A 1 169 ? -42.346 17.224  -0.390 1.00 68.42  ? 171 MET A CB  1 
ATOM   1251 C CG  . MET A 1 169 ? -41.820 18.523  -0.957 1.00 79.28  ? 171 MET A CG  1 
ATOM   1252 S SD  . MET A 1 169 ? -41.623 18.471  -2.749 1.00 82.87  ? 171 MET A SD  1 
ATOM   1253 C CE  . MET A 1 169 ? -43.236 19.076  -3.205 1.00 85.69  ? 171 MET A CE  1 
ATOM   1254 N N   . PHE A 1 170 ? -45.119 16.390  0.827  1.00 63.07  ? 172 PHE A N   1 
ATOM   1255 C CA  . PHE A 1 170 ? -46.580 16.389  0.573  1.00 62.79  ? 172 PHE A CA  1 
ATOM   1256 C C   . PHE A 1 170 ? -47.405 16.157  1.815  1.00 61.04  ? 172 PHE A C   1 
ATOM   1257 O O   . PHE A 1 170 ? -48.618 16.343  1.810  1.00 58.21  ? 172 PHE A O   1 
ATOM   1258 C CB  . PHE A 1 170 ? -46.951 15.384  -0.534 1.00 60.57  ? 172 PHE A CB  1 
ATOM   1259 C CG  . PHE A 1 170 ? -46.429 15.796  -1.890 1.00 75.32  ? 172 PHE A CG  1 
ATOM   1260 C CD1 . PHE A 1 170 ? -46.831 17.004  -2.462 1.00 76.04  ? 172 PHE A CD1 1 
ATOM   1261 C CD2 . PHE A 1 170 ? -45.495 15.013  -2.573 1.00 78.95  ? 172 PHE A CD2 1 
ATOM   1262 C CE1 . PHE A 1 170 ? -46.313 17.415  -3.693 1.00 79.44  ? 172 PHE A CE1 1 
ATOM   1263 C CE2 . PHE A 1 170 ? -44.984 15.414  -3.817 1.00 77.56  ? 172 PHE A CE2 1 
ATOM   1264 C CZ  . PHE A 1 170 ? -45.385 16.610  -4.367 1.00 78.15  ? 172 PHE A CZ  1 
ATOM   1265 N N   . ILE A 1 171 ? -46.732 15.734  2.875  1.00 58.30  ? 173 ILE A N   1 
ATOM   1266 C CA  . ILE A 1 171 ? -47.321 15.663  4.217  1.00 56.30  ? 173 ILE A CA  1 
ATOM   1267 C C   . ILE A 1 171 ? -46.362 16.367  5.193  1.00 57.35  ? 173 ILE A C   1 
ATOM   1268 O O   . ILE A 1 171 ? -45.690 15.715  5.992  1.00 57.91  ? 173 ILE A O   1 
ATOM   1269 C CB  . ILE A 1 171 ? -47.610 14.182  4.643  1.00 54.63  ? 173 ILE A CB  1 
ATOM   1270 C CG1 . ILE A 1 171 ? -48.164 13.366  3.460  1.00 55.61  ? 173 ILE A CG1 1 
ATOM   1271 C CG2 . ILE A 1 171 ? -48.534 14.125  5.880  1.00 52.77  ? 173 ILE A CG2 1 
ATOM   1272 C CD1 . ILE A 1 171 ? -48.296 11.859  3.746  1.00 54.20  ? 173 ILE A CD1 1 
ATOM   1273 N N   . PRO A 1 172 ? -46.310 17.709  5.142  1.00 58.93  ? 174 PRO A N   1 
ATOM   1274 C CA  . PRO A 1 172 ? -45.348 18.458  5.961  1.00 61.75  ? 174 PRO A CA  1 
ATOM   1275 C C   . PRO A 1 172 ? -45.580 18.286  7.477  1.00 61.35  ? 174 PRO A C   1 
ATOM   1276 O O   . PRO A 1 172 ? -44.632 18.382  8.255  1.00 60.90  ? 174 PRO A O   1 
ATOM   1277 C CB  . PRO A 1 172 ? -45.566 19.913  5.535  1.00 63.98  ? 174 PRO A CB  1 
ATOM   1278 C CG  . PRO A 1 172 ? -46.334 19.825  4.208  1.00 68.70  ? 174 PRO A CG  1 
ATOM   1279 C CD  . PRO A 1 172 ? -47.159 18.599  4.318  1.00 62.80  ? 174 PRO A CD  1 
ATOM   1280 N N   . ASP A 1 173 ? -46.822 18.028  7.885  1.00 62.72  ? 175 ASP A N   1 
ATOM   1281 C CA  . ASP A 1 173 ? -47.128 17.838  9.310  1.00 63.10  ? 175 ASP A CA  1 
ATOM   1282 C C   . ASP A 1 173 ? -47.429 16.381  9.674  1.00 56.17  ? 175 ASP A C   1 
ATOM   1283 O O   . ASP A 1 173 ? -48.240 16.121  10.558 1.00 54.12  ? 175 ASP A O   1 
ATOM   1284 C CB  . ASP A 1 173 ? -48.283 18.750  9.774  1.00 68.27  ? 175 ASP A CB  1 
ATOM   1285 C CG  . ASP A 1 173 ? -48.335 18.886  11.301 1.00 77.98  ? 175 ASP A CG  1 
ATOM   1286 O OD1 . ASP A 1 173 ? -47.291 19.244  11.905 1.00 90.64  ? 175 ASP A OD1 1 
ATOM   1287 O OD2 . ASP A 1 173 ? -49.404 18.610  11.899 1.00 90.12  ? 175 ASP A OD2 1 
ATOM   1288 N N   . GLY A 1 174 ? -46.761 15.440  9.008  1.00 51.95  ? 176 GLY A N   1 
ATOM   1289 C CA  . GLY A 1 174 ? -46.962 14.019  9.276  1.00 46.51  ? 176 GLY A CA  1 
ATOM   1290 C C   . GLY A 1 174 ? -46.466 13.736  10.681 1.00 44.04  ? 176 GLY A C   1 
ATOM   1291 O O   . GLY A 1 174 ? -45.587 14.434  11.199 1.00 46.04  ? 176 GLY A O   1 
ATOM   1292 N N   . ARG A 1 175 ? -47.040 12.720  11.316 1.00 43.28  ? 177 ARG A N   1 
ATOM   1293 C CA  . ARG A 1 175 ? -46.729 12.403  12.681 1.00 42.08  ? 177 ARG A CA  1 
ATOM   1294 C C   . ARG A 1 175 ? -46.836 10.933  12.947 1.00 39.69  ? 177 ARG A C   1 
ATOM   1295 O O   . ARG A 1 175 ? -47.646 10.251  12.357 1.00 37.03  ? 177 ARG A O   1 
ATOM   1296 C CB  . ARG A 1 175 ? -47.678 13.124  13.628 1.00 49.83  ? 177 ARG A CB  1 
ATOM   1297 C CG  . ARG A 1 175 ? -47.207 14.522  13.911 1.00 62.05  ? 177 ARG A CG  1 
ATOM   1298 C CD  . ARG A 1 175 ? -48.325 15.533  14.149 1.00 78.90  ? 177 ARG A CD  1 
ATOM   1299 N NE  . ARG A 1 175 ? -47.805 16.904  14.060 1.00 84.47  ? 177 ARG A NE  1 
ATOM   1300 C CZ  . ARG A 1 175 ? -46.941 17.451  14.920 1.00 94.06  ? 177 ARG A CZ  1 
ATOM   1301 N NH1 . ARG A 1 175 ? -46.478 16.754  15.958 1.00 87.52  ? 177 ARG A NH1 1 
ATOM   1302 N NH2 . ARG A 1 175 ? -46.533 18.706  14.745 1.00 97.01  ? 177 ARG A NH2 1 
ATOM   1303 N N   . VAL A 1 176 ? -46.010 10.448  13.863 1.00 38.86  ? 178 VAL A N   1 
ATOM   1304 C CA  . VAL A 1 176 ? -46.166 9.091   14.349 1.00 32.54  ? 178 VAL A CA  1 
ATOM   1305 C C   . VAL A 1 176 ? -46.332 9.174   15.859 1.00 37.02  ? 178 VAL A C   1 
ATOM   1306 O O   . VAL A 1 176 ? -45.543 9.888   16.524 1.00 33.95  ? 178 VAL A O   1 
ATOM   1307 C CB  . VAL A 1 176 ? -44.929 8.254   14.006 1.00 30.65  ? 178 VAL A CB  1 
ATOM   1308 C CG1 . VAL A 1 176 ? -45.031 6.882   14.632 1.00 37.71  ? 178 VAL A CG1 1 
ATOM   1309 C CG2 . VAL A 1 176 ? -44.771 8.107   12.474 1.00 31.05  ? 178 VAL A CG2 1 
ATOM   1310 N N   . SER A 1 177 ? -47.336 8.485   16.421 1.00 33.11  ? 179 SER A N   1 
ATOM   1311 C CA  . SER A 1 177 ? -47.476 8.546   17.882 1.00 33.77  ? 179 SER A CA  1 
ATOM   1312 C C   . SER A 1 177 ? -47.711 7.174   18.476 1.00 37.18  ? 179 SER A C   1 
ATOM   1313 O O   . SER A 1 177 ? -48.128 6.232   17.781 1.00 36.38  ? 179 SER A O   1 
ATOM   1314 C CB  . SER A 1 177 ? -48.637 9.462   18.270 1.00 40.22  ? 179 SER A CB  1 
ATOM   1315 O OG  . SER A 1 177 ? -49.877 8.820   18.023 1.00 49.54  ? 179 SER A OG  1 
ATOM   1316 N N   . VAL A 1 178 ? -47.398 7.053   19.773 1.00 38.69  ? 180 VAL A N   1 
ATOM   1317 C CA  . VAL A 1 178 ? -47.676 5.834   20.520 1.00 37.11  ? 180 VAL A CA  1 
ATOM   1318 C C   . VAL A 1 178 ? -48.097 6.273   21.872 1.00 37.99  ? 180 VAL A C   1 
ATOM   1319 O O   . VAL A 1 178 ? -47.497 7.171   22.440 1.00 36.13  ? 180 VAL A O   1 
ATOM   1320 C CB  . VAL A 1 178 ? -46.478 4.831   20.590 1.00 40.77  ? 180 VAL A CB  1 
ATOM   1321 C CG1 . VAL A 1 178 ? -45.146 5.501   20.925 1.00 42.08  ? 180 VAL A CG1 1 
ATOM   1322 C CG2 . VAL A 1 178 ? -46.786 3.695   21.578 1.00 40.57  ? 180 VAL A CG2 1 
ATOM   1323 N N   . SER A 1 179 ? -49.134 5.620   22.368 1.00 39.52  ? 181 SER A N   1 
ATOM   1324 C CA  . SER A 1 179 ? -49.660 5.818   23.688 1.00 40.30  ? 181 SER A CA  1 
ATOM   1325 C C   . SER A 1 179 ? -49.872 4.402   24.232 1.00 41.87  ? 181 SER A C   1 
ATOM   1326 O O   . SER A 1 179 ? -50.473 3.565   23.557 1.00 44.65  ? 181 SER A O   1 
ATOM   1327 C CB  . SER A 1 179 ? -50.971 6.591   23.581 1.00 43.86  ? 181 SER A CB  1 
ATOM   1328 O OG  . SER A 1 179 ? -51.482 6.832   24.865 1.00 59.54  ? 181 SER A OG  1 
ATOM   1329 N N   . ALA A 1 180 ? -49.364 4.122   25.435 1.00 38.88  ? 182 ALA A N   1 
ATOM   1330 C CA  . ALA A 1 180 ? -49.388 2.752   25.974 1.00 37.08  ? 182 ALA A CA  1 
ATOM   1331 C C   . ALA A 1 180 ? -49.810 2.759   27.430 1.00 41.49  ? 182 ALA A C   1 
ATOM   1332 O O   . ALA A 1 180 ? -49.685 3.791   28.090 1.00 40.71  ? 182 ALA A O   1 
ATOM   1333 C CB  . ALA A 1 180 ? -48.035 2.127   25.834 1.00 33.54  ? 182 ALA A CB  1 
ATOM   1334 N N   . ARG A 1 181 ? -50.343 1.618   27.907 1.00 39.17  ? 183 ARG A N   1 
ATOM   1335 C CA  . ARG A 1 181 ? -50.776 1.463   29.273 1.00 40.91  ? 183 ARG A CA  1 
ATOM   1336 C C   . ARG A 1 181 ? -50.452 0.086   29.715 1.00 39.65  ? 183 ARG A C   1 
ATOM   1337 O O   . ARG A 1 181 ? -50.664 -0.873  28.970 1.00 39.90  ? 183 ARG A O   1 
ATOM   1338 C CB  . ARG A 1 181 ? -52.312 1.683   29.435 1.00 42.73  ? 183 ARG A CB  1 
ATOM   1339 C CG  . ARG A 1 181 ? -52.933 2.741   28.572 1.00 55.75  ? 183 ARG A CG  1 
ATOM   1340 C CD  . ARG A 1 181 ? -54.461 2.766   28.750 1.00 57.85  ? 183 ARG A CD  1 
ATOM   1341 N NE  . ARG A 1 181 ? -54.722 3.168   30.106 1.00 62.34  ? 183 ARG A NE  1 
ATOM   1342 C CZ  . ARG A 1 181 ? -55.068 4.397   30.461 1.00 68.45  ? 183 ARG A CZ  1 
ATOM   1343 N NH1 . ARG A 1 181 ? -55.263 5.353   29.554 1.00 75.28  ? 183 ARG A NH1 1 
ATOM   1344 N NH2 . ARG A 1 181 ? -55.220 4.658   31.725 1.00 56.33  ? 183 ARG A NH2 1 
ATOM   1345 N N   . ILE A 1 182 ? -49.906 -0.024  30.926 1.00 43.97  ? 184 ILE A N   1 
ATOM   1346 C CA  . ILE A 1 182 ? -49.752 -1.294  31.614 1.00 42.37  ? 184 ILE A CA  1 
ATOM   1347 C C   . ILE A 1 182 ? -50.375 -1.269  33.027 1.00 48.93  ? 184 ILE A C   1 
ATOM   1348 O O   . ILE A 1 182 ? -50.610 -0.194  33.584 1.00 51.80  ? 184 ILE A O   1 
ATOM   1349 C CB  . ILE A 1 182 ? -48.253 -1.743  31.692 1.00 37.51  ? 184 ILE A CB  1 
ATOM   1350 C CG1 . ILE A 1 182 ? -47.375 -0.670  32.334 1.00 37.08  ? 184 ILE A CG1 1 
ATOM   1351 C CG2 . ILE A 1 182 ? -47.765 -2.083  30.295 1.00 38.59  ? 184 ILE A CG2 1 
ATOM   1352 C CD1 . ILE A 1 182 ? -45.926 -1.130  32.700 1.00 41.61  ? 184 ILE A CD1 1 
ATOM   1353 N N   . ASP A 1 183 ? -50.537 -2.454  33.619 1.00 49.96  ? 185 ASP A N   1 
ATOM   1354 C CA  . ASP A 1 183 ? -51.325 -2.631  34.854 1.00 52.81  ? 185 ASP A CA  1 
ATOM   1355 C C   . ASP A 1 183 ? -50.629 -2.184  36.142 1.00 53.06  ? 185 ASP A C   1 
ATOM   1356 O O   . ASP A 1 183 ? -51.264 -1.961  37.166 1.00 60.04  ? 185 ASP A O   1 
ATOM   1357 C CB  . ASP A 1 183 ? -51.735 -4.100  35.007 1.00 54.35  ? 185 ASP A CB  1 
ATOM   1358 C CG  . ASP A 1 183 ? -52.648 -4.593  33.895 1.00 62.11  ? 185 ASP A CG  1 
ATOM   1359 O OD1 . ASP A 1 183 ? -52.974 -5.790  33.883 1.00 72.90  ? 185 ASP A OD1 1 
ATOM   1360 O OD2 . ASP A 1 183 ? -53.055 -3.804  33.027 1.00 64.24  ? 185 ASP A OD2 1 
ATOM   1361 N N   . ARG A 1 184 ? -49.322 -2.071  36.104 1.00 49.38  ? 186 ARG A N   1 
ATOM   1362 C CA  . ARG A 1 184 ? -48.531 -1.805  37.304 1.00 53.79  ? 186 ARG A CA  1 
ATOM   1363 C C   . ARG A 1 184 ? -47.074 -1.759  36.917 1.00 48.73  ? 186 ARG A C   1 
ATOM   1364 O O   . ARG A 1 184 ? -46.750 -2.063  35.776 1.00 49.38  ? 186 ARG A O   1 
ATOM   1365 C CB  . ARG A 1 184 ? -48.748 -2.881  38.361 1.00 58.28  ? 186 ARG A CB  1 
ATOM   1366 C CG  . ARG A 1 184 ? -48.211 -4.248  38.010 1.00 57.15  ? 186 ARG A CG  1 
ATOM   1367 C CD  . ARG A 1 184 ? -48.781 -5.263  38.981 1.00 66.44  ? 186 ARG A CD  1 
ATOM   1368 N NE  . ARG A 1 184 ? -48.354 -6.610  38.627 1.00 64.58  ? 186 ARG A NE  1 
ATOM   1369 C CZ  . ARG A 1 184 ? -49.098 -7.462  37.927 1.00 69.19  ? 186 ARG A CZ  1 
ATOM   1370 N NH1 . ARG A 1 184 ? -50.301 -7.094  37.502 1.00 65.98  ? 186 ARG A NH1 1 
ATOM   1371 N NH2 . ARG A 1 184 ? -48.628 -8.670  37.637 1.00 63.27  ? 186 ARG A NH2 1 
ATOM   1372 N N   . LYS A 1 185 ? -46.208 -1.374  37.857 1.00 49.49  ? 187 LYS A N   1 
ATOM   1373 C CA  . LYS A 1 185 ? -44.757 -1.329  37.641 1.00 51.57  ? 187 LYS A CA  1 
ATOM   1374 C C   . LYS A 1 185 ? -44.099 -2.657  38.016 1.00 51.39  ? 187 LYS A C   1 
ATOM   1375 O O   . LYS A 1 185 ? -43.145 -3.083  37.388 1.00 50.23  ? 187 LYS A O   1 
ATOM   1376 C CB  . LYS A 1 185 ? -44.160 -0.262  38.547 1.00 55.87  ? 187 LYS A CB  1 
ATOM   1377 C CG  . LYS A 1 185 ? -43.075 0.574   37.933 1.00 64.03  ? 187 LYS A CG  1 
ATOM   1378 C CD  . LYS A 1 185 ? -42.430 1.531   38.949 1.00 67.58  ? 187 LYS A CD  1 
ATOM   1379 C CE  . LYS A 1 185 ? -40.957 1.812   38.552 1.00 68.15  ? 187 LYS A CE  1 
ATOM   1380 N NZ  . LYS A 1 185 ? -40.580 3.268   38.615 1.00 70.37  ? 187 LYS A NZ  1 
ATOM   1381 N N   . GLY A 1 186 ? -44.608 -3.329  39.049 1.00 55.53  ? 188 GLY A N   1 
ATOM   1382 C CA  . GLY A 1 186 ? -43.907 -4.517  39.574 1.00 51.26  ? 188 GLY A CA  1 
ATOM   1383 C C   . GLY A 1 186 ? -44.511 -5.819  39.109 1.00 56.11  ? 188 GLY A C   1 
ATOM   1384 O O   . GLY A 1 186 ? -45.701 -6.036  39.295 1.00 54.96  ? 188 GLY A O   1 
ATOM   1385 N N   . PHE A 1 187 ? -43.685 -6.697  38.520 1.00 57.47  ? 189 PHE A N   1 
ATOM   1386 C CA  . PHE A 1 187 ? -44.139 -7.998  37.976 1.00 57.55  ? 189 PHE A CA  1 
ATOM   1387 C C   . PHE A 1 187 ? -43.207 -9.082  38.487 1.00 59.84  ? 189 PHE A C   1 
ATOM   1388 O O   . PHE A 1 187 ? -42.059 -8.802  38.777 1.00 55.06  ? 189 PHE A O   1 
ATOM   1389 C CB  . PHE A 1 187 ? -44.104 -8.023  36.435 1.00 55.24  ? 189 PHE A CB  1 
ATOM   1390 C CG  . PHE A 1 187 ? -45.075 -7.076  35.783 1.00 50.18  ? 189 PHE A CG  1 
ATOM   1391 C CD1 . PHE A 1 187 ? -46.355 -7.492  35.454 1.00 55.78  ? 189 PHE A CD1 1 
ATOM   1392 C CD2 . PHE A 1 187 ? -44.698 -5.777  35.502 1.00 43.48  ? 189 PHE A CD2 1 
ATOM   1393 C CE1 . PHE A 1 187 ? -47.267 -6.609  34.844 1.00 49.84  ? 189 PHE A CE1 1 
ATOM   1394 C CE2 . PHE A 1 187 ? -45.592 -4.889  34.911 1.00 45.53  ? 189 PHE A CE2 1 
ATOM   1395 C CZ  . PHE A 1 187 ? -46.877 -5.301  34.584 1.00 49.50  ? 189 PHE A CZ  1 
ATOM   1396 N N   . CYS A 1 188 ? -43.725 -10.308 38.578 1.00 64.42  ? 190 CYS A N   1 
ATOM   1397 C CA  . CYS A 1 188 ? -42.970 -11.477 39.014 1.00 68.55  ? 190 CYS A CA  1 
ATOM   1398 C C   . CYS A 1 188 ? -42.392 -12.199 37.812 1.00 64.77  ? 190 CYS A C   1 
ATOM   1399 O O   . CYS A 1 188 ? -43.079 -12.322 36.796 1.00 62.75  ? 190 CYS A O   1 
ATOM   1400 C CB  . CYS A 1 188 ? -43.937 -12.439 39.716 1.00 75.46  ? 190 CYS A CB  1 
ATOM   1401 S SG  . CYS A 1 188 ? -44.590 -11.860 41.316 1.00 94.95  ? 190 CYS A SG  1 
ATOM   1402 N N   . GLU A 1 189 ? -41.167 -12.722 37.924 1.00 65.35  ? 191 GLU A N   1 
ATOM   1403 C CA  . GLU A 1 189 ? -40.643 -13.613 36.885 1.00 67.06  ? 191 GLU A CA  1 
ATOM   1404 C C   . GLU A 1 189 ? -41.707 -14.650 36.532 1.00 70.53  ? 191 GLU A C   1 
ATOM   1405 O O   . GLU A 1 189 ? -42.363 -15.200 37.419 1.00 75.87  ? 191 GLU A O   1 
ATOM   1406 C CB  . GLU A 1 189 ? -39.351 -14.302 37.338 1.00 68.66  ? 191 GLU A CB  1 
ATOM   1407 C CG  . GLU A 1 189 ? -38.170 -13.335 37.509 1.00 68.03  ? 191 GLU A CG  1 
ATOM   1408 C CD  . GLU A 1 189 ? -36.844 -14.012 37.788 1.00 71.87  ? 191 GLU A CD  1 
ATOM   1409 O OE1 . GLU A 1 189 ? -35.804 -13.368 37.472 1.00 71.12  ? 191 GLU A OE1 1 
ATOM   1410 O OE2 . GLU A 1 189 ? -36.840 -15.165 38.311 1.00 68.01  ? 191 GLU A OE2 1 
ATOM   1411 N N   . GLY A 1 190 ? -41.923 -14.877 35.245 1.00 70.51  ? 192 GLY A N   1 
ATOM   1412 C CA  . GLY A 1 190 ? -42.935 -15.824 34.812 1.00 73.12  ? 192 GLY A CA  1 
ATOM   1413 C C   . GLY A 1 190 ? -44.278 -15.197 34.491 1.00 74.13  ? 192 GLY A C   1 
ATOM   1414 O O   . GLY A 1 190 ? -45.091 -15.809 33.800 1.00 76.48  ? 192 GLY A O   1 
ATOM   1415 N N   . ASP A 1 191 ? -44.517 -13.978 34.978 1.00 73.31  ? 193 ASP A N   1 
ATOM   1416 C CA  . ASP A 1 191 ? -45.709 -13.206 34.596 1.00 72.14  ? 193 ASP A CA  1 
ATOM   1417 C C   . ASP A 1 191 ? -45.790 -12.882 33.094 1.00 71.20  ? 193 ASP A C   1 
ATOM   1418 O O   . ASP A 1 191 ? -44.904 -13.203 32.302 1.00 71.22  ? 193 ASP A O   1 
ATOM   1419 C CB  . ASP A 1 191 ? -45.779 -11.885 35.379 1.00 71.46  ? 193 ASP A CB  1 
ATOM   1420 C CG  . ASP A 1 191 ? -46.366 -12.049 36.769 1.00 79.38  ? 193 ASP A CG  1 
ATOM   1421 O OD1 . ASP A 1 191 ? -46.806 -13.172 37.114 1.00 89.15  ? 193 ASP A OD1 1 
ATOM   1422 O OD2 . ASP A 1 191 ? -46.386 -11.046 37.525 1.00 81.59  ? 193 ASP A OD2 1 
ATOM   1423 N N   . GLU A 1 192 ? -46.886 -12.245 32.720 1.00 68.66  ? 194 GLU A N   1 
ATOM   1424 C CA  . GLU A 1 192 ? -46.997 -11.608 31.445 1.00 66.73  ? 194 GLU A CA  1 
ATOM   1425 C C   . GLU A 1 192 ? -47.311 -10.155 31.713 1.00 63.05  ? 194 GLU A C   1 
ATOM   1426 O O   . GLU A 1 192 ? -48.127 -9.844  32.583 1.00 63.58  ? 194 GLU A O   1 
ATOM   1427 C CB  . GLU A 1 192 ? -48.107 -12.252 30.624 1.00 70.21  ? 194 GLU A CB  1 
ATOM   1428 C CG  . GLU A 1 192 ? -47.567 -13.238 29.582 1.00 79.96  ? 194 GLU A CG  1 
ATOM   1429 C CD  . GLU A 1 192 ? -48.510 -14.394 29.308 1.00 93.80  ? 194 GLU A CD  1 
ATOM   1430 O OE1 . GLU A 1 192 ? -49.713 -14.143 29.064 1.00 100.63 ? 194 GLU A OE1 1 
ATOM   1431 O OE2 . GLU A 1 192 ? -48.039 -15.558 29.337 1.00 100.63 ? 194 GLU A OE2 1 
ATOM   1432 N N   . ILE A 1 193 ? -46.635 -9.267  30.989 1.00 56.83  ? 195 ILE A N   1 
ATOM   1433 C CA  . ILE A 1 193 ? -47.019 -7.867  30.945 1.00 50.73  ? 195 ILE A CA  1 
ATOM   1434 C C   . ILE A 1 193 ? -47.987 -7.709  29.779 1.00 51.94  ? 195 ILE A C   1 
ATOM   1435 O O   . ILE A 1 193 ? -47.637 -7.896  28.650 1.00 49.53  ? 195 ILE A O   1 
ATOM   1436 C CB  . ILE A 1 193 ? -45.797 -6.926  30.783 1.00 48.16  ? 195 ILE A CB  1 
ATOM   1437 C CG1 . ILE A 1 193 ? -44.720 -7.244  31.828 1.00 52.45  ? 195 ILE A CG1 1 
ATOM   1438 C CG2 . ILE A 1 193 ? -46.217 -5.444  30.853 1.00 45.07  ? 195 ILE A CG2 1 
ATOM   1439 C CD1 . ILE A 1 193 ? -43.462 -6.340  31.702 1.00 48.21  ? 195 ILE A CD1 1 
ATOM   1440 N N   . SER A 1 194 ? -49.227 -7.404  30.104 1.00 53.55  ? 196 SER A N   1 
ATOM   1441 C CA  . SER A 1 194 ? -50.283 -7.222  29.155 1.00 52.95  ? 196 SER A CA  1 
ATOM   1442 C C   . SER A 1 194 ? -50.239 -5.739  28.767 1.00 49.29  ? 196 SER A C   1 
ATOM   1443 O O   . SER A 1 194 ? -50.121 -4.866  29.631 1.00 47.82  ? 196 SER A O   1 
ATOM   1444 C CB  . SER A 1 194 ? -51.607 -7.611  29.830 1.00 59.46  ? 196 SER A CB  1 
ATOM   1445 O OG  . SER A 1 194 ? -52.708 -7.517  28.953 1.00 62.76  ? 196 SER A OG  1 
ATOM   1446 N N   . ILE A 1 195 ? -50.299 -5.467  27.466 1.00 45.01  ? 197 ILE A N   1 
ATOM   1447 C CA  . ILE A 1 195 ? -50.103 -4.114  26.946 1.00 43.63  ? 197 ILE A CA  1 
ATOM   1448 C C   . ILE A 1 195 ? -51.280 -3.646  26.126 1.00 44.48  ? 197 ILE A C   1 
ATOM   1449 O O   . ILE A 1 195 ? -51.701 -4.308  25.188 1.00 46.65  ? 197 ILE A O   1 
ATOM   1450 C CB  . ILE A 1 195 ? -48.809 -3.952  26.034 1.00 41.76  ? 197 ILE A CB  1 
ATOM   1451 C CG1 . ILE A 1 195 ? -47.525 -4.429  26.760 1.00 44.03  ? 197 ILE A CG1 1 
ATOM   1452 C CG2 . ILE A 1 195 ? -48.657 -2.487  25.636 1.00 35.13  ? 197 ILE A CG2 1 
ATOM   1453 C CD1 . ILE A 1 195 ? -46.358 -4.944  25.800 1.00 44.86  ? 197 ILE A CD1 1 
ATOM   1454 N N   . HIS A 1 196 ? -51.748 -2.447  26.467 1.00 39.45  ? 198 HIS A N   1 
ATOM   1455 C CA  . HIS A 1 196 ? -52.774 -1.739  25.748 1.00 39.86  ? 198 HIS A CA  1 
ATOM   1456 C C   . HIS A 1 196 ? -52.042 -0.582  25.088 1.00 40.75  ? 198 HIS A C   1 
ATOM   1457 O O   . HIS A 1 196 ? -51.443 0.234   25.786 1.00 40.36  ? 198 HIS A O   1 
ATOM   1458 C CB  . HIS A 1 196 ? -53.736 -1.155  26.766 1.00 41.13  ? 198 HIS A CB  1 
ATOM   1459 C CG  . HIS A 1 196 ? -54.892 -0.406  26.179 1.00 50.08  ? 198 HIS A CG  1 
ATOM   1460 N ND1 . HIS A 1 196 ? -54.848 0.951   25.917 1.00 57.96  ? 198 HIS A ND1 1 
ATOM   1461 C CD2 . HIS A 1 196 ? -56.133 -0.817  25.829 1.00 50.66  ? 198 HIS A CD2 1 
ATOM   1462 C CE1 . HIS A 1 196 ? -56.013 1.341   25.428 1.00 52.37  ? 198 HIS A CE1 1 
ATOM   1463 N NE2 . HIS A 1 196 ? -56.809 0.287   25.363 1.00 53.55  ? 198 HIS A NE2 1 
ATOM   1464 N N   . ALA A 1 197 ? -52.059 -0.520  23.755 1.00 39.25  ? 199 ALA A N   1 
ATOM   1465 C CA  . ALA A 1 197 ? -51.423 0.597   23.067 1.00 37.64  ? 199 ALA A CA  1 
ATOM   1466 C C   . ALA A 1 197 ? -52.170 1.020   21.815 1.00 38.28  ? 199 ALA A C   1 
ATOM   1467 O O   . ALA A 1 197 ? -52.883 0.240   21.195 1.00 39.11  ? 199 ALA A O   1 
ATOM   1468 C CB  . ALA A 1 197 ? -49.992 0.294   22.753 1.00 33.08  ? 199 ALA A CB  1 
ATOM   1469 N N   . ASP A 1 198 ? -52.000 2.280   21.466 1.00 36.72  ? 200 ASP A N   1 
ATOM   1470 C CA  . ASP A 1 198 ? -52.618 2.828   20.272 1.00 36.38  ? 200 ASP A CA  1 
ATOM   1471 C C   . ASP A 1 198 ? -51.504 3.515   19.532 1.00 36.68  ? 200 ASP A C   1 
ATOM   1472 O O   . ASP A 1 198 ? -50.681 4.211   20.153 1.00 35.51  ? 200 ASP A O   1 
ATOM   1473 C CB  . ASP A 1 198 ? -53.669 3.888   20.657 1.00 36.58  ? 200 ASP A CB  1 
ATOM   1474 C CG  . ASP A 1 198 ? -54.856 3.302   21.398 1.00 46.95  ? 200 ASP A CG  1 
ATOM   1475 O OD1 . ASP A 1 198 ? -55.192 2.086   21.280 1.00 45.66  ? 200 ASP A OD1 1 
ATOM   1476 O OD2 . ASP A 1 198 ? -55.466 4.077   22.128 1.00 36.49  ? 200 ASP A OD2 1 
ATOM   1477 N N   . PHE A 1 199 ? -51.503 3.363   18.205 1.00 34.73  ? 201 PHE A N   1 
ATOM   1478 C CA  . PHE A 1 199 ? -50.400 3.838   17.398 1.00 33.72  ? 201 PHE A CA  1 
ATOM   1479 C C   . PHE A 1 199 ? -51.034 4.670   16.293 1.00 37.49  ? 201 PHE A C   1 
ATOM   1480 O O   . PHE A 1 199 ? -51.954 4.200   15.699 1.00 38.85  ? 201 PHE A O   1 
ATOM   1481 C CB  . PHE A 1 199 ? -49.706 2.612   16.785 1.00 33.02  ? 201 PHE A CB  1 
ATOM   1482 C CG  . PHE A 1 199 ? -49.059 1.699   17.821 1.00 32.27  ? 201 PHE A CG  1 
ATOM   1483 C CD1 . PHE A 1 199 ? -47.839 2.027   18.362 1.00 31.44  ? 201 PHE A CD1 1 
ATOM   1484 C CD2 . PHE A 1 199 ? -49.668 0.516   18.223 1.00 39.64  ? 201 PHE A CD2 1 
ATOM   1485 C CE1 . PHE A 1 199 ? -47.222 1.196   19.297 1.00 35.28  ? 201 PHE A CE1 1 
ATOM   1486 C CE2 . PHE A 1 199 ? -49.074 -0.286  19.196 1.00 31.44  ? 201 PHE A CE2 1 
ATOM   1487 C CZ  . PHE A 1 199 ? -47.854 0.074   19.719 1.00 36.78  ? 201 PHE A CZ  1 
ATOM   1488 N N   . GLU A 1 200 ? -50.553 5.881   16.021 1.00 35.97  ? 202 GLU A N   1 
ATOM   1489 C CA  . GLU A 1 200 ? -51.060 6.643   14.879 1.00 36.75  ? 202 GLU A CA  1 
ATOM   1490 C C   . GLU A 1 200 ? -49.958 6.828   13.865 1.00 36.32  ? 202 GLU A C   1 
ATOM   1491 O O   . GLU A 1 200 ? -48.822 7.110   14.252 1.00 36.04  ? 202 GLU A O   1 
ATOM   1492 C CB  . GLU A 1 200 ? -51.441 8.076   15.247 1.00 37.36  ? 202 GLU A CB  1 
ATOM   1493 C CG  . GLU A 1 200 ? -52.628 8.323   16.126 1.00 51.80  ? 202 GLU A CG  1 
ATOM   1494 C CD  . GLU A 1 200 ? -53.353 9.615   15.707 1.00 55.80  ? 202 GLU A CD  1 
ATOM   1495 O OE1 . GLU A 1 200 ? -52.861 10.410  14.835 1.00 60.36  ? 202 GLU A OE1 1 
ATOM   1496 O OE2 . GLU A 1 200 ? -54.435 9.823   16.240 1.00 59.61  ? 202 GLU A OE2 1 
ATOM   1497 N N   . ASN A 1 201 ? -50.295 6.754   12.588 1.00 33.61  ? 203 ASN A N   1 
ATOM   1498 C CA  . ASN A 1 201 ? -49.320 7.047   11.497 1.00 33.98  ? 203 ASN A CA  1 
ATOM   1499 C C   . ASN A 1 201 ? -49.903 7.918   10.401 1.00 33.06  ? 203 ASN A C   1 
ATOM   1500 O O   . ASN A 1 201 ? -50.532 7.418   9.471  1.00 35.19  ? 203 ASN A O   1 
ATOM   1501 C CB  . ASN A 1 201 ? -48.771 5.733   10.910 1.00 35.02  ? 203 ASN A CB  1 
ATOM   1502 C CG  . ASN A 1 201 ? -47.738 5.966   9.845  1.00 38.44  ? 203 ASN A CG  1 
ATOM   1503 O OD1 . ASN A 1 201 ? -47.143 7.045   9.798  1.00 35.23  ? 203 ASN A OD1 1 
ATOM   1504 N ND2 . ASN A 1 201 ? -47.536 4.982   8.950  1.00 33.63  ? 203 ASN A ND2 1 
ATOM   1505 N N   . THR A 1 202 ? -49.734 9.237   10.504 1.00 35.35  ? 204 THR A N   1 
ATOM   1506 C CA  . THR A 1 202 ? -50.159 10.139  9.441  1.00 36.91  ? 204 THR A CA  1 
ATOM   1507 C C   . THR A 1 202 ? -48.947 10.461  8.564  1.00 39.99  ? 204 THR A C   1 
ATOM   1508 O O   . THR A 1 202 ? -49.057 11.212  7.583  1.00 44.17  ? 204 THR A O   1 
ATOM   1509 C CB  . THR A 1 202 ? -50.771 11.491  9.992  1.00 40.84  ? 204 THR A CB  1 
ATOM   1510 O OG1 . THR A 1 202 ? -49.826 12.128  10.842 1.00 40.18  ? 204 THR A OG1 1 
ATOM   1511 C CG2 . THR A 1 202 ? -52.002 11.236  10.853 1.00 40.46  ? 204 THR A CG2 1 
ATOM   1512 N N   . SER A 1 203 ? -47.784 9.877   8.875  1.00 37.88  ? 205 SER A N   1 
ATOM   1513 C CA  . SER A 1 203 ? -46.569 10.082  8.040  1.00 37.00  ? 205 SER A CA  1 
ATOM   1514 C C   . SER A 1 203 ? -46.736 9.420   6.656  1.00 40.84  ? 205 SER A C   1 
ATOM   1515 O O   . SER A 1 203 ? -47.684 8.625   6.463  1.00 39.17  ? 205 SER A O   1 
ATOM   1516 C CB  . SER A 1 203 ? -45.349 9.502   8.758  1.00 36.72  ? 205 SER A CB  1 
ATOM   1517 O OG  . SER A 1 203 ? -45.133 8.169   8.319  1.00 42.15  ? 205 SER A OG  1 
ATOM   1518 N N   . SER A 1 204 ? -45.841 9.754   5.687  1.00 39.05  ? 206 SER A N   1 
ATOM   1519 C CA  . SER A 1 204 ? -45.773 9.070   4.422  1.00 43.67  ? 206 SER A CA  1 
ATOM   1520 C C   . SER A 1 204 ? -45.164 7.665   4.482  1.00 44.64  ? 206 SER A C   1 
ATOM   1521 O O   . SER A 1 204 ? -45.253 6.940   3.510  1.00 45.70  ? 206 SER A O   1 
ATOM   1522 C CB  . SER A 1 204 ? -44.973 9.904   3.402  1.00 46.43  ? 206 SER A CB  1 
ATOM   1523 O OG  . SER A 1 204 ? -43.635 10.009  3.882  1.00 49.10  ? 206 SER A OG  1 
ATOM   1524 N N   . ARG A 1 205 ? -44.618 7.266   5.633  1.00 43.34  ? 207 ARG A N   1 
ATOM   1525 C CA  . ARG A 1 205 ? -43.874 6.002   5.804  1.00 43.41  ? 207 ARG A CA  1 
ATOM   1526 C C   . ARG A 1 205 ? -44.760 4.843   6.234  1.00 43.33  ? 207 ARG A C   1 
ATOM   1527 O O   . ARG A 1 205 ? -45.807 5.068   6.800  1.00 38.09  ? 207 ARG A O   1 
ATOM   1528 C CB  . ARG A 1 205 ? -42.862 6.206   6.944  1.00 38.45  ? 207 ARG A CB  1 
ATOM   1529 C CG  . ARG A 1 205 ? -41.488 6.726   6.556  1.00 52.16  ? 207 ARG A CG  1 
ATOM   1530 C CD  . ARG A 1 205 ? -41.546 7.810   5.484  1.00 56.59  ? 207 ARG A CD  1 
ATOM   1531 N NE  . ARG A 1 205 ? -40.400 8.723   5.519  1.00 58.06  ? 207 ARG A NE  1 
ATOM   1532 C CZ  . ARG A 1 205 ? -40.516 10.042  5.694  1.00 68.43  ? 207 ARG A CZ  1 
ATOM   1533 N NH1 . ARG A 1 205 ? -41.714 10.606  5.840  1.00 54.50  ? 207 ARG A NH1 1 
ATOM   1534 N NH2 . ARG A 1 205 ? -39.435 10.806  5.720  1.00 69.95  ? 207 ARG A NH2 1 
ATOM   1535 N N   . ILE A 1 206 ? -44.287 3.606   6.066  1.00 41.84  ? 208 ILE A N   1 
ATOM   1536 C CA  . ILE A 1 206 ? -44.945 2.456   6.676  1.00 41.33  ? 208 ILE A CA  1 
ATOM   1537 C C   . ILE A 1 206 ? -44.124 2.192   7.924  1.00 42.34  ? 208 ILE A C   1 
ATOM   1538 O O   . ILE A 1 206 ? -42.890 2.005   7.813  1.00 42.75  ? 208 ILE A O   1 
ATOM   1539 C CB  . ILE A 1 206 ? -44.874 1.203   5.770  1.00 41.06  ? 208 ILE A CB  1 
ATOM   1540 C CG1 . ILE A 1 206 ? -45.691 1.400   4.484  1.00 43.76  ? 208 ILE A CG1 1 
ATOM   1541 C CG2 . ILE A 1 206 ? -45.385 0.014   6.510  1.00 46.34  ? 208 ILE A CG2 1 
ATOM   1542 C CD1 . ILE A 1 206 ? -45.222 0.507   3.273  1.00 51.24  ? 208 ILE A CD1 1 
ATOM   1543 N N   . VAL A 1 207 ? -44.779 2.207   9.096  1.00 38.78  ? 209 VAL A N   1 
ATOM   1544 C CA  . VAL A 1 207 ? -44.071 2.122   10.400 1.00 33.01  ? 209 VAL A CA  1 
ATOM   1545 C C   . VAL A 1 207 ? -44.407 0.792   11.099 1.00 36.65  ? 209 VAL A C   1 
ATOM   1546 O O   . VAL A 1 207 ? -45.364 0.126   10.701 1.00 36.85  ? 209 VAL A O   1 
ATOM   1547 C CB  . VAL A 1 207 ? -44.334 3.381   11.261 1.00 33.31  ? 209 VAL A CB  1 
ATOM   1548 C CG1 . VAL A 1 207 ? -44.135 4.659   10.416 1.00 27.71  ? 209 VAL A CG1 1 
ATOM   1549 C CG2 . VAL A 1 207 ? -45.730 3.356   11.876 1.00 26.40  ? 209 VAL A CG2 1 
ATOM   1550 N N   . VAL A 1 208 ? -43.595 0.366   12.065 1.00 36.54  ? 210 VAL A N   1 
ATOM   1551 C CA  . VAL A 1 208 ? -43.755 -0.934  12.693 1.00 37.08  ? 210 VAL A CA  1 
ATOM   1552 C C   . VAL A 1 208 ? -43.619 -0.793  14.197 1.00 36.64  ? 210 VAL A C   1 
ATOM   1553 O O   . VAL A 1 208 ? -42.534 -0.429  14.700 1.00 36.24  ? 210 VAL A O   1 
ATOM   1554 C CB  . VAL A 1 208 ? -42.711 -1.997  12.225 1.00 38.00  ? 210 VAL A CB  1 
ATOM   1555 C CG1 . VAL A 1 208 ? -42.980 -3.334  12.946 1.00 36.40  ? 210 VAL A CG1 1 
ATOM   1556 C CG2 . VAL A 1 208 ? -42.764 -2.208  10.765 1.00 45.94  ? 210 VAL A CG2 1 
ATOM   1557 N N   . PRO A 1 209 ? -44.717 -1.078  14.939 1.00 38.51  ? 211 PRO A N   1 
ATOM   1558 C CA  . PRO A 1 209 ? -44.692 -1.064  16.409 1.00 31.14  ? 211 PRO A CA  1 
ATOM   1559 C C   . PRO A 1 209 ? -44.047 -2.332  16.978 1.00 35.72  ? 211 PRO A C   1 
ATOM   1560 O O   . PRO A 1 209 ? -44.237 -3.450  16.442 1.00 32.05  ? 211 PRO A O   1 
ATOM   1561 C CB  . PRO A 1 209 ? -46.158 -1.036  16.769 1.00 32.53  ? 211 PRO A CB  1 
ATOM   1562 C CG  . PRO A 1 209 ? -46.800 -1.826  15.692 1.00 33.62  ? 211 PRO A CG  1 
ATOM   1563 C CD  . PRO A 1 209 ? -46.062 -1.427  14.415 1.00 36.94  ? 211 PRO A CD  1 
ATOM   1564 N N   . LYS A 1 210 ? -43.232 -2.150  18.004 1.00 33.25  ? 212 LYS A N   1 
ATOM   1565 C CA  . LYS A 1 210 ? -42.472 -3.251  18.605 1.00 33.17  ? 212 LYS A CA  1 
ATOM   1566 C C   . LYS A 1 210 ? -42.420 -2.989  20.079 1.00 35.60  ? 212 LYS A C   1 
ATOM   1567 O O   . LYS A 1 210 ? -42.680 -1.872  20.530 1.00 34.54  ? 212 LYS A O   1 
ATOM   1568 C CB  . LYS A 1 210 ? -41.033 -3.361  18.016 1.00 32.15  ? 212 LYS A CB  1 
ATOM   1569 C CG  . LYS A 1 210 ? -40.984 -3.339  16.507 1.00 31.98  ? 212 LYS A CG  1 
ATOM   1570 C CD  . LYS A 1 210 ? -39.544 -3.526  15.987 1.00 36.03  ? 212 LYS A CD  1 
ATOM   1571 C CE  . LYS A 1 210 ? -39.514 -3.519  14.472 1.00 41.12  ? 212 LYS A CE  1 
ATOM   1572 N NZ  . LYS A 1 210 ? -38.081 -3.498  14.046 1.00 46.68  ? 212 LYS A NZ  1 
ATOM   1573 N N   . ALA A 1 211 ? -42.157 -4.038  20.851 1.00 36.41  ? 213 ALA A N   1 
ATOM   1574 C CA  . ALA A 1 211 ? -41.960 -3.846  22.274 1.00 33.94  ? 213 ALA A CA  1 
ATOM   1575 C C   . ALA A 1 211 ? -40.978 -4.898  22.796 1.00 31.26  ? 213 ALA A C   1 
ATOM   1576 O O   . ALA A 1 211 ? -40.823 -5.962  22.221 1.00 35.88  ? 213 ALA A O   1 
ATOM   1577 C CB  . ALA A 1 211 ? -43.265 -3.938  23.014 1.00 31.27  ? 213 ALA A CB  1 
ATOM   1578 N N   . ALA A 1 212 ? -40.291 -4.586  23.872 1.00 33.17  ? 214 ALA A N   1 
ATOM   1579 C CA  . ALA A 1 212 ? -39.256 -5.473  24.339 1.00 31.13  ? 214 ALA A CA  1 
ATOM   1580 C C   . ALA A 1 212 ? -39.034 -5.166  25.768 1.00 34.56  ? 214 ALA A C   1 
ATOM   1581 O O   . ALA A 1 212 ? -39.120 -3.995  26.210 1.00 32.17  ? 214 ALA A O   1 
ATOM   1582 C CB  . ALA A 1 212 ? -37.935 -5.327  23.528 1.00 33.23  ? 214 ALA A CB  1 
ATOM   1583 N N   . ILE A 1 213 ? -38.768 -6.226  26.515 1.00 34.62  ? 215 ILE A N   1 
ATOM   1584 C CA  . ILE A 1 213 ? -38.279 -6.068  27.869 1.00 33.44  ? 215 ILE A CA  1 
ATOM   1585 C C   . ILE A 1 213 ? -36.755 -6.040  27.755 1.00 34.15  ? 215 ILE A C   1 
ATOM   1586 O O   . ILE A 1 213 ? -36.140 -6.843  27.030 1.00 33.59  ? 215 ILE A O   1 
ATOM   1587 C CB  . ILE A 1 213 ? -38.751 -7.192  28.805 1.00 34.24  ? 215 ILE A CB  1 
ATOM   1588 C CG1 . ILE A 1 213 ? -40.254 -7.088  29.057 1.00 43.10  ? 215 ILE A CG1 1 
ATOM   1589 C CG2 . ILE A 1 213 ? -38.044 -7.082  30.166 1.00 40.96  ? 215 ILE A CG2 1 
ATOM   1590 C CD1 . ILE A 1 213 ? -40.888 -8.440  29.399 1.00 51.61  ? 215 ILE A CD1 1 
ATOM   1591 N N   . VAL A 1 214 ? -36.134 -5.089  28.431 1.00 33.69  ? 216 VAL A N   1 
ATOM   1592 C CA  . VAL A 1 214 ? -34.660 -4.964  28.414 1.00 38.63  ? 216 VAL A CA  1 
ATOM   1593 C C   . VAL A 1 214 ? -34.128 -4.917  29.858 1.00 37.83  ? 216 VAL A C   1 
ATOM   1594 O O   . VAL A 1 214 ? -34.767 -4.320  30.751 1.00 37.45  ? 216 VAL A O   1 
ATOM   1595 C CB  . VAL A 1 214 ? -34.189 -3.697  27.633 1.00 41.17  ? 216 VAL A CB  1 
ATOM   1596 C CG1 . VAL A 1 214 ? -34.646 -3.748  26.172 1.00 39.54  ? 216 VAL A CG1 1 
ATOM   1597 C CG2 . VAL A 1 214 ? -34.734 -2.432  28.297 1.00 43.88  ? 216 VAL A CG2 1 
ATOM   1598 N N   . ALA A 1 215 ? -32.987 -5.580  30.061 1.00 40.17  ? 217 ALA A N   1 
ATOM   1599 C CA  . ALA A 1 215 ? -32.326 -5.780  31.368 1.00 40.59  ? 217 ALA A CA  1 
ATOM   1600 C C   . ALA A 1 215 ? -31.024 -5.031  31.306 1.00 43.66  ? 217 ALA A C   1 
ATOM   1601 O O   . ALA A 1 215 ? -30.175 -5.316  30.456 1.00 46.25  ? 217 ALA A O   1 
ATOM   1602 C CB  . ALA A 1 215 ? -32.038 -7.258  31.597 1.00 39.51  ? 217 ALA A CB  1 
ATOM   1603 N N   . ARG A 1 216 ? -30.866 -4.042  32.165 1.00 44.11  ? 218 ARG A N   1 
ATOM   1604 C CA  . ARG A 1 216 ? -29.634 -3.280  32.160 1.00 46.08  ? 218 ARG A CA  1 
ATOM   1605 C C   . ARG A 1 216 ? -28.760 -3.660  33.375 1.00 47.92  ? 218 ARG A C   1 
ATOM   1606 O O   . ARG A 1 216 ? -29.011 -3.229  34.486 1.00 46.42  ? 218 ARG A O   1 
ATOM   1607 C CB  . ARG A 1 216 ? -29.945 -1.791  32.119 1.00 46.25  ? 218 ARG A CB  1 
ATOM   1608 C CG  . ARG A 1 216 ? -30.720 -1.370  30.873 1.00 43.62  ? 218 ARG A CG  1 
ATOM   1609 C CD  . ARG A 1 216 ? -30.867 0.142   30.843 1.00 47.21  ? 218 ARG A CD  1 
ATOM   1610 N NE  . ARG A 1 216 ? -31.785 0.574   29.778 1.00 54.53  ? 218 ARG A NE  1 
ATOM   1611 C CZ  . ARG A 1 216 ? -33.072 0.847   29.982 1.00 53.40  ? 218 ARG A CZ  1 
ATOM   1612 N NH1 . ARG A 1 216 ? -33.592 0.720   31.211 1.00 45.06  ? 218 ARG A NH1 1 
ATOM   1613 N NH2 . ARG A 1 216 ? -33.838 1.228   28.958 1.00 41.53  ? 218 ARG A NH2 1 
ATOM   1614 N N   . HIS A 1 217 ? -27.752 -4.492  33.125 1.00 50.51  ? 219 HIS A N   1 
ATOM   1615 C CA  . HIS A 1 217 ? -26.904 -5.036  34.188 1.00 52.05  ? 219 HIS A CA  1 
ATOM   1616 C C   . HIS A 1 217 ? -25.859 -4.037  34.611 1.00 51.20  ? 219 HIS A C   1 
ATOM   1617 O O   . HIS A 1 217 ? -25.101 -3.513  33.808 1.00 51.06  ? 219 HIS A O   1 
ATOM   1618 C CB  . HIS A 1 217 ? -26.228 -6.321  33.754 1.00 51.96  ? 219 HIS A CB  1 
ATOM   1619 C CG  . HIS A 1 217 ? -27.178 -7.449  33.518 1.00 57.61  ? 219 HIS A CG  1 
ATOM   1620 N ND1 . HIS A 1 217 ? -27.868 -7.606  32.333 1.00 64.26  ? 219 HIS A ND1 1 
ATOM   1621 C CD2 . HIS A 1 217 ? -27.548 -8.485  34.309 1.00 65.46  ? 219 HIS A CD2 1 
ATOM   1622 C CE1 . HIS A 1 217 ? -28.621 -8.690  32.405 1.00 61.48  ? 219 HIS A CE1 1 
ATOM   1623 N NE2 . HIS A 1 217 ? -28.446 -9.241  33.593 1.00 67.99  ? 219 HIS A NE2 1 
ATOM   1624 N N   . THR A 1 218 ? -25.868 -3.750  35.897 1.00 53.11  ? 220 THR A N   1 
ATOM   1625 C CA  . THR A 1 218 ? -24.852 -2.945  36.518 1.00 53.49  ? 220 THR A CA  1 
ATOM   1626 C C   . THR A 1 218 ? -24.030 -3.988  37.283 1.00 51.36  ? 220 THR A C   1 
ATOM   1627 O O   . THR A 1 218 ? -24.549 -4.750  38.105 1.00 52.35  ? 220 THR A O   1 
ATOM   1628 C CB  . THR A 1 218 ? -25.481 -1.843  37.429 1.00 53.52  ? 220 THR A CB  1 
ATOM   1629 O OG1 . THR A 1 218 ? -25.940 -0.756  36.617 1.00 58.64  ? 220 THR A OG1 1 
ATOM   1630 C CG2 . THR A 1 218 ? -24.449 -1.281  38.371 1.00 55.91  ? 220 THR A CG2 1 
ATOM   1631 N N   . TYR A 1 219 ? -22.768 -4.083  36.931 1.00 55.26  ? 221 TYR A N   1 
ATOM   1632 C CA  . TYR A 1 219 ? -21.943 -5.223  37.370 1.00 56.17  ? 221 TYR A CA  1 
ATOM   1633 C C   . TYR A 1 219 ? -20.564 -4.710  37.677 1.00 56.81  ? 221 TYR A C   1 
ATOM   1634 O O   . TYR A 1 219 ? -20.136 -3.686  37.102 1.00 55.66  ? 221 TYR A O   1 
ATOM   1635 C CB  . TYR A 1 219 ? -21.901 -6.378  36.332 1.00 57.76  ? 221 TYR A CB  1 
ATOM   1636 C CG  . TYR A 1 219 ? -21.248 -6.064  34.994 1.00 62.16  ? 221 TYR A CG  1 
ATOM   1637 C CD1 . TYR A 1 219 ? -19.954 -6.499  34.701 1.00 65.75  ? 221 TYR A CD1 1 
ATOM   1638 C CD2 . TYR A 1 219 ? -21.939 -5.359  34.002 1.00 68.17  ? 221 TYR A CD2 1 
ATOM   1639 C CE1 . TYR A 1 219 ? -19.355 -6.217  33.452 1.00 67.70  ? 221 TYR A CE1 1 
ATOM   1640 C CE2 . TYR A 1 219 ? -21.346 -5.069  32.750 1.00 65.16  ? 221 TYR A CE2 1 
ATOM   1641 C CZ  . TYR A 1 219 ? -20.062 -5.500  32.484 1.00 69.48  ? 221 TYR A CZ  1 
ATOM   1642 O OH  . TYR A 1 219 ? -19.490 -5.217  31.260 1.00 62.86  ? 221 TYR A OH  1 
ATOM   1643 N N   . LEU A 1 220 ? -19.892 -5.408  38.600 1.00 53.61  ? 222 LEU A N   1 
ATOM   1644 C CA  . LEU A 1 220 ? -18.534 -5.050  38.975 1.00 57.87  ? 222 LEU A CA  1 
ATOM   1645 C C   . LEU A 1 220 ? -17.586 -5.833  38.095 1.00 58.76  ? 222 LEU A C   1 
ATOM   1646 O O   . LEU A 1 220 ? -17.585 -7.082  38.145 1.00 55.23  ? 222 LEU A O   1 
ATOM   1647 C CB  . LEU A 1 220 ? -18.260 -5.372  40.456 1.00 58.59  ? 222 LEU A CB  1 
ATOM   1648 C CG  . LEU A 1 220 ? -19.207 -4.773  41.494 1.00 55.87  ? 222 LEU A CG  1 
ATOM   1649 C CD1 . LEU A 1 220 ? -19.169 -5.593  42.788 1.00 57.54  ? 222 LEU A CD1 1 
ATOM   1650 C CD2 . LEU A 1 220 ? -18.897 -3.305  41.733 1.00 68.86  ? 222 LEU A CD2 1 
ATOM   1651 N N   . ALA A 1 221 ? -16.817 -5.098  37.275 1.00 59.17  ? 223 ALA A N   1 
ATOM   1652 C CA  . ALA A 1 221 ? -15.825 -5.688  36.381 1.00 61.58  ? 223 ALA A CA  1 
ATOM   1653 C C   . ALA A 1 221 ? -14.689 -4.706  36.134 1.00 64.29  ? 223 ALA A C   1 
ATOM   1654 O O   . ALA A 1 221 ? -14.913 -3.530  35.779 1.00 64.35  ? 223 ALA A O   1 
ATOM   1655 C CB  . ALA A 1 221 ? -16.442 -6.126  35.070 1.00 63.19  ? 223 ALA A CB  1 
ATOM   1656 N N   . ASN A 1 222 ? -13.473 -5.229  36.327 1.00 66.08  ? 224 ASN A N   1 
ATOM   1657 C CA  . ASN A 1 222 ? -12.240 -4.438  36.475 1.00 65.77  ? 224 ASN A CA  1 
ATOM   1658 C C   . ASN A 1 222 ? -12.278 -3.449  37.645 1.00 61.61  ? 224 ASN A C   1 
ATOM   1659 O O   . ASN A 1 222 ? -12.690 -3.787  38.772 1.00 59.36  ? 224 ASN A O   1 
ATOM   1660 C CB  . ASN A 1 222 ? -11.867 -3.745  35.152 1.00 66.33  ? 224 ASN A CB  1 
ATOM   1661 C CG  . ASN A 1 222 ? -11.163 -4.690  34.182 1.00 80.44  ? 224 ASN A CG  1 
ATOM   1662 O OD1 . ASN A 1 222 ? -10.472 -4.249  33.242 1.00 81.38  ? 224 ASN A OD1 1 
ATOM   1663 N ND2 . ASN A 1 222 ? -11.312 -6.004  34.423 1.00 75.79  ? 224 ASN A ND2 1 
ATOM   1664 N N   . GLY A 1 223 ? -11.859 -2.223  37.365 1.00 63.11  ? 225 GLY A N   1 
ATOM   1665 C CA  . GLY A 1 223 ? -11.872 -1.185  38.367 1.00 63.89  ? 225 GLY A CA  1 
ATOM   1666 C C   . GLY A 1 223 ? -13.149 -0.399  38.294 1.00 66.45  ? 225 GLY A C   1 
ATOM   1667 O O   . GLY A 1 223 ? -13.205 0.725   38.791 1.00 69.11  ? 225 GLY A O   1 
ATOM   1668 N N   . GLN A 1 224 ? -14.178 -0.998  37.685 1.00 66.46  ? 226 GLN A N   1 
ATOM   1669 C CA  . GLN A 1 224 ? -15.404 -0.273  37.334 1.00 67.49  ? 226 GLN A CA  1 
ATOM   1670 C C   . GLN A 1 224 ? -16.730 -0.965  37.667 1.00 65.35  ? 226 GLN A C   1 
ATOM   1671 O O   . GLN A 1 224 ? -16.831 -2.184  37.867 1.00 62.92  ? 226 GLN A O   1 
ATOM   1672 C CB  . GLN A 1 224 ? -15.409 0.121   35.842 1.00 65.95  ? 226 GLN A CB  1 
ATOM   1673 C CG  . GLN A 1 224 ? -14.197 0.959   35.372 1.00 76.62  ? 226 GLN A CG  1 
ATOM   1674 C CD  . GLN A 1 224 ? -14.221 2.421   35.841 1.00 89.51  ? 226 GLN A CD  1 
ATOM   1675 O OE1 . GLN A 1 224 ? -14.285 2.708   37.047 1.00 88.32  ? 226 GLN A OE1 1 
ATOM   1676 N NE2 . GLN A 1 224 ? -14.137 3.355   34.883 1.00 90.62  ? 226 GLN A NE2 1 
ATOM   1677 N N   . THR A 1 225 ? -17.741 -0.115  37.740 1.00 67.55  ? 227 THR A N   1 
ATOM   1678 C CA  . THR A 1 225 ? -19.117 -0.506  37.579 1.00 67.32  ? 227 THR A CA  1 
ATOM   1679 C C   . THR A 1 225 ? -19.443 -0.182  36.119 1.00 66.16  ? 227 THR A C   1 
ATOM   1680 O O   . THR A 1 225 ? -19.384 0.983   35.704 1.00 69.80  ? 227 THR A O   1 
ATOM   1681 C CB  . THR A 1 225 ? -20.012 0.274   38.551 1.00 68.06  ? 227 THR A CB  1 
ATOM   1682 O OG1 . THR A 1 225 ? -19.653 -0.071  39.900 1.00 69.02  ? 227 THR A OG1 1 
ATOM   1683 C CG2 . THR A 1 225 ? -21.497 -0.036  38.304 1.00 64.68  ? 227 THR A CG2 1 
ATOM   1684 N N   . LYS A 1 226 ? -19.702 -1.220  35.329 1.00 61.70  ? 228 LYS A N   1 
ATOM   1685 C CA  . LYS A 1 226 ? -20.197 -1.029  33.941 1.00 61.59  ? 228 LYS A CA  1 
ATOM   1686 C C   . LYS A 1 226 ? -21.650 -1.517  33.804 1.00 56.36  ? 228 LYS A C   1 
ATOM   1687 O O   . LYS A 1 226 ? -22.198 -2.129  34.747 1.00 54.35  ? 228 LYS A O   1 
ATOM   1688 C CB  . LYS A 1 226 ? -19.284 -1.718  32.905 1.00 63.30  ? 228 LYS A CB  1 
ATOM   1689 C CG  . LYS A 1 226 ? -17.995 -0.926  32.559 1.00 69.11  ? 228 LYS A CG  1 
ATOM   1690 C CD  . LYS A 1 226 ? -17.305 -1.406  31.280 1.00 65.79  ? 228 LYS A CD  1 
ATOM   1691 C CE  . LYS A 1 226 ? -16.527 -2.706  31.462 1.00 65.92  ? 228 LYS A CE  1 
ATOM   1692 N NZ  . LYS A 1 226 ? -15.752 -3.101  30.233 1.00 69.21  ? 228 LYS A NZ  1 
ATOM   1693 N N   . VAL A 1 227 ? -22.244 -1.271  32.631 1.00 58.59  ? 229 VAL A N   1 
ATOM   1694 C CA  . VAL A 1 227 ? -23.638 -1.657  32.341 1.00 54.72  ? 229 VAL A CA  1 
ATOM   1695 C C   . VAL A 1 227 ? -23.792 -2.374  30.993 1.00 53.15  ? 229 VAL A C   1 
ATOM   1696 O O   . VAL A 1 227 ? -23.416 -1.860  29.932 1.00 52.70  ? 229 VAL A O   1 
ATOM   1697 C CB  . VAL A 1 227 ? -24.657 -0.447  32.533 1.00 59.08  ? 229 VAL A CB  1 
ATOM   1698 C CG1 . VAL A 1 227 ? -24.205 0.804   31.773 1.00 59.37  ? 229 VAL A CG1 1 
ATOM   1699 C CG2 . VAL A 1 227 ? -26.114 -0.836  32.159 1.00 50.62  ? 229 VAL A CG2 1 
ATOM   1700 N N   . LEU A 1 228 ? -24.321 -3.592  31.046 1.00 47.92  ? 230 LEU A N   1 
ATOM   1701 C CA  . LEU A 1 228 ? -24.666 -4.318  29.826 1.00 49.73  ? 230 LEU A CA  1 
ATOM   1702 C C   . LEU A 1 228 ? -26.190 -4.161  29.651 1.00 46.15  ? 230 LEU A C   1 
ATOM   1703 O O   . LEU A 1 228 ? -26.936 -4.398  30.587 1.00 42.88  ? 230 LEU A O   1 
ATOM   1704 C CB  . LEU A 1 228 ? -24.302 -5.788  30.038 1.00 49.94  ? 230 LEU A CB  1 
ATOM   1705 C CG  . LEU A 1 228 ? -24.359 -6.900  29.001 1.00 56.96  ? 230 LEU A CG  1 
ATOM   1706 C CD1 . LEU A 1 228 ? -23.736 -6.482  27.682 1.00 59.24  ? 230 LEU A CD1 1 
ATOM   1707 C CD2 . LEU A 1 228 ? -23.632 -8.116  29.562 1.00 62.68  ? 230 LEU A CD2 1 
ATOM   1708 N N   . THR A 1 229 ? -26.638 -3.746  28.478 1.00 48.51  ? 231 THR A N   1 
ATOM   1709 C CA  . THR A 1 229 ? -28.069 -3.796  28.107 1.00 45.30  ? 231 THR A CA  1 
ATOM   1710 C C   . THR A 1 229 ? -28.415 -5.068  27.355 1.00 44.51  ? 231 THR A C   1 
ATOM   1711 O O   . THR A 1 229 ? -27.893 -5.356  26.273 1.00 46.48  ? 231 THR A O   1 
ATOM   1712 C CB  . THR A 1 229 ? -28.480 -2.555  27.298 1.00 49.55  ? 231 THR A CB  1 
ATOM   1713 O OG1 . THR A 1 229 ? -28.016 -1.371  27.975 1.00 52.63  ? 231 THR A OG1 1 
ATOM   1714 C CG2 . THR A 1 229 ? -30.001 -2.487  27.136 1.00 41.99  ? 231 THR A CG2 1 
ATOM   1715 N N   . GLN A 1 230 ? -29.290 -5.857  27.951 1.00 43.33  ? 232 GLN A N   1 
ATOM   1716 C CA  . GLN A 1 230 ? -29.722 -7.106  27.354 1.00 44.36  ? 232 GLN A CA  1 
ATOM   1717 C C   . GLN A 1 230 ? -31.212 -7.005  26.949 1.00 44.38  ? 232 GLN A C   1 
ATOM   1718 O O   . GLN A 1 230 ? -32.020 -6.489  27.698 1.00 44.89  ? 232 GLN A O   1 
ATOM   1719 C CB  . GLN A 1 230 ? -29.565 -8.217  28.370 1.00 46.15  ? 232 GLN A CB  1 
ATOM   1720 C CG  . GLN A 1 230 ? -30.007 -9.567  27.874 1.00 55.16  ? 232 GLN A CG  1 
ATOM   1721 C CD  . GLN A 1 230 ? -29.911 -10.676 28.924 1.00 61.20  ? 232 GLN A CD  1 
ATOM   1722 O OE1 . GLN A 1 230 ? -29.658 -10.424 30.095 1.00 60.25  ? 232 GLN A OE1 1 
ATOM   1723 N NE2 . GLN A 1 230 ? -30.127 -11.920 28.490 1.00 69.42  ? 232 GLN A NE2 1 
ATOM   1724 N N   . LYS A 1 231 ? -31.553 -7.533  25.789 1.00 42.79  ? 233 LYS A N   1 
ATOM   1725 C CA  . LYS A 1 231 ? -32.939 -7.591  25.296 1.00 42.43  ? 233 LYS A CA  1 
ATOM   1726 C C   . LYS A 1 231 ? -33.489 -8.969  25.658 1.00 40.29  ? 233 LYS A C   1 
ATOM   1727 O O   . LYS A 1 231 ? -32.914 -10.004 25.319 1.00 37.46  ? 233 LYS A O   1 
ATOM   1728 C CB  . LYS A 1 231 ? -32.944 -7.383  23.781 1.00 42.23  ? 233 LYS A CB  1 
ATOM   1729 C CG  . LYS A 1 231 ? -34.319 -7.294  23.130 1.00 41.91  ? 233 LYS A CG  1 
ATOM   1730 C CD  . LYS A 1 231 ? -34.116 -7.447  21.640 1.00 50.86  ? 233 LYS A CD  1 
ATOM   1731 C CE  . LYS A 1 231 ? -35.417 -7.549  20.920 1.00 56.04  ? 233 LYS A CE  1 
ATOM   1732 N NZ  . LYS A 1 231 ? -35.168 -7.712  19.461 1.00 47.54  ? 233 LYS A NZ  1 
ATOM   1733 N N   . LEU A 1 232 ? -34.579 -8.974  26.399 1.00 39.53  ? 234 LEU A N   1 
ATOM   1734 C CA  . LEU A 1 232 ? -35.238 -10.206 26.763 1.00 41.31  ? 234 LEU A CA  1 
ATOM   1735 C C   . LEU A 1 232 ? -36.390 -10.435 25.793 1.00 45.33  ? 234 LEU A C   1 
ATOM   1736 O O   . LEU A 1 232 ? -36.191 -10.404 24.575 1.00 41.81  ? 234 LEU A O   1 
ATOM   1737 C CB  . LEU A 1 232 ? -35.704 -10.138 28.216 1.00 38.55  ? 234 LEU A CB  1 
ATOM   1738 C CG  . LEU A 1 232 ? -34.620 -9.772  29.243 1.00 38.01  ? 234 LEU A CG  1 
ATOM   1739 C CD1 . LEU A 1 232 ? -35.128 -9.903  30.654 1.00 37.92  ? 234 LEU A CD1 1 
ATOM   1740 C CD2 . LEU A 1 232 ? -33.449 -10.706 29.055 1.00 46.91  ? 234 LEU A CD2 1 
ATOM   1741 N N   . SER A 1 233 ? -37.586 -10.692 26.310 1.00 40.14  ? 235 SER A N   1 
ATOM   1742 C CA  . SER A 1 233 ? -38.653 -11.079 25.416 1.00 48.07  ? 235 SER A CA  1 
ATOM   1743 C C   . SER A 1 233 ? -39.052 -9.859  24.567 1.00 41.45  ? 235 SER A C   1 
ATOM   1744 O O   . SER A 1 233 ? -38.881 -8.707  24.994 1.00 38.58  ? 235 SER A O   1 
ATOM   1745 C CB  . SER A 1 233 ? -39.813 -11.677 26.223 1.00 49.07  ? 235 SER A CB  1 
ATOM   1746 O OG  . SER A 1 233 ? -40.096 -10.843 27.330 1.00 57.45  ? 235 SER A OG  1 
ATOM   1747 N N   . SER A 1 234 ? -39.507 -10.118 23.350 1.00 42.87  ? 236 SER A N   1 
ATOM   1748 C CA  . SER A 1 234 ? -39.884 -9.044  22.444 1.00 41.09  ? 236 SER A CA  1 
ATOM   1749 C C   . SER A 1 234 ? -41.090 -9.421  21.630 1.00 45.44  ? 236 SER A C   1 
ATOM   1750 O O   . SER A 1 234 ? -41.342 -10.607 21.425 1.00 43.84  ? 236 SER A O   1 
ATOM   1751 C CB  . SER A 1 234 ? -38.739 -8.707  21.490 1.00 35.78  ? 236 SER A CB  1 
ATOM   1752 O OG  . SER A 1 234 ? -38.378 -9.818  20.694 1.00 45.00  ? 236 SER A OG  1 
ATOM   1753 N N   . VAL A 1 235 ? -41.821 -8.407  21.156 1.00 46.22  ? 237 VAL A N   1 
ATOM   1754 C CA  . VAL A 1 235 ? -42.893 -8.615  20.171 1.00 48.82  ? 237 VAL A CA  1 
ATOM   1755 C C   . VAL A 1 235 ? -42.784 -7.631  19.005 1.00 49.57  ? 237 VAL A C   1 
ATOM   1756 O O   . VAL A 1 235 ? -42.298 -6.514  19.153 1.00 43.02  ? 237 VAL A O   1 
ATOM   1757 C CB  . VAL A 1 235 ? -44.340 -8.561  20.772 1.00 49.65  ? 237 VAL A CB  1 
ATOM   1758 C CG1 . VAL A 1 235 ? -44.674 -9.808  21.538 1.00 57.45  ? 237 VAL A CG1 1 
ATOM   1759 C CG2 . VAL A 1 235 ? -44.557 -7.385  21.651 1.00 44.55  ? 237 VAL A CG2 1 
ATOM   1760 N N   . ARG A 1 236 ? -43.213 -8.082  17.832 1.00 52.29  ? 238 ARG A N   1 
ATOM   1761 C CA  . ARG A 1 236 ? -43.387 -7.227  16.671 1.00 51.49  ? 238 ARG A CA  1 
ATOM   1762 C C   . ARG A 1 236 ? -44.890 -7.102  16.361 1.00 53.16  ? 238 ARG A C   1 
ATOM   1763 O O   . ARG A 1 236 ? -45.653 -8.071  16.505 1.00 53.37  ? 238 ARG A O   1 
ATOM   1764 C CB  . ARG A 1 236 ? -42.679 -7.888  15.505 1.00 52.62  ? 238 ARG A CB  1 
ATOM   1765 C CG  . ARG A 1 236 ? -42.240 -6.951  14.470 1.00 55.86  ? 238 ARG A CG  1 
ATOM   1766 C CD  . ARG A 1 236 ? -41.665 -7.705  13.309 1.00 58.45  ? 238 ARG A CD  1 
ATOM   1767 N NE  . ARG A 1 236 ? -41.936 -6.987  12.055 1.00 57.25  ? 238 ARG A NE  1 
ATOM   1768 C CZ  . ARG A 1 236 ? -41.008 -6.371  11.324 1.00 57.82  ? 238 ARG A CZ  1 
ATOM   1769 N NH1 . ARG A 1 236 ? -41.352 -5.754  10.197 1.00 52.39  ? 238 ARG A NH1 1 
ATOM   1770 N NH2 . ARG A 1 236 ? -39.731 -6.386  11.706 1.00 66.22  ? 238 ARG A NH2 1 
ATOM   1771 N N   . GLY A 1 237 ? -45.329 -5.920  15.947 1.00 49.42  ? 239 GLY A N   1 
ATOM   1772 C CA  . GLY A 1 237 ? -46.728 -5.768  15.535 1.00 47.15  ? 239 GLY A CA  1 
ATOM   1773 C C   . GLY A 1 237 ? -46.833 -5.736  14.023 1.00 47.37  ? 239 GLY A C   1 
ATOM   1774 O O   . GLY A 1 237 ? -45.800 -5.705  13.320 1.00 45.86  ? 239 GLY A O   1 
ATOM   1775 N N   . ASN A 1 238 ? -48.062 -5.736  13.498 1.00 47.17  ? 240 ASN A N   1 
ATOM   1776 C CA  . ASN A 1 238 ? -48.247 -5.599  12.044 1.00 50.87  ? 240 ASN A CA  1 
ATOM   1777 C C   . ASN A 1 238 ? -47.780 -4.225  11.643 1.00 48.25  ? 240 ASN A C   1 
ATOM   1778 O O   . ASN A 1 238 ? -47.933 -3.283  12.423 1.00 50.53  ? 240 ASN A O   1 
ATOM   1779 C CB  . ASN A 1 238 ? -49.718 -5.710  11.665 1.00 53.13  ? 240 ASN A CB  1 
ATOM   1780 C CG  . ASN A 1 238 ? -50.272 -7.042  11.981 1.00 64.75  ? 240 ASN A CG  1 
ATOM   1781 O OD1 . ASN A 1 238 ? -49.881 -8.049  11.383 1.00 59.93  ? 240 ASN A OD1 1 
ATOM   1782 N ND2 . ASN A 1 238 ? -51.165 -7.081  12.957 1.00 70.94  ? 240 ASN A ND2 1 
ATOM   1783 N N   . HIS A 1 239 ? -47.216 -4.105  10.449 1.00 45.37  ? 241 HIS A N   1 
ATOM   1784 C CA  . HIS A 1 239 ? -46.833 -2.799  9.964  1.00 47.26  ? 241 HIS A CA  1 
ATOM   1785 C C   . HIS A 1 239 ? -48.068 -1.917  9.867  1.00 48.10  ? 241 HIS A C   1 
ATOM   1786 O O   . HIS A 1 239 ? -49.199 -2.422  9.721  1.00 49.33  ? 241 HIS A O   1 
ATOM   1787 C CB  . HIS A 1 239 ? -46.125 -2.909  8.624  1.00 50.39  ? 241 HIS A CB  1 
ATOM   1788 C CG  . HIS A 1 239 ? -46.964 -3.504  7.534  1.00 64.54  ? 241 HIS A CG  1 
ATOM   1789 N ND1 . HIS A 1 239 ? -47.126 -4.867  7.373  1.00 78.99  ? 241 HIS A ND1 1 
ATOM   1790 C CD2 . HIS A 1 239 ? -47.681 -2.920  6.540  1.00 70.99  ? 241 HIS A CD2 1 
ATOM   1791 C CE1 . HIS A 1 239 ? -47.904 -5.096  6.327  1.00 81.46  ? 241 HIS A CE1 1 
ATOM   1792 N NE2 . HIS A 1 239 ? -48.252 -3.933  5.803  1.00 77.24  ? 241 HIS A NE2 1 
ATOM   1793 N N   . ILE A 1 240 ? -47.860 -0.607  9.933  1.00 41.59  ? 242 ILE A N   1 
ATOM   1794 C CA  . ILE A 1 240 ? -48.958 0.337   9.910  1.00 35.83  ? 242 ILE A CA  1 
ATOM   1795 C C   . ILE A 1 240 ? -48.728 1.261   8.717  1.00 40.02  ? 242 ILE A C   1 
ATOM   1796 O O   . ILE A 1 240 ? -47.753 2.010   8.722  1.00 35.93  ? 242 ILE A O   1 
ATOM   1797 C CB  . ILE A 1 240 ? -49.011 1.138   11.264 1.00 31.09  ? 242 ILE A CB  1 
ATOM   1798 C CG1 . ILE A 1 240 ? -49.225 0.190   12.462 1.00 35.44  ? 242 ILE A CG1 1 
ATOM   1799 C CG2 . ILE A 1 240 ? -50.101 2.139   11.230 1.00 34.82  ? 242 ILE A CG2 1 
ATOM   1800 C CD1 . ILE A 1 240 ? -49.009 0.867   13.846 1.00 40.73  ? 242 ILE A CD1 1 
ATOM   1801 N N   . ILE A 1 241 ? -49.604 1.213   7.695  1.00 39.61  ? 243 ILE A N   1 
ATOM   1802 C CA  . ILE A 1 241 ? -49.406 2.036   6.505  1.00 37.26  ? 243 ILE A CA  1 
ATOM   1803 C C   . ILE A 1 241 ? -49.775 3.483   6.792  1.00 38.87  ? 243 ILE A C   1 
ATOM   1804 O O   . ILE A 1 241 ? -50.462 3.795   7.795  1.00 34.76  ? 243 ILE A O   1 
ATOM   1805 C CB  . ILE A 1 241 ? -50.242 1.517   5.258  1.00 38.58  ? 243 ILE A CB  1 
ATOM   1806 C CG1 . ILE A 1 241 ? -51.763 1.771   5.458  1.00 42.29  ? 243 ILE A CG1 1 
ATOM   1807 C CG2 . ILE A 1 241 ? -49.965 0.055   5.004  1.00 45.41  ? 243 ILE A CG2 1 
ATOM   1808 C CD1 . ILE A 1 241 ? -52.660 1.415   4.238  1.00 42.62  ? 243 ILE A CD1 1 
ATOM   1809 N N   . SER A 1 242 ? -49.341 4.363   5.891  1.00 37.60  ? 244 SER A N   1 
ATOM   1810 C CA  . SER A 1 242 ? -49.630 5.780   5.963  1.00 40.71  ? 244 SER A CA  1 
ATOM   1811 C C   . SER A 1 242 ? -51.134 6.017   6.064  1.00 41.77  ? 244 SER A C   1 
ATOM   1812 O O   . SER A 1 242 ? -51.928 5.429   5.298  1.00 38.83  ? 244 SER A O   1 
ATOM   1813 C CB  . SER A 1 242 ? -49.112 6.497   4.704  1.00 36.82  ? 244 SER A CB  1 
ATOM   1814 O OG  . SER A 1 242 ? -49.306 7.889   4.845  1.00 48.01  ? 244 SER A OG  1 
ATOM   1815 N N   . GLY A 1 243 ? -51.537 6.853   7.013  1.00 37.53  ? 245 GLY A N   1 
ATOM   1816 C CA  . GLY A 1 243 ? -52.955 7.234   7.084  1.00 35.23  ? 245 GLY A CA  1 
ATOM   1817 C C   . GLY A 1 243 ? -53.821 6.214   7.797  1.00 39.51  ? 245 GLY A C   1 
ATOM   1818 O O   . GLY A 1 243 ? -55.018 6.162   7.557  1.00 37.57  ? 245 GLY A O   1 
ATOM   1819 N N   . THR A 1 244 ? -53.229 5.429   8.710  1.00 39.55  ? 246 THR A N   1 
ATOM   1820 C CA  . THR A 1 244 ? -53.982 4.465   9.535  1.00 34.36  ? 246 THR A CA  1 
ATOM   1821 C C   . THR A 1 244 ? -53.448 4.490   10.951 1.00 35.51  ? 246 THR A C   1 
ATOM   1822 O O   . THR A 1 244 ? -52.366 5.053   11.214 1.00 35.61  ? 246 THR A O   1 
ATOM   1823 C CB  . THR A 1 244 ? -53.912 3.024   8.999  1.00 39.09  ? 246 THR A CB  1 
ATOM   1824 O OG1 . THR A 1 244 ? -52.544 2.557   8.991  1.00 35.21  ? 246 THR A OG1 1 
ATOM   1825 C CG2 . THR A 1 244 ? -54.488 2.925   7.564  1.00 35.43  ? 246 THR A CG2 1 
ATOM   1826 N N   . CYS A 1 245 ? -54.232 3.927   11.869 1.00 35.47  ? 247 CYS A N   1 
ATOM   1827 C CA  . CYS A 1 245 ? -53.822 3.695   13.241 1.00 35.06  ? 247 CYS A CA  1 
ATOM   1828 C C   . CYS A 1 245 ? -54.023 2.210   13.497 1.00 38.47  ? 247 CYS A C   1 
ATOM   1829 O O   . CYS A 1 245 ? -54.795 1.547   12.787 1.00 40.32  ? 247 CYS A O   1 
ATOM   1830 C CB  . CYS A 1 245 ? -54.749 4.437   14.172 1.00 36.07  ? 247 CYS A CB  1 
ATOM   1831 S SG  . CYS A 1 245 ? -54.713 6.227   13.962 1.00 42.53  ? 247 CYS A SG  1 
ATOM   1832 N N   . ALA A 1 246 ? -53.374 1.712   14.541 1.00 37.91  ? 248 ALA A N   1 
ATOM   1833 C CA  . ALA A 1 246 ? -53.646 0.370   15.035 1.00 37.54  ? 248 ALA A CA  1 
ATOM   1834 C C   . ALA A 1 246 ? -53.504 0.304   16.539 1.00 41.19  ? 248 ALA A C   1 
ATOM   1835 O O   . ALA A 1 246 ? -52.898 1.176   17.147 1.00 39.62  ? 248 ALA A O   1 
ATOM   1836 C CB  . ALA A 1 246 ? -52.742 -0.657  14.362 1.00 41.01  ? 248 ALA A CB  1 
ATOM   1837 N N   . SER A 1 247 ? -54.032 -0.775  17.110 1.00 40.90  ? 249 SER A N   1 
ATOM   1838 C CA  . SER A 1 247 ? -54.201 -0.944  18.548 1.00 41.36  ? 249 SER A CA  1 
ATOM   1839 C C   . SER A 1 247 ? -53.657 -2.277  18.951 1.00 41.66  ? 249 SER A C   1 
ATOM   1840 O O   . SER A 1 247 ? -53.645 -3.243  18.149 1.00 38.87  ? 249 SER A O   1 
ATOM   1841 C CB  . SER A 1 247 ? -55.691 -0.921  18.875 1.00 41.94  ? 249 SER A CB  1 
ATOM   1842 O OG  . SER A 1 247 ? -56.134 0.421   18.828 1.00 46.46  ? 249 SER A OG  1 
ATOM   1843 N N   . TRP A 1 248 ? -53.138 -2.315  20.175 1.00 41.24  ? 250 TRP A N   1 
ATOM   1844 C CA  . TRP A 1 248 ? -52.848 -3.571  20.829 1.00 41.70  ? 250 TRP A CA  1 
ATOM   1845 C C   . TRP A 1 248 ? -53.785 -3.575  22.007 1.00 45.11  ? 250 TRP A C   1 
ATOM   1846 O O   . TRP A 1 248 ? -53.999 -2.548  22.648 1.00 43.98  ? 250 TRP A O   1 
ATOM   1847 C CB  . TRP A 1 248 ? -51.414 -3.631  21.344 1.00 41.77  ? 250 TRP A CB  1 
ATOM   1848 C CG  . TRP A 1 248 ? -50.323 -3.782  20.297 1.00 38.45  ? 250 TRP A CG  1 
ATOM   1849 C CD1 . TRP A 1 248 ? -50.460 -3.995  18.930 1.00 41.03  ? 250 TRP A CD1 1 
ATOM   1850 C CD2 . TRP A 1 248 ? -48.935 -3.772  20.565 1.00 38.94  ? 250 TRP A CD2 1 
ATOM   1851 N NE1 . TRP A 1 248 ? -49.217 -4.097  18.350 1.00 41.07  ? 250 TRP A NE1 1 
ATOM   1852 C CE2 . TRP A 1 248 ? -48.263 -3.961  19.336 1.00 43.37  ? 250 TRP A CE2 1 
ATOM   1853 C CE3 . TRP A 1 248 ? -48.179 -3.595  21.742 1.00 38.52  ? 250 TRP A CE3 1 
ATOM   1854 C CZ2 . TRP A 1 248 ? -46.858 -4.001  19.249 1.00 29.72  ? 250 TRP A CZ2 1 
ATOM   1855 C CZ3 . TRP A 1 248 ? -46.783 -3.617  21.653 1.00 31.79  ? 250 TRP A CZ3 1 
ATOM   1856 C CH2 . TRP A 1 248 ? -46.138 -3.819  20.395 1.00 30.18  ? 250 TRP A CH2 1 
ATOM   1857 N N   . ARG A 1 249 ? -54.360 -4.731  22.280 1.00 46.60  ? 251 ARG A N   1 
ATOM   1858 C CA  . ARG A 1 249 ? -55.339 -4.849  23.328 1.00 51.71  ? 251 ARG A CA  1 
ATOM   1859 C C   . ARG A 1 249 ? -54.991 -6.114  24.052 1.00 55.81  ? 251 ARG A C   1 
ATOM   1860 O O   . ARG A 1 249 ? -55.280 -7.198  23.558 1.00 59.11  ? 251 ARG A O   1 
ATOM   1861 C CB  . ARG A 1 249 ? -56.748 -4.945  22.712 1.00 53.14  ? 251 ARG A CB  1 
ATOM   1862 C CG  . ARG A 1 249 ? -57.204 -3.685  22.023 1.00 53.04  ? 251 ARG A CG  1 
ATOM   1863 C CD  . ARG A 1 249 ? -57.465 -2.626  23.046 1.00 51.68  ? 251 ARG A CD  1 
ATOM   1864 N NE  . ARG A 1 249 ? -57.922 -1.386  22.439 1.00 43.86  ? 251 ARG A NE  1 
ATOM   1865 C CZ  . ARG A 1 249 ? -57.130 -0.355  22.177 1.00 51.15  ? 251 ARG A CZ  1 
ATOM   1866 N NH1 . ARG A 1 249 ? -55.843 -0.428  22.462 1.00 42.30  ? 251 ARG A NH1 1 
ATOM   1867 N NH2 . ARG A 1 249 ? -57.631 0.758   21.661 1.00 44.39  ? 251 ARG A NH2 1 
ATOM   1868 N N   . GLY A 1 250 ? -54.305 -5.975  25.177 1.00 56.78  ? 252 GLY A N   1 
ATOM   1869 C CA  . GLY A 1 250 ? -53.831 -7.143  25.937 1.00 62.20  ? 252 GLY A CA  1 
ATOM   1870 C C   . GLY A 1 250 ? -52.805 -7.981  25.195 1.00 60.49  ? 252 GLY A C   1 
ATOM   1871 O O   . GLY A 1 250 ? -52.737 -9.189  25.373 1.00 63.10  ? 252 GLY A O   1 
ATOM   1872 N N   . LYS A 1 251 ? -52.012 -7.335  24.348 1.00 57.88  ? 253 LYS A N   1 
ATOM   1873 C CA  . LYS A 1 251 ? -50.830 -7.969  23.774 1.00 56.52  ? 253 LYS A CA  1 
ATOM   1874 C C   . LYS A 1 251 ? -49.829 -8.111  24.914 1.00 55.65  ? 253 LYS A C   1 
ATOM   1875 O O   . LYS A 1 251 ? -49.589 -7.161  25.666 1.00 54.25  ? 253 LYS A O   1 
ATOM   1876 C CB  . LYS A 1 251 ? -50.276 -7.100  22.633 1.00 54.76  ? 253 LYS A CB  1 
ATOM   1877 C CG  . LYS A 1 251 ? -48.837 -7.386  22.182 1.00 58.72  ? 253 LYS A CG  1 
ATOM   1878 C CD  . LYS A 1 251 ? -48.761 -8.386  21.049 1.00 58.49  ? 253 LYS A CD  1 
ATOM   1879 C CE  . LYS A 1 251 ? -49.023 -7.760  19.708 1.00 56.04  ? 253 LYS A CE  1 
ATOM   1880 N NZ  . LYS A 1 251 ? -48.710 -8.710  18.598 1.00 67.56  ? 253 LYS A NZ  1 
ATOM   1881 N N   . SER A 1 252 ? -49.229 -9.281  25.041 1.00 56.02  ? 254 SER A N   1 
ATOM   1882 C CA  . SER A 1 252 ? -48.445 -9.566  26.218 1.00 56.59  ? 254 SER A CA  1 
ATOM   1883 C C   . SER A 1 252 ? -47.012 -9.965  25.922 1.00 54.23  ? 254 SER A C   1 
ATOM   1884 O O   . SER A 1 252 ? -46.727 -10.524 24.878 1.00 58.27  ? 254 SER A O   1 
ATOM   1885 C CB  . SER A 1 252 ? -49.146 -10.634 27.073 1.00 60.66  ? 254 SER A CB  1 
ATOM   1886 O OG  . SER A 1 252 ? -49.659 -11.673 26.248 1.00 70.62  ? 254 SER A OG  1 
ATOM   1887 N N   . LEU A 1 253 ? -46.126 -9.671  26.867 1.00 53.84  ? 255 LEU A N   1 
ATOM   1888 C CA  . LEU A 1 253 ? -44.739 -10.102 26.839 1.00 51.11  ? 255 LEU A CA  1 
ATOM   1889 C C   . LEU A 1 253 ? -44.480 -10.876 28.093 1.00 51.57  ? 255 LEU A C   1 
ATOM   1890 O O   . LEU A 1 253 ? -44.811 -10.407 29.163 1.00 53.81  ? 255 LEU A O   1 
ATOM   1891 C CB  . LEU A 1 253 ? -43.802 -8.893  26.870 1.00 48.08  ? 255 LEU A CB  1 
ATOM   1892 C CG  . LEU A 1 253 ? -43.418 -8.395  25.509 1.00 48.34  ? 255 LEU A CG  1 
ATOM   1893 C CD1 . LEU A 1 253 ? -42.567 -7.190  25.650 1.00 36.96  ? 255 LEU A CD1 1 
ATOM   1894 C CD2 . LEU A 1 253 ? -42.663 -9.522  24.931 1.00 55.22  ? 255 LEU A CD2 1 
ATOM   1895 N N   . ARG A 1 254 ? -43.830 -12.027 27.955 1.00 54.12  ? 256 ARG A N   1 
ATOM   1896 C CA  . ARG A 1 254 ? -43.451 -12.882 29.075 1.00 56.64  ? 256 ARG A CA  1 
ATOM   1897 C C   . ARG A 1 254 ? -42.254 -12.309 29.819 1.00 55.19  ? 256 ARG A C   1 
ATOM   1898 O O   . ARG A 1 254 ? -41.256 -11.887 29.209 1.00 52.19  ? 256 ARG A O   1 
ATOM   1899 C CB  . ARG A 1 254 ? -43.163 -14.311 28.542 1.00 60.24  ? 256 ARG A CB  1 
ATOM   1900 C CG  . ARG A 1 254 ? -42.667 -15.324 29.541 1.00 62.81  ? 256 ARG A CG  1 
ATOM   1901 C CD  . ARG A 1 254 ? -43.740 -15.763 30.540 1.00 69.78  ? 256 ARG A CD  1 
ATOM   1902 N NE  . ARG A 1 254 ? -44.721 -16.680 29.964 1.00 81.14  ? 256 ARG A NE  1 
ATOM   1903 C CZ  . ARG A 1 254 ? -44.551 -17.995 29.828 1.00 85.45  ? 256 ARG A CZ  1 
ATOM   1904 N NH1 . ARG A 1 254 ? -43.431 -18.585 30.224 1.00 88.42  ? 256 ARG A NH1 1 
ATOM   1905 N NH2 . ARG A 1 254 ? -45.512 -18.730 29.289 1.00 95.00  ? 256 ARG A NH2 1 
ATOM   1906 N N   . VAL A 1 255 ? -42.353 -12.274 31.142 1.00 54.51  ? 257 VAL A N   1 
ATOM   1907 C CA  . VAL A 1 255 ? -41.219 -11.897 31.946 1.00 55.07  ? 257 VAL A CA  1 
ATOM   1908 C C   . VAL A 1 255 ? -40.342 -13.109 32.153 1.00 60.02  ? 257 VAL A C   1 
ATOM   1909 O O   . VAL A 1 255 ? -40.665 -14.003 32.934 1.00 64.23  ? 257 VAL A O   1 
ATOM   1910 C CB  . VAL A 1 255 ? -41.608 -11.312 33.323 1.00 56.23  ? 257 VAL A CB  1 
ATOM   1911 C CG1 . VAL A 1 255 ? -40.345 -10.893 34.044 1.00 52.52  ? 257 VAL A CG1 1 
ATOM   1912 C CG2 . VAL A 1 255 ? -42.533 -10.124 33.144 1.00 52.82  ? 257 VAL A CG2 1 
ATOM   1913 N N   . GLN A 1 256 ? -39.221 -13.141 31.450 1.00 62.50  ? 258 GLN A N   1 
ATOM   1914 C CA  . GLN A 1 256 ? -38.320 -14.281 31.543 1.00 64.69  ? 258 GLN A CA  1 
ATOM   1915 C C   . GLN A 1 256 ? -37.444 -14.227 32.794 1.00 68.30  ? 258 GLN A C   1 
ATOM   1916 O O   . GLN A 1 256 ? -37.115 -13.142 33.314 1.00 64.75  ? 258 GLN A O   1 
ATOM   1917 C CB  . GLN A 1 256 ? -37.484 -14.367 30.284 1.00 64.49  ? 258 GLN A CB  1 
ATOM   1918 C CG  . GLN A 1 256 ? -38.340 -14.663 29.054 1.00 61.97  ? 258 GLN A CG  1 
ATOM   1919 C CD  . GLN A 1 256 ? -37.534 -14.696 27.790 1.00 60.56  ? 258 GLN A CD  1 
ATOM   1920 O OE1 . GLN A 1 256 ? -36.603 -13.910 27.607 1.00 68.18  ? 258 GLN A OE1 1 
ATOM   1921 N NE2 . GLN A 1 256 ? -37.874 -15.617 26.908 1.00 72.30  ? 258 GLN A NE2 1 
ATOM   1922 N N   . LYS A 1 257 ? -37.101 -15.425 33.267 1.00 73.83  ? 259 LYS A N   1 
ATOM   1923 C CA  . LYS A 1 257 ? -36.186 -15.642 34.381 1.00 75.49  ? 259 LYS A CA  1 
ATOM   1924 C C   . LYS A 1 257 ? -34.771 -15.483 33.860 1.00 76.40  ? 259 LYS A C   1 
ATOM   1925 O O   . LYS A 1 257 ? -34.369 -16.181 32.929 1.00 77.17  ? 259 LYS A O   1 
ATOM   1926 C CB  . LYS A 1 257 ? -36.379 -17.057 34.919 1.00 78.13  ? 259 LYS A CB  1 
ATOM   1927 C CG  . LYS A 1 257 ? -37.800 -17.359 35.408 1.00 84.35  ? 259 LYS A CG  1 
ATOM   1928 C CD  . LYS A 1 257 ? -38.114 -18.854 35.355 1.00 93.13  ? 259 LYS A CD  1 
ATOM   1929 C CE  . LYS A 1 257 ? -37.194 -19.674 36.262 1.00 100.39 ? 259 LYS A CE  1 
ATOM   1930 N NZ  . LYS A 1 257 ? -37.390 -21.141 36.056 1.00 102.74 ? 259 LYS A NZ  1 
ATOM   1931 N N   . ILE A 1 258 ? -34.004 -14.571 34.449 1.00 78.33  ? 260 ILE A N   1 
ATOM   1932 C CA  . ILE A 1 258 ? -32.637 -14.334 33.957 1.00 78.55  ? 260 ILE A CA  1 
ATOM   1933 C C   . ILE A 1 258 ? -31.624 -15.311 34.562 1.00 78.89  ? 260 ILE A C   1 
ATOM   1934 O O   . ILE A 1 258 ? -31.846 -16.527 34.563 1.00 79.49  ? 260 ILE A O   1 
ATOM   1935 C CB  . ILE A 1 258 ? -32.197 -12.848 34.125 1.00 77.88  ? 260 ILE A CB  1 
ATOM   1936 C CG1 . ILE A 1 258 ? -31.517 -12.361 32.842 1.00 77.05  ? 260 ILE A CG1 1 
ATOM   1937 C CG2 . ILE A 1 258 ? -31.332 -12.641 35.400 1.00 75.52  ? 260 ILE A CG2 1 
ATOM   1938 C CD1 . ILE A 1 258 ? -31.782 -10.928 32.546 1.00 66.80  ? 260 ILE A CD1 1 
ATOM   1939 N N   . ASN A 1 266 ? -20.557 -10.948 40.812 1.00 61.02  ? 268 ASN A N   1 
ATOM   1940 C CA  . ASN A 1 266 ? -20.145 -9.562  40.558 1.00 63.28  ? 268 ASN A CA  1 
ATOM   1941 C C   . ASN A 1 266 ? -21.194 -8.596  39.966 1.00 62.57  ? 268 ASN A C   1 
ATOM   1942 O O   . ASN A 1 266 ? -20.868 -7.442  39.617 1.00 61.24  ? 268 ASN A O   1 
ATOM   1943 C CB  . ASN A 1 266 ? -18.871 -9.506  39.716 1.00 61.42  ? 268 ASN A CB  1 
ATOM   1944 C CG  . ASN A 1 266 ? -17.620 -9.183  40.553 1.00 72.32  ? 268 ASN A CG  1 
ATOM   1945 O OD1 . ASN A 1 266 ? -16.507 -9.094  40.011 1.00 69.73  ? 268 ASN A OD1 1 
ATOM   1946 N ND2 . ASN A 1 266 ? -17.803 -8.994  41.874 1.00 63.85  ? 268 ASN A ND2 1 
ATOM   1947 N N   . ILE A 1 267 ? -22.444 -9.029  39.857 1.00 63.29  ? 269 ILE A N   1 
ATOM   1948 C CA  . ILE A 1 267 ? -23.451 -8.041  39.454 1.00 63.97  ? 269 ILE A CA  1 
ATOM   1949 C C   . ILE A 1 267 ? -24.051 -7.360  40.686 1.00 62.13  ? 269 ILE A C   1 
ATOM   1950 O O   . ILE A 1 267 ? -24.470 -8.039  41.635 1.00 66.22  ? 269 ILE A O   1 
ATOM   1951 C CB  . ILE A 1 267 ? -24.541 -8.589  38.495 1.00 64.27  ? 269 ILE A CB  1 
ATOM   1952 C CG1 . ILE A 1 267 ? -25.553 -9.463  39.225 1.00 65.58  ? 269 ILE A CG1 1 
ATOM   1953 C CG2 . ILE A 1 267 ? -23.931 -9.326  37.297 1.00 69.81  ? 269 ILE A CG2 1 
ATOM   1954 C CD1 . ILE A 1 267 ? -26.985 -9.144  38.803 1.00 52.94  ? 269 ILE A CD1 1 
ATOM   1955 N N   . LEU A 1 268 ? -24.060 -6.026  40.689 1.00 58.83  ? 270 LEU A N   1 
ATOM   1956 C CA  . LEU A 1 268 ? -24.774 -5.249  41.730 1.00 54.43  ? 270 LEU A CA  1 
ATOM   1957 C C   . LEU A 1 268 ? -26.287 -5.410  41.585 1.00 54.82  ? 270 LEU A C   1 
ATOM   1958 O O   . LEU A 1 268 ? -27.013 -5.997  42.455 1.00 50.20  ? 270 LEU A O   1 
ATOM   1959 C CB  . LEU A 1 268 ? -24.417 -3.761  41.594 1.00 54.33  ? 270 LEU A CB  1 
ATOM   1960 C CG  . LEU A 1 268 ? -22.966 -3.330  41.874 1.00 55.50  ? 270 LEU A CG  1 
ATOM   1961 C CD1 . LEU A 1 268 ? -22.525 -2.264  40.960 1.00 50.45  ? 270 LEU A CD1 1 
ATOM   1962 C CD2 . LEU A 1 268 ? -22.795 -2.838  43.299 1.00 48.93  ? 270 LEU A CD2 1 
ATOM   1963 N N   . ARG A 1 269 ? -26.766 -4.893  40.451 1.00 51.20  ? 271 ARG A N   1 
ATOM   1964 C CA  . ARG A 1 269 ? -28.197 -4.840  40.203 1.00 51.68  ? 271 ARG A CA  1 
ATOM   1965 C C   . ARG A 1 269 ? -28.531 -4.967  38.711 1.00 49.48  ? 271 ARG A C   1 
ATOM   1966 O O   . ARG A 1 269 ? -27.709 -4.645  37.849 1.00 48.18  ? 271 ARG A O   1 
ATOM   1967 C CB  . ARG A 1 269 ? -28.751 -3.534  40.758 1.00 50.83  ? 271 ARG A CB  1 
ATOM   1968 C CG  . ARG A 1 269 ? -28.035 -2.318  40.246 1.00 50.41  ? 271 ARG A CG  1 
ATOM   1969 C CD  . ARG A 1 269 ? -28.684 -1.127  40.848 1.00 50.63  ? 271 ARG A CD  1 
ATOM   1970 N NE  . ARG A 1 269 ? -28.326 0.087   40.140 1.00 47.12  ? 271 ARG A NE  1 
ATOM   1971 C CZ  . ARG A 1 269 ? -27.211 0.774   40.336 1.00 55.80  ? 271 ARG A CZ  1 
ATOM   1972 N NH1 . ARG A 1 269 ? -26.304 0.353   41.218 1.00 56.16  ? 271 ARG A NH1 1 
ATOM   1973 N NH2 . ARG A 1 269 ? -27.003 1.885   39.633 1.00 52.46  ? 271 ARG A NH2 1 
ATOM   1974 N N   . VAL A 1 270 ? -29.719 -5.495  38.441 1.00 51.81  ? 272 VAL A N   1 
ATOM   1975 C CA  . VAL A 1 270 ? -30.309 -5.469  37.104 1.00 53.26  ? 272 VAL A CA  1 
ATOM   1976 C C   . VAL A 1 270 ? -31.486 -4.513  37.162 1.00 54.21  ? 272 VAL A C   1 
ATOM   1977 O O   . VAL A 1 270 ? -32.311 -4.582  38.069 1.00 57.12  ? 272 VAL A O   1 
ATOM   1978 C CB  . VAL A 1 270 ? -30.836 -6.844  36.660 1.00 54.19  ? 272 VAL A CB  1 
ATOM   1979 C CG1 . VAL A 1 270 ? -31.227 -6.826  35.173 1.00 54.76  ? 272 VAL A CG1 1 
ATOM   1980 C CG2 . VAL A 1 270 ? -29.815 -7.913  36.888 1.00 56.89  ? 272 VAL A CG2 1 
ATOM   1981 N N   . GLU A 1 271 ? -31.564 -3.599  36.208 1.00 53.28  ? 273 GLU A N   1 
ATOM   1982 C CA  . GLU A 1 271 ? -32.748 -2.776  36.122 1.00 51.99  ? 273 GLU A CA  1 
ATOM   1983 C C   . GLU A 1 271 ? -33.441 -2.996  34.794 1.00 47.11  ? 273 GLU A C   1 
ATOM   1984 O O   . GLU A 1 271 ? -32.797 -3.126  33.741 1.00 41.74  ? 273 GLU A O   1 
ATOM   1985 C CB  . GLU A 1 271 ? -32.460 -1.308  36.404 1.00 55.72  ? 273 GLU A CB  1 
ATOM   1986 C CG  . GLU A 1 271 ? -31.343 -0.694  35.603 1.00 57.34  ? 273 GLU A CG  1 
ATOM   1987 C CD  . GLU A 1 271 ? -30.933 0.676   36.151 1.00 65.25  ? 273 GLU A CD  1 
ATOM   1988 O OE1 . GLU A 1 271 ? -30.872 1.619   35.325 1.00 71.48  ? 273 GLU A OE1 1 
ATOM   1989 O OE2 . GLU A 1 271 ? -30.684 0.801   37.390 1.00 59.73  ? 273 GLU A OE2 1 
ATOM   1990 N N   . TYR A 1 272 ? -34.760 -3.077  34.871 1.00 46.93  ? 274 TYR A N   1 
ATOM   1991 C CA  . TYR A 1 272 ? -35.585 -3.470  33.745 1.00 41.95  ? 274 TYR A CA  1 
ATOM   1992 C C   . TYR A 1 272 ? -36.437 -2.336  33.216 1.00 41.45  ? 274 TYR A C   1 
ATOM   1993 O O   . TYR A 1 272 ? -36.730 -1.372  33.928 1.00 38.17  ? 274 TYR A O   1 
ATOM   1994 C CB  . TYR A 1 272 ? -36.516 -4.574  34.183 1.00 43.98  ? 274 TYR A CB  1 
ATOM   1995 C CG  . TYR A 1 272 ? -35.814 -5.822  34.635 1.00 38.71  ? 274 TYR A CG  1 
ATOM   1996 C CD1 . TYR A 1 272 ? -35.542 -6.860  33.735 1.00 43.42  ? 274 TYR A CD1 1 
ATOM   1997 C CD2 . TYR A 1 272 ? -35.437 -5.980  35.972 1.00 40.16  ? 274 TYR A CD2 1 
ATOM   1998 C CE1 . TYR A 1 272 ? -34.873 -8.036  34.170 1.00 42.34  ? 274 TYR A CE1 1 
ATOM   1999 C CE2 . TYR A 1 272 ? -34.777 -7.142  36.412 1.00 44.35  ? 274 TYR A CE2 1 
ATOM   2000 C CZ  . TYR A 1 272 ? -34.509 -8.163  35.514 1.00 53.85  ? 274 TYR A CZ  1 
ATOM   2001 O OH  . TYR A 1 272 ? -33.881 -9.310  35.968 1.00 56.59  ? 274 TYR A OH  1 
ATOM   2002 N N   . SER A 1 273 ? -36.835 -2.476  31.951 1.00 37.96  ? 275 SER A N   1 
ATOM   2003 C CA  . SER A 1 273 ? -37.712 -1.536  31.308 1.00 36.42  ? 275 SER A CA  1 
ATOM   2004 C C   . SER A 1 273 ? -38.491 -2.308  30.283 1.00 32.44  ? 275 SER A C   1 
ATOM   2005 O O   . SER A 1 273 ? -37.993 -3.270  29.706 1.00 32.45  ? 275 SER A O   1 
ATOM   2006 C CB  . SER A 1 273 ? -36.896 -0.456  30.613 1.00 38.86  ? 275 SER A CB  1 
ATOM   2007 O OG  . SER A 1 273 ? -36.638 0.625   31.499 1.00 39.69  ? 275 SER A OG  1 
ATOM   2008 N N   . LEU A 1 274 ? -39.737 -1.900  30.112 1.00 35.36  ? 276 LEU A N   1 
ATOM   2009 C CA  . LEU A 1 274 ? -40.512 -2.209  28.960 1.00 33.97  ? 276 LEU A CA  1 
ATOM   2010 C C   . LEU A 1 274 ? -40.259 -1.146  27.913 1.00 34.59  ? 276 LEU A C   1 
ATOM   2011 O O   . LEU A 1 274 ? -40.592 0.020   28.110 1.00 30.76  ? 276 LEU A O   1 
ATOM   2012 C CB  . LEU A 1 274 ? -41.993 -2.125  29.343 1.00 31.24  ? 276 LEU A CB  1 
ATOM   2013 C CG  . LEU A 1 274 ? -42.988 -2.540  28.262 1.00 35.51  ? 276 LEU A CG  1 
ATOM   2014 C CD1 . LEU A 1 274 ? -42.659 -3.805  27.508 1.00 35.48  ? 276 LEU A CD1 1 
ATOM   2015 C CD2 . LEU A 1 274 ? -44.375 -2.664  28.910 1.00 35.32  ? 276 LEU A CD2 1 
ATOM   2016 N N   . LEU A 1 275 ? -39.746 -1.529  26.749 1.00 28.72  ? 277 LEU A N   1 
ATOM   2017 C CA  . LEU A 1 275 ? -39.699 -0.551  25.697 1.00 34.28  ? 277 LEU A CA  1 
ATOM   2018 C C   . LEU A 1 275 ? -40.836 -0.783  24.733 1.00 34.30  ? 277 LEU A C   1 
ATOM   2019 O O   . LEU A 1 275 ? -41.014 -1.913  24.232 1.00 33.91  ? 277 LEU A O   1 
ATOM   2020 C CB  . LEU A 1 275 ? -38.382 -0.689  24.909 1.00 34.65  ? 277 LEU A CB  1 
ATOM   2021 C CG  . LEU A 1 275 ? -37.096 -0.560  25.693 1.00 40.93  ? 277 LEU A CG  1 
ATOM   2022 C CD1 . LEU A 1 275 ? -35.931 -0.613  24.740 1.00 46.24  ? 277 LEU A CD1 1 
ATOM   2023 C CD2 . LEU A 1 275 ? -37.043 0.673   26.539 1.00 39.23  ? 277 LEU A CD2 1 
ATOM   2024 N N   . ILE A 1 276 ? -41.527 0.294   24.392 1.00 34.35  ? 278 ILE A N   1 
ATOM   2025 C CA  . ILE A 1 276 ? -42.595 0.263   23.383 1.00 35.09  ? 278 ILE A CA  1 
ATOM   2026 C C   . ILE A 1 276 ? -42.247 1.309   22.368 1.00 36.22  ? 278 ILE A C   1 
ATOM   2027 O O   . ILE A 1 276 ? -42.166 2.486   22.700 1.00 37.00  ? 278 ILE A O   1 
ATOM   2028 C CB  . ILE A 1 276 ? -43.994 0.560   23.982 1.00 34.32  ? 278 ILE A CB  1 
ATOM   2029 C CG1 . ILE A 1 276 ? -44.336 -0.490  25.039 1.00 39.13  ? 278 ILE A CG1 1 
ATOM   2030 C CG2 . ILE A 1 276 ? -45.086 0.481   22.883 1.00 35.60  ? 278 ILE A CG2 1 
ATOM   2031 C CD1 . ILE A 1 276 ? -45.227 0.010   26.165 1.00 44.80  ? 278 ILE A CD1 1 
ATOM   2032 N N   . TYR A 1 277 ? -42.002 0.890   21.126 1.00 33.32  ? 279 TYR A N   1 
ATOM   2033 C CA  . TYR A 1 277 ? -41.494 1.838   20.169 1.00 35.90  ? 279 TYR A CA  1 
ATOM   2034 C C   . TYR A 1 277 ? -42.011 1.584   18.789 1.00 35.48  ? 279 TYR A C   1 
ATOM   2035 O O   . TYR A 1 277 ? -42.583 0.521   18.507 1.00 30.60  ? 279 TYR A O   1 
ATOM   2036 C CB  . TYR A 1 277 ? -39.946 1.848   20.177 1.00 35.70  ? 279 TYR A CB  1 
ATOM   2037 C CG  . TYR A 1 277 ? -39.259 0.528   19.914 1.00 35.36  ? 279 TYR A CG  1 
ATOM   2038 C CD1 . TYR A 1 277 ? -39.164 -0.459  20.905 1.00 38.65  ? 279 TYR A CD1 1 
ATOM   2039 C CD2 . TYR A 1 277 ? -38.655 0.295   18.705 1.00 37.34  ? 279 TYR A CD2 1 
ATOM   2040 C CE1 . TYR A 1 277 ? -38.522 -1.671  20.654 1.00 31.96  ? 279 TYR A CE1 1 
ATOM   2041 C CE2 . TYR A 1 277 ? -37.988 -0.892  18.443 1.00 47.62  ? 279 TYR A CE2 1 
ATOM   2042 C CZ  . TYR A 1 277 ? -37.921 -1.861  19.426 1.00 41.65  ? 279 TYR A CZ  1 
ATOM   2043 O OH  . TYR A 1 277 ? -37.266 -3.025  19.120 1.00 43.00  ? 279 TYR A OH  1 
ATOM   2044 N N   . VAL A 1 278 ? -41.770 2.557   17.923 1.00 35.57  ? 280 VAL A N   1 
ATOM   2045 C CA  . VAL A 1 278 ? -42.218 2.487   16.542 1.00 32.44  ? 280 VAL A CA  1 
ATOM   2046 C C   . VAL A 1 278 ? -41.015 2.725   15.682 1.00 32.74  ? 280 VAL A C   1 
ATOM   2047 O O   . VAL A 1 278 ? -40.354 3.757   15.778 1.00 36.04  ? 280 VAL A O   1 
ATOM   2048 C CB  . VAL A 1 278 ? -43.331 3.528   16.208 1.00 30.83  ? 280 VAL A CB  1 
ATOM   2049 C CG1 . VAL A 1 278 ? -43.739 3.400   14.738 1.00 29.99  ? 280 VAL A CG1 1 
ATOM   2050 C CG2 . VAL A 1 278 ? -44.583 3.331   17.071 1.00 34.45  ? 280 VAL A CG2 1 
ATOM   2051 N N   . SER A 1 279 ? -40.677 1.735   14.882 1.00 33.14  ? 281 SER A N   1 
ATOM   2052 C CA  . SER A 1 279 ? -39.606 1.886   13.930 1.00 36.41  ? 281 SER A CA  1 
ATOM   2053 C C   . SER A 1 279 ? -40.111 2.658   12.693 1.00 39.89  ? 281 SER A C   1 
ATOM   2054 O O   . SER A 1 279 ? -41.137 2.313   12.097 1.00 37.01  ? 281 SER A O   1 
ATOM   2055 C CB  . SER A 1 279 ? -39.052 0.487   13.624 1.00 40.08  ? 281 SER A CB  1 
ATOM   2056 O OG  . SER A 1 279 ? -38.298 0.478   12.429 1.00 54.39  ? 281 SER A OG  1 
ATOM   2057 N N   . VAL A 1 280 ? -39.393 3.728   12.337 1.00 41.21  ? 282 VAL A N   1 
ATOM   2058 C CA  . VAL A 1 280 ? -39.778 4.629   11.256 1.00 44.32  ? 282 VAL A CA  1 
ATOM   2059 C C   . VAL A 1 280 ? -38.637 4.625   10.249 1.00 48.06  ? 282 VAL A C   1 
ATOM   2060 O O   . VAL A 1 280 ? -37.567 5.160   10.580 1.00 48.74  ? 282 VAL A O   1 
ATOM   2061 C CB  . VAL A 1 280 ? -39.994 6.099   11.773 1.00 40.35  ? 282 VAL A CB  1 
ATOM   2062 C CG1 . VAL A 1 280 ? -40.424 7.002   10.625 1.00 45.68  ? 282 VAL A CG1 1 
ATOM   2063 C CG2 . VAL A 1 280 ? -41.014 6.124   12.883 1.00 35.64  ? 282 VAL A CG2 1 
ATOM   2064 N N   . PRO A 1 281 ? -38.820 3.956   9.073  1.00 49.23  ? 283 PRO A N   1 
ATOM   2065 C CA  . PRO A 1 281 ? -37.757 3.840   8.063  1.00 55.87  ? 283 PRO A CA  1 
ATOM   2066 C C   . PRO A 1 281 ? -37.274 5.206   7.604  1.00 59.88  ? 283 PRO A C   1 
ATOM   2067 O O   . PRO A 1 281 ? -38.102 6.088   7.341  1.00 56.11  ? 283 PRO A O   1 
ATOM   2068 C CB  . PRO A 1 281 ? -38.441 3.128   6.882  1.00 54.33  ? 283 PRO A CB  1 
ATOM   2069 C CG  . PRO A 1 281 ? -39.527 2.355   7.514  1.00 55.46  ? 283 PRO A CG  1 
ATOM   2070 C CD  . PRO A 1 281 ? -40.038 3.245   8.626  1.00 47.18  ? 283 PRO A CD  1 
ATOM   2071 N N   . GLY A 1 282 ? -35.944 5.361   7.532  1.00 64.22  ? 284 GLY A N   1 
ATOM   2072 C CA  . GLY A 1 282 ? -35.304 6.638   7.209  1.00 66.11  ? 284 GLY A CA  1 
ATOM   2073 C C   . GLY A 1 282 ? -35.218 7.635   8.350  1.00 67.17  ? 284 GLY A C   1 
ATOM   2074 O O   . GLY A 1 282 ? -34.572 8.667   8.194  1.00 73.70  ? 284 GLY A O   1 
ATOM   2075 N N   . SER A 1 283 ? -35.867 7.350   9.492  1.00 62.01  ? 285 SER A N   1 
ATOM   2076 C CA  . SER A 1 283 ? -35.822 8.225   10.665 1.00 58.86  ? 285 SER A CA  1 
ATOM   2077 C C   . SER A 1 283 ? -35.470 7.451   11.951 1.00 54.84  ? 285 SER A C   1 
ATOM   2078 O O   . SER A 1 283 ? -35.257 6.241   11.925 1.00 54.25  ? 285 SER A O   1 
ATOM   2079 C CB  . SER A 1 283 ? -37.138 8.984   10.876 1.00 58.59  ? 285 SER A CB  1 
ATOM   2080 O OG  . SER A 1 283 ? -37.557 9.707   9.713  1.00 76.31  ? 285 SER A OG  1 
ATOM   2081 N N   . LYS A 1 284 ? -35.389 8.169   13.061 1.00 52.12  ? 286 LYS A N   1 
ATOM   2082 C CA  . LYS A 1 284 ? -35.138 7.547   14.330 1.00 51.08  ? 286 LYS A CA  1 
ATOM   2083 C C   . LYS A 1 284 ? -36.435 7.007   14.924 1.00 48.71  ? 286 LYS A C   1 
ATOM   2084 O O   . LYS A 1 284 ? -37.521 7.518   14.599 1.00 48.65  ? 286 LYS A O   1 
ATOM   2085 C CB  . LYS A 1 284 ? -34.464 8.552   15.267 1.00 55.85  ? 286 LYS A CB  1 
ATOM   2086 C CG  . LYS A 1 284 ? -33.013 8.833   14.879 1.00 61.81  ? 286 LYS A CG  1 
ATOM   2087 C CD  . LYS A 1 284 ? -32.198 9.140   16.114 1.00 68.73  ? 286 LYS A CD  1 
ATOM   2088 C CE  . LYS A 1 284 ? -31.915 10.611  16.259 1.00 75.16  ? 286 LYS A CE  1 
ATOM   2089 N NZ  . LYS A 1 284 ? -33.153 11.424  16.331 1.00 87.45  ? 286 LYS A NZ  1 
ATOM   2090 N N   . LYS A 1 285 ? -36.332 5.977   15.780 1.00 45.22  ? 287 LYS A N   1 
ATOM   2091 C CA  . LYS A 1 285 ? -37.507 5.361   16.426 1.00 41.23  ? 287 LYS A CA  1 
ATOM   2092 C C   . LYS A 1 285 ? -38.223 6.375   17.301 1.00 41.05  ? 287 LYS A C   1 
ATOM   2093 O O   . LYS A 1 285 ? -37.607 7.338   17.776 1.00 45.37  ? 287 LYS A O   1 
ATOM   2094 C CB  . LYS A 1 285 ? -37.092 4.169   17.301 1.00 35.57  ? 287 LYS A CB  1 
ATOM   2095 C CG  . LYS A 1 285 ? -36.365 3.015   16.525 1.00 35.83  ? 287 LYS A CG  1 
ATOM   2096 C CD  . LYS A 1 285 ? -35.597 2.202   17.612 1.00 29.70  ? 287 LYS A CD  1 
ATOM   2097 C CE  . LYS A 1 285 ? -34.782 1.009   17.071 1.00 35.16  ? 287 LYS A CE  1 
ATOM   2098 N NZ  . LYS A 1 285 ? -33.712 1.411   16.083 1.00 43.05  ? 287 LYS A NZ  1 
ATOM   2099 N N   . VAL A 1 286 ? -39.513 6.166   17.534 1.00 38.19  ? 288 VAL A N   1 
ATOM   2100 C CA  . VAL A 1 286 ? -40.247 6.935   18.539 1.00 37.90  ? 288 VAL A CA  1 
ATOM   2101 C C   . VAL A 1 286 ? -40.362 5.953   19.710 1.00 39.00  ? 288 VAL A C   1 
ATOM   2102 O O   . VAL A 1 286 ? -40.993 4.891   19.545 1.00 38.26  ? 288 VAL A O   1 
ATOM   2103 C CB  . VAL A 1 286 ? -41.689 7.221   18.092 1.00 37.27  ? 288 VAL A CB  1 
ATOM   2104 C CG1 . VAL A 1 286 ? -42.412 8.067   19.126 1.00 43.99  ? 288 VAL A CG1 1 
ATOM   2105 C CG2 . VAL A 1 286 ? -41.726 7.881   16.697 1.00 43.41  ? 288 VAL A CG2 1 
ATOM   2106 N N   . ILE A 1 287 ? -39.820 6.315   20.880 1.00 36.22  ? 289 ILE A N   1 
ATOM   2107 C CA  . ILE A 1 287 ? -39.611 5.322   21.958 1.00 37.48  ? 289 ILE A CA  1 
ATOM   2108 C C   . ILE A 1 287 ? -40.308 5.714   23.252 1.00 39.78  ? 289 ILE A C   1 
ATOM   2109 O O   . ILE A 1 287 ? -40.146 6.870   23.717 1.00 41.44  ? 289 ILE A O   1 
ATOM   2110 C CB  . ILE A 1 287 ? -38.056 5.077   22.186 1.00 38.15  ? 289 ILE A CB  1 
ATOM   2111 C CG1 . ILE A 1 287 ? -37.393 4.461   20.945 1.00 37.20  ? 289 ILE A CG1 1 
ATOM   2112 C CG2 . ILE A 1 287 ? -37.738 4.223   23.440 1.00 38.61  ? 289 ILE A CG2 1 
ATOM   2113 C CD1 . ILE A 1 287 ? -35.862 4.883   20.757 1.00 39.26  ? 289 ILE A CD1 1 
ATOM   2114 N N   . LEU A 1 288 ? -41.106 4.783   23.812 1.00 34.22  ? 290 LEU A N   1 
ATOM   2115 C CA  . LEU A 1 288 ? -41.461 4.813   25.247 1.00 36.84  ? 290 LEU A CA  1 
ATOM   2116 C C   . LEU A 1 288 ? -40.554 3.856   26.028 1.00 36.69  ? 290 LEU A C   1 
ATOM   2117 O O   . LEU A 1 288 ? -40.315 2.723   25.616 1.00 37.17  ? 290 LEU A O   1 
ATOM   2118 C CB  . LEU A 1 288 ? -42.922 4.425   25.495 1.00 34.52  ? 290 LEU A CB  1 
ATOM   2119 C CG  . LEU A 1 288 ? -43.991 5.260   24.780 1.00 42.21  ? 290 LEU A CG  1 
ATOM   2120 C CD1 . LEU A 1 288 ? -45.411 4.693   25.007 1.00 30.30  ? 290 LEU A CD1 1 
ATOM   2121 C CD2 . LEU A 1 288 ? -43.928 6.661   25.236 1.00 41.81  ? 290 LEU A CD2 1 
ATOM   2122 N N   . ASP A 1 289 ? -40.030 4.341   27.134 1.00 36.77  ? 291 ASP A N   1 
ATOM   2123 C CA  . ASP A 1 289 ? -39.300 3.520   28.083 1.00 35.70  ? 291 ASP A CA  1 
ATOM   2124 C C   . ASP A 1 289 ? -40.096 3.527   29.380 1.00 39.53  ? 291 ASP A C   1 
ATOM   2125 O O   . ASP A 1 289 ? -40.190 4.561   30.030 1.00 37.90  ? 291 ASP A O   1 
ATOM   2126 C CB  . ASP A 1 289 ? -37.920 4.141   28.308 1.00 39.07  ? 291 ASP A CB  1 
ATOM   2127 C CG  . ASP A 1 289 ? -37.042 3.342   29.284 1.00 39.30  ? 291 ASP A CG  1 
ATOM   2128 O OD1 . ASP A 1 289 ? -37.540 2.806   30.293 1.00 49.34  ? 291 ASP A OD1 1 
ATOM   2129 O OD2 . ASP A 1 289 ? -35.834 3.250   29.010 1.00 40.62  ? 291 ASP A OD2 1 
ATOM   2130 N N   . LEU A 1 290 ? -40.686 2.388   29.760 1.00 36.09  ? 292 LEU A N   1 
ATOM   2131 C CA  . LEU A 1 290 ? -41.409 2.334   31.050 1.00 39.20  ? 292 LEU A CA  1 
ATOM   2132 C C   . LEU A 1 290 ? -40.640 1.466   32.059 1.00 39.19  ? 292 LEU A C   1 
ATOM   2133 O O   . LEU A 1 290 ? -40.573 0.249   31.898 1.00 41.98  ? 292 LEU A O   1 
ATOM   2134 C CB  . LEU A 1 290 ? -42.826 1.756   30.868 1.00 38.63  ? 292 LEU A CB  1 
ATOM   2135 C CG  . LEU A 1 290 ? -43.805 2.322   29.834 1.00 38.08  ? 292 LEU A CG  1 
ATOM   2136 C CD1 . LEU A 1 290 ? -45.108 1.577   29.966 1.00 43.53  ? 292 LEU A CD1 1 
ATOM   2137 C CD2 . LEU A 1 290 ? -44.054 3.810   30.074 1.00 54.00  ? 292 LEU A CD2 1 
ATOM   2138 N N   . PRO A 1 291 ? -40.058 2.077   33.109 1.00 46.51  ? 293 PRO A N   1 
ATOM   2139 C CA  . PRO A 1 291 ? -39.341 1.276   34.128 1.00 43.72  ? 293 PRO A CA  1 
ATOM   2140 C C   . PRO A 1 291 ? -40.197 0.247   34.863 1.00 45.56  ? 293 PRO A C   1 
ATOM   2141 O O   . PRO A 1 291 ? -41.347 0.508   35.237 1.00 43.26  ? 293 PRO A O   1 
ATOM   2142 C CB  . PRO A 1 291 ? -38.831 2.324   35.126 1.00 45.82  ? 293 PRO A CB  1 
ATOM   2143 C CG  . PRO A 1 291 ? -38.861 3.629   34.383 1.00 53.59  ? 293 PRO A CG  1 
ATOM   2144 C CD  . PRO A 1 291 ? -40.041 3.523   33.432 1.00 46.93  ? 293 PRO A CD  1 
ATOM   2145 N N   . LEU A 1 292 ? -39.599 -0.911  35.107 1.00 39.50  ? 294 LEU A N   1 
ATOM   2146 C CA  . LEU A 1 292 ? -40.268 -2.035  35.735 1.00 39.29  ? 294 LEU A CA  1 
ATOM   2147 C C   . LEU A 1 292 ? -39.437 -2.442  36.932 1.00 43.67  ? 294 LEU A C   1 
ATOM   2148 O O   . LEU A 1 292 ? -38.256 -2.113  37.022 1.00 40.98  ? 294 LEU A O   1 
ATOM   2149 C CB  . LEU A 1 292 ? -40.339 -3.221  34.759 1.00 40.00  ? 294 LEU A CB  1 
ATOM   2150 C CG  . LEU A 1 292 ? -41.067 -2.976  33.414 1.00 34.17  ? 294 LEU A CG  1 
ATOM   2151 C CD1 . LEU A 1 292 ? -40.882 -4.219  32.565 1.00 40.63  ? 294 LEU A CD1 1 
ATOM   2152 C CD2 . LEU A 1 292 ? -42.532 -2.718  33.671 1.00 44.21  ? 294 LEU A CD2 1 
ATOM   2153 N N   . VAL A 1 293 ? -40.090 -3.106  37.865 1.00 44.15  ? 295 VAL A N   1 
ATOM   2154 C CA  . VAL A 1 293 ? -39.420 -3.770  38.927 1.00 49.16  ? 295 VAL A CA  1 
ATOM   2155 C C   . VAL A 1 293 ? -39.755 -5.237  38.759 1.00 50.69  ? 295 VAL A C   1 
ATOM   2156 O O   . VAL A 1 293 ? -40.928 -5.599  38.731 1.00 51.64  ? 295 VAL A O   1 
ATOM   2157 C CB  . VAL A 1 293 ? -39.948 -3.246  40.287 1.00 51.90  ? 295 VAL A CB  1 
ATOM   2158 C CG1 . VAL A 1 293 ? -39.397 -4.087  41.409 1.00 50.75  ? 295 VAL A CG1 1 
ATOM   2159 C CG2 . VAL A 1 293 ? -39.565 -1.766  40.455 1.00 54.28  ? 295 VAL A CG2 1 
ATOM   2160 N N   . ILE A 1 294 ? -38.738 -6.086  38.632 1.00 49.82  ? 296 ILE A N   1 
ATOM   2161 C CA  . ILE A 1 294 ? -39.004 -7.496  38.360 1.00 52.91  ? 296 ILE A CA  1 
ATOM   2162 C C   . ILE A 1 294 ? -38.407 -8.338  39.469 1.00 54.46  ? 296 ILE A C   1 
ATOM   2163 O O   . ILE A 1 294 ? -37.227 -8.275  39.680 1.00 54.59  ? 296 ILE A O   1 
ATOM   2164 C CB  . ILE A 1 294 ? -38.465 -7.929  36.945 1.00 50.97  ? 296 ILE A CB  1 
ATOM   2165 C CG1 . ILE A 1 294 ? -39.375 -7.367  35.857 1.00 50.38  ? 296 ILE A CG1 1 
ATOM   2166 C CG2 . ILE A 1 294 ? -38.454 -9.436  36.772 1.00 44.30  ? 296 ILE A CG2 1 
ATOM   2167 C CD1 . ILE A 1 294 ? -38.940 -6.079  35.379 1.00 60.86  ? 296 ILE A CD1 1 
ATOM   2168 N N   . GLY A 1 295 ? -39.236 -9.119  40.154 1.00 61.75  ? 297 GLY A N   1 
ATOM   2169 C CA  . GLY A 1 295 ? -38.782 -9.905  41.292 1.00 66.48  ? 297 GLY A CA  1 
ATOM   2170 C C   . GLY A 1 295 ? -38.869 -11.412 41.135 1.00 70.06  ? 297 GLY A C   1 
ATOM   2171 O O   . GLY A 1 295 ? -39.666 -11.936 40.352 1.00 71.31  ? 297 GLY A O   1 
ATOM   2172 N N   . SER A 1 296 ? -38.061 -12.102 41.934 1.00 72.58  ? 298 SER A N   1 
ATOM   2173 C CA  . SER A 1 296 ? -37.863 -13.546 41.843 1.00 74.86  ? 298 SER A CA  1 
ATOM   2174 C C   . SER A 1 296 ? -38.937 -14.398 42.539 1.00 77.59  ? 298 SER A C   1 
ATOM   2175 O O   . SER A 1 296 ? -39.765 -13.895 43.297 1.00 76.17  ? 298 SER A O   1 
ATOM   2176 C CB  . SER A 1 296 ? -36.491 -13.882 42.405 1.00 74.96  ? 298 SER A CB  1 
ATOM   2177 O OG  . SER A 1 296 ? -35.519 -12.922 41.983 1.00 73.75  ? 298 SER A OG  1 
ATOM   2178 N N   . MET B 2 1   ? -77.136 9.876   4.933  1.00 79.88  ? 1   MET B N   1 
ATOM   2179 C CA  . MET B 2 1   ? -76.863 9.605   6.378  1.00 79.30  ? 1   MET B CA  1 
ATOM   2180 C C   . MET B 2 1   ? -76.193 8.253   6.618  1.00 75.92  ? 1   MET B C   1 
ATOM   2181 O O   . MET B 2 1   ? -76.439 7.276   5.896  1.00 76.47  ? 1   MET B O   1 
ATOM   2182 C CB  . MET B 2 1   ? -78.141 9.696   7.225  1.00 87.42  ? 1   MET B CB  1 
ATOM   2183 C CG  . MET B 2 1   ? -78.383 11.045  7.914  1.00 94.70  ? 1   MET B CG  1 
ATOM   2184 S SD  . MET B 2 1   ? -79.386 12.186  6.930  1.00 113.25 ? 1   MET B SD  1 
ATOM   2185 C CE  . MET B 2 1   ? -81.061 11.559  7.188  1.00 119.89 ? 1   MET B CE  1 
ATOM   2186 N N   . VAL B 2 2   ? -75.361 8.228   7.661  1.00 72.27  ? 2   VAL B N   1 
ATOM   2187 C CA  . VAL B 2 2   ? -74.624 7.040   8.112  1.00 67.78  ? 2   VAL B CA  1 
ATOM   2188 C C   . VAL B 2 2   ? -75.223 6.488   9.401  1.00 72.67  ? 2   VAL B C   1 
ATOM   2189 O O   . VAL B 2 2   ? -75.384 7.204   10.393 1.00 72.60  ? 2   VAL B O   1 
ATOM   2190 C CB  . VAL B 2 2   ? -73.117 7.352   8.345  1.00 62.28  ? 2   VAL B CB  1 
ATOM   2191 C CG1 . VAL B 2 2   ? -72.379 6.125   8.849  1.00 54.34  ? 2   VAL B CG1 1 
ATOM   2192 C CG2 . VAL B 2 2   ? -72.484 7.867   7.072  1.00 47.88  ? 2   VAL B CG2 1 
ATOM   2193 N N   . LYS B 2 3   ? -75.541 5.200   9.363  1.00 76.30  ? 3   LYS B N   1 
ATOM   2194 C CA  . LYS B 2 3   ? -76.120 4.497   10.495 1.00 85.57  ? 3   LYS B CA  1 
ATOM   2195 C C   . LYS B 2 3   ? -75.013 4.128   11.487 1.00 83.34  ? 3   LYS B C   1 
ATOM   2196 O O   . LYS B 2 3   ? -74.213 3.233   11.210 1.00 81.69  ? 3   LYS B O   1 
ATOM   2197 C CB  . LYS B 2 3   ? -76.815 3.226   9.992  1.00 89.78  ? 3   LYS B CB  1 
ATOM   2198 C CG  . LYS B 2 3   ? -78.090 2.811   10.724 1.00 102.48 ? 3   LYS B CG  1 
ATOM   2199 C CD  . LYS B 2 3   ? -78.887 1.824   9.849  1.00 115.11 ? 3   LYS B CD  1 
ATOM   2200 C CE  . LYS B 2 3   ? -79.287 2.458   8.498  1.00 112.99 ? 3   LYS B CE  1 
ATOM   2201 N NZ  . LYS B 2 3   ? -79.422 1.466   7.392  1.00 118.46 ? 3   LYS B NZ  1 
ATOM   2202 N N   . GLN B 2 4   ? -74.961 4.825   12.623 1.00 85.80  ? 4   GLN B N   1 
ATOM   2203 C CA  . GLN B 2 4   ? -74.128 4.391   13.761 1.00 86.09  ? 4   GLN B CA  1 
ATOM   2204 C C   . GLN B 2 4   ? -74.577 2.993   14.160 1.00 91.52  ? 4   GLN B C   1 
ATOM   2205 O O   . GLN B 2 4   ? -75.778 2.729   14.258 1.00 99.63  ? 4   GLN B O   1 
ATOM   2206 C CB  . GLN B 2 4   ? -74.240 5.353   14.952 1.00 89.58  ? 4   GLN B CB  1 
ATOM   2207 C CG  . GLN B 2 4   ? -73.593 6.726   14.725 1.00 87.28  ? 4   GLN B CG  1 
ATOM   2208 C CD  . GLN B 2 4   ? -74.481 7.915   15.139 1.00 98.62  ? 4   GLN B CD  1 
ATOM   2209 O OE1 . GLN B 2 4   ? -75.516 7.755   15.802 1.00 103.21 ? 4   GLN B OE1 1 
ATOM   2210 N NE2 . GLN B 2 4   ? -74.073 9.117   14.733 1.00 90.26  ? 4   GLN B NE2 1 
ATOM   2211 N N   . ILE B 2 5   ? -73.620 2.094   14.358 1.00 89.18  ? 5   ILE B N   1 
ATOM   2212 C CA  . ILE B 2 5   ? -73.944 0.689   14.577 1.00 96.95  ? 5   ILE B CA  1 
ATOM   2213 C C   . ILE B 2 5   ? -73.251 0.152   15.828 1.00 100.30 ? 5   ILE B C   1 
ATOM   2214 O O   . ILE B 2 5   ? -72.024 0.013   15.872 1.00 96.15  ? 5   ILE B O   1 
ATOM   2215 C CB  . ILE B 2 5   ? -73.705 -0.173  13.297 1.00 94.03  ? 5   ILE B CB  1 
ATOM   2216 C CG1 . ILE B 2 5   ? -74.845 0.053   12.312 1.00 95.56  ? 5   ILE B CG1 1 
ATOM   2217 C CG2 . ILE B 2 5   ? -73.584 -1.680  13.626 1.00 103.68 ? 5   ILE B CG2 1 
ATOM   2218 C CD1 . ILE B 2 5   ? -74.729 -0.733  11.040 1.00 92.64  ? 5   ILE B CD1 1 
ATOM   2219 N N   . GLU B 2 6   ? -74.068 -0.154  16.836 1.00 109.88 ? 6   GLU B N   1 
ATOM   2220 C CA  . GLU B 2 6   ? -73.591 -0.358  18.197 1.00 113.89 ? 6   GLU B CA  1 
ATOM   2221 C C   . GLU B 2 6   ? -73.821 -1.758  18.756 1.00 123.28 ? 6   GLU B C   1 
ATOM   2222 O O   . GLU B 2 6   ? -73.699 -1.978  19.966 1.00 129.77 ? 6   GLU B O   1 
ATOM   2223 C CB  . GLU B 2 6   ? -74.194 0.713   19.110 1.00 117.25 ? 6   GLU B CB  1 
ATOM   2224 C CG  . GLU B 2 6   ? -73.388 2.006   19.103 1.00 113.64 ? 6   GLU B CG  1 
ATOM   2225 C CD  . GLU B 2 6   ? -74.247 3.259   19.063 1.00 121.02 ? 6   GLU B CD  1 
ATOM   2226 O OE1 . GLU B 2 6   ? -75.356 3.258   19.642 1.00 132.97 ? 6   GLU B OE1 1 
ATOM   2227 O OE2 . GLU B 2 6   ? -73.803 4.252   18.446 1.00 115.26 ? 6   GLU B OE2 1 
ATOM   2228 N N   . SER B 2 7   ? -74.133 -2.703  17.872 1.00 125.28 ? 7   SER B N   1 
ATOM   2229 C CA  . SER B 2 7   ? -74.379 -4.091  18.274 1.00 136.81 ? 7   SER B CA  1 
ATOM   2230 C C   . SER B 2 7   ? -73.886 -5.085  17.235 1.00 135.96 ? 7   SER B C   1 
ATOM   2231 O O   . SER B 2 7   ? -73.595 -4.724  16.091 1.00 128.41 ? 7   SER B O   1 
ATOM   2232 C CB  . SER B 2 7   ? -75.871 -4.342  18.556 1.00 147.36 ? 7   SER B CB  1 
ATOM   2233 O OG  . SER B 2 7   ? -76.270 -3.789  19.798 1.00 152.41 ? 7   SER B OG  1 
ATOM   2234 N N   . LYS B 2 8   ? -73.822 -6.343  17.654 1.00 145.83 ? 8   LYS B N   1 
ATOM   2235 C CA  . LYS B 2 8   ? -73.384 -7.441  16.808 1.00 148.13 ? 8   LYS B CA  1 
ATOM   2236 C C   . LYS B 2 8   ? -74.536 -7.881  15.916 1.00 154.45 ? 8   LYS B C   1 
ATOM   2237 O O   . LYS B 2 8   ? -74.358 -8.045  14.709 1.00 151.21 ? 8   LYS B O   1 
ATOM   2238 C CB  . LYS B 2 8   ? -72.897 -8.616  17.670 1.00 157.73 ? 8   LYS B CB  1 
ATOM   2239 C CG  . LYS B 2 8   ? -72.399 -8.206  19.053 1.00 156.26 ? 8   LYS B CG  1 
ATOM   2240 C CD  . LYS B 2 8   ? -72.101 -9.419  19.933 1.00 170.34 ? 8   LYS B CD  1 
ATOM   2241 C CE  . LYS B 2 8   ? -72.608 -9.228  21.365 1.00 176.03 ? 8   LYS B CE  1 
ATOM   2242 N NZ  . LYS B 2 8   ? -72.044 -8.024  22.044 1.00 165.80 ? 8   LYS B NZ  1 
ATOM   2243 N N   . THR B 2 9   ? -75.716 -8.063  16.513 1.00 164.82 ? 9   THR B N   1 
ATOM   2244 C CA  . THR B 2 9   ? -76.905 -8.480  15.758 1.00 172.57 ? 9   THR B CA  1 
ATOM   2245 C C   . THR B 2 9   ? -77.506 -7.339  14.933 1.00 165.38 ? 9   THR B C   1 
ATOM   2246 O O   . THR B 2 9   ? -78.235 -7.595  13.969 1.00 168.54 ? 9   THR B O   1 
ATOM   2247 C CB  . THR B 2 9   ? -77.999 -9.162  16.640 1.00 187.56 ? 9   THR B CB  1 
ATOM   2248 O OG1 . THR B 2 9   ? -78.226 -8.403  17.833 1.00 186.00 ? 9   THR B OG1 1 
ATOM   2249 C CG2 . THR B 2 9   ? -77.589 -10.579 17.007 1.00 196.21 ? 9   THR B CG2 1 
ATOM   2250 N N   . ALA B 2 10  ? -77.188 -6.093  15.308 1.00 156.72 ? 10  ALA B N   1 
ATOM   2251 C CA  . ALA B 2 10  ? -77.569 -4.903  14.521 1.00 148.69 ? 10  ALA B CA  1 
ATOM   2252 C C   . ALA B 2 10  ? -76.679 -4.716  13.286 1.00 138.90 ? 10  ALA B C   1 
ATOM   2253 O O   . ALA B 2 10  ? -76.956 -3.869  12.435 1.00 134.24 ? 10  ALA B O   1 
ATOM   2254 C CB  . ALA B 2 10  ? -77.567 -3.636  15.391 1.00 143.97 ? 10  ALA B CB  1 
ATOM   2255 N N   . PHE B 2 11  ? -75.610 -5.506  13.198 1.00 137.15 ? 11  PHE B N   1 
ATOM   2256 C CA  . PHE B 2 11  ? -74.788 -5.567  11.992 1.00 130.07 ? 11  PHE B CA  1 
ATOM   2257 C C   . PHE B 2 11  ? -75.422 -6.534  10.984 1.00 137.32 ? 11  PHE B C   1 
ATOM   2258 O O   . PHE B 2 11  ? -75.210 -6.425  9.770  1.00 132.35 ? 11  PHE B O   1 
ATOM   2259 C CB  . PHE B 2 11  ? -73.334 -5.948  12.335 1.00 126.29 ? 11  PHE B CB  1 
ATOM   2260 C CG  . PHE B 2 11  ? -72.378 -5.825  11.173 1.00 117.64 ? 11  PHE B CG  1 
ATOM   2261 C CD1 . PHE B 2 11  ? -72.064 -4.574  10.636 1.00 104.10 ? 11  PHE B CD1 1 
ATOM   2262 C CD2 . PHE B 2 11  ? -71.790 -6.962  10.615 1.00 118.48 ? 11  PHE B CD2 1 
ATOM   2263 C CE1 . PHE B 2 11  ? -71.189 -4.463  9.554  1.00 99.97  ? 11  PHE B CE1 1 
ATOM   2264 C CE2 . PHE B 2 11  ? -70.914 -6.862  9.535  1.00 108.63 ? 11  PHE B CE2 1 
ATOM   2265 C CZ  . PHE B 2 11  ? -70.611 -5.614  9.005  1.00 101.55 ? 11  PHE B CZ  1 
ATOM   2266 N N   . GLN B 2 12  ? -76.212 -7.468  11.505 1.00 150.40 ? 12  GLN B N   1 
ATOM   2267 C CA  . GLN B 2 12  ? -77.054 -8.338  10.683 1.00 161.22 ? 12  GLN B CA  1 
ATOM   2268 C C   . GLN B 2 12  ? -78.330 -7.590  10.273 1.00 161.90 ? 12  GLN B C   1 
ATOM   2269 O O   . GLN B 2 12  ? -78.831 -7.776  9.159  1.00 164.37 ? 12  GLN B O   1 
ATOM   2270 C CB  . GLN B 2 12  ? -77.383 -9.637  11.425 1.00 175.35 ? 12  GLN B CB  1 
ATOM   2271 C CG  . GLN B 2 12  ? -77.071 -10.902 10.624 1.00 185.32 ? 12  GLN B CG  1 
ATOM   2272 C CD  . GLN B 2 12  ? -75.575 -11.193 10.524 1.00 181.26 ? 12  GLN B CD  1 
ATOM   2273 O OE1 . GLN B 2 12  ? -74.982 -11.102 9.447  1.00 176.83 ? 12  GLN B OE1 1 
ATOM   2274 N NE2 . GLN B 2 12  ? -74.961 -11.537 11.654 1.00 184.06 ? 12  GLN B NE2 1 
ATOM   2275 N N   . GLU B 2 13  ? -78.843 -6.747  11.174 1.00 160.57 ? 13  GLU B N   1 
ATOM   2276 C CA  . GLU B 2 13  ? -79.870 -5.755  10.823 1.00 159.63 ? 13  GLU B CA  1 
ATOM   2277 C C   . GLU B 2 13  ? -79.243 -4.548  10.105 1.00 147.11 ? 13  GLU B C   1 
ATOM   2278 O O   . GLU B 2 13  ? -78.995 -3.503  10.719 1.00 139.36 ? 13  GLU B O   1 
ATOM   2279 C CB  . GLU B 2 13  ? -80.659 -5.282  12.053 1.00 163.75 ? 13  GLU B CB  1 
ATOM   2280 C CG  . GLU B 2 13  ? -81.795 -6.186  12.492 1.00 175.52 ? 13  GLU B CG  1 
ATOM   2281 C CD  . GLU B 2 13  ? -81.517 -6.917  13.795 1.00 182.86 ? 13  GLU B CD  1 
ATOM   2282 O OE1 . GLU B 2 13  ? -80.587 -6.523  14.529 1.00 175.75 ? 13  GLU B OE1 1 
ATOM   2283 O OE2 . GLU B 2 13  ? -82.246 -7.886  14.100 1.00 193.02 ? 13  GLU B OE2 1 
ATOM   2284 N N   . ALA B 2 14  ? -78.977 -4.732  8.810  1.00 145.99 ? 14  ALA B N   1 
ATOM   2285 C CA  . ALA B 2 14  ? -78.527 -3.696  7.857  1.00 135.60 ? 14  ALA B CA  1 
ATOM   2286 C C   . ALA B 2 14  ? -78.010 -4.424  6.623  1.00 137.35 ? 14  ALA B C   1 
ATOM   2287 O O   . ALA B 2 14  ? -78.332 -4.061  5.484  1.00 136.70 ? 14  ALA B O   1 
ATOM   2288 C CB  . ALA B 2 14  ? -77.449 -2.813  8.441  1.00 125.00 ? 14  ALA B CB  1 
ATOM   2289 N N   . LEU B 2 15  ? -77.225 -5.472  6.884  1.00 140.76 ? 15  LEU B N   1 
ATOM   2290 C CA  . LEU B 2 15  ? -76.730 -6.415  5.880  1.00 146.05 ? 15  LEU B CA  1 
ATOM   2291 C C   . LEU B 2 15  ? -77.894 -7.174  5.223  1.00 158.27 ? 15  LEU B C   1 
ATOM   2292 O O   . LEU B 2 15  ? -77.769 -7.684  4.103  1.00 161.79 ? 15  LEU B O   1 
ATOM   2293 C CB  . LEU B 2 15  ? -75.777 -7.414  6.556  1.00 149.50 ? 15  LEU B CB  1 
ATOM   2294 C CG  . LEU B 2 15  ? -74.530 -7.966  5.850  1.00 149.67 ? 15  LEU B CG  1 
ATOM   2295 C CD1 . LEU B 2 15  ? -73.343 -7.027  6.030  1.00 127.11 ? 15  LEU B CD1 1 
ATOM   2296 C CD2 . LEU B 2 15  ? -74.187 -9.354  6.384  1.00 159.92 ? 15  LEU B CD2 1 
ATOM   2297 N N   . ASP B 2 16  ? -79.015 -7.241  5.943  1.00 164.76 ? 16  ASP B N   1 
ATOM   2298 C CA  . ASP B 2 16  ? -80.260 -7.839  5.455  1.00 177.15 ? 16  ASP B CA  1 
ATOM   2299 C C   . ASP B 2 16  ? -81.129 -6.845  4.665  1.00 173.83 ? 16  ASP B C   1 
ATOM   2300 O O   . ASP B 2 16  ? -81.666 -7.191  3.611  1.00 180.57 ? 16  ASP B O   1 
ATOM   2301 C CB  . ASP B 2 16  ? -81.054 -8.456  6.622  1.00 187.08 ? 16  ASP B CB  1 
ATOM   2302 C CG  . ASP B 2 16  ? -81.583 -7.409  7.612  1.00 181.89 ? 16  ASP B CG  1 
ATOM   2303 O OD1 . ASP B 2 16  ? -80.956 -6.336  7.774  1.00 168.37 ? 16  ASP B OD1 1 
ATOM   2304 O OD2 . ASP B 2 16  ? -82.635 -7.670  8.235  1.00 190.99 ? 16  ASP B OD2 1 
ATOM   2305 N N   . ALA B 2 17  ? -81.247 -5.616  5.181  1.00 164.72 ? 17  ALA B N   1 
ATOM   2306 C CA  . ALA B 2 17  ? -82.073 -4.558  4.581  1.00 162.09 ? 17  ALA B CA  1 
ATOM   2307 C C   . ALA B 2 17  ? -81.618 -4.178  3.173  1.00 157.68 ? 17  ALA B C   1 
ATOM   2308 O O   . ALA B 2 17  ? -82.426 -3.755  2.350  1.00 159.79 ? 17  ALA B O   1 
ATOM   2309 C CB  . ALA B 2 17  ? -82.101 -3.321  5.485  1.00 153.87 ? 17  ALA B CB  1 
ATOM   2310 N N   . ALA B 2 18  ? -80.319 -4.325  2.917  1.00 152.52 ? 18  ALA B N   1 
ATOM   2311 C CA  . ALA B 2 18  ? -79.740 -4.092  1.593  1.00 149.66 ? 18  ALA B CA  1 
ATOM   2312 C C   . ALA B 2 18  ? -80.137 -5.223  0.648  1.00 160.74 ? 18  ALA B C   1 
ATOM   2313 O O   . ALA B 2 18  ? -80.085 -6.395  1.017  1.00 168.81 ? 18  ALA B O   1 
ATOM   2314 C CB  . ALA B 2 18  ? -78.207 -3.973  1.694  1.00 141.28 ? 18  ALA B CB  1 
ATOM   2315 N N   . GLY B 2 19  ? -80.548 -4.865  -0.563 1.00 162.70 ? 19  GLY B N   1 
ATOM   2316 C CA  . GLY B 2 19  ? -80.984 -5.856  -1.547 1.00 174.95 ? 19  GLY B CA  1 
ATOM   2317 C C   . GLY B 2 19  ? -79.795 -6.344  -2.347 1.00 175.00 ? 19  GLY B C   1 
ATOM   2318 O O   . GLY B 2 19  ? -78.839 -6.890  -1.782 1.00 173.56 ? 19  GLY B O   1 
ATOM   2319 N N   . ASP B 2 20  ? -79.857 -6.143  -3.663 1.00 177.17 ? 20  ASP B N   1 
ATOM   2320 C CA  . ASP B 2 20  ? -78.694 -6.298  -4.540 1.00 175.68 ? 20  ASP B CA  1 
ATOM   2321 C C   . ASP B 2 20  ? -77.689 -5.156  -4.306 1.00 160.53 ? 20  ASP B C   1 
ATOM   2322 O O   . ASP B 2 20  ? -76.624 -5.114  -4.934 1.00 158.27 ? 20  ASP B O   1 
ATOM   2323 C CB  . ASP B 2 20  ? -79.131 -6.296  -6.013 1.00 184.41 ? 20  ASP B CB  1 
ATOM   2324 C CG  . ASP B 2 20  ? -79.788 -7.601  -6.446 1.00 200.48 ? 20  ASP B CG  1 
ATOM   2325 O OD1 . ASP B 2 20  ? -79.875 -8.545  -5.631 1.00 205.68 ? 20  ASP B OD1 1 
ATOM   2326 O OD2 . ASP B 2 20  ? -80.212 -7.680  -7.622 1.00 204.55 ? 20  ASP B OD2 1 
ATOM   2327 N N   . LYS B 2 21  ? -78.034 -4.243  -3.395 1.00 149.99 ? 21  LYS B N   1 
ATOM   2328 C CA  . LYS B 2 21  ? -77.298 -2.994  -3.235 1.00 136.88 ? 21  LYS B CA  1 
ATOM   2329 C C   . LYS B 2 21  ? -76.050 -3.075  -2.339 1.00 128.63 ? 21  LYS B C   1 
ATOM   2330 O O   . LYS B 2 21  ? -75.973 -3.860  -1.374 1.00 130.44 ? 21  LYS B O   1 
ATOM   2331 C CB  . LYS B 2 21  ? -78.225 -1.831  -2.837 1.00 131.96 ? 21  LYS B CB  1 
ATOM   2332 C CG  . LYS B 2 21  ? -78.964 -1.976  -1.516 1.00 133.36 ? 21  LYS B CG  1 
ATOM   2333 C CD  . LYS B 2 21  ? -79.919 -0.799  -1.343 1.00 135.94 ? 21  LYS B CD  1 
ATOM   2334 C CE  . LYS B 2 21  ? -80.328 -0.603  0.112  1.00 135.56 ? 21  LYS B CE  1 
ATOM   2335 N NZ  . LYS B 2 21  ? -81.192 0.618   0.263  1.00 133.18 ? 21  LYS B NZ  1 
ATOM   2336 N N   . LEU B 2 22  ? -75.077 -2.245  -2.701 1.00 118.36 ? 22  LEU B N   1 
ATOM   2337 C CA  . LEU B 2 22  ? -73.778 -2.199  -2.064 1.00 106.85 ? 22  LEU B CA  1 
ATOM   2338 C C   . LEU B 2 22  ? -73.847 -1.513  -0.703 1.00 97.31  ? 22  LEU B C   1 
ATOM   2339 O O   . LEU B 2 22  ? -74.461 -0.443  -0.542 1.00 90.85  ? 22  LEU B O   1 
ATOM   2340 C CB  . LEU B 2 22  ? -72.794 -1.476  -2.986 1.00 102.68 ? 22  LEU B CB  1 
ATOM   2341 C CG  . LEU B 2 22  ? -71.352 -1.239  -2.544 1.00 86.83  ? 22  LEU B CG  1 
ATOM   2342 C CD1 . LEU B 2 22  ? -70.444 -2.231  -3.242 1.00 88.78  ? 22  LEU B CD1 1 
ATOM   2343 C CD2 . LEU B 2 22  ? -70.982 0.178   -2.895 1.00 73.39  ? 22  LEU B CD2 1 
ATOM   2344 N N   . VAL B 2 23  ? -73.221 -2.155  0.277  1.00 95.42  ? 23  VAL B N   1 
ATOM   2345 C CA  . VAL B 2 23  ? -73.030 -1.543  1.593  1.00 87.93  ? 23  VAL B CA  1 
ATOM   2346 C C   . VAL B 2 23  ? -71.550 -1.174  1.794  1.00 79.34  ? 23  VAL B C   1 
ATOM   2347 O O   . VAL B 2 23  ? -70.668 -1.831  1.235  1.00 78.61  ? 23  VAL B O   1 
ATOM   2348 C CB  . VAL B 2 23  ? -73.604 -2.427  2.754  1.00 92.46  ? 23  VAL B CB  1 
ATOM   2349 C CG1 . VAL B 2 23  ? -73.054 -3.843  2.710  1.00 99.27  ? 23  VAL B CG1 1 
ATOM   2350 C CG2 . VAL B 2 23  ? -73.354 -1.787  4.106  1.00 86.44  ? 23  VAL B CG2 1 
ATOM   2351 N N   . VAL B 2 24  ? -71.313 -0.102  2.555  1.00 70.85  ? 24  VAL B N   1 
ATOM   2352 C CA  . VAL B 2 24  ? -69.973 0.338   2.931  1.00 64.62  ? 24  VAL B CA  1 
ATOM   2353 C C   . VAL B 2 24  ? -69.878 0.587   4.450  1.00 62.01  ? 24  VAL B C   1 
ATOM   2354 O O   . VAL B 2 24  ? -70.673 1.332   5.017  1.00 62.00  ? 24  VAL B O   1 
ATOM   2355 C CB  . VAL B 2 24  ? -69.500 1.561   2.070  1.00 58.37  ? 24  VAL B CB  1 
ATOM   2356 C CG1 . VAL B 2 24  ? -70.445 2.717   2.183  1.00 59.86  ? 24  VAL B CG1 1 
ATOM   2357 C CG2 . VAL B 2 24  ? -68.053 1.978   2.407  1.00 54.05  ? 24  VAL B CG2 1 
ATOM   2358 N N   . VAL B 2 25  ? -68.924 -0.072  5.108  1.00 61.52  ? 25  VAL B N   1 
ATOM   2359 C CA  . VAL B 2 25  ? -68.731 0.078   6.556  1.00 59.57  ? 25  VAL B CA  1 
ATOM   2360 C C   . VAL B 2 25  ? -67.412 0.806   6.857  1.00 53.59  ? 25  VAL B C   1 
ATOM   2361 O O   . VAL B 2 25  ? -66.366 0.416   6.357  1.00 53.94  ? 25  VAL B O   1 
ATOM   2362 C CB  . VAL B 2 25  ? -68.716 -1.282  7.268  1.00 65.61  ? 25  VAL B CB  1 
ATOM   2363 C CG1 . VAL B 2 25  ? -68.950 -1.106  8.768  1.00 61.72  ? 25  VAL B CG1 1 
ATOM   2364 C CG2 . VAL B 2 25  ? -69.756 -2.221  6.663  1.00 75.04  ? 25  VAL B CG2 1 
ATOM   2365 N N   . ASP B 2 26  ? -67.493 1.878   7.638  1.00 49.24  ? 26  ASP B N   1 
ATOM   2366 C CA  . ASP B 2 26  ? -66.339 2.584   8.165  1.00 45.02  ? 26  ASP B CA  1 
ATOM   2367 C C   . ASP B 2 26  ? -66.015 2.029   9.565  1.00 44.76  ? 26  ASP B C   1 
ATOM   2368 O O   . ASP B 2 26  ? -66.618 2.443   10.551 1.00 46.22  ? 26  ASP B O   1 
ATOM   2369 C CB  . ASP B 2 26  ? -66.621 4.110   8.223  1.00 39.38  ? 26  ASP B CB  1 
ATOM   2370 C CG  . ASP B 2 26  ? -65.489 4.924   8.859  1.00 38.79  ? 26  ASP B CG  1 
ATOM   2371 O OD1 . ASP B 2 26  ? -64.492 4.339   9.316  1.00 45.20  ? 26  ASP B OD1 1 
ATOM   2372 O OD2 . ASP B 2 26  ? -65.596 6.173   8.935  1.00 36.38  ? 26  ASP B OD2 1 
ATOM   2373 N N   . PHE B 2 27  ? -65.069 1.087   9.634  1.00 45.17  ? 27  PHE B N   1 
ATOM   2374 C CA  . PHE B 2 27  ? -64.496 0.667   10.915 1.00 44.23  ? 27  PHE B CA  1 
ATOM   2375 C C   . PHE B 2 27  ? -63.519 1.716   11.401 1.00 40.01  ? 27  PHE B C   1 
ATOM   2376 O O   . PHE B 2 27  ? -62.410 1.856   10.878 1.00 38.14  ? 27  PHE B O   1 
ATOM   2377 C CB  . PHE B 2 27  ? -63.802 -0.673  10.796 1.00 49.36  ? 27  PHE B CB  1 
ATOM   2378 C CG  . PHE B 2 27  ? -64.740 -1.796  10.553 1.00 61.39  ? 27  PHE B CG  1 
ATOM   2379 C CD1 . PHE B 2 27  ? -65.310 -2.471  11.620 1.00 70.57  ? 27  PHE B CD1 1 
ATOM   2380 C CD2 . PHE B 2 27  ? -65.079 -2.164  9.256  1.00 68.49  ? 27  PHE B CD2 1 
ATOM   2381 C CE1 . PHE B 2 27  ? -66.192 -3.507  11.400 1.00 82.68  ? 27  PHE B CE1 1 
ATOM   2382 C CE2 . PHE B 2 27  ? -65.968 -3.196  9.023  1.00 79.22  ? 27  PHE B CE2 1 
ATOM   2383 C CZ  . PHE B 2 27  ? -66.530 -3.868  10.093 1.00 86.44  ? 27  PHE B CZ  1 
ATOM   2384 N N   . SER B 2 28  ? -63.954 2.449   12.404 1.00 39.24  ? 28  SER B N   1 
ATOM   2385 C CA  . SER B 2 28  ? -63.301 3.655   12.844 1.00 34.61  ? 28  SER B CA  1 
ATOM   2386 C C   . SER B 2 28  ? -62.980 3.529   14.311 1.00 37.23  ? 28  SER B C   1 
ATOM   2387 O O   . SER B 2 28  ? -63.309 2.527   14.926 1.00 44.67  ? 28  SER B O   1 
ATOM   2388 C CB  . SER B 2 28  ? -64.281 4.796   12.667 1.00 32.61  ? 28  SER B CB  1 
ATOM   2389 O OG  . SER B 2 28  ? -63.708 6.000   13.117 1.00 43.67  ? 28  SER B OG  1 
ATOM   2390 N N   . ALA B 2 29  ? -62.329 4.548   14.866 1.00 34.14  ? 29  ALA B N   1 
ATOM   2391 C CA  . ALA B 2 29  ? -62.090 4.650   16.285 1.00 40.76  ? 29  ALA B CA  1 
ATOM   2392 C C   . ALA B 2 29  ? -61.970 6.134   16.579 1.00 43.08  ? 29  ALA B C   1 
ATOM   2393 O O   . ALA B 2 29  ? -61.534 6.922   15.727 1.00 40.39  ? 29  ALA B O   1 
ATOM   2394 C CB  . ALA B 2 29  ? -60.808 3.902   16.705 1.00 41.25  ? 29  ALA B CB  1 
ATOM   2395 N N   . THR B 2 30  ? -62.362 6.489   17.791 1.00 52.37  ? 30  THR B N   1 
ATOM   2396 C CA  . THR B 2 30  ? -62.544 7.866   18.209 1.00 57.51  ? 30  THR B CA  1 
ATOM   2397 C C   . THR B 2 30  ? -61.241 8.625   18.445 1.00 54.09  ? 30  THR B C   1 
ATOM   2398 O O   . THR B 2 30  ? -61.206 9.841   18.315 1.00 57.75  ? 30  THR B O   1 
ATOM   2399 C CB  . THR B 2 30  ? -63.504 7.946   19.460 1.00 67.41  ? 30  THR B CB  1 
ATOM   2400 O OG1 . THR B 2 30  ? -63.834 9.310   19.736 1.00 81.41  ? 30  THR B OG1 1 
ATOM   2401 C CG2 . THR B 2 30  ? -62.899 7.302   20.745 1.00 71.82  ? 30  THR B CG2 1 
ATOM   2402 N N   . TRP B 2 31  ? -60.175 7.901   18.794 1.00 51.82  ? 31  TRP B N   1 
ATOM   2403 C CA  . TRP B 2 31  ? -58.875 8.494   19.134 1.00 46.92  ? 31  TRP B CA  1 
ATOM   2404 C C   . TRP B 2 31  ? -57.962 8.609   17.907 1.00 40.36  ? 31  TRP B C   1 
ATOM   2405 O O   . TRP B 2 31  ? -56.923 9.264   17.952 1.00 42.06  ? 31  TRP B O   1 
ATOM   2406 C CB  . TRP B 2 31  ? -58.182 7.656   20.233 1.00 52.22  ? 31  TRP B CB  1 
ATOM   2407 C CG  . TRP B 2 31  ? -58.139 6.193   19.878 1.00 39.93  ? 31  TRP B CG  1 
ATOM   2408 C CD1 . TRP B 2 31  ? -59.040 5.248   20.251 1.00 43.28  ? 31  TRP B CD1 1 
ATOM   2409 C CD2 . TRP B 2 31  ? -57.175 5.529   19.047 1.00 31.11  ? 31  TRP B CD2 1 
ATOM   2410 N NE1 . TRP B 2 31  ? -58.711 4.037   19.709 1.00 43.53  ? 31  TRP B NE1 1 
ATOM   2411 C CE2 . TRP B 2 31  ? -57.570 4.182   18.958 1.00 34.48  ? 31  TRP B CE2 1 
ATOM   2412 C CE3 . TRP B 2 31  ? -56.034 5.947   18.343 1.00 24.52  ? 31  TRP B CE3 1 
ATOM   2413 C CZ2 . TRP B 2 31  ? -56.845 3.237   18.238 1.00 30.35  ? 31  TRP B CZ2 1 
ATOM   2414 C CZ3 . TRP B 2 31  ? -55.315 5.006   17.624 1.00 25.90  ? 31  TRP B CZ3 1 
ATOM   2415 C CH2 . TRP B 2 31  ? -55.732 3.665   17.570 1.00 30.49  ? 31  TRP B CH2 1 
ATOM   2416 N N   . CYS B 2 32  ? -58.380 7.999   16.803 1.00 35.83  ? 32  CYS B N   1 
ATOM   2417 C CA  . CYS B 2 32  ? -57.596 7.880   15.596 1.00 31.22  ? 32  CYS B CA  1 
ATOM   2418 C C   . CYS B 2 32  ? -57.696 9.122   14.677 1.00 32.49  ? 32  CYS B C   1 
ATOM   2419 O O   . CYS B 2 32  ? -58.755 9.401   14.118 1.00 28.84  ? 32  CYS B O   1 
ATOM   2420 C CB  . CYS B 2 32  ? -58.077 6.636   14.878 1.00 28.52  ? 32  CYS B CB  1 
ATOM   2421 S SG  . CYS B 2 32  ? -57.345 6.336   13.307 1.00 32.24  ? 32  CYS B SG  1 
ATOM   2422 N N   . GLY B 2 33  ? -56.595 9.871   14.550 1.00 31.24  ? 33  GLY B N   1 
ATOM   2423 C CA  . GLY B 2 33  ? -56.514 11.063  13.717 1.00 31.89  ? 33  GLY B CA  1 
ATOM   2424 C C   . GLY B 2 33  ? -56.989 10.832  12.283 1.00 29.82  ? 33  GLY B C   1 
ATOM   2425 O O   . GLY B 2 33  ? -57.936 11.479  11.851 1.00 33.16  ? 33  GLY B O   1 
ATOM   2426 N N   . PRO B 2 34  ? -56.341 9.918   11.523 1.00 21.92  ? 34  PRO B N   1 
ATOM   2427 C CA  . PRO B 2 34  ? -56.891 9.649   10.178 1.00 22.42  ? 34  PRO B CA  1 
ATOM   2428 C C   . PRO B 2 34  ? -58.380 9.235   10.127 1.00 24.62  ? 34  PRO B C   1 
ATOM   2429 O O   . PRO B 2 34  ? -59.046 9.630   9.203  1.00 25.37  ? 34  PRO B O   1 
ATOM   2430 C CB  . PRO B 2 34  ? -56.004 8.518   9.650  1.00 22.51  ? 34  PRO B CB  1 
ATOM   2431 C CG  . PRO B 2 34  ? -54.724 8.623   10.430 1.00 18.21  ? 34  PRO B CG  1 
ATOM   2432 C CD  . PRO B 2 34  ? -55.107 9.140   11.783 1.00 23.51  ? 34  PRO B CD  1 
ATOM   2433 N N   . ALA B 2 35  ? -58.906 8.481   11.107 1.00 25.98  ? 35  ALA B N   1 
ATOM   2434 C CA  . ALA B 2 35  ? -60.345 8.111   11.096 1.00 26.63  ? 35  ALA B CA  1 
ATOM   2435 C C   . ALA B 2 35  ? -61.304 9.284   11.350 1.00 32.77  ? 35  ALA B C   1 
ATOM   2436 O O   . ALA B 2 35  ? -62.388 9.354   10.741 1.00 35.22  ? 35  ALA B O   1 
ATOM   2437 C CB  . ALA B 2 35  ? -60.644 6.982   12.049 1.00 25.05  ? 35  ALA B CB  1 
ATOM   2438 N N   . LYS B 2 36  ? -60.919 10.185  12.245 1.00 32.62  ? 36  LYS B N   1 
ATOM   2439 C CA  . LYS B 2 36  ? -61.603 11.460  12.435 1.00 37.47  ? 36  LYS B CA  1 
ATOM   2440 C C   . LYS B 2 36  ? -61.531 12.440  11.242 1.00 37.25  ? 36  LYS B C   1 
ATOM   2441 O O   . LYS B 2 36  ? -62.469 13.209  10.980 1.00 38.33  ? 36  LYS B O   1 
ATOM   2442 C CB  . LYS B 2 36  ? -61.024 12.158  13.648 1.00 43.30  ? 36  LYS B CB  1 
ATOM   2443 C CG  . LYS B 2 36  ? -61.328 11.482  14.978 1.00 54.14  ? 36  LYS B CG  1 
ATOM   2444 C CD  . LYS B 2 36  ? -61.050 12.425  16.162 1.00 62.28  ? 36  LYS B CD  1 
ATOM   2445 C CE  . LYS B 2 36  ? -62.215 13.423  16.371 1.00 79.91  ? 36  LYS B CE  1 
ATOM   2446 N NZ  . LYS B 2 36  ? -62.535 13.721  17.814 1.00 84.88  ? 36  LYS B NZ  1 
ATOM   2447 N N   . MET B 2 37  ? -60.400 12.466  10.553 1.00 33.78  ? 37  MET B N   1 
ATOM   2448 C CA  . MET B 2 37  ? -60.281 13.267  9.344  1.00 36.37  ? 37  MET B CA  1 
ATOM   2449 C C   . MET B 2 37  ? -61.243 12.744  8.240  1.00 33.89  ? 37  MET B C   1 
ATOM   2450 O O   . MET B 2 37  ? -61.882 13.529  7.574  1.00 37.83  ? 37  MET B O   1 
ATOM   2451 C CB  . MET B 2 37  ? -58.822 13.336  8.876  1.00 36.39  ? 37  MET B CB  1 
ATOM   2452 C CG  . MET B 2 37  ? -58.598 14.040  7.522  1.00 48.91  ? 37  MET B CG  1 
ATOM   2453 S SD  . MET B 2 37  ? -58.898 12.990  6.060  1.00 43.47  ? 37  MET B SD  1 
ATOM   2454 C CE  . MET B 2 37  ? -57.306 12.187  5.890  1.00 43.15  ? 37  MET B CE  1 
ATOM   2455 N N   . ILE B 2 38  ? -61.362 11.431  8.060  1.00 29.26  ? 38  ILE B N   1 
ATOM   2456 C CA  . ILE B 2 38  ? -62.137 10.903  6.940  1.00 29.71  ? 38  ILE B CA  1 
ATOM   2457 C C   . ILE B 2 38  ? -63.649 11.004  7.217  1.00 32.29  ? 38  ILE B C   1 
ATOM   2458 O O   . ILE B 2 38  ? -64.488 10.999  6.313  1.00 33.44  ? 38  ILE B O   1 
ATOM   2459 C CB  . ILE B 2 38  ? -61.696 9.460   6.612  1.00 27.48  ? 38  ILE B CB  1 
ATOM   2460 C CG1 . ILE B 2 38  ? -62.105 9.074   5.192  1.00 35.48  ? 38  ILE B CG1 1 
ATOM   2461 C CG2 . ILE B 2 38  ? -62.228 8.468   7.608  1.00 28.55  ? 38  ILE B CG2 1 
ATOM   2462 C CD1 . ILE B 2 38  ? -61.389 9.832   4.164  1.00 30.86  ? 38  ILE B CD1 1 
ATOM   2463 N N   . LYS B 2 39  ? -63.969 11.117  8.491  1.00 29.87  ? 39  LYS B N   1 
ATOM   2464 C CA  . LYS B 2 39  ? -65.327 10.999  8.995  1.00 33.08  ? 39  LYS B CA  1 
ATOM   2465 C C   . LYS B 2 39  ? -66.316 11.892  8.261  1.00 35.57  ? 39  LYS B C   1 
ATOM   2466 O O   . LYS B 2 39  ? -67.308 11.371  7.771  1.00 37.49  ? 39  LYS B O   1 
ATOM   2467 C CB  . LYS B 2 39  ? -65.330 11.262  10.491 1.00 36.33  ? 39  LYS B CB  1 
ATOM   2468 C CG  . LYS B 2 39  ? -66.613 11.068  11.221 1.00 46.16  ? 39  LYS B CG  1 
ATOM   2469 C CD  . LYS B 2 39  ? -66.536 11.816  12.565 1.00 59.45  ? 39  LYS B CD  1 
ATOM   2470 C CE  . LYS B 2 39  ? -66.540 13.354  12.404 1.00 68.49  ? 39  LYS B CE  1 
ATOM   2471 N NZ  . LYS B 2 39  ? -67.872 13.905  11.926 1.00 67.07  ? 39  LYS B NZ  1 
ATOM   2472 N N   . PRO B 2 40  ? -66.058 13.221  8.156  1.00 36.01  ? 40  PRO B N   1 
ATOM   2473 C CA  . PRO B 2 40  ? -67.090 13.995  7.471  1.00 40.96  ? 40  PRO B CA  1 
ATOM   2474 C C   . PRO B 2 40  ? -67.278 13.567  6.013  1.00 42.81  ? 40  PRO B C   1 
ATOM   2475 O O   . PRO B 2 40  ? -68.421 13.623  5.497  1.00 44.81  ? 40  PRO B O   1 
ATOM   2476 C CB  . PRO B 2 40  ? -66.550 15.435  7.477  1.00 45.37  ? 40  PRO B CB  1 
ATOM   2477 C CG  . PRO B 2 40  ? -65.381 15.448  8.323  1.00 41.33  ? 40  PRO B CG  1 
ATOM   2478 C CD  . PRO B 2 40  ? -64.919 14.046  8.562  1.00 34.44  ? 40  PRO B CD  1 
ATOM   2479 N N   . PHE B 2 41  ? -66.174 13.164  5.361  1.00 35.51  ? 41  PHE B N   1 
ATOM   2480 C CA  . PHE B 2 41  ? -66.160 12.850  3.921  1.00 36.11  ? 41  PHE B CA  1 
ATOM   2481 C C   . PHE B 2 41  ? -67.002 11.636  3.655  1.00 34.93  ? 41  PHE B C   1 
ATOM   2482 O O   . PHE B 2 41  ? -67.742 11.574  2.670  1.00 37.12  ? 41  PHE B O   1 
ATOM   2483 C CB  . PHE B 2 41  ? -64.729 12.648  3.417  1.00 33.65  ? 41  PHE B CB  1 
ATOM   2484 C CG  . PHE B 2 41  ? -63.885 13.888  3.496  1.00 41.26  ? 41  PHE B CG  1 
ATOM   2485 C CD1 . PHE B 2 41  ? -62.736 13.920  4.300  1.00 47.05  ? 41  PHE B CD1 1 
ATOM   2486 C CD2 . PHE B 2 41  ? -64.250 15.045  2.793  1.00 50.29  ? 41  PHE B CD2 1 
ATOM   2487 C CE1 . PHE B 2 41  ? -61.949 15.078  4.380  1.00 50.00  ? 41  PHE B CE1 1 
ATOM   2488 C CE2 . PHE B 2 41  ? -63.474 16.212  2.863  1.00 53.64  ? 41  PHE B CE2 1 
ATOM   2489 C CZ  . PHE B 2 41  ? -62.310 16.222  3.669  1.00 54.57  ? 41  PHE B CZ  1 
ATOM   2490 N N   . PHE B 2 42  ? -66.926 10.698  4.581  1.00 31.80  ? 42  PHE B N   1 
ATOM   2491 C CA  . PHE B 2 42  ? -67.724 9.491   4.538  1.00 34.33  ? 42  PHE B CA  1 
ATOM   2492 C C   . PHE B 2 42  ? -69.240 9.796   4.681  1.00 40.41  ? 42  PHE B C   1 
ATOM   2493 O O   . PHE B 2 42  ? -70.096 9.119   4.079  1.00 41.37  ? 42  PHE B O   1 
ATOM   2494 C CB  . PHE B 2 42  ? -67.252 8.576   5.653  1.00 28.38  ? 42  PHE B CB  1 
ATOM   2495 C CG  . PHE B 2 42  ? -67.884 7.225   5.632  1.00 36.39  ? 42  PHE B CG  1 
ATOM   2496 C CD1 . PHE B 2 42  ? -67.562 6.311   4.650  1.00 26.71  ? 42  PHE B CD1 1 
ATOM   2497 C CD2 . PHE B 2 42  ? -68.799 6.861   6.609  1.00 38.11  ? 42  PHE B CD2 1 
ATOM   2498 C CE1 . PHE B 2 42  ? -68.119 5.062   4.642  1.00 35.38  ? 42  PHE B CE1 1 
ATOM   2499 C CE2 . PHE B 2 42  ? -69.367 5.613   6.593  1.00 42.91  ? 42  PHE B CE2 1 
ATOM   2500 C CZ  . PHE B 2 42  ? -69.026 4.711   5.612  1.00 37.95  ? 42  PHE B CZ  1 
ATOM   2501 N N   . HIS B 2 43  ? -69.559 10.810  5.480  1.00 43.23  ? 43  HIS B N   1 
ATOM   2502 C CA  . HIS B 2 43  ? -70.941 11.285  5.606  1.00 50.09  ? 43  HIS B CA  1 
ATOM   2503 C C   . HIS B 2 43  ? -71.425 12.052  4.334  1.00 52.62  ? 43  HIS B C   1 
ATOM   2504 O O   . HIS B 2 43  ? -72.525 11.802  3.810  1.00 56.05  ? 43  HIS B O   1 
ATOM   2505 C CB  . HIS B 2 43  ? -71.083 12.123  6.892  1.00 51.55  ? 43  HIS B CB  1 
ATOM   2506 C CG  . HIS B 2 43  ? -72.462 12.678  7.111  1.00 65.53  ? 43  HIS B CG  1 
ATOM   2507 N ND1 . HIS B 2 43  ? -72.816 13.959  6.740  1.00 70.53  ? 43  HIS B ND1 1 
ATOM   2508 C CD2 . HIS B 2 43  ? -73.569 12.128  7.674  1.00 64.73  ? 43  HIS B CD2 1 
ATOM   2509 C CE1 . HIS B 2 43  ? -74.084 14.167  7.047  1.00 73.13  ? 43  HIS B CE1 1 
ATOM   2510 N NE2 . HIS B 2 43  ? -74.562 13.074  7.617  1.00 75.58  ? 43  HIS B NE2 1 
ATOM   2511 N N   . SER B 2 44  ? -70.620 12.993  3.851  1.00 53.31  ? 44  SER B N   1 
ATOM   2512 C CA  . SER B 2 44  ? -70.908 13.655  2.581  1.00 57.33  ? 44  SER B CA  1 
ATOM   2513 C C   . SER B 2 44  ? -71.105 12.663  1.433  1.00 57.17  ? 44  SER B C   1 
ATOM   2514 O O   . SER B 2 44  ? -71.918 12.917  0.556  1.00 64.76  ? 44  SER B O   1 
ATOM   2515 C CB  . SER B 2 44  ? -69.791 14.619  2.214  1.00 58.00  ? 44  SER B CB  1 
ATOM   2516 O OG  . SER B 2 44  ? -69.725 15.664  3.153  1.00 63.88  ? 44  SER B OG  1 
ATOM   2517 N N   . LEU B 2 45  ? -70.350 11.561  1.412  1.00 50.53  ? 45  LEU B N   1 
ATOM   2518 C CA  . LEU B 2 45  ? -70.538 10.495  0.409  1.00 50.67  ? 45  LEU B CA  1 
ATOM   2519 C C   . LEU B 2 45  ? -71.878 9.778   0.571  1.00 56.03  ? 45  LEU B C   1 
ATOM   2520 O O   . LEU B 2 45  ? -72.470 9.325   -0.412 1.00 59.31  ? 45  LEU B O   1 
ATOM   2521 C CB  . LEU B 2 45  ? -69.388 9.482   0.433  1.00 48.02  ? 45  LEU B CB  1 
ATOM   2522 C CG  . LEU B 2 45  ? -68.044 9.836   -0.230 1.00 42.37  ? 45  LEU B CG  1 
ATOM   2523 C CD1 . LEU B 2 45  ? -66.911 8.930   0.197  1.00 40.85  ? 45  LEU B CD1 1 
ATOM   2524 C CD2 . LEU B 2 45  ? -68.153 9.848   -1.753 1.00 40.98  ? 45  LEU B CD2 1 
ATOM   2525 N N   . SER B 2 46  ? -72.366 9.693   1.809  1.00 55.20  ? 46  SER B N   1 
ATOM   2526 C CA  . SER B 2 46  ? -73.624 9.012   2.080  1.00 57.51  ? 46  SER B CA  1 
ATOM   2527 C C   . SER B 2 46  ? -74.832 9.796   1.601  1.00 61.94  ? 46  SER B C   1 
ATOM   2528 O O   . SER B 2 46  ? -75.866 9.192   1.271  1.00 65.04  ? 46  SER B O   1 
ATOM   2529 C CB  . SER B 2 46  ? -73.779 8.693   3.568  1.00 57.23  ? 46  SER B CB  1 
ATOM   2530 O OG  . SER B 2 46  ? -73.792 9.878   4.333  1.00 53.59  ? 46  SER B OG  1 
ATOM   2531 N N   . GLU B 2 47  ? -74.710 11.127  1.599  1.00 61.39  ? 47  GLU B N   1 
ATOM   2532 C CA  . GLU B 2 47  ? -75.749 12.001  1.068  1.00 68.01  ? 47  GLU B CA  1 
ATOM   2533 C C   . GLU B 2 47  ? -75.718 11.910  -0.448 1.00 68.68  ? 47  GLU B C   1 
ATOM   2534 O O   . GLU B 2 47  ? -76.774 11.802  -1.099 1.00 68.81  ? 47  GLU B O   1 
ATOM   2535 C CB  . GLU B 2 47  ? -75.538 13.466  1.474  1.00 71.31  ? 47  GLU B CB  1 
ATOM   2536 C CG  . GLU B 2 47  ? -75.075 13.702  2.905  1.00 75.49  ? 47  GLU B CG  1 
ATOM   2537 C CD  . GLU B 2 47  ? -76.182 13.611  3.940  1.00 82.45  ? 47  GLU B CD  1 
ATOM   2538 O OE1 . GLU B 2 47  ? -76.491 14.663  4.541  1.00 90.69  ? 47  GLU B OE1 1 
ATOM   2539 O OE2 . GLU B 2 47  ? -76.733 12.505  4.165  1.00 85.26  ? 47  GLU B OE2 1 
ATOM   2540 N N   . LYS B 2 48  ? -74.505 11.960  -1.013 1.00 61.52  ? 48  LYS B N   1 
ATOM   2541 C CA  . LYS B 2 48  ? -74.364 11.906  -2.469 1.00 66.12  ? 48  LYS B CA  1 
ATOM   2542 C C   . LYS B 2 48  ? -74.895 10.592  -3.029 1.00 70.42  ? 48  LYS B C   1 
ATOM   2543 O O   . LYS B 2 48  ? -75.798 10.585  -3.886 1.00 79.01  ? 48  LYS B O   1 
ATOM   2544 C CB  . LYS B 2 48  ? -72.928 12.151  -2.935 1.00 59.91  ? 48  LYS B CB  1 
ATOM   2545 C CG  . LYS B 2 48  ? -72.867 12.743  -4.339 1.00 62.77  ? 48  LYS B CG  1 
ATOM   2546 C CD  . LYS B 2 48  ? -71.640 12.340  -5.105 1.00 63.96  ? 48  LYS B CD  1 
ATOM   2547 C CE  . LYS B 2 48  ? -71.529 13.079  -6.428 1.00 63.89  ? 48  LYS B CE  1 
ATOM   2548 N NZ  . LYS B 2 48  ? -72.456 12.571  -7.473 1.00 82.25  ? 48  LYS B NZ  1 
ATOM   2549 N N   . TYR B 2 49  ? -74.375 9.491   -2.508 1.00 66.28  ? 49  TYR B N   1 
ATOM   2550 C CA  . TYR B 2 49  ? -74.646 8.168   -3.058 1.00 71.52  ? 49  TYR B CA  1 
ATOM   2551 C C   . TYR B 2 49  ? -75.793 7.492   -2.293 1.00 72.81  ? 49  TYR B C   1 
ATOM   2552 O O   . TYR B 2 49  ? -75.589 6.517   -1.579 1.00 70.25  ? 49  TYR B O   1 
ATOM   2553 C CB  . TYR B 2 49  ? -73.348 7.318   -3.081 1.00 68.97  ? 49  TYR B CB  1 
ATOM   2554 C CG  . TYR B 2 49  ? -72.263 7.851   -4.026 1.00 71.84  ? 49  TYR B CG  1 
ATOM   2555 C CD1 . TYR B 2 49  ? -72.265 7.511   -5.379 1.00 75.03  ? 49  TYR B CD1 1 
ATOM   2556 C CD2 . TYR B 2 49  ? -71.246 8.701   -3.566 1.00 67.07  ? 49  TYR B CD2 1 
ATOM   2557 C CE1 . TYR B 2 49  ? -71.287 8.001   -6.256 1.00 81.57  ? 49  TYR B CE1 1 
ATOM   2558 C CE2 . TYR B 2 49  ? -70.253 9.199   -4.442 1.00 66.41  ? 49  TYR B CE2 1 
ATOM   2559 C CZ  . TYR B 2 49  ? -70.278 8.839   -5.788 1.00 78.01  ? 49  TYR B CZ  1 
ATOM   2560 O OH  . TYR B 2 49  ? -69.310 9.303   -6.675 1.00 70.08  ? 49  TYR B OH  1 
ATOM   2561 N N   . SER B 2 50  ? -77.011 8.021   -2.467 1.00 78.81  ? 50  SER B N   1 
ATOM   2562 C CA  . SER B 2 50  ? -78.208 7.515   -1.760 1.00 82.78  ? 50  SER B CA  1 
ATOM   2563 C C   . SER B 2 50  ? -78.626 6.082   -2.160 1.00 89.26  ? 50  SER B C   1 
ATOM   2564 O O   . SER B 2 50  ? -79.366 5.404   -1.433 1.00 92.84  ? 50  SER B O   1 
ATOM   2565 C CB  . SER B 2 50  ? -79.378 8.485   -1.936 1.00 87.29  ? 50  SER B CB  1 
ATOM   2566 O OG  . SER B 2 50  ? -79.769 8.544   -3.299 1.00 91.94  ? 50  SER B OG  1 
ATOM   2567 N N   . ASN B 2 51  ? -78.143 5.635   -3.317 1.00 93.23  ? 51  ASN B N   1 
ATOM   2568 C CA  . ASN B 2 51  ? -78.294 4.252   -3.784 1.00 100.12 ? 51  ASN B CA  1 
ATOM   2569 C C   . ASN B 2 51  ? -77.435 3.240   -3.001 1.00 96.77  ? 51  ASN B C   1 
ATOM   2570 O O   . ASN B 2 51  ? -77.637 2.024   -3.105 1.00 102.13 ? 51  ASN B O   1 
ATOM   2571 C CB  . ASN B 2 51  ? -77.968 4.174   -5.288 1.00 106.74 ? 51  ASN B CB  1 
ATOM   2572 C CG  . ASN B 2 51  ? -76.599 4.812   -5.648 1.00 106.16 ? 51  ASN B CG  1 
ATOM   2573 O OD1 . ASN B 2 51  ? -76.233 5.888   -5.148 1.00 91.13  ? 51  ASN B OD1 1 
ATOM   2574 N ND2 . ASN B 2 51  ? -75.856 4.147   -6.543 1.00 108.60 ? 51  ASN B ND2 1 
ATOM   2575 N N   . VAL B 2 52  ? -76.476 3.752   -2.227 1.00 88.16  ? 52  VAL B N   1 
ATOM   2576 C CA  . VAL B 2 52  ? -75.559 2.918   -1.427 1.00 83.82  ? 52  VAL B CA  1 
ATOM   2577 C C   . VAL B 2 52  ? -75.824 3.109   0.067  1.00 79.48  ? 52  VAL B C   1 
ATOM   2578 O O   . VAL B 2 52  ? -76.135 4.222   0.512  1.00 74.19  ? 52  VAL B O   1 
ATOM   2579 C CB  . VAL B 2 52  ? -74.075 3.216   -1.773 1.00 78.81  ? 52  VAL B CB  1 
ATOM   2580 C CG1 . VAL B 2 52  ? -73.095 2.500   -0.801 1.00 76.16  ? 52  VAL B CG1 1 
ATOM   2581 C CG2 . VAL B 2 52  ? -73.781 2.830   -3.209 1.00 81.61  ? 52  VAL B CG2 1 
ATOM   2582 N N   . ILE B 2 53  ? -75.712 2.023   0.834  1.00 82.28  ? 53  ILE B N   1 
ATOM   2583 C CA  . ILE B 2 53  ? -75.948 2.088   2.279  1.00 81.95  ? 53  ILE B CA  1 
ATOM   2584 C C   . ILE B 2 53  ? -74.622 2.211   3.069  1.00 77.54  ? 53  ILE B C   1 
ATOM   2585 O O   . ILE B 2 53  ? -73.711 1.377   2.943  1.00 75.75  ? 53  ILE B O   1 
ATOM   2586 C CB  . ILE B 2 53  ? -76.903 0.941   2.763  1.00 91.63  ? 53  ILE B CB  1 
ATOM   2587 C CG1 . ILE B 2 53  ? -77.998 1.473   3.709  1.00 100.75 ? 53  ILE B CG1 1 
ATOM   2588 C CG2 . ILE B 2 53  ? -76.173 -0.240  3.352  1.00 87.64  ? 53  ILE B CG2 1 
ATOM   2589 C CD1 . ILE B 2 53  ? -79.341 0.706   3.599  1.00 103.45 ? 53  ILE B CD1 1 
ATOM   2590 N N   . PHE B 2 54  ? -74.525 3.290   3.843  1.00 73.01  ? 54  PHE B N   1 
ATOM   2591 C CA  . PHE B 2 54  ? -73.340 3.586   4.638  1.00 69.40  ? 54  PHE B CA  1 
ATOM   2592 C C   . PHE B 2 54  ? -73.543 3.179   6.078  1.00 69.36  ? 54  PHE B C   1 
ATOM   2593 O O   . PHE B 2 54  ? -74.607 3.417   6.640  1.00 74.17  ? 54  PHE B O   1 
ATOM   2594 C CB  . PHE B 2 54  ? -73.017 5.075   4.557  1.00 63.73  ? 54  PHE B CB  1 
ATOM   2595 C CG  . PHE B 2 54  ? -72.518 5.498   3.227  1.00 67.89  ? 54  PHE B CG  1 
ATOM   2596 C CD1 . PHE B 2 54  ? -73.357 5.440   2.098  1.00 70.43  ? 54  PHE B CD1 1 
ATOM   2597 C CD2 . PHE B 2 54  ? -71.212 5.959   3.084  1.00 51.73  ? 54  PHE B CD2 1 
ATOM   2598 C CE1 . PHE B 2 54  ? -72.892 5.831   0.850  1.00 71.20  ? 54  PHE B CE1 1 
ATOM   2599 C CE2 . PHE B 2 54  ? -70.737 6.361   1.842  1.00 58.74  ? 54  PHE B CE2 1 
ATOM   2600 C CZ  . PHE B 2 54  ? -71.578 6.300   0.718  1.00 65.93  ? 54  PHE B CZ  1 
ATOM   2601 N N   . LEU B 2 55  ? -72.515 2.564   6.659  1.00 67.42  ? 55  LEU B N   1 
ATOM   2602 C CA  . LEU B 2 55  ? -72.515 2.108   8.061  1.00 68.90  ? 55  LEU B CA  1 
ATOM   2603 C C   . LEU B 2 55  ? -71.198 2.487   8.747  1.00 64.01  ? 55  LEU B C   1 
ATOM   2604 O O   . LEU B 2 55  ? -70.142 2.505   8.101  1.00 58.62  ? 55  LEU B O   1 
ATOM   2605 C CB  . LEU B 2 55  ? -72.686 0.582   8.142  1.00 74.52  ? 55  LEU B CB  1 
ATOM   2606 C CG  . LEU B 2 55  ? -73.862 -0.124  7.454  1.00 81.70  ? 55  LEU B CG  1 
ATOM   2607 C CD1 . LEU B 2 55  ? -73.820 -1.645  7.694  1.00 86.23  ? 55  LEU B CD1 1 
ATOM   2608 C CD2 . LEU B 2 55  ? -75.196 0.462   7.891  1.00 80.39  ? 55  LEU B CD2 1 
ATOM   2609 N N   . GLU B 2 56  ? -71.273 2.779   10.048 1.00 64.93  ? 56  GLU B N   1 
ATOM   2610 C CA  . GLU B 2 56  ? -70.101 3.053   10.872 1.00 61.46  ? 56  GLU B CA  1 
ATOM   2611 C C   . GLU B 2 56  ? -70.033 2.100   12.073 1.00 66.06  ? 56  GLU B C   1 
ATOM   2612 O O   . GLU B 2 56  ? -71.000 1.948   12.814 1.00 70.81  ? 56  GLU B O   1 
ATOM   2613 C CB  . GLU B 2 56  ? -70.076 4.518   11.350 1.00 59.57  ? 56  GLU B CB  1 
ATOM   2614 C CG  . GLU B 2 56  ? -68.906 4.831   12.305 1.00 61.15  ? 56  GLU B CG  1 
ATOM   2615 C CD  . GLU B 2 56  ? -68.420 6.278   12.250 1.00 60.32  ? 56  GLU B CD  1 
ATOM   2616 O OE1 . GLU B 2 56  ? -69.003 7.097   11.512 1.00 66.40  ? 56  GLU B OE1 1 
ATOM   2617 O OE2 . GLU B 2 56  ? -67.440 6.598   12.952 1.00 59.59  ? 56  GLU B OE2 1 
ATOM   2618 N N   . VAL B 2 57  ? -68.879 1.462   12.247 1.00 64.45  ? 57  VAL B N   1 
ATOM   2619 C CA  . VAL B 2 57  ? -68.591 0.619   13.413 1.00 66.92  ? 57  VAL B CA  1 
ATOM   2620 C C   . VAL B 2 57  ? -67.356 1.147   14.162 1.00 64.24  ? 57  VAL B C   1 
ATOM   2621 O O   . VAL B 2 57  ? -66.249 1.228   13.606 1.00 57.43  ? 57  VAL B O   1 
ATOM   2622 C CB  . VAL B 2 57  ? -68.364 -0.849  12.995 1.00 70.83  ? 57  VAL B CB  1 
ATOM   2623 C CG1 . VAL B 2 57  ? -67.864 -1.694  14.191 1.00 74.06  ? 57  VAL B CG1 1 
ATOM   2624 C CG2 . VAL B 2 57  ? -69.647 -1.439  12.382 1.00 77.84  ? 57  VAL B CG2 1 
ATOM   2625 N N   . ASP B 2 58  ? -67.548 1.512   15.424 1.00 67.74  ? 58  ASP B N   1 
ATOM   2626 C CA  . ASP B 2 58  ? -66.442 1.932   16.262 1.00 63.88  ? 58  ASP B CA  1 
ATOM   2627 C C   . ASP B 2 58  ? -65.748 0.697   16.818 1.00 66.75  ? 58  ASP B C   1 
ATOM   2628 O O   . ASP B 2 58  ? -66.299 -0.025  17.661 1.00 71.85  ? 58  ASP B O   1 
ATOM   2629 C CB  . ASP B 2 58  ? -66.914 2.861   17.380 1.00 66.27  ? 58  ASP B CB  1 
ATOM   2630 C CG  . ASP B 2 58  ? -65.777 3.332   18.268 1.00 67.02  ? 58  ASP B CG  1 
ATOM   2631 O OD1 . ASP B 2 58  ? -65.028 2.486   18.792 1.00 74.92  ? 58  ASP B OD1 1 
ATOM   2632 O OD2 . ASP B 2 58  ? -65.633 4.557   18.460 1.00 69.92  ? 58  ASP B OD2 1 
ATOM   2633 N N   . VAL B 2 59  ? -64.522 0.476   16.352 1.00 58.77  ? 59  VAL B N   1 
ATOM   2634 C CA  . VAL B 2 59  ? -63.778 -0.737  16.677 1.00 59.70  ? 59  VAL B CA  1 
ATOM   2635 C C   . VAL B 2 59  ? -63.629 -0.997  18.179 1.00 62.67  ? 59  VAL B C   1 
ATOM   2636 O O   . VAL B 2 59  ? -63.484 -2.148  18.585 1.00 67.12  ? 59  VAL B O   1 
ATOM   2637 C CB  . VAL B 2 59  ? -62.377 -0.763  15.994 1.00 55.13  ? 59  VAL B CB  1 
ATOM   2638 C CG1 . VAL B 2 59  ? -62.510 -0.641  14.476 1.00 48.33  ? 59  VAL B CG1 1 
ATOM   2639 C CG2 . VAL B 2 59  ? -61.472 0.316   16.547 1.00 46.79  ? 59  VAL B CG2 1 
ATOM   2640 N N   . ASP B 2 60  ? -63.650 0.066   18.988 1.00 61.57  ? 60  ASP B N   1 
ATOM   2641 C CA  . ASP B 2 60  ? -63.419 -0.054  20.443 1.00 70.54  ? 60  ASP B CA  1 
ATOM   2642 C C   . ASP B 2 60  ? -64.702 -0.291  21.246 1.00 81.23  ? 60  ASP B C   1 
ATOM   2643 O O   . ASP B 2 60  ? -64.674 -0.398  22.464 1.00 87.00  ? 60  ASP B O   1 
ATOM   2644 C CB  . ASP B 2 60  ? -62.726 1.191   20.987 1.00 65.85  ? 60  ASP B CB  1 
ATOM   2645 C CG  . ASP B 2 60  ? -61.319 1.345   20.467 1.00 66.74  ? 60  ASP B CG  1 
ATOM   2646 O OD1 . ASP B 2 60  ? -60.950 2.481   20.080 1.00 67.85  ? 60  ASP B OD1 1 
ATOM   2647 O OD2 . ASP B 2 60  ? -60.594 0.326   20.431 1.00 54.63  ? 60  ASP B OD2 1 
ATOM   2648 N N   . ASP B 2 61  ? -65.830 -0.342  20.562 1.00 84.85  ? 61  ASP B N   1 
ATOM   2649 C CA  . ASP B 2 61  ? -67.092 -0.516  21.246 1.00 97.57  ? 61  ASP B CA  1 
ATOM   2650 C C   . ASP B 2 61  ? -67.669 -1.828  20.783 1.00 104.16 ? 61  ASP B C   1 
ATOM   2651 O O   . ASP B 2 61  ? -68.110 -2.643  21.598 1.00 115.26 ? 61  ASP B O   1 
ATOM   2652 C CB  . ASP B 2 61  ? -68.032 0.654   20.958 1.00 97.15  ? 61  ASP B CB  1 
ATOM   2653 C CG  . ASP B 2 61  ? -67.621 1.924   21.692 1.00 99.61  ? 61  ASP B CG  1 
ATOM   2654 O OD1 . ASP B 2 61  ? -66.694 1.858   22.544 1.00 106.34 ? 61  ASP B OD1 1 
ATOM   2655 O OD2 . ASP B 2 61  ? -68.223 2.988   21.411 1.00 100.72 ? 61  ASP B OD2 1 
ATOM   2656 N N   . CYS B 2 62  ? -67.623 -2.031  19.471 1.00 97.87  ? 62  CYS B N   1 
ATOM   2657 C CA  . CYS B 2 62  ? -68.007 -3.283  18.875 1.00 103.93 ? 62  CYS B CA  1 
ATOM   2658 C C   . CYS B 2 62  ? -66.781 -4.133  18.570 1.00 102.33 ? 62  CYS B C   1 
ATOM   2659 O O   . CYS B 2 62  ? -66.658 -4.653  17.465 1.00 100.42 ? 62  CYS B O   1 
ATOM   2660 C CB  . CYS B 2 62  ? -68.784 -3.024  17.589 1.00 103.06 ? 62  CYS B CB  1 
ATOM   2661 S SG  . CYS B 2 62  ? -70.146 -1.877  17.748 1.00 108.14 ? 62  CYS B SG  1 
ATOM   2662 N N   . GLN B 2 63  ? -65.885 -4.280  19.551 1.00 105.24 ? 63  GLN B N   1 
ATOM   2663 C CA  . GLN B 2 63  ? -64.721 -5.173  19.428 1.00 107.05 ? 63  GLN B CA  1 
ATOM   2664 C C   . GLN B 2 63  ? -65.108 -6.540  18.848 1.00 114.48 ? 63  GLN B C   1 
ATOM   2665 O O   . GLN B 2 63  ? -64.278 -7.221  18.232 1.00 114.84 ? 63  GLN B O   1 
ATOM   2666 C CB  . GLN B 2 63  ? -63.991 -5.350  20.774 1.00 111.05 ? 63  GLN B CB  1 
ATOM   2667 C CG  . GLN B 2 63  ? -63.381 -4.065  21.351 1.00 108.84 ? 63  GLN B CG  1 
ATOM   2668 C CD  . GLN B 2 63  ? -61.897 -4.198  21.727 1.00 111.39 ? 63  GLN B CD  1 
ATOM   2669 O OE1 . GLN B 2 63  ? -61.490 -5.158  22.387 1.00 115.60 ? 63  GLN B OE1 1 
ATOM   2670 N NE2 . GLN B 2 63  ? -61.086 -3.218  21.304 1.00 97.81  ? 63  GLN B NE2 1 
ATOM   2671 N N   . ASP B 2 64  ? -66.375 -6.913  19.041 1.00 121.17 ? 64  ASP B N   1 
ATOM   2672 C CA  . ASP B 2 64  ? -66.942 -8.168  18.554 1.00 129.69 ? 64  ASP B CA  1 
ATOM   2673 C C   . ASP B 2 64  ? -66.963 -8.232  17.022 1.00 123.10 ? 64  ASP B C   1 
ATOM   2674 O O   . ASP B 2 64  ? -66.361 -9.129  16.427 1.00 125.86 ? 64  ASP B O   1 
ATOM   2675 C CB  . ASP B 2 64  ? -68.373 -8.376  19.098 1.00 140.62 ? 64  ASP B CB  1 
ATOM   2676 C CG  . ASP B 2 64  ? -68.734 -7.414  20.231 1.00 142.41 ? 64  ASP B CG  1 
ATOM   2677 O OD1 . ASP B 2 64  ? -67.956 -7.311  21.205 1.00 146.24 ? 64  ASP B OD1 1 
ATOM   2678 O OD2 . ASP B 2 64  ? -69.804 -6.766  20.147 1.00 141.28 ? 64  ASP B OD2 1 
ATOM   2679 N N   . VAL B 2 65  ? -67.669 -7.292  16.395 1.00 114.82 ? 65  VAL B N   1 
ATOM   2680 C CA  . VAL B 2 65  ? -67.791 -7.278  14.930 1.00 111.54 ? 65  VAL B CA  1 
ATOM   2681 C C   . VAL B 2 65  ? -66.438 -6.991  14.245 1.00 103.20 ? 65  VAL B C   1 
ATOM   2682 O O   . VAL B 2 65  ? -66.099 -7.618  13.231 1.00 104.13 ? 65  VAL B O   1 
ATOM   2683 C CB  . VAL B 2 65  ? -68.989 -6.391  14.409 1.00 107.88 ? 65  VAL B CB  1 
ATOM   2684 C CG1 . VAL B 2 65  ? -68.962 -5.002  14.990 1.00 97.36  ? 65  VAL B CG1 1 
ATOM   2685 C CG2 . VAL B 2 65  ? -69.017 -6.338  12.889 1.00 103.16 ? 65  VAL B CG2 1 
ATOM   2686 N N   . ALA B 2 66  ? -65.671 -6.070  14.835 1.00 96.29  ? 66  ALA B N   1 
ATOM   2687 C CA  . ALA B 2 66  ? -64.274 -5.823  14.474 1.00 88.06  ? 66  ALA B CA  1 
ATOM   2688 C C   . ALA B 2 66  ? -63.502 -7.128  14.307 1.00 94.00  ? 66  ALA B C   1 
ATOM   2689 O O   . ALA B 2 66  ? -62.990 -7.419  13.227 1.00 93.08  ? 66  ALA B O   1 
ATOM   2690 C CB  . ALA B 2 66  ? -63.613 -4.948  15.529 1.00 82.94  ? 66  ALA B CB  1 
ATOM   2691 N N   . SER B 2 67  ? -63.445 -7.918  15.375 1.00 101.54 ? 67  SER B N   1 
ATOM   2692 C CA  . SER B 2 67  ? -62.736 -9.199  15.378 1.00 110.87 ? 67  SER B CA  1 
ATOM   2693 C C   . SER B 2 67  ? -63.164 -10.147 14.248 1.00 118.55 ? 67  SER B C   1 
ATOM   2694 O O   . SER B 2 67  ? -62.316 -10.784 13.606 1.00 121.68 ? 67  SER B O   1 
ATOM   2695 C CB  . SER B 2 67  ? -62.908 -9.875  16.738 1.00 119.51 ? 67  SER B CB  1 
ATOM   2696 O OG  . SER B 2 67  ? -62.982 -11.291 16.634 1.00 138.56 ? 67  SER B OG  1 
ATOM   2697 N N   . GLU B 2 68  ? -64.477 -10.221 14.020 1.00 121.48 ? 68  GLU B N   1 
ATOM   2698 C CA  . GLU B 2 68  ? -65.090 -11.151 13.070 1.00 129.43 ? 68  GLU B CA  1 
ATOM   2699 C C   . GLU B 2 68  ? -64.888 -10.728 11.616 1.00 123.85 ? 68  GLU B C   1 
ATOM   2700 O O   . GLU B 2 68  ? -64.887 -11.573 10.713 1.00 131.45 ? 68  GLU B O   1 
ATOM   2701 C CB  . GLU B 2 68  ? -66.584 -11.276 13.364 1.00 135.29 ? 68  GLU B CB  1 
ATOM   2702 C CG  . GLU B 2 68  ? -67.196 -12.612 12.955 1.00 151.14 ? 68  GLU B CG  1 
ATOM   2703 C CD  . GLU B 2 68  ? -68.708 -12.552 12.853 1.00 155.66 ? 68  GLU B CD  1 
ATOM   2704 O OE1 . GLU B 2 68  ? -69.237 -11.525 12.360 1.00 148.46 ? 68  GLU B OE1 1 
ATOM   2705 O OE2 . GLU B 2 68  ? -69.363 -13.533 13.261 1.00 161.95 ? 68  GLU B OE2 1 
ATOM   2706 N N   . CYS B 2 69  ? -64.756 -9.416  11.400 1.00 110.35 ? 69  CYS B N   1 
ATOM   2707 C CA  . CYS B 2 69  ? -64.431 -8.843  10.090 1.00 103.24 ? 69  CYS B CA  1 
ATOM   2708 C C   . CYS B 2 69  ? -62.916 -8.784  9.876  1.00 97.22  ? 69  CYS B C   1 
ATOM   2709 O O   . CYS B 2 69  ? -62.437 -8.446  8.785  1.00 91.96  ? 69  CYS B O   1 
ATOM   2710 C CB  . CYS B 2 69  ? -65.032 -7.441  9.958  1.00 94.11  ? 69  CYS B CB  1 
ATOM   2711 S SG  . CYS B 2 69  ? -66.844 -7.400  10.076 1.00 103.25 ? 69  CYS B SG  1 
ATOM   2712 N N   . GLU B 2 70  ? -62.180 -9.135  10.933 1.00 96.68  ? 70  GLU B N   1 
ATOM   2713 C CA  . GLU B 2 70  ? -60.714 -9.117  10.947 1.00 93.55  ? 70  GLU B CA  1 
ATOM   2714 C C   . GLU B 2 70  ? -60.160 -7.763  10.504 1.00 80.98  ? 70  GLU B C   1 
ATOM   2715 O O   . GLU B 2 70  ? -59.322 -7.683  9.601  1.00 80.09  ? 70  GLU B O   1 
ATOM   2716 C CB  . GLU B 2 70  ? -60.136 -10.265 10.114 1.00 103.42 ? 70  GLU B CB  1 
ATOM   2717 C CG  . GLU B 2 70  ? -60.513 -11.645 10.628 1.00 118.05 ? 70  GLU B CG  1 
ATOM   2718 C CD  . GLU B 2 70  ? -60.289 -12.718 9.596  1.00 132.37 ? 70  GLU B CD  1 
ATOM   2719 O OE1 . GLU B 2 70  ? -59.548 -12.452 8.625  1.00 129.08 ? 70  GLU B OE1 1 
ATOM   2720 O OE2 . GLU B 2 70  ? -60.851 -13.823 9.754  1.00 148.55 ? 70  GLU B OE2 1 
ATOM   2721 N N   . VAL B 2 71  ? -60.684 -6.716  11.138 1.00 72.04  ? 71  VAL B N   1 
ATOM   2722 C CA  . VAL B 2 71  ? -60.175 -5.358  11.043 1.00 63.38  ? 71  VAL B CA  1 
ATOM   2723 C C   . VAL B 2 71  ? -58.920 -5.248  11.937 1.00 63.93  ? 71  VAL B C   1 
ATOM   2724 O O   . VAL B 2 71  ? -58.908 -5.714  13.076 1.00 68.92  ? 71  VAL B O   1 
ATOM   2725 C CB  . VAL B 2 71  ? -61.260 -4.348  11.459 1.00 56.27  ? 71  VAL B CB  1 
ATOM   2726 C CG1 . VAL B 2 71  ? -60.695 -2.958  11.573 1.00 47.43  ? 71  VAL B CG1 1 
ATOM   2727 C CG2 . VAL B 2 71  ? -62.349 -4.325  10.426 1.00 62.13  ? 71  VAL B CG2 1 
ATOM   2728 N N   . LYS B 2 72  ? -57.859 -4.660  11.399 1.00 59.34  ? 72  LYS B N   1 
ATOM   2729 C CA  . LYS B 2 72  ? -56.574 -4.659  12.070 1.00 58.18  ? 72  LYS B CA  1 
ATOM   2730 C C   . LYS B 2 72  ? -56.053 -3.238  12.162 1.00 50.07  ? 72  LYS B C   1 
ATOM   2731 O O   . LYS B 2 72  ? -55.067 -2.985  12.847 1.00 50.86  ? 72  LYS B O   1 
ATOM   2732 C CB  . LYS B 2 72  ? -55.596 -5.577  11.335 1.00 60.97  ? 72  LYS B CB  1 
ATOM   2733 C CG  . LYS B 2 72  ? -55.901 -7.061  11.553 1.00 78.75  ? 72  LYS B CG  1 
ATOM   2734 C CD  . LYS B 2 72  ? -55.155 -7.982  10.581 1.00 92.50  ? 72  LYS B CD  1 
ATOM   2735 C CE  . LYS B 2 72  ? -56.028 -8.435  9.394  1.00 97.89  ? 72  LYS B CE  1 
ATOM   2736 N NZ  . LYS B 2 72  ? -55.497 -9.710  8.820  1.00 104.87 ? 72  LYS B NZ  1 
ATOM   2737 N N   . CYS B 2 73  ? -56.737 -2.319  11.478 1.00 42.66  ? 73  CYS B N   1 
ATOM   2738 C CA  . CYS B 2 73  ? -56.362 -0.921  11.480 1.00 35.60  ? 73  CYS B CA  1 
ATOM   2739 C C   . CYS B 2 73  ? -57.554 -0.041  11.151 1.00 34.11  ? 73  CYS B C   1 
ATOM   2740 O O   . CYS B 2 73  ? -58.610 -0.523  10.750 1.00 40.25  ? 73  CYS B O   1 
ATOM   2741 C CB  . CYS B 2 73  ? -55.188 -0.675  10.517 1.00 30.02  ? 73  CYS B CB  1 
ATOM   2742 S SG  . CYS B 2 73  ? -55.545 -0.945  8.776  1.00 37.95  ? 73  CYS B SG  1 
ATOM   2743 N N   . MET B 2 74  ? -57.378 1.257   11.304 1.00 27.78  ? 74  MET B N   1 
ATOM   2744 C CA  . MET B 2 74  ? -58.480 2.207   11.194 1.00 30.15  ? 74  MET B CA  1 
ATOM   2745 C C   . MET B 2 74  ? -57.949 3.438   10.488 1.00 27.05  ? 74  MET B C   1 
ATOM   2746 O O   . MET B 2 74  ? -56.783 3.807   10.722 1.00 24.95  ? 74  MET B O   1 
ATOM   2747 C CB  . MET B 2 74  ? -58.968 2.645   12.583 1.00 32.51  ? 74  MET B CB  1 
ATOM   2748 C CG  . MET B 2 74  ? -59.615 1.567   13.449 1.00 38.24  ? 74  MET B CG  1 
ATOM   2749 S SD  . MET B 2 74  ? -58.525 0.294   14.119 1.00 42.24  ? 74  MET B SD  1 
ATOM   2750 C CE  . MET B 2 74  ? -57.632 1.204   15.395 1.00 41.61  ? 74  MET B CE  1 
ATOM   2751 N N   . PRO B 2 75  ? -58.772 4.087   9.635  1.00 25.19  ? 75  PRO B N   1 
ATOM   2752 C CA  . PRO B 2 75  ? -60.087 3.601   9.168  1.00 28.85  ? 75  PRO B CA  1 
ATOM   2753 C C   . PRO B 2 75  ? -59.873 2.428   8.254  1.00 31.31  ? 75  PRO B C   1 
ATOM   2754 O O   . PRO B 2 75  ? -58.973 2.482   7.411  1.00 31.64  ? 75  PRO B O   1 
ATOM   2755 C CB  . PRO B 2 75  ? -60.687 4.794   8.368  1.00 27.32  ? 75  PRO B CB  1 
ATOM   2756 C CG  . PRO B 2 75  ? -59.576 5.727   8.101  1.00 27.73  ? 75  PRO B CG  1 
ATOM   2757 C CD  . PRO B 2 75  ? -58.391 5.377   9.031  1.00 20.57  ? 75  PRO B CD  1 
ATOM   2758 N N   . THR B 2 76  ? -60.646 1.358   8.448  1.00 32.59  ? 76  THR B N   1 
ATOM   2759 C CA  . THR B 2 76  ? -60.785 0.339   7.422  1.00 37.65  ? 76  THR B CA  1 
ATOM   2760 C C   . THR B 2 76  ? -62.210 0.387   6.848  1.00 39.57  ? 76  THR B C   1 
ATOM   2761 O O   . THR B 2 76  ? -63.177 0.537   7.591  1.00 40.59  ? 76  THR B O   1 
ATOM   2762 C CB  . THR B 2 76  ? -60.494 -1.073  7.956  1.00 43.58  ? 76  THR B CB  1 
ATOM   2763 O OG1 . THR B 2 76  ? -59.092 -1.237  8.190  1.00 44.53  ? 76  THR B OG1 1 
ATOM   2764 C CG2 . THR B 2 76  ? -60.960 -2.133  6.977  1.00 53.21  ? 76  THR B CG2 1 
ATOM   2765 N N   . PHE B 2 77  ? -62.314 0.265   5.527  1.00 42.43  ? 77  PHE B N   1 
ATOM   2766 C CA  . PHE B 2 77  ? -63.600 0.234   4.818  1.00 44.34  ? 77  PHE B CA  1 
ATOM   2767 C C   . PHE B 2 77  ? -63.841 -1.123  4.151  1.00 51.66  ? 77  PHE B C   1 
ATOM   2768 O O   . PHE B 2 77  ? -63.022 -1.607  3.372  1.00 54.75  ? 77  PHE B O   1 
ATOM   2769 C CB  . PHE B 2 77  ? -63.643 1.332   3.777  1.00 42.89  ? 77  PHE B CB  1 
ATOM   2770 C CG  . PHE B 2 77  ? -63.479 2.699   4.338  1.00 34.08  ? 77  PHE B CG  1 
ATOM   2771 C CD1 . PHE B 2 77  ? -64.569 3.375   4.854  1.00 37.44  ? 77  PHE B CD1 1 
ATOM   2772 C CD2 . PHE B 2 77  ? -62.231 3.322   4.337  1.00 27.14  ? 77  PHE B CD2 1 
ATOM   2773 C CE1 . PHE B 2 77  ? -64.422 4.663   5.385  1.00 34.89  ? 77  PHE B CE1 1 
ATOM   2774 C CE2 . PHE B 2 77  ? -62.075 4.612   4.864  1.00 23.23  ? 77  PHE B CE2 1 
ATOM   2775 C CZ  . PHE B 2 77  ? -63.166 5.277   5.384  1.00 36.15  ? 77  PHE B CZ  1 
ATOM   2776 N N   . GLN B 2 78  ? -64.963 -1.749  4.481  1.00 58.04  ? 78  GLN B N   1 
ATOM   2777 C CA  . GLN B 2 78  ? -65.333 -3.041  3.887  1.00 65.02  ? 78  GLN B CA  1 
ATOM   2778 C C   . GLN B 2 78  ? -66.582 -2.912  3.012  1.00 66.51  ? 78  GLN B C   1 
ATOM   2779 O O   . GLN B 2 78  ? -67.548 -2.275  3.407  1.00 62.61  ? 78  GLN B O   1 
ATOM   2780 C CB  . GLN B 2 78  ? -65.583 -4.070  4.982  1.00 69.75  ? 78  GLN B CB  1 
ATOM   2781 C CG  . GLN B 2 78  ? -64.484 -4.191  6.008  1.00 68.83  ? 78  GLN B CG  1 
ATOM   2782 C CD  . GLN B 2 78  ? -64.381 -5.600  6.554  1.00 86.43  ? 78  GLN B CD  1 
ATOM   2783 O OE1 . GLN B 2 78  ? -65.382 -6.320  6.631  1.00 100.35 ? 78  GLN B OE1 1 
ATOM   2784 N NE2 . GLN B 2 78  ? -63.168 -6.012  6.927  1.00 86.72  ? 78  GLN B NE2 1 
ATOM   2785 N N   . PHE B 2 79  ? -66.560 -3.519  1.831  1.00 73.72  ? 79  PHE B N   1 
ATOM   2786 C CA  . PHE B 2 79  ? -67.668 -3.352  0.887  1.00 79.65  ? 79  PHE B CA  1 
ATOM   2787 C C   . PHE B 2 79  ? -68.346 -4.685  0.609  1.00 92.34  ? 79  PHE B C   1 
ATOM   2788 O O   . PHE B 2 79  ? -67.671 -5.680  0.300  1.00 97.55  ? 79  PHE B O   1 
ATOM   2789 C CB  . PHE B 2 79  ? -67.165 -2.751  -0.424 1.00 80.31  ? 79  PHE B CB  1 
ATOM   2790 C CG  . PHE B 2 79  ? -66.570 -1.369  -0.288 1.00 70.95  ? 79  PHE B CG  1 
ATOM   2791 C CD1 . PHE B 2 79  ? -65.337 -1.172  0.351  1.00 69.67  ? 79  PHE B CD1 1 
ATOM   2792 C CD2 . PHE B 2 79  ? -67.215 -0.270  -0.839 1.00 63.90  ? 79  PHE B CD2 1 
ATOM   2793 C CE1 . PHE B 2 79  ? -64.776 0.105   0.465  1.00 62.77  ? 79  PHE B CE1 1 
ATOM   2794 C CE2 . PHE B 2 79  ? -66.673 1.012   -0.723 1.00 63.05  ? 79  PHE B CE2 1 
ATOM   2795 C CZ  . PHE B 2 79  ? -65.445 1.205   -0.074 1.00 54.99  ? 79  PHE B CZ  1 
ATOM   2796 N N   . PHE B 2 80  ? -69.678 -4.697  0.712  1.00 97.56  ? 80  PHE B N   1 
ATOM   2797 C CA  . PHE B 2 80  ? -70.487 -5.904  0.491  1.00 109.76 ? 80  PHE B CA  1 
ATOM   2798 C C   . PHE B 2 80  ? -71.598 -5.671  -0.552 1.00 116.63 ? 80  PHE B C   1 
ATOM   2799 O O   . PHE B 2 80  ? -72.253 -4.614  -0.565 1.00 110.17 ? 80  PHE B O   1 
ATOM   2800 C CB  . PHE B 2 80  ? -71.151 -6.385  1.790  1.00 110.54 ? 80  PHE B CB  1 
ATOM   2801 C CG  . PHE B 2 80  ? -70.237 -6.420  2.985  1.00 108.49 ? 80  PHE B CG  1 
ATOM   2802 C CD1 . PHE B 2 80  ? -69.933 -5.249  3.690  1.00 94.94  ? 80  PHE B CD1 1 
ATOM   2803 C CD2 . PHE B 2 80  ? -69.712 -7.628  3.433  1.00 113.68 ? 80  PHE B CD2 1 
ATOM   2804 C CE1 . PHE B 2 80  ? -69.106 -5.279  4.810  1.00 94.32  ? 80  PHE B CE1 1 
ATOM   2805 C CE2 . PHE B 2 80  ? -68.871 -7.671  4.552  1.00 115.68 ? 80  PHE B CE2 1 
ATOM   2806 C CZ  . PHE B 2 80  ? -68.567 -6.496  5.241  1.00 99.25  ? 80  PHE B CZ  1 
ATOM   2807 N N   . LYS B 2 81  ? -71.883 -6.636  -1.417 1.00 128.71 ? 81  LYS B N   1 
ATOM   2808 C CA  . LYS B 2 81  ? -73.058 -6.468  -2.294 1.00 136.05 ? 81  LYS B CA  1 
ATOM   2809 C C   . LYS B 2 81  ? -74.389 -7.055  -1.764 1.00 144.59 ? 81  LYS B C   1 
ATOM   2810 O O   . LYS B 2 81  ? -75.308 -6.311  -1.427 1.00 139.58 ? 81  LYS B O   1 
ATOM   2811 C CB  . LYS B 2 81  ? -72.770 -6.859  -3.746 1.00 143.58 ? 81  LYS B CB  1 
ATOM   2812 C CG  . LYS B 2 81  ? -73.294 -5.840  -4.731 1.00 141.95 ? 81  LYS B CG  1 
ATOM   2813 C CD  . LYS B 2 81  ? -72.215 -5.219  -5.571 1.00 139.26 ? 81  LYS B CD  1 
ATOM   2814 C CE  . LYS B 2 81  ? -71.584 -6.231  -6.482 1.00 153.47 ? 81  LYS B CE  1 
ATOM   2815 N NZ  . LYS B 2 81  ? -70.524 -5.662  -7.353 1.00 151.45 ? 81  LYS B NZ  1 
ATOM   2816 N N   . LYS B 2 82  ? -74.516 -8.367  -1.684 1.00 158.35 ? 82  LYS B N   1 
ATOM   2817 C CA  . LYS B 2 82  ? -75.776 -8.909  -1.189 1.00 167.75 ? 82  LYS B CA  1 
ATOM   2818 C C   . LYS B 2 82  ? -75.624 -9.169  0.290  1.00 165.91 ? 82  LYS B C   1 
ATOM   2819 O O   . LYS B 2 82  ? -76.582 -9.289  1.053  1.00 169.20 ? 82  LYS B O   1 
ATOM   2820 C CB  . LYS B 2 82  ? -76.132 -10.205 -1.915 1.00 183.54 ? 82  LYS B CB  1 
ATOM   2821 C CG  . LYS B 2 82  ? -75.669 -10.268 -3.367 1.00 186.42 ? 82  LYS B CG  1 
ATOM   2822 C CD  . LYS B 2 82  ? -76.792 -9.935  -4.342 1.00 193.67 ? 82  LYS B CD  1 
ATOM   2823 C CE  . LYS B 2 82  ? -76.890 -10.959 -5.475 1.00 206.27 ? 82  LYS B CE  1 
ATOM   2824 N NZ  . LYS B 2 82  ? -78.184 -11.694 -5.510 1.00 216.50 ? 82  LYS B NZ  1 
ATOM   2825 N N   . GLY B 2 83  ? -74.368 -9.244  0.666  1.00 160.74 ? 83  GLY B N   1 
ATOM   2826 C CA  . GLY B 2 83  ? -73.931 -9.752  1.970  1.00 161.23 ? 83  GLY B CA  1 
ATOM   2827 C C   . GLY B 2 83  ? -72.564 -10.420 1.918  1.00 163.07 ? 83  GLY B C   1 
ATOM   2828 O O   . GLY B 2 83  ? -71.959 -10.695 2.961  1.00 162.22 ? 83  GLY B O   1 
ATOM   2829 N N   . GLN B 2 84  ? -72.082 -10.684 0.700  1.00 166.77 ? 84  GLN B N   1 
ATOM   2830 C CA  . GLN B 2 84  ? -70.722 -11.182 0.469  1.00 167.40 ? 84  GLN B CA  1 
ATOM   2831 C C   . GLN B 2 84  ? -69.756 -10.007 0.253  1.00 153.19 ? 84  GLN B C   1 
ATOM   2832 O O   . GLN B 2 84  ? -69.968 -9.175  -0.645 1.00 149.08 ? 84  GLN B O   1 
ATOM   2833 C CB  . GLN B 2 84  ? -70.681 -12.107 -0.755 1.00 181.77 ? 84  GLN B CB  1 
ATOM   2834 C CG  . GLN B 2 84  ? -71.979 -12.861 -1.064 1.00 198.02 ? 84  GLN B CG  1 
ATOM   2835 C CD  . GLN B 2 84  ? -72.148 -14.137 -0.252 1.00 213.35 ? 84  GLN B CD  1 
ATOM   2836 O OE1 . GLN B 2 84  ? -71.564 -14.292 0.826  1.00 209.98 ? 84  GLN B OE1 1 
ATOM   2837 N NE2 . GLN B 2 84  ? -72.957 -15.060 -0.771 1.00 227.15 ? 84  GLN B NE2 1 
ATOM   2838 N N   . LYS B 2 85  ? -68.703 -9.939  1.070  1.00 145.19 ? 85  LYS B N   1 
ATOM   2839 C CA  . LYS B 2 85  ? -67.684 -8.897  0.930  1.00 132.15 ? 85  LYS B CA  1 
ATOM   2840 C C   . LYS B 2 85  ? -67.062 -8.929  -0.463 1.00 135.64 ? 85  LYS B C   1 
ATOM   2841 O O   . LYS B 2 85  ? -66.585 -9.971  -0.920 1.00 145.53 ? 85  LYS B O   1 
ATOM   2842 C CB  . LYS B 2 85  ? -66.613 -9.018  2.026  1.00 127.18 ? 85  LYS B CB  1 
ATOM   2843 C CG  . LYS B 2 85  ? -65.399 -8.094  1.853  1.00 112.16 ? 85  LYS B CG  1 
ATOM   2844 C CD  . LYS B 2 85  ? -64.932 -7.483  3.181  1.00 102.87 ? 85  LYS B CD  1 
ATOM   2845 C CE  . LYS B 2 85  ? -64.587 -8.525  4.242  1.00 102.78 ? 85  LYS B CE  1 
ATOM   2846 N NZ  . LYS B 2 85  ? -63.272 -9.187  4.015  1.00 109.13 ? 85  LYS B NZ  1 
ATOM   2847 N N   . VAL B 2 86  ? -67.092 -7.783  -1.138 1.00 127.42 ? 86  VAL B N   1 
ATOM   2848 C CA  . VAL B 2 86  ? -66.586 -7.690  -2.509 1.00 132.71 ? 86  VAL B CA  1 
ATOM   2849 C C   . VAL B 2 86  ? -65.368 -6.756  -2.606 1.00 123.40 ? 86  VAL B C   1 
ATOM   2850 O O   . VAL B 2 86  ? -64.564 -6.850  -3.539 1.00 129.10 ? 86  VAL B O   1 
ATOM   2851 C CB  . VAL B 2 86  ? -67.726 -7.334  -3.543 1.00 136.65 ? 86  VAL B CB  1 
ATOM   2852 C CG1 . VAL B 2 86  ? -68.264 -5.912  -3.340 1.00 122.88 ? 86  VAL B CG1 1 
ATOM   2853 C CG2 . VAL B 2 86  ? -67.256 -7.559  -4.978 1.00 145.19 ? 86  VAL B CG2 1 
ATOM   2854 N N   . GLY B 2 87  ? -65.226 -5.875  -1.625 1.00 110.54 ? 87  GLY B N   1 
ATOM   2855 C CA  . GLY B 2 87  ? -64.108 -4.954  -1.598 1.00 100.80 ? 87  GLY B CA  1 
ATOM   2856 C C   . GLY B 2 87  ? -63.606 -4.749  -0.184 1.00 92.46  ? 87  GLY B C   1 
ATOM   2857 O O   . GLY B 2 87  ? -64.213 -5.217  0.800  1.00 91.21  ? 87  GLY B O   1 
ATOM   2858 N N   . GLU B 2 88  ? -62.482 -4.049  -0.090 1.00 86.19  ? 88  GLU B N   1 
ATOM   2859 C CA  . GLU B 2 88  ? -61.910 -3.682  1.195  1.00 77.16  ? 88  GLU B CA  1 
ATOM   2860 C C   . GLU B 2 88  ? -60.610 -2.944  1.005  1.00 70.54  ? 88  GLU B C   1 
ATOM   2861 O O   . GLU B 2 88  ? -59.771 -3.336  0.181  1.00 73.30  ? 88  GLU B O   1 
ATOM   2862 C CB  . GLU B 2 88  ? -61.664 -4.922  2.035  1.00 81.55  ? 88  GLU B CB  1 
ATOM   2863 C CG  . GLU B 2 88  ? -61.644 -4.622  3.510  1.00 79.26  ? 88  GLU B CG  1 
ATOM   2864 C CD  . GLU B 2 88  ? -60.973 -5.721  4.302  1.00 94.86  ? 88  GLU B CD  1 
ATOM   2865 O OE1 . GLU B 2 88  ? -60.894 -6.869  3.783  1.00 100.53 ? 88  GLU B OE1 1 
ATOM   2866 O OE2 . GLU B 2 88  ? -60.526 -5.429  5.440  1.00 92.14  ? 88  GLU B OE2 1 
ATOM   2867 N N   . PHE B 2 89  ? -60.466 -1.865  1.768  1.00 61.10  ? 89  PHE B N   1 
ATOM   2868 C CA  . PHE B 2 89  ? -59.199 -1.171  1.900  1.00 54.87  ? 89  PHE B CA  1 
ATOM   2869 C C   . PHE B 2 89  ? -59.094 -0.436  3.232  1.00 46.81  ? 89  PHE B C   1 
ATOM   2870 O O   . PHE B 2 89  ? -60.111 -0.049  3.831  1.00 44.90  ? 89  PHE B O   1 
ATOM   2871 C CB  . PHE B 2 89  ? -58.948 -0.228  0.709  1.00 55.60  ? 89  PHE B CB  1 
ATOM   2872 C CG  . PHE B 2 89  ? -59.646 1.104   0.815  1.00 51.01  ? 89  PHE B CG  1 
ATOM   2873 C CD1 . PHE B 2 89  ? -58.954 2.226   1.260  1.00 40.62  ? 89  PHE B CD1 1 
ATOM   2874 C CD2 . PHE B 2 89  ? -60.987 1.241   0.434  1.00 50.84  ? 89  PHE B CD2 1 
ATOM   2875 C CE1 . PHE B 2 89  ? -59.588 3.466   1.372  1.00 30.83  ? 89  PHE B CE1 1 
ATOM   2876 C CE2 . PHE B 2 89  ? -61.643 2.476   0.523  1.00 41.09  ? 89  PHE B CE2 1 
ATOM   2877 C CZ  . PHE B 2 89  ? -60.948 3.597   0.980  1.00 42.03  ? 89  PHE B CZ  1 
ATOM   2878 N N   . SER B 2 90  ? -57.853 -0.221  3.673  1.00 42.40  ? 90  SER B N   1 
ATOM   2879 C CA  . SER B 2 90  ? -57.563 0.596   4.857  1.00 35.49  ? 90  SER B CA  1 
ATOM   2880 C C   . SER B 2 90  ? -56.901 1.924   4.501  1.00 29.86  ? 90  SER B C   1 
ATOM   2881 O O   . SER B 2 90  ? -56.165 2.006   3.545  1.00 32.45  ? 90  SER B O   1 
ATOM   2882 C CB  . SER B 2 90  ? -56.669 -0.189  5.796  1.00 36.49  ? 90  SER B CB  1 
ATOM   2883 O OG  . SER B 2 90  ? -57.329 -1.362  6.262  1.00 43.40  ? 90  SER B OG  1 
ATOM   2884 N N   . GLY B 2 91  ? -57.178 2.966   5.270  1.00 27.98  ? 91  GLY B N   1 
ATOM   2885 C CA  . GLY B 2 91  ? -56.556 4.269   5.054  1.00 28.84  ? 91  GLY B CA  1 
ATOM   2886 C C   . GLY B 2 91  ? -57.520 5.428   4.838  1.00 28.93  ? 91  GLY B C   1 
ATOM   2887 O O   . GLY B 2 91  ? -58.506 5.315   4.132  1.00 31.30  ? 91  GLY B O   1 
ATOM   2888 N N   . ALA B 2 92  ? -57.204 6.575   5.413  1.00 29.50  ? 92  ALA B N   1 
ATOM   2889 C CA  . ALA B 2 92  ? -58.074 7.751   5.274  1.00 27.06  ? 92  ALA B CA  1 
ATOM   2890 C C   . ALA B 2 92  ? -57.858 8.384   3.907  1.00 30.51  ? 92  ALA B C   1 
ATOM   2891 O O   . ALA B 2 92  ? -57.383 9.509   3.794  1.00 34.69  ? 92  ALA B O   1 
ATOM   2892 C CB  . ALA B 2 92  ? -57.780 8.732   6.389  1.00 26.54  ? 92  ALA B CB  1 
ATOM   2893 N N   . ASN B 2 93  ? -58.206 7.642   2.863  1.00 32.09  ? 93  ASN B N   1 
ATOM   2894 C CA  . ASN B 2 93  ? -58.029 8.073   1.471  1.00 36.35  ? 93  ASN B CA  1 
ATOM   2895 C C   . ASN B 2 93  ? -59.389 8.321   0.842  1.00 36.78  ? 93  ASN B C   1 
ATOM   2896 O O   . ASN B 2 93  ? -60.087 7.372   0.535  1.00 38.26  ? 93  ASN B O   1 
ATOM   2897 C CB  . ASN B 2 93  ? -57.284 6.956   0.726  1.00 39.26  ? 93  ASN B CB  1 
ATOM   2898 C CG  . ASN B 2 93  ? -56.825 7.353   -0.671 1.00 49.77  ? 93  ASN B CG  1 
ATOM   2899 O OD1 . ASN B 2 93  ? -57.348 8.279   -1.301 1.00 41.31  ? 93  ASN B OD1 1 
ATOM   2900 N ND2 . ASN B 2 93  ? -55.841 6.616   -1.175 1.00 58.11  ? 93  ASN B ND2 1 
ATOM   2901 N N   . LYS B 2 94  ? -59.774 9.592   0.683  1.00 39.72  ? 94  LYS B N   1 
ATOM   2902 C CA  . LYS B 2 94  ? -61.124 9.969   0.234  1.00 40.95  ? 94  LYS B CA  1 
ATOM   2903 C C   . LYS B 2 94  ? -61.370 9.547   -1.213 1.00 45.81  ? 94  LYS B C   1 
ATOM   2904 O O   . LYS B 2 94  ? -62.473 9.105   -1.595 1.00 48.50  ? 94  LYS B O   1 
ATOM   2905 C CB  . LYS B 2 94  ? -61.324 11.487  0.280  1.00 41.86  ? 94  LYS B CB  1 
ATOM   2906 C CG  . LYS B 2 94  ? -60.939 12.197  1.537  1.00 48.22  ? 94  LYS B CG  1 
ATOM   2907 C CD  . LYS B 2 94  ? -60.973 13.705  1.312  1.00 56.46  ? 94  LYS B CD  1 
ATOM   2908 C CE  . LYS B 2 94  ? -60.254 14.068  0.023  1.00 66.29  ? 94  LYS B CE  1 
ATOM   2909 N NZ  . LYS B 2 94  ? -59.595 15.405  0.061  1.00 71.78  ? 94  LYS B NZ  1 
ATOM   2910 N N   . GLU B 2 95  ? -60.332 9.730   -2.022 1.00 47.92  ? 95  GLU B N   1 
ATOM   2911 C CA  . GLU B 2 95  ? -60.414 9.509   -3.465 1.00 49.35  ? 95  GLU B CA  1 
ATOM   2912 C C   . GLU B 2 95  ? -60.469 8.006   -3.676 1.00 48.36  ? 95  GLU B C   1 
ATOM   2913 O O   . GLU B 2 95  ? -61.215 7.561   -4.513 1.00 50.08  ? 95  GLU B O   1 
ATOM   2914 C CB  . GLU B 2 95  ? -59.219 10.150  -4.186 1.00 57.37  ? 95  GLU B CB  1 
ATOM   2915 C CG  . GLU B 2 95  ? -59.197 11.692  -4.168 1.00 58.11  ? 95  GLU B CG  1 
ATOM   2916 C CD  . GLU B 2 95  ? -58.670 12.315  -2.849 1.00 65.51  ? 95  GLU B CD  1 
ATOM   2917 O OE1 . GLU B 2 95  ? -58.049 11.612  -1.983 1.00 53.56  ? 95  GLU B OE1 1 
ATOM   2918 O OE2 . GLU B 2 95  ? -58.897 13.537  -2.689 1.00 68.16  ? 95  GLU B OE2 1 
ATOM   2919 N N   . LYS B 2 96  ? -59.733 7.212   -2.895 1.00 40.16  ? 96  LYS B N   1 
ATOM   2920 C CA  . LYS B 2 96  ? -59.830 5.754   -3.021 1.00 45.93  ? 96  LYS B CA  1 
ATOM   2921 C C   . LYS B 2 96  ? -61.189 5.274   -2.539 1.00 47.13  ? 96  LYS B C   1 
ATOM   2922 O O   . LYS B 2 96  ? -61.743 4.336   -3.108 1.00 54.36  ? 96  LYS B O   1 
ATOM   2923 C CB  . LYS B 2 96  ? -58.747 5.003   -2.233 1.00 49.19  ? 96  LYS B CB  1 
ATOM   2924 C CG  . LYS B 2 96  ? -58.721 3.482   -2.512 1.00 57.05  ? 96  LYS B CG  1 
ATOM   2925 C CD  . LYS B 2 96  ? -57.445 2.839   -1.963 1.00 67.81  ? 96  LYS B CD  1 
ATOM   2926 C CE  . LYS B 2 96  ? -57.186 1.447   -2.579 1.00 83.94  ? 96  LYS B CE  1 
ATOM   2927 N NZ  . LYS B 2 96  ? -56.220 0.662   -1.732 1.00 82.84  ? 96  LYS B NZ  1 
ATOM   2928 N N   . LEU B 2 97  ? -61.729 5.904   -1.493 1.00 41.50  ? 97  LEU B N   1 
ATOM   2929 C CA  . LEU B 2 97  ? -63.024 5.501   -0.953 1.00 38.63  ? 97  LEU B CA  1 
ATOM   2930 C C   . LEU B 2 97  ? -64.152 5.749   -1.971 1.00 44.31  ? 97  LEU B C   1 
ATOM   2931 O O   . LEU B 2 97  ? -64.971 4.861   -2.213 1.00 45.37  ? 97  LEU B O   1 
ATOM   2932 C CB  . LEU B 2 97  ? -63.299 6.209   0.372  1.00 35.50  ? 97  LEU B CB  1 
ATOM   2933 C CG  . LEU B 2 97  ? -64.692 6.165   1.026  1.00 32.64  ? 97  LEU B CG  1 
ATOM   2934 C CD1 . LEU B 2 97  ? -65.096 4.785   1.490  1.00 36.53  ? 97  LEU B CD1 1 
ATOM   2935 C CD2 . LEU B 2 97  ? -64.699 7.157   2.173  1.00 33.04  ? 97  LEU B CD2 1 
ATOM   2936 N N   . GLU B 2 98  ? -64.196 6.947   -2.560 1.00 44.73  ? 98  GLU B N   1 
ATOM   2937 C CA  . GLU B 2 98  ? -65.217 7.235   -3.569 1.00 48.15  ? 98  GLU B CA  1 
ATOM   2938 C C   . GLU B 2 98  ? -64.961 6.393   -4.804 1.00 59.27  ? 98  GLU B C   1 
ATOM   2939 O O   . GLU B 2 98  ? -65.890 5.831   -5.377 1.00 69.20  ? 98  GLU B O   1 
ATOM   2940 C CB  . GLU B 2 98  ? -65.286 8.729   -3.937 1.00 46.75  ? 98  GLU B CB  1 
ATOM   2941 C CG  . GLU B 2 98  ? -66.495 9.084   -4.867 1.00 55.97  ? 98  GLU B CG  1 
ATOM   2942 C CD  . GLU B 2 98  ? -66.640 10.590  -5.139 1.00 56.00  ? 98  GLU B CD  1 
ATOM   2943 O OE1 . GLU B 2 98  ? -65.651 11.348  -4.928 1.00 51.75  ? 98  GLU B OE1 1 
ATOM   2944 O OE2 . GLU B 2 98  ? -67.754 11.009  -5.554 1.00 54.98  ? 98  GLU B OE2 1 
ATOM   2945 N N   . ALA B 2 99  ? -63.706 6.315   -5.226 1.00 59.49  ? 99  ALA B N   1 
ATOM   2946 C CA  . ALA B 2 99  ? -63.375 5.551   -6.407 1.00 69.14  ? 99  ALA B CA  1 
ATOM   2947 C C   . ALA B 2 99  ? -63.815 4.093   -6.261 1.00 73.41  ? 99  ALA B C   1 
ATOM   2948 O O   . ALA B 2 99  ? -64.298 3.518   -7.224 1.00 77.96  ? 99  ALA B O   1 
ATOM   2949 C CB  . ALA B 2 99  ? -61.905 5.669   -6.742 1.00 69.41  ? 99  ALA B CB  1 
ATOM   2950 N N   . THR B 2 100 ? -63.698 3.526   -5.054 1.00 67.55  ? 100 THR B N   1 
ATOM   2951 C CA  . THR B 2 100 ? -64.053 2.110   -4.804 1.00 72.52  ? 100 THR B CA  1 
ATOM   2952 C C   . THR B 2 100 ? -65.558 1.920   -4.842 1.00 76.07  ? 100 THR B C   1 
ATOM   2953 O O   . THR B 2 100 ? -66.043 0.872   -5.264 1.00 83.42  ? 100 THR B O   1 
ATOM   2954 C CB  . THR B 2 100 ? -63.517 1.574   -3.439 1.00 66.95  ? 100 THR B CB  1 
ATOM   2955 O OG1 . THR B 2 100 ? -62.101 1.766   -3.365 1.00 67.20  ? 100 THR B OG1 1 
ATOM   2956 C CG2 . THR B 2 100 ? -63.811 0.081   -3.267 1.00 72.01  ? 100 THR B CG2 1 
ATOM   2957 N N   . ILE B 2 101 ? -66.290 2.927   -4.379 1.00 71.98  ? 101 ILE B N   1 
ATOM   2958 C CA  . ILE B 2 101 ? -67.757 2.911   -4.442 1.00 75.14  ? 101 ILE B CA  1 
ATOM   2959 C C   . ILE B 2 101 ? -68.232 2.859   -5.901 1.00 83.79  ? 101 ILE B C   1 
ATOM   2960 O O   . ILE B 2 101 ? -68.929 1.923   -6.316 1.00 92.00  ? 101 ILE B O   1 
ATOM   2961 C CB  . ILE B 2 101 ? -68.353 4.136   -3.679 1.00 69.93  ? 101 ILE B CB  1 
ATOM   2962 C CG1 . ILE B 2 101 ? -68.138 3.962   -2.161 1.00 59.28  ? 101 ILE B CG1 1 
ATOM   2963 C CG2 . ILE B 2 101 ? -69.841 4.395   -4.093 1.00 65.23  ? 101 ILE B CG2 1 
ATOM   2964 C CD1 . ILE B 2 101 ? -68.489 5.194   -1.317 1.00 45.06  ? 101 ILE B CD1 1 
ATOM   2965 N N   . ASN B 2 102 ? -67.818 3.851   -6.686 1.00 84.91  ? 102 ASN B N   1 
ATOM   2966 C CA  . ASN B 2 102 ? -68.130 3.903   -8.111 1.00 91.82  ? 102 ASN B CA  1 
ATOM   2967 C C   . ASN B 2 102 ? -67.778 2.579   -8.774 1.00 102.08 ? 102 ASN B C   1 
ATOM   2968 O O   . ASN B 2 102 ? -68.476 2.120   -9.695 1.00 111.20 ? 102 ASN B O   1 
ATOM   2969 C CB  . ASN B 2 102 ? -67.326 5.009   -8.811 1.00 91.64  ? 102 ASN B CB  1 
ATOM   2970 C CG  . ASN B 2 102 ? -67.577 6.399   -8.233 1.00 79.90  ? 102 ASN B CG  1 
ATOM   2971 O OD1 . ASN B 2 102 ? -68.676 6.630   -7.656 1.00 76.34  ? 102 ASN B OD1 1 
ATOM   2972 N ND2 . ASN B 2 102 ? -66.546 7.357   -8.420 1.00 77.75  ? 102 ASN B ND2 1 
ATOM   2973 N N   . GLU B 2 103 ? -66.671 1.986   -8.319 1.00 99.27  ? 103 GLU B N   1 
ATOM   2974 C CA  . GLU B 2 103 ? -66.145 0.744   -8.894 1.00 109.96 ? 103 GLU B CA  1 
ATOM   2975 C C   . GLU B 2 103 ? -66.978 -0.492  -8.520 1.00 115.25 ? 103 GLU B C   1 
ATOM   2976 O O   . GLU B 2 103 ? -67.015 -1.465  -9.289 1.00 127.41 ? 103 GLU B O   1 
ATOM   2977 C CB  . GLU B 2 103 ? -64.661 0.573   -8.542 1.00 108.17 ? 103 GLU B CB  1 
ATOM   2978 C CG  . GLU B 2 103 ? -64.060 -0.810  -8.758 1.00 119.98 ? 103 GLU B CG  1 
ATOM   2979 C CD  . GLU B 2 103 ? -62.749 -0.980  -7.998 1.00 119.60 ? 103 GLU B CD  1 
ATOM   2980 O OE1 . GLU B 2 103 ? -61.748 -0.338  -8.387 1.00 122.86 ? 103 GLU B OE1 1 
ATOM   2981 O OE2 . GLU B 2 103 ? -62.719 -1.760  -7.018 1.00 113.00 ? 103 GLU B OE2 1 
ATOM   2982 N N   . LEU B 2 104 ? -67.692 -0.431  -7.393 1.00 107.29 ? 104 LEU B N   1 
ATOM   2983 C CA  . LEU B 2 104 ? -68.407 -1.607  -6.881 1.00 112.41 ? 104 LEU B CA  1 
ATOM   2984 C C   . LEU B 2 104 ? -69.945 -1.607  -6.982 1.00 116.27 ? 104 LEU B C   1 
ATOM   2985 O O   . LEU B 2 104 ? -70.540 -2.670  -7.163 1.00 125.25 ? 104 LEU B O   1 
ATOM   2986 C CB  . LEU B 2 104 ? -67.968 -1.919  -5.447 1.00 105.57 ? 104 LEU B CB  1 
ATOM   2987 C CG  . LEU B 2 104 ? -66.610 -2.580  -5.216 1.00 103.80 ? 104 LEU B CG  1 
ATOM   2988 C CD1 . LEU B 2 104 ? -66.404 -2.708  -3.728 1.00 102.50 ? 104 LEU B CD1 1 
ATOM   2989 C CD2 . LEU B 2 104 ? -66.494 -3.943  -5.894 1.00 119.67 ? 104 LEU B CD2 1 
ATOM   2990 N N   . VAL B 2 105 ? -70.567 -0.429  -6.856 1.00 111.33 ? 105 VAL B N   1 
ATOM   2991 C CA  . VAL B 2 105 ? -72.044 -0.239  -6.853 1.00 112.04 ? 105 VAL B CA  1 
ATOM   2992 C C   . VAL B 2 105 ? -72.874 -1.355  -7.528 1.00 126.24 ? 105 VAL B C   1 
ATOM   2993 O O   . VAL B 2 105 ? -73.781 -1.938  -6.919 1.00 129.12 ? 105 VAL B O   1 
ATOM   2994 C CB  . VAL B 2 105 ? -72.433 1.165   -7.432 1.00 108.29 ? 105 VAL B CB  1 
ATOM   2995 C CG1 . VAL B 2 105 ? -73.849 1.173   -8.027 1.00 116.29 ? 105 VAL B CG1 1 
ATOM   2996 C CG2 . VAL B 2 105 ? -72.303 2.229   -6.379 1.00 90.37  ? 105 VAL B CG2 1 
ATOM   2997 O OXT . VAL B 2 105 ? -72.664 -1.696  -8.698 1.00 133.85 ? 105 VAL B OXT 1 
ATOM   2998 N N   . LYS C 1 6   ? -16.361 6.444   5.932  1.00 61.55  ? 8   LYS C N   1 
ATOM   2999 C CA  . LYS C 1 6   ? -15.932 7.843   5.588  1.00 63.45  ? 8   LYS C CA  1 
ATOM   3000 C C   . LYS C 1 6   ? -15.093 8.553   6.658  1.00 64.93  ? 8   LYS C C   1 
ATOM   3001 O O   . LYS C 1 6   ? -13.946 8.928   6.403  1.00 66.33  ? 8   LYS C O   1 
ATOM   3002 C CB  . LYS C 1 6   ? -17.129 8.730   5.302  1.00 62.78  ? 8   LYS C CB  1 
ATOM   3003 C CG  . LYS C 1 6   ? -16.711 10.140  4.965  1.00 60.47  ? 8   LYS C CG  1 
ATOM   3004 C CD  . LYS C 1 6   ? -17.857 11.097  4.994  1.00 61.15  ? 8   LYS C CD  1 
ATOM   3005 C CE  . LYS C 1 6   ? -17.365 12.502  4.694  1.00 75.08  ? 8   LYS C CE  1 
ATOM   3006 N NZ  . LYS C 1 6   ? -18.497 13.411  4.332  1.00 84.57  ? 8   LYS C NZ  1 
ATOM   3007 N N   . SER C 1 7   ? -15.701 8.799   7.824  1.00 62.98  ? 9   SER C N   1 
ATOM   3008 C CA  . SER C 1 7   ? -15.016 9.449   8.953  1.00 60.22  ? 9   SER C CA  1 
ATOM   3009 C C   . SER C 1 7   ? -15.189 8.584   10.197 1.00 56.97  ? 9   SER C C   1 
ATOM   3010 O O   . SER C 1 7   ? -16.201 7.884   10.374 1.00 56.82  ? 9   SER C O   1 
ATOM   3011 C CB  . SER C 1 7   ? -15.571 10.853  9.230  1.00 60.10  ? 9   SER C CB  1 
ATOM   3012 O OG  . SER C 1 7   ? -16.361 11.336  8.156  1.00 67.28  ? 9   SER C OG  1 
ATOM   3013 N N   . PHE C 1 8   ? -14.202 8.655   11.073 1.00 53.47  ? 10  PHE C N   1 
ATOM   3014 C CA  . PHE C 1 8   ? -14.216 7.868   12.274 1.00 48.74  ? 10  PHE C CA  1 
ATOM   3015 C C   . PHE C 1 8   ? -13.265 8.552   13.223 1.00 48.56  ? 10  PHE C C   1 
ATOM   3016 O O   . PHE C 1 8   ? -12.063 8.455   13.038 1.00 43.63  ? 10  PHE C O   1 
ATOM   3017 C CB  . PHE C 1 8   ? -13.716 6.478   11.952 1.00 47.07  ? 10  PHE C CB  1 
ATOM   3018 C CG  . PHE C 1 8   ? -13.813 5.532   13.089 1.00 49.88  ? 10  PHE C CG  1 
ATOM   3019 C CD1 . PHE C 1 8   ? -14.944 5.506   13.891 1.00 48.61  ? 10  PHE C CD1 1 
ATOM   3020 C CD2 . PHE C 1 8   ? -12.791 4.650   13.344 1.00 38.24  ? 10  PHE C CD2 1 
ATOM   3021 C CE1 . PHE C 1 8   ? -15.025 4.632   14.942 1.00 46.98  ? 10  PHE C CE1 1 
ATOM   3022 C CE2 . PHE C 1 8   ? -12.893 3.759   14.381 1.00 52.41  ? 10  PHE C CE2 1 
ATOM   3023 C CZ  . PHE C 1 8   ? -14.020 3.758   15.179 1.00 44.83  ? 10  PHE C CZ  1 
ATOM   3024 N N   . GLU C 1 9   ? -13.790 9.272   14.209 1.00 45.76  ? 11  GLU C N   1 
ATOM   3025 C CA  . GLU C 1 9   ? -12.905 10.112  15.009 1.00 48.21  ? 11  GLU C CA  1 
ATOM   3026 C C   . GLU C 1 9   ? -13.304 10.137  16.473 1.00 44.15  ? 11  GLU C C   1 
ATOM   3027 O O   . GLU C 1 9   ? -14.502 10.164  16.784 1.00 41.58  ? 11  GLU C O   1 
ATOM   3028 C CB  . GLU C 1 9   ? -12.907 11.548  14.463 1.00 51.89  ? 11  GLU C CB  1 
ATOM   3029 C CG  . GLU C 1 9   ? -11.626 12.348  14.817 1.00 58.71  ? 11  GLU C CG  1 
ATOM   3030 C CD  . GLU C 1 9   ? -11.836 13.856  14.778 1.00 58.89  ? 11  GLU C CD  1 
ATOM   3031 O OE1 . GLU C 1 9   ? -12.777 14.290  14.101 1.00 50.13  ? 11  GLU C OE1 1 
ATOM   3032 O OE2 . GLU C 1 9   ? -11.070 14.612  15.428 1.00 56.23  ? 11  GLU C OE2 1 
ATOM   3033 N N   . VAL C 1 10  ? -12.302 10.166  17.361 1.00 43.15  ? 12  VAL C N   1 
ATOM   3034 C CA  . VAL C 1 10  ? -12.566 10.423  18.764 1.00 40.07  ? 12  VAL C CA  1 
ATOM   3035 C C   . VAL C 1 10  ? -12.602 11.945  18.933 1.00 41.21  ? 12  VAL C C   1 
ATOM   3036 O O   . VAL C 1 10  ? -11.678 12.644  18.515 1.00 42.80  ? 12  VAL C O   1 
ATOM   3037 C CB  . VAL C 1 10  ? -11.505 9.765   19.671 1.00 43.61  ? 12  VAL C CB  1 
ATOM   3038 C CG1 . VAL C 1 10  ? -11.689 10.216  21.113 1.00 35.25  ? 12  VAL C CG1 1 
ATOM   3039 C CG2 . VAL C 1 10  ? -11.596 8.227   19.583 1.00 36.49  ? 12  VAL C CG2 1 
ATOM   3040 N N   . VAL C 1 11  ? -13.664 12.464  19.544 1.00 41.75  ? 13  VAL C N   1 
ATOM   3041 C CA  . VAL C 1 11  ? -13.793 13.909  19.788 1.00 37.06  ? 13  VAL C CA  1 
ATOM   3042 C C   . VAL C 1 11  ? -13.974 14.175  21.289 1.00 35.13  ? 13  VAL C C   1 
ATOM   3043 O O   . VAL C 1 11  ? -15.035 13.935  21.861 1.00 36.02  ? 13  VAL C O   1 
ATOM   3044 C CB  . VAL C 1 11  ? -14.908 14.533  18.884 1.00 40.18  ? 13  VAL C CB  1 
ATOM   3045 C CG1 . VAL C 1 11  ? -15.051 16.034  19.114 1.00 43.43  ? 13  VAL C CG1 1 
ATOM   3046 C CG2 . VAL C 1 11  ? -14.571 14.304  17.442 1.00 39.55  ? 13  VAL C CG2 1 
ATOM   3047 N N   . PHE C 1 12  ? -12.926 14.687  21.936 1.00 36.81  ? 14  PHE C N   1 
ATOM   3048 C CA  . PHE C 1 12  ? -13.029 15.064  23.331 1.00 36.68  ? 14  PHE C CA  1 
ATOM   3049 C C   . PHE C 1 12  ? -13.828 16.345  23.493 1.00 39.34  ? 14  PHE C C   1 
ATOM   3050 O O   . PHE C 1 12  ? -13.711 17.255  22.683 1.00 41.73  ? 14  PHE C O   1 
ATOM   3051 C CB  . PHE C 1 12  ? -11.647 15.233  23.959 1.00 34.98  ? 14  PHE C CB  1 
ATOM   3052 C CG  . PHE C 1 12  ? -10.827 13.964  23.998 1.00 35.65  ? 14  PHE C CG  1 
ATOM   3053 C CD1 . PHE C 1 12  ? -11.082 12.976  24.952 1.00 25.91  ? 14  PHE C CD1 1 
ATOM   3054 C CD2 . PHE C 1 12  ? -9.801  13.756  23.070 1.00 33.44  ? 14  PHE C CD2 1 
ATOM   3055 C CE1 . PHE C 1 12  ? -10.311 11.796  24.985 1.00 26.28  ? 14  PHE C CE1 1 
ATOM   3056 C CE2 . PHE C 1 12  ? -9.011  12.593  23.125 1.00 29.19  ? 14  PHE C CE2 1 
ATOM   3057 C CZ  . PHE C 1 12  ? -9.273  11.621  24.083 1.00 31.70  ? 14  PHE C CZ  1 
ATOM   3058 N N   . ASN C 1 13  ? -14.622 16.400  24.560 1.00 40.29  ? 15  ASN C N   1 
ATOM   3059 C CA  . ASN C 1 13  ? -15.455 17.537  24.905 1.00 41.57  ? 15  ASN C CA  1 
ATOM   3060 C C   . ASN C 1 13  ? -14.664 18.807  25.215 1.00 45.10  ? 15  ASN C C   1 
ATOM   3061 O O   . ASN C 1 13  ? -15.106 19.908  24.866 1.00 48.65  ? 15  ASN C O   1 
ATOM   3062 C CB  . ASN C 1 13  ? -16.318 17.183  26.113 1.00 41.68  ? 15  ASN C CB  1 
ATOM   3063 C CG  . ASN C 1 13  ? -17.526 16.322  25.745 1.00 38.52  ? 15  ASN C CG  1 
ATOM   3064 O OD1 . ASN C 1 13  ? -17.771 16.027  24.578 1.00 43.33  ? 15  ASN C OD1 1 
ATOM   3065 N ND2 . ASN C 1 13  ? -18.277 15.911  26.755 1.00 44.97  ? 15  ASN C ND2 1 
ATOM   3066 N N   . ASP C 1 14  ? -13.522 18.640  25.897 1.00 40.72  ? 16  ASP C N   1 
ATOM   3067 C CA  . ASP C 1 14  ? -12.515 19.698  26.161 1.00 40.38  ? 16  ASP C CA  1 
ATOM   3068 C C   . ASP C 1 14  ? -11.208 19.309  25.446 1.00 36.87  ? 16  ASP C C   1 
ATOM   3069 O O   . ASP C 1 14  ? -10.325 18.701  26.055 1.00 37.83  ? 16  ASP C O   1 
ATOM   3070 C CB  . ASP C 1 14  ? -12.218 19.772  27.677 1.00 41.92  ? 16  ASP C CB  1 
ATOM   3071 C CG  . ASP C 1 14  ? -13.488 19.810  28.535 1.00 58.56  ? 16  ASP C CG  1 
ATOM   3072 O OD1 . ASP C 1 14  ? -13.659 18.932  29.435 1.00 61.85  ? 16  ASP C OD1 1 
ATOM   3073 O OD2 . ASP C 1 14  ? -14.327 20.698  28.279 1.00 59.84  ? 16  ASP C OD2 1 
ATOM   3074 N N   . PRO C 1 15  ? -11.079 19.605  24.150 1.00 37.85  ? 17  PRO C N   1 
ATOM   3075 C CA  . PRO C 1 15  ? -9.897  19.063  23.470 1.00 39.43  ? 17  PRO C CA  1 
ATOM   3076 C C   . PRO C 1 15  ? -8.541  19.632  23.893 1.00 41.89  ? 17  PRO C C   1 
ATOM   3077 O O   . PRO C 1 15  ? -7.499  19.008  23.641 1.00 40.10  ? 17  PRO C O   1 
ATOM   3078 C CB  . PRO C 1 15  ? -10.187 19.338  21.987 1.00 42.92  ? 17  PRO C CB  1 
ATOM   3079 C CG  . PRO C 1 15  ? -11.271 20.262  21.939 1.00 38.16  ? 17  PRO C CG  1 
ATOM   3080 C CD  . PRO C 1 15  ? -11.962 20.351  23.239 1.00 40.33  ? 17  PRO C CD  1 
ATOM   3081 N N   . GLU C 1 16  ? -8.537  20.780  24.577 1.00 41.79  ? 18  GLU C N   1 
ATOM   3082 C CA  . GLU C 1 16  ? -7.276  21.370  25.070 1.00 36.05  ? 18  GLU C CA  1 
ATOM   3083 C C   . GLU C 1 16  ? -7.023  21.182  26.567 1.00 36.34  ? 18  GLU C C   1 
ATOM   3084 O O   . GLU C 1 16  ? -6.011  21.633  27.113 1.00 33.77  ? 18  GLU C O   1 
ATOM   3085 C CB  . GLU C 1 16  ? -7.219  22.848  24.671 1.00 39.61  ? 18  GLU C CB  1 
ATOM   3086 C CG  . GLU C 1 16  ? -6.608  23.086  23.309 1.00 44.49  ? 18  GLU C CG  1 
ATOM   3087 C CD  . GLU C 1 16  ? -7.460  22.533  22.181 1.00 46.51  ? 18  GLU C CD  1 
ATOM   3088 O OE1 . GLU C 1 16  ? -8.603  23.002  22.006 1.00 58.33  ? 18  GLU C OE1 1 
ATOM   3089 O OE2 . GLU C 1 16  ? -6.988  21.632  21.467 1.00 48.86  ? 18  GLU C OE2 1 
ATOM   3090 N N   . LYS C 1 17  ? -7.918  20.477  27.246 1.00 32.07  ? 19  LYS C N   1 
ATOM   3091 C CA  . LYS C 1 17  ? -7.729  20.296  28.657 1.00 32.39  ? 19  LYS C CA  1 
ATOM   3092 C C   . LYS C 1 17  ? -6.582  19.338  28.946 1.00 35.06  ? 19  LYS C C   1 
ATOM   3093 O O   . LYS C 1 17  ? -6.384  18.359  28.236 1.00 34.78  ? 19  LYS C O   1 
ATOM   3094 C CB  . LYS C 1 17  ? -8.996  19.797  29.311 1.00 33.27  ? 19  LYS C CB  1 
ATOM   3095 C CG  . LYS C 1 17  ? -8.863  19.715  30.852 1.00 36.47  ? 19  LYS C CG  1 
ATOM   3096 C CD  . LYS C 1 17  ? -10.208 19.377  31.433 1.00 40.73  ? 19  LYS C CD  1 
ATOM   3097 C CE  . LYS C 1 17  ? -10.059 19.163  32.918 1.00 48.28  ? 19  LYS C CE  1 
ATOM   3098 N NZ  . LYS C 1 17  ? -11.410 18.958  33.458 1.00 55.17  ? 19  LYS C NZ  1 
ATOM   3099 N N   . VAL C 1 18  ? -5.853  19.632  30.017 1.00 35.11  ? 20  VAL C N   1 
ATOM   3100 C CA  . VAL C 1 18  ? -4.814  18.769  30.581 1.00 32.73  ? 20  VAL C CA  1 
ATOM   3101 C C   . VAL C 1 18  ? -5.449  18.262  31.879 1.00 35.86  ? 20  VAL C C   1 
ATOM   3102 O O   . VAL C 1 18  ? -5.757  19.072  32.768 1.00 35.26  ? 20  VAL C O   1 
ATOM   3103 C CB  . VAL C 1 18  ? -3.545  19.604  30.894 1.00 32.96  ? 20  VAL C CB  1 
ATOM   3104 C CG1 . VAL C 1 18  ? -2.435  18.780  31.383 1.00 34.83  ? 20  VAL C CG1 1 
ATOM   3105 C CG2 . VAL C 1 18  ? -3.066  20.386  29.610 1.00 26.74  ? 20  VAL C CG2 1 
ATOM   3106 N N   . TYR C 1 19  ? -5.681  16.947  31.968 1.00 33.56  ? 21  TYR C N   1 
ATOM   3107 C CA  . TYR C 1 19  ? -6.521  16.384  33.030 1.00 33.34  ? 21  TYR C CA  1 
ATOM   3108 C C   . TYR C 1 19  ? -5.723  15.994  34.265 1.00 32.75  ? 21  TYR C C   1 
ATOM   3109 O O   . TYR C 1 19  ? -4.588  15.539  34.166 1.00 28.44  ? 21  TYR C O   1 
ATOM   3110 C CB  . TYR C 1 19  ? -7.259  15.136  32.549 1.00 36.88  ? 21  TYR C CB  1 
ATOM   3111 C CG  . TYR C 1 19  ? -8.201  15.356  31.406 1.00 33.15  ? 21  TYR C CG  1 
ATOM   3112 C CD1 . TYR C 1 19  ? -9.552  15.593  31.612 1.00 33.59  ? 21  TYR C CD1 1 
ATOM   3113 C CD2 . TYR C 1 19  ? -7.718  15.345  30.118 1.00 35.37  ? 21  TYR C CD2 1 
ATOM   3114 C CE1 . TYR C 1 19  ? -10.399 15.814  30.533 1.00 34.74  ? 21  TYR C CE1 1 
ATOM   3115 C CE2 . TYR C 1 19  ? -8.509  15.555  29.085 1.00 26.30  ? 21  TYR C CE2 1 
ATOM   3116 C CZ  . TYR C 1 19  ? -9.863  15.789  29.276 1.00 41.36  ? 21  TYR C CZ  1 
ATOM   3117 O OH  . TYR C 1 19  ? -10.634 15.990  28.164 1.00 44.26  ? 21  TYR C OH  1 
ATOM   3118 N N   . GLY C 1 20  ? -6.365  16.084  35.428 1.00 33.08  ? 22  GLY C N   1 
ATOM   3119 C CA  . GLY C 1 20  ? -5.676  15.776  36.684 1.00 35.64  ? 22  GLY C CA  1 
ATOM   3120 C C   . GLY C 1 20  ? -6.310  14.556  37.298 1.00 36.48  ? 22  GLY C C   1 
ATOM   3121 O O   . GLY C 1 20  ? -7.337  14.085  36.850 1.00 32.80  ? 22  GLY C O   1 
ATOM   3122 N N   . SER C 1 21  ? -5.673  14.038  38.332 1.00 38.94  ? 23  SER C N   1 
ATOM   3123 C CA  . SER C 1 21  ? -6.111  12.837  38.997 1.00 38.75  ? 23  SER C CA  1 
ATOM   3124 C C   . SER C 1 21  ? -7.573  12.972  39.397 1.00 38.60  ? 23  SER C C   1 
ATOM   3125 O O   . SER C 1 21  ? -8.032  14.043  39.806 1.00 39.42  ? 23  SER C O   1 
ATOM   3126 C CB  . SER C 1 21  ? -5.206  12.642  40.222 1.00 42.81  ? 23  SER C CB  1 
ATOM   3127 O OG  . SER C 1 21  ? -5.498  11.418  40.815 1.00 53.42  ? 23  SER C OG  1 
ATOM   3128 N N   . GLY C 1 22  ? -8.337  11.905  39.217 1.00 38.19  ? 24  GLY C N   1 
ATOM   3129 C CA  . GLY C 1 22  ? -9.754  11.954  39.557 1.00 40.95  ? 24  GLY C CA  1 
ATOM   3130 C C   . GLY C 1 22  ? -10.729 12.623  38.598 1.00 43.51  ? 24  GLY C C   1 
ATOM   3131 O O   . GLY C 1 22  ? -11.933 12.482  38.766 1.00 45.38  ? 24  GLY C O   1 
ATOM   3132 N N   . GLU C 1 23  ? -10.243 13.328  37.579 1.00 39.55  ? 25  GLU C N   1 
ATOM   3133 C CA  . GLU C 1 23  ? -11.141 14.012  36.635 1.00 38.48  ? 25  GLU C CA  1 
ATOM   3134 C C   . GLU C 1 23  ? -11.814 13.113  35.618 1.00 37.81  ? 25  GLU C C   1 
ATOM   3135 O O   . GLU C 1 23  ? -11.326 12.041  35.281 1.00 36.31  ? 25  GLU C O   1 
ATOM   3136 C CB  . GLU C 1 23  ? -10.437 15.189  35.934 1.00 37.66  ? 25  GLU C CB  1 
ATOM   3137 C CG  . GLU C 1 23  ? -9.862  16.213  36.920 1.00 42.16  ? 25  GLU C CG  1 
ATOM   3138 C CD  . GLU C 1 23  ? -9.525  17.543  36.261 1.00 49.98  ? 25  GLU C CD  1 
ATOM   3139 O OE1 . GLU C 1 23  ? -8.501  17.631  35.558 1.00 39.11  ? 25  GLU C OE1 1 
ATOM   3140 O OE2 . GLU C 1 23  ? -10.271 18.522  36.463 1.00 59.49  ? 25  GLU C OE2 1 
ATOM   3141 N N   . LYS C 1 24  ? -12.929 13.565  35.091 1.00 38.96  ? 26  LYS C N   1 
ATOM   3142 C CA  . LYS C 1 24  ? -13.669 12.792  34.129 1.00 39.51  ? 26  LYS C CA  1 
ATOM   3143 C C   . LYS C 1 24  ? -13.254 13.164  32.723 1.00 36.73  ? 26  LYS C C   1 
ATOM   3144 O O   . LYS C 1 24  ? -13.111 14.299  32.417 1.00 37.52  ? 26  LYS C O   1 
ATOM   3145 C CB  . LYS C 1 24  ? -15.160 13.001  34.342 1.00 18.31  ? 26  LYS C CB  1 
ATOM   3146 C CG  . LYS C 1 24  ? -16.038 12.336  33.333 1.00 18.34  ? 26  LYS C CG  1 
ATOM   3147 C CD  . LYS C 1 24  ? -17.211 11.623  33.962 1.00 18.76  ? 26  LYS C CD  1 
ATOM   3148 C CE  . LYS C 1 24  ? -17.649 10.437  33.134 1.00 18.62  ? 26  LYS C CE  1 
ATOM   3149 N NZ  . LYS C 1 24  ? -17.723 9.167   33.917 1.00 18.65  ? 26  LYS C NZ  1 
ATOM   3150 N N   . VAL C 1 25  ? -13.042 12.169  31.890 1.00 35.66  ? 27  VAL C N   1 
ATOM   3151 C CA  . VAL C 1 25  ? -12.670 12.404  30.505 1.00 33.60  ? 27  VAL C CA  1 
ATOM   3152 C C   . VAL C 1 25  ? -13.852 11.980  29.680 1.00 34.23  ? 27  VAL C C   1 
ATOM   3153 O O   . VAL C 1 25  ? -14.259 10.814  29.740 1.00 37.62  ? 27  VAL C O   1 
ATOM   3154 C CB  . VAL C 1 25  ? -11.405 11.634  30.110 1.00 31.00  ? 27  VAL C CB  1 
ATOM   3155 C CG1 . VAL C 1 25  ? -11.021 11.999  28.737 1.00 25.60  ? 27  VAL C CG1 1 
ATOM   3156 C CG2 . VAL C 1 25  ? -10.238 11.957  31.093 1.00 29.28  ? 27  VAL C CG2 1 
ATOM   3157 N N   . ALA C 1 26  ? -14.446 12.940  28.965 1.00 35.03  ? 28  ALA C N   1 
ATOM   3158 C CA  . ALA C 1 26  ? -15.662 12.683  28.208 1.00 34.42  ? 28  ALA C CA  1 
ATOM   3159 C C   . ALA C 1 26  ? -15.580 13.170  26.768 1.00 34.54  ? 28  ALA C C   1 
ATOM   3160 O O   . ALA C 1 26  ? -14.921 14.150  26.459 1.00 32.60  ? 28  ALA C O   1 
ATOM   3161 C CB  . ALA C 1 26  ? -16.892 13.312  28.945 1.00 37.23  ? 28  ALA C CB  1 
ATOM   3162 N N   . GLY C 1 27  ? -16.265 12.476  25.869 1.00 33.36  ? 29  GLY C N   1 
ATOM   3163 C CA  . GLY C 1 27  ? -16.310 12.920  24.499 1.00 33.37  ? 29  GLY C CA  1 
ATOM   3164 C C   . GLY C 1 27  ? -17.299 12.113  23.720 1.00 35.49  ? 29  GLY C C   1 
ATOM   3165 O O   . GLY C 1 27  ? -18.238 11.536  24.291 1.00 31.77  ? 29  GLY C O   1 
ATOM   3166 N N   . ARG C 1 28  ? -17.077 12.092  22.409 1.00 31.82  ? 30  ARG C N   1 
ATOM   3167 C CA  . ARG C 1 28  ? -17.937 11.396  21.509 1.00 35.57  ? 30  ARG C CA  1 
ATOM   3168 C C   . ARG C 1 28  ? -17.046 10.651  20.550 1.00 36.78  ? 30  ARG C C   1 
ATOM   3169 O O   . ARG C 1 28  ? -15.918 11.062  20.289 1.00 36.85  ? 30  ARG C O   1 
ATOM   3170 C CB  . ARG C 1 28  ? -18.854 12.393  20.755 1.00 37.38  ? 30  ARG C CB  1 
ATOM   3171 C CG  . ARG C 1 28  ? -20.023 12.937  21.568 1.00 38.59  ? 30  ARG C CG  1 
ATOM   3172 C CD  . ARG C 1 28  ? -20.544 14.270  20.999 1.00 47.53  ? 30  ARG C CD  1 
ATOM   3173 N NE  . ARG C 1 28  ? -19.439 15.220  20.782 1.00 51.95  ? 30  ARG C NE  1 
ATOM   3174 C CZ  . ARG C 1 28  ? -19.400 16.150  19.821 1.00 61.94  ? 30  ARG C CZ  1 
ATOM   3175 N NH1 . ARG C 1 28  ? -20.403 16.284  18.948 1.00 63.00  ? 30  ARG C NH1 1 
ATOM   3176 N NH2 . ARG C 1 28  ? -18.353 16.955  19.725 1.00 55.08  ? 30  ARG C NH2 1 
ATOM   3177 N N   . VAL C 1 29  ? -17.507 9.495   20.089 1.00 38.91  ? 31  VAL C N   1 
ATOM   3178 C CA  . VAL C 1 29  ? -16.915 8.865   18.909 1.00 37.58  ? 31  VAL C CA  1 
ATOM   3179 C C   . VAL C 1 29  ? -17.910 9.134   17.766 1.00 40.32  ? 31  VAL C C   1 
ATOM   3180 O O   . VAL C 1 29  ? -19.076 8.747   17.815 1.00 40.53  ? 31  VAL C O   1 
ATOM   3181 C CB  . VAL C 1 29  ? -16.710 7.344   19.097 1.00 36.57  ? 31  VAL C CB  1 
ATOM   3182 C CG1 . VAL C 1 29  ? -16.164 6.715   17.816 1.00 38.22  ? 31  VAL C CG1 1 
ATOM   3183 C CG2 . VAL C 1 29  ? -15.782 7.064   20.273 1.00 35.34  ? 31  VAL C CG2 1 
ATOM   3184 N N   . ILE C 1 30  ? -17.453 9.840   16.749 1.00 43.55  ? 32  ILE C N   1 
ATOM   3185 C CA  . ILE C 1 30  ? -18.345 10.323  15.715 1.00 46.18  ? 32  ILE C CA  1 
ATOM   3186 C C   . ILE C 1 30  ? -18.037 9.559   14.417 1.00 49.63  ? 32  ILE C C   1 
ATOM   3187 O O   . ILE C 1 30  ? -16.888 9.517   13.958 1.00 45.72  ? 32  ILE C O   1 
ATOM   3188 C CB  . ILE C 1 30  ? -18.251 11.866  15.545 1.00 47.64  ? 32  ILE C CB  1 
ATOM   3189 C CG1 . ILE C 1 30  ? -18.403 12.560  16.919 1.00 45.33  ? 32  ILE C CG1 1 
ATOM   3190 C CG2 . ILE C 1 30  ? -19.269 12.355  14.492 1.00 51.92  ? 32  ILE C CG2 1 
ATOM   3191 C CD1 . ILE C 1 30  ? -18.657 14.053  16.893 1.00 44.12  ? 32  ILE C CD1 1 
ATOM   3192 N N   . VAL C 1 31  ? -19.084 8.947   13.851 1.00 51.51  ? 33  VAL C N   1 
ATOM   3193 C CA  . VAL C 1 31  ? -18.933 7.997   12.756 1.00 54.77  ? 33  VAL C CA  1 
ATOM   3194 C C   . VAL C 1 31  ? -19.773 8.490   11.598 1.00 56.61  ? 33  VAL C C   1 
ATOM   3195 O O   . VAL C 1 31  ? -20.937 8.874   11.786 1.00 56.30  ? 33  VAL C O   1 
ATOM   3196 C CB  . VAL C 1 31  ? -19.371 6.548   13.135 1.00 54.05  ? 33  VAL C CB  1 
ATOM   3197 C CG1 . VAL C 1 31  ? -18.875 5.549   12.089 1.00 63.49  ? 33  VAL C CG1 1 
ATOM   3198 C CG2 . VAL C 1 31  ? -18.844 6.130   14.489 1.00 56.29  ? 33  VAL C CG2 1 
ATOM   3199 N N   . GLU C 1 32  ? -19.172 8.513   10.416 1.00 60.98  ? 34  GLU C N   1 
ATOM   3200 C CA  . GLU C 1 32  ? -19.885 8.892   9.186  1.00 67.06  ? 34  GLU C CA  1 
ATOM   3201 C C   . GLU C 1 32  ? -19.620 7.903   8.058  1.00 70.29  ? 34  GLU C C   1 
ATOM   3202 O O   . GLU C 1 32  ? -18.510 7.349   7.948  1.00 69.65  ? 34  GLU C O   1 
ATOM   3203 C CB  . GLU C 1 32  ? -19.503 10.299  8.737  1.00 66.88  ? 34  GLU C CB  1 
ATOM   3204 C CG  . GLU C 1 32  ? -19.708 11.365  9.793  1.00 70.52  ? 34  GLU C CG  1 
ATOM   3205 C CD  . GLU C 1 32  ? -20.073 12.715  9.202  1.00 76.30  ? 34  GLU C CD  1 
ATOM   3206 O OE1 . GLU C 1 32  ? -19.828 12.931  7.992  1.00 78.22  ? 34  GLU C OE1 1 
ATOM   3207 O OE2 . GLU C 1 32  ? -20.610 13.562  9.951  1.00 77.01  ? 34  GLU C OE2 1 
ATOM   3208 N N   . VAL C 1 33  ? -20.660 7.673   7.245  1.00 73.52  ? 35  VAL C N   1 
ATOM   3209 C CA  . VAL C 1 33  ? -20.562 6.823   6.060  1.00 75.80  ? 35  VAL C CA  1 
ATOM   3210 C C   . VAL C 1 33  ? -20.985 7.546   4.770  1.00 77.59  ? 35  VAL C C   1 
ATOM   3211 O O   . VAL C 1 33  ? -21.804 8.478   4.797  1.00 72.47  ? 35  VAL C O   1 
ATOM   3212 C CB  . VAL C 1 33  ? -21.298 5.450   6.221  1.00 76.39  ? 35  VAL C CB  1 
ATOM   3213 C CG1 . VAL C 1 33  ? -20.578 4.592   7.258  1.00 76.12  ? 35  VAL C CG1 1 
ATOM   3214 C CG2 . VAL C 1 33  ? -22.776 5.620   6.568  1.00 75.19  ? 35  VAL C CG2 1 
ATOM   3215 N N   . CYS C 1 34  ? -20.356 7.117   3.670  1.00 82.70  ? 36  CYS C N   1 
ATOM   3216 C CA  . CYS C 1 34  ? -20.646 7.564   2.297  1.00 88.86  ? 36  CYS C CA  1 
ATOM   3217 C C   . CYS C 1 34  ? -21.560 6.579   1.564  1.00 90.25  ? 36  CYS C C   1 
ATOM   3218 O O   . CYS C 1 34  ? -22.096 6.896   0.502  1.00 91.87  ? 36  CYS C O   1 
ATOM   3219 C CB  . CYS C 1 34  ? -19.341 7.728   1.500  1.00 91.17  ? 36  CYS C CB  1 
ATOM   3220 S SG  . CYS C 1 34  ? -18.748 9.441   1.353  1.00 96.72  ? 36  CYS C SG  1 
ATOM   3221 N N   . GLU C 1 35  ? -21.715 5.388   2.143  1.00 90.75  ? 37  GLU C N   1 
ATOM   3222 C CA  . GLU C 1 35  ? -22.529 4.305   1.596  1.00 91.91  ? 37  GLU C CA  1 
ATOM   3223 C C   . GLU C 1 35  ? -23.126 3.465   2.737  1.00 92.61  ? 37  GLU C C   1 
ATOM   3224 O O   . GLU C 1 35  ? -22.456 3.205   3.749  1.00 92.65  ? 37  GLU C O   1 
ATOM   3225 C CB  . GLU C 1 35  ? -21.682 3.463   0.643  1.00 93.37  ? 37  GLU C CB  1 
ATOM   3226 C CG  . GLU C 1 35  ? -21.938 1.963   0.639  1.00 96.02  ? 37  GLU C CG  1 
ATOM   3227 C CD  . GLU C 1 35  ? -20.696 1.180   0.237  1.00 101.19 ? 37  GLU C CD  1 
ATOM   3228 O OE1 . GLU C 1 35  ? -19.818 1.756   -0.450 1.00 101.43 ? 37  GLU C OE1 1 
ATOM   3229 O OE2 . GLU C 1 35  ? -20.589 -0.008  0.616  1.00 101.80 ? 37  GLU C OE2 1 
ATOM   3230 N N   . VAL C 1 36  ? -24.393 3.081   2.572  1.00 92.32  ? 38  VAL C N   1 
ATOM   3231 C CA  . VAL C 1 36  ? -25.146 2.262   3.532  1.00 91.94  ? 38  VAL C CA  1 
ATOM   3232 C C   . VAL C 1 36  ? -24.301 1.112   4.100  1.00 91.97  ? 38  VAL C C   1 
ATOM   3233 O O   . VAL C 1 36  ? -23.655 0.367   3.345  1.00 92.68  ? 38  VAL C O   1 
ATOM   3234 C CB  . VAL C 1 36  ? -26.456 1.691   2.890  1.00 93.88  ? 38  VAL C CB  1 
ATOM   3235 C CG1 . VAL C 1 36  ? -27.365 1.055   3.950  1.00 92.73  ? 38  VAL C CG1 1 
ATOM   3236 C CG2 . VAL C 1 36  ? -27.215 2.778   2.104  1.00 94.92  ? 38  VAL C CG2 1 
ATOM   3237 N N   . THR C 1 37  ? -24.295 0.988   5.431  1.00 89.71  ? 39  THR C N   1 
ATOM   3238 C CA  . THR C 1 37  ? -23.494 -0.033  6.124  1.00 88.09  ? 39  THR C CA  1 
ATOM   3239 C C   . THR C 1 37  ? -24.115 -0.509  7.443  1.00 87.05  ? 39  THR C C   1 
ATOM   3240 O O   . THR C 1 37  ? -24.803 0.254   8.121  1.00 87.91  ? 39  THR C O   1 
ATOM   3241 C CB  . THR C 1 37  ? -22.036 0.452   6.365  1.00 87.42  ? 39  THR C CB  1 
ATOM   3242 O OG1 . THR C 1 37  ? -21.510 -0.139  7.562  1.00 85.61  ? 39  THR C OG1 1 
ATOM   3243 C CG2 . THR C 1 37  ? -21.994 1.944   6.521  1.00 86.42  ? 39  THR C CG2 1 
ATOM   3244 N N   . ARG C 1 38  ? -23.872 -1.773  7.787  1.00 85.70  ? 40  ARG C N   1 
ATOM   3245 C CA  . ARG C 1 38  ? -24.233 -2.323  9.102  1.00 84.65  ? 40  ARG C CA  1 
ATOM   3246 C C   . ARG C 1 38  ? -23.066 -2.156  10.095 1.00 80.80  ? 40  ARG C C   1 
ATOM   3247 O O   . ARG C 1 38  ? -21.906 -2.076  9.680  1.00 82.18  ? 40  ARG C O   1 
ATOM   3248 C CB  . ARG C 1 38  ? -24.623 -3.800  8.976  1.00 85.67  ? 40  ARG C CB  1 
ATOM   3249 C CG  . ARG C 1 38  ? -25.594 -4.277  10.042 1.00 90.03  ? 40  ARG C CG  1 
ATOM   3250 C CD  . ARG C 1 38  ? -26.206 -5.599  9.637  1.00 100.89 ? 40  ARG C CD  1 
ATOM   3251 N NE  . ARG C 1 38  ? -27.537 -5.780  10.215 1.00 107.03 ? 40  ARG C NE  1 
ATOM   3252 C CZ  . ARG C 1 38  ? -28.184 -6.944  10.275 1.00 108.52 ? 40  ARG C CZ  1 
ATOM   3253 N NH1 . ARG C 1 38  ? -27.628 -8.057  9.804  1.00 108.35 ? 40  ARG C NH1 1 
ATOM   3254 N NH2 . ARG C 1 38  ? -29.389 -6.994  10.820 1.00 107.43 ? 40  ARG C NH2 1 
ATOM   3255 N N   . VAL C 1 39  ? -23.363 -2.104  11.393 1.00 76.03  ? 41  VAL C N   1 
ATOM   3256 C CA  . VAL C 1 39  ? -22.309 -1.945  12.396 1.00 71.16  ? 41  VAL C CA  1 
ATOM   3257 C C   . VAL C 1 39  ? -22.514 -2.844  13.620 1.00 71.10  ? 41  VAL C C   1 
ATOM   3258 O O   . VAL C 1 39  ? -23.452 -2.661  14.390 1.00 70.74  ? 41  VAL C O   1 
ATOM   3259 C CB  . VAL C 1 39  ? -22.165 -0.467  12.823 1.00 71.41  ? 41  VAL C CB  1 
ATOM   3260 C CG1 . VAL C 1 39  ? -21.184 -0.337  13.980 1.00 63.14  ? 41  VAL C CG1 1 
ATOM   3261 C CG2 . VAL C 1 39  ? -21.750 0.415   11.633 1.00 68.02  ? 41  VAL C CG2 1 
ATOM   3262 N N   . LYS C 1 40  ? -21.634 -3.822  13.792 1.00 70.23  ? 42  LYS C N   1 
ATOM   3263 C CA  . LYS C 1 40  ? -21.730 -4.742  14.926 1.00 70.83  ? 42  LYS C CA  1 
ATOM   3264 C C   . LYS C 1 40  ? -21.525 -4.034  16.278 1.00 69.08  ? 42  LYS C C   1 
ATOM   3265 O O   . LYS C 1 40  ? -22.190 -4.357  17.277 1.00 66.84  ? 42  LYS C O   1 
ATOM   3266 C CB  . LYS C 1 40  ? -20.754 -5.919  14.758 1.00 71.50  ? 42  LYS C CB  1 
ATOM   3267 C CG  . LYS C 1 40  ? -20.640 -6.854  15.995 1.00 77.18  ? 42  LYS C CG  1 
ATOM   3268 C CD  . LYS C 1 40  ? -19.690 -8.040  15.761 1.00 84.61  ? 42  LYS C CD  1 
ATOM   3269 C CE  . LYS C 1 40  ? -20.345 -9.123  14.889 1.00 95.53  ? 42  LYS C CE  1 
ATOM   3270 N NZ  . LYS C 1 40  ? -19.469 -10.323 14.687 1.00 100.64 ? 42  LYS C NZ  1 
ATOM   3271 N N   . ALA C 1 41  ? -20.597 -3.073  16.295 1.00 67.08  ? 43  ALA C N   1 
ATOM   3272 C CA  . ALA C 1 41  ? -20.229 -2.356  17.499 1.00 63.62  ? 43  ALA C CA  1 
ATOM   3273 C C   . ALA C 1 41  ? -19.408 -1.092  17.232 1.00 62.02  ? 43  ALA C C   1 
ATOM   3274 O O   . ALA C 1 41  ? -18.838 -0.904  16.146 1.00 61.39  ? 43  ALA C O   1 
ATOM   3275 C CB  . ALA C 1 41  ? -19.461 -3.292  18.471 1.00 65.17  ? 43  ALA C CB  1 
ATOM   3276 N N   . VAL C 1 42  ? -19.416 -0.216  18.240 1.00 59.58  ? 44  VAL C N   1 
ATOM   3277 C CA  . VAL C 1 42  ? -18.365 0.764   18.483 1.00 53.38  ? 44  VAL C CA  1 
ATOM   3278 C C   . VAL C 1 42  ? -17.899 0.544   19.907 1.00 54.16  ? 44  VAL C C   1 
ATOM   3279 O O   . VAL C 1 42  ? -18.699 0.578   20.850 1.00 54.57  ? 44  VAL C O   1 
ATOM   3280 C CB  . VAL C 1 42  ? -18.812 2.214   18.216 1.00 52.78  ? 44  VAL C CB  1 
ATOM   3281 C CG1 . VAL C 1 42  ? -17.767 3.210   18.656 1.00 48.09  ? 44  VAL C CG1 1 
ATOM   3282 C CG2 . VAL C 1 42  ? -19.023 2.400   16.750 1.00 38.71  ? 44  VAL C CG2 1 
ATOM   3283 N N   . ARG C 1 43  ? -16.601 0.262   20.044 1.00 51.66  ? 45  ARG C N   1 
ATOM   3284 C CA  . ARG C 1 43  ? -15.962 0.118   21.347 1.00 52.61  ? 45  ARG C CA  1 
ATOM   3285 C C   . ARG C 1 43  ? -14.870 1.170   21.470 1.00 49.14  ? 45  ARG C C   1 
ATOM   3286 O O   . ARG C 1 43  ? -14.375 1.687   20.467 1.00 44.68  ? 45  ARG C O   1 
ATOM   3287 C CB  . ARG C 1 43  ? -15.359 -1.284  21.528 1.00 53.33  ? 45  ARG C CB  1 
ATOM   3288 C CG  . ARG C 1 43  ? -16.387 -2.420  21.528 1.00 57.85  ? 45  ARG C CG  1 
ATOM   3289 C CD  . ARG C 1 43  ? -15.754 -3.786  21.290 1.00 59.88  ? 45  ARG C CD  1 
ATOM   3290 N NE  . ARG C 1 43  ? -15.003 -3.829  20.030 1.00 63.98  ? 45  ARG C NE  1 
ATOM   3291 C CZ  . ARG C 1 43  ? -13.707 -4.132  19.919 1.00 62.92  ? 45  ARG C CZ  1 
ATOM   3292 N NH1 . ARG C 1 43  ? -12.984 -4.453  20.995 1.00 56.79  ? 45  ARG C NH1 1 
ATOM   3293 N NH2 . ARG C 1 43  ? -13.136 -4.140  18.714 1.00 61.51  ? 45  ARG C NH2 1 
ATOM   3294 N N   . ILE C 1 44  ? -14.562 1.508   22.711 1.00 47.95  ? 46  ILE C N   1 
ATOM   3295 C CA  . ILE C 1 44  ? -13.364 2.243   23.028 1.00 47.13  ? 46  ILE C CA  1 
ATOM   3296 C C   . ILE C 1 44  ? -12.468 1.458   23.962 1.00 46.73  ? 46  ILE C C   1 
ATOM   3297 O O   . ILE C 1 44  ? -12.930 0.646   24.780 1.00 49.38  ? 46  ILE C O   1 
ATOM   3298 C CB  . ILE C 1 44  ? -13.663 3.613   23.691 1.00 43.36  ? 46  ILE C CB  1 
ATOM   3299 C CG1 . ILE C 1 44  ? -14.570 3.450   24.913 1.00 40.23  ? 46  ILE C CG1 1 
ATOM   3300 C CG2 . ILE C 1 44  ? -14.228 4.582   22.659 1.00 36.33  ? 46  ILE C CG2 1 
ATOM   3301 C CD1 . ILE C 1 44  ? -14.436 4.648   25.906 1.00 47.63  ? 46  ILE C CD1 1 
ATOM   3302 N N   . LEU C 1 45  ? -11.174 1.745   23.869 1.00 45.35  ? 47  LEU C N   1 
ATOM   3303 C CA  . LEU C 1 45  ? -10.226 1.434   24.949 1.00 39.77  ? 47  LEU C CA  1 
ATOM   3304 C C   . LEU C 1 45  ? -9.485  2.714   25.388 1.00 37.68  ? 47  LEU C C   1 
ATOM   3305 O O   . LEU C 1 45  ? -9.011  3.475   24.551 1.00 37.25  ? 47  LEU C O   1 
ATOM   3306 C CB  . LEU C 1 45  ? -9.239  0.377   24.464 1.00 43.45  ? 47  LEU C CB  1 
ATOM   3307 C CG  . LEU C 1 45  ? -8.012  0.091   25.293 1.00 45.31  ? 47  LEU C CG  1 
ATOM   3308 C CD1 . LEU C 1 45  ? -8.321  -0.728  26.566 1.00 50.58  ? 47  LEU C CD1 1 
ATOM   3309 C CD2 . LEU C 1 45  ? -6.978  -0.605  24.394 1.00 56.24  ? 47  LEU C CD2 1 
ATOM   3310 N N   . ALA C 1 46  ? -9.422  2.973   26.688 1.00 38.30  ? 48  ALA C N   1 
ATOM   3311 C CA  . ALA C 1 46  ? -8.664  4.110   27.181 1.00 38.70  ? 48  ALA C CA  1 
ATOM   3312 C C   . ALA C 1 46  ? -7.540  3.621   28.057 1.00 40.50  ? 48  ALA C C   1 
ATOM   3313 O O   . ALA C 1 46  ? -7.766  2.949   29.054 1.00 44.16  ? 48  ALA C O   1 
ATOM   3314 C CB  . ALA C 1 46  ? -9.512  5.060   27.964 1.00 33.18  ? 48  ALA C CB  1 
ATOM   3315 N N   . CYS C 1 47  ? -6.337  4.040   27.730 1.00 39.72  ? 49  CYS C N   1 
ATOM   3316 C CA  . CYS C 1 47  ? -5.157  3.557   28.452 1.00 37.47  ? 49  CYS C CA  1 
ATOM   3317 C C   . CYS C 1 47  ? -4.281  4.688   28.874 1.00 33.95  ? 49  CYS C C   1 
ATOM   3318 O O   . CYS C 1 47  ? -4.221  5.735   28.226 1.00 31.77  ? 49  CYS C O   1 
ATOM   3319 C CB  . CYS C 1 47  ? -4.328  2.638   27.554 1.00 41.22  ? 49  CYS C CB  1 
ATOM   3320 S SG  . CYS C 1 47  ? -5.025  0.979   27.279 1.00 58.50  ? 49  CYS C SG  1 
ATOM   3321 N N   . GLY C 1 48  ? -3.528  4.445   29.933 1.00 30.45  ? 50  GLY C N   1 
ATOM   3322 C CA  . GLY C 1 48  ? -2.595  5.401   30.434 1.00 28.90  ? 50  GLY C CA  1 
ATOM   3323 C C   . GLY C 1 48  ? -1.460  4.527   30.879 1.00 32.38  ? 50  GLY C C   1 
ATOM   3324 O O   . GLY C 1 48  ? -1.618  3.712   31.783 1.00 29.45  ? 50  GLY C O   1 
ATOM   3325 N N   . VAL C 1 49  ? -0.325  4.667   30.221 1.00 33.86  ? 51  VAL C N   1 
ATOM   3326 C CA  . VAL C 1 49  ? 0.848   3.865   30.611 1.00 33.96  ? 51  VAL C CA  1 
ATOM   3327 C C   . VAL C 1 49  ? 2.137   4.666   30.637 1.00 32.93  ? 51  VAL C C   1 
ATOM   3328 O O   . VAL C 1 49  ? 2.387   5.499   29.758 1.00 33.77  ? 51  VAL C O   1 
ATOM   3329 C CB  . VAL C 1 49  ? 0.981   2.594   29.760 1.00 36.48  ? 51  VAL C CB  1 
ATOM   3330 C CG1 . VAL C 1 49  ? 1.107   2.951   28.271 1.00 39.96  ? 51  VAL C CG1 1 
ATOM   3331 C CG2 . VAL C 1 49  ? 2.198   1.713   30.250 1.00 37.00  ? 51  VAL C CG2 1 
ATOM   3332 N N   . ALA C 1 50  ? 2.946   4.413   31.670 1.00 33.23  ? 52  ALA C N   1 
ATOM   3333 C CA  . ALA C 1 50  ? 4.292   4.986   31.817 1.00 33.62  ? 52  ALA C CA  1 
ATOM   3334 C C   . ALA C 1 50  ? 5.328   3.882   31.678 1.00 37.98  ? 52  ALA C C   1 
ATOM   3335 O O   . ALA C 1 50  ? 5.094   2.744   32.100 1.00 33.99  ? 52  ALA C O   1 
ATOM   3336 C CB  . ALA C 1 50  ? 4.449   5.673   33.151 1.00 35.15  ? 52  ALA C CB  1 
ATOM   3337 N N   . LYS C 1 51  ? 6.440   4.205   31.021 1.00 39.22  ? 53  LYS C N   1 
ATOM   3338 C CA  . LYS C 1 51  ? 7.590   3.300   30.924 1.00 44.24  ? 53  LYS C CA  1 
ATOM   3339 C C   . LYS C 1 51  ? 8.811   4.103   31.270 1.00 47.42  ? 53  LYS C C   1 
ATOM   3340 O O   . LYS C 1 51  ? 9.060   5.143   30.652 1.00 52.06  ? 53  LYS C O   1 
ATOM   3341 C CB  . LYS C 1 51  ? 7.734   2.770   29.513 1.00 42.77  ? 53  LYS C CB  1 
ATOM   3342 C CG  . LYS C 1 51  ? 6.458   2.250   28.959 1.00 50.49  ? 53  LYS C CG  1 
ATOM   3343 C CD  . LYS C 1 51  ? 6.668   1.390   27.732 1.00 60.79  ? 53  LYS C CD  1 
ATOM   3344 C CE  . LYS C 1 51  ? 5.385   0.671   27.347 1.00 62.92  ? 53  LYS C CE  1 
ATOM   3345 N NZ  . LYS C 1 51  ? 4.468   1.538   26.537 1.00 69.84  ? 53  LYS C NZ  1 
ATOM   3346 N N   . VAL C 1 52  ? 9.540   3.656   32.282 1.00 44.83  ? 54  VAL C N   1 
ATOM   3347 C CA  . VAL C 1 52  ? 10.798  4.271   32.681 1.00 45.99  ? 54  VAL C CA  1 
ATOM   3348 C C   . VAL C 1 52  ? 11.858  3.263   32.208 1.00 45.23  ? 54  VAL C C   1 
ATOM   3349 O O   . VAL C 1 52  ? 11.706  2.061   32.397 1.00 44.06  ? 54  VAL C O   1 
ATOM   3350 C CB  . VAL C 1 52  ? 10.834  4.549   34.207 1.00 42.02  ? 54  VAL C CB  1 
ATOM   3351 C CG1 . VAL C 1 52  ? 12.011  5.414   34.608 1.00 55.23  ? 54  VAL C CG1 1 
ATOM   3352 C CG2 . VAL C 1 52  ? 9.543   5.243   34.644 1.00 56.55  ? 54  VAL C CG2 1 
ATOM   3353 N N   . LEU C 1 53  ? 12.874  3.755   31.507 1.00 45.88  ? 55  LEU C N   1 
ATOM   3354 C CA  . LEU C 1 53  ? 13.875  2.917   30.889 1.00 45.56  ? 55  LEU C CA  1 
ATOM   3355 C C   . LEU C 1 53  ? 15.176  3.641   31.190 1.00 45.66  ? 55  LEU C C   1 
ATOM   3356 O O   . LEU C 1 53  ? 15.204  4.870   31.088 1.00 45.78  ? 55  LEU C O   1 
ATOM   3357 C CB  . LEU C 1 53  ? 13.622  2.923   29.381 1.00 51.51  ? 55  LEU C CB  1 
ATOM   3358 C CG  . LEU C 1 53  ? 13.965  1.722   28.500 1.00 60.31  ? 55  LEU C CG  1 
ATOM   3359 C CD1 . LEU C 1 53  ? 13.160  0.503   28.913 1.00 63.96  ? 55  LEU C CD1 1 
ATOM   3360 C CD2 . LEU C 1 53  ? 13.696  2.047   27.036 1.00 57.85  ? 55  LEU C CD2 1 
ATOM   3361 N N   . TRP C 1 54  ? 16.215  2.914   31.628 1.00 41.80  ? 56  TRP C N   1 
ATOM   3362 C CA  . TRP C 1 54  ? 17.577  3.473   31.848 1.00 41.80  ? 56  TRP C CA  1 
ATOM   3363 C C   . TRP C 1 54  ? 18.620  2.365   31.721 1.00 44.31  ? 56  TRP C C   1 
ATOM   3364 O O   . TRP C 1 54  ? 18.275  1.191   31.773 1.00 41.04  ? 56  TRP C O   1 
ATOM   3365 C CB  . TRP C 1 54  ? 17.745  4.202   33.222 1.00 40.69  ? 56  TRP C CB  1 
ATOM   3366 C CG  . TRP C 1 54  ? 17.714  3.321   34.476 1.00 41.51  ? 56  TRP C CG  1 
ATOM   3367 C CD1 . TRP C 1 54  ? 18.796  2.938   35.261 1.00 40.23  ? 56  TRP C CD1 1 
ATOM   3368 C CD2 . TRP C 1 54  ? 16.549  2.756   35.110 1.00 38.91  ? 56  TRP C CD2 1 
ATOM   3369 N NE1 . TRP C 1 54  ? 18.358  2.136   36.288 1.00 38.56  ? 56  TRP C NE1 1 
ATOM   3370 C CE2 . TRP C 1 54  ? 16.996  2.017   36.229 1.00 42.97  ? 56  TRP C CE2 1 
ATOM   3371 C CE3 . TRP C 1 54  ? 15.181  2.777   34.820 1.00 38.13  ? 56  TRP C CE3 1 
ATOM   3372 C CZ2 . TRP C 1 54  ? 16.118  1.337   37.075 1.00 40.06  ? 56  TRP C CZ2 1 
ATOM   3373 C CZ3 . TRP C 1 54  ? 14.313  2.075   35.649 1.00 48.51  ? 56  TRP C CZ3 1 
ATOM   3374 C CH2 . TRP C 1 54  ? 14.798  1.357   36.761 1.00 39.78  ? 56  TRP C CH2 1 
ATOM   3375 N N   . MET C 1 55  ? 19.884  2.755   31.578 1.00 45.75  ? 57  MET C N   1 
ATOM   3376 C CA  . MET C 1 55  ? 21.011  1.813   31.496 1.00 49.41  ? 57  MET C CA  1 
ATOM   3377 C C   . MET C 1 55  ? 21.740  1.826   32.826 1.00 48.25  ? 57  MET C C   1 
ATOM   3378 O O   . MET C 1 55  ? 22.091  2.893   33.327 1.00 51.29  ? 57  MET C O   1 
ATOM   3379 C CB  . MET C 1 55  ? 22.012  2.213   30.384 1.00 53.79  ? 57  MET C CB  1 
ATOM   3380 C CG  . MET C 1 55  ? 21.487  2.181   28.963 1.00 45.31  ? 57  MET C CG  1 
ATOM   3381 S SD  . MET C 1 55  ? 20.873  0.576   28.472 1.00 54.96  ? 57  MET C SD  1 
ATOM   3382 C CE  . MET C 1 55  ? 22.358  -0.379  28.720 1.00 46.97  ? 57  MET C CE  1 
ATOM   3383 N N   . GLN C 1 56  ? 21.928  0.654   33.424 1.00 46.45  ? 58  GLN C N   1 
ATOM   3384 C CA  . GLN C 1 56  ? 22.818  0.534   34.581 1.00 50.28  ? 58  GLN C CA  1 
ATOM   3385 C C   . GLN C 1 56  ? 24.048  -0.188  34.053 1.00 48.71  ? 58  GLN C C   1 
ATOM   3386 O O   . GLN C 1 56  ? 24.023  -1.396  33.818 1.00 50.59  ? 58  GLN C O   1 
ATOM   3387 C CB  . GLN C 1 56  ? 22.135  -0.246  35.722 1.00 52.33  ? 58  GLN C CB  1 
ATOM   3388 C CG  . GLN C 1 56  ? 22.534  0.176   37.163 1.00 50.65  ? 58  GLN C CG  1 
ATOM   3389 C CD  . GLN C 1 56  ? 21.854  1.496   37.609 1.00 69.11  ? 58  GLN C CD  1 
ATOM   3390 O OE1 . GLN C 1 56  ? 20.595  1.623   37.678 1.00 60.20  ? 58  GLN C OE1 1 
ATOM   3391 N NE2 . GLN C 1 56  ? 22.691  2.475   37.938 1.00 64.64  ? 58  GLN C NE2 1 
ATOM   3392 N N   . GLY C 1 57  ? 25.102  0.566   33.783 1.00 51.29  ? 59  GLY C N   1 
ATOM   3393 C CA  . GLY C 1 57  ? 26.254  0.010   33.076 1.00 50.99  ? 59  GLY C CA  1 
ATOM   3394 C C   . GLY C 1 57  ? 25.806  -0.465  31.723 1.00 52.32  ? 59  GLY C C   1 
ATOM   3395 O O   . GLY C 1 57  ? 25.148  0.281   30.981 1.00 54.27  ? 59  GLY C O   1 
ATOM   3396 N N   . SER C 1 58  ? 26.104  -1.718  31.394 1.00 54.72  ? 60  SER C N   1 
ATOM   3397 C CA  . SER C 1 58  ? 25.664  -2.272  30.110 1.00 58.42  ? 60  SER C CA  1 
ATOM   3398 C C   . SER C 1 58  ? 24.274  -2.874  30.112 1.00 57.43  ? 60  SER C C   1 
ATOM   3399 O O   . SER C 1 58  ? 23.844  -3.446  29.091 1.00 55.19  ? 60  SER C O   1 
ATOM   3400 C CB  . SER C 1 58  ? 26.603  -3.371  29.676 1.00 61.42  ? 60  SER C CB  1 
ATOM   3401 O OG  . SER C 1 58  ? 26.536  -4.449  30.579 1.00 60.62  ? 60  SER C OG  1 
ATOM   3402 N N   . GLN C 1 59  ? 23.584  -2.786  31.250 1.00 53.40  ? 61  GLN C N   1 
ATOM   3403 C CA  . GLN C 1 59  ? 22.290  -3.458  31.429 1.00 52.45  ? 61  GLN C CA  1 
ATOM   3404 C C   . GLN C 1 59  ? 21.129  -2.451  31.439 1.00 48.61  ? 61  GLN C C   1 
ATOM   3405 O O   . GLN C 1 59  ? 21.156  -1.483  32.239 1.00 45.56  ? 61  GLN C O   1 
ATOM   3406 C CB  . GLN C 1 59  ? 22.299  -4.207  32.765 1.00 56.14  ? 61  GLN C CB  1 
ATOM   3407 C CG  . GLN C 1 59  ? 21.020  -5.015  33.046 1.00 60.55  ? 61  GLN C CG  1 
ATOM   3408 C CD  . GLN C 1 59  ? 21.184  -6.490  32.720 1.00 70.95  ? 61  GLN C CD  1 
ATOM   3409 O OE1 . GLN C 1 59  ? 20.330  -7.099  32.074 1.00 78.38  ? 61  GLN C OE1 1 
ATOM   3410 N NE2 . GLN C 1 59  ? 22.295  -7.068  33.165 1.00 83.60  ? 61  GLN C NE2 1 
ATOM   3411 N N   . GLN C 1 60  ? 20.124  -2.700  30.593 1.00 44.93  ? 62  GLN C N   1 
ATOM   3412 C CA  . GLN C 1 60  ? 18.903  -1.872  30.535 1.00 47.09  ? 62  GLN C CA  1 
ATOM   3413 C C   . GLN C 1 60  ? 17.955  -2.318  31.625 1.00 45.56  ? 62  GLN C C   1 
ATOM   3414 O O   . GLN C 1 60  ? 17.813  -3.522  31.860 1.00 48.25  ? 62  GLN C O   1 
ATOM   3415 C CB  . GLN C 1 60  ? 18.187  -2.006  29.184 1.00 47.53  ? 62  GLN C CB  1 
ATOM   3416 C CG  . GLN C 1 60  ? 17.085  -0.958  29.003 1.00 47.07  ? 62  GLN C CG  1 
ATOM   3417 C CD  . GLN C 1 60  ? 16.425  -1.003  27.648 1.00 61.30  ? 62  GLN C CD  1 
ATOM   3418 O OE1 . GLN C 1 60  ? 16.563  -1.967  26.896 1.00 72.36  ? 62  GLN C OE1 1 
ATOM   3419 N NE2 . GLN C 1 60  ? 15.706  0.048   27.324 1.00 59.67  ? 62  GLN C NE2 1 
ATOM   3420 N N   . CYS C 1 61  ? 17.318  -1.363  32.303 1.00 42.41  ? 63  CYS C N   1 
ATOM   3421 C CA  . CYS C 1 61  ? 16.350  -1.696  33.354 1.00 39.89  ? 63  CYS C CA  1 
ATOM   3422 C C   . CYS C 1 61  ? 15.079  -0.970  32.992 1.00 40.97  ? 63  CYS C C   1 
ATOM   3423 O O   . CYS C 1 61  ? 15.147  0.113   32.403 1.00 38.89  ? 63  CYS C O   1 
ATOM   3424 C CB  . CYS C 1 61  ? 16.877  -1.330  34.759 1.00 41.74  ? 63  CYS C CB  1 
ATOM   3425 S SG  . CYS C 1 61  ? 18.352  -2.344  35.088 1.00 53.61  ? 63  CYS C SG  1 
ATOM   3426 N N   . LYS C 1 62  ? 13.943  -1.599  33.279 1.00 36.18  ? 64  LYS C N   1 
ATOM   3427 C CA  . LYS C 1 62  ? 12.636  -1.098  32.817 1.00 36.56  ? 64  LYS C CA  1 
ATOM   3428 C C   . LYS C 1 62  ? 11.550  -1.295  33.881 1.00 34.32  ? 64  LYS C C   1 
ATOM   3429 O O   . LYS C 1 62  ? 11.443  -2.380  34.472 1.00 29.46  ? 64  LYS C O   1 
ATOM   3430 C CB  . LYS C 1 62  ? 12.266  -1.817  31.513 1.00 40.44  ? 64  LYS C CB  1 
ATOM   3431 C CG  . LYS C 1 62  ? 10.928  -1.367  30.871 1.00 54.03  ? 64  LYS C CG  1 
ATOM   3432 C CD  . LYS C 1 62  ? 10.531  -2.367  29.776 1.00 58.58  ? 64  LYS C CD  1 
ATOM   3433 C CE  . LYS C 1 62  ? 9.741   -1.716  28.645 1.00 70.35  ? 64  LYS C CE  1 
ATOM   3434 N NZ  . LYS C 1 62  ? 9.498   -2.716  27.573 1.00 71.09  ? 64  LYS C NZ  1 
ATOM   3435 N N   . GLN C 1 63  ? 10.785  -0.233  34.174 1.00 34.99  ? 65  GLN C N   1 
ATOM   3436 C CA  . GLN C 1 63  ? 9.559   -0.321  34.992 1.00 35.59  ? 65  GLN C CA  1 
ATOM   3437 C C   . GLN C 1 63  ? 8.394   0.192   34.133 1.00 37.39  ? 65  GLN C C   1 
ATOM   3438 O O   . GLN C 1 63  ? 8.407   1.341   33.706 1.00 38.26  ? 65  GLN C O   1 
ATOM   3439 C CB  . GLN C 1 63  ? 9.628   0.498   36.288 1.00 34.54  ? 65  GLN C CB  1 
ATOM   3440 C CG  . GLN C 1 63  ? 8.310   0.488   37.137 1.00 34.18  ? 65  GLN C CG  1 
ATOM   3441 C CD  . GLN C 1 63  ? 8.445   1.022   38.580 1.00 38.75  ? 65  GLN C CD  1 
ATOM   3442 O OE1 . GLN C 1 63  ? 9.418   1.691   38.933 1.00 44.57  ? 65  GLN C OE1 1 
ATOM   3443 N NE2 . GLN C 1 63  ? 7.453   0.708   39.424 1.00 39.44  ? 65  GLN C NE2 1 
ATOM   3444 N N   . THR C 1 64  ? 7.438   -0.688  33.848 1.00 35.54  ? 66  THR C N   1 
ATOM   3445 C CA  . THR C 1 64  ? 6.207   -0.317  33.151 1.00 35.74  ? 66  THR C CA  1 
ATOM   3446 C C   . THR C 1 64  ? 5.089   -0.170  34.193 1.00 34.51  ? 66  THR C C   1 
ATOM   3447 O O   . THR C 1 64  ? 4.942   -1.025  35.078 1.00 35.28  ? 66  THR C O   1 
ATOM   3448 C CB  . THR C 1 64  ? 5.854   -1.357  32.102 1.00 37.66  ? 66  THR C CB  1 
ATOM   3449 O OG1 . THR C 1 64  ? 6.931   -1.440  31.149 1.00 47.53  ? 66  THR C OG1 1 
ATOM   3450 C CG2 . THR C 1 64  ? 4.577   -0.965  31.379 1.00 45.48  ? 66  THR C CG2 1 
ATOM   3451 N N   . SER C 1 65  ? 4.333   0.922   34.104 1.00 32.64  ? 67  SER C N   1 
ATOM   3452 C CA  . SER C 1 65  ? 3.257   1.242   35.068 1.00 29.21  ? 67  SER C CA  1 
ATOM   3453 C C   . SER C 1 65  ? 1.985   1.686   34.321 1.00 34.34  ? 67  SER C C   1 
ATOM   3454 O O   . SER C 1 65  ? 1.977   2.750   33.696 1.00 35.39  ? 67  SER C O   1 
ATOM   3455 C CB  . SER C 1 65  ? 3.674   2.384   35.966 1.00 31.38  ? 67  SER C CB  1 
ATOM   3456 O OG  . SER C 1 65  ? 4.775   2.043   36.771 1.00 35.34  ? 67  SER C OG  1 
ATOM   3457 N N   . GLU C 1 66  ? 0.926   0.880   34.411 1.00 29.94  ? 68  GLU C N   1 
ATOM   3458 C CA  . GLU C 1 66  ? -0.407  1.226   33.953 1.00 35.67  ? 68  GLU C CA  1 
ATOM   3459 C C   . GLU C 1 66  ? -1.121  2.126   34.957 1.00 35.86  ? 68  GLU C C   1 
ATOM   3460 O O   . GLU C 1 66  ? -1.139  1.857   36.147 1.00 37.44  ? 68  GLU C O   1 
ATOM   3461 C CB  . GLU C 1 66  ? -1.196  -0.046  33.791 1.00 35.10  ? 68  GLU C CB  1 
ATOM   3462 C CG  . GLU C 1 66  ? -1.099  -0.618  32.454 1.00 39.74  ? 68  GLU C CG  1 
ATOM   3463 C CD  . GLU C 1 66  ? -1.923  -1.862  32.345 1.00 51.49  ? 68  GLU C CD  1 
ATOM   3464 O OE1 . GLU C 1 66  ? -3.058  -1.799  31.821 1.00 42.14  ? 68  GLU C OE1 1 
ATOM   3465 O OE2 . GLU C 1 66  ? -1.431  -2.907  32.810 1.00 40.04  ? 68  GLU C OE2 1 
ATOM   3466 N N   . TYR C 1 67  ? -1.717  3.205   34.473 1.00 39.06  ? 69  TYR C N   1 
ATOM   3467 C CA  . TYR C 1 67  ? -2.383  4.145   35.349 1.00 36.53  ? 69  TYR C CA  1 
ATOM   3468 C C   . TYR C 1 67  ? -3.856  4.177   35.082 1.00 36.39  ? 69  TYR C C   1 
ATOM   3469 O O   . TYR C 1 67  ? -4.622  4.580   35.954 1.00 38.39  ? 69  TYR C O   1 
ATOM   3470 C CB  . TYR C 1 67  ? -1.817  5.551   35.192 1.00 36.91  ? 69  TYR C CB  1 
ATOM   3471 C CG  . TYR C 1 67  ? -0.489  5.700   35.806 1.00 40.23  ? 69  TYR C CG  1 
ATOM   3472 C CD1 . TYR C 1 67  ? 0.662   5.747   35.010 1.00 31.59  ? 69  TYR C CD1 1 
ATOM   3473 C CD2 . TYR C 1 67  ? -0.353  5.785   37.183 1.00 37.46  ? 69  TYR C CD2 1 
ATOM   3474 C CE1 . TYR C 1 67  ? 1.862   5.867   35.555 1.00 39.17  ? 69  TYR C CE1 1 
ATOM   3475 C CE2 . TYR C 1 67  ? 0.891   5.924   37.756 1.00 42.46  ? 69  TYR C CE2 1 
ATOM   3476 C CZ  . TYR C 1 67  ? 1.981   5.946   36.927 1.00 39.44  ? 69  TYR C CZ  1 
ATOM   3477 O OH  . TYR C 1 67  ? 3.206   6.078   37.442 1.00 38.60  ? 69  TYR C OH  1 
ATOM   3478 N N   . LEU C 1 68  ? -4.236  3.737   33.887 1.00 35.65  ? 70  LEU C N   1 
ATOM   3479 C CA  . LEU C 1 68  ? -5.596  3.770   33.420 1.00 37.67  ? 70  LEU C CA  1 
ATOM   3480 C C   . LEU C 1 68  ? -5.841  2.586   32.520 1.00 39.55  ? 70  LEU C C   1 
ATOM   3481 O O   . LEU C 1 68  ? -5.165  2.402   31.500 1.00 39.62  ? 70  LEU C O   1 
ATOM   3482 C CB  . LEU C 1 68  ? -5.849  5.023   32.585 1.00 33.01  ? 70  LEU C CB  1 
ATOM   3483 C CG  . LEU C 1 68  ? -7.176  5.116   31.832 1.00 37.37  ? 70  LEU C CG  1 
ATOM   3484 C CD1 . LEU C 1 68  ? -8.385  5.207   32.838 1.00 38.22  ? 70  LEU C CD1 1 
ATOM   3485 C CD2 . LEU C 1 68  ? -7.173  6.303   30.853 1.00 29.35  ? 70  LEU C CD2 1 
ATOM   3486 N N   . ARG C 1 69  ? -6.843  1.791   32.857 1.00 39.57  ? 71  ARG C N   1 
ATOM   3487 C CA  . ARG C 1 69  ? -7.221  0.719   31.968 1.00 42.45  ? 71  ARG C CA  1 
ATOM   3488 C C   . ARG C 1 69  ? -8.719  0.578   32.110 1.00 49.35  ? 71  ARG C C   1 
ATOM   3489 O O   . ARG C 1 69  ? -9.220  0.103   33.135 1.00 48.76  ? 71  ARG C O   1 
ATOM   3490 C CB  . ARG C 1 69  ? -6.499  -0.584  32.287 1.00 46.07  ? 71  ARG C CB  1 
ATOM   3491 C CG  . ARG C 1 69  ? -6.740  -1.686  31.241 1.00 44.05  ? 71  ARG C CG  1 
ATOM   3492 C CD  . ARG C 1 69  ? -6.548  -3.062  31.869 1.00 50.53  ? 71  ARG C CD  1 
ATOM   3493 N NE  . ARG C 1 69  ? -5.197  -3.260  32.407 1.00 48.19  ? 71  ARG C NE  1 
ATOM   3494 C CZ  . ARG C 1 69  ? -4.846  -4.252  33.216 1.00 43.46  ? 71  ARG C CZ  1 
ATOM   3495 N NH1 . ARG C 1 69  ? -5.740  -5.125  33.637 1.00 44.70  ? 71  ARG C NH1 1 
ATOM   3496 N NH2 . ARG C 1 69  ? -3.590  -4.357  33.635 1.00 45.05  ? 71  ARG C NH2 1 
ATOM   3497 N N   . TYR C 1 70  ? -9.392  1.041   31.058 1.00 47.35  ? 72  TYR C N   1 
ATOM   3498 C CA  . TYR C 1 70  ? -10.814 1.270   31.014 1.00 50.02  ? 72  TYR C CA  1 
ATOM   3499 C C   . TYR C 1 70  ? -11.260 0.820   29.643 1.00 49.18  ? 72  TYR C C   1 
ATOM   3500 O O   . TYR C 1 70  ? -10.721 1.238   28.631 1.00 50.76  ? 72  TYR C O   1 
ATOM   3501 C CB  . TYR C 1 70  ? -11.142 2.774   31.209 1.00 47.06  ? 72  TYR C CB  1 
ATOM   3502 C CG  . TYR C 1 70  ? -12.595 3.104   30.923 1.00 53.93  ? 72  TYR C CG  1 
ATOM   3503 C CD1 . TYR C 1 70  ? -13.547 3.082   31.950 1.00 49.47  ? 72  TYR C CD1 1 
ATOM   3504 C CD2 . TYR C 1 70  ? -13.029 3.398   29.619 1.00 44.53  ? 72  TYR C CD2 1 
ATOM   3505 C CE1 . TYR C 1 70  ? -14.911 3.367   31.689 1.00 62.88  ? 72  TYR C CE1 1 
ATOM   3506 C CE2 . TYR C 1 70  ? -14.379 3.685   29.356 1.00 57.30  ? 72  TYR C CE2 1 
ATOM   3507 C CZ  . TYR C 1 70  ? -15.312 3.664   30.393 1.00 56.38  ? 72  TYR C CZ  1 
ATOM   3508 O OH  . TYR C 1 70  ? -16.640 3.948   30.135 1.00 67.23  ? 72  TYR C OH  1 
ATOM   3509 N N   . GLU C 1 71  ? -12.267 -0.037  29.605 1.00 53.14  ? 73  GLU C N   1 
ATOM   3510 C CA  . GLU C 1 71  ? -12.822 -0.467  28.341 1.00 52.55  ? 73  GLU C CA  1 
ATOM   3511 C C   . GLU C 1 71  ? -14.358 -0.395  28.440 1.00 53.82  ? 73  GLU C C   1 
ATOM   3512 O O   . GLU C 1 71  ? -14.914 -0.325  29.545 1.00 54.71  ? 73  GLU C O   1 
ATOM   3513 C CB  . GLU C 1 71  ? -12.324 -1.873  27.999 1.00 54.29  ? 73  GLU C CB  1 
ATOM   3514 C CG  . GLU C 1 71  ? -12.148 -2.122  26.499 1.00 64.37  ? 73  GLU C CG  1 
ATOM   3515 C CD  . GLU C 1 71  ? -11.610 -3.515  26.164 1.00 74.96  ? 73  GLU C CD  1 
ATOM   3516 O OE1 . GLU C 1 71  ? -11.269 -4.276  27.103 1.00 78.99  ? 73  GLU C OE1 1 
ATOM   3517 O OE2 . GLU C 1 71  ? -11.529 -3.846  24.951 1.00 78.41  ? 73  GLU C OE2 1 
ATOM   3518 N N   . ASP C 1 72  ? -15.028 -0.373  27.293 1.00 49.75  ? 74  ASP C N   1 
ATOM   3519 C CA  . ASP C 1 72  ? -16.479 -0.118  27.251 1.00 53.20  ? 74  ASP C CA  1 
ATOM   3520 C C   . ASP C 1 72  ? -16.995 -0.275  25.839 1.00 51.16  ? 74  ASP C C   1 
ATOM   3521 O O   . ASP C 1 72  ? -16.268 -0.046  24.890 1.00 52.09  ? 74  ASP C O   1 
ATOM   3522 C CB  . ASP C 1 72  ? -16.786 1.299   27.734 1.00 53.27  ? 74  ASP C CB  1 
ATOM   3523 C CG  . ASP C 1 72  ? -18.143 1.411   28.369 1.00 58.87  ? 74  ASP C CG  1 
ATOM   3524 O OD1 . ASP C 1 72  ? -18.621 0.410   28.936 1.00 55.79  ? 74  ASP C OD1 1 
ATOM   3525 O OD2 . ASP C 1 72  ? -18.725 2.512   28.313 1.00 69.16  ? 74  ASP C OD2 1 
ATOM   3526 N N   . THR C 1 73  ? -18.240 -0.716  25.699 1.00 54.55  ? 75  THR C N   1 
ATOM   3527 C CA  . THR C 1 73  ? -18.894 -0.754  24.385 1.00 51.30  ? 75  THR C CA  1 
ATOM   3528 C C   . THR C 1 73  ? -19.928 0.358   24.369 1.00 49.49  ? 75  THR C C   1 
ATOM   3529 O O   . THR C 1 73  ? -20.676 0.530   25.340 1.00 46.75  ? 75  THR C O   1 
ATOM   3530 C CB  . THR C 1 73  ? -19.567 -2.115  24.149 1.00 56.30  ? 75  THR C CB  1 
ATOM   3531 O OG1 . THR C 1 73  ? -18.606 -3.157  24.421 1.00 55.35  ? 75  THR C OG1 1 
ATOM   3532 C CG2 . THR C 1 73  ? -20.115 -2.233  22.697 1.00 56.63  ? 75  THR C CG2 1 
ATOM   3533 N N   . LEU C 1 74  ? -19.963 1.112   23.267 1.00 49.61  ? 76  LEU C N   1 
ATOM   3534 C CA  . LEU C 1 74  ? -20.769 2.341   23.168 1.00 45.12  ? 76  LEU C CA  1 
ATOM   3535 C C   . LEU C 1 74  ? -22.116 2.160   22.430 1.00 46.18  ? 76  LEU C C   1 
ATOM   3536 O O   . LEU C 1 74  ? -22.219 1.382   21.483 1.00 44.64  ? 76  LEU C O   1 
ATOM   3537 C CB  . LEU C 1 74  ? -19.950 3.471   22.499 1.00 43.39  ? 76  LEU C CB  1 
ATOM   3538 C CG  . LEU C 1 74  ? -18.558 3.816   23.082 1.00 33.93  ? 76  LEU C CG  1 
ATOM   3539 C CD1 . LEU C 1 74  ? -17.999 5.020   22.382 1.00 33.50  ? 76  LEU C CD1 1 
ATOM   3540 C CD2 . LEU C 1 74  ? -18.589 4.011   24.596 1.00 43.83  ? 76  LEU C CD2 1 
ATOM   3541 N N   . LEU C 1 75  ? -23.108 2.948   22.839 1.00 47.47  ? 77  LEU C N   1 
ATOM   3542 C CA  . LEU C 1 75  ? -24.464 2.891   22.241 1.00 50.22  ? 77  LEU C CA  1 
ATOM   3543 C C   . LEU C 1 75  ? -24.986 4.230   21.732 1.00 48.71  ? 77  LEU C C   1 
ATOM   3544 O O   . LEU C 1 75  ? -24.725 5.262   22.338 1.00 46.80  ? 77  LEU C O   1 
ATOM   3545 C CB  . LEU C 1 75  ? -25.448 2.400   23.292 1.00 53.33  ? 77  LEU C CB  1 
ATOM   3546 C CG  . LEU C 1 75  ? -25.308 1.021   23.939 1.00 57.48  ? 77  LEU C CG  1 
ATOM   3547 C CD1 . LEU C 1 75  ? -26.503 0.833   24.855 1.00 61.35  ? 77  LEU C CD1 1 
ATOM   3548 C CD2 . LEU C 1 75  ? -25.243 -0.128  22.890 1.00 62.79  ? 77  LEU C CD2 1 
ATOM   3549 N N   . LEU C 1 76  ? -25.765 4.205   20.649 1.00 49.39  ? 78  LEU C N   1 
ATOM   3550 C CA  . LEU C 1 76  ? -26.576 5.356   20.284 1.00 49.72  ? 78  LEU C CA  1 
ATOM   3551 C C   . LEU C 1 76  ? -27.875 5.330   21.065 1.00 52.60  ? 78  LEU C C   1 
ATOM   3552 O O   . LEU C 1 76  ? -28.356 4.250   21.455 1.00 54.27  ? 78  LEU C O   1 
ATOM   3553 C CB  . LEU C 1 76  ? -26.870 5.379   18.777 1.00 50.03  ? 78  LEU C CB  1 
ATOM   3554 C CG  . LEU C 1 76  ? -25.665 5.597   17.855 1.00 50.76  ? 78  LEU C CG  1 
ATOM   3555 C CD1 . LEU C 1 76  ? -26.015 5.181   16.482 1.00 57.56  ? 78  LEU C CD1 1 
ATOM   3556 C CD2 . LEU C 1 76  ? -25.205 7.038   17.860 1.00 54.40  ? 78  LEU C CD2 1 
ATOM   3557 N N   . GLU C 1 77  ? -28.459 6.518   21.275 1.00 54.43  ? 79  GLU C N   1 
ATOM   3558 C CA  . GLU C 1 77  ? -29.802 6.632   21.815 1.00 55.84  ? 79  GLU C CA  1 
ATOM   3559 C C   . GLU C 1 77  ? -30.792 5.844   20.947 1.00 51.19  ? 79  GLU C C   1 
ATOM   3560 O O   . GLU C 1 77  ? -31.740 5.285   21.457 1.00 50.97  ? 79  GLU C O   1 
ATOM   3561 C CB  . GLU C 1 77  ? -30.253 8.097   21.874 1.00 60.17  ? 79  GLU C CB  1 
ATOM   3562 C CG  . GLU C 1 77  ? -29.955 8.839   23.171 1.00 67.27  ? 79  GLU C CG  1 
ATOM   3563 C CD  . GLU C 1 77  ? -30.748 10.152  23.282 1.00 76.89  ? 79  GLU C CD  1 
ATOM   3564 O OE1 . GLU C 1 77  ? -30.385 11.144  22.595 1.00 76.14  ? 79  GLU C OE1 1 
ATOM   3565 O OE2 . GLU C 1 77  ? -31.738 10.186  24.054 1.00 81.93  ? 79  GLU C OE2 1 
ATOM   3566 N N   . ASP C 1 78  ? -30.555 5.798   19.642 1.00 49.56  ? 80  ASP C N   1 
ATOM   3567 C CA  . ASP C 1 78  ? -31.465 5.100   18.701 1.00 51.56  ? 80  ASP C CA  1 
ATOM   3568 C C   . ASP C 1 78  ? -31.327 3.562   18.664 1.00 49.95  ? 80  ASP C C   1 
ATOM   3569 O O   . ASP C 1 78  ? -31.915 2.886   17.822 1.00 50.41  ? 80  ASP C O   1 
ATOM   3570 C CB  . ASP C 1 78  ? -31.308 5.683   17.294 1.00 51.47  ? 80  ASP C CB  1 
ATOM   3571 C CG  . ASP C 1 78  ? -32.489 5.371   16.407 1.00 46.51  ? 80  ASP C CG  1 
ATOM   3572 O OD1 . ASP C 1 78  ? -33.626 5.537   16.878 1.00 39.52  ? 80  ASP C OD1 1 
ATOM   3573 O OD2 . ASP C 1 78  ? -32.280 4.950   15.248 1.00 50.12  ? 80  ASP C OD2 1 
ATOM   3574 N N   . GLN C 1 79  ? -30.584 3.028   19.620 1.00 51.82  ? 81  GLN C N   1 
ATOM   3575 C CA  . GLN C 1 79  ? -30.343 1.599   19.783 1.00 51.49  ? 81  GLN C CA  1 
ATOM   3576 C C   . GLN C 1 79  ? -30.883 1.169   21.148 1.00 48.61  ? 81  GLN C C   1 
ATOM   3577 O O   . GLN C 1 79  ? -30.121 0.717   21.980 1.00 50.95  ? 81  GLN C O   1 
ATOM   3578 C CB  . GLN C 1 79  ? -28.839 1.337   19.810 1.00 48.40  ? 81  GLN C CB  1 
ATOM   3579 C CG  . GLN C 1 79  ? -28.110 1.229   18.499 1.00 49.67  ? 81  GLN C CG  1 
ATOM   3580 C CD  . GLN C 1 79  ? -26.663 0.755   18.732 1.00 62.27  ? 81  GLN C CD  1 
ATOM   3581 O OE1 . GLN C 1 79  ? -25.779 1.534   19.132 1.00 62.68  ? 81  GLN C OE1 1 
ATOM   3582 N NE2 . GLN C 1 79  ? -26.423 -0.535  18.495 1.00 64.94  ? 81  GLN C NE2 1 
ATOM   3583 N N   . PRO C 1 80  ? -32.186 1.286   21.378 1.00 48.88  ? 82  PRO C N   1 
ATOM   3584 C CA  . PRO C 1 80  ? -32.652 1.096   22.758 1.00 51.33  ? 82  PRO C CA  1 
ATOM   3585 C C   . PRO C 1 80  ? -32.654 -0.341  23.341 1.00 53.17  ? 82  PRO C C   1 
ATOM   3586 O O   . PRO C 1 80  ? -32.750 -0.507  24.565 1.00 54.63  ? 82  PRO C O   1 
ATOM   3587 C CB  . PRO C 1 80  ? -34.052 1.670   22.715 1.00 49.24  ? 82  PRO C CB  1 
ATOM   3588 C CG  . PRO C 1 80  ? -34.564 1.307   21.302 1.00 51.77  ? 82  PRO C CG  1 
ATOM   3589 C CD  . PRO C 1 80  ? -33.289 1.574   20.454 1.00 52.15  ? 82  PRO C CD  1 
ATOM   3590 N N   . THR C 1 81  ? -32.546 -1.368  22.497 1.00 51.27  ? 83  THR C N   1 
ATOM   3591 C CA  . THR C 1 81  ? -32.519 -2.752  23.000 1.00 50.82  ? 83  THR C CA  1 
ATOM   3592 C C   . THR C 1 81  ? -31.062 -3.198  23.274 1.00 54.49  ? 83  THR C C   1 
ATOM   3593 O O   . THR C 1 81  ? -30.785 -4.336  23.677 1.00 55.30  ? 83  THR C O   1 
ATOM   3594 C CB  . THR C 1 81  ? -33.255 -3.711  22.062 1.00 53.11  ? 83  THR C CB  1 
ATOM   3595 O OG1 . THR C 1 81  ? -32.537 -3.784  20.836 1.00 51.61  ? 83  THR C OG1 1 
ATOM   3596 C CG2 . THR C 1 81  ? -34.699 -3.216  21.790 1.00 45.05  ? 83  THR C CG2 1 
ATOM   3597 N N   . GLY C 1 82  ? -30.138 -2.280  23.045 1.00 54.43  ? 84  GLY C N   1 
ATOM   3598 C CA  . GLY C 1 82  ? -28.822 -2.415  23.562 1.00 57.46  ? 84  GLY C CA  1 
ATOM   3599 C C   . GLY C 1 82  ? -27.754 -2.961  22.659 1.00 60.13  ? 84  GLY C C   1 
ATOM   3600 O O   . GLY C 1 82  ? -27.856 -2.881  21.445 1.00 57.30  ? 84  GLY C O   1 
ATOM   3601 N N   . GLU C 1 83  ? -26.751 -3.542  23.326 1.00 65.65  ? 85  GLU C N   1 
ATOM   3602 C CA  . GLU C 1 83  ? -25.425 -3.894  22.798 1.00 70.78  ? 85  GLU C CA  1 
ATOM   3603 C C   . GLU C 1 83  ? -25.399 -4.914  21.669 1.00 72.62  ? 85  GLU C C   1 
ATOM   3604 O O   . GLU C 1 83  ? -24.398 -5.021  20.964 1.00 69.30  ? 85  GLU C O   1 
ATOM   3605 C CB  . GLU C 1 83  ? -24.554 -4.436  23.944 1.00 72.83  ? 85  GLU C CB  1 
ATOM   3606 C CG  . GLU C 1 83  ? -25.024 -4.043  25.354 1.00 75.63  ? 85  GLU C CG  1 
ATOM   3607 C CD  . GLU C 1 83  ? -24.365 -2.789  25.844 1.00 73.60  ? 85  GLU C CD  1 
ATOM   3608 O OE1 . GLU C 1 83  ? -23.126 -2.682  25.708 1.00 78.14  ? 85  GLU C OE1 1 
ATOM   3609 O OE2 . GLU C 1 83  ? -25.079 -1.916  26.369 1.00 71.94  ? 85  GLU C OE2 1 
ATOM   3610 N N   . ASN C 1 84  ? -26.475 -5.686  21.532 1.00 77.97  ? 86  ASN C N   1 
ATOM   3611 C CA  . ASN C 1 84  ? -26.610 -6.606  20.402 1.00 81.78  ? 86  ASN C CA  1 
ATOM   3612 C C   . ASN C 1 84  ? -27.330 -6.000  19.210 1.00 82.08  ? 86  ASN C C   1 
ATOM   3613 O O   . ASN C 1 84  ? -26.938 -6.239  18.067 1.00 83.87  ? 86  ASN C O   1 
ATOM   3614 C CB  . ASN C 1 84  ? -27.295 -7.904  20.806 1.00 83.90  ? 86  ASN C CB  1 
ATOM   3615 C CG  . ASN C 1 84  ? -26.520 -9.112  20.354 1.00 85.11  ? 86  ASN C CG  1 
ATOM   3616 O OD1 . ASN C 1 84  ? -25.588 -9.542  21.033 1.00 87.52  ? 86  ASN C OD1 1 
ATOM   3617 N ND2 . ASN C 1 84  ? -26.885 -9.664  19.202 1.00 85.84  ? 86  ASN C ND2 1 
ATOM   3618 N N   . GLU C 1 85  ? -28.388 -5.235  19.464 1.00 83.17  ? 87  GLU C N   1 
ATOM   3619 C CA  . GLU C 1 85  ? -29.053 -4.504  18.385 1.00 82.33  ? 87  GLU C CA  1 
ATOM   3620 C C   . GLU C 1 85  ? -27.995 -3.986  17.409 1.00 80.53  ? 87  GLU C C   1 
ATOM   3621 O O   . GLU C 1 85  ? -27.211 -3.093  17.750 1.00 79.55  ? 87  GLU C O   1 
ATOM   3622 C CB  . GLU C 1 85  ? -29.892 -3.338  18.942 1.00 83.57  ? 87  GLU C CB  1 
ATOM   3623 C CG  . GLU C 1 85  ? -30.595 -2.488  17.872 1.00 79.22  ? 87  GLU C CG  1 
ATOM   3624 C CD  . GLU C 1 85  ? -31.683 -1.554  18.426 1.00 85.03  ? 87  GLU C CD  1 
ATOM   3625 O OE1 . GLU C 1 85  ? -32.095 -1.699  19.599 1.00 80.10  ? 87  GLU C OE1 1 
ATOM   3626 O OE2 . GLU C 1 85  ? -32.141 -0.673  17.664 1.00 81.12  ? 87  GLU C OE2 1 
ATOM   3627 N N   . MET C 1 86  ? -27.940 -4.587  16.222 1.00 80.02  ? 88  MET C N   1 
ATOM   3628 C CA  . MET C 1 86  ? -27.110 -4.075  15.133 1.00 79.23  ? 88  MET C CA  1 
ATOM   3629 C C   . MET C 1 86  ? -27.533 -2.651  14.852 1.00 77.21  ? 88  MET C C   1 
ATOM   3630 O O   . MET C 1 86  ? -28.634 -2.243  15.218 1.00 78.86  ? 88  MET C O   1 
ATOM   3631 C CB  . MET C 1 86  ? -27.288 -4.911  13.858 1.00 82.38  ? 88  MET C CB  1 
ATOM   3632 C CG  . MET C 1 86  ? -26.562 -6.254  13.857 1.00 86.71  ? 88  MET C CG  1 
ATOM   3633 S SD  . MET C 1 86  ? -24.864 -6.114  13.267 1.00 87.02  ? 88  MET C SD  1 
ATOM   3634 C CE  . MET C 1 86  ? -24.350 -7.839  13.226 1.00 86.38  ? 88  MET C CE  1 
ATOM   3635 N N   . VAL C 1 87  ? -26.668 -1.892  14.197 1.00 74.45  ? 89  VAL C N   1 
ATOM   3636 C CA  . VAL C 1 87  ? -26.996 -0.508  13.858 1.00 72.15  ? 89  VAL C CA  1 
ATOM   3637 C C   . VAL C 1 87  ? -26.806 -0.302  12.369 1.00 71.45  ? 89  VAL C C   1 
ATOM   3638 O O   . VAL C 1 87  ? -25.781 -0.664  11.809 1.00 70.56  ? 89  VAL C O   1 
ATOM   3639 C CB  . VAL C 1 87  ? -26.198 0.521   14.721 1.00 69.26  ? 89  VAL C CB  1 
ATOM   3640 C CG1 . VAL C 1 87  ? -24.820 -0.040  15.081 1.00 68.24  ? 89  VAL C CG1 1 
ATOM   3641 C CG2 . VAL C 1 87  ? -26.118 1.907   14.048 1.00 63.15  ? 89  VAL C CG2 1 
ATOM   3642 N N   . ILE C 1 88  ? -27.826 0.258   11.738 1.00 73.66  ? 90  ILE C N   1 
ATOM   3643 C CA  . ILE C 1 88  ? -27.830 0.466   10.294 1.00 73.06  ? 90  ILE C CA  1 
ATOM   3644 C C   . ILE C 1 88  ? -27.386 1.890   10.019 1.00 71.02  ? 90  ILE C C   1 
ATOM   3645 O O   . ILE C 1 88  ? -28.157 2.844   10.173 1.00 69.25  ? 90  ILE C O   1 
ATOM   3646 C CB  . ILE C 1 88  ? -29.234 0.131   9.666  1.00 74.54  ? 90  ILE C CB  1 
ATOM   3647 C CG1 . ILE C 1 88  ? -29.436 -1.392  9.590  1.00 75.48  ? 90  ILE C CG1 1 
ATOM   3648 C CG2 . ILE C 1 88  ? -29.416 0.798   8.302  1.00 73.03  ? 90  ILE C CG2 1 
ATOM   3649 C CD1 . ILE C 1 88  ? -28.482 -2.137  8.635  1.00 76.31  ? 90  ILE C CD1 1 
ATOM   3650 N N   . MET C 1 89  ? -26.119 2.028   9.652  1.00 70.64  ? 91  MET C N   1 
ATOM   3651 C CA  . MET C 1 89  ? -25.564 3.345   9.368  1.00 71.58  ? 91  MET C CA  1 
ATOM   3652 C C   . MET C 1 89  ? -25.735 3.678   7.903  1.00 74.17  ? 91  MET C C   1 
ATOM   3653 O O   . MET C 1 89  ? -25.165 3.002   7.030  1.00 74.46  ? 91  MET C O   1 
ATOM   3654 C CB  . MET C 1 89  ? -24.084 3.442   9.754  1.00 68.25  ? 91  MET C CB  1 
ATOM   3655 C CG  . MET C 1 89  ? -23.812 3.407   11.249 1.00 64.84  ? 91  MET C CG  1 
ATOM   3656 S SD  . MET C 1 89  ? -22.143 3.972   11.567 1.00 61.87  ? 91  MET C SD  1 
ATOM   3657 C CE  . MET C 1 89  ? -22.189 5.588   10.767 1.00 45.80  ? 91  MET C CE  1 
ATOM   3658 N N   . ARG C 1 90  ? -26.512 4.731   7.653  1.00 76.17  ? 92  ARG C N   1 
ATOM   3659 C CA  . ARG C 1 90  ? -26.802 5.201   6.301  1.00 77.69  ? 92  ARG C CA  1 
ATOM   3660 C C   . ARG C 1 90  ? -26.139 6.552   6.074  1.00 76.42  ? 92  ARG C C   1 
ATOM   3661 O O   . ARG C 1 90  ? -26.038 7.352   7.010  1.00 75.58  ? 92  ARG C O   1 
ATOM   3662 C CB  . ARG C 1 90  ? -28.331 5.284   6.066  1.00 78.85  ? 92  ARG C CB  1 
ATOM   3663 C CG  . ARG C 1 90  ? -28.981 6.687   6.166  1.00 82.35  ? 92  ARG C CG  1 
ATOM   3664 C CD  . ARG C 1 90  ? -30.522 6.622   6.301  1.00 91.18  ? 92  ARG C CD  1 
ATOM   3665 N NE  . ARG C 1 90  ? -31.065 5.400   5.702  1.00 98.51  ? 92  ARG C NE  1 
ATOM   3666 C CZ  . ARG C 1 90  ? -31.374 4.299   6.387  1.00 97.47  ? 92  ARG C CZ  1 
ATOM   3667 N NH1 . ARG C 1 90  ? -31.218 4.270   7.708  1.00 94.15  ? 92  ARG C NH1 1 
ATOM   3668 N NH2 . ARG C 1 90  ? -31.843 3.231   5.751  1.00 92.29  ? 92  ARG C NH2 1 
ATOM   3669 N N   . PRO C 1 91  ? -25.697 6.816   4.828  1.00 77.96  ? 93  PRO C N   1 
ATOM   3670 C CA  . PRO C 1 91  ? -24.992 8.064   4.480  1.00 79.21  ? 93  PRO C CA  1 
ATOM   3671 C C   . PRO C 1 91  ? -25.784 9.343   4.776  1.00 79.86  ? 93  PRO C C   1 
ATOM   3672 O O   . PRO C 1 91  ? -26.992 9.281   4.934  1.00 80.71  ? 93  PRO C O   1 
ATOM   3673 C CB  . PRO C 1 91  ? -24.741 7.921   2.973  1.00 79.61  ? 93  PRO C CB  1 
ATOM   3674 C CG  . PRO C 1 91  ? -24.837 6.472   2.695  1.00 75.16  ? 93  PRO C CG  1 
ATOM   3675 C CD  . PRO C 1 91  ? -25.829 5.923   3.662  1.00 77.88  ? 93  PRO C CD  1 
ATOM   3676 N N   . GLY C 1 92  ? -25.142 10.461  4.730  1.00 80.75  ? 94  GLY C N   1 
ATOM   3677 C CA  . GLY C 1 92  ? -25.984 11.579  4.749  1.00 82.02  ? 94  GLY C CA  1 
ATOM   3678 C C   . GLY C 1 92  ? -25.912 12.366  5.987  1.00 82.40  ? 94  GLY C C   1 
ATOM   3679 O O   . GLY C 1 92  ? -25.849 13.552  5.745  1.00 83.19  ? 94  GLY C O   1 
ATOM   3680 N N   . ASN C 1 93  ? -25.930 11.723  7.184  1.00 80.91  ? 95  ASN C N   1 
ATOM   3681 C CA  . ASN C 1 93  ? -25.930 12.317  8.554  1.00 80.53  ? 95  ASN C CA  1 
ATOM   3682 C C   . ASN C 1 93  ? -24.850 11.855  9.587  1.00 79.24  ? 95  ASN C C   1 
ATOM   3683 O O   . ASN C 1 93  ? -24.217 10.829  9.396  1.00 79.41  ? 95  ASN C O   1 
ATOM   3684 C CB  . ASN C 1 93  ? -27.281 12.113  9.246  1.00 82.10  ? 95  ASN C CB  1 
ATOM   3685 C CG  . ASN C 1 93  ? -28.218 11.180  8.490  1.00 83.75  ? 95  ASN C CG  1 
ATOM   3686 O OD1 . ASN C 1 93  ? -29.062 11.644  7.750  1.00 79.87  ? 95  ASN C OD1 1 
ATOM   3687 N ND2 . ASN C 1 93  ? -28.097 9.874   8.710  1.00 77.00  ? 95  ASN C ND2 1 
ATOM   3688 N N   . LYS C 1 94  ? -24.697 12.588  10.698 1.00 75.55  ? 96  LYS C N   1 
ATOM   3689 C CA  . LYS C 1 94  ? -23.658 12.348  11.741 1.00 70.91  ? 96  LYS C CA  1 
ATOM   3690 C C   . LYS C 1 94  ? -23.948 11.394  12.919 1.00 65.36  ? 96  LYS C C   1 
ATOM   3691 O O   . LYS C 1 94  ? -24.799 11.683  13.722 1.00 64.87  ? 96  LYS C O   1 
ATOM   3692 C CB  . LYS C 1 94  ? -23.363 13.682  12.402 1.00 72.83  ? 96  LYS C CB  1 
ATOM   3693 C CG  . LYS C 1 94  ? -22.039 14.297  12.097 1.00 74.77  ? 96  LYS C CG  1 
ATOM   3694 C CD  . LYS C 1 94  ? -22.143 15.807  12.214 1.00 82.16  ? 96  LYS C CD  1 
ATOM   3695 C CE  . LYS C 1 94  ? -20.934 16.417  12.886 1.00 84.71  ? 96  LYS C CE  1 
ATOM   3696 N NZ  . LYS C 1 94  ? -20.328 17.508  12.088 1.00 84.47  ? 96  LYS C NZ  1 
ATOM   3697 N N   . TYR C 1 95  ? -23.193 10.311  13.068 1.00 58.57  ? 97  TYR C N   1 
ATOM   3698 C CA  . TYR C 1 95  ? -23.318 9.422   14.231 1.00 53.70  ? 97  TYR C CA  1 
ATOM   3699 C C   . TYR C 1 95  ? -22.388 9.627   15.501 1.00 47.73  ? 97  TYR C C   1 
ATOM   3700 O O   . TYR C 1 95  ? -21.060 9.522   15.527 1.00 43.75  ? 97  TYR C O   1 
ATOM   3701 C CB  . TYR C 1 95  ? -23.381 7.964   13.810 1.00 53.77  ? 97  TYR C CB  1 
ATOM   3702 C CG  . TYR C 1 95  ? -24.388 7.620   12.715 1.00 59.83  ? 97  TYR C CG  1 
ATOM   3703 C CD1 . TYR C 1 95  ? -25.621 7.110   13.024 1.00 62.04  ? 97  TYR C CD1 1 
ATOM   3704 C CD2 . TYR C 1 95  ? -24.065 7.743   11.390 1.00 57.82  ? 97  TYR C CD2 1 
ATOM   3705 C CE1 . TYR C 1 95  ? -26.510 6.774   12.055 1.00 71.41  ? 97  TYR C CE1 1 
ATOM   3706 C CE2 . TYR C 1 95  ? -24.952 7.417   10.414 1.00 68.59  ? 97  TYR C CE2 1 
ATOM   3707 C CZ  . TYR C 1 95  ? -26.182 6.935   10.751 1.00 71.91  ? 97  TYR C CZ  1 
ATOM   3708 O OH  . TYR C 1 95  ? -27.084 6.587   9.784  1.00 73.06  ? 97  TYR C OH  1 
ATOM   3709 N N   . GLU C 1 96  ? -23.110 9.944   16.581 1.00 46.56  ? 98  GLU C N   1 
ATOM   3710 C CA  . GLU C 1 96  ? -22.319 10.330  17.768 1.00 47.40  ? 98  GLU C CA  1 
ATOM   3711 C C   . GLU C 1 96  ? -22.521 9.343   18.941 1.00 48.99  ? 98  GLU C C   1 
ATOM   3712 O O   . GLU C 1 96  ? -23.627 9.250   19.504 1.00 48.41  ? 98  GLU C O   1 
ATOM   3713 C CB  . GLU C 1 96  ? -22.757 11.720  18.222 1.00 47.62  ? 98  GLU C CB  1 
ATOM   3714 C CG  . GLU C 1 96  ? -22.396 12.864  17.284 1.00 46.28  ? 98  GLU C CG  1 
ATOM   3715 C CD  . GLU C 1 96  ? -22.952 14.206  17.772 1.00 61.07  ? 98  GLU C CD  1 
ATOM   3716 O OE1 . GLU C 1 96  ? -23.308 14.343  18.970 1.00 65.94  ? 98  GLU C OE1 1 
ATOM   3717 O OE2 . GLU C 1 96  ? -23.031 15.149  16.959 1.00 72.07  ? 98  GLU C OE2 1 
ATOM   3718 N N   . TYR C 1 97  ? -21.473 8.606   19.296 1.00 45.85  ? 99  TYR C N   1 
ATOM   3719 C CA  . TYR C 1 97  ? -21.515 7.719   20.467 1.00 44.20  ? 99  TYR C CA  1 
ATOM   3720 C C   . TYR C 1 97  ? -20.810 8.391   21.651 1.00 40.25  ? 99  TYR C C   1 
ATOM   3721 O O   . TYR C 1 97  ? -19.592 8.531   21.630 1.00 36.54  ? 99  TYR C O   1 
ATOM   3722 C CB  . TYR C 1 97  ? -20.749 6.444   20.159 1.00 42.83  ? 99  TYR C CB  1 
ATOM   3723 C CG  . TYR C 1 97  ? -21.360 5.523   19.145 1.00 51.53  ? 99  TYR C CG  1 
ATOM   3724 C CD1 . TYR C 1 97  ? -21.833 4.273   19.533 1.00 55.77  ? 99  TYR C CD1 1 
ATOM   3725 C CD2 . TYR C 1 97  ? -21.423 5.863   17.793 1.00 53.66  ? 99  TYR C CD2 1 
ATOM   3726 C CE1 . TYR C 1 97  ? -22.376 3.390   18.610 1.00 54.00  ? 99  TYR C CE1 1 
ATOM   3727 C CE2 . TYR C 1 97  ? -21.980 4.982   16.863 1.00 61.72  ? 99  TYR C CE2 1 
ATOM   3728 C CZ  . TYR C 1 97  ? -22.450 3.744   17.298 1.00 52.47  ? 99  TYR C CZ  1 
ATOM   3729 O OH  . TYR C 1 97  ? -22.975 2.831   16.417 1.00 63.10  ? 99  TYR C OH  1 
ATOM   3730 N N   . LYS C 1 98  ? -21.544 8.777   22.688 1.00 38.07  ? 100 LYS C N   1 
ATOM   3731 C CA  . LYS C 1 98  ? -20.907 9.372   23.866 1.00 34.33  ? 100 LYS C CA  1 
ATOM   3732 C C   . LYS C 1 98  ? -20.078 8.359   24.683 1.00 36.11  ? 100 LYS C C   1 
ATOM   3733 O O   . LYS C 1 98  ? -20.465 7.219   24.804 1.00 36.90  ? 100 LYS C O   1 
ATOM   3734 C CB  . LYS C 1 98  ? -21.947 9.993   24.770 1.00 37.14  ? 100 LYS C CB  1 
ATOM   3735 C CG  . LYS C 1 98  ? -22.654 11.197  24.193 1.00 42.72  ? 100 LYS C CG  1 
ATOM   3736 C CD  . LYS C 1 98  ? -23.808 11.613  25.099 1.00 57.51  ? 100 LYS C CD  1 
ATOM   3737 C CE  . LYS C 1 98  ? -24.632 12.738  24.470 1.00 71.03  ? 100 LYS C CE  1 
ATOM   3738 N NZ  . LYS C 1 98  ? -26.099 12.620  24.766 1.00 74.14  ? 100 LYS C NZ  1 
ATOM   3739 N N   . PHE C 1 99  ? -18.961 8.813   25.253 1.00 32.09  ? 101 PHE C N   1 
ATOM   3740 C CA  . PHE C 1 99  ? -18.166 8.024   26.207 1.00 34.83  ? 101 PHE C CA  1 
ATOM   3741 C C   . PHE C 1 99  ? -17.714 8.898   27.353 1.00 35.36  ? 101 PHE C C   1 
ATOM   3742 O O   . PHE C 1 99  ? -17.619 10.121  27.221 1.00 33.76  ? 101 PHE C O   1 
ATOM   3743 C CB  . PHE C 1 99  ? -16.946 7.351   25.541 1.00 31.71  ? 101 PHE C CB  1 
ATOM   3744 C CG  . PHE C 1 99  ? -15.888 8.316   25.068 1.00 31.93  ? 101 PHE C CG  1 
ATOM   3745 C CD1 . PHE C 1 99  ? -14.914 8.812   25.950 1.00 34.58  ? 101 PHE C CD1 1 
ATOM   3746 C CD2 . PHE C 1 99  ? -15.837 8.713   23.740 1.00 36.15  ? 101 PHE C CD2 1 
ATOM   3747 C CE1 . PHE C 1 99  ? -13.941 9.704   25.518 1.00 28.53  ? 101 PHE C CE1 1 
ATOM   3748 C CE2 . PHE C 1 99  ? -14.846 9.599   23.301 1.00 26.64  ? 101 PHE C CE2 1 
ATOM   3749 C CZ  . PHE C 1 99  ? -13.910 10.100  24.181 1.00 25.10  ? 101 PHE C CZ  1 
ATOM   3750 N N   . GLY C 1 100 ? -17.397 8.268   28.490 1.00 36.19  ? 102 GLY C N   1 
ATOM   3751 C CA  . GLY C 1 100 ? -16.912 9.029   29.615 1.00 31.68  ? 102 GLY C CA  1 
ATOM   3752 C C   . GLY C 1 100 ? -16.250 8.077   30.580 1.00 40.02  ? 102 GLY C C   1 
ATOM   3753 O O   . GLY C 1 100 ? -16.686 6.932   30.764 1.00 41.21  ? 102 GLY C O   1 
ATOM   3754 N N   . PHE C 1 101 ? -15.170 8.528   31.187 1.00 39.61  ? 103 PHE C N   1 
ATOM   3755 C CA  . PHE C 1 101 ? -14.551 7.698   32.212 1.00 38.39  ? 103 PHE C CA  1 
ATOM   3756 C C   . PHE C 1 101 ? -13.792 8.583   33.161 1.00 41.22  ? 103 PHE C C   1 
ATOM   3757 O O   . PHE C 1 101 ? -13.525 9.757   32.885 1.00 39.90  ? 103 PHE C O   1 
ATOM   3758 C CB  . PHE C 1 101 ? -13.668 6.647   31.551 1.00 33.45  ? 103 PHE C CB  1 
ATOM   3759 C CG  . PHE C 1 101 ? -12.610 7.226   30.649 1.00 31.76  ? 103 PHE C CG  1 
ATOM   3760 C CD1 . PHE C 1 101 ? -11.410 7.706   31.186 1.00 32.28  ? 103 PHE C CD1 1 
ATOM   3761 C CD2 . PHE C 1 101 ? -12.817 7.306   29.283 1.00 31.68  ? 103 PHE C CD2 1 
ATOM   3762 C CE1 . PHE C 1 101 ? -10.453 8.238   30.361 1.00 32.18  ? 103 PHE C CE1 1 
ATOM   3763 C CE2 . PHE C 1 101 ? -11.872 7.842   28.453 1.00 29.99  ? 103 PHE C CE2 1 
ATOM   3764 C CZ  . PHE C 1 101 ? -10.689 8.305   29.002 1.00 24.61  ? 103 PHE C CZ  1 
ATOM   3765 N N   . GLU C 1 102 ? -13.461 8.025   34.310 1.00 46.08  ? 104 GLU C N   1 
ATOM   3766 C CA  . GLU C 1 102 ? -12.811 8.788   35.319 1.00 44.14  ? 104 GLU C CA  1 
ATOM   3767 C C   . GLU C 1 102 ? -11.383 8.308   35.408 1.00 43.78  ? 104 GLU C C   1 
ATOM   3768 O O   . GLU C 1 102 ? -11.070 7.111   35.230 1.00 44.03  ? 104 GLU C O   1 
ATOM   3769 C CB  . GLU C 1 102 ? -13.564 8.709   36.644 1.00 49.53  ? 104 GLU C CB  1 
ATOM   3770 C CG  . GLU C 1 102 ? -14.352 9.978   36.930 1.00 57.63  ? 104 GLU C CG  1 
ATOM   3771 C CD  . GLU C 1 102 ? -15.844 9.746   37.239 1.00 79.79  ? 104 GLU C CD  1 
ATOM   3772 O OE1 . GLU C 1 102 ? -16.517 10.715  37.676 1.00 84.34  ? 104 GLU C OE1 1 
ATOM   3773 O OE2 . GLU C 1 102 ? -16.354 8.616   37.035 1.00 83.21  ? 104 GLU C OE2 1 
ATOM   3774 N N   . LEU C 1 103 ? -10.497 9.272   35.586 1.00 40.07  ? 105 LEU C N   1 
ATOM   3775 C CA  . LEU C 1 103 ? -9.131  8.946   35.827 1.00 35.76  ? 105 LEU C CA  1 
ATOM   3776 C C   . LEU C 1 103 ? -9.052  8.536   37.298 1.00 38.79  ? 105 LEU C C   1 
ATOM   3777 O O   . LEU C 1 103 ? -9.704  9.160   38.150 1.00 34.51  ? 105 LEU C O   1 
ATOM   3778 C CB  . LEU C 1 103 ? -8.246  10.143  35.540 1.00 36.03  ? 105 LEU C CB  1 
ATOM   3779 C CG  . LEU C 1 103 ? -8.190  10.574  34.081 1.00 29.05  ? 105 LEU C CG  1 
ATOM   3780 C CD1 . LEU C 1 103 ? -7.328  11.773  34.032 1.00 30.17  ? 105 LEU C CD1 1 
ATOM   3781 C CD2 . LEU C 1 103 ? -7.648  9.490   33.199 1.00 29.16  ? 105 LEU C CD2 1 
ATOM   3782 N N   . PRO C 1 104 ? -8.248  7.499   37.588 1.00 42.09  ? 106 PRO C N   1 
ATOM   3783 C CA  . PRO C 1 104 ? -8.111  6.919   38.936 1.00 45.33  ? 106 PRO C CA  1 
ATOM   3784 C C   . PRO C 1 104 ? -7.521  7.950   39.899 1.00 45.79  ? 106 PRO C C   1 
ATOM   3785 O O   . PRO C 1 104 ? -6.877  8.904   39.469 1.00 43.88  ? 106 PRO C O   1 
ATOM   3786 C CB  . PRO C 1 104 ? -7.116  5.778   38.736 1.00 44.26  ? 106 PRO C CB  1 
ATOM   3787 C CG  . PRO C 1 104 ? -6.379  6.142   37.488 1.00 48.86  ? 106 PRO C CG  1 
ATOM   3788 C CD  . PRO C 1 104 ? -7.332  6.872   36.617 1.00 42.15  ? 106 PRO C CD  1 
ATOM   3789 N N   . GLN C 1 105 ? -7.758  7.749   41.192 1.00 51.42  ? 107 GLN C N   1 
ATOM   3790 C CA  . GLN C 1 105 ? -7.388  8.725   42.220 1.00 53.88  ? 107 GLN C CA  1 
ATOM   3791 C C   . GLN C 1 105 ? -5.893  8.912   42.388 1.00 53.78  ? 107 GLN C C   1 
ATOM   3792 O O   . GLN C 1 105 ? -5.435  9.994   42.757 1.00 54.64  ? 107 GLN C O   1 
ATOM   3793 C CB  . GLN C 1 105 ? -7.960  8.289   43.580 1.00 57.45  ? 107 GLN C CB  1 
ATOM   3794 C CG  . GLN C 1 105 ? -9.447  8.603   43.777 1.00 60.37  ? 107 GLN C CG  1 
ATOM   3795 C CD  . GLN C 1 105 ? -9.800  10.043  43.424 1.00 60.90  ? 107 GLN C CD  1 
ATOM   3796 O OE1 . GLN C 1 105 ? -9.088  10.980  43.795 1.00 69.25  ? 107 GLN C OE1 1 
ATOM   3797 N NE2 . GLN C 1 105 ? -10.900 10.222  42.701 1.00 57.99  ? 107 GLN C NE2 1 
ATOM   3798 N N   . GLY C 1 106 ? -5.136  7.857   42.141 1.00 54.10  ? 108 GLY C N   1 
ATOM   3799 C CA  . GLY C 1 106 ? -3.807  7.757   42.741 1.00 59.15  ? 108 GLY C CA  1 
ATOM   3800 C C   . GLY C 1 106 ? -2.937  8.932   42.373 1.00 58.09  ? 108 GLY C C   1 
ATOM   3801 O O   . GLY C 1 106 ? -3.447  9.946   41.888 1.00 56.36  ? 108 GLY C O   1 
ATOM   3802 N N   . PRO C 1 107 ? -1.620  8.818   42.627 1.00 57.29  ? 109 PRO C N   1 
ATOM   3803 C CA  . PRO C 1 107 ? -0.764  9.634   41.805 1.00 54.18  ? 109 PRO C CA  1 
ATOM   3804 C C   . PRO C 1 107 ? -0.645  8.911   40.476 1.00 53.44  ? 109 PRO C C   1 
ATOM   3805 O O   . PRO C 1 107 ? -0.214  7.750   40.447 1.00 56.32  ? 109 PRO C O   1 
ATOM   3806 C CB  . PRO C 1 107 ? 0.569   9.665   42.574 1.00 55.82  ? 109 PRO C CB  1 
ATOM   3807 C CG  . PRO C 1 107 ? 0.565   8.459   43.451 1.00 55.04  ? 109 PRO C CG  1 
ATOM   3808 C CD  . PRO C 1 107 ? -0.878  8.014   43.622 1.00 59.68  ? 109 PRO C CD  1 
ATOM   3809 N N   . LEU C 1 108 ? -1.095  9.568   39.408 1.00 49.09  ? 110 LEU C N   1 
ATOM   3810 C CA  . LEU C 1 108 ? -0.902  9.122   38.033 1.00 47.09  ? 110 LEU C CA  1 
ATOM   3811 C C   . LEU C 1 108 ? 0.434   9.642   37.569 1.00 45.05  ? 110 LEU C C   1 
ATOM   3812 O O   . LEU C 1 108 ? 0.901   10.658  38.083 1.00 46.79  ? 110 LEU C O   1 
ATOM   3813 C CB  . LEU C 1 108 ? -1.896  9.778   37.084 1.00 46.38  ? 110 LEU C CB  1 
ATOM   3814 C CG  . LEU C 1 108 ? -3.267  10.304  37.471 1.00 50.28  ? 110 LEU C CG  1 
ATOM   3815 C CD1 . LEU C 1 108 ? -3.551  11.537  36.605 1.00 42.93  ? 110 LEU C CD1 1 
ATOM   3816 C CD2 . LEU C 1 108 ? -4.310  9.238   37.271 1.00 44.58  ? 110 LEU C CD2 1 
ATOM   3817 N N   . GLY C 1 109 ? 1.029   8.996   36.563 1.00 41.98  ? 111 GLY C N   1 
ATOM   3818 C CA  . GLY C 1 109 ? 2.290   9.473   36.028 1.00 36.68  ? 111 GLY C CA  1 
ATOM   3819 C C   . GLY C 1 109 ? 1.903   10.673  35.189 1.00 41.97  ? 111 GLY C C   1 
ATOM   3820 O O   . GLY C 1 109 ? 0.770   10.731  34.648 1.00 42.53  ? 111 GLY C O   1 
ATOM   3821 N N   . THR C 1 110 ? 2.809   11.633  35.044 1.00 40.57  ? 112 THR C N   1 
ATOM   3822 C CA  . THR C 1 110 ? 2.512   12.787  34.167 1.00 45.13  ? 112 THR C CA  1 
ATOM   3823 C C   . THR C 1 110 ? 2.871   12.465  32.707 1.00 46.53  ? 112 THR C C   1 
ATOM   3824 O O   . THR C 1 110 ? 3.854   11.755  32.454 1.00 48.26  ? 112 THR C O   1 
ATOM   3825 C CB  . THR C 1 110 ? 3.267   14.031  34.636 1.00 43.92  ? 112 THR C CB  1 
ATOM   3826 O OG1 . THR C 1 110 ? 2.993   14.234  36.016 1.00 48.22  ? 112 THR C OG1 1 
ATOM   3827 C CG2 . THR C 1 110 ? 2.835   15.282  33.868 1.00 52.02  ? 112 THR C CG2 1 
ATOM   3828 N N   . SER C 1 111 ? 2.071   12.973  31.766 1.00 45.26  ? 113 SER C N   1 
ATOM   3829 C CA  . SER C 1 111 ? 2.316   12.860  30.331 1.00 44.71  ? 113 SER C CA  1 
ATOM   3830 C C   . SER C 1 111 ? 3.721   13.380  29.987 1.00 44.30  ? 113 SER C C   1 
ATOM   3831 O O   . SER C 1 111 ? 3.989   14.540  30.217 1.00 46.56  ? 113 SER C O   1 
ATOM   3832 C CB  . SER C 1 111 ? 1.277   13.692  29.552 1.00 43.09  ? 113 SER C CB  1 
ATOM   3833 O OG  . SER C 1 111 ? 0.017   13.063  29.470 1.00 35.74  ? 113 SER C OG  1 
ATOM   3834 N N   . PHE C 1 112 ? 4.560   12.516  29.393 1.00 47.26  ? 114 PHE C N   1 
ATOM   3835 C CA  . PHE C 1 112 ? 6.001   12.742  29.155 1.00 49.77  ? 114 PHE C CA  1 
ATOM   3836 C C   . PHE C 1 112 ? 6.511   11.990  27.914 1.00 51.94  ? 114 PHE C C   1 
ATOM   3837 O O   . PHE C 1 112 ? 6.055   10.890  27.599 1.00 45.47  ? 114 PHE C O   1 
ATOM   3838 C CB  . PHE C 1 112 ? 6.770   12.221  30.394 1.00 53.46  ? 114 PHE C CB  1 
ATOM   3839 C CG  . PHE C 1 112 ? 8.179   12.738  30.560 1.00 62.79  ? 114 PHE C CG  1 
ATOM   3840 C CD1 . PHE C 1 112 ? 8.473   14.103  30.504 1.00 76.01  ? 114 PHE C CD1 1 
ATOM   3841 C CD2 . PHE C 1 112 ? 9.211   11.847  30.885 1.00 75.26  ? 114 PHE C CD2 1 
ATOM   3842 C CE1 . PHE C 1 112 ? 9.798   14.567  30.704 1.00 84.32  ? 114 PHE C CE1 1 
ATOM   3843 C CE2 . PHE C 1 112 ? 10.532  12.298  31.097 1.00 80.36  ? 114 PHE C CE2 1 
ATOM   3844 C CZ  . PHE C 1 112 ? 10.824  13.656  31.006 1.00 82.67  ? 114 PHE C CZ  1 
ATOM   3845 N N   . LYS C 1 113 ? 7.452   12.618  27.209 1.00 57.91  ? 115 LYS C N   1 
ATOM   3846 C CA  . LYS C 1 113 ? 8.378   11.966  26.277 1.00 62.84  ? 115 LYS C CA  1 
ATOM   3847 C C   . LYS C 1 113 ? 9.688   12.644  26.599 1.00 65.76  ? 115 LYS C C   1 
ATOM   3848 O O   . LYS C 1 113 ? 9.825   13.858  26.447 1.00 67.28  ? 115 LYS C O   1 
ATOM   3849 C CB  . LYS C 1 113 ? 8.004   12.213  24.811 1.00 66.09  ? 115 LYS C CB  1 
ATOM   3850 C CG  . LYS C 1 113 ? 7.275   11.064  24.161 1.00 66.59  ? 115 LYS C CG  1 
ATOM   3851 C CD  . LYS C 1 113 ? 5.774   11.260  24.216 1.00 72.05  ? 115 LYS C CD  1 
ATOM   3852 C CE  . LYS C 1 113 ? 5.045   9.931   24.364 1.00 67.00  ? 115 LYS C CE  1 
ATOM   3853 N NZ  . LYS C 1 113 ? 5.606   8.825   23.515 1.00 69.36  ? 115 LYS C NZ  1 
ATOM   3854 N N   . GLY C 1 114 ? 10.640  11.883  27.114 1.00 67.35  ? 116 GLY C N   1 
ATOM   3855 C CA  . GLY C 1 114 ? 11.823  12.507  27.653 1.00 69.00  ? 116 GLY C CA  1 
ATOM   3856 C C   . GLY C 1 114 ? 12.927  11.539  27.990 1.00 70.31  ? 116 GLY C C   1 
ATOM   3857 O O   . GLY C 1 114 ? 13.116  10.512  27.313 1.00 70.13  ? 116 GLY C O   1 
ATOM   3858 N N   . LYS C 1 115 ? 13.633  11.888  29.059 1.00 69.38  ? 117 LYS C N   1 
ATOM   3859 C CA  . LYS C 1 115 ? 14.922  11.314  29.416 1.00 69.50  ? 117 LYS C CA  1 
ATOM   3860 C C   . LYS C 1 115 ? 14.880  9.793   29.610 1.00 66.27  ? 117 LYS C C   1 
ATOM   3861 O O   . LYS C 1 115 ? 15.202  9.014   28.701 1.00 65.35  ? 117 LYS C O   1 
ATOM   3862 C CB  . LYS C 1 115 ? 15.414  12.020  30.682 1.00 72.20  ? 117 LYS C CB  1 
ATOM   3863 C CG  . LYS C 1 115 ? 14.291  12.290  31.720 1.00 74.33  ? 117 LYS C CG  1 
ATOM   3864 C CD  . LYS C 1 115 ? 14.519  13.584  32.502 1.00 76.02  ? 117 LYS C CD  1 
ATOM   3865 C CE  . LYS C 1 115 ? 14.168  14.808  31.656 1.00 80.26  ? 117 LYS C CE  1 
ATOM   3866 N NZ  . LYS C 1 115 ? 13.725  15.966  32.486 1.00 80.88  ? 117 LYS C NZ  1 
ATOM   3867 N N   . TYR C 1 116 ? 14.464  9.384   30.798 1.00 63.08  ? 118 TYR C N   1 
ATOM   3868 C CA  . TYR C 1 116 ? 14.352  7.984   31.116 1.00 61.44  ? 118 TYR C CA  1 
ATOM   3869 C C   . TYR C 1 116 ? 12.897  7.498   30.838 1.00 59.27  ? 118 TYR C C   1 
ATOM   3870 O O   . TYR C 1 116 ? 12.200  7.058   31.739 1.00 60.65  ? 118 TYR C O   1 
ATOM   3871 C CB  . TYR C 1 116 ? 14.838  7.738   32.567 1.00 57.82  ? 118 TYR C CB  1 
ATOM   3872 C CG  . TYR C 1 116 ? 16.246  8.253   32.885 1.00 57.96  ? 118 TYR C CG  1 
ATOM   3873 C CD1 . TYR C 1 116 ? 17.378  7.548   32.481 1.00 53.78  ? 118 TYR C CD1 1 
ATOM   3874 C CD2 . TYR C 1 116 ? 16.444  9.444   33.606 1.00 43.00  ? 118 TYR C CD2 1 
ATOM   3875 C CE1 . TYR C 1 116 ? 18.676  8.022   32.772 1.00 63.29  ? 118 TYR C CE1 1 
ATOM   3876 C CE2 . TYR C 1 116 ? 17.724  9.925   33.894 1.00 51.26  ? 118 TYR C CE2 1 
ATOM   3877 C CZ  . TYR C 1 116 ? 18.834  9.211   33.474 1.00 55.95  ? 118 TYR C CZ  1 
ATOM   3878 O OH  . TYR C 1 116 ? 20.092  9.684   33.749 1.00 64.33  ? 118 TYR C OH  1 
ATOM   3879 N N   . GLY C 1 117 ? 12.443  7.634   29.588 1.00 60.76  ? 119 GLY C N   1 
ATOM   3880 C CA  . GLY C 1 117 ? 11.148  7.092   29.110 1.00 58.54  ? 119 GLY C CA  1 
ATOM   3881 C C   . GLY C 1 117 ? 9.906   7.988   28.968 1.00 57.86  ? 119 GLY C C   1 
ATOM   3882 O O   . GLY C 1 117 ? 9.970   9.215   29.164 1.00 57.25  ? 119 GLY C O   1 
ATOM   3883 N N   . SER C 1 118 ? 8.761   7.343   28.688 1.00 53.92  ? 120 SER C N   1 
ATOM   3884 C CA  . SER C 1 118 ? 7.500   8.018   28.307 1.00 47.74  ? 120 SER C CA  1 
ATOM   3885 C C   . SER C 1 118 ? 6.265   7.767   29.212 1.00 44.41  ? 120 SER C C   1 
ATOM   3886 O O   . SER C 1 118 ? 6.187   6.752   29.904 1.00 41.57  ? 120 SER C O   1 
ATOM   3887 C CB  . SER C 1 118 ? 7.156   7.601   26.889 1.00 48.49  ? 120 SER C CB  1 
ATOM   3888 O OG  . SER C 1 118 ? 6.678   6.270   26.861 1.00 54.22  ? 120 SER C OG  1 
ATOM   3889 N N   . VAL C 1 119 ? 5.304   8.697   29.187 1.00 42.04  ? 121 VAL C N   1 
ATOM   3890 C CA  . VAL C 1 119 ? 3.958   8.467   29.767 1.00 35.61  ? 121 VAL C CA  1 
ATOM   3891 C C   . VAL C 1 119 ? 2.966   8.874   28.695 1.00 31.94  ? 121 VAL C C   1 
ATOM   3892 O O   . VAL C 1 119 ? 3.120   9.945   28.117 1.00 32.13  ? 121 VAL C O   1 
ATOM   3893 C CB  . VAL C 1 119 ? 3.736   9.248   31.103 1.00 36.16  ? 121 VAL C CB  1 
ATOM   3894 C CG1 . VAL C 1 119 ? 2.394   8.926   31.704 1.00 31.24  ? 121 VAL C CG1 1 
ATOM   3895 C CG2 . VAL C 1 119 ? 4.802   8.888   32.120 1.00 40.76  ? 121 VAL C CG2 1 
ATOM   3896 N N   . ASP C 1 120 ? 2.017   7.998   28.360 1.00 26.58  ? 122 ASP C N   1 
ATOM   3897 C CA  . ASP C 1 120 ? 1.030   8.275   27.292 1.00 31.35  ? 122 ASP C CA  1 
ATOM   3898 C C   . ASP C 1 120 ? -0.354  7.890   27.724 1.00 30.27  ? 122 ASP C C   1 
ATOM   3899 O O   . ASP C 1 120 ? -0.534  6.750   28.188 1.00 27.66  ? 122 ASP C O   1 
ATOM   3900 C CB  . ASP C 1 120 ? 1.291   7.403   26.057 1.00 34.51  ? 122 ASP C CB  1 
ATOM   3901 C CG  . ASP C 1 120 ? 2.691   7.508   25.560 1.00 49.93  ? 122 ASP C CG  1 
ATOM   3902 O OD1 . ASP C 1 120 ? 3.309   6.444   25.304 1.00 60.86  ? 122 ASP C OD1 1 
ATOM   3903 O OD2 . ASP C 1 120 ? 3.169   8.656   25.440 1.00 65.30  ? 122 ASP C OD2 1 
ATOM   3904 N N   . TYR C 1 121 ? -1.315  8.813   27.546 1.00 29.10  ? 123 TYR C N   1 
ATOM   3905 C CA  . TYR C 1 121 ? -2.753  8.510   27.693 1.00 26.91  ? 123 TYR C CA  1 
ATOM   3906 C C   . TYR C 1 121 ? -3.448  8.694   26.375 1.00 26.98  ? 123 TYR C C   1 
ATOM   3907 O O   . TYR C 1 121 ? -3.181  9.636   25.618 1.00 28.76  ? 123 TYR C O   1 
ATOM   3908 C CB  . TYR C 1 121 ? -3.392  9.418   28.740 1.00 26.23  ? 123 TYR C CB  1 
ATOM   3909 C CG  . TYR C 1 121 ? -2.949  9.176   30.162 1.00 24.13  ? 123 TYR C CG  1 
ATOM   3910 C CD1 . TYR C 1 121 ? -3.778  8.559   31.065 1.00 21.63  ? 123 TYR C CD1 1 
ATOM   3911 C CD2 . TYR C 1 121 ? -1.697  9.596   30.602 1.00 23.60  ? 123 TYR C CD2 1 
ATOM   3912 C CE1 . TYR C 1 121 ? -3.383  8.383   32.385 1.00 20.72  ? 123 TYR C CE1 1 
ATOM   3913 C CE2 . TYR C 1 121 ? -1.261  9.365   31.912 1.00 26.78  ? 123 TYR C CE2 1 
ATOM   3914 C CZ  . TYR C 1 121 ? -2.152  8.739   32.792 1.00 29.09  ? 123 TYR C CZ  1 
ATOM   3915 O OH  . TYR C 1 121 ? -1.845  8.544   34.110 1.00 32.23  ? 123 TYR C OH  1 
ATOM   3916 N N   . TRP C 1 122 ? -4.382  7.821   26.072 1.00 24.96  ? 124 TRP C N   1 
ATOM   3917 C CA  . TRP C 1 122 ? -5.033  7.906   24.792 1.00 24.97  ? 124 TRP C CA  1 
ATOM   3918 C C   . TRP C 1 122 ? -6.343  7.168   24.851 1.00 30.67  ? 124 TRP C C   1 
ATOM   3919 O O   . TRP C 1 122 ? -6.567  6.358   25.768 1.00 31.48  ? 124 TRP C O   1 
ATOM   3920 C CB  . TRP C 1 122 ? -4.140  7.354   23.647 1.00 32.00  ? 124 TRP C CB  1 
ATOM   3921 C CG  . TRP C 1 122 ? -3.384  6.054   23.933 1.00 40.45  ? 124 TRP C CG  1 
ATOM   3922 C CD1 . TRP C 1 122 ? -2.047  5.926   24.203 1.00 40.16  ? 124 TRP C CD1 1 
ATOM   3923 C CD2 . TRP C 1 122 ? -3.912  4.707   23.906 1.00 41.42  ? 124 TRP C CD2 1 
ATOM   3924 N NE1 . TRP C 1 122 ? -1.716  4.603   24.374 1.00 36.33  ? 124 TRP C NE1 1 
ATOM   3925 C CE2 . TRP C 1 122 ? -2.838  3.832   24.200 1.00 45.12  ? 124 TRP C CE2 1 
ATOM   3926 C CE3 . TRP C 1 122 ? -5.191  4.166   23.708 1.00 43.50  ? 124 TRP C CE3 1 
ATOM   3927 C CZ2 . TRP C 1 122 ? -2.995  2.440   24.258 1.00 43.28  ? 124 TRP C CZ2 1 
ATOM   3928 C CZ3 . TRP C 1 122 ? -5.359  2.787   23.781 1.00 43.08  ? 124 TRP C CZ3 1 
ATOM   3929 C CH2 . TRP C 1 122 ? -4.263  1.936   24.051 1.00 45.90  ? 124 TRP C CH2 1 
ATOM   3930 N N   . VAL C 1 123 ? -7.234  7.498   23.911 1.00 29.96  ? 125 VAL C N   1 
ATOM   3931 C CA  . VAL C 1 123 ? -8.466  6.739   23.724 1.00 33.87  ? 125 VAL C CA  1 
ATOM   3932 C C   . VAL C 1 123 ? -8.379  6.185   22.316 1.00 36.12  ? 125 VAL C C   1 
ATOM   3933 O O   . VAL C 1 123 ? -8.048  6.909   21.385 1.00 37.10  ? 125 VAL C O   1 
ATOM   3934 C CB  . VAL C 1 123 ? -9.755  7.600   23.838 1.00 35.41  ? 125 VAL C CB  1 
ATOM   3935 C CG1 . VAL C 1 123 ? -11.036 6.767   23.483 1.00 28.06  ? 125 VAL C CG1 1 
ATOM   3936 C CG2 . VAL C 1 123 ? -9.877  8.190   25.237 1.00 26.74  ? 125 VAL C CG2 1 
ATOM   3937 N N   . LYS C 1 124 ? -8.668  4.893   22.199 1.00 35.42  ? 126 LYS C N   1 
ATOM   3938 C CA  . LYS C 1 124 ? -8.699  4.175   20.951 1.00 36.99  ? 126 LYS C CA  1 
ATOM   3939 C C   . LYS C 1 124 ? -10.161 3.723   20.740 1.00 37.85  ? 126 LYS C C   1 
ATOM   3940 O O   . LYS C 1 124 ? -10.745 3.120   21.655 1.00 38.29  ? 126 LYS C O   1 
ATOM   3941 C CB  . LYS C 1 124 ? -7.865  2.904   21.134 1.00 38.69  ? 126 LYS C CB  1 
ATOM   3942 C CG  . LYS C 1 124 ? -7.179  2.381   19.888 1.00 52.10  ? 126 LYS C CG  1 
ATOM   3943 C CD  . LYS C 1 124 ? -5.681  2.688   19.883 1.00 61.11  ? 126 LYS C CD  1 
ATOM   3944 C CE  . LYS C 1 124 ? -4.866  1.513   20.426 1.00 68.71  ? 126 LYS C CE  1 
ATOM   3945 N NZ  . LYS C 1 124 ? -3.498  1.428   19.825 1.00 59.75  ? 126 LYS C NZ  1 
ATOM   3946 N N   . ALA C 1 125 ? -10.736 4.049   19.590 1.00 39.60  ? 127 ALA C N   1 
ATOM   3947 C CA  . ALA C 1 125 ? -12.074 3.572   19.196 1.00 42.95  ? 127 ALA C CA  1 
ATOM   3948 C C   . ALA C 1 125 ? -11.920 2.478   18.176 1.00 48.33  ? 127 ALA C C   1 
ATOM   3949 O O   . ALA C 1 125 ? -11.087 2.599   17.275 1.00 50.80  ? 127 ALA C O   1 
ATOM   3950 C CB  . ALA C 1 125 ? -12.918 4.696   18.592 1.00 40.34  ? 127 ALA C CB  1 
ATOM   3951 N N   . PHE C 1 126 ? -12.726 1.424   18.325 1.00 51.46  ? 128 PHE C N   1 
ATOM   3952 C CA  . PHE C 1 126 ? -12.803 0.306   17.378 1.00 55.93  ? 128 PHE C CA  1 
ATOM   3953 C C   . PHE C 1 126 ? -14.189 0.225   16.762 1.00 58.34  ? 128 PHE C C   1 
ATOM   3954 O O   . PHE C 1 126 ? -15.203 0.248   17.469 1.00 60.59  ? 128 PHE C O   1 
ATOM   3955 C CB  . PHE C 1 126 ? -12.559 -1.003  18.111 1.00 55.16  ? 128 PHE C CB  1 
ATOM   3956 C CG  . PHE C 1 126 ? -11.402 -0.957  19.047 1.00 55.54  ? 128 PHE C CG  1 
ATOM   3957 C CD1 . PHE C 1 126 ? -10.137 -1.314  18.615 1.00 61.73  ? 128 PHE C CD1 1 
ATOM   3958 C CD2 . PHE C 1 126 ? -11.574 -0.567  20.365 1.00 57.81  ? 128 PHE C CD2 1 
ATOM   3959 C CE1 . PHE C 1 126 ? -9.056  -1.268  19.478 1.00 56.37  ? 128 PHE C CE1 1 
ATOM   3960 C CE2 . PHE C 1 126 ? -10.489 -0.520  21.237 1.00 55.76  ? 128 PHE C CE2 1 
ATOM   3961 C CZ  . PHE C 1 126 ? -9.240  -0.886  20.794 1.00 54.86  ? 128 PHE C CZ  1 
ATOM   3962 N N   . LEU C 1 127 ? -14.228 0.148   15.447 1.00 61.97  ? 129 LEU C N   1 
ATOM   3963 C CA  . LEU C 1 127 ? -15.465 -0.052  14.711 1.00 64.81  ? 129 LEU C CA  1 
ATOM   3964 C C   . LEU C 1 127 ? -15.577 -1.540  14.318 1.00 68.34  ? 129 LEU C C   1 
ATOM   3965 O O   . LEU C 1 127 ? -14.821 -2.023  13.483 1.00 69.67  ? 129 LEU C O   1 
ATOM   3966 C CB  . LEU C 1 127 ? -15.469 0.868   13.486 1.00 62.17  ? 129 LEU C CB  1 
ATOM   3967 C CG  . LEU C 1 127 ? -16.693 0.978   12.587 1.00 68.95  ? 129 LEU C CG  1 
ATOM   3968 C CD1 . LEU C 1 127 ? -17.970 1.213   13.401 1.00 59.24  ? 129 LEU C CD1 1 
ATOM   3969 C CD2 . LEU C 1 127 ? -16.482 2.083   11.541 1.00 63.72  ? 129 LEU C CD2 1 
ATOM   3970 N N   . ASP C 1 128 ? -16.482 -2.276  14.962 1.00 70.61  ? 130 ASP C N   1 
ATOM   3971 C CA  . ASP C 1 128 ? -16.692 -3.679  14.626 1.00 73.18  ? 130 ASP C CA  1 
ATOM   3972 C C   . ASP C 1 128 ? -17.693 -3.762  13.486 1.00 76.50  ? 130 ASP C C   1 
ATOM   3973 O O   . ASP C 1 128 ? -18.684 -3.021  13.469 1.00 77.36  ? 130 ASP C O   1 
ATOM   3974 C CB  . ASP C 1 128 ? -17.232 -4.462  15.823 1.00 72.32  ? 130 ASP C CB  1 
ATOM   3975 C CG  . ASP C 1 128 ? -16.217 -4.618  16.943 1.00 79.27  ? 130 ASP C CG  1 
ATOM   3976 O OD1 . ASP C 1 128 ? -16.652 -4.858  18.098 1.00 83.66  ? 130 ASP C OD1 1 
ATOM   3977 O OD2 . ASP C 1 128 ? -14.996 -4.505  16.680 1.00 80.24  ? 130 ASP C OD2 1 
ATOM   3978 N N   . ARG C 1 129 ? -17.449 -4.669  12.540 1.00 79.61  ? 131 ARG C N   1 
ATOM   3979 C CA  . ARG C 1 129 ? -18.380 -4.886  11.420 1.00 80.76  ? 131 ARG C CA  1 
ATOM   3980 C C   . ARG C 1 129 ? -18.533 -6.379  11.054 1.00 84.02  ? 131 ARG C C   1 
ATOM   3981 O O   . ARG C 1 129 ? -17.607 -7.170  11.290 1.00 84.67  ? 131 ARG C O   1 
ATOM   3982 C CB  . ARG C 1 129 ? -17.946 -4.066  10.200 1.00 80.22  ? 131 ARG C CB  1 
ATOM   3983 C CG  . ARG C 1 129 ? -18.191 -2.584  10.340 1.00 73.59  ? 131 ARG C CG  1 
ATOM   3984 C CD  . ARG C 1 129 ? -17.360 -1.820  9.351  1.00 79.70  ? 131 ARG C CD  1 
ATOM   3985 N NE  . ARG C 1 129 ? -18.011 -1.639  8.052  1.00 82.43  ? 131 ARG C NE  1 
ATOM   3986 C CZ  . ARG C 1 129 ? -17.391 -1.211  6.947  1.00 85.27  ? 131 ARG C CZ  1 
ATOM   3987 N NH1 . ARG C 1 129 ? -16.094 -0.930  6.964  1.00 75.35  ? 131 ARG C NH1 1 
ATOM   3988 N NH2 . ARG C 1 129 ? -18.068 -1.073  5.811  1.00 86.10  ? 131 ARG C NH2 1 
ATOM   3989 N N   . PRO C 1 130 ? -19.710 -6.772  10.490 1.00 86.30  ? 132 PRO C N   1 
ATOM   3990 C CA  . PRO C 1 130 ? -19.876 -8.154  10.007 1.00 87.00  ? 132 PRO C CA  1 
ATOM   3991 C C   . PRO C 1 130 ? -18.944 -8.477  8.834  1.00 87.98  ? 132 PRO C C   1 
ATOM   3992 O O   . PRO C 1 130 ? -18.946 -7.788  7.787  1.00 86.09  ? 132 PRO C O   1 
ATOM   3993 C CB  . PRO C 1 130 ? -21.340 -8.212  9.564  1.00 86.99  ? 132 PRO C CB  1 
ATOM   3994 C CG  . PRO C 1 130 ? -21.993 -7.025  10.192 1.00 87.73  ? 132 PRO C CG  1 
ATOM   3995 C CD  . PRO C 1 130 ? -20.933 -5.976  10.275 1.00 85.26  ? 132 PRO C CD  1 
ATOM   3996 N N   . SER C 1 131 ? -18.126 -9.504  9.058  1.00 89.74  ? 133 SER C N   1 
ATOM   3997 C CA  . SER C 1 131 ? -17.239 -10.086 8.043  1.00 91.11  ? 133 SER C CA  1 
ATOM   3998 C C   . SER C 1 131 ? -16.025 -9.222  7.684  1.00 88.76  ? 133 SER C C   1 
ATOM   3999 O O   . SER C 1 131 ? -15.148 -9.660  6.934  1.00 88.81  ? 133 SER C O   1 
ATOM   4000 C CB  . SER C 1 131 ? -18.039 -10.493 6.797  1.00 93.13  ? 133 SER C CB  1 
ATOM   4001 O OG  . SER C 1 131 ? -19.109 -11.356 7.159  1.00 95.16  ? 133 SER C OG  1 
ATOM   4002 N N   . GLN C 1 132 ? -15.974 -8.013  8.246  1.00 85.79  ? 134 GLN C N   1 
ATOM   4003 C CA  . GLN C 1 132 ? -14.885 -7.078  7.996  1.00 84.56  ? 134 GLN C CA  1 
ATOM   4004 C C   . GLN C 1 132 ? -13.859 -7.094  9.123  1.00 83.82  ? 134 GLN C C   1 
ATOM   4005 O O   . GLN C 1 132 ? -14.221 -7.303  10.288 1.00 82.59  ? 134 GLN C O   1 
ATOM   4006 C CB  . GLN C 1 132 ? -15.429 -5.662  7.823  1.00 83.53  ? 134 GLN C CB  1 
ATOM   4007 C CG  . GLN C 1 132 ? -16.152 -5.428  6.511  1.00 87.13  ? 134 GLN C CG  1 
ATOM   4008 C CD  . GLN C 1 132 ? -15.203 -5.267  5.344  1.00 90.20  ? 134 GLN C CD  1 
ATOM   4009 O OE1 . GLN C 1 132 ? -15.376 -5.899  4.295  1.00 90.11  ? 134 GLN C OE1 1 
ATOM   4010 N NE2 . GLN C 1 132 ? -14.191 -4.420  5.517  1.00 86.46  ? 134 GLN C NE2 1 
ATOM   4011 N N   . PRO C 1 133 ? -12.567 -6.863  8.791  1.00 83.79  ? 135 PRO C N   1 
ATOM   4012 C CA  . PRO C 1 133 ? -11.618 -6.648  9.879  1.00 81.08  ? 135 PRO C CA  1 
ATOM   4013 C C   . PRO C 1 133 ? -11.975 -5.322  10.565 1.00 78.52  ? 135 PRO C C   1 
ATOM   4014 O O   . PRO C 1 133 ? -12.457 -4.385  9.902  1.00 74.43  ? 135 PRO C O   1 
ATOM   4015 C CB  . PRO C 1 133 ? -10.265 -6.574  9.162  1.00 82.14  ? 135 PRO C CB  1 
ATOM   4016 C CG  . PRO C 1 133 ? -10.593 -6.130  7.777  1.00 83.93  ? 135 PRO C CG  1 
ATOM   4017 C CD  . PRO C 1 133 ? -11.922 -6.763  7.466  1.00 85.41  ? 135 PRO C CD  1 
ATOM   4018 N N   . THR C 1 134 ? -11.774 -5.261  11.881 1.00 76.99  ? 136 THR C N   1 
ATOM   4019 C CA  . THR C 1 134 ? -12.251 -4.120  12.669 1.00 74.17  ? 136 THR C CA  1 
ATOM   4020 C C   . THR C 1 134 ? -11.296 -2.946  12.513 1.00 71.31  ? 136 THR C C   1 
ATOM   4021 O O   . THR C 1 134 ? -10.079 -3.116  12.576 1.00 71.83  ? 136 THR C O   1 
ATOM   4022 C CB  . THR C 1 134 ? -12.450 -4.478  14.161 1.00 73.16  ? 136 THR C CB  1 
ATOM   4023 O OG1 . THR C 1 134 ? -11.213 -4.940  14.712 1.00 79.72  ? 136 THR C OG1 1 
ATOM   4024 C CG2 . THR C 1 134 ? -13.485 -5.589  14.323 1.00 76.75  ? 136 THR C CG2 1 
ATOM   4025 N N   . GLN C 1 135 ? -11.856 -1.762  12.292 1.00 66.70  ? 137 GLN C N   1 
ATOM   4026 C CA  . GLN C 1 135 ? -11.062 -0.557  12.086 1.00 63.33  ? 137 GLN C CA  1 
ATOM   4027 C C   . GLN C 1 135 ? -10.740 0.149   13.421 1.00 60.76  ? 137 GLN C C   1 
ATOM   4028 O O   . GLN C 1 135 ? -11.538 0.107   14.360 1.00 59.96  ? 137 GLN C O   1 
ATOM   4029 C CB  . GLN C 1 135 ? -11.821 0.365   11.145 1.00 61.48  ? 137 GLN C CB  1 
ATOM   4030 C CG  . GLN C 1 135 ? -11.109 1.633   10.730 1.00 61.10  ? 137 GLN C CG  1 
ATOM   4031 C CD  . GLN C 1 135 ? -11.943 2.390   9.738  1.00 59.46  ? 137 GLN C CD  1 
ATOM   4032 O OE1 . GLN C 1 135 ? -12.949 1.876   9.277  1.00 63.03  ? 137 GLN C OE1 1 
ATOM   4033 N NE2 . GLN C 1 135 ? -11.543 3.609   9.399  1.00 55.46  ? 137 GLN C NE2 1 
ATOM   4034 N N   . GLU C 1 136 ? -9.575  0.798   13.479 1.00 58.68  ? 138 GLU C N   1 
ATOM   4035 C CA  . GLU C 1 136 ? -9.123  1.566   14.648 1.00 54.94  ? 138 GLU C CA  1 
ATOM   4036 C C   . GLU C 1 136 ? -8.948  3.068   14.409 1.00 53.70  ? 138 GLU C C   1 
ATOM   4037 O O   . GLU C 1 136 ? -8.605  3.505   13.308 1.00 52.92  ? 138 GLU C O   1 
ATOM   4038 C CB  . GLU C 1 136 ? -7.767  1.045   15.095 1.00 57.70  ? 138 GLU C CB  1 
ATOM   4039 C CG  . GLU C 1 136 ? -7.795  -0.207  15.931 1.00 63.08  ? 138 GLU C CG  1 
ATOM   4040 C CD  . GLU C 1 136 ? -6.439  -0.490  16.520 1.00 65.77  ? 138 GLU C CD  1 
ATOM   4041 O OE1 . GLU C 1 136 ? -6.133  -1.683  16.742 1.00 68.29  ? 138 GLU C OE1 1 
ATOM   4042 O OE2 . GLU C 1 136 ? -5.685  0.490   16.750 1.00 62.21  ? 138 GLU C OE2 1 
ATOM   4043 N N   . THR C 1 137 ? -9.174  3.854   15.467 1.00 50.69  ? 139 THR C N   1 
ATOM   4044 C CA  . THR C 1 137 ? -8.722  5.252   15.513 1.00 46.32  ? 139 THR C CA  1 
ATOM   4045 C C   . THR C 1 137 ? -8.229  5.571   16.942 1.00 43.63  ? 139 THR C C   1 
ATOM   4046 O O   . THR C 1 137 ? -8.771  5.069   17.915 1.00 46.34  ? 139 THR C O   1 
ATOM   4047 C CB  . THR C 1 137 ? -9.786  6.257   14.984 1.00 42.88  ? 139 THR C CB  1 
ATOM   4048 O OG1 . THR C 1 137 ? -9.221  7.573   14.913 1.00 47.65  ? 139 THR C OG1 1 
ATOM   4049 C CG2 . THR C 1 137 ? -10.994 6.345   15.884 1.00 36.43  ? 139 THR C CG2 1 
ATOM   4050 N N   . LYS C 1 138 ? -7.198  6.401   17.053 1.00 42.80  ? 140 LYS C N   1 
ATOM   4051 C CA  . LYS C 1 138 ? -6.576  6.715   18.349 1.00 42.79  ? 140 LYS C CA  1 
ATOM   4052 C C   . LYS C 1 138 ? -6.370  8.212   18.491 1.00 42.36  ? 140 LYS C C   1 
ATOM   4053 O O   . LYS C 1 138 ? -5.932  8.859   17.537 1.00 43.06  ? 140 LYS C O   1 
ATOM   4054 C CB  . LYS C 1 138 ? -5.236  5.996   18.459 1.00 43.32  ? 140 LYS C CB  1 
ATOM   4055 C CG  . LYS C 1 138 ? -4.366  6.402   19.623 1.00 45.10  ? 140 LYS C CG  1 
ATOM   4056 C CD  . LYS C 1 138 ? -3.201  5.484   19.693 1.00 52.46  ? 140 LYS C CD  1 
ATOM   4057 C CE  . LYS C 1 138 ? -2.037  6.149   20.377 1.00 52.60  ? 140 LYS C CE  1 
ATOM   4058 N NZ  . LYS C 1 138 ? -0.854  5.302   20.131 1.00 52.51  ? 140 LYS C NZ  1 
ATOM   4059 N N   . LYS C 1 139 ? -6.736  8.755   19.658 1.00 38.56  ? 141 LYS C N   1 
ATOM   4060 C CA  . LYS C 1 139 ? -6.420  10.134  20.007 1.00 34.07  ? 141 LYS C CA  1 
ATOM   4061 C C   . LYS C 1 139 ? -5.867  10.246  21.446 1.00 31.20  ? 141 LYS C C   1 
ATOM   4062 O O   . LYS C 1 139 ? -6.441  9.707   22.395 1.00 32.82  ? 141 LYS C O   1 
ATOM   4063 C CB  . LYS C 1 139 ? -7.647  11.028  19.840 1.00 34.88  ? 141 LYS C CB  1 
ATOM   4064 C CG  . LYS C 1 139 ? -7.258  12.452  19.511 1.00 35.27  ? 141 LYS C CG  1 
ATOM   4065 C CD  . LYS C 1 139 ? -8.460  13.305  19.292 1.00 38.25  ? 141 LYS C CD  1 
ATOM   4066 C CE  . LYS C 1 139 ? -8.529  13.740  17.861 1.00 44.88  ? 141 LYS C CE  1 
ATOM   4067 N NZ  . LYS C 1 139 ? -9.694  14.625  17.679 1.00 46.69  ? 141 LYS C NZ  1 
ATOM   4068 N N   . ASN C 1 140 ? -4.737  10.925  21.587 1.00 31.88  ? 142 ASN C N   1 
ATOM   4069 C CA  . ASN C 1 140 ? -4.067  11.110  22.873 1.00 30.01  ? 142 ASN C CA  1 
ATOM   4070 C C   . ASN C 1 140 ? -4.807  12.151  23.659 1.00 29.25  ? 142 ASN C C   1 
ATOM   4071 O O   . ASN C 1 140 ? -5.518  12.949  23.079 1.00 28.01  ? 142 ASN C O   1 
ATOM   4072 C CB  . ASN C 1 140 ? -2.656  11.641  22.671 1.00 32.97  ? 142 ASN C CB  1 
ATOM   4073 C CG  . ASN C 1 140 ? -1.788  10.691  21.867 1.00 46.67  ? 142 ASN C CG  1 
ATOM   4074 O OD1 . ASN C 1 140 ? -1.232  11.072  20.835 1.00 59.36  ? 142 ASN C OD1 1 
ATOM   4075 N ND2 . ASN C 1 140 ? -1.687  9.444   22.321 1.00 45.15  ? 142 ASN C ND2 1 
ATOM   4076 N N   . PHE C 1 141 ? -4.585  12.168  24.964 1.00 28.15  ? 143 PHE C N   1 
ATOM   4077 C CA  . PHE C 1 141 ? -5.053  13.253  25.797 1.00 28.19  ? 143 PHE C CA  1 
ATOM   4078 C C   . PHE C 1 141 ? -4.001  13.498  26.838 1.00 27.93  ? 143 PHE C C   1 
ATOM   4079 O O   . PHE C 1 141 ? -3.194  12.586  27.138 1.00 28.57  ? 143 PHE C O   1 
ATOM   4080 C CB  . PHE C 1 141 ? -6.465  13.026  26.364 1.00 23.75  ? 143 PHE C CB  1 
ATOM   4081 C CG  . PHE C 1 141 ? -6.594  11.881  27.311 1.00 26.93  ? 143 PHE C CG  1 
ATOM   4082 C CD1 . PHE C 1 141 ? -7.008  10.642  26.857 1.00 26.45  ? 143 PHE C CD1 1 
ATOM   4083 C CD2 . PHE C 1 141 ? -6.359  12.050  28.665 1.00 25.60  ? 143 PHE C CD2 1 
ATOM   4084 C CE1 . PHE C 1 141 ? -7.116  9.584   27.717 1.00 21.34  ? 143 PHE C CE1 1 
ATOM   4085 C CE2 . PHE C 1 141 ? -6.487  11.019  29.549 1.00 27.01  ? 143 PHE C CE2 1 
ATOM   4086 C CZ  . PHE C 1 141 ? -6.896  9.765   29.065 1.00 21.16  ? 143 PHE C CZ  1 
ATOM   4087 N N   . GLU C 1 142 ? -3.958  14.727  27.366 1.00 25.63  ? 144 GLU C N   1 
ATOM   4088 C CA  . GLU C 1 142 ? -2.878  15.080  28.296 1.00 24.24  ? 144 GLU C CA  1 
ATOM   4089 C C   . GLU C 1 142 ? -3.278  15.014  29.739 1.00 27.39  ? 144 GLU C C   1 
ATOM   4090 O O   . GLU C 1 142 ? -4.409  15.394  30.087 1.00 25.20  ? 144 GLU C O   1 
ATOM   4091 C CB  . GLU C 1 142 ? -2.298  16.465  27.984 1.00 32.23  ? 144 GLU C CB  1 
ATOM   4092 C CG  . GLU C 1 142 ? -1.737  16.563  26.585 1.00 39.81  ? 144 GLU C CG  1 
ATOM   4093 C CD  . GLU C 1 142 ? -0.526  15.647  26.363 1.00 26.77  ? 144 GLU C CD  1 
ATOM   4094 O OE1 . GLU C 1 142 ? 0.406   15.655  27.178 1.00 37.54  ? 144 GLU C OE1 1 
ATOM   4095 O OE2 . GLU C 1 142 ? -0.559  14.912  25.353 1.00 45.78  ? 144 GLU C OE2 1 
ATOM   4096 N N   . VAL C 1 143 ? -2.329  14.566  30.565 1.00 24.35  ? 145 VAL C N   1 
ATOM   4097 C CA  . VAL C 1 143 ? -2.538  14.420  32.017 1.00 30.47  ? 145 VAL C CA  1 
ATOM   4098 C C   . VAL C 1 143 ? -1.434  15.153  32.760 1.00 34.07  ? 145 VAL C C   1 
ATOM   4099 O O   . VAL C 1 143 ? -0.314  15.195  32.284 1.00 35.55  ? 145 VAL C O   1 
ATOM   4100 C CB  . VAL C 1 143 ? -2.536  12.932  32.408 1.00 29.99  ? 145 VAL C CB  1 
ATOM   4101 C CG1 . VAL C 1 143 ? -2.525  12.716  33.907 1.00 39.26  ? 145 VAL C CG1 1 
ATOM   4102 C CG2 . VAL C 1 143 ? -3.794  12.260  31.796 1.00 28.47  ? 145 VAL C CG2 1 
ATOM   4103 N N   . VAL C 1 144 ? -1.766  15.742  33.907 1.00 37.44  ? 146 VAL C N   1 
ATOM   4104 C CA  . VAL C 1 144 ? -0.738  16.247  34.828 1.00 41.09  ? 146 VAL C CA  1 
ATOM   4105 C C   . VAL C 1 144 ? -1.079  15.801  36.252 1.00 43.30  ? 146 VAL C C   1 
ATOM   4106 O O   . VAL C 1 144 ? -2.204  15.931  36.679 1.00 38.82  ? 146 VAL C O   1 
ATOM   4107 C CB  . VAL C 1 144 ? -0.588  17.786  34.763 1.00 44.85  ? 146 VAL C CB  1 
ATOM   4108 C CG1 . VAL C 1 144 ? -1.945  18.529  35.040 1.00 50.94  ? 146 VAL C CG1 1 
ATOM   4109 C CG2 . VAL C 1 144 ? 0.536   18.277  35.728 1.00 49.56  ? 146 VAL C CG2 1 
ATOM   4110 N N   . ASP C 1 145 ? -0.100  15.263  36.974 1.00 46.84  ? 147 ASP C N   1 
ATOM   4111 C CA  . ASP C 1 145 ? -0.262  15.021  38.401 1.00 52.10  ? 147 ASP C CA  1 
ATOM   4112 C C   . ASP C 1 145 ? 0.358   16.142  39.248 1.00 54.34  ? 147 ASP C C   1 
ATOM   4113 O O   . ASP C 1 145 ? 1.464   16.610  38.962 1.00 55.53  ? 147 ASP C O   1 
ATOM   4114 C CB  . ASP C 1 145 ? 0.312   13.663  38.806 1.00 51.62  ? 147 ASP C CB  1 
ATOM   4115 C CG  . ASP C 1 145 ? -0.471  13.018  39.983 1.00 62.58  ? 147 ASP C CG  1 
ATOM   4116 O OD1 . ASP C 1 145 ? -1.738  13.081  40.023 1.00 54.17  ? 147 ASP C OD1 1 
ATOM   4117 O OD2 . ASP C 1 145 ? 0.192   12.444  40.870 1.00 66.87  ? 147 ASP C OD2 1 
ATOM   4118 N N   . PRO C 1 152 ? 12.324  14.890  39.787 1.00 69.33  ? 154 PRO C N   1 
ATOM   4119 C CA  . PRO C 1 152 ? 13.780  15.046  39.734 1.00 69.06  ? 154 PRO C CA  1 
ATOM   4120 C C   . PRO C 1 152 ? 14.487  13.859  39.059 1.00 67.89  ? 154 PRO C C   1 
ATOM   4121 O O   . PRO C 1 152 ? 13.915  12.765  39.004 1.00 67.16  ? 154 PRO C O   1 
ATOM   4122 C CB  . PRO C 1 152 ? 14.174  15.150  41.207 1.00 69.16  ? 154 PRO C CB  1 
ATOM   4123 C CG  . PRO C 1 152 ? 13.123  14.364  41.930 1.00 70.28  ? 154 PRO C CG  1 
ATOM   4124 C CD  . PRO C 1 152 ? 11.855  14.415  41.103 1.00 69.57  ? 154 PRO C CD  1 
ATOM   4125 N N   . ASP C 1 153 ? 15.711  14.105  38.563 1.00 66.78  ? 155 ASP C N   1 
ATOM   4126 C CA  . ASP C 1 153 ? 16.539  13.153  37.795 1.00 64.23  ? 155 ASP C CA  1 
ATOM   4127 C C   . ASP C 1 153 ? 16.634  11.822  38.518 1.00 61.19  ? 155 ASP C C   1 
ATOM   4128 O O   . ASP C 1 153 ? 16.914  11.785  39.712 1.00 61.14  ? 155 ASP C O   1 
ATOM   4129 C CB  . ASP C 1 153 ? 17.956  13.734  37.564 1.00 65.86  ? 155 ASP C CB  1 
ATOM   4130 C CG  . ASP C 1 153 ? 18.944  12.733  36.910 1.00 63.14  ? 155 ASP C CG  1 
ATOM   4131 O OD1 . ASP C 1 153 ? 18.523  11.782  36.239 1.00 59.04  ? 155 ASP C OD1 1 
ATOM   4132 O OD2 . ASP C 1 153 ? 20.175  12.926  37.047 1.00 72.54  ? 155 ASP C OD2 1 
ATOM   4133 N N   . LEU C 1 154 ? 16.411  10.746  37.767 1.00 55.93  ? 156 LEU C N   1 
ATOM   4134 C CA  . LEU C 1 154 ? 16.351  9.390   38.290 1.00 53.05  ? 156 LEU C CA  1 
ATOM   4135 C C   . LEU C 1 154 ? 17.697  8.871   38.816 1.00 50.63  ? 156 LEU C C   1 
ATOM   4136 O O   . LEU C 1 154 ? 17.735  7.995   39.671 1.00 46.50  ? 156 LEU C O   1 
ATOM   4137 C CB  . LEU C 1 154 ? 15.823  8.483   37.192 1.00 55.33  ? 156 LEU C CB  1 
ATOM   4138 C CG  . LEU C 1 154 ? 15.351  7.058   37.414 1.00 53.93  ? 156 LEU C CG  1 
ATOM   4139 C CD1 . LEU C 1 154 ? 14.355  6.773   36.344 1.00 59.03  ? 156 LEU C CD1 1 
ATOM   4140 C CD2 . LEU C 1 154 ? 16.526  6.161   37.227 1.00 56.03  ? 156 LEU C CD2 1 
ATOM   4141 N N   . MET C 1 155 ? 18.791  9.402   38.279 1.00 47.17  ? 157 MET C N   1 
ATOM   4142 C CA  . MET C 1 155 ? 20.128  9.044   38.698 1.00 42.92  ? 157 MET C CA  1 
ATOM   4143 C C   . MET C 1 155 ? 20.657  10.007  39.759 1.00 40.12  ? 157 MET C C   1 
ATOM   4144 O O   . MET C 1 155 ? 21.777  9.845   40.216 1.00 39.78  ? 157 MET C O   1 
ATOM   4145 C CB  . MET C 1 155 ? 21.085  9.052   37.497 1.00 49.53  ? 157 MET C CB  1 
ATOM   4146 C CG  . MET C 1 155 ? 20.733  8.062   36.393 1.00 54.96  ? 157 MET C CG  1 
ATOM   4147 S SD  . MET C 1 155 ? 20.919  6.323   36.880 1.00 69.51  ? 157 MET C SD  1 
ATOM   4148 C CE  . MET C 1 155 ? 19.428  5.977   37.737 1.00 56.14  ? 157 MET C CE  1 
ATOM   4149 N N   . ALA C 1 156 ? 19.879  11.022  40.142 1.00 39.28  ? 158 ALA C N   1 
ATOM   4150 C CA  . ALA C 1 156 ? 20.361  11.980  41.168 1.00 40.46  ? 158 ALA C CA  1 
ATOM   4151 C C   . ALA C 1 156 ? 20.174  11.417  42.593 1.00 43.13  ? 158 ALA C C   1 
ATOM   4152 O O   . ALA C 1 156 ? 19.207  10.695  42.849 1.00 41.65  ? 158 ALA C O   1 
ATOM   4153 C CB  . ALA C 1 156 ? 19.624  13.304  41.029 1.00 45.24  ? 158 ALA C CB  1 
ATOM   4154 N N   . PRO C 1 157 ? 21.073  11.770  43.535 1.00 46.70  ? 159 PRO C N   1 
ATOM   4155 C CA  . PRO C 1 157 ? 21.019  11.203  44.879 1.00 45.94  ? 159 PRO C CA  1 
ATOM   4156 C C   . PRO C 1 157 ? 19.763  11.633  45.606 1.00 48.82  ? 159 PRO C C   1 
ATOM   4157 O O   . PRO C 1 157 ? 19.253  12.726  45.358 1.00 52.06  ? 159 PRO C O   1 
ATOM   4158 C CB  . PRO C 1 157 ? 22.254  11.790  45.551 1.00 48.44  ? 159 PRO C CB  1 
ATOM   4159 C CG  . PRO C 1 157 ? 22.530  13.062  44.824 1.00 53.42  ? 159 PRO C CG  1 
ATOM   4160 C CD  . PRO C 1 157 ? 22.159  12.760  43.398 1.00 48.35  ? 159 PRO C CD  1 
ATOM   4161 N N   . VAL C 1 158 ? 19.237  10.770  46.470 1.00 48.55  ? 160 VAL C N   1 
ATOM   4162 C CA  . VAL C 1 158 ? 17.959  11.035  47.145 1.00 47.46  ? 160 VAL C CA  1 
ATOM   4163 C C   . VAL C 1 158 ? 18.246  11.063  48.657 1.00 47.66  ? 160 VAL C C   1 
ATOM   4164 O O   . VAL C 1 158 ? 18.982  10.216  49.164 1.00 42.58  ? 160 VAL C O   1 
ATOM   4165 C CB  . VAL C 1 158 ? 16.889  9.964   46.814 1.00 46.85  ? 160 VAL C CB  1 
ATOM   4166 C CG1 . VAL C 1 158 ? 15.564  10.280  47.506 1.00 54.50  ? 160 VAL C CG1 1 
ATOM   4167 C CG2 . VAL C 1 158 ? 16.638  9.877   45.321 1.00 51.38  ? 160 VAL C CG2 1 
ATOM   4168 N N   . SER C 1 159 ? 17.667  12.026  49.363 1.00 45.93  ? 161 SER C N   1 
ATOM   4169 C CA  . SER C 1 159 ? 17.995  12.200  50.771 1.00 48.68  ? 161 SER C CA  1 
ATOM   4170 C C   . SER C 1 159 ? 16.849  12.867  51.518 1.00 47.81  ? 161 SER C C   1 
ATOM   4171 O O   . SER C 1 159 ? 15.944  13.440  50.894 1.00 45.07  ? 161 SER C O   1 
ATOM   4172 C CB  . SER C 1 159 ? 19.275  13.027  50.901 1.00 46.43  ? 161 SER C CB  1 
ATOM   4173 O OG  . SER C 1 159 ? 18.985  14.393  50.689 1.00 60.61  ? 161 SER C OG  1 
ATOM   4174 N N   . ALA C 1 160 ? 16.895  12.790  52.850 1.00 44.44  ? 162 ALA C N   1 
ATOM   4175 C CA  . ALA C 1 160 ? 15.873  13.374  53.689 1.00 39.31  ? 162 ALA C CA  1 
ATOM   4176 C C   . ALA C 1 160 ? 16.415  13.416  55.128 1.00 40.06  ? 162 ALA C C   1 
ATOM   4177 O O   . ALA C 1 160 ? 17.365  12.714  55.448 1.00 38.92  ? 162 ALA C O   1 
ATOM   4178 C CB  . ALA C 1 160 ? 14.636  12.545  53.640 1.00 39.21  ? 162 ALA C CB  1 
ATOM   4179 N N   . LYS C 1 161 ? 15.788  14.224  55.978 1.00 40.96  ? 163 LYS C N   1 
ATOM   4180 C CA  . LYS C 1 161 ? 16.108  14.250  57.411 1.00 40.45  ? 163 LYS C CA  1 
ATOM   4181 C C   . LYS C 1 161 ? 14.852  14.535  58.192 1.00 42.06  ? 163 LYS C C   1 
ATOM   4182 O O   . LYS C 1 161 ? 13.961  15.237  57.696 1.00 41.63  ? 163 LYS C O   1 
ATOM   4183 C CB  . LYS C 1 161 ? 17.229  15.238  57.729 1.00 47.87  ? 163 LYS C CB  1 
ATOM   4184 C CG  . LYS C 1 161 ? 17.008  16.673  57.246 1.00 54.72  ? 163 LYS C CG  1 
ATOM   4185 C CD  . LYS C 1 161 ? 18.346  17.347  57.013 1.00 70.17  ? 163 LYS C CD  1 
ATOM   4186 C CE  . LYS C 1 161 ? 18.254  18.867  57.103 1.00 80.70  ? 163 LYS C CE  1 
ATOM   4187 N NZ  . LYS C 1 161 ? 19.619  19.456  57.306 1.00 81.29  ? 163 LYS C NZ  1 
ATOM   4188 N N   . LYS C 1 162 ? 14.756  13.944  59.387 1.00 39.33  ? 164 LYS C N   1 
ATOM   4189 C CA  . LYS C 1 162 ? 13.630  14.131  60.266 1.00 39.91  ? 164 LYS C CA  1 
ATOM   4190 C C   . LYS C 1 162 ? 14.156  14.133  61.706 1.00 43.81  ? 164 LYS C C   1 
ATOM   4191 O O   . LYS C 1 162 ? 15.045  13.367  62.054 1.00 39.07  ? 164 LYS C O   1 
ATOM   4192 C CB  . LYS C 1 162 ? 12.636  13.000  60.075 1.00 39.67  ? 164 LYS C CB  1 
ATOM   4193 C CG  . LYS C 1 162 ? 11.244  13.241  60.614 1.00 45.30  ? 164 LYS C CG  1 
ATOM   4194 C CD  . LYS C 1 162 ? 10.283  13.403  59.471 1.00 47.63  ? 164 LYS C CD  1 
ATOM   4195 C CE  . LYS C 1 162 ? 8.991   12.719  59.800 1.00 60.15  ? 164 LYS C CE  1 
ATOM   4196 N NZ  . LYS C 1 162 ? 8.285   12.271  58.579 1.00 62.87  ? 164 LYS C NZ  1 
ATOM   4197 N N   . GLU C 1 163 ? 13.623  15.033  62.516 1.00 47.45  ? 165 GLU C N   1 
ATOM   4198 C CA  . GLU C 1 163 ? 13.978  15.114  63.927 1.00 49.25  ? 165 GLU C CA  1 
ATOM   4199 C C   . GLU C 1 163 ? 12.688  15.152  64.720 1.00 51.94  ? 165 GLU C C   1 
ATOM   4200 O O   . GLU C 1 163 ? 11.763  15.885  64.389 1.00 53.01  ? 165 GLU C O   1 
ATOM   4201 C CB  . GLU C 1 163 ? 14.848  16.344  64.205 1.00 49.63  ? 165 GLU C CB  1 
ATOM   4202 C CG  . GLU C 1 163 ? 15.094  16.595  65.692 1.00 59.22  ? 165 GLU C CG  1 
ATOM   4203 C CD  . GLU C 1 163 ? 16.474  17.137  65.988 1.00 71.08  ? 165 GLU C CD  1 
ATOM   4204 O OE1 . GLU C 1 163 ? 16.857  18.147  65.354 1.00 75.18  ? 165 GLU C OE1 1 
ATOM   4205 O OE2 . GLU C 1 163 ? 17.165  16.557  66.864 1.00 75.91  ? 165 GLU C OE2 1 
ATOM   4206 N N   . LYS C 1 164 ? 12.615  14.325  65.760 1.00 52.90  ? 166 LYS C N   1 
ATOM   4207 C CA  . LYS C 1 164 ? 11.431  14.263  66.595 1.00 49.77  ? 166 LYS C CA  1 
ATOM   4208 C C   . LYS C 1 164 ? 11.816  14.499  68.059 1.00 48.75  ? 166 LYS C C   1 
ATOM   4209 O O   . LYS C 1 164 ? 12.816  13.969  68.548 1.00 42.28  ? 166 LYS C O   1 
ATOM   4210 C CB  . LYS C 1 164 ? 10.745  12.911  66.466 1.00 47.33  ? 166 LYS C CB  1 
ATOM   4211 C CG  . LYS C 1 164 ? 9.246   12.974  66.795 1.00 60.14  ? 166 LYS C CG  1 
ATOM   4212 C CD  . LYS C 1 164 ? 8.582   11.610  66.708 1.00 63.11  ? 166 LYS C CD  1 
ATOM   4213 C CE  . LYS C 1 164 ? 8.433   10.986  68.079 1.00 59.29  ? 166 LYS C CE  1 
ATOM   4214 N NZ  . LYS C 1 164 ? 8.402   9.519   67.930 1.00 58.85  ? 166 LYS C NZ  1 
ATOM   4215 N N   . LYS C 1 165 ? 10.997  15.295  68.727 1.00 48.52  ? 167 LYS C N   1 
ATOM   4216 C CA  . LYS C 1 165 ? 11.077  15.528  70.154 1.00 51.98  ? 167 LYS C CA  1 
ATOM   4217 C C   . LYS C 1 165 ? 10.564  14.263  70.855 1.00 51.10  ? 167 LYS C C   1 
ATOM   4218 O O   . LYS C 1 165 ? 9.463   13.794  70.578 1.00 48.72  ? 167 LYS C O   1 
ATOM   4219 C CB  . LYS C 1 165 ? 10.243  16.762  70.499 1.00 54.36  ? 167 LYS C CB  1 
ATOM   4220 C CG  . LYS C 1 165 ? 10.325  17.200  71.941 1.00 60.67  ? 167 LYS C CG  1 
ATOM   4221 C CD  . LYS C 1 165 ? 9.300   18.290  72.311 1.00 73.90  ? 167 LYS C CD  1 
ATOM   4222 C CE  . LYS C 1 165 ? 7.999   17.707  72.906 1.00 77.66  ? 167 LYS C CE  1 
ATOM   4223 N NZ  . LYS C 1 165 ? 7.410   18.581  73.976 1.00 76.30  ? 167 LYS C NZ  1 
ATOM   4224 N N   . VAL C 1 166 ? 11.388  13.697  71.741 1.00 51.68  ? 168 VAL C N   1 
ATOM   4225 C CA  . VAL C 1 166 ? 11.021  12.531  72.522 1.00 46.85  ? 168 VAL C CA  1 
ATOM   4226 C C   . VAL C 1 166 ? 11.419  12.854  73.952 1.00 50.29  ? 168 VAL C C   1 
ATOM   4227 O O   . VAL C 1 166 ? 12.535  12.555  74.396 1.00 45.80  ? 168 VAL C O   1 
ATOM   4228 C CB  . VAL C 1 166 ? 11.739  11.256  72.035 1.00 44.05  ? 168 VAL C CB  1 
ATOM   4229 C CG1 . VAL C 1 166 ? 11.259  10.057  72.845 1.00 45.84  ? 168 VAL C CG1 1 
ATOM   4230 C CG2 . VAL C 1 166 ? 11.502  11.018  70.552 1.00 41.27  ? 168 VAL C CG2 1 
ATOM   4231 N N   . SER C 1 167 ? 10.497  13.495  74.659 1.00 53.09  ? 169 SER C N   1 
ATOM   4232 C CA  . SER C 1 167 ? 10.803  14.099  75.934 1.00 54.18  ? 169 SER C CA  1 
ATOM   4233 C C   . SER C 1 167 ? 10.509  13.165  77.090 1.00 54.67  ? 169 SER C C   1 
ATOM   4234 O O   . SER C 1 167 ? 9.771   12.171  76.950 1.00 52.77  ? 169 SER C O   1 
ATOM   4235 C CB  . SER C 1 167 ? 10.023  15.401  76.103 1.00 57.51  ? 169 SER C CB  1 
ATOM   4236 O OG  . SER C 1 167 ? 8.647   15.125  76.188 1.00 61.67  ? 169 SER C OG  1 
ATOM   4237 N N   . SER C 1 168 ? 11.074  13.559  78.237 1.00 54.89  ? 170 SER C N   1 
ATOM   4238 C CA  . SER C 1 168 ? 11.261  12.793  79.438 1.00 55.25  ? 170 SER C CA  1 
ATOM   4239 C C   . SER C 1 168 ? 11.029  13.853  80.519 1.00 58.84  ? 170 SER C C   1 
ATOM   4240 O O   . SER C 1 168 ? 11.202  15.041  80.263 1.00 61.14  ? 170 SER C O   1 
ATOM   4241 C CB  . SER C 1 168 ? 12.762  12.438  79.501 1.00 55.09  ? 170 SER C CB  1 
ATOM   4242 O OG  . SER C 1 168 ? 13.015  11.216  80.107 1.00 59.36  ? 170 SER C OG  1 
ATOM   4243 N N   . MET C 1 169 ? 10.693  13.460  81.742 1.00 62.10  ? 171 MET C N   1 
ATOM   4244 C CA  . MET C 1 169 ? 10.722  14.451  82.824 1.00 64.81  ? 171 MET C CA  1 
ATOM   4245 C C   . MET C 1 169 ? 12.141  15.025  83.061 1.00 64.46  ? 171 MET C C   1 
ATOM   4246 O O   . MET C 1 169 ? 12.299  16.243  83.251 1.00 63.60  ? 171 MET C O   1 
ATOM   4247 C CB  . MET C 1 169 ? 10.150  13.899  84.130 1.00 68.62  ? 171 MET C CB  1 
ATOM   4248 C CG  . MET C 1 169 ? 10.155  14.955  85.218 1.00 66.46  ? 171 MET C CG  1 
ATOM   4249 S SD  . MET C 1 169 ? 9.361   14.491  86.774 1.00 81.28  ? 171 MET C SD  1 
ATOM   4250 C CE  . MET C 1 169 ? 9.920   12.836  86.998 1.00 75.62  ? 171 MET C CE  1 
ATOM   4251 N N   . PHE C 1 170 ? 13.159  14.156  83.013 1.00 61.45  ? 172 PHE C N   1 
ATOM   4252 C CA  . PHE C 1 170 ? 14.542  14.591  83.270 1.00 65.32  ? 172 PHE C CA  1 
ATOM   4253 C C   . PHE C 1 170 ? 15.344  14.976  82.023 1.00 63.63  ? 172 PHE C C   1 
ATOM   4254 O O   . PHE C 1 170 ? 16.406  15.602  82.129 1.00 60.86  ? 172 PHE C O   1 
ATOM   4255 C CB  . PHE C 1 170 ? 15.282  13.571  84.147 1.00 64.54  ? 172 PHE C CB  1 
ATOM   4256 C CG  . PHE C 1 170 ? 14.661  13.405  85.501 1.00 67.33  ? 172 PHE C CG  1 
ATOM   4257 C CD1 . PHE C 1 170 ? 14.622  14.476  86.399 1.00 75.02  ? 172 PHE C CD1 1 
ATOM   4258 C CD2 . PHE C 1 170 ? 14.059  12.207  85.861 1.00 66.71  ? 172 PHE C CD2 1 
ATOM   4259 C CE1 . PHE C 1 170 ? 14.012  14.343  87.653 1.00 82.01  ? 172 PHE C CE1 1 
ATOM   4260 C CE2 . PHE C 1 170 ? 13.454  12.049  87.117 1.00 71.47  ? 172 PHE C CE2 1 
ATOM   4261 C CZ  . PHE C 1 170 ? 13.437  13.121  88.022 1.00 80.20  ? 172 PHE C CZ  1 
ATOM   4262 N N   . ILE C 1 171 ? 14.830  14.609  80.848 1.00 60.58  ? 173 ILE C N   1 
ATOM   4263 C CA  . ILE C 1 171 ? 15.391  15.104  79.590 1.00 58.88  ? 173 ILE C CA  1 
ATOM   4264 C C   . ILE C 1 171 ? 14.225  15.691  78.793 1.00 60.05  ? 173 ILE C C   1 
ATOM   4265 O O   . ILE C 1 171 ? 13.798  15.097  77.804 1.00 59.30  ? 173 ILE C O   1 
ATOM   4266 C CB  . ILE C 1 171 ? 16.105  14.004  78.736 1.00 55.68  ? 173 ILE C CB  1 
ATOM   4267 C CG1 . ILE C 1 171 ? 16.996  13.105  79.596 1.00 55.29  ? 173 ILE C CG1 1 
ATOM   4268 C CG2 . ILE C 1 171 ? 16.915  14.654  77.597 1.00 57.07  ? 173 ILE C CG2 1 
ATOM   4269 C CD1 . ILE C 1 171 ? 17.447  11.849  78.870 1.00 55.92  ? 173 ILE C CD1 1 
ATOM   4270 N N   . PRO C 1 172 ? 13.725  16.872  79.210 1.00 61.19  ? 174 PRO C N   1 
ATOM   4271 C CA  . PRO C 1 172 ? 12.584  17.443  78.517 1.00 62.97  ? 174 PRO C CA  1 
ATOM   4272 C C   . PRO C 1 172 ? 12.888  17.743  77.054 1.00 62.95  ? 174 PRO C C   1 
ATOM   4273 O O   . PRO C 1 172 ? 11.961  17.809  76.250 1.00 65.55  ? 174 PRO C O   1 
ATOM   4274 C CB  . PRO C 1 172 ? 12.327  18.748  79.281 1.00 66.65  ? 174 PRO C CB  1 
ATOM   4275 C CG  . PRO C 1 172 ? 13.012  18.564  80.591 1.00 68.40  ? 174 PRO C CG  1 
ATOM   4276 C CD  . PRO C 1 172 ? 14.196  17.741  80.303 1.00 62.79  ? 174 PRO C CD  1 
ATOM   4277 N N   . ASP C 1 173 ? 14.164  17.939  76.717 1.00 63.41  ? 175 ASP C N   1 
ATOM   4278 C CA  . ASP C 1 173 ? 14.559  18.323  75.351 1.00 63.25  ? 175 ASP C CA  1 
ATOM   4279 C C   . ASP C 1 173 ? 15.139  17.142  74.570 1.00 56.76  ? 175 ASP C C   1 
ATOM   4280 O O   . ASP C 1 173 ? 15.877  17.326  73.593 1.00 55.07  ? 175 ASP C O   1 
ATOM   4281 C CB  . ASP C 1 173 ? 15.584  19.459  75.381 1.00 65.75  ? 175 ASP C CB  1 
ATOM   4282 C CG  . ASP C 1 173 ? 15.101  20.679  76.146 1.00 80.04  ? 175 ASP C CG  1 
ATOM   4283 O OD1 . ASP C 1 173 ? 15.972  21.444  76.627 1.00 83.55  ? 175 ASP C OD1 1 
ATOM   4284 O OD2 . ASP C 1 173 ? 13.865  20.890  76.261 1.00 87.86  ? 175 ASP C OD2 1 
ATOM   4285 N N   . GLY C 1 174 ? 14.836  15.936  75.029 1.00 53.51  ? 176 GLY C N   1 
ATOM   4286 C CA  . GLY C 1 174 ? 15.233  14.737  74.331 1.00 49.59  ? 176 GLY C CA  1 
ATOM   4287 C C   . GLY C 1 174 ? 14.729  14.734  72.894 1.00 47.00  ? 176 GLY C C   1 
ATOM   4288 O O   . GLY C 1 174 ? 13.653  15.263  72.591 1.00 48.56  ? 176 GLY C O   1 
ATOM   4289 N N   . ARG C 1 175 ? 15.516  14.132  72.004 1.00 45.76  ? 177 ARG C N   1 
ATOM   4290 C CA  . ARG C 1 175 ? 15.234  14.159  70.570 1.00 43.89  ? 177 ARG C CA  1 
ATOM   4291 C C   . ARG C 1 175 ? 15.849  12.959  69.915 1.00 41.61  ? 177 ARG C C   1 
ATOM   4292 O O   . ARG C 1 175 ? 16.897  12.469  70.365 1.00 40.05  ? 177 ARG C O   1 
ATOM   4293 C CB  . ARG C 1 175 ? 15.809  15.422  69.915 1.00 46.66  ? 177 ARG C CB  1 
ATOM   4294 C CG  . ARG C 1 175 ? 15.023  16.667  70.276 1.00 54.51  ? 177 ARG C CG  1 
ATOM   4295 C CD  . ARG C 1 175 ? 15.596  17.948  69.716 1.00 73.63  ? 177 ARG C CD  1 
ATOM   4296 N NE  . ARG C 1 175 ? 14.650  19.059  69.885 1.00 78.03  ? 177 ARG C NE  1 
ATOM   4297 C CZ  . ARG C 1 175 ? 13.583  19.273  69.112 1.00 84.79  ? 177 ARG C CZ  1 
ATOM   4298 N NH1 . ARG C 1 175 ? 13.293  18.456  68.096 1.00 78.06  ? 177 ARG C NH1 1 
ATOM   4299 N NH2 . ARG C 1 175 ? 12.795  20.313  69.355 1.00 86.89  ? 177 ARG C NH2 1 
ATOM   4300 N N   . VAL C 1 176 ? 15.208  12.519  68.830 1.00 43.00  ? 178 VAL C N   1 
ATOM   4301 C CA  . VAL C 1 176 ? 15.712  11.449  67.987 1.00 37.46  ? 178 VAL C CA  1 
ATOM   4302 C C   . VAL C 1 176 ? 15.685  11.963  66.563 1.00 38.15  ? 178 VAL C C   1 
ATOM   4303 O O   . VAL C 1 176 ? 14.672  12.472  66.131 1.00 35.95  ? 178 VAL C O   1 
ATOM   4304 C CB  . VAL C 1 176 ? 14.875  10.168  68.135 1.00 37.87  ? 178 VAL C CB  1 
ATOM   4305 C CG1 . VAL C 1 176 ? 15.269  9.111   67.073 1.00 35.13  ? 178 VAL C CG1 1 
ATOM   4306 C CG2 . VAL C 1 176 ? 15.013  9.604   69.558 1.00 31.57  ? 178 VAL C CG2 1 
ATOM   4307 N N   . SER C 1 177 ? 16.805  11.837  65.852 1.00 38.27  ? 179 SER C N   1 
ATOM   4308 C CA  . SER C 1 177 ? 16.921  12.363  64.480 1.00 39.48  ? 179 SER C CA  1 
ATOM   4309 C C   . SER C 1 177 ? 17.495  11.286  63.575 1.00 37.71  ? 179 SER C C   1 
ATOM   4310 O O   . SER C 1 177 ? 18.180  10.365  64.057 1.00 32.51  ? 179 SER C O   1 
ATOM   4311 C CB  . SER C 1 177 ? 17.841  13.590  64.474 1.00 41.85  ? 179 SER C CB  1 
ATOM   4312 O OG  . SER C 1 177 ? 19.188  13.200  64.288 1.00 55.23  ? 179 SER C OG  1 
ATOM   4313 N N   . VAL C 1 178 ? 17.175  11.377  62.272 1.00 37.51  ? 180 VAL C N   1 
ATOM   4314 C CA  . VAL C 1 178 ? 17.773  10.538  61.236 1.00 32.92  ? 180 VAL C CA  1 
ATOM   4315 C C   . VAL C 1 178 ? 17.833  11.357  59.975 1.00 34.79  ? 180 VAL C C   1 
ATOM   4316 O O   . VAL C 1 178 ? 16.893  12.107  59.665 1.00 35.08  ? 180 VAL C O   1 
ATOM   4317 C CB  . VAL C 1 178 ? 17.000  9.214   61.019 1.00 36.84  ? 180 VAL C CB  1 
ATOM   4318 C CG1 . VAL C 1 178 ? 15.488  9.446   60.789 1.00 38.76  ? 180 VAL C CG1 1 
ATOM   4319 C CG2 . VAL C 1 178 ? 17.608  8.389   59.880 1.00 34.95  ? 180 VAL C CG2 1 
ATOM   4320 N N   . SER C 1 179 ? 18.969  11.267  59.295 1.00 35.34  ? 181 SER C N   1 
ATOM   4321 C CA  . SER C 1 179 ? 19.139  11.822  57.961 1.00 37.47  ? 181 SER C CA  1 
ATOM   4322 C C   . SER C 1 179 ? 19.813  10.724  57.204 1.00 37.72  ? 181 SER C C   1 
ATOM   4323 O O   . SER C 1 179 ? 20.688  10.070  57.736 1.00 36.72  ? 181 SER C O   1 
ATOM   4324 C CB  . SER C 1 179 ? 20.053  13.043  57.955 1.00 39.62  ? 181 SER C CB  1 
ATOM   4325 O OG  . SER C 1 179 ? 21.389  12.659  58.153 1.00 48.39  ? 181 SER C OG  1 
ATOM   4326 N N   . ALA C 1 180 ? 19.409  10.531  55.950 1.00 33.60  ? 182 ALA C N   1 
ATOM   4327 C CA  . ALA C 1 180 ? 19.889  9.411   55.174 1.00 35.18  ? 182 ALA C CA  1 
ATOM   4328 C C   . ALA C 1 180 ? 19.956  9.849   53.744 1.00 37.49  ? 182 ALA C C   1 
ATOM   4329 O O   . ALA C 1 180 ? 19.259  10.785  53.357 1.00 36.99  ? 182 ALA C O   1 
ATOM   4330 C CB  . ALA C 1 180 ? 18.952  8.246   55.287 1.00 34.66  ? 182 ALA C CB  1 
ATOM   4331 N N   . ARG C 1 181 ? 20.800  9.179   52.971 1.00 37.19  ? 183 ARG C N   1 
ATOM   4332 C CA  . ARG C 1 181 ? 20.988  9.533   51.583 1.00 41.74  ? 183 ARG C CA  1 
ATOM   4333 C C   . ARG C 1 181 ? 21.299  8.263   50.832 1.00 38.77  ? 183 ARG C C   1 
ATOM   4334 O O   . ARG C 1 181 ? 22.045  7.446   51.317 1.00 35.05  ? 183 ARG C O   1 
ATOM   4335 C CB  . ARG C 1 181 ? 22.167  10.495  51.434 1.00 46.19  ? 183 ARG C CB  1 
ATOM   4336 C CG  . ARG C 1 181 ? 22.295  11.123  50.036 1.00 54.21  ? 183 ARG C CG  1 
ATOM   4337 C CD  . ARG C 1 181 ? 23.693  11.725  49.795 1.00 57.39  ? 183 ARG C CD  1 
ATOM   4338 N NE  . ARG C 1 181 ? 24.169  11.433  48.429 1.00 78.83  ? 183 ARG C NE  1 
ATOM   4339 C CZ  . ARG C 1 181 ? 25.126  12.108  47.780 1.00 81.29  ? 183 ARG C CZ  1 
ATOM   4340 N NH1 . ARG C 1 181 ? 25.740  13.140  48.349 1.00 85.92  ? 183 ARG C NH1 1 
ATOM   4341 N NH2 . ARG C 1 181 ? 25.475  11.751  46.548 1.00 78.06  ? 183 ARG C NH2 1 
ATOM   4342 N N   . ILE C 1 182 ? 20.714  8.121   49.643 1.00 38.12  ? 184 ILE C N   1 
ATOM   4343 C CA  . ILE C 1 182 ? 21.083  7.078   48.705 1.00 37.39  ? 184 ILE C CA  1 
ATOM   4344 C C   . ILE C 1 182 ? 21.559  7.724   47.414 1.00 35.61  ? 184 ILE C C   1 
ATOM   4345 O O   . ILE C 1 182 ? 21.193  8.872   47.115 1.00 34.06  ? 184 ILE C O   1 
ATOM   4346 C CB  . ILE C 1 182 ? 19.913  6.131   48.429 1.00 35.46  ? 184 ILE C CB  1 
ATOM   4347 C CG1 . ILE C 1 182 ? 18.678  6.915   47.976 1.00 34.03  ? 184 ILE C CG1 1 
ATOM   4348 C CG2 . ILE C 1 182 ? 19.667  5.261   49.689 1.00 36.65  ? 184 ILE C CG2 1 
ATOM   4349 C CD1 . ILE C 1 182 ? 17.530  6.043   47.522 1.00 30.23  ? 184 ILE C CD1 1 
ATOM   4350 N N   . ASP C 1 183 ? 22.361  6.995   46.645 1.00 38.17  ? 185 ASP C N   1 
ATOM   4351 C CA  . ASP C 1 183 ? 23.032  7.623   45.515 1.00 43.03  ? 185 ASP C CA  1 
ATOM   4352 C C   . ASP C 1 183 ? 22.158  7.875   44.294 1.00 42.58  ? 185 ASP C C   1 
ATOM   4353 O O   . ASP C 1 183 ? 22.507  8.693   43.450 1.00 39.85  ? 185 ASP C O   1 
ATOM   4354 C CB  . ASP C 1 183 ? 24.316  6.900   45.144 1.00 48.86  ? 185 ASP C CB  1 
ATOM   4355 C CG  . ASP C 1 183 ? 24.078  5.521   44.591 1.00 62.99  ? 185 ASP C CG  1 
ATOM   4356 O OD1 . ASP C 1 183 ? 23.636  5.416   43.422 1.00 74.93  ? 185 ASP C OD1 1 
ATOM   4357 O OD2 . ASP C 1 183 ? 24.383  4.539   45.310 1.00 74.44  ? 185 ASP C OD2 1 
ATOM   4358 N N   . ARG C 1 184 ? 21.016  7.185   44.202 1.00 37.87  ? 186 ARG C N   1 
ATOM   4359 C CA  . ARG C 1 184 ? 20.114  7.351   43.038 1.00 36.01  ? 186 ARG C CA  1 
ATOM   4360 C C   . ARG C 1 184 ? 18.710  6.910   43.431 1.00 36.10  ? 186 ARG C C   1 
ATOM   4361 O O   . ARG C 1 184 ? 18.548  6.357   44.502 1.00 34.91  ? 186 ARG C O   1 
ATOM   4362 C CB  . ARG C 1 184 ? 20.652  6.585   41.829 1.00 35.01  ? 186 ARG C CB  1 
ATOM   4363 C CG  . ARG C 1 184 ? 20.921  5.146   42.087 1.00 37.72  ? 186 ARG C CG  1 
ATOM   4364 C CD  . ARG C 1 184 ? 21.648  4.508   40.975 1.00 40.03  ? 186 ARG C CD  1 
ATOM   4365 N NE  . ARG C 1 184 ? 21.492  3.047   40.999 1.00 40.45  ? 186 ARG C NE  1 
ATOM   4366 C CZ  . ARG C 1 184 ? 22.340  2.216   41.591 1.00 43.60  ? 186 ARG C CZ  1 
ATOM   4367 N NH1 . ARG C 1 184 ? 23.386  2.707   42.234 1.00 45.40  ? 186 ARG C NH1 1 
ATOM   4368 N NH2 . ARG C 1 184 ? 22.140  0.903   41.557 1.00 41.35  ? 186 ARG C NH2 1 
ATOM   4369 N N   . LYS C 1 185 ? 17.710  7.171   42.586 1.00 34.77  ? 187 LYS C N   1 
ATOM   4370 C CA  . LYS C 1 185 ? 16.357  6.729   42.856 1.00 35.38  ? 187 LYS C CA  1 
ATOM   4371 C C   . LYS C 1 185 ? 16.002  5.423   42.095 1.00 37.16  ? 187 LYS C C   1 
ATOM   4372 O O   . LYS C 1 185 ? 15.150  4.648   42.536 1.00 33.46  ? 187 LYS C O   1 
ATOM   4373 C CB  . LYS C 1 185 ? 15.400  7.859   42.481 1.00 36.07  ? 187 LYS C CB  1 
ATOM   4374 C CG  . LYS C 1 185 ? 13.938  7.528   42.498 1.00 42.14  ? 187 LYS C CG  1 
ATOM   4375 C CD  . LYS C 1 185 ? 13.112  8.751   42.080 1.00 41.40  ? 187 LYS C CD  1 
ATOM   4376 C CE  . LYS C 1 185 ? 11.711  8.668   42.585 1.00 51.79  ? 187 LYS C CE  1 
ATOM   4377 N NZ  . LYS C 1 185 ? 11.021  9.985   42.535 1.00 60.82  ? 187 LYS C NZ  1 
ATOM   4378 N N   . GLY C 1 186 ? 16.650  5.182   40.951 1.00 37.57  ? 188 GLY C N   1 
ATOM   4379 C CA  . GLY C 1 186 ? 16.264  4.058   40.090 1.00 33.79  ? 188 GLY C CA  1 
ATOM   4380 C C   . GLY C 1 186 ? 17.253  2.938   40.311 1.00 33.07  ? 188 GLY C C   1 
ATOM   4381 O O   . GLY C 1 186 ? 18.459  3.146   40.234 1.00 33.17  ? 188 GLY C O   1 
ATOM   4382 N N   . PHE C 1 187 ? 16.735  1.749   40.629 1.00 33.70  ? 189 PHE C N   1 
ATOM   4383 C CA  . PHE C 1 187 ? 17.570  0.579   40.870 1.00 33.80  ? 189 PHE C CA  1 
ATOM   4384 C C   . PHE C 1 187 ? 17.019  -0.565  40.075 1.00 34.20  ? 189 PHE C C   1 
ATOM   4385 O O   . PHE C 1 187 ? 15.826  -0.612  39.815 1.00 36.73  ? 189 PHE C O   1 
ATOM   4386 C CB  . PHE C 1 187 ? 17.541  0.184   42.370 1.00 32.66  ? 189 PHE C CB  1 
ATOM   4387 C CG  . PHE C 1 187 ? 18.231  1.170   43.254 1.00 32.98  ? 189 PHE C CG  1 
ATOM   4388 C CD1 . PHE C 1 187 ? 19.581  1.066   43.513 1.00 30.42  ? 189 PHE C CD1 1 
ATOM   4389 C CD2 . PHE C 1 187 ? 17.538  2.231   43.779 1.00 33.03  ? 189 PHE C CD2 1 
ATOM   4390 C CE1 . PHE C 1 187 ? 20.240  2.004   44.325 1.00 32.05  ? 189 PHE C CE1 1 
ATOM   4391 C CE2 . PHE C 1 187 ? 18.183  3.182   44.545 1.00 24.39  ? 189 PHE C CE2 1 
ATOM   4392 C CZ  . PHE C 1 187 ? 19.523  3.064   44.830 1.00 23.17  ? 189 PHE C CZ  1 
ATOM   4393 N N   . CYS C 1 188 ? 17.887  -1.492  39.701 1.00 33.26  ? 190 CYS C N   1 
ATOM   4394 C CA  . CYS C 1 188 ? 17.491  -2.700  39.000 1.00 39.97  ? 190 CYS C CA  1 
ATOM   4395 C C   . CYS C 1 188 ? 17.279  -3.828  39.989 1.00 36.47  ? 190 CYS C C   1 
ATOM   4396 O O   . CYS C 1 188 ? 18.022  -3.941  40.972 1.00 32.30  ? 190 CYS C O   1 
ATOM   4397 C CB  . CYS C 1 188 ? 18.611  -3.117  38.044 1.00 45.22  ? 190 CYS C CB  1 
ATOM   4398 S SG  . CYS C 1 188 ? 19.126  -1.784  36.877 1.00 62.50  ? 190 CYS C SG  1 
ATOM   4399 N N   . GLU C 1 189 ? 16.307  -4.685  39.713 1.00 36.45  ? 191 GLU C N   1 
ATOM   4400 C CA  . GLU C 1 189 ? 16.043  -5.799  40.600 1.00 41.85  ? 191 GLU C CA  1 
ATOM   4401 C C   . GLU C 1 189 ? 17.338  -6.580  40.751 1.00 45.49  ? 191 GLU C C   1 
ATOM   4402 O O   . GLU C 1 189 ? 18.017  -6.841  39.765 1.00 48.62  ? 191 GLU C O   1 
ATOM   4403 C CB  . GLU C 1 189 ? 14.891  -6.648  40.086 1.00 42.57  ? 191 GLU C CB  1 
ATOM   4404 C CG  . GLU C 1 189 ? 15.307  -7.828  39.279 1.00 52.86  ? 191 GLU C CG  1 
ATOM   4405 C CD  . GLU C 1 189 ? 14.227  -8.309  38.354 1.00 66.69  ? 191 GLU C CD  1 
ATOM   4406 O OE1 . GLU C 1 189 ? 14.499  -8.416  37.122 1.00 63.40  ? 191 GLU C OE1 1 
ATOM   4407 O OE2 . GLU C 1 189 ? 13.117  -8.578  38.861 1.00 65.76  ? 191 GLU C OE2 1 
ATOM   4408 N N   . GLY C 1 190 ? 17.735  -6.849  41.996 1.00 46.91  ? 192 GLY C N   1 
ATOM   4409 C CA  . GLY C 1 190 ? 18.939  -7.630  42.278 1.00 47.61  ? 192 GLY C CA  1 
ATOM   4410 C C   . GLY C 1 190 ? 20.131  -6.796  42.698 1.00 48.38  ? 192 GLY C C   1 
ATOM   4411 O O   . GLY C 1 190 ? 21.124  -7.335  43.203 1.00 51.80  ? 192 GLY C O   1 
ATOM   4412 N N   . ASP C 1 191 ? 20.049  -5.486  42.467 1.00 45.36  ? 193 ASP C N   1 
ATOM   4413 C CA  . ASP C 1 191 ? 21.098  -4.553  42.838 1.00 42.67  ? 193 ASP C CA  1 
ATOM   4414 C C   . ASP C 1 191 ? 20.978  -4.305  44.341 1.00 42.26  ? 193 ASP C C   1 
ATOM   4415 O O   . ASP C 1 191 ? 19.978  -4.669  44.947 1.00 38.91  ? 193 ASP C O   1 
ATOM   4416 C CB  . ASP C 1 191 ? 20.936  -3.249  42.041 1.00 44.78  ? 193 ASP C CB  1 
ATOM   4417 C CG  . ASP C 1 191 ? 21.493  -3.340  40.604 1.00 54.76  ? 193 ASP C CG  1 
ATOM   4418 O OD1 . ASP C 1 191 ? 21.715  -4.461  40.085 1.00 55.91  ? 193 ASP C OD1 1 
ATOM   4419 O OD2 . ASP C 1 191 ? 21.722  -2.270  39.991 1.00 62.15  ? 193 ASP C OD2 1 
ATOM   4420 N N   . GLU C 1 192 ? 22.022  -3.768  44.964 1.00 41.66  ? 194 GLU C N   1 
ATOM   4421 C CA  . GLU C 1 192 ? 21.912  -3.386  46.371 1.00 44.87  ? 194 GLU C CA  1 
ATOM   4422 C C   . GLU C 1 192 ? 21.663  -1.892  46.493 1.00 41.64  ? 194 GLU C C   1 
ATOM   4423 O O   . GLU C 1 192 ? 22.228  -1.112  45.738 1.00 43.87  ? 194 GLU C O   1 
ATOM   4424 C CB  . GLU C 1 192 ? 23.164  -3.814  47.141 1.00 49.57  ? 194 GLU C CB  1 
ATOM   4425 C CG  . GLU C 1 192 ? 24.353  -2.906  46.965 1.00 58.78  ? 194 GLU C CG  1 
ATOM   4426 C CD  . GLU C 1 192 ? 25.492  -3.250  47.925 1.00 70.03  ? 194 GLU C CD  1 
ATOM   4427 O OE1 . GLU C 1 192 ? 25.836  -4.450  48.022 1.00 82.73  ? 194 GLU C OE1 1 
ATOM   4428 O OE2 . GLU C 1 192 ? 26.028  -2.322  48.582 1.00 80.25  ? 194 GLU C OE2 1 
ATOM   4429 N N   . ILE C 1 193 ? 20.769  -1.474  47.376 1.00 40.40  ? 195 ILE C N   1 
ATOM   4430 C CA  . ILE C 1 193 ? 20.738  -0.044  47.752 1.00 39.32  ? 195 ILE C CA  1 
ATOM   4431 C C   . ILE C 1 193 ? 21.712  0.118   48.923 1.00 42.68  ? 195 ILE C C   1 
ATOM   4432 O O   . ILE C 1 193 ? 21.520  -0.490  49.969 1.00 44.13  ? 195 ILE C O   1 
ATOM   4433 C CB  . ILE C 1 193 ? 19.338  0.449   48.198 1.00 37.60  ? 195 ILE C CB  1 
ATOM   4434 C CG1 . ILE C 1 193 ? 18.277  0.077   47.169 1.00 40.94  ? 195 ILE C CG1 1 
ATOM   4435 C CG2 . ILE C 1 193 ? 19.367  1.974   48.511 1.00 38.67  ? 195 ILE C CG2 1 
ATOM   4436 C CD1 . ILE C 1 193 ? 16.842  0.481   47.559 1.00 32.30  ? 195 ILE C CD1 1 
ATOM   4437 N N   . SER C 1 194 ? 22.738  0.948   48.758 1.00 38.58  ? 196 SER C N   1 
ATOM   4438 C CA  . SER C 1 194 ? 23.716  1.181   49.813 1.00 41.21  ? 196 SER C CA  1 
ATOM   4439 C C   . SER C 1 194 ? 23.295  2.472   50.499 1.00 38.73  ? 196 SER C C   1 
ATOM   4440 O O   . SER C 1 194 ? 23.186  3.511   49.857 1.00 37.74  ? 196 SER C O   1 
ATOM   4441 C CB  . SER C 1 194 ? 25.109  1.246   49.173 1.00 45.62  ? 196 SER C CB  1 
ATOM   4442 O OG  . SER C 1 194 ? 26.025  2.071   49.877 1.00 57.36  ? 196 SER C OG  1 
ATOM   4443 N N   . ILE C 1 195 ? 22.946  2.378   51.780 1.00 37.65  ? 197 ILE C N   1 
ATOM   4444 C CA  . ILE C 1 195 ? 22.349  3.512   52.508 1.00 36.77  ? 197 ILE C CA  1 
ATOM   4445 C C   . ILE C 1 195 ? 23.381  4.195   53.401 1.00 40.25  ? 197 ILE C C   1 
ATOM   4446 O O   . ILE C 1 195 ? 23.976  3.537   54.230 1.00 37.19  ? 197 ILE C O   1 
ATOM   4447 C CB  . ILE C 1 195 ? 21.175  3.057   53.432 1.00 37.50  ? 197 ILE C CB  1 
ATOM   4448 C CG1 . ILE C 1 195 ? 20.111  2.275   52.623 1.00 35.24  ? 197 ILE C CG1 1 
ATOM   4449 C CG2 . ILE C 1 195 ? 20.533  4.286   54.111 1.00 31.11  ? 197 ILE C CG2 1 
ATOM   4450 C CD1 . ILE C 1 195 ? 19.119  1.564   53.470 1.00 36.03  ? 197 ILE C CD1 1 
ATOM   4451 N N   . HIS C 1 196 ? 23.533  5.516   53.260 1.00 38.94  ? 198 HIS C N   1 
ATOM   4452 C CA  . HIS C 1 196 ? 24.305  6.304   54.215 1.00 40.80  ? 198 HIS C CA  1 
ATOM   4453 C C   . HIS C 1 196 ? 23.365  7.075   55.141 1.00 37.32  ? 198 HIS C C   1 
ATOM   4454 O O   . HIS C 1 196 ? 22.502  7.809   54.675 1.00 37.20  ? 198 HIS C O   1 
ATOM   4455 C CB  . HIS C 1 196 ? 25.235  7.256   53.452 1.00 44.83  ? 198 HIS C CB  1 
ATOM   4456 C CG  . HIS C 1 196 ? 26.201  6.544   52.549 1.00 51.15  ? 198 HIS C CG  1 
ATOM   4457 N ND1 . HIS C 1 196 ? 27.525  6.339   52.884 1.00 57.61  ? 198 HIS C ND1 1 
ATOM   4458 C CD2 . HIS C 1 196 ? 26.028  5.977   51.329 1.00 62.85  ? 198 HIS C CD2 1 
ATOM   4459 C CE1 . HIS C 1 196 ? 28.125  5.682   51.909 1.00 63.54  ? 198 HIS C CE1 1 
ATOM   4460 N NE2 . HIS C 1 196 ? 27.238  5.445   50.956 1.00 68.95  ? 198 HIS C NE2 1 
ATOM   4461 N N   . ALA C 1 197 ? 23.525  6.910   56.451 1.00 35.57  ? 199 ALA C N   1 
ATOM   4462 C CA  . ALA C 1 197 ? 22.575  7.480   57.405 1.00 33.28  ? 199 ALA C CA  1 
ATOM   4463 C C   . ALA C 1 197 ? 23.270  7.818   58.696 1.00 32.85  ? 199 ALA C C   1 
ATOM   4464 O O   . ALA C 1 197 ? 24.161  7.083   59.118 1.00 29.61  ? 199 ALA C O   1 
ATOM   4465 C CB  . ALA C 1 197 ? 21.457  6.459   57.682 1.00 29.85  ? 199 ALA C CB  1 
ATOM   4466 N N   . ASP C 1 198 ? 22.802  8.863   59.377 1.00 31.94  ? 200 ASP C N   1 
ATOM   4467 C CA  . ASP C 1 198 ? 23.349  9.238   60.679 1.00 34.03  ? 200 ASP C CA  1 
ATOM   4468 C C   . ASP C 1 198 ? 22.184  9.388   61.618 1.00 33.73  ? 200 ASP C C   1 
ATOM   4469 O O   . ASP C 1 198 ? 21.206  10.089  61.286 1.00 29.54  ? 200 ASP C O   1 
ATOM   4470 C CB  . ASP C 1 198 ? 24.075  10.580  60.606 1.00 34.12  ? 200 ASP C CB  1 
ATOM   4471 C CG  . ASP C 1 198 ? 25.348  10.525  59.794 1.00 43.53  ? 200 ASP C CG  1 
ATOM   4472 O OD1 . ASP C 1 198 ? 26.073  9.491   59.781 1.00 38.12  ? 200 ASP C OD1 1 
ATOM   4473 O OD2 . ASP C 1 198 ? 25.649  11.570  59.188 1.00 39.15  ? 200 ASP C OD2 1 
ATOM   4474 N N   . PHE C 1 199 ? 22.287  8.755   62.787 1.00 30.44  ? 201 PHE C N   1 
ATOM   4475 C CA  . PHE C 1 199 ? 21.202  8.752   63.794 1.00 31.59  ? 201 PHE C CA  1 
ATOM   4476 C C   . PHE C 1 199 ? 21.693  9.388   65.081 1.00 34.68  ? 201 PHE C C   1 
ATOM   4477 O O   . PHE C 1 199 ? 22.787  9.075   65.508 1.00 32.05  ? 201 PHE C O   1 
ATOM   4478 C CB  . PHE C 1 199 ? 20.802  7.311   64.124 1.00 32.09  ? 201 PHE C CB  1 
ATOM   4479 C CG  . PHE C 1 199 ? 20.477  6.485   62.939 1.00 39.92  ? 201 PHE C CG  1 
ATOM   4480 C CD1 . PHE C 1 199 ? 19.180  6.469   62.421 1.00 30.18  ? 201 PHE C CD1 1 
ATOM   4481 C CD2 . PHE C 1 199 ? 21.459  5.717   62.329 1.00 34.01  ? 201 PHE C CD2 1 
ATOM   4482 C CE1 . PHE C 1 199 ? 18.885  5.693   61.299 1.00 37.87  ? 201 PHE C CE1 1 
ATOM   4483 C CE2 . PHE C 1 199 ? 21.168  4.990   61.206 1.00 34.22  ? 201 PHE C CE2 1 
ATOM   4484 C CZ  . PHE C 1 199 ? 19.891  4.981   60.690 1.00 29.32  ? 201 PHE C CZ  1 
ATOM   4485 N N   . GLU C 1 200 ? 20.898  10.295  65.672 1.00 36.20  ? 202 GLU C N   1 
ATOM   4486 C CA  . GLU C 1 200 ? 21.192  10.934  66.970 1.00 40.08  ? 202 GLU C CA  1 
ATOM   4487 C C   . GLU C 1 200 ? 20.080  10.552  67.960 1.00 38.29  ? 202 GLU C C   1 
ATOM   4488 O O   . GLU C 1 200 ? 18.889  10.662  67.632 1.00 35.32  ? 202 GLU C O   1 
ATOM   4489 C CB  . GLU C 1 200 ? 21.193  12.473  66.850 1.00 41.57  ? 202 GLU C CB  1 
ATOM   4490 C CG  . GLU C 1 200 ? 22.524  13.173  66.983 1.00 56.85  ? 202 GLU C CG  1 
ATOM   4491 C CD  . GLU C 1 200 ? 22.441  14.612  67.527 1.00 49.20  ? 202 GLU C CD  1 
ATOM   4492 O OE1 . GLU C 1 200 ? 21.644  14.903  68.459 1.00 50.90  ? 202 GLU C OE1 1 
ATOM   4493 O OE2 . GLU C 1 200 ? 23.200  15.450  67.008 1.00 54.37  ? 202 GLU C OE2 1 
ATOM   4494 N N   . ASN C 1 201 ? 20.475  10.141  69.162 1.00 34.32  ? 203 ASN C N   1 
ATOM   4495 C CA  . ASN C 1 201 ? 19.554  9.824   70.252 1.00 35.15  ? 203 ASN C CA  1 
ATOM   4496 C C   . ASN C 1 201 ? 19.954  10.541  71.562 1.00 35.86  ? 203 ASN C C   1 
ATOM   4497 O O   . ASN C 1 201 ? 20.806  10.053  72.293 1.00 35.84  ? 203 ASN C O   1 
ATOM   4498 C CB  . ASN C 1 201 ? 19.486  8.292   70.529 1.00 35.20  ? 203 ASN C CB  1 
ATOM   4499 C CG  . ASN C 1 201 ? 18.485  7.957   71.634 1.00 33.87  ? 203 ASN C CG  1 
ATOM   4500 O OD1 . ASN C 1 201 ? 17.670  8.811   72.005 1.00 36.95  ? 203 ASN C OD1 1 
ATOM   4501 N ND2 . ASN C 1 201 ? 18.593  6.767   72.229 1.00 32.48  ? 203 ASN C ND2 1 
ATOM   4502 N N   . THR C 1 202 ? 19.328  11.676  71.862 1.00 38.90  ? 204 THR C N   1 
ATOM   4503 C CA  . THR C 1 202 ? 19.508  12.340  73.175 1.00 43.62  ? 204 THR C CA  1 
ATOM   4504 C C   . THR C 1 202 ? 18.299  12.089  74.102 1.00 44.55  ? 204 THR C C   1 
ATOM   4505 O O   . THR C 1 202 ? 18.169  12.703  75.166 1.00 45.46  ? 204 THR C O   1 
ATOM   4506 C CB  . THR C 1 202 ? 19.682  13.861  72.999 1.00 46.50  ? 204 THR C CB  1 
ATOM   4507 O OG1 . THR C 1 202 ? 18.557  14.360  72.299 1.00 42.22  ? 204 THR C OG1 1 
ATOM   4508 C CG2 . THR C 1 202 ? 20.932  14.215  72.171 1.00 50.14  ? 204 THR C CG2 1 
ATOM   4509 N N   . SER C 1 203 ? 17.378  11.221  73.689 1.00 44.36  ? 205 SER C N   1 
ATOM   4510 C CA  . SER C 1 203 ? 16.211  10.928  74.533 1.00 44.70  ? 205 SER C CA  1 
ATOM   4511 C C   . SER C 1 203 ? 16.587  9.888   75.581 1.00 46.01  ? 205 SER C C   1 
ATOM   4512 O O   . SER C 1 203 ? 17.682  9.315   75.513 1.00 43.58  ? 205 SER C O   1 
ATOM   4513 C CB  . SER C 1 203 ? 15.073  10.367  73.687 1.00 44.10  ? 205 SER C CB  1 
ATOM   4514 O OG  . SER C 1 203 ? 15.347  9.019   73.365 1.00 43.29  ? 205 SER C OG  1 
ATOM   4515 N N   . SER C 1 204 ? 15.654  9.586   76.494 1.00 44.84  ? 206 SER C N   1 
ATOM   4516 C CA  . SER C 1 204 ? 15.898  8.592   77.547 1.00 48.80  ? 206 SER C CA  1 
ATOM   4517 C C   . SER C 1 204 ? 15.749  7.140   77.106 1.00 47.88  ? 206 SER C C   1 
ATOM   4518 O O   . SER C 1 204 ? 15.972  6.216   77.912 1.00 49.18  ? 206 SER C O   1 
ATOM   4519 C CB  . SER C 1 204 ? 14.959  8.834   78.735 1.00 51.53  ? 206 SER C CB  1 
ATOM   4520 O OG  . SER C 1 204 ? 13.618  8.647   78.315 1.00 50.04  ? 206 SER C OG  1 
ATOM   4521 N N   . ARG C 1 205 ? 15.377  6.930   75.850 1.00 44.93  ? 207 ARG C N   1 
ATOM   4522 C CA  . ARG C 1 205 ? 15.010  5.596   75.351 1.00 45.65  ? 207 ARG C CA  1 
ATOM   4523 C C   . ARG C 1 205 ? 16.192  5.021   74.600 1.00 42.80  ? 207 ARG C C   1 
ATOM   4524 O O   . ARG C 1 205 ? 17.057  5.765   74.165 1.00 41.18  ? 207 ARG C O   1 
ATOM   4525 C CB  . ARG C 1 205 ? 13.795  5.659   74.382 1.00 46.57  ? 207 ARG C CB  1 
ATOM   4526 C CG  . ARG C 1 205 ? 12.426  5.750   75.050 1.00 53.25  ? 207 ARG C CG  1 
ATOM   4527 C CD  . ARG C 1 205 ? 12.164  7.164   75.478 1.00 61.65  ? 207 ARG C CD  1 
ATOM   4528 N NE  . ARG C 1 205 ? 10.850  7.352   76.080 1.00 65.98  ? 207 ARG C NE  1 
ATOM   4529 C CZ  . ARG C 1 205 ? 10.410  8.520   76.546 1.00 68.37  ? 207 ARG C CZ  1 
ATOM   4530 N NH1 . ARG C 1 205 ? 11.193  9.594   76.512 1.00 55.87  ? 207 ARG C NH1 1 
ATOM   4531 N NH2 . ARG C 1 205 ? 9.187   8.611   77.059 1.00 73.41  ? 207 ARG C NH2 1 
ATOM   4532 N N   . ILE C 1 206 ? 16.214  3.698   74.473 1.00 41.89  ? 208 ILE C N   1 
ATOM   4533 C CA  . ILE C 1 206 ? 17.100  2.999   73.585 1.00 40.83  ? 208 ILE C CA  1 
ATOM   4534 C C   . ILE C 1 206 ? 16.253  2.853   72.315 1.00 41.88  ? 208 ILE C C   1 
ATOM   4535 O O   . ILE C 1 206 ? 15.133  2.295   72.371 1.00 42.10  ? 208 ILE C O   1 
ATOM   4536 C CB  . ILE C 1 206 ? 17.449  1.612   74.125 1.00 40.03  ? 208 ILE C CB  1 
ATOM   4537 C CG1 . ILE C 1 206 ? 18.142  1.721   75.503 1.00 46.01  ? 208 ILE C CG1 1 
ATOM   4538 C CG2 . ILE C 1 206 ? 18.391  0.891   73.194 1.00 40.59  ? 208 ILE C CG2 1 
ATOM   4539 C CD1 . ILE C 1 206 ? 18.246  0.394   76.238 1.00 52.63  ? 208 ILE C CD1 1 
ATOM   4540 N N   . VAL C 1 207 ? 16.781  3.385   71.213 1.00 40.78  ? 209 VAL C N   1 
ATOM   4541 C CA  . VAL C 1 207 ? 16.111  3.450   69.884 1.00 35.71  ? 209 VAL C CA  1 
ATOM   4542 C C   . VAL C 1 207 ? 16.830  2.517   68.886 1.00 36.42  ? 209 VAL C C   1 
ATOM   4543 O O   . VAL C 1 207 ? 17.974  2.089   69.112 1.00 38.81  ? 209 VAL C O   1 
ATOM   4544 C CB  . VAL C 1 207 ? 15.945  4.925   69.366 1.00 35.91  ? 209 VAL C CB  1 
ATOM   4545 C CG1 . VAL C 1 207 ? 15.324  5.837   70.460 1.00 33.22  ? 209 VAL C CG1 1 
ATOM   4546 C CG2 . VAL C 1 207 ? 17.257  5.540   68.854 1.00 27.92  ? 209 VAL C CG2 1 
ATOM   4547 N N   . VAL C 1 208 ? 16.141  2.139   67.814 1.00 35.17  ? 210 VAL C N   1 
ATOM   4548 C CA  . VAL C 1 208 ? 16.638  1.103   66.937 1.00 37.10  ? 210 VAL C CA  1 
ATOM   4549 C C   . VAL C 1 208 ? 16.433  1.538   65.510 1.00 37.28  ? 210 VAL C C   1 
ATOM   4550 O O   . VAL C 1 208 ? 15.281  1.679   65.073 1.00 37.79  ? 210 VAL C O   1 
ATOM   4551 C CB  . VAL C 1 208 ? 15.900  -0.240  67.147 1.00 37.35  ? 210 VAL C CB  1 
ATOM   4552 C CG1 . VAL C 1 208 ? 16.494  -1.321  66.212 1.00 35.05  ? 210 VAL C CG1 1 
ATOM   4553 C CG2 . VAL C 1 208 ? 15.971  -0.680  68.619 1.00 44.70  ? 210 VAL C CG2 1 
ATOM   4554 N N   . PRO C 1 209 ? 17.535  1.751   64.777 1.00 37.48  ? 211 PRO C N   1 
ATOM   4555 C CA  . PRO C 1 209 ? 17.439  2.163   63.395 1.00 34.09  ? 211 PRO C CA  1 
ATOM   4556 C C   . PRO C 1 209 ? 17.149  0.962   62.491 1.00 37.32  ? 211 PRO C C   1 
ATOM   4557 O O   . PRO C 1 209 ? 17.674  -0.127  62.721 1.00 32.82  ? 211 PRO C O   1 
ATOM   4558 C CB  . PRO C 1 209 ? 18.799  2.770   63.131 1.00 35.51  ? 211 PRO C CB  1 
ATOM   4559 C CG  . PRO C 1 209 ? 19.749  2.018   64.046 1.00 36.62  ? 211 PRO C CG  1 
ATOM   4560 C CD  . PRO C 1 209 ? 18.931  1.553   65.211 1.00 38.68  ? 211 PRO C CD  1 
ATOM   4561 N N   . LYS C 1 210 ? 16.285  1.155   61.481 1.00 35.79  ? 212 LYS C N   1 
ATOM   4562 C CA  . LYS C 1 210 ? 15.868  0.064   60.604 1.00 34.39  ? 212 LYS C CA  1 
ATOM   4563 C C   . LYS C 1 210 ? 15.616  0.661   59.250 1.00 32.81  ? 212 LYS C C   1 
ATOM   4564 O O   . LYS C 1 210 ? 15.295  1.825   59.162 1.00 31.64  ? 212 LYS C O   1 
ATOM   4565 C CB  . LYS C 1 210 ? 14.557  -0.538  61.102 1.00 30.21  ? 212 LYS C CB  1 
ATOM   4566 C CG  . LYS C 1 210 ? 14.684  -1.254  62.401 1.00 35.73  ? 212 LYS C CG  1 
ATOM   4567 C CD  . LYS C 1 210 ? 13.368  -1.563  63.025 1.00 37.71  ? 212 LYS C CD  1 
ATOM   4568 C CE  . LYS C 1 210 ? 13.540  -2.223  64.347 1.00 39.08  ? 212 LYS C CE  1 
ATOM   4569 N NZ  . LYS C 1 210 ? 12.210  -2.566  64.898 1.00 48.29  ? 212 LYS C NZ  1 
ATOM   4570 N N   . ALA C 1 211 ? 15.733  -0.143  58.202 1.00 33.18  ? 213 ALA C N   1 
ATOM   4571 C CA  . ALA C 1 211 ? 15.263  0.261   56.887 1.00 31.61  ? 213 ALA C CA  1 
ATOM   4572 C C   . ALA C 1 211 ? 14.517  -0.884  56.210 1.00 34.25  ? 213 ALA C C   1 
ATOM   4573 O O   . ALA C 1 211 ? 14.734  -2.058  56.512 1.00 35.66  ? 213 ALA C O   1 
ATOM   4574 C CB  . ALA C 1 211 ? 16.399  0.757   56.012 1.00 30.48  ? 213 ALA C CB  1 
ATOM   4575 N N   . ALA C 1 212 ? 13.641  -0.528  55.280 1.00 30.18  ? 214 ALA C N   1 
ATOM   4576 C CA  . ALA C 1 212 ? 12.833  -1.521  54.579 1.00 30.07  ? 214 ALA C CA  1 
ATOM   4577 C C   . ALA C 1 212 ? 12.422  -0.976  53.216 1.00 30.35  ? 214 ALA C C   1 
ATOM   4578 O O   . ALA C 1 212 ? 12.103  0.222   53.106 1.00 29.07  ? 214 ALA C O   1 
ATOM   4579 C CB  . ALA C 1 212 ? 11.582  -1.872  55.409 1.00 26.73  ? 214 ALA C CB  1 
ATOM   4580 N N   . ILE C 1 213 ? 12.433  -1.850  52.197 1.00 31.22  ? 215 ILE C N   1 
ATOM   4581 C CA  . ILE C 1 213 ? 11.745  -1.580  50.923 1.00 33.08  ? 215 ILE C CA  1 
ATOM   4582 C C   . ILE C 1 213 ? 10.289  -1.985  51.002 1.00 32.45  ? 215 ILE C C   1 
ATOM   4583 O O   . ILE C 1 213 ? 9.951   -3.098  51.396 1.00 31.24  ? 215 ILE C O   1 
ATOM   4584 C CB  . ILE C 1 213 ? 12.409  -2.227  49.661 1.00 34.79  ? 215 ILE C CB  1 
ATOM   4585 C CG1 . ILE C 1 213 ? 13.865  -1.765  49.501 1.00 34.66  ? 215 ILE C CG1 1 
ATOM   4586 C CG2 . ILE C 1 213 ? 11.559  -1.834  48.419 1.00 31.99  ? 215 ILE C CG2 1 
ATOM   4587 C CD1 . ILE C 1 213 ? 14.785  -2.759  48.666 1.00 40.27  ? 215 ILE C CD1 1 
ATOM   4588 N N   . VAL C 1 214 ? 9.418   -1.048  50.683 1.00 31.54  ? 216 VAL C N   1 
ATOM   4589 C CA  . VAL C 1 214 ? 7.994   -1.299  50.757 1.00 30.39  ? 216 VAL C CA  1 
ATOM   4590 C C   . VAL C 1 214 ? 7.353   -1.097  49.361 1.00 30.18  ? 216 VAL C C   1 
ATOM   4591 O O   . VAL C 1 214 ? 7.651   -0.135  48.693 1.00 31.47  ? 216 VAL C O   1 
ATOM   4592 C CB  . VAL C 1 214 ? 7.383   -0.447  51.854 1.00 31.14  ? 216 VAL C CB  1 
ATOM   4593 C CG1 . VAL C 1 214 ? 5.892   -0.712  51.968 1.00 38.90  ? 216 VAL C CG1 1 
ATOM   4594 C CG2 . VAL C 1 214 ? 8.121   -0.803  53.250 1.00 27.79  ? 216 VAL C CG2 1 
ATOM   4595 N N   . ALA C 1 215 ? 6.564   -2.090  48.927 1.00 32.87  ? 217 ALA C N   1 
ATOM   4596 C CA  . ALA C 1 215 ? 5.910   -2.134  47.596 1.00 29.76  ? 217 ALA C CA  1 
ATOM   4597 C C   . ALA C 1 215 ? 4.442   -1.945  47.788 1.00 28.35  ? 217 ALA C C   1 
ATOM   4598 O O   . ALA C 1 215 ? 3.850   -2.596  48.659 1.00 27.70  ? 217 ALA C O   1 
ATOM   4599 C CB  . ALA C 1 215 ? 6.141   -3.488  46.968 1.00 25.21  ? 217 ALA C CB  1 
ATOM   4600 N N   . ARG C 1 216 ? 3.848   -1.056  47.003 1.00 25.09  ? 218 ARG C N   1 
ATOM   4601 C CA  . ARG C 1 216 ? 2.406   -0.878  46.990 1.00 27.91  ? 218 ARG C CA  1 
ATOM   4602 C C   . ARG C 1 216 ? 2.001   -1.283  45.617 1.00 26.41  ? 218 ARG C C   1 
ATOM   4603 O O   . ARG C 1 216 ? 2.313   -0.573  44.661 1.00 25.49  ? 218 ARG C O   1 
ATOM   4604 C CB  . ARG C 1 216 ? 2.055   0.599   47.181 1.00 26.71  ? 218 ARG C CB  1 
ATOM   4605 C CG  . ARG C 1 216 ? 2.464   1.133   48.514 1.00 46.89  ? 218 ARG C CG  1 
ATOM   4606 C CD  . ARG C 1 216 ? 2.295   2.630   48.527 1.00 53.02  ? 218 ARG C CD  1 
ATOM   4607 N NE  . ARG C 1 216 ? 3.532   3.305   48.151 1.00 60.29  ? 218 ARG C NE  1 
ATOM   4608 C CZ  . ARG C 1 216 ? 4.572   3.421   48.971 1.00 56.38  ? 218 ARG C CZ  1 
ATOM   4609 N NH1 . ARG C 1 216 ? 4.534   2.910   50.202 1.00 53.50  ? 218 ARG C NH1 1 
ATOM   4610 N NH2 . ARG C 1 216 ? 5.637   4.057   48.556 1.00 46.46  ? 218 ARG C NH2 1 
ATOM   4611 N N   . HIS C 1 217 ? 1.353   -2.437  45.510 1.00 25.96  ? 219 HIS C N   1 
ATOM   4612 C CA  . HIS C 1 217 ? 0.897   -2.940  44.228 1.00 25.49  ? 219 HIS C CA  1 
ATOM   4613 C C   . HIS C 1 217 ? -0.493  -2.455  43.983 1.00 26.57  ? 219 HIS C C   1 
ATOM   4614 O O   . HIS C 1 217 ? -1.378  -2.775  44.784 1.00 27.15  ? 219 HIS C O   1 
ATOM   4615 C CB  . HIS C 1 217 ? 0.849   -4.492  44.289 1.00 23.64  ? 219 HIS C CB  1 
ATOM   4616 C CG  . HIS C 1 217 ? 2.096   -5.089  44.859 1.00 28.35  ? 219 HIS C CG  1 
ATOM   4617 N ND1 . HIS C 1 217 ? 3.145   -5.507  44.065 1.00 34.99  ? 219 HIS C ND1 1 
ATOM   4618 C CD2 . HIS C 1 217 ? 2.489   -5.291  46.143 1.00 21.99  ? 219 HIS C CD2 1 
ATOM   4619 C CE1 . HIS C 1 217 ? 4.128   -5.949  44.838 1.00 38.53  ? 219 HIS C CE1 1 
ATOM   4620 N NE2 . HIS C 1 217 ? 3.751   -5.838  46.102 1.00 37.18  ? 219 HIS C NE2 1 
ATOM   4621 N N   . THR C 1 218 ? -0.722  -1.749  42.864 1.00 28.80  ? 220 THR C N   1 
ATOM   4622 C CA  . THR C 1 218 ? -2.101  -1.314  42.497 1.00 29.77  ? 220 THR C CA  1 
ATOM   4623 C C   . THR C 1 218 ? -2.652  -2.355  41.576 1.00 31.90  ? 220 THR C C   1 
ATOM   4624 O O   . THR C 1 218 ? -1.987  -2.782  40.608 1.00 28.45  ? 220 THR C O   1 
ATOM   4625 C CB  . THR C 1 218 ? -2.133  0.051   41.865 1.00 28.80  ? 220 THR C CB  1 
ATOM   4626 O OG1 . THR C 1 218 ? -1.641  1.006   42.805 1.00 31.54  ? 220 THR C OG1 1 
ATOM   4627 C CG2 . THR C 1 218 ? -3.503  0.435   41.444 1.00 39.82  ? 220 THR C CG2 1 
ATOM   4628 N N   . TYR C 1 219 ? -3.847  -2.834  41.935 1.00 32.33  ? 221 TYR C N   1 
ATOM   4629 C CA  . TYR C 1 219 ? -4.491  -3.870  41.170 1.00 36.41  ? 221 TYR C CA  1 
ATOM   4630 C C   . TYR C 1 219 ? -5.986  -3.580  41.118 1.00 38.37  ? 221 TYR C C   1 
ATOM   4631 O O   . TYR C 1 219 ? -6.485  -2.730  41.874 1.00 39.11  ? 221 TYR C O   1 
ATOM   4632 C CB  . TYR C 1 219 ? -4.143  -5.221  41.760 1.00 39.88  ? 221 TYR C CB  1 
ATOM   4633 C CG  . TYR C 1 219 ? -4.792  -5.499  43.097 1.00 44.95  ? 221 TYR C CG  1 
ATOM   4634 C CD1 . TYR C 1 219 ? -4.331  -4.892  44.271 1.00 45.64  ? 221 TYR C CD1 1 
ATOM   4635 C CD2 . TYR C 1 219 ? -5.864  -6.403  43.184 1.00 52.90  ? 221 TYR C CD2 1 
ATOM   4636 C CE1 . TYR C 1 219 ? -4.929  -5.168  45.503 1.00 44.15  ? 221 TYR C CE1 1 
ATOM   4637 C CE2 . TYR C 1 219 ? -6.468  -6.680  44.386 1.00 43.98  ? 221 TYR C CE2 1 
ATOM   4638 C CZ  . TYR C 1 219 ? -6.000  -6.061  45.546 1.00 52.00  ? 221 TYR C CZ  1 
ATOM   4639 O OH  . TYR C 1 219 ? -6.612  -6.345  46.742 1.00 50.18  ? 221 TYR C OH  1 
ATOM   4640 N N   . LEU C 1 220 ? -6.679  -4.261  40.219 1.00 40.93  ? 222 LEU C N   1 
ATOM   4641 C CA  . LEU C 1 220 ? -8.109  -4.080  39.961 1.00 39.89  ? 222 LEU C CA  1 
ATOM   4642 C C   . LEU C 1 220 ? -8.837  -5.253  40.533 1.00 43.50  ? 222 LEU C C   1 
ATOM   4643 O O   . LEU C 1 220 ? -8.472  -6.372  40.303 1.00 44.63  ? 222 LEU C O   1 
ATOM   4644 C CB  . LEU C 1 220 ? -8.392  -3.992  38.463 1.00 39.27  ? 222 LEU C CB  1 
ATOM   4645 C CG  . LEU C 1 220 ? -7.798  -2.845  37.652 1.00 44.20  ? 222 LEU C CG  1 
ATOM   4646 C CD1 . LEU C 1 220 ? -8.087  -2.953  36.195 1.00 43.36  ? 222 LEU C CD1 1 
ATOM   4647 C CD2 . LEU C 1 220 ? -8.245  -1.506  38.137 1.00 41.90  ? 222 LEU C CD2 1 
ATOM   4648 N N   . ALA C 1 221 ? -9.861  -4.988  41.312 1.00 48.59  ? 223 ALA C N   1 
ATOM   4649 C CA  . ALA C 1 221 ? -10.628 -6.064  41.918 1.00 58.20  ? 223 ALA C CA  1 
ATOM   4650 C C   . ALA C 1 221 ? -12.022 -5.559  42.244 1.00 63.05  ? 223 ALA C C   1 
ATOM   4651 O O   . ALA C 1 221 ? -12.221 -4.364  42.336 1.00 66.89  ? 223 ALA C O   1 
ATOM   4652 C CB  . ALA C 1 221 ? -9.940  -6.559  43.139 1.00 59.00  ? 223 ALA C CB  1 
ATOM   4653 N N   . ASN C 1 222 ? -12.940 -6.489  42.451 1.00 70.07  ? 224 ASN C N   1 
ATOM   4654 C CA  . ASN C 1 222 ? -14.307 -6.104  42.719 1.00 71.95  ? 224 ASN C CA  1 
ATOM   4655 C C   . ASN C 1 222 ? -14.512 -5.154  41.590 1.00 71.80  ? 224 ASN C C   1 
ATOM   4656 O O   . ASN C 1 222 ? -14.182 -5.481  40.464 1.00 73.68  ? 224 ASN C O   1 
ATOM   4657 C CB  . ASN C 1 222 ? -14.379 -5.340  44.034 1.00 74.30  ? 224 ASN C CB  1 
ATOM   4658 C CG  . ASN C 1 222 ? -15.666 -5.578  44.808 1.00 81.25  ? 224 ASN C CG  1 
ATOM   4659 O OD1 . ASN C 1 222 ? -16.362 -6.570  44.621 1.00 84.55  ? 224 ASN C OD1 1 
ATOM   4660 N ND2 . ASN C 1 222 ? -15.967 -4.660  45.712 1.00 86.49  ? 224 ASN C ND2 1 
ATOM   4661 N N   . GLY C 1 223 ? -14.981 -3.959  41.906 1.00 68.61  ? 225 GLY C N   1 
ATOM   4662 C CA  . GLY C 1 223 ? -15.101 -2.902  40.935 1.00 61.30  ? 225 GLY C CA  1 
ATOM   4663 C C   . GLY C 1 223 ? -14.308 -1.700  41.380 1.00 58.06  ? 225 GLY C C   1 
ATOM   4664 O O   . GLY C 1 223 ? -14.708 -0.559  41.220 1.00 56.32  ? 225 GLY C O   1 
ATOM   4665 N N   . GLN C 1 224 ? -13.151 -1.975  41.948 1.00 52.47  ? 226 GLN C N   1 
ATOM   4666 C CA  . GLN C 1 224 ? -12.268 -0.940  42.427 1.00 49.84  ? 226 GLN C CA  1 
ATOM   4667 C C   . GLN C 1 224 ? -10.825 -1.141  41.970 1.00 45.69  ? 226 GLN C C   1 
ATOM   4668 O O   . GLN C 1 224 ? -10.370 -2.251  41.632 1.00 39.86  ? 226 GLN C O   1 
ATOM   4669 C CB  . GLN C 1 224 ? -12.269 -0.889  43.967 1.00 49.88  ? 226 GLN C CB  1 
ATOM   4670 C CG  . GLN C 1 224 ? -13.643 -0.826  44.706 1.00 51.09  ? 226 GLN C CG  1 
ATOM   4671 C CD  . GLN C 1 224 ? -13.496 -1.231  46.184 1.00 53.28  ? 226 GLN C CD  1 
ATOM   4672 O OE1 . GLN C 1 224 ? -14.148 -2.176  46.651 1.00 44.52  ? 226 GLN C OE1 1 
ATOM   4673 N NE2 . GLN C 1 224 ? -12.583 -0.560  46.902 1.00 44.50  ? 226 GLN C NE2 1 
ATOM   4674 N N   . THR C 1 225 ? -10.113 -0.022  41.992 1.00 45.83  ? 227 THR C N   1 
ATOM   4675 C CA  . THR C 1 225 ? -8.686  -0.022  42.095 1.00 45.10  ? 227 THR C CA  1 
ATOM   4676 C C   . THR C 1 225 ? -8.359  -0.139  43.601 1.00 45.73  ? 227 THR C C   1 
ATOM   4677 O O   . THR C 1 225 ? -8.858  0.662   44.425 1.00 43.88  ? 227 THR C O   1 
ATOM   4678 C CB  . THR C 1 225 ? -8.136  1.289   41.532 1.00 46.61  ? 227 THR C CB  1 
ATOM   4679 O OG1 . THR C 1 225 ? -8.584  1.430   40.168 1.00 45.12  ? 227 THR C OG1 1 
ATOM   4680 C CG2 . THR C 1 225 ? -6.620  1.277   41.546 1.00 42.10  ? 227 THR C CG2 1 
ATOM   4681 N N   . LYS C 1 226 ? -7.563  -1.150  43.953 1.00 43.49  ? 228 LYS C N   1 
ATOM   4682 C CA  . LYS C 1 226 ? -7.057  -1.329  45.333 1.00 41.15  ? 228 LYS C CA  1 
ATOM   4683 C C   . LYS C 1 226 ? -5.518  -1.327  45.385 1.00 42.58  ? 228 LYS C C   1 
ATOM   4684 O O   . LYS C 1 226 ? -4.860  -1.422  44.346 1.00 38.79  ? 228 LYS C O   1 
ATOM   4685 C CB  . LYS C 1 226 ? -7.601  -2.633  45.931 1.00 44.26  ? 228 LYS C CB  1 
ATOM   4686 C CG  . LYS C 1 226 ? -9.127  -2.778  45.856 1.00 47.46  ? 228 LYS C CG  1 
ATOM   4687 C CD  . LYS C 1 226 ? -9.524  -4.187  46.230 1.00 51.55  ? 228 LYS C CD  1 
ATOM   4688 C CE  . LYS C 1 226 ? -10.997 -4.293  46.587 1.00 60.60  ? 228 LYS C CE  1 
ATOM   4689 N NZ  . LYS C 1 226 ? -11.171 -5.443  47.540 1.00 53.63  ? 228 LYS C NZ  1 
ATOM   4690 N N   . VAL C 1 227 ? -4.959  -1.233  46.594 1.00 38.46  ? 229 VAL C N   1 
ATOM   4691 C CA  . VAL C 1 227 ? -3.512  -1.184  46.788 1.00 37.72  ? 229 VAL C CA  1 
ATOM   4692 C C   . VAL C 1 227 ? -3.169  -2.251  47.823 1.00 40.44  ? 229 VAL C C   1 
ATOM   4693 O O   . VAL C 1 227 ? -3.783  -2.267  48.899 1.00 39.13  ? 229 VAL C O   1 
ATOM   4694 C CB  . VAL C 1 227 ? -3.048  0.186   47.322 1.00 39.38  ? 229 VAL C CB  1 
ATOM   4695 C CG1 . VAL C 1 227 ? -1.523  0.212   47.559 1.00 36.72  ? 229 VAL C CG1 1 
ATOM   4696 C CG2 . VAL C 1 227 ? -3.456  1.344   46.380 1.00 36.53  ? 229 VAL C CG2 1 
ATOM   4697 N N   . LEU C 1 228 ? -2.265  -3.184  47.472 1.00 39.86  ? 230 LEU C N   1 
ATOM   4698 C CA  . LEU C 1 228 ? -1.707  -4.135  48.442 1.00 35.59  ? 230 LEU C CA  1 
ATOM   4699 C C   . LEU C 1 228 ? -0.318  -3.675  48.775 1.00 31.42  ? 230 LEU C C   1 
ATOM   4700 O O   . LEU C 1 228 ? 0.505   -3.534  47.872 1.00 31.69  ? 230 LEU C O   1 
ATOM   4701 C CB  . LEU C 1 228 ? -1.667  -5.577  47.904 1.00 37.18  ? 230 LEU C CB  1 
ATOM   4702 C CG  . LEU C 1 228 ? -0.734  -6.441  48.765 1.00 35.99  ? 230 LEU C CG  1 
ATOM   4703 C CD1 . LEU C 1 228 ? -1.511  -7.056  49.902 1.00 47.33  ? 230 LEU C CD1 1 
ATOM   4704 C CD2 . LEU C 1 228 ? 0.015   -7.519  48.014 1.00 44.51  ? 230 LEU C CD2 1 
ATOM   4705 N N   . THR C 1 229 ? -0.066  -3.404  50.060 1.00 27.55  ? 231 THR C N   1 
ATOM   4706 C CA  . THR C 1 229 ? 1.214   -2.929  50.543 1.00 31.53  ? 231 THR C CA  1 
ATOM   4707 C C   . THR C 1 229 ? 1.988   -4.146  51.104 1.00 30.39  ? 231 THR C C   1 
ATOM   4708 O O   . THR C 1 229 ? 1.449   -4.991  51.838 1.00 31.70  ? 231 THR C O   1 
ATOM   4709 C CB  . THR C 1 229 ? 1.028   -1.759  51.543 1.00 33.89  ? 231 THR C CB  1 
ATOM   4710 O OG1 . THR C 1 229 ? 0.199   -0.748  50.933 1.00 39.19  ? 231 THR C OG1 1 
ATOM   4711 C CG2 . THR C 1 229 ? 2.339   -1.092  51.844 1.00 38.66  ? 231 THR C CG2 1 
ATOM   4712 N N   . GLN C 1 230 ? 3.236   -4.244  50.721 1.00 30.52  ? 232 GLN C N   1 
ATOM   4713 C CA  . GLN C 1 230 ? 4.046   -5.415  51.040 1.00 31.36  ? 232 GLN C CA  1 
ATOM   4714 C C   . GLN C 1 230 ? 5.453   -4.991  51.442 1.00 32.47  ? 232 GLN C C   1 
ATOM   4715 O O   . GLN C 1 230 ? 6.137   -4.314  50.678 1.00 31.34  ? 232 GLN C O   1 
ATOM   4716 C CB  . GLN C 1 230 ? 4.045   -6.359  49.821 1.00 36.47  ? 232 GLN C CB  1 
ATOM   4717 C CG  . GLN C 1 230 ? 5.038   -7.497  49.875 1.00 37.41  ? 232 GLN C CG  1 
ATOM   4718 C CD  . GLN C 1 230 ? 5.045   -8.378  48.616 1.00 47.48  ? 232 GLN C CD  1 
ATOM   4719 O OE1 . GLN C 1 230 ? 4.936   -7.895  47.484 1.00 43.89  ? 232 GLN C OE1 1 
ATOM   4720 N NE2 . GLN C 1 230 ? 5.229   -9.676  48.815 1.00 51.18  ? 232 GLN C NE2 1 
ATOM   4721 N N   . LYS C 1 231 ? 5.904   -5.424  52.639 1.00 33.58  ? 233 LYS C N   1 
ATOM   4722 C CA  . LYS C 1 231 ? 7.315   -5.255  53.046 1.00 33.04  ? 233 LYS C CA  1 
ATOM   4723 C C   . LYS C 1 231 ? 8.197   -6.244  52.288 1.00 37.46  ? 233 LYS C C   1 
ATOM   4724 O O   . LYS C 1 231 ? 7.997   -7.449  52.396 1.00 32.06  ? 233 LYS C O   1 
ATOM   4725 C CB  . LYS C 1 231 ? 7.454   -5.522  54.531 1.00 36.91  ? 233 LYS C CB  1 
ATOM   4726 C CG  . LYS C 1 231 ? 8.838   -5.208  55.131 1.00 43.60  ? 233 LYS C CG  1 
ATOM   4727 C CD  . LYS C 1 231 ? 8.685   -5.176  56.658 1.00 45.58  ? 233 LYS C CD  1 
ATOM   4728 C CE  . LYS C 1 231 ? 9.914   -5.589  57.376 1.00 45.57  ? 233 LYS C CE  1 
ATOM   4729 N NZ  . LYS C 1 231 ? 9.677   -5.587  58.864 1.00 55.61  ? 233 LYS C NZ  1 
ATOM   4730 N N   . LEU C 1 232 ? 9.144   -5.743  51.495 1.00 33.24  ? 234 LEU C N   1 
ATOM   4731 C CA  . LEU C 1 232 ? 10.108  -6.623  50.853 1.00 39.37  ? 234 LEU C CA  1 
ATOM   4732 C C   . LEU C 1 232 ? 11.329  -6.758  51.804 1.00 43.36  ? 234 LEU C C   1 
ATOM   4733 O O   . LEU C 1 232 ? 11.203  -7.140  52.975 1.00 46.06  ? 234 LEU C O   1 
ATOM   4734 C CB  . LEU C 1 232 ? 10.498  -6.074  49.465 1.00 33.52  ? 234 LEU C CB  1 
ATOM   4735 C CG  . LEU C 1 232 ? 9.266   -5.795  48.588 1.00 40.04  ? 234 LEU C CG  1 
ATOM   4736 C CD1 . LEU C 1 232 ? 9.627   -5.202  47.233 1.00 31.68  ? 234 LEU C CD1 1 
ATOM   4737 C CD2 . LEU C 1 232 ? 8.487   -7.071  48.416 1.00 36.19  ? 234 LEU C CD2 1 
ATOM   4738 N N   . SER C 1 233 ? 12.506  -6.438  51.324 1.00 41.81  ? 235 SER C N   1 
ATOM   4739 C CA  . SER C 1 233 ? 13.685  -6.650  52.131 1.00 41.76  ? 235 SER C CA  1 
ATOM   4740 C C   . SER C 1 233 ? 13.732  -5.596  53.232 1.00 41.22  ? 235 SER C C   1 
ATOM   4741 O O   . SER C 1 233 ? 13.234  -4.459  53.050 1.00 39.86  ? 235 SER C O   1 
ATOM   4742 C CB  . SER C 1 233 ? 14.917  -6.553  51.254 1.00 44.14  ? 235 SER C CB  1 
ATOM   4743 O OG  . SER C 1 233 ? 14.656  -5.656  50.205 1.00 50.54  ? 235 SER C OG  1 
ATOM   4744 N N   . SER C 1 234 ? 14.313  -5.978  54.367 1.00 41.68  ? 236 SER C N   1 
ATOM   4745 C CA  . SER C 1 234 ? 14.580  -5.036  55.444 1.00 37.87  ? 236 SER C CA  1 
ATOM   4746 C C   . SER C 1 234 ? 15.927  -5.340  56.106 1.00 43.19  ? 236 SER C C   1 
ATOM   4747 O O   . SER C 1 234 ? 16.475  -6.450  55.946 1.00 37.84  ? 236 SER C O   1 
ATOM   4748 C CB  . SER C 1 234 ? 13.457  -5.045  56.480 1.00 39.29  ? 236 SER C CB  1 
ATOM   4749 O OG  . SER C 1 234 ? 13.258  -6.334  57.004 1.00 44.06  ? 236 SER C OG  1 
ATOM   4750 N N   . VAL C 1 235 ? 16.465  -4.325  56.800 1.00 39.97  ? 237 VAL C N   1 
ATOM   4751 C CA  . VAL C 1 235 ? 17.617  -4.489  57.698 1.00 42.65  ? 237 VAL C CA  1 
ATOM   4752 C C   . VAL C 1 235 ? 17.364  -3.819  59.052 1.00 42.56  ? 237 VAL C C   1 
ATOM   4753 O O   . VAL C 1 235 ? 16.510  -2.943  59.179 1.00 37.12  ? 237 VAL C O   1 
ATOM   4754 C CB  . VAL C 1 235 ? 18.933  -3.914  57.099 1.00 41.01  ? 237 VAL C CB  1 
ATOM   4755 C CG1 . VAL C 1 235 ? 19.467  -4.809  55.954 1.00 50.93  ? 237 VAL C CG1 1 
ATOM   4756 C CG2 . VAL C 1 235 ? 18.750  -2.496  56.647 1.00 40.56  ? 237 VAL C CG2 1 
ATOM   4757 N N   . ARG C 1 236 ? 18.156  -4.231  60.036 1.00 44.95  ? 238 ARG C N   1 
ATOM   4758 C CA  . ARG C 1 236 ? 18.136  -3.718  61.400 1.00 49.05  ? 238 ARG C CA  1 
ATOM   4759 C C   . ARG C 1 236 ? 19.565  -3.281  61.775 1.00 49.42  ? 238 ARG C C   1 
ATOM   4760 O O   . ARG C 1 236 ? 20.512  -4.007  61.510 1.00 47.90  ? 238 ARG C O   1 
ATOM   4761 C CB  . ARG C 1 236 ? 17.725  -4.862  62.305 1.00 50.51  ? 238 ARG C CB  1 
ATOM   4762 C CG  . ARG C 1 236 ? 17.236  -4.481  63.666 1.00 60.57  ? 238 ARG C CG  1 
ATOM   4763 C CD  . ARG C 1 236 ? 17.023  -5.742  64.484 1.00 65.60  ? 238 ARG C CD  1 
ATOM   4764 N NE  . ARG C 1 236 ? 16.059  -5.531  65.558 1.00 75.85  ? 238 ARG C NE  1 
ATOM   4765 C CZ  . ARG C 1 236 ? 16.387  -5.206  66.806 1.00 84.18  ? 238 ARG C CZ  1 
ATOM   4766 N NH1 . ARG C 1 236 ? 17.667  -5.055  67.153 1.00 84.74  ? 238 ARG C NH1 1 
ATOM   4767 N NH2 . ARG C 1 236 ? 15.431  -5.027  67.713 1.00 88.66  ? 238 ARG C NH2 1 
ATOM   4768 N N   . GLY C 1 237 ? 19.731  -2.112  62.385 1.00 46.40  ? 239 GLY C N   1 
ATOM   4769 C CA  . GLY C 1 237 ? 21.046  -1.724  62.906 1.00 42.29  ? 239 GLY C CA  1 
ATOM   4770 C C   . GLY C 1 237 ? 21.167  -2.038  64.394 1.00 43.17  ? 239 GLY C C   1 
ATOM   4771 O O   . GLY C 1 237 ? 20.216  -2.503  65.012 1.00 42.54  ? 239 GLY C O   1 
ATOM   4772 N N   . ASN C 1 238 ? 22.322  -1.765  64.991 1.00 42.95  ? 240 ASN C N   1 
ATOM   4773 C CA  . ASN C 1 238 ? 22.484  -1.942  66.440 1.00 44.34  ? 240 ASN C CA  1 
ATOM   4774 C C   . ASN C 1 238 ? 21.570  -0.963  67.171 1.00 41.00  ? 240 ASN C C   1 
ATOM   4775 O O   . ASN C 1 238 ? 21.226  0.091   66.612 1.00 40.48  ? 240 ASN C O   1 
ATOM   4776 C CB  . ASN C 1 238 ? 23.931  -1.656  66.844 1.00 44.68  ? 240 ASN C CB  1 
ATOM   4777 C CG  . ASN C 1 238 ? 24.929  -2.432  66.032 1.00 57.25  ? 240 ASN C CG  1 
ATOM   4778 O OD1 . ASN C 1 238 ? 25.860  -1.847  65.459 1.00 53.99  ? 240 ASN C OD1 1 
ATOM   4779 N ND2 . ASN C 1 238 ? 24.772  -3.764  65.999 1.00 52.48  ? 240 ASN C ND2 1 
ATOM   4780 N N   . HIS C 1 239 ? 21.141  -1.324  68.369 1.00 44.12  ? 241 HIS C N   1 
ATOM   4781 C CA  . HIS C 1 239 ? 20.437  -0.398  69.277 1.00 47.65  ? 241 HIS C CA  1 
ATOM   4782 C C   . HIS C 1 239 ? 21.305  0.864   69.526 1.00 46.50  ? 241 HIS C C   1 
ATOM   4783 O O   . HIS C 1 239 ? 22.541  0.800   69.530 1.00 45.08  ? 241 HIS C O   1 
ATOM   4784 C CB  . HIS C 1 239 ? 20.181  -1.065  70.633 1.00 53.01  ? 241 HIS C CB  1 
ATOM   4785 C CG  . HIS C 1 239 ? 19.087  -2.095  70.629 1.00 70.79  ? 241 HIS C CG  1 
ATOM   4786 N ND1 . HIS C 1 239 ? 19.172  -3.278  69.924 1.00 85.90  ? 241 HIS C ND1 1 
ATOM   4787 C CD2 . HIS C 1 239 ? 17.905  -2.142  71.294 1.00 80.55  ? 241 HIS C CD2 1 
ATOM   4788 C CE1 . HIS C 1 239 ? 18.077  -3.993  70.127 1.00 81.96  ? 241 HIS C CE1 1 
ATOM   4789 N NE2 . HIS C 1 239 ? 17.295  -3.329  70.959 1.00 79.92  ? 241 HIS C NE2 1 
ATOM   4790 N N   . ILE C 1 240 ? 20.654  1.998   69.755 1.00 43.69  ? 242 ILE C N   1 
ATOM   4791 C CA  . ILE C 1 240 ? 21.354  3.251   69.981 1.00 37.83  ? 242 ILE C CA  1 
ATOM   4792 C C   . ILE C 1 240 ? 20.937  3.775   71.348 1.00 40.33  ? 242 ILE C C   1 
ATOM   4793 O O   . ILE C 1 240 ? 19.782  4.167   71.549 1.00 39.58  ? 242 ILE C O   1 
ATOM   4794 C CB  . ILE C 1 240 ? 21.001  4.263   68.880 1.00 36.29  ? 242 ILE C CB  1 
ATOM   4795 C CG1 . ILE C 1 240 ? 21.468  3.738   67.517 1.00 38.68  ? 242 ILE C CG1 1 
ATOM   4796 C CG2 . ILE C 1 240 ? 21.693  5.665   69.186 1.00 34.12  ? 242 ILE C CG2 1 
ATOM   4797 C CD1 . ILE C 1 240 ? 21.182  4.714   66.298 1.00 35.84  ? 242 ILE C CD1 1 
ATOM   4798 N N   . ILE C 1 241 ? 21.870  3.774   72.304 1.00 41.23  ? 243 ILE C N   1 
ATOM   4799 C CA  . ILE C 1 241 ? 21.525  4.041   73.680 1.00 38.92  ? 243 ILE C CA  1 
ATOM   4800 C C   . ILE C 1 241 ? 21.404  5.550   73.865 1.00 39.86  ? 243 ILE C C   1 
ATOM   4801 O O   . ILE C 1 241 ? 21.877  6.311   73.030 1.00 37.11  ? 243 ILE C O   1 
ATOM   4802 C CB  . ILE C 1 241 ? 22.549  3.445   74.653 1.00 44.64  ? 243 ILE C CB  1 
ATOM   4803 C CG1 . ILE C 1 241 ? 23.923  4.170   74.567 1.00 36.16  ? 243 ILE C CG1 1 
ATOM   4804 C CG2 . ILE C 1 241 ? 22.662  1.926   74.437 1.00 42.08  ? 243 ILE C CG2 1 
ATOM   4805 C CD1 . ILE C 1 241 ? 24.947  3.786   75.781 1.00 37.10  ? 243 ILE C CD1 1 
ATOM   4806 N N   . SER C 1 242 ? 20.753  5.965   74.942 1.00 36.66  ? 244 SER C N   1 
ATOM   4807 C CA  . SER C 1 242 ? 20.592  7.373   75.265 1.00 40.70  ? 244 SER C CA  1 
ATOM   4808 C C   . SER C 1 242 ? 21.940  8.075   75.274 1.00 41.89  ? 244 SER C C   1 
ATOM   4809 O O   . SER C 1 242 ? 22.894  7.583   75.895 1.00 43.37  ? 244 SER C O   1 
ATOM   4810 C CB  . SER C 1 242 ? 19.947  7.491   76.633 1.00 43.52  ? 244 SER C CB  1 
ATOM   4811 O OG  . SER C 1 242 ? 19.771  8.846   76.994 1.00 44.47  ? 244 SER C OG  1 
ATOM   4812 N N   . GLY C 1 243 ? 22.038  9.197   74.565 1.00 39.62  ? 245 GLY C N   1 
ATOM   4813 C CA  . GLY C 1 243 ? 23.250  10.021  74.597 1.00 43.48  ? 245 GLY C CA  1 
ATOM   4814 C C   . GLY C 1 243 ? 24.354  9.572   73.649 1.00 42.74  ? 245 GLY C C   1 
ATOM   4815 O O   . GLY C 1 243 ? 25.542  9.766   73.940 1.00 43.94  ? 245 GLY C O   1 
ATOM   4816 N N   . THR C 1 244 ? 23.983  8.955   72.527 1.00 40.60  ? 246 THR C N   1 
ATOM   4817 C CA  . THR C 1 244 ? 24.959  8.596   71.494 1.00 36.36  ? 246 THR C CA  1 
ATOM   4818 C C   . THR C 1 244 ? 24.373  8.787   70.113 1.00 39.09  ? 246 THR C C   1 
ATOM   4819 O O   . THR C 1 244 ? 23.164  8.944   69.969 1.00 42.25  ? 246 THR C O   1 
ATOM   4820 C CB  . THR C 1 244 ? 25.387  7.139   71.583 1.00 37.60  ? 246 THR C CB  1 
ATOM   4821 O OG1 . THR C 1 244 ? 24.257  6.287   71.318 1.00 36.37  ? 246 THR C OG1 1 
ATOM   4822 C CG2 . THR C 1 244 ? 26.045  6.788   72.981 1.00 35.82  ? 246 THR C CG2 1 
ATOM   4823 N N   . CYS C 1 245 ? 25.254  8.762   69.108 1.00 39.29  ? 247 CYS C N   1 
ATOM   4824 C CA  . CYS C 1 245 ? 24.929  8.803   67.705 1.00 37.55  ? 247 CYS C CA  1 
ATOM   4825 C C   . CYS C 1 245 ? 25.509  7.574   67.044 1.00 36.78  ? 247 CYS C C   1 
ATOM   4826 O O   . CYS C 1 245 ? 26.406  6.948   67.588 1.00 38.35  ? 247 CYS C O   1 
ATOM   4827 C CB  . CYS C 1 245 ? 25.584  10.001  67.041 1.00 40.78  ? 247 CYS C CB  1 
ATOM   4828 S SG  . CYS C 1 245 ? 25.143  11.616  67.656 1.00 46.06  ? 247 CYS C SG  1 
ATOM   4829 N N   . ALA C 1 246 ? 24.985  7.204   65.881 1.00 36.05  ? 248 ALA C N   1 
ATOM   4830 C CA  . ALA C 1 246 ? 25.587  6.137   65.091 1.00 36.62  ? 248 ALA C CA  1 
ATOM   4831 C C   . ALA C 1 246 ? 25.350  6.457   63.673 1.00 35.15  ? 248 ALA C C   1 
ATOM   4832 O O   . ALA C 1 246 ? 24.537  7.315   63.370 1.00 37.22  ? 248 ALA C O   1 
ATOM   4833 C CB  . ALA C 1 246 ? 24.973  4.797   65.401 1.00 36.92  ? 248 ALA C CB  1 
ATOM   4834 N N   . SER C 1 247 ? 26.056  5.758   62.805 1.00 34.29  ? 249 SER C N   1 
ATOM   4835 C CA  . SER C 1 247 ? 26.097  6.089   61.398 1.00 34.60  ? 249 SER C CA  1 
ATOM   4836 C C   . SER C 1 247 ? 26.043  4.788   60.641 1.00 36.32  ? 249 SER C C   1 
ATOM   4837 O O   . SER C 1 247 ? 26.660  3.807   61.043 1.00 35.28  ? 249 SER C O   1 
ATOM   4838 C CB  . SER C 1 247 ? 27.441  6.711   61.083 1.00 36.74  ? 249 SER C CB  1 
ATOM   4839 O OG  . SER C 1 247 ? 27.461  8.082   61.363 1.00 46.20  ? 249 SER C OG  1 
ATOM   4840 N N   . TRP C 1 248 ? 25.350  4.769   59.517 1.00 35.20  ? 250 TRP C N   1 
ATOM   4841 C CA  . TRP C 1 248 ? 25.553  3.629   58.601 1.00 36.40  ? 250 TRP C CA  1 
ATOM   4842 C C   . TRP C 1 248 ? 26.388  4.172   57.445 1.00 35.40  ? 250 TRP C C   1 
ATOM   4843 O O   . TRP C 1 248 ? 26.138  5.257   56.947 1.00 35.23  ? 250 TRP C O   1 
ATOM   4844 C CB  . TRP C 1 248 ? 24.217  3.093   58.070 1.00 38.75  ? 250 TRP C CB  1 
ATOM   4845 C CG  . TRP C 1 248 ? 23.269  2.417   59.077 1.00 36.22  ? 250 TRP C CG  1 
ATOM   4846 C CD1 . TRP C 1 248 ? 23.550  1.933   60.330 1.00 35.43  ? 250 TRP C CD1 1 
ATOM   4847 C CD2 . TRP C 1 248 ? 21.903  2.103   58.826 1.00 33.31  ? 250 TRP C CD2 1 
ATOM   4848 N NE1 . TRP C 1 248 ? 22.399  1.365   60.892 1.00 30.06  ? 250 TRP C NE1 1 
ATOM   4849 C CE2 . TRP C 1 248 ? 21.390  1.449   59.968 1.00 33.19  ? 250 TRP C CE2 1 
ATOM   4850 C CE3 . TRP C 1 248 ? 21.042  2.351   57.743 1.00 35.95  ? 250 TRP C CE3 1 
ATOM   4851 C CZ2 . TRP C 1 248 ? 20.065  1.044   60.055 1.00 36.28  ? 250 TRP C CZ2 1 
ATOM   4852 C CZ3 . TRP C 1 248 ? 19.738  1.940   57.827 1.00 27.79  ? 250 TRP C CZ3 1 
ATOM   4853 C CH2 . TRP C 1 248 ? 19.260  1.296   58.970 1.00 28.16  ? 250 TRP C CH2 1 
ATOM   4854 N N   . ARG C 1 249 ? 27.382  3.419   57.012 1.00 39.05  ? 251 ARG C N   1 
ATOM   4855 C CA  . ARG C 1 249 ? 28.263  3.892   55.949 1.00 45.91  ? 251 ARG C CA  1 
ATOM   4856 C C   . ARG C 1 249 ? 28.168  2.957   54.756 1.00 47.64  ? 251 ARG C C   1 
ATOM   4857 O O   . ARG C 1 249 ? 29.077  2.168   54.468 1.00 51.18  ? 251 ARG C O   1 
ATOM   4858 C CB  . ARG C 1 249 ? 29.706  3.960   56.434 1.00 46.29  ? 251 ARG C CB  1 
ATOM   4859 C CG  . ARG C 1 249 ? 29.905  4.894   57.598 1.00 51.93  ? 251 ARG C CG  1 
ATOM   4860 C CD  . ARG C 1 249 ? 31.324  4.759   58.185 1.00 72.37  ? 251 ARG C CD  1 
ATOM   4861 N NE  . ARG C 1 249 ? 31.394  5.446   59.473 1.00 69.95  ? 251 ARG C NE  1 
ATOM   4862 C CZ  . ARG C 1 249 ? 31.688  6.734   59.614 1.00 74.82  ? 251 ARG C CZ  1 
ATOM   4863 N NH1 . ARG C 1 249 ? 31.970  7.474   58.543 1.00 64.85  ? 251 ARG C NH1 1 
ATOM   4864 N NH2 . ARG C 1 249 ? 31.697  7.279   60.829 1.00 73.48  ? 251 ARG C NH2 1 
ATOM   4865 N N   . GLY C 1 250 ? 27.051  3.050   54.066 1.00 47.02  ? 252 GLY C N   1 
ATOM   4866 C CA  . GLY C 1 250 ? 26.833  2.207   52.915 1.00 48.08  ? 252 GLY C CA  1 
ATOM   4867 C C   . GLY C 1 250 ? 26.304  0.869   53.380 1.00 49.73  ? 252 GLY C C   1 
ATOM   4868 O O   . GLY C 1 250 ? 26.792  -0.174  52.973 1.00 53.77  ? 252 GLY C O   1 
ATOM   4869 N N   . LYS C 1 251 ? 25.302  0.894   54.247 1.00 46.80  ? 253 LYS C N   1 
ATOM   4870 C CA  . LYS C 1 251 ? 24.676  -0.348  54.649 1.00 45.28  ? 253 LYS C CA  1 
ATOM   4871 C C   . LYS C 1 251 ? 23.779  -0.765  53.478 1.00 45.31  ? 253 LYS C C   1 
ATOM   4872 O O   . LYS C 1 251 ? 23.084  0.088   52.940 1.00 43.04  ? 253 LYS C O   1 
ATOM   4873 C CB  . LYS C 1 251 ? 23.891  -0.081  55.915 1.00 45.64  ? 253 LYS C CB  1 
ATOM   4874 C CG  . LYS C 1 251 ? 22.638  -0.841  56.045 1.00 51.30  ? 253 LYS C CG  1 
ATOM   4875 C CD  . LYS C 1 251 ? 22.833  -1.984  56.914 1.00 46.55  ? 253 LYS C CD  1 
ATOM   4876 C CE  . LYS C 1 251 ? 22.391  -1.636  58.284 1.00 33.90  ? 253 LYS C CE  1 
ATOM   4877 N NZ  . LYS C 1 251 ? 23.497  -2.141  59.156 1.00 46.51  ? 253 LYS C NZ  1 
ATOM   4878 N N   . SER C 1 252 ? 23.801  -2.042  53.087 1.00 46.89  ? 254 SER C N   1 
ATOM   4879 C CA  . SER C 1 252 ? 23.112  -2.491  51.863 1.00 48.70  ? 254 SER C CA  1 
ATOM   4880 C C   . SER C 1 252 ? 21.783  -3.187  52.067 1.00 48.96  ? 254 SER C C   1 
ATOM   4881 O O   . SER C 1 252 ? 21.603  -3.999  52.981 1.00 47.33  ? 254 SER C O   1 
ATOM   4882 C CB  . SER C 1 252 ? 24.009  -3.376  51.004 1.00 50.66  ? 254 SER C CB  1 
ATOM   4883 O OG  . SER C 1 252 ? 25.129  -3.837  51.732 1.00 62.50  ? 254 SER C OG  1 
ATOM   4884 N N   . LEU C 1 253 ? 20.845  -2.872  51.188 1.00 45.90  ? 255 LEU C N   1 
ATOM   4885 C CA  . LEU C 1 253 ? 19.589  -3.572  51.161 1.00 45.43  ? 255 LEU C CA  1 
ATOM   4886 C C   . LEU C 1 253 ? 19.378  -4.152  49.743 1.00 46.78  ? 255 LEU C C   1 
ATOM   4887 O O   . LEU C 1 253 ? 19.602  -3.464  48.758 1.00 41.25  ? 255 LEU C O   1 
ATOM   4888 C CB  . LEU C 1 253 ? 18.497  -2.583  51.556 1.00 47.13  ? 255 LEU C CB  1 
ATOM   4889 C CG  . LEU C 1 253 ? 17.135  -3.032  52.079 1.00 41.88  ? 255 LEU C CG  1 
ATOM   4890 C CD1 . LEU C 1 253 ? 17.206  -4.380  52.730 1.00 49.48  ? 255 LEU C CD1 1 
ATOM   4891 C CD2 . LEU C 1 253 ? 16.719  -2.032  53.074 1.00 42.99  ? 255 LEU C CD2 1 
ATOM   4892 N N   . ARG C 1 254 ? 18.939  -5.404  49.639 1.00 50.67  ? 256 ARG C N   1 
ATOM   4893 C CA  . ARG C 1 254 ? 18.775  -6.031  48.327 1.00 53.86  ? 256 ARG C CA  1 
ATOM   4894 C C   . ARG C 1 254 ? 17.416  -5.778  47.671 1.00 53.50  ? 256 ARG C C   1 
ATOM   4895 O O   . ARG C 1 254 ? 16.341  -5.951  48.283 1.00 51.92  ? 256 ARG C O   1 
ATOM   4896 C CB  . ARG C 1 254 ? 19.119  -7.523  48.351 1.00 58.46  ? 256 ARG C CB  1 
ATOM   4897 C CG  . ARG C 1 254 ? 19.670  -8.034  46.999 1.00 63.15  ? 256 ARG C CG  1 
ATOM   4898 C CD  . ARG C 1 254 ? 20.936  -8.877  47.158 1.00 78.48  ? 256 ARG C CD  1 
ATOM   4899 N NE  . ARG C 1 254 ? 22.003  -8.128  47.831 1.00 86.07  ? 256 ARG C NE  1 
ATOM   4900 C CZ  . ARG C 1 254 ? 23.027  -7.530  47.219 1.00 90.00  ? 256 ARG C CZ  1 
ATOM   4901 N NH1 . ARG C 1 254 ? 23.933  -6.868  47.936 1.00 88.61  ? 256 ARG C NH1 1 
ATOM   4902 N NH2 . ARG C 1 254 ? 23.159  -7.598  45.896 1.00 90.64  ? 256 ARG C NH2 1 
ATOM   4903 N N   . VAL C 1 255 ? 17.471  -5.356  46.416 1.00 53.65  ? 257 VAL C N   1 
ATOM   4904 C CA  . VAL C 1 255 ? 16.265  -5.227  45.604 1.00 53.01  ? 257 VAL C CA  1 
ATOM   4905 C C   . VAL C 1 255 ? 16.014  -6.595  44.998 1.00 57.53  ? 257 VAL C C   1 
ATOM   4906 O O   . VAL C 1 255 ? 16.752  -7.000  44.115 1.00 58.03  ? 257 VAL C O   1 
ATOM   4907 C CB  . VAL C 1 255 ? 16.469  -4.227  44.453 1.00 52.16  ? 257 VAL C CB  1 
ATOM   4908 C CG1 . VAL C 1 255 ? 15.134  -3.958  43.779 1.00 57.91  ? 257 VAL C CG1 1 
ATOM   4909 C CG2 . VAL C 1 255 ? 17.083  -2.922  44.930 1.00 44.18  ? 257 VAL C CG2 1 
ATOM   4910 N N   . GLN C 1 256 ? 15.014  -7.344  45.457 1.00 63.07  ? 258 GLN C N   1 
ATOM   4911 C CA  . GLN C 1 256 ? 14.793  -8.675  44.832 1.00 69.71  ? 258 GLN C CA  1 
ATOM   4912 C C   . GLN C 1 256 ? 13.716  -8.699  43.717 1.00 72.31  ? 258 GLN C C   1 
ATOM   4913 O O   . GLN C 1 256 ? 12.980  -7.724  43.542 1.00 72.74  ? 258 GLN C O   1 
ATOM   4914 C CB  . GLN C 1 256 ? 14.621  -9.798  45.873 1.00 70.67  ? 258 GLN C CB  1 
ATOM   4915 C CG  . GLN C 1 256 ? 14.437  -9.328  47.315 1.00 75.09  ? 258 GLN C CG  1 
ATOM   4916 C CD  . GLN C 1 256 ? 12.982  -9.127  47.696 1.00 82.69  ? 258 GLN C CD  1 
ATOM   4917 O OE1 . GLN C 1 256 ? 12.602  -9.315  48.860 1.00 87.98  ? 258 GLN C OE1 1 
ATOM   4918 N NE2 . GLN C 1 256 ? 12.153  -8.756  46.722 1.00 81.30  ? 258 GLN C NE2 1 
ATOM   4919 N N   . LYS C 1 257 ? 13.661  -9.804  42.965 1.00 76.48  ? 259 LYS C N   1 
ATOM   4920 C CA  . LYS C 1 257 ? 12.692  -10.025 41.866 1.00 79.54  ? 259 LYS C CA  1 
ATOM   4921 C C   . LYS C 1 257 ? 11.653  -8.904  41.619 1.00 79.51  ? 259 LYS C C   1 
ATOM   4922 O O   . LYS C 1 257 ? 10.505  -8.946  42.098 1.00 79.19  ? 259 LYS C O   1 
ATOM   4923 C CB  . LYS C 1 257 ? 11.982  -11.372 42.040 1.00 81.53  ? 259 LYS C CB  1 
ATOM   4924 C CG  . LYS C 1 257 ? 11.277  -11.866 40.781 1.00 84.68  ? 259 LYS C CG  1 
ATOM   4925 C CD  . LYS C 1 257 ? 12.116  -12.885 40.022 1.00 87.59  ? 259 LYS C CD  1 
ATOM   4926 C CE  . LYS C 1 257 ? 11.989  -14.269 40.649 1.00 92.59  ? 259 LYS C CE  1 
ATOM   4927 N NZ  . LYS C 1 257 ? 12.161  -15.351 39.636 1.00 98.37  ? 259 LYS C NZ  1 
ATOM   4928 N N   . GLY C 1 264 ? -2.541  -11.067 39.299 1.00 70.43  ? 266 GLY C N   1 
ATOM   4929 C CA  . GLY C 1 264 ? -1.592  -11.066 38.180 1.00 69.44  ? 266 GLY C CA  1 
ATOM   4930 C C   . GLY C 1 264 ? -1.968  -10.071 37.090 1.00 67.37  ? 266 GLY C C   1 
ATOM   4931 O O   . GLY C 1 264 ? -1.510  -8.923  37.104 1.00 66.18  ? 266 GLY C O   1 
ATOM   4932 N N   . SER C 1 265 ? -2.807  -10.509 36.148 1.00 65.67  ? 267 SER C N   1 
ATOM   4933 C CA  . SER C 1 265 ? -3.254  -9.666  35.016 1.00 63.91  ? 267 SER C CA  1 
ATOM   4934 C C   . SER C 1 265 ? -3.946  -8.359  35.433 1.00 59.25  ? 267 SER C C   1 
ATOM   4935 O O   . SER C 1 265 ? -3.950  -7.372  34.685 1.00 57.51  ? 267 SER C O   1 
ATOM   4936 C CB  . SER C 1 265 ? -4.184  -10.453 34.076 1.00 64.11  ? 267 SER C CB  1 
ATOM   4937 O OG  . SER C 1 265 ? -3.433  -11.244 33.168 1.00 72.17  ? 267 SER C OG  1 
ATOM   4938 N N   . ASN C 1 266 ? -4.551  -8.365  36.615 1.00 56.20  ? 268 ASN C N   1 
ATOM   4939 C CA  . ASN C 1 266 ? -5.174  -7.169  37.125 1.00 53.33  ? 268 ASN C CA  1 
ATOM   4940 C C   . ASN C 1 266 ? -4.205  -6.291  37.920 1.00 50.93  ? 268 ASN C C   1 
ATOM   4941 O O   . ASN C 1 266 ? -4.627  -5.255  38.407 1.00 49.55  ? 268 ASN C O   1 
ATOM   4942 C CB  . ASN C 1 266 ? -6.455  -7.492  37.913 1.00 59.13  ? 268 ASN C CB  1 
ATOM   4943 C CG  . ASN C 1 266 ? -6.228  -8.524  39.021 1.00 66.89  ? 268 ASN C CG  1 
ATOM   4944 O OD1 . ASN C 1 266 ? -5.341  -9.378  38.922 1.00 74.10  ? 268 ASN C OD1 1 
ATOM   4945 N ND2 . ASN C 1 266 ? -7.044  -8.453  40.080 1.00 74.01  ? 268 ASN C ND2 1 
ATOM   4946 N N   . ILE C 1 267 ? -2.922  -6.689  38.020 1.00 45.47  ? 269 ILE C N   1 
ATOM   4947 C CA  . ILE C 1 267 ? -1.876  -5.791  38.531 1.00 47.18  ? 269 ILE C CA  1 
ATOM   4948 C C   . ILE C 1 267 ? -1.429  -4.707  37.520 1.00 45.48  ? 269 ILE C C   1 
ATOM   4949 O O   . ILE C 1 267 ? -0.910  -5.001  36.441 1.00 48.67  ? 269 ILE C O   1 
ATOM   4950 C CB  . ILE C 1 267 ? -0.653  -6.538  39.151 1.00 42.84  ? 269 ILE C CB  1 
ATOM   4951 C CG1 . ILE C 1 267 ? 0.130   -5.575  40.050 1.00 47.20  ? 269 ILE C CG1 1 
ATOM   4952 C CG2 . ILE C 1 267 ? 0.202   -7.188  38.089 1.00 55.45  ? 269 ILE C CG2 1 
ATOM   4953 C CD1 . ILE C 1 267 ? 1.579   -5.439  39.731 1.00 46.85  ? 269 ILE C CD1 1 
ATOM   4954 N N   . LEU C 1 268 ? -1.622  -3.452  37.897 1.00 38.34  ? 270 LEU C N   1 
ATOM   4955 C CA  . LEU C 1 268 ? -1.409  -2.353  36.995 1.00 31.84  ? 270 LEU C CA  1 
ATOM   4956 C C   . LEU C 1 268 ? -0.057  -1.768  37.162 1.00 27.31  ? 270 LEU C C   1 
ATOM   4957 O O   . LEU C 1 268 ? 0.616   -1.453  36.183 1.00 23.28  ? 270 LEU C O   1 
ATOM   4958 C CB  . LEU C 1 268 ? -2.474  -1.274  37.240 1.00 32.96  ? 270 LEU C CB  1 
ATOM   4959 C CG  . LEU C 1 268 ? -3.728  -1.366  36.350 1.00 41.28  ? 270 LEU C CG  1 
ATOM   4960 C CD1 . LEU C 1 268 ? -4.374  -2.704  36.496 1.00 47.90  ? 270 LEU C CD1 1 
ATOM   4961 C CD2 . LEU C 1 268 ? -4.690  -0.275  36.720 1.00 42.75  ? 270 LEU C CD2 1 
ATOM   4962 N N   . ARG C 1 269 ? 0.331   -1.559  38.423 1.00 24.48  ? 271 ARG C N   1 
ATOM   4963 C CA  . ARG C 1 269 ? 1.651   -1.002  38.680 1.00 25.84  ? 271 ARG C CA  1 
ATOM   4964 C C   . ARG C 1 269 ? 2.093   -1.265  40.093 1.00 23.30  ? 271 ARG C C   1 
ATOM   4965 O O   . ARG C 1 269 ? 1.324   -1.720  40.914 1.00 23.70  ? 271 ARG C O   1 
ATOM   4966 C CB  . ARG C 1 269 ? 1.663   0.503   38.452 1.00 28.25  ? 271 ARG C CB  1 
ATOM   4967 C CG  . ARG C 1 269 ? 0.549   1.254   39.090 1.00 34.65  ? 271 ARG C CG  1 
ATOM   4968 C CD  . ARG C 1 269 ? 0.829   2.716   38.988 1.00 41.28  ? 271 ARG C CD  1 
ATOM   4969 N NE  . ARG C 1 269 ? 0.067   3.516   39.950 1.00 48.30  ? 271 ARG C NE  1 
ATOM   4970 C CZ  . ARG C 1 269 ? -1.254  3.650   39.956 1.00 46.42  ? 271 ARG C CZ  1 
ATOM   4971 N NH1 . ARG C 1 269 ? -2.038  2.987   39.076 1.00 31.02  ? 271 ARG C NH1 1 
ATOM   4972 N NH2 . ARG C 1 269 ? -1.798  4.434   40.887 1.00 55.55  ? 271 ARG C NH2 1 
ATOM   4973 N N   . VAL C 1 270 ? 3.360   -0.999  40.363 1.00 27.46  ? 272 VAL C N   1 
ATOM   4974 C CA  . VAL C 1 270 ? 3.875   -1.142  41.741 1.00 30.38  ? 272 VAL C CA  1 
ATOM   4975 C C   . VAL C 1 270 ? 4.719   0.065   42.013 1.00 33.51  ? 272 VAL C C   1 
ATOM   4976 O O   . VAL C 1 270 ? 5.569   0.387   41.188 1.00 33.91  ? 272 VAL C O   1 
ATOM   4977 C CB  . VAL C 1 270 ? 4.774   -2.351  41.926 1.00 28.55  ? 272 VAL C CB  1 
ATOM   4978 C CG1 . VAL C 1 270 ? 5.093   -2.601  43.462 1.00 26.08  ? 272 VAL C CG1 1 
ATOM   4979 C CG2 . VAL C 1 270 ? 4.190   -3.574  41.292 1.00 35.02  ? 272 VAL C CG2 1 
ATOM   4980 N N   . GLU C 1 271 ? 4.461   0.728   43.150 1.00 32.05  ? 273 GLU C N   1 
ATOM   4981 C CA  . GLU C 1 271 ? 5.237   1.878   43.618 1.00 33.22  ? 273 GLU C CA  1 
ATOM   4982 C C   . GLU C 1 271 ? 6.043   1.470   44.842 1.00 32.26  ? 273 GLU C C   1 
ATOM   4983 O O   . GLU C 1 271 ? 5.538   0.800   45.733 1.00 28.49  ? 273 GLU C O   1 
ATOM   4984 C CB  . GLU C 1 271 ? 4.339   3.041   43.977 1.00 34.01  ? 273 GLU C CB  1 
ATOM   4985 C CG  . GLU C 1 271 ? 3.510   3.515   42.774 1.00 46.73  ? 273 GLU C CG  1 
ATOM   4986 C CD  . GLU C 1 271 ? 2.520   4.575   43.130 1.00 57.61  ? 273 GLU C CD  1 
ATOM   4987 O OE1 . GLU C 1 271 ? 2.365   4.861   44.342 1.00 63.80  ? 273 GLU C OE1 1 
ATOM   4988 O OE2 . GLU C 1 271 ? 1.893   5.124   42.194 1.00 69.02  ? 273 GLU C OE2 1 
ATOM   4989 N N   . TYR C 1 272 ? 7.306   1.867   44.840 1.00 31.38  ? 274 TYR C N   1 
ATOM   4990 C CA  . TYR C 1 272 ? 8.279   1.383   45.788 1.00 31.41  ? 274 TYR C CA  1 
ATOM   4991 C C   . TYR C 1 272 ? 8.795   2.563   46.582 1.00 31.53  ? 274 TYR C C   1 
ATOM   4992 O O   . TYR C 1 272 ? 8.963   3.657   46.058 1.00 30.28  ? 274 TYR C O   1 
ATOM   4993 C CB  . TYR C 1 272 ? 9.438   0.747   45.051 1.00 31.59  ? 274 TYR C CB  1 
ATOM   4994 C CG  . TYR C 1 272 ? 9.120   -0.532  44.260 1.00 34.04  ? 274 TYR C CG  1 
ATOM   4995 C CD1 . TYR C 1 272 ? 9.282   -1.769  44.850 1.00 30.60  ? 274 TYR C CD1 1 
ATOM   4996 C CD2 . TYR C 1 272 ? 8.764   -0.493  42.916 1.00 34.34  ? 274 TYR C CD2 1 
ATOM   4997 C CE1 . TYR C 1 272 ? 9.058   -2.920  44.171 1.00 32.65  ? 274 TYR C CE1 1 
ATOM   4998 C CE2 . TYR C 1 272 ? 8.492   -1.671  42.211 1.00 28.51  ? 274 TYR C CE2 1 
ATOM   4999 C CZ  . TYR C 1 272 ? 8.684   -2.876  42.864 1.00 36.96  ? 274 TYR C CZ  1 
ATOM   5000 O OH  . TYR C 1 272 ? 8.471   -4.078  42.279 1.00 36.64  ? 274 TYR C OH  1 
ATOM   5001 N N   . SER C 1 273 ? 9.023   2.346   47.868 1.00 32.05  ? 275 SER C N   1 
ATOM   5002 C CA  . SER C 1 273 ? 9.672   3.329   48.718 1.00 26.24  ? 275 SER C CA  1 
ATOM   5003 C C   . SER C 1 273 ? 10.696  2.617   49.568 1.00 27.86  ? 275 SER C C   1 
ATOM   5004 O O   . SER C 1 273 ? 10.504  1.456   49.956 1.00 25.92  ? 275 SER C O   1 
ATOM   5005 C CB  . SER C 1 273 ? 8.614   3.894   49.650 1.00 31.96  ? 275 SER C CB  1 
ATOM   5006 O OG  . SER C 1 273 ? 7.866   4.880   48.980 1.00 42.33  ? 275 SER C OG  1 
ATOM   5007 N N   . LEU C 1 274 ? 11.779  3.308   49.886 1.00 26.87  ? 276 LEU C N   1 
ATOM   5008 C CA  . LEU C 1 274 ? 12.694  2.838   50.910 1.00 27.08  ? 276 LEU C CA  1 
ATOM   5009 C C   . LEU C 1 274 ? 12.367  3.564   52.200 1.00 26.33  ? 276 LEU C C   1 
ATOM   5010 O O   . LEU C 1 274 ? 12.411  4.794   52.240 1.00 28.77  ? 276 LEU C O   1 
ATOM   5011 C CB  . LEU C 1 274 ? 14.087  3.209   50.517 1.00 28.96  ? 276 LEU C CB  1 
ATOM   5012 C CG  . LEU C 1 274 ? 15.206  3.092   51.552 1.00 28.63  ? 276 LEU C CG  1 
ATOM   5013 C CD1 . LEU C 1 274 ? 15.457  1.657   51.922 1.00 32.64  ? 276 LEU C CD1 1 
ATOM   5014 C CD2 . LEU C 1 274 ? 16.464  3.698   50.959 1.00 30.03  ? 276 LEU C CD2 1 
ATOM   5015 N N   . LEU C 1 275 ? 12.007  2.818   53.241 1.00 27.15  ? 277 LEU C N   1 
ATOM   5016 C CA  . LEU C 1 275 ? 11.736  3.406   54.550 1.00 28.79  ? 277 LEU C CA  1 
ATOM   5017 C C   . LEU C 1 275 ? 12.993  3.318   55.337 1.00 30.70  ? 277 LEU C C   1 
ATOM   5018 O O   . LEU C 1 275 ? 13.550  2.224   55.433 1.00 35.67  ? 277 LEU C O   1 
ATOM   5019 C CB  . LEU C 1 275 ? 10.607  2.668   55.298 1.00 29.27  ? 277 LEU C CB  1 
ATOM   5020 C CG  . LEU C 1 275 ? 9.308   2.702   54.497 1.00 34.68  ? 277 LEU C CG  1 
ATOM   5021 C CD1 . LEU C 1 275 ? 8.284   2.039   55.297 1.00 42.49  ? 277 LEU C CD1 1 
ATOM   5022 C CD2 . LEU C 1 275 ? 8.926   4.133   54.213 1.00 32.85  ? 277 LEU C CD2 1 
ATOM   5023 N N   . ILE C 1 276 ? 13.467  4.460   55.846 1.00 28.79  ? 278 ILE C N   1 
ATOM   5024 C CA  . ILE C 1 276 ? 14.553  4.490   56.865 1.00 31.16  ? 278 ILE C CA  1 
ATOM   5025 C C   . ILE C 1 276 ? 13.952  5.094   58.082 1.00 32.26  ? 278 ILE C C   1 
ATOM   5026 O O   . ILE C 1 276 ? 13.470  6.233   58.064 1.00 33.62  ? 278 ILE C O   1 
ATOM   5027 C CB  . ILE C 1 276 ? 15.774  5.266   56.435 1.00 32.81  ? 278 ILE C CB  1 
ATOM   5028 C CG1 . ILE C 1 276 ? 16.222  4.776   55.061 1.00 30.09  ? 278 ILE C CG1 1 
ATOM   5029 C CG2 . ILE C 1 276 ? 16.904  5.145   57.544 1.00 32.50  ? 278 ILE C CG2 1 
ATOM   5030 C CD1 . ILE C 1 276 ? 16.871  5.801   54.175 1.00 35.86  ? 278 ILE C CD1 1 
ATOM   5031 N N   . TYR C 1 277 ? 13.878  4.309   59.139 1.00 31.94  ? 279 TYR C N   1 
ATOM   5032 C CA  . TYR C 1 277 ? 13.215  4.799   60.318 1.00 34.44  ? 279 TYR C CA  1 
ATOM   5033 C C   . TYR C 1 277 ? 13.884  4.398   61.640 1.00 34.55  ? 279 TYR C C   1 
ATOM   5034 O O   . TYR C 1 277 ? 14.777  3.524   61.699 1.00 33.29  ? 279 TYR C O   1 
ATOM   5035 C CB  . TYR C 1 277 ? 11.732  4.390   60.324 1.00 34.34  ? 279 TYR C CB  1 
ATOM   5036 C CG  . TYR C 1 277 ? 11.492  2.903   60.294 1.00 36.77  ? 279 TYR C CG  1 
ATOM   5037 C CD1 . TYR C 1 277 ? 11.620  2.158   59.087 1.00 34.22  ? 279 TYR C CD1 1 
ATOM   5038 C CD2 . TYR C 1 277 ? 11.124  2.234   61.449 1.00 37.85  ? 279 TYR C CD2 1 
ATOM   5039 C CE1 . TYR C 1 277 ? 11.390  0.774   59.064 1.00 27.42  ? 279 TYR C CE1 1 
ATOM   5040 C CE2 . TYR C 1 277 ? 10.892  0.860   61.445 1.00 34.76  ? 279 TYR C CE2 1 
ATOM   5041 C CZ  . TYR C 1 277 ? 11.023  0.142   60.259 1.00 30.54  ? 279 TYR C CZ  1 
ATOM   5042 O OH  . TYR C 1 277 ? 10.787  -1.215  60.334 1.00 45.26  ? 279 TYR C OH  1 
ATOM   5043 N N   . VAL C 1 278 ? 13.451  5.071   62.697 1.00 33.10  ? 280 VAL C N   1 
ATOM   5044 C CA  . VAL C 1 278 ? 13.969  4.735   64.039 1.00 35.07  ? 280 VAL C CA  1 
ATOM   5045 C C   . VAL C 1 278 ? 12.774  4.336   64.895 1.00 36.74  ? 280 VAL C C   1 
ATOM   5046 O O   . VAL C 1 278 ? 11.820  5.104   65.035 1.00 34.35  ? 280 VAL C O   1 
ATOM   5047 C CB  . VAL C 1 278 ? 14.774  5.897   64.647 1.00 36.04  ? 280 VAL C CB  1 
ATOM   5048 C CG1 . VAL C 1 278 ? 15.239  5.543   66.048 1.00 33.39  ? 280 VAL C CG1 1 
ATOM   5049 C CG2 . VAL C 1 278 ? 15.972  6.215   63.794 1.00 32.57  ? 280 VAL C CG2 1 
ATOM   5050 N N   . SER C 1 279 ? 12.817  3.123   65.425 1.00 40.81  ? 281 SER C N   1 
ATOM   5051 C CA  . SER C 1 279 ? 11.828  2.695   66.407 1.00 43.35  ? 281 SER C CA  1 
ATOM   5052 C C   . SER C 1 279 ? 12.162  3.261   67.791 1.00 42.99  ? 281 SER C C   1 
ATOM   5053 O O   . SER C 1 279 ? 13.245  3.007   68.319 1.00 41.25  ? 281 SER C O   1 
ATOM   5054 C CB  . SER C 1 279 ? 11.783  1.164   66.473 1.00 47.62  ? 281 SER C CB  1 
ATOM   5055 O OG  . SER C 1 279 ? 11.463  0.649   65.200 1.00 52.67  ? 281 SER C OG  1 
ATOM   5056 N N   . VAL C 1 280 ? 11.218  4.002   68.368 1.00 42.77  ? 282 VAL C N   1 
ATOM   5057 C CA  . VAL C 1 280 ? 11.357  4.626   69.675 1.00 43.03  ? 282 VAL C CA  1 
ATOM   5058 C C   . VAL C 1 280 ? 10.324  3.951   70.583 1.00 47.16  ? 282 VAL C C   1 
ATOM   5059 O O   . VAL C 1 280 ? 9.139   4.210   70.423 1.00 49.97  ? 282 VAL C O   1 
ATOM   5060 C CB  . VAL C 1 280 ? 11.057  6.159   69.587 1.00 44.29  ? 282 VAL C CB  1 
ATOM   5061 C CG1 . VAL C 1 280 ? 11.233  6.841   70.946 1.00 42.83  ? 282 VAL C CG1 1 
ATOM   5062 C CG2 . VAL C 1 280 ? 11.928  6.822   68.550 1.00 43.55  ? 282 VAL C CG2 1 
ATOM   5063 N N   . PRO C 1 281 ? 10.757  3.065   71.517 1.00 51.31  ? 283 PRO C N   1 
ATOM   5064 C CA  . PRO C 1 281 ? 9.845   2.338   72.433 1.00 53.36  ? 283 PRO C CA  1 
ATOM   5065 C C   . PRO C 1 281 ? 8.907   3.229   73.229 1.00 57.07  ? 283 PRO C C   1 
ATOM   5066 O O   . PRO C 1 281 ? 9.334   4.203   73.835 1.00 57.34  ? 283 PRO C O   1 
ATOM   5067 C CB  . PRO C 1 281 ? 10.796  1.587   73.362 1.00 56.68  ? 283 PRO C CB  1 
ATOM   5068 C CG  . PRO C 1 281 ? 11.999  1.370   72.528 1.00 54.55  ? 283 PRO C CG  1 
ATOM   5069 C CD  . PRO C 1 281 ? 12.153  2.650   71.729 1.00 50.11  ? 283 PRO C CD  1 
ATOM   5070 N N   . GLY C 1 282 ? 7.611   2.907   73.179 1.00 62.58  ? 284 GLY C N   1 
ATOM   5071 C CA  . GLY C 1 282 ? 6.568   3.736   73.792 1.00 64.98  ? 284 GLY C CA  1 
ATOM   5072 C C   . GLY C 1 282 ? 6.329   5.076   73.114 1.00 65.75  ? 284 GLY C C   1 
ATOM   5073 O O   . GLY C 1 282 ? 5.735   5.975   73.692 1.00 69.17  ? 284 GLY C O   1 
ATOM   5074 N N   . SER C 1 283 ? 6.778   5.220   71.874 1.00 64.59  ? 285 SER C N   1 
ATOM   5075 C CA  . SER C 1 283 ? 6.520   6.437   71.123 1.00 62.81  ? 285 SER C CA  1 
ATOM   5076 C C   . SER C 1 283 ? 6.345   6.103   69.641 1.00 58.89  ? 285 SER C C   1 
ATOM   5077 O O   . SER C 1 283 ? 6.555   4.962   69.224 1.00 57.98  ? 285 SER C O   1 
ATOM   5078 C CB  . SER C 1 283 ? 7.646   7.447   71.358 1.00 62.62  ? 285 SER C CB  1 
ATOM   5079 O OG  . SER C 1 283 ? 7.347   8.708   70.800 1.00 68.97  ? 285 SER C OG  1 
ATOM   5080 N N   . LYS C 1 284 ? 5.944   7.084   68.844 1.00 57.36  ? 286 LYS C N   1 
ATOM   5081 C CA  . LYS C 1 284 ? 5.799   6.843   67.407 1.00 56.21  ? 286 LYS C CA  1 
ATOM   5082 C C   . LYS C 1 284 ? 7.171   6.719   66.758 1.00 53.20  ? 286 LYS C C   1 
ATOM   5083 O O   . LYS C 1 284 ? 8.157   7.225   67.291 1.00 54.82  ? 286 LYS C O   1 
ATOM   5084 C CB  . LYS C 1 284 ? 4.964   7.932   66.735 1.00 55.02  ? 286 LYS C CB  1 
ATOM   5085 C CG  . LYS C 1 284 ? 3.476   7.889   67.132 1.00 59.75  ? 286 LYS C CG  1 
ATOM   5086 C CD  . LYS C 1 284 ? 2.577   8.715   66.189 1.00 66.01  ? 286 LYS C CD  1 
ATOM   5087 C CE  . LYS C 1 284 ? 2.954   10.202  66.168 1.00 72.84  ? 286 LYS C CE  1 
ATOM   5088 N NZ  . LYS C 1 284 ? 1.919   11.045  65.495 1.00 72.17  ? 286 LYS C NZ  1 
ATOM   5089 N N   . LYS C 1 285 ? 7.231   6.039   65.615 1.00 48.93  ? 287 LYS C N   1 
ATOM   5090 C CA  . LYS C 1 285 ? 8.448   5.937   64.826 1.00 43.64  ? 287 LYS C CA  1 
ATOM   5091 C C   . LYS C 1 285 ? 8.834   7.288   64.276 1.00 42.98  ? 287 LYS C C   1 
ATOM   5092 O O   . LYS C 1 285 ? 7.983   8.128   64.030 1.00 42.36  ? 287 LYS C O   1 
ATOM   5093 C CB  . LYS C 1 285 ? 8.243   4.956   63.675 1.00 42.11  ? 287 LYS C CB  1 
ATOM   5094 C CG  . LYS C 1 285 ? 8.052   3.492   64.127 1.00 38.06  ? 287 LYS C CG  1 
ATOM   5095 C CD  . LYS C 1 285 ? 7.782   2.607   62.903 1.00 40.50  ? 287 LYS C CD  1 
ATOM   5096 C CE  . LYS C 1 285 ? 7.573   1.177   63.350 1.00 49.56  ? 287 LYS C CE  1 
ATOM   5097 N NZ  . LYS C 1 285 ? 6.339   1.032   64.205 1.00 58.39  ? 287 LYS C NZ  1 
ATOM   5098 N N   . VAL C 1 286 ? 10.123  7.506   64.086 1.00 42.56  ? 288 VAL C N   1 
ATOM   5099 C CA  . VAL C 1 286 ? 10.557  8.586   63.228 1.00 39.32  ? 288 VAL C CA  1 
ATOM   5100 C C   . VAL C 1 286 ? 10.981  8.005   61.883 1.00 37.88  ? 288 VAL C C   1 
ATOM   5101 O O   . VAL C 1 286 ? 11.874  7.158   61.800 1.00 34.26  ? 288 VAL C O   1 
ATOM   5102 C CB  . VAL C 1 286 ? 11.519  9.623   63.886 1.00 40.33  ? 288 VAL C CB  1 
ATOM   5103 C CG1 . VAL C 1 286 ? 12.023  9.161   65.253 1.00 40.13  ? 288 VAL C CG1 1 
ATOM   5104 C CG2 . VAL C 1 286 ? 12.616  10.068  62.961 1.00 41.39  ? 288 VAL C CG2 1 
ATOM   5105 N N   . ILE C 1 287 ? 10.265  8.438   60.850 1.00 35.76  ? 289 ILE C N   1 
ATOM   5106 C CA  . ILE C 1 287 ? 10.266  7.723   59.557 1.00 34.32  ? 289 ILE C CA  1 
ATOM   5107 C C   . ILE C 1 287 ? 10.690  8.615   58.417 1.00 35.74  ? 289 ILE C C   1 
ATOM   5108 O O   . ILE C 1 287 ? 10.140  9.711   58.259 1.00 37.84  ? 289 ILE C O   1 
ATOM   5109 C CB  . ILE C 1 287 ? 8.868   7.183   59.225 1.00 38.21  ? 289 ILE C CB  1 
ATOM   5110 C CG1 . ILE C 1 287 ? 8.361   6.256   60.299 1.00 39.17  ? 289 ILE C CG1 1 
ATOM   5111 C CG2 . ILE C 1 287 ? 8.853   6.420   57.851 1.00 33.07  ? 289 ILE C CG2 1 
ATOM   5112 C CD1 . ILE C 1 287 ? 6.857   6.003   60.175 1.00 38.17  ? 289 ILE C CD1 1 
ATOM   5113 N N   . LEU C 1 288 ? 11.644  8.147   57.614 1.00 34.77  ? 290 LEU C N   1 
ATOM   5114 C CA  . LEU C 1 288 ? 11.945  8.750   56.303 1.00 34.47  ? 290 LEU C CA  1 
ATOM   5115 C C   . LEU C 1 288 ? 11.430  7.807   55.231 1.00 36.08  ? 290 LEU C C   1 
ATOM   5116 O O   . LEU C 1 288 ? 11.656  6.619   55.308 1.00 37.98  ? 290 LEU C O   1 
ATOM   5117 C CB  . LEU C 1 288 ? 13.445  8.939   56.082 1.00 36.05  ? 290 LEU C CB  1 
ATOM   5118 C CG  . LEU C 1 288 ? 14.243  9.700   57.158 1.00 38.68  ? 290 LEU C CG  1 
ATOM   5119 C CD1 . LEU C 1 288 ? 15.665  9.707   56.787 1.00 27.83  ? 290 LEU C CD1 1 
ATOM   5120 C CD2 . LEU C 1 288 ? 13.701  11.119  57.222 1.00 28.14  ? 290 LEU C CD2 1 
ATOM   5121 N N   . ASP C 1 289 ? 10.750  8.366   54.241 1.00 35.17  ? 291 ASP C N   1 
ATOM   5122 C CA  . ASP C 1 289 ? 10.259  7.632   53.076 1.00 35.14  ? 291 ASP C CA  1 
ATOM   5123 C C   . ASP C 1 289 ? 10.902  8.237   51.822 1.00 33.80  ? 291 ASP C C   1 
ATOM   5124 O O   . ASP C 1 289 ? 10.602  9.370   51.440 1.00 30.54  ? 291 ASP C O   1 
ATOM   5125 C CB  . ASP C 1 289 ? 8.739   7.808   53.021 1.00 38.78  ? 291 ASP C CB  1 
ATOM   5126 C CG  . ASP C 1 289 ? 8.073   6.992   51.918 1.00 41.08  ? 291 ASP C CG  1 
ATOM   5127 O OD1 . ASP C 1 289 ? 8.716   6.626   50.914 1.00 39.32  ? 291 ASP C OD1 1 
ATOM   5128 O OD2 . ASP C 1 289 ? 6.887   6.727   52.072 1.00 42.59  ? 291 ASP C OD2 1 
ATOM   5129 N N   . LEU C 1 290 ? 11.798  7.477   51.197 1.00 32.30  ? 292 LEU C N   1 
ATOM   5130 C CA  . LEU C 1 290 ? 12.411  7.884   49.961 1.00 32.91  ? 292 LEU C CA  1 
ATOM   5131 C C   . LEU C 1 290 ? 11.798  7.087   48.805 1.00 34.67  ? 292 LEU C C   1 
ATOM   5132 O O   . LEU C 1 290 ? 11.953  5.880   48.771 1.00 32.15  ? 292 LEU C O   1 
ATOM   5133 C CB  . LEU C 1 290 ? 13.914  7.591   49.996 1.00 30.81  ? 292 LEU C CB  1 
ATOM   5134 C CG  . LEU C 1 290 ? 14.719  8.031   51.232 1.00 36.78  ? 292 LEU C CG  1 
ATOM   5135 C CD1 . LEU C 1 290 ? 16.174  7.842   50.941 1.00 34.55  ? 292 LEU C CD1 1 
ATOM   5136 C CD2 . LEU C 1 290 ? 14.396  9.488   51.485 1.00 41.68  ? 292 LEU C CD2 1 
ATOM   5137 N N   . PRO C 1 291 ? 11.102  7.752   47.876 1.00 35.50  ? 293 PRO C N   1 
ATOM   5138 C CA  . PRO C 1 291 ? 10.557  7.080   46.699 1.00 35.49  ? 293 PRO C CA  1 
ATOM   5139 C C   . PRO C 1 291 ? 11.636  6.504   45.815 1.00 32.22  ? 293 PRO C C   1 
ATOM   5140 O O   . PRO C 1 291 ? 12.698  7.109   45.640 1.00 37.30  ? 293 PRO C O   1 
ATOM   5141 C CB  . PRO C 1 291 ? 9.877   8.213   45.940 1.00 38.78  ? 293 PRO C CB  1 
ATOM   5142 C CG  . PRO C 1 291 ? 9.535   9.206   47.027 1.00 41.38  ? 293 PRO C CG  1 
ATOM   5143 C CD  . PRO C 1 291 ? 10.781  9.187   47.849 1.00 38.30  ? 293 PRO C CD  1 
ATOM   5144 N N   . LEU C 1 292 ? 11.356  5.317   45.288 1.00 27.30  ? 294 LEU C N   1 
ATOM   5145 C CA  . LEU C 1 292 ? 12.250  4.590   44.441 1.00 26.87  ? 294 LEU C CA  1 
ATOM   5146 C C   . LEU C 1 292 ? 11.591  4.254   43.088 1.00 28.74  ? 294 LEU C C   1 
ATOM   5147 O O   . LEU C 1 292 ? 10.363  4.243   42.957 1.00 28.51  ? 294 LEU C O   1 
ATOM   5148 C CB  . LEU C 1 292 ? 12.649  3.288   45.123 1.00 25.88  ? 294 LEU C CB  1 
ATOM   5149 C CG  . LEU C 1 292 ? 13.431  3.305   46.450 1.00 33.67  ? 294 LEU C CG  1 
ATOM   5150 C CD1 . LEU C 1 292 ? 13.601  1.893   46.854 1.00 31.04  ? 294 LEU C CD1 1 
ATOM   5151 C CD2 . LEU C 1 292 ? 14.800  4.017   46.382 1.00 30.01  ? 294 LEU C CD2 1 
ATOM   5152 N N   . VAL C 1 293 ? 12.430  3.944   42.107 1.00 30.72  ? 295 VAL C N   1 
ATOM   5153 C CA  . VAL C 1 293 ? 11.972  3.385   40.848 1.00 29.66  ? 295 VAL C CA  1 
ATOM   5154 C C   . VAL C 1 293 ? 12.655  2.034   40.811 1.00 28.09  ? 295 VAL C C   1 
ATOM   5155 O O   . VAL C 1 293 ? 13.857  1.933   41.065 1.00 30.86  ? 295 VAL C O   1 
ATOM   5156 C CB  . VAL C 1 293 ? 12.397  4.288   39.667 1.00 30.87  ? 295 VAL C CB  1 
ATOM   5157 C CG1 . VAL C 1 293 ? 12.273  3.558   38.325 1.00 29.33  ? 295 VAL C CG1 1 
ATOM   5158 C CG2 . VAL C 1 293 ? 11.567  5.538   39.659 1.00 30.73  ? 295 VAL C CG2 1 
ATOM   5159 N N   . ILE C 1 294 ? 11.915  0.955   40.583 1.00 27.59  ? 296 ILE C N   1 
ATOM   5160 C CA  . ILE C 1 294 ? 12.602  -0.349  40.536 1.00 29.08  ? 296 ILE C CA  1 
ATOM   5161 C C   . ILE C 1 294 ? 12.259  -0.994  39.218 1.00 30.07  ? 296 ILE C C   1 
ATOM   5162 O O   . ILE C 1 294 ? 11.120  -1.117  38.913 1.00 27.07  ? 296 ILE C O   1 
ATOM   5163 C CB  . ILE C 1 294 ? 12.280  -1.206  41.791 1.00 31.96  ? 296 ILE C CB  1 
ATOM   5164 C CG1 . ILE C 1 294 ? 13.035  -0.602  42.995 1.00 34.31  ? 296 ILE C CG1 1 
ATOM   5165 C CG2 . ILE C 1 294 ? 12.700  -2.662  41.625 1.00 29.76  ? 296 ILE C CG2 1 
ATOM   5166 C CD1 . ILE C 1 294 ? 12.772  -1.276  44.300 1.00 49.94  ? 296 ILE C CD1 1 
ATOM   5167 N N   . GLY C 1 295 ? 13.272  -1.369  38.440 1.00 32.99  ? 297 GLY C N   1 
ATOM   5168 C CA  . GLY C 1 295 ? 13.069  -1.910  37.121 1.00 35.62  ? 297 GLY C CA  1 
ATOM   5169 C C   . GLY C 1 295 ? 13.609  -3.310  37.006 1.00 39.96  ? 297 GLY C C   1 
ATOM   5170 O O   . GLY C 1 295 ? 14.509  -3.684  37.745 1.00 38.83  ? 297 GLY C O   1 
ATOM   5171 N N   . SER C 1 296 ? 13.028  -4.100  36.103 1.00 41.76  ? 298 SER C N   1 
ATOM   5172 C CA  . SER C 1 296 ? 13.570  -5.428  35.822 1.00 45.76  ? 298 SER C CA  1 
ATOM   5173 C C   . SER C 1 296 ? 14.620  -5.361  34.683 1.00 47.63  ? 298 SER C C   1 
ATOM   5174 O O   . SER C 1 296 ? 14.636  -4.398  33.895 1.00 44.85  ? 298 SER C O   1 
ATOM   5175 C CB  . SER C 1 296 ? 12.423  -6.364  35.455 1.00 47.59  ? 298 SER C CB  1 
ATOM   5176 O OG  . SER C 1 296 ? 11.871  -5.921  34.243 1.00 47.09  ? 298 SER C OG  1 
ATOM   5177 N N   . ARG C 1 297 ? 15.473  -6.390  34.609 1.00 50.78  ? 299 ARG C N   1 
ATOM   5178 C CA  . ARG C 1 297 ? 16.579  -6.480  33.658 1.00 54.57  ? 299 ARG C CA  1 
ATOM   5179 C C   . ARG C 1 297 ? 16.155  -7.135  32.351 1.00 58.58  ? 299 ARG C C   1 
ATOM   5180 O O   . ARG C 1 297 ? 15.232  -6.663  31.675 1.00 60.49  ? 299 ARG C O   1 
ATOM   5181 C CB  . ARG C 1 297 ? 17.723  -7.284  34.278 1.00 59.04  ? 299 ARG C CB  1 
ATOM   5182 C CG  . ARG C 1 297 ? 17.918  -7.027  35.771 1.00 59.16  ? 299 ARG C CG  1 
ATOM   5183 C CD  . ARG C 1 297 ? 19.302  -7.419  36.264 1.00 76.36  ? 299 ARG C CD  1 
ATOM   5184 N NE  . ARG C 1 297 ? 20.222  -6.273  36.319 1.00 78.07  ? 299 ARG C NE  1 
ATOM   5185 C CZ  . ARG C 1 297 ? 20.849  -5.846  37.416 1.00 74.67  ? 299 ARG C CZ  1 
ATOM   5186 N NH1 . ARG C 1 297 ? 20.676  -6.469  38.580 1.00 61.95  ? 299 ARG C NH1 1 
ATOM   5187 N NH2 . ARG C 1 297 ? 21.676  -4.800  37.347 1.00 73.33  ? 299 ARG C NH2 1 
ATOM   5188 N N   . MET D 2 1   ? 44.907  19.389  78.423 1.00 51.90  ? 1   MET D N   1 
ATOM   5189 C CA  . MET D 2 1   ? 44.688  19.473  76.955 1.00 47.71  ? 1   MET D CA  1 
ATOM   5190 C C   . MET D 2 1   ? 44.406  18.112  76.384 1.00 45.55  ? 1   MET D C   1 
ATOM   5191 O O   . MET D 2 1   ? 44.830  17.112  76.943 1.00 48.18  ? 1   MET D O   1 
ATOM   5192 C CB  . MET D 2 1   ? 45.924  20.021  76.265 1.00 51.08  ? 1   MET D CB  1 
ATOM   5193 C CG  . MET D 2 1   ? 46.275  21.434  76.676 1.00 62.95  ? 1   MET D CG  1 
ATOM   5194 S SD  . MET D 2 1   ? 44.876  22.584  76.595 1.00 62.09  ? 1   MET D SD  1 
ATOM   5195 C CE  . MET D 2 1   ? 44.512  22.503  74.838 1.00 52.61  ? 1   MET D CE  1 
ATOM   5196 N N   . VAL D 2 2   ? 43.738  18.103  75.237 1.00 44.16  ? 2   VAL D N   1 
ATOM   5197 C CA  . VAL D 2 2   ? 43.389  16.885  74.492 1.00 41.15  ? 2   VAL D CA  1 
ATOM   5198 C C   . VAL D 2 2   ? 44.093  16.868  73.122 1.00 44.33  ? 2   VAL D C   1 
ATOM   5199 O O   . VAL D 2 2   ? 43.974  17.832  72.362 1.00 40.01  ? 2   VAL D O   1 
ATOM   5200 C CB  . VAL D 2 2   ? 41.882  16.843  74.268 1.00 37.84  ? 2   VAL D CB  1 
ATOM   5201 C CG1 . VAL D 2 2   ? 41.498  15.717  73.306 1.00 28.25  ? 2   VAL D CG1 1 
ATOM   5202 C CG2 . VAL D 2 2   ? 41.168  16.683  75.614 1.00 30.98  ? 2   VAL D CG2 1 
ATOM   5203 N N   . LYS D 2 3   ? 44.831  15.794  72.809 1.00 44.44  ? 3   LYS D N   1 
ATOM   5204 C CA  . LYS D 2 3   ? 45.503  15.716  71.510 1.00 47.04  ? 3   LYS D CA  1 
ATOM   5205 C C   . LYS D 2 3   ? 44.622  15.073  70.445 1.00 45.01  ? 3   LYS D C   1 
ATOM   5206 O O   . LYS D 2 3   ? 44.067  14.010  70.673 1.00 43.59  ? 3   LYS D O   1 
ATOM   5207 C CB  . LYS D 2 3   ? 46.802  14.919  71.624 1.00 54.68  ? 3   LYS D CB  1 
ATOM   5208 C CG  . LYS D 2 3   ? 47.522  14.686  70.293 1.00 60.83  ? 3   LYS D CG  1 
ATOM   5209 C CD  . LYS D 2 3   ? 48.531  13.550  70.407 1.00 65.65  ? 3   LYS D CD  1 
ATOM   5210 C CE  . LYS D 2 3   ? 49.745  13.798  69.531 1.00 69.94  ? 3   LYS D CE  1 
ATOM   5211 N NZ  . LYS D 2 3   ? 49.440  14.649  68.360 1.00 68.57  ? 3   LYS D NZ  1 
ATOM   5212 N N   . GLN D 2 4   ? 44.522  15.721  69.285 1.00 45.80  ? 4   GLN D N   1 
ATOM   5213 C CA  . GLN D 2 4   ? 43.809  15.198  68.136 1.00 46.85  ? 4   GLN D CA  1 
ATOM   5214 C C   . GLN D 2 4   ? 44.626  14.216  67.316 1.00 50.39  ? 4   GLN D C   1 
ATOM   5215 O O   . GLN D 2 4   ? 45.685  14.565  66.823 1.00 55.05  ? 4   GLN D O   1 
ATOM   5216 C CB  . GLN D 2 4   ? 43.381  16.332  67.213 1.00 46.14  ? 4   GLN D CB  1 
ATOM   5217 C CG  . GLN D 2 4   ? 42.354  15.862  66.172 1.00 51.99  ? 4   GLN D CG  1 
ATOM   5218 C CD  . GLN D 2 4   ? 40.922  15.879  66.710 1.00 53.49  ? 4   GLN D CD  1 
ATOM   5219 O OE1 . GLN D 2 4   ? 40.550  16.787  67.449 1.00 52.18  ? 4   GLN D OE1 1 
ATOM   5220 N NE2 . GLN D 2 4   ? 40.117  14.885  66.328 1.00 41.77  ? 4   GLN D NE2 1 
ATOM   5221 N N   . ILE D 2 5   ? 44.098  13.007  67.144 1.00 50.25  ? 5   ILE D N   1 
ATOM   5222 C CA  . ILE D 2 5   ? 44.735  11.978  66.337 1.00 55.07  ? 5   ILE D CA  1 
ATOM   5223 C C   . ILE D 2 5   ? 44.178  11.959  64.910 1.00 58.02  ? 5   ILE D C   1 
ATOM   5224 O O   . ILE D 2 5   ? 43.011  11.652  64.703 1.00 52.12  ? 5   ILE D O   1 
ATOM   5225 C CB  . ILE D 2 5   ? 44.537  10.601  66.966 1.00 55.25  ? 5   ILE D CB  1 
ATOM   5226 C CG1 . ILE D 2 5   ? 45.129  10.568  68.388 1.00 46.61  ? 5   ILE D CG1 1 
ATOM   5227 C CG2 . ILE D 2 5   ? 45.110  9.533   66.058 1.00 57.24  ? 5   ILE D CG2 1 
ATOM   5228 C CD1 . ILE D 2 5   ? 46.634  10.904  68.495 1.00 53.39  ? 5   ILE D CD1 1 
ATOM   5229 N N   . GLU D 2 6   ? 45.035  12.273  63.935 1.00 64.15  ? 6   GLU D N   1 
ATOM   5230 C CA  . GLU D 2 6   ? 44.607  12.464  62.543 1.00 66.51  ? 6   GLU D CA  1 
ATOM   5231 C C   . GLU D 2 6   ? 44.855  11.227  61.698 1.00 70.74  ? 6   GLU D C   1 
ATOM   5232 O O   . GLU D 2 6   ? 44.439  11.165  60.535 1.00 74.29  ? 6   GLU D O   1 
ATOM   5233 C CB  . GLU D 2 6   ? 45.295  13.684  61.912 1.00 69.78  ? 6   GLU D CB  1 
ATOM   5234 C CG  . GLU D 2 6   ? 44.964  15.043  62.551 1.00 71.04  ? 6   GLU D CG  1 
ATOM   5235 C CD  . GLU D 2 6   ? 43.509  15.512  62.339 1.00 77.11  ? 6   GLU D CD  1 
ATOM   5236 O OE1 . GLU D 2 6   ? 42.654  14.744  61.834 1.00 70.91  ? 6   GLU D OE1 1 
ATOM   5237 O OE2 . GLU D 2 6   ? 43.217  16.673  62.697 1.00 76.03  ? 6   GLU D OE2 1 
ATOM   5238 N N   . SER D 2 7   ? 45.486  10.226  62.309 1.00 71.26  ? 7   SER D N   1 
ATOM   5239 C CA  . SER D 2 7   ? 45.985  9.082   61.579 1.00 75.46  ? 7   SER D CA  1 
ATOM   5240 C C   . SER D 2 7   ? 46.118  7.815   62.427 1.00 77.21  ? 7   SER D C   1 
ATOM   5241 O O   . SER D 2 7   ? 46.073  7.863   63.650 1.00 75.86  ? 7   SER D O   1 
ATOM   5242 C CB  . SER D 2 7   ? 47.339  9.468   60.985 1.00 82.80  ? 7   SER D CB  1 
ATOM   5243 O OG  . SER D 2 7   ? 48.278  8.431   61.113 1.00 88.12  ? 7   SER D OG  1 
ATOM   5244 N N   . LYS D 2 8   ? 46.311  6.683   61.762 1.00 81.44  ? 8   LYS D N   1 
ATOM   5245 C CA  . LYS D 2 8   ? 46.538  5.407   62.440 1.00 85.29  ? 8   LYS D CA  1 
ATOM   5246 C C   . LYS D 2 8   ? 48.004  5.221   62.891 1.00 90.92  ? 8   LYS D C   1 
ATOM   5247 O O   . LYS D 2 8   ? 48.305  4.416   63.783 1.00 89.96  ? 8   LYS D O   1 
ATOM   5248 C CB  . LYS D 2 8   ? 46.155  4.268   61.502 1.00 88.71  ? 8   LYS D CB  1 
ATOM   5249 C CG  . LYS D 2 8   ? 45.706  3.009   62.211 1.00 93.45  ? 8   LYS D CG  1 
ATOM   5250 C CD  . LYS D 2 8   ? 44.953  2.085   61.258 1.00 85.69  ? 8   LYS D CD  1 
ATOM   5251 C CE  . LYS D 2 8   ? 45.913  1.233   60.458 1.00 102.32 ? 8   LYS D CE  1 
ATOM   5252 N NZ  . LYS D 2 8   ? 46.658  0.265   61.325 1.00 111.38 ? 8   LYS D NZ  1 
ATOM   5253 N N   . THR D 2 9   ? 48.894  5.945   62.217 1.00 94.24  ? 9   THR D N   1 
ATOM   5254 C CA  . THR D 2 9   ? 50.304  6.002   62.540 1.00 100.17 ? 9   THR D CA  1 
ATOM   5255 C C   . THR D 2 9   ? 50.494  6.909   63.760 1.00 97.51  ? 9   THR D C   1 
ATOM   5256 O O   . THR D 2 9   ? 51.276  6.586   64.655 1.00 101.91 ? 9   THR D O   1 
ATOM   5257 C CB  . THR D 2 9   ? 51.124  6.489   61.311 1.00 106.22 ? 9   THR D CB  1 
ATOM   5258 O OG1 . THR D 2 9   ? 51.142  5.455   60.319 1.00 107.68 ? 9   THR D OG1 1 
ATOM   5259 C CG2 . THR D 2 9   ? 52.576  6.858   61.690 1.00 113.27 ? 9   THR D CG2 1 
ATOM   5260 N N   . ALA D 2 10  ? 49.758  8.025   63.801 1.00 89.67  ? 10  ALA D N   1 
ATOM   5261 C CA  . ALA D 2 10  ? 49.812  8.957   64.923 1.00 82.99  ? 10  ALA D CA  1 
ATOM   5262 C C   . ALA D 2 10  ? 49.151  8.331   66.130 1.00 77.30  ? 10  ALA D C   1 
ATOM   5263 O O   . ALA D 2 10  ? 49.541  8.577   67.263 1.00 75.28  ? 10  ALA D O   1 
ATOM   5264 C CB  . ALA D 2 10  ? 49.151  10.275  64.571 1.00 79.71  ? 10  ALA D CB  1 
ATOM   5265 N N   . PHE D 2 11  ? 48.154  7.497   65.882 1.00 74.55  ? 11  PHE D N   1 
ATOM   5266 C CA  . PHE D 2 11  ? 47.542  6.765   66.962 1.00 70.97  ? 11  PHE D CA  1 
ATOM   5267 C C   . PHE D 2 11  ? 48.547  5.847   67.623 1.00 77.65  ? 11  PHE D C   1 
ATOM   5268 O O   . PHE D 2 11  ? 48.707  5.895   68.833 1.00 78.47  ? 11  PHE D O   1 
ATOM   5269 C CB  . PHE D 2 11  ? 46.329  5.977   66.497 1.00 68.84  ? 11  PHE D CB  1 
ATOM   5270 C CG  . PHE D 2 11  ? 45.454  5.539   67.619 1.00 63.31  ? 11  PHE D CG  1 
ATOM   5271 C CD1 . PHE D 2 11  ? 44.935  6.469   68.507 1.00 61.39  ? 11  PHE D CD1 1 
ATOM   5272 C CD2 . PHE D 2 11  ? 45.172  4.198   67.815 1.00 72.12  ? 11  PHE D CD2 1 
ATOM   5273 C CE1 . PHE D 2 11  ? 44.132  6.065   69.559 1.00 66.20  ? 11  PHE D CE1 1 
ATOM   5274 C CE2 . PHE D 2 11  ? 44.365  3.786   68.871 1.00 68.68  ? 11  PHE D CE2 1 
ATOM   5275 C CZ  . PHE D 2 11  ? 43.843  4.716   69.738 1.00 65.77  ? 11  PHE D CZ  1 
ATOM   5276 N N   . GLN D 2 12  ? 49.225  5.022   66.828 1.00 84.21  ? 12  GLN D N   1 
ATOM   5277 C CA  . GLN D 2 12  ? 50.258  4.104   67.340 1.00 90.32  ? 12  GLN D CA  1 
ATOM   5278 C C   . GLN D 2 12  ? 51.324  4.837   68.155 1.00 93.44  ? 12  GLN D C   1 
ATOM   5279 O O   . GLN D 2 12  ? 51.630  4.472   69.300 1.00 97.46  ? 12  GLN D O   1 
ATOM   5280 C CB  . GLN D 2 12  ? 50.904  3.354   66.174 1.00 97.43  ? 12  GLN D CB  1 
ATOM   5281 C CG  . GLN D 2 12  ? 51.490  1.989   66.526 1.00 109.90 ? 12  GLN D CG  1 
ATOM   5282 C CD  . GLN D 2 12  ? 50.547  1.128   67.353 1.00 113.40 ? 12  GLN D CD  1 
ATOM   5283 O OE1 . GLN D 2 12  ? 50.406  1.324   68.563 1.00 109.19 ? 12  GLN D OE1 1 
ATOM   5284 N NE2 . GLN D 2 12  ? 49.910  0.155   66.704 1.00 115.27 ? 12  GLN D NE2 1 
ATOM   5285 N N   . GLU D 2 13  ? 51.882  5.874   67.540 1.00 92.85  ? 13  GLU D N   1 
ATOM   5286 C CA  . GLU D 2 13  ? 52.856  6.757   68.154 1.00 95.89  ? 13  GLU D CA  1 
ATOM   5287 C C   . GLU D 2 13  ? 52.422  7.358   69.498 1.00 91.99  ? 13  GLU D C   1 
ATOM   5288 O O   . GLU D 2 13  ? 53.254  7.637   70.340 1.00 96.79  ? 13  GLU D O   1 
ATOM   5289 C CB  . GLU D 2 13  ? 53.221  7.866   67.157 1.00 96.03  ? 13  GLU D CB  1 
ATOM   5290 C CG  . GLU D 2 13  ? 54.359  8.798   67.600 1.00 107.81 ? 13  GLU D CG  1 
ATOM   5291 C CD  . GLU D 2 13  ? 55.642  8.062   68.006 1.00 120.00 ? 13  GLU D CD  1 
ATOM   5292 O OE1 . GLU D 2 13  ? 56.411  8.636   68.808 1.00 123.69 ? 13  GLU D OE1 1 
ATOM   5293 O OE2 . GLU D 2 13  ? 55.881  6.923   67.534 1.00 126.02 ? 13  GLU D OE2 1 
ATOM   5294 N N   . ALA D 2 14  ? 51.127  7.560   69.702 1.00 84.80  ? 14  ALA D N   1 
ATOM   5295 C CA  . ALA D 2 14  ? 50.644  8.134   70.955 1.00 81.05  ? 14  ALA D CA  1 
ATOM   5296 C C   . ALA D 2 14  ? 50.595  7.105   72.080 1.00 83.24  ? 14  ALA D C   1 
ATOM   5297 O O   . ALA D 2 14  ? 50.931  7.414   73.222 1.00 86.09  ? 14  ALA D O   1 
ATOM   5298 C CB  . ALA D 2 14  ? 49.280  8.782   70.753 1.00 71.47  ? 14  ALA D CB  1 
ATOM   5299 N N   . LEU D 2 15  ? 50.175  5.884   71.746 1.00 84.80  ? 15  LEU D N   1 
ATOM   5300 C CA  . LEU D 2 15  ? 50.026  4.786   72.712 1.00 89.00  ? 15  LEU D CA  1 
ATOM   5301 C C   . LEU D 2 15  ? 51.365  4.333   73.273 1.00 98.85  ? 15  LEU D C   1 
ATOM   5302 O O   . LEU D 2 15  ? 51.456  3.930   74.433 1.00 101.88 ? 15  LEU D O   1 
ATOM   5303 C CB  . LEU D 2 15  ? 49.355  3.579   72.042 1.00 88.34  ? 15  LEU D CB  1 
ATOM   5304 C CG  . LEU D 2 15  ? 47.841  3.322   72.072 1.00 86.88  ? 15  LEU D CG  1 
ATOM   5305 C CD1 . LEU D 2 15  ? 46.999  4.562   72.418 1.00 73.49  ? 15  LEU D CD1 1 
ATOM   5306 C CD2 . LEU D 2 15  ? 47.443  2.736   70.737 1.00 73.51  ? 15  LEU D CD2 1 
ATOM   5307 N N   . ASP D 2 16  ? 52.385  4.377   72.418 1.00 103.97 ? 16  ASP D N   1 
ATOM   5308 C CA  . ASP D 2 16  ? 53.723  3.926   72.759 1.00 113.28 ? 16  ASP D CA  1 
ATOM   5309 C C   . ASP D 2 16  ? 54.529  5.037   73.441 1.00 115.17 ? 16  ASP D C   1 
ATOM   5310 O O   . ASP D 2 16  ? 55.318  4.756   74.330 1.00 121.97 ? 16  ASP D O   1 
ATOM   5311 C CB  . ASP D 2 16  ? 54.464  3.412   71.510 1.00 118.44 ? 16  ASP D CB  1 
ATOM   5312 C CG  . ASP D 2 16  ? 53.733  2.243   70.811 1.00 120.76 ? 16  ASP D CG  1 
ATOM   5313 O OD1 . ASP D 2 16  ? 52.846  1.559   71.440 1.00 116.97 ? 16  ASP D OD1 1 
ATOM   5314 O OD2 . ASP D 2 16  ? 54.062  2.013   69.613 1.00 117.11 ? 16  ASP D OD2 1 
ATOM   5315 N N   . ALA D 2 17  ? 54.335  6.288   73.024 1.00 109.92 ? 17  ALA D N   1 
ATOM   5316 C CA  . ALA D 2 17  ? 54.988  7.426   73.678 1.00 109.94 ? 17  ALA D CA  1 
ATOM   5317 C C   . ALA D 2 17  ? 54.490  7.570   75.101 1.00 107.72 ? 17  ALA D C   1 
ATOM   5318 O O   . ALA D 2 17  ? 55.210  8.064   75.960 1.00 111.06 ? 17  ALA D O   1 
ATOM   5319 C CB  . ALA D 2 17  ? 54.765  8.726   72.906 1.00 105.07 ? 17  ALA D CB  1 
ATOM   5320 N N   . ALA D 2 18  ? 53.247  7.169   75.347 1.00 102.40 ? 18  ALA D N   1 
ATOM   5321 C CA  . ALA D 2 18  ? 52.758  7.051   76.712 1.00 101.11 ? 18  ALA D CA  1 
ATOM   5322 C C   . ALA D 2 18  ? 53.474  5.845   77.307 1.00 109.43 ? 18  ALA D C   1 
ATOM   5323 O O   . ALA D 2 18  ? 53.781  4.880   76.603 1.00 115.67 ? 18  ALA D O   1 
ATOM   5324 C CB  . ALA D 2 18  ? 51.248  6.862   76.736 1.00 94.10  ? 18  ALA D CB  1 
ATOM   5325 N N   . GLY D 2 19  ? 53.769  5.900   78.592 1.00 112.71 ? 19  GLY D N   1 
ATOM   5326 C CA  . GLY D 2 19  ? 54.570  4.838   79.209 1.00 120.76 ? 19  GLY D CA  1 
ATOM   5327 C C   . GLY D 2 19  ? 53.613  3.783   79.712 1.00 120.78 ? 19  GLY D C   1 
ATOM   5328 O O   . GLY D 2 19  ? 52.995  3.037   78.912 1.00 117.14 ? 19  GLY D O   1 
ATOM   5329 N N   . ASP D 2 20  ? 53.489  3.746   81.047 1.00 122.65 ? 20  ASP D N   1 
ATOM   5330 C CA  . ASP D 2 20  ? 52.466  2.938   81.714 1.00 122.61 ? 20  ASP D CA  1 
ATOM   5331 C C   . ASP D 2 20  ? 51.314  3.834   82.188 1.00 112.60 ? 20  ASP D C   1 
ATOM   5332 O O   . ASP D 2 20  ? 50.527  3.443   83.143 1.00 113.82 ? 20  ASP D O   1 
ATOM   5333 C CB  . ASP D 2 20  ? 53.098  2.204   82.907 1.00 133.87 ? 20  ASP D CB  1 
ATOM   5334 C CG  . ASP D 2 20  ? 54.097  3.082   83.659 1.00 141.71 ? 20  ASP D CG  1 
ATOM   5335 O OD1 . ASP D 2 20  ? 54.849  2.537   84.508 1.00 161.32 ? 20  ASP D OD1 1 
ATOM   5336 O OD2 . ASP D 2 20  ? 54.143  4.311   83.399 1.00 139.01 ? 20  ASP D OD2 1 
ATOM   5337 N N   . LYS D 2 21  ? 51.233  5.058   81.512 1.00 103.76 ? 21  LYS D N   1 
ATOM   5338 C CA  . LYS D 2 21  ? 50.176  5.987   81.904 1.00 96.16  ? 21  LYS D CA  1 
ATOM   5339 C C   . LYS D 2 21  ? 48.848  5.592   81.240 1.00 89.67  ? 21  LYS D C   1 
ATOM   5340 O O   . LYS D 2 21  ? 48.822  5.023   80.132 1.00 88.08  ? 21  LYS D O   1 
ATOM   5341 C CB  . LYS D 2 21  ? 50.539  7.442   81.516 1.00 92.51  ? 21  LYS D CB  1 
ATOM   5342 C CG  . LYS D 2 21  ? 51.746  7.513   80.538 1.00 95.25  ? 21  LYS D CG  1 
ATOM   5343 C CD  . LYS D 2 21  ? 53.006  8.064   81.259 1.00 107.27 ? 21  LYS D CD  1 
ATOM   5344 C CE  . LYS D 2 21  ? 52.952  9.610   81.362 1.00 97.82  ? 21  LYS D CE  1 
ATOM   5345 N NZ  . LYS D 2 21  ? 52.869  10.296  79.970 1.00 95.40  ? 21  LYS D NZ  1 
ATOM   5346 N N   . LEU D 2 22  ? 47.764  5.871   81.958 1.00 85.33  ? 22  LEU D N   1 
ATOM   5347 C CA  . LEU D 2 22  ? 46.419  5.792   81.418 1.00 79.42  ? 22  LEU D CA  1 
ATOM   5348 C C   . LEU D 2 22  ? 46.271  6.717   80.197 1.00 71.89  ? 22  LEU D C   1 
ATOM   5349 O O   . LEU D 2 22  ? 46.726  7.866   80.190 1.00 66.69  ? 22  LEU D O   1 
ATOM   5350 C CB  . LEU D 2 22  ? 45.381  6.140   82.498 1.00 77.35  ? 22  LEU D CB  1 
ATOM   5351 C CG  . LEU D 2 22  ? 43.899  5.903   82.138 1.00 75.52  ? 22  LEU D CG  1 
ATOM   5352 C CD1 . LEU D 2 22  ? 43.606  4.401   82.010 1.00 74.30  ? 22  LEU D CD1 1 
ATOM   5353 C CD2 . LEU D 2 22  ? 42.963  6.539   83.172 1.00 66.51  ? 22  LEU D CD2 1 
ATOM   5354 N N   . VAL D 2 23  ? 45.656  6.177   79.146 1.00 70.91  ? 23  VAL D N   1 
ATOM   5355 C CA  . VAL D 2 23  ? 45.358  6.925   77.923 1.00 64.24  ? 23  VAL D CA  1 
ATOM   5356 C C   . VAL D 2 23  ? 43.867  6.713   77.728 1.00 60.09  ? 23  VAL D C   1 
ATOM   5357 O O   . VAL D 2 23  ? 43.404  5.568   77.708 1.00 59.01  ? 23  VAL D O   1 
ATOM   5358 C CB  . VAL D 2 23  ? 46.141  6.344   76.704 1.00 67.76  ? 23  VAL D CB  1 
ATOM   5359 C CG1 . VAL D 2 23  ? 45.805  7.089   75.402 1.00 57.82  ? 23  VAL D CG1 1 
ATOM   5360 C CG2 . VAL D 2 23  ? 47.637  6.339   76.968 1.00 77.54  ? 23  VAL D CG2 1 
ATOM   5361 N N   . VAL D 2 24  ? 43.114  7.809   77.664 1.00 55.26  ? 24  VAL D N   1 
ATOM   5362 C CA  . VAL D 2 24  ? 41.691  7.742   77.366 1.00 49.77  ? 24  VAL D CA  1 
ATOM   5363 C C   . VAL D 2 24  ? 41.435  8.403   76.000 1.00 46.94  ? 24  VAL D C   1 
ATOM   5364 O O   . VAL D 2 24  ? 41.982  9.484   75.707 1.00 40.89  ? 24  VAL D O   1 
ATOM   5365 C CB  . VAL D 2 24  ? 40.829  8.338   78.501 1.00 49.05  ? 24  VAL D CB  1 
ATOM   5366 C CG1 . VAL D 2 24  ? 41.182  9.758   78.733 1.00 50.00  ? 24  VAL D CG1 1 
ATOM   5367 C CG2 . VAL D 2 24  ? 39.325  8.216   78.178 1.00 42.36  ? 24  VAL D CG2 1 
ATOM   5368 N N   . VAL D 2 25  ? 40.653  7.729   75.150 1.00 42.68  ? 25  VAL D N   1 
ATOM   5369 C CA  . VAL D 2 25  ? 40.380  8.260   73.814 1.00 39.83  ? 25  VAL D CA  1 
ATOM   5370 C C   . VAL D 2 25  ? 38.914  8.617   73.680 1.00 36.40  ? 25  VAL D C   1 
ATOM   5371 O O   . VAL D 2 25  ? 38.062  7.783   73.916 1.00 39.45  ? 25  VAL D O   1 
ATOM   5372 C CB  . VAL D 2 25  ? 40.796  7.260   72.703 1.00 41.69  ? 25  VAL D CB  1 
ATOM   5373 C CG1 . VAL D 2 25  ? 40.580  7.885   71.320 1.00 40.45  ? 25  VAL D CG1 1 
ATOM   5374 C CG2 . VAL D 2 25  ? 42.245  6.844   72.858 1.00 47.79  ? 25  VAL D CG2 1 
ATOM   5375 N N   . ASP D 2 26  ? 38.625  9.859   73.297 1.00 36.19  ? 26  ASP D N   1 
ATOM   5376 C CA  . ASP D 2 26  ? 37.278  10.267  72.932 1.00 27.89  ? 26  ASP D CA  1 
ATOM   5377 C C   . ASP D 2 26  ? 37.085  9.958   71.453 1.00 29.83  ? 26  ASP D C   1 
ATOM   5378 O O   . ASP D 2 26  ? 37.643  10.653  70.597 1.00 26.56  ? 26  ASP D O   1 
ATOM   5379 C CB  . ASP D 2 26  ? 37.105  11.758  73.195 1.00 29.54  ? 26  ASP D CB  1 
ATOM   5380 C CG  . ASP D 2 26  ? 35.746  12.252  72.917 1.00 26.01  ? 26  ASP D CG  1 
ATOM   5381 O OD1 . ASP D 2 26  ? 34.904  11.416  72.495 1.00 28.55  ? 26  ASP D OD1 1 
ATOM   5382 O OD2 . ASP D 2 26  ? 35.527  13.493  73.053 1.00 26.82  ? 26  ASP D OD2 1 
ATOM   5383 N N   . PHE D 2 27  ? 36.346  8.876   71.149 1.00 28.20  ? 27  PHE D N   1 
ATOM   5384 C CA  . PHE D 2 27  ? 35.900  8.609   69.760 1.00 33.07  ? 27  PHE D CA  1 
ATOM   5385 C C   . PHE D 2 27  ? 34.615  9.371   69.489 1.00 26.83  ? 27  PHE D C   1 
ATOM   5386 O O   . PHE D 2 27  ? 33.529  9.006   69.943 1.00 28.30  ? 27  PHE D O   1 
ATOM   5387 C CB  . PHE D 2 27  ? 35.683  7.121   69.492 1.00 34.31  ? 27  PHE D CB  1 
ATOM   5388 C CG  . PHE D 2 27  ? 36.957  6.314   69.435 1.00 40.52  ? 27  PHE D CG  1 
ATOM   5389 C CD1 . PHE D 2 27  ? 37.644  6.143   68.220 1.00 35.64  ? 27  PHE D CD1 1 
ATOM   5390 C CD2 . PHE D 2 27  ? 37.448  5.689   70.566 1.00 45.37  ? 27  PHE D CD2 1 
ATOM   5391 C CE1 . PHE D 2 27  ? 38.772  5.389   68.136 1.00 41.92  ? 27  PHE D CE1 1 
ATOM   5392 C CE2 . PHE D 2 27  ? 38.615  4.910   70.501 1.00 47.04  ? 27  PHE D CE2 1 
ATOM   5393 C CZ  . PHE D 2 27  ? 39.269  4.755   69.277 1.00 52.59  ? 27  PHE D CZ  1 
ATOM   5394 N N   . SER D 2 28  ? 34.772  10.415  68.703 1.00 27.34  ? 28  SER D N   1 
ATOM   5395 C CA  . SER D 2 28  ? 33.836  11.501  68.540 1.00 25.82  ? 28  SER D CA  1 
ATOM   5396 C C   . SER D 2 28  ? 33.484  11.739  67.037 1.00 26.57  ? 28  SER D C   1 
ATOM   5397 O O   . SER D 2 28  ? 34.111  11.187  66.116 1.00 28.89  ? 28  SER D O   1 
ATOM   5398 C CB  . SER D 2 28  ? 34.533  12.753  69.087 1.00 28.50  ? 28  SER D CB  1 
ATOM   5399 O OG  . SER D 2 28  ? 33.629  13.829  69.262 1.00 32.51  ? 28  SER D OG  1 
ATOM   5400 N N   . ALA D 2 29  ? 32.469  12.569  66.820 1.00 26.46  ? 29  ALA D N   1 
ATOM   5401 C CA  . ALA D 2 29  ? 32.056  13.001  65.507 1.00 31.06  ? 29  ALA D CA  1 
ATOM   5402 C C   . ALA D 2 29  ? 31.693  14.459  65.648 1.00 30.73  ? 29  ALA D C   1 
ATOM   5403 O O   . ALA D 2 29  ? 31.110  14.852  66.639 1.00 31.55  ? 29  ALA D O   1 
ATOM   5404 C CB  . ALA D 2 29  ? 30.860  12.195  65.062 1.00 27.93  ? 29  ALA D CB  1 
ATOM   5405 N N   . THR D 2 30  ? 32.042  15.253  64.652 1.00 31.27  ? 30  THR D N   1 
ATOM   5406 C CA  . THR D 2 30  ? 31.779  16.681  64.645 1.00 34.74  ? 30  THR D CA  1 
ATOM   5407 C C   . THR D 2 30  ? 30.275  17.100  64.580 1.00 37.78  ? 30  THR D C   1 
ATOM   5408 O O   . THR D 2 30  ? 29.895  18.176  65.083 1.00 35.29  ? 30  THR D O   1 
ATOM   5409 C CB  . THR D 2 30  ? 32.547  17.273  63.430 1.00 40.01  ? 30  THR D CB  1 
ATOM   5410 O OG1 . THR D 2 30  ? 33.932  17.427  63.781 1.00 44.16  ? 30  THR D OG1 1 
ATOM   5411 C CG2 . THR D 2 30  ? 32.015  18.540  63.050 1.00 42.39  ? 30  THR D CG2 1 
ATOM   5412 N N   . TRP D 2 31  ? 29.450  16.265  63.929 1.00 37.66  ? 31  TRP D N   1 
ATOM   5413 C CA  . TRP D 2 31  ? 28.006  16.485  63.732 1.00 40.66  ? 31  TRP D CA  1 
ATOM   5414 C C   . TRP D 2 31  ? 27.112  15.931  64.851 1.00 39.29  ? 31  TRP D C   1 
ATOM   5415 O O   . TRP D 2 31  ? 25.926  16.225  64.901 1.00 40.02  ? 31  TRP D O   1 
ATOM   5416 C CB  . TRP D 2 31  ? 27.578  15.859  62.397 1.00 40.48  ? 31  TRP D CB  1 
ATOM   5417 C CG  . TRP D 2 31  ? 28.002  14.416  62.304 1.00 37.99  ? 31  TRP D CG  1 
ATOM   5418 C CD1 . TRP D 2 31  ? 29.129  13.941  61.718 1.00 33.76  ? 31  TRP D CD1 1 
ATOM   5419 C CD2 . TRP D 2 31  ? 27.293  13.267  62.807 1.00 28.45  ? 31  TRP D CD2 1 
ATOM   5420 N NE1 . TRP D 2 31  ? 29.187  12.568  61.841 1.00 33.56  ? 31  TRP D NE1 1 
ATOM   5421 C CE2 . TRP D 2 31  ? 28.071  12.132  62.501 1.00 30.34  ? 31  TRP D CE2 1 
ATOM   5422 C CE3 . TRP D 2 31  ? 26.069  13.090  63.484 1.00 38.03  ? 31  TRP D CE3 1 
ATOM   5423 C CZ2 . TRP D 2 31  ? 27.671  10.830  62.846 1.00 32.82  ? 31  TRP D CZ2 1 
ATOM   5424 C CZ3 . TRP D 2 31  ? 25.679  11.787  63.855 1.00 29.06  ? 31  TRP D CZ3 1 
ATOM   5425 C CH2 . TRP D 2 31  ? 26.485  10.683  63.533 1.00 24.51  ? 31  TRP D CH2 1 
ATOM   5426 N N   . CYS D 2 32  ? 27.698  15.156  65.761 1.00 37.37  ? 32  CYS D N   1 
ATOM   5427 C CA  . CYS D 2 32  ? 26.964  14.392  66.795 1.00 35.98  ? 32  CYS D CA  1 
ATOM   5428 C C   . CYS D 2 32  ? 26.692  15.196  68.070 1.00 33.91  ? 32  CYS D C   1 
ATOM   5429 O O   . CYS D 2 32  ? 27.628  15.559  68.798 1.00 31.90  ? 32  CYS D O   1 
ATOM   5430 C CB  . CYS D 2 32  ? 27.777  13.144  67.163 1.00 35.50  ? 32  CYS D CB  1 
ATOM   5431 S SG  . CYS D 2 32  ? 27.047  12.161  68.525 1.00 37.04  ? 32  CYS D SG  1 
ATOM   5432 N N   . GLY D 2 33  ? 25.423  15.436  68.366 1.00 30.99  ? 33  GLY D N   1 
ATOM   5433 C CA  . GLY D 2 33  ? 25.002  16.226  69.525 1.00 30.08  ? 33  GLY D CA  1 
ATOM   5434 C C   . GLY D 2 33  ? 25.687  15.791  70.828 1.00 30.85  ? 33  GLY D C   1 
ATOM   5435 O O   . GLY D 2 33  ? 26.449  16.562  71.418 1.00 31.64  ? 33  GLY D O   1 
ATOM   5436 N N   . PRO D 2 34  ? 25.407  14.563  71.299 1.00 29.87  ? 34  PRO D N   1 
ATOM   5437 C CA  . PRO D 2 34  ? 26.050  14.084  72.539 1.00 28.50  ? 34  PRO D CA  1 
ATOM   5438 C C   . PRO D 2 34  ? 27.568  14.250  72.540 1.00 27.68  ? 34  PRO D C   1 
ATOM   5439 O O   . PRO D 2 34  ? 28.119  14.649  73.558 1.00 26.13  ? 34  PRO D O   1 
ATOM   5440 C CB  . PRO D 2 34  ? 25.649  12.610  72.601 1.00 27.28  ? 34  PRO D CB  1 
ATOM   5441 C CG  . PRO D 2 34  ? 24.344  12.565  71.882 1.00 28.76  ? 34  PRO D CG  1 
ATOM   5442 C CD  . PRO D 2 34  ? 24.457  13.572  70.750 1.00 31.63  ? 34  PRO D CD  1 
ATOM   5443 N N   . ALA D 2 35  ? 28.223  13.992  71.397 1.00 26.99  ? 35  ALA D N   1 
ATOM   5444 C CA  . ALA D 2 35  ? 29.684  14.116  71.274 1.00 23.70  ? 35  ALA D CA  1 
ATOM   5445 C C   . ALA D 2 35  ? 30.166  15.562  71.483 1.00 26.15  ? 35  ALA D C   1 
ATOM   5446 O O   . ALA D 2 35  ? 31.074  15.803  72.263 1.00 24.65  ? 35  ALA D O   1 
ATOM   5447 C CB  . ALA D 2 35  ? 30.175  13.543  69.939 1.00 20.69  ? 35  ALA D CB  1 
ATOM   5448 N N   . LYS D 2 36  ? 29.547  16.523  70.809 1.00 22.85  ? 36  LYS D N   1 
ATOM   5449 C CA  . LYS D 2 36  ? 29.842  17.948  71.045 1.00 28.68  ? 36  LYS D CA  1 
ATOM   5450 C C   . LYS D 2 36  ? 29.605  18.340  72.510 1.00 27.33  ? 36  LYS D C   1 
ATOM   5451 O O   . LYS D 2 36  ? 30.313  19.171  73.054 1.00 30.77  ? 36  LYS D O   1 
ATOM   5452 C CB  . LYS D 2 36  ? 28.926  18.866  70.219 1.00 29.02  ? 36  LYS D CB  1 
ATOM   5453 C CG  . LYS D 2 36  ? 29.005  18.766  68.728 1.00 37.79  ? 36  LYS D CG  1 
ATOM   5454 C CD  . LYS D 2 36  ? 27.812  19.611  68.101 1.00 38.35  ? 36  LYS D CD  1 
ATOM   5455 C CE  . LYS D 2 36  ? 27.348  19.016  66.773 1.00 45.89  ? 36  LYS D CE  1 
ATOM   5456 N NZ  . LYS D 2 36  ? 26.405  19.886  65.948 1.00 58.11  ? 36  LYS D NZ  1 
ATOM   5457 N N   . MET D 2 37  ? 28.554  17.812  73.117 1.00 28.50  ? 37  MET D N   1 
ATOM   5458 C CA  . MET D 2 37  ? 28.190  18.221  74.459 1.00 28.65  ? 37  MET D CA  1 
ATOM   5459 C C   . MET D 2 37  ? 29.314  17.845  75.451 1.00 28.79  ? 37  MET D C   1 
ATOM   5460 O O   . MET D 2 37  ? 29.654  18.627  76.364 1.00 28.99  ? 37  MET D O   1 
ATOM   5461 C CB  . MET D 2 37  ? 26.855  17.581  74.862 1.00 30.26  ? 37  MET D CB  1 
ATOM   5462 C CG  . MET D 2 37  ? 26.384  17.859  76.312 1.00 30.78  ? 37  MET D CG  1 
ATOM   5463 S SD  . MET D 2 37  ? 27.016  16.731  77.578 1.00 42.11  ? 37  MET D SD  1 
ATOM   5464 C CE  . MET D 2 37  ? 25.816  15.410  77.409 1.00 44.49  ? 37  MET D CE  1 
ATOM   5465 N N   . ILE D 2 38  ? 29.862  16.642  75.299 1.00 25.94  ? 38  ILE D N   1 
ATOM   5466 C CA  . ILE D 2 38  ? 30.790  16.146  76.320 1.00 24.72  ? 38  ILE D CA  1 
ATOM   5467 C C   . ILE D 2 38  ? 32.218  16.641  76.112 1.00 26.53  ? 38  ILE D C   1 
ATOM   5468 O O   . ILE D 2 38  ? 33.068  16.478  77.001 1.00 27.10  ? 38  ILE D O   1 
ATOM   5469 C CB  . ILE D 2 38  ? 30.689  14.609  76.520 1.00 26.68  ? 38  ILE D CB  1 
ATOM   5470 C CG1 . ILE D 2 38  ? 31.338  14.214  77.873 1.00 25.53  ? 38  ILE D CG1 1 
ATOM   5471 C CG2 . ILE D 2 38  ? 31.233  13.834  75.300 1.00 29.42  ? 38  ILE D CG2 1 
ATOM   5472 C CD1 . ILE D 2 38  ? 30.629  13.066  78.553 1.00 30.34  ? 38  ILE D CD1 1 
ATOM   5473 N N   . LYS D 2 39  ? 32.482  17.257  74.941 1.00 22.01  ? 39  LYS D N   1 
ATOM   5474 C CA  . LYS D 2 39  ? 33.844  17.653  74.563 1.00 23.00  ? 39  LYS D CA  1 
ATOM   5475 C C   . LYS D 2 39  ? 34.550  18.583  75.541 1.00 25.43  ? 39  LYS D C   1 
ATOM   5476 O O   . LYS D 2 39  ? 35.741  18.363  75.830 1.00 24.81  ? 39  LYS D O   1 
ATOM   5477 C CB  . LYS D 2 39  ? 33.856  18.362  73.185 1.00 22.58  ? 39  LYS D CB  1 
ATOM   5478 C CG  . LYS D 2 39  ? 34.254  17.506  72.048 1.00 34.91  ? 39  LYS D CG  1 
ATOM   5479 C CD  . LYS D 2 39  ? 34.447  18.387  70.802 1.00 35.10  ? 39  LYS D CD  1 
ATOM   5480 C CE  . LYS D 2 39  ? 35.879  18.820  70.663 1.00 36.28  ? 39  LYS D CE  1 
ATOM   5481 N NZ  . LYS D 2 39  ? 36.124  19.557  69.381 1.00 53.53  ? 39  LYS D NZ  1 
ATOM   5482 N N   . PRO D 2 40  ? 33.872  19.696  75.959 1.00 28.00  ? 40  PRO D N   1 
ATOM   5483 C CA  . PRO D 2 40  ? 34.428  20.647  76.967 1.00 26.38  ? 40  PRO D CA  1 
ATOM   5484 C C   . PRO D 2 40  ? 34.719  19.937  78.267 1.00 31.23  ? 40  PRO D C   1 
ATOM   5485 O O   . PRO D 2 40  ? 35.691  20.280  78.988 1.00 31.43  ? 40  PRO D O   1 
ATOM   5486 C CB  . PRO D 2 40  ? 33.271  21.628  77.216 1.00 27.25  ? 40  PRO D CB  1 
ATOM   5487 C CG  . PRO D 2 40  ? 32.404  21.531  76.039 1.00 30.44  ? 40  PRO D CG  1 
ATOM   5488 C CD  . PRO D 2 40  ? 32.535  20.125  75.504 1.00 24.84  ? 40  PRO D CD  1 
ATOM   5489 N N   . PHE D 2 41  ? 33.882  18.956  78.594 1.00 29.05  ? 41  PHE D N   1 
ATOM   5490 C CA  . PHE D 2 41  ? 34.065  18.268  79.871 1.00 29.69  ? 41  PHE D CA  1 
ATOM   5491 C C   . PHE D 2 41  ? 35.247  17.335  79.779 1.00 28.62  ? 41  PHE D C   1 
ATOM   5492 O O   . PHE D 2 41  ? 35.985  17.177  80.738 1.00 30.49  ? 41  PHE D O   1 
ATOM   5493 C CB  . PHE D 2 41  ? 32.819  17.477  80.294 1.00 33.76  ? 41  PHE D CB  1 
ATOM   5494 C CG  . PHE D 2 41  ? 31.632  18.342  80.619 1.00 41.53  ? 41  PHE D CG  1 
ATOM   5495 C CD1 . PHE D 2 41  ? 31.650  19.191  81.716 1.00 47.04  ? 41  PHE D CD1 1 
ATOM   5496 C CD2 . PHE D 2 41  ? 30.505  18.334  79.790 1.00 47.52  ? 41  PHE D CD2 1 
ATOM   5497 C CE1 . PHE D 2 41  ? 30.558  20.004  82.010 1.00 44.66  ? 41  PHE D CE1 1 
ATOM   5498 C CE2 . PHE D 2 41  ? 29.404  19.136  80.070 1.00 53.84  ? 41  PHE D CE2 1 
ATOM   5499 C CZ  . PHE D 2 41  ? 29.431  19.975  81.181 1.00 58.57  ? 41  PHE D CZ  1 
ATOM   5500 N N   . PHE D 2 42  ? 35.419  16.688  78.639 1.00 25.02  ? 42  PHE D N   1 
ATOM   5501 C CA  . PHE D 2 42  ? 36.608  15.827  78.422 1.00 26.74  ? 42  PHE D CA  1 
ATOM   5502 C C   . PHE D 2 42  ? 37.859  16.679  78.491 1.00 28.25  ? 42  PHE D C   1 
ATOM   5503 O O   . PHE D 2 42  ? 38.882  16.266  79.012 1.00 29.79  ? 42  PHE D O   1 
ATOM   5504 C CB  . PHE D 2 42  ? 36.460  15.210  77.014 1.00 28.36  ? 42  PHE D CB  1 
ATOM   5505 C CG  . PHE D 2 42  ? 37.429  14.119  76.715 1.00 20.77  ? 42  PHE D CG  1 
ATOM   5506 C CD1 . PHE D 2 42  ? 37.356  12.897  77.366 1.00 26.77  ? 42  PHE D CD1 1 
ATOM   5507 C CD2 . PHE D 2 42  ? 38.431  14.315  75.778 1.00 30.20  ? 42  PHE D CD2 1 
ATOM   5508 C CE1 . PHE D 2 42  ? 38.269  11.894  77.065 1.00 25.67  ? 42  PHE D CE1 1 
ATOM   5509 C CE2 . PHE D 2 42  ? 39.342  13.317  75.480 1.00 19.73  ? 42  PHE D CE2 1 
ATOM   5510 C CZ  . PHE D 2 42  ? 39.247  12.099  76.113 1.00 29.35  ? 42  PHE D CZ  1 
ATOM   5511 N N   . HIS D 2 43  ? 37.780  17.910  77.969 1.00 26.82  ? 43  HIS D N   1 
ATOM   5512 C CA  . HIS D 2 43  ? 38.886  18.848  78.095 1.00 26.75  ? 43  HIS D CA  1 
ATOM   5513 C C   . HIS D 2 43  ? 39.205  19.312  79.525 1.00 31.74  ? 43  HIS D C   1 
ATOM   5514 O O   . HIS D 2 43  ? 40.365  19.354  79.950 1.00 30.54  ? 43  HIS D O   1 
ATOM   5515 C CB  . HIS D 2 43  ? 38.667  20.079  77.234 1.00 26.32  ? 43  HIS D CB  1 
ATOM   5516 C CG  . HIS D 2 43  ? 39.723  21.110  77.448 1.00 40.77  ? 43  HIS D CG  1 
ATOM   5517 N ND1 . HIS D 2 43  ? 40.895  21.126  76.728 1.00 41.24  ? 43  HIS D ND1 1 
ATOM   5518 C CD2 . HIS D 2 43  ? 39.824  22.105  78.362 1.00 48.62  ? 43  HIS D CD2 1 
ATOM   5519 C CE1 . HIS D 2 43  ? 41.660  22.111  77.164 1.00 50.58  ? 43  HIS D CE1 1 
ATOM   5520 N NE2 . HIS D 2 43  ? 41.037  22.714  78.164 1.00 50.33  ? 43  HIS D NE2 1 
ATOM   5521 N N   . SER D 2 44  ? 38.176  19.735  80.240 1.00 30.62  ? 44  SER D N   1 
ATOM   5522 C CA  . SER D 2 44  ? 38.329  20.128  81.615 1.00 35.19  ? 44  SER D CA  1 
ATOM   5523 C C   . SER D 2 44  ? 38.965  19.014  82.418 1.00 39.10  ? 44  SER D C   1 
ATOM   5524 O O   . SER D 2 44  ? 39.792  19.266  83.302 1.00 45.61  ? 44  SER D O   1 
ATOM   5525 C CB  . SER D 2 44  ? 36.951  20.470  82.164 1.00 36.11  ? 44  SER D CB  1 
ATOM   5526 O OG  . SER D 2 44  ? 36.481  21.589  81.454 1.00 37.53  ? 44  SER D OG  1 
ATOM   5527 N N   . LEU D 2 45  ? 38.575  17.772  82.129 1.00 34.73  ? 45  LEU D N   1 
ATOM   5528 C CA  . LEU D 2 45  ? 39.146  16.637  82.861 1.00 35.68  ? 45  LEU D CA  1 
ATOM   5529 C C   . LEU D 2 45  ? 40.615  16.424  82.514 1.00 38.40  ? 45  LEU D C   1 
ATOM   5530 O O   . LEU D 2 45  ? 41.431  16.068  83.384 1.00 43.78  ? 45  LEU D O   1 
ATOM   5531 C CB  . LEU D 2 45  ? 38.365  15.367  82.562 1.00 37.62  ? 45  LEU D CB  1 
ATOM   5532 C CG  . LEU D 2 45  ? 37.012  15.039  83.222 1.00 43.03  ? 45  LEU D CG  1 
ATOM   5533 C CD1 . LEU D 2 45  ? 36.476  13.788  82.567 1.00 29.13  ? 45  LEU D CD1 1 
ATOM   5534 C CD2 . LEU D 2 45  ? 37.140  14.815  84.708 1.00 44.01  ? 45  LEU D CD2 1 
ATOM   5535 N N   . SER D 2 46  ? 40.968  16.661  81.254 1.00 37.05  ? 46  SER D N   1 
ATOM   5536 C CA  . SER D 2 46  ? 42.363  16.543  80.801 1.00 39.73  ? 46  SER D CA  1 
ATOM   5537 C C   . SER D 2 46  ? 43.280  17.541  81.502 1.00 42.13  ? 46  SER D C   1 
ATOM   5538 O O   . SER D 2 46  ? 44.488  17.290  81.657 1.00 46.21  ? 46  SER D O   1 
ATOM   5539 C CB  . SER D 2 46  ? 42.451  16.726  79.275 1.00 35.77  ? 46  SER D CB  1 
ATOM   5540 O OG  . SER D 2 46  ? 42.528  18.086  78.928 1.00 35.71  ? 46  SER D OG  1 
ATOM   5541 N N   . GLU D 2 47  ? 42.706  18.674  81.901 1.00 40.70  ? 47  GLU D N   1 
ATOM   5542 C CA  . GLU D 2 47  ? 43.424  19.690  82.697 1.00 47.30  ? 47  GLU D CA  1 
ATOM   5543 C C   . GLU D 2 47  ? 43.507  19.356  84.190 1.00 51.27  ? 47  GLU D C   1 
ATOM   5544 O O   . GLU D 2 47  ? 44.503  19.683  84.863 1.00 53.21  ? 47  GLU D O   1 
ATOM   5545 C CB  . GLU D 2 47  ? 42.770  21.054  82.499 1.00 48.68  ? 47  GLU D CB  1 
ATOM   5546 C CG  . GLU D 2 47  ? 43.025  21.679  81.112 1.00 52.95  ? 47  GLU D CG  1 
ATOM   5547 C CD  . GLU D 2 47  ? 44.509  21.929  80.829 1.00 62.19  ? 47  GLU D CD  1 
ATOM   5548 O OE1 . GLU D 2 47  ? 45.241  22.328  81.762 1.00 71.54  ? 47  GLU D OE1 1 
ATOM   5549 O OE2 . GLU D 2 47  ? 44.957  21.721  79.678 1.00 60.99  ? 47  GLU D OE2 1 
ATOM   5550 N N   . LYS D 2 48  ? 42.473  18.705  84.726 1.00 50.57  ? 48  LYS D N   1 
ATOM   5551 C CA  . LYS D 2 48  ? 42.546  18.255  86.114 1.00 56.03  ? 48  LYS D CA  1 
ATOM   5552 C C   . LYS D 2 48  ? 43.475  17.058  86.200 1.00 57.59  ? 48  LYS D C   1 
ATOM   5553 O O   . LYS D 2 48  ? 44.404  17.075  86.964 1.00 61.79  ? 48  LYS D O   1 
ATOM   5554 C CB  . LYS D 2 48  ? 41.165  17.901  86.683 1.00 57.59  ? 48  LYS D CB  1 
ATOM   5555 C CG  . LYS D 2 48  ? 41.194  17.413  88.176 1.00 56.60  ? 48  LYS D CG  1 
ATOM   5556 C CD  . LYS D 2 48  ? 39.827  16.826  88.536 1.00 59.40  ? 48  LYS D CD  1 
ATOM   5557 C CE  . LYS D 2 48  ? 39.738  16.408  90.026 1.00 69.37  ? 48  LYS D CE  1 
ATOM   5558 N NZ  . LYS D 2 48  ? 39.579  17.575  90.953 1.00 67.96  ? 48  LYS D NZ  1 
ATOM   5559 N N   . TYR D 2 49  ? 43.218  16.017  85.415 1.00 52.52  ? 49  TYR D N   1 
ATOM   5560 C CA  . TYR D 2 49  ? 44.006  14.790  85.480 1.00 57.78  ? 49  TYR D CA  1 
ATOM   5561 C C   . TYR D 2 49  ? 45.274  14.824  84.650 1.00 60.98  ? 49  TYR D C   1 
ATOM   5562 O O   . TYR D 2 49  ? 45.408  14.063  83.707 1.00 61.60  ? 49  TYR D O   1 
ATOM   5563 C CB  . TYR D 2 49  ? 43.146  13.554  85.157 1.00 56.08  ? 49  TYR D CB  1 
ATOM   5564 C CG  . TYR D 2 49  ? 42.040  13.379  86.167 1.00 57.20  ? 49  TYR D CG  1 
ATOM   5565 C CD1 . TYR D 2 49  ? 42.283  12.757  87.378 1.00 67.69  ? 49  TYR D CD1 1 
ATOM   5566 C CD2 . TYR D 2 49  ? 40.757  13.873  85.927 1.00 59.13  ? 49  TYR D CD2 1 
ATOM   5567 C CE1 . TYR D 2 49  ? 41.281  12.614  88.327 1.00 71.87  ? 49  TYR D CE1 1 
ATOM   5568 C CE2 . TYR D 2 49  ? 39.741  13.740  86.876 1.00 58.72  ? 49  TYR D CE2 1 
ATOM   5569 C CZ  . TYR D 2 49  ? 40.017  13.104  88.081 1.00 66.83  ? 49  TYR D CZ  1 
ATOM   5570 O OH  . TYR D 2 49  ? 39.034  12.969  89.044 1.00 60.65  ? 49  TYR D OH  1 
ATOM   5571 N N   . SER D 2 50  ? 46.224  15.676  85.062 1.00 66.30  ? 50  SER D N   1 
ATOM   5572 C CA  . SER D 2 50  ? 47.459  15.968  84.303 1.00 68.28  ? 50  SER D CA  1 
ATOM   5573 C C   . SER D 2 50  ? 48.370  14.753  84.091 1.00 73.83  ? 50  SER D C   1 
ATOM   5574 O O   . SER D 2 50  ? 49.246  14.768  83.231 1.00 74.96  ? 50  SER D O   1 
ATOM   5575 C CB  . SER D 2 50  ? 48.242  17.112  84.979 1.00 73.24  ? 50  SER D CB  1 
ATOM   5576 O OG  . SER D 2 50  ? 48.620  16.803  86.320 1.00 78.17  ? 50  SER D OG  1 
ATOM   5577 N N   . ASN D 2 51  ? 48.144  13.710  84.890 1.00 77.44  ? 51  ASN D N   1 
ATOM   5578 C CA  . ASN D 2 51  ? 48.885  12.453  84.858 1.00 84.21  ? 51  ASN D CA  1 
ATOM   5579 C C   . ASN D 2 51  ? 48.384  11.421  83.829 1.00 82.35  ? 51  ASN D C   1 
ATOM   5580 O O   . ASN D 2 51  ? 49.037  10.389  83.595 1.00 87.78  ? 51  ASN D O   1 
ATOM   5581 C CB  . ASN D 2 51  ? 48.795  11.835  86.251 1.00 92.77  ? 51  ASN D CB  1 
ATOM   5582 C CG  . ASN D 2 51  ? 47.357  11.838  86.805 1.00 95.21  ? 51  ASN D CG  1 
ATOM   5583 O OD1 . ASN D 2 51  ? 46.689  12.879  86.845 1.00 86.57  ? 51  ASN D OD1 1 
ATOM   5584 N ND2 . ASN D 2 51  ? 46.890  10.669  87.241 1.00 105.16 ? 51  ASN D ND2 1 
ATOM   5585 N N   . VAL D 2 52  ? 47.228  11.712  83.228 1.00 73.64  ? 52  VAL D N   1 
ATOM   5586 C CA  . VAL D 2 52  ? 46.563  10.842  82.267 1.00 68.53  ? 52  VAL D CA  1 
ATOM   5587 C C   . VAL D 2 52  ? 46.606  11.496  80.888 1.00 64.84  ? 52  VAL D C   1 
ATOM   5588 O O   . VAL D 2 52  ? 46.467  12.716  80.775 1.00 63.19  ? 52  VAL D O   1 
ATOM   5589 C CB  . VAL D 2 52  ? 45.098  10.639  82.663 1.00 65.26  ? 52  VAL D CB  1 
ATOM   5590 C CG1 . VAL D 2 52  ? 44.343  9.825   81.599 1.00 60.93  ? 52  VAL D CG1 1 
ATOM   5591 C CG2 . VAL D 2 52  ? 44.994  9.963   83.998 1.00 64.19  ? 52  VAL D CG2 1 
ATOM   5592 N N   . ILE D 2 53  ? 46.811  10.689  79.848 1.00 62.44  ? 53  ILE D N   1 
ATOM   5593 C CA  . ILE D 2 53  ? 46.898  11.199  78.482 1.00 58.37  ? 53  ILE D CA  1 
ATOM   5594 C C   . ILE D 2 53  ? 45.494  11.179  77.834 1.00 51.71  ? 53  ILE D C   1 
ATOM   5595 O O   . ILE D 2 53  ? 44.812  10.149  77.837 1.00 50.56  ? 53  ILE D O   1 
ATOM   5596 C CB  . ILE D 2 53  ? 47.881  10.365  77.605 1.00 63.06  ? 53  ILE D CB  1 
ATOM   5597 C CG1 . ILE D 2 53  ? 49.316  10.312  78.199 1.00 69.69  ? 53  ILE D CG1 1 
ATOM   5598 C CG2 . ILE D 2 53  ? 47.787  10.769  76.080 1.00 57.78  ? 53  ILE D CG2 1 
ATOM   5599 C CD1 . ILE D 2 53  ? 50.206  11.505  77.874 1.00 81.14  ? 53  ILE D CD1 1 
ATOM   5600 N N   . PHE D 2 54  ? 45.084  12.316  77.265 1.00 48.63  ? 54  PHE D N   1 
ATOM   5601 C CA  . PHE D 2 54  ? 43.754  12.445  76.652 1.00 39.92  ? 54  PHE D CA  1 
ATOM   5602 C C   . PHE D 2 54  ? 43.848  12.637  75.144 1.00 42.65  ? 54  PHE D C   1 
ATOM   5603 O O   . PHE D 2 54  ? 44.492  13.580  74.662 1.00 41.14  ? 54  PHE D O   1 
ATOM   5604 C CB  . PHE D 2 54  ? 42.965  13.613  77.284 1.00 35.34  ? 54  PHE D CB  1 
ATOM   5605 C CG  . PHE D 2 54  ? 42.496  13.353  78.701 1.00 38.01  ? 54  PHE D CG  1 
ATOM   5606 C CD1 . PHE D 2 54  ? 43.387  13.415  79.782 1.00 47.39  ? 54  PHE D CD1 1 
ATOM   5607 C CD2 . PHE D 2 54  ? 41.170  13.072  78.966 1.00 47.00  ? 54  PHE D CD2 1 
ATOM   5608 C CE1 . PHE D 2 54  ? 42.950  13.173  81.090 1.00 47.60  ? 54  PHE D CE1 1 
ATOM   5609 C CE2 . PHE D 2 54  ? 40.726  12.840  80.271 1.00 49.17  ? 54  PHE D CE2 1 
ATOM   5610 C CZ  . PHE D 2 54  ? 41.618  12.886  81.335 1.00 45.74  ? 54  PHE D CZ  1 
ATOM   5611 N N   . LEU D 2 55  ? 43.196  11.746  74.398 1.00 39.30  ? 55  LEU D N   1 
ATOM   5612 C CA  . LEU D 2 55  ? 43.222  11.810  72.943 1.00 39.33  ? 55  LEU D CA  1 
ATOM   5613 C C   . LEU D 2 55  ? 41.821  11.893  72.370 1.00 35.07  ? 55  LEU D C   1 
ATOM   5614 O O   . LEU D 2 55  ? 40.882  11.424  72.986 1.00 32.49  ? 55  LEU D O   1 
ATOM   5615 C CB  . LEU D 2 55  ? 43.914  10.576  72.370 1.00 45.58  ? 55  LEU D CB  1 
ATOM   5616 C CG  . LEU D 2 55  ? 45.308  10.162  72.840 1.00 49.56  ? 55  LEU D CG  1 
ATOM   5617 C CD1 . LEU D 2 55  ? 45.680  8.855   72.193 1.00 50.81  ? 55  LEU D CD1 1 
ATOM   5618 C CD2 . LEU D 2 55  ? 46.314  11.256  72.496 1.00 48.66  ? 55  LEU D CD2 1 
ATOM   5619 N N   . GLU D 2 56  ? 41.688  12.503  71.198 1.00 34.34  ? 56  GLU D N   1 
ATOM   5620 C CA  . GLU D 2 56  ? 40.415  12.440  70.454 1.00 36.04  ? 56  GLU D CA  1 
ATOM   5621 C C   . GLU D 2 56  ? 40.623  11.914  69.028 1.00 37.21  ? 56  GLU D C   1 
ATOM   5622 O O   . GLU D 2 56  ? 41.536  12.349  68.323 1.00 40.76  ? 56  GLU D O   1 
ATOM   5623 C CB  . GLU D 2 56  ? 39.689  13.782  70.377 1.00 35.30  ? 56  GLU D CB  1 
ATOM   5624 C CG  . GLU D 2 56  ? 38.318  13.614  69.644 1.00 28.77  ? 56  GLU D CG  1 
ATOM   5625 C CD  . GLU D 2 56  ? 37.712  14.922  69.204 1.00 45.26  ? 56  GLU D CD  1 
ATOM   5626 O OE1 . GLU D 2 56  ? 37.512  15.795  70.084 1.00 39.18  ? 56  GLU D OE1 1 
ATOM   5627 O OE2 . GLU D 2 56  ? 37.435  15.067  67.973 1.00 40.15  ? 56  GLU D OE2 1 
ATOM   5628 N N   . VAL D 2 57  ? 39.772  10.973  68.640 1.00 36.18  ? 57  VAL D N   1 
ATOM   5629 C CA  . VAL D 2 57  ? 39.714  10.482  67.260 1.00 36.89  ? 57  VAL D CA  1 
ATOM   5630 C C   . VAL D 2 57  ? 38.364  10.802  66.666 1.00 34.72  ? 57  VAL D C   1 
ATOM   5631 O O   . VAL D 2 57  ? 37.337  10.400  67.203 1.00 30.26  ? 57  VAL D O   1 
ATOM   5632 C CB  . VAL D 2 57  ? 39.984  8.972   67.209 1.00 40.08  ? 57  VAL D CB  1 
ATOM   5633 C CG1 . VAL D 2 57  ? 39.960  8.465   65.775 1.00 44.40  ? 57  VAL D CG1 1 
ATOM   5634 C CG2 . VAL D 2 57  ? 41.342  8.672   67.869 1.00 36.74  ? 57  VAL D CG2 1 
ATOM   5635 N N   . ASP D 2 58  ? 38.367  11.538  65.557 1.00 35.09  ? 58  ASP D N   1 
ATOM   5636 C CA  . ASP D 2 58  ? 37.134  11.823  64.849 1.00 36.36  ? 58  ASP D CA  1 
ATOM   5637 C C   . ASP D 2 58  ? 36.872  10.665  63.920 1.00 35.84  ? 58  ASP D C   1 
ATOM   5638 O O   . ASP D 2 58  ? 37.675  10.367  63.019 1.00 41.04  ? 58  ASP D O   1 
ATOM   5639 C CB  . ASP D 2 58  ? 37.232  13.136  64.081 1.00 37.58  ? 58  ASP D CB  1 
ATOM   5640 C CG  . ASP D 2 58  ? 35.936  13.497  63.398 1.00 40.20  ? 58  ASP D CG  1 
ATOM   5641 O OD1 . ASP D 2 58  ? 35.506  12.754  62.501 1.00 42.02  ? 58  ASP D OD1 1 
ATOM   5642 O OD2 . ASP D 2 58  ? 35.344  14.522  63.763 1.00 34.36  ? 58  ASP D OD2 1 
ATOM   5643 N N   . VAL D 2 59  ? 35.761  9.990   64.164 1.00 33.68  ? 59  VAL D N   1 
ATOM   5644 C CA  . VAL D 2 59  ? 35.507  8.701   63.514 1.00 37.95  ? 59  VAL D CA  1 
ATOM   5645 C C   . VAL D 2 59  ? 35.215  8.871   62.015 1.00 40.42  ? 59  VAL D C   1 
ATOM   5646 O O   . VAL D 2 59  ? 35.247  7.881   61.259 1.00 45.07  ? 59  VAL D O   1 
ATOM   5647 C CB  . VAL D 2 59  ? 34.311  7.947   64.164 1.00 34.94  ? 59  VAL D CB  1 
ATOM   5648 C CG1 . VAL D 2 59  ? 34.495  7.811   65.650 1.00 34.19  ? 59  VAL D CG1 1 
ATOM   5649 C CG2 . VAL D 2 59  ? 32.980  8.640   63.836 1.00 39.68  ? 59  VAL D CG2 1 
ATOM   5650 N N   . ASP D 2 60  ? 34.917  10.108  61.598 1.00 38.36  ? 60  ASP D N   1 
ATOM   5651 C CA  . ASP D 2 60  ? 34.674  10.387  60.176 1.00 42.54  ? 60  ASP D CA  1 
ATOM   5652 C C   . ASP D 2 60  ? 35.978  10.592  59.442 1.00 46.83  ? 60  ASP D C   1 
ATOM   5653 O O   . ASP D 2 60  ? 36.126  10.153  58.312 1.00 51.98  ? 60  ASP D O   1 
ATOM   5654 C CB  . ASP D 2 60  ? 33.736  11.580  59.975 1.00 42.16  ? 60  ASP D CB  1 
ATOM   5655 C CG  . ASP D 2 60  ? 32.331  11.287  60.475 1.00 47.68  ? 60  ASP D CG  1 
ATOM   5656 O OD1 . ASP D 2 60  ? 31.772  12.082  61.255 1.00 51.13  ? 60  ASP D OD1 1 
ATOM   5657 O OD2 . ASP D 2 60  ? 31.804  10.230  60.116 1.00 46.48  ? 60  ASP D OD2 1 
ATOM   5658 N N   . ASP D 2 61  ? 36.924  11.256  60.092 1.00 46.56  ? 61  ASP D N   1 
ATOM   5659 C CA  . ASP D 2 61  ? 38.221  11.520  59.505 1.00 52.19  ? 61  ASP D CA  1 
ATOM   5660 C C   . ASP D 2 61  ? 39.108  10.281  59.533 1.00 58.13  ? 61  ASP D C   1 
ATOM   5661 O O   . ASP D 2 61  ? 39.838  10.012  58.558 1.00 62.75  ? 61  ASP D O   1 
ATOM   5662 C CB  . ASP D 2 61  ? 38.933  12.658  60.230 1.00 51.34  ? 61  ASP D CB  1 
ATOM   5663 C CG  . ASP D 2 61  ? 38.171  13.975  60.182 1.00 52.97  ? 61  ASP D CG  1 
ATOM   5664 O OD1 . ASP D 2 61  ? 37.610  14.340  59.126 1.00 58.61  ? 61  ASP D OD1 1 
ATOM   5665 O OD2 . ASP D 2 61  ? 38.199  14.686  61.209 1.00 50.13  ? 61  ASP D OD2 1 
ATOM   5666 N N   . CYS D 2 62  ? 39.049  9.544   60.643 1.00 55.90  ? 62  CYS D N   1 
ATOM   5667 C CA  . CYS D 2 62  ? 39.869  8.350   60.837 1.00 61.24  ? 62  CYS D CA  1 
ATOM   5668 C C   . CYS D 2 62  ? 39.014  7.099   60.946 1.00 59.94  ? 62  CYS D C   1 
ATOM   5669 O O   . CYS D 2 62  ? 38.967  6.458   61.991 1.00 58.54  ? 62  CYS D O   1 
ATOM   5670 C CB  . CYS D 2 62  ? 40.729  8.505   62.081 1.00 60.54  ? 62  CYS D CB  1 
ATOM   5671 S SG  . CYS D 2 62  ? 41.784  9.941   62.015 1.00 70.44  ? 62  CYS D SG  1 
ATOM   5672 N N   . GLN D 2 63  ? 38.339  6.745   59.860 1.00 63.84  ? 63  GLN D N   1 
ATOM   5673 C CA  . GLN D 2 63  ? 37.417  5.598   59.876 1.00 67.63  ? 63  GLN D CA  1 
ATOM   5674 C C   . GLN D 2 63  ? 38.127  4.281   60.215 1.00 69.88  ? 63  GLN D C   1 
ATOM   5675 O O   . GLN D 2 63  ? 37.544  3.415   60.861 1.00 69.25  ? 63  GLN D O   1 
ATOM   5676 C CB  . GLN D 2 63  ? 36.637  5.468   58.554 1.00 72.13  ? 63  GLN D CB  1 
ATOM   5677 C CG  . GLN D 2 63  ? 36.006  6.753   58.035 1.00 77.19  ? 63  GLN D CG  1 
ATOM   5678 C CD  . GLN D 2 63  ? 35.515  6.653   56.577 1.00 90.55  ? 63  GLN D CD  1 
ATOM   5679 O OE1 . GLN D 2 63  ? 35.398  7.670   55.879 1.00 94.10  ? 63  GLN D OE1 1 
ATOM   5680 N NE2 . GLN D 2 63  ? 35.231  5.430   56.118 1.00 97.68  ? 63  GLN D NE2 1 
ATOM   5681 N N   . ASP D 2 64  ? 39.381  4.143   59.769 1.00 75.01  ? 64  ASP D N   1 
ATOM   5682 C CA  . ASP D 2 64  ? 40.181  2.927   59.993 1.00 80.16  ? 64  ASP D CA  1 
ATOM   5683 C C   . ASP D 2 64  ? 40.636  2.729   61.452 1.00 77.63  ? 64  ASP D C   1 
ATOM   5684 O O   . ASP D 2 64  ? 40.646  1.602   61.955 1.00 82.85  ? 64  ASP D O   1 
ATOM   5685 C CB  . ASP D 2 64  ? 41.378  2.864   59.027 1.00 86.91  ? 64  ASP D CB  1 
ATOM   5686 C CG  . ASP D 2 64  ? 42.345  4.040   59.189 1.00 90.92  ? 64  ASP D CG  1 
ATOM   5687 O OD1 . ASP D 2 64  ? 41.928  5.132   59.643 1.00 90.98  ? 64  ASP D OD1 1 
ATOM   5688 O OD2 . ASP D 2 64  ? 43.540  3.870   58.843 1.00 107.19 ? 64  ASP D OD2 1 
ATOM   5689 N N   . VAL D 2 65  ? 41.001  3.818   62.124 1.00 71.39  ? 65  VAL D N   1 
ATOM   5690 C CA  . VAL D 2 65  ? 41.302  3.776   63.558 1.00 68.55  ? 65  VAL D CA  1 
ATOM   5691 C C   . VAL D 2 65  ? 40.019  3.349   64.269 1.00 64.13  ? 65  VAL D C   1 
ATOM   5692 O O   . VAL D 2 65  ? 40.026  2.384   65.044 1.00 66.25  ? 65  VAL D O   1 
ATOM   5693 C CB  . VAL D 2 65  ? 41.854  5.139   64.102 1.00 65.86  ? 65  VAL D CB  1 
ATOM   5694 C CG1 . VAL D 2 65  ? 42.094  5.093   65.607 1.00 55.23  ? 65  VAL D CG1 1 
ATOM   5695 C CG2 . VAL D 2 65  ? 43.135  5.505   63.400 1.00 71.30  ? 65  VAL D CG2 1 
ATOM   5696 N N   . ALA D 2 66  ? 38.912  4.029   63.955 1.00 58.12  ? 66  ALA D N   1 
ATOM   5697 C CA  . ALA D 2 66  ? 37.608  3.691   64.527 1.00 51.77  ? 66  ALA D CA  1 
ATOM   5698 C C   . ALA D 2 66  ? 37.185  2.238   64.319 1.00 55.76  ? 66  ALA D C   1 
ATOM   5699 O O   . ALA D 2 66  ? 36.644  1.613   65.234 1.00 54.68  ? 66  ALA D O   1 
ATOM   5700 C CB  . ALA D 2 66  ? 36.559  4.617   64.006 1.00 47.81  ? 66  ALA D CB  1 
ATOM   5701 N N   . SER D 2 67  ? 37.419  1.697   63.123 1.00 59.47  ? 67  SER D N   1 
ATOM   5702 C CA  . SER D 2 67  ? 36.989  0.335   62.835 1.00 65.10  ? 67  SER D CA  1 
ATOM   5703 C C   . SER D 2 67  ? 37.903  -0.713  63.465 1.00 69.24  ? 67  SER D C   1 
ATOM   5704 O O   . SER D 2 67  ? 37.442  -1.780  63.880 1.00 70.32  ? 67  SER D O   1 
ATOM   5705 C CB  . SER D 2 67  ? 36.775  0.102   61.326 1.00 69.83  ? 67  SER D CB  1 
ATOM   5706 O OG  . SER D 2 67  ? 37.899  0.493   60.563 1.00 79.81  ? 67  SER D OG  1 
ATOM   5707 N N   . GLU D 2 68  ? 39.194  -0.410  63.541 1.00 73.95  ? 68  GLU D N   1 
ATOM   5708 C CA  . GLU D 2 68  ? 40.130  -1.295  64.238 1.00 81.25  ? 68  GLU D CA  1 
ATOM   5709 C C   . GLU D 2 68  ? 39.866  -1.301  65.745 1.00 77.96  ? 68  GLU D C   1 
ATOM   5710 O O   . GLU D 2 68  ? 39.976  -2.329  66.408 1.00 83.21  ? 68  GLU D O   1 
ATOM   5711 C CB  . GLU D 2 68  ? 41.572  -0.911  63.934 1.00 85.18  ? 68  GLU D CB  1 
ATOM   5712 C CG  . GLU D 2 68  ? 41.990  -1.311  62.533 1.00 98.18  ? 68  GLU D CG  1 
ATOM   5713 C CD  . GLU D 2 68  ? 43.436  -0.978  62.216 1.00 110.69 ? 68  GLU D CD  1 
ATOM   5714 O OE1 . GLU D 2 68  ? 43.832  -1.167  61.044 1.00 114.54 ? 68  GLU D OE1 1 
ATOM   5715 O OE2 . GLU D 2 68  ? 44.175  -0.530  63.128 1.00 111.61 ? 68  GLU D OE2 1 
ATOM   5716 N N   . CYS D 2 69  ? 39.483  -0.147  66.275 1.00 72.94  ? 69  CYS D N   1 
ATOM   5717 C CA  . CYS D 2 69  ? 39.069  -0.062  67.666 1.00 67.88  ? 69  CYS D CA  1 
ATOM   5718 C C   . CYS D 2 69  ? 37.617  -0.536  67.847 1.00 67.14  ? 69  CYS D C   1 
ATOM   5719 O O   . CYS D 2 69  ? 37.136  -0.659  68.974 1.00 68.15  ? 69  CYS D O   1 
ATOM   5720 C CB  . CYS D 2 69  ? 39.317  1.349   68.192 1.00 62.57  ? 69  CYS D CB  1 
ATOM   5721 S SG  . CYS D 2 69  ? 41.095  1.799   68.095 1.00 62.10  ? 69  CYS D SG  1 
ATOM   5722 N N   . GLU D 2 70  ? 36.939  -0.816  66.730 1.00 65.90  ? 70  GLU D N   1 
ATOM   5723 C CA  . GLU D 2 70  ? 35.578  -1.353  66.727 1.00 66.19  ? 70  GLU D CA  1 
ATOM   5724 C C   . GLU D 2 70  ? 34.573  -0.424  67.402 1.00 60.20  ? 70  GLU D C   1 
ATOM   5725 O O   . GLU D 2 70  ? 33.725  -0.836  68.211 1.00 61.16  ? 70  GLU D O   1 
ATOM   5726 C CB  . GLU D 2 70  ? 35.524  -2.751  67.343 1.00 73.82  ? 70  GLU D CB  1 
ATOM   5727 C CG  . GLU D 2 70  ? 36.157  -3.845  66.500 1.00 81.06  ? 70  GLU D CG  1 
ATOM   5728 C CD  . GLU D 2 70  ? 36.127  -5.184  67.207 1.00 90.62  ? 70  GLU D CD  1 
ATOM   5729 O OE1 . GLU D 2 70  ? 36.537  -5.246  68.390 1.00 95.76  ? 70  GLU D OE1 1 
ATOM   5730 O OE2 . GLU D 2 70  ? 35.695  -6.172  66.583 1.00 100.49 ? 70  GLU D OE2 1 
ATOM   5731 N N   . VAL D 2 71  ? 34.655  0.839   67.035 1.00 53.47  ? 71  VAL D N   1 
ATOM   5732 C CA  . VAL D 2 71  ? 33.754  1.825   67.571 1.00 48.31  ? 71  VAL D CA  1 
ATOM   5733 C C   . VAL D 2 71  ? 32.479  1.836   66.718 1.00 48.68  ? 71  VAL D C   1 
ATOM   5734 O O   . VAL D 2 71  ? 32.540  1.779   65.491 1.00 51.28  ? 71  VAL D O   1 
ATOM   5735 C CB  . VAL D 2 71  ? 34.484  3.167   67.664 1.00 42.51  ? 71  VAL D CB  1 
ATOM   5736 C CG1 . VAL D 2 71  ? 33.540  4.293   67.966 1.00 41.28  ? 71  VAL D CG1 1 
ATOM   5737 C CG2 . VAL D 2 71  ? 35.497  3.052   68.775 1.00 44.78  ? 71  VAL D CG2 1 
ATOM   5738 N N   . LYS D 2 72  ? 31.328  1.885   67.370 1.00 48.09  ? 72  LYS D N   1 
ATOM   5739 C CA  . LYS D 2 72  ? 30.063  1.695   66.675 1.00 51.07  ? 72  LYS D CA  1 
ATOM   5740 C C   . LYS D 2 72  ? 29.088  2.836   66.919 1.00 47.02  ? 72  LYS D C   1 
ATOM   5741 O O   . LYS D 2 72  ? 28.075  2.980   66.233 1.00 44.21  ? 72  LYS D O   1 
ATOM   5742 C CB  . LYS D 2 72  ? 29.453  0.340   67.052 1.00 58.03  ? 72  LYS D CB  1 
ATOM   5743 C CG  . LYS D 2 72  ? 30.068  -0.830  66.272 1.00 63.59  ? 72  LYS D CG  1 
ATOM   5744 C CD  . LYS D 2 72  ? 30.154  -2.075  67.118 1.00 71.00  ? 72  LYS D CD  1 
ATOM   5745 C CE  . LYS D 2 72  ? 31.270  -2.984  66.608 1.00 82.72  ? 72  LYS D CE  1 
ATOM   5746 N NZ  . LYS D 2 72  ? 31.467  -4.187  67.469 1.00 90.94  ? 72  LYS D NZ  1 
ATOM   5747 N N   . CYS D 2 73  ? 29.406  3.637   67.924 1.00 41.97  ? 73  CYS D N   1 
ATOM   5748 C CA  . CYS D 2 73  ? 28.639  4.821   68.235 1.00 37.24  ? 73  CYS D CA  1 
ATOM   5749 C C   . CYS D 2 73  ? 29.560  5.838   68.868 1.00 33.06  ? 73  CYS D C   1 
ATOM   5750 O O   . CYS D 2 73  ? 30.719  5.512   69.252 1.00 31.94  ? 73  CYS D O   1 
ATOM   5751 C CB  . CYS D 2 73  ? 27.489  4.499   69.189 1.00 39.63  ? 73  CYS D CB  1 
ATOM   5752 S SG  . CYS D 2 73  ? 28.024  3.815   70.786 1.00 44.28  ? 73  CYS D SG  1 
ATOM   5753 N N   . MET D 2 74  ? 29.024  7.042   69.010 1.00 27.53  ? 74  MET D N   1 
ATOM   5754 C CA  . MET D 2 74  ? 29.780  8.202   69.471 1.00 26.10  ? 74  MET D CA  1 
ATOM   5755 C C   . MET D 2 74  ? 28.937  8.983   70.488 1.00 24.90  ? 74  MET D C   1 
ATOM   5756 O O   . MET D 2 74  ? 27.732  9.066   70.302 1.00 26.67  ? 74  MET D O   1 
ATOM   5757 C CB  . MET D 2 74  ? 30.074  9.108   68.291 1.00 23.81  ? 74  MET D CB  1 
ATOM   5758 C CG  . MET D 2 74  ? 31.039  8.508   67.251 1.00 27.27  ? 74  MET D CG  1 
ATOM   5759 S SD  . MET D 2 74  ? 30.322  7.298   66.131 1.00 40.69  ? 74  MET D SD  1 
ATOM   5760 C CE  . MET D 2 74  ? 29.208  8.333   65.212 1.00 33.59  ? 74  MET D CE  1 
ATOM   5761 N N   . PRO D 2 75  ? 29.549  9.536   71.562 1.00 24.24  ? 75  PRO D N   1 
ATOM   5762 C CA  . PRO D 2 75  ? 30.954  9.357   71.973 1.00 22.30  ? 75  PRO D CA  1 
ATOM   5763 C C   . PRO D 2 75  ? 31.153  8.000   72.560 1.00 26.15  ? 75  PRO D C   1 
ATOM   5764 O O   . PRO D 2 75  ? 30.279  7.529   73.274 1.00 26.32  ? 75  PRO D O   1 
ATOM   5765 C CB  . PRO D 2 75  ? 31.148  10.411  73.048 1.00 21.10  ? 75  PRO D CB  1 
ATOM   5766 C CG  . PRO D 2 75  ? 29.848  10.572  73.670 1.00 23.75  ? 75  PRO D CG  1 
ATOM   5767 C CD  . PRO D 2 75  ? 28.834  10.423  72.505 1.00 21.81  ? 75  PRO D CD  1 
ATOM   5768 N N   . THR D 2 76  ? 32.257  7.356   72.197 1.00 27.45  ? 76  THR D N   1 
ATOM   5769 C CA  . THR D 2 76  ? 32.717  6.121   72.856 1.00 31.99  ? 76  THR D CA  1 
ATOM   5770 C C   . THR D 2 76  ? 34.069  6.468   73.485 1.00 34.54  ? 76  THR D C   1 
ATOM   5771 O O   . THR D 2 76  ? 34.901  7.111   72.844 1.00 30.66  ? 76  THR D O   1 
ATOM   5772 C CB  . THR D 2 76  ? 32.857  4.952   71.880 1.00 38.52  ? 76  THR D CB  1 
ATOM   5773 O OG1 . THR D 2 76  ? 31.554  4.569   71.448 1.00 40.29  ? 76  THR D OG1 1 
ATOM   5774 C CG2 . THR D 2 76  ? 33.512  3.693   72.523 1.00 45.96  ? 76  THR D CG2 1 
ATOM   5775 N N   . PHE D 2 77  ? 34.265  6.037   74.733 1.00 34.90  ? 77  PHE D N   1 
ATOM   5776 C CA  . PHE D 2 77  ? 35.497  6.309   75.452 1.00 35.87  ? 77  PHE D CA  1 
ATOM   5777 C C   . PHE D 2 77  ? 36.227  5.006   75.710 1.00 40.01  ? 77  PHE D C   1 
ATOM   5778 O O   . PHE D 2 77  ? 35.693  4.118   76.318 1.00 45.22  ? 77  PHE D O   1 
ATOM   5779 C CB  . PHE D 2 77  ? 35.161  6.996   76.752 1.00 30.20  ? 77  PHE D CB  1 
ATOM   5780 C CG  . PHE D 2 77  ? 34.595  8.363   76.555 1.00 32.99  ? 77  PHE D CG  1 
ATOM   5781 C CD1 . PHE D 2 77  ? 35.440  9.442   76.319 1.00 25.19  ? 77  PHE D CD1 1 
ATOM   5782 C CD2 . PHE D 2 77  ? 33.230  8.570   76.614 1.00 30.94  ? 77  PHE D CD2 1 
ATOM   5783 C CE1 . PHE D 2 77  ? 34.897  10.702  76.104 1.00 33.43  ? 77  PHE D CE1 1 
ATOM   5784 C CE2 . PHE D 2 77  ? 32.692  9.823   76.434 1.00 29.73  ? 77  PHE D CE2 1 
ATOM   5785 C CZ  . PHE D 2 77  ? 33.520  10.876  76.159 1.00 18.01  ? 77  PHE D CZ  1 
ATOM   5786 N N   . GLN D 2 78  ? 37.425  4.898   75.169 1.00 40.05  ? 78  GLN D N   1 
ATOM   5787 C CA  . GLN D 2 78  ? 38.234  3.730   75.373 1.00 46.15  ? 78  GLN D CA  1 
ATOM   5788 C C   . GLN D 2 78  ? 39.440  4.115   76.233 1.00 48.18  ? 78  GLN D C   1 
ATOM   5789 O O   . GLN D 2 78  ? 39.934  5.219   76.111 1.00 42.13  ? 78  GLN D O   1 
ATOM   5790 C CB  . GLN D 2 78  ? 38.660  3.168   74.039 1.00 47.93  ? 78  GLN D CB  1 
ATOM   5791 C CG  . GLN D 2 78  ? 37.463  2.613   73.226 1.00 53.48  ? 78  GLN D CG  1 
ATOM   5792 C CD  . GLN D 2 78  ? 37.905  1.714   72.102 1.00 56.88  ? 78  GLN D CD  1 
ATOM   5793 O OE1 . GLN D 2 78  ? 39.068  1.728   71.727 1.00 62.04  ? 78  GLN D OE1 1 
ATOM   5794 N NE2 . GLN D 2 78  ? 36.971  0.941   71.537 1.00 55.10  ? 78  GLN D NE2 1 
ATOM   5795 N N   . PHE D 2 79  ? 39.892  3.168   77.062 1.00 53.07  ? 79  PHE D N   1 
ATOM   5796 C CA  . PHE D 2 79  ? 40.915  3.360   78.088 1.00 58.81  ? 79  PHE D CA  1 
ATOM   5797 C C   . PHE D 2 79  ? 42.118  2.429   77.806 1.00 65.51  ? 79  PHE D C   1 
ATOM   5798 O O   . PHE D 2 79  ? 41.933  1.215   77.665 1.00 71.70  ? 79  PHE D O   1 
ATOM   5799 C CB  . PHE D 2 79  ? 40.271  3.149   79.488 1.00 56.39  ? 79  PHE D CB  1 
ATOM   5800 C CG  . PHE D 2 79  ? 39.215  4.192   79.822 1.00 59.16  ? 79  PHE D CG  1 
ATOM   5801 C CD1 . PHE D 2 79  ? 37.894  4.073   79.327 1.00 43.23  ? 79  PHE D CD1 1 
ATOM   5802 C CD2 . PHE D 2 79  ? 39.544  5.327   80.577 1.00 45.12  ? 79  PHE D CD2 1 
ATOM   5803 C CE1 . PHE D 2 79  ? 36.915  5.095   79.577 1.00 56.42  ? 79  PHE D CE1 1 
ATOM   5804 C CE2 . PHE D 2 79  ? 38.566  6.335   80.853 1.00 43.75  ? 79  PHE D CE2 1 
ATOM   5805 C CZ  . PHE D 2 79  ? 37.255  6.243   80.308 1.00 33.11  ? 79  PHE D CZ  1 
ATOM   5806 N N   . PHE D 2 80  ? 43.326  2.994   77.665 1.00 65.01  ? 80  PHE D N   1 
ATOM   5807 C CA  . PHE D 2 80  ? 44.545  2.177   77.402 1.00 74.34  ? 80  PHE D CA  1 
ATOM   5808 C C   . PHE D 2 80  ? 45.691  2.306   78.422 1.00 81.80  ? 80  PHE D C   1 
ATOM   5809 O O   . PHE D 2 80  ? 45.859  3.347   79.057 1.00 80.67  ? 80  PHE D O   1 
ATOM   5810 C CB  . PHE D 2 80  ? 45.119  2.435   76.012 1.00 70.34  ? 80  PHE D CB  1 
ATOM   5811 C CG  . PHE D 2 80  ? 44.149  2.141   74.903 1.00 74.96  ? 80  PHE D CG  1 
ATOM   5812 C CD1 . PHE D 2 80  ? 43.170  3.069   74.558 1.00 62.23  ? 80  PHE D CD1 1 
ATOM   5813 C CD2 . PHE D 2 80  ? 44.196  0.934   74.211 1.00 65.65  ? 80  PHE D CD2 1 
ATOM   5814 C CE1 . PHE D 2 80  ? 42.251  2.796   73.539 1.00 61.67  ? 80  PHE D CE1 1 
ATOM   5815 C CE2 . PHE D 2 80  ? 43.264  0.675   73.176 1.00 69.53  ? 80  PHE D CE2 1 
ATOM   5816 C CZ  . PHE D 2 80  ? 42.307  1.602   72.856 1.00 65.79  ? 80  PHE D CZ  1 
ATOM   5817 N N   . LYS D 2 81  ? 46.460  1.222   78.531 1.00 90.21  ? 81  LYS D N   1 
ATOM   5818 C CA  . LYS D 2 81  ? 47.704  1.134   79.306 1.00 99.49  ? 81  LYS D CA  1 
ATOM   5819 C C   . LYS D 2 81  ? 48.709  0.302   78.502 1.00 105.91 ? 81  LYS D C   1 
ATOM   5820 O O   . LYS D 2 81  ? 48.419  -0.846  78.131 1.00 108.90 ? 81  LYS D O   1 
ATOM   5821 C CB  . LYS D 2 81  ? 47.450  0.449   80.652 1.00 104.69 ? 81  LYS D CB  1 
ATOM   5822 C CG  . LYS D 2 81  ? 47.072  1.374   81.813 1.00 104.18 ? 81  LYS D CG  1 
ATOM   5823 C CD  . LYS D 2 81  ? 46.612  0.528   83.002 1.00 116.08 ? 81  LYS D CD  1 
ATOM   5824 C CE  . LYS D 2 81  ? 47.158  1.064   84.317 1.00 126.88 ? 81  LYS D CE  1 
ATOM   5825 N NZ  . LYS D 2 81  ? 46.277  2.140   84.859 1.00 123.23 ? 81  LYS D NZ  1 
ATOM   5826 N N   . LYS D 2 82  ? 49.880  0.879   78.218 1.00 109.05 ? 82  LYS D N   1 
ATOM   5827 C CA  . LYS D 2 82  ? 50.932  0.162   77.483 1.00 116.77 ? 82  LYS D CA  1 
ATOM   5828 C C   . LYS D 2 82  ? 50.421  -0.495  76.191 1.00 115.91 ? 82  LYS D C   1 
ATOM   5829 O O   . LYS D 2 82  ? 50.857  -1.592  75.824 1.00 122.69 ? 82  LYS D O   1 
ATOM   5830 C CB  . LYS D 2 82  ? 51.616  -0.872  78.399 1.00 126.17 ? 82  LYS D CB  1 
ATOM   5831 C CG  . LYS D 2 82  ? 52.832  -0.327  79.143 1.00 133.42 ? 82  LYS D CG  1 
ATOM   5832 C CD  . LYS D 2 82  ? 54.146  -0.772  78.454 1.00 145.12 ? 82  LYS D CD  1 
ATOM   5833 C CE  . LYS D 2 82  ? 55.310  0.212   78.778 1.00 146.35 ? 82  LYS D CE  1 
ATOM   5834 N NZ  . LYS D 2 82  ? 55.845  0.037   80.303 1.00 146.18 ? 82  LYS D NZ  1 
ATOM   5835 N N   . GLY D 2 83  ? 49.491  0.185   75.515 1.00 107.75 ? 83  GLY D N   1 
ATOM   5836 C CA  . GLY D 2 83  ? 48.962  -0.246  74.215 1.00 107.02 ? 83  GLY D CA  1 
ATOM   5837 C C   . GLY D 2 83  ? 47.853  -1.286  74.272 1.00 107.80 ? 83  GLY D C   1 
ATOM   5838 O O   . GLY D 2 83  ? 47.455  -1.822  73.239 1.00 106.91 ? 83  GLY D O   1 
ATOM   5839 N N   . GLN D 2 84  ? 47.367  -1.560  75.485 1.00 109.22 ? 84  GLN D N   1 
ATOM   5840 C CA  . GLN D 2 84  ? 46.365  -2.596  75.775 1.00 111.55 ? 84  GLN D CA  1 
ATOM   5841 C C   . GLN D 2 84  ? 45.127  -1.969  76.413 1.00 103.75 ? 84  GLN D C   1 
ATOM   5842 O O   . GLN D 2 84  ? 45.257  -1.143  77.321 1.00 101.57 ? 84  GLN D O   1 
ATOM   5843 C CB  . GLN D 2 84  ? 46.951  -3.630  76.746 1.00 120.87 ? 84  GLN D CB  1 
ATOM   5844 C CG  . GLN D 2 84  ? 47.751  -4.762  76.097 1.00 130.17 ? 84  GLN D CG  1 
ATOM   5845 C CD  . GLN D 2 84  ? 46.850  -5.865  75.561 1.00 132.29 ? 84  GLN D CD  1 
ATOM   5846 O OE1 . GLN D 2 84  ? 46.179  -5.700  74.541 1.00 122.89 ? 84  GLN D OE1 1 
ATOM   5847 N NE2 . GLN D 2 84  ? 46.825  -6.995  76.256 1.00 134.94 ? 84  GLN D NE2 1 
ATOM   5848 N N   . LYS D 2 85  ? 43.939  -2.380  75.956 1.00 101.05 ? 85  LYS D N   1 
ATOM   5849 C CA  . LYS D 2 85  ? 42.671  -1.754  76.376 1.00 92.95  ? 85  LYS D CA  1 
ATOM   5850 C C   . LYS D 2 85  ? 42.160  -2.297  77.710 1.00 95.27  ? 85  LYS D C   1 
ATOM   5851 O O   . LYS D 2 85  ? 42.008  -3.506  77.878 1.00 102.37 ? 85  LYS D O   1 
ATOM   5852 C CB  . LYS D 2 85  ? 41.583  -1.887  75.286 1.00 87.25  ? 85  LYS D CB  1 
ATOM   5853 C CG  . LYS D 2 85  ? 40.223  -1.279  75.688 1.00 80.68  ? 85  LYS D CG  1 
ATOM   5854 C CD  . LYS D 2 85  ? 39.195  -1.286  74.545 1.00 75.92  ? 85  LYS D CD  1 
ATOM   5855 C CE  . LYS D 2 85  ? 38.959  -2.690  73.996 1.00 88.91  ? 85  LYS D CE  1 
ATOM   5856 N NZ  . LYS D 2 85  ? 38.453  -2.664  72.586 1.00 89.35  ? 85  LYS D NZ  1 
ATOM   5857 N N   . VAL D 2 86  ? 41.881  -1.393  78.650 1.00 90.91  ? 86  VAL D N   1 
ATOM   5858 C CA  . VAL D 2 86  ? 41.455  -1.801  79.999 1.00 91.49  ? 86  VAL D CA  1 
ATOM   5859 C C   . VAL D 2 86  ? 40.053  -1.323  80.371 1.00 84.67  ? 86  VAL D C   1 
ATOM   5860 O O   . VAL D 2 86  ? 39.561  -1.569  81.476 1.00 82.99  ? 86  VAL D O   1 
ATOM   5861 C CB  . VAL D 2 86  ? 42.499  -1.438  81.108 1.00 97.77  ? 86  VAL D CB  1 
ATOM   5862 C CG1 . VAL D 2 86  ? 43.745  -2.278  80.949 1.00 103.47 ? 86  VAL D CG1 1 
ATOM   5863 C CG2 . VAL D 2 86  ? 42.842  0.043   81.105 1.00 88.55  ? 86  VAL D CG2 1 
ATOM   5864 N N   . GLY D 2 87  ? 39.389  -0.654  79.433 1.00 75.18  ? 87  GLY D N   1 
ATOM   5865 C CA  . GLY D 2 87  ? 38.028  -0.241  79.697 1.00 72.55  ? 87  GLY D CA  1 
ATOM   5866 C C   . GLY D 2 87  ? 37.407  0.423   78.498 1.00 66.22  ? 87  GLY D C   1 
ATOM   5867 O O   . GLY D 2 87  ? 38.111  0.856   77.577 1.00 63.29  ? 87  GLY D O   1 
ATOM   5868 N N   . GLU D 2 88  ? 36.084  0.510   78.531 1.00 63.69  ? 88  GLU D N   1 
ATOM   5869 C CA  . GLU D 2 88  ? 35.329  1.125   77.450 1.00 61.31  ? 88  GLU D CA  1 
ATOM   5870 C C   . GLU D 2 88  ? 33.885  1.262   77.879 1.00 60.18  ? 88  GLU D C   1 
ATOM   5871 O O   . GLU D 2 88  ? 33.344  0.384   78.533 1.00 67.62  ? 88  GLU D O   1 
ATOM   5872 C CB  . GLU D 2 88  ? 35.439  0.254   76.194 1.00 62.07  ? 88  GLU D CB  1 
ATOM   5873 C CG  . GLU D 2 88  ? 34.605  0.717   75.011 1.00 69.00  ? 88  GLU D CG  1 
ATOM   5874 C CD  . GLU D 2 88  ? 34.725  -0.214  73.813 1.00 67.95  ? 88  GLU D CD  1 
ATOM   5875 O OE1 . GLU D 2 88  ? 35.327  -1.318  73.932 1.00 76.25  ? 88  GLU D OE1 1 
ATOM   5876 O OE2 . GLU D 2 88  ? 34.216  0.177   72.753 1.00 71.78  ? 88  GLU D OE2 1 
ATOM   5877 N N   . PHE D 2 89  ? 33.283  2.390   77.549 1.00 52.29  ? 89  PHE D N   1 
ATOM   5878 C CA  . PHE D 2 89  ? 31.848  2.552   77.645 1.00 51.11  ? 89  PHE D CA  1 
ATOM   5879 C C   . PHE D 2 89  ? 31.488  3.540   76.547 1.00 47.30  ? 89  PHE D C   1 
ATOM   5880 O O   . PHE D 2 89  ? 32.359  4.177   75.968 1.00 44.99  ? 89  PHE D O   1 
ATOM   5881 C CB  . PHE D 2 89  ? 31.391  3.069   79.013 1.00 52.22  ? 89  PHE D CB  1 
ATOM   5882 C CG  . PHE D 2 89  ? 31.776  4.512   79.271 1.00 50.41  ? 89  PHE D CG  1 
ATOM   5883 C CD1 . PHE D 2 89  ? 30.902  5.550   78.967 1.00 37.69  ? 89  PHE D CD1 1 
ATOM   5884 C CD2 . PHE D 2 89  ? 33.000  4.809   79.839 1.00 42.66  ? 89  PHE D CD2 1 
ATOM   5885 C CE1 . PHE D 2 89  ? 31.265  6.871   79.193 1.00 39.00  ? 89  PHE D CE1 1 
ATOM   5886 C CE2 . PHE D 2 89  ? 33.363  6.094   80.069 1.00 46.63  ? 89  PHE D CE2 1 
ATOM   5887 C CZ  . PHE D 2 89  ? 32.502  7.143   79.748 1.00 39.07  ? 89  PHE D CZ  1 
ATOM   5888 N N   . SER D 2 90  ? 30.203  3.638   76.256 1.00 47.98  ? 90  SER D N   1 
ATOM   5889 C CA  . SER D 2 90  ? 29.722  4.529   75.237 1.00 42.54  ? 90  SER D CA  1 
ATOM   5890 C C   . SER D 2 90  ? 28.767  5.536   75.878 1.00 42.04  ? 90  SER D C   1 
ATOM   5891 O O   . SER D 2 90  ? 28.086  5.204   76.842 1.00 41.75  ? 90  SER D O   1 
ATOM   5892 C CB  . SER D 2 90  ? 29.052  3.706   74.143 1.00 44.57  ? 90  SER D CB  1 
ATOM   5893 O OG  . SER D 2 90  ? 30.023  3.279   73.190 1.00 39.28  ? 90  SER D OG  1 
ATOM   5894 N N   . GLY D 2 91  ? 28.741  6.778   75.386 1.00 33.15  ? 91  GLY D N   1 
ATOM   5895 C CA  . GLY D 2 91  ? 27.710  7.702   75.849 1.00 32.22  ? 91  GLY D CA  1 
ATOM   5896 C C   . GLY D 2 91  ? 28.235  8.978   76.431 1.00 32.78  ? 91  GLY D C   1 
ATOM   5897 O O   . GLY D 2 91  ? 29.238  8.961   77.117 1.00 35.76  ? 91  GLY D O   1 
ATOM   5898 N N   . ALA D 2 92  ? 27.562  10.099  76.165 1.00 34.75  ? 92  ALA D N   1 
ATOM   5899 C CA  . ALA D 2 92  ? 27.938  11.376  76.807 1.00 34.23  ? 92  ALA D CA  1 
ATOM   5900 C C   . ALA D 2 92  ? 27.566  11.441  78.313 1.00 39.07  ? 92  ALA D C   1 
ATOM   5901 O O   . ALA D 2 92  ? 26.711  12.245  78.722 1.00 38.82  ? 92  ALA D O   1 
ATOM   5902 C CB  . ALA D 2 92  ? 27.355  12.544  76.048 1.00 30.35  ? 92  ALA D CB  1 
ATOM   5903 N N   . ASN D 2 93  ? 28.214  10.583  79.109 1.00 40.50  ? 93  ASN D N   1 
ATOM   5904 C CA  . ASN D 2 93  ? 27.978  10.415  80.567 1.00 42.31  ? 93  ASN D CA  1 
ATOM   5905 C C   . ASN D 2 93  ? 29.243  10.804  81.336 1.00 42.31  ? 93  ASN D C   1 
ATOM   5906 O O   . ASN D 2 93  ? 30.138  9.969   81.553 1.00 44.90  ? 93  ASN D O   1 
ATOM   5907 C CB  . ASN D 2 93  ? 27.610  8.965   80.865 1.00 42.20  ? 93  ASN D CB  1 
ATOM   5908 C CG  . ASN D 2 93  ? 27.089  8.752   82.275 1.00 53.04  ? 93  ASN D CG  1 
ATOM   5909 O OD1 . ASN D 2 93  ? 27.244  9.598   83.160 1.00 51.88  ? 93  ASN D OD1 1 
ATOM   5910 N ND2 . ASN D 2 93  ? 26.487  7.585   82.496 1.00 57.03  ? 93  ASN D ND2 1 
ATOM   5911 N N   . LYS D 2 94  ? 29.291  12.065  81.752 1.00 41.20  ? 94  LYS D N   1 
ATOM   5912 C CA  . LYS D 2 94  ? 30.483  12.674  82.330 1.00 44.41  ? 94  LYS D CA  1 
ATOM   5913 C C   . LYS D 2 94  ? 30.878  12.091  83.669 1.00 47.95  ? 94  LYS D C   1 
ATOM   5914 O O   . LYS D 2 94  ? 32.064  11.959  83.960 1.00 49.77  ? 94  LYS D O   1 
ATOM   5915 C CB  . LYS D 2 94  ? 30.341  14.198  82.409 1.00 45.25  ? 94  LYS D CB  1 
ATOM   5916 C CG  . LYS D 2 94  ? 29.233  14.681  83.312 1.00 54.77  ? 94  LYS D CG  1 
ATOM   5917 C CD  . LYS D 2 94  ? 28.849  16.128  83.022 1.00 65.53  ? 94  LYS D CD  1 
ATOM   5918 C CE  . LYS D 2 94  ? 28.059  16.698  84.199 1.00 74.29  ? 94  LYS D CE  1 
ATOM   5919 N NZ  . LYS D 2 94  ? 27.311  17.941  83.858 1.00 83.69  ? 94  LYS D NZ  1 
ATOM   5920 N N   . GLU D 2 95  ? 29.882  11.699  84.456 1.00 51.94  ? 95  GLU D N   1 
ATOM   5921 C CA  . GLU D 2 95  ? 30.123  11.127  85.772 1.00 56.59  ? 95  GLU D CA  1 
ATOM   5922 C C   . GLU D 2 95  ? 30.667  9.723   85.568 1.00 58.43  ? 95  GLU D C   1 
ATOM   5923 O O   . GLU D 2 95  ? 31.630  9.345   86.193 1.00 59.20  ? 95  GLU D O   1 
ATOM   5924 C CB  . GLU D 2 95  ? 28.843  11.124  86.604 1.00 62.39  ? 95  GLU D CB  1 
ATOM   5925 C CG  . GLU D 2 95  ? 28.407  12.523  87.085 1.00 64.34  ? 95  GLU D CG  1 
ATOM   5926 C CD  . GLU D 2 95  ? 27.697  13.344  86.010 1.00 69.66  ? 95  GLU D CD  1 
ATOM   5927 O OE1 . GLU D 2 95  ? 27.353  12.779  84.944 1.00 72.77  ? 95  GLU D OE1 1 
ATOM   5928 O OE2 . GLU D 2 95  ? 27.466  14.556  86.235 1.00 73.42  ? 95  GLU D OE2 1 
ATOM   5929 N N   . LYS D 2 96  ? 30.094  8.961   84.642 1.00 52.91  ? 96  LYS D N   1 
ATOM   5930 C CA  . LYS D 2 96  ? 30.709  7.690   84.279 1.00 52.46  ? 96  LYS D CA  1 
ATOM   5931 C C   . LYS D 2 96  ? 32.118  7.917   83.762 1.00 50.50  ? 96  LYS D C   1 
ATOM   5932 O O   . LYS D 2 96  ? 33.024  7.186   84.158 1.00 54.86  ? 96  LYS D O   1 
ATOM   5933 C CB  . LYS D 2 96  ? 29.877  6.901   83.261 1.00 51.25  ? 96  LYS D CB  1 
ATOM   5934 C CG  . LYS D 2 96  ? 30.142  5.395   83.304 1.00 50.27  ? 96  LYS D CG  1 
ATOM   5935 C CD  . LYS D 2 96  ? 29.421  4.689   82.125 1.00 44.22  ? 96  LYS D CD  1 
ATOM   5936 C CE  . LYS D 2 96  ? 28.997  3.285   82.558 1.00 68.44  ? 96  LYS D CE  1 
ATOM   5937 N NZ  . LYS D 2 96  ? 28.392  2.553   81.402 1.00 60.28  ? 96  LYS D NZ  1 
ATOM   5938 N N   . LEU D 2 97  ? 32.305  8.942   82.910 1.00 44.70  ? 97  LEU D N   1 
ATOM   5939 C CA  . LEU D 2 97  ? 33.618  9.332   82.399 1.00 37.21  ? 97  LEU D CA  1 
ATOM   5940 C C   . LEU D 2 97  ? 34.641  9.480   83.541 1.00 43.85  ? 97  LEU D C   1 
ATOM   5941 O O   . LEU D 2 97  ? 35.670  8.805   83.549 1.00 48.66  ? 97  LEU D O   1 
ATOM   5942 C CB  . LEU D 2 97  ? 33.552  10.648  81.565 1.00 33.73  ? 97  LEU D CB  1 
ATOM   5943 C CG  . LEU D 2 97  ? 34.766  11.196  80.785 1.00 39.15  ? 97  LEU D CG  1 
ATOM   5944 C CD1 . LEU D 2 97  ? 35.495  10.121  80.060 1.00 24.77  ? 97  LEU D CD1 1 
ATOM   5945 C CD2 . LEU D 2 97  ? 34.484  12.433  79.800 1.00 24.65  ? 97  LEU D CD2 1 
ATOM   5946 N N   . GLU D 2 98  ? 34.359  10.363  84.488 1.00 44.33  ? 98  GLU D N   1 
ATOM   5947 C CA  . GLU D 2 98  ? 35.322  10.635  85.562 1.00 45.28  ? 98  GLU D CA  1 
ATOM   5948 C C   . GLU D 2 98  ? 35.548  9.451   86.467 1.00 54.96  ? 98  GLU D C   1 
ATOM   5949 O O   . GLU D 2 98  ? 36.664  9.264   86.949 1.00 63.48  ? 98  GLU D O   1 
ATOM   5950 C CB  . GLU D 2 98  ? 34.936  11.869  86.393 1.00 46.42  ? 98  GLU D CB  1 
ATOM   5951 C CG  . GLU D 2 98  ? 36.004  12.278  87.463 1.00 46.71  ? 98  GLU D CG  1 
ATOM   5952 C CD  . GLU D 2 98  ? 35.703  13.609  88.121 1.00 51.88  ? 98  GLU D CD  1 
ATOM   5953 O OE1 . GLU D 2 98  ? 34.552  14.075  88.069 1.00 54.53  ? 98  GLU D OE1 1 
ATOM   5954 O OE2 . GLU D 2 98  ? 36.623  14.205  88.721 1.00 55.22  ? 98  GLU D OE2 1 
ATOM   5955 N N   . ALA D 2 99  ? 34.490  8.685   86.721 1.00 57.16  ? 99  ALA D N   1 
ATOM   5956 C CA  . ALA D 2 99  ? 34.530  7.533   87.630 1.00 64.59  ? 99  ALA D CA  1 
ATOM   5957 C C   . ALA D 2 99  ? 35.324  6.377   87.011 1.00 66.92  ? 99  ALA D C   1 
ATOM   5958 O O   . ALA D 2 99  ? 36.071  5.706   87.680 1.00 67.00  ? 99  ALA D O   1 
ATOM   5959 C CB  . ALA D 2 99  ? 33.126  7.098   87.965 1.00 66.16  ? 99  ALA D CB  1 
ATOM   5960 N N   . THR D 2 100 ? 35.190  6.170   85.713 1.00 58.98  ? 100 THR D N   1 
ATOM   5961 C CA  . THR D 2 100 ? 36.039  5.199   85.004 1.00 62.50  ? 100 THR D CA  1 
ATOM   5962 C C   . THR D 2 100 ? 37.521  5.607   84.997 1.00 65.38  ? 100 THR D C   1 
ATOM   5963 O O   . THR D 2 100 ? 38.396  4.771   85.192 1.00 70.28  ? 100 THR D O   1 
ATOM   5964 C CB  . THR D 2 100 ? 35.559  4.950   83.548 1.00 58.33  ? 100 THR D CB  1 
ATOM   5965 O OG1 . THR D 2 100 ? 34.119  4.913   83.514 1.00 55.21  ? 100 THR D OG1 1 
ATOM   5966 C CG2 . THR D 2 100 ? 36.142  3.639   83.008 1.00 61.53  ? 100 THR D CG2 1 
ATOM   5967 N N   . ILE D 2 101 ? 37.799  6.884   84.760 1.00 63.70  ? 101 ILE D N   1 
ATOM   5968 C CA  . ILE D 2 101 ? 39.181  7.387   84.831 1.00 65.97  ? 101 ILE D CA  1 
ATOM   5969 C C   . ILE D 2 101 ? 39.792  7.133   86.199 1.00 74.18  ? 101 ILE D C   1 
ATOM   5970 O O   . ILE D 2 101 ? 40.888  6.577   86.299 1.00 81.10  ? 101 ILE D O   1 
ATOM   5971 C CB  . ILE D 2 101 ? 39.275  8.894   84.486 1.00 60.70  ? 101 ILE D CB  1 
ATOM   5972 C CG1 . ILE D 2 101 ? 39.370  9.077   82.980 1.00 51.89  ? 101 ILE D CG1 1 
ATOM   5973 C CG2 . ILE D 2 101 ? 40.519  9.539   85.134 1.00 58.40  ? 101 ILE D CG2 1 
ATOM   5974 C CD1 . ILE D 2 101 ? 38.934  10.466  82.551 1.00 51.17  ? 101 ILE D CD1 1 
ATOM   5975 N N   . ASN D 2 102 ? 39.068  7.524   87.244 1.00 74.99  ? 102 ASN D N   1 
ATOM   5976 C CA  . ASN D 2 102 ? 39.519  7.334   88.617 1.00 77.43  ? 102 ASN D CA  1 
ATOM   5977 C C   . ASN D 2 102 ? 39.755  5.859   88.911 1.00 87.01  ? 102 ASN D C   1 
ATOM   5978 O O   . ASN D 2 102 ? 40.576  5.509   89.767 1.00 92.11  ? 102 ASN D O   1 
ATOM   5979 C CB  . ASN D 2 102 ? 38.471  7.841   89.608 1.00 77.66  ? 102 ASN D CB  1 
ATOM   5980 C CG  . ASN D 2 102 ? 38.406  9.359   89.678 1.00 75.66  ? 102 ASN D CG  1 
ATOM   5981 O OD1 . ASN D 2 102 ? 39.390  10.037  89.396 1.00 74.59  ? 102 ASN D OD1 1 
ATOM   5982 N ND2 . ASN D 2 102 ? 37.222  9.909   90.077 1.00 73.37  ? 102 ASN D ND2 1 
ATOM   5983 N N   . GLU D 2 103 ? 39.010  5.006   88.223 1.00 81.35  ? 103 GLU D N   1 
ATOM   5984 C CA  . GLU D 2 103 ? 38.986  3.590   88.494 1.00 87.64  ? 103 GLU D CA  1 
ATOM   5985 C C   . GLU D 2 103 ? 40.139  2.896   87.781 1.00 89.37  ? 103 GLU D C   1 
ATOM   5986 O O   . GLU D 2 103 ? 40.481  1.776   88.110 1.00 97.78  ? 103 GLU D O   1 
ATOM   5987 C CB  . GLU D 2 103 ? 37.610  3.028   88.071 1.00 84.56  ? 103 GLU D CB  1 
ATOM   5988 C CG  . GLU D 2 103 ? 37.340  1.544   88.252 1.00 90.84  ? 103 GLU D CG  1 
ATOM   5989 C CD  . GLU D 2 103 ? 35.996  1.084   87.630 1.00 96.33  ? 103 GLU D CD  1 
ATOM   5990 O OE1 . GLU D 2 103 ? 35.649  1.516   86.488 1.00 84.93  ? 103 GLU D OE1 1 
ATOM   5991 O OE2 . GLU D 2 103 ? 35.293  0.256   88.273 1.00 108.64 ? 103 GLU D OE2 1 
ATOM   5992 N N   . LEU D 2 104 ? 40.745  3.553   86.806 1.00 84.63  ? 104 LEU D N   1 
ATOM   5993 C CA  . LEU D 2 104 ? 41.739  2.866   85.971 1.00 90.24  ? 104 LEU D CA  1 
ATOM   5994 C C   . LEU D 2 104 ? 43.149  3.462   85.970 1.00 94.65  ? 104 LEU D C   1 
ATOM   5995 O O   . LEU D 2 104 ? 44.049  2.908   85.323 1.00 97.59  ? 104 LEU D O   1 
ATOM   5996 C CB  . LEU D 2 104 ? 41.239  2.719   84.522 1.00 82.36  ? 104 LEU D CB  1 
ATOM   5997 C CG  . LEU D 2 104 ? 40.162  1.686   84.173 1.00 84.79  ? 104 LEU D CG  1 
ATOM   5998 C CD1 . LEU D 2 104 ? 39.563  1.941   82.792 1.00 79.74  ? 104 LEU D CD1 1 
ATOM   5999 C CD2 . LEU D 2 104 ? 40.693  0.256   84.260 1.00 83.12  ? 104 LEU D CD2 1 
ATOM   6000 N N   . VAL D 2 105 ? 43.334  4.589   86.671 1.00 94.94  ? 105 VAL D N   1 
ATOM   6001 C CA  . VAL D 2 105 ? 44.639  5.234   86.766 1.00 98.57  ? 105 VAL D CA  1 
ATOM   6002 C C   . VAL D 2 105 ? 45.624  4.358   87.556 1.00 111.60 ? 105 VAL D C   1 
ATOM   6003 O O   . VAL D 2 105 ? 45.281  3.783   88.605 1.00 118.17 ? 105 VAL D O   1 
ATOM   6004 C CB  . VAL D 2 105 ? 44.569  6.654   87.393 1.00 96.22  ? 105 VAL D CB  1 
ATOM   6005 C CG1 . VAL D 2 105 ? 44.683  7.701   86.332 1.00 88.15  ? 105 VAL D CG1 1 
ATOM   6006 C CG2 . VAL D 2 105 ? 43.299  6.857   88.217 1.00 94.19  ? 105 VAL D CG2 1 
ATOM   6007 O OXT . VAL D 2 105 ? 46.782  4.196   87.145 1.00 116.60 ? 105 VAL D OXT 1 
HETATM 6008 O O   . HOH E 3 .   ? -39.432 15.484  10.180 1.00 48.06  ? 401 HOH A O   1 
HETATM 6009 O O   . HOH E 3 .   ? -35.599 0.963   34.424 1.00 58.99  ? 402 HOH A O   1 
HETATM 6010 O O   . HOH E 3 .   ? -36.072 -2.268  15.444 1.00 50.64  ? 403 HOH A O   1 
HETATM 6011 O O   . HOH E 3 .   ? -10.395 -11.497 65.407 1.00 44.07  ? 404 HOH A O   1 
HETATM 6012 O O   . HOH E 3 .   ? -37.916 -5.571  19.597 1.00 44.61  ? 405 HOH A O   1 
HETATM 6013 O O   . HOH E 3 .   ? -44.947 13.554  22.697 1.00 49.98  ? 406 HOH A O   1 
HETATM 6014 O O   . HOH E 3 .   ? -3.523  -3.333  61.071 1.00 36.35  ? 407 HOH A O   1 
HETATM 6015 O O   . HOH E 3 .   ? -4.814  -3.689  58.546 1.00 35.36  ? 408 HOH A O   1 
HETATM 6016 O O   . HOH E 3 .   ? -14.527 -12.202 57.434 1.00 62.62  ? 409 HOH A O   1 
HETATM 6017 O O   . HOH E 3 .   ? -3.172  -5.464  57.180 1.00 41.39  ? 410 HOH A O   1 
HETATM 6018 O O   . HOH E 3 .   ? 3.350   6.328   57.665 1.00 58.46  ? 411 HOH A O   1 
HETATM 6019 O O   . HOH E 3 .   ? -29.359 -8.785  23.861 1.00 43.19  ? 412 HOH A O   1 
HETATM 6020 O O   . HOH E 3 .   ? -51.803 -2.121  10.857 1.00 47.47  ? 413 HOH A O   1 
HETATM 6021 O O   . HOH E 3 .   ? -31.644 -12.539 26.396 1.00 45.34  ? 414 HOH A O   1 
HETATM 6022 O O   . HOH E 3 .   ? -52.173 -0.071  8.680  1.00 36.96  ? 415 HOH A O   1 
HETATM 6023 O O   . HOH E 3 .   ? -38.358 8.569   20.849 1.00 42.85  ? 416 HOH A O   1 
HETATM 6024 O O   . HOH E 3 .   ? -53.439 3.854   25.255 1.00 39.98  ? 417 HOH A O   1 
HETATM 6025 O O   . HOH E 3 .   ? -4.023  -7.196  55.053 1.00 46.78  ? 418 HOH A O   1 
HETATM 6026 O O   . HOH E 3 .   ? -19.305 -0.079  65.354 1.00 48.13  ? 419 HOH A O   1 
HETATM 6027 O O   . HOH E 3 .   ? -49.903 10.321  21.276 1.00 54.56  ? 420 HOH A O   1 
HETATM 6028 O O   . HOH E 3 .   ? -6.575  2.413   53.073 1.00 61.73  ? 421 HOH A O   1 
HETATM 6029 O O   . HOH E 3 .   ? -38.316 7.012   4.502  1.00 45.57  ? 422 HOH A O   1 
HETATM 6030 O O   . HOH E 3 .   ? -46.557 2.743   39.007 1.00 50.81  ? 423 HOH A O   1 
HETATM 6031 O O   . HOH E 3 .   ? -54.036 -9.095  21.709 1.00 56.42  ? 424 HOH A O   1 
HETATM 6032 O O   . HOH E 3 .   ? -4.194  -11.813 68.894 1.00 44.10  ? 425 HOH A O   1 
HETATM 6033 O O   . HOH E 3 .   ? -17.529 -4.244  68.635 1.00 49.89  ? 426 HOH A O   1 
HETATM 6034 O O   . HOH E 3 .   ? -36.723 4.098   12.987 1.00 39.29  ? 427 HOH A O   1 
HETATM 6035 O O   . HOH E 3 .   ? -1.963  -5.432  61.059 1.00 42.25  ? 428 HOH A O   1 
HETATM 6036 O O   . HOH E 3 .   ? -25.667 -7.692  58.549 1.00 61.79  ? 429 HOH A O   1 
HETATM 6037 O O   . HOH E 3 .   ? 7.062   -9.060  56.725 1.00 42.22  ? 430 HOH A O   1 
HETATM 6038 O O   . HOH E 3 .   ? -6.837  -0.540  48.629 1.00 42.66  ? 431 HOH A O   1 
HETATM 6039 O O   . HOH E 3 .   ? -0.491  -5.196  58.882 1.00 41.75  ? 432 HOH A O   1 
HETATM 6040 O O   . HOH E 3 .   ? -50.225 -7.775  33.030 1.00 38.26  ? 433 HOH A O   1 
HETATM 6041 O O   . HOH E 3 .   ? -5.577  13.728  56.173 1.00 59.97  ? 434 HOH A O   1 
HETATM 6042 O O   . HOH E 3 .   ? -52.657 2.635   32.666 1.00 51.32  ? 435 HOH A O   1 
HETATM 6043 O O   . HOH E 3 .   ? -13.004 14.272  62.476 1.00 65.34  ? 436 HOH A O   1 
HETATM 6044 O O   . HOH E 3 .   ? -12.966 -6.269  53.309 1.00 50.84  ? 437 HOH A O   1 
HETATM 6045 O O   . HOH E 3 .   ? 5.210   7.453   62.909 1.00 48.61  ? 438 HOH A O   1 
HETATM 6046 O O   . HOH E 3 .   ? -2.454  -19.572 63.242 1.00 53.17  ? 439 HOH A O   1 
HETATM 6047 O O   . HOH E 3 .   ? -5.113  -0.038  73.500 1.00 53.90  ? 440 HOH A O   1 
HETATM 6048 O O   . HOH E 3 .   ? -41.549 -0.265  8.153  1.00 46.70  ? 441 HOH A O   1 
HETATM 6049 O O   . HOH E 3 .   ? -44.649 12.269  6.308  1.00 38.48  ? 442 HOH A O   1 
HETATM 6050 O O   . HOH E 3 .   ? 2.715   -3.378  59.487 1.00 57.23  ? 443 HOH A O   1 
HETATM 6051 O O   . HOH E 3 .   ? -44.308 -6.366  10.961 1.00 42.11  ? 444 HOH A O   1 
HETATM 6052 O O   . HOH E 3 .   ? -51.552 9.537   4.065  1.00 39.59  ? 445 HOH A O   1 
HETATM 6053 O O   . HOH E 3 .   ? -54.118 5.925   3.632  1.00 47.02  ? 446 HOH A O   1 
HETATM 6054 O O   . HOH E 3 .   ? -32.824 -8.697  38.939 1.00 58.59  ? 447 HOH A O   1 
HETATM 6055 O O   . HOH E 3 .   ? -17.096 -4.116  27.680 1.00 62.14  ? 448 HOH A O   1 
HETATM 6056 O O   . HOH E 3 .   ? -51.335 11.506  6.306  1.00 36.23  ? 449 HOH A O   1 
HETATM 6057 O O   . HOH E 3 .   ? -11.337 3.580   52.990 1.00 49.90  ? 450 HOH A O   1 
HETATM 6058 O O   . HOH E 3 .   ? -20.987 -4.460  67.129 1.00 65.75  ? 451 HOH A O   1 
HETATM 6059 O O   . HOH E 3 .   ? -48.360 3.585   3.288  1.00 39.85  ? 452 HOH A O   1 
HETATM 6060 O O   . HOH E 3 .   ? -49.753 -5.418  32.216 1.00 41.28  ? 453 HOH A O   1 
HETATM 6061 O O   . HOH E 3 .   ? -12.201 -13.229 68.504 1.00 57.18  ? 454 HOH A O   1 
HETATM 6062 O O   . HOH E 3 .   ? -28.533 -1.430  36.129 1.00 48.87  ? 455 HOH A O   1 
HETATM 6063 O O   . HOH E 3 .   ? -36.058 1.629   11.106 1.00 48.89  ? 456 HOH A O   1 
HETATM 6064 O O   . HOH E 3 .   ? -27.893 -8.727  43.417 1.00 64.51  ? 457 HOH A O   1 
HETATM 6065 O O   . HOH E 3 .   ? -25.818 5.196   41.304 1.00 57.75  ? 458 HOH A O   1 
HETATM 6066 O O   . HOH E 3 .   ? -51.178 6.996   19.843 1.00 45.76  ? 459 HOH A O   1 
HETATM 6067 O O   . HOH E 3 .   ? -43.066 -16.209 40.357 1.00 59.36  ? 460 HOH A O   1 
HETATM 6068 O O   . HOH E 3 .   ? -43.529 -5.272  7.994  1.00 63.60  ? 461 HOH A O   1 
HETATM 6069 O O   . HOH E 3 .   ? -33.728 4.825   10.295 1.00 57.73  ? 462 HOH A O   1 
HETATM 6070 O O   . HOH E 3 .   ? -46.533 10.567  28.651 1.00 50.19  ? 463 HOH A O   1 
HETATM 6071 O O   . HOH E 3 .   ? -38.725 -2.507  11.281 1.00 52.23  ? 464 HOH A O   1 
HETATM 6072 O O   . HOH E 3 .   ? -52.479 -8.958  44.427 1.00 53.82  ? 465 HOH A O   1 
HETATM 6073 O O   . HOH E 3 .   ? -37.336 -11.895 52.095 1.00 61.10  ? 466 HOH A O   1 
HETATM 6074 O O   . HOH E 3 .   ? -11.138 -10.783 68.300 1.00 51.55  ? 467 HOH A O   1 
HETATM 6075 O O   . HOH E 3 .   ? -50.604 14.875  11.049 1.00 47.71  ? 468 HOH A O   1 
HETATM 6076 O O   . HOH E 3 .   ? -42.021 3.419   4.323  1.00 36.15  ? 469 HOH A O   1 
HETATM 6077 O O   . HOH E 3 .   ? -43.504 15.933  20.824 1.00 59.71  ? 470 HOH A O   1 
HETATM 6078 O O   . HOH E 3 .   ? -9.021  3.248   49.077 1.00 61.19  ? 471 HOH A O   1 
HETATM 6079 O O   . HOH E 3 .   ? -28.563 1.809   33.654 1.00 64.75  ? 472 HOH A O   1 
HETATM 6080 O O   . HOH E 3 .   ? -4.780  -15.030 71.597 1.00 63.65  ? 473 HOH A O   1 
HETATM 6081 O O   . HOH E 3 .   ? -14.718 -11.096 41.952 1.00 66.17  ? 474 HOH A O   1 
HETATM 6082 O O   . HOH E 3 .   ? -49.678 -3.835  15.521 1.00 58.21  ? 475 HOH A O   1 
HETATM 6083 O O   . HOH E 3 .   ? -11.261 10.696  73.552 1.00 63.71  ? 476 HOH A O   1 
HETATM 6084 O O   . HOH E 3 .   ? -20.989 -2.826  28.157 1.00 68.70  ? 477 HOH A O   1 
HETATM 6085 O O   . HOH E 3 .   ? -49.465 17.719  6.735  1.00 57.61  ? 478 HOH A O   1 
HETATM 6086 O O   . HOH E 3 .   ? -41.086 15.969  16.883 1.00 51.10  ? 479 HOH A O   1 
HETATM 6087 O O   . HOH E 3 .   ? -35.526 11.732  13.365 1.00 51.83  ? 480 HOH A O   1 
HETATM 6088 O O   . HOH E 3 .   ? -34.643 -3.851  44.163 1.00 58.92  ? 481 HOH A O   1 
HETATM 6089 O O   . HOH E 3 .   ? -42.004 -17.097 52.481 1.00 69.56  ? 482 HOH A O   1 
HETATM 6090 O O   . HOH E 3 .   ? -50.562 -8.588  47.923 1.00 58.78  ? 483 HOH A O   1 
HETATM 6091 O O   . HOH F 3 .   ? -68.353 -6.161  -7.735 1.00 60.07  ? 201 HOH B O   1 
HETATM 6092 O O   . HOH F 3 .   ? -54.737 10.048  4.904  1.00 45.82  ? 202 HOH B O   1 
HETATM 6093 O O   . HOH F 3 .   ? -63.495 11.377  -6.444 1.00 44.40  ? 203 HOH B O   1 
HETATM 6094 O O   . HOH F 3 .   ? -58.913 -0.583  18.487 1.00 46.38  ? 204 HOH B O   1 
HETATM 6095 O O   . HOH F 3 .   ? -70.216 3.009   17.017 1.00 63.84  ? 205 HOH B O   1 
HETATM 6096 O O   . HOH F 3 .   ? -61.741 16.108  7.788  1.00 47.48  ? 206 HOH B O   1 
HETATM 6097 O O   . HOH F 3 .   ? -55.779 -2.575  15.236 1.00 43.88  ? 207 HOH B O   1 
HETATM 6098 O O   . HOH F 3 .   ? -54.729 4.697   1.479  1.00 54.31  ? 208 HOH B O   1 
HETATM 6099 O O   . HOH F 3 .   ? -76.708 15.489  6.925  1.00 62.92  ? 209 HOH B O   1 
HETATM 6100 O O   . HOH F 3 .   ? -58.127 11.649  2.297  1.00 52.06  ? 210 HOH B O   1 
HETATM 6101 O O   . HOH F 3 .   ? -54.623 7.080   -3.678 1.00 64.59  ? 211 HOH B O   1 
HETATM 6102 O O   . HOH F 3 .   ? -76.438 6.750   0.972  1.00 60.95  ? 212 HOH B O   1 
HETATM 6103 O O   . HOH F 3 .   ? -61.818 3.799   22.967 1.00 55.88  ? 213 HOH B O   1 
HETATM 6104 O O   . HOH F 3 .   ? -72.820 -11.999 4.970  1.00 58.71  ? 214 HOH B O   1 
HETATM 6105 O O   . HOH F 3 .   ? -71.648 -3.000  20.745 1.00 70.27  ? 215 HOH B O   1 
HETATM 6106 O O   . HOH F 3 .   ? -55.896 11.746  0.060  1.00 66.45  ? 216 HOH B O   1 
HETATM 6107 O O   . HOH F 3 .   ? -73.036 -5.374  22.820 1.00 68.23  ? 217 HOH B O   1 
HETATM 6108 O O   . HOH F 3 .   ? -58.131 -3.652  8.717  1.00 48.34  ? 218 HOH B O   1 
HETATM 6109 O O   . HOH G 3 .   ? 28.722  12.428  58.402 1.00 57.39  ? 401 HOH C O   1 
HETATM 6110 O O   . HOH G 3 .   ? -0.567  11.558  27.281 1.00 30.04  ? 402 HOH C O   1 
HETATM 6111 O O   . HOH G 3 .   ? 2.948   14.441  26.402 1.00 44.67  ? 403 HOH C O   1 
HETATM 6112 O O   . HOH G 3 .   ? 23.150  18.046  66.697 1.00 59.99  ? 404 HOH C O   1 
HETATM 6113 O O   . HOH G 3 .   ? 25.967  -3.464  54.873 1.00 58.78  ? 405 HOH C O   1 
HETATM 6114 O O   . HOH G 3 .   ? -33.980 3.312   13.855 1.00 38.31  ? 406 HOH C O   1 
HETATM 6115 O O   . HOH G 3 .   ? 14.997  -7.259  59.551 1.00 47.59  ? 407 HOH C O   1 
HETATM 6116 O O   . HOH G 3 .   ? -13.183 -7.071  3.174  1.00 65.27  ? 408 HOH C O   1 
HETATM 6117 O O   . HOH G 3 .   ? 5.092   9.687   69.671 1.00 61.79  ? 409 HOH C O   1 
HETATM 6118 O O   . HOH G 3 .   ? 13.931  2.194   75.916 1.00 42.79  ? 410 HOH C O   1 
HETATM 6119 O O   . HOH G 3 .   ? 24.536  3.346   71.228 1.00 40.01  ? 411 HOH C O   1 
HETATM 6120 O O   . HOH G 3 .   ? 7.540   15.296  27.203 1.00 42.09  ? 412 HOH C O   1 
HETATM 6121 O O   . HOH G 3 .   ? 8.016   3.301   42.314 1.00 30.48  ? 413 HOH C O   1 
HETATM 6122 O O   . HOH G 3 .   ? -10.020 -3.507  22.982 1.00 63.87  ? 414 HOH C O   1 
HETATM 6123 O O   . HOH G 3 .   ? 7.652   11.358  75.806 1.00 53.92  ? 415 HOH C O   1 
HETATM 6124 O O   . HOH G 3 .   ? 6.556   10.826  71.956 1.00 74.08  ? 416 HOH C O   1 
HETATM 6125 O O   . HOH G 3 .   ? -14.233 -1.751  24.770 1.00 69.95  ? 417 HOH C O   1 
HETATM 6126 O O   . HOH G 3 .   ? 20.657  12.579  62.054 1.00 43.11  ? 418 HOH C O   1 
HETATM 6127 O O   . HOH G 3 .   ? 4.191   -4.054  34.851 1.00 55.72  ? 419 HOH C O   1 
HETATM 6128 O O   . HOH G 3 .   ? -13.052 15.736  27.252 1.00 37.23  ? 420 HOH C O   1 
HETATM 6129 O O   . HOH G 3 .   ? 15.951  17.137  37.678 1.00 59.72  ? 421 HOH C O   1 
HETATM 6130 O O   . HOH G 3 .   ? -14.275 15.922  29.833 1.00 43.19  ? 422 HOH C O   1 
HETATM 6131 O O   . HOH G 3 .   ? -17.908 5.337   28.050 1.00 41.70  ? 423 HOH C O   1 
HETATM 6132 O O   . HOH G 3 .   ? -12.705 -2.370  8.462  1.00 49.15  ? 424 HOH C O   1 
HETATM 6133 O O   . HOH G 3 .   ? 11.427  14.341  55.968 1.00 62.24  ? 425 HOH C O   1 
HETATM 6134 O O   . HOH G 3 .   ? 20.251  3.822   77.261 1.00 48.67  ? 426 HOH C O   1 
HETATM 6135 O O   . HOH G 3 .   ? -30.314 5.963   13.821 1.00 49.27  ? 427 HOH C O   1 
HETATM 6136 O O   . HOH G 3 .   ? -32.595 4.997   23.999 1.00 53.07  ? 428 HOH C O   1 
HETATM 6137 O O   . HOH G 3 .   ? -5.855  16.652  26.524 1.00 31.36  ? 429 HOH C O   1 
HETATM 6138 O O   . HOH G 3 .   ? -10.505 0.690   46.676 1.00 54.98  ? 430 HOH C O   1 
HETATM 6139 O O   . HOH G 3 .   ? -3.235  12.080  19.043 1.00 47.60  ? 431 HOH C O   1 
HETATM 6140 O O   . HOH G 3 .   ? -7.305  19.721  34.840 1.00 45.63  ? 432 HOH C O   1 
HETATM 6141 O O   . HOH G 3 .   ? 7.763   13.784  73.252 1.00 55.91  ? 433 HOH C O   1 
HETATM 6142 O O   . HOH G 3 .   ? 7.932   10.340  61.241 1.00 39.71  ? 434 HOH C O   1 
HETATM 6143 O O   . HOH G 3 .   ? -24.250 7.794   22.734 1.00 39.79  ? 435 HOH C O   1 
HETATM 6144 O O   . HOH G 3 .   ? -8.767  16.306  25.658 1.00 42.42  ? 436 HOH C O   1 
HETATM 6145 O O   . HOH G 3 .   ? -9.608  10.007  16.443 1.00 37.16  ? 437 HOH C O   1 
HETATM 6146 O O   . HOH G 3 .   ? 13.854  11.879  76.597 1.00 38.68  ? 438 HOH C O   1 
HETATM 6147 O O   . HOH G 3 .   ? 0.801   1.297   43.250 1.00 43.22  ? 439 HOH C O   1 
HETATM 6148 O O   . HOH G 3 .   ? 5.162   -0.908  38.110 1.00 37.40  ? 440 HOH C O   1 
HETATM 6149 O O   . HOH G 3 .   ? 22.633  4.143   47.318 1.00 59.56  ? 441 HOH C O   1 
HETATM 6150 O O   . HOH G 3 .   ? -19.752 13.159  26.090 1.00 47.31  ? 442 HOH C O   1 
HETATM 6151 O O   . HOH G 3 .   ? -4.994  4.745   41.410 1.00 52.36  ? 443 HOH C O   1 
HETATM 6152 O O   . HOH G 3 .   ? -11.428 9.824   9.789  1.00 63.01  ? 444 HOH C O   1 
HETATM 6153 O O   . HOH G 3 .   ? 10.683  11.851  54.520 1.00 48.54  ? 445 HOH C O   1 
HETATM 6154 O O   . HOH G 3 .   ? 7.658   -3.114  35.352 1.00 40.74  ? 446 HOH C O   1 
HETATM 6155 O O   . HOH G 3 .   ? -15.105 19.278  21.238 1.00 55.46  ? 447 HOH C O   1 
HETATM 6156 O O   . HOH G 3 .   ? -9.888  22.807  19.500 1.00 59.25  ? 448 HOH C O   1 
HETATM 6157 O O   . HOH G 3 .   ? -1.010  2.802   19.751 1.00 58.19  ? 449 HOH C O   1 
HETATM 6158 O O   . HOH G 3 .   ? 14.028  16.044  54.468 1.00 54.91  ? 450 HOH C O   1 
HETATM 6159 O O   . HOH G 3 .   ? 8.920   7.177   42.548 1.00 60.97  ? 451 HOH C O   1 
HETATM 6160 O O   . HOH G 3 .   ? -16.180 11.874  12.350 1.00 50.09  ? 452 HOH C O   1 
HETATM 6161 O O   . HOH G 3 .   ? 4.262   5.121   27.418 1.00 51.20  ? 453 HOH C O   1 
HETATM 6162 O O   . HOH G 3 .   ? -22.324 5.242   24.780 1.00 46.21  ? 454 HOH C O   1 
HETATM 6163 O O   . HOH G 3 .   ? -15.610 23.149  24.928 1.00 65.26  ? 455 HOH C O   1 
HETATM 6164 O O   . HOH G 3 .   ? -8.106  -4.516  12.532 1.00 60.90  ? 456 HOH C O   1 
HETATM 6165 O O   . HOH G 3 .   ? 8.372   3.534   67.595 1.00 40.01  ? 457 HOH C O   1 
HETATM 6166 O O   . HOH G 3 .   ? 12.248  17.381  61.359 1.00 47.33  ? 458 HOH C O   1 
HETATM 6167 O O   . HOH G 3 .   ? -34.544 7.046   18.572 1.00 38.78  ? 459 HOH C O   1 
HETATM 6168 O O   . HOH G 3 .   ? -8.243  16.780  21.598 1.00 40.43  ? 460 HOH C O   1 
HETATM 6169 O O   . HOH G 3 .   ? -10.483 22.752  25.617 1.00 49.66  ? 461 HOH C O   1 
HETATM 6170 O O   . HOH G 3 .   ? 7.550   5.574   44.580 1.00 59.15  ? 462 HOH C O   1 
HETATM 6171 O O   . HOH G 3 .   ? 16.600  11.173  42.200 1.00 49.70  ? 463 HOH C O   1 
HETATM 6172 O O   . HOH G 3 .   ? 2.667   11.836  26.234 1.00 46.51  ? 464 HOH C O   1 
HETATM 6173 O O   . HOH G 3 .   ? 16.223  14.617  48.000 1.00 56.05  ? 465 HOH C O   1 
HETATM 6174 O O   . HOH G 3 .   ? -8.114  2.334   35.643 1.00 35.94  ? 466 HOH C O   1 
HETATM 6175 O O   . HOH G 3 .   ? 23.191  -5.045  54.900 1.00 55.77  ? 467 HOH C O   1 
HETATM 6176 O O   . HOH G 3 .   ? 23.695  8.296   40.047 1.00 46.81  ? 468 HOH C O   1 
HETATM 6177 O O   . HOH G 3 .   ? 24.878  2.142   68.070 1.00 51.40  ? 469 HOH C O   1 
HETATM 6178 O O   . HOH G 3 .   ? -3.630  -0.885  51.174 1.00 62.00  ? 470 HOH C O   1 
HETATM 6179 O O   . HOH G 3 .   ? 4.457   3.022   39.368 1.00 37.87  ? 471 HOH C O   1 
HETATM 6180 O O   . HOH G 3 .   ? -10.920 -0.462  35.135 1.00 52.07  ? 472 HOH C O   1 
HETATM 6181 O O   . HOH G 3 .   ? 11.788  -3.135  59.137 1.00 48.40  ? 473 HOH C O   1 
HETATM 6182 O O   . HOH G 3 .   ? 6.879   3.016   35.472 1.00 42.86  ? 474 HOH C O   1 
HETATM 6183 O O   . HOH G 3 .   ? -4.472  3.460   38.764 1.00 50.15  ? 475 HOH C O   1 
HETATM 6184 O O   . HOH G 3 .   ? 24.622  8.189   77.968 1.00 54.21  ? 476 HOH C O   1 
HETATM 6185 O O   . HOH G 3 .   ? -2.456  15.388  23.450 1.00 38.58  ? 477 HOH C O   1 
HETATM 6186 O O   . HOH G 3 .   ? -28.829 -6.491  23.424 1.00 60.16  ? 478 HOH C O   1 
HETATM 6187 O O   . HOH G 3 .   ? -4.716  14.778  20.756 1.00 58.41  ? 479 HOH C O   1 
HETATM 6188 O O   . HOH G 3 .   ? 27.473  0.689   57.998 1.00 59.26  ? 480 HOH C O   1 
HETATM 6189 O O   . HOH G 3 .   ? 23.511  11.615  55.994 1.00 58.28  ? 481 HOH C O   1 
HETATM 6190 O O   . HOH G 3 .   ? 14.904  -4.333  30.202 1.00 55.03  ? 482 HOH C O   1 
HETATM 6191 O O   . HOH G 3 .   ? -18.246 20.266  24.873 1.00 56.40  ? 483 HOH C O   1 
HETATM 6192 O O   . HOH G 3 .   ? 28.406  10.047  58.665 1.00 49.38  ? 484 HOH C O   1 
HETATM 6193 O O   . HOH G 3 .   ? 12.222  19.123  65.693 1.00 61.30  ? 485 HOH C O   1 
HETATM 6194 O O   . HOH G 3 .   ? -14.619 -0.758  9.251  1.00 43.87  ? 486 HOH C O   1 
HETATM 6195 O O   . HOH G 3 .   ? -11.710 8.498   40.315 1.00 68.08  ? 487 HOH C O   1 
HETATM 6196 O O   . HOH G 3 .   ? 23.362  1.563   46.099 1.00 43.66  ? 488 HOH C O   1 
HETATM 6197 O O   . HOH G 3 .   ? 4.868   9.316   20.974 1.00 55.37  ? 489 HOH C O   1 
HETATM 6198 O O   . HOH G 3 .   ? 27.394  3.846   47.878 1.00 56.95  ? 490 HOH C O   1 
HETATM 6199 O O   . HOH G 3 .   ? -10.857 16.104  20.648 1.00 39.22  ? 491 HOH C O   1 
HETATM 6200 O O   . HOH G 3 .   ? -15.039 -2.968  2.476  1.00 67.99  ? 492 HOH C O   1 
HETATM 6201 O O   . HOH G 3 .   ? -34.954 2.819   4.764  1.00 57.86  ? 493 HOH C O   1 
HETATM 6202 O O   . HOH G 3 .   ? 25.776  10.185  56.254 1.00 56.02  ? 494 HOH C O   1 
HETATM 6203 O O   . HOH G 3 .   ? -17.348 5.572   34.109 1.00 55.12  ? 495 HOH C O   1 
HETATM 6204 O O   . HOH G 3 .   ? -21.987 1.741   26.766 1.00 63.98  ? 496 HOH C O   1 
HETATM 6205 O O   . HOH G 3 .   ? -17.246 15.779  22.439 1.00 50.54  ? 497 HOH C O   1 
HETATM 6206 O O   . HOH G 3 .   ? -17.203 6.101   37.478 1.00 63.83  ? 498 HOH C O   1 
HETATM 6207 O O   . HOH G 3 .   ? -20.145 7.663   30.810 1.00 65.17  ? 499 HOH C O   1 
HETATM 6208 O O   . HOH G 3 .   ? 10.136  -9.671  44.981 1.00 60.86  ? 500 HOH C O   1 
HETATM 6209 O O   . HOH G 3 .   ? 23.784  -4.824  63.327 1.00 59.63  ? 501 HOH C O   1 
HETATM 6210 O O   . HOH G 3 .   ? 12.368  14.380  36.712 1.00 69.40  ? 502 HOH C O   1 
HETATM 6211 O O   . HOH G 3 .   ? -13.893 9.889   39.916 1.00 58.04  ? 503 HOH C O   1 
HETATM 6212 O O   . HOH G 3 .   ? -29.250 8.127   18.289 1.00 53.27  ? 504 HOH C O   1 
HETATM 6213 O O   . HOH G 3 .   ? 19.922  -5.211  28.964 1.00 53.44  ? 505 HOH C O   1 
HETATM 6214 O O   . HOH G 3 .   ? 23.616  -3.632  26.615 1.00 48.58  ? 506 HOH C O   1 
HETATM 6215 O O   . HOH G 3 .   ? -22.987 0.285   18.065 1.00 56.93  ? 507 HOH C O   1 
HETATM 6216 O O   . HOH G 3 .   ? -30.022 2.824   14.766 1.00 58.13  ? 508 HOH C O   1 
HETATM 6217 O O   . HOH G 3 .   ? -2.107  4.429   44.195 1.00 67.13  ? 509 HOH C O   1 
HETATM 6218 O O   . HOH G 3 .   ? -13.070 -0.700  32.583 1.00 44.92  ? 510 HOH C O   1 
HETATM 6219 O O   . HOH H 3 .   ? 46.553  19.157  87.344 1.00 60.58  ? 201 HOH D O   1 
HETATM 6220 O O   . HOH H 3 .   ? 26.018  5.872   79.190 1.00 55.96  ? 202 HOH D O   1 
HETATM 6221 O O   . HOH H 3 .   ? 34.794  -0.030  81.481 1.00 57.32  ? 203 HOH D O   1 
HETATM 6222 O O   . HOH H 3 .   ? 37.740  17.611  74.257 1.00 34.60  ? 204 HOH D O   1 
HETATM 6223 O O   . HOH H 3 .   ? 28.674  0.985   77.132 1.00 60.10  ? 205 HOH D O   1 
HETATM 6224 O O   . HOH H 3 .   ? 25.351  12.628  83.179 1.00 57.61  ? 206 HOH D O   1 
HETATM 6225 O O   . HOH H 3 .   ? 31.584  21.271  72.228 1.00 38.42  ? 207 HOH D O   1 
HETATM 6226 O O   . HOH H 3 .   ? 28.896  21.126  77.151 1.00 50.62  ? 208 HOH D O   1 
HETATM 6227 O O   . HOH H 3 .   ? 28.697  4.302   64.033 1.00 46.30  ? 209 HOH D O   1 
HETATM 6228 O O   . HOH H 3 .   ? 53.791  -0.857  68.564 1.00 61.34  ? 210 HOH D O   1 
HETATM 6229 O O   . HOH H 3 .   ? 40.254  14.724  62.498 1.00 57.56  ? 211 HOH D O   1 
HETATM 6230 O O   . HOH H 3 .   ? 47.073  14.493  75.316 1.00 55.16  ? 212 HOH D O   1 
HETATM 6231 O O   . HOH H 3 .   ? 47.973  13.316  64.599 1.00 59.66  ? 213 HOH D O   1 
HETATM 6232 O O   . HOH H 3 .   ? 42.975  7.524   59.195 1.00 56.95  ? 214 HOH D O   1 
HETATM 6233 O O   . HOH H 3 .   ? 33.587  10.496  56.006 1.00 58.51  ? 215 HOH D O   1 
HETATM 6234 O O   . HOH H 3 .   ? 46.103  15.363  80.651 1.00 42.76  ? 216 HOH D O   1 
HETATM 6235 O O   . HOH H 3 .   ? 40.560  12.975  64.642 1.00 46.53  ? 217 HOH D O   1 
HETATM 6236 O O   . HOH H 3 .   ? 46.206  14.914  77.838 1.00 42.41  ? 218 HOH D O   1 
HETATM 6237 O O   . HOH H 3 .   ? 47.502  20.870  82.958 1.00 58.84  ? 219 HOH D O   1 
HETATM 6238 O O   . HOH H 3 .   ? 30.362  20.844  65.291 1.00 45.53  ? 220 HOH D O   1 
HETATM 6239 O O   . HOH H 3 .   ? 37.573  24.292  82.060 1.00 70.23  ? 221 HOH D O   1 
HETATM 6240 O O   . HOH H 3 .   ? 49.771  -4.017  73.375 1.00 59.05  ? 222 HOH D O   1 
HETATM 6241 O O   . HOH H 3 .   ? 37.044  -5.429  71.106 1.00 63.29  ? 223 HOH D O   1 
HETATM 6242 O O   . HOH H 3 .   ? 37.287  15.251  72.953 1.00 33.85  ? 224 HOH D O   1 
HETATM 6243 O O   . HOH H 3 .   ? 33.298  14.571  72.095 1.00 58.88  ? 225 HOH D O   1 
HETATM 6244 O O   . HOH H 3 .   ? 41.249  18.427  63.260 1.00 54.69  ? 226 HOH D O   1 
HETATM 6245 O O   . HOH H 3 .   ? 47.399  18.938  79.018 1.00 55.42  ? 227 HOH D O   1 
HETATM 6246 O O   . HOH H 3 .   ? 38.114  14.555  56.160 1.00 67.26  ? 228 HOH D O   1 
HETATM 6247 O O   . HOH H 3 .   ? 51.138  10.772  68.228 1.00 65.98  ? 229 HOH D O   1 
HETATM 6248 O O   . HOH H 3 .   ? 40.382  -0.790  70.690 1.00 60.04  ? 230 HOH D O   1 
HETATM 6249 O O   . HOH H 3 .   ? 45.194  10.596  89.089 1.00 55.86  ? 231 HOH D O   1 
HETATM 6250 O O   . HOH H 3 .   ? 49.422  -0.975  69.803 1.00 50.89  ? 232 HOH D O   1 
HETATM 6251 O O   . HOH H 3 .   ? 36.219  22.925  78.924 1.00 51.23  ? 233 HOH D O   1 
HETATM 6252 O O   . HOH H 3 .   ? 39.808  13.693  92.054 1.00 52.22  ? 234 HOH D O   1 
HETATM 6253 O O   . HOH H 3 .   ? 42.658  9.737   57.756 1.00 64.44  ? 235 HOH D O   1 
HETATM 6254 O O   . HOH H 3 .   ? 26.371  13.747  81.067 1.00 51.51  ? 236 HOH D O   1 
HETATM 6255 O O   . HOH H 3 .   ? 33.051  14.011  62.291 1.00 38.89  ? 237 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ILE A 5   ? 0.9607 1.4544 0.8173 0.3241  -0.0219 -0.0107 7   ILE A N   
2    C CA  . ILE A 5   ? 0.9532 1.4007 0.7876 0.3286  -0.0319 -0.0327 7   ILE A CA  
3    C C   . ILE A 5   ? 0.9957 1.4556 0.7996 0.3591  -0.0392 -0.0450 7   ILE A C   
4    O O   . ILE A 5   ? 1.0459 1.5400 0.8481 0.3711  -0.0336 -0.0376 7   ILE A O   
5    C CB  . ILE A 5   ? 0.8919 1.3139 0.7386 0.3100  -0.0286 -0.0320 7   ILE A CB  
6    C CG1 . ILE A 5   ? 0.8880 1.2906 0.7600 0.2830  -0.0247 -0.0256 7   ILE A CG1 
7    C CG2 . ILE A 5   ? 0.8171 1.1982 0.6409 0.3160  -0.0399 -0.0516 7   ILE A CG2 
8    C CD1 . ILE A 5   ? 0.8675 1.2296 0.7323 0.2749  -0.0335 -0.0392 7   ILE A CD1 
9    N N   . LYS A 6   ? 1.0066 1.4380 0.7863 0.3719  -0.0533 -0.0640 8   LYS A N   
10   C CA  . LYS A 6   ? 1.0675 1.5084 0.8149 0.4052  -0.0644 -0.0793 8   LYS A CA  
11   C C   . LYS A 6   ? 1.0616 1.4967 0.7953 0.4170  -0.0676 -0.0872 8   LYS A C   
12   O O   . LYS A 6   ? 1.1359 1.6116 0.8582 0.4408  -0.0647 -0.0855 8   LYS A O   
13   C CB  . LYS A 6   ? 1.1070 1.5063 0.8332 0.4125  -0.0830 -0.0991 8   LYS A CB  
14   C CG  . LYS A 6   ? 1.2335 1.6539 0.9302 0.4481  -0.0937 -0.1121 8   LYS A CG  
15   C CD  . LYS A 6   ? 1.3271 1.7039 1.0053 0.4530  -0.1140 -0.1303 8   LYS A CD  
16   C CE  . LYS A 6   ? 1.3272 1.6508 0.9840 0.4589  -0.1352 -0.1505 8   LYS A CE  
17   N NZ  . LYS A 6   ? 1.5816 1.8651 1.2189 0.4667  -0.1588 -0.1677 8   LYS A NZ  
18   N N   . SER A 7   ? 1.0079 1.3947 0.7426 0.4009  -0.0741 -0.0953 9   SER A N   
19   C CA  . SER A 7   ? 0.9729 1.3479 0.6987 0.4062  -0.0770 -0.1014 9   SER A CA  
20   C C   . SER A 7   ? 0.9169 1.2553 0.6612 0.3756  -0.0742 -0.0975 9   SER A C   
21   O O   . SER A 7   ? 0.9082 1.2159 0.6619 0.3556  -0.0778 -0.0983 9   SER A O   
22   C CB  . SER A 7   ? 1.0536 1.3991 0.7451 0.4317  -0.0988 -0.1253 9   SER A CB  
23   O OG  . SER A 7   ? 1.1075 1.3996 0.7948 0.4182  -0.1146 -0.1360 9   SER A OG  
24   N N   . PHE A 8   ? 0.9087 1.2529 0.6570 0.3738  -0.0682 -0.0935 10  PHE A N   
25   C CA  . PHE A 8   ? 0.8607 1.1783 0.6258 0.3479  -0.0641 -0.0891 10  PHE A CA  
26   C C   . PHE A 8   ? 0.8644 1.1858 0.6183 0.3604  -0.0652 -0.0930 10  PHE A C   
27   O O   . PHE A 8   ? 0.8650 1.2279 0.6239 0.3699  -0.0543 -0.0825 10  PHE A O   
28   C CB  . PHE A 8   ? 0.7848 1.1259 0.5819 0.3258  -0.0468 -0.0693 10  PHE A CB  
29   C CG  . PHE A 8   ? 0.7543 1.0698 0.5684 0.3005  -0.0429 -0.0659 10  PHE A CG  
30   C CD1 . PHE A 8   ? 0.7644 1.0386 0.5752 0.2875  -0.0523 -0.0752 10  PHE A CD1 
31   C CD2 . PHE A 8   ? 0.6004 0.9358 0.4344 0.2900  -0.0308 -0.0524 10  PHE A CD2 
32   C CE1 . PHE A 8   ? 0.6876 0.9445 0.5137 0.2658  -0.0481 -0.0714 10  PHE A CE1 
33   C CE2 . PHE A 8   ? 0.6848 0.9984 0.5328 0.2693  -0.0279 -0.0507 10  PHE A CE2 
34   C CZ  . PHE A 8   ? 0.6427 0.9191 0.4861 0.2580  -0.0357 -0.0605 10  PHE A CZ  
35   N N   . GLU A 9   ? 0.8760 1.1552 0.6143 0.3610  -0.0800 -0.1074 11  GLU A N   
36   C CA  . GLU A 9   ? 0.9074 1.1849 0.6299 0.3769  -0.0853 -0.1150 11  GLU A CA  
37   C C   . GLU A 9   ? 0.8755 1.1053 0.5961 0.3613  -0.0961 -0.1221 11  GLU A C   
38   O O   . GLU A 9   ? 0.8806 1.0733 0.5997 0.3486  -0.1084 -0.1276 11  GLU A O   
39   C CB  . GLU A 9   ? 0.9870 1.2702 0.6780 0.4126  -0.1005 -0.1316 11  GLU A CB  
40   C CG  . GLU A 9   ? 1.1403 1.4812 0.8284 0.4353  -0.0905 -0.1249 11  GLU A CG  
41   C CD  . GLU A 9   ? 1.2349 1.6269 0.9351 0.4396  -0.0728 -0.1087 11  GLU A CD  
42   O OE1 . GLU A 9   ? 1.2553 1.6392 0.9541 0.4389  -0.0727 -0.1100 11  GLU A OE1 
43   O OE2 . GLU A 9   ? 1.2315 1.6731 0.9434 0.4432  -0.0600 -0.0933 11  GLU A OE2 
44   N N   . VAL A 10  ? 0.8658 1.0996 0.5867 0.3624  -0.0920 -0.1203 12  VAL A N   
45   C CA  . VAL A 10  ? 0.8869 1.0797 0.6023 0.3526  -0.1039 -0.1275 12  VAL A CA  
46   C C   . VAL A 10  ? 0.9865 1.1600 0.6705 0.3809  -0.1257 -0.1463 12  VAL A C   
47   O O   . VAL A 10  ? 1.0154 1.2177 0.6874 0.4056  -0.1228 -0.1497 12  VAL A O   
48   C CB  . VAL A 10  ? 0.8737 1.0816 0.6049 0.3407  -0.0888 -0.1163 12  VAL A CB  
49   C CG1 . VAL A 10  ? 0.7950 0.9638 0.5214 0.3300  -0.1001 -0.1222 12  VAL A CG1 
50   C CG2 . VAL A 10  ? 0.7923 1.0191 0.5537 0.3158  -0.0697 -0.0992 12  VAL A CG2 
51   N N   . VAL A 11  ? 1.0301 1.1570 0.7010 0.3785  -0.1489 -0.1582 13  VAL A N   
52   C CA  . VAL A 11  ? 1.1190 1.2205 0.7602 0.4051  -0.1741 -0.1775 13  VAL A CA  
53   C C   . VAL A 11  ? 1.1344 1.1888 0.7736 0.3899  -0.1915 -0.1809 13  VAL A C   
54   O O   . VAL A 11  ? 1.1530 1.1707 0.7964 0.3705  -0.2061 -0.1800 13  VAL A O   
55   C CB  . VAL A 11  ? 1.1877 1.2749 0.8084 0.4249  -0.1942 -0.1919 13  VAL A CB  
56   C CG1 . VAL A 11  ? 1.3118 1.3790 0.8986 0.4603  -0.2209 -0.2144 13  VAL A CG1 
57   C CG2 . VAL A 11  ? 1.2097 1.3455 0.8354 0.4358  -0.1759 -0.1856 13  VAL A CG2 
58   N N   . PHE A 12  ? 1.1299 1.1884 0.7639 0.3982  -0.1899 -0.1830 14  PHE A N   
59   C CA  . PHE A 12  ? 1.1858 1.2027 0.8164 0.3869  -0.2072 -0.1863 14  PHE A CA  
60   C C   . PHE A 12  ? 1.2869 1.2578 0.8921 0.4033  -0.2433 -0.2045 14  PHE A C   
61   O O   . PHE A 12  ? 1.3359 1.3139 0.9203 0.4334  -0.2534 -0.2187 14  PHE A O   
62   C CB  . PHE A 12  ? 1.1555 1.1902 0.7833 0.3974  -0.1982 -0.1862 14  PHE A CB  
63   C CG  . PHE A 12  ? 1.0749 1.1518 0.7278 0.3815  -0.1660 -0.1681 14  PHE A CG  
64   C CD1 . PHE A 12  ? 1.0079 1.0757 0.6838 0.3484  -0.1557 -0.1544 14  PHE A CD1 
65   C CD2 . PHE A 12  ? 1.0036 1.1305 0.6569 0.4003  -0.1479 -0.1642 14  PHE A CD2 
66   C CE1 . PHE A 12  ? 0.9632 1.0660 0.6612 0.3350  -0.1294 -0.1393 14  PHE A CE1 
67   C CE2 . PHE A 12  ? 0.9561 1.1185 0.6334 0.3847  -0.1221 -0.1465 14  PHE A CE2 
68   C CZ  . PHE A 12  ? 0.9431 1.0910 0.6426 0.3522  -0.1135 -0.1350 14  PHE A CZ  
69   N N   . ASN A 13  ? 1.3439 1.2691 0.9513 0.3835  -0.2641 -0.2033 15  ASN A N   
70   C CA  . ASN A 13  ? 1.4626 1.3372 1.0481 0.3953  -0.3036 -0.2187 15  ASN A CA  
71   C C   . ASN A 13  ? 1.5482 1.4135 1.1051 0.4322  -0.3222 -0.2392 15  ASN A C   
72   O O   . ASN A 13  ? 1.6263 1.4672 1.1585 0.4584  -0.3502 -0.2580 15  ASN A O   
73   C CB  . ASN A 13  ? 1.4793 1.3108 1.0773 0.3622  -0.3222 -0.2082 15  ASN A CB  
74   C CG  . ASN A 13  ? 1.4778 1.3147 1.0997 0.3302  -0.3113 -0.1908 15  ASN A CG  
75   O OD1 . ASN A 13  ? 1.5063 1.3574 1.1282 0.3357  -0.3053 -0.1923 15  ASN A OD1 
76   N ND2 . ASN A 13  ? 1.4255 1.2535 1.0676 0.2973  -0.3089 -0.1741 15  ASN A ND2 
77   N N   . ASP A 14  ? 1.5496 1.4347 1.1096 0.4351  -0.3073 -0.2361 16  ASP A N   
78   C CA  . ASP A 14  ? 1.6302 1.5213 1.1654 0.4721  -0.3170 -0.2536 16  ASP A CA  
79   C C   . ASP A 14  ? 1.5972 1.5540 1.1385 0.4858  -0.2815 -0.2470 16  ASP A C   
80   O O   . ASP A 14  ? 1.5500 1.5278 1.1071 0.4720  -0.2606 -0.2343 16  ASP A O   
81   C CB  . ASP A 14  ? 1.6571 1.5130 1.1900 0.4643  -0.3338 -0.2550 16  ASP A CB  
82   C CG  . ASP A 14  ? 1.7499 1.6039 1.2539 0.5053  -0.3507 -0.2764 16  ASP A CG  
83   O OD1 . ASP A 14  ? 1.7345 1.6123 1.2181 0.5415  -0.3526 -0.2916 16  ASP A OD1 
84   O OD2 . ASP A 14  ? 1.7881 1.6186 1.2896 0.5024  -0.3625 -0.2781 16  ASP A OD2 
85   N N   . PRO A 15  ? 1.6278 1.6186 1.1576 0.5122  -0.2754 -0.2541 17  PRO A N   
86   C CA  . PRO A 15  ? 1.6174 1.6757 1.1555 0.5234  -0.2430 -0.2439 17  PRO A CA  
87   C C   . PRO A 15  ? 1.6564 1.7466 1.1838 0.5489  -0.2363 -0.2481 17  PRO A C   
88   O O   . PRO A 15  ? 1.6127 1.7601 1.1521 0.5522  -0.2089 -0.2346 17  PRO A O   
89   C CB  . PRO A 15  ? 1.6536 1.7312 1.1769 0.5480  -0.2474 -0.2534 17  PRO A CB  
90   C CG  . PRO A 15  ? 1.6914 1.7107 1.2089 0.5363  -0.2752 -0.2622 17  PRO A CG  
91   C CD  . PRO A 15  ? 1.6998 1.6667 1.2086 0.5318  -0.3011 -0.2709 17  PRO A CD  
92   N N   . GLU A 16  ? 1.7523 1.8063 1.2580 0.5668  -0.2627 -0.2657 18  GLU A N   
93   C CA  . GLU A 16  ? 1.7807 1.8594 1.2767 0.5890  -0.2585 -0.2699 18  GLU A CA  
94   C C   . GLU A 16  ? 1.7939 1.8259 1.2947 0.5686  -0.2712 -0.2693 18  GLU A C   
95   O O   . GLU A 16  ? 1.8837 1.8781 1.3616 0.5887  -0.3008 -0.2883 18  GLU A O   
96   C CB  . GLU A 16  ? 1.8723 1.9608 1.3320 0.6406  -0.2795 -0.2953 18  GLU A CB  
97   C CG  . GLU A 16  ? 1.8602 2.0125 1.3140 0.6668  -0.2628 -0.2941 18  GLU A CG  
98   C CD  . GLU A 16  ? 1.9485 2.1393 1.3726 0.7184  -0.2702 -0.3118 18  GLU A CD  
99   O OE1 . GLU A 16  ? 1.9260 2.0932 1.3338 0.7351  -0.2881 -0.3261 18  GLU A OE1 
100  O OE2 . GLU A 16  ? 1.9495 2.1976 1.3667 0.7431  -0.2579 -0.3108 18  GLU A OE2 
101  N N   . LYS A 17  ? 1.7243 1.7582 1.2547 0.5294  -0.2503 -0.2478 19  LYS A N   
102  C CA  . LYS A 17  ? 1.7154 1.7122 1.2531 0.5077  -0.2588 -0.2440 19  LYS A CA  
103  C C   . LYS A 17  ? 1.6566 1.6878 1.2176 0.4883  -0.2288 -0.2248 19  LYS A C   
104  O O   . LYS A 17  ? 1.5927 1.6604 1.1754 0.4715  -0.2015 -0.2078 19  LYS A O   
105  C CB  . LYS A 17  ? 1.7076 1.6523 1.2564 0.4741  -0.2749 -0.2388 19  LYS A CB  
106  C CG  . LYS A 17  ? 1.6828 1.5864 1.2342 0.4568  -0.2910 -0.2372 19  LYS A CG  
107  C CD  . LYS A 17  ? 1.7001 1.5583 1.2636 0.4231  -0.3077 -0.2289 19  LYS A CD  
108  C CE  . LYS A 17  ? 1.6717 1.5021 1.2434 0.4016  -0.3167 -0.2213 19  LYS A CE  
109  N NZ  . LYS A 17  ? 1.6205 1.4118 1.2051 0.3680  -0.3342 -0.2102 19  LYS A NZ  
110  N N   . VAL A 18  ? 1.6853 1.7019 1.2406 0.4918  -0.2366 -0.2285 20  VAL A N   
111  C CA  . VAL A 18  ? 1.6392 1.6709 1.2154 0.4689  -0.2159 -0.2120 20  VAL A CA  
112  C C   . VAL A 18  ? 1.6350 1.6186 1.2242 0.4331  -0.2268 -0.2051 20  VAL A C   
113  O O   . VAL A 18  ? 1.6935 1.6311 1.2694 0.4351  -0.2551 -0.2155 20  VAL A O   
114  C CB  . VAL A 18  ? 1.6756 1.7157 1.2369 0.4935  -0.2211 -0.2206 20  VAL A CB  
115  C CG1 . VAL A 18  ? 1.6328 1.6712 1.2130 0.4672  -0.2081 -0.2061 20  VAL A CG1 
116  C CG2 . VAL A 18  ? 1.7063 1.8062 1.2586 0.5269  -0.2061 -0.2225 20  VAL A CG2 
117  N N   . TYR A 19  ? 1.5570 1.5528 1.1722 0.4010  -0.2058 -0.1871 21  TYR A N   
118  C CA  . TYR A 19  ? 1.5289 1.4902 1.1586 0.3665  -0.2125 -0.1777 21  TYR A CA  
119  C C   . TYR A 19  ? 1.5170 1.4798 1.1570 0.3523  -0.2038 -0.1691 21  TYR A C   
120  O O   . TYR A 19  ? 1.4939 1.4936 1.1405 0.3583  -0.1823 -0.1634 21  TYR A O   
121  C CB  . TYR A 19  ? 1.4707 1.4461 1.1222 0.3412  -0.1951 -0.1640 21  TYR A CB  
122  C CG  . TYR A 19  ? 1.4144 1.3850 1.0575 0.3514  -0.2046 -0.1712 21  TYR A CG  
123  C CD1 . TYR A 19  ? 1.4334 1.3614 1.0712 0.3414  -0.2301 -0.1752 21  TYR A CD1 
124  C CD2 . TYR A 19  ? 1.4000 1.4099 1.0411 0.3702  -0.1889 -0.1726 21  TYR A CD2 
125  C CE1 . TYR A 19  ? 1.5176 1.4398 1.1474 0.3508  -0.2399 -0.1820 21  TYR A CE1 
126  C CE2 . TYR A 19  ? 1.4288 1.4353 1.0617 0.3801  -0.1975 -0.1795 21  TYR A CE2 
127  C CZ  . TYR A 19  ? 1.4644 1.4257 1.0911 0.3708  -0.2231 -0.1851 21  TYR A CZ  
128  O OH  . TYR A 19  ? 1.4294 1.3854 1.0477 0.3804  -0.2329 -0.1920 21  TYR A OH  
129  N N   . GLY A 20  ? 1.5323 1.4564 1.1744 0.3329  -0.2215 -0.1667 22  GLY A N   
130  C CA  . GLY A 20  ? 1.5171 1.4398 1.1681 0.3184  -0.2155 -0.1586 22  GLY A CA  
131  C C   . GLY A 20  ? 1.4598 1.3947 1.1367 0.2839  -0.1960 -0.1403 22  GLY A C   
132  O O   . GLY A 20  ? 1.4288 1.3784 1.1185 0.2717  -0.1835 -0.1332 22  GLY A O   
133  N N   . SER A 21  ? 1.4491 1.3790 1.1330 0.2699  -0.1939 -0.1333 23  SER A N   
134  C CA  . SER A 21  ? 1.3853 1.3229 1.0910 0.2383  -0.1802 -0.1175 23  SER A CA  
135  C C   . SER A 21  ? 1.3890 1.2998 1.0989 0.2175  -0.1981 -0.1118 23  SER A C   
136  O O   . SER A 21  ? 1.4279 1.3037 1.1239 0.2235  -0.2268 -0.1187 23  SER A O   
137  C CB  . SER A 21  ? 1.3813 1.3178 1.0904 0.2308  -0.1774 -0.1127 23  SER A CB  
138  O OG  . SER A 21  ? 1.3166 1.2663 1.0456 0.2036  -0.1626 -0.0985 23  SER A OG  
139  N N   . GLY A 22  ? 1.3165 1.2450 1.0457 0.1941  -0.1827 -0.0989 24  GLY A N   
140  C CA  . GLY A 22  ? 1.3153 1.2284 1.0519 0.1726  -0.1962 -0.0901 24  GLY A CA  
141  C C   . GLY A 22  ? 1.3536 1.2434 1.0782 0.1831  -0.2172 -0.0982 24  GLY A C   
142  O O   . GLY A 22  ? 1.3820 1.2476 1.1079 0.1683  -0.2390 -0.0920 24  GLY A O   
143  N N   . GLU A 23  ? 1.3559 1.2543 1.0688 0.2088  -0.2120 -0.1111 25  GLU A N   
144  C CA  . GLU A 23  ? 1.4099 1.2875 1.1079 0.2244  -0.2319 -0.1220 25  GLU A CA  
145  C C   . GLU A 23  ? 1.3694 1.2655 1.0775 0.2181  -0.2193 -0.1178 25  GLU A C   
146  O O   . GLU A 23  ? 1.3162 1.2471 1.0377 0.2142  -0.1918 -0.1122 25  GLU A O   
147  C CB  . GLU A 23  ? 1.4536 1.3335 1.1309 0.2592  -0.2350 -0.1392 25  GLU A CB  
148  C CG  . GLU A 23  ? 1.5518 1.4060 1.2083 0.2812  -0.2607 -0.1544 25  GLU A CG  
149  C CD  . GLU A 23  ? 1.6570 1.4612 1.3043 0.2748  -0.2981 -0.1571 25  GLU A CD  
150  O OE1 . GLU A 23  ? 1.6547 1.4454 1.3162 0.2465  -0.3058 -0.1433 25  GLU A OE1 
151  O OE2 . GLU A 23  ? 1.6543 1.4339 1.2807 0.2984  -0.3208 -0.1722 25  GLU A OE2 
152  N N   . LYS A 24  ? 1.3820 1.2528 1.0840 0.2168  -0.2414 -0.1204 26  LYS A N   
153  C CA  . LYS A 24  ? 1.3519 1.2362 1.0618 0.2116  -0.2331 -0.1172 26  LYS A CA  
154  C C   . LYS A 24  ? 1.3170 1.2151 1.0143 0.2395  -0.2267 -0.1306 26  LYS A C   
155  O O   . LYS A 24  ? 1.3934 1.2702 1.0699 0.2621  -0.2475 -0.1448 26  LYS A O   
156  C CB  . LYS A 24  ? 0.5918 0.4431 0.3006 0.1985  -0.2614 -0.1134 26  LYS A CB  
157  C CG  . LYS A 24  ? 0.5714 0.4341 0.3024 0.1663  -0.2544 -0.0942 26  LYS A CG  
158  C CD  . LYS A 24  ? 0.5638 0.4355 0.3019 0.1609  -0.2509 -0.0909 26  LYS A CD  
159  C CE  . LYS A 24  ? 0.5474 0.4319 0.3071 0.1292  -0.2468 -0.0708 26  LYS A CE  
160  N NZ  . LYS A 24  ? 0.5055 0.4319 0.2815 0.1234  -0.2138 -0.0655 26  LYS A NZ  
161  N N   . VAL A 25  ? 1.2284 1.1633 0.9385 0.2379  -0.1992 -0.1255 27  VAL A N   
162  C CA  . VAL A 25  ? 1.1516 1.1051 0.8535 0.2601  -0.1921 -0.1340 27  VAL A CA  
163  C C   . VAL A 25  ? 1.1477 1.0982 0.8583 0.2468  -0.1942 -0.1290 27  VAL A C   
164  O O   . VAL A 25  ? 1.1003 1.0646 0.8313 0.2231  -0.1798 -0.1160 27  VAL A O   
165  C CB  . VAL A 25  ? 1.0835 1.0812 0.7959 0.2663  -0.1619 -0.1294 27  VAL A CB  
166  C CG1 . VAL A 25  ? 1.0290 1.0494 0.7319 0.2911  -0.1565 -0.1367 27  VAL A CG1 
167  C CG2 . VAL A 25  ? 1.0242 1.0263 0.7330 0.2728  -0.1580 -0.1303 27  VAL A CG2 
168  N N   . ALA A 26  ? 1.1712 1.1042 0.8655 0.2633  -0.2129 -0.1401 28  ALA A N   
169  C CA  . ALA A 26  ? 1.1643 1.0892 0.8639 0.2525  -0.2198 -0.1367 28  ALA A CA  
170  C C   . ALA A 26  ? 1.1733 1.1066 0.8578 0.2790  -0.2220 -0.1491 28  ALA A C   
171  O O   . ALA A 26  ? 1.2205 1.1497 0.8836 0.3076  -0.2324 -0.1637 28  ALA A O   
172  C CB  . ALA A 26  ? 1.2040 1.0849 0.8996 0.2383  -0.2519 -0.1348 28  ALA A CB  
173  N N   . GLY A 27  ? 1.1137 1.0610 0.8088 0.2709  -0.2126 -0.1436 29  GLY A N   
174  C CA  . GLY A 27  ? 1.0790 1.0389 0.7615 0.2946  -0.2127 -0.1536 29  GLY A CA  
175  C C   . GLY A 27  ? 1.0445 1.0141 0.7406 0.2810  -0.2052 -0.1460 29  GLY A C   
176  O O   . GLY A 27  ? 1.0138 0.9695 0.7239 0.2553  -0.2094 -0.1358 29  GLY A O   
177  N N   . ARG A 28  ? 1.0265 1.0226 0.7181 0.2991  -0.1945 -0.1504 30  ARG A N   
178  C CA  . ARG A 28  ? 0.9578 0.9679 0.6621 0.2892  -0.1851 -0.1437 30  ARG A CA  
179  C C   . ARG A 28  ? 0.9021 0.9586 0.6162 0.2973  -0.1582 -0.1383 30  ARG A C   
180  O O   . ARG A 28  ? 0.9193 0.9970 0.6216 0.3209  -0.1536 -0.1441 30  ARG A O   
181  C CB  . ARG A 28  ? 1.0277 1.0144 0.7131 0.3042  -0.2090 -0.1557 30  ARG A CB  
182  C CG  . ARG A 28  ? 1.1126 1.0567 0.7988 0.2852  -0.2343 -0.1536 30  ARG A CG  
183  C CD  . ARG A 28  ? 1.2669 1.1695 0.9257 0.3053  -0.2698 -0.1704 30  ARG A CD  
184  N NE  . ARG A 28  ? 1.3053 1.2199 0.9405 0.3421  -0.2732 -0.1877 30  ARG A NE  
185  C CZ  . ARG A 28  ? 1.4426 1.3622 1.0595 0.3685  -0.2765 -0.2000 30  ARG A CZ  
186  N NH1 . ARG A 28  ? 1.3080 1.2188 0.9273 0.3619  -0.2766 -0.1975 30  ARG A NH1 
187  N NH2 . ARG A 28  ? 1.4700 1.4069 1.0657 0.4028  -0.2792 -0.2148 30  ARG A NH2 
188  N N   . VAL A 29  ? 0.8408 0.9146 0.5769 0.2782  -0.1419 -0.1263 31  VAL A N   
189  C CA  . VAL A 29  ? 0.8033 0.9165 0.5487 0.2854  -0.1225 -0.1207 31  VAL A CA  
190  C C   . VAL A 29  ? 0.8152 0.9235 0.5541 0.2914  -0.1317 -0.1252 31  VAL A C   
191  O O   . VAL A 29  ? 0.8116 0.8987 0.5573 0.2740  -0.1397 -0.1226 31  VAL A O   
192  C CB  . VAL A 29  ? 0.7162 0.8507 0.4896 0.2628  -0.1008 -0.1059 31  VAL A CB  
193  C CG1 . VAL A 29  ? 0.7280 0.9016 0.5116 0.2703  -0.0841 -0.0988 31  VAL A CG1 
194  C CG2 . VAL A 29  ? 0.7451 0.8803 0.5243 0.2557  -0.0942 -0.1022 31  VAL A CG2 
195  N N   . ILE A 30  ? 0.8370 0.9677 0.5626 0.3166  -0.1307 -0.1311 32  ILE A N   
196  C CA  . ILE A 30  ? 0.8769 1.0007 0.5906 0.3277  -0.1429 -0.1386 32  ILE A CA  
197  C C   . ILE A 30  ? 0.8556 1.0202 0.5829 0.3289  -0.1239 -0.1288 32  ILE A C   
198  O O   . ILE A 30  ? 0.8080 1.0116 0.5371 0.3423  -0.1099 -0.1238 32  ILE A O   
199  C CB  . ILE A 30  ? 0.9720 1.0812 0.6535 0.3593  -0.1649 -0.1572 32  ILE A CB  
200  C CG1 . ILE A 30  ? 1.0181 1.0802 0.6887 0.3540  -0.1875 -0.1654 32  ILE A CG1 
201  C CG2 . ILE A 30  ? 1.0240 1.1264 0.6922 0.3725  -0.1785 -0.1659 32  ILE A CG2 
202  C CD1 . ILE A 30  ? 1.1755 1.2218 0.8146 0.3867  -0.2099 -0.1849 32  ILE A CD1 
203  N N   . VAL A 31  ? 0.8498 1.0070 0.5891 0.3130  -0.1238 -0.1240 33  VAL A N   
204  C CA  . VAL A 31  ? 0.8231 1.0149 0.5769 0.3116  -0.1080 -0.1141 33  VAL A CA  
205  C C   . VAL A 31  ? 0.8710 1.0570 0.6110 0.3242  -0.1206 -0.1221 33  VAL A C   
206  O O   . VAL A 31  ? 0.9081 1.0579 0.6407 0.3179  -0.1383 -0.1291 33  VAL A O   
207  C CB  . VAL A 31  ? 0.7599 0.9569 0.5439 0.2824  -0.0928 -0.0997 33  VAL A CB  
208  C CG1 . VAL A 31  ? 0.7237 0.9609 0.5240 0.2832  -0.0758 -0.0880 33  VAL A CG1 
209  C CG2 . VAL A 31  ? 0.7357 0.9278 0.5313 0.2678  -0.0853 -0.0945 33  VAL A CG2 
210  N N   . GLU A 32  ? 0.8941 1.1177 0.6309 0.3420  -0.1122 -0.1198 34  GLU A N   
211  C CA  . GLU A 32  ? 0.9268 1.1534 0.6536 0.3536  -0.1202 -0.1250 34  GLU A CA  
212  C C   . GLU A 32  ? 0.9068 1.1779 0.6545 0.3484  -0.0999 -0.1089 34  GLU A C   
213  O O   . GLU A 32  ? 0.8615 1.1664 0.6218 0.3480  -0.0841 -0.0973 34  GLU A O   
214  C CB  . GLU A 32  ? 1.0107 1.2398 0.7050 0.3886  -0.1359 -0.1417 34  GLU A CB  
215  C CG  . GLU A 32  ? 1.1671 1.3480 0.8407 0.3944  -0.1597 -0.1581 34  GLU A CG  
216  C CD  . GLU A 32  ? 1.2907 1.4729 0.9306 0.4324  -0.1770 -0.1771 34  GLU A CD  
217  O OE1 . GLU A 32  ? 1.2489 1.4564 0.8755 0.4553  -0.1785 -0.1824 34  GLU A OE1 
218  O OE2 . GLU A 32  ? 1.3890 1.5466 1.0148 0.4405  -0.1902 -0.1875 34  GLU A OE2 
219  N N   . VAL A 33  ? 0.8999 1.1700 0.6526 0.3430  -0.1016 -0.1071 35  VAL A N   
220  C CA  . VAL A 33  ? 0.9314 1.2406 0.7055 0.3362  -0.0845 -0.0910 35  VAL A CA  
221  C C   . VAL A 33  ? 0.9757 1.3021 0.7376 0.3536  -0.0899 -0.0945 35  VAL A C   
222  O O   . VAL A 33  ? 0.9911 1.2887 0.7331 0.3630  -0.1075 -0.1091 35  VAL A O   
223  C CB  . VAL A 33  ? 0.9084 1.2054 0.7110 0.3052  -0.0758 -0.0800 35  VAL A CB  
224  C CG1 . VAL A 33  ? 0.9336 1.1961 0.7333 0.2950  -0.0884 -0.0871 35  VAL A CG1 
225  C CG2 . VAL A 33  ? 0.9515 1.2893 0.7789 0.2979  -0.0589 -0.0620 35  VAL A CG2 
226  N N   . CYS A 34  ? 0.9954 1.3692 0.7697 0.3578  -0.0760 -0.0801 36  CYS A N   
227  C CA  . CYS A 34  ? 1.0524 1.4514 0.8182 0.3735  -0.0783 -0.0801 36  CYS A CA  
228  C C   . CYS A 34  ? 1.0376 1.4173 0.8171 0.3546  -0.0800 -0.0773 36  CYS A C   
229  O O   . CYS A 34  ? 1.0878 1.4633 0.8530 0.3661  -0.0900 -0.0855 36  CYS A O   
230  C CB  . CYS A 34  ? 1.0342 1.4946 0.8125 0.3810  -0.0629 -0.0613 36  CYS A CB  
231  S SG  . CYS A 34  ? 1.2592 1.7520 1.0205 0.4067  -0.0608 -0.0631 36  CYS A SG  
232  N N   . GLU A 35  ? 0.9983 1.3671 0.8049 0.3266  -0.0707 -0.0664 37  GLU A N   
233  C CA  . GLU A 35  ? 0.9661 1.3218 0.7896 0.3075  -0.0701 -0.0617 37  GLU A CA  
234  C C   . GLU A 35  ? 0.9250 1.2449 0.7625 0.2828  -0.0705 -0.0625 37  GLU A C   
235  O O   . GLU A 35  ? 0.9066 1.2181 0.7462 0.2778  -0.0677 -0.0629 37  GLU A O   
236  C CB  . GLU A 35  ? 0.9435 1.3397 0.7915 0.3003  -0.0559 -0.0426 37  GLU A CB  
237  C CG  . GLU A 35  ? 0.9664 1.3754 0.8386 0.2851  -0.0437 -0.0288 37  GLU A CG  
238  C CD  . GLU A 35  ? 1.1286 1.5818 1.0221 0.2825  -0.0336 -0.0085 37  GLU A CD  
239  O OE1 . GLU A 35  ? 1.1790 1.6653 1.0638 0.2989  -0.0339 -0.0039 37  GLU A OE1 
240  O OE2 . GLU A 35  ? 1.1571 1.6125 1.0762 0.2644  -0.0268 0.0034  37  GLU A OE2 
241  N N   . VAL A 36  ? 0.8811 1.1839 0.7286 0.2679  -0.0735 -0.0618 38  VAL A N   
242  C CA  . VAL A 36  ? 0.8426 1.1199 0.7051 0.2451  -0.0729 -0.0606 38  VAL A CA  
243  C C   . VAL A 36  ? 0.8264 1.1184 0.7109 0.2329  -0.0585 -0.0503 38  VAL A C   
244  O O   . VAL A 36  ? 0.8053 1.1240 0.7086 0.2292  -0.0481 -0.0386 38  VAL A O   
245  C CB  . VAL A 36  ? 0.8445 1.1129 0.7182 0.2319  -0.0754 -0.0581 38  VAL A CB  
246  C CG1 . VAL A 36  ? 0.7873 1.0369 0.6764 0.2101  -0.0742 -0.0559 38  VAL A CG1 
247  C CG2 . VAL A 36  ? 0.8339 1.0830 0.6855 0.2428  -0.0923 -0.0687 38  VAL A CG2 
248  N N   . THR A 37  ? 0.7631 1.0364 0.6452 0.2266  -0.0600 -0.0544 39  THR A N   
249  C CA  . THR A 37  ? 0.7175 1.0024 0.6148 0.2194  -0.0488 -0.0473 39  THR A CA  
250  C C   . THR A 37  ? 0.6486 0.9108 0.5541 0.2021  -0.0497 -0.0495 39  THR A C   
251  O O   . THR A 37  ? 0.6525 0.8900 0.5439 0.2011  -0.0601 -0.0572 39  THR A O   
252  C CB  . THR A 37  ? 0.6986 0.9915 0.5807 0.2348  -0.0489 -0.0502 39  THR A CB  
253  O OG1 . THR A 37  ? 0.8346 1.1583 0.7111 0.2517  -0.0465 -0.0457 39  THR A OG1 
254  C CG2 . THR A 37  ? 0.6972 0.9977 0.5941 0.2262  -0.0392 -0.0433 39  THR A CG2 
255  N N   . ARG A 38  ? 0.6069 0.8787 0.5351 0.1891  -0.0404 -0.0421 40  ARG A N   
256  C CA  . ARG A 38  ? 0.6094 0.8679 0.5461 0.1750  -0.0392 -0.0435 40  ARG A CA  
257  C C   . ARG A 38  ? 0.5713 0.8336 0.5099 0.1758  -0.0336 -0.0424 40  ARG A C   
258  O O   . ARG A 38  ? 0.5153 0.7963 0.4617 0.1808  -0.0272 -0.0362 40  ARG A O   
259  C CB  . ARG A 38  ? 0.6153 0.8809 0.5734 0.1628  -0.0343 -0.0389 40  ARG A CB  
260  C CG  . ARG A 38  ? 0.7042 0.9647 0.6598 0.1610  -0.0405 -0.0399 40  ARG A CG  
261  C CD  . ARG A 38  ? 0.7279 1.0050 0.7015 0.1586  -0.0353 -0.0339 40  ARG A CD  
262  N NE  . ARG A 38  ? 0.8377 1.1209 0.8316 0.1487  -0.0294 -0.0316 40  ARG A NE  
263  C CZ  . ARG A 38  ? 0.8056 1.1003 0.8135 0.1491  -0.0238 -0.0273 40  ARG A CZ  
264  N NH1 . ARG A 38  ? 0.7787 1.0841 0.7848 0.1570  -0.0221 -0.0220 40  ARG A NH1 
265  N NH2 . ARG A 38  ? 0.6627 0.9599 0.6868 0.1422  -0.0214 -0.0279 40  ARG A NH2 
266  N N   . VAL A 39  ? 0.5494 0.7947 0.4821 0.1696  -0.0370 -0.0470 41  VAL A N   
267  C CA  . VAL A 39  ? 0.5118 0.7560 0.4410 0.1717  -0.0341 -0.0477 41  VAL A CA  
268  C C   . VAL A 39  ? 0.4970 0.7356 0.4371 0.1578  -0.0315 -0.0476 41  VAL A C   
269  O O   . VAL A 39  ? 0.5098 0.7372 0.4481 0.1490  -0.0371 -0.0492 41  VAL A O   
270  C CB  . VAL A 39  ? 0.5142 0.7417 0.4188 0.1824  -0.0445 -0.0551 41  VAL A CB  
271  C CG1 . VAL A 39  ? 0.5187 0.7398 0.4185 0.1822  -0.0435 -0.0569 41  VAL A CG1 
272  C CG2 . VAL A 39  ? 0.5190 0.7593 0.4130 0.1994  -0.0454 -0.0557 41  VAL A CG2 
273  N N   . LYS A 40  ? 0.4651 0.7140 0.4172 0.1558  -0.0236 -0.0447 42  LYS A N   
274  C CA  . LYS A 40  ? 0.4286 0.6762 0.3904 0.1457  -0.0206 -0.0455 42  LYS A CA  
275  C C   . LYS A 40  ? 0.4424 0.6774 0.3919 0.1440  -0.0237 -0.0486 42  LYS A C   
276  O O   . LYS A 40  ? 0.4562 0.6872 0.4074 0.1346  -0.0253 -0.0493 42  LYS A O   
277  C CB  . LYS A 40  ? 0.4017 0.6626 0.3806 0.1455  -0.0137 -0.0421 42  LYS A CB  
278  C CG  . LYS A 40  ? 0.5676 0.8377 0.5646 0.1411  -0.0118 -0.0408 42  LYS A CG  
279  C CD  . LYS A 40  ? 0.5995 0.8798 0.6116 0.1438  -0.0099 -0.0353 42  LYS A CD  
280  C CE  . LYS A 40  ? 0.5391 0.8184 0.5595 0.1410  -0.0087 -0.0379 42  LYS A CE  
281  N NZ  . LYS A 40  ? 0.6314 0.9124 0.6608 0.1369  -0.0093 -0.0436 42  LYS A NZ  
282  N N   . ALA A 41  ? 0.4044 0.6367 0.3433 0.1531  -0.0242 -0.0495 43  ALA A N   
283  C CA  . ALA A 41  ? 0.4213 0.6406 0.3484 0.1524  -0.0279 -0.0526 43  ALA A CA  
284  C C   . ALA A 41  ? 0.4582 0.6746 0.3698 0.1661  -0.0311 -0.0548 43  ALA A C   
285  O O   . ALA A 41  ? 0.4540 0.6855 0.3673 0.1759  -0.0271 -0.0519 43  ALA A O   
286  C CB  . ALA A 41  ? 0.4541 0.6800 0.3928 0.1459  -0.0208 -0.0512 43  ALA A CB  
287  N N   . VAL A 42  ? 0.4842 0.6830 0.3809 0.1672  -0.0392 -0.0594 44  VAL A N   
288  C CA  . VAL A 42  ? 0.4842 0.6809 0.3664 0.1807  -0.0417 -0.0626 44  VAL A CA  
289  C C   . VAL A 42  ? 0.4964 0.6845 0.3787 0.1734  -0.0411 -0.0629 44  VAL A C   
290  O O   . VAL A 42  ? 0.4864 0.6595 0.3674 0.1621  -0.0478 -0.0636 44  VAL A O   
291  C CB  . VAL A 42  ? 0.5734 0.7529 0.4340 0.1923  -0.0560 -0.0701 44  VAL A CB  
292  C CG1 . VAL A 42  ? 0.5265 0.6998 0.3704 0.2058  -0.0610 -0.0755 44  VAL A CG1 
293  C CG2 . VAL A 42  ? 0.5790 0.7722 0.4380 0.2032  -0.0552 -0.0700 44  VAL A CG2 
294  N N   . ARG A 43  ? 0.4625 0.6626 0.3480 0.1786  -0.0335 -0.0606 45  ARG A N   
295  C CA  . ARG A 43  ? 0.5160 0.7095 0.4032 0.1711  -0.0319 -0.0605 45  ARG A CA  
296  C C   . ARG A 43  ? 0.5345 0.7280 0.4091 0.1840  -0.0334 -0.0627 45  ARG A C   
297  O O   . ARG A 43  ? 0.5797 0.7858 0.4484 0.1984  -0.0327 -0.0625 45  ARG A O   
298  C CB  . ARG A 43  ? 0.4767 0.6856 0.3842 0.1622  -0.0209 -0.0552 45  ARG A CB  
299  C CG  . ARG A 43  ? 0.5253 0.7429 0.4469 0.1559  -0.0175 -0.0529 45  ARG A CG  
300  C CD  . ARG A 43  ? 0.6480 0.8791 0.5886 0.1510  -0.0097 -0.0492 45  ARG A CD  
301  N NE  . ARG A 43  ? 0.6369 0.8834 0.5878 0.1570  -0.0063 -0.0430 45  ARG A NE  
302  C CZ  . ARG A 43  ? 0.6292 0.8858 0.5872 0.1600  -0.0034 -0.0373 45  ARG A CZ  
303  N NH1 . ARG A 43  ? 0.5512 0.8026 0.5061 0.1587  -0.0026 -0.0387 45  ARG A NH1 
304  N NH2 . ARG A 43  ? 0.4843 0.7572 0.4536 0.1635  -0.0021 -0.0287 45  ARG A NH2 
305  N N   . ILE A 44  ? 0.5625 0.7439 0.4320 0.1799  -0.0362 -0.0646 46  ILE A N   
306  C CA  . ILE A 44  ? 0.6160 0.7999 0.4756 0.1920  -0.0363 -0.0661 46  ILE A CA  
307  C C   . ILE A 44  ? 0.6095 0.7997 0.4797 0.1843  -0.0282 -0.0618 46  ILE A C   
308  O O   . ILE A 44  ? 0.5933 0.7798 0.4739 0.1700  -0.0256 -0.0602 46  ILE A O   
309  C CB  . ILE A 44  ? 0.6629 0.8234 0.4995 0.2017  -0.0517 -0.0749 46  ILE A CB  
310  C CG1 . ILE A 44  ? 0.6185 0.7546 0.4532 0.1867  -0.0610 -0.0759 46  ILE A CG1 
311  C CG2 . ILE A 44  ? 0.6937 0.8505 0.5171 0.2152  -0.0608 -0.0806 46  ILE A CG2 
312  C CD1 . ILE A 44  ? 0.8171 0.9297 0.6321 0.1953  -0.0767 -0.0830 46  ILE A CD1 
313  N N   . LEU A 45  ? 0.5975 0.8000 0.4647 0.1952  -0.0246 -0.0597 47  LEU A N   
314  C CA  . LEU A 45  ? 0.6145 0.8210 0.4887 0.1904  -0.0191 -0.0562 47  LEU A CA  
315  C C   . LEU A 45  ? 0.6374 0.8413 0.4944 0.2050  -0.0241 -0.0599 47  LEU A C   
316  O O   . LEU A 45  ? 0.6637 0.8840 0.5142 0.2206  -0.0237 -0.0589 47  LEU A O   
317  C CB  . LEU A 45  ? 0.5650 0.7958 0.4586 0.1885  -0.0093 -0.0463 47  LEU A CB  
318  C CG  . LEU A 45  ? 0.5993 0.8373 0.5004 0.1862  -0.0048 -0.0411 47  LEU A CG  
319  C CD1 . LEU A 45  ? 0.5586 0.7824 0.4660 0.1721  -0.0043 -0.0442 47  LEU A CD1 
320  C CD2 . LEU A 45  ? 0.6400 0.9029 0.5590 0.1867  0.0006  -0.0291 47  LEU A CD2 
321  N N   . ALA A 46  ? 0.6591 0.8438 0.5079 0.2008  -0.0298 -0.0644 48  ALA A N   
322  C CA  . ALA A 46  ? 0.6815 0.8618 0.5142 0.2146  -0.0355 -0.0688 48  ALA A CA  
323  C C   . ALA A 46  ? 0.6967 0.8860 0.5389 0.2092  -0.0275 -0.0630 48  ALA A C   
324  O O   . ALA A 46  ? 0.6140 0.7984 0.4682 0.1933  -0.0235 -0.0602 48  ALA A O   
325  C CB  . ALA A 46  ? 0.7168 0.8658 0.5330 0.2140  -0.0511 -0.0776 48  ALA A CB  
326  N N   . CYS A 47  ? 0.7313 0.9366 0.5682 0.2235  -0.0253 -0.0610 49  CYS A N   
327  C CA  . CYS A 47  ? 0.7556 0.9735 0.6032 0.2192  -0.0177 -0.0535 49  CYS A CA  
328  C C   . CYS A 47  ? 0.7727 0.9942 0.6061 0.2343  -0.0210 -0.0559 49  CYS A C   
329  O O   . CYS A 47  ? 0.7715 1.0033 0.5909 0.2536  -0.0251 -0.0596 49  CYS A O   
330  C CB  . CYS A 47  ? 0.7459 0.9935 0.6127 0.2175  -0.0079 -0.0410 49  CYS A CB  
331  S SG  . CYS A 47  ? 0.9773 1.2199 0.8658 0.1971  -0.0035 -0.0373 49  CYS A SG  
332  N N   . GLY A 48  ? 0.7477 0.9625 0.5844 0.2268  -0.0195 -0.0542 50  GLY A N   
333  C CA  . GLY A 48  ? 0.7908 1.0131 0.6176 0.2400  -0.0209 -0.0545 50  GLY A CA  
334  C C   . GLY A 48  ? 0.7683 1.0062 0.6123 0.2306  -0.0118 -0.0433 50  GLY A C   
335  O O   . GLY A 48  ? 0.7276 0.9509 0.5806 0.2142  -0.0103 -0.0429 50  GLY A O   
336  N N   . VAL A 49  ? 0.7805 1.0503 0.6294 0.2414  -0.0065 -0.0334 51  VAL A N   
337  C CA  . VAL A 49  ? 0.7656 1.0532 0.6331 0.2324  0.0003  -0.0198 51  VAL A CA  
338  C C   . VAL A 49  ? 0.8082 1.1189 0.6693 0.2475  0.0011  -0.0144 51  VAL A C   
339  O O   . VAL A 49  ? 0.8537 1.1919 0.7072 0.2659  0.0015  -0.0115 51  VAL A O   
340  C CB  . VAL A 49  ? 0.7629 1.0747 0.6517 0.2258  0.0054  -0.0060 51  VAL A CB  
341  C CG1 . VAL A 49  ? 0.7426 1.0704 0.6519 0.2160  0.0086  0.0092  51  VAL A CG1 
342  C CG2 . VAL A 49  ? 0.7759 1.0668 0.6712 0.2124  0.0046  -0.0119 51  VAL A CG2 
343  N N   . ALA A 50  ? 0.7758 1.0779 0.6389 0.2413  0.0013  -0.0133 52  ALA A N   
344  C CA  . ALA A 50  ? 0.7448 1.0740 0.6071 0.2529  0.0034  -0.0044 52  ALA A CA  
345  C C   . ALA A 50  ? 0.7263 1.0802 0.6143 0.2407  0.0089  0.0153  52  ALA A C   
346  O O   . ALA A 50  ? 0.7568 1.0938 0.6593 0.2222  0.0090  0.0175  52  ALA A O   
347  C CB  . ALA A 50  ? 0.7542 1.0612 0.6024 0.2557  -0.0012 -0.0144 52  ALA A CB  
348  N N   . LYS A 51  ? 0.7809 1.1763 0.6745 0.2517  0.0119  0.0304  53  LYS A N   
349  C CA  . LYS A 51  ? 0.8098 1.2303 0.7285 0.2400  0.0141  0.0522  53  LYS A CA  
350  C C   . LYS A 51  ? 0.8592 1.3014 0.7748 0.2492  0.0151  0.0598  53  LYS A C   
351  O O   . LYS A 51  ? 0.8986 1.3721 0.8020 0.2700  0.0167  0.0618  53  LYS A O   
352  C CB  . LYS A 51  ? 0.8299 1.2871 0.7636 0.2412  0.0158  0.0692  53  LYS A CB  
353  C CG  . LYS A 51  ? 0.8764 1.3638 0.8385 0.2288  0.0149  0.0960  53  LYS A CG  
354  C CD  . LYS A 51  ? 1.0089 1.5512 0.9724 0.2439  0.0179  0.1150  53  LYS A CD  
355  C CE  . LYS A 51  ? 0.9902 1.5767 0.9524 0.2585  0.0208  0.1250  53  LYS A CE  
356  N NZ  . LYS A 51  ? 0.9627 1.5644 0.9515 0.2425  0.0180  0.1448  53  LYS A NZ  
357  N N   . VAL A 52  ? 0.8588 1.2847 0.7840 0.2352  0.0137  0.0628  54  VAL A N   
358  C CA  . VAL A 52  ? 0.8805 1.3271 0.8057 0.2413  0.0145  0.0721  54  VAL A CA  
359  C C   . VAL A 52  ? 0.8680 1.3464 0.8218 0.2291  0.0138  0.0993  54  VAL A C   
360  O O   . VAL A 52  ? 0.8616 1.3203 0.8331 0.2095  0.0097  0.1039  54  VAL A O   
361  C CB  . VAL A 52  ? 0.8555 1.2644 0.7702 0.2359  0.0122  0.0576  54  VAL A CB  
362  C CG1 . VAL A 52  ? 0.8968 1.3289 0.8108 0.2440  0.0131  0.0670  54  VAL A CG1 
363  C CG2 . VAL A 52  ? 0.8912 1.2676 0.7798 0.2457  0.0097  0.0334  54  VAL A CG2 
364  N N   . LEU A 53  ? 0.8949 1.4238 0.8528 0.2415  0.0164  0.1175  55  LEU A N   
365  C CA  . LEU A 53  ? 0.9072 1.4742 0.8941 0.2300  0.0140  0.1480  55  LEU A CA  
366  C C   . LEU A 53  ? 0.9228 1.5376 0.9131 0.2406  0.0161  0.1669  55  LEU A C   
367  O O   . LEU A 53  ? 0.9428 1.5790 0.9120 0.2640  0.0210  0.1590  55  LEU A O   
368  C CB  . LEU A 53  ? 0.9296 1.5213 0.9267 0.2302  0.0143  0.1589  55  LEU A CB  
369  C CG  . LEU A 53  ? 0.9378 1.5912 0.9572 0.2300  0.0135  0.1922  55  LEU A CG  
370  C CD1 . LEU A 53  ? 0.9030 1.5505 0.9481 0.2096  0.0064  0.2062  55  LEU A CD1 
371  C CD2 . LEU A 53  ? 0.9954 1.6928 0.9964 0.2568  0.0208  0.1909  55  LEU A CD2 
372  N N   . TRP A 54  ? 0.9286 1.5589 0.9454 0.2236  0.0109  0.1916  56  TRP A N   
373  C CA  . TRP A 54  ? 0.9683 1.6474 0.9937 0.2295  0.0118  0.2146  56  TRP A CA  
374  C C   . TRP A 54  ? 1.0041 1.6999 1.0656 0.2055  0.0022  0.2464  56  TRP A C   
375  O O   . TRP A 54  ? 0.9627 1.6296 1.0390 0.1876  -0.0053 0.2468  56  TRP A O   
376  C CB  . TRP A 54  ? 0.9579 1.6148 0.9670 0.2356  0.0134  0.1996  56  TRP A CB  
377  C CG  . TRP A 54  ? 0.9073 1.5164 0.9275 0.2128  0.0064  0.1954  56  TRP A CG  
378  C CD1 . TRP A 54  ? 0.8595 1.4779 0.9004 0.1986  0.0001  0.2157  56  TRP A CD1 
379  C CD2 . TRP A 54  ? 0.8850 1.4328 0.8962 0.2026  0.0041  0.1699  56  TRP A CD2 
380  N NE1 . TRP A 54  ? 0.8947 1.4599 0.9387 0.1816  -0.0063 0.2025  56  TRP A NE1 
381  C CE2 . TRP A 54  ? 0.8295 1.3531 0.8554 0.1841  -0.0033 0.1748  56  TRP A CE2 
382  C CE3 . TRP A 54  ? 0.7865 1.2998 0.7788 0.2074  0.0069  0.1442  56  TRP A CE3 
383  C CZ2 . TRP A 54  ? 0.7920 1.2619 0.8133 0.1723  -0.0070 0.1543  56  TRP A CZ2 
384  C CZ3 . TRP A 54  ? 0.7950 1.2565 0.7844 0.1939  0.0035  0.1261  56  TRP A CZ3 
385  C CH2 . TRP A 54  ? 0.6867 1.1287 0.6900 0.1775  -0.0029 0.1308  56  TRP A CH2 
386  N N   . MET A 55  ? 1.0908 1.8333 1.1667 0.2056  0.0008  0.2733  57  MET A N   
387  C CA  . MET A 55  ? 1.1567 1.9187 1.2687 0.1824  -0.0113 0.3076  57  MET A CA  
388  C C   . MET A 55  ? 1.1940 1.9565 1.3148 0.1746  -0.0160 0.3185  57  MET A C   
389  O O   . MET A 55  ? 1.2265 2.0354 1.3425 0.1889  -0.0097 0.3302  57  MET A O   
390  C CB  . MET A 55  ? 1.1878 2.0229 1.3174 0.1866  -0.0108 0.3415  57  MET A CB  
391  C CG  . MET A 55  ? 1.2106 2.0404 1.3529 0.1766  -0.0158 0.3466  57  MET A CG  
392  S SD  . MET A 55  ? 1.2997 2.1961 1.4854 0.1583  -0.0285 0.4012  57  MET A SD  
393  C CE  . MET A 55  ? 1.1447 1.9912 1.3510 0.1335  -0.0441 0.4002  57  MET A CE  
394  N N   . GLN A 56  ? 1.2203 1.9324 1.3531 0.1536  -0.0275 0.3138  58  GLN A N   
395  C CA  . GLN A 56  ? 1.2462 1.9510 1.3868 0.1448  -0.0335 0.3217  58  GLN A CA  
396  C C   . GLN A 56  ? 1.2831 2.0412 1.4581 0.1313  -0.0445 0.3666  58  GLN A C   
397  O O   . GLN A 56  ? 1.3002 2.0516 1.5024 0.1109  -0.0601 0.3855  58  GLN A O   
398  C CB  . GLN A 56  ? 1.2284 1.8632 1.3698 0.1282  -0.0435 0.3013  58  GLN A CB  
399  C CG  . GLN A 56  ? 1.2676 1.8821 1.4038 0.1256  -0.0451 0.2951  58  GLN A CG  
400  C CD  . GLN A 56  ? 1.3345 1.9301 1.4358 0.1450  -0.0303 0.2635  58  GLN A CD  
401  O OE1 . GLN A 56  ? 1.3463 1.9044 1.4275 0.1505  -0.0249 0.2347  58  GLN A OE1 
402  N NE2 . GLN A 56  ? 1.2636 1.8848 1.3585 0.1547  -0.0251 0.2699  58  GLN A NE2 
403  N N   . GLY A 57  ? 1.3069 2.1189 1.4812 0.1430  -0.0379 0.3844  59  GLY A N   
404  C CA  . GLY A 57  ? 1.3353 2.2148 1.5412 0.1338  -0.0458 0.4312  59  GLY A CA  
405  C C   . GLY A 57  ? 1.3462 2.2694 1.5634 0.1357  -0.0451 0.4499  59  GLY A C   
406  O O   . GLY A 57  ? 1.3539 2.3378 1.5609 0.1571  -0.0323 0.4578  59  GLY A O   
407  N N   . SER A 58  ? 1.3489 2.2406 1.5862 0.1145  -0.0596 0.4557  60  SER A N   
408  C CA  . SER A 58  ? 1.3561 2.2760 1.6045 0.1131  -0.0609 0.4699  60  SER A CA  
409  C C   . SER A 58  ? 1.3334 2.1862 1.5854 0.0982  -0.0718 0.4503  60  SER A C   
410  O O   . SER A 58  ? 1.3317 2.1976 1.6057 0.0858  -0.0825 0.4705  60  SER A O   
411  C CB  . SER A 58  ? 1.3975 2.3875 1.6838 0.0984  -0.0732 0.5235  60  SER A CB  
412  O OG  . SER A 58  ? 1.4690 2.5340 1.7502 0.1168  -0.0604 0.5421  60  SER A OG  
413  N N   . GLN A 59  ? 1.3051 2.0892 1.5354 0.1002  -0.0694 0.4117  61  GLN A N   
414  C CA  . GLN A 59  ? 1.2764 1.9960 1.5052 0.0899  -0.0778 0.3877  61  GLN A CA  
415  C C   . GLN A 59  ? 1.2235 1.9241 1.4192 0.1098  -0.0599 0.3521  61  GLN A C   
416  O O   . GLN A 59  ? 1.2199 1.9285 1.3887 0.1296  -0.0440 0.3342  61  GLN A O   
417  C CB  . GLN A 59  ? 1.2744 1.9344 1.5027 0.0783  -0.0885 0.3707  61  GLN A CB  
418  C CG  . GLN A 59  ? 1.2969 1.8976 1.5336 0.0638  -0.1047 0.3558  61  GLN A CG  
419  C CD  . GLN A 59  ? 1.3237 1.8654 1.5492 0.0601  -0.1101 0.3288  61  GLN A CD  
420  O OE1 . GLN A 59  ? 1.3107 1.8038 1.5378 0.0527  -0.1217 0.3112  61  GLN A OE1 
421  N NE2 . GLN A 59  ? 1.3141 1.8618 1.5276 0.0664  -0.1019 0.3252  61  GLN A NE2 
422  N N   . GLN A 60  ? 1.1775 1.8515 1.3757 0.1045  -0.0643 0.3419  62  GLN A N   
423  C CA  . GLN A 60  ? 1.1262 1.7855 1.2964 0.1214  -0.0493 0.3120  62  GLN A CA  
424  C C   . GLN A 60  ? 1.0782 1.6718 1.2243 0.1242  -0.0453 0.2714  62  GLN A C   
425  O O   . GLN A 60  ? 1.0644 1.6162 1.2158 0.1135  -0.0540 0.2591  62  GLN A O   
426  C CB  . GLN A 60  ? 1.1342 1.8087 1.3179 0.1169  -0.0536 0.3235  62  GLN A CB  
427  C CG  . GLN A 60  ? 1.1782 1.8323 1.3948 0.0922  -0.0761 0.3417  62  GLN A CG  
428  C CD  . GLN A 60  ? 1.2206 1.9330 1.4708 0.0803  -0.0878 0.3885  62  GLN A CD  
429  O OE1 . GLN A 60  ? 1.2284 2.0015 1.4771 0.0920  -0.0770 0.4064  62  GLN A OE1 
430  N NE2 . GLN A 60  ? 1.1625 1.8574 1.4433 0.0575  -0.1116 0.4086  62  GLN A NE2 
431  N N   . CYS A 61  ? 1.0271 1.6147 1.1467 0.1394  -0.0328 0.2517  63  CYS A N   
432  C CA  . CYS A 61  ? 0.9552 1.4875 1.0513 0.1424  -0.0284 0.2163  63  CYS A CA  
433  C C   . CYS A 61  ? 0.9008 1.4255 0.9679 0.1604  -0.0153 0.1911  63  CYS A C   
434  O O   . CYS A 61  ? 0.8956 1.4525 0.9478 0.1783  -0.0061 0.1919  63  CYS A O   
435  C CB  . CYS A 61  ? 0.9446 1.4637 1.0346 0.1417  -0.0285 0.2116  63  CYS A CB  
436  S SG  . CYS A 61  ? 0.9785 1.4635 1.0934 0.1180  -0.0473 0.2194  63  CYS A SG  
437  N N   . LYS A 62  ? 0.8392 1.3215 0.8982 0.1561  -0.0160 0.1688  64  LYS A N   
438  C CA  . LYS A 62  ? 0.8172 1.2878 0.8517 0.1698  -0.0068 0.1462  64  LYS A CA  
439  C C   . LYS A 62  ? 0.7800 1.1985 0.8039 0.1631  -0.0080 0.1202  64  LYS A C   
440  O O   . LYS A 62  ? 0.7872 1.1847 0.8266 0.1488  -0.0164 0.1209  64  LYS A O   
441  C CB  . LYS A 62  ? 0.8447 1.3426 0.8872 0.1729  -0.0061 0.1573  64  LYS A CB  
442  C CG  . LYS A 62  ? 0.8130 1.2903 0.8365 0.1811  -0.0007 0.1349  64  LYS A CG  
443  C CD  . LYS A 62  ? 0.9069 1.4156 0.9414 0.1832  -0.0008 0.1495  64  LYS A CD  
444  C CE  . LYS A 62  ? 0.9292 1.4065 0.9639 0.1762  -0.0030 0.1354  64  LYS A CE  
445  N NZ  . LYS A 62  ? 1.0055 1.5143 1.0545 0.1759  -0.0045 0.1527  64  LYS A NZ  
446  N N   . GLN A 63  ? 0.7770 1.1769 0.7751 0.1739  -0.0010 0.0982  65  GLN A N   
447  C CA  . GLN A 63  ? 0.7542 1.1118 0.7401 0.1692  -0.0009 0.0746  65  GLN A CA  
448  C C   . GLN A 63  ? 0.7664 1.1234 0.7360 0.1802  0.0039  0.0629  65  GLN A C   
449  O O   . GLN A 63  ? 0.7872 1.1635 0.7428 0.1958  0.0078  0.0627  65  GLN A O   
450  C CB  . GLN A 63  ? 0.7799 1.1145 0.7504 0.1701  0.0004  0.0612  65  GLN A CB  
451  C CG  . GLN A 63  ? 0.7155 1.0138 0.6688 0.1681  0.0016  0.0379  65  GLN A CG  
452  C CD  . GLN A 63  ? 0.7839 1.0628 0.7243 0.1674  0.0016  0.0280  65  GLN A CD  
453  O OE1 . GLN A 63  ? 0.7132 1.0037 0.6534 0.1711  0.0018  0.0356  65  GLN A OE1 
454  N NE2 . GLN A 63  ? 0.6087 0.8605 0.5388 0.1623  0.0012  0.0125  65  GLN A NE2 
455  N N   . THR A 64  ? 0.7655 1.1009 0.7367 0.1730  0.0024  0.0528  66  THR A N   
456  C CA  . THR A 64  ? 0.7191 1.0498 0.6772 0.1805  0.0054  0.0416  66  THR A CA  
457  C C   . THR A 64  ? 0.6897 0.9848 0.6332 0.1766  0.0053  0.0212  66  THR A C   
458  O O   . THR A 64  ? 0.7307 1.0073 0.6822 0.1647  0.0028  0.0166  66  THR A O   
459  C CB  . THR A 64  ? 0.7187 1.0586 0.6941 0.1742  0.0031  0.0502  66  THR A CB  
460  O OG1 . THR A 64  ? 0.6430 1.0193 0.6345 0.1756  0.0018  0.0729  66  THR A OG1 
461  C CG2 . THR A 64  ? 0.6928 1.0285 0.6554 0.1815  0.0059  0.0395  66  THR A CG2 
462  N N   . SER A 65  ? 0.6806 0.9676 0.6032 0.1870  0.0064  0.0095  67  SER A N   
463  C CA  . SER A 65  ? 0.6664 0.9224 0.5756 0.1822  0.0046  -0.0068 67  SER A CA  
464  C C   . SER A 65  ? 0.6972 0.9463 0.5931 0.1892  0.0031  -0.0158 67  SER A C   
465  O O   . SER A 65  ? 0.7172 0.9729 0.5985 0.2041  0.0015  -0.0184 67  SER A O   
466  C CB  . SER A 65  ? 0.6918 0.9357 0.5874 0.1852  0.0029  -0.0125 67  SER A CB  
467  O OG  . SER A 65  ? 0.5952 0.8477 0.5021 0.1804  0.0039  -0.0033 67  SER A OG  
468  N N   . GLU A 66  ? 0.6628 0.8991 0.5631 0.1798  0.0027  -0.0212 68  GLU A N   
469  C CA  . GLU A 66  ? 0.6636 0.8882 0.5514 0.1834  -0.0003 -0.0303 68  GLU A CA  
470  C C   . GLU A 66  ? 0.6162 0.8168 0.4885 0.1812  -0.0057 -0.0401 68  GLU A C   
471  O O   . GLU A 66  ? 0.6425 0.8350 0.5179 0.1722  -0.0053 -0.0405 68  GLU A O   
472  C CB  . GLU A 66  ? 0.6362 0.8576 0.5353 0.1733  0.0010  -0.0314 68  GLU A CB  
473  C CG  . GLU A 66  ? 0.7212 0.9626 0.6391 0.1720  0.0040  -0.0209 68  GLU A CG  
474  C CD  . GLU A 66  ? 0.7379 0.9723 0.6673 0.1615  0.0039  -0.0241 68  GLU A CD  
475  O OE1 . GLU A 66  ? 0.6804 0.9014 0.6010 0.1588  0.0027  -0.0331 68  GLU A OE1 
476  O OE2 . GLU A 66  ? 0.7271 0.9691 0.6742 0.1561  0.0034  -0.0174 68  GLU A OE2 
477  N N   . TYR A 67  ? 0.6456 0.8347 0.5016 0.1895  -0.0125 -0.0474 69  TYR A N   
478  C CA  . TYR A 67  ? 0.6460 0.8094 0.4881 0.1860  -0.0217 -0.0553 69  TYR A CA  
479  C C   . TYR A 67  ? 0.6989 0.8485 0.5364 0.1816  -0.0281 -0.0602 69  TYR A C   
480  O O   . TYR A 67  ? 0.7046 0.8344 0.5360 0.1728  -0.0365 -0.0634 69  TYR A O   
481  C CB  . TYR A 67  ? 0.7008 0.8590 0.5256 0.2020  -0.0291 -0.0598 69  TYR A CB  
482  C CG  . TYR A 67  ? 0.7332 0.9025 0.5617 0.2041  -0.0241 -0.0547 69  TYR A CG  
483  C CD1 . TYR A 67  ? 0.7117 0.9097 0.5488 0.2127  -0.0160 -0.0462 69  TYR A CD1 
484  C CD2 . TYR A 67  ? 0.7948 0.9475 0.6199 0.1960  -0.0278 -0.0565 69  TYR A CD2 
485  C CE1 . TYR A 67  ? 0.7720 0.9810 0.6139 0.2134  -0.0123 -0.0400 69  TYR A CE1 
486  C CE2 . TYR A 67  ? 0.7178 0.8801 0.5467 0.1973  -0.0234 -0.0517 69  TYR A CE2 
487  C CZ  . TYR A 67  ? 0.7379 0.9277 0.5751 0.2061  -0.0158 -0.0436 69  TYR A CZ  
488  O OH  . TYR A 67  ? 0.8063 1.0061 0.6482 0.2064  -0.0125 -0.0375 69  TYR A OH  
489  N N   . LEU A 68  ? 0.7008 0.8625 0.5422 0.1872  -0.0250 -0.0592 70  LEU A N   
490  C CA  . LEU A 68  ? 0.7153 0.8672 0.5541 0.1836  -0.0302 -0.0628 70  LEU A CA  
491  C C   . LEU A 68  ? 0.6909 0.8609 0.5463 0.1788  -0.0207 -0.0577 70  LEU A C   
492  O O   . LEU A 68  ? 0.6572 0.8474 0.5194 0.1866  -0.0144 -0.0524 70  LEU A O   
493  C CB  . LEU A 68  ? 0.7596 0.9051 0.5810 0.2009  -0.0400 -0.0694 70  LEU A CB  
494  C CG  . LEU A 68  ? 0.7349 0.8678 0.5510 0.1999  -0.0483 -0.0737 70  LEU A CG  
495  C CD1 . LEU A 68  ? 0.7868 0.8933 0.5985 0.1861  -0.0603 -0.0756 70  LEU A CD1 
496  C CD2 . LEU A 68  ? 0.7476 0.8803 0.5465 0.2219  -0.0568 -0.0809 70  LEU A CD2 
497  N N   . ARG A 69  ? 0.7267 0.8912 0.5890 0.1662  -0.0208 -0.0581 71  ARG A N   
498  C CA  . ARG A 69  ? 0.7356 0.9138 0.6122 0.1625  -0.0142 -0.0550 71  ARG A CA  
499  C C   . ARG A 69  ? 0.7413 0.9097 0.6170 0.1535  -0.0188 -0.0578 71  ARG A C   
500  O O   . ARG A 69  ? 0.7403 0.9071 0.6215 0.1416  -0.0180 -0.0573 71  ARG A O   
501  C CB  . ARG A 69  ? 0.7459 0.9355 0.6392 0.1549  -0.0066 -0.0508 71  ARG A CB  
502  C CG  . ARG A 69  ? 0.7821 0.9850 0.6913 0.1528  -0.0020 -0.0474 71  ARG A CG  
503  C CD  . ARG A 69  ? 0.9318 1.1397 0.8549 0.1461  0.0012  -0.0457 71  ARG A CD  
504  N NE  . ARG A 69  ? 1.0011 1.2223 0.9397 0.1482  0.0028  -0.0386 71  ARG A NE  
505  C CZ  . ARG A 69  ? 1.0751 1.2999 1.0254 0.1454  0.0026  -0.0348 71  ARG A CZ  
506  N NH1 . ARG A 69  ? 0.9748 1.1921 0.9217 0.1417  0.0023  -0.0386 71  ARG A NH1 
507  N NH2 . ARG A 69  ? 1.1194 1.3553 1.0853 0.1460  0.0010  -0.0262 71  ARG A NH2 
508  N N   . TYR A 70  ? 0.6958 0.8601 0.5644 0.1597  -0.0239 -0.0601 72  TYR A N   
509  C CA  . TYR A 70  ? 0.6884 0.8416 0.5544 0.1515  -0.0310 -0.0616 72  TYR A CA  
510  C C   . TYR A 70  ? 0.6866 0.8495 0.5590 0.1543  -0.0279 -0.0611 72  TYR A C   
511  O O   . TYR A 70  ? 0.6929 0.8615 0.5607 0.1670  -0.0276 -0.0620 72  TYR A O   
512  C CB  . TYR A 70  ? 0.6871 0.8177 0.5347 0.1564  -0.0459 -0.0660 72  TYR A CB  
513  C CG  . TYR A 70  ? 0.7778 0.8959 0.6222 0.1498  -0.0565 -0.0663 72  TYR A CG  
514  C CD1 . TYR A 70  ? 0.7575 0.8703 0.6066 0.1330  -0.0615 -0.0614 72  TYR A CD1 
515  C CD2 . TYR A 70  ? 0.7259 0.8401 0.5630 0.1603  -0.0620 -0.0703 72  TYR A CD2 
516  C CE1 . TYR A 70  ? 0.7163 0.8197 0.5642 0.1254  -0.0724 -0.0591 72  TYR A CE1 
517  C CE2 . TYR A 70  ? 0.6892 0.7905 0.5237 0.1536  -0.0731 -0.0700 72  TYR A CE2 
518  C CZ  . TYR A 70  ? 0.7341 0.8298 0.5747 0.1355  -0.0786 -0.0637 72  TYR A CZ  
519  O OH  . TYR A 70  ? 0.7311 0.8164 0.5711 0.1272  -0.0907 -0.0608 72  TYR A OH  
520  N N   . GLU A 71  ? 0.6741 0.8421 0.5573 0.1432  -0.0253 -0.0593 73  GLU A N   
521  C CA  . GLU A 71  ? 0.6811 0.8559 0.5697 0.1450  -0.0239 -0.0589 73  GLU A CA  
522  C C   . GLU A 71  ? 0.6263 0.7938 0.5140 0.1350  -0.0308 -0.0585 73  GLU A C   
523  O O   . GLU A 71  ? 0.6012 0.7681 0.4915 0.1239  -0.0323 -0.0562 73  GLU A O   
524  C CB  . GLU A 71  ? 0.6963 0.8898 0.6023 0.1442  -0.0135 -0.0560 73  GLU A CB  
525  C CG  . GLU A 71  ? 0.7970 0.9971 0.7145 0.1339  -0.0094 -0.0559 73  GLU A CG  
526  C CD  . GLU A 71  ? 0.9265 1.1368 0.8561 0.1358  -0.0033 -0.0545 73  GLU A CD  
527  O OE1 . GLU A 71  ? 0.8881 1.1054 0.8237 0.1423  -0.0013 -0.0510 73  GLU A OE1 
528  O OE2 . GLU A 71  ? 0.9658 1.1778 0.8989 0.1308  -0.0016 -0.0559 73  GLU A OE2 
529  N N   . ASP A 72  ? 0.6358 0.7994 0.5195 0.1394  -0.0357 -0.0598 74  ASP A N   
530  C CA  . ASP A 72  ? 0.6390 0.7955 0.5221 0.1302  -0.0440 -0.0580 74  ASP A CA  
531  C C   . ASP A 72  ? 0.5862 0.7486 0.4727 0.1351  -0.0427 -0.0588 74  ASP A C   
532  O O   . ASP A 72  ? 0.5276 0.6935 0.4104 0.1477  -0.0401 -0.0613 74  ASP A O   
533  C CB  . ASP A 72  ? 0.7343 0.8658 0.6010 0.1300  -0.0611 -0.0595 74  ASP A CB  
534  C CG  . ASP A 72  ? 0.8443 0.9689 0.7133 0.1152  -0.0723 -0.0535 74  ASP A CG  
535  O OD1 . ASP A 72  ? 0.9667 1.1090 0.8492 0.1028  -0.0652 -0.0472 74  ASP A OD1 
536  O OD2 . ASP A 72  ? 0.8683 0.9706 0.7255 0.1165  -0.0895 -0.0548 74  ASP A OD2 
537  N N   . THR A 73  ? 0.5789 0.7452 0.4727 0.1251  -0.0443 -0.0556 75  THR A N   
538  C CA  . THR A 73  ? 0.5460 0.7164 0.4428 0.1286  -0.0442 -0.0561 75  THR A CA  
539  C C   . THR A 73  ? 0.6073 0.7567 0.4910 0.1272  -0.0609 -0.0566 75  THR A C   
540  O O   . THR A 73  ? 0.6564 0.7984 0.5401 0.1148  -0.0697 -0.0518 75  THR A O   
541  C CB  . THR A 73  ? 0.5587 0.7484 0.4730 0.1195  -0.0357 -0.0525 75  THR A CB  
542  O OG1 . THR A 73  ? 0.5630 0.7673 0.4882 0.1240  -0.0240 -0.0537 75  THR A OG1 
543  C CG2 . THR A 73  ? 0.4464 0.6386 0.3638 0.1206  -0.0374 -0.0521 75  THR A CG2 
544  N N   . LEU A 74  ? 0.6164 0.7566 0.4888 0.1403  -0.0669 -0.0618 76  LEU A N   
545  C CA  . LEU A 74  ? 0.6520 0.7677 0.5098 0.1414  -0.0860 -0.0643 76  LEU A CA  
546  C C   . LEU A 74  ? 0.7041 0.8205 0.5678 0.1338  -0.0906 -0.0608 76  LEU A C   
547  O O   . LEU A 74  ? 0.6522 0.7880 0.5276 0.1341  -0.0784 -0.0593 76  LEU A O   
548  C CB  . LEU A 74  ? 0.7200 0.8244 0.5590 0.1621  -0.0932 -0.0737 76  LEU A CB  
549  C CG  . LEU A 74  ? 0.6410 0.7511 0.4756 0.1715  -0.0860 -0.0764 76  LEU A CG  
550  C CD1 . LEU A 74  ? 0.7100 0.8149 0.5255 0.1942  -0.0933 -0.0855 76  LEU A CD1 
551  C CD2 . LEU A 74  ? 0.6478 0.7440 0.4813 0.1602  -0.0923 -0.0739 76  LEU A CD2 
552  N N   . LEU A 75  ? 0.7696 0.8645 0.6263 0.1262  -0.1098 -0.0585 77  LEU A N   
553  C CA  . LEU A 75  ? 0.8193 0.9142 0.6826 0.1161  -0.1166 -0.0529 77  LEU A CA  
554  C C   . LEU A 75  ? 0.8720 0.9370 0.7186 0.1227  -0.1399 -0.0579 77  LEU A C   
555  O O   . LEU A 75  ? 0.9371 0.9769 0.7693 0.1270  -0.1568 -0.0619 77  LEU A O   
556  C CB  . LEU A 75  ? 0.8255 0.9287 0.7021 0.0944  -0.1190 -0.0401 77  LEU A CB  
557  C CG  . LEU A 75  ? 0.8682 0.9969 0.7580 0.0876  -0.1013 -0.0358 77  LEU A CG  
558  C CD1 . LEU A 75  ? 0.8643 1.0024 0.7640 0.0676  -0.1081 -0.0221 77  LEU A CD1 
559  C CD2 . LEU A 75  ? 0.8866 1.0420 0.7892 0.0930  -0.0808 -0.0386 77  LEU A CD2 
560  N N   . LEU A 76  ? 0.8622 0.9293 0.7107 0.1240  -0.1419 -0.0580 78  LEU A N   
561  C CA  . LEU A 76  ? 0.9081 0.9474 0.7420 0.1297  -0.1654 -0.0627 78  LEU A CA  
562  C C   . LEU A 76  ? 0.9487 0.9751 0.7900 0.1080  -0.1837 -0.0502 78  LEU A C   
563  O O   . LEU A 76  ? 0.9101 0.9599 0.7702 0.0915  -0.1733 -0.0383 78  LEU A O   
564  C CB  . LEU A 76  ? 0.8548 0.9058 0.6893 0.1397  -0.1580 -0.0669 78  LEU A CB  
565  C CG  . LEU A 76  ? 0.8389 0.9040 0.6653 0.1621  -0.1448 -0.0771 78  LEU A CG  
566  C CD1 . LEU A 76  ? 0.7796 0.8576 0.6103 0.1663  -0.1394 -0.0773 78  LEU A CD1 
567  C CD2 . LEU A 76  ? 0.9366 0.9789 0.7382 0.1824  -0.1613 -0.0896 78  LEU A CD2 
568  N N   . GLU A 77  ? 0.9861 0.9769 0.8131 0.1085  -0.2121 -0.0523 79  GLU A N   
569  C CA  . GLU A 77  ? 1.0187 0.9946 0.8529 0.0866  -0.2346 -0.0378 79  GLU A CA  
570  C C   . GLU A 77  ? 1.0152 0.9989 0.8587 0.0786  -0.2368 -0.0313 79  GLU A C   
571  O O   . GLU A 77  ? 0.9979 0.9900 0.8568 0.0564  -0.2437 -0.0140 79  GLU A O   
572  C CB  . GLU A 77  ? 1.1068 1.0377 0.9226 0.0913  -0.2686 -0.0431 79  GLU A CB  
573  C CG  . GLU A 77  ? 1.2100 1.1315 1.0182 0.0958  -0.2699 -0.0470 79  GLU A CG  
574  C CD  . GLU A 77  ? 1.3549 1.2282 1.1437 0.1026  -0.3070 -0.0540 79  GLU A CD  
575  O OE1 . GLU A 77  ? 1.4083 1.2700 1.1857 0.1137  -0.3095 -0.0625 79  GLU A OE1 
576  O OE2 . GLU A 77  ? 1.5077 1.3536 1.2927 0.0974  -0.3351 -0.0512 79  GLU A OE2 
577  N N   . ASP A 78  ? 0.9530 0.9376 0.7881 0.0965  -0.2304 -0.0436 80  ASP A N   
578  C CA  . ASP A 78  ? 0.9653 0.9571 0.8089 0.0897  -0.2321 -0.0379 80  ASP A CA  
579  C C   . ASP A 78  ? 0.9088 0.9434 0.7734 0.0823  -0.2023 -0.0308 80  ASP A C   
580  O O   . ASP A 78  ? 0.9331 0.9786 0.8063 0.0776  -0.1998 -0.0264 80  ASP A O   
581  C CB  . ASP A 78  ? 0.9621 0.9343 0.7870 0.1111  -0.2429 -0.0532 80  ASP A CB  
582  C CG  . ASP A 78  ? 1.0671 1.0358 0.8981 0.1020  -0.2540 -0.0467 80  ASP A CG  
583  O OD1 . ASP A 78  ? 0.9821 0.9314 0.8172 0.0845  -0.2782 -0.0351 80  ASP A OD1 
584  O OD2 . ASP A 78  ? 1.0065 0.9928 0.8392 0.1116  -0.2390 -0.0517 80  ASP A OD2 
585  N N   . GLN A 79  ? 0.8309 0.8884 0.7034 0.0820  -0.1810 -0.0302 81  GLN A N   
586  C CA  . GLN A 79  ? 0.7734 0.8691 0.6653 0.0763  -0.1556 -0.0248 81  GLN A CA  
587  C C   . GLN A 79  ? 0.7753 0.8907 0.6811 0.0595  -0.1496 -0.0125 81  GLN A C   
588  O O   . GLN A 79  ? 0.7538 0.8830 0.6621 0.0637  -0.1340 -0.0159 81  GLN A O   
589  C CB  . GLN A 79  ? 0.7240 0.8335 0.6138 0.0943  -0.1346 -0.0364 81  GLN A CB  
590  C CG  . GLN A 79  ? 0.8014 0.8994 0.6780 0.1120  -0.1389 -0.0471 81  GLN A CG  
591  C CD  . GLN A 79  ? 0.9119 1.0197 0.7975 0.1080  -0.1377 -0.0433 81  GLN A CD  
592  O OE1 . GLN A 79  ? 0.8247 0.9546 0.7285 0.0950  -0.1277 -0.0343 81  GLN A OE1 
593  N NE2 . GLN A 79  ? 0.8902 0.9830 0.7621 0.1211  -0.1479 -0.0512 81  GLN A NE2 
594  N N   . PRO A 80  ? 0.7992 0.9200 0.7150 0.0403  -0.1618 0.0031  82  PRO A N   
595  C CA  . PRO A 80  ? 0.7910 0.9296 0.7173 0.0242  -0.1613 0.0168  82  PRO A CA  
596  C C   . PRO A 80  ? 0.7681 0.9518 0.7119 0.0210  -0.1367 0.0211  82  PRO A C   
597  O O   . PRO A 80  ? 0.7439 0.9503 0.6968 0.0098  -0.1333 0.0319  82  PRO A O   
598  C CB  . PRO A 80  ? 0.7974 0.9281 0.7289 0.0051  -0.1855 0.0340  82  PRO A CB  
599  C CG  . PRO A 80  ? 0.8579 0.9899 0.7920 0.0087  -0.1854 0.0317  82  PRO A CG  
600  C CD  . PRO A 80  ? 0.8055 0.9223 0.7255 0.0322  -0.1750 0.0105  82  PRO A CD  
601  N N   . THR A 81  ? 0.7184 0.9155 0.6666 0.0316  -0.1212 0.0126  83  THR A N   
602  C CA  . THR A 81  ? 0.7291 0.9670 0.6945 0.0287  -0.1033 0.0168  83  THR A CA  
603  C C   . THR A 81  ? 0.6949 0.9528 0.6644 0.0365  -0.0844 0.0098  83  THR A C   
604  O O   . THR A 81  ? 0.7363 1.0290 0.7187 0.0333  -0.0735 0.0143  83  THR A O   
605  C CB  . THR A 81  ? 0.7124 0.9564 0.6830 0.0349  -0.0978 0.0125  83  THR A CB  
606  O OG1 . THR A 81  ? 0.7709 0.9873 0.7285 0.0496  -0.0989 -0.0009 83  THR A OG1 
607  C CG2 . THR A 81  ? 0.8019 1.0459 0.7773 0.0207  -0.1137 0.0262  83  THR A CG2 
608  N N   . GLY A 82  ? 0.6129 0.8504 0.5714 0.0476  -0.0815 -0.0014 84  GLY A N   
609  C CA  . GLY A 82  ? 0.5756 0.8282 0.5377 0.0551  -0.0657 -0.0081 84  GLY A CA  
610  C C   . GLY A 82  ? 0.5373 0.7851 0.4983 0.0708  -0.0543 -0.0210 84  GLY A C   
611  O O   . GLY A 82  ? 0.5452 0.7834 0.5040 0.0768  -0.0561 -0.0245 84  GLY A O   
612  N N   . GLU A 83  ? 0.5088 0.7648 0.4723 0.0769  -0.0436 -0.0265 85  GLU A N   
613  C CA  . GLU A 83  ? 0.5254 0.7767 0.4888 0.0902  -0.0348 -0.0359 85  GLU A CA  
614  C C   . GLU A 83  ? 0.5073 0.7756 0.4842 0.0954  -0.0261 -0.0391 85  GLU A C   
615  O O   . GLU A 83  ? 0.5341 0.7983 0.5128 0.1046  -0.0217 -0.0440 85  GLU A O   
616  C CB  . GLU A 83  ? 0.5726 0.8267 0.5355 0.0929  -0.0287 -0.0391 85  GLU A CB  
617  C CG  . GLU A 83  ? 0.5263 0.7597 0.4751 0.0921  -0.0364 -0.0386 85  GLU A CG  
618  C CD  . GLU A 83  ? 0.7566 0.9973 0.7067 0.0912  -0.0308 -0.0394 85  GLU A CD  
619  O OE1 . GLU A 83  ? 0.5269 0.7755 0.4834 0.0987  -0.0213 -0.0449 85  GLU A OE1 
620  O OE2 . GLU A 83  ? 0.6442 0.8822 0.5895 0.0823  -0.0374 -0.0338 85  GLU A OE2 
621  N N   . ASN A 84  ? 0.4553 0.7445 0.4422 0.0897  -0.0245 -0.0355 86  ASN A N   
622  C CA  . ASN A 84  ? 0.4121 0.7166 0.4117 0.0953  -0.0183 -0.0392 86  ASN A CA  
623  C C   . ASN A 84  ? 0.4040 0.7035 0.4040 0.0934  -0.0233 -0.0360 86  ASN A C   
624  O O   . ASN A 84  ? 0.4132 0.7274 0.4238 0.0947  -0.0205 -0.0365 86  ASN A O   
625  C CB  . ASN A 84  ? 0.4077 0.7413 0.4173 0.0940  -0.0134 -0.0391 86  ASN A CB  
626  C CG  . ASN A 84  ? 0.4872 0.8366 0.4966 0.0819  -0.0182 -0.0283 86  ASN A CG  
627  O OD1 . ASN A 84  ? 0.4387 0.7728 0.4391 0.0730  -0.0266 -0.0210 86  ASN A OD1 
628  N ND2 . ASN A 84  ? 0.3932 0.7743 0.4131 0.0820  -0.0145 -0.0264 86  ASN A ND2 
629  N N   . GLU A 85  ? 0.4660 0.7436 0.4536 0.0913  -0.0319 -0.0336 87  GLU A N   
630  C CA  . GLU A 85  ? 0.5006 0.7686 0.4854 0.0919  -0.0380 -0.0323 87  GLU A CA  
631  C C   . GLU A 85  ? 0.5037 0.7497 0.4750 0.1012  -0.0415 -0.0370 87  GLU A C   
632  O O   . GLU A 85  ? 0.5113 0.7419 0.4701 0.1013  -0.0475 -0.0377 87  GLU A O   
633  C CB  . GLU A 85  ? 0.5583 0.8241 0.5403 0.0797  -0.0494 -0.0235 87  GLU A CB  
634  C CG  . GLU A 85  ? 0.6686 0.9232 0.6473 0.0799  -0.0575 -0.0223 87  GLU A CG  
635  C CD  . GLU A 85  ? 0.8475 1.1234 0.8397 0.0729  -0.0561 -0.0161 87  GLU A CD  
636  O OE1 . GLU A 85  ? 0.8663 1.1327 0.8549 0.0656  -0.0682 -0.0098 87  GLU A OE1 
637  O OE2 . GLU A 85  ? 0.8400 1.1409 0.8457 0.0753  -0.0448 -0.0176 87  GLU A OE2 
638  N N   . MET A 86  ? 0.4623 0.7095 0.4362 0.1099  -0.0376 -0.0400 88  MET A N   
639  C CA  . MET A 86  ? 0.4917 0.7260 0.4531 0.1207  -0.0399 -0.0434 88  MET A CA  
640  C C   . MET A 86  ? 0.5136 0.7301 0.4599 0.1220  -0.0529 -0.0440 88  MET A C   
641  O O   . MET A 86  ? 0.5441 0.7599 0.4935 0.1145  -0.0587 -0.0406 88  MET A O   
642  C CB  . MET A 86  ? 0.4431 0.6891 0.4135 0.1290  -0.0325 -0.0436 88  MET A CB  
643  C CG  . MET A 86  ? 0.5328 0.7927 0.5190 0.1284  -0.0233 -0.0434 88  MET A CG  
644  S SD  . MET A 86  ? 0.5077 0.7788 0.5053 0.1365  -0.0188 -0.0403 88  MET A SD  
645  C CE  . MET A 86  ? 0.5102 0.7899 0.5214 0.1324  -0.0193 -0.0391 88  MET A CE  
646  N N   . VAL A 87  ? 0.4980 0.7011 0.4281 0.1326  -0.0581 -0.0485 89  VAL A N   
647  C CA  . VAL A 87  ? 0.5863 0.7689 0.4982 0.1386  -0.0733 -0.0522 89  VAL A CA  
648  C C   . VAL A 87  ? 0.5814 0.7711 0.4892 0.1520  -0.0715 -0.0550 89  VAL A C   
649  O O   . VAL A 87  ? 0.5412 0.7474 0.4536 0.1604  -0.0608 -0.0545 89  VAL A O   
650  C CB  . VAL A 87  ? 0.5738 0.7398 0.4689 0.1458  -0.0809 -0.0573 89  VAL A CB  
651  C CG1 . VAL A 87  ? 0.7232 0.8692 0.5964 0.1596  -0.0969 -0.0648 89  VAL A CG1 
652  C CG2 . VAL A 87  ? 0.6498 0.8059 0.5471 0.1312  -0.0871 -0.0531 89  VAL A CG2 
653  N N   . ILE A 88  ? 0.6461 0.8250 0.5464 0.1533  -0.0829 -0.0564 90  ILE A N   
654  C CA  . ILE A 88  ? 0.6413 0.8273 0.5350 0.1673  -0.0830 -0.0594 90  ILE A CA  
655  C C   . ILE A 88  ? 0.6678 0.8358 0.5364 0.1833  -0.0972 -0.0685 90  ILE A C   
656  O O   . ILE A 88  ? 0.7012 0.8428 0.5577 0.1805  -0.1148 -0.0723 90  ILE A O   
657  C CB  . ILE A 88  ? 0.6865 0.8733 0.5874 0.1607  -0.0866 -0.0563 90  ILE A CB  
658  C CG1 . ILE A 88  ? 0.6317 0.8351 0.5567 0.1454  -0.0749 -0.0485 90  ILE A CG1 
659  C CG2 . ILE A 88  ? 0.7093 0.9088 0.6053 0.1754  -0.0844 -0.0581 90  ILE A CG2 
660  C CD1 . ILE A 88  ? 0.7282 0.9302 0.6600 0.1361  -0.0807 -0.0448 90  ILE A CD1 
661  N N   . MET A 89  ? 0.6414 0.8250 0.5024 0.2005  -0.0909 -0.0714 91  MET A N   
662  C CA  . MET A 89  ? 0.7095 0.8824 0.5454 0.2204  -0.1029 -0.0816 91  MET A CA  
663  C C   . MET A 89  ? 0.7544 0.9392 0.5810 0.2363  -0.1058 -0.0847 91  MET A C   
664  O O   . MET A 89  ? 0.7180 0.9299 0.5592 0.2349  -0.0924 -0.0768 91  MET A O   
665  C CB  . MET A 89  ? 0.6669 0.8564 0.5009 0.2303  -0.0926 -0.0813 91  MET A CB  
666  C CG  . MET A 89  ? 0.6882 0.8635 0.5250 0.2197  -0.0925 -0.0809 91  MET A CG  
667  S SD  . MET A 89  ? 0.7502 0.9414 0.5769 0.2374  -0.0858 -0.0835 91  MET A SD  
668  C CE  . MET A 89  ? 0.6536 0.8220 0.4817 0.2238  -0.0892 -0.0842 91  MET A CE  
669  N N   . ARG A 90  ? 0.8336 0.9978 0.6362 0.2513  -0.1247 -0.0962 92  ARG A N   
670  C CA  . ARG A 90  ? 0.8894 1.0636 0.6800 0.2683  -0.1300 -0.1010 92  ARG A CA  
671  C C   . ARG A 90  ? 0.9569 1.1320 0.7189 0.2979  -0.1410 -0.1143 92  ARG A C   
672  O O   . ARG A 90  ? 0.9697 1.1209 0.7174 0.3033  -0.1534 -0.1229 92  ARG A O   
673  C CB  . ARG A 90  ? 0.9028 1.0498 0.6919 0.2583  -0.1461 -0.1031 92  ARG A CB  
674  C CG  . ARG A 90  ? 0.9720 1.1289 0.7885 0.2345  -0.1336 -0.0902 92  ARG A CG  
675  C CD  . ARG A 90  ? 1.0945 1.2221 0.9145 0.2166  -0.1487 -0.0885 92  ARG A CD  
676  N NE  . ARG A 90  ? 1.1841 1.3262 1.0314 0.1943  -0.1338 -0.0759 92  ARG A NE  
677  C CZ  . ARG A 90  ? 1.2288 1.3606 1.0870 0.1764  -0.1403 -0.0697 92  ARG A CZ  
678  N NH1 . ARG A 90  ? 1.3358 1.4400 1.1813 0.1756  -0.1628 -0.0731 92  ARG A NH1 
679  N NH2 . ARG A 90  ? 1.1107 1.2610 0.9925 0.1601  -0.1254 -0.0597 92  ARG A NH2 
680  N N   . PRO A 91  ? 0.9976 1.2024 0.7509 0.3184  -0.1371 -0.1159 93  PRO A N   
681  C CA  . PRO A 91  ? 1.0903 1.3017 0.8145 0.3504  -0.1476 -0.1296 93  PRO A CA  
682  C C   . PRO A 91  ? 1.1834 1.3492 0.8813 0.3617  -0.1773 -0.1477 93  PRO A C   
683  O O   . PRO A 91  ? 1.2018 1.3386 0.9032 0.3475  -0.1897 -0.1481 93  PRO A O   
684  C CB  . PRO A 91  ? 1.0770 1.3312 0.8003 0.3663  -0.1382 -0.1252 93  PRO A CB  
685  C CG  . PRO A 91  ? 1.0206 1.2735 0.7661 0.3435  -0.1317 -0.1143 93  PRO A CG  
686  C CD  . PRO A 91  ? 0.9587 1.1948 0.7280 0.3143  -0.1235 -0.1050 93  PRO A CD  
687  N N   . GLY A 92  ? 1.2522 1.4111 0.9246 0.3868  -0.1901 -0.1621 94  GLY A N   
688  C CA  . GLY A 92  ? 1.3351 1.4470 0.9808 0.4002  -0.2226 -0.1809 94  GLY A CA  
689  C C   . GLY A 92  ? 1.3729 1.4424 1.0198 0.3845  -0.2362 -0.1827 94  GLY A C   
690  O O   . GLY A 92  ? 1.4514 1.4807 1.0756 0.3970  -0.2655 -0.1981 94  GLY A O   
691  N N   . ASN A 93  ? 1.3069 1.3854 0.9800 0.3578  -0.2166 -0.1669 95  ASN A N   
692  C CA  . ASN A 93  ? 1.2845 1.3296 0.9627 0.3396  -0.2261 -0.1650 95  ASN A CA  
693  C C   . ASN A 93  ? 1.2520 1.3164 0.9317 0.3449  -0.2113 -0.1633 95  ASN A C   
694  O O   . ASN A 93  ? 1.1947 1.3024 0.8851 0.3489  -0.1865 -0.1552 95  ASN A O   
695  C CB  . ASN A 93  ? 1.2566 1.2961 0.9638 0.3034  -0.2168 -0.1480 95  ASN A CB  
696  C CG  . ASN A 93  ? 1.2611 1.2917 0.9726 0.2951  -0.2251 -0.1455 95  ASN A CG  
697  O OD1 . ASN A 93  ? 1.3811 1.3743 1.0796 0.2958  -0.2529 -0.1527 95  ASN A OD1 
698  N ND2 . ASN A 93  ? 1.1866 1.2502 0.9174 0.2864  -0.2027 -0.1346 95  ASN A ND2 
699  N N   . LYS A 94  ? 1.2605 1.2917 0.9304 0.3439  -0.2284 -0.1697 96  LYS A N   
700  C CA  . LYS A 94  ? 1.2254 1.2667 0.8982 0.3442  -0.2173 -0.1675 96  LYS A CA  
701  C C   . LYS A 94  ? 1.1509 1.1763 0.8466 0.3103  -0.2126 -0.1538 96  LYS A C   
702  O O   . LYS A 94  ? 1.1947 1.1808 0.8874 0.2980  -0.2349 -0.1550 96  LYS A O   
703  C CB  . LYS A 94  ? 1.3000 1.3155 0.9436 0.3697  -0.2416 -0.1856 96  LYS A CB  
704  C CG  . LYS A 94  ? 1.4465 1.4804 1.0635 0.4083  -0.2483 -0.2017 96  LYS A CG  
705  C CD  . LYS A 94  ? 1.5465 1.5624 1.1361 0.4358  -0.2682 -0.2196 96  LYS A CD  
706  C CE  . LYS A 94  ? 1.6976 1.6545 1.2653 0.4432  -0.3090 -0.2361 96  LYS A CE  
707  N NZ  . LYS A 94  ? 1.7774 1.7181 1.3154 0.4759  -0.3308 -0.2567 96  LYS A NZ  
708  N N   . TYR A 95  ? 1.0438 1.1013 0.7624 0.2957  -0.1849 -0.1402 97  TYR A N   
709  C CA  . TYR A 95  ? 0.9704 1.0207 0.7107 0.2663  -0.1777 -0.1277 97  TYR A CA  
710  C C   . TYR A 95  ? 0.9783 1.0265 0.7145 0.2697  -0.1753 -0.1295 97  TYR A C   
711  O O   . TYR A 95  ? 0.9509 1.0286 0.6878 0.2818  -0.1584 -0.1290 97  TYR A O   
712  C CB  . TYR A 95  ? 0.9068 0.9899 0.6737 0.2499  -0.1519 -0.1138 97  TYR A CB  
713  C CG  . TYR A 95  ? 0.8497 0.9363 0.6205 0.2478  -0.1539 -0.1122 97  TYR A CG  
714  C CD1 . TYR A 95  ? 0.8713 0.9417 0.6540 0.2260  -0.1610 -0.1052 97  TYR A CD1 
715  C CD2 . TYR A 95  ? 0.8239 0.9323 0.5860 0.2682  -0.1494 -0.1168 97  TYR A CD2 
716  C CE1 . TYR A 95  ? 0.7947 0.8677 0.5806 0.2244  -0.1636 -0.1039 97  TYR A CE1 
717  C CE2 . TYR A 95  ? 0.7866 0.8977 0.5516 0.2667  -0.1517 -0.1155 97  TYR A CE2 
718  C CZ  . TYR A 95  ? 0.8543 0.9464 0.6313 0.2447  -0.1588 -0.1095 97  TYR A CZ  
719  O OH  . TYR A 95  ? 0.8460 0.9414 0.6264 0.2431  -0.1609 -0.1079 97  TYR A OH  
720  N N   . GLU A 96  ? 0.9934 1.0068 0.7250 0.2592  -0.1944 -0.1307 98  GLU A N   
721  C CA  . GLU A 96  ? 1.0357 1.0398 0.7605 0.2629  -0.1976 -0.1339 98  GLU A CA  
722  C C   . GLU A 96  ? 0.9748 0.9773 0.7208 0.2338  -0.1898 -0.1200 98  GLU A C   
723  O O   . GLU A 96  ? 0.9793 0.9602 0.7319 0.2144  -0.2038 -0.1133 98  GLU A O   
724  C CB  . GLU A 96  ? 1.1189 1.0819 0.8178 0.2784  -0.2307 -0.1483 98  GLU A CB  
725  C CG  . GLU A 96  ? 1.1985 1.1567 0.8747 0.3064  -0.2452 -0.1635 98  GLU A CG  
726  C CD  . GLU A 96  ? 1.3924 1.3098 1.0403 0.3272  -0.2797 -0.1810 98  GLU A CD  
727  O OE1 . GLU A 96  ? 1.3778 1.2605 1.0257 0.3138  -0.2989 -0.1792 98  GLU A OE1 
728  O OE2 . GLU A 96  ? 1.5101 1.4311 1.1353 0.3582  -0.2888 -0.1968 98  GLU A OE2 
729  N N   . TYR A 97  ? 0.9298 0.9580 0.6867 0.2315  -0.1676 -0.1148 99  TYR A N   
730  C CA  . TYR A 97  ? 0.8584 0.8909 0.6338 0.2082  -0.1577 -0.1033 99  TYR A CA  
731  C C   . TYR A 97  ? 0.9234 0.9380 0.6883 0.2115  -0.1675 -0.1072 99  TYR A C   
732  O O   . TYR A 97  ? 0.9249 0.9496 0.6801 0.2295  -0.1615 -0.1139 99  TYR A O   
733  C CB  . TYR A 97  ? 0.7795 0.8497 0.5730 0.2051  -0.1290 -0.0962 99  TYR A CB  
734  C CG  . TYR A 97  ? 0.6846 0.7752 0.4926 0.1993  -0.1170 -0.0905 99  TYR A CG  
735  C CD1 . TYR A 97  ? 0.6744 0.7734 0.5028 0.1778  -0.1084 -0.0805 99  TYR A CD1 
736  C CD2 . TYR A 97  ? 0.6604 0.7651 0.4622 0.2162  -0.1139 -0.0949 99  TYR A CD2 
737  C CE1 . TYR A 97  ? 0.6949 0.8117 0.5369 0.1728  -0.0982 -0.0758 99  TYR A CE1 
738  C CE2 . TYR A 97  ? 0.6761 0.7988 0.4929 0.2092  -0.1035 -0.0887 99  TYR A CE2 
739  C CZ  . TYR A 97  ? 0.7017 0.8286 0.5386 0.1874  -0.0960 -0.0796 99  TYR A CZ  
740  O OH  . TYR A 97  ? 0.5852 0.7291 0.4378 0.1802  -0.0863 -0.0739 99  TYR A OH  
741  N N   . LYS A 98  ? 0.9621 0.9523 0.7298 0.1937  -0.1832 -0.1015 100 LYS A N   
742  C CA  . LYS A 98  ? 1.0150 0.9871 0.7748 0.1937  -0.1937 -0.1034 100 LYS A CA  
743  C C   . LYS A 98  ? 0.9625 0.9607 0.7368 0.1853  -0.1697 -0.0962 100 LYS A C   
744  O O   . LYS A 98  ? 0.9240 0.9423 0.7180 0.1672  -0.1541 -0.0852 100 LYS A O   
745  C CB  . LYS A 98  ? 1.0475 0.9893 0.8096 0.1734  -0.2181 -0.0954 100 LYS A CB  
746  C CG  . LYS A 98  ? 1.1319 1.0374 0.8780 0.1806  -0.2498 -0.1026 100 LYS A CG  
747  C CD  . LYS A 98  ? 1.3290 1.2057 1.0800 0.1582  -0.2753 -0.0912 100 LYS A CD  
748  C CE  . LYS A 98  ? 1.4218 1.2516 1.1520 0.1696  -0.3142 -0.1015 100 LYS A CE  
749  N NZ  . LYS A 98  ? 1.5237 1.3251 1.2557 0.1530  -0.3388 -0.0924 100 LYS A NZ  
750  N N   . PHE A 99  ? 0.9866 0.9847 0.7503 0.1998  -0.1678 -0.1031 101 PHE A N   
751  C CA  . PHE A 99  ? 0.9763 0.9900 0.7510 0.1909  -0.1517 -0.0967 101 PHE A CA  
752  C C   . PHE A 99  ? 1.0137 1.0027 0.7772 0.1919  -0.1677 -0.0997 101 PHE A C   
753  O O   . PHE A 99  ? 1.0860 1.0472 0.8303 0.2059  -0.1905 -0.1097 101 PHE A O   
754  C CB  . PHE A 99  ? 0.9318 0.9789 0.7118 0.2033  -0.1277 -0.0977 101 PHE A CB  
755  C CG  . PHE A 99  ? 0.9508 0.9995 0.7121 0.2298  -0.1313 -0.1084 101 PHE A CG  
756  C CD1 . PHE A 99  ? 0.9277 0.9718 0.6822 0.2355  -0.1327 -0.1110 101 PHE A CD1 
757  C CD2 . PHE A 99  ? 0.9749 1.0345 0.7260 0.2500  -0.1319 -0.1153 101 PHE A CD2 
758  C CE1 . PHE A 99  ? 0.9654 1.0157 0.7023 0.2620  -0.1357 -0.1209 101 PHE A CE1 
759  C CE2 . PHE A 99  ? 1.0566 1.1252 0.7899 0.2771  -0.1345 -0.1249 101 PHE A CE2 
760  C CZ  . PHE A 99  ? 1.0037 1.0684 0.7300 0.2834  -0.1362 -0.1277 101 PHE A CZ  
761  N N   . GLY A 100 ? 0.9994 0.9980 0.7746 0.1778  -0.1571 -0.0916 102 GLY A N   
762  C CA  . GLY A 100 ? 1.0006 0.9780 0.7676 0.1762  -0.1708 -0.0925 102 GLY A CA  
763  C C   . GLY A 100 ? 0.9543 0.9515 0.7362 0.1621  -0.1529 -0.0834 102 GLY A C   
764  O O   . GLY A 100 ? 0.9375 0.9511 0.7366 0.1433  -0.1423 -0.0728 102 GLY A O   
765  N N   . PHE A 101 ? 0.9467 0.9442 0.7214 0.1728  -0.1495 -0.0882 103 PHE A N   
766  C CA  . PHE A 101 ? 0.9330 0.9454 0.7196 0.1607  -0.1353 -0.0808 103 PHE A CA  
767  C C   . PHE A 101 ? 1.0061 0.9990 0.7797 0.1679  -0.1477 -0.0854 103 PHE A C   
768  O O   . PHE A 101 ? 1.0332 1.0123 0.7891 0.1890  -0.1588 -0.0967 103 PHE A O   
769  C CB  . PHE A 101 ? 0.8503 0.8961 0.6480 0.1660  -0.1092 -0.0799 103 PHE A CB  
770  C CG  . PHE A 101 ? 0.8808 0.9347 0.6672 0.1904  -0.1051 -0.0887 103 PHE A CG  
771  C CD1 . PHE A 101 ? 0.8076 0.8661 0.5887 0.2003  -0.1012 -0.0911 103 PHE A CD1 
772  C CD2 . PHE A 101 ? 0.8638 0.9241 0.6450 0.2039  -0.1055 -0.0935 103 PHE A CD2 
773  C CE1 . PHE A 101 ? 0.7932 0.8652 0.5643 0.2233  -0.0977 -0.0972 103 PHE A CE1 
774  C CE2 . PHE A 101 ? 0.7425 0.8170 0.5133 0.2272  -0.1018 -0.0998 103 PHE A CE2 
775  C CZ  . PHE A 101 ? 0.8511 0.9330 0.6170 0.2371  -0.0978 -0.1012 103 PHE A CZ  
776  N N   . GLU A 102 ? 1.0399 1.0334 0.8219 0.1514  -0.1461 -0.0769 104 GLU A N   
777  C CA  . GLU A 102 ? 1.0993 1.0755 0.8716 0.1551  -0.1569 -0.0795 104 GLU A CA  
778  C C   . GLU A 102 ? 1.0646 1.0644 0.8405 0.1633  -0.1354 -0.0811 104 GLU A C   
779  O O   . GLU A 102 ? 0.9982 1.0234 0.7901 0.1525  -0.1157 -0.0741 104 GLU A O   
780  C CB  . GLU A 102 ? 1.1006 1.0665 0.8810 0.1308  -0.1682 -0.0670 104 GLU A CB  
781  C CG  . GLU A 102 ? 1.2427 1.1734 1.0096 0.1327  -0.1954 -0.0693 104 GLU A CG  
782  C CD  . GLU A 102 ? 1.3901 1.3050 1.1643 0.1084  -0.2163 -0.0550 104 GLU A CD  
783  O OE1 . GLU A 102 ? 1.4399 1.3188 1.2026 0.1109  -0.2462 -0.0577 104 GLU A OE1 
784  O OE2 . GLU A 102 ? 1.3746 1.3140 1.1660 0.0875  -0.2044 -0.0407 104 GLU A OE2 
785  N N   . LEU A 103 ? 1.0823 1.0743 0.8434 0.1833  -0.1406 -0.0906 105 LEU A N   
786  C CA  . LEU A 103 ? 1.0661 1.0791 0.8303 0.1909  -0.1234 -0.0907 105 LEU A CA  
787  C C   . LEU A 103 ? 1.0780 1.0872 0.8495 0.1737  -0.1226 -0.0831 105 LEU A C   
788  O O   . LEU A 103 ? 1.1118 1.0992 0.8817 0.1604  -0.1393 -0.0791 105 LEU A O   
789  C CB  . LEU A 103 ? 1.0908 1.0996 0.8363 0.2182  -0.1307 -0.1022 105 LEU A CB  
790  C CG  . LEU A 103 ? 1.0639 1.0879 0.8008 0.2409  -0.1275 -0.1098 105 LEU A CG  
791  C CD1 . LEU A 103 ? 1.0712 1.0813 0.7846 0.2677  -0.1444 -0.1232 105 LEU A CD1 
792  C CD2 . LEU A 103 ? 0.8260 0.8902 0.5765 0.2441  -0.1023 -0.1031 105 LEU A CD2 
793  N N   . PRO A 104 ? 1.0508 1.0821 0.8313 0.1729  -0.1043 -0.0797 106 PRO A N   
794  C CA  . PRO A 104 ? 1.0766 1.1067 0.8638 0.1574  -0.1026 -0.0728 106 PRO A CA  
795  C C   . PRO A 104 ? 1.1395 1.1453 0.9130 0.1627  -0.1196 -0.0765 106 PRO A C   
796  O O   . PRO A 104 ? 1.1591 1.1547 0.9175 0.1833  -0.1283 -0.0862 106 PRO A O   
797  C CB  . PRO A 104 ? 1.0267 1.0845 0.8251 0.1595  -0.0809 -0.0703 106 PRO A CB  
798  C CG  . PRO A 104 ? 0.9947 1.0701 0.7965 0.1707  -0.0710 -0.0725 106 PRO A CG  
799  C CD  . PRO A 104 ? 1.0146 1.0736 0.8005 0.1852  -0.0858 -0.0804 106 PRO A CD  
800  N N   . GLN A 105 ? 1.1760 1.1745 0.9545 0.1449  -0.1247 -0.0687 107 GLN A N   
801  C CA  . GLN A 105 ? 1.2275 1.2077 0.9971 0.1468  -0.1371 -0.0699 107 GLN A CA  
802  C C   . GLN A 105 ? 1.2116 1.2111 0.9842 0.1540  -0.1195 -0.0709 107 GLN A C   
803  O O   . GLN A 105 ? 1.2014 1.2254 0.9881 0.1451  -0.1007 -0.0652 107 GLN A O   
804  C CB  . GLN A 105 ? 1.2335 1.2042 1.0098 0.1231  -0.1480 -0.0582 107 GLN A CB  
805  C CG  . GLN A 105 ? 1.3543 1.2884 1.1193 0.1214  -0.1787 -0.0585 107 GLN A CG  
806  C CD  . GLN A 105 ? 1.4476 1.3698 1.2129 0.1155  -0.1930 -0.0562 107 GLN A CD  
807  O OE1 . GLN A 105 ? 1.5072 1.4444 1.2758 0.1209  -0.1808 -0.0595 107 GLN A OE1 
808  N NE2 . GLN A 105 ? 1.5242 1.4185 1.2869 0.1035  -0.2205 -0.0494 107 GLN A NE2 
809  N N   . GLY A 106 ? 1.2229 1.2114 0.9824 0.1707  -0.1272 -0.0782 108 GLY A N   
810  C CA  . GLY A 106 ? 1.1826 1.1893 0.9451 0.1775  -0.1124 -0.0778 108 GLY A CA  
811  C C   . GLY A 106 ? 1.1607 1.1909 0.9220 0.1975  -0.0993 -0.0822 108 GLY A C   
812  O O   . GLY A 106 ? 1.1751 1.2014 0.9248 0.2150  -0.1070 -0.0901 108 GLY A O   
813  N N   . PRO A 107 ? 1.1211 1.1773 0.8948 0.1950  -0.0806 -0.0762 109 PRO A N   
814  C CA  . PRO A 107 ? 1.1108 1.1919 0.8841 0.2138  -0.0705 -0.0771 109 PRO A CA  
815  C C   . PRO A 107 ? 1.0923 1.1860 0.8681 0.2197  -0.0662 -0.0779 109 PRO A C   
816  O O   . PRO A 107 ? 1.0469 1.1432 0.8348 0.2046  -0.0603 -0.0736 109 PRO A O   
817  C CB  . PRO A 107 ? 1.0663 1.1686 0.8559 0.2040  -0.0544 -0.0678 109 PRO A CB  
818  C CG  . PRO A 107 ? 1.0406 1.1350 0.8410 0.1813  -0.0522 -0.0637 109 PRO A CG  
819  C CD  . PRO A 107 ? 1.0961 1.1618 0.8851 0.1758  -0.0693 -0.0678 109 PRO A CD  
820  N N   . LEU A 108 ? 1.1016 1.2041 0.8653 0.2425  -0.0700 -0.0838 110 LEU A N   
821  C CA  . LEU A 108 ? 1.0916 1.2088 0.8565 0.2503  -0.0662 -0.0844 110 LEU A CA  
822  C C   . LEU A 108 ? 1.0788 1.2358 0.8537 0.2597  -0.0507 -0.0759 110 LEU A C   
823  O O   . LEU A 108 ? 1.0695 1.2459 0.8466 0.2678  -0.0461 -0.0741 110 LEU A O   
824  C CB  . LEU A 108 ? 1.1344 1.2332 0.8781 0.2688  -0.0839 -0.0971 110 LEU A CB  
825  C CG  . LEU A 108 ? 1.1905 1.2492 0.9273 0.2564  -0.1024 -0.1025 110 LEU A CG  
826  C CD1 . LEU A 108 ? 1.2863 1.3222 1.0001 0.2776  -0.1246 -0.1165 110 LEU A CD1 
827  C CD2 . LEU A 108 ? 1.1143 1.1713 0.8654 0.2354  -0.0973 -0.0962 110 LEU A CD2 
828  N N   . GLY A 109 ? 1.0702 1.2401 0.8523 0.2574  -0.0434 -0.0690 111 GLY A N   
829  C CA  . GLY A 109 ? 1.0880 1.2966 0.8832 0.2623  -0.0302 -0.0569 111 GLY A CA  
830  C C   . GLY A 109 ? 1.1568 1.3904 0.9392 0.2889  -0.0319 -0.0582 111 GLY A C   
831  O O   . GLY A 109 ? 1.1535 1.4257 0.9461 0.2953  -0.0223 -0.0461 111 GLY A O   
832  N N   . THR A 110 ? 1.2230 1.4355 0.9829 0.3047  -0.0458 -0.0724 112 THR A N   
833  C CA  . THR A 110 ? 1.2882 1.5221 1.0309 0.3349  -0.0506 -0.0782 112 THR A CA  
834  C C   . THR A 110 ? 1.3169 1.5636 1.0598 0.3400  -0.0478 -0.0735 112 THR A C   
835  O O   . THR A 110 ? 1.3532 1.6186 1.0812 0.3659  -0.0521 -0.0785 112 THR A O   
836  C CB  . THR A 110 ? 1.3409 1.5424 1.0582 0.3516  -0.0706 -0.0978 112 THR A CB  
837  O OG1 . THR A 110 ? 1.3204 1.5490 1.0206 0.3845  -0.0746 -0.1048 112 THR A OG1 
838  C CG2 . THR A 110 ? 1.3556 1.5133 1.0618 0.3461  -0.0864 -0.1078 112 THR A CG2 
839  N N   . SER A 111 ? 1.3041 1.5433 1.0643 0.3161  -0.0404 -0.0639 113 SER A N   
840  C CA  . SER A 111 ? 1.3174 1.5617 1.0800 0.3153  -0.0383 -0.0591 113 SER A CA  
841  C C   . SER A 111 ? 1.3404 1.6342 1.1074 0.3321  -0.0295 -0.0473 113 SER A C   
842  O O   . SER A 111 ? 1.3871 1.6899 1.1394 0.3528  -0.0348 -0.0528 113 SER A O   
843  C CB  . SER A 111 ? 1.2709 1.4998 1.0522 0.2860  -0.0318 -0.0507 113 SER A CB  
844  O OG  . SER A 111 ? 1.2317 1.4765 1.0333 0.2713  -0.0213 -0.0394 113 SER A OG  
845  N N   . PHE A 112 ? 1.3289 1.6558 1.1165 0.3233  -0.0174 -0.0304 114 PHE A N   
846  C CA  . PHE A 112 ? 1.3410 1.7215 1.1367 0.3366  -0.0093 -0.0143 114 PHE A CA  
847  C C   . PHE A 112 ? 1.3515 1.7663 1.1481 0.3491  -0.0058 -0.0090 114 PHE A C   
848  O O   . PHE A 112 ? 1.3358 1.7463 1.1455 0.3340  -0.0023 -0.0040 114 PHE A O   
849  C CB  . PHE A 112 ? 1.3115 1.7068 1.1331 0.3151  -0.0007 0.0057  114 PHE A CB  
850  C CG  . PHE A 112 ? 1.3210 1.6833 1.1420 0.3021  -0.0038 0.0006  114 PHE A CG  
851  C CD1 . PHE A 112 ? 1.3720 1.7369 1.1793 0.3172  -0.0078 -0.0045 114 PHE A CD1 
852  C CD2 . PHE A 112 ? 1.2628 1.5930 1.0958 0.2764  -0.0032 -0.0001 114 PHE A CD2 
853  C CE1 . PHE A 112 ? 1.3670 1.7016 1.1735 0.3050  -0.0110 -0.0089 114 PHE A CE1 
854  C CE2 . PHE A 112 ? 1.3233 1.6261 1.1549 0.2652  -0.0060 -0.0047 114 PHE A CE2 
855  C CZ  . PHE A 112 ? 1.3593 1.6636 1.1780 0.2787  -0.0099 -0.0086 114 PHE A CZ  
856  N N   . LYS A 113 ? 1.3820 1.8324 1.1637 0.3784  -0.0073 -0.0107 115 LYS A N   
857  C CA  . LYS A 113 ? 1.3812 1.8694 1.1592 0.3962  -0.0049 -0.0074 115 LYS A CA  
858  C C   . LYS A 113 ? 1.3727 1.9273 1.1528 0.4175  0.0014  0.0086  115 LYS A C   
859  O O   . LYS A 113 ? 1.3906 1.9572 1.1697 0.4230  0.0019  0.0126  115 LYS A O   
860  C CB  . LYS A 113 ? 1.4251 1.8839 1.1745 0.4167  -0.0176 -0.0330 115 LYS A CB  
861  C CG  . LYS A 113 ? 1.5081 1.9609 1.2297 0.4462  -0.0293 -0.0511 115 LYS A CG  
862  C CD  . LYS A 113 ? 1.5196 1.9159 1.2349 0.4331  -0.0391 -0.0638 115 LYS A CD  
863  C CE  . LYS A 113 ? 1.6038 1.9901 1.2911 0.4633  -0.0540 -0.0829 115 LYS A CE  
864  N NZ  . LYS A 113 ? 1.6182 1.9407 1.2962 0.4508  -0.0687 -0.0980 115 LYS A NZ  
865  N N   . GLY A 114 ? 1.3593 1.9599 1.1429 0.4292  0.0062  0.0192  116 GLY A N   
866  C CA  . GLY A 114 ? 1.3473 2.0201 1.1323 0.4517  0.0121  0.0360  116 GLY A CA  
867  C C   . GLY A 114 ? 1.2801 1.9897 1.0972 0.4301  0.0214  0.0680  116 GLY A C   
868  O O   . GLY A 114 ? 1.2569 1.9840 1.0982 0.4107  0.0264  0.0882  116 GLY A O   
869  N N   . LYS A 115 ? 1.2467 1.9661 1.0641 0.4333  0.0218  0.0727  117 LYS A N   
870  C CA  . LYS A 115 ? 1.1945 1.9524 1.0411 0.4158  0.0284  0.1039  117 LYS A CA  
871  C C   . LYS A 115 ? 1.1250 1.8527 1.0000 0.3779  0.0293  0.1169  117 LYS A C   
872  O O   . LYS A 115 ? 1.0872 1.8532 0.9875 0.3651  0.0327  0.1437  117 LYS A O   
873  C CB  . LYS A 115 ? 1.1899 1.9382 1.0307 0.4191  0.0266  0.1002  117 LYS A CB  
874  C CG  . LYS A 115 ? 1.2318 2.0510 1.0856 0.4284  0.0321  0.1275  117 LYS A CG  
875  C CD  . LYS A 115 ? 1.2178 2.0618 1.1101 0.3971  0.0359  0.1627  117 LYS A CD  
876  C CE  . LYS A 115 ? 1.2510 2.1625 1.1565 0.4046  0.0396  0.1907  117 LYS A CE  
877  N NZ  . LYS A 115 ? 1.2281 2.1787 1.1715 0.3787  0.0408  0.2296  117 LYS A NZ  
878  N N   . TYR A 116 ? 1.0724 1.7324 0.9426 0.3610  0.0248  0.0976  118 TYR A N   
879  C CA  . TYR A 116 ? 1.0287 1.6575 0.9234 0.3275  0.0245  0.1067  118 TYR A CA  
880  C C   . TYR A 116 ? 1.0192 1.6049 0.9094 0.3180  0.0221  0.0903  118 TYR A C   
881  O O   . TYR A 116 ? 1.0028 1.5799 0.9142 0.2961  0.0222  0.1009  118 TYR A O   
882  C CB  . TYR A 116 ? 0.9916 1.5836 0.8886 0.3131  0.0219  0.1017  118 TYR A CB  
883  C CG  . TYR A 116 ? 0.9795 1.6105 0.8822 0.3202  0.0238  0.1181  118 TYR A CG  
884  C CD1 . TYR A 116 ? 0.9813 1.6548 0.9130 0.3069  0.0255  0.1499  118 TYR A CD1 
885  C CD2 . TYR A 116 ? 0.9711 1.5958 0.8512 0.3396  0.0222  0.1027  118 TYR A CD2 
886  C CE1 . TYR A 116 ? 1.0006 1.7124 0.9387 0.3127  0.0268  0.1669  118 TYR A CE1 
887  C CE2 . TYR A 116 ? 0.9991 1.6608 0.8841 0.3469  0.0241  0.1175  118 TYR A CE2 
888  C CZ  . TYR A 116 ? 0.9925 1.6987 0.9065 0.3333  0.0270  0.1499  118 TYR A CZ  
889  O OH  . TYR A 116 ? 1.0943 1.8390 1.0135 0.3403  0.0285  0.1656  118 TYR A OH  
890  N N   . GLY A 117 ? 1.0396 1.5984 0.9022 0.3350  0.0184  0.0646  119 GLY A N   
891  C CA  . GLY A 117 ? 1.0437 1.5596 0.8999 0.3266  0.0151  0.0480  119 GLY A CA  
892  C C   . GLY A 117 ? 1.0533 1.5863 0.8986 0.3433  0.0146  0.0426  119 GLY A C   
893  O O   . GLY A 117 ? 1.0753 1.6478 0.9072 0.3698  0.0150  0.0431  119 GLY A O   
894  N N   . SER A 118 ? 1.0267 1.5306 0.8774 0.3283  0.0136  0.0370  120 SER A N   
895  C CA  . SER A 118 ? 1.0469 1.5503 0.8843 0.3410  0.0112  0.0262  120 SER A CA  
896  C C   . SER A 118 ? 1.0226 1.4680 0.8541 0.3263  0.0056  0.0078  120 SER A C   
897  O O   . SER A 118 ? 0.9947 1.4124 0.8406 0.3024  0.0067  0.0100  120 SER A O   
898  C CB  . SER A 118 ? 1.0544 1.6039 0.9108 0.3386  0.0173  0.0476  120 SER A CB  
899  O OG  . SER A 118 ? 1.0414 1.6046 0.9274 0.3159  0.0212  0.0705  120 SER A OG  
900  N N   . VAL A 119 ? 1.0230 1.4519 0.8328 0.3418  -0.0014 -0.0101 121 VAL A N   
901  C CA  . VAL A 119 ? 1.0092 1.3881 0.8125 0.3295  -0.0081 -0.0259 121 VAL A CA  
902  C C   . VAL A 119 ? 1.0344 1.4217 0.8351 0.3357  -0.0088 -0.0281 121 VAL A C   
903  O O   . VAL A 119 ? 1.0491 1.4746 0.8425 0.3573  -0.0076 -0.0249 121 VAL A O   
904  C CB  . VAL A 119 ? 1.0223 1.3602 0.8017 0.3381  -0.0207 -0.0464 121 VAL A CB  
905  C CG1 . VAL A 119 ? 1.1323 1.4755 0.8849 0.3692  -0.0311 -0.0613 121 VAL A CG1 
906  C CG2 . VAL A 119 ? 0.9856 1.2747 0.7665 0.3166  -0.0264 -0.0555 121 VAL A CG2 
907  N N   . ASP A 120 ? 0.9819 1.3370 0.7886 0.3175  -0.0106 -0.0331 122 ASP A N   
908  C CA  . ASP A 120 ? 0.9761 1.3397 0.7859 0.3182  -0.0095 -0.0320 122 ASP A CA  
909  C C   . ASP A 120 ? 0.9269 1.2435 0.7294 0.3069  -0.0177 -0.0468 122 ASP A C   
910  O O   . ASP A 120 ? 0.9214 1.2147 0.7365 0.2846  -0.0158 -0.0452 122 ASP A O   
911  C CB  . ASP A 120 ? 0.9790 1.3656 0.8180 0.2992  0.0007  -0.0120 122 ASP A CB  
912  C CG  . ASP A 120 ? 1.0319 1.4652 0.8775 0.3104  0.0054  0.0016  122 ASP A CG  
913  O OD1 . ASP A 120 ? 1.0552 1.5204 0.9228 0.3017  0.0118  0.0224  122 ASP A OD1 
914  O OD2 . ASP A 120 ? 1.1679 1.6065 0.9976 0.3271  0.0017  -0.0074 122 ASP A OD2 
915  N N   . TYR A 121 ? 0.8968 1.2005 0.6792 0.3224  -0.0278 -0.0607 123 TYR A N   
916  C CA  . TYR A 121 ? 0.8676 1.1304 0.6455 0.3104  -0.0366 -0.0715 123 TYR A CA  
917  C C   . TYR A 121 ? 0.8521 1.1227 0.6267 0.3176  -0.0384 -0.0739 123 TYR A C   
918  O O   . TYR A 121 ? 0.8962 1.1805 0.6533 0.3419  -0.0444 -0.0810 123 TYR A O   
919  C CB  . TYR A 121 ? 0.8822 1.1063 0.6387 0.3169  -0.0531 -0.0876 123 TYR A CB  
920  C CG  . TYR A 121 ? 0.9093 1.1120 0.6736 0.2980  -0.0524 -0.0851 123 TYR A CG  
921  C CD1 . TYR A 121 ? 0.8668 1.0334 0.6329 0.2786  -0.0598 -0.0890 123 TYR A CD1 
922  C CD2 . TYR A 121 ? 0.9135 1.1351 0.6836 0.2996  -0.0445 -0.0777 123 TYR A CD2 
923  C CE1 . TYR A 121 ? 0.8709 1.0225 0.6441 0.2620  -0.0588 -0.0859 123 TYR A CE1 
924  C CE2 . TYR A 121 ? 0.9275 1.1305 0.7041 0.2832  -0.0439 -0.0758 123 TYR A CE2 
925  C CZ  . TYR A 121 ? 0.9151 1.0838 0.6929 0.2648  -0.0508 -0.0802 123 TYR A CZ  
926  O OH  . TYR A 121 ? 0.8685 1.0230 0.6524 0.2493  -0.0500 -0.0775 123 TYR A OH  
927  N N   . TRP A 122 ? 0.7678 1.0316 0.5588 0.2978  -0.0334 -0.0683 124 TRP A N   
928  C CA  . TRP A 122 ? 0.7375 1.0076 0.5261 0.3034  -0.0352 -0.0702 124 TRP A CA  
929  C C   . TRP A 122 ? 0.7277 0.9701 0.5249 0.2829  -0.0374 -0.0723 124 TRP A C   
930  O O   . TRP A 122 ? 0.6700 0.8959 0.4796 0.2624  -0.0345 -0.0692 124 TRP A O   
931  C CB  . TRP A 122 ? 0.7352 1.0518 0.5385 0.3079  -0.0230 -0.0549 124 TRP A CB  
932  C CG  . TRP A 122 ? 0.8437 1.1763 0.6730 0.2892  -0.0115 -0.0383 124 TRP A CG  
933  C CD1 . TRP A 122 ? 0.8641 1.2252 0.7016 0.2924  -0.0052 -0.0262 124 TRP A CD1 
934  C CD2 . TRP A 122 ? 0.7869 1.1085 0.6378 0.2654  -0.0067 -0.0318 124 TRP A CD2 
935  N NE1 . TRP A 122 ? 0.8806 1.2459 0.7436 0.2714  0.0016  -0.0126 124 TRP A NE1 
936  C CE2 . TRP A 122 ? 0.8103 1.1513 0.6811 0.2558  0.0006  -0.0169 124 TRP A CE2 
937  C CE3 . TRP A 122 ? 0.8420 1.1400 0.6971 0.2524  -0.0091 -0.0373 124 TRP A CE3 
938  C CZ2 . TRP A 122 ? 0.7758 1.1105 0.6691 0.2352  0.0042  -0.0094 124 TRP A CZ2 
939  C CZ3 . TRP A 122 ? 0.7696 1.0652 0.6472 0.2324  -0.0036 -0.0295 124 TRP A CZ3 
940  C CH2 . TRP A 122 ? 0.8142 1.1266 0.7099 0.2249  0.0022  -0.0167 124 TRP A CH2 
941  N N   . VAL A 123 ? 0.7372 0.9788 0.5278 0.2898  -0.0423 -0.0769 125 VAL A N   
942  C CA  . VAL A 123 ? 0.6944 0.9202 0.4951 0.2727  -0.0427 -0.0764 125 VAL A CA  
943  C C   . VAL A 123 ? 0.6966 0.9540 0.5093 0.2753  -0.0335 -0.0671 125 VAL A C   
944  O O   . VAL A 123 ? 0.7184 0.9968 0.5193 0.2959  -0.0354 -0.0689 125 VAL A O   
945  C CB  . VAL A 123 ? 0.7232 0.9177 0.5046 0.2789  -0.0599 -0.0900 125 VAL A CB  
946  C CG1 . VAL A 123 ? 0.6395 0.8219 0.4327 0.2607  -0.0597 -0.0875 125 VAL A CG1 
947  C CG2 . VAL A 123 ? 0.6875 0.8488 0.4547 0.2786  -0.0739 -0.0992 125 VAL A CG2 
948  N N   . LYS A 124 ? 0.6506 0.9131 0.4861 0.2560  -0.0245 -0.0573 126 LYS A N   
949  C CA  . LYS A 124 ? 0.6435 0.9263 0.4910 0.2545  -0.0193 -0.0498 126 LYS A CA  
950  C C   . LYS A 124 ? 0.5777 0.8343 0.4260 0.2425  -0.0245 -0.0564 126 LYS A C   
951  O O   . LYS A 124 ? 0.5245 0.7584 0.3776 0.2269  -0.0260 -0.0590 126 LYS A O   
952  C CB  . LYS A 124 ? 0.6188 0.9241 0.4925 0.2417  -0.0085 -0.0343 126 LYS A CB  
953  C CG  . LYS A 124 ? 0.7300 1.0641 0.6090 0.2486  -0.0033 -0.0231 126 LYS A CG  
954  C CD  . LYS A 124 ? 0.8288 1.1878 0.7341 0.2378  0.0031  -0.0057 126 LYS A CD  
955  C CE  . LYS A 124 ? 0.9696 1.3583 0.8850 0.2404  0.0071  0.0094  126 LYS A CE  
956  N NZ  . LYS A 124 ? 0.9374 1.3073 0.8624 0.2263  0.0076  0.0094  126 LYS A NZ  
957  N N   . ALA A 125 ? 0.5648 0.8278 0.4078 0.2507  -0.0275 -0.0583 127 ALA A N   
958  C CA  . ALA A 125 ? 0.5725 0.8195 0.4193 0.2402  -0.0310 -0.0612 127 ALA A CA  
959  C C   . ALA A 125 ? 0.5771 0.8498 0.4449 0.2341  -0.0210 -0.0494 127 ALA A C   
960  O O   . ALA A 125 ? 0.6026 0.9064 0.4743 0.2442  -0.0158 -0.0406 127 ALA A O   
961  C CB  . ALA A 125 ? 0.5605 0.7973 0.3868 0.2552  -0.0428 -0.0714 127 ALA A CB  
962  N N   . PHE A 126 ? 0.5751 0.8371 0.4567 0.2177  -0.0195 -0.0483 128 PHE A N   
963  C CA  . PHE A 126 ? 0.5488 0.8299 0.4505 0.2112  -0.0128 -0.0384 128 PHE A CA  
964  C C   . PHE A 126 ? 0.5585 0.8291 0.4581 0.2082  -0.0171 -0.0430 128 PHE A C   
965  O O   . PHE A 126 ? 0.5173 0.7637 0.4114 0.2002  -0.0227 -0.0506 128 PHE A O   
966  C CB  . PHE A 126 ? 0.5433 0.8222 0.4651 0.1953  -0.0075 -0.0334 128 PHE A CB  
967  C CG  . PHE A 126 ? 0.5113 0.7933 0.4338 0.1959  -0.0050 -0.0306 128 PHE A CG  
968  C CD1 . PHE A 126 ? 0.6188 0.9259 0.5534 0.1987  -0.0007 -0.0181 128 PHE A CD1 
969  C CD2 . PHE A 126 ? 0.4500 0.7107 0.3625 0.1922  -0.0077 -0.0387 128 PHE A CD2 
970  C CE1 . PHE A 126 ? 0.6977 1.0080 0.6339 0.1986  0.0011  -0.0147 128 PHE A CE1 
971  C CE2 . PHE A 126 ? 0.6270 0.8905 0.5403 0.1926  -0.0054 -0.0361 128 PHE A CE2 
972  C CZ  . PHE A 126 ? 0.6718 0.9594 0.5967 0.1959  -0.0008 -0.0246 128 PHE A CZ  
973  N N   . LEU A 127 ? 0.5482 0.8389 0.4528 0.2140  -0.0152 -0.0371 129 LEU A N   
974  C CA  . LEU A 127 ? 0.5736 0.8579 0.4808 0.2095  -0.0179 -0.0393 129 LEU A CA  
975  C C   . LEU A 127 ? 0.5460 0.8408 0.4783 0.1966  -0.0119 -0.0304 129 LEU A C   
976  O O   . LEU A 127 ? 0.5330 0.8520 0.4782 0.1987  -0.0078 -0.0191 129 LEU A O   
977  C CB  . LEU A 127 ? 0.5698 0.8696 0.4645 0.2261  -0.0210 -0.0395 129 LEU A CB  
978  C CG  . LEU A 127 ? 0.6078 0.9030 0.5006 0.2259  -0.0254 -0.0424 129 LEU A CG  
979  C CD1 . LEU A 127 ? 0.5955 0.8567 0.4769 0.2197  -0.0351 -0.0537 129 LEU A CD1 
980  C CD2 . LEU A 127 ? 0.6242 0.9409 0.5023 0.2466  -0.0279 -0.0425 129 LEU A CD2 
981  N N   . ASP A 128 ? 0.5108 0.7894 0.4504 0.1840  -0.0129 -0.0346 130 ASP A N   
982  C CA  . ASP A 128 ? 0.4802 0.7665 0.4420 0.1741  -0.0093 -0.0288 130 ASP A CA  
983  C C   . ASP A 128 ? 0.4814 0.7682 0.4445 0.1735  -0.0116 -0.0295 130 ASP A C   
984  O O   . ASP A 128 ? 0.4991 0.7713 0.4496 0.1734  -0.0163 -0.0368 130 ASP A O   
985  C CB  . ASP A 128 ? 0.4926 0.7661 0.4624 0.1627  -0.0083 -0.0333 130 ASP A CB  
986  C CG  . ASP A 128 ? 0.5815 0.8529 0.5498 0.1626  -0.0064 -0.0332 130 ASP A CG  
987  O OD1 . ASP A 128 ? 0.5733 0.8575 0.5433 0.1687  -0.0047 -0.0263 130 ASP A OD1 
988  O OD2 . ASP A 128 ? 0.5876 0.8470 0.5537 0.1562  -0.0066 -0.0390 130 ASP A OD2 
989  N N   . ARG A 129 ? 0.4588 0.7621 0.4384 0.1722  -0.0096 -0.0208 131 ARG A N   
990  C CA  . ARG A 129 ? 0.4744 0.7806 0.4570 0.1718  -0.0114 -0.0202 131 ARG A CA  
991  C C   . ARG A 129 ? 0.5152 0.8273 0.5219 0.1627  -0.0105 -0.0146 131 ARG A C   
992  O O   . ARG A 129 ? 0.4930 0.8121 0.5132 0.1601  -0.0098 -0.0080 131 ARG A O   
993  C CB  . ARG A 129 ? 0.4855 0.8109 0.4609 0.1837  -0.0118 -0.0139 131 ARG A CB  
994  C CG  . ARG A 129 ? 0.5168 0.8350 0.4655 0.1967  -0.0159 -0.0225 131 ARG A CG  
995  C CD  . ARG A 129 ? 0.5077 0.8531 0.4488 0.2123  -0.0153 -0.0159 131 ARG A CD  
996  N NE  . ARG A 129 ? 0.6764 1.0345 0.6225 0.2139  -0.0161 -0.0113 131 ARG A NE  
997  C CZ  . ARG A 129 ? 0.7680 1.1586 0.7175 0.2228  -0.0139 0.0001  131 ARG A CZ  
998  N NH1 . ARG A 129 ? 0.6335 1.0499 0.5834 0.2308  -0.0105 0.0094  131 ARG A NH1 
999  N NH2 . ARG A 129 ? 0.7549 1.1550 0.7085 0.2234  -0.0151 0.0036  131 ARG A NH2 
1000 N N   . PRO A 130 ? 0.5396 0.8476 0.5517 0.1583  -0.0121 -0.0174 132 PRO A N   
1001 C CA  . PRO A 130 ? 0.5618 0.8746 0.5958 0.1520  -0.0133 -0.0135 132 PRO A CA  
1002 C C   . PRO A 130 ? 0.5987 0.9306 0.6464 0.1541  -0.0148 0.0007  132 PRO A C   
1003 O O   . PRO A 130 ? 0.6134 0.9584 0.6537 0.1605  -0.0142 0.0065  132 PRO A O   
1004 C CB  . PRO A 130 ? 0.5816 0.8904 0.6135 0.1501  -0.0147 -0.0179 132 PRO A CB  
1005 C CG  . PRO A 130 ? 0.5834 0.8799 0.5939 0.1521  -0.0153 -0.0256 132 PRO A CG  
1006 C CD  . PRO A 130 ? 0.5253 0.8238 0.5225 0.1600  -0.0147 -0.0241 132 PRO A CD  
1007 N N   . SER A 131 ? 0.6194 0.9537 0.6866 0.1490  -0.0182 0.0068  133 SER A N   
1008 C CA  . SER A 131 ? 0.6486 1.0009 0.7338 0.1476  -0.0227 0.0234  133 SER A CA  
1009 C C   . SER A 131 ? 0.6921 1.0656 0.7716 0.1533  -0.0202 0.0359  133 SER A C   
1010 O O   . SER A 131 ? 0.7479 1.1432 0.8419 0.1520  -0.0237 0.0532  133 SER A O   
1011 C CB  . SER A 131 ? 0.6704 1.0299 0.7636 0.1466  -0.0253 0.0277  133 SER A CB  
1012 O OG  . SER A 131 ? 0.7490 1.0924 0.8484 0.1424  -0.0279 0.0168  133 SER A OG  
1013 N N   . GLN A 132 ? 0.6780 1.0473 0.7372 0.1597  -0.0150 0.0282  134 GLN A N   
1014 C CA  . GLN A 132 ? 0.6841 1.0748 0.7364 0.1673  -0.0125 0.0382  134 GLN A CA  
1015 C C   . GLN A 132 ? 0.6900 1.0742 0.7437 0.1650  -0.0121 0.0379  134 GLN A C   
1016 O O   . GLN A 132 ? 0.7074 1.0676 0.7580 0.1605  -0.0120 0.0251  134 GLN A O   
1017 C CB  . GLN A 132 ? 0.6645 1.0589 0.6904 0.1804  -0.0087 0.0302  134 GLN A CB  
1018 C CG  . GLN A 132 ? 0.6964 1.0971 0.7189 0.1840  -0.0098 0.0299  134 GLN A CG  
1019 C CD  . GLN A 132 ? 0.8149 1.2466 0.8560 0.1827  -0.0114 0.0495  134 GLN A CD  
1020 O OE1 . GLN A 132 ? 0.8206 1.2768 0.8721 0.1829  -0.0114 0.0653  134 GLN A OE1 
1021 N NE2 . GLN A 132 ? 0.7208 1.1530 0.7674 0.1803  -0.0134 0.0501  134 GLN A NE2 
1022 N N   . PRO A 133 ? 0.7106 1.1192 0.7702 0.1675  -0.0122 0.0535  135 PRO A N   
1023 C CA  . PRO A 133 ? 0.6801 1.0848 0.7357 0.1680  -0.0108 0.0526  135 PRO A CA  
1024 C C   . PRO A 133 ? 0.6634 1.0578 0.6907 0.1787  -0.0054 0.0372  135 PRO A C   
1025 O O   . PRO A 133 ? 0.6689 1.0701 0.6801 0.1889  -0.0037 0.0329  135 PRO A O   
1026 C CB  . PRO A 133 ? 0.6906 1.1316 0.7580 0.1699  -0.0120 0.0754  135 PRO A CB  
1027 C CG  . PRO A 133 ? 0.7677 1.2262 0.8529 0.1652  -0.0167 0.0898  135 PRO A CG  
1028 C CD  . PRO A 133 ? 0.7507 1.1952 0.8222 0.1696  -0.0139 0.0747  135 PRO A CD  
1029 N N   . THR A 134 ? 0.6567 1.0329 0.6778 0.1766  -0.0045 0.0284  136 THR A N   
1030 C CA  . THR A 134 ? 0.6836 1.0460 0.6794 0.1852  -0.0021 0.0141  136 THR A CA  
1031 C C   . THR A 134 ? 0.6835 1.0716 0.6666 0.1998  -0.0002 0.0208  136 THR A C   
1032 O O   . THR A 134 ? 0.6787 1.0917 0.6738 0.2000  0.0008  0.0361  136 THR A O   
1033 C CB  . THR A 134 ? 0.6754 1.0128 0.6681 0.1785  -0.0020 0.0036  136 THR A CB  
1034 O OG1 . THR A 134 ? 0.7077 1.0544 0.7026 0.1801  -0.0008 0.0104  136 THR A OG1 
1035 C CG2 . THR A 134 ? 0.7348 1.0579 0.7450 0.1658  -0.0042 0.0007  136 THR A CG2 
1036 N N   . GLN A 135 ? 0.6786 1.0624 0.6382 0.2127  -0.0010 0.0099  137 GLN A N   
1037 C CA  . GLN A 135 ? 0.6776 1.0851 0.6210 0.2307  -0.0003 0.0122  137 GLN A CA  
1038 C C   . GLN A 135 ? 0.6930 1.0802 0.6194 0.2354  -0.0017 0.0002  137 GLN A C   
1039 O O   . GLN A 135 ? 0.6671 1.0204 0.5857 0.2290  -0.0052 -0.0133 137 GLN A O   
1040 C CB  . GLN A 135 ? 0.6619 1.0747 0.5881 0.2446  -0.0033 0.0054  137 GLN A CB  
1041 C CG  . GLN A 135 ? 0.7840 1.2145 0.6863 0.2678  -0.0051 0.0005  137 GLN A CG  
1042 C CD  . GLN A 135 ? 0.7283 1.1711 0.6163 0.2830  -0.0088 -0.0039 137 GLN A CD  
1043 O OE1 . GLN A 135 ? 0.7792 1.2210 0.6778 0.2746  -0.0087 -0.0004 137 GLN A OE1 
1044 N NE2 . GLN A 135 ? 0.7573 1.2120 0.6204 0.3067  -0.0129 -0.0124 137 GLN A NE2 
1045 N N   . GLU A 136 ? 0.7164 1.1263 0.6377 0.2463  0.0004  0.0064  138 GLU A N   
1046 C CA  . GLU A 136 ? 0.7388 1.1307 0.6426 0.2527  -0.0018 -0.0050 138 GLU A CA  
1047 C C   . GLU A 136 ? 0.7609 1.1714 0.6411 0.2773  -0.0044 -0.0100 138 GLU A C   
1048 O O   . GLU A 136 ? 0.7409 1.1920 0.6222 0.2899  -0.0013 0.0012  138 GLU A O   
1049 C CB  . GLU A 136 ? 0.7684 1.1582 0.6878 0.2401  0.0018  0.0025  138 GLU A CB  
1050 C CG  . GLU A 136 ? 0.8363 1.2648 0.7654 0.2456  0.0059  0.0200  138 GLU A CG  
1051 C CD  . GLU A 136 ? 0.8235 1.2450 0.7715 0.2298  0.0074  0.0280  138 GLU A CD  
1052 O OE1 . GLU A 136 ? 0.8769 1.3148 0.8492 0.2187  0.0076  0.0446  138 GLU A OE1 
1053 O OE2 . GLU A 136 ? 0.8989 1.2969 0.8378 0.2282  0.0067  0.0176  138 GLU A OE2 
1054 N N   . THR A 137 ? 0.7672 1.1486 0.6260 0.2847  -0.0112 -0.0267 139 THR A N   
1055 C CA  . THR A 137 ? 0.7690 1.1621 0.6040 0.3091  -0.0157 -0.0343 139 THR A CA  
1056 C C   . THR A 137 ? 0.7602 1.1325 0.5893 0.3067  -0.0177 -0.0404 139 THR A C   
1057 O O   . THR A 137 ? 0.7011 1.0379 0.5347 0.2895  -0.0201 -0.0460 139 THR A O   
1058 C CB  . THR A 137 ? 0.8001 1.1748 0.6097 0.3257  -0.0275 -0.0518 139 THR A CB  
1059 O OG1 . THR A 137 ? 0.8155 1.2071 0.6018 0.3534  -0.0328 -0.0595 139 THR A OG1 
1060 C CG2 . THR A 137 ? 0.7437 1.0655 0.5462 0.3130  -0.0377 -0.0661 139 THR A CG2 
1061 N N   . LYS A 138 ? 0.7699 1.1666 0.5883 0.3249  -0.0170 -0.0391 140 LYS A N   
1062 C CA  . LYS A 138 ? 0.8035 1.1865 0.6173 0.3242  -0.0181 -0.0427 140 LYS A CA  
1063 C C   . LYS A 138 ? 0.8314 1.2135 0.6155 0.3520  -0.0279 -0.0577 140 LYS A C   
1064 O O   . LYS A 138 ? 0.8827 1.3033 0.6575 0.3745  -0.0267 -0.0550 140 LYS A O   
1065 C CB  . LYS A 138 ? 0.8002 1.2187 0.6358 0.3166  -0.0068 -0.0224 140 LYS A CB  
1066 C CG  . LYS A 138 ? 0.8590 1.2726 0.6912 0.3177  -0.0064 -0.0233 140 LYS A CG  
1067 C CD  . LYS A 138 ? 0.9098 1.3547 0.7680 0.3053  0.0032  -0.0012 140 LYS A CD  
1068 C CE  . LYS A 138 ? 0.9874 1.4321 0.8435 0.3067  0.0041  0.0000  140 LYS A CE  
1069 N NZ  . LYS A 138 ? 0.9825 1.4731 0.8589 0.3042  0.0113  0.0238  140 LYS A NZ  
1070 N N   . LYS A 139 ? 0.8451 1.1847 0.6146 0.3510  -0.0389 -0.0730 141 LYS A N   
1071 C CA  . LYS A 139 ? 0.9046 1.2370 0.6462 0.3770  -0.0512 -0.0885 141 LYS A CA  
1072 C C   . LYS A 139 ? 0.9082 1.2230 0.6485 0.3720  -0.0527 -0.0906 141 LYS A C   
1073 O O   . LYS A 139 ? 0.8317 1.1058 0.5760 0.3522  -0.0579 -0.0948 141 LYS A O   
1074 C CB  . LYS A 139 ? 0.9555 1.2486 0.6745 0.3867  -0.0703 -0.1082 141 LYS A CB  
1075 C CG  . LYS A 139 ? 1.0140 1.3310 0.7140 0.4159  -0.0764 -0.1160 141 LYS A CG  
1076 C CD  . LYS A 139 ? 1.0769 1.3948 0.7475 0.4490  -0.0902 -0.1325 141 LYS A CD  
1077 C CE  . LYS A 139 ? 1.2317 1.5726 0.8813 0.4802  -0.0980 -0.1426 141 LYS A CE  
1078 N NZ  . LYS A 139 ? 1.1579 1.4635 0.8016 0.4744  -0.1109 -0.1524 141 LYS A NZ  
1079 N N   . ASN A 140 ? 0.9029 1.2507 0.6370 0.3906  -0.0488 -0.0873 142 ASN A N   
1080 C CA  . ASN A 140 ? 0.9351 1.2694 0.6661 0.3892  -0.0507 -0.0897 142 ASN A CA  
1081 C C   . ASN A 140 ? 0.9991 1.2886 0.7036 0.4019  -0.0714 -0.1117 142 ASN A C   
1082 O O   . ASN A 140 ? 1.0642 1.3462 0.7478 0.4228  -0.0848 -0.1258 142 ASN A O   
1083 C CB  . ASN A 140 ? 0.9782 1.3635 0.7102 0.4066  -0.0413 -0.0791 142 ASN A CB  
1084 C CG  . ASN A 140 ? 0.9934 1.4160 0.7558 0.3879  -0.0239 -0.0541 142 ASN A CG  
1085 O OD1 . ASN A 140 ? 1.0714 1.5290 0.8432 0.3903  -0.0173 -0.0426 142 ASN A OD1 
1086 N ND2 . ASN A 140 ? 1.1090 1.5242 0.8871 0.3693  -0.0181 -0.0452 142 ASN A ND2 
1087 N N   . PHE A 141 ? 0.9592 1.2177 0.6648 0.3889  -0.0759 -0.1144 143 PHE A N   
1088 C CA  . PHE A 141 ? 1.0429 1.2613 0.7245 0.4016  -0.0974 -0.1330 143 PHE A CA  
1089 C C   . PHE A 141 ? 1.0953 1.3164 0.7746 0.4057  -0.0962 -0.1323 143 PHE A C   
1090 O O   . PHE A 141 ? 1.0429 1.2910 0.7416 0.3932  -0.0786 -0.1166 143 PHE A O   
1091 C CB  . PHE A 141 ? 1.0265 1.1914 0.7080 0.3808  -0.1123 -0.1396 143 PHE A CB  
1092 C CG  . PHE A 141 ? 0.9737 1.1257 0.6785 0.3469  -0.1021 -0.1271 143 PHE A CG  
1093 C CD1 . PHE A 141 ? 0.9550 1.0842 0.6590 0.3379  -0.1076 -0.1282 143 PHE A CD1 
1094 C CD2 . PHE A 141 ? 0.9036 1.0669 0.6306 0.3252  -0.0879 -0.1149 143 PHE A CD2 
1095 C CE1 . PHE A 141 ? 0.7706 0.8921 0.4951 0.3086  -0.0979 -0.1170 143 PHE A CE1 
1096 C CE2 . PHE A 141 ? 0.8594 1.0139 0.6062 0.2976  -0.0792 -0.1052 143 PHE A CE2 
1097 C CZ  . PHE A 141 ? 0.8457 0.9804 0.5910 0.2894  -0.0839 -0.1062 143 PHE A CZ  
1098 N N   . GLU A 142 ? 1.1923 1.3834 0.8478 0.4232  -0.1169 -0.1495 144 GLU A N   
1099 C CA  . GLU A 142 ? 1.2369 1.4315 0.8851 0.4341  -0.1188 -0.1521 144 GLU A CA  
1100 C C   . GLU A 142 ? 1.2424 1.3915 0.8954 0.4108  -0.1277 -0.1529 144 GLU A C   
1101 O O   . GLU A 142 ? 1.2617 1.3650 0.9058 0.4040  -0.1476 -0.1627 144 GLU A O   
1102 C CB  . GLU A 142 ? 1.2930 1.4898 0.9101 0.4742  -0.1369 -0.1714 144 GLU A CB  
1103 C CG  . GLU A 142 ? 1.3827 1.6028 0.9934 0.4915  -0.1335 -0.1715 144 GLU A CG  
1104 C CD  . GLU A 142 ? 1.4553 1.7454 1.0766 0.5032  -0.1105 -0.1556 144 GLU A CD  
1105 O OE1 . GLU A 142 ? 1.2828 1.6032 0.9182 0.4959  -0.0967 -0.1433 144 GLU A OE1 
1106 O OE2 . GLU A 142 ? 1.4313 1.7471 1.0474 0.5194  -0.1073 -0.1544 144 GLU A OE2 
1107 N N   . VAL A 143 ? 1.2543 1.4181 0.9217 0.3984  -0.1137 -0.1412 145 VAL A N   
1108 C CA  . VAL A 143 ? 1.2898 1.4178 0.9611 0.3788  -0.1206 -0.1410 145 VAL A CA  
1109 C C   . VAL A 143 ? 1.3478 1.4790 1.0048 0.3989  -0.1271 -0.1478 145 VAL A C   
1110 O O   . VAL A 143 ? 1.3503 1.5212 1.0004 0.4240  -0.1201 -0.1481 145 VAL A O   
1111 C CB  . VAL A 143 ? 1.2158 1.3512 0.9151 0.3458  -0.1017 -0.1236 145 VAL A CB  
1112 C CG1 . VAL A 143 ? 1.1989 1.3673 0.9097 0.3455  -0.0850 -0.1123 145 VAL A CG1 
1113 C CG2 . VAL A 143 ? 1.2609 1.3530 0.9637 0.3215  -0.1128 -0.1245 145 VAL A CG2 
1114 N N   . VAL A 144 ? 1.3829 1.4749 1.0362 0.3879  -0.1408 -0.1522 146 VAL A N   
1115 C CA  . VAL A 144 ? 1.4508 1.5323 1.0863 0.4082  -0.1547 -0.1629 146 VAL A CA  
1116 C C   . VAL A 144 ? 1.4348 1.5485 1.0818 0.4058  -0.1361 -0.1514 146 VAL A C   
1117 O O   . VAL A 144 ? 1.4848 1.6095 1.1177 0.4297  -0.1413 -0.1585 146 VAL A O   
1118 C CB  . VAL A 144 ? 1.4858 1.5097 1.1135 0.3957  -0.1801 -0.1709 146 VAL A CB  
1119 C CG1 . VAL A 144 ? 1.4581 1.4734 1.1046 0.3652  -0.1707 -0.1573 146 VAL A CG1 
1120 C CG2 . VAL A 144 ? 1.5980 1.6001 1.1979 0.4273  -0.2062 -0.1903 146 VAL A CG2 
1121 N N   . PRO A 152 ? 1.2809 1.6142 1.0189 0.3830  -0.0390 -0.0456 154 PRO A N   
1122 C CA  . PRO A 152 ? 1.2666 1.6307 1.0179 0.3800  -0.0302 -0.0295 154 PRO A CA  
1123 C C   . PRO A 152 ? 1.2087 1.6193 0.9856 0.3689  -0.0155 -0.0052 154 PRO A C   
1124 O O   . PRO A 152 ? 1.1924 1.5957 0.9814 0.3524  -0.0116 -0.0009 154 PRO A O   
1125 C CB  . PRO A 152 ? 1.2452 1.5655 1.0029 0.3539  -0.0329 -0.0313 154 PRO A CB  
1126 C CG  . PRO A 152 ? 1.2198 1.5039 0.9807 0.3340  -0.0352 -0.0376 154 PRO A CG  
1127 C CD  . PRO A 152 ? 1.2471 1.5308 0.9911 0.3546  -0.0425 -0.0503 154 PRO A CD  
1128 N N   . ASP A 153 ? 1.1528 1.6106 0.9389 0.3772  -0.0089 0.0117  155 ASP A N   
1129 C CA  . ASP A 153 ? 1.0684 1.5741 0.8795 0.3678  0.0019  0.0375  155 ASP A CA  
1130 C C   . ASP A 153 ? 0.9654 1.4506 0.8021 0.3329  0.0058  0.0504  155 ASP A C   
1131 O O   . ASP A 153 ? 0.9447 1.4057 0.7867 0.3179  0.0045  0.0507  155 ASP A O   
1132 C CB  . ASP A 153 ? 1.1100 1.6773 0.9265 0.3848  0.0070  0.0558  155 ASP A CB  
1133 C CG  . ASP A 153 ? 1.1224 1.7460 0.9619 0.3803  0.0153  0.0830  155 ASP A CG  
1134 O OD1 . ASP A 153 ? 1.1226 1.7638 0.9883 0.3592  0.0192  0.1068  155 ASP A OD1 
1135 O OD2 . ASP A 153 ? 1.2206 1.8703 1.0525 0.3971  0.0165  0.0811  155 ASP A OD2 
1136 N N   . LEU A 154 ? 0.8686 1.3648 0.7204 0.3218  0.0097  0.0604  156 LEU A N   
1137 C CA  . LEU A 154 ? 0.8083 1.2852 0.6834 0.2917  0.0112  0.0705  156 LEU A CA  
1138 C C   . LEU A 154 ? 0.7343 1.2315 0.6313 0.2780  0.0128  0.0924  156 LEU A C   
1139 O O   . LEU A 154 ? 0.7059 1.1736 0.6152 0.2558  0.0107  0.0936  156 LEU A O   
1140 C CB  . LEU A 154 ? 0.7880 1.2827 0.6753 0.2872  0.0139  0.0796  156 LEU A CB  
1141 C CG  . LEU A 154 ? 0.8138 1.2865 0.7234 0.2592  0.0132  0.0871  156 LEU A CG  
1142 C CD1 . LEU A 154 ? 0.7690 1.1858 0.6664 0.2497  0.0100  0.0638  156 LEU A CD1 
1143 C CD2 . LEU A 154 ? 0.8324 1.3368 0.7582 0.2568  0.0152  0.1032  156 LEU A CD2 
1144 N N   . MET A 155 ? 0.7139 1.2637 0.6156 0.2921  0.0157  0.1098  157 MET A N   
1145 C CA  . MET A 155 ? 0.7042 1.2797 0.6294 0.2788  0.0160  0.1347  157 MET A CA  
1146 C C   . MET A 155 ? 0.6729 1.2450 0.5892 0.2853  0.0150  0.1312  157 MET A C   
1147 O O   . MET A 155 ? 0.6931 1.2871 0.6278 0.2753  0.0145  0.1519  157 MET A O   
1148 C CB  . MET A 155 ? 0.7287 1.3704 0.6711 0.2852  0.0192  0.1628  157 MET A CB  
1149 C CG  . MET A 155 ? 0.7256 1.3696 0.6838 0.2721  0.0185  0.1717  157 MET A CG  
1150 S SD  . MET A 155 ? 0.8420 1.4525 0.8302 0.2358  0.0110  0.1847  157 MET A SD  
1151 C CE  . MET A 155 ? 0.7223 1.2671 0.6986 0.2259  0.0094  0.1552  157 MET A CE  
1152 N N   . ALA A 156 ? 0.6461 1.1904 0.5349 0.3017  0.0130  0.1059  158 ALA A N   
1153 C CA  . ALA A 156 ? 0.6774 1.2162 0.5548 0.3106  0.0110  0.0999  158 ALA A CA  
1154 C C   . ALA A 156 ? 0.6709 1.1593 0.5541 0.2858  0.0076  0.0936  158 ALA A C   
1155 O O   . ALA A 156 ? 0.6662 1.1144 0.5482 0.2718  0.0057  0.0813  158 ALA A O   
1156 C CB  . ALA A 156 ? 0.7204 1.2441 0.5663 0.3374  0.0066  0.0745  158 ALA A CB  
1157 N N   . PRO A 157 ? 0.6739 1.1674 0.5633 0.2812  0.0069  0.1022  159 PRO A N   
1158 C CA  . PRO A 157 ? 0.6692 1.1173 0.5605 0.2614  0.0034  0.0946  159 PRO A CA  
1159 C C   . PRO A 157 ? 0.7200 1.1183 0.5882 0.2639  -0.0010 0.0674  159 PRO A C   
1160 O O   . PRO A 157 ? 0.7192 1.1167 0.5666 0.2850  -0.0035 0.0533  159 PRO A O   
1161 C CB  . PRO A 157 ? 0.6658 1.1349 0.5594 0.2668  0.0032  0.1049  159 PRO A CB  
1162 C CG  . PRO A 157 ? 0.6107 1.1425 0.5183 0.2770  0.0073  0.1293  159 PRO A CG  
1163 C CD  . PRO A 157 ? 0.6496 1.1960 0.5441 0.2957  0.0095  0.1203  159 PRO A CD  
1164 N N   . VAL A 158 ? 0.7046 1.0630 0.5771 0.2426  -0.0033 0.0610  160 VAL A N   
1165 C CA  . VAL A 158 ? 0.7312 1.0445 0.5856 0.2402  -0.0083 0.0395  160 VAL A CA  
1166 C C   . VAL A 158 ? 0.6959 0.9882 0.5509 0.2288  -0.0109 0.0386  160 VAL A C   
1167 O O   . VAL A 158 ? 0.6766 0.9734 0.5491 0.2132  -0.0091 0.0505  160 VAL A O   
1168 C CB  . VAL A 158 ? 0.6937 0.9818 0.5529 0.2242  -0.0081 0.0331  160 VAL A CB  
1169 C CG1 . VAL A 158 ? 0.7355 0.9828 0.5761 0.2225  -0.0143 0.0135  160 VAL A CG1 
1170 C CG2 . VAL A 158 ? 0.7421 1.0531 0.6065 0.2307  -0.0047 0.0380  160 VAL A CG2 
1171 N N   . SER A 159 ? 0.7323 1.0030 0.5684 0.2376  -0.0168 0.0250  161 SER A N   
1172 C CA  . SER A 159 ? 0.7207 0.9677 0.5550 0.2265  -0.0203 0.0221  161 SER A CA  
1173 C C   . SER A 159 ? 0.7628 0.9690 0.5804 0.2229  -0.0282 0.0046  161 SER A C   
1174 O O   . SER A 159 ? 0.7891 0.9879 0.5916 0.2374  -0.0340 -0.0061 161 SER A O   
1175 C CB  . SER A 159 ? 0.7624 1.0293 0.5932 0.2402  -0.0212 0.0278  161 SER A CB  
1176 O OG  . SER A 159 ? 0.8973 1.1521 0.7060 0.2595  -0.0291 0.0136  161 SER A OG  
1177 N N   . ALA A 160 ? 0.6817 0.8636 0.5030 0.2032  -0.0295 0.0029  162 ALA A N   
1178 C CA  . ALA A 160 ? 0.6125 0.7596 0.4219 0.1950  -0.0374 -0.0090 162 ALA A CA  
1179 C C   . ALA A 160 ? 0.5917 0.7250 0.4032 0.1811  -0.0392 -0.0070 162 ALA A C   
1180 O O   . ALA A 160 ? 0.5272 0.6740 0.3520 0.1734  -0.0332 0.0023  162 ALA A O   
1181 C CB  . ALA A 160 ? 0.5560 0.6933 0.3697 0.1827  -0.0355 -0.0123 162 ALA A CB  
1182 N N   . LYS A 161 ? 0.5587 0.6655 0.3574 0.1784  -0.0491 -0.0149 163 LYS A N   
1183 C CA  . LYS A 161 ? 0.6012 0.6939 0.3998 0.1654  -0.0524 -0.0135 163 LYS A CA  
1184 C C   . LYS A 161 ? 0.6281 0.6953 0.4193 0.1532  -0.0612 -0.0192 163 LYS A C   
1185 O O   . LYS A 161 ? 0.6433 0.6983 0.4253 0.1596  -0.0692 -0.0256 163 LYS A O   
1186 C CB  . LYS A 161 ? 0.6308 0.7230 0.4212 0.1783  -0.0583 -0.0137 163 LYS A CB  
1187 C CG  . LYS A 161 ? 0.8557 0.9257 0.6280 0.1910  -0.0733 -0.0239 163 LYS A CG  
1188 C CD  . LYS A 161 ? 0.9873 1.0419 0.7521 0.1915  -0.0830 -0.0248 163 LYS A CD  
1189 C CE  . LYS A 161 ? 1.1207 1.1503 0.8856 0.1691  -0.0902 -0.0240 163 LYS A CE  
1190 N NZ  . LYS A 161 ? 1.1070 1.1296 0.8716 0.1625  -0.0939 -0.0201 163 LYS A NZ  
1191 N N   . LYS A 162 ? 0.5917 0.6531 0.3875 0.1358  -0.0605 -0.0159 164 LYS A N   
1192 C CA  . LYS A 162 ? 0.6107 0.6537 0.4013 0.1217  -0.0693 -0.0173 164 LYS A CA  
1193 C C   . LYS A 162 ? 0.6238 0.6649 0.4166 0.1093  -0.0700 -0.0125 164 LYS A C   
1194 O O   . LYS A 162 ? 0.5984 0.6540 0.4004 0.1049  -0.0603 -0.0090 164 LYS A O   
1195 C CB  . LYS A 162 ? 0.5394 0.5893 0.3368 0.1106  -0.0635 -0.0171 164 LYS A CB  
1196 C CG  . LYS A 162 ? 0.6803 0.7175 0.4736 0.0971  -0.0729 -0.0161 164 LYS A CG  
1197 C CD  . LYS A 162 ? 0.8458 0.8753 0.6348 0.1022  -0.0784 -0.0202 164 LYS A CD  
1198 C CE  . LYS A 162 ? 0.9489 0.9809 0.7416 0.0860  -0.0799 -0.0166 164 LYS A CE  
1199 N NZ  . LYS A 162 ? 0.7032 0.7455 0.5005 0.0898  -0.0721 -0.0200 164 LYS A NZ  
1200 N N   . GLU A 163 ? 0.6591 0.6816 0.4438 0.1037  -0.0830 -0.0119 165 GLU A N   
1201 C CA  . GLU A 163 ? 0.6805 0.7005 0.4662 0.0904  -0.0857 -0.0063 165 GLU A CA  
1202 C C   . GLU A 163 ? 0.6989 0.7117 0.4834 0.0738  -0.0946 -0.0020 165 GLU A C   
1203 O O   . GLU A 163 ? 0.6999 0.6986 0.4792 0.0750  -0.1056 -0.0036 165 GLU A O   
1204 C CB  . GLU A 163 ? 0.7028 0.7075 0.4802 0.0994  -0.0965 -0.0072 165 GLU A CB  
1205 C CG  . GLU A 163 ? 0.8815 0.8844 0.6601 0.0879  -0.0989 -0.0013 165 GLU A CG  
1206 C CD  . GLU A 163 ? 1.1034 1.0841 0.8720 0.0943  -0.1153 -0.0024 165 GLU A CD  
1207 O OE1 . GLU A 163 ? 1.1777 1.1381 0.9393 0.0939  -0.1313 -0.0041 165 GLU A OE1 
1208 O OE2 . GLU A 163 ? 1.1618 1.1446 0.9300 0.0999  -0.1138 -0.0015 165 GLU A OE2 
1209 N N   . LYS A 164 ? 0.6769 0.7014 0.4664 0.0588  -0.0907 0.0042  166 LYS A N   
1210 C CA  . LYS A 164 ? 0.6515 0.6787 0.4420 0.0416  -0.0978 0.0118  166 LYS A CA  
1211 C C   . LYS A 164 ? 0.6597 0.6898 0.4503 0.0303  -0.1015 0.0194  166 LYS A C   
1212 O O   . LYS A 164 ? 0.5471 0.5875 0.3403 0.0325  -0.0920 0.0180  166 LYS A O   
1213 C CB  . LYS A 164 ? 0.6566 0.7083 0.4543 0.0356  -0.0853 0.0118  166 LYS A CB  
1214 C CG  . LYS A 164 ? 0.8106 0.8672 0.6093 0.0224  -0.0928 0.0190  166 LYS A CG  
1215 C CD  . LYS A 164 ? 0.9326 1.0151 0.7376 0.0200  -0.0801 0.0173  166 LYS A CD  
1216 C CE  . LYS A 164 ? 0.8956 1.0041 0.7042 0.0131  -0.0717 0.0200  166 LYS A CE  
1217 N NZ  . LYS A 164 ? 0.7496 0.8854 0.5618 0.0032  -0.0694 0.0258  166 LYS A NZ  
1218 N N   . LYS A 165 ? 0.6818 0.7026 0.4703 0.0175  -0.1169 0.0286  167 LYS A N   
1219 C CA  . LYS A 165 ? 0.7112 0.7364 0.5005 0.0042  -0.1228 0.0387  167 LYS A CA  
1220 C C   . LYS A 165 ? 0.6856 0.7451 0.4814 -0.0079 -0.1114 0.0446  167 LYS A C   
1221 O O   . LYS A 165 ? 0.6350 0.7084 0.4341 -0.0147 -0.1109 0.0486  167 LYS A O   
1222 C CB  . LYS A 165 ? 0.7740 0.7769 0.5602 -0.0061 -0.1464 0.0483  167 LYS A CB  
1223 C CG  . LYS A 165 ? 0.9439 0.9490 0.7313 -0.0204 -0.1553 0.0606  167 LYS A CG  
1224 C CD  . LYS A 165 ? 1.0837 1.0693 0.8711 -0.0344 -0.1812 0.0736  167 LYS A CD  
1225 C CE  . LYS A 165 ? 1.1558 1.1392 0.9444 -0.0475 -0.1928 0.0861  167 LYS A CE  
1226 N NZ  . LYS A 165 ? 1.2257 1.2013 1.0189 -0.0678 -0.2175 0.1049  167 LYS A NZ  
1227 N N   . VAL A 166 ? 0.6463 0.7208 0.4432 -0.0091 -0.1026 0.0447  168 VAL A N   
1228 C CA  . VAL A 166 ? 0.5943 0.7030 0.3952 -0.0177 -0.0935 0.0490  168 VAL A CA  
1229 C C   . VAL A 166 ? 0.6491 0.7648 0.4491 -0.0286 -0.0991 0.0591  168 VAL A C   
1230 O O   . VAL A 166 ? 0.6116 0.7291 0.4104 -0.0231 -0.0924 0.0540  168 VAL A O   
1231 C CB  . VAL A 166 ? 0.5487 0.6716 0.3517 -0.0055 -0.0768 0.0363  168 VAL A CB  
1232 C CG1 . VAL A 166 ? 0.6132 0.7720 0.4179 -0.0112 -0.0694 0.0384  168 VAL A CG1 
1233 C CG2 . VAL A 166 ? 0.5708 0.6874 0.3757 0.0048  -0.0716 0.0274  168 VAL A CG2 
1234 N N   . SER A 167 ? 0.6910 0.8107 0.4923 -0.0446 -0.1126 0.0747  169 SER A N   
1235 C CA  . SER A 167 ? 0.6789 0.8019 0.4798 -0.0563 -0.1211 0.0866  169 SER A CA  
1236 C C   . SER A 167 ? 0.6704 0.8358 0.4734 -0.0638 -0.1118 0.0931  169 SER A C   
1237 O O   . SER A 167 ? 0.6165 0.8111 0.4214 -0.0624 -0.1019 0.0911  169 SER A O   
1238 C CB  . SER A 167 ? 0.7460 0.8549 0.5489 -0.0720 -0.1431 0.1034  169 SER A CB  
1239 O OG  . SER A 167 ? 0.7917 0.9250 0.6000 -0.0830 -0.1447 0.1140  169 SER A OG  
1240 N N   . SER A 168 ? 0.6773 0.8461 0.4792 -0.0707 -0.1160 0.1005  170 SER A N   
1241 C CA  . SER A 168 ? 0.7087 0.9171 0.5109 -0.0772 -0.1096 0.1075  170 SER A CA  
1242 C C   . SER A 168 ? 0.7350 0.9392 0.5393 -0.0943 -0.1260 0.1265  170 SER A C   
1243 O O   . SER A 168 ? 0.7448 0.9104 0.5486 -0.0959 -0.1401 0.1283  170 SER A O   
1244 C CB  . SER A 168 ? 0.6825 0.8875 0.4803 -0.0643 -0.0986 0.0931  170 SER A CB  
1245 O OG  . SER A 168 ? 0.8510 1.0611 0.6480 -0.0493 -0.0853 0.0766  170 SER A OG  
1246 N N   . MET A 169 ? 0.7778 1.0214 0.5838 -0.1056 -0.1252 0.1403  171 MET A N   
1247 C CA  . MET A 169 ? 0.8137 1.0541 0.6222 -0.1221 -0.1408 0.1591  171 MET A CA  
1248 C C   . MET A 169 ? 0.8115 1.0156 0.6151 -0.1141 -0.1429 0.1491  171 MET A C   
1249 O O   . MET A 169 ? 0.8354 1.0090 0.6400 -0.1220 -0.1604 0.1577  171 MET A O   
1250 C CB  . MET A 169 ? 0.8310 1.1273 0.6416 -0.1329 -0.1364 0.1744  171 MET A CB  
1251 C CG  . MET A 169 ? 0.9610 1.2714 0.7798 -0.1573 -0.1555 0.2040  171 MET A CG  
1252 S SD  . MET A 169 ? 0.9848 1.3592 0.8047 -0.1681 -0.1506 0.2220  171 MET A SD  
1253 C CE  . MET A 169 ? 1.0353 1.3692 0.8514 -0.1688 -0.1592 0.2192  171 MET A CE  
1254 N N   . PHE A 170 ? 0.7968 1.0040 0.5954 -0.0981 -0.1266 0.1310  172 PHE A N   
1255 C CA  . PHE A 170 ? 0.8029 0.9852 0.5975 -0.0908 -0.1263 0.1229  172 PHE A CA  
1256 C C   . PHE A 170 ? 0.7949 0.9371 0.5872 -0.0750 -0.1248 0.1068  172 PHE A C   
1257 O O   . PHE A 170 ? 0.7676 0.8865 0.5576 -0.0690 -0.1271 0.1020  172 PHE A O   
1258 C CB  . PHE A 170 ? 0.7662 0.9777 0.5574 -0.0849 -0.1128 0.1162  172 PHE A CB  
1259 C CG  . PHE A 170 ? 0.9393 1.1911 0.7315 -0.0996 -0.1160 0.1336  172 PHE A CG  
1260 C CD1 . PHE A 170 ? 0.9502 1.1941 0.7448 -0.1148 -0.1305 0.1508  172 PHE A CD1 
1261 C CD2 . PHE A 170 ? 0.9696 1.2698 0.7604 -0.0978 -0.1056 0.1336  172 PHE A CD2 
1262 C CE1 . PHE A 170 ? 0.9788 1.2642 0.7755 -0.1297 -0.1341 0.1699  172 PHE A CE1 
1263 C CE2 . PHE A 170 ? 0.9369 1.2817 0.7285 -0.1105 -0.1083 0.1514  172 PHE A CE2 
1264 C CZ  . PHE A 170 ? 0.9453 1.2836 0.7405 -0.1273 -0.1222 0.1705  172 PHE A CZ  
1265 N N   . ILE A 171 ? 0.7612 0.8992 0.5545 -0.0679 -0.1206 0.0992  173 ILE A N   
1266 C CA  . ILE A 171 ? 0.7480 0.8517 0.5396 -0.0536 -0.1210 0.0867  173 ILE A CA  
1267 C C   . ILE A 171 ? 0.7651 0.8562 0.5580 -0.0577 -0.1319 0.0913  173 ILE A C   
1268 O O   . ILE A 171 ? 0.7701 0.8661 0.5640 -0.0510 -0.1242 0.0839  173 ILE A O   
1269 C CB  . ILE A 171 ? 0.7245 0.8348 0.5162 -0.0376 -0.1037 0.0703  173 ILE A CB  
1270 C CG1 . ILE A 171 ? 0.7305 0.8610 0.5215 -0.0364 -0.0948 0.0674  173 ILE A CG1 
1271 C CG2 . ILE A 171 ? 0.7115 0.7914 0.5020 -0.0226 -0.1039 0.0600  173 ILE A CG2 
1272 C CD1 . ILE A 171 ? 0.7097 0.8476 0.5021 -0.0228 -0.0816 0.0528  173 ILE A CD1 
1273 N N   . PRO A 172 ? 0.7910 0.8637 0.5842 -0.0689 -0.1516 0.1036  174 PRO A N   
1274 C CA  . PRO A 172 ? 0.8306 0.8900 0.6256 -0.0749 -0.1661 0.1099  174 PRO A CA  
1275 C C   . PRO A 172 ? 0.8366 0.8671 0.6271 -0.0567 -0.1656 0.0939  174 PRO A C   
1276 O O   . PRO A 172 ? 0.8315 0.8593 0.6234 -0.0578 -0.1699 0.0945  174 PRO A O   
1277 C CB  . PRO A 172 ? 0.8655 0.9041 0.6613 -0.0886 -0.1906 0.1250  174 PRO A CB  
1278 C CG  . PRO A 172 ? 0.9196 0.9750 0.7157 -0.0944 -0.1853 0.1306  174 PRO A CG  
1279 C CD  . PRO A 172 ? 0.8444 0.9054 0.6365 -0.0765 -0.1638 0.1125  174 PRO A CD  
1280 N N   . ASP A 173 ? 0.8616 0.8742 0.6473 -0.0400 -0.1604 0.0809  175 ASP A N   
1281 C CA  . ASP A 173 ? 0.8748 0.8665 0.6561 -0.0210 -0.1590 0.0666  175 ASP A CA  
1282 C C   . ASP A 173 ? 0.7806 0.7898 0.5638 -0.0079 -0.1366 0.0547  175 ASP A C   
1283 O O   . ASP A 173 ? 0.7597 0.7568 0.5399 0.0091  -0.1328 0.0444  175 ASP A O   
1284 C CB  . ASP A 173 ? 0.9536 0.9124 0.7280 -0.0090 -0.1733 0.0613  175 ASP A CB  
1285 C CG  . ASP A 173 ? 1.0854 1.0235 0.8539 0.0099  -0.1778 0.0489  175 ASP A CG  
1286 O OD1 . ASP A 173 ? 1.2484 1.1789 1.0168 0.0059  -0.1873 0.0505  175 ASP A OD1 
1287 O OD2 . ASP A 173 ? 1.2425 1.1750 1.0067 0.0289  -0.1718 0.0382  175 ASP A OD2 
1288 N N   . GLY A 174 ? 0.7156 0.7545 0.5037 -0.0152 -0.1232 0.0568  176 GLY A N   
1289 C CA  . GLY A 174 ? 0.6408 0.6946 0.4316 -0.0041 -0.1053 0.0463  176 GLY A CA  
1290 C C   . GLY A 174 ? 0.6123 0.6580 0.4030 0.0062  -0.1032 0.0387  176 GLY A C   
1291 O O   . GLY A 174 ? 0.6408 0.6783 0.4302 0.0015  -0.1130 0.0422  176 GLY A O   
1292 N N   . ARG A 175 ? 0.6012 0.6493 0.3940 0.0197  -0.0917 0.0294  177 ARG A N   
1293 C CA  . ARG A 175 ? 0.5879 0.6302 0.3809 0.0308  -0.0891 0.0225  177 ARG A CA  
1294 C C   . ARG A 175 ? 0.5502 0.6081 0.3496 0.0381  -0.0747 0.0163  177 ARG A C   
1295 O O   . ARG A 175 ? 0.5130 0.5781 0.3159 0.0397  -0.0688 0.0156  177 ARG A O   
1296 C CB  . ARG A 175 ? 0.6951 0.7157 0.4826 0.0446  -0.0969 0.0188  177 ARG A CB  
1297 C CG  . ARG A 175 ? 0.8592 0.8583 0.6399 0.0412  -0.1149 0.0217  177 ARG A CG  
1298 C CD  . ARG A 175 ? 1.0826 1.0593 0.8558 0.0516  -0.1276 0.0196  177 ARG A CD  
1299 N NE  . ARG A 175 ? 1.1627 1.1165 0.9304 0.0438  -0.1491 0.0243  177 ARG A NE  
1300 C CZ  . ARG A 175 ? 1.2901 1.2293 1.0543 0.0454  -0.1609 0.0223  177 ARG A CZ  
1301 N NH1 . ARG A 175 ? 1.2046 1.1512 0.9693 0.0552  -0.1515 0.0151  177 ARG A NH1 
1302 N NH2 . ARG A 175 ? 1.3363 1.2525 1.0970 0.0367  -0.1838 0.0283  177 ARG A NH2 
1303 N N   . VAL A 176 ? 0.5378 0.5995 0.3393 0.0422  -0.0707 0.0122  178 VAL A N   
1304 C CA  . VAL A 176 ? 0.4517 0.5244 0.2601 0.0503  -0.0597 0.0067  178 VAL A CA  
1305 C C   . VAL A 176 ? 0.5117 0.5757 0.3193 0.0631  -0.0601 0.0033  178 VAL A C   
1306 O O   . VAL A 176 ? 0.4773 0.5326 0.2801 0.0631  -0.0662 0.0025  178 VAL A O   
1307 C CB  . VAL A 176 ? 0.4208 0.5107 0.2331 0.0443  -0.0539 0.0044  178 VAL A CB  
1308 C CG1 . VAL A 176 ? 0.5054 0.6023 0.3252 0.0530  -0.0458 -0.0014 178 VAL A CG1 
1309 C CG2 . VAL A 176 ? 0.4212 0.5257 0.2330 0.0345  -0.0531 0.0070  178 VAL A CG2 
1310 N N   . SER A 177 ? 0.4592 0.5270 0.2717 0.0738  -0.0548 0.0024  179 SER A N   
1311 C CA  . SER A 177 ? 0.4686 0.5344 0.2801 0.0872  -0.0546 0.0001  179 SER A CA  
1312 C C   . SER A 177 ? 0.5031 0.5841 0.3255 0.0926  -0.0457 0.0006  179 SER A C   
1313 O O   . SER A 177 ? 0.4874 0.5768 0.3182 0.0881  -0.0417 0.0030  179 SER A O   
1314 C CB  . SER A 177 ? 0.5554 0.6127 0.3603 0.0985  -0.0608 0.0009  179 SER A CB  
1315 O OG  . SER A 177 ? 0.6674 0.7359 0.4792 0.1025  -0.0556 0.0054  179 SER A OG  
1316 N N   . VAL A 178 ? 0.5211 0.6052 0.3437 0.1021  -0.0441 -0.0013 180 VAL A N   
1317 C CA  . VAL A 178 ? 0.4922 0.5917 0.3261 0.1077  -0.0374 0.0016  180 VAL A CA  
1318 C C   . VAL A 178 ? 0.5031 0.6072 0.3331 0.1230  -0.0380 0.0021  180 VAL A C   
1319 O O   . VAL A 178 ? 0.4866 0.5802 0.3061 0.1279  -0.0429 -0.0035 180 VAL A O   
1320 C CB  . VAL A 178 ? 0.5347 0.6390 0.3754 0.1012  -0.0333 -0.0016 180 VAL A CB  
1321 C CG1 . VAL A 178 ? 0.5566 0.6528 0.3892 0.0988  -0.0356 -0.0073 180 VAL A CG1 
1322 C CG2 . VAL A 178 ? 0.5234 0.6419 0.3761 0.1078  -0.0290 0.0028  180 VAL A CG2 
1323 N N   . SER A 179 ? 0.5138 0.6354 0.3526 0.1306  -0.0343 0.0096  181 SER A N   
1324 C CA  . SER A 179 ? 0.5193 0.6554 0.3563 0.1471  -0.0333 0.0121  181 SER A CA  
1325 C C   . SER A 179 ? 0.5262 0.6845 0.3802 0.1460  -0.0273 0.0218  181 SER A C   
1326 O O   . SER A 179 ? 0.5552 0.7198 0.4216 0.1378  -0.0266 0.0297  181 SER A O   
1327 C CB  . SER A 179 ? 0.5649 0.7055 0.3961 0.1575  -0.0365 0.0152  181 SER A CB  
1328 O OG  . SER A 179 ? 0.7584 0.9177 0.5862 0.1766  -0.0358 0.0169  181 SER A OG  
1329 N N   . ALA A 180 ? 0.4842 0.6534 0.3397 0.1536  -0.0248 0.0217  182 ALA A N   
1330 C CA  . ALA A 180 ? 0.4492 0.6378 0.3221 0.1505  -0.0210 0.0318  182 ALA A CA  
1331 C C   . ALA A 180 ? 0.4958 0.7109 0.3698 0.1662  -0.0183 0.0386  182 ALA A C   
1332 O O   . ALA A 180 ? 0.4916 0.7050 0.3504 0.1802  -0.0195 0.0307  182 ALA A O   
1333 C CB  . ALA A 180 ? 0.4075 0.5835 0.2836 0.1402  -0.0204 0.0249  182 ALA A CB  
1334 N N   . ARG A 181 ? 0.4518 0.6925 0.3440 0.1643  -0.0162 0.0540  183 ARG A N   
1335 C CA  . ARG A 181 ? 0.4614 0.7353 0.3577 0.1781  -0.0132 0.0642  183 ARG A CA  
1336 C C   . ARG A 181 ? 0.4344 0.7215 0.3505 0.1687  -0.0129 0.0759  183 ARG A C   
1337 O O   . ARG A 181 ? 0.4340 0.7163 0.3656 0.1541  -0.0167 0.0839  183 ARG A O   
1338 C CB  . ARG A 181 ? 0.4731 0.7775 0.3730 0.1885  -0.0126 0.0781  183 ARG A CB  
1339 C CG  . ARG A 181 ? 0.6474 0.9368 0.5340 0.1924  -0.0151 0.0704  183 ARG A CG  
1340 C CD  . ARG A 181 ? 0.6601 0.9846 0.5533 0.2020  -0.0141 0.0865  183 ARG A CD  
1341 N NE  . ARG A 181 ? 0.7083 1.0657 0.5947 0.2240  -0.0112 0.0889  183 ARG A NE  
1342 C CZ  . ARG A 181 ? 0.7914 1.1514 0.6579 0.2452  -0.0127 0.0780  183 ARG A CZ  
1343 N NH1 . ARG A 181 ? 0.8919 1.2234 0.7450 0.2458  -0.0176 0.0659  183 ARG A NH1 
1344 N NH2 . ARG A 181 ? 0.6296 1.0212 0.4895 0.2666  -0.0106 0.0790  183 ARG A NH2 
1345 N N   . ILE A 182 ? 0.4845 0.7865 0.3998 0.1772  -0.0100 0.0764  184 ILE A N   
1346 C CA  . ILE A 182 ? 0.4508 0.7730 0.3860 0.1709  -0.0104 0.0910  184 ILE A CA  
1347 C C   . ILE A 182 ? 0.5179 0.8848 0.4564 0.1866  -0.0067 0.1053  184 ILE A C   
1348 O O   . ILE A 182 ? 0.5567 0.9339 0.4776 0.2053  -0.0035 0.0978  184 ILE A O   
1349 C CB  . ILE A 182 ? 0.3974 0.6957 0.3321 0.1628  -0.0109 0.0791  184 ILE A CB  
1350 C CG1 . ILE A 182 ? 0.4024 0.6905 0.3161 0.1752  -0.0074 0.0624  184 ILE A CG1 
1351 C CG2 . ILE A 182 ? 0.4216 0.6868 0.3580 0.1473  -0.0152 0.0697  184 ILE A CG2 
1352 C CD1 . ILE A 182 ? 0.4643 0.7377 0.3789 0.1694  -0.0071 0.0537  184 ILE A CD1 
1353 N N   . ASP A 183 ? 0.5151 0.9077 0.4754 0.1795  -0.0084 0.1249  185 ASP A N   
1354 C CA  . ASP A 183 ? 0.5309 0.9759 0.4997 0.1918  -0.0054 0.1452  185 ASP A CA  
1355 C C   . ASP A 183 ? 0.5334 0.9930 0.4895 0.2083  -0.0001 0.1374  185 ASP A C   
1356 O O   . ASP A 183 ? 0.6073 1.1115 0.5623 0.2250  0.0037  0.1487  185 ASP A O   
1357 C CB  . ASP A 183 ? 0.5326 1.0004 0.5320 0.1756  -0.0117 0.1722  185 ASP A CB  
1358 C CG  . ASP A 183 ? 0.6282 1.0895 0.6423 0.1611  -0.0190 0.1843  185 ASP A CG  
1359 O OD1 . ASP A 183 ? 0.7524 1.2252 0.7921 0.1460  -0.0279 0.2058  185 ASP A OD1 
1360 O OD2 . ASP A 183 ? 0.6652 1.1092 0.6663 0.1642  -0.0176 0.1731  185 ASP A OD2 
1361 N N   . ARG A 184 ? 0.5015 0.9264 0.4481 0.2045  -0.0001 0.1187  186 ARG A N   
1362 C CA  . ARG A 184 ? 0.5574 0.9920 0.4942 0.2173  0.0034  0.1117  186 ARG A CA  
1363 C C   . ARG A 184 ? 0.5109 0.9007 0.4398 0.2078  0.0019  0.0918  186 ARG A C   
1364 O O   . ARG A 184 ? 0.5282 0.8865 0.4615 0.1918  -0.0014 0.0861  186 ARG A O   
1365 C CB  . ARG A 184 ? 0.5931 1.0706 0.5508 0.2157  0.0040  0.1353  186 ARG A CB  
1366 C CG  . ARG A 184 ? 0.5759 1.0389 0.5569 0.1927  -0.0017 0.1451  186 ARG A CG  
1367 C CD  . ARG A 184 ? 0.6693 1.1809 0.6741 0.1901  -0.0036 0.1746  186 ARG A CD  
1368 N NE  . ARG A 184 ? 0.6433 1.1387 0.6718 0.1681  -0.0129 0.1849  186 ARG A NE  
1369 C CZ  . ARG A 184 ? 0.6941 1.1906 0.7442 0.1522  -0.0224 0.2028  186 ARG A CZ  
1370 N NH1 . ARG A 184 ? 0.6470 1.1618 0.6982 0.1551  -0.0220 0.2131  186 ARG A NH1 
1371 N NH2 . ARG A 184 ? 0.6189 1.0962 0.6890 0.1341  -0.0338 0.2094  186 ARG A NH2 
1372 N N   . LYS A 185 ? 0.5247 0.9139 0.4419 0.2183  0.0040  0.0815  187 LYS A N   
1373 C CA  . LYS A 185 ? 0.5657 0.9177 0.4761 0.2100  0.0027  0.0645  187 LYS A CA  
1374 C C   . LYS A 185 ? 0.5549 0.9126 0.4852 0.1971  0.0023  0.0743  187 LYS A C   
1375 O O   . LYS A 185 ? 0.5487 0.8772 0.4825 0.1837  0.0001  0.0656  187 LYS A O   
1376 C CB  . LYS A 185 ? 0.6285 0.9772 0.5171 0.2281  0.0032  0.0494  187 LYS A CB  
1377 C CG  . LYS A 185 ? 0.7519 1.0566 0.6241 0.2238  -0.0005 0.0283  187 LYS A CG  
1378 C CD  . LYS A 185 ? 0.8051 1.1052 0.6575 0.2410  -0.0032 0.0148  187 LYS A CD  
1379 C CE  . LYS A 185 ? 0.8273 1.0889 0.6732 0.2294  -0.0069 0.0003  187 LYS A CE  
1380 N NZ  . LYS A 185 ? 0.8718 1.1075 0.6943 0.2403  -0.0156 -0.0163 187 LYS A NZ  
1381 N N   . GLY A 186 ? 0.5894 0.9871 0.5335 0.2017  0.0036  0.0934  188 GLY A N   
1382 C CA  . GLY A 186 ? 0.5276 0.9305 0.4897 0.1909  0.0017  0.1026  188 GLY A CA  
1383 C C   . GLY A 186 ? 0.5769 0.9888 0.5661 0.1740  -0.0050 0.1233  188 GLY A C   
1384 O O   . GLY A 186 ? 0.5474 0.9928 0.5479 0.1757  -0.0060 0.1435  188 GLY A O   
1385 N N   . PHE A 187 ? 0.6002 0.9831 0.6001 0.1583  -0.0111 0.1186  189 PHE A N   
1386 C CA  . PHE A 187 ? 0.5929 0.9752 0.6184 0.1417  -0.0220 0.1354  189 PHE A CA  
1387 C C   . PHE A 187 ? 0.6188 0.9958 0.6590 0.1332  -0.0282 0.1387  189 PHE A C   
1388 O O   . PHE A 187 ? 0.5676 0.9287 0.5959 0.1372  -0.0237 0.1220  189 PHE A O   
1389 C CB  . PHE A 187 ? 0.5771 0.9220 0.5996 0.1320  -0.0272 0.1223  189 PHE A CB  
1390 C CG  . PHE A 187 ? 0.5162 0.8634 0.5270 0.1377  -0.0231 0.1204  189 PHE A CG  
1391 C CD1 . PHE A 187 ? 0.5762 0.9413 0.6021 0.1324  -0.0288 0.1400  189 PHE A CD1 
1392 C CD2 . PHE A 187 ? 0.4452 0.7760 0.4309 0.1476  -0.0153 0.1000  189 PHE A CD2 
1393 C CE1 . PHE A 187 ? 0.5037 0.8714 0.5188 0.1380  -0.0251 0.1382  189 PHE A CE1 
1394 C CE2 . PHE A 187 ? 0.4744 0.8061 0.4495 0.1531  -0.0128 0.0981  189 PHE A CE2 
1395 C CZ  . PHE A 187 ? 0.5137 0.8642 0.5030 0.1490  -0.0169 0.1165  189 PHE A CZ  
1396 N N   . CYS A 188 ? 0.6637 1.0535 0.7304 0.1211  -0.0401 0.1612  190 CYS A N   
1397 C CA  . CYS A 188 ? 0.7122 1.0960 0.7965 0.1116  -0.0499 0.1672  190 CYS A CA  
1398 C C   . CYS A 188 ? 0.6772 1.0176 0.7661 0.1005  -0.0619 0.1533  190 CYS A C   
1399 O O   . CYS A 188 ? 0.6547 0.9825 0.7470 0.0948  -0.0689 0.1544  190 CYS A O   
1400 C CB  . CYS A 188 ? 0.7777 1.1991 0.8904 0.1032  -0.0602 0.2020  190 CYS A CB  
1401 S SG  . CYS A 188 ? 1.0036 1.4888 1.1151 0.1174  -0.0477 0.2233  190 CYS A SG  
1402 N N   . GLU A 189 ? 0.6914 1.0107 0.7807 0.0984  -0.0656 0.1406  191 GLU A N   
1403 C CA  . GLU A 189 ? 0.7228 1.0059 0.8191 0.0899  -0.0801 0.1291  191 GLU A CA  
1404 C C   . GLU A 189 ? 0.7577 1.0434 0.8789 0.0779  -0.0992 0.1512  191 GLU A C   
1405 O O   . GLU A 189 ? 0.8088 1.1235 0.9503 0.0722  -0.1057 0.1786  191 GLU A O   
1406 C CB  . GLU A 189 ? 0.7463 1.0160 0.8464 0.0891  -0.0848 0.1200  191 GLU A CB  
1407 C CG  . GLU A 189 ? 0.7489 1.0110 0.8249 0.0992  -0.0684 0.0967  191 GLU A CG  
1408 C CD  . GLU A 189 ? 0.8016 1.0487 0.8805 0.0987  -0.0731 0.0857  191 GLU A CD  
1409 O OE1 . GLU A 189 ? 0.8031 1.0361 0.8633 0.1046  -0.0636 0.0638  191 GLU A OE1 
1410 O OE2 . GLU A 189 ? 0.7445 0.9947 0.8448 0.0920  -0.0870 0.0997  191 GLU A OE2 
1411 N N   . GLY A 190 ? 0.7671 1.0251 0.8870 0.0740  -0.1089 0.1410  192 GLY A N   
1412 C CA  . GLY A 190 ? 0.7933 1.0490 0.9361 0.0624  -0.1295 0.1607  192 GLY A CA  
1413 C C   . GLY A 190 ? 0.7998 1.0749 0.9421 0.0615  -0.1245 0.1745  192 GLY A C   
1414 O O   . GLY A 190 ? 0.8277 1.0939 0.9843 0.0524  -0.1410 0.1856  192 GLY A O   
1415 N N   . ASP A 191 ? 0.7865 1.0868 0.9120 0.0717  -0.1033 0.1733  193 ASP A N   
1416 C CA  . ASP A 191 ? 0.7678 1.0849 0.8881 0.0741  -0.0965 0.1815  193 ASP A CA  
1417 C C   . ASP A 191 ? 0.7715 1.0551 0.8788 0.0735  -0.0986 0.1619  193 ASP A C   
1418 O O   . ASP A 191 ? 0.7854 1.0346 0.8860 0.0726  -0.1044 0.1406  193 ASP A O   
1419 C CB  . ASP A 191 ? 0.7565 1.1015 0.8571 0.0888  -0.0748 0.1781  193 ASP A CB  
1420 C CG  . ASP A 191 ? 0.8360 1.2297 0.9505 0.0912  -0.0722 0.2056  193 ASP A CG  
1421 O OD1 . ASP A 191 ? 0.9456 1.3542 1.0873 0.0791  -0.0872 0.2311  193 ASP A OD1 
1422 O OD2 . ASP A 191 ? 0.8612 1.2794 0.9594 0.1057  -0.0565 0.2021  193 ASP A OD2 
1423 N N   . GLU A 192 ? 0.7358 1.0331 0.8398 0.0748  -0.0939 0.1699  194 GLU A N   
1424 C CA  . GLU A 192 ? 0.7252 0.9979 0.8125 0.0769  -0.0908 0.1513  194 GLU A CA  
1425 C C   . GLU A 192 ? 0.6793 0.9702 0.7460 0.0890  -0.0715 0.1461  194 GLU A C   
1426 O O   . GLU A 192 ? 0.6723 0.9994 0.7440 0.0936  -0.0659 0.1649  194 GLU A O   
1427 C CB  . GLU A 192 ? 0.7654 1.0333 0.8691 0.0664  -0.1068 0.1660  194 GLU A CB  
1428 C CG  . GLU A 192 ? 0.9003 1.1285 1.0092 0.0593  -0.1254 0.1524  194 GLU A CG  
1429 C CD  . GLU A 192 ? 1.0676 1.2933 1.2032 0.0462  -0.1497 0.1749  194 GLU A CD  
1430 O OE1 . GLU A 192 ? 1.1467 1.3882 1.2886 0.0423  -0.1507 0.1915  194 GLU A OE1 
1431 O OE2 . GLU A 192 ? 1.1553 1.3624 1.3059 0.0397  -0.1694 0.1762  194 GLU A OE2 
1432 N N   . ILE A 193 ? 0.6162 0.8834 0.6598 0.0948  -0.0625 0.1209  195 ILE A N   
1433 C CA  . ILE A 193 ? 0.5429 0.8183 0.5665 0.1050  -0.0490 0.1142  195 ILE A CA  
1434 C C   . ILE A 193 ? 0.5610 0.8279 0.5848 0.1004  -0.0535 0.1162  195 ILE A C   
1435 O O   . ILE A 193 ? 0.5411 0.7802 0.5607 0.0951  -0.0588 0.1027  195 ILE A O   
1436 C CB  . ILE A 193 ? 0.5250 0.7800 0.5249 0.1120  -0.0391 0.0889  195 ILE A CB  
1437 C CG1 . ILE A 193 ? 0.5775 0.8366 0.5787 0.1147  -0.0366 0.0860  195 ILE A CG1 
1438 C CG2 . ILE A 193 ? 0.4902 0.7521 0.4702 0.1231  -0.0285 0.0831  195 ILE A CG2 
1439 C CD1 . ILE A 193 ? 0.5373 0.7774 0.5169 0.1201  -0.0284 0.0632  195 ILE A CD1 
1440 N N   . SER A 194 ? 0.5703 0.8649 0.5996 0.1034  -0.0516 0.1341  196 SER A N   
1441 C CA  . SER A 194 ? 0.5630 0.8551 0.5940 0.0996  -0.0554 0.1393  196 SER A CA  
1442 C C   . SER A 194 ? 0.5278 0.8119 0.5330 0.1103  -0.0433 0.1219  196 SER A C   
1443 O O   . SER A 194 ? 0.5081 0.8081 0.5009 0.1229  -0.0334 0.1189  196 SER A O   
1444 C CB  . SER A 194 ? 0.6256 0.9573 0.6762 0.0982  -0.0592 0.1696  196 SER A CB  
1445 O OG  . SER A 194 ? 0.6659 0.9977 0.7207 0.0936  -0.0640 0.1776  196 SER A OG  
1446 N N   . ILE A 195 ? 0.4848 0.7434 0.4819 0.1055  -0.0458 0.1100  197 ILE A N   
1447 C CA  . ILE A 195 ? 0.4795 0.7249 0.4532 0.1128  -0.0372 0.0929  197 ILE A CA  
1448 C C   . ILE A 195 ? 0.4903 0.7375 0.4624 0.1121  -0.0385 0.0982  197 ILE A C   
1449 O O   . ILE A 195 ? 0.5182 0.7544 0.4999 0.1021  -0.0470 0.1019  197 ILE A O   
1450 C CB  . ILE A 195 ? 0.4712 0.6838 0.4317 0.1084  -0.0371 0.0701  197 ILE A CB  
1451 C CG1 . ILE A 195 ? 0.5007 0.7098 0.4623 0.1089  -0.0360 0.0632  197 ILE A CG1 
1452 C CG2 . ILE A 195 ? 0.3979 0.6006 0.3364 0.1147  -0.0299 0.0569  197 ILE A CG2 
1453 C CD1 . ILE A 195 ? 0.5208 0.7045 0.4792 0.1021  -0.0403 0.0466  197 ILE A CD1 
1454 N N   . HIS A 196 ? 0.4274 0.6860 0.3855 0.1239  -0.0309 0.0964  198 HIS A N   
1455 C CA  . HIS A 196 ? 0.4343 0.6936 0.3865 0.1260  -0.0308 0.0984  198 HIS A CA  
1456 C C   . HIS A 196 ? 0.4621 0.6941 0.3919 0.1287  -0.0274 0.0771  198 HIS A C   
1457 O O   . HIS A 196 ? 0.4622 0.6933 0.3782 0.1387  -0.0229 0.0678  198 HIS A O   
1458 C CB  . HIS A 196 ? 0.4391 0.7334 0.3903 0.1406  -0.0259 0.1107  198 HIS A CB  
1459 C CG  . HIS A 196 ? 0.5523 0.8524 0.4980 0.1453  -0.0258 0.1142  198 HIS A CG  
1460 N ND1 . HIS A 196 ? 0.6640 0.9504 0.5880 0.1557  -0.0228 0.0988  198 HIS A ND1 
1461 C CD2 . HIS A 196 ? 0.5488 0.8674 0.5086 0.1411  -0.0295 0.1320  198 HIS A CD2 
1462 C CE1 . HIS A 196 ? 0.5899 0.8859 0.5141 0.1585  -0.0239 0.1061  198 HIS A CE1 
1463 N NE2 . HIS A 196 ? 0.5908 0.9073 0.5365 0.1497  -0.0272 0.1263  198 HIS A NE2 
1464 N N   . ALA A 197 ? 0.4516 0.6618 0.3781 0.1195  -0.0309 0.0701  199 ALA A N   
1465 C CA  . ALA A 197 ? 0.4451 0.6329 0.3522 0.1201  -0.0289 0.0535  199 ALA A CA  
1466 C C   . ALA A 197 ? 0.4578 0.6355 0.3611 0.1151  -0.0318 0.0529  199 ALA A C   
1467 O O   . ALA A 197 ? 0.4635 0.6437 0.3789 0.1080  -0.0363 0.0614  199 ALA A O   
1468 C CB  . ALA A 197 ? 0.3945 0.5646 0.2979 0.1133  -0.0291 0.0407  199 ALA A CB  
1469 N N   . ASP A 198 ? 0.4479 0.6130 0.3343 0.1188  -0.0307 0.0433  200 ASP A N   
1470 C CA  . ASP A 198 ? 0.4489 0.6033 0.3299 0.1140  -0.0335 0.0420  200 ASP A CA  
1471 C C   . ASP A 198 ? 0.4641 0.5976 0.3319 0.1079  -0.0343 0.0287  200 ASP A C   
1472 O O   . ASP A 198 ? 0.4544 0.5824 0.3124 0.1125  -0.0335 0.0218  200 ASP A O   
1473 C CB  . ASP A 198 ? 0.4511 0.6141 0.3245 0.1261  -0.0334 0.0460  200 ASP A CB  
1474 C CG  . ASP A 198 ? 0.5685 0.7602 0.4552 0.1332  -0.0320 0.0619  200 ASP A CG  
1475 O OD1 . ASP A 198 ? 0.5430 0.7449 0.4472 0.1250  -0.0336 0.0732  200 ASP A OD1 
1476 O OD2 . ASP A 198 ? 0.4336 0.6393 0.3134 0.1479  -0.0308 0.0639  200 ASP A OD2 
1477 N N   . PHE A 199 ? 0.4427 0.5665 0.3102 0.0977  -0.0368 0.0261  201 PHE A N   
1478 C CA  . PHE A 199 ? 0.4376 0.5485 0.2950 0.0903  -0.0376 0.0162  201 PHE A CA  
1479 C C   . PHE A 199 ? 0.4904 0.5935 0.3406 0.0861  -0.0408 0.0168  201 PHE A C   
1480 O O   . PHE A 199 ? 0.5045 0.6106 0.3611 0.0839  -0.0422 0.0218  201 PHE A O   
1481 C CB  . PHE A 199 ? 0.4258 0.5378 0.2908 0.0831  -0.0380 0.0122  201 PHE A CB  
1482 C CG  . PHE A 199 ? 0.4115 0.5299 0.2848 0.0865  -0.0361 0.0118  201 PHE A CG  
1483 C CD1 . PHE A 199 ? 0.4036 0.5204 0.2706 0.0875  -0.0333 0.0052  201 PHE A CD1 
1484 C CD2 . PHE A 199 ? 0.4973 0.6232 0.3857 0.0875  -0.0386 0.0193  201 PHE A CD2 
1485 C CE1 . PHE A 199 ? 0.4478 0.5703 0.3225 0.0904  -0.0317 0.0047  201 PHE A CE1 
1486 C CE2 . PHE A 199 ? 0.3887 0.5204 0.2853 0.0899  -0.0380 0.0201  201 PHE A CE2 
1487 C CZ  . PHE A 199 ? 0.4596 0.5894 0.3486 0.0918  -0.0339 0.0120  201 PHE A CZ  
1488 N N   . GLU A 200 ? 0.4787 0.5715 0.3166 0.0841  -0.0434 0.0127  202 GLU A N   
1489 C CA  . GLU A 200 ? 0.4930 0.5785 0.3249 0.0782  -0.0475 0.0141  202 GLU A CA  
1490 C C   . GLU A 200 ? 0.4899 0.5731 0.3168 0.0668  -0.0488 0.0100  202 GLU A C   
1491 O O   . GLU A 200 ? 0.4880 0.5702 0.3111 0.0649  -0.0489 0.0068  202 GLU A O   
1492 C CB  . GLU A 200 ? 0.5079 0.5825 0.3293 0.0842  -0.0532 0.0145  202 GLU A CB  
1493 C CG  . GLU A 200 ? 0.6891 0.7681 0.5110 0.0983  -0.0536 0.0180  202 GLU A CG  
1494 C CD  . GLU A 200 ? 0.7471 0.8140 0.5592 0.1013  -0.0615 0.0184  202 GLU A CD  
1495 O OE1 . GLU A 200 ? 0.8118 0.8646 0.6170 0.0913  -0.0679 0.0167  202 GLU A OE1 
1496 O OE2 . GLU A 200 ? 0.7931 0.8667 0.6051 0.1138  -0.0620 0.0212  202 GLU A OE2 
1497 N N   . ASN A 201 ? 0.4554 0.5400 0.2818 0.0595  -0.0501 0.0112  203 ASN A N   
1498 C CA  . ASN A 201 ? 0.4605 0.5493 0.2813 0.0489  -0.0515 0.0094  203 ASN A CA  
1499 C C   . ASN A 201 ? 0.4519 0.5368 0.2673 0.0421  -0.0563 0.0140  203 ASN A C   
1500 O O   . ASN A 201 ? 0.4768 0.5661 0.2943 0.0400  -0.0559 0.0143  203 ASN A O   
1501 C CB  . ASN A 201 ? 0.4678 0.5694 0.2935 0.0476  -0.0478 0.0038  203 ASN A CB  
1502 C CG  . ASN A 201 ? 0.5089 0.6229 0.3286 0.0394  -0.0482 0.0022  203 ASN A CG  
1503 O OD1 . ASN A 201 ? 0.4702 0.5841 0.2843 0.0330  -0.0508 0.0067  203 ASN A OD1 
1504 N ND2 . ASN A 201 ? 0.4435 0.5697 0.2645 0.0400  -0.0471 -0.0035 203 ASN A ND2 
1505 N N   . THR A 202 ? 0.4866 0.5615 0.2951 0.0387  -0.0629 0.0178  204 THR A N   
1506 C CA  . THR A 202 ? 0.5093 0.5802 0.3130 0.0306  -0.0692 0.0234  204 THR A CA  
1507 C C   . THR A 202 ? 0.5451 0.6286 0.3460 0.0178  -0.0712 0.0269  204 THR A C   
1508 O O   . THR A 202 ? 0.5985 0.6836 0.3962 0.0083  -0.0770 0.0336  204 THR A O   
1509 C CB  . THR A 202 ? 0.5677 0.6184 0.3658 0.0344  -0.0791 0.0266  204 THR A CB  
1510 O OG1 . THR A 202 ? 0.5633 0.6058 0.3577 0.0347  -0.0847 0.0258  204 THR A OG1 
1511 C CG2 . THR A 202 ? 0.5640 0.6093 0.3642 0.0490  -0.0767 0.0243  204 THR A CG2 
1512 N N   . SER A 203 ? 0.5135 0.6096 0.3163 0.0172  -0.0666 0.0235  205 SER A N   
1513 C CA  . SER A 203 ? 0.4961 0.6124 0.2972 0.0059  -0.0674 0.0281  205 SER A CA  
1514 C C   . SER A 203 ? 0.5381 0.6750 0.3387 0.0033  -0.0633 0.0270  205 SER A C   
1515 O O   . SER A 203 ? 0.5177 0.6502 0.3202 0.0106  -0.0600 0.0210  205 SER A O   
1516 C CB  . SER A 203 ? 0.4883 0.6152 0.2917 0.0084  -0.0627 0.0238  205 SER A CB  
1517 O OG  . SER A 203 ? 0.5503 0.6951 0.3561 0.0139  -0.0545 0.0156  205 SER A OG  
1518 N N   . SER A 204 ? 0.5082 0.6693 0.3063 -0.0067 -0.0646 0.0337  206 SER A N   
1519 C CA  . SER A 204 ? 0.5589 0.7456 0.3549 -0.0066 -0.0606 0.0310  206 SER A CA  
1520 C C   . SER A 204 ? 0.5654 0.7683 0.3623 0.0042  -0.0532 0.0183  206 SER A C   
1521 O O   . SER A 204 ? 0.5741 0.7942 0.3681 0.0087  -0.0513 0.0122  206 SER A O   
1522 C CB  . SER A 204 ? 0.5855 0.7997 0.3789 -0.0200 -0.0645 0.0442  206 SER A CB  
1523 O OG  . SER A 204 ? 0.6133 0.8436 0.4085 -0.0235 -0.0638 0.0479  206 SER A OG  
1524 N N   . ARG A 205 ? 0.5503 0.7457 0.3508 0.0096  -0.0505 0.0132  207 ARG A N   
1525 C CA  . ARG A 205 ? 0.5460 0.7557 0.3477 0.0195  -0.0452 0.0016  207 ARG A CA  
1526 C C   . ARG A 205 ? 0.5497 0.7408 0.3558 0.0309  -0.0446 -0.0094 207 ARG A C   
1527 O O   . ARG A 205 ? 0.4900 0.6577 0.2997 0.0313  -0.0464 -0.0066 207 ARG A O   
1528 C CB  . ARG A 205 ? 0.4826 0.6911 0.2872 0.0185  -0.0437 0.0032  207 ARG A CB  
1529 C CG  . ARG A 205 ? 0.6469 0.8852 0.4495 0.0104  -0.0435 0.0110  207 ARG A CG  
1530 C CD  . ARG A 205 ? 0.6993 0.9521 0.4987 -0.0026 -0.0484 0.0251  207 ARG A CD  
1531 N NE  . ARG A 205 ? 0.7112 0.9827 0.5120 -0.0151 -0.0522 0.0394  207 ARG A NE  
1532 C CZ  . ARG A 205 ? 0.8471 1.1037 0.6493 -0.0284 -0.0619 0.0538  207 ARG A CZ  
1533 N NH1 . ARG A 205 ? 0.6817 0.9063 0.4829 -0.0291 -0.0676 0.0543  207 ARG A NH1 
1534 N NH2 . ARG A 205 ? 0.8596 1.1335 0.6647 -0.0409 -0.0676 0.0684  207 ARG A NH2 
1535 N N   . ILE A 206 ? 0.5269 0.7291 0.3337 0.0406  -0.0433 -0.0211 208 ILE A N   
1536 C CA  . ILE A 206 ? 0.5244 0.7078 0.3380 0.0499  -0.0454 -0.0295 208 ILE A CA  
1537 C C   . ILE A 206 ? 0.5366 0.7173 0.3549 0.0528  -0.0423 -0.0314 208 ILE A C   
1538 O O   . ILE A 206 ? 0.5360 0.7370 0.3513 0.0547  -0.0397 -0.0356 208 ILE A O   
1539 C CB  . ILE A 206 ? 0.5184 0.7117 0.3298 0.0600  -0.0497 -0.0426 208 ILE A CB  
1540 C CG1 . ILE A 206 ? 0.5533 0.7500 0.3593 0.0582  -0.0535 -0.0418 208 ILE A CG1 
1541 C CG2 . ILE A 206 ? 0.5891 0.7620 0.4097 0.0678  -0.0549 -0.0493 208 ILE A CG2 
1542 C CD1 . ILE A 206 ? 0.6436 0.8617 0.4417 0.0689  -0.0577 -0.0554 208 ILE A CD1 
1543 N N   . VAL A 207 ? 0.4962 0.6556 0.3216 0.0536  -0.0423 -0.0277 209 VAL A N   
1544 C CA  . VAL A 207 ? 0.4229 0.5788 0.2524 0.0557  -0.0392 -0.0278 209 VAL A CA  
1545 C C   . VAL A 207 ? 0.4691 0.6153 0.3082 0.0640  -0.0415 -0.0336 209 VAL A C   
1546 O O   . VAL A 207 ? 0.4727 0.6110 0.3163 0.0665  -0.0467 -0.0347 209 VAL A O   
1547 C CB  . VAL A 207 ? 0.4312 0.5750 0.2595 0.0507  -0.0382 -0.0182 209 VAL A CB  
1548 C CG1 . VAL A 207 ? 0.3608 0.5110 0.1811 0.0409  -0.0400 -0.0110 209 VAL A CG1 
1549 C CG2 . VAL A 207 ? 0.3477 0.4741 0.1813 0.0542  -0.0398 -0.0140 209 VAL A CG2 
1550 N N   . VAL A 208 ? 0.4660 0.6135 0.3090 0.0676  -0.0393 -0.0365 210 VAL A N   
1551 C CA  . VAL A 208 ? 0.4719 0.6120 0.3250 0.0744  -0.0433 -0.0410 210 VAL A CA  
1552 C C   . VAL A 208 ? 0.4663 0.6005 0.3254 0.0751  -0.0397 -0.0356 210 VAL A C   
1553 O O   . VAL A 208 ? 0.4601 0.6012 0.3157 0.0747  -0.0352 -0.0373 210 VAL A O   
1554 C CB  . VAL A 208 ? 0.4803 0.6312 0.3324 0.0813  -0.0465 -0.0540 210 VAL A CB  
1555 C CG1 . VAL A 208 ? 0.4601 0.5985 0.3244 0.0873  -0.0540 -0.0571 210 VAL A CG1 
1556 C CG2 . VAL A 208 ? 0.5801 0.7405 0.4248 0.0838  -0.0506 -0.0613 210 VAL A CG2 
1557 N N   . PRO A 209 ? 0.4903 0.6144 0.3586 0.0764  -0.0419 -0.0281 211 PRO A N   
1558 C CA  . PRO A 209 ? 0.3955 0.5179 0.2700 0.0790  -0.0389 -0.0224 211 PRO A CA  
1559 C C   . PRO A 209 ? 0.4499 0.5734 0.3338 0.0830  -0.0421 -0.0270 211 PRO A C   
1560 O O   . PRO A 209 ? 0.4024 0.5224 0.2930 0.0846  -0.0503 -0.0311 211 PRO A O   
1561 C CB  . PRO A 209 ? 0.4120 0.5302 0.2938 0.0796  -0.0411 -0.0116 211 PRO A CB  
1562 C CG  . PRO A 209 ? 0.4255 0.5399 0.3119 0.0778  -0.0487 -0.0130 211 PRO A CG  
1563 C CD  . PRO A 209 ? 0.4708 0.5881 0.3447 0.0756  -0.0478 -0.0231 211 PRO A CD  
1564 N N   . LYS A 210 ? 0.4175 0.5445 0.3012 0.0848  -0.0373 -0.0272 212 LYS A N   
1565 C CA  . LYS A 210 ? 0.4134 0.5418 0.3052 0.0883  -0.0399 -0.0318 212 LYS A CA  
1566 C C   . LYS A 210 ? 0.4422 0.5724 0.3380 0.0902  -0.0354 -0.0246 212 LYS A C   
1567 O O   . LYS A 210 ? 0.4309 0.5616 0.3199 0.0902  -0.0303 -0.0197 212 LYS A O   
1568 C CB  . LYS A 210 ? 0.4005 0.5366 0.2844 0.0897  -0.0384 -0.0441 212 LYS A CB  
1569 C CG  . LYS A 210 ? 0.3993 0.5402 0.2754 0.0893  -0.0411 -0.0513 212 LYS A CG  
1570 C CD  . LYS A 210 ? 0.4479 0.6040 0.3170 0.0927  -0.0393 -0.0623 212 LYS A CD  
1571 C CE  . LYS A 210 ? 0.5118 0.6784 0.3723 0.0942  -0.0419 -0.0692 212 LYS A CE  
1572 N NZ  . LYS A 210 ? 0.5771 0.7665 0.4302 0.0977  -0.0383 -0.0771 212 LYS A NZ  
1573 N N   . ALA A 211 ? 0.4485 0.5794 0.3556 0.0928  -0.0389 -0.0237 213 ALA A N   
1574 C CA  . ALA A 211 ? 0.4144 0.5502 0.3248 0.0954  -0.0343 -0.0176 213 ALA A CA  
1575 C C   . ALA A 211 ? 0.3777 0.5144 0.2958 0.0973  -0.0372 -0.0226 213 ALA A C   
1576 O O   . ALA A 211 ? 0.4354 0.5676 0.3602 0.0976  -0.0456 -0.0279 213 ALA A O   
1577 C CB  . ALA A 211 ? 0.3758 0.5163 0.2959 0.0966  -0.0356 -0.0033 213 ALA A CB  
1578 N N   . ALA A 212 ? 0.4007 0.5422 0.3173 0.0996  -0.0316 -0.0218 214 ALA A N   
1579 C CA  . ALA A 212 ? 0.3726 0.5152 0.2952 0.1014  -0.0338 -0.0273 214 ALA A CA  
1580 C C   . ALA A 212 ? 0.4134 0.5622 0.3377 0.1040  -0.0286 -0.0210 214 ALA A C   
1581 O O   . ALA A 212 ? 0.3858 0.5367 0.3000 0.1056  -0.0222 -0.0188 214 ALA A O   
1582 C CB  . ALA A 212 ? 0.4021 0.5460 0.3145 0.1016  -0.0318 -0.0412 214 ALA A CB  
1583 N N   . ILE A 213 ? 0.4091 0.5601 0.3461 0.1052  -0.0329 -0.0182 215 ILE A N   
1584 C CA  . ILE A 213 ? 0.3912 0.5497 0.3295 0.1082  -0.0280 -0.0142 215 ILE A CA  
1585 C C   . ILE A 213 ? 0.4034 0.5595 0.3347 0.1087  -0.0254 -0.0269 215 ILE A C   
1586 O O   . ILE A 213 ? 0.3965 0.5490 0.3307 0.1084  -0.0306 -0.0358 215 ILE A O   
1587 C CB  . ILE A 213 ? 0.3931 0.5582 0.3496 0.1083  -0.0343 -0.0021 215 ILE A CB  
1588 C CG1 . ILE A 213 ? 0.4996 0.6744 0.4634 0.1079  -0.0357 0.0138  215 ILE A CG1 
1589 C CG2 . ILE A 213 ? 0.4751 0.6492 0.4320 0.1120  -0.0290 0.0001  215 ILE A CG2 
1590 C CD1 . ILE A 213 ? 0.5985 0.7782 0.5843 0.1037  -0.0473 0.0279  215 ILE A CD1 
1591 N N   . VAL A 214 ? 0.3999 0.5588 0.3214 0.1104  -0.0184 -0.0283 216 VAL A N   
1592 C CA  . VAL A 214 ? 0.4642 0.6238 0.3798 0.1099  -0.0158 -0.0378 216 VAL A CA  
1593 C C   . VAL A 214 ? 0.4521 0.6157 0.3697 0.1132  -0.0128 -0.0346 216 VAL A C   
1594 O O   . VAL A 214 ? 0.4471 0.6133 0.3624 0.1167  -0.0105 -0.0274 216 VAL A O   
1595 C CB  . VAL A 214 ? 0.5019 0.6601 0.4025 0.1064  -0.0122 -0.0425 216 VAL A CB  
1596 C CG1 . VAL A 214 ? 0.4823 0.6396 0.3805 0.1034  -0.0147 -0.0456 216 VAL A CG1 
1597 C CG2 . VAL A 214 ? 0.5404 0.6946 0.4323 0.1078  -0.0100 -0.0368 216 VAL A CG2 
1598 N N   . ALA A 215 ? 0.4796 0.6454 0.4012 0.1134  -0.0134 -0.0406 217 ALA A N   
1599 C CA  . ALA A 215 ? 0.4823 0.6522 0.4076 0.1161  -0.0115 -0.0387 217 ALA A CA  
1600 C C   . ALA A 215 ? 0.5246 0.6951 0.4393 0.1145  -0.0077 -0.0459 217 ALA A C   
1601 O O   . ALA A 215 ? 0.5567 0.7303 0.4703 0.1125  -0.0083 -0.0535 217 ALA A O   
1602 C CB  . ALA A 215 ? 0.4633 0.6345 0.4035 0.1170  -0.0174 -0.0392 217 ALA A CB  
1603 N N   . ARG A 216 ? 0.5334 0.7025 0.4400 0.1159  -0.0050 -0.0432 218 ARG A N   
1604 C CA  . ARG A 216 ? 0.5614 0.7300 0.4593 0.1128  -0.0038 -0.0477 218 ARG A CA  
1605 C C   . ARG A 216 ? 0.5824 0.7543 0.4842 0.1157  -0.0027 -0.0481 218 ARG A C   
1606 O O   . ARG A 216 ? 0.5649 0.7348 0.4638 0.1204  -0.0025 -0.0445 218 ARG A O   
1607 C CB  . ARG A 216 ? 0.5709 0.7311 0.4555 0.1115  -0.0052 -0.0456 218 ARG A CB  
1608 C CG  . ARG A 216 ? 0.5399 0.6971 0.4205 0.1077  -0.0065 -0.0449 218 ARG A CG  
1609 C CD  . ARG A 216 ? 0.5931 0.7398 0.4609 0.1058  -0.0106 -0.0430 218 ARG A CD  
1610 N NE  . ARG A 216 ? 0.6882 0.8313 0.5524 0.1030  -0.0121 -0.0413 218 ARG A NE  
1611 C CZ  . ARG A 216 ? 0.6764 0.8142 0.5384 0.1088  -0.0131 -0.0384 218 ARG A CZ  
1612 N NH1 . ARG A 216 ? 0.5701 0.7090 0.4331 0.1185  -0.0123 -0.0365 218 ARG A NH1 
1613 N NH2 . ARG A 216 ? 0.5281 0.6627 0.3871 0.1055  -0.0146 -0.0370 218 ARG A NH2 
1614 N N   . HIS A 217 ? 0.6109 0.7893 0.5190 0.1142  -0.0024 -0.0532 219 HIS A N   
1615 C CA  . HIS A 217 ? 0.6273 0.8093 0.5411 0.1167  -0.0017 -0.0538 219 HIS A CA  
1616 C C   . HIS A 217 ? 0.6197 0.8013 0.5244 0.1140  -0.0007 -0.0547 219 HIS A C   
1617 O O   . HIS A 217 ? 0.6183 0.8038 0.5177 0.1084  -0.0009 -0.0569 219 HIS A O   
1618 C CB  . HIS A 217 ? 0.6206 0.8090 0.5445 0.1176  -0.0035 -0.0599 219 HIS A CB  
1619 C CG  . HIS A 217 ? 0.6894 0.8748 0.6246 0.1202  -0.0085 -0.0584 219 HIS A CG  
1620 N ND1 . HIS A 217 ? 0.7746 0.9575 0.7093 0.1194  -0.0115 -0.0608 219 HIS A ND1 
1621 C CD2 . HIS A 217 ? 0.7848 0.9693 0.7332 0.1226  -0.0129 -0.0536 219 HIS A CD2 
1622 C CE1 . HIS A 217 ? 0.7368 0.9153 0.6838 0.1212  -0.0184 -0.0578 219 HIS A CE1 
1623 N NE2 . HIS A 217 ? 0.8157 0.9956 0.7720 0.1225  -0.0198 -0.0525 219 HIS A NE2 
1624 N N   . THR A 218 ? 0.6456 0.8237 0.5486 0.1181  -0.0008 -0.0517 220 THR A N   
1625 C CA  . THR A 218 ? 0.6538 0.8291 0.5495 0.1164  -0.0021 -0.0524 220 THR A CA  
1626 C C   . THR A 218 ? 0.6210 0.8041 0.5266 0.1186  -0.0001 -0.0540 220 THR A C   
1627 O O   . THR A 218 ? 0.6300 0.8156 0.5433 0.1241  0.0007  -0.0512 220 THR A O   
1628 C CB  . THR A 218 ? 0.6614 0.8259 0.5461 0.1220  -0.0056 -0.0500 220 THR A CB  
1629 O OG1 . THR A 218 ? 0.7328 0.8879 0.6076 0.1186  -0.0097 -0.0495 220 THR A OG1 
1630 C CG2 . THR A 218 ? 0.6950 0.8551 0.5742 0.1224  -0.0090 -0.0512 220 THR A CG2 
1631 N N   . TYR A 219 ? 0.6678 0.8574 0.5745 0.1139  0.0002  -0.0572 221 TYR A N   
1632 C CA  . TYR A 219 ? 0.6730 0.8711 0.5901 0.1161  0.0017  -0.0602 221 TYR A CA  
1633 C C   . TYR A 219 ? 0.6807 0.8834 0.5943 0.1121  0.0015  -0.0607 221 TYR A C   
1634 O O   . TYR A 219 ? 0.6687 0.8720 0.5744 0.1055  -0.0004 -0.0587 221 TYR A O   
1635 C CB  . TYR A 219 ? 0.6876 0.8938 0.6134 0.1173  0.0015  -0.0657 221 TYR A CB  
1636 C CG  . TYR A 219 ? 0.7411 0.9585 0.6621 0.1135  0.0022  -0.0697 221 TYR A CG  
1637 C CD1 . TYR A 219 ? 0.7804 1.0136 0.7042 0.1141  0.0031  -0.0745 221 TYR A CD1 
1638 C CD2 . TYR A 219 ? 0.8201 1.0358 0.7342 0.1100  0.0020  -0.0680 221 TYR A CD2 
1639 C CE1 . TYR A 219 ? 0.8006 1.0516 0.7201 0.1117  0.0041  -0.0766 221 TYR A CE1 
1640 C CE2 . TYR A 219 ? 0.7783 1.0092 0.6883 0.1064  0.0027  -0.0699 221 TYR A CE2 
1641 C CZ  . TYR A 219 ? 0.8256 1.0761 0.7383 0.1075  0.0040  -0.0738 221 TYR A CZ  
1642 O OH  . TYR A 219 ? 0.7357 1.0081 0.6446 0.1051  0.0051  -0.0741 221 TYR A OH  
1643 N N   . LEU A 220 ? 0.6367 0.8431 0.5571 0.1151  0.0023  -0.0619 222 LEU A N   
1644 C CA  . LEU A 220 ? 0.6893 0.9013 0.6081 0.1114  0.0018  -0.0618 222 LEU A CA  
1645 C C   . LEU A 220 ? 0.6926 0.9220 0.6179 0.1106  0.0037  -0.0666 222 LEU A C   
1646 O O   . LEU A 220 ? 0.6434 0.8768 0.5783 0.1166  0.0041  -0.0716 222 LEU A O   
1647 C CB  . LEU A 220 ? 0.6987 0.9068 0.6207 0.1159  0.0017  -0.0608 222 LEU A CB  
1648 C CG  . LEU A 220 ? 0.6703 0.8666 0.5857 0.1210  -0.0001 -0.0572 222 LEU A CG  
1649 C CD1 . LEU A 220 ? 0.6879 0.8877 0.6107 0.1271  0.0011  -0.0557 222 LEU A CD1 
1650 C CD2 . LEU A 220 ? 0.8430 1.0284 0.7449 0.1181  -0.0055 -0.0558 222 LEU A CD2 
1651 N N   . ALA A 221 ? 0.6955 0.9368 0.6160 0.1038  0.0035  -0.0644 223 ALA A N   
1652 C CA  . ALA A 221 ? 0.7166 0.9819 0.6414 0.1046  0.0056  -0.0683 223 ALA A CA  
1653 C C   . ALA A 221 ? 0.7469 1.0278 0.6682 0.0951  0.0045  -0.0605 223 ALA A C   
1654 O O   . ALA A 221 ? 0.7514 1.0277 0.6659 0.0863  0.0011  -0.0526 223 ALA A O   
1655 C CB  . ALA A 221 ? 0.7344 1.0075 0.6590 0.1082  0.0064  -0.0733 223 ALA A CB  
1656 N N   . ASN A 222 ? 0.7614 1.0609 0.6883 0.0968  0.0062  -0.0620 224 ASN A N   
1657 C CA  . ASN A 222 ? 0.7526 1.0673 0.6792 0.0874  0.0042  -0.0525 224 ASN A CA  
1658 C C   . ASN A 222 ? 0.7095 0.9995 0.6318 0.0804  -0.0019 -0.0455 224 ASN A C   
1659 O O   . ASN A 222 ? 0.6877 0.9576 0.6102 0.0863  -0.0020 -0.0500 224 ASN A O   
1660 C CB  . ASN A 222 ? 0.7518 1.0924 0.6759 0.0794  0.0037  -0.0444 224 ASN A CB  
1661 C CG  . ASN A 222 ? 0.9168 1.2943 0.8453 0.0878  0.0090  -0.0505 224 ASN A CG  
1662 O OD1 . ASN A 222 ? 0.9177 1.3284 0.8460 0.0824  0.0096  -0.0423 224 ASN A OD1 
1663 N ND2 . ASN A 222 ? 0.8578 1.2314 0.7903 0.1017  0.0116  -0.0646 224 ASN A ND2 
1664 N N   . GLY A 223 ? 0.7291 1.0216 0.6474 0.0682  -0.0084 -0.0340 225 GLY A N   
1665 C CA  . GLY A 223 ? 0.7494 1.0163 0.6620 0.0624  -0.0179 -0.0283 225 GLY A CA  
1666 C C   . GLY A 223 ? 0.7934 1.0344 0.6969 0.0626  -0.0231 -0.0286 225 GLY A C   
1667 O O   . GLY A 223 ? 0.8364 1.0566 0.7330 0.0571  -0.0345 -0.0231 225 GLY A O   
1668 N N   . GLN A 224 ? 0.7936 1.0348 0.6968 0.0697  -0.0164 -0.0354 226 GLN A N   
1669 C CA  . GLN A 224 ? 0.8155 1.0379 0.7107 0.0695  -0.0204 -0.0349 226 GLN A CA  
1670 C C   . GLN A 224 ? 0.7932 1.0025 0.6874 0.0815  -0.0150 -0.0436 226 GLN A C   
1671 O O   . GLN A 224 ? 0.7575 0.9743 0.6588 0.0893  -0.0078 -0.0500 226 GLN A O   
1672 C CB  . GLN A 224 ? 0.7902 1.0298 0.6856 0.0610  -0.0207 -0.0286 226 GLN A CB  
1673 C CG  . GLN A 224 ? 0.9187 1.1763 0.8163 0.0465  -0.0278 -0.0151 226 GLN A CG  
1674 C CD  . GLN A 224 ? 1.0925 1.3247 0.9836 0.0367  -0.0437 -0.0057 226 GLN A CD  
1675 O OE1 . GLN A 224 ? 1.0875 1.2945 0.9739 0.0411  -0.0500 -0.0094 226 GLN A OE1 
1676 N NE2 . GLN A 224 ? 1.1044 1.3435 0.9950 0.0237  -0.0520 0.0067  226 GLN A NE2 
1677 N N   . THR A 225 ? 0.8306 1.0200 0.7160 0.0824  -0.0205 -0.0426 227 THR A N   
1678 C CA  . THR A 225 ? 0.8304 1.0128 0.7145 0.0904  -0.0164 -0.0471 227 THR A CA  
1679 C C   . THR A 225 ? 0.8136 1.0034 0.6966 0.0837  -0.0163 -0.0443 227 THR A C   
1680 O O   . THR A 225 ? 0.8641 1.0470 0.7408 0.0755  -0.0245 -0.0381 227 THR A O   
1681 C CB  . THR A 225 ? 0.8505 1.0106 0.7247 0.0976  -0.0226 -0.0481 227 THR A CB  
1682 O OG1 . THR A 225 ? 0.8633 1.0208 0.7383 0.1047  -0.0222 -0.0505 227 THR A OG1 
1683 C CG2 . THR A 225 ? 0.8091 0.9659 0.6824 0.1052  -0.0186 -0.0504 227 THR A CG2 
1684 N N   . LYS A 226 ? 0.7501 0.9544 0.6398 0.0868  -0.0089 -0.0485 228 LYS A N   
1685 C CA  . LYS A 226 ? 0.7468 0.9587 0.6348 0.0828  -0.0082 -0.0471 228 LYS A CA  
1686 C C   . LYS A 226 ? 0.6841 0.8853 0.5721 0.0903  -0.0056 -0.0514 228 LYS A C   
1687 O O   . LYS A 226 ? 0.6604 0.8532 0.5517 0.0982  -0.0039 -0.0543 228 LYS A O   
1688 C CB  . LYS A 226 ? 0.7569 0.9973 0.6507 0.0809  -0.0037 -0.0486 228 LYS A CB  
1689 C CG  . LYS A 226 ? 0.8247 1.0833 0.7180 0.0699  -0.0071 -0.0393 228 LYS A CG  
1690 C CD  . LYS A 226 ? 0.7697 1.0635 0.6665 0.0692  -0.0027 -0.0391 228 LYS A CD  
1691 C CE  . LYS A 226 ? 0.7631 1.0749 0.6667 0.0792  0.0030  -0.0483 228 LYS A CE  
1692 N NZ  . LYS A 226 ? 0.7913 1.1421 0.6964 0.0813  0.0064  -0.0490 228 LYS A NZ  
1693 N N   . VAL A 227 ? 0.7121 0.9166 0.5975 0.0872  -0.0057 -0.0504 229 VAL A N   
1694 C CA  . VAL A 227 ? 0.6659 0.8616 0.5518 0.0927  -0.0042 -0.0530 229 VAL A CA  
1695 C C   . VAL A 227 ? 0.6402 0.8500 0.5294 0.0931  -0.0015 -0.0570 229 VAL A C   
1696 O O   . VAL A 227 ? 0.6315 0.8538 0.5170 0.0869  -0.0021 -0.0545 229 VAL A O   
1697 C CB  . VAL A 227 ? 0.7304 0.9073 0.6069 0.0917  -0.0092 -0.0486 229 VAL A CB  
1698 C CG1 . VAL A 227 ? 0.7365 0.9134 0.6059 0.0811  -0.0153 -0.0425 229 VAL A CG1 
1699 C CG2 . VAL A 227 ? 0.6247 0.7962 0.5023 0.0970  -0.0073 -0.0498 229 VAL A CG2 
1700 N N   . LEU A 228 ? 0.5718 0.7806 0.4685 0.1007  -0.0001 -0.0627 230 LEU A N   
1701 C CA  . LEU A 228 ? 0.5912 0.8082 0.4901 0.1034  -0.0004 -0.0682 230 LEU A CA  
1702 C C   . LEU A 228 ? 0.5511 0.7533 0.4491 0.1040  -0.0020 -0.0653 230 LEU A C   
1703 O O   . LEU A 228 ? 0.5121 0.7028 0.4142 0.1072  -0.0027 -0.0623 230 LEU A O   
1704 C CB  . LEU A 228 ? 0.5892 0.8104 0.4978 0.1116  -0.0017 -0.0762 230 LEU A CB  
1705 C CG  . LEU A 228 ? 0.6746 0.9031 0.5867 0.1187  -0.0054 -0.0859 230 LEU A CG  
1706 C CD1 . LEU A 228 ? 0.6988 0.9491 0.6031 0.1180  -0.0034 -0.0891 230 LEU A CD1 
1707 C CD2 . LEU A 228 ? 0.7433 0.9740 0.6643 0.1263  -0.0087 -0.0931 230 LEU A CD2 
1708 N N   . THR A 229 ? 0.5817 0.7871 0.4744 0.1010  -0.0025 -0.0651 231 THR A N   
1709 C CA  . THR A 229 ? 0.5447 0.7388 0.4378 0.1022  -0.0044 -0.0634 231 THR A CA  
1710 C C   . THR A 229 ? 0.5315 0.7282 0.4313 0.1078  -0.0076 -0.0705 231 THR A C   
1711 O O   . THR A 229 ? 0.5529 0.7628 0.4501 0.1095  -0.0083 -0.0771 231 THR A O   
1712 C CB  . THR A 229 ? 0.6021 0.7950 0.4856 0.0955  -0.0046 -0.0585 231 THR A CB  
1713 O OG1 . THR A 229 ? 0.6449 0.8327 0.5221 0.0905  -0.0054 -0.0527 231 THR A OG1 
1714 C CG2 . THR A 229 ? 0.5106 0.6907 0.3942 0.0971  -0.0063 -0.0557 231 THR A CG2 
1715 N N   . GLN A 230 ? 0.5173 0.7029 0.4261 0.1114  -0.0111 -0.0686 232 GLN A N   
1716 C CA  . GLN A 230 ? 0.5288 0.7114 0.4455 0.1163  -0.0183 -0.0743 232 GLN A CA  
1717 C C   . GLN A 230 ? 0.5318 0.7044 0.4500 0.1143  -0.0214 -0.0684 232 GLN A C   
1718 O O   . GLN A 230 ? 0.5397 0.7070 0.4590 0.1120  -0.0192 -0.0587 232 GLN A O   
1719 C CB  . GLN A 230 ? 0.5488 0.7265 0.4782 0.1201  -0.0232 -0.0739 232 GLN A CB  
1720 C CG  . GLN A 230 ? 0.6621 0.8322 0.6015 0.1248  -0.0350 -0.0789 232 GLN A CG  
1721 C CD  . GLN A 230 ? 0.7359 0.8996 0.6899 0.1268  -0.0425 -0.0758 232 GLN A CD  
1722 O OE1 . GLN A 230 ? 0.7218 0.8885 0.6787 0.1247  -0.0373 -0.0687 232 GLN A OE1 
1723 N NE2 . GLN A 230 ? 0.8399 0.9942 0.8034 0.1311  -0.0567 -0.0812 232 GLN A NE2 
1724 N N   . LYS A 231 ? 0.5119 0.6838 0.4301 0.1166  -0.0272 -0.0746 233 LYS A N   
1725 C CA  . LYS A 231 ? 0.5096 0.6720 0.4304 0.1148  -0.0318 -0.0695 233 LYS A CA  
1726 C C   . LYS A 231 ? 0.4809 0.6331 0.4170 0.1176  -0.0435 -0.0678 233 LYS A C   
1727 O O   . LYS A 231 ? 0.4444 0.5944 0.3847 0.1233  -0.0522 -0.0778 233 LYS A O   
1728 C CB  . LYS A 231 ? 0.5084 0.6759 0.4201 0.1157  -0.0329 -0.0774 233 LYS A CB  
1729 C CG  . LYS A 231 ? 0.5072 0.6656 0.4197 0.1132  -0.0371 -0.0726 233 LYS A CG  
1730 C CD  . LYS A 231 ? 0.6210 0.7860 0.5256 0.1169  -0.0405 -0.0834 233 LYS A CD  
1731 C CE  . LYS A 231 ? 0.6894 0.8442 0.5956 0.1152  -0.0466 -0.0803 233 LYS A CE  
1732 N NZ  . LYS A 231 ? 0.5821 0.7450 0.4792 0.1204  -0.0502 -0.0920 233 LYS A NZ  
1733 N N   . LEU A 232 ? 0.4698 0.6172 0.4147 0.1139  -0.0448 -0.0544 234 LEU A N   
1734 C CA  . LEU A 232 ? 0.4894 0.6288 0.4513 0.1137  -0.0577 -0.0478 234 LEU A CA  
1735 C C   . LEU A 232 ? 0.5421 0.6735 0.5066 0.1117  -0.0661 -0.0453 234 LEU A C   
1736 O O   . LEU A 232 ? 0.5015 0.6299 0.4570 0.1147  -0.0685 -0.0573 234 LEU A O   
1737 C CB  . LEU A 232 ? 0.4492 0.5948 0.4208 0.1109  -0.0545 -0.0318 234 LEU A CB  
1738 C CG  . LEU A 232 ? 0.4411 0.5944 0.4086 0.1130  -0.0456 -0.0338 234 LEU A CG  
1739 C CD1 . LEU A 232 ? 0.4335 0.5954 0.4117 0.1119  -0.0445 -0.0181 234 LEU A CD1 
1740 C CD2 . LEU A 232 ? 0.5542 0.7034 0.5249 0.1167  -0.0521 -0.0461 234 LEU A CD2 
1741 N N   . SER A 233 ? 0.4726 0.6029 0.4497 0.1071  -0.0712 -0.0291 235 SER A N   
1742 C CA  . SER A 233 ? 0.5743 0.6957 0.5565 0.1045  -0.0820 -0.0258 235 SER A CA  
1743 C C   . SER A 233 ? 0.4944 0.6194 0.4609 0.1039  -0.0713 -0.0290 235 SER A C   
1744 O O   . SER A 233 ? 0.4585 0.5927 0.4146 0.1037  -0.0574 -0.0269 235 SER A O   
1745 C CB  . SER A 233 ? 0.5796 0.7034 0.5814 0.0985  -0.0908 -0.0046 235 SER A CB  
1746 O OG  . SER A 233 ? 0.6803 0.8216 0.6810 0.0976  -0.0773 0.0081  235 SER A OG  
1747 N N   . SER A 234 ? 0.5162 0.6324 0.4803 0.1042  -0.0795 -0.0350 236 SER A N   
1748 C CA  . SER A 234 ? 0.4973 0.6165 0.4474 0.1030  -0.0711 -0.0378 236 SER A CA  
1749 C C   . SER A 234 ? 0.5534 0.6638 0.5092 0.1003  -0.0818 -0.0330 236 SER A C   
1750 O O   . SER A 234 ? 0.5331 0.6321 0.5006 0.1008  -0.0983 -0.0334 236 SER A O   
1751 C CB  . SER A 234 ? 0.4340 0.5571 0.3684 0.1078  -0.0665 -0.0553 236 SER A CB  
1752 O OG  . SER A 234 ? 0.5524 0.6683 0.4889 0.1140  -0.0800 -0.0681 236 SER A OG  
1753 N N   . VAL A 235 ? 0.5649 0.6789 0.5123 0.0973  -0.0741 -0.0286 237 VAL A N   
1754 C CA  . VAL A 235 ? 0.5997 0.7059 0.5494 0.0949  -0.0830 -0.0261 237 VAL A CA  
1755 C C   . VAL A 235 ? 0.6142 0.7230 0.5464 0.0955  -0.0753 -0.0354 237 VAL A C   
1756 O O   . VAL A 235 ? 0.5321 0.6497 0.4527 0.0950  -0.0622 -0.0366 237 VAL A O   
1757 C CB  . VAL A 235 ? 0.6047 0.7142 0.5674 0.0891  -0.0851 -0.0054 237 VAL A CB  
1758 C CG1 . VAL A 235 ? 0.6976 0.8042 0.6812 0.0863  -0.0991 0.0063  237 VAL A CG1 
1759 C CG2 . VAL A 235 ? 0.5374 0.6609 0.4945 0.0891  -0.0699 0.0035  237 VAL A CG2 
1760 N N   . ARG A 236 ? 0.6517 0.7525 0.5826 0.0965  -0.0854 -0.0416 238 ARG A N   
1761 C CA  . ARG A 236 ? 0.6451 0.7495 0.5619 0.0959  -0.0800 -0.0469 238 ARG A CA  
1762 C C   . ARG A 236 ? 0.6663 0.7643 0.5892 0.0905  -0.0848 -0.0349 238 ARG A C   
1763 O O   . ARG A 236 ? 0.6674 0.7556 0.6048 0.0889  -0.0984 -0.0279 238 ARG A O   
1764 C CB  . ARG A 236 ? 0.6624 0.7657 0.5715 0.1034  -0.0884 -0.0647 238 ARG A CB  
1765 C CG  . ARG A 236 ? 0.7045 0.8210 0.5969 0.1042  -0.0794 -0.0720 238 ARG A CG  
1766 C CD  . ARG A 236 ? 0.7388 0.8585 0.6236 0.1142  -0.0888 -0.0894 238 ARG A CD  
1767 N NE  . ARG A 236 ? 0.7245 0.8539 0.5969 0.1134  -0.0853 -0.0921 238 ARG A NE  
1768 C CZ  . ARG A 236 ? 0.7286 0.8808 0.5873 0.1163  -0.0770 -0.0990 238 ARG A CZ  
1769 N NH1 . ARG A 236 ? 0.6599 0.8218 0.5089 0.1146  -0.0750 -0.0992 238 ARG A NH1 
1770 N NH2 . ARG A 236 ? 0.8310 0.9987 0.6865 0.1205  -0.0712 -0.1046 238 ARG A NH2 
1771 N N   . GLY A 237 ? 0.6204 0.7238 0.5334 0.0872  -0.0752 -0.0313 239 GLY A N   
1772 C CA  . GLY A 237 ? 0.5918 0.6904 0.5094 0.0829  -0.0795 -0.0210 239 GLY A CA  
1773 C C   . GLY A 237 ? 0.5991 0.6939 0.5070 0.0837  -0.0843 -0.0311 239 GLY A C   
1774 O O   . GLY A 237 ? 0.5820 0.6821 0.4784 0.0882  -0.0825 -0.0453 239 GLY A O   
1775 N N   . ASN A 238 ? 0.5970 0.6859 0.5092 0.0800  -0.0903 -0.0233 240 ASN A N   
1776 C CA  . ASN A 238 ? 0.6483 0.7346 0.5501 0.0808  -0.0943 -0.0322 240 ASN A CA  
1777 C C   . ASN A 238 ? 0.6162 0.7146 0.5024 0.0790  -0.0800 -0.0346 240 ASN A C   
1778 O O   . ASN A 238 ? 0.6439 0.7466 0.5295 0.0756  -0.0701 -0.0254 240 ASN A O   
1779 C CB  . ASN A 238 ? 0.6769 0.7551 0.5868 0.0758  -0.1022 -0.0211 240 ASN A CB  
1780 C CG  . ASN A 238 ? 0.8223 0.8882 0.7497 0.0752  -0.1196 -0.0154 240 ASN A CG  
1781 O OD1 . ASN A 238 ? 0.7649 0.8197 0.6926 0.0802  -0.1341 -0.0276 240 ASN A OD1 
1782 N ND2 . ASN A 238 ? 0.8946 0.9637 0.8371 0.0696  -0.1198 0.0036  240 ASN A ND2 
1783 N N   . HIS A 239 ? 0.5817 0.6865 0.4555 0.0819  -0.0804 -0.0464 241 HIS A N   
1784 C CA  . HIS A 239 ? 0.6057 0.7233 0.4666 0.0780  -0.0694 -0.0456 241 HIS A CA  
1785 C C   . HIS A 239 ? 0.6181 0.7298 0.4796 0.0712  -0.0671 -0.0334 241 HIS A C   
1786 O O   . HIS A 239 ? 0.6343 0.7357 0.5041 0.0704  -0.0748 -0.0283 241 HIS A O   
1787 C CB  . HIS A 239 ? 0.6449 0.7759 0.4937 0.0824  -0.0712 -0.0581 241 HIS A CB  
1788 C CG  . HIS A 239 ? 0.8268 0.9506 0.6748 0.0852  -0.0822 -0.0628 241 HIS A CG  
1789 N ND1 . HIS A 239 ? 1.0118 1.1235 0.8658 0.0931  -0.0967 -0.0719 241 HIS A ND1 
1790 C CD2 . HIS A 239 ? 0.9100 1.0356 0.7518 0.0813  -0.0824 -0.0598 241 HIS A CD2 
1791 C CE1 . HIS A 239 ? 1.0460 1.1518 0.8971 0.0943  -0.1058 -0.0748 241 HIS A CE1 
1792 N NE2 . HIS A 239 ? 0.9920 1.1072 0.8356 0.0872  -0.0963 -0.0675 241 HIS A NE2 
1793 N N   . ILE A 240 ? 0.5362 0.6542 0.3897 0.0664  -0.0582 -0.0283 242 ILE A N   
1794 C CA  . ILE A 240 ? 0.4655 0.5777 0.3184 0.0616  -0.0565 -0.0178 242 ILE A CA  
1795 C C   . ILE A 240 ? 0.5198 0.6399 0.3607 0.0567  -0.0547 -0.0191 242 ILE A C   
1796 O O   . ILE A 240 ? 0.4673 0.5969 0.3009 0.0537  -0.0500 -0.0196 242 ILE A O   
1797 C CB  . ILE A 240 ? 0.4057 0.5152 0.2604 0.0617  -0.0506 -0.0098 242 ILE A CB  
1798 C CG1 . ILE A 240 ? 0.4573 0.5643 0.3248 0.0665  -0.0521 -0.0066 242 ILE A CG1 
1799 C CG2 . ILE A 240 ? 0.4554 0.5597 0.3079 0.0595  -0.0501 -0.0009 242 ILE A CG2 
1800 C CD1 . ILE A 240 ? 0.5240 0.6324 0.3913 0.0694  -0.0461 -0.0016 242 ILE A CD1 
1801 N N   . ILE A 241 ? 0.5161 0.6336 0.3555 0.0549  -0.0593 -0.0183 243 ILE A N   
1802 C CA  . ILE A 241 ? 0.4865 0.6143 0.3151 0.0498  -0.0581 -0.0183 243 ILE A CA  
1803 C C   . ILE A 241 ? 0.5095 0.6325 0.3347 0.0430  -0.0549 -0.0078 243 ILE A C   
1804 O O   . ILE A 241 ? 0.4597 0.5707 0.2902 0.0445  -0.0542 -0.0015 243 ILE A O   
1805 C CB  . ILE A 241 ? 0.5041 0.6305 0.3314 0.0507  -0.0650 -0.0215 243 ILE A CB  
1806 C CG1 . ILE A 241 ? 0.5540 0.6649 0.3881 0.0477  -0.0678 -0.0115 243 ILE A CG1 
1807 C CG2 . ILE A 241 ? 0.5897 0.7157 0.4200 0.0593  -0.0723 -0.0334 243 ILE A CG2 
1808 C CD1 . ILE A 241 ? 0.5596 0.6675 0.3924 0.0471  -0.0750 -0.0129 243 ILE A CD1 
1809 N N   . SER A 242 ? 0.4927 0.6265 0.3092 0.0364  -0.0544 -0.0054 244 SER A N   
1810 C CA  . SER A 242 ? 0.5355 0.6631 0.3482 0.0291  -0.0551 0.0044  244 SER A CA  
1811 C C   . SER A 242 ? 0.5532 0.6647 0.3692 0.0304  -0.0578 0.0096  244 SER A C   
1812 O O   . SER A 242 ? 0.5154 0.6265 0.3333 0.0313  -0.0602 0.0082  244 SER A O   
1813 C CB  . SER A 242 ? 0.4834 0.6276 0.2882 0.0204  -0.0565 0.0082  244 SER A CB  
1814 O OG  . SER A 242 ? 0.6289 0.7641 0.4311 0.0125  -0.0601 0.0183  244 SER A OG  
1815 N N   . GLY A 243 ? 0.5034 0.6025 0.3199 0.0317  -0.0584 0.0150  245 GLY A N   
1816 C CA  . GLY A 243 ? 0.4773 0.5652 0.2960 0.0340  -0.0611 0.0207  245 GLY A CA  
1817 C C   . GLY A 243 ? 0.5287 0.6148 0.3576 0.0419  -0.0597 0.0211  245 GLY A C   
1818 O O   . GLY A 243 ? 0.5039 0.5868 0.3366 0.0430  -0.0619 0.0261  245 GLY A O   
1819 N N   . THR A 244 ? 0.5264 0.6157 0.3607 0.0467  -0.0568 0.0177  246 THR A N   
1820 C CA  . THR A 244 ? 0.4564 0.5465 0.3027 0.0530  -0.0568 0.0212  246 THR A CA  
1821 C C   . THR A 244 ? 0.4697 0.5617 0.3180 0.0593  -0.0531 0.0212  246 THR A C   
1822 O O   . THR A 244 ? 0.4736 0.5647 0.3146 0.0584  -0.0511 0.0164  246 THR A O   
1823 C CB  . THR A 244 ? 0.5129 0.6053 0.3669 0.0520  -0.0604 0.0172  246 THR A CB  
1824 O OG1 . THR A 244 ? 0.4634 0.5601 0.3143 0.0523  -0.0588 0.0077  246 THR A OG1 
1825 C CG2 . THR A 244 ? 0.4682 0.5586 0.3193 0.0473  -0.0653 0.0162  246 THR A CG2 
1826 N N   . CYS A 245 ? 0.4641 0.5607 0.3228 0.0653  -0.0528 0.0280  247 CYS A N   
1827 C CA  . CYS A 245 ? 0.4557 0.5580 0.3186 0.0721  -0.0495 0.0289  247 CYS A CA  
1828 C C   . CYS A 245 ? 0.4918 0.6002 0.3698 0.0715  -0.0520 0.0328  247 CYS A C   
1829 O O   . CYS A 245 ? 0.5130 0.6204 0.3985 0.0676  -0.0575 0.0372  247 CYS A O   
1830 C CB  . CYS A 245 ? 0.4667 0.5746 0.3292 0.0812  -0.0481 0.0364  247 CYS A CB  
1831 S SG  . CYS A 245 ? 0.5581 0.6543 0.4035 0.0838  -0.0500 0.0322  247 CYS A SG  
1832 N N   . ALA A 246 ? 0.4813 0.5948 0.3642 0.0753  -0.0498 0.0323  248 ALA A N   
1833 C CA  . ALA A 246 ? 0.4692 0.5890 0.3684 0.0750  -0.0540 0.0391  248 ALA A CA  
1834 C C   . ALA A 246 ? 0.5095 0.6415 0.4141 0.0818  -0.0498 0.0452  248 ALA A C   
1835 O O   . ALA A 246 ? 0.4930 0.6253 0.3870 0.0872  -0.0440 0.0398  248 ALA A O   
1836 C CB  . ALA A 246 ? 0.5152 0.6266 0.4166 0.0705  -0.0593 0.0292  248 ALA A CB  
1837 N N   . SER A 247 ? 0.4967 0.6390 0.4185 0.0811  -0.0545 0.0568  249 SER A N   
1838 C CA  . SER A 247 ? 0.4935 0.6545 0.4236 0.0876  -0.0512 0.0674  249 SER A CA  
1839 C C   . SER A 247 ? 0.4925 0.6537 0.4368 0.0833  -0.0572 0.0700  249 SER A C   
1840 O O   . SER A 247 ? 0.4583 0.6076 0.4108 0.0759  -0.0672 0.0686  249 SER A O   
1841 C CB  . SER A 247 ? 0.4906 0.6716 0.4311 0.0900  -0.0527 0.0857  249 SER A CB  
1842 O OG  . SER A 247 ? 0.5519 0.7352 0.4780 0.0979  -0.0467 0.0826  249 SER A OG  
1843 N N   . TRP A 248 ? 0.4826 0.6554 0.4288 0.0889  -0.0524 0.0722  250 TRP A N   
1844 C CA  . TRP A 248 ? 0.4810 0.6594 0.4440 0.0855  -0.0587 0.0797  250 TRP A CA  
1845 C C   . TRP A 248 ? 0.5105 0.7187 0.4849 0.0904  -0.0564 0.1000  250 TRP A C   
1846 O O   . TRP A 248 ? 0.4950 0.7173 0.4588 0.1008  -0.0471 0.1000  250 TRP A O   
1847 C CB  . TRP A 248 ? 0.4866 0.6579 0.4427 0.0882  -0.0544 0.0667  250 TRP A CB  
1848 C CG  . TRP A 248 ? 0.4552 0.6041 0.4015 0.0845  -0.0567 0.0478  250 TRP A CG  
1849 C CD1 . TRP A 248 ? 0.4936 0.6282 0.4370 0.0795  -0.0631 0.0406  250 TRP A CD1 
1850 C CD2 . TRP A 248 ? 0.4659 0.6090 0.4046 0.0866  -0.0527 0.0348  250 TRP A CD2 
1851 N NE1 . TRP A 248 ? 0.5012 0.6245 0.4349 0.0797  -0.0627 0.0237  250 TRP A NE1 
1852 C CE2 . TRP A 248 ? 0.5295 0.6579 0.4607 0.0834  -0.0563 0.0204  250 TRP A CE2 
1853 C CE3 . TRP A 248 ? 0.4585 0.6093 0.3956 0.0915  -0.0464 0.0340  250 TRP A CE3 
1854 C CZ2 . TRP A 248 ? 0.3608 0.4848 0.2838 0.0849  -0.0535 0.0064  250 TRP A CZ2 
1855 C CZ3 . TRP A 248 ? 0.3788 0.5213 0.3080 0.0918  -0.0440 0.0198  250 TRP A CZ3 
1856 C CH2 . TRP A 248 ? 0.3646 0.4950 0.2872 0.0884  -0.0474 0.0066  250 TRP A CH2 
1857 N N   . ARG A 249 ? 0.5184 0.7377 0.5146 0.0835  -0.0665 0.1177  251 ARG A N   
1858 C CA  . ARG A 249 ? 0.5666 0.8213 0.5768 0.0868  -0.0655 0.1412  251 ARG A CA  
1859 C C   . ARG A 249 ? 0.6096 0.8714 0.6398 0.0802  -0.0745 0.1533  251 ARG A C   
1860 O O   . ARG A 249 ? 0.6489 0.9008 0.6963 0.0687  -0.0897 0.1624  251 ARG A O   
1861 C CB  . ARG A 249 ? 0.5778 0.8427 0.5986 0.0816  -0.0720 0.1576  251 ARG A CB  
1862 C CG  . ARG A 249 ? 0.5845 0.8439 0.5867 0.0883  -0.0640 0.1474  251 ARG A CG  
1863 C CD  . ARG A 249 ? 0.5619 0.8482 0.5535 0.1040  -0.0518 0.1495  251 ARG A CD  
1864 N NE  . ARG A 249 ? 0.4710 0.7507 0.4449 0.1114  -0.0464 0.1398  251 ARG A NE  
1865 C CZ  . ARG A 249 ? 0.5780 0.8357 0.5299 0.1175  -0.0407 0.1185  251 ARG A CZ  
1866 N NH1 . ARG A 249 ? 0.4732 0.7156 0.4184 0.1171  -0.0386 0.1051  251 ARG A NH1 
1867 N NH2 . ARG A 249 ? 0.4989 0.7511 0.4367 0.1237  -0.0382 0.1120  251 ARG A NH2 
1868 N N   . GLY A 250 ? 0.6183 0.8936 0.6454 0.0875  -0.0668 0.1519  252 GLY A N   
1869 C CA  . GLY A 250 ? 0.6789 0.9602 0.7243 0.0814  -0.0751 0.1624  252 GLY A CA  
1870 C C   . GLY A 250 ? 0.6691 0.9138 0.7154 0.0735  -0.0857 0.1464  252 GLY A C   
1871 O O   . GLY A 250 ? 0.6967 0.9382 0.7625 0.0647  -0.1002 0.1571  252 GLY A O   
1872 N N   . LYS A 251 ? 0.6517 0.8703 0.6771 0.0770  -0.0796 0.1212  253 LYS A N   
1873 C CA  . LYS A 251 ? 0.6452 0.8353 0.6671 0.0740  -0.0863 0.1028  253 LYS A CA  
1874 C C   . LYS A 251 ? 0.6315 0.8294 0.6535 0.0784  -0.0807 0.1003  253 LYS A C   
1875 O O   . LYS A 251 ? 0.6131 0.8251 0.6231 0.0868  -0.0667 0.0978  253 LYS A O   
1876 C CB  . LYS A 251 ? 0.6372 0.8068 0.6365 0.0773  -0.0793 0.0798  253 LYS A CB  
1877 C CG  . LYS A 251 ? 0.6973 0.8467 0.6870 0.0786  -0.0802 0.0582  253 LYS A CG  
1878 C CD  . LYS A 251 ? 0.6998 0.8281 0.6946 0.0742  -0.0962 0.0503  253 LYS A CD  
1879 C CE  . LYS A 251 ? 0.6768 0.7949 0.6576 0.0744  -0.0945 0.0395  253 LYS A CE  
1880 N NZ  . LYS A 251 ? 0.8290 0.9271 0.8107 0.0737  -0.1099 0.0269  253 LYS A NZ  
1881 N N   . SER A 252 ? 0.6355 0.8226 0.6702 0.0734  -0.0929 0.1001  254 SER A N   
1882 C CA  . SER A 252 ? 0.6378 0.8353 0.6769 0.0761  -0.0895 0.1023  254 SER A CA  
1883 C C   . SER A 252 ? 0.6182 0.7927 0.6497 0.0778  -0.0917 0.0809  254 SER A C   
1884 O O   . SER A 252 ? 0.6773 0.8290 0.7078 0.0755  -0.1026 0.0688  254 SER A O   
1885 C CB  . SER A 252 ? 0.6741 0.8904 0.7402 0.0688  -0.1022 0.1292  254 SER A CB  
1886 O OG  . SER A 252 ? 0.8009 0.9997 0.8827 0.0589  -0.1230 0.1355  254 SER A OG  
1887 N N   . LEU A 253 ? 0.6124 0.7952 0.6381 0.0831  -0.0818 0.0764  255 LEU A N   
1888 C CA  . LEU A 253 ? 0.5845 0.7518 0.6055 0.0851  -0.0834 0.0594  255 LEU A CA  
1889 C C   . LEU A 253 ? 0.5810 0.7605 0.6180 0.0836  -0.0878 0.0722  255 LEU A C   
1890 O O   . LEU A 253 ? 0.6008 0.8042 0.6394 0.0864  -0.0786 0.0850  255 LEU A O   
1891 C CB  . LEU A 253 ? 0.5539 0.7208 0.5523 0.0923  -0.0666 0.0426  255 LEU A CB  
1892 C CG  . LEU A 253 ? 0.5679 0.7183 0.5503 0.0930  -0.0649 0.0245  255 LEU A CG  
1893 C CD1 . LEU A 253 ? 0.4295 0.5820 0.3930 0.0978  -0.0507 0.0131  255 LEU A CD1 
1894 C CD2 . LEU A 253 ? 0.6584 0.7934 0.6462 0.0922  -0.0771 0.0135  255 LEU A CD2 
1895 N N   . ARG A 254 ? 0.6152 0.7786 0.6625 0.0806  -0.1021 0.0672  256 ARG A N   
1896 C CA  . ARG A 254 ? 0.6390 0.8104 0.7026 0.0782  -0.1089 0.0783  256 ARG A CA  
1897 C C   . ARG A 254 ? 0.6232 0.8002 0.6735 0.0854  -0.0939 0.0663  256 ARG A C   
1898 O O   . ARG A 254 ? 0.5956 0.7585 0.6289 0.0905  -0.0875 0.0443  256 ARG A O   
1899 C CB  . ARG A 254 ? 0.6879 0.8349 0.7662 0.0735  -0.1329 0.0747  256 ARG A CB  
1900 C CG  . ARG A 254 ? 0.7137 0.8629 0.8098 0.0702  -0.1440 0.0843  256 ARG A CG  
1901 C CD  . ARG A 254 ? 0.7857 0.9599 0.9058 0.0608  -0.1512 0.1175  256 ARG A CD  
1902 N NE  . ARG A 254 ? 0.9265 1.0900 1.0665 0.0507  -0.1751 0.1326  256 ARG A NE  
1903 C CZ  . ARG A 254 ? 0.9822 1.1239 1.1405 0.0443  -0.2018 0.1360  256 ARG A CZ  
1904 N NH1 . ARG A 254 ? 1.0236 1.1529 1.1831 0.0477  -0.2075 0.1249  256 ARG A NH1 
1905 N NH2 . ARG A 254 ? 1.1009 1.2319 1.2769 0.0347  -0.2249 0.1507  256 ARG A NH2 
1906 N N   . VAL A 255 ? 0.6042 0.8044 0.6624 0.0859  -0.0886 0.0817  257 VAL A N   
1907 C CA  . VAL A 255 ? 0.6132 0.8176 0.6617 0.0920  -0.0776 0.0720  257 VAL A CA  
1908 C C   . VAL A 255 ? 0.6760 0.8675 0.7370 0.0890  -0.0906 0.0686  257 VAL A C   
1909 O O   . VAL A 255 ? 0.7190 0.9207 0.8006 0.0834  -0.1014 0.0872  257 VAL A O   
1910 C CB  . VAL A 255 ? 0.6172 0.8530 0.6663 0.0965  -0.0663 0.0876  257 VAL A CB  
1911 C CG1 . VAL A 255 ? 0.5744 0.8096 0.6114 0.1031  -0.0562 0.0746  257 VAL A CG1 
1912 C CG2 . VAL A 255 ? 0.5739 0.8226 0.6102 0.1019  -0.0555 0.0902  257 VAL A CG2 
1913 N N   . GLN A 256 ? 0.7182 0.8891 0.7673 0.0929  -0.0904 0.0456  258 GLN A N   
1914 C CA  . GLN A 256 ? 0.7473 0.9043 0.8063 0.0924  -0.1037 0.0389  258 GLN A CA  
1915 C C   . GLN A 256 ? 0.7888 0.9580 0.8484 0.0950  -0.0955 0.0406  258 GLN A C   
1916 O O   . GLN A 256 ? 0.7445 0.9265 0.7893 0.0998  -0.0779 0.0373  258 GLN A O   
1917 C CB  . GLN A 256 ? 0.7564 0.8920 0.8020 0.0979  -0.1069 0.0138  258 GLN A CB  
1918 C CG  . GLN A 256 ? 0.7285 0.8502 0.7757 0.0958  -0.1191 0.0120  258 GLN A CG  
1919 C CD  . GLN A 256 ? 0.7208 0.8270 0.7530 0.1034  -0.1215 -0.0131 258 GLN A CD  
1920 O OE1 . GLN A 256 ? 0.8211 0.9334 0.8360 0.1090  -0.1065 -0.0272 258 GLN A OE1 
1921 N NE2 . GLN A 256 ? 0.8735 0.9613 0.9124 0.1041  -0.1416 -0.0183 258 GLN A NE2 
1922 N N   . LYS A 257 ? 0.8548 1.0183 0.9319 0.0917  -0.1108 0.0462  259 LYS A N   
1923 C CA  . LYS A 257 ? 0.8721 1.0436 0.9525 0.0935  -0.1070 0.0472  259 LYS A CA  
1924 C C   . LYS A 257 ? 0.8938 1.0507 0.9584 0.1011  -0.1020 0.0211  259 LYS A C   
1925 O O   . LYS A 257 ? 0.9100 1.0471 0.9749 0.1035  -0.1149 0.0069  259 LYS A O   
1926 C CB  . LYS A 257 ? 0.8979 1.0661 1.0045 0.0862  -0.1287 0.0631  259 LYS A CB  
1927 C CG  . LYS A 257 ? 0.9638 1.1507 1.0903 0.0766  -0.1367 0.0934  259 LYS A CG  
1928 C CD  . LYS A 257 ? 1.0710 1.2434 1.2241 0.0671  -0.1660 0.1069  259 LYS A CD  
1929 C CE  . LYS A 257 ? 1.1596 1.3302 1.3245 0.0660  -0.1745 0.1091  259 LYS A CE  
1930 N NZ  . LYS A 257 ? 1.1884 1.3371 1.3779 0.0575  -0.2072 0.1186  259 LYS A NZ  
1931 N N   . ILE A 258 ? 0.9193 1.0872 0.9697 0.1056  -0.0845 0.0147  260 ILE A N   
1932 C CA  . ILE A 258 ? 0.9299 1.0889 0.9656 0.1119  -0.0788 -0.0076 260 ILE A CA  
1933 C C   . ILE A 258 ? 0.9324 1.0869 0.9781 0.1136  -0.0873 -0.0114 260 ILE A C   
1934 O O   . ILE A 258 ? 0.9377 1.0818 1.0006 0.1111  -0.1060 -0.0064 260 ILE A O   
1935 C CB  . ILE A 258 ? 0.9248 1.0941 0.9401 0.1152  -0.0588 -0.0138 260 ILE A CB  
1936 C CG1 . ILE A 258 ? 0.9223 1.0836 0.9216 0.1186  -0.0550 -0.0328 260 ILE A CG1 
1937 C CG2 . ILE A 258 ? 0.8919 1.0713 0.9063 0.1171  -0.0511 -0.0119 260 ILE A CG2 
1938 C CD1 . ILE A 258 ? 0.7962 0.9630 0.7789 0.1183  -0.0419 -0.0336 260 ILE A CD1 
1939 N N   . ASN A 266 ? 0.7098 0.9216 0.6872 0.1319  -0.0090 -0.0598 268 ASN A N   
1940 C CA  . ASN A 266 ? 0.7433 0.9561 0.7051 0.1294  -0.0027 -0.0620 268 ASN A CA  
1941 C C   . ASN A 266 ? 0.7393 0.9470 0.6912 0.1277  -0.0010 -0.0592 268 ASN A C   
1942 O O   . ASN A 266 ? 0.7270 0.9333 0.6667 0.1246  0.0015  -0.0606 268 ASN A O   
1943 C CB  . ASN A 266 ? 0.7184 0.9385 0.6768 0.1282  -0.0016 -0.0708 268 ASN A CB  
1944 C CG  . ASN A 266 ? 0.8554 1.0807 0.8118 0.1269  0.0008  -0.0708 268 ASN A CG  
1945 O OD1 . ASN A 266 ? 0.8196 1.0556 0.7741 0.1256  0.0020  -0.0756 268 ASN A OD1 
1946 N ND2 . ASN A 266 ? 0.7495 0.9702 0.7063 0.1278  0.0013  -0.0648 268 ASN A ND2 
1947 N N   . ILE A 267 ? 0.7473 0.9524 0.7051 0.1290  -0.0035 -0.0540 269 ILE A N   
1948 C CA  . ILE A 267 ? 0.7606 0.9617 0.7085 0.1284  -0.0016 -0.0509 269 ILE A CA  
1949 C C   . ILE A 267 ? 0.7385 0.9409 0.6811 0.1325  0.0003  -0.0434 269 ILE A C   
1950 O O   . ILE A 267 ? 0.7848 0.9945 0.7369 0.1357  -0.0006 -0.0359 269 ILE A O   
1951 C CB  . ILE A 267 ? 0.7632 0.9618 0.7169 0.1277  -0.0050 -0.0495 269 ILE A CB  
1952 C CG1 . ILE A 267 ? 0.7742 0.9760 0.7415 0.1294  -0.0091 -0.0389 269 ILE A CG1 
1953 C CG2 . ILE A 267 ? 0.8322 1.0304 0.7897 0.1269  -0.0086 -0.0591 269 ILE A CG2 
1954 C CD1 . ILE A 267 ? 0.6146 0.8161 0.5807 0.1293  -0.0097 -0.0320 269 ILE A CD1 
1955 N N   . LEU A 268 ? 0.7037 0.9004 0.6312 0.1331  0.0017  -0.0452 270 LEU A N   
1956 C CA  . LEU A 268 ? 0.6506 0.8481 0.5695 0.1406  0.0018  -0.0406 270 LEU A CA  
1957 C C   . LEU A 268 ? 0.6524 0.8558 0.5745 0.1444  0.0020  -0.0335 270 LEU A C   
1958 O O   . LEU A 268 ? 0.5866 0.8039 0.5169 0.1496  0.0025  -0.0244 270 LEU A O   
1959 C CB  . LEU A 268 ? 0.6591 0.8444 0.5607 0.1406  -0.0008 -0.0457 270 LEU A CB  
1960 C CG  . LEU A 268 ? 0.6772 0.8571 0.5743 0.1365  -0.0030 -0.0501 270 LEU A CG  
1961 C CD1 . LEU A 268 ? 0.6201 0.7895 0.5075 0.1292  -0.0072 -0.0527 270 LEU A CD1 
1962 C CD2 . LEU A 268 ? 0.5971 0.7754 0.4866 0.1450  -0.0056 -0.0501 270 LEU A CD2 
1963 N N   . ARG A 269 ? 0.6111 0.8066 0.5275 0.1410  0.0013  -0.0361 271 ARG A N   
1964 C CA  . ARG A 269 ? 0.6154 0.8154 0.5328 0.1443  0.0013  -0.0299 271 ARG A CA  
1965 C C   . ARG A 269 ? 0.5894 0.7822 0.5085 0.1372  0.0003  -0.0325 271 ARG A C   
1966 O O   . ARG A 269 ? 0.5772 0.7620 0.4914 0.1314  -0.0001 -0.0398 271 ARG A O   
1967 C CB  . ARG A 269 ? 0.6108 0.8086 0.5120 0.1533  0.0005  -0.0305 271 ARG A CB  
1968 C CG  . ARG A 269 ? 0.6163 0.7964 0.5026 0.1502  -0.0029 -0.0392 271 ARG A CG  
1969 C CD  . ARG A 269 ? 0.6258 0.8013 0.4967 0.1613  -0.0069 -0.0407 271 ARG A CD  
1970 N NE  . ARG A 269 ? 0.5922 0.7481 0.4502 0.1570  -0.0135 -0.0466 271 ARG A NE  
1971 C CZ  . ARG A 269 ? 0.7088 0.8519 0.5594 0.1534  -0.0195 -0.0512 271 ARG A CZ  
1972 N NH1 . ARG A 269 ? 0.7107 0.8583 0.5648 0.1543  -0.0183 -0.0520 271 ARG A NH1 
1973 N NH2 . ARG A 269 ? 0.6755 0.8015 0.5163 0.1478  -0.0277 -0.0537 271 ARG A NH2 
1974 N N   . VAL A 270 ? 0.6141 0.8128 0.5415 0.1378  -0.0007 -0.0252 272 VAL A N   
1975 C CA  . VAL A 270 ? 0.6348 0.8270 0.5619 0.1331  -0.0022 -0.0269 272 VAL A CA  
1976 C C   . VAL A 270 ? 0.6494 0.8429 0.5673 0.1382  -0.0014 -0.0225 272 VAL A C   
1977 O O   . VAL A 270 ? 0.6810 0.8876 0.6018 0.1452  -0.0006 -0.0137 272 VAL A O   
1978 C CB  . VAL A 270 ? 0.6396 0.8352 0.5840 0.1295  -0.0066 -0.0217 272 VAL A CB  
1979 C CG1 . VAL A 270 ? 0.6503 0.8374 0.5928 0.1251  -0.0090 -0.0264 272 VAL A CG1 
1980 C CG2 . VAL A 270 ? 0.6704 0.8659 0.6254 0.1275  -0.0096 -0.0251 272 VAL A CG2 
1981 N N   . GLU A 271 ? 0.6451 0.8276 0.5518 0.1356  -0.0019 -0.0280 273 GLU A N   
1982 C CA  . GLU A 271 ? 0.6313 0.8139 0.5301 0.1407  -0.0023 -0.0245 273 GLU A CA  
1983 C C   . GLU A 271 ? 0.5696 0.7482 0.4720 0.1346  -0.0034 -0.0237 273 GLU A C   
1984 O O   . GLU A 271 ? 0.5043 0.6753 0.4064 0.1270  -0.0042 -0.0300 273 GLU A O   
1985 C CB  . GLU A 271 ? 0.6882 0.8599 0.5690 0.1455  -0.0046 -0.0305 273 GLU A CB  
1986 C CG  . GLU A 271 ? 0.7159 0.8734 0.5896 0.1365  -0.0072 -0.0377 273 GLU A CG  
1987 C CD  . GLU A 271 ? 0.8254 0.9701 0.6835 0.1408  -0.0133 -0.0419 273 GLU A CD  
1988 O OE1 . GLU A 271 ? 0.9114 1.0435 0.7611 0.1353  -0.0185 -0.0439 273 GLU A OE1 
1989 O OE2 . GLU A 271 ? 0.7559 0.9029 0.6105 0.1495  -0.0144 -0.0429 273 GLU A OE2 
1990 N N   . TYR A 272 ? 0.5634 0.7503 0.4695 0.1386  -0.0036 -0.0154 274 TYR A N   
1991 C CA  . TYR A 272 ? 0.4990 0.6839 0.4111 0.1332  -0.0056 -0.0126 274 TYR A CA  
1992 C C   . TYR A 272 ? 0.4983 0.6781 0.3984 0.1359  -0.0057 -0.0130 274 TYR A C   
1993 O O   . TYR A 272 ? 0.4599 0.6413 0.3490 0.1448  -0.0053 -0.0132 274 TYR A O   
1994 C CB  . TYR A 272 ? 0.5141 0.7139 0.4432 0.1338  -0.0076 0.0004  274 TYR A CB  
1995 C CG  . TYR A 272 ? 0.4414 0.6446 0.3850 0.1303  -0.0103 0.0025  274 TYR A CG  
1996 C CD1 . TYR A 272 ? 0.5005 0.6947 0.4546 0.1231  -0.0164 -0.0008 274 TYR A CD1 
1997 C CD2 . TYR A 272 ? 0.4548 0.6700 0.4013 0.1353  -0.0082 0.0071  274 TYR A CD2 
1998 C CE1 . TYR A 272 ? 0.4821 0.6771 0.4496 0.1210  -0.0214 0.0002  274 TYR A CE1 
1999 C CE2 . TYR A 272 ? 0.5023 0.7199 0.4629 0.1317  -0.0118 0.0095  274 TYR A CE2 
2000 C CZ  . TYR A 272 ? 0.6227 0.8293 0.5940 0.1245  -0.0189 0.0061  274 TYR A CZ  
2001 O OH  . TYR A 272 ? 0.6527 0.8597 0.6379 0.1220  -0.0247 0.0079  274 TYR A OH  
2002 N N   . SER A 273 ? 0.4557 0.6289 0.3576 0.1292  -0.0074 -0.0141 275 SER A N   
2003 C CA  . SER A 273 ? 0.4411 0.6092 0.3336 0.1304  -0.0082 -0.0137 275 SER A CA  
2004 C C   . SER A 273 ? 0.3871 0.5560 0.2897 0.1245  -0.0103 -0.0096 275 SER A C   
2005 O O   . SER A 273 ? 0.3852 0.5514 0.2963 0.1185  -0.0125 -0.0125 275 SER A O   
2006 C CB  . SER A 273 ? 0.4816 0.6348 0.3601 0.1260  -0.0095 -0.0229 275 SER A CB  
2007 O OG  . SER A 273 ? 0.4977 0.6462 0.3641 0.1332  -0.0112 -0.0254 275 SER A OG  
2008 N N   . LEU A 274 ? 0.4232 0.5960 0.3244 0.1276  -0.0108 -0.0032 276 LEU A N   
2009 C CA  . LEU A 274 ? 0.4052 0.5745 0.3110 0.1219  -0.0136 -0.0008 276 LEU A CA  
2010 C C   . LEU A 274 ? 0.4223 0.5780 0.3138 0.1183  -0.0137 -0.0093 276 LEU A C   
2011 O O   . LEU A 274 ? 0.3790 0.5311 0.2588 0.1232  -0.0135 -0.0099 276 LEU A O   
2012 C CB  . LEU A 274 ? 0.3646 0.5475 0.2751 0.1274  -0.0138 0.0116  276 LEU A CB  
2013 C CG  . LEU A 274 ? 0.4168 0.5979 0.3346 0.1215  -0.0178 0.0169  276 LEU A CG  
2014 C CD1 . LEU A 274 ? 0.4146 0.5886 0.3448 0.1127  -0.0237 0.0155  276 LEU A CD1 
2015 C CD2 . LEU A 274 ? 0.4046 0.6064 0.3310 0.1270  -0.0180 0.0329  276 LEU A CD2 
2016 N N   . LEU A 275 ? 0.3500 0.4990 0.2424 0.1106  -0.0153 -0.0154 277 LEU A N   
2017 C CA  . LEU A 275 ? 0.4269 0.5677 0.3077 0.1063  -0.0159 -0.0198 277 LEU A CA  
2018 C C   . LEU A 275 ? 0.4263 0.5662 0.3106 0.1038  -0.0183 -0.0161 277 LEU A C   
2019 O O   . LEU A 275 ? 0.4174 0.5590 0.3120 0.1013  -0.0213 -0.0159 277 LEU A O   
2020 C CB  . LEU A 275 ? 0.4330 0.5729 0.3107 0.1000  -0.0158 -0.0283 277 LEU A CB  
2021 C CG  . LEU A 275 ? 0.5128 0.6544 0.3881 0.1005  -0.0139 -0.0319 277 LEU A CG  
2022 C CD1 . LEU A 275 ? 0.5794 0.7258 0.4516 0.0944  -0.0137 -0.0382 277 LEU A CD1 
2023 C CD2 . LEU A 275 ? 0.4965 0.6319 0.3621 0.1036  -0.0145 -0.0301 277 LEU A CD2 
2024 N N   . ILE A 276 ? 0.4316 0.5668 0.3068 0.1044  -0.0188 -0.0142 278 ILE A N   
2025 C CA  . ILE A 276 ? 0.4409 0.5745 0.3177 0.1016  -0.0211 -0.0109 278 ILE A CA  
2026 C C   . ILE A 276 ? 0.4621 0.5876 0.3267 0.0960  -0.0222 -0.0155 278 ILE A C   
2027 O O   . ILE A 276 ? 0.4773 0.5966 0.3318 0.0978  -0.0234 -0.0156 278 ILE A O   
2028 C CB  . ILE A 276 ? 0.4287 0.5678 0.3077 0.1085  -0.0212 -0.0014 278 ILE A CB  
2029 C CG1 . ILE A 276 ? 0.4802 0.6330 0.3733 0.1129  -0.0207 0.0069  278 ILE A CG1 
2030 C CG2 . ILE A 276 ? 0.4445 0.5819 0.3261 0.1045  -0.0239 0.0026  278 ILE A CG2 
2031 C CD1 . ILE A 276 ? 0.5478 0.7144 0.4400 0.1237  -0.0187 0.0154  278 ILE A CD1 
2032 N N   . TYR A 277 ? 0.4248 0.5510 0.2901 0.0895  -0.0234 -0.0193 279 TYR A N   
2033 C CA  . TYR A 277 ? 0.4618 0.5858 0.3167 0.0829  -0.0244 -0.0218 279 TYR A CA  
2034 C C   . TYR A 277 ? 0.4557 0.5816 0.3107 0.0786  -0.0262 -0.0226 279 TYR A C   
2035 O O   . TYR A 277 ? 0.3907 0.5180 0.2540 0.0806  -0.0277 -0.0232 279 TYR A O   
2036 C CB  . TYR A 277 ? 0.4580 0.5883 0.3101 0.0794  -0.0229 -0.0268 279 TYR A CB  
2037 C CG  . TYR A 277 ? 0.4481 0.5883 0.3073 0.0808  -0.0216 -0.0331 279 TYR A CG  
2038 C CD1 . TYR A 277 ? 0.4867 0.6268 0.3551 0.0865  -0.0210 -0.0343 279 TYR A CD1 
2039 C CD2 . TYR A 277 ? 0.4706 0.6216 0.3268 0.0775  -0.0220 -0.0381 279 TYR A CD2 
2040 C CE1 . TYR A 277 ? 0.3978 0.5441 0.2725 0.0887  -0.0224 -0.0412 279 TYR A CE1 
2041 C CE2 . TYR A 277 ? 0.5961 0.7563 0.4570 0.0817  -0.0225 -0.0462 279 TYR A CE2 
2042 C CZ  . TYR A 277 ? 0.5190 0.6745 0.3890 0.0873  -0.0233 -0.0482 279 TYR A CZ  
2043 O OH  . TYR A 277 ? 0.5326 0.6946 0.4067 0.0924  -0.0263 -0.0573 279 TYR A OH  
2044 N N   . VAL A 278 ? 0.4598 0.5857 0.3059 0.0722  -0.0275 -0.0219 280 VAL A N   
2045 C CA  . VAL A 278 ? 0.4196 0.5492 0.2638 0.0679  -0.0292 -0.0223 280 VAL A CA  
2046 C C   . VAL A 278 ? 0.4206 0.5641 0.2593 0.0619  -0.0287 -0.0249 280 VAL A C   
2047 O O   . VAL A 278 ? 0.4638 0.6085 0.2969 0.0560  -0.0299 -0.0206 280 VAL A O   
2048 C CB  . VAL A 278 ? 0.4041 0.5239 0.2433 0.0656  -0.0322 -0.0160 280 VAL A CB  
2049 C CG1 . VAL A 278 ? 0.3924 0.5174 0.2297 0.0609  -0.0338 -0.0164 280 VAL A CG1 
2050 C CG2 . VAL A 278 ? 0.4507 0.5629 0.2954 0.0731  -0.0323 -0.0119 280 VAL A CG2 
2051 N N   . SER A 279 ? 0.4210 0.5767 0.2615 0.0640  -0.0282 -0.0317 281 SER A N   
2052 C CA  . SER A 279 ? 0.4572 0.6339 0.2922 0.0603  -0.0273 -0.0338 281 SER A CA  
2053 C C   . SER A 279 ? 0.5015 0.6836 0.3303 0.0535  -0.0294 -0.0287 281 SER A C   
2054 O O   . SER A 279 ? 0.4671 0.6426 0.2964 0.0558  -0.0315 -0.0304 281 SER A O   
2055 C CB  . SER A 279 ? 0.4988 0.6873 0.3368 0.0689  -0.0272 -0.0452 281 SER A CB  
2056 O OG  . SER A 279 ? 0.6737 0.8876 0.5053 0.0688  -0.0267 -0.0486 281 SER A OG  
2057 N N   . VAL A 280 ? 0.5161 0.7100 0.3398 0.0443  -0.0300 -0.0207 282 VAL A N   
2058 C CA  . VAL A 280 ? 0.5551 0.7549 0.3738 0.0357  -0.0331 -0.0128 282 VAL A CA  
2059 C C   . VAL A 280 ? 0.5920 0.8268 0.4074 0.0318  -0.0316 -0.0109 282 VAL A C   
2060 O O   . VAL A 280 ? 0.5964 0.8434 0.4122 0.0255  -0.0318 -0.0041 282 VAL A O   
2061 C CB  . VAL A 280 ? 0.5114 0.6938 0.3281 0.0264  -0.0389 -0.0014 282 VAL A CB  
2062 C CG1 . VAL A 280 ? 0.5786 0.7660 0.3911 0.0168  -0.0437 0.0077  282 VAL A CG1 
2063 C CG2 . VAL A 280 ? 0.4605 0.6143 0.2792 0.0334  -0.0399 -0.0039 282 VAL A CG2 
2064 N N   . PRO A 281 ? 0.6018 0.8549 0.4139 0.0369  -0.0304 -0.0171 283 PRO A N   
2065 C CA  . PRO A 281 ? 0.6737 0.9676 0.4817 0.0368  -0.0283 -0.0163 283 PRO A CA  
2066 C C   . PRO A 281 ? 0.7191 1.0304 0.5257 0.0209  -0.0310 0.0019  283 PRO A C   
2067 O O   . PRO A 281 ? 0.6768 0.9723 0.4827 0.0120  -0.0357 0.0107  283 PRO A O   
2068 C CB  . PRO A 281 ? 0.6529 0.9554 0.4560 0.0451  -0.0292 -0.0254 283 PRO A CB  
2069 C CG  . PRO A 281 ? 0.6776 0.9448 0.4849 0.0528  -0.0315 -0.0350 283 PRO A CG  
2070 C CD  . PRO A 281 ? 0.5806 0.8191 0.3927 0.0442  -0.0321 -0.0251 283 PRO A CD  
2071 N N   . GLY A 282 ? 0.7629 1.1069 0.5703 0.0172  -0.0292 0.0082  284 GLY A N   
2072 C CA  . GLY A 282 ? 0.7799 1.1432 0.5888 -0.0001 -0.0340 0.0289  284 GLY A CA  
2073 C C   . GLY A 282 ? 0.8019 1.1346 0.6155 -0.0112 -0.0411 0.0390  284 GLY A C   
2074 O O   . GLY A 282 ? 0.8793 1.2253 0.6958 -0.0263 -0.0481 0.0570  284 GLY A O   
2075 N N   . SER A 283 ? 0.7496 1.0425 0.5642 -0.0036 -0.0408 0.0285  285 SER A N   
2076 C CA  . SER A 283 ? 0.7190 0.9816 0.5360 -0.0099 -0.0482 0.0346  285 SER A CA  
2077 C C   . SER A 283 ? 0.6718 0.9208 0.4912 0.0008  -0.0433 0.0230  285 SER A C   
2078 O O   . SER A 283 ? 0.6598 0.9214 0.4799 0.0121  -0.0350 0.0109  285 SER A O   
2079 C CB  . SER A 283 ? 0.7286 0.9544 0.5432 -0.0115 -0.0554 0.0360  285 SER A CB  
2080 O OG  . SER A 283 ? 0.9506 1.1856 0.7633 -0.0216 -0.0608 0.0467  285 SER A OG  
2081 N N   . LYS A 284 ? 0.6457 0.8688 0.4660 -0.0024 -0.0500 0.0267  286 LYS A N   
2082 C CA  . LYS A 284 ? 0.6363 0.8457 0.4586 0.0074  -0.0460 0.0169  286 LYS A CA  
2083 C C   . LYS A 284 ? 0.6154 0.7983 0.4371 0.0196  -0.0429 0.0060  286 LYS A C   
2084 O O   . LYS A 284 ? 0.6208 0.7883 0.4396 0.0189  -0.0468 0.0080  286 LYS A O   
2085 C CB  . LYS A 284 ? 0.7015 0.8964 0.5243 -0.0002 -0.0557 0.0253  286 LYS A CB  
2086 C CG  . LYS A 284 ? 0.7653 0.9912 0.5918 -0.0119 -0.0580 0.0371  286 LYS A CG  
2087 C CD  . LYS A 284 ? 0.8567 1.0696 0.6852 -0.0131 -0.0632 0.0386  286 LYS A CD  
2088 C CE  . LYS A 284 ? 0.9432 1.1408 0.7717 -0.0278 -0.0809 0.0541  286 LYS A CE  
2089 N NZ  . LYS A 284 ? 1.1122 1.2752 0.9352 -0.0264 -0.0908 0.0531  286 LYS A NZ  
2090 N N   . LYS A 285 ? 0.5712 0.7508 0.3963 0.0305  -0.0365 -0.0042 287 LYS A N   
2091 C CA  . LYS A 285 ? 0.5266 0.6865 0.3535 0.0414  -0.0338 -0.0117 287 LYS A CA  
2092 C C   . LYS A 285 ? 0.5340 0.6683 0.3574 0.0426  -0.0403 -0.0081 287 LYS A C   
2093 O O   . LYS A 285 ? 0.5924 0.7191 0.4126 0.0374  -0.0474 -0.0030 287 LYS A O   
2094 C CB  . LYS A 285 ? 0.4520 0.6146 0.2847 0.0507  -0.0280 -0.0201 287 LYS A CB  
2095 C CG  . LYS A 285 ? 0.4465 0.6330 0.2819 0.0536  -0.0233 -0.0271 287 LYS A CG  
2096 C CD  . LYS A 285 ? 0.3668 0.5540 0.2076 0.0601  -0.0202 -0.0330 287 LYS A CD  
2097 C CE  . LYS A 285 ? 0.4281 0.6366 0.2714 0.0661  -0.0173 -0.0421 287 LYS A CE  
2098 N NZ  . LYS A 285 ? 0.5197 0.7576 0.3583 0.0607  -0.0164 -0.0390 287 LYS A NZ  
2099 N N   . VAL A 286 ? 0.5019 0.6234 0.3258 0.0503  -0.0394 -0.0106 288 VAL A N   
2100 C CA  . VAL A 286 ? 0.5063 0.6073 0.3263 0.0568  -0.0446 -0.0097 288 VAL A CA  
2101 C C   . VAL A 286 ? 0.5180 0.6202 0.3436 0.0679  -0.0384 -0.0149 288 VAL A C   
2102 O O   . VAL A 286 ? 0.5041 0.6130 0.3365 0.0721  -0.0329 -0.0169 288 VAL A O   
2103 C CB  . VAL A 286 ? 0.5018 0.5943 0.3200 0.0599  -0.0465 -0.0080 288 VAL A CB  
2104 C CG1 . VAL A 286 ? 0.5946 0.6694 0.4072 0.0696  -0.0526 -0.0082 288 VAL A CG1 
2105 C CG2 . VAL A 286 ? 0.5798 0.6752 0.3945 0.0485  -0.0510 -0.0026 288 VAL A CG2 
2106 N N   . ILE A 287 ? 0.4859 0.5812 0.3091 0.0724  -0.0407 -0.0162 289 ILE A N   
2107 C CA  . ILE A 287 ? 0.4978 0.5990 0.3274 0.0808  -0.0345 -0.0200 289 ILE A CA  
2108 C C   . ILE A 287 ? 0.5309 0.6233 0.3571 0.0933  -0.0367 -0.0204 289 ILE A C   
2109 O O   . ILE A 287 ? 0.5597 0.6384 0.3765 0.0957  -0.0451 -0.0210 289 ILE A O   
2110 C CB  . ILE A 287 ? 0.5032 0.6119 0.3343 0.0756  -0.0332 -0.0220 289 ILE A CB  
2111 C CG1 . ILE A 287 ? 0.4844 0.6098 0.3192 0.0672  -0.0297 -0.0225 289 ILE A CG1 
2112 C CG2 . ILE A 287 ? 0.5060 0.6183 0.3428 0.0840  -0.0285 -0.0255 289 ILE A CG2 
2113 C CD1 . ILE A 287 ? 0.5077 0.6434 0.3407 0.0582  -0.0317 -0.0202 289 ILE A CD1 
2114 N N   . LEU A 288 ? 0.4552 0.5563 0.2889 0.1017  -0.0309 -0.0195 290 LEU A N   
2115 C CA  . LEU A 288 ? 0.4879 0.5912 0.3207 0.1150  -0.0304 -0.0194 290 LEU A CA  
2116 C C   . LEU A 288 ? 0.4804 0.5927 0.3208 0.1155  -0.0255 -0.0209 290 LEU A C   
2117 O O   . LEU A 288 ? 0.4801 0.6010 0.3310 0.1102  -0.0212 -0.0203 290 LEU A O   
2118 C CB  . LEU A 288 ? 0.4534 0.5669 0.2914 0.1238  -0.0278 -0.0139 290 LEU A CB  
2119 C CG  . LEU A 288 ? 0.5552 0.6620 0.3868 0.1251  -0.0320 -0.0120 290 LEU A CG  
2120 C CD1 . LEU A 288 ? 0.3965 0.5189 0.2359 0.1328  -0.0286 -0.0044 290 LEU A CD1 
2121 C CD2 . LEU A 288 ? 0.5598 0.6521 0.3768 0.1327  -0.0406 -0.0166 290 LEU A CD2 
2122 N N   . ASP A 289 ? 0.4845 0.5934 0.3191 0.1225  -0.0278 -0.0236 291 ASP A N   
2123 C CA  . ASP A 289 ? 0.4659 0.5837 0.3070 0.1252  -0.0235 -0.0245 291 ASP A CA  
2124 C C   . ASP A 289 ? 0.5114 0.6387 0.3518 0.1404  -0.0225 -0.0218 291 ASP A C   
2125 O O   . ASP A 289 ? 0.4974 0.6171 0.3255 0.1503  -0.0282 -0.0255 291 ASP A O   
2126 C CB  . ASP A 289 ? 0.5141 0.6220 0.3484 0.1206  -0.0276 -0.0293 291 ASP A CB  
2127 C CG  . ASP A 289 ? 0.5121 0.6283 0.3526 0.1229  -0.0234 -0.0308 291 ASP A CG  
2128 O OD1 . ASP A 289 ? 0.6344 0.7608 0.4794 0.1329  -0.0201 -0.0285 291 ASP A OD1 
2129 O OD2 . ASP A 289 ? 0.5290 0.6440 0.3705 0.1145  -0.0235 -0.0331 291 ASP A OD2 
2130 N N   . LEU A 290 ? 0.4576 0.6028 0.3110 0.1430  -0.0170 -0.0149 292 LEU A N   
2131 C CA  . LEU A 290 ? 0.4910 0.6534 0.3450 0.1577  -0.0154 -0.0097 292 LEU A CA  
2132 C C   . LEU A 290 ? 0.4845 0.6579 0.3468 0.1588  -0.0119 -0.0081 292 LEU A C   
2133 O O   . LEU A 290 ? 0.5117 0.6938 0.3894 0.1513  -0.0092 -0.0022 292 LEU A O   
2134 C CB  . LEU A 290 ? 0.4743 0.6548 0.3386 0.1601  -0.0130 0.0016  292 LEU A CB  
2135 C CG  . LEU A 290 ? 0.4708 0.6451 0.3311 0.1584  -0.0154 0.0027  292 LEU A CG  
2136 C CD1 . LEU A 290 ? 0.5276 0.7254 0.4010 0.1613  -0.0131 0.0165  292 LEU A CD1 
2137 C CD2 . LEU A 290 ? 0.6821 0.8461 0.5237 0.1702  -0.0207 -0.0045 292 LEU A CD2 
2138 N N   . PRO A 291 ? 0.5809 0.7529 0.4332 0.1684  -0.0136 -0.0134 293 PRO A N   
2139 C CA  . PRO A 291 ? 0.5392 0.7228 0.3992 0.1699  -0.0102 -0.0115 293 PRO A CA  
2140 C C   . PRO A 291 ? 0.5480 0.7604 0.4226 0.1750  -0.0059 0.0019  293 PRO A C   
2141 O O   . PRO A 291 ? 0.5134 0.7438 0.3866 0.1859  -0.0054 0.0089  293 PRO A O   
2142 C CB  . PRO A 291 ? 0.5734 0.7503 0.4172 0.1825  -0.0145 -0.0198 293 PRO A CB  
2143 C CG  . PRO A 291 ? 0.6848 0.8381 0.5135 0.1820  -0.0224 -0.0278 293 PRO A CG  
2144 C CD  . PRO A 291 ? 0.5972 0.7553 0.4305 0.1791  -0.0207 -0.0219 293 PRO A CD  
2145 N N   . LEU A 292 ? 0.4644 0.6830 0.3535 0.1673  -0.0039 0.0064  294 LEU A N   
2146 C CA  . LEU A 292 ? 0.4470 0.6919 0.3538 0.1679  -0.0023 0.0218  294 LEU A CA  
2147 C C   . LEU A 292 ? 0.4982 0.7529 0.4081 0.1718  -0.0007 0.0224  294 LEU A C   
2148 O O   . LEU A 292 ? 0.4727 0.7102 0.3742 0.1702  -0.0009 0.0107  294 LEU A O   
2149 C CB  . LEU A 292 ? 0.4522 0.6912 0.3765 0.1530  -0.0052 0.0271  294 LEU A CB  
2150 C CG  . LEU A 292 ? 0.3828 0.6101 0.3055 0.1471  -0.0075 0.0259  294 LEU A CG  
2151 C CD1 . LEU A 292 ? 0.4622 0.6811 0.4005 0.1344  -0.0125 0.0280  294 LEU A CD1 
2152 C CD2 . LEU A 292 ? 0.5021 0.7506 0.4269 0.1545  -0.0070 0.0386  294 LEU A CD2 
2153 N N   . VAL A 293 ? 0.4903 0.7750 0.4122 0.1768  0.0006  0.0376  295 VAL A N   
2154 C CA  . VAL A 293 ? 0.5469 0.8444 0.4767 0.1779  0.0015  0.0421  295 VAL A CA  
2155 C C   . VAL A 293 ? 0.5542 0.8627 0.5091 0.1655  -0.0023 0.0582  295 VAL A C   
2156 O O   . VAL A 293 ? 0.5553 0.8853 0.5216 0.1650  -0.0039 0.0744  295 VAL A O   
2157 C CB  . VAL A 293 ? 0.5737 0.9024 0.4959 0.1962  0.0047  0.0482  295 VAL A CB  
2158 C CG1 . VAL A 293 ? 0.5489 0.8967 0.4825 0.1962  0.0057  0.0568  295 VAL A CG1 
2159 C CG2 . VAL A 293 ? 0.6183 0.9300 0.5143 0.2097  0.0044  0.0300  295 VAL A CG2 
2160 N N   . ILE A 294 ? 0.5449 0.8388 0.5091 0.1555  -0.0053 0.0543  296 ILE A N   
2161 C CA  . ILE A 294 ? 0.5750 0.8724 0.5629 0.1435  -0.0131 0.0677  296 ILE A CA  
2162 C C   . ILE A 294 ? 0.5858 0.8971 0.5864 0.1425  -0.0149 0.0761  296 ILE A C   
2163 O O   . ILE A 294 ? 0.5943 0.8914 0.5883 0.1430  -0.0131 0.0633  296 ILE A O   
2164 C CB  . ILE A 294 ? 0.5606 0.8259 0.5501 0.1326  -0.0188 0.0550  296 ILE A CB  
2165 C CG1 . ILE A 294 ? 0.5577 0.8158 0.5408 0.1316  -0.0190 0.0534  296 ILE A CG1 
2166 C CG2 . ILE A 294 ? 0.4693 0.7319 0.4818 0.1222  -0.0304 0.0646  296 ILE A CG2 
2167 C CD1 . ILE A 294 ? 0.7029 0.9457 0.6638 0.1366  -0.0126 0.0367  296 ILE A CD1 
2168 N N   . GLY A 295 ? 0.6620 1.0026 0.6817 0.1404  -0.0192 0.0991  297 GLY A N   
2169 C CA  . GLY A 295 ? 0.7114 1.0699 0.7445 0.1392  -0.0216 0.1105  297 GLY A CA  
2170 C C   . GLY A 295 ? 0.7484 1.1049 0.8088 0.1245  -0.0356 0.1259  297 GLY A C   
2171 O O   . GLY A 295 ? 0.7615 1.1135 0.8345 0.1159  -0.0448 0.1353  297 GLY A O   
2172 N N   . SER A 296 ? 0.7761 1.1357 0.8459 0.1221  -0.0389 0.1292  298 SER A N   
2173 C CA  . SER A 296 ? 0.7996 1.1504 0.8943 0.1088  -0.0550 0.1402  298 SER A CA  
2174 C C   . SER A 296 ? 0.8136 1.1995 0.9348 0.1011  -0.0650 0.1740  298 SER A C   
2175 O O   . SER A 296 ? 0.7828 1.2082 0.9032 0.1079  -0.0571 0.1903  298 SER A O   
2176 C CB  . SER A 296 ? 0.8054 1.1442 0.8986 0.1097  -0.0547 0.1289  298 SER A CB  
2177 O OG  . SER A 296 ? 0.8059 1.1221 0.8742 0.1175  -0.0436 0.1017  298 SER A OG  
2178 N N   . MET B 1   ? 0.7722 1.2263 1.0366 0.0812  -0.0736 0.1400  1   MET B N   
2179 C CA  . MET B 1   ? 0.7604 1.2326 1.0201 0.0852  -0.0530 0.1292  1   MET B CA  
2180 C C   . MET B 1   ? 0.7373 1.1796 0.9676 0.0522  -0.0662 0.1294  1   MET B C   
2181 O O   . MET B 1   ? 0.7483 1.1786 0.9784 0.0226  -0.0944 0.1439  1   MET B O   
2182 C CB  . MET B 1   ? 0.8159 1.3840 1.1216 0.0961  -0.0401 0.1517  1   MET B CB  
2183 C CG  . MET B 1   ? 0.8910 1.4897 1.2174 0.1441  -0.0124 0.1308  1   MET B CG  
2184 S SD  . MET B 1   ? 1.1037 1.7218 1.4774 0.1724  -0.0174 0.1448  1   MET B SD  
2185 C CE  . MET B 1   ? 1.1295 1.8716 1.5541 0.1631  -0.0198 0.1912  1   MET B CE  
2186 N N   . VAL B 2   ? 0.7019 1.1332 0.9109 0.0592  -0.0479 0.1117  2   VAL B N   
2187 C CA  . VAL B 2   ? 0.6613 1.0668 0.8474 0.0338  -0.0566 0.1137  2   VAL B CA  
2188 C C   . VAL B 2   ? 0.6885 1.1710 0.9014 0.0249  -0.0466 0.1404  2   VAL B C   
2189 O O   . VAL B 2   ? 0.6670 1.2054 0.8861 0.0501  -0.0196 0.1327  2   VAL B O   
2190 C CB  . VAL B 2   ? 0.6265 0.9716 0.7684 0.0455  -0.0446 0.0804  2   VAL B CB  
2191 C CG1 . VAL B 2   ? 0.5390 0.8625 0.6631 0.0231  -0.0534 0.0858  2   VAL B CG1 
2192 C CG2 . VAL B 2   ? 0.4718 0.7569 0.5904 0.0523  -0.0543 0.0629  2   VAL B CG2 
2193 N N   . LYS B 3   ? 0.7268 1.2148 0.9574 -0.0108 -0.0713 0.1721  3   LYS B N   
2194 C CA  . LYS B 3   ? 0.8063 1.3747 1.0704 -0.0281 -0.0681 0.2127  3   LYS B CA  
2195 C C   . LYS B 3   ? 0.7913 1.3468 1.0285 -0.0281 -0.0557 0.2054  3   LYS B C   
2196 O O   . LYS B 3   ? 0.7987 1.2844 1.0208 -0.0485 -0.0764 0.2042  3   LYS B O   
2197 C CB  . LYS B 3   ? 0.8479 1.4136 1.1497 -0.0721 -0.1075 0.2534  3   LYS B CB  
2198 C CG  . LYS B 3   ? 0.9509 1.6305 1.3123 -0.0920 -0.1095 0.3118  3   LYS B CG  
2199 C CD  . LYS B 3   ? 1.1029 1.7651 1.5055 -0.1354 -0.1558 0.3443  3   LYS B CD  
2200 C CE  . LYS B 3   ? 1.0911 1.7189 1.4830 -0.1242 -0.1670 0.3167  3   LYS B CE  
2201 N NZ  . LYS B 3   ? 1.1801 1.7400 1.5809 -0.1612 -0.2175 0.3167  3   LYS B NZ  
2202 N N   . GLN B 4   ? 0.8011 1.4266 1.0324 -0.0024 -0.0233 0.1977  4   GLN B N   
2203 C CA  . GLN B 4   ? 0.8034 1.4505 1.0171 -0.0060 -0.0117 0.2027  4   GLN B CA  
2204 C C   . GLN B 4   ? 0.8448 1.5332 1.0993 -0.0468 -0.0339 0.2648  4   GLN B C   
2205 O O   . GLN B 4   ? 0.9059 1.6723 1.2073 -0.0612 -0.0405 0.3076  4   GLN B O   
2206 C CB  . GLN B 4   ? 0.8198 1.5595 1.0243 0.0291  0.0241  0.1842  4   GLN B CB  
2207 C CG  . GLN B 4   ? 0.8207 1.5064 0.9892 0.0675  0.0411  0.1203  4   GLN B CG  
2208 C CD  . GLN B 4   ? 0.9340 1.6946 1.1187 0.1082  0.0639  0.0978  4   GLN B CD  
2209 O OE1 . GLN B 4   ? 0.9436 1.8187 1.1591 0.1134  0.0744  0.1271  4   GLN B OE1 
2210 N NE2 . GLN B 4   ? 0.8541 1.5526 1.0227 0.1384  0.0700  0.0473  4   GLN B NE2 
2211 N N   . ILE B 5   ? 0.8365 1.4724 1.0796 -0.0662 -0.0482 0.2737  5   ILE B N   
2212 C CA  . ILE B 5   ? 0.9150 1.5633 1.2053 -0.1085 -0.0788 0.3341  5   ILE B CA  
2213 C C   . ILE B 5   ? 0.9416 1.6375 1.2318 -0.1153 -0.0692 0.3639  5   ILE B C   
2214 O O   . ILE B 5   ? 0.9235 1.5517 1.1782 -0.1078 -0.0684 0.3378  5   ILE B O   
2215 C CB  . ILE B 5   ? 0.9173 1.4422 1.2133 -0.1320 -0.1219 0.3245  5   ILE B CB  
2216 C CG1 . ILE B 5   ? 0.9279 1.4553 1.2477 -0.1395 -0.1383 0.3249  5   ILE B CG1 
2217 C CG2 . ILE B 5   ? 1.0314 1.5353 1.3725 -0.1720 -0.1581 0.3761  5   ILE B CG2 
2218 C CD1 . ILE B 5   ? 0.9255 1.3464 1.2480 -0.1601 -0.1823 0.3086  5   ILE B CD1 
2219 N N   . GLU B 6   ? 1.0056 1.8305 1.3386 -0.1296 -0.0622 0.4239  6   GLU B N   
2220 C CA  . GLU B 6   ? 1.0274 1.9430 1.3570 -0.1281 -0.0432 0.4540  6   GLU B CA  
2221 C C   . GLU B 6   ? 1.1110 2.0694 1.5036 -0.1740 -0.0720 0.5415  6   GLU B C   
2222 O O   . GLU B 6   ? 1.1524 2.2229 1.5552 -0.1774 -0.0569 0.5858  6   GLU B O   
2223 C CB  . GLU B 6   ? 1.0268 2.0855 1.3425 -0.0940 -0.0018 0.4430  6   GLU B CB  
2224 C CG  . GLU B 6   ? 1.0172 2.0348 1.2656 -0.0475 0.0274  0.3579  6   GLU B CG  
2225 C CD  . GLU B 6   ? 1.0930 2.1703 1.3350 -0.0088 0.0526  0.3193  6   GLU B CD  
2226 O OE1 . GLU B 6   ? 1.1877 2.3990 1.4654 -0.0061 0.0636  0.3582  6   GLU B OE1 
2227 O OE2 . GLU B 6   ? 1.0603 2.0532 1.2658 0.0199  0.0604  0.2526  6   GLU B OE2 
2228 N N   . SER B 7   ? 1.1510 2.0211 1.5880 -0.2096 -0.1165 0.5665  7   SER B N   
2229 C CA  . SER B 7   ? 1.2664 2.1547 1.7770 -0.2582 -0.1544 0.6522  7   SER B CA  
2230 C C   . SER B 7   ? 1.3049 2.0271 1.8341 -0.2816 -0.2049 0.6390  7   SER B C   
2231 O O   . SER B 7   ? 1.2601 1.8705 1.7486 -0.2633 -0.2116 0.5686  7   SER B O   
2232 C CB  . SER B 7   ? 1.3348 2.3480 1.9162 -0.2888 -0.1640 0.7262  7   SER B CB  
2233 O OG  . SER B 7   ? 1.3393 2.5330 1.9186 -0.2720 -0.1226 0.7600  7   SER B OG  
2234 N N   . LYS B 8   ? 1.4107 2.1249 2.0055 -0.3210 -0.2421 0.7093  8   LYS B N   
2235 C CA  . LYS B 8   ? 1.4811 2.0410 2.1064 -0.3431 -0.2967 0.7012  8   LYS B CA  
2236 C C   . LYS B 8   ? 1.5542 2.0804 2.2337 -0.3778 -0.3404 0.7157  8   LYS B C   
2237 O O   . LYS B 8   ? 1.5624 1.9598 2.2230 -0.3725 -0.3691 0.6547  8   LYS B O   
2238 C CB  . LYS B 8   ? 1.5808 2.1452 2.2671 -0.3720 -0.3237 0.7768  8   LYS B CB  
2239 C CG  . LYS B 8   ? 1.5257 2.2223 2.1893 -0.3557 -0.2781 0.8118  8   LYS B CG  
2240 C CD  . LYS B 8   ? 1.6704 2.3928 2.4091 -0.3909 -0.3084 0.9061  8   LYS B CD  
2241 C CE  . LYS B 8   ? 1.6646 2.5952 2.4284 -0.4029 -0.2772 0.9917  8   LYS B CE  
2242 N NZ  . LYS B 8   ? 1.5339 2.5582 2.2076 -0.3546 -0.2144 0.9402  8   LYS B NZ  
2243 N N   . THR B 9   ? 1.6211 2.2739 2.3674 -0.4128 -0.3456 0.7971  9   THR B N   
2244 C CA  . THR B 9   ? 1.7033 2.3436 2.5100 -0.4519 -0.3890 0.8217  9   THR B CA  
2245 C C   . THR B 9   ? 1.6246 2.2802 2.3790 -0.4229 -0.3626 0.7583  9   THR B C   
2246 O O   . THR B 9   ? 1.6716 2.2782 2.4539 -0.4460 -0.4005 0.7491  9   THR B O   
2247 C CB  . THR B 9   ? 1.8129 2.5907 2.7226 -0.5060 -0.4099 0.9431  9   THR B CB  
2248 O OG1 . THR B 9   ? 1.7380 2.6988 2.6303 -0.4849 -0.3518 0.9817  9   THR B OG1 
2249 C CG2 . THR B 9   ? 1.9173 2.6320 2.9059 -0.5502 -0.4639 1.0103  9   THR B CG2 
2250 N N   . ALA B 10  ? 1.5170 2.2382 2.1994 -0.3730 -0.3014 0.7149  10  ALA B N   
2251 C CA  . ALA B 10  ? 1.4326 2.1545 2.0622 -0.3377 -0.2743 0.6494  10  ALA B CA  
2252 C C   . ALA B 10  ? 1.3820 1.9462 1.9493 -0.3133 -0.2857 0.5599  10  ALA B C   
2253 O O   . ALA B 10  ? 1.3410 1.8881 1.8713 -0.2899 -0.2738 0.5095  10  ALA B O   
2254 C CB  . ALA B 10  ? 1.3474 2.1912 1.9317 -0.2926 -0.2104 0.6345  10  ALA B CB  
2255 N N   . PHE B 11  ? 1.3980 1.8566 1.9564 -0.3169 -0.3087 0.5440  11  PHE B N   
2256 C CA  . PHE B 11  ? 1.3722 1.6891 1.8809 -0.2969 -0.3272 0.4661  11  PHE B CA  
2257 C C   . PHE B 11  ? 1.4742 1.7126 2.0306 -0.3334 -0.3906 0.4677  11  PHE B C   
2258 O O   . PHE B 11  ? 1.4528 1.6054 1.9706 -0.3183 -0.4078 0.4023  11  PHE B O   
2259 C CB  . PHE B 11  ? 1.3583 1.6047 1.8353 -0.2776 -0.3221 0.4436  11  PHE B CB  
2260 C CG  . PHE B 11  ? 1.3091 1.4359 1.7248 -0.2464 -0.3296 0.3607  11  PHE B CG  
2261 C CD1 . PHE B 11  ? 1.1586 1.2921 1.5046 -0.2077 -0.2913 0.3032  11  PHE B CD1 
2262 C CD2 . PHE B 11  ? 1.3525 1.3648 1.7843 -0.2539 -0.3765 0.3417  11  PHE B CD2 
2263 C CE1 . PHE B 11  ? 1.1545 1.1970 1.4467 -0.1800 -0.2977 0.2352  11  PHE B CE1 
2264 C CE2 . PHE B 11  ? 1.2781 1.1978 1.6515 -0.2204 -0.3819 0.2642  11  PHE B CE2 
2265 C CZ  . PHE B 11  ? 1.2046 1.1466 1.5074 -0.1847 -0.3413 0.2145  11  PHE B CZ  
2266 N N   . GLN B 12  ? 1.5986 1.8749 2.2410 -0.3826 -0.4269 0.5446  12  GLN B N   
2267 C CA  . GLN B 12  ? 1.7336 1.9558 2.4360 -0.4260 -0.4912 0.5570  12  GLN B CA  
2268 C C   . GLN B 12  ? 1.7095 2.0221 2.4200 -0.4338 -0.4812 0.5674  12  GLN B C   
2269 O O   . GLN B 12  ? 1.7574 2.0151 2.4727 -0.4474 -0.5197 0.5354  12  GLN B O   
2270 C CB  . GLN B 12  ? 1.8775 2.1044 2.6804 -0.4806 -0.5389 0.6442  12  GLN B CB  
2271 C CG  . GLN B 12  ? 2.0435 2.1132 2.8845 -0.5048 -0.6136 0.6176  12  GLN B CG  
2272 C CD  . GLN B 12  ? 2.0466 2.0026 2.8377 -0.4652 -0.6100 0.5585  12  GLN B CD  
2273 O OE1 . GLN B 12  ? 2.0440 1.8990 2.7755 -0.4326 -0.6198 0.4684  12  GLN B OE1 
2274 N NE2 . GLN B 12  ? 2.0641 2.0492 2.8801 -0.4666 -0.5951 0.6122  12  GLN B NE2 
2275 N N   . GLU B 13  ? 1.6446 2.1001 2.3563 -0.4221 -0.4304 0.6096  13  GLU B N   
2276 C CA  . GLU B 13  ? 1.6049 2.1514 2.3089 -0.4104 -0.4062 0.6067  13  GLU B CA  
2277 C C   . GLU B 13  ? 1.4913 1.9949 2.1034 -0.3537 -0.3667 0.5198  13  GLU B C   
2278 O O   . GLU B 13  ? 1.3841 1.9548 1.9563 -0.3140 -0.3115 0.5075  13  GLU B O   
2279 C CB  . GLU B 13  ? 1.5865 2.3082 2.3269 -0.4113 -0.3665 0.6787  13  GLU B CB  
2280 C CG  . GLU B 13  ? 1.6722 2.4817 2.5150 -0.4712 -0.4049 0.7769  13  GLU B CG  
2281 C CD  . GLU B 13  ? 1.7280 2.6015 2.6185 -0.4949 -0.4042 0.8538  13  GLU B CD  
2282 O OE1 . GLU B 13  ? 1.6509 2.5364 2.4903 -0.4587 -0.3623 0.8332  13  GLU B OE1 
2283 O OE2 . GLU B 13  ? 1.8104 2.7297 2.7939 -0.5524 -0.4476 0.9404  13  GLU B OE2 
2284 N N   . ALA B 14  ? 1.5235 1.9174 2.1061 -0.3515 -0.3990 0.4609  14  ALA B N   
2285 C CA  . ALA B 14  ? 1.4302 1.7850 1.9371 -0.3069 -0.3741 0.3872  14  ALA B CA  
2286 C C   . ALA B 14  ? 1.5019 1.7309 1.9859 -0.3130 -0.4222 0.3318  14  ALA B C   
2287 O O   . ALA B 14  ? 1.5075 1.7200 1.9666 -0.3054 -0.4352 0.2941  14  ALA B O   
2288 C CB  . ALA B 14  ? 1.3155 1.6728 1.7612 -0.2602 -0.3194 0.3557  14  ALA B CB  
2289 N N   . LEU B 15  ? 1.5685 1.7163 2.0635 -0.3250 -0.4497 0.3284  15  LEU B N   
2290 C CA  . LEU B 15  ? 1.6793 1.7051 2.1647 -0.3310 -0.5031 0.2767  15  LEU B CA  
2291 C C   . LEU B 15  ? 1.8171 1.8332 2.3631 -0.3785 -0.5656 0.2943  15  LEU B C   
2292 O O   . LEU B 15  ? 1.8952 1.8281 2.4241 -0.3793 -0.6107 0.2374  15  LEU B O   
2293 C CB  . LEU B 15  ? 1.7407 1.6946 2.2452 -0.3353 -0.5197 0.2852  15  LEU B CB  
2294 C CG  . LEU B 15  ? 1.7987 1.6308 2.2573 -0.3058 -0.5406 0.2123  15  LEU B CG  
2295 C CD1 . LEU B 15  ? 1.5353 1.3785 1.9159 -0.2538 -0.4810 0.1761  15  LEU B CD1 
2296 C CD2 . LEU B 15  ? 1.9329 1.6890 2.4545 -0.3315 -0.5874 0.2394  15  LEU B CD2 
2297 N N   . ASP B 16  ? 1.8444 1.9543 2.4614 -0.4172 -0.5684 0.3729  16  ASP B N   
2298 C CA  . ASP B 16  ? 1.9731 2.0997 2.6579 -0.4683 -0.6244 0.4049  16  ASP B CA  
2299 C C   . ASP B 16  ? 1.9145 2.1153 2.5751 -0.4573 -0.6082 0.3909  16  ASP B C   
2300 O O   . ASP B 16  ? 2.0080 2.1757 2.6770 -0.4782 -0.6567 0.3641  16  ASP B O   
2301 C CB  . ASP B 16  ? 2.0400 2.2457 2.8227 -0.5190 -0.6383 0.5078  16  ASP B CB  
2302 C CG  . ASP B 16  ? 1.9210 2.2840 2.7059 -0.5026 -0.5720 0.5639  16  ASP B CG  
2303 O OD1 . ASP B 16  ? 1.7665 2.1524 2.4786 -0.4490 -0.5115 0.5248  16  ASP B OD1 
2304 O OD2 . ASP B 16  ? 1.9754 2.4428 2.8385 -0.5432 -0.5828 0.6472  16  ASP B OD2 
2305 N N   . ALA B 17  ? 1.7756 2.0752 2.4077 -0.4231 -0.5424 0.4071  17  ALA B N   
2306 C CA  . ALA B 17  ? 1.7206 2.1006 2.3376 -0.4070 -0.5206 0.4033  17  ALA B CA  
2307 C C   . ALA B 17  ? 1.7105 2.0222 2.2583 -0.3792 -0.5308 0.3249  17  ALA B C   
2308 O O   . ALA B 17  ? 1.7218 2.0772 2.2722 -0.3833 -0.5424 0.3221  17  ALA B O   
2309 C CB  . ALA B 17  ? 1.5885 2.0700 2.1878 -0.3672 -0.4489 0.4260  17  ALA B CB  
2310 N N   . ALA B 18  ? 1.6969 1.9136 2.1846 -0.3501 -0.5254 0.2657  18  ALA B N   
2311 C CA  . ALA B 18  ? 1.7029 1.8610 2.1226 -0.3223 -0.5366 0.1916  18  ALA B CA  
2312 C C   . ALA B 18  ? 1.8566 1.9527 2.2981 -0.3577 -0.6111 0.1638  18  ALA B C   
2313 O O   . ALA B 18  ? 1.9643 1.9978 2.4519 -0.3902 -0.6547 0.1741  18  ALA B O   
2314 C CB  . ALA B 18  ? 1.6418 1.7298 1.9965 -0.2805 -0.5084 0.1424  18  ALA B CB  
2315 N N   . GLY B 19  ? 1.8850 2.0000 2.2969 -0.3518 -0.6286 0.1296  19  GLY B N   
2316 C CA  . GLY B 19  ? 2.0518 2.1165 2.4789 -0.3836 -0.7024 0.0940  19  GLY B CA  
2317 C C   . GLY B 19  ? 2.1074 2.0743 2.4675 -0.3512 -0.7223 0.0065  19  GLY B C   
2318 O O   . GLY B 19  ? 2.1159 2.0084 2.4702 -0.3382 -0.7183 -0.0092 19  GLY B O   
2319 N N   . ASP B 20  ? 2.1481 2.1258 2.4579 -0.3359 -0.7432 -0.0489 20  ASP B N   
2320 C CA  . ASP B 20  ? 2.1745 2.0958 2.4047 -0.2912 -0.7478 -0.1339 20  ASP B CA  
2321 C C   . ASP B 20  ? 1.9911 1.9475 2.1610 -0.2396 -0.6731 -0.1321 20  ASP B C   
2322 O O   . ASP B 20  ? 1.9935 1.9236 2.0964 -0.1980 -0.6646 -0.1913 20  ASP B O   
2323 C CB  . ASP B 20  ? 2.2875 2.2397 2.4794 -0.2889 -0.7881 -0.1866 20  ASP B CB  
2324 C CG  . ASP B 20  ? 2.4973 2.3866 2.7333 -0.3322 -0.8742 -0.2187 20  ASP B CG  
2325 O OD1 . ASP B 20  ? 2.5664 2.3806 2.8680 -0.3650 -0.9054 -0.1973 20  ASP B OD1 
2326 O OD2 . ASP B 20  ? 2.5492 2.4665 2.7564 -0.3344 -0.9138 -0.2649 20  ASP B OD2 
2327 N N   . LYS B 21  ? 1.8275 1.8469 2.0247 -0.2422 -0.6215 -0.0649 21  LYS B N   
2328 C CA  . LYS B 21  ? 1.6632 1.7246 1.8132 -0.1992 -0.5558 -0.0582 21  LYS B CA  
2329 C C   . LYS B 21  ? 1.5826 1.5910 1.7137 -0.1749 -0.5218 -0.0651 21  LYS B C   
2330 O O   . LYS B 21  ? 1.6070 1.5693 1.7799 -0.1953 -0.5323 -0.0447 21  LYS B O   
2331 C CB  . LYS B 21  ? 1.5588 1.7145 1.7407 -0.2040 -0.5180 0.0045  21  LYS B CB  
2332 C CG  . LYS B 21  ? 1.5446 1.7251 1.7974 -0.2334 -0.5075 0.0680  21  LYS B CG  
2333 C CD  . LYS B 21  ? 1.5349 1.8160 1.8142 -0.2286 -0.4739 0.1176  21  LYS B CD  
2334 C CE  . LYS B 21  ? 1.4984 1.8225 1.8297 -0.2370 -0.4418 0.1744  21  LYS B CE  
2335 N NZ  . LYS B 21  ? 1.4280 1.8498 1.7824 -0.2210 -0.4066 0.2133  21  LYS B NZ  
2336 N N   . LEU B 22  ? 1.4678 1.4905 1.5386 -0.1329 -0.4830 -0.0891 22  LEU B N   
2337 C CA  . LEU B 22  ? 1.3448 1.3276 1.3875 -0.1053 -0.4504 -0.1015 22  LEU B CA  
2338 C C   . LEU B 22  ? 1.2038 1.2152 1.2783 -0.1093 -0.4043 -0.0466 22  LEU B C   
2339 O O   . LEU B 22  ? 1.0958 1.1731 1.1831 -0.1075 -0.3749 -0.0120 22  LEU B O   
2340 C CB  . LEU B 22  ? 1.3077 1.3129 1.2808 -0.0631 -0.4272 -0.1385 22  LEU B CB  
2341 C CG  . LEU B 22  ? 1.1272 1.1082 1.0639 -0.0305 -0.3912 -0.1521 22  LEU B CG  
2342 C CD1 . LEU B 22  ? 1.1822 1.1122 1.0787 -0.0077 -0.4205 -0.2153 22  LEU B CD1 
2343 C CD2 . LEU B 22  ? 0.9456 0.9909 0.8519 -0.0066 -0.3488 -0.1358 22  LEU B CD2 
2344 N N   . VAL B 23  ? 1.1909 1.1550 1.2797 -0.1124 -0.4003 -0.0407 23  VAL B N   
2345 C CA  . VAL B 23  ? 1.0803 1.0742 1.1865 -0.1095 -0.3552 0.0008  23  VAL B CA  
2346 C C   . VAL B 23  ? 0.9966 0.9650 1.0532 -0.0745 -0.3225 -0.0251 23  VAL B C   
2347 O O   . VAL B 23  ? 1.0155 0.9313 1.0401 -0.0587 -0.3407 -0.0671 23  VAL B O   
2348 C CB  . VAL B 23  ? 1.1177 1.1072 1.2882 -0.1453 -0.3713 0.0464  23  VAL B CB  
2349 C CG1 . VAL B 23  ? 1.2287 1.1323 1.4107 -0.1563 -0.4145 0.0247  23  VAL B CG1 
2350 C CG2 . VAL B 23  ? 1.0231 1.0579 1.2032 -0.1375 -0.3239 0.0834  23  VAL B CG2 
2351 N N   . VAL B 24  ? 0.8767 0.8867 0.9287 -0.0611 -0.2766 -0.0024 24  VAL B N   
2352 C CA  . VAL B 24  ? 0.8153 0.8105 0.8296 -0.0342 -0.2449 -0.0177 24  VAL B CA  
2353 C C   . VAL B 24  ? 0.7664 0.7851 0.8047 -0.0396 -0.2154 0.0154  24  VAL B C   
2354 O O   . VAL B 24  ? 0.7400 0.8127 0.8031 -0.0444 -0.1955 0.0429  24  VAL B O   
2355 C CB  . VAL B 24  ? 0.7408 0.7628 0.7142 -0.0071 -0.2219 -0.0345 24  VAL B CB  
2356 C CG1 . VAL B 24  ? 0.7333 0.8105 0.7308 -0.0093 -0.2026 -0.0060 24  VAL B CG1 
2357 C CG2 . VAL B 24  ? 0.7021 0.7111 0.6406 0.0167  -0.1938 -0.0476 24  VAL B CG2 
2358 N N   . VAL B 25  ? 0.7738 0.7581 0.8054 -0.0364 -0.2139 0.0117  25  VAL B N   
2359 C CA  . VAL B 25  ? 0.7331 0.7481 0.7823 -0.0411 -0.1879 0.0419  25  VAL B CA  
2360 C C   . VAL B 25  ? 0.6720 0.6843 0.6798 -0.0149 -0.1561 0.0226  25  VAL B C   
2361 O O   . VAL B 25  ? 0.7005 0.6705 0.6786 0.0000  -0.1630 -0.0034 25  VAL B O   
2362 C CB  . VAL B 25  ? 0.8059 0.7956 0.8915 -0.0635 -0.2131 0.0667  25  VAL B CB  
2363 C CG1 . VAL B 25  ? 0.7259 0.7794 0.8395 -0.0746 -0.1886 0.1109  25  VAL B CG1 
2364 C CG2 . VAL B 25  ? 0.9197 0.8861 1.0455 -0.0912 -0.2584 0.0764  25  VAL B CG2 
2365 N N   . ASP B 26  ? 0.6007 0.6613 0.6087 -0.0081 -0.1235 0.0333  26  ASP B N   
2366 C CA  . ASP B 26  ? 0.5560 0.6199 0.5346 0.0098  -0.0962 0.0201  26  ASP B CA  
2367 C C   . ASP B 26  ? 0.5407 0.6271 0.5329 0.0007  -0.0879 0.0423  26  ASP B C   
2368 O O   . ASP B 26  ? 0.5338 0.6775 0.5450 -0.0040 -0.0714 0.0612  26  ASP B O   
2369 C CB  . ASP B 26  ? 0.4742 0.5725 0.4497 0.0232  -0.0712 0.0136  26  ASP B CB  
2370 C CG  . ASP B 26  ? 0.4734 0.5748 0.4256 0.0372  -0.0475 -0.0005 26  ASP B CG  
2371 O OD1 . ASP B 26  ? 0.5643 0.6522 0.5008 0.0366  -0.0467 -0.0020 26  ASP B OD1 
2372 O OD2 . ASP B 26  ? 0.4371 0.5540 0.3911 0.0486  -0.0320 -0.0097 26  ASP B OD2 
2373 N N   . PHE B 27  ? 0.5614 0.6100 0.5448 0.0010  -0.0999 0.0406  27  PHE B N   
2374 C CA  . PHE B 27  ? 0.5386 0.6121 0.5300 -0.0043 -0.0902 0.0631  27  PHE B CA  
2375 C C   . PHE B 27  ? 0.4887 0.5850 0.4466 0.0127  -0.0607 0.0448  27  PHE B C   
2376 O O   . PHE B 27  ? 0.4855 0.5496 0.4141 0.0274  -0.0588 0.0227  27  PHE B O   
2377 C CB  . PHE B 27  ? 0.6178 0.6400 0.6176 -0.0068 -0.1154 0.0689  27  PHE B CB  
2378 C CG  . PHE B 27  ? 0.7641 0.7603 0.8082 -0.0290 -0.1507 0.0912  27  PHE B CG  
2379 C CD1 . PHE B 27  ? 0.8520 0.8860 0.9434 -0.0543 -0.1585 0.1422  27  PHE B CD1 
2380 C CD2 . PHE B 27  ? 0.8732 0.8146 0.9145 -0.0267 -0.1787 0.0635  27  PHE B CD2 
2381 C CE1 . PHE B 27  ? 0.9967 1.0059 1.1387 -0.0806 -0.1961 0.1693  27  PHE B CE1 
2382 C CE2 . PHE B 27  ? 1.0036 0.9162 1.0901 -0.0509 -0.2173 0.0815  27  PHE B CE2 
2383 C CZ  . PHE B 27  ? 1.0671 1.0096 1.2076 -0.0798 -0.2274 0.1364  27  PHE B CZ  
2384 N N   . SER B 28  ? 0.4563 0.6139 0.4209 0.0110  -0.0398 0.0534  28  SER B N   
2385 C CA  . SER B 28  ? 0.3991 0.5780 0.3380 0.0254  -0.0161 0.0295  28  SER B CA  
2386 C C   . SER B 28  ? 0.4119 0.6510 0.3516 0.0213  -0.0026 0.0445  28  SER B C   
2387 O O   . SER B 28  ? 0.4887 0.7569 0.4517 0.0070  -0.0105 0.0802  28  SER B O   
2388 C CB  . SER B 28  ? 0.3634 0.5646 0.3112 0.0332  -0.0057 0.0158  28  SER B CB  
2389 O OG  . SER B 28  ? 0.5052 0.7184 0.4357 0.0469  0.0117  -0.0110 28  SER B OG  
2390 N N   . ALA B 29  ? 0.3732 0.6339 0.2901 0.0324  0.0149  0.0193  29  ALA B N   
2391 C CA  . ALA B 29  ? 0.4350 0.7670 0.3467 0.0316  0.0288  0.0248  29  ALA B CA  
2392 C C   . ALA B 29  ? 0.4654 0.8111 0.3604 0.0472  0.0431  -0.0181 29  ALA B C   
2393 O O   . ALA B 29  ? 0.4532 0.7421 0.3392 0.0540  0.0399  -0.0436 29  ALA B O   
2394 C CB  . ALA B 29  ? 0.4467 0.7754 0.3453 0.0257  0.0250  0.0398  29  ALA B CB  
2395 N N   . THR B 30  ? 0.5568 0.9820 0.4509 0.0531  0.0565  -0.0246 30  THR B N   
2396 C CA  . THR B 30  ? 0.6183 1.0629 0.5040 0.0724  0.0669  -0.0713 30  THR B CA  
2397 C C   . THR B 30  ? 0.5921 1.0104 0.4528 0.0743  0.0652  -0.1057 30  THR B C   
2398 O O   . THR B 30  ? 0.6475 1.0380 0.5086 0.0870  0.0640  -0.1469 30  THR B O   
2399 C CB  . THR B 30  ? 0.7045 1.2604 0.5963 0.0840  0.0818  -0.0714 30  THR B CB  
2400 O OG1 . THR B 30  ? 0.8799 1.4453 0.7680 0.1102  0.0890  -0.1259 30  THR B OG1 
2401 C CG2 . THR B 30  ? 0.7377 1.3785 0.6125 0.0754  0.0881  -0.0520 30  THR B CG2 
2402 N N   . TRP B 31  ? 0.5658 0.9927 0.4104 0.0607  0.0624  -0.0860 31  TRP B N   
2403 C CA  . TRP B 31  ? 0.5142 0.9315 0.3370 0.0579  0.0594  -0.1113 31  TRP B CA  
2404 C C   . TRP B 31  ? 0.4588 0.7935 0.2814 0.0511  0.0483  -0.1075 31  TRP B C   
2405 O O   . TRP B 31  ? 0.4889 0.8077 0.3014 0.0465  0.0428  -0.1257 31  TRP B O   
2406 C CB  . TRP B 31  ? 0.5629 1.0506 0.3706 0.0482  0.0629  -0.0870 31  TRP B CB  
2407 C CG  . TRP B 31  ? 0.4058 0.8844 0.2271 0.0371  0.0582  -0.0323 31  TRP B CG  
2408 C CD1 . TRP B 31  ? 0.4260 0.9508 0.2677 0.0320  0.0598  0.0074  31  TRP B CD1 
2409 C CD2 . TRP B 31  ? 0.3143 0.7324 0.1353 0.0314  0.0480  -0.0127 31  TRP B CD2 
2410 N NE1 . TRP B 31  ? 0.4374 0.9216 0.2950 0.0220  0.0474  0.0479  31  TRP B NE1 
2411 C CE2 . TRP B 31  ? 0.3495 0.7687 0.1919 0.0251  0.0413  0.0323  31  TRP B CE2 
2412 C CE3 . TRP B 31  ? 0.2520 0.6194 0.0603 0.0322  0.0426  -0.0279 31  TRP B CE3 
2413 C CZ2 . TRP B 31  ? 0.3127 0.6790 0.1614 0.0248  0.0290  0.0537  31  TRP B CZ2 
2414 C CZ3 . TRP B 31  ? 0.2810 0.6111 0.0922 0.0328  0.0346  -0.0026 31  TRP B CZ3 
2415 C CH2 . TRP B 31  ? 0.3342 0.6598 0.1643 0.0317  0.0276  0.0332  31  TRP B CH2 
2416 N N   . CYS B 32  ? 0.4121 0.7023 0.2471 0.0504  0.0435  -0.0838 32  CYS B N   
2417 C CA  . CYS B 32  ? 0.3741 0.6060 0.2061 0.0478  0.0345  -0.0751 32  CYS B CA  
2418 C C   . CYS B 32  ? 0.4019 0.5885 0.2440 0.0520  0.0294  -0.0955 32  CYS B C   
2419 O O   . CYS B 32  ? 0.3560 0.5257 0.2143 0.0586  0.0285  -0.0978 32  CYS B O   
2420 C CB  . CYS B 32  ? 0.3440 0.5557 0.1839 0.0476  0.0285  -0.0466 32  CYS B CB  
2421 S SG  . CYS B 32  ? 0.4125 0.5677 0.2449 0.0527  0.0178  -0.0412 32  CYS B SG  
2422 N N   . GLY B 33  ? 0.3922 0.5644 0.2302 0.0462  0.0241  -0.1048 33  GLY B N   
2423 C CA  . GLY B 33  ? 0.4078 0.5399 0.2640 0.0454  0.0151  -0.1137 33  GLY B CA  
2424 C C   . GLY B 33  ? 0.3884 0.4916 0.2529 0.0503  0.0115  -0.0925 33  GLY B C   
2425 O O   . GLY B 33  ? 0.4300 0.5145 0.3155 0.0564  0.0088  -0.0981 33  GLY B O   
2426 N N   . PRO B 34  ? 0.2935 0.3976 0.1419 0.0506  0.0104  -0.0703 34  PRO B N   
2427 C CA  . PRO B 34  ? 0.3048 0.3911 0.1561 0.0578  0.0054  -0.0569 34  PRO B CA  
2428 C C   . PRO B 34  ? 0.3313 0.4118 0.1924 0.0631  0.0054  -0.0600 34  PRO B C   
2429 O O   . PRO B 34  ? 0.3408 0.4087 0.2143 0.0667  0.0000  -0.0551 34  PRO B O   
2430 C CB  . PRO B 34  ? 0.3106 0.4060 0.1386 0.0637  0.0042  -0.0440 34  PRO B CB  
2431 C CG  . PRO B 34  ? 0.2516 0.3688 0.0715 0.0572  0.0081  -0.0422 34  PRO B CG  
2432 C CD  . PRO B 34  ? 0.3134 0.4382 0.1416 0.0482  0.0122  -0.0590 34  PRO B CD  
2433 N N   . ALA B 35  ? 0.3431 0.4414 0.2026 0.0619  0.0105  -0.0623 35  ALA B N   
2434 C CA  . ALA B 35  ? 0.3440 0.4480 0.2197 0.0634  0.0092  -0.0583 35  ALA B CA  
2435 C C   . ALA B 35  ? 0.4115 0.5234 0.3102 0.0697  0.0141  -0.0721 35  ALA B C   
2436 O O   . ALA B 35  ? 0.4376 0.5467 0.3539 0.0735  0.0101  -0.0658 35  ALA B O   
2437 C CB  . ALA B 35  ? 0.3147 0.4464 0.1907 0.0575  0.0112  -0.0462 35  ALA B CB  
2438 N N   . LYS B 36  ? 0.4055 0.5282 0.3058 0.0727  0.0205  -0.0932 36  LYS B N   
2439 C CA  . LYS B 36  ? 0.4601 0.5786 0.3849 0.0846  0.0215  -0.1152 36  LYS B CA  
2440 C C   . LYS B 36  ? 0.4649 0.5393 0.4112 0.0863  0.0103  -0.1096 36  LYS B C   
2441 O O   . LYS B 36  ? 0.4716 0.5377 0.4472 0.0983  0.0079  -0.1149 36  LYS B O   
2442 C CB  . LYS B 36  ? 0.5306 0.6649 0.4499 0.0877  0.0253  -0.1468 36  LYS B CB  
2443 C CG  . LYS B 36  ? 0.6516 0.8502 0.5554 0.0906  0.0378  -0.1535 36  LYS B CG  
2444 C CD  . LYS B 36  ? 0.7478 0.9711 0.6475 0.1009  0.0400  -0.1972 36  LYS B CD  
2445 C CE  . LYS B 36  ? 0.9601 1.1902 0.8858 0.1268  0.0422  -0.2296 36  LYS B CE  
2446 N NZ  . LYS B 36  ? 1.0032 1.3039 0.9177 0.1458  0.0520  -0.2695 36  LYS B NZ  
2447 N N   . MET B 37  ? 0.4310 0.4852 0.3671 0.0754  0.0031  -0.0952 37  MET B N   
2448 C CA  . MET B 37  ? 0.4651 0.4936 0.4231 0.0737  -0.0083 -0.0769 37  MET B CA  
2449 C C   . MET B 37  ? 0.4308 0.4655 0.3912 0.0789  -0.0108 -0.0561 37  MET B C   
2450 O O   . MET B 37  ? 0.4741 0.4989 0.4641 0.0841  -0.0177 -0.0457 37  MET B O   
2451 C CB  . MET B 37  ? 0.4699 0.4964 0.4163 0.0607  -0.0141 -0.0598 37  MET B CB  
2452 C CG  . MET B 37  ? 0.6231 0.6433 0.5918 0.0563  -0.0258 -0.0277 37  MET B CG  
2453 S SD  . MET B 37  ? 0.5533 0.6019 0.4964 0.0631  -0.0255 -0.0021 37  MET B SD  
2454 C CE  . MET B 37  ? 0.5520 0.6295 0.4580 0.0596  -0.0218 0.0065  37  MET B CE  
2455 N N   . ILE B 38  ? 0.3761 0.4261 0.3095 0.0771  -0.0085 -0.0503 38  ILE B N   
2456 C CA  . ILE B 38  ? 0.3802 0.4352 0.3133 0.0793  -0.0165 -0.0350 38  ILE B CA  
2457 C C   . ILE B 38  ? 0.4008 0.4663 0.3598 0.0846  -0.0153 -0.0370 38  ILE B C   
2458 O O   . ILE B 38  ? 0.4091 0.4810 0.3805 0.0865  -0.0237 -0.0236 38  ILE B O   
2459 C CB  . ILE B 38  ? 0.3617 0.4205 0.2618 0.0767  -0.0207 -0.0339 38  ILE B CB  
2460 C CG1 . ILE B 38  ? 0.4637 0.5279 0.3566 0.0801  -0.0340 -0.0242 38  ILE B CG1 
2461 C CG2 . ILE B 38  ? 0.3740 0.4380 0.2729 0.0725  -0.0179 -0.0402 38  ILE B CG2 
2462 C CD1 . ILE B 38  ? 0.4018 0.4790 0.2915 0.0836  -0.0368 -0.0094 38  ILE B CD1 
2463 N N   . LYS B 39  ? 0.3633 0.4414 0.3301 0.0882  -0.0048 -0.0532 39  LYS B N   
2464 C CA  . LYS B 39  ? 0.3870 0.4948 0.3753 0.0946  -0.0001 -0.0537 39  LYS B CA  
2465 C C   . LYS B 39  ? 0.4072 0.5144 0.4298 0.1060  -0.0051 -0.0459 39  LYS B C   
2466 O O   . LYS B 39  ? 0.4212 0.5489 0.4543 0.1033  -0.0107 -0.0297 39  LYS B O   
2467 C CB  . LYS B 39  ? 0.4185 0.5537 0.4080 0.1023  0.0139  -0.0756 39  LYS B CB  
2468 C CG  . LYS B 39  ? 0.5188 0.7073 0.5277 0.1110  0.0226  -0.0743 39  LYS B CG  
2469 C CD  . LYS B 39  ? 0.6761 0.8962 0.6863 0.1286  0.0363  -0.1070 39  LYS B CD  
2470 C CE  . LYS B 39  ? 0.7944 0.9794 0.8285 0.1500  0.0330  -0.1362 39  LYS B CE  
2471 N NZ  . LYS B 39  ? 0.7590 0.9571 0.8322 0.1695  0.0324  -0.1303 39  LYS B NZ  
2472 N N   . PRO B 40  ? 0.4133 0.4962 0.4587 0.1172  -0.0066 -0.0545 40  PRO B N   
2473 C CA  . PRO B 40  ? 0.4621 0.5474 0.5470 0.1300  -0.0128 -0.0415 40  PRO B CA  
2474 C C   . PRO B 40  ? 0.4856 0.5750 0.5660 0.1190  -0.0258 -0.0092 40  PRO B C   
2475 O O   . PRO B 40  ? 0.4951 0.6076 0.5998 0.1248  -0.0306 0.0065  40  PRO B O   
2476 C CB  . PRO B 40  ? 0.5210 0.5666 0.6360 0.1398  -0.0189 -0.0506 40  PRO B CB  
2477 C CG  . PRO B 40  ? 0.4835 0.5119 0.5748 0.1323  -0.0151 -0.0743 40  PRO B CG  
2478 C CD  . PRO B 40  ? 0.4041 0.4562 0.4484 0.1168  -0.0074 -0.0711 40  PRO B CD  
2479 N N   . PHE B 41  ? 0.4079 0.4842 0.4573 0.1057  -0.0317 -0.0007 41  PHE B N   
2480 C CA  . PHE B 41  ? 0.4146 0.5043 0.4530 0.0993  -0.0448 0.0244  41  PHE B CA  
2481 C C   . PHE B 41  ? 0.3976 0.5091 0.4204 0.0934  -0.0510 0.0238  41  PHE B C   
2482 O O   . PHE B 41  ? 0.4153 0.5487 0.4466 0.0926  -0.0632 0.0407  41  PHE B O   
2483 C CB  . PHE B 41  ? 0.3958 0.4805 0.4022 0.0918  -0.0471 0.0291  41  PHE B CB  
2484 C CG  . PHE B 41  ? 0.4900 0.5572 0.5204 0.0911  -0.0472 0.0400  41  PHE B CG  
2485 C CD1 . PHE B 41  ? 0.5740 0.6238 0.5898 0.0852  -0.0408 0.0248  41  PHE B CD1 
2486 C CD2 . PHE B 41  ? 0.5894 0.6575 0.6639 0.0942  -0.0571 0.0688  41  PHE B CD2 
2487 C CE1 . PHE B 41  ? 0.6080 0.6392 0.6525 0.0796  -0.0465 0.0361  41  PHE B CE1 
2488 C CE2 . PHE B 41  ? 0.6283 0.6734 0.7364 0.0893  -0.0634 0.0837  41  PHE B CE2 
2489 C CZ  . PHE B 41  ? 0.6518 0.6769 0.7446 0.0806  -0.0591 0.0656  41  PHE B CZ  
2490 N N   . PHE B 42  ? 0.3651 0.4729 0.3704 0.0875  -0.0453 0.0069  42  PHE B N   
2491 C CA  . PHE B 42  ? 0.3939 0.5159 0.3946 0.0771  -0.0553 0.0085  42  PHE B CA  
2492 C C   . PHE B 42  ? 0.4466 0.6014 0.4873 0.0796  -0.0559 0.0219  42  PHE B C   
2493 O O   . PHE B 42  ? 0.4504 0.6235 0.4979 0.0692  -0.0720 0.0335  42  PHE B O   
2494 C CB  . PHE B 42  ? 0.3265 0.4404 0.3116 0.0695  -0.0489 -0.0032 42  PHE B CB  
2495 C CG  . PHE B 42  ? 0.4258 0.5445 0.4122 0.0542  -0.0649 0.0031  42  PHE B CG  
2496 C CD1 . PHE B 42  ? 0.3181 0.4148 0.2818 0.0483  -0.0861 -0.0034 42  PHE B CD1 
2497 C CD2 . PHE B 42  ? 0.4283 0.5778 0.4421 0.0459  -0.0611 0.0156  42  PHE B CD2 
2498 C CE1 . PHE B 42  ? 0.4278 0.5170 0.3996 0.0322  -0.1074 -0.0004 42  PHE B CE1 
2499 C CE2 . PHE B 42  ? 0.4845 0.6366 0.5094 0.0262  -0.0809 0.0288  42  PHE B CE2 
2500 C CZ  . PHE B 42  ? 0.4406 0.5546 0.4467 0.0182  -0.1062 0.0194  42  PHE B CZ  
2501 N N   . HIS B 43  ? 0.4698 0.6346 0.5383 0.0950  -0.0403 0.0179  43  HIS B N   
2502 C CA  . HIS B 43  ? 0.5298 0.7334 0.6401 0.1057  -0.0381 0.0297  43  HIS B CA  
2503 C C   . HIS B 43  ? 0.5529 0.7600 0.6865 0.1125  -0.0502 0.0504  43  HIS B C   
2504 O O   . HIS B 43  ? 0.5775 0.8203 0.7319 0.1088  -0.0603 0.0698  43  HIS B O   
2505 C CB  . HIS B 43  ? 0.5370 0.7537 0.6678 0.1275  -0.0181 0.0102  43  HIS B CB  
2506 C CG  . HIS B 43  ? 0.6832 0.9479 0.8588 0.1472  -0.0128 0.0182  43  HIS B CG  
2507 N ND1 . HIS B 43  ? 0.7377 0.9921 0.9499 0.1718  -0.0134 0.0177  43  HIS B ND1 
2508 C CD2 . HIS B 43  ? 0.6452 0.9741 0.8400 0.1470  -0.0076 0.0305  43  HIS B CD2 
2509 C CE1 . HIS B 43  ? 0.7399 1.0495 0.9892 0.1899  -0.0073 0.0252  43  HIS B CE1 
2510 N NE2 . HIS B 43  ? 0.7575 1.1183 0.9960 0.1744  -0.0028 0.0341  43  HIS B NE2 
2511 N N   . SER B 44  ? 0.5714 0.7481 0.7063 0.1203  -0.0509 0.0517  44  SER B N   
2512 C CA  . SER B 44  ? 0.6119 0.7984 0.7679 0.1234  -0.0643 0.0804  44  SER B CA  
2513 C C   . SER B 44  ? 0.6106 0.8232 0.7383 0.1061  -0.0819 0.0941  44  SER B C   
2514 O O   . SER B 44  ? 0.6885 0.9343 0.8380 0.1073  -0.0938 0.1187  44  SER B O   
2515 C CB  . SER B 44  ? 0.6299 0.7842 0.7896 0.1266  -0.0657 0.0879  44  SER B CB  
2516 O OG  . SER B 44  ? 0.7027 0.8273 0.8972 0.1435  -0.0568 0.0724  44  SER B OG  
2517 N N   . LEU B 45  ? 0.5467 0.7455 0.6277 0.0922  -0.0857 0.0762  45  LEU B N   
2518 C CA  . LEU B 45  ? 0.5520 0.7693 0.6040 0.0789  -0.1065 0.0759  45  LEU B CA  
2519 C C   . LEU B 45  ? 0.6048 0.8466 0.6775 0.0675  -0.1182 0.0802  45  LEU B C   
2520 O O   . LEU B 45  ? 0.6387 0.9072 0.7074 0.0582  -0.1401 0.0875  45  LEU B O   
2521 C CB  . LEU B 45  ? 0.5441 0.7338 0.5468 0.0727  -0.1095 0.0502  45  LEU B CB  
2522 C CG  . LEU B 45  ? 0.4833 0.6713 0.4553 0.0805  -0.1063 0.0499  45  LEU B CG  
2523 C CD1 . LEU B 45  ? 0.4865 0.6461 0.4195 0.0801  -0.1029 0.0232  45  LEU B CD1 
2524 C CD2 . LEU B 45  ? 0.4560 0.6890 0.4120 0.0828  -0.1238 0.0629  45  LEU B CD2 
2525 N N   . SER B 46  ? 0.5861 0.8287 0.6827 0.0675  -0.1050 0.0776  46  SER B N   
2526 C CA  . SER B 46  ? 0.5947 0.8721 0.7183 0.0539  -0.1153 0.0900  46  SER B CA  
2527 C C   . SER B 46  ? 0.6203 0.9462 0.7870 0.0627  -0.1182 0.1165  46  SER B C   
2528 O O   . SER B 46  ? 0.6408 1.0039 0.8265 0.0466  -0.1365 0.1325  46  SER B O   
2529 C CB  . SER B 46  ? 0.5839 0.8688 0.7217 0.0524  -0.0985 0.0867  46  SER B CB  
2530 O OG  . SER B 46  ? 0.5274 0.8229 0.6860 0.0781  -0.0732 0.0829  46  SER B OG  
2531 N N   . GLU B 47  ? 0.6066 0.9313 0.7945 0.0875  -0.1029 0.1228  47  GLU B N   
2532 C CA  . GLU B 47  ? 0.6612 1.0277 0.8950 0.1014  -0.1061 0.1506  47  GLU B CA  
2533 C C   . GLU B 47  ? 0.6697 1.0515 0.8884 0.0906  -0.1295 0.1683  47  GLU B C   
2534 O O   . GLU B 47  ? 0.6470 1.0784 0.8890 0.0843  -0.1454 0.1917  47  GLU B O   
2535 C CB  . GLU B 47  ? 0.6980 1.0464 0.9651 0.1327  -0.0884 0.1508  47  GLU B CB  
2536 C CG  . GLU B 47  ? 0.7602 1.0824 1.0257 0.1471  -0.0658 0.1197  47  GLU B CG  
2537 C CD  . GLU B 47  ? 0.8206 1.1946 1.1177 0.1606  -0.0526 0.1173  47  GLU B CD  
2538 O OE1 . GLU B 47  ? 0.9112 1.2903 1.2442 0.1938  -0.0388 0.1065  47  GLU B OE1 
2539 O OE2 . GLU B 47  ? 0.8457 1.2583 1.1354 0.1393  -0.0574 0.1263  47  GLU B OE2 
2540 N N   . LYS B 48  ? 0.6026 0.9531 0.7820 0.0889  -0.1317 0.1587  48  LYS B N   
2541 C CA  . LYS B 48  ? 0.6575 1.0383 0.8164 0.0824  -0.1520 0.1747  48  LYS B CA  
2542 C C   . LYS B 48  ? 0.7132 1.1173 0.8452 0.0605  -0.1776 0.1615  48  LYS B C   
2543 O O   . LYS B 48  ? 0.7998 1.2557 0.9467 0.0542  -0.1970 0.1822  48  LYS B O   
2544 C CB  . LYS B 48  ? 0.5985 0.9578 0.7201 0.0861  -0.1482 0.1691  48  LYS B CB  
2545 C CG  . LYS B 48  ? 0.6168 1.0286 0.7394 0.0890  -0.1617 0.2038  48  LYS B CG  
2546 C CD  . LYS B 48  ? 0.6466 1.0698 0.7140 0.0868  -0.1665 0.1932  48  LYS B CD  
2547 C CE  . LYS B 48  ? 0.6205 1.1132 0.6939 0.0908  -0.1769 0.2375  48  LYS B CE  
2548 N NZ  . LYS B 48  ? 0.8347 1.3944 0.8958 0.0846  -0.2007 0.2435  48  LYS B NZ  
2549 N N   . TYR B 49  ? 0.6850 1.0499 0.7833 0.0483  -0.1806 0.1281  49  TYR B N   
2550 C CA  . TYR B 49  ? 0.7593 1.1272 0.8310 0.0274  -0.2111 0.1072  49  TYR B CA  
2551 C C   . TYR B 49  ? 0.7606 1.1355 0.8702 0.0075  -0.2205 0.1148  49  TYR B C   
2552 O O   . TYR B 49  ? 0.7427 1.0810 0.8457 -0.0068 -0.2258 0.0969  49  TYR B O   
2553 C CB  . TYR B 49  ? 0.7610 1.0808 0.7786 0.0281  -0.2144 0.0678  49  TYR B CB  
2554 C CG  . TYR B 49  ? 0.8050 1.1409 0.7837 0.0459  -0.2093 0.0646  49  TYR B CG  
2555 C CD1 . TYR B 49  ? 0.8419 1.2216 0.7875 0.0469  -0.2338 0.0548  49  TYR B CD1 
2556 C CD2 . TYR B 49  ? 0.7513 1.0687 0.7283 0.0608  -0.1817 0.0732  49  TYR B CD2 
2557 C CE1 . TYR B 49  ? 0.9239 1.3400 0.8353 0.0640  -0.2279 0.0589  49  TYR B CE1 
2558 C CE2 . TYR B 49  ? 0.7431 1.0885 0.6916 0.0736  -0.1781 0.0805  49  TYR B CE2 
2559 C CZ  . TYR B 49  ? 0.8827 1.2831 0.7981 0.0760  -0.1998 0.0757  49  TYR B CZ  
2560 O OH  . TYR B 49  ? 0.7756 1.2244 0.6629 0.0895  -0.1954 0.0885  49  TYR B OH  
2561 N N   . SER B 50  ? 0.8033 1.2332 0.9580 0.0063  -0.2239 0.1475  50  SER B N   
2562 C CA  . SER B 50  ? 0.8287 1.2877 1.0288 -0.0121 -0.2312 0.1659  50  SER B CA  
2563 C C   . SER B 50  ? 0.9152 1.3683 1.1081 -0.0476 -0.2725 0.1536  50  SER B C   
2564 O O   . SER B 50  ? 0.9443 1.4097 1.1735 -0.0704 -0.2820 0.1690  50  SER B O   
2565 C CB  . SER B 50  ? 0.8456 1.3732 1.0978 -0.0002 -0.2248 0.2052  50  SER B CB  
2566 O OG  . SER B 50  ? 0.8940 1.4598 1.1396 -0.0070 -0.2514 0.2159  50  SER B OG  
2567 N N   . ASN B 51  ? 0.9850 1.4233 1.1339 -0.0517 -0.2990 0.1260  51  ASN B N   
2568 C CA  . ASN B 51  ? 1.0856 1.4989 1.2197 -0.0806 -0.3437 0.0981  51  ASN B CA  
2569 C C   . ASN B 51  ? 1.0744 1.4108 1.1914 -0.0879 -0.3466 0.0684  51  ASN B C   
2570 O O   . ASN B 51  ? 1.1521 1.4547 1.2739 -0.1141 -0.3858 0.0493  51  ASN B O   
2571 C CB  . ASN B 51  ? 1.1798 1.6103 1.2654 -0.0737 -0.3695 0.0693  51  ASN B CB  
2572 C CG  . ASN B 51  ? 1.1944 1.6110 1.2282 -0.0404 -0.3427 0.0507  51  ASN B CG  
2573 O OD1 . ASN B 51  ? 0.9983 1.4201 1.0441 -0.0204 -0.3045 0.0762  51  ASN B OD1 
2574 N ND2 . ASN B 51  ? 1.2480 1.6516 1.2266 -0.0338 -0.3654 0.0053  51  ASN B ND2 
2575 N N   . VAL B 52  ? 0.9801 1.2880 1.0816 -0.0653 -0.3083 0.0656  52  VAL B N   
2576 C CA  . VAL B 52  ? 0.9522 1.1943 1.0382 -0.0678 -0.3060 0.0430  52  VAL B CA  
2577 C C   . VAL B 52  ? 0.8807 1.1321 1.0071 -0.0726 -0.2780 0.0751  52  VAL B C   
2578 O O   . VAL B 52  ? 0.7932 1.0872 0.9384 -0.0559 -0.2457 0.0988  52  VAL B O   
2579 C CB  . VAL B 52  ? 0.9189 1.1277 0.9479 -0.0384 -0.2878 0.0100  52  VAL B CB  
2580 C CG1 . VAL B 52  ? 0.9091 1.0573 0.9274 -0.0371 -0.2794 -0.0065 52  VAL B CG1 
2581 C CG2 . VAL B 52  ? 0.9678 1.1799 0.9530 -0.0316 -0.3176 -0.0256 52  VAL B CG2 
2582 N N   . ILE B 53  ? 0.9227 1.1385 1.0650 -0.0935 -0.2925 0.0760  53  ILE B N   
2583 C CA  . ILE B 53  ? 0.8982 1.1388 1.0769 -0.0992 -0.2675 0.1095  53  ILE B CA  
2584 C C   . ILE B 53  ? 0.8662 1.0673 1.0126 -0.0790 -0.2385 0.0919  53  ILE B C   
2585 O O   . ILE B 53  ? 0.8724 1.0126 0.9933 -0.0807 -0.2541 0.0663  53  ILE B O   
2586 C CB  . ILE B 53  ? 0.9976 1.2521 1.2318 -0.1406 -0.3007 0.1430  53  ILE B CB  
2587 C CG1 . ILE B 53  ? 1.0652 1.4110 1.3519 -0.1458 -0.2776 0.1941  53  ILE B CG1 
2588 C CG2 . ILE B 53  ? 0.9671 1.1595 1.2032 -0.1564 -0.3184 0.1371  53  ILE B CG2 
2589 C CD1 . ILE B 53  ? 1.0638 1.4551 1.4116 -0.1875 -0.3156 0.2352  53  ILE B CD1 
2590 N N   . PHE B 54  ? 0.7959 1.0333 0.9448 -0.0575 -0.1981 0.1028  54  PHE B N   
2591 C CA  . PHE B 54  ? 0.7680 0.9800 0.8888 -0.0390 -0.1697 0.0875  54  PHE B CA  
2592 C C   . PHE B 54  ? 0.7473 0.9913 0.8968 -0.0502 -0.1573 0.1140  54  PHE B C   
2593 O O   . PHE B 54  ? 0.7725 1.0839 0.9617 -0.0557 -0.1495 0.1444  54  PHE B O   
2594 C CB  . PHE B 54  ? 0.6962 0.9234 0.8019 -0.0082 -0.1383 0.0773  54  PHE B CB  
2595 C CG  . PHE B 54  ? 0.7677 0.9698 0.8420 0.0035  -0.1471 0.0580  54  PHE B CG  
2596 C CD1 . PHE B 54  ? 0.7898 1.0127 0.8734 -0.0044 -0.1710 0.0648  54  PHE B CD1 
2597 C CD2 . PHE B 54  ? 0.5864 0.7560 0.6232 0.0212  -0.1326 0.0370  54  PHE B CD2 
2598 C CE1 . PHE B 54  ? 0.8117 1.0288 0.8646 0.0072  -0.1789 0.0511  54  PHE B CE1 
2599 C CE2 . PHE B 54  ? 0.6857 0.8502 0.6958 0.0318  -0.1399 0.0270  54  PHE B CE2 
2600 C CZ  . PHE B 54  ? 0.7657 0.9570 0.7823 0.0258  -0.1624 0.0342  54  PHE B CZ  
2601 N N   . LEU B 55  ? 0.7417 0.9476 0.8722 -0.0518 -0.1554 0.1051  55  LEU B N   
2602 C CA  . LEU B 55  ? 0.7408 0.9824 0.8945 -0.0625 -0.1440 0.1337  55  LEU B CA  
2603 C C   . LEU B 55  ? 0.6976 0.9204 0.8141 -0.0420 -0.1174 0.1125  55  LEU B C   
2604 O O   . LEU B 55  ? 0.6619 0.8249 0.7403 -0.0299 -0.1205 0.0813  55  LEU B O   
2605 C CB  . LEU B 55  ? 0.8107 1.0251 0.9954 -0.0965 -0.1815 0.1583  55  LEU B CB  
2606 C CG  . LEU B 55  ? 0.8864 1.1045 1.1135 -0.1271 -0.2210 0.1797  55  LEU B CG  
2607 C CD1 . LEU B 55  ? 0.9454 1.1215 1.2094 -0.1612 -0.2618 0.2034  55  LEU B CD1 
2608 C CD2 . LEU B 55  ? 0.8233 1.1395 1.0917 -0.1333 -0.2070 0.2184  55  LEU B CD2 
2609 N N   . GLU B 56  ? 0.6851 0.9690 0.8129 -0.0378 -0.0924 0.1301  56  GLU B N   
2610 C CA  . GLU B 56  ? 0.6531 0.9320 0.7502 -0.0232 -0.0702 0.1142  56  GLU B CA  
2611 C C   . GLU B 56  ? 0.6903 1.0105 0.8094 -0.0418 -0.0718 0.1516  56  GLU B C   
2612 O O   . GLU B 56  ? 0.7116 1.1120 0.8670 -0.0530 -0.0677 0.1884  56  GLU B O   
2613 C CB  . GLU B 56  ? 0.6209 0.9387 0.7037 0.0056  -0.0375 0.0905  56  GLU B CB  
2614 C CG  . GLU B 56  ? 0.6497 0.9708 0.7027 0.0177  -0.0174 0.0725  56  GLU B CG  
2615 C CD  . GLU B 56  ? 0.6511 0.9590 0.6817 0.0448  0.0017  0.0329  56  GLU B CD  
2616 O OE1 . GLU B 56  ? 0.7280 1.0257 0.7691 0.0569  0.0014  0.0223  56  GLU B OE1 
2617 O OE2 . GLU B 56  ? 0.6501 0.9574 0.6568 0.0525  0.0141  0.0146  56  GLU B OE2 
2618 N N   . VAL B 57  ? 0.6917 0.9655 0.7916 -0.0441 -0.0781 0.1465  57  VAL B N   
2619 C CA  . VAL B 57  ? 0.7038 1.0159 0.8230 -0.0593 -0.0789 0.1846  57  VAL B CA  
2620 C C   . VAL B 57  ? 0.6799 1.0015 0.7596 -0.0398 -0.0534 0.1628  57  VAL B C   
2621 O O   . VAL B 57  ? 0.6270 0.8817 0.6733 -0.0275 -0.0551 0.1312  57  VAL B O   
2622 C CB  . VAL B 57  ? 0.7666 1.0124 0.9122 -0.0827 -0.1179 0.2066  57  VAL B CB  
2623 C CG1 . VAL B 57  ? 0.7888 1.0683 0.9570 -0.0965 -0.1196 0.2506  57  VAL B CG1 
2624 C CG2 . VAL B 57  ? 0.8408 1.0835 1.0332 -0.1087 -0.1491 0.2319  57  VAL B CG2 
2625 N N   . ASP B 58  ? 0.6920 1.1063 0.7754 -0.0366 -0.0304 0.1796  58  ASP B N   
2626 C CA  . ASP B 58  ? 0.6474 1.0829 0.6967 -0.0224 -0.0102 0.1618  58  ASP B CA  
2627 C C   . ASP B 58  ? 0.6796 1.1131 0.7434 -0.0403 -0.0246 0.2016  58  ASP B C   
2628 O O   . ASP B 58  ? 0.7080 1.2131 0.8088 -0.0595 -0.0295 0.2552  58  ASP B O   
2629 C CB  . ASP B 58  ? 0.6446 1.1860 0.6874 -0.0071 0.0184  0.1545  58  ASP B CB  
2630 C CG  . ASP B 58  ? 0.6579 1.2247 0.6638 0.0060  0.0356  0.1305  58  ASP B CG  
2631 O OD1 . ASP B 58  ? 0.7550 1.3302 0.7615 -0.0071 0.0292  0.1594  58  ASP B OD1 
2632 O OD2 . ASP B 58  ? 0.6996 1.2779 0.6793 0.0293  0.0531  0.0830  58  ASP B OD2 
2633 N N   . VAL B 59  ? 0.6120 0.9704 0.6504 -0.0329 -0.0316 0.1795  59  VAL B N   
2634 C CA  . VAL B 59  ? 0.6251 0.9623 0.6811 -0.0448 -0.0496 0.2135  59  VAL B CA  
2635 C C   . VAL B 59  ? 0.6251 1.0627 0.6935 -0.0540 -0.0374 0.2574  59  VAL B C   
2636 O O   . VAL B 59  ? 0.6677 1.1091 0.7735 -0.0717 -0.0568 0.3084  59  VAL B O   
2637 C CB  . VAL B 59  ? 0.6055 0.8624 0.6269 -0.0269 -0.0531 0.1774  59  VAL B CB  
2638 C CG1 . VAL B 59  ? 0.5514 0.7239 0.5610 -0.0173 -0.0673 0.1395  59  VAL B CG1 
2639 C CG2 . VAL B 59  ? 0.5019 0.7955 0.4803 -0.0105 -0.0252 0.1477  59  VAL B CG2 
2640 N N   . ASP B 60  ? 0.5936 1.1130 0.6328 -0.0409 -0.0079 0.2370  60  ASP B N   
2641 C CA  . ASP B 60  ? 0.6694 1.3012 0.7094 -0.0452 0.0062  0.2705  60  ASP B CA  
2642 C C   . ASP B 60  ? 0.7536 1.5016 0.8310 -0.0591 0.0108  0.3206  60  ASP B C   
2643 O O   . ASP B 60  ? 0.7873 1.6513 0.8672 -0.0624 0.0231  0.3539  60  ASP B O   
2644 C CB  . ASP B 60  ? 0.6150 1.2844 0.6026 -0.0224 0.0323  0.2170  60  ASP B CB  
2645 C CG  . ASP B 60  ? 0.6645 1.2504 0.6208 -0.0135 0.0284  0.1838  60  ASP B CG  
2646 O OD1 . ASP B 60  ? 0.7009 1.2538 0.6233 0.0029  0.0391  0.1279  60  ASP B OD1 
2647 O OD2 . ASP B 60  ? 0.5166 1.0715 0.4877 -0.0226 0.0131  0.2167  60  ASP B OD2 
2648 N N   . ASP B 61  ? 0.7962 1.5253 0.9023 -0.0666 0.0011  0.3274  61  ASP B N   
2649 C CA  . ASP B 61  ? 0.9046 1.7528 1.0498 -0.0793 0.0059  0.3774  61  ASP B CA  
2650 C C   . ASP B 61  ? 0.9794 1.7887 1.1894 -0.1149 -0.0302 0.4414  61  ASP B C   
2651 O O   . ASP B 61  ? 1.0739 1.9728 1.3326 -0.1403 -0.0393 0.5170  61  ASP B O   
2652 C CB  . ASP B 61  ? 0.8940 1.7730 1.0241 -0.0566 0.0258  0.3331  61  ASP B CB  
2653 C CG  . ASP B 61  ? 0.9224 1.8618 1.0004 -0.0219 0.0580  0.2752  61  ASP B CG  
2654 O OD1 . ASP B 61  ? 1.0027 1.9817 1.0560 -0.0193 0.0660  0.2755  61  ASP B OD1 
2655 O OD2 . ASP B 61  ? 0.9390 1.8843 1.0037 0.0032  0.0725  0.2285  61  ASP B OD2 
2656 N N   . CYS B 62  ? 0.9431 1.6205 1.1549 -0.1173 -0.0533 0.4112  62  CYS B N   
2657 C CA  . CYS B 62  ? 1.0227 1.6337 1.2923 -0.1489 -0.0953 0.4554  62  CYS B CA  
2658 C C   . CYS B 62  ? 1.0376 1.5444 1.3060 -0.1493 -0.1185 0.4510  62  CYS B C   
2659 O O   . CYS B 62  ? 1.0493 1.4398 1.3263 -0.1518 -0.1484 0.4274  62  CYS B O   
2660 C CB  . CYS B 62  ? 1.0347 1.5739 1.3071 -0.1490 -0.1100 0.4208  62  CYS B CB  
2661 S SG  . CYS B 62  ? 1.0635 1.7110 1.3343 -0.1382 -0.0815 0.4139  62  CYS B SG  
2662 N N   . GLN B 63  ? 1.0618 1.6172 1.3196 -0.1445 -0.1055 0.4722  63  GLN B N   
2663 C CA  . GLN B 63  ? 1.1093 1.5827 1.3755 -0.1433 -0.1274 0.4795  63  GLN B CA  
2664 C C   . GLN B 63  ? 1.2085 1.5964 1.5449 -0.1701 -0.1779 0.5196  63  GLN B C   
2665 O O   . GLN B 63  ? 1.2480 1.5268 1.5886 -0.1604 -0.2029 0.4995  63  GLN B O   
2666 C CB  . GLN B 63  ? 1.1282 1.6965 1.3947 -0.1444 -0.1120 0.5240  63  GLN B CB  
2667 C CG  . GLN B 63  ? 1.1006 1.7389 1.2958 -0.1168 -0.0690 0.4748  63  GLN B CG  
2668 C CD  . GLN B 63  ? 1.1470 1.7699 1.3155 -0.1027 -0.0642 0.4667  63  GLN B CD  
2669 O OE1 . GLN B 63  ? 1.1781 1.8285 1.3856 -0.1166 -0.0795 0.5284  63  GLN B OE1 
2670 N NE2 . GLN B 63  ? 1.0088 1.5918 1.1157 -0.0763 -0.0445 0.3954  63  GLN B NE2 
2671 N N   . ASP B 64  ? 1.2566 1.6972 1.6500 -0.2024 -0.1944 0.5739  64  ASP B N   
2672 C CA  . ASP B 64  ? 1.3631 1.7304 1.8343 -0.2358 -0.2481 0.6174  64  ASP B CA  
2673 C C   . ASP B 64  ? 1.3327 1.5590 1.7855 -0.2238 -0.2739 0.5452  64  ASP B C   
2674 O O   . ASP B 64  ? 1.3993 1.5103 1.8725 -0.2204 -0.3110 0.5300  64  ASP B O   
2675 C CB  . ASP B 64  ? 1.4441 1.9195 1.9792 -0.2753 -0.2569 0.6933  64  ASP B CB  
2676 C CG  . ASP B 64  ? 1.4188 2.0675 1.9248 -0.2664 -0.2063 0.7151  64  ASP B CG  
2677 O OD1 . ASP B 64  ? 1.4510 2.1689 1.9365 -0.2550 -0.1834 0.7332  64  ASP B OD1 
2678 O OD2 . ASP B 64  ? 1.3814 2.1013 1.8854 -0.2687 -0.1908 0.7119  64  ASP B OD2 
2679 N N   . VAL B 65  ? 1.2348 1.4768 1.6510 -0.2150 -0.2555 0.5013  65  VAL B N   
2680 C CA  . VAL B 65  ? 1.2373 1.3676 1.6332 -0.2045 -0.2786 0.4362  65  VAL B CA  
2681 C C   . VAL B 65  ? 1.1818 1.2275 1.5120 -0.1628 -0.2674 0.3627  65  VAL B C   
2682 O O   . VAL B 65  ? 1.2292 1.1673 1.5598 -0.1537 -0.3010 0.3232  65  VAL B O   
2683 C CB  . VAL B 65  ? 1.1796 1.3563 1.5630 -0.2086 -0.2655 0.4186  65  VAL B CB  
2684 C CG1 . VAL B 65  ? 1.0316 1.3057 1.3620 -0.1833 -0.2096 0.4003  65  VAL B CG1 
2685 C CG2 . VAL B 65  ? 1.1635 1.2364 1.5196 -0.1958 -0.2880 0.3514  65  VAL B CG2 
2686 N N   . ALA B 66  ? 1.0932 1.1953 1.3701 -0.1379 -0.2223 0.3457  66  ALA B N   
2687 C CA  . ALA B 66  ? 1.0247 1.0733 1.2479 -0.1026 -0.2087 0.2945  66  ALA B CA  
2688 C C   . ALA B 66  ? 1.1171 1.0809 1.3736 -0.0999 -0.2458 0.3036  66  ALA B C   
2689 O O   . ALA B 66  ? 1.1423 1.0155 1.3789 -0.0772 -0.2646 0.2510  66  ALA B O   
2690 C CB  . ALA B 66  ? 0.9431 1.0791 1.1290 -0.0896 -0.1649 0.2999  66  ALA B CB  
2691 N N   . SER B 67  ? 1.1829 1.1823 1.4929 -0.1208 -0.2575 0.3716  67  SER B N   
2692 C CA  . SER B 67  ? 1.3117 1.2334 1.6674 -0.1184 -0.2954 0.3909  67  SER B CA  
2693 C C   . SER B 67  ? 1.4361 1.2379 1.8302 -0.1233 -0.3496 0.3645  67  SER B C   
2694 O O   . SER B 67  ? 1.5082 1.2154 1.8995 -0.0952 -0.3731 0.3242  67  SER B O   
2695 C CB  . SER B 67  ? 1.3749 1.3696 1.7965 -0.1495 -0.3034 0.4851  67  SER B CB  
2696 O OG  . SER B 67  ? 1.6163 1.5289 2.1197 -0.1676 -0.3592 0.5247  67  SER B OG  
2697 N N   . GLU B 68  ? 1.4578 1.2701 1.8876 -0.1572 -0.3698 0.3847  68  GLU B N   
2698 C CA  . GLU B 68  ? 1.5771 1.2864 2.0541 -0.1724 -0.4280 0.3676  68  GLU B CA  
2699 C C   . GLU B 68  ? 1.5515 1.1905 1.9637 -0.1384 -0.4297 0.2713  68  GLU B C   
2700 O O   . GLU B 68  ? 1.6754 1.2104 2.1087 -0.1323 -0.4783 0.2318  68  GLU B O   
2701 C CB  . GLU B 68  ? 1.6130 1.3772 2.1501 -0.2234 -0.4467 0.4278  68  GLU B CB  
2702 C CG  . GLU B 68  ? 1.8155 1.4860 2.4412 -0.2576 -0.5197 0.4518  68  GLU B CG  
2703 C CD  . GLU B 68  ? 1.8414 1.5609 2.5121 -0.3043 -0.5385 0.4907  68  GLU B CD  
2704 O OE1 . GLU B 68  ? 1.7522 1.5212 2.3672 -0.2949 -0.5070 0.4530  68  GLU B OE1 
2705 O OE2 . GLU B 68  ? 1.8918 1.6027 2.6588 -0.3510 -0.5865 0.5632  68  GLU B OE2 
2706 N N   . CYS B 69  ? 1.3850 1.0857 1.7221 -0.1170 -0.3793 0.2352  69  CYS B N   
2707 C CA  . CYS B 69  ? 1.3311 0.9908 1.6009 -0.0824 -0.3722 0.1528  69  CYS B CA  
2708 C C   . CYS B 69  ? 1.2807 0.9115 1.5018 -0.0359 -0.3543 0.1097  69  CYS B C   
2709 O O   . CYS B 69  ? 1.2417 0.8434 1.4090 -0.0023 -0.3502 0.0443  69  CYS B O   
2710 C CB  . CYS B 69  ? 1.2038 0.9443 1.4276 -0.0836 -0.3302 0.1436  69  CYS B CB  
2711 S SG  . CYS B 69  ? 1.2855 1.0747 1.5627 -0.1314 -0.3475 0.1898  69  CYS B SG  
2712 N N   . GLU B 70  ? 1.2600 0.9102 1.5033 -0.0348 -0.3445 0.1520  70  GLU B N   
2713 C CA  . GLU B 70  ? 1.2365 0.8749 1.4432 0.0062  -0.3262 0.1254  70  GLU B CA  
2714 C C   . GLU B 70  ? 1.0868 0.7766 1.2136 0.0325  -0.2791 0.0819  70  GLU B C   
2715 O O   . GLU B 70  ? 1.0997 0.7590 1.1843 0.0704  -0.2767 0.0278  70  GLU B O   
2716 C CB  . GLU B 70  ? 1.3910 0.9233 1.6153 0.0357  -0.3704 0.0822  70  GLU B CB  
2717 C CG  . GLU B 70  ? 1.5669 1.0365 1.8819 0.0106  -0.4223 0.1296  70  GLU B CG  
2718 C CD  . GLU B 70  ? 1.7810 1.1316 2.1167 0.0377  -0.4759 0.0716  70  GLU B CD  
2719 O OE1 . GLU B 70  ? 1.7665 1.0976 2.0403 0.0856  -0.4654 -0.0030 70  GLU B OE1 
2720 O OE2 . GLU B 70  ? 1.9827 1.2631 2.3986 0.0119  -0.5301 0.1004  70  GLU B OE2 
2721 N N   . VAL B 71  ? 0.9515 0.7225 1.0632 0.0120  -0.2445 0.1076  71  VAL B N   
2722 C CA  . VAL B 71  ? 0.8438 0.6696 0.8945 0.0291  -0.2007 0.0818  71  VAL B CA  
2723 C C   . VAL B 71  ? 0.8431 0.7051 0.8808 0.0428  -0.1772 0.0986  71  VAL B C   
2724 O O   . VAL B 71  ? 0.8839 0.7776 0.9571 0.0255  -0.1785 0.1485  71  VAL B O   
2725 C CB  . VAL B 71  ? 0.7322 0.6246 0.7810 0.0047  -0.1783 0.1003  71  VAL B CB  
2726 C CG1 . VAL B 71  ? 0.6202 0.5636 0.6183 0.0198  -0.1376 0.0791  71  VAL B CG1 
2727 C CG2 . VAL B 71  ? 0.8144 0.6771 0.8690 -0.0039 -0.1988 0.0794  71  VAL B CG2 
2728 N N   . LYS B 72  ? 0.8000 0.6650 0.7896 0.0727  -0.1579 0.0612  72  LYS B N   
2729 C CA  . LYS B 72  ? 0.7792 0.6735 0.7579 0.0880  -0.1411 0.0732  72  LYS B CA  
2730 C C   . LYS B 72  ? 0.6725 0.6258 0.6040 0.0920  -0.1044 0.0579  72  LYS B C   
2731 O O   . LYS B 72  ? 0.6727 0.6667 0.5929 0.0975  -0.0874 0.0701  72  LYS B O   
2732 C CB  . LYS B 72  ? 0.8335 0.6712 0.8119 0.1240  -0.1610 0.0468  72  LYS B CB  
2733 C CG  . LYS B 72  ? 1.0597 0.8341 1.0982 0.1198  -0.2017 0.0694  72  LYS B CG  
2734 C CD  . LYS B 72  ? 1.2575 0.9602 1.2967 0.1626  -0.2284 0.0257  72  LYS B CD  
2735 C CE  . LYS B 72  ? 1.3479 0.9803 1.3911 0.1663  -0.2628 -0.0193 72  LYS B CE  
2736 N NZ  . LYS B 72  ? 1.4553 1.0053 1.5241 0.2029  -0.3023 -0.0525 72  LYS B NZ  
2737 N N   . CYS B 73  ? 0.5846 0.5419 0.4943 0.0874  -0.0958 0.0336  73  CYS B N   
2738 C CA  . CYS B 73  ? 0.4920 0.4936 0.3671 0.0886  -0.0674 0.0199  73  CYS B CA  
2739 C C   . CYS B 73  ? 0.4711 0.4803 0.3448 0.0745  -0.0621 0.0110  73  CYS B C   
2740 O O   . CYS B 73  ? 0.5509 0.5338 0.4447 0.0657  -0.0800 0.0125  73  CYS B O   
2741 C CB  . CYS B 73  ? 0.4340 0.4299 0.2768 0.1166  -0.0624 -0.0073 73  CYS B CB  
2742 S SG  . CYS B 73  ? 0.5542 0.5069 0.3810 0.1380  -0.0809 -0.0451 73  CYS B SG  
2743 N N   . MET B 74  ? 0.3859 0.4296 0.2400 0.0725  -0.0405 0.0020  74  MET B N   
2744 C CA  . MET B 74  ? 0.4101 0.4666 0.2688 0.0620  -0.0336 -0.0038 74  MET B CA  
2745 C C   . MET B 74  ? 0.3772 0.4374 0.2133 0.0710  -0.0222 -0.0236 74  MET B C   
2746 O O   . MET B 74  ? 0.3504 0.4263 0.1713 0.0760  -0.0129 -0.0254 74  MET B O   
2747 C CB  . MET B 74  ? 0.4188 0.5259 0.2906 0.0476  -0.0193 0.0115  74  MET B CB  
2748 C CG  . MET B 74  ? 0.4746 0.6018 0.3765 0.0333  -0.0285 0.0447  74  MET B CG  
2749 S SD  . MET B 74  ? 0.5226 0.6486 0.4338 0.0338  -0.0381 0.0723  74  MET B SD  
2750 C CE  . MET B 74  ? 0.4985 0.6958 0.3867 0.0333  -0.0125 0.0718  74  MET B CE  
2751 N N   . PRO B 75  ? 0.3559 0.4066 0.1946 0.0712  -0.0247 -0.0328 75  PRO B N   
2752 C CA  . PRO B 75  ? 0.4015 0.4365 0.2581 0.0653  -0.0391 -0.0301 75  PRO B CA  
2753 C C   . PRO B 75  ? 0.4468 0.4461 0.2965 0.0747  -0.0608 -0.0384 75  PRO B C   
2754 O O   . PRO B 75  ? 0.4611 0.4553 0.2860 0.0921  -0.0614 -0.0535 75  PRO B O   
2755 C CB  . PRO B 75  ? 0.3800 0.4205 0.2373 0.0675  -0.0349 -0.0379 75  PRO B CB  
2756 C CG  . PRO B 75  ? 0.3884 0.4367 0.2285 0.0753  -0.0241 -0.0436 75  PRO B CG  
2757 C CD  . PRO B 75  ? 0.2981 0.3563 0.1271 0.0755  -0.0162 -0.0414 75  PRO B CD  
2758 N N   . THR B 76  ? 0.4618 0.4406 0.3359 0.0640  -0.0803 -0.0287 76  THR B N   
2759 C CA  . THR B 76  ? 0.5405 0.4760 0.4139 0.0719  -0.1087 -0.0457 76  THR B CA  
2760 C C   . THR B 76  ? 0.5598 0.4921 0.4516 0.0572  -0.1245 -0.0447 76  THR B C   
2761 O O   . THR B 76  ? 0.5551 0.5103 0.4767 0.0368  -0.1212 -0.0196 76  THR B O   
2762 C CB  . THR B 76  ? 0.6196 0.5201 0.5159 0.0700  -0.1296 -0.0359 76  THR B CB  
2763 O OG1 . THR B 76  ? 0.6378 0.5394 0.5148 0.0903  -0.1192 -0.0416 76  THR B OG1 
2764 C CG2 . THR B 76  ? 0.7561 0.6027 0.6628 0.0739  -0.1671 -0.0577 76  THR B CG2 
2765 N N   . PHE B 77  ? 0.6080 0.5230 0.4812 0.0693  -0.1414 -0.0715 77  PHE B N   
2766 C CA  . PHE B 77  ? 0.6275 0.5415 0.5156 0.0562  -0.1612 -0.0733 77  PHE B CA  
2767 C C   . PHE B 77  ? 0.7343 0.5978 0.6306 0.0559  -0.2023 -0.0958 77  PHE B C   
2768 O O   . PHE B 77  ? 0.7909 0.6312 0.6581 0.0812  -0.2142 -0.1310 77  PHE B O   
2769 C CB  . PHE B 77  ? 0.6073 0.5534 0.4689 0.0685  -0.1501 -0.0847 77  PHE B CB  
2770 C CG  . PHE B 77  ? 0.4831 0.4662 0.3455 0.0681  -0.1175 -0.0655 77  PHE B CG  
2771 C CD1 . PHE B 77  ? 0.5079 0.5147 0.3998 0.0534  -0.1088 -0.0447 77  PHE B CD1 
2772 C CD2 . PHE B 77  ? 0.3994 0.3952 0.2367 0.0836  -0.0979 -0.0697 77  PHE B CD2 
2773 C CE1 . PHE B 77  ? 0.4656 0.4984 0.3617 0.0572  -0.0827 -0.0352 77  PHE B CE1 
2774 C CE2 . PHE B 77  ? 0.3392 0.3598 0.1835 0.0809  -0.0741 -0.0552 77  PHE B CE2 
2775 C CZ  . PHE B 77  ? 0.4888 0.5227 0.3620 0.0693  -0.0676 -0.0417 77  PHE B CZ  
2776 N N   . GLN B 78  ? 0.8055 0.6548 0.7449 0.0280  -0.2262 -0.0760 78  GLN B N   
2777 C CA  . GLN B 78  ? 0.9066 0.6991 0.8649 0.0214  -0.2736 -0.0970 78  GLN B CA  
2778 C C   . GLN B 78  ? 0.9180 0.7232 0.8858 0.0047  -0.2966 -0.1029 78  GLN B C   
2779 O O   . GLN B 78  ? 0.8456 0.6955 0.8379 -0.0168 -0.2839 -0.0680 78  GLN B O   
2780 C CB  . GLN B 78  ? 0.9583 0.7200 0.9719 -0.0040 -0.2930 -0.0615 78  GLN B CB  
2781 C CG  . GLN B 78  ? 0.9471 0.7091 0.9591 0.0074  -0.2704 -0.0443 78  GLN B CG  
2782 C CD  . GLN B 78  ? 1.1725 0.8778 1.2338 -0.0052 -0.3061 -0.0265 78  GLN B CD  
2783 O OE1 . GLN B 78  ? 1.3389 1.0221 1.4517 -0.0365 -0.3415 -0.0038 78  GLN B OE1 
2784 N NE2 . GLN B 78  ? 1.1869 0.8692 1.2389 0.0180  -0.2999 -0.0326 78  GLN B NE2 
2785 N N   . PHE B 79  ? 1.0271 0.7989 0.9752 0.0172  -0.3310 -0.1492 79  PHE B N   
2786 C CA  . PHE B 79  ? 1.0945 0.8870 1.0449 0.0031  -0.3541 -0.1586 79  PHE B CA  
2787 C C   . PHE B 79  ? 1.2629 0.9943 1.2514 -0.0193 -0.4126 -0.1752 79  PHE B C   
2788 O O   . PHE B 79  ? 1.3528 1.0199 1.3340 -0.0016 -0.4424 -0.2175 79  PHE B O   
2789 C CB  . PHE B 79  ? 1.1119 0.9379 1.0017 0.0361  -0.3467 -0.2004 79  PHE B CB  
2790 C CG  . PHE B 79  ? 0.9830 0.8687 0.8442 0.0530  -0.2960 -0.1789 79  PHE B CG  
2791 C CD1 . PHE B 79  ? 0.9739 0.8550 0.8183 0.0725  -0.2665 -0.1758 79  PHE B CD1 
2792 C CD2 . PHE B 79  ? 0.8756 0.8212 0.7310 0.0492  -0.2818 -0.1610 79  PHE B CD2 
2793 C CE1 . PHE B 79  ? 0.8765 0.8075 0.7009 0.0839  -0.2260 -0.1561 79  PHE B CE1 
2794 C CE2 . PHE B 79  ? 0.8550 0.8462 0.6942 0.0627  -0.2414 -0.1393 79  PHE B CE2 
2795 C CZ  . PHE B 79  ? 0.7612 0.7431 0.5851 0.0786  -0.2148 -0.1379 79  PHE B CZ  
2796 N N   . PHE B 80  ? 1.3073 1.0592 1.3403 -0.0573 -0.4313 -0.1423 80  PHE B N   
2797 C CA  . PHE B 80  ? 1.4635 1.1616 1.5455 -0.0891 -0.4922 -0.1485 80  PHE B CA  
2798 C C   . PHE B 80  ? 1.5394 1.2724 1.6196 -0.1055 -0.5187 -0.1612 80  PHE B C   
2799 O O   . PHE B 80  ? 1.4329 1.2425 1.5107 -0.1119 -0.4886 -0.1283 80  PHE B O   
2800 C CB  . PHE B 80  ? 1.4485 1.1446 1.6069 -0.1317 -0.4995 -0.0803 80  PHE B CB  
2801 C CG  . PHE B 80  ? 1.4226 1.1123 1.5871 -0.1211 -0.4669 -0.0514 80  PHE B CG  
2802 C CD1 . PHE B 80  ? 1.2359 0.9957 1.3757 -0.1072 -0.4071 -0.0234 80  PHE B CD1 
2803 C CD2 . PHE B 80  ? 1.5017 1.1159 1.7019 -0.1260 -0.4994 -0.0510 80  PHE B CD2 
2804 C CE1 . PHE B 80  ? 1.2259 0.9881 1.3699 -0.0993 -0.3794 0.0019  80  PHE B CE1 
2805 C CE2 . PHE B 80  ? 1.5234 1.1411 1.7309 -0.1171 -0.4702 -0.0192 80  PHE B CE2 
2806 C CZ  . PHE B 80  ? 1.2995 0.9953 1.4760 -0.1045 -0.4097 0.0064  80  PHE B CZ  
2807 N N   . LYS B 81  ? 1.7082 1.3882 1.7940 -0.1129 -0.5775 -0.2081 81  LYS B N   
2808 C CA  . LYS B 81  ? 1.7853 1.5058 1.8781 -0.1363 -0.6069 -0.2123 81  LYS B CA  
2809 C C   . LYS B 81  ? 1.8665 1.5834 2.0440 -0.1950 -0.6460 -0.1597 81  LYS B C   
2810 O O   . LYS B 81  ? 1.7682 1.5630 1.9723 -0.2173 -0.6232 -0.1036 81  LYS B O   
2811 C CB  . LYS B 81  ? 1.9055 1.6057 1.9442 -0.1097 -0.6448 -0.2956 81  LYS B CB  
2812 C CG  . LYS B 81  ? 1.8673 1.6612 1.8651 -0.1021 -0.6294 -0.2986 81  LYS B CG  
2813 C CD  . LYS B 81  ? 1.8474 1.6805 1.7633 -0.0487 -0.5987 -0.3438 81  LYS B CD  
2814 C CE  . LYS B 81  ? 2.0579 1.8391 1.9343 -0.0194 -0.6438 -0.4316 81  LYS B CE  
2815 N NZ  . LYS B 81  ? 2.0396 1.8796 1.8354 0.0349  -0.6139 -0.4733 81  LYS B NZ  
2816 N N   . LYS B 82  ? 2.0531 1.6846 2.2789 -0.2200 -0.7061 -0.1741 82  LYS B N   
2817 C CA  . LYS B 82  ? 2.1409 1.7783 2.4544 -0.2807 -0.7455 -0.1147 82  LYS B CA  
2818 C C   . LYS B 82  ? 2.0997 1.7328 2.4712 -0.3002 -0.7248 -0.0431 82  LYS B C   
2819 O O   . LYS B 82  ? 2.1024 1.7806 2.5459 -0.3461 -0.7320 0.0318  82  LYS B O   
2820 C CB  . LYS B 82  ? 2.3593 1.9067 2.7077 -0.3061 -0.8317 -0.1622 82  LYS B CB  
2821 C CG  . LYS B 82  ? 2.4299 1.9514 2.7017 -0.2661 -0.8559 -0.2638 82  LYS B CG  
2822 C CD  . LYS B 82  ? 2.5023 2.0879 2.7682 -0.2895 -0.8831 -0.2729 82  LYS B CD  
2823 C CE  . LYS B 82  ? 2.6895 2.2012 2.9466 -0.2911 -0.9636 -0.3615 82  LYS B CE  
2824 N NZ  . LYS B 82  ? 2.7976 2.2898 3.1386 -0.3581 -1.0344 -0.3341 82  LYS B NZ  
2825 N N   . GLY B 83  ? 2.0603 1.6497 2.3976 -0.2626 -0.6982 -0.0659 83  GLY B N   
2826 C CA  . GLY B 83  ? 2.0580 1.6232 2.4447 -0.2745 -0.6888 -0.0125 83  GLY B CA  
2827 C C   . GLY B 83  ? 2.1213 1.5932 2.4812 -0.2358 -0.6974 -0.0646 83  GLY B C   
2828 O O   . GLY B 83  ? 2.1062 1.5651 2.4924 -0.2345 -0.6801 -0.0252 83  GLY B O   
2829 N N   . GLN B 84  ? 2.2040 1.6206 2.5118 -0.2018 -0.7244 -0.1530 84  GLN B N   
2830 C CA  . GLN B 84  ? 2.2493 1.5926 2.5186 -0.1519 -0.7268 -0.2146 84  GLN B CA  
2831 C C   . GLN B 84  ? 2.0766 1.4874 2.2566 -0.1002 -0.6569 -0.2381 84  GLN B C   
2832 O O   . GLN B 84  ? 2.0233 1.4939 2.1472 -0.0846 -0.6387 -0.2674 84  GLN B O   
2833 C CB  . GLN B 84  ? 2.4635 1.7212 2.7216 -0.1360 -0.7942 -0.3047 84  GLN B CB  
2834 C CG  . GLN B 84  ? 2.6588 1.8784 2.9865 -0.1917 -0.8663 -0.2964 84  GLN B CG  
2835 C CD  . GLN B 84  ? 2.8510 1.9738 3.2817 -0.2306 -0.9229 -0.2563 84  GLN B CD  
2836 O OE1 . GLN B 84  ? 2.8010 1.9141 3.2630 -0.2292 -0.8976 -0.2035 84  GLN B OE1 
2837 N NE2 . GLN B 84  ? 3.0299 2.0828 3.5179 -0.2679 -1.0033 -0.2782 84  GLN B NE2 
2838 N N   . LYS B 85  ? 1.9799 1.3850 2.1515 -0.0763 -0.6205 -0.2204 85  LYS B N   
2839 C CA  . LYS B 85  ? 1.8206 1.2841 1.9165 -0.0307 -0.5593 -0.2388 85  LYS B CA  
2840 C C   . LYS B 85  ? 1.8910 1.3444 1.9184 0.0169  -0.5713 -0.3256 85  LYS B C   
2841 O O   . LYS B 85  ? 2.0411 1.4175 2.0710 0.0404  -0.6142 -0.3823 85  LYS B O   
2842 C CB  . LYS B 85  ? 1.7587 1.2103 1.8633 -0.0149 -0.5288 -0.2092 85  LYS B CB  
2843 C CG  . LYS B 85  ? 1.5760 1.0778 1.6079 0.0322  -0.4739 -0.2320 85  LYS B CG  
2844 C CD  . LYS B 85  ? 1.4399 0.9873 1.4816 0.0249  -0.4245 -0.1713 85  LYS B CD  
2845 C CE  . LYS B 85  ? 1.4369 0.9316 1.5367 0.0130  -0.4439 -0.1364 85  LYS B CE  
2846 N NZ  . LYS B 85  ? 1.5412 0.9832 1.6219 0.0579  -0.4520 -0.1792 85  LYS B NZ  
2847 N N   . VAL B 86  ? 1.7786 1.3150 1.7480 0.0325  -0.5349 -0.3345 86  VAL B N   
2848 C CA  . VAL B 86  ? 1.8614 1.4184 1.7627 0.0763  -0.5425 -0.4080 86  VAL B CA  
2849 C C   . VAL B 86  ? 1.7419 1.3643 1.5825 0.1193  -0.4851 -0.4103 86  VAL B C   
2850 O O   . VAL B 86  ? 1.8260 1.4673 1.6120 0.1653  -0.4866 -0.4682 86  VAL B O   
2851 C CB  . VAL B 86  ? 1.9003 1.5035 1.7883 0.0573  -0.5654 -0.4227 86  VAL B CB  
2852 C CG1 . VAL B 86  ? 1.6969 1.3940 1.5782 0.0391  -0.5163 -0.3620 86  VAL B CG1 
2853 C CG2 . VAL B 86  ? 2.0245 1.6450 1.8470 0.1021  -0.5874 -0.5068 86  VAL B CG2 
2854 N N   . GLY B 87  ? 1.5620 1.2234 1.4146 0.1044  -0.4368 -0.3475 87  GLY B N   
2855 C CA  . GLY B 87  ? 1.4345 1.1543 1.2412 0.1362  -0.3861 -0.3408 87  GLY B CA  
2856 C C   . GLY B 87  ? 1.3224 1.0331 1.1578 0.1248  -0.3536 -0.2901 87  GLY B C   
2857 O O   . GLY B 87  ? 1.3007 0.9742 1.1908 0.0910  -0.3658 -0.2529 87  GLY B O   
2858 N N   . GLU B 88  ? 1.2403 0.9945 1.0398 0.1520  -0.3137 -0.2860 88  GLU B N   
2859 C CA  . GLU B 88  ? 1.1177 0.8783 0.9356 0.1432  -0.2801 -0.2415 88  GLU B CA  
2860 C C   . GLU B 88  ? 1.0312 0.8433 0.8056 0.1752  -0.2440 -0.2461 88  GLU B C   
2861 O O   . GLU B 88  ? 1.0755 0.8944 0.8152 0.2137  -0.2510 -0.2879 88  GLU B O   
2862 C CB  . GLU B 88  ? 1.1830 0.8739 1.0417 0.1391  -0.3040 -0.2371 88  GLU B CB  
2863 C CG  . GLU B 88  ? 1.1382 0.8427 1.0306 0.1131  -0.2781 -0.1789 88  GLU B CG  
2864 C CD  . GLU B 88  ? 1.3420 0.9955 1.2667 0.1191  -0.2935 -0.1698 88  GLU B CD  
2865 O OE1 . GLU B 88  ? 1.4312 1.0181 1.3706 0.1340  -0.3350 -0.2050 88  GLU B OE1 
2866 O OE2 . GLU B 88  ? 1.2944 0.9750 1.2315 0.1101  -0.2664 -0.1285 88  GLU B OE2 
2867 N N   . PHE B 89  ? 0.8966 0.7496 0.6753 0.1596  -0.2072 -0.2038 89  PHE B N   
2868 C CA  . PHE B 89  ? 0.8119 0.7091 0.5638 0.1799  -0.1745 -0.1959 89  PHE B CA  
2869 C C   . PHE B 89  ? 0.6979 0.6087 0.4721 0.1561  -0.1462 -0.1524 89  PHE B C   
2870 O O   . PHE B 89  ? 0.6650 0.5745 0.4665 0.1272  -0.1435 -0.1279 89  PHE B O   
2871 C CB  . PHE B 89  ? 0.8121 0.7746 0.5259 0.1965  -0.1619 -0.2044 89  PHE B CB  
2872 C CG  . PHE B 89  ? 0.7381 0.7362 0.4638 0.1707  -0.1430 -0.1688 89  PHE B CG  
2873 C CD1 . PHE B 89  ? 0.5939 0.6298 0.3194 0.1667  -0.1129 -0.1391 89  PHE B CD1 
2874 C CD2 . PHE B 89  ? 0.7323 0.7258 0.4735 0.1515  -0.1586 -0.1659 89  PHE B CD2 
2875 C CE1 . PHE B 89  ? 0.4565 0.5151 0.1998 0.1464  -0.0997 -0.1101 89  PHE B CE1 
2876 C CE2 . PHE B 89  ? 0.5929 0.6182 0.3503 0.1331  -0.1422 -0.1337 89  PHE B CE2 
2877 C CZ  . PHE B 89  ? 0.5945 0.6485 0.3539 0.1321  -0.1134 -0.1076 89  PHE B CZ  
2878 N N   . SER B 90  ? 0.6390 0.5715 0.4004 0.1705  -0.1255 -0.1451 90  SER B N   
2879 C CA  . SER B 90  ? 0.5395 0.4950 0.3139 0.1515  -0.0990 -0.1114 90  SER B CA  
2880 C C   . SER B 90  ? 0.4574 0.4656 0.2117 0.1552  -0.0752 -0.1018 90  SER B C   
2881 O O   . SER B 90  ? 0.4888 0.5269 0.2173 0.1780  -0.0740 -0.1139 90  SER B O   
2882 C CB  . SER B 90  ? 0.5538 0.4951 0.3377 0.1584  -0.0977 -0.1036 90  SER B CB  
2883 O OG  . SER B 90  ? 0.6472 0.5390 0.4627 0.1487  -0.1222 -0.1004 90  SER B OG  
2884 N N   . GLY B 91  ? 0.4234 0.4465 0.1931 0.1331  -0.0586 -0.0795 91  GLY B N   
2885 C CA  . GLY B 91  ? 0.4234 0.4860 0.1865 0.1311  -0.0416 -0.0662 91  GLY B CA  
2886 C C   . GLY B 91  ? 0.4168 0.4854 0.1969 0.1156  -0.0386 -0.0553 91  GLY B C   
2887 O O   . GLY B 91  ? 0.4480 0.5099 0.2315 0.1154  -0.0500 -0.0603 91  GLY B O   
2888 N N   . ALA B 92  ? 0.4151 0.4967 0.2090 0.1036  -0.0259 -0.0411 92  ALA B N   
2889 C CA  . ALA B 92  ? 0.3763 0.4574 0.1942 0.0927  -0.0248 -0.0317 92  ALA B CA  
2890 C C   . ALA B 92  ? 0.4115 0.5217 0.2262 0.0987  -0.0294 -0.0164 92  ALA B C   
2891 O O   . ALA B 92  ? 0.4536 0.5793 0.2853 0.0911  -0.0260 0.0035  92  ALA B O   
2892 C CB  . ALA B 92  ? 0.3646 0.4424 0.2016 0.0804  -0.0148 -0.0288 92  ALA B CB  
2893 N N   . ASN B 93  ? 0.4343 0.5556 0.2296 0.1113  -0.0401 -0.0245 93  ASN B N   
2894 C CA  . ASN B 93  ? 0.4757 0.6438 0.2614 0.1202  -0.0452 -0.0094 93  ASN B CA  
2895 C C   . ASN B 93  ? 0.4769 0.6437 0.2769 0.1160  -0.0560 -0.0056 93  ASN B C   
2896 O O   . ASN B 93  ? 0.5045 0.6586 0.2907 0.1214  -0.0684 -0.0276 93  ASN B O   
2897 C CB  . ASN B 93  ? 0.5171 0.7120 0.2627 0.1444  -0.0504 -0.0299 93  ASN B CB  
2898 C CG  . ASN B 93  ? 0.6313 0.9003 0.3596 0.1583  -0.0523 -0.0133 93  ASN B CG  
2899 O OD1 . ASN B 93  ? 0.5086 0.8061 0.2548 0.1486  -0.0550 0.0146  93  ASN B OD1 
2900 N ND2 . ASN B 93  ? 0.7349 1.0436 0.4293 0.1841  -0.0513 -0.0291 93  ASN B ND2 
2901 N N   . LYS B 94  ? 0.4998 0.6769 0.3326 0.1054  -0.0541 0.0232  94  LYS B N   
2902 C CA  . LYS B 94  ? 0.5077 0.6848 0.3633 0.1014  -0.0631 0.0323  94  LYS B CA  
2903 C C   . LYS B 94  ? 0.5610 0.7877 0.3919 0.1119  -0.0766 0.0348  94  LYS B C   
2904 O O   . LYS B 94  ? 0.5957 0.8206 0.4267 0.1113  -0.0893 0.0245  94  LYS B O   
2905 C CB  . LYS B 94  ? 0.5034 0.6817 0.4054 0.0923  -0.0608 0.0658  94  LYS B CB  
2906 C CG  . LYS B 94  ? 0.5886 0.7268 0.5169 0.0840  -0.0514 0.0618  94  LYS B CG  
2907 C CD  . LYS B 94  ? 0.6768 0.8136 0.6550 0.0771  -0.0568 0.0954  94  LYS B CD  
2908 C CE  . LYS B 94  ? 0.7826 0.9762 0.7600 0.0748  -0.0639 0.1373  94  LYS B CE  
2909 N NZ  . LYS B 94  ? 0.8373 1.0265 0.8636 0.0608  -0.0705 0.1749  94  LYS B NZ  
2910 N N   . GLU B 95  ? 0.5763 0.8576 0.3871 0.1211  -0.0745 0.0505  95  GLU B N   
2911 C CA  . GLU B 95  ? 0.5797 0.9315 0.3639 0.1344  -0.0856 0.0562  95  GLU B CA  
2912 C C   . GLU B 95  ? 0.5863 0.9258 0.3255 0.1516  -0.0967 0.0038  95  GLU B C   
2913 O O   . GLU B 95  ? 0.6058 0.9679 0.3291 0.1575  -0.1136 -0.0113 95  GLU B O   
2914 C CB  . GLU B 95  ? 0.6571 1.0868 0.4357 0.1403  -0.0784 0.0933  95  GLU B CB  
2915 C CG  . GLU B 95  ? 0.6438 1.0863 0.4780 0.1201  -0.0759 0.1530  95  GLU B CG  
2916 C CD  . GLU B 95  ? 0.7476 1.1251 0.6165 0.1036  -0.0664 0.1575  95  GLU B CD  
2917 O OE1 . GLU B 95  ? 0.6154 0.9578 0.4618 0.1075  -0.0577 0.1240  95  GLU B OE1 
2918 O OE2 . GLU B 95  ? 0.7684 1.1308 0.6905 0.0874  -0.0703 0.1947  95  GLU B OE2 
2919 N N   . LYS B 96  ? 0.5010 0.8006 0.2243 0.1589  -0.0909 -0.0246 96  LYS B N   
2920 C CA  . LYS B 96  ? 0.5938 0.8655 0.2857 0.1753  -0.1068 -0.0750 96  LYS B CA  
2921 C C   . LYS B 96  ? 0.6216 0.8330 0.3361 0.1572  -0.1225 -0.0888 96  LYS B C   
2922 O O   . LYS B 96  ? 0.7219 0.9236 0.4200 0.1638  -0.1462 -0.1217 96  LYS B O   
2923 C CB  . LYS B 96  ? 0.6499 0.8902 0.3290 0.1877  -0.0988 -0.0959 96  LYS B CB  
2924 C CG  . LYS B 96  ? 0.7687 0.9786 0.4201 0.2105  -0.1201 -0.1488 96  LYS B CG  
2925 C CD  . LYS B 96  ? 0.9132 1.1115 0.5519 0.2312  -0.1111 -0.1637 96  LYS B CD  
2926 C CE  . LYS B 96  ? 1.1324 1.3161 0.7410 0.2663  -0.1342 -0.2198 96  LYS B CE  
2927 N NZ  . LYS B 96  ? 1.1298 1.2753 0.7424 0.2821  -0.1298 -0.2320 96  LYS B NZ  
2928 N N   . LEU B 97  ? 0.5490 0.7251 0.3027 0.1351  -0.1112 -0.0652 97  LEU B N   
2929 C CA  . LEU B 97  ? 0.5173 0.6526 0.2977 0.1176  -0.1231 -0.0701 97  LEU B CA  
2930 C C   . LEU B 97  ? 0.5761 0.7443 0.3629 0.1129  -0.1400 -0.0629 97  LEU B C   
2931 O O   . LEU B 97  ? 0.5953 0.7465 0.3820 0.1068  -0.1636 -0.0835 97  LEU B O   
2932 C CB  . LEU B 97  ? 0.4737 0.5839 0.2913 0.1018  -0.1044 -0.0483 97  LEU B CB  
2933 C CG  . LEU B 97  ? 0.4310 0.5242 0.2849 0.0847  -0.1092 -0.0403 97  LEU B CG  
2934 C CD1 . LEU B 97  ? 0.4908 0.5500 0.3471 0.0755  -0.1266 -0.0575 97  LEU B CD1 
2935 C CD2 . LEU B 97  ? 0.4282 0.5167 0.3103 0.0798  -0.0865 -0.0235 97  LEU B CD2 
2936 N N   . GLU B 98  ? 0.5620 0.7780 0.3594 0.1138  -0.1309 -0.0302 98  GLU B N   
2937 C CA  . GLU B 98  ? 0.5886 0.8472 0.3935 0.1104  -0.1468 -0.0171 98  GLU B CA  
2938 C C   . GLU B 98  ? 0.7319 1.0309 0.4894 0.1261  -0.1677 -0.0475 98  GLU B C   
2939 O O   . GLU B 98  ? 0.8564 1.1630 0.6098 0.1211  -0.1922 -0.0644 98  GLU B O   
2940 C CB  . GLU B 98  ? 0.5466 0.8485 0.3813 0.1086  -0.1350 0.0318  98  GLU B CB  
2941 C CG  . GLU B 98  ? 0.6420 0.9905 0.4942 0.1038  -0.1514 0.0534  98  GLU B CG  
2942 C CD  . GLU B 98  ? 0.6165 0.9990 0.5123 0.1021  -0.1425 0.1084  98  GLU B CD  
2943 O OE1 . GLU B 98  ? 0.5595 0.9420 0.4649 0.1043  -0.1281 0.1304  98  GLU B OE1 
2944 O OE2 . GLU B 98  ? 0.5850 0.9931 0.5109 0.0975  -0.1526 0.1317  98  GLU B OE2 
2945 N N   . ALA B 99  ? 0.7355 1.0674 0.4576 0.1464  -0.1593 -0.0562 99  ALA B N   
2946 C CA  . ALA B 99  ? 0.8572 1.2400 0.5297 0.1694  -0.1773 -0.0916 99  ALA B CA  
2947 C C   . ALA B 99  ? 0.9369 1.2576 0.5947 0.1717  -0.2050 -0.1495 99  ALA B C   
2948 O O   . ALA B 99  ? 0.9935 1.3423 0.6263 0.1797  -0.2321 -0.1811 99  ALA B O   
2949 C CB  . ALA B 99  ? 0.8540 1.2890 0.4943 0.1943  -0.1608 -0.0907 99  ALA B CB  
2950 N N   . THR B 100 ? 0.8831 1.1221 0.5614 0.1623  -0.2014 -0.1603 100 THR B N   
2951 C CA  . THR B 100 ? 0.9691 1.1396 0.6466 0.1608  -0.2313 -0.2068 100 THR B CA  
2952 C C   . THR B 100 ? 1.0098 1.1618 0.7187 0.1323  -0.2563 -0.2013 100 THR B C   
2953 O O   . THR B 100 ? 1.1144 1.2377 0.8173 0.1306  -0.2930 -0.2412 100 THR B O   
2954 C CB  . THR B 100 ? 0.9158 1.0134 0.6146 0.1555  -0.2209 -0.2070 100 THR B CB  
2955 O OG1 . THR B 100 ? 0.9202 1.0401 0.5932 0.1808  -0.1978 -0.2088 100 THR B OG1 
2956 C CG2 . THR B 100 ? 1.0012 1.0275 0.7073 0.1541  -0.2570 -0.2490 100 THR B CG2 
2957 N N   . ILE B 101 ? 0.9403 1.1081 0.6865 0.1108  -0.2387 -0.1530 101 ILE B N   
2958 C CA  . ILE B 101 ? 0.9683 1.1377 0.7489 0.0850  -0.2585 -0.1385 101 ILE B CA  
2959 C C   . ILE B 101 ? 1.0671 1.2956 0.8208 0.0914  -0.2847 -0.1552 101 ILE B C   
2960 O O   . ILE B 101 ? 1.1772 1.3881 0.9302 0.0811  -0.3225 -0.1867 101 ILE B O   
2961 C CB  . ILE B 101 ? 0.8822 1.0673 0.7077 0.0705  -0.2304 -0.0851 101 ILE B CB  
2962 C CG1 . ILE B 101 ? 0.7561 0.8879 0.6084 0.0610  -0.2122 -0.0763 101 ILE B CG1 
2963 C CG2 . ILE B 101 ? 0.8006 1.0195 0.6584 0.0518  -0.2478 -0.0632 101 ILE B CG2 
2964 C CD1 . ILE B 101 ? 0.5587 0.7054 0.4480 0.0562  -0.1822 -0.0368 101 ILE B CD1 
2965 N N   . ASN B 102 ? 1.0633 1.3660 0.7968 0.1072  -0.2675 -0.1327 102 ASN B N   
2966 C CA  . ASN B 102 ? 1.1350 1.5162 0.8377 0.1167  -0.2886 -0.1430 102 ASN B CA  
2967 C C   . ASN B 102 ? 1.2850 1.6534 0.9402 0.1346  -0.3217 -0.2140 102 ASN B C   
2968 O O   . ASN B 102 ? 1.3952 1.7961 1.0336 0.1323  -0.3561 -0.2420 102 ASN B O   
2969 C CB  . ASN B 102 ? 1.1102 1.5783 0.7934 0.1360  -0.2636 -0.1076 102 ASN B CB  
2970 C CG  . ASN B 102 ? 0.9421 1.4166 0.6771 0.1218  -0.2355 -0.0402 102 ASN B CG  
2971 O OD1 . ASN B 102 ? 0.8923 1.3352 0.6732 0.1009  -0.2384 -0.0200 102 ASN B OD1 
2972 N ND2 . ASN B 102 ? 0.9007 1.4214 0.6322 0.1344  -0.2102 -0.0039 102 ASN B ND2 
2973 N N   . GLU B 103 ? 1.2714 1.5948 0.9058 0.1548  -0.3129 -0.2453 103 GLU B N   
2974 C CA  . GLU B 103 ? 1.4275 1.7324 1.0182 0.1817  -0.3426 -0.3188 103 GLU B CA  
2975 C C   . GLU B 103 ? 1.5166 1.7285 1.1339 0.1605  -0.3859 -0.3581 103 GLU B C   
2976 O O   . GLU B 103 ? 1.6838 1.8857 1.2716 0.1764  -0.4258 -0.4230 103 GLU B O   
2977 C CB  . GLU B 103 ? 1.4165 1.7115 0.9821 0.2139  -0.3179 -0.3339 103 GLU B CB  
2978 C CG  . GLU B 103 ? 1.5922 1.8391 1.1275 0.2449  -0.3465 -0.4109 103 GLU B CG  
2979 C CD  . GLU B 103 ? 1.5985 1.8154 1.1303 0.2679  -0.3195 -0.4112 103 GLU B CD  
2980 O OE1 . GLU B 103 ? 1.6229 1.9215 1.1236 0.2945  -0.2897 -0.3959 103 GLU B OE1 
2981 O OE2 . GLU B 103 ? 1.5371 1.6557 1.1007 0.2580  -0.3295 -0.4217 103 GLU B OE2 
2982 N N   . LEU B 104 ? 1.4166 1.5685 1.0916 0.1243  -0.3813 -0.3181 104 LEU B N   
2983 C CA  . LEU B 104 ? 1.4980 1.5627 1.2104 0.0987  -0.4216 -0.3409 104 LEU B CA  
2984 C C   . LEU B 104 ? 1.5302 1.6030 1.2846 0.0582  -0.4496 -0.3173 104 LEU B C   
2985 O O   . LEU B 104 ? 1.6547 1.6781 1.4263 0.0410  -0.4987 -0.3517 104 LEU B O   
2986 C CB  . LEU B 104 ? 1.4237 1.4142 1.1733 0.0889  -0.4036 -0.3180 104 LEU B CB  
2987 C CG  . LEU B 104 ? 1.4243 1.3716 1.1480 0.1227  -0.3984 -0.3554 104 LEU B CG  
2988 C CD1 . LEU B 104 ? 1.4116 1.3032 1.1798 0.1045  -0.3789 -0.3162 104 LEU B CD1 
2989 C CD2 . LEU B 104 ? 1.6485 1.5422 1.3563 0.1404  -0.4503 -0.4294 104 LEU B CD2 
2990 N N   . VAL B 105 ? 1.4404 1.5738 1.2160 0.0438  -0.4211 -0.2587 105 VAL B N   
2991 C CA  . VAL B 105 ? 1.4260 1.5832 1.2478 0.0076  -0.4393 -0.2238 105 VAL B CA  
2992 C C   . VAL B 105 ? 1.6107 1.7466 1.4391 -0.0133 -0.5008 -0.2652 105 VAL B C   
2993 O O   . VAL B 105 ? 1.6420 1.7382 1.5256 -0.0504 -0.5264 -0.2471 105 VAL B O   
2994 C CB  . VAL B 105 ? 1.3477 1.6005 1.1662 0.0133  -0.4124 -0.1788 105 VAL B CB  
2995 C CG1 . VAL B 105 ? 1.4246 1.7235 1.2704 -0.0136 -0.4443 -0.1630 105 VAL B CG1 
2996 C CG2 . VAL B 105 ? 1.1092 1.3636 0.9608 0.0131  -0.3641 -0.1235 105 VAL B CG2 
2997 O OXT . VAL B 105 ? 1.7140 1.8772 1.4946 0.0055  -0.5284 -0.3174 105 VAL B OXT 
2998 N N   . LYS C 6   ? 0.6156 1.0165 0.7066 0.0051  -0.1049 -0.0514 8   LYS C N   
2999 C CA  . LYS C 6   ? 0.6420 1.0451 0.7237 0.0009  -0.1066 -0.0424 8   LYS C CA  
3000 C C   . LYS C 6   ? 0.6648 1.0595 0.7428 -0.0015 -0.1041 -0.0362 8   LYS C C   
3001 O O   . LYS C 6   ? 0.6823 1.0850 0.7529 -0.0048 -0.1037 -0.0326 8   LYS C O   
3002 C CB  . LYS C 6   ? 0.6353 1.0326 0.7176 0.0003  -0.1107 -0.0380 8   LYS C CB  
3003 C CG  . LYS C 6   ? 0.6093 1.0062 0.6819 -0.0042 -0.1142 -0.0285 8   LYS C CG  
3004 C CD  . LYS C 6   ? 0.6210 1.0078 0.6946 -0.0037 -0.1188 -0.0241 8   LYS C CD  
3005 C CE  . LYS C 6   ? 0.8019 1.1857 0.8651 -0.0087 -0.1238 -0.0142 8   LYS C CE  
3006 N NZ  . LYS C 6   ? 0.9246 1.3010 0.9875 -0.0078 -0.1304 -0.0105 8   LYS C NZ  
3007 N N   . SER C 7   ? 0.6434 1.0232 0.7264 0.0001  -0.1029 -0.0346 9   SER C N   
3008 C CA  . SER C 7   ? 0.6128 0.9827 0.6926 -0.0014 -0.1009 -0.0295 9   SER C CA  
3009 C C   . SER C 7   ? 0.5718 0.9334 0.6595 0.0018  -0.0965 -0.0339 9   SER C C   
3010 O O   . SER C 7   ? 0.5679 0.9273 0.6638 0.0045  -0.0961 -0.0383 9   SER C O   
3011 C CB  . SER C 7   ? 0.6162 0.9751 0.6923 -0.0025 -0.1049 -0.0222 9   SER C CB  
3012 O OG  . SER C 7   ? 0.7063 1.0692 0.7809 -0.0030 -0.1099 -0.0207 9   SER C OG  
3013 N N   . PHE C 8   ? 0.5296 0.8871 0.6147 0.0007  -0.0936 -0.0319 10  PHE C N   
3014 C CA  . PHE C 8   ? 0.4701 0.8201 0.5615 0.0030  -0.0897 -0.0351 10  PHE C CA  
3015 C C   . PHE C 8   ? 0.4720 0.8151 0.5580 0.0012  -0.0880 -0.0301 10  PHE C C   
3016 O O   . PHE C 8   ? 0.4090 0.7584 0.4903 -0.0009 -0.0871 -0.0294 10  PHE C O   
3017 C CB  . PHE C 8   ? 0.4453 0.8029 0.5402 0.0045  -0.0883 -0.0422 10  PHE C CB  
3018 C CG  . PHE C 8   ? 0.4813 0.8309 0.5830 0.0063  -0.0854 -0.0454 10  PHE C CG  
3019 C CD1 . PHE C 8   ? 0.4659 0.8071 0.5740 0.0071  -0.0847 -0.0445 10  PHE C CD1 
3020 C CD2 . PHE C 8   ? 0.3332 0.6848 0.4351 0.0072  -0.0839 -0.0492 10  PHE C CD2 
3021 C CE1 . PHE C 8   ? 0.4453 0.7803 0.5594 0.0076  -0.0825 -0.0464 10  PHE C CE1 
3022 C CE2 . PHE C 8   ? 0.5134 0.8566 0.6213 0.0083  -0.0822 -0.0515 10  PHE C CE2 
3023 C CZ  . PHE C 8   ? 0.4182 0.7532 0.5320 0.0080  -0.0815 -0.0496 10  PHE C CZ  
3024 N N   . GLU C 9   ? 0.4403 0.7717 0.5268 0.0021  -0.0880 -0.0268 11  GLU C N   
3025 C CA  . GLU C 9   ? 0.4760 0.7999 0.5560 0.0001  -0.0878 -0.0215 11  GLU C CA  
3026 C C   . GLU C 9   ? 0.4272 0.7397 0.5106 0.0029  -0.0852 -0.0218 11  GLU C C   
3027 O O   . GLU C 9   ? 0.3939 0.7033 0.4825 0.0061  -0.0853 -0.0234 11  GLU C O   
3028 C CB  . GLU C 9   ? 0.5264 0.8471 0.5983 -0.0026 -0.0934 -0.0149 11  GLU C CB  
3029 C CG  . GLU C 9   ? 0.6167 0.9338 0.6801 -0.0070 -0.0947 -0.0087 11  GLU C CG  
3030 C CD  . GLU C 9   ? 0.6249 0.9315 0.6811 -0.0090 -0.1015 -0.0018 11  GLU C CD  
3031 O OE1 . GLU C 9   ? 0.5141 0.8198 0.5706 -0.0077 -0.1056 -0.0014 11  GLU C OE1 
3032 O OE2 . GLU C 9   ? 0.5961 0.8941 0.6462 -0.0117 -0.1035 0.0031  11  GLU C OE2 
3033 N N   . VAL C 10  ? 0.4171 0.7250 0.4973 0.0017  -0.0829 -0.0201 12  VAL C N   
3034 C CA  . VAL C 10  ? 0.3813 0.6786 0.4626 0.0040  -0.0810 -0.0194 12  VAL C CA  
3035 C C   . VAL C 10  ? 0.4013 0.6894 0.4751 0.0038  -0.0857 -0.0143 12  VAL C C   
3036 O O   . VAL C 10  ? 0.4243 0.7116 0.4905 -0.0002 -0.0889 -0.0096 12  VAL C O   
3037 C CB  . VAL C 10  ? 0.4267 0.7225 0.5079 0.0030  -0.0771 -0.0199 12  VAL C CB  
3038 C CG1 . VAL C 10  ? 0.3247 0.6098 0.4050 0.0050  -0.0756 -0.0184 12  VAL C CG1 
3039 C CG2 . VAL C 10  ? 0.3318 0.6340 0.4207 0.0039  -0.0739 -0.0254 12  VAL C CG2 
3040 N N   . VAL C 11  ? 0.4097 0.6910 0.4855 0.0082  -0.0869 -0.0151 13  VAL C N   
3041 C CA  . VAL C 11  ? 0.3564 0.6266 0.4252 0.0096  -0.0927 -0.0114 13  VAL C CA  
3042 C C   . VAL C 11  ? 0.3349 0.5962 0.4036 0.0139  -0.0909 -0.0128 13  VAL C C   
3043 O O   . VAL C 11  ? 0.3436 0.6068 0.4183 0.0190  -0.0887 -0.0165 13  VAL C O   
3044 C CB  . VAL C 11  ? 0.3955 0.6663 0.4650 0.0120  -0.0981 -0.0115 13  VAL C CB  
3045 C CG1 . VAL C 11  ? 0.4437 0.7009 0.5057 0.0140  -0.1058 -0.0082 13  VAL C CG1 
3046 C CG2 . VAL C 11  ? 0.3849 0.6649 0.4530 0.0071  -0.0999 -0.0097 13  VAL C CG2 
3047 N N   . PHE C 12  ? 0.3613 0.6143 0.4230 0.0117  -0.0920 -0.0096 14  PHE C N   
3048 C CA  . PHE C 12  ? 0.3632 0.6073 0.4233 0.0160  -0.0912 -0.0109 14  PHE C CA  
3049 C C   . PHE C 12  ? 0.4015 0.6357 0.4577 0.0214  -0.0982 -0.0112 14  PHE C C   
3050 O O   . PHE C 12  ? 0.4357 0.6638 0.4861 0.0195  -0.1056 -0.0076 14  PHE C O   
3051 C CB  . PHE C 12  ? 0.3458 0.5836 0.3995 0.0120  -0.0910 -0.0075 14  PHE C CB  
3052 C CG  . PHE C 12  ? 0.3500 0.5969 0.4077 0.0081  -0.0845 -0.0081 14  PHE C CG  
3053 C CD1 . PHE C 12  ? 0.2235 0.4736 0.2873 0.0105  -0.0782 -0.0117 14  PHE C CD1 
3054 C CD2 . PHE C 12  ? 0.3207 0.5740 0.3760 0.0022  -0.0852 -0.0052 14  PHE C CD2 
3055 C CE1 . PHE C 12  ? 0.2249 0.4814 0.2922 0.0074  -0.0736 -0.0125 14  PHE C CE1 
3056 C CE2 . PHE C 12  ? 0.2629 0.5245 0.3218 0.0000  -0.0800 -0.0068 14  PHE C CE2 
3057 C CZ  . PHE C 12  ? 0.2926 0.5545 0.3575 0.0028  -0.0746 -0.0106 14  PHE C CZ  
3058 N N   . ASN C 13  ? 0.4129 0.6460 0.4719 0.0284  -0.0961 -0.0154 15  ASN C N   
3059 C CA  . ASN C 13  ? 0.4330 0.6577 0.4888 0.0359  -0.1025 -0.0177 15  ASN C CA  
3060 C C   . ASN C 13  ? 0.4874 0.6945 0.5320 0.0355  -0.1109 -0.0145 15  ASN C C   
3061 O O   . ASN C 13  ? 0.5371 0.7342 0.5770 0.0391  -0.1199 -0.0143 15  ASN C O   
3062 C CB  . ASN C 13  ? 0.4305 0.6615 0.4917 0.0432  -0.0972 -0.0233 15  ASN C CB  
3063 C CG  . ASN C 13  ? 0.3814 0.6284 0.4536 0.0452  -0.0924 -0.0265 15  ASN C CG  
3064 O OD1 . ASN C 13  ? 0.4395 0.6916 0.5150 0.0420  -0.0934 -0.0253 15  ASN C OD1 
3065 N ND2 . ASN C 13  ? 0.4583 0.7143 0.5359 0.0501  -0.0872 -0.0304 15  ASN C ND2 
3066 N N   . ASP C 14  ? 0.4347 0.6375 0.4751 0.0313  -0.1085 -0.0121 16  ASP C N   
3067 C CA  . ASP C 14  ? 0.4393 0.6258 0.4690 0.0284  -0.1163 -0.0078 16  ASP C CA  
3068 C C   . ASP C 14  ? 0.3944 0.5847 0.4219 0.0177  -0.1150 -0.0012 16  ASP C C   
3069 O O   . ASP C 14  ? 0.4055 0.5987 0.4332 0.0144  -0.1096 -0.0004 16  ASP C O   
3070 C CB  . ASP C 14  ? 0.4617 0.6422 0.4887 0.0326  -0.1140 -0.0107 16  ASP C CB  
3071 C CG  . ASP C 14  ? 0.6701 0.8540 0.7010 0.0435  -0.1120 -0.0182 16  ASP C CG  
3072 O OD1 . ASP C 14  ? 0.7067 0.9006 0.7428 0.0455  -0.1033 -0.0213 16  ASP C OD1 
3073 O OD2 . ASP C 14  ? 0.6889 0.8668 0.7180 0.0499  -0.1193 -0.0208 16  ASP C OD2 
3074 N N   . PRO C 15  ? 0.4066 0.5990 0.4324 0.0123  -0.1197 0.0034  17  PRO C N   
3075 C CA  . PRO C 15  ? 0.4238 0.6254 0.4488 0.0029  -0.1169 0.0086  17  PRO C CA  
3076 C C   . PRO C 15  ? 0.4604 0.6538 0.4773 -0.0035 -0.1207 0.0144  17  PRO C C   
3077 O O   . PRO C 15  ? 0.4341 0.6377 0.4516 -0.0099 -0.1164 0.0173  17  PRO C O   
3078 C CB  . PRO C 15  ? 0.4664 0.6734 0.4908 -0.0010 -0.1216 0.0121  17  PRO C CB  
3079 C CG  . PRO C 15  ? 0.4104 0.6063 0.4330 0.0051  -0.1290 0.0106  17  PRO C CG  
3080 C CD  . PRO C 15  ? 0.4396 0.6283 0.4643 0.0144  -0.1273 0.0040  17  PRO C CD  
3081 N N   . GLU C 16  ? 0.4677 0.6431 0.4772 -0.0013 -0.1289 0.0157  18  GLU C N   
3082 C CA  . GLU C 16  ? 0.4007 0.5668 0.4023 -0.0075 -0.1335 0.0214  18  GLU C CA  
3083 C C   . GLU C 16  ? 0.4066 0.5664 0.4078 -0.0028 -0.1297 0.0171  18  GLU C C   
3084 O O   . GLU C 16  ? 0.3789 0.5304 0.3738 -0.0072 -0.1333 0.0211  18  GLU C O   
3085 C CB  . GLU C 16  ? 0.4547 0.6036 0.4469 -0.0107 -0.1476 0.0275  18  GLU C CB  
3086 C CG  . GLU C 16  ? 0.5150 0.6713 0.5043 -0.0215 -0.1520 0.0364  18  GLU C CG  
3087 C CD  . GLU C 16  ? 0.5338 0.7039 0.5292 -0.0200 -0.1484 0.0344  18  GLU C CD  
3088 O OE1 . GLU C 16  ? 0.6860 0.8482 0.6820 -0.0134 -0.1531 0.0312  18  GLU C OE1 
3089 O OE2 . GLU C 16  ? 0.5559 0.7450 0.5556 -0.0250 -0.1412 0.0356  18  GLU C OE2 
3090 N N   . LYS C 17  ? 0.3487 0.5135 0.3565 0.0057  -0.1224 0.0095  19  LYS C N   
3091 C CA  . LYS C 17  ? 0.3545 0.5148 0.3615 0.0100  -0.1188 0.0057  19  LYS C CA  
3092 C C   . LYS C 17  ? 0.3844 0.5539 0.3936 0.0040  -0.1114 0.0079  19  LYS C C   
3093 O O   . LYS C 17  ? 0.3740 0.5581 0.3894 0.0004  -0.1052 0.0085  19  LYS C O   
3094 C CB  . LYS C 17  ? 0.3617 0.5273 0.3751 0.0198  -0.1130 -0.0022 19  LYS C CB  
3095 C CG  . LYS C 17  ? 0.4043 0.5656 0.4158 0.0248  -0.1099 -0.0060 19  LYS C CG  
3096 C CD  . LYS C 17  ? 0.4538 0.6225 0.4711 0.0342  -0.1052 -0.0131 19  LYS C CD  
3097 C CE  . LYS C 17  ? 0.5503 0.7183 0.5658 0.0383  -0.1011 -0.0165 19  LYS C CE  
3098 N NZ  . LYS C 17  ? 0.6327 0.8100 0.6533 0.0474  -0.0973 -0.0230 19  LYS C NZ  
3099 N N   . VAL C 18  ? 0.3898 0.5504 0.3938 0.0038  -0.1126 0.0085  20  VAL C N   
3100 C CA  . VAL C 18  ? 0.3567 0.5243 0.3626 -0.0001 -0.1060 0.0096  20  VAL C CA  
3101 C C   . VAL C 18  ? 0.3956 0.5629 0.4042 0.0077  -0.1001 0.0033  20  VAL C C   
3102 O O   . VAL C 18  ? 0.3938 0.5490 0.3968 0.0131  -0.1046 0.0008  20  VAL C O   
3103 C CB  . VAL C 18  ? 0.3661 0.5231 0.3632 -0.0065 -0.1129 0.0155  20  VAL C CB  
3104 C CG1 . VAL C 18  ? 0.3866 0.5513 0.3855 -0.0106 -0.1069 0.0169  20  VAL C CG1 
3105 C CG2 . VAL C 18  ? 0.2890 0.4451 0.2818 -0.0148 -0.1210 0.0231  20  VAL C CG2 
3106 N N   . TYR C 19  ? 0.3591 0.5399 0.3762 0.0085  -0.0909 0.0006  21  TYR C N   
3107 C CA  . TYR C 19  ? 0.3540 0.5379 0.3749 0.0151  -0.0851 -0.0047 21  TYR C CA  
3108 C C   . TYR C 19  ? 0.3480 0.5296 0.3666 0.0145  -0.0818 -0.0045 21  TYR C C   
3109 O O   . TYR C 19  ? 0.2928 0.4765 0.3112 0.0086  -0.0805 -0.0011 21  TYR C O   
3110 C CB  . TYR C 19  ? 0.3906 0.5890 0.4218 0.0155  -0.0780 -0.0070 21  TYR C CB  
3111 C CG  . TYR C 19  ? 0.3408 0.5432 0.3755 0.0169  -0.0802 -0.0080 21  TYR C CG  
3112 C CD1 . TYR C 19  ? 0.3448 0.5491 0.3822 0.0238  -0.0802 -0.0122 21  TYR C CD1 
3113 C CD2 . TYR C 19  ? 0.3677 0.5735 0.4028 0.0114  -0.0825 -0.0047 21  TYR C CD2 
3114 C CE1 . TYR C 19  ? 0.3571 0.5651 0.3978 0.0250  -0.0827 -0.0129 21  TYR C CE1 
3115 C CE2 . TYR C 19  ? 0.2508 0.4601 0.2884 0.0123  -0.0848 -0.0053 21  TYR C CE2 
3116 C CZ  . TYR C 19  ? 0.4404 0.6501 0.4809 0.0191  -0.0851 -0.0094 21  TYR C CZ  
3117 O OH  . TYR C 19  ? 0.4750 0.6884 0.5183 0.0198  -0.0878 -0.0097 21  TYR C OH  
3118 N N   . GLY C 20  ? 0.3533 0.5331 0.3707 0.0208  -0.0801 -0.0084 22  GLY C N   
3119 C CA  . GLY C 20  ? 0.3875 0.5649 0.4018 0.0206  -0.0773 -0.0083 22  GLY C CA  
3120 C C   . GLY C 20  ? 0.3916 0.5811 0.4132 0.0224  -0.0690 -0.0105 22  GLY C C   
3121 O O   . GLY C 20  ? 0.3397 0.5384 0.3682 0.0243  -0.0660 -0.0124 22  GLY C O   
3122 N N   . SER C 21  ? 0.4233 0.6127 0.4435 0.0211  -0.0658 -0.0096 23  SER C N   
3123 C CA  . SER C 21  ? 0.4154 0.6152 0.4418 0.0211  -0.0588 -0.0102 23  SER C CA  
3124 C C   . SER C 21  ? 0.4102 0.6175 0.4389 0.0274  -0.0567 -0.0140 23  SER C C   
3125 O O   . SER C 21  ? 0.4240 0.6267 0.4469 0.0336  -0.0603 -0.0173 23  SER C O   
3126 C CB  . SER C 21  ? 0.4699 0.6653 0.4912 0.0198  -0.0576 -0.0087 23  SER C CB  
3127 O OG  . SER C 21  ? 0.5994 0.8040 0.6265 0.0184  -0.0517 -0.0079 23  SER C OG  
3128 N N   . GLY C 22  ? 0.3980 0.6175 0.4355 0.0260  -0.0516 -0.0138 24  GLY C N   
3129 C CA  . GLY C 22  ? 0.4282 0.6585 0.4692 0.0312  -0.0491 -0.0169 24  GLY C CA  
3130 C C   . GLY C 22  ? 0.4591 0.6917 0.5025 0.0354  -0.0521 -0.0199 24  GLY C C   
3131 O O   . GLY C 22  ? 0.4771 0.7217 0.5254 0.0392  -0.0495 -0.0222 24  GLY C O   
3132 N N   . GLU C 23  ? 0.4132 0.6358 0.4537 0.0345  -0.0576 -0.0194 25  GLU C N   
3133 C CA  . GLU C 23  ? 0.3988 0.6222 0.4410 0.0384  -0.0613 -0.0219 25  GLU C CA  
3134 C C   . GLU C 23  ? 0.3834 0.6178 0.4356 0.0352  -0.0583 -0.0211 25  GLU C C   
3135 O O   . GLU C 23  ? 0.3617 0.5994 0.4186 0.0290  -0.0551 -0.0184 25  GLU C O   
3136 C CB  . GLU C 23  ? 0.3960 0.6043 0.4305 0.0380  -0.0695 -0.0208 25  GLU C CB  
3137 C CG  . GLU C 23  ? 0.4607 0.6562 0.4849 0.0417  -0.0743 -0.0220 25  GLU C CG  
3138 C CD  . GLU C 23  ? 0.5675 0.7475 0.5840 0.0424  -0.0843 -0.0213 25  GLU C CD  
3139 O OE1 . GLU C 23  ? 0.4327 0.6064 0.4470 0.0351  -0.0873 -0.0163 25  GLU C OE1 
3140 O OE2 . GLU C 23  ? 0.6910 0.8656 0.7037 0.0503  -0.0899 -0.0257 25  GLU C OE2 
3141 N N   . LYS C 24  ? 0.3953 0.6346 0.4504 0.0399  -0.0602 -0.0240 26  LYS C N   
3142 C CA  . LYS C 24  ? 0.3957 0.6455 0.4601 0.0374  -0.0580 -0.0237 26  LYS C CA  
3143 C C   . LYS C 24  ? 0.3631 0.6061 0.4264 0.0345  -0.0629 -0.0223 26  LYS C C   
3144 O O   . LYS C 24  ? 0.3785 0.6119 0.4353 0.0372  -0.0689 -0.0227 26  LYS C O   
3145 C CB  . LYS C 24  ? 0.1215 0.3833 0.1908 0.0439  -0.0570 -0.0275 26  LYS C CB  
3146 C CG  . LYS C 24  ? 0.1151 0.3876 0.1939 0.0417  -0.0557 -0.0274 26  LYS C CG  
3147 C CD  . LYS C 24  ? 0.1119 0.4022 0.1988 0.0429  -0.0505 -0.0284 26  LYS C CD  
3148 C CE  . LYS C 24  ? 0.1038 0.4029 0.2006 0.0365  -0.0482 -0.0262 26  LYS C CE  
3149 N NZ  . LYS C 24  ? 0.0993 0.4075 0.2016 0.0308  -0.0430 -0.0230 26  LYS C NZ  
3150 N N   . VAL C 25  ? 0.3458 0.5940 0.4150 0.0287  -0.0606 -0.0205 27  VAL C N   
3151 C CA  . VAL C 25  ? 0.3210 0.5662 0.3895 0.0257  -0.0646 -0.0191 27  VAL C CA  
3152 C C   . VAL C 25  ? 0.3229 0.5782 0.3994 0.0267  -0.0639 -0.0210 27  VAL C C   
3153 O O   . VAL C 25  ? 0.3602 0.6247 0.4446 0.0244  -0.0595 -0.0214 27  VAL C O   
3154 C CB  . VAL C 25  ? 0.2885 0.5327 0.3567 0.0191  -0.0632 -0.0164 27  VAL C CB  
3155 C CG1 . VAL C 25  ? 0.2210 0.4644 0.2873 0.0163  -0.0673 -0.0150 27  VAL C CG1 
3156 C CG2 . VAL C 25  ? 0.2720 0.5074 0.3329 0.0180  -0.0634 -0.0144 27  VAL C CG2 
3157 N N   . ALA C 26  ? 0.3345 0.5875 0.4091 0.0302  -0.0689 -0.0220 28  ALA C N   
3158 C CA  . ALA C 26  ? 0.3210 0.5838 0.4031 0.0319  -0.0689 -0.0241 28  ALA C CA  
3159 C C   . ALA C 26  ? 0.3241 0.5840 0.4043 0.0302  -0.0742 -0.0229 28  ALA C C   
3160 O O   . ALA C 26  ? 0.3056 0.5553 0.3777 0.0297  -0.0796 -0.0208 28  ALA C O   
3161 C CB  . ALA C 26  ? 0.3545 0.6219 0.4382 0.0400  -0.0693 -0.0277 28  ALA C CB  
3162 N N   . GLY C 27  ? 0.3034 0.5729 0.3910 0.0287  -0.0732 -0.0240 29  GLY C N   
3163 C CA  . GLY C 27  ? 0.3045 0.5731 0.3904 0.0273  -0.0782 -0.0230 29  GLY C CA  
3164 C C   . GLY C 27  ? 0.3244 0.6046 0.4194 0.0269  -0.0767 -0.0251 29  GLY C C   
3165 O O   . GLY C 27  ? 0.2720 0.5605 0.3746 0.0291  -0.0731 -0.0273 29  GLY C O   
3166 N N   . ARG C 28  ? 0.2778 0.5594 0.3719 0.0238  -0.0797 -0.0241 30  ARG C N   
3167 C CA  . ARG C 28  ? 0.3195 0.6110 0.4212 0.0232  -0.0795 -0.0262 30  ARG C CA  
3168 C C   . ARG C 28  ? 0.3341 0.6284 0.4349 0.0178  -0.0792 -0.0257 30  ARG C C   
3169 O O   . ARG C 28  ? 0.3391 0.6287 0.4324 0.0151  -0.0808 -0.0231 30  ARG C O   
3170 C CB  . ARG C 28  ? 0.3427 0.6341 0.4435 0.0270  -0.0852 -0.0265 30  ARG C CB  
3171 C CG  . ARG C 28  ? 0.3564 0.6494 0.4606 0.0339  -0.0855 -0.0289 30  ARG C CG  
3172 C CD  . ARG C 28  ? 0.4731 0.7603 0.5726 0.0386  -0.0931 -0.0287 30  ARG C CD  
3173 N NE  . ARG C 28  ? 0.5373 0.8107 0.6257 0.0364  -0.0984 -0.0248 30  ARG C NE  
3174 C CZ  . ARG C 28  ? 0.6680 0.9349 0.7505 0.0359  -0.1061 -0.0221 30  ARG C CZ  
3175 N NH1 . ARG C 28  ? 0.6784 0.9507 0.7648 0.0382  -0.1095 -0.0235 30  ARG C NH1 
3176 N NH2 . ARG C 28  ? 0.5884 0.8434 0.6609 0.0324  -0.1110 -0.0175 30  ARG C NH2 
3177 N N   . VAL C 29  ? 0.3557 0.6583 0.4643 0.0163  -0.0773 -0.0284 31  VAL C N   
3178 C CA  . VAL C 29  ? 0.3376 0.6447 0.4455 0.0129  -0.0786 -0.0295 31  VAL C CA  
3179 C C   . VAL C 29  ? 0.3695 0.6824 0.4799 0.0140  -0.0823 -0.0306 31  VAL C C   
3180 O O   . VAL C 29  ? 0.3680 0.6857 0.4862 0.0157  -0.0820 -0.0327 31  VAL C O   
3181 C CB  . VAL C 29  ? 0.3214 0.6323 0.4358 0.0108  -0.0755 -0.0326 31  VAL C CB  
3182 C CG1 . VAL C 29  ? 0.3407 0.6573 0.4543 0.0090  -0.0775 -0.0353 31  VAL C CG1 
3183 C CG2 . VAL C 29  ? 0.3085 0.6135 0.4207 0.0099  -0.0721 -0.0314 31  VAL C CG2 
3184 N N   . ILE C 30  ? 0.4127 0.7257 0.5164 0.0126  -0.0862 -0.0286 32  ILE C N   
3185 C CA  . ILE C 30  ? 0.4445 0.7614 0.5488 0.0138  -0.0906 -0.0286 32  ILE C CA  
3186 C C   . ILE C 30  ? 0.4850 0.8110 0.5897 0.0109  -0.0916 -0.0309 32  ILE C C   
3187 O O   . ILE C 30  ? 0.4368 0.7651 0.5354 0.0080  -0.0917 -0.0297 32  ILE C O   
3188 C CB  . ILE C 30  ? 0.4684 0.7776 0.5642 0.0146  -0.0960 -0.0240 32  ILE C CB  
3189 C CG1 . ILE C 30  ? 0.4427 0.7423 0.5374 0.0184  -0.0953 -0.0231 32  ILE C CG1 
3190 C CG2 . ILE C 30  ? 0.5210 0.8338 0.6179 0.0162  -0.1012 -0.0240 32  ILE C CG2 
3191 C CD1 . ILE C 30  ? 0.4329 0.7228 0.5208 0.0211  -0.1021 -0.0200 32  ILE C CD1 
3192 N N   . VAL C 31  ? 0.5043 0.8367 0.6162 0.0120  -0.0925 -0.0343 33  VAL C N   
3193 C CA  . VAL C 31  ? 0.5422 0.8832 0.6558 0.0103  -0.0934 -0.0382 33  VAL C CA  
3194 C C   . VAL C 31  ? 0.5638 0.9100 0.6772 0.0108  -0.0981 -0.0379 33  VAL C C   
3195 O O   . VAL C 31  ? 0.5585 0.9038 0.6767 0.0133  -0.0995 -0.0376 33  VAL C O   
3196 C CB  . VAL C 31  ? 0.5291 0.8722 0.6523 0.0104  -0.0911 -0.0431 33  VAL C CB  
3197 C CG1 . VAL C 31  ? 0.6464 0.9962 0.7695 0.0093  -0.0927 -0.0480 33  VAL C CG1 
3198 C CG2 . VAL C 31  ? 0.5590 0.8958 0.6838 0.0100  -0.0869 -0.0424 33  VAL C CG2 
3199 N N   . GLU C 32  ? 0.6189 0.9717 0.7265 0.0088  -0.1005 -0.0381 34  GLU C N   
3200 C CA  . GLU C 32  ? 0.6941 1.0530 0.8006 0.0088  -0.1053 -0.0379 34  GLU C CA  
3201 C C   . GLU C 32  ? 0.7314 1.1012 0.8381 0.0078  -0.1061 -0.0430 34  GLU C C   
3202 O O   . GLU C 32  ? 0.7230 1.0970 0.8262 0.0067  -0.1041 -0.0451 34  GLU C O   
3203 C CB  . GLU C 32  ? 0.6960 1.0524 0.7927 0.0069  -0.1094 -0.0311 34  GLU C CB  
3204 C CG  . GLU C 32  ? 0.7468 1.0907 0.8418 0.0087  -0.1102 -0.0267 34  GLU C CG  
3205 C CD  . GLU C 32  ? 0.8236 1.1631 0.9123 0.0085  -0.1172 -0.0213 34  GLU C CD  
3206 O OE1 . GLU C 32  ? 0.8475 1.1938 0.9307 0.0051  -0.1210 -0.0190 34  GLU C OE1 
3207 O OE2 . GLU C 32  ? 0.8359 1.1652 0.9248 0.0119  -0.1195 -0.0195 34  GLU C OE2 
3208 N N   . VAL C 33  ? 0.7691 1.1440 0.8801 0.0088  -0.1094 -0.0456 35  VAL C N   
3209 C CA  . VAL C 33  ? 0.7947 1.1802 0.9054 0.0086  -0.1114 -0.0511 35  VAL C CA  
3210 C C   . VAL C 33  ? 0.8166 1.2093 0.9222 0.0077  -0.1164 -0.0488 35  VAL C C   
3211 O O   . VAL C 33  ? 0.7531 1.1415 0.8591 0.0081  -0.1192 -0.0444 35  VAL C O   
3212 C CB  . VAL C 33  ? 0.7986 1.1841 0.9198 0.0101  -0.1113 -0.0581 35  VAL C CB  
3213 C CG1 . VAL C 33  ? 0.7961 1.1759 0.9201 0.0103  -0.1074 -0.0605 35  VAL C CG1 
3214 C CG2 . VAL C 33  ? 0.7815 1.1640 0.9114 0.0110  -0.1127 -0.0569 35  VAL C CG2 
3215 N N   . CYS C 34  ? 0.8792 1.2835 0.9796 0.0068  -0.1178 -0.0520 36  CYS C N   
3216 C CA  . CYS C 34  ? 0.9557 1.3699 1.0507 0.0056  -0.1225 -0.0508 36  CYS C CA  
3217 C C   . CYS C 34  ? 0.9693 1.3889 1.0708 0.0079  -0.1252 -0.0584 36  CYS C C   
3218 O O   . CYS C 34  ? 0.9883 1.4149 1.0872 0.0075  -0.1296 -0.0578 36  CYS C O   
3219 C CB  . CYS C 34  ? 0.9843 1.4111 1.0686 0.0030  -0.1224 -0.0495 36  CYS C CB  
3220 S SG  . CYS C 34  ? 1.0588 1.4846 1.1317 -0.0025 -0.1248 -0.0369 36  CYS C SG  
3221 N N   . GLU C 35  ? 0.9742 1.3901 1.0839 0.0100  -0.1233 -0.0650 37  GLU C N   
3222 C CA  . GLU C 35  ? 0.9856 1.4044 1.1022 0.0118  -0.1266 -0.0725 37  GLU C CA  
3223 C C   . GLU C 35  ? 0.9941 1.4027 1.1219 0.0123  -0.1249 -0.0748 37  GLU C C   
3224 O O   . GLU C 35  ? 0.9965 1.3986 1.1252 0.0122  -0.1210 -0.0743 37  GLU C O   
3225 C CB  . GLU C 35  ? 1.0022 1.4318 1.1136 0.0135  -0.1281 -0.0801 37  GLU C CB  
3226 C CG  . GLU C 35  ? 1.0341 1.4613 1.1527 0.0161  -0.1305 -0.0897 37  GLU C CG  
3227 C CD  . GLU C 35  ? 1.0991 1.5336 1.2120 0.0192  -0.1304 -0.0973 37  GLU C CD  
3228 O OE1 . GLU C 35  ? 1.1012 1.5483 1.2044 0.0192  -0.1293 -0.0959 37  GLU C OE1 
3229 O OE2 . GLU C 35  ? 1.1071 1.5355 1.2254 0.0216  -0.1320 -0.1045 37  GLU C OE2 
3230 N N   . VAL C 36  ? 0.9877 1.3958 1.1240 0.0122  -0.1282 -0.0767 38  VAL C N   
3231 C CA  . VAL C 36  ? 0.9816 1.3826 1.1292 0.0113  -0.1277 -0.0779 38  VAL C CA  
3232 C C   . VAL C 36  ? 0.9834 1.3789 1.1322 0.0115  -0.1265 -0.0827 38  VAL C C   
3233 O O   . VAL C 36  ? 0.9925 1.3913 1.1374 0.0132  -0.1293 -0.0895 38  VAL C O   
3234 C CB  . VAL C 36  ? 1.0023 1.4070 1.1579 0.0107  -0.1331 -0.0812 38  VAL C CB  
3235 C CG1 . VAL C 36  ? 0.9853 1.3849 1.1531 0.0083  -0.1326 -0.0800 38  VAL C CG1 
3236 C CG2 . VAL C 36  ? 1.0140 1.4252 1.1674 0.0113  -0.1354 -0.0776 38  VAL C CG2 
3237 N N   . THR C 37  ? 0.9558 1.3433 1.1096 0.0101  -0.1228 -0.0793 39  THR C N   
3238 C CA  . THR C 37  ? 0.9371 1.3177 1.0922 0.0099  -0.1219 -0.0827 39  THR C CA  
3239 C C   . THR C 37  ? 0.9234 1.2963 1.0879 0.0069  -0.1203 -0.0794 39  THR C C   
3240 O O   . THR C 37  ? 0.9328 1.3064 1.1007 0.0057  -0.1171 -0.0734 39  THR C O   
3241 C CB  . THR C 37  ? 0.9319 1.3122 1.0775 0.0116  -0.1176 -0.0816 39  THR C CB  
3242 O OG1 . THR C 37  ? 0.9109 1.2823 1.0594 0.0109  -0.1150 -0.0811 39  THR C OG1 
3243 C CG2 . THR C 37  ? 0.9203 1.3027 1.0606 0.0112  -0.1141 -0.0741 39  THR C CG2 
3244 N N   . ARG C 38  ? 0.9072 1.2733 1.0757 0.0057  -0.1230 -0.0834 40  ARG C N   
3245 C CA  . ARG C 38  ? 0.8937 1.2526 1.0700 0.0019  -0.1217 -0.0795 40  ARG C CA  
3246 C C   . ARG C 38  ? 0.8485 1.2013 1.0200 0.0028  -0.1166 -0.0773 40  ARG C C   
3247 O O   . ARG C 38  ? 0.8686 1.2216 1.0321 0.0062  -0.1160 -0.0809 40  ARG C O   
3248 C CB  . ARG C 38  ? 0.9063 1.2593 1.0896 -0.0008 -0.1290 -0.0841 40  ARG C CB  
3249 C CG  . ARG C 38  ? 0.9589 1.3090 1.1526 -0.0070 -0.1293 -0.0783 40  ARG C CG  
3250 C CD  . ARG C 38  ? 1.0958 1.4410 1.2964 -0.0107 -0.1384 -0.0821 40  ARG C CD  
3251 N NE  . ARG C 38  ? 1.1686 1.5180 1.3799 -0.0174 -0.1393 -0.0757 40  ARG C NE  
3252 C CZ  . ARG C 38  ? 1.1865 1.5309 1.4057 -0.0234 -0.1470 -0.0757 40  ARG C CZ  
3253 N NH1 . ARG C 38  ? 1.1888 1.5215 1.4063 -0.0228 -0.1553 -0.0825 40  ARG C NH1 
3254 N NH2 . ARG C 38  ? 1.1670 1.5187 1.3960 -0.0300 -0.1469 -0.0689 40  ARG C NH2 
3255 N N   . VAL C 39  ? 0.7879 1.1369 0.9641 -0.0002 -0.1129 -0.0715 41  VAL C N   
3256 C CA  . VAL C 39  ? 0.7297 1.0726 0.9014 0.0004  -0.1083 -0.0691 41  VAL C CA  
3257 C C   . VAL C 39  ? 0.7292 1.0648 0.9076 -0.0040 -0.1085 -0.0662 41  VAL C C   
3258 O O   . VAL C 39  ? 0.7214 1.0601 0.9061 -0.0074 -0.1064 -0.0607 41  VAL C O   
3259 C CB  . VAL C 39  ? 0.7334 1.0798 0.8999 0.0022  -0.1020 -0.0637 41  VAL C CB  
3260 C CG1 . VAL C 39  ? 0.6321 0.9720 0.7949 0.0022  -0.0975 -0.0609 41  VAL C CG1 
3261 C CG2 . VAL C 39  ? 0.6913 1.0436 0.8496 0.0055  -0.1026 -0.0656 41  VAL C CG2 
3262 N N   . LYS C 40  ? 0.7215 1.0485 0.8986 -0.0038 -0.1116 -0.0698 42  LYS C N   
3263 C CA  . LYS C 40  ? 0.7299 1.0485 0.9126 -0.0085 -0.1130 -0.0666 42  LYS C CA  
3264 C C   . LYS C 40  ? 0.7083 1.0269 0.8897 -0.0098 -0.1056 -0.0594 42  LYS C C   
3265 O O   . LYS C 40  ? 0.6780 0.9962 0.8655 -0.0150 -0.1048 -0.0538 42  LYS C O   
3266 C CB  . LYS C 40  ? 0.7427 1.0506 0.9235 -0.0069 -0.1191 -0.0728 42  LYS C CB  
3267 C CG  . LYS C 40  ? 0.8169 1.1137 1.0019 -0.0118 -0.1213 -0.0689 42  LYS C CG  
3268 C CD  . LYS C 40  ? 0.9157 1.2005 1.0988 -0.0090 -0.1290 -0.0761 42  LYS C CD  
3269 C CE  . LYS C 40  ? 1.0539 1.3338 1.2421 -0.0104 -0.1397 -0.0816 42  LYS C CE  
3270 N NZ  . LYS C 40  ? 1.1236 1.3902 1.3100 -0.0068 -0.1488 -0.0895 42  LYS C NZ  
3271 N N   . ALA C 41  ? 0.6853 1.0051 0.8584 -0.0054 -0.1005 -0.0596 43  ALA C N   
3272 C CA  . ALA C 41  ? 0.6428 0.9615 0.8130 -0.0056 -0.0941 -0.0540 43  ALA C CA  
3273 C C   . ALA C 41  ? 0.6247 0.9460 0.7857 -0.0011 -0.0898 -0.0540 43  ALA C C   
3274 O O   . ALA C 41  ? 0.6175 0.9415 0.7735 0.0019  -0.0916 -0.0583 43  ALA C O   
3275 C CB  . ALA C 41  ? 0.6657 0.9744 0.8362 -0.0077 -0.0950 -0.0532 43  ALA C CB  
3276 N N   . VAL C 42  ? 0.5945 0.9159 0.7535 -0.0010 -0.0846 -0.0488 44  VAL C N   
3277 C CA  . VAL C 42  ? 0.5196 0.8390 0.6697 0.0018  -0.0809 -0.0475 44  VAL C CA  
3278 C C   . VAL C 42  ? 0.5315 0.8448 0.6814 0.0002  -0.0777 -0.0440 44  VAL C C   
3279 O O   . VAL C 42  ? 0.5348 0.8494 0.6891 -0.0018 -0.0756 -0.0401 44  VAL C O   
3280 C CB  . VAL C 42  ? 0.5117 0.8357 0.6580 0.0041  -0.0792 -0.0449 44  VAL C CB  
3281 C CG1 . VAL C 42  ? 0.4566 0.7766 0.5940 0.0058  -0.0763 -0.0424 44  VAL C CG1 
3282 C CG2 . VAL C 42  ? 0.3321 0.6616 0.4770 0.0054  -0.0827 -0.0481 44  VAL C CG2 
3283 N N   . ARG C 43  ? 0.5034 0.8112 0.6483 0.0011  -0.0776 -0.0456 45  ARG C N   
3284 C CA  . ARG C 43  ? 0.5180 0.8195 0.6613 0.0000  -0.0748 -0.0425 45  ARG C CA  
3285 C C   . ARG C 43  ? 0.4774 0.7779 0.6117 0.0024  -0.0718 -0.0413 45  ARG C C   
3286 O O   . ARG C 43  ? 0.4213 0.7255 0.5508 0.0043  -0.0729 -0.0434 45  ARG C O   
3287 C CB  . ARG C 43  ? 0.5284 0.8233 0.6744 -0.0014 -0.0783 -0.0452 45  ARG C CB  
3288 C CG  . ARG C 43  ? 0.5833 0.8768 0.7381 -0.0053 -0.0827 -0.0454 45  ARG C CG  
3289 C CD  . ARG C 43  ? 0.6110 0.8965 0.7676 -0.0054 -0.0889 -0.0500 45  ARG C CD  
3290 N NE  . ARG C 43  ? 0.6635 0.9515 0.8161 -0.0004 -0.0916 -0.0574 45  ARG C NE  
3291 C CZ  . ARG C 43  ? 0.6525 0.9378 0.8005 0.0033  -0.0928 -0.0616 45  ARG C CZ  
3292 N NH1 . ARG C 43  ? 0.5777 0.8555 0.7246 0.0026  -0.0919 -0.0593 45  ARG C NH1 
3293 N NH2 . ARG C 43  ? 0.6338 0.9251 0.7783 0.0080  -0.0950 -0.0684 45  ARG C NH2 
3294 N N   . ILE C 44  ? 0.4646 0.7607 0.5967 0.0019  -0.0685 -0.0374 46  ILE C N   
3295 C CA  . ILE C 44  ? 0.4579 0.7509 0.5820 0.0032  -0.0665 -0.0361 46  ILE C CA  
3296 C C   . ILE C 44  ? 0.4550 0.7418 0.5789 0.0022  -0.0658 -0.0357 46  ILE C C   
3297 O O   . ILE C 44  ? 0.4880 0.7715 0.6169 -0.0001 -0.0659 -0.0342 46  ILE C O   
3298 C CB  . ILE C 44  ? 0.4120 0.7040 0.5316 0.0044  -0.0637 -0.0319 46  ILE C CB  
3299 C CG1 . ILE C 44  ? 0.3709 0.6626 0.4949 0.0035  -0.0612 -0.0292 46  ILE C CG1 
3300 C CG2 . ILE C 44  ? 0.3220 0.6186 0.4396 0.0060  -0.0655 -0.0322 46  ILE C CG2 
3301 C CD1 . ILE C 44  ? 0.4677 0.7564 0.5856 0.0057  -0.0585 -0.0262 46  ILE C CD1 
3302 N N   . LEU C 45  ? 0.4399 0.7256 0.5576 0.0034  -0.0655 -0.0363 47  LEU C N   
3303 C CA  . LEU C 45  ? 0.3721 0.6516 0.4875 0.0029  -0.0641 -0.0347 47  LEU C CA  
3304 C C   . LEU C 45  ? 0.3486 0.6270 0.4561 0.0033  -0.0615 -0.0312 47  LEU C C   
3305 O O   . LEU C 45  ? 0.3432 0.6261 0.4460 0.0040  -0.0623 -0.0315 47  LEU C O   
3306 C CB  . LEU C 45  ? 0.4184 0.6979 0.5348 0.0042  -0.0672 -0.0396 47  LEU C CB  
3307 C CG  . LEU C 45  ? 0.4444 0.7192 0.5578 0.0046  -0.0667 -0.0390 47  LEU C CG  
3308 C CD1 . LEU C 45  ? 0.5128 0.7788 0.6300 0.0023  -0.0668 -0.0363 47  LEU C CD1 
3309 C CD2 . LEU C 45  ? 0.5814 0.8609 0.6944 0.0079  -0.0700 -0.0453 47  LEU C CD2 
3310 N N   . ALA C 46  ? 0.3590 0.6317 0.4646 0.0026  -0.0591 -0.0276 48  ALA C N   
3311 C CA  . ALA C 46  ? 0.3676 0.6374 0.4655 0.0029  -0.0577 -0.0245 48  ALA C CA  
3312 C C   . ALA C 46  ? 0.3925 0.6577 0.4884 0.0022  -0.0569 -0.0238 48  ALA C C   
3313 O O   . ALA C 46  ? 0.4394 0.7004 0.5381 0.0014  -0.0558 -0.0227 48  ALA C O   
3314 C CB  . ALA C 46  ? 0.2992 0.5663 0.3952 0.0037  -0.0559 -0.0216 48  ALA C CB  
3315 N N   . CYS C 47  ? 0.3839 0.6507 0.4747 0.0022  -0.0576 -0.0237 49  CYS C N   
3316 C CA  . CYS C 47  ? 0.3570 0.6208 0.4461 0.0020  -0.0573 -0.0234 49  CYS C CA  
3317 C C   . CYS C 47  ? 0.3155 0.5774 0.3970 0.0009  -0.0567 -0.0198 49  CYS C C   
3318 O O   . CYS C 47  ? 0.2884 0.5531 0.3655 0.0001  -0.0578 -0.0181 49  CYS C O   
3319 C CB  . CYS C 47  ? 0.4014 0.6717 0.4930 0.0034  -0.0596 -0.0282 49  CYS C CB  
3320 S SG  . CYS C 47  ? 0.6179 0.8865 0.7183 0.0048  -0.0624 -0.0333 49  CYS C SG  
3321 N N   . GLY C 48  ? 0.2735 0.5303 0.3532 0.0006  -0.0559 -0.0183 50  GLY C N   
3322 C CA  . GLY C 48  ? 0.2570 0.5114 0.3297 -0.0008 -0.0559 -0.0148 50  GLY C CA  
3323 C C   . GLY C 48  ? 0.3006 0.5554 0.3743 -0.0006 -0.0560 -0.0160 50  GLY C C   
3324 O O   . GLY C 48  ? 0.2644 0.5136 0.3409 0.0000  -0.0553 -0.0163 50  GLY C O   
3325 N N   . VAL C 49  ? 0.3173 0.5800 0.3890 -0.0011 -0.0573 -0.0166 51  VAL C N   
3326 C CA  . VAL C 49  ? 0.3175 0.5823 0.3905 0.0000  -0.0579 -0.0183 51  VAL C CA  
3327 C C   . VAL C 49  ? 0.3045 0.5747 0.3719 -0.0022 -0.0585 -0.0153 51  VAL C C   
3328 O O   . VAL C 49  ? 0.3134 0.5918 0.3777 -0.0045 -0.0594 -0.0134 51  VAL C O   
3329 C CB  . VAL C 49  ? 0.3449 0.6170 0.4241 0.0035  -0.0596 -0.0247 51  VAL C CB  
3330 C CG1 . VAL C 49  ? 0.3845 0.6705 0.4634 0.0037  -0.0605 -0.0270 51  VAL C CG1 
3331 C CG2 . VAL C 49  ? 0.3506 0.6239 0.4313 0.0058  -0.0611 -0.0273 51  VAL C CG2 
3332 N N   . ALA C 50  ? 0.3102 0.5759 0.3764 -0.0022 -0.0584 -0.0141 52  ALA C N   
3333 C CA  . ALA C 50  ? 0.3147 0.5862 0.3766 -0.0045 -0.0592 -0.0113 52  ALA C CA  
3334 C C   . ALA C 50  ? 0.3655 0.6459 0.4317 -0.0012 -0.0602 -0.0158 52  ALA C C   
3335 O O   . ALA C 50  ? 0.3153 0.5899 0.3861 0.0023  -0.0606 -0.0195 52  ALA C O   
3336 C CB  . ALA C 50  ? 0.3399 0.5993 0.3964 -0.0068 -0.0590 -0.0065 52  ALA C CB  
3337 N N   . LYS C 51  ? 0.3767 0.6720 0.4416 -0.0024 -0.0610 -0.0155 53  LYS C N   
3338 C CA  . LYS C 51  ? 0.4354 0.7418 0.5039 0.0014  -0.0622 -0.0200 53  LYS C CA  
3339 C C   . LYS C 51  ? 0.4747 0.7883 0.5389 -0.0026 -0.0625 -0.0150 53  LYS C C   
3340 O O   . LYS C 51  ? 0.5317 0.8543 0.5919 -0.0077 -0.0627 -0.0105 53  LYS C O   
3341 C CB  . LYS C 51  ? 0.4095 0.7336 0.4818 0.0050  -0.0630 -0.0261 53  LYS C CB  
3342 C CG  . LYS C 51  ? 0.5082 0.8263 0.5838 0.0075  -0.0631 -0.0300 53  LYS C CG  
3343 C CD  . LYS C 51  ? 0.6320 0.9657 0.7121 0.0130  -0.0648 -0.0382 53  LYS C CD  
3344 C CE  . LYS C 51  ? 0.6607 0.9853 0.7447 0.0158  -0.0659 -0.0426 53  LYS C CE  
3345 N NZ  . LYS C 51  ? 0.7482 1.0754 0.8299 0.0121  -0.0644 -0.0395 53  LYS C NZ  
3346 N N   . VAL C 52  ? 0.4433 0.7522 0.5080 -0.0011 -0.0632 -0.0152 54  VAL C N   
3347 C CA  . VAL C 52  ? 0.4566 0.7730 0.5180 -0.0047 -0.0639 -0.0109 54  VAL C CA  
3348 C C   . VAL C 52  ? 0.4392 0.7733 0.5060 0.0010  -0.0651 -0.0173 54  VAL C C   
3349 O O   . VAL C 52  ? 0.4243 0.7536 0.4960 0.0075  -0.0662 -0.0237 54  VAL C O   
3350 C CB  . VAL C 52  ? 0.4136 0.7118 0.4711 -0.0067 -0.0641 -0.0065 54  VAL C CB  
3351 C CG1 . VAL C 52  ? 0.5803 0.8845 0.6335 -0.0118 -0.0655 -0.0009 54  VAL C CG1 
3352 C CG2 . VAL C 52  ? 0.6047 0.8857 0.6581 -0.0092 -0.0630 -0.0031 54  VAL C CG2 
3353 N N   . LEU C 53  ? 0.4405 0.7962 0.5067 -0.0015 -0.0654 -0.0158 55  LEU C N   
3354 C CA  . LEU C 53  ? 0.4275 0.8050 0.4988 0.0044  -0.0664 -0.0225 55  LEU C CA  
3355 C C   . LEU C 53  ? 0.4250 0.8163 0.4938 -0.0008 -0.0669 -0.0168 55  LEU C C   
3356 O O   . LEU C 53  ? 0.4278 0.8204 0.4913 -0.0096 -0.0667 -0.0084 55  LEU C O   
3357 C CB  . LEU C 53  ? 0.4960 0.8926 0.5687 0.0055  -0.0657 -0.0260 55  LEU C CB  
3358 C CG  . LEU C 53  ? 0.5994 1.0136 0.6783 0.0153  -0.0669 -0.0371 55  LEU C CG  
3359 C CD1 . LEU C 53  ? 0.6510 1.0451 0.7340 0.0229  -0.0690 -0.0444 55  LEU C CD1 
3360 C CD2 . LEU C 53  ? 0.5620 0.9959 0.6403 0.0143  -0.0659 -0.0385 55  LEU C CD2 
3361 N N   . TRP C 54  ? 0.3721 0.7717 0.4446 0.0043  -0.0683 -0.0208 56  TRP C N   
3362 C CA  . TRP C 54  ? 0.3666 0.7837 0.4381 -0.0001 -0.0690 -0.0162 56  TRP C CA  
3363 C C   . TRP C 54  ? 0.3900 0.8256 0.4681 0.0092  -0.0705 -0.0248 56  TRP C C   
3364 O O   . TRP C 54  ? 0.3498 0.7775 0.4322 0.0186  -0.0720 -0.0336 56  TRP C O   
3365 C CB  . TRP C 54  ? 0.3607 0.7582 0.4271 -0.0066 -0.0698 -0.0080 56  TRP C CB  
3366 C CG  . TRP C 54  ? 0.3771 0.7550 0.4452 -0.0008 -0.0710 -0.0114 56  TRP C CG  
3367 C CD1 . TRP C 54  ? 0.3591 0.7407 0.4289 0.0015  -0.0729 -0.0120 56  TRP C CD1 
3368 C CD2 . TRP C 54  ? 0.3527 0.7050 0.4206 0.0024  -0.0707 -0.0136 56  TRP C CD2 
3369 N NE1 . TRP C 54  ? 0.3451 0.7045 0.4156 0.0061  -0.0741 -0.0147 56  TRP C NE1 
3370 C CE2 . TRP C 54  ? 0.4071 0.7490 0.4764 0.0063  -0.0727 -0.0153 56  TRP C CE2 
3371 C CE3 . TRP C 54  ? 0.3477 0.6865 0.4145 0.0023  -0.0692 -0.0141 56  TRP C CE3 
3372 C CZ2 . TRP C 54  ? 0.3781 0.6966 0.4473 0.0091  -0.0733 -0.0165 56  TRP C CZ2 
3373 C CZ3 . TRP C 54  ? 0.4863 0.8032 0.5537 0.0053  -0.0695 -0.0158 56  TRP C CZ3 
3374 C CH2 . TRP C 54  ? 0.3785 0.6859 0.4470 0.0084  -0.0716 -0.0167 56  TRP C CH2 
3375 N N   . MET C 55  ? 0.3999 0.8598 0.4787 0.0064  -0.0709 -0.0221 57  MET C N   
3376 C CA  . MET C 55  ? 0.4372 0.9181 0.5222 0.0154  -0.0726 -0.0303 57  MET C CA  
3377 C C   . MET C 55  ? 0.4262 0.8964 0.5107 0.0142  -0.0745 -0.0267 57  MET C C   
3378 O O   . MET C 55  ? 0.4668 0.9353 0.5467 0.0041  -0.0741 -0.0167 57  MET C O   
3379 C CB  . MET C 55  ? 0.4786 0.9998 0.5654 0.0134  -0.0715 -0.0299 57  MET C CB  
3380 C CG  . MET C 55  ? 0.3654 0.9036 0.4526 0.0150  -0.0698 -0.0338 57  MET C CG  
3381 S SD  . MET C 55  ? 0.4874 1.0204 0.5804 0.0312  -0.0716 -0.0499 57  MET C SD  
3382 C CE  . MET C 55  ? 0.3763 0.9324 0.4761 0.0424  -0.0747 -0.0592 57  MET C CE  
3383 N N   . GLN C 56  ? 0.4049 0.8660 0.4938 0.0242  -0.0773 -0.0346 58  GLN C N   
3384 C CA  . GLN C 56  ? 0.4550 0.9113 0.5443 0.0245  -0.0796 -0.0325 58  GLN C CA  
3385 C C   . GLN C 56  ? 0.4224 0.9097 0.5186 0.0335  -0.0817 -0.0409 58  GLN C C   
3386 O O   . GLN C 56  ? 0.4444 0.9319 0.5457 0.0456  -0.0846 -0.0519 58  GLN C O   
3387 C CB  . GLN C 56  ? 0.4923 0.9151 0.5811 0.0287  -0.0820 -0.0344 58  GLN C CB  
3388 C CG  . GLN C 56  ? 0.4777 0.8841 0.5625 0.0232  -0.0830 -0.0269 58  GLN C CG  
3389 C CD  . GLN C 56  ? 0.7195 1.1101 0.7962 0.0113  -0.0802 -0.0161 58  GLN C CD  
3390 O OE1 . GLN C 56  ? 0.6145 0.9849 0.6880 0.0094  -0.0786 -0.0147 58  GLN C OE1 
3391 N NE2 . GLN C 56  ? 0.6610 1.0606 0.7345 0.0035  -0.0803 -0.0086 58  GLN C NE2 
3392 N N   . GLY C 57  ? 0.4459 0.9608 0.5423 0.0277  -0.0805 -0.0358 59  GLY C N   
3393 C CA  . GLY C 57  ? 0.4276 0.9793 0.5307 0.0359  -0.0817 -0.0438 59  GLY C CA  
3394 C C   . GLY C 57  ? 0.4380 1.0064 0.5437 0.0428  -0.0806 -0.0524 59  GLY C C   
3395 O O   . GLY C 57  ? 0.4630 1.0343 0.5648 0.0352  -0.0773 -0.0473 59  GLY C O   
3396 N N   . SER C 58  ? 0.4633 1.0409 0.5751 0.0578  -0.0839 -0.0661 60  SER C N   
3397 C CA  . SER C 58  ? 0.5044 1.0970 0.6185 0.0659  -0.0837 -0.0760 60  SER C CA  
3398 C C   . SER C 58  ? 0.5034 1.0626 0.6159 0.0695  -0.0852 -0.0802 60  SER C C   
3399 O O   . SER C 58  ? 0.4714 1.0395 0.5859 0.0772  -0.0860 -0.0894 60  SER C O   
3400 C CB  . SER C 58  ? 0.5313 1.1498 0.6526 0.0818  -0.0877 -0.0904 60  SER C CB  
3401 O OG  . SER C 58  ? 0.5293 1.1208 0.6532 0.0916  -0.0937 -0.0974 60  SER C OG  
3402 N N   . GLN C 59  ? 0.4658 0.9881 0.5750 0.0643  -0.0859 -0.0737 61  GLN C N   
3403 C CA  . GLN C 59  ? 0.4649 0.9548 0.5733 0.0674  -0.0880 -0.0770 61  GLN C CA  
3404 C C   . GLN C 59  ? 0.4241 0.8965 0.5264 0.0551  -0.0833 -0.0666 61  GLN C C   
3405 O O   . GLN C 59  ? 0.3905 0.8527 0.4880 0.0446  -0.0809 -0.0554 61  GLN C O   
3406 C CB  . GLN C 59  ? 0.5208 0.9822 0.6301 0.0710  -0.0928 -0.0775 61  GLN C CB  
3407 C CG  . GLN C 59  ? 0.5877 1.0162 0.6968 0.0738  -0.0960 -0.0804 61  GLN C CG  
3408 C CD  . GLN C 59  ? 0.7179 1.1452 0.8327 0.0885  -0.1037 -0.0942 61  GLN C CD  
3409 O OE1 . GLN C 59  ? 0.8144 1.2333 0.9304 0.0929  -0.1061 -0.1005 61  GLN C OE1 
3410 N NE2 . GLN C 59  ? 0.8742 1.3095 0.9926 0.0963  -0.1084 -0.0993 61  GLN C NE2 
3411 N N   . GLN C 60  ? 0.3789 0.8470 0.4811 0.0572  -0.0829 -0.0707 62  GLN C N   
3412 C CA  . GLN C 60  ? 0.4137 0.8646 0.5108 0.0474  -0.0792 -0.0624 62  GLN C CA  
3413 C C   . GLN C 60  ? 0.4068 0.8215 0.5028 0.0468  -0.0810 -0.0605 62  GLN C C   
3414 O O   . GLN C 60  ? 0.4435 0.8465 0.5434 0.0556  -0.0858 -0.0683 62  GLN C O   
3415 C CB  . GLN C 60  ? 0.4156 0.8771 0.5134 0.0500  -0.0782 -0.0679 62  GLN C CB  
3416 C CG  . GLN C 60  ? 0.4156 0.8650 0.5080 0.0394  -0.0743 -0.0586 62  GLN C CG  
3417 C CD  . GLN C 60  ? 0.5917 1.0531 0.6844 0.0412  -0.0734 -0.0631 62  GLN C CD  
3418 O OE1 . GLN C 60  ? 0.7262 1.1998 0.8232 0.0514  -0.0760 -0.0743 62  GLN C OE1 
3419 N NE2 . GLN C 60  ? 0.5737 1.0316 0.6618 0.0318  -0.0702 -0.0548 62  GLN C NE2 
3420 N N   . CYS C 61  ? 0.3744 0.7718 0.4650 0.0367  -0.0779 -0.0500 63  CYS C N   
3421 C CA  . CYS C 61  ? 0.3535 0.7194 0.4426 0.0352  -0.0789 -0.0473 63  CYS C CA  
3422 C C   . CYS C 61  ? 0.3716 0.7279 0.4570 0.0288  -0.0754 -0.0425 63  CYS C C   
3423 O O   . CYS C 61  ? 0.3422 0.7110 0.4243 0.0226  -0.0723 -0.0375 63  CYS C O   
3424 C CB  . CYS C 61  ? 0.3821 0.7360 0.4680 0.0308  -0.0790 -0.0403 63  CYS C CB  
3425 S SG  . CYS C 61  ? 0.5266 0.8925 0.6177 0.0401  -0.0840 -0.0475 63  CYS C SG  
3426 N N   . LYS C 62  ? 0.3176 0.6531 0.4041 0.0303  -0.0766 -0.0440 64  LYS C N   
3427 C CA  . LYS C 62  ? 0.3257 0.6534 0.4101 0.0260  -0.0739 -0.0412 64  LYS C CA  
3428 C C   . LYS C 62  ? 0.3064 0.6081 0.3894 0.0232  -0.0738 -0.0372 64  LYS C C   
3429 O O   . LYS C 62  ? 0.2480 0.5375 0.3341 0.0272  -0.0775 -0.0403 64  LYS C O   
3430 C CB  . LYS C 62  ? 0.3698 0.7080 0.4587 0.0321  -0.0756 -0.0499 64  LYS C CB  
3431 C CG  . LYS C 62  ? 0.5443 0.8770 0.6318 0.0283  -0.0732 -0.0479 64  LYS C CG  
3432 C CD  . LYS C 62  ? 0.5983 0.9369 0.6907 0.0356  -0.0763 -0.0576 64  LYS C CD  
3433 C CE  . LYS C 62  ? 0.7451 1.0921 0.8359 0.0326  -0.0736 -0.0569 64  LYS C CE  
3434 N NZ  . LYS C 62  ? 0.7504 1.1050 0.8457 0.0403  -0.0772 -0.0672 64  LYS C NZ  
3435 N N   . GLN C 63  ? 0.3191 0.6130 0.3972 0.0162  -0.0702 -0.0300 65  GLN C N   
3436 C CA  . GLN C 63  ? 0.3339 0.6076 0.4108 0.0137  -0.0693 -0.0266 65  GLN C CA  
3437 C C   . GLN C 63  ? 0.3565 0.6311 0.4330 0.0115  -0.0670 -0.0261 65  GLN C C   
3438 O O   . GLN C 63  ? 0.3666 0.6479 0.4391 0.0075  -0.0647 -0.0224 65  GLN C O   
3439 C CB  . GLN C 63  ? 0.3262 0.5891 0.3971 0.0085  -0.0674 -0.0190 65  GLN C CB  
3440 C CG  . GLN C 63  ? 0.3279 0.5735 0.3971 0.0060  -0.0659 -0.0155 65  GLN C CG  
3441 C CD  . GLN C 63  ? 0.3913 0.6262 0.4548 0.0026  -0.0648 -0.0095 65  GLN C CD  
3442 O OE1 . GLN C 63  ? 0.4652 0.7036 0.5247 0.0009  -0.0649 -0.0070 65  GLN C OE1 
3443 N NE2 . GLN C 63  ? 0.4044 0.6270 0.4672 0.0013  -0.0640 -0.0072 65  GLN C NE2 
3444 N N   . THR C 64  ? 0.3339 0.6018 0.4148 0.0140  -0.0685 -0.0299 66  THR C N   
3445 C CA  . THR C 64  ? 0.3366 0.6037 0.4178 0.0121  -0.0667 -0.0294 66  THR C CA  
3446 C C   . THR C 64  ? 0.3268 0.5780 0.4065 0.0085  -0.0650 -0.0243 66  THR C C   
3447 O O   . THR C 64  ? 0.3394 0.5800 0.4210 0.0090  -0.0668 -0.0239 66  THR C O   
3448 C CB  . THR C 64  ? 0.3574 0.6290 0.4445 0.0170  -0.0698 -0.0370 66  THR C CB  
3449 O OG1 . THR C 64  ? 0.4761 0.7656 0.5641 0.0211  -0.0710 -0.0423 66  THR C OG1 
3450 C CG2 . THR C 64  ? 0.4565 0.7276 0.5440 0.0149  -0.0680 -0.0364 66  THR C CG2 
3451 N N   . SER C 65  ? 0.3045 0.5549 0.3805 0.0050  -0.0619 -0.0204 67  SER C N   
3452 C CA  . SER C 65  ? 0.2656 0.5045 0.3396 0.0022  -0.0597 -0.0159 67  SER C CA  
3453 C C   . SER C 65  ? 0.3297 0.5702 0.4049 0.0014  -0.0582 -0.0161 67  SER C C   
3454 O O   . SER C 65  ? 0.3424 0.5882 0.4141 0.0003  -0.0573 -0.0149 67  SER C O   
3455 C CB  . SER C 65  ? 0.2967 0.5320 0.3635 -0.0005 -0.0579 -0.0107 67  SER C CB  
3456 O OG  . SER C 65  ? 0.3480 0.5812 0.4135 -0.0002 -0.0592 -0.0099 67  SER C OG  
3457 N N   . GLU C 66  ? 0.2740 0.5098 0.3539 0.0016  -0.0587 -0.0171 68  GLU C N   
3458 C CA  . GLU C 66  ? 0.3457 0.5823 0.4272 0.0007  -0.0572 -0.0167 68  GLU C CA  
3459 C C   . GLU C 66  ? 0.3512 0.5829 0.4284 -0.0013 -0.0541 -0.0119 68  GLU C C   
3460 O O   . GLU C 66  ? 0.3736 0.5993 0.4495 -0.0024 -0.0534 -0.0091 68  GLU C O   
3461 C CB  . GLU C 66  ? 0.3371 0.5710 0.4256 0.0009  -0.0595 -0.0190 68  GLU C CB  
3462 C CG  . GLU C 66  ? 0.3924 0.6325 0.4851 0.0036  -0.0624 -0.0247 68  GLU C CG  
3463 C CD  . GLU C 66  ? 0.5406 0.7758 0.6399 0.0034  -0.0658 -0.0267 68  GLU C CD  
3464 O OE1 . GLU C 66  ? 0.4206 0.6577 0.5229 0.0022  -0.0654 -0.0269 68  GLU C OE1 
3465 O OE2 . GLU C 66  ? 0.3970 0.6259 0.4986 0.0041  -0.0697 -0.0279 68  GLU C OE2 
3466 N N   . TYR C 67  ? 0.3918 0.6261 0.4663 -0.0013 -0.0529 -0.0113 69  TYR C N   
3467 C CA  . TYR C 67  ? 0.3625 0.5928 0.4326 -0.0016 -0.0508 -0.0082 69  TYR C CA  
3468 C C   . TYR C 67  ? 0.3587 0.5916 0.4325 -0.0010 -0.0496 -0.0088 69  TYR C C   
3469 O O   . TYR C 67  ? 0.3850 0.6165 0.4570 -0.0006 -0.0476 -0.0070 69  TYR C O   
3470 C CB  . TYR C 67  ? 0.3702 0.5994 0.4329 -0.0016 -0.0516 -0.0067 69  TYR C CB  
3471 C CG  . TYR C 67  ? 0.4147 0.6410 0.4728 -0.0027 -0.0524 -0.0050 69  TYR C CG  
3472 C CD1 . TYR C 67  ? 0.3037 0.5356 0.3612 -0.0037 -0.0543 -0.0055 69  TYR C CD1 
3473 C CD2 . TYR C 67  ? 0.3831 0.6028 0.4374 -0.0028 -0.0514 -0.0027 69  TYR C CD2 
3474 C CE1 . TYR C 67  ? 0.4011 0.6319 0.4552 -0.0049 -0.0552 -0.0038 69  TYR C CE1 
3475 C CE2 . TYR C 67  ? 0.4487 0.6657 0.4989 -0.0039 -0.0525 -0.0011 69  TYR C CE2 
3476 C CZ  . TYR C 67  ? 0.4085 0.6311 0.4590 -0.0050 -0.0545 -0.0016 69  TYR C CZ  
3477 O OH  . TYR C 67  ? 0.3992 0.6209 0.4463 -0.0063 -0.0557 0.0001  69  TYR C OH  
3478 N N   . LEU C 68  ? 0.3459 0.5838 0.4248 -0.0007 -0.0509 -0.0116 70  LEU C N   
3479 C CA  . LEU C 68  ? 0.3688 0.6105 0.4519 -0.0003 -0.0503 -0.0124 70  LEU C CA  
3480 C C   . LEU C 68  ? 0.3891 0.6341 0.4795 -0.0009 -0.0523 -0.0155 70  LEU C C   
3481 O O   . LEU C 68  ? 0.3888 0.6369 0.4796 0.0001  -0.0544 -0.0186 70  LEU C O   
3482 C CB  . LEU C 68  ? 0.3102 0.5543 0.3897 0.0011  -0.0509 -0.0129 70  LEU C CB  
3483 C CG  . LEU C 68  ? 0.3622 0.6114 0.4463 0.0021  -0.0510 -0.0144 70  LEU C CG  
3484 C CD1 . LEU C 68  ? 0.3721 0.6221 0.4579 0.0029  -0.0486 -0.0130 70  LEU C CD1 
3485 C CD2 . LEU C 68  ? 0.2617 0.5122 0.3415 0.0032  -0.0530 -0.0147 70  LEU C CD2 
3486 N N   . ARG C 69  ? 0.3873 0.6326 0.4835 -0.0024 -0.0522 -0.0147 71  ARG C N   
3487 C CA  . ARG C 69  ? 0.4208 0.6680 0.5239 -0.0031 -0.0552 -0.0178 71  ARG C CA  
3488 C C   . ARG C 69  ? 0.5053 0.7562 0.6135 -0.0050 -0.0543 -0.0160 71  ARG C C   
3489 O O   . ARG C 69  ? 0.4975 0.7475 0.6077 -0.0078 -0.0533 -0.0123 71  ARG C O   
3490 C CB  . ARG C 69  ? 0.4678 0.7092 0.5736 -0.0041 -0.0586 -0.0186 71  ARG C CB  
3491 C CG  . ARG C 69  ? 0.4399 0.6816 0.5521 -0.0036 -0.0634 -0.0232 71  ARG C CG  
3492 C CD  . ARG C 69  ? 0.5236 0.7570 0.6395 -0.0057 -0.0678 -0.0225 71  ARG C CD  
3493 N NE  . ARG C 69  ? 0.4967 0.7253 0.6089 -0.0038 -0.0689 -0.0231 71  ARG C NE  
3494 C CZ  . ARG C 69  ? 0.4393 0.6592 0.5530 -0.0055 -0.0726 -0.0214 71  ARG C CZ  
3495 N NH1 . ARG C 69  ? 0.4550 0.6699 0.5734 -0.0100 -0.0757 -0.0181 71  ARG C NH1 
3496 N NH2 . ARG C 69  ? 0.4617 0.6782 0.5720 -0.0031 -0.0735 -0.0224 71  ARG C NH2 
3497 N N   . TYR C 70  ? 0.4776 0.7340 0.5875 -0.0035 -0.0546 -0.0183 72  TYR C N   
3498 C CA  . TYR C 70  ? 0.5080 0.7706 0.6220 -0.0042 -0.0533 -0.0172 72  TYR C CA  
3499 C C   . TYR C 70  ? 0.4945 0.7605 0.6135 -0.0040 -0.0565 -0.0209 72  TYR C C   
3500 O O   . TYR C 70  ? 0.5151 0.7822 0.6314 -0.0016 -0.0578 -0.0241 72  TYR C O   
3501 C CB  . TYR C 70  ? 0.4714 0.7367 0.5800 -0.0011 -0.0505 -0.0163 72  TYR C CB  
3502 C CG  . TYR C 70  ? 0.5542 0.8276 0.6673 -0.0003 -0.0498 -0.0164 72  TYR C CG  
3503 C CD1 . TYR C 70  ? 0.4949 0.7741 0.6106 -0.0011 -0.0471 -0.0137 72  TYR C CD1 
3504 C CD2 . TYR C 70  ? 0.4334 0.7103 0.5484 0.0012  -0.0519 -0.0193 72  TYR C CD2 
3505 C CE1 . TYR C 70  ? 0.6598 0.9490 0.7804 0.0000  -0.0464 -0.0141 72  TYR C CE1 
3506 C CE2 . TYR C 70  ? 0.5909 0.8758 0.7106 0.0021  -0.0515 -0.0195 72  TYR C CE2 
3507 C CZ  . TYR C 70  ? 0.5761 0.8674 0.6988 0.0017  -0.0488 -0.0171 72  TYR C CZ  
3508 O OH  . TYR C 70  ? 0.7085 1.0098 0.8362 0.0031  -0.0485 -0.0176 72  TYR C OH  
3509 N N   . GLU C 71  ? 0.5414 0.8099 0.6677 -0.0070 -0.0582 -0.0202 73  GLU C N   
3510 C CA  . GLU C 71  ? 0.5312 0.8031 0.6625 -0.0069 -0.0616 -0.0239 73  GLU C CA  
3511 C C   . GLU C 71  ? 0.5426 0.8224 0.6799 -0.0091 -0.0606 -0.0215 73  GLU C C   
3512 O O   . GLU C 71  ? 0.5524 0.8354 0.6910 -0.0113 -0.0578 -0.0171 73  GLU C O   
3513 C CB  . GLU C 71  ? 0.5541 0.8197 0.6891 -0.0084 -0.0670 -0.0267 73  GLU C CB  
3514 C CG  . GLU C 71  ? 0.6807 0.9483 0.8167 -0.0056 -0.0708 -0.0330 73  GLU C CG  
3515 C CD  . GLU C 71  ? 0.8161 1.0767 0.9552 -0.0056 -0.0773 -0.0373 73  GLU C CD  
3516 O OE1 . GLU C 71  ? 0.8695 1.1222 1.0096 -0.0079 -0.0791 -0.0348 73  GLU C OE1 
3517 O OE2 . GLU C 71  ? 0.8587 1.1215 0.9989 -0.0028 -0.0811 -0.0433 73  GLU C OE2 
3518 N N   . ASP C 72  ? 0.4883 0.7729 0.6292 -0.0082 -0.0628 -0.0245 74  ASP C N   
3519 C CA  . ASP C 72  ? 0.5270 0.8211 0.6735 -0.0094 -0.0618 -0.0227 74  ASP C CA  
3520 C C   . ASP C 72  ? 0.4988 0.7963 0.6489 -0.0086 -0.0654 -0.0267 74  ASP C C   
3521 O O   . ASP C 72  ? 0.5128 0.8076 0.6588 -0.0056 -0.0671 -0.0308 74  ASP C O   
3522 C CB  . ASP C 72  ? 0.5277 0.8269 0.6696 -0.0055 -0.0573 -0.0213 74  ASP C CB  
3523 C CG  . ASP C 72  ? 0.5929 0.9032 0.7404 -0.0068 -0.0551 -0.0184 74  ASP C CG  
3524 O OD1 . ASP C 72  ? 0.5509 0.8644 0.7045 -0.0122 -0.0556 -0.0151 74  ASP C OD1 
3525 O OD2 . ASP C 72  ? 0.7218 1.0383 0.8677 -0.0023 -0.0532 -0.0192 74  ASP C OD2 
3526 N N   . THR C 73  ? 0.5368 0.8412 0.6947 -0.0117 -0.0669 -0.0255 75  THR C N   
3527 C CA  . THR C 73  ? 0.4929 0.8018 0.6544 -0.0108 -0.0703 -0.0291 75  THR C CA  
3528 C C   . THR C 73  ? 0.4662 0.7855 0.6287 -0.0082 -0.0672 -0.0278 75  THR C C   
3529 O O   . THR C 73  ? 0.4281 0.7546 0.5937 -0.0096 -0.0642 -0.0240 75  THR C O   
3530 C CB  . THR C 73  ? 0.5535 0.8621 0.7236 -0.0164 -0.0755 -0.0288 75  THR C CB  
3531 O OG1 . THR C 73  ? 0.5457 0.8429 0.7146 -0.0184 -0.0790 -0.0296 75  THR C OG1 
3532 C CG2 . THR C 73  ? 0.5555 0.8674 0.7286 -0.0152 -0.0798 -0.0335 75  THR C CG2 
3533 N N   . LEU C 74  ? 0.4681 0.7891 0.6277 -0.0042 -0.0684 -0.0312 76  LEU C N   
3534 C CA  . LEU C 74  ? 0.4090 0.7376 0.5679 -0.0002 -0.0666 -0.0307 76  LEU C CA  
3535 C C   . LEU C 74  ? 0.4163 0.7549 0.5833 -0.0011 -0.0690 -0.0316 76  LEU C C   
3536 O O   . LEU C 74  ? 0.3960 0.7338 0.5663 -0.0034 -0.0731 -0.0341 76  LEU C O   
3537 C CB  . LEU C 74  ? 0.3919 0.7152 0.5415 0.0044  -0.0670 -0.0326 76  LEU C CB  
3538 C CG  . LEU C 74  ? 0.2779 0.5922 0.4190 0.0052  -0.0651 -0.0317 76  LEU C CG  
3539 C CD1 . LEU C 74  ? 0.2762 0.5875 0.4091 0.0085  -0.0665 -0.0322 76  LEU C CD1 
3540 C CD2 . LEU C 74  ? 0.4038 0.7173 0.5442 0.0053  -0.0612 -0.0285 76  LEU C CD2 
3541 N N   . LEU C 75  ? 0.4287 0.7768 0.5981 0.0017  -0.0669 -0.0303 77  LEU C N   
3542 C CA  . LEU C 75  ? 0.4568 0.8167 0.6344 0.0014  -0.0689 -0.0309 77  LEU C CA  
3543 C C   . LEU C 75  ? 0.4373 0.8014 0.6121 0.0081  -0.0695 -0.0328 77  LEU C C   
3544 O O   . LEU C 75  ? 0.4158 0.7776 0.5846 0.0131  -0.0674 -0.0325 77  LEU C O   
3545 C CB  . LEU C 75  ? 0.4894 0.8616 0.6753 -0.0021 -0.0664 -0.0271 77  LEU C CB  
3546 C CG  . LEU C 75  ? 0.5409 0.9115 0.7316 -0.0103 -0.0669 -0.0235 77  LEU C CG  
3547 C CD1 . LEU C 75  ? 0.5815 0.9693 0.7804 -0.0135 -0.0644 -0.0190 77  LEU C CD1 
3548 C CD2 . LEU C 75  ? 0.6089 0.9732 0.8036 -0.0153 -0.0730 -0.0253 77  LEU C CD2 
3549 N N   . LEU C 76  ? 0.4425 0.8123 0.6218 0.0084  -0.0731 -0.0347 78  LEU C N   
3550 C CA  . LEU C 76  ? 0.4445 0.8208 0.6237 0.0145  -0.0743 -0.0360 78  LEU C CA  
3551 C C   . LEU C 76  ? 0.4726 0.8651 0.6608 0.0152  -0.0721 -0.0347 78  LEU C C   
3552 O O   . LEU C 76  ? 0.4885 0.8889 0.6848 0.0090  -0.0710 -0.0324 78  LEU C O   
3553 C CB  . LEU C 76  ? 0.4482 0.8246 0.6280 0.0146  -0.0792 -0.0385 78  LEU C CB  
3554 C CG  . LEU C 76  ? 0.4647 0.8291 0.6350 0.0147  -0.0817 -0.0399 78  LEU C CG  
3555 C CD1 . LEU C 76  ? 0.5490 0.9162 0.7217 0.0130  -0.0861 -0.0423 78  LEU C CD1 
3556 C CD2 . LEU C 76  ? 0.5160 0.8740 0.6769 0.0201  -0.0823 -0.0393 78  LEU C CD2 
3557 N N   . GLU C 77  ? 0.4943 0.8925 0.6811 0.0228  -0.0720 -0.0362 79  GLU C N   
3558 C CA  . GLU C 77  ? 0.5028 0.9201 0.6986 0.0252  -0.0705 -0.0361 79  GLU C CA  
3559 C C   . GLU C 77  ? 0.4369 0.8651 0.6429 0.0205  -0.0733 -0.0358 79  GLU C C   
3560 O O   . GLU C 77  ? 0.4253 0.8703 0.6410 0.0173  -0.0715 -0.0338 79  GLU C O   
3561 C CB  . GLU C 77  ? 0.5582 0.9779 0.7502 0.0358  -0.0720 -0.0394 79  GLU C CB  
3562 C CG  . GLU C 77  ? 0.6500 1.0692 0.8365 0.0418  -0.0687 -0.0400 79  GLU C CG  
3563 C CD  . GLU C 77  ? 0.7700 1.1957 0.9556 0.0531  -0.0714 -0.0443 79  GLU C CD  
3564 O OE1 . GLU C 77  ? 0.7678 1.1795 0.9457 0.0584  -0.0767 -0.0464 79  GLU C OE1 
3565 O OE2 . GLU C 77  ? 0.8250 1.2705 1.0176 0.0569  -0.0686 -0.0455 79  GLU C OE2 
3566 N N   . ASP C 78  ? 0.4198 0.8394 0.6236 0.0197  -0.0779 -0.0377 80  ASP C N   
3567 C CA  . ASP C 78  ? 0.4393 0.8679 0.6520 0.0156  -0.0815 -0.0381 80  ASP C CA  
3568 C C   . ASP C 78  ? 0.4174 0.8447 0.6357 0.0056  -0.0823 -0.0358 80  ASP C C   
3569 O O   . ASP C 78  ? 0.4199 0.8512 0.6445 0.0015  -0.0864 -0.0364 80  ASP C O   
3570 C CB  . ASP C 78  ? 0.4425 0.8632 0.6500 0.0189  -0.0866 -0.0411 80  ASP C CB  
3571 C CG  . ASP C 78  ? 0.3726 0.8053 0.5891 0.0176  -0.0906 -0.0421 80  ASP C CG  
3572 O OD1 . ASP C 78  ? 0.2758 0.7250 0.5009 0.0194  -0.0895 -0.0415 80  ASP C OD1 
3573 O OD2 . ASP C 78  ? 0.4208 0.8476 0.6360 0.0148  -0.0948 -0.0437 80  ASP C OD2 
3574 N N   . GLN C 79  ? 0.4439 0.8652 0.6598 0.0019  -0.0791 -0.0333 81  GLN C N   
3575 C CA  . GLN C 79  ? 0.4396 0.8571 0.6599 -0.0072 -0.0805 -0.0308 81  GLN C CA  
3576 C C   . GLN C 79  ? 0.3968 0.8266 0.6235 -0.0117 -0.0767 -0.0256 81  GLN C C   
3577 O O   . GLN C 79  ? 0.4299 0.8524 0.6534 -0.0149 -0.0746 -0.0230 81  GLN C O   
3578 C CB  . GLN C 79  ? 0.4097 0.8086 0.6206 -0.0076 -0.0804 -0.0320 81  GLN C CB  
3579 C CG  . GLN C 79  ? 0.4316 0.8187 0.6368 -0.0063 -0.0847 -0.0365 81  GLN C CG  
3580 C CD  . GLN C 79  ? 0.5987 0.9709 0.7965 -0.0075 -0.0843 -0.0372 81  GLN C CD  
3581 O OE1 . GLN C 79  ? 0.6087 0.9747 0.7981 -0.0034 -0.0810 -0.0372 81  GLN C OE1 
3582 N NE2 . GLN C 79  ? 0.6333 0.9996 0.8343 -0.0129 -0.0884 -0.0381 81  GLN C NE2 
3583 N N   . PRO C 80  ? 0.3905 0.8405 0.6264 -0.0122 -0.0759 -0.0237 82  PRO C N   
3584 C CA  . PRO C 80  ? 0.4149 0.8800 0.6555 -0.0154 -0.0713 -0.0186 82  PRO C CA  
3585 C C   . PRO C 80  ? 0.4360 0.9016 0.6825 -0.0277 -0.0727 -0.0122 82  PRO C C   
3586 O O   . PRO C 80  ? 0.4509 0.9262 0.6987 -0.0309 -0.0686 -0.0073 82  PRO C O   
3587 C CB  . PRO C 80  ? 0.3778 0.8666 0.6267 -0.0118 -0.0704 -0.0190 82  PRO C CB  
3588 C CG  . PRO C 80  ? 0.4087 0.8957 0.6627 -0.0140 -0.0767 -0.0212 82  PRO C CG  
3589 C CD  . PRO C 80  ? 0.4257 0.8876 0.6683 -0.0102 -0.0791 -0.0258 82  PRO C CD  
3590 N N   . THR C 81  ? 0.4145 0.8695 0.6638 -0.0345 -0.0792 -0.0121 83  THR C N   
3591 C CA  . THR C 81  ? 0.4082 0.8603 0.6625 -0.0463 -0.0826 -0.0060 83  THR C CA  
3592 C C   . THR C 81  ? 0.4653 0.8944 0.7106 -0.0468 -0.0833 -0.0068 83  THR C C   
3593 O O   . THR C 81  ? 0.4776 0.8987 0.7249 -0.0556 -0.0872 -0.0024 83  THR C O   
3594 C CB  . THR C 81  ? 0.4340 0.8871 0.6970 -0.0539 -0.0905 -0.0053 83  THR C CB  
3595 O OG1 . THR C 81  ? 0.4232 0.8573 0.6803 -0.0497 -0.0953 -0.0123 83  THR C OG1 
3596 C CG2 . THR C 81  ? 0.3207 0.7982 0.5930 -0.0529 -0.0896 -0.0045 83  THR C CG2 
3597 N N   . GLY C 82  ? 0.4714 0.8898 0.7067 -0.0375 -0.0802 -0.0122 84  GLY C N   
3598 C CA  . GLY C 82  ? 0.5181 0.9202 0.7449 -0.0366 -0.0788 -0.0126 84  GLY C CA  
3599 C C   . GLY C 82  ? 0.5605 0.9423 0.7818 -0.0359 -0.0840 -0.0174 84  GLY C C   
3600 O O   . GLY C 82  ? 0.5256 0.9047 0.7468 -0.0331 -0.0877 -0.0224 84  GLY C O   
3601 N N   . GLU C 83  ? 0.6360 1.0052 0.8530 -0.0383 -0.0843 -0.0158 85  GLU C N   
3602 C CA  . GLU C 83  ? 0.7097 1.0603 0.9193 -0.0356 -0.0874 -0.0208 85  GLU C CA  
3603 C C   . GLU C 83  ? 0.7350 1.0766 0.9475 -0.0380 -0.0961 -0.0250 85  GLU C C   
3604 O O   . GLU C 83  ? 0.6989 1.0289 0.9051 -0.0336 -0.0985 -0.0311 85  GLU C O   
3605 C CB  . GLU C 83  ? 0.7399 1.0812 0.9463 -0.0388 -0.0865 -0.0171 85  GLU C CB  
3606 C CG  . GLU C 83  ? 0.7708 1.1241 0.9786 -0.0414 -0.0802 -0.0101 85  GLU C CG  
3607 C CD  . GLU C 83  ? 0.7478 1.1015 0.9471 -0.0334 -0.0731 -0.0118 85  GLU C CD  
3608 O OE1 . GLU C 83  ? 0.8125 1.1525 1.0040 -0.0297 -0.0733 -0.0152 85  GLU C OE1 
3609 O OE2 . GLU C 83  ? 0.7218 1.0897 0.9220 -0.0308 -0.0680 -0.0101 85  GLU C OE2 
3610 N N   . ASN C 84  ? 0.7977 1.1452 1.0194 -0.0452 -0.1010 -0.0220 86  ASN C N   
3611 C CA  . ASN C 84  ? 0.8477 1.1872 1.0725 -0.0473 -0.1102 -0.0265 86  ASN C CA  
3612 C C   . ASN C 84  ? 0.8479 1.1965 1.0744 -0.0432 -0.1107 -0.0309 86  ASN C C   
3613 O O   . ASN C 84  ? 0.8740 1.2150 1.0975 -0.0397 -0.1157 -0.0379 86  ASN C O   
3614 C CB  . ASN C 84  ? 0.8723 1.2099 1.1057 -0.0582 -0.1176 -0.0208 86  ASN C CB  
3615 C CG  . ASN C 84  ? 0.8949 1.2123 1.1264 -0.0596 -0.1275 -0.0252 86  ASN C CG  
3616 O OD1 . ASN C 84  ? 0.9309 1.2363 1.1582 -0.0599 -0.1283 -0.0243 86  ASN C OD1 
3617 N ND2 . ASN C 84  ? 0.9046 1.2180 1.1390 -0.0598 -0.1356 -0.0305 86  ASN C ND2 
3618 N N   . GLU C 85  ? 0.8544 1.2201 1.0857 -0.0434 -0.1060 -0.0272 87  GLU C N   
3619 C CA  . GLU C 85  ? 0.8404 1.2151 1.0728 -0.0387 -0.1062 -0.0311 87  GLU C CA  
3620 C C   . GLU C 85  ? 0.8244 1.1889 1.0467 -0.0306 -0.1063 -0.0386 87  GLU C C   
3621 O O   . GLU C 85  ? 0.8153 1.1776 1.0298 -0.0250 -0.1006 -0.0391 87  GLU C O   
3622 C CB  . GLU C 85  ? 0.8493 1.2418 1.0842 -0.0356 -0.0991 -0.0277 87  GLU C CB  
3623 C CG  . GLU C 85  ? 0.7910 1.1924 1.0267 -0.0300 -0.0996 -0.0316 87  GLU C CG  
3624 C CD  . GLU C 85  ? 0.8563 1.2772 1.0971 -0.0275 -0.0946 -0.0284 87  GLU C CD  
3625 O OE1 . GLU C 85  ? 0.7890 1.2200 1.0345 -0.0313 -0.0910 -0.0230 87  GLU C OE1 
3626 O OE2 . GLU C 85  ? 0.8050 1.2318 1.0452 -0.0214 -0.0948 -0.0316 87  GLU C OE2 
3627 N N   . MET C 86  ? 0.8197 1.1785 1.0421 -0.0304 -0.1132 -0.0441 88  MET C N   
3628 C CA  . MET C 86  ? 0.8143 1.1682 1.0277 -0.0231 -0.1136 -0.0510 88  MET C CA  
3629 C C   . MET C 86  ? 0.7860 1.1507 0.9970 -0.0179 -0.1085 -0.0503 88  MET C C   
3630 O O   . MET C 86  ? 0.8008 1.1770 1.0183 -0.0193 -0.1065 -0.0463 88  MET C O   
3631 C CB  . MET C 86  ? 0.8549 1.2051 1.0700 -0.0236 -0.1222 -0.0572 88  MET C CB  
3632 C CG  . MET C 86  ? 0.9147 1.2507 1.1293 -0.0259 -0.1291 -0.0608 88  MET C CG  
3633 S SD  . MET C 86  ? 0.9256 1.2530 1.1279 -0.0176 -0.1284 -0.0688 88  MET C SD  
3634 C CE  . MET C 86  ? 0.9222 1.2334 1.1263 -0.0198 -0.1390 -0.0740 88  MET C CE  
3635 N N   . VAL C 87  ? 0.7552 1.1167 0.9567 -0.0119 -0.1069 -0.0539 89  VAL C N   
3636 C CA  . VAL C 87  ? 0.7248 1.0939 0.9228 -0.0070 -0.1037 -0.0530 89  VAL C CA  
3637 C C   . VAL C 87  ? 0.7174 1.0869 0.9104 -0.0039 -0.1077 -0.0581 89  VAL C C   
3638 O O   . VAL C 87  ? 0.7103 1.0738 0.8970 -0.0025 -0.1095 -0.0622 89  VAL C O   
3639 C CB  . VAL C 87  ? 0.6917 1.0575 0.8822 -0.0034 -0.0974 -0.0502 89  VAL C CB  
3640 C CG1 . VAL C 87  ? 0.6844 1.0393 0.8690 -0.0039 -0.0966 -0.0516 89  VAL C CG1 
3641 C CG2 . VAL C 87  ? 0.6159 0.9843 0.7993 0.0021  -0.0966 -0.0506 89  VAL C CG2 
3642 N N   . ILE C 88  ? 0.7413 1.1197 0.9377 -0.0027 -0.1093 -0.0578 90  ILE C N   
3643 C CA  . ILE C 88  ? 0.7344 1.1151 0.9266 -0.0003 -0.1136 -0.0620 90  ILE C CA  
3644 C C   . ILE C 88  ? 0.7113 1.0927 0.8944 0.0044  -0.1110 -0.0603 90  ILE C C   
3645 O O   . ILE C 88  ? 0.6865 1.0732 0.8714 0.0066  -0.1101 -0.0573 90  ILE C O   
3646 C CB  . ILE C 88  ? 0.7471 1.1365 0.9485 -0.0025 -0.1184 -0.0627 90  ILE C CB  
3647 C CG1 . ILE C 88  ? 0.7580 1.1438 0.9662 -0.0077 -0.1236 -0.0654 90  ILE C CG1 
3648 C CG2 . ILE C 88  ? 0.7281 1.1221 0.9246 0.0010  -0.1217 -0.0654 90  ILE C CG2 
3649 C CD1 . ILE C 88  ? 0.7732 1.1514 0.9748 -0.0063 -0.1283 -0.0724 90  ILE C CD1 
3650 N N   . MET C 89  ? 0.7114 1.0877 0.8848 0.0059  -0.1104 -0.0621 91  MET C N   
3651 C CA  . MET C 89  ? 0.7265 1.1027 0.8905 0.0089  -0.1089 -0.0595 91  MET C CA  
3652 C C   . MET C 89  ? 0.7589 1.1408 0.9186 0.0100  -0.1134 -0.0616 91  MET C C   
3653 O O   . MET C 89  ? 0.7631 1.1468 0.9195 0.0096  -0.1159 -0.0662 91  MET C O   
3654 C CB  . MET C 89  ? 0.6893 1.0592 0.8448 0.0092  -0.1057 -0.0590 91  MET C CB  
3655 C CG  . MET C 89  ? 0.6474 1.0112 0.8049 0.0086  -0.1010 -0.0560 91  MET C CG  
3656 S SD  . MET C 89  ? 0.6156 0.9734 0.7618 0.0094  -0.0978 -0.0542 91  MET C SD  
3657 C CE  . MET C 89  ? 0.4140 0.7742 0.5518 0.0112  -0.0999 -0.0505 91  MET C CE  
3658 N N   . ARG C 90  ? 0.7831 1.1683 0.9427 0.0119  -0.1148 -0.0585 92  ARG C N   
3659 C CA  . ARG C 90  ? 0.8019 1.1926 0.9573 0.0128  -0.1196 -0.0592 92  ARG C CA  
3660 C C   . ARG C 90  ? 0.7903 1.1783 0.9349 0.0141  -0.1198 -0.0546 92  ARG C C   
3661 O O   . ARG C 90  ? 0.7821 1.1642 0.9254 0.0155  -0.1175 -0.0506 92  ARG C O   
3662 C CB  . ARG C 90  ? 0.8116 1.2084 0.9760 0.0136  -0.1227 -0.0593 92  ARG C CB  
3663 C CG  . ARG C 90  ? 0.8561 1.2534 1.0192 0.0171  -0.1240 -0.0550 92  ARG C CG  
3664 C CD  . ARG C 90  ? 0.9616 1.3665 1.1362 0.0185  -0.1259 -0.0555 92  ARG C CD  
3665 N NE  . ARG C 90  ? 1.0501 1.4611 1.2320 0.0152  -0.1283 -0.0595 92  ARG C NE  
3666 C CZ  . ARG C 90  ? 1.0334 1.4459 1.2243 0.0119  -0.1265 -0.0608 92  ARG C CZ  
3667 N NH1 . ARG C 90  ? 0.9912 1.4011 1.1851 0.0117  -0.1215 -0.0584 92  ARG C NH1 
3668 N NH2 . ARG C 90  ? 0.9645 1.3807 1.1612 0.0087  -0.1304 -0.0644 92  ARG C NH2 
3669 N N   . PRO C 91  ? 0.8109 1.2035 0.9476 0.0133  -0.1233 -0.0549 93  PRO C N   
3670 C CA  . PRO C 91  ? 0.8312 1.2217 0.9567 0.0129  -0.1247 -0.0493 93  PRO C CA  
3671 C C   . PRO C 91  ? 0.8411 1.2266 0.9667 0.0152  -0.1276 -0.0443 93  PRO C C   
3672 O O   . PRO C 91  ? 0.8484 1.2356 0.9825 0.0177  -0.1289 -0.0458 93  PRO C O   
3673 C CB  . PRO C 91  ? 0.8351 1.2352 0.9545 0.0113  -0.1287 -0.0511 93  PRO C CB  
3674 C CG  . PRO C 91  ? 0.7751 1.1803 0.9004 0.0114  -0.1281 -0.0588 93  PRO C CG  
3675 C CD  . PRO C 91  ? 0.8070 1.2076 0.9444 0.0125  -0.1266 -0.0604 93  PRO C CD  
3676 N N   . GLY C 92  ? 0.8574 1.2375 0.9735 0.0144  -0.1295 -0.0387 94  GLY C N   
3677 C CA  . GLY C 92  ? 0.8750 1.2504 0.9910 0.0173  -0.1343 -0.0351 94  GLY C CA  
3678 C C   . GLY C 92  ? 0.8836 1.2482 0.9990 0.0202  -0.1332 -0.0324 94  GLY C C   
3679 O O   . GLY C 92  ? 0.8983 1.2562 1.0065 0.0207  -0.1388 -0.0275 94  GLY C O   
3680 N N   . ASN C 93  ? 0.8628 1.2261 0.9852 0.0217  -0.1270 -0.0353 95  ASN C N   
3681 C CA  . ASN C 93  ? 0.8607 1.2153 0.9838 0.0252  -0.1249 -0.0339 95  ASN C CA  
3682 C C   . ASN C 93  ? 0.8465 1.1965 0.9678 0.0231  -0.1186 -0.0338 95  ASN C C   
3683 O O   . ASN C 93  ? 0.8469 1.2012 0.9690 0.0195  -0.1150 -0.0359 95  ASN C O   
3684 C CB  . ASN C 93  ? 0.8751 1.2346 1.0096 0.0302  -0.1236 -0.0373 95  ASN C CB  
3685 C CG  . ASN C 93  ? 0.8891 1.2604 1.0326 0.0291  -0.1241 -0.0409 95  ASN C CG  
3686 O OD1 . ASN C 93  ? 0.8383 1.2132 0.9832 0.0313  -0.1293 -0.0409 95  ASN C OD1 
3687 N ND2 . ASN C 93  ? 0.7998 1.1763 0.9495 0.0257  -0.1195 -0.0439 95  ASN C ND2 
3688 N N   . LYS C 94  ? 0.8035 1.1447 0.9226 0.0261  -0.1178 -0.0319 96  LYS C N   
3689 C CA  . LYS C 94  ? 0.7475 1.0829 0.8638 0.0245  -0.1127 -0.0312 96  LYS C CA  
3690 C C   . LYS C 94  ? 0.6731 1.0118 0.7983 0.0255  -0.1060 -0.0344 96  LYS C C   
3691 O O   . LYS C 94  ? 0.6650 1.0045 0.7952 0.0300  -0.1053 -0.0355 96  LYS C O   
3692 C CB  . LYS C 94  ? 0.7784 1.1017 0.8873 0.0273  -0.1160 -0.0276 96  LYS C CB  
3693 C CG  . LYS C 94  ? 0.8092 1.1249 0.9067 0.0227  -0.1186 -0.0224 96  LYS C CG  
3694 C CD  . LYS C 94  ? 0.9094 1.2126 0.9995 0.0255  -0.1263 -0.0184 96  LYS C CD  
3695 C CE  . LYS C 94  ? 0.9485 1.2405 1.0296 0.0228  -0.1270 -0.0142 96  LYS C CE  
3696 N NZ  . LYS C 94  ? 0.9516 1.2358 1.0219 0.0184  -0.1354 -0.0072 96  LYS C NZ  
3697 N N   . TYR C 95  ? 0.5861 0.9268 0.7125 0.0216  -0.1016 -0.0358 97  TYR C N   
3698 C CA  . TYR C 95  ? 0.5216 0.8636 0.6550 0.0214  -0.0960 -0.0376 97  TYR C CA  
3699 C C   . TYR C 95  ? 0.4502 0.7841 0.5792 0.0215  -0.0921 -0.0357 97  TYR C C   
3700 O O   . TYR C 95  ? 0.4038 0.7325 0.5259 0.0185  -0.0909 -0.0343 97  TYR C O   
3701 C CB  . TYR C 95  ? 0.5181 0.8667 0.6582 0.0178  -0.0945 -0.0409 97  TYR C CB  
3702 C CG  . TYR C 95  ? 0.5903 0.9471 0.7360 0.0176  -0.0982 -0.0433 97  TYR C CG  
3703 C CD1 . TYR C 95  ? 0.6123 0.9762 0.7685 0.0181  -0.0978 -0.0447 97  TYR C CD1 
3704 C CD2 . TYR C 95  ? 0.5658 0.9247 0.7063 0.0165  -0.1020 -0.0440 97  TYR C CD2 
3705 C CE1 . TYR C 95  ? 0.7268 1.0981 0.8883 0.0176  -0.1014 -0.0468 97  TYR C CE1 
3706 C CE2 . TYR C 95  ? 0.6982 1.0643 0.8434 0.0164  -0.1055 -0.0464 97  TYR C CE2 
3707 C CZ  . TYR C 95  ? 0.7349 1.1067 0.8907 0.0170  -0.1053 -0.0478 97  TYR C CZ  
3708 O OH  . TYR C 95  ? 0.7453 1.1245 0.9062 0.0166  -0.1092 -0.0501 97  TYR C OH  
3709 N N   . GLU C 96  ? 0.4339 0.7681 0.5669 0.0252  -0.0903 -0.0358 98  GLU C N   
3710 C CA  . GLU C 96  ? 0.4490 0.7752 0.5768 0.0261  -0.0875 -0.0341 98  GLU C CA  
3711 C C   . GLU C 96  ? 0.4653 0.7960 0.6002 0.0250  -0.0817 -0.0350 98  GLU C C   
3712 O O   . GLU C 96  ? 0.4527 0.7915 0.5949 0.0276  -0.0803 -0.0360 98  GLU C O   
3713 C CB  . GLU C 96  ? 0.4549 0.7759 0.5786 0.0323  -0.0908 -0.0334 98  GLU C CB  
3714 C CG  . GLU C 96  ? 0.4435 0.7564 0.5583 0.0328  -0.0977 -0.0310 98  GLU C CG  
3715 C CD  . GLU C 96  ? 0.6344 0.9404 0.7456 0.0398  -0.1026 -0.0311 98  GLU C CD  
3716 O OE1 . GLU C 96  ? 0.6951 1.0016 0.8087 0.0446  -0.0999 -0.0332 98  GLU C OE1 
3717 O OE2 . GLU C 96  ? 0.7776 1.0775 0.8833 0.0409  -0.1098 -0.0292 98  GLU C OE2 
3718 N N   . TYR C 97  ? 0.4275 0.7541 0.5604 0.0211  -0.0788 -0.0343 99  TYR C N   
3719 C CA  . TYR C 97  ? 0.4042 0.7330 0.5423 0.0193  -0.0741 -0.0341 99  TYR C CA  
3720 C C   . TYR C 97  ? 0.3589 0.6802 0.4904 0.0213  -0.0718 -0.0323 99  TYR C C   
3721 O O   . TYR C 97  ? 0.3170 0.6301 0.4413 0.0196  -0.0719 -0.0311 99  TYR C O   
3722 C CB  . TYR C 97  ? 0.3868 0.7142 0.5265 0.0142  -0.0733 -0.0349 99  TYR C CB  
3723 C CG  . TYR C 97  ? 0.4926 0.8263 0.6391 0.0117  -0.0759 -0.0374 99  TYR C CG  
3724 C CD1 . TYR C 97  ? 0.5423 0.8795 0.6972 0.0081  -0.0751 -0.0378 99  TYR C CD1 
3725 C CD2 . TYR C 97  ? 0.5197 0.8552 0.6637 0.0125  -0.0797 -0.0391 99  TYR C CD2 
3726 C CE1 . TYR C 97  ? 0.5164 0.8579 0.6773 0.0056  -0.0785 -0.0403 99  TYR C CE1 
3727 C CE2 . TYR C 97  ? 0.6180 0.9590 0.7680 0.0104  -0.0825 -0.0419 99  TYR C CE2 
3728 C CZ  . TYR C 97  ? 0.4972 0.8407 0.6557 0.0071  -0.0820 -0.0427 99  TYR C CZ  
3729 O OH  . TYR C 97  ? 0.6287 0.9760 0.7929 0.0049  -0.0857 -0.0457 99  TYR C OH  
3730 N N   . LYS C 98  ? 0.3291 0.6544 0.4631 0.0250  -0.0698 -0.0323 100 LYS C N   
3731 C CA  . LYS C 98  ? 0.2861 0.6045 0.4136 0.0274  -0.0678 -0.0312 100 LYS C CA  
3732 C C   . LYS C 98  ? 0.3094 0.6255 0.4373 0.0226  -0.0636 -0.0295 100 LYS C C   
3733 O O   . LYS C 98  ? 0.3146 0.6374 0.4501 0.0187  -0.0616 -0.0292 100 LYS C O   
3734 C CB  . LYS C 98  ? 0.3186 0.6441 0.4485 0.0335  -0.0667 -0.0326 100 LYS C CB  
3735 C CG  . LYS C 98  ? 0.3900 0.7152 0.5180 0.0401  -0.0718 -0.0347 100 LYS C CG  
3736 C CD  . LYS C 98  ? 0.5721 0.9085 0.7044 0.0470  -0.0704 -0.0373 100 LYS C CD  
3737 C CE  . LYS C 98  ? 0.7436 1.0802 0.8750 0.0545  -0.0764 -0.0402 100 LYS C CE  
3738 N NZ  . LYS C 98  ? 0.7734 1.1289 0.9145 0.0593  -0.0749 -0.0431 100 LYS C NZ  
3739 N N   . PHE C 99  ? 0.2644 0.5706 0.3842 0.0228  -0.0631 -0.0282 101 PHE C N   
3740 C CA  . PHE C 99  ? 0.3003 0.6036 0.4195 0.0194  -0.0595 -0.0266 101 PHE C CA  
3741 C C   . PHE C 99  ? 0.3114 0.6086 0.4235 0.0228  -0.0584 -0.0258 101 PHE C C   
3742 O O   . PHE C 99  ? 0.2954 0.5865 0.4009 0.0270  -0.0617 -0.0263 101 PHE C O   
3743 C CB  . PHE C 99  ? 0.2635 0.5610 0.3804 0.0149  -0.0604 -0.0262 101 PHE C CB  
3744 C CG  . PHE C 99  ? 0.2722 0.5614 0.3797 0.0156  -0.0631 -0.0254 101 PHE C CG  
3745 C CD1 . PHE C 99  ? 0.3108 0.5920 0.4112 0.0158  -0.0623 -0.0235 101 PHE C CD1 
3746 C CD2 . PHE C 99  ? 0.3260 0.6159 0.4315 0.0152  -0.0669 -0.0259 101 PHE C CD2 
3747 C CE1 . PHE C 99  ? 0.2393 0.5135 0.3313 0.0152  -0.0654 -0.0218 101 PHE C CE1 
3748 C CE2 . PHE C 99  ? 0.2106 0.4944 0.3073 0.0144  -0.0698 -0.0238 101 PHE C CE2 
3749 C CZ  . PHE C 99  ? 0.1958 0.4717 0.2860 0.0142  -0.0693 -0.0215 101 PHE C CZ  
3750 N N   . GLY C 100 ? 0.3215 0.6192 0.4343 0.0208  -0.0546 -0.0243 102 GLY C N   
3751 C CA  . GLY C 100 ? 0.2688 0.5607 0.3743 0.0240  -0.0536 -0.0238 102 GLY C CA  
3752 C C   . GLY C 100 ? 0.3745 0.6656 0.4806 0.0198  -0.0500 -0.0215 102 GLY C C   
3753 O O   . GLY C 100 ? 0.3847 0.6830 0.4981 0.0157  -0.0477 -0.0202 102 GLY C O   
3754 N N   . PHE C 101 ? 0.3752 0.6565 0.4733 0.0202  -0.0501 -0.0205 103 PHE C N   
3755 C CA  . PHE C 101 ? 0.3602 0.6404 0.4582 0.0167  -0.0469 -0.0182 103 PHE C CA  
3756 C C   . PHE C 101 ? 0.4017 0.6738 0.4906 0.0195  -0.0470 -0.0179 103 PHE C C   
3757 O O   . PHE C 101 ? 0.3896 0.6545 0.4719 0.0231  -0.0505 -0.0191 103 PHE C O   
3758 C CB  . PHE C 101 ? 0.2981 0.5743 0.3985 0.0113  -0.0477 -0.0173 103 PHE C CB  
3759 C CG  . PHE C 101 ? 0.2812 0.5498 0.3758 0.0113  -0.0509 -0.0180 103 PHE C CG  
3760 C CD1 . PHE C 101 ? 0.2931 0.5534 0.3800 0.0112  -0.0513 -0.0165 103 PHE C CD1 
3761 C CD2 . PHE C 101 ? 0.2788 0.5497 0.3753 0.0111  -0.0536 -0.0195 103 PHE C CD2 
3762 C CE1 . PHE C 101 ? 0.2950 0.5507 0.3769 0.0102  -0.0543 -0.0162 103 PHE C CE1 
3763 C CE2 . PHE C 101 ? 0.2606 0.5272 0.3516 0.0104  -0.0564 -0.0193 103 PHE C CE2 
3764 C CZ  . PHE C 101 ? 0.1973 0.4568 0.2811 0.0097  -0.0567 -0.0174 103 PHE C CZ  
3765 N N   . GLU C 102 ? 0.4634 0.7360 0.5516 0.0177  -0.0440 -0.0160 104 GLU C N   
3766 C CA  . GLU C 102 ? 0.4439 0.7097 0.5236 0.0204  -0.0440 -0.0159 104 GLU C CA  
3767 C C   . GLU C 102 ? 0.4434 0.7001 0.5199 0.0160  -0.0444 -0.0135 104 GLU C C   
3768 O O   . GLU C 102 ? 0.4444 0.7026 0.5260 0.0111  -0.0433 -0.0119 104 GLU C O   
3769 C CB  . GLU C 102 ? 0.5088 0.7839 0.5891 0.0228  -0.0403 -0.0158 104 GLU C CB  
3770 C CG  . GLU C 102 ? 0.6118 0.8898 0.6881 0.0310  -0.0417 -0.0197 104 GLU C CG  
3771 C CD  . GLU C 102 ? 0.8840 1.1802 0.9674 0.0337  -0.0386 -0.0211 104 GLU C CD  
3772 O OE1 . GLU C 102 ? 0.9411 1.2422 1.0214 0.0417  -0.0395 -0.0251 104 GLU C OE1 
3773 O OE2 . GLU C 102 ? 0.9211 1.2273 1.0131 0.0280  -0.0360 -0.0182 104 GLU C OE2 
3774 N N   . LEU C 103 ? 0.4026 0.6495 0.4706 0.0177  -0.0470 -0.0136 105 LEU C N   
3775 C CA  . LEU C 103 ? 0.3515 0.5912 0.4159 0.0141  -0.0474 -0.0115 105 LEU C CA  
3776 C C   . LEU C 103 ? 0.3902 0.6308 0.4529 0.0140  -0.0442 -0.0101 105 LEU C C   
3777 O O   . LEU C 103 ? 0.3362 0.5793 0.3958 0.0182  -0.0432 -0.0113 105 LEU C O   
3778 C CB  . LEU C 103 ? 0.3611 0.5908 0.4170 0.0150  -0.0518 -0.0112 105 LEU C CB  
3779 C CG  . LEU C 103 ? 0.2726 0.5020 0.3291 0.0139  -0.0554 -0.0114 105 LEU C CG  
3780 C CD1 . LEU C 103 ? 0.2931 0.5124 0.3406 0.0137  -0.0603 -0.0097 105 LEU C CD1 
3781 C CD2 . LEU C 103 ? 0.2705 0.5048 0.3325 0.0095  -0.0543 -0.0108 105 LEU C CD2 
3782 N N   . PRO C 104 ? 0.4318 0.6709 0.4964 0.0095  -0.0429 -0.0078 106 PRO C N   
3783 C CA  . PRO C 104 ? 0.4729 0.7130 0.5365 0.0081  -0.0402 -0.0054 106 PRO C CA  
3784 C C   . PRO C 104 ? 0.4842 0.7176 0.5381 0.0112  -0.0410 -0.0057 106 PRO C C   
3785 O O   . PRO C 104 ? 0.4645 0.6901 0.5128 0.0128  -0.0444 -0.0067 106 PRO C O   
3786 C CB  . PRO C 104 ? 0.4596 0.6959 0.5262 0.0034  -0.0410 -0.0035 106 PRO C CB  
3787 C CG  . PRO C 104 ? 0.5193 0.7518 0.5852 0.0035  -0.0440 -0.0053 106 PRO C CG  
3788 C CD  . PRO C 104 ? 0.4327 0.6690 0.4999 0.0061  -0.0448 -0.0075 106 PRO C CD  
3789 N N   . GLN C 105 ? 0.5551 0.7919 0.6068 0.0117  -0.0383 -0.0044 107 GLN C N   
3790 C CA  . GLN C 105 ? 0.5911 0.8228 0.6333 0.0156  -0.0391 -0.0055 107 GLN C CA  
3791 C C   . GLN C 105 ? 0.5957 0.8158 0.6321 0.0134  -0.0418 -0.0040 107 GLN C C   
3792 O O   . GLN C 105 ? 0.6118 0.8242 0.6400 0.0165  -0.0447 -0.0054 107 GLN C O   
3793 C CB  . GLN C 105 ? 0.6335 0.8743 0.6750 0.0160  -0.0352 -0.0041 107 GLN C CB  
3794 C CG  . GLN C 105 ? 0.6650 0.9195 0.7091 0.0205  -0.0328 -0.0066 107 GLN C CG  
3795 C CD  . GLN C 105 ? 0.6748 0.9254 0.7139 0.0283  -0.0362 -0.0120 107 GLN C CD  
3796 O OE1 . GLN C 105 ? 0.7872 1.0267 0.8174 0.0317  -0.0396 -0.0140 107 GLN C OE1 
3797 N NE2 . GLN C 105 ? 0.6333 0.8921 0.6778 0.0311  -0.0360 -0.0144 107 GLN C NE2 
3798 N N   . GLY C 106 ? 0.5986 0.8176 0.6392 0.0084  -0.0414 -0.0013 108 GLY C N   
3799 C CA  . GLY C 106 ? 0.6668 0.8783 0.7025 0.0062  -0.0427 0.0007  108 GLY C CA  
3800 C C   . GLY C 106 ? 0.6584 0.8612 0.6873 0.0074  -0.0468 -0.0002 108 GLY C C   
3801 O O   . GLY C 106 ? 0.6379 0.8390 0.6643 0.0104  -0.0490 -0.0024 108 GLY C O   
3802 N N   . PRO C 107 ? 0.6512 0.8485 0.6771 0.0046  -0.0485 0.0018  109 PRO C N   
3803 C CA  . PRO C 107 ? 0.6145 0.8069 0.6372 0.0033  -0.0527 0.0020  109 PRO C CA  
3804 C C   . PRO C 107 ? 0.6005 0.7991 0.6309 0.0009  -0.0523 0.0018  109 PRO C C   
3805 O O   . PRO C 107 ? 0.6340 0.8362 0.6696 -0.0010 -0.0508 0.0023  109 PRO C O   
3806 C CB  . PRO C 107 ? 0.6388 0.8256 0.6564 0.0011  -0.0543 0.0043  109 PRO C CB  
3807 C CG  . PRO C 107 ? 0.6268 0.8167 0.6477 0.0004  -0.0508 0.0053  109 PRO C CG  
3808 C CD  . PRO C 107 ? 0.6821 0.8781 0.7072 0.0024  -0.0473 0.0042  109 PRO C CD  
3809 N N   . LEU C 108 ? 0.5447 0.7447 0.5757 0.0015  -0.0543 0.0008  110 LEU C N   
3810 C CA  . LEU C 108 ? 0.5153 0.7218 0.5520 -0.0006 -0.0547 0.0003  110 LEU C CA  
3811 C C   . LEU C 108 ? 0.4911 0.6968 0.5239 -0.0039 -0.0581 0.0026  110 LEU C C   
3812 O O   . LEU C 108 ? 0.5180 0.7163 0.5434 -0.0046 -0.0612 0.0046  110 LEU C O   
3813 C CB  . LEU C 108 ? 0.5055 0.7137 0.5431 0.0010  -0.0561 -0.0010 110 LEU C CB  
3814 C CG  . LEU C 108 ? 0.5556 0.7624 0.5925 0.0053  -0.0554 -0.0030 110 LEU C CG  
3815 C CD1 . LEU C 108 ? 0.4649 0.6681 0.4980 0.0062  -0.0601 -0.0031 110 LEU C CD1 
3816 C CD2 . LEU C 108 ? 0.4778 0.6929 0.5232 0.0060  -0.0515 -0.0047 110 LEU C CD2 
3817 N N   . GLY C 109 ? 0.4477 0.6618 0.4854 -0.0060 -0.0581 0.0022  111 GLY C N   
3818 C CA  . GLY C 109 ? 0.3805 0.5980 0.4152 -0.0096 -0.0610 0.0047  111 GLY C CA  
3819 C C   . GLY C 109 ? 0.4493 0.6654 0.4800 -0.0111 -0.0646 0.0064  111 GLY C C   
3820 O O   . GLY C 109 ? 0.4553 0.6720 0.4885 -0.0089 -0.0640 0.0045  111 GLY C O   
3821 N N   . THR C 110 ? 0.4341 0.6485 0.4588 -0.0153 -0.0689 0.0105  112 THR C N   
3822 C CA  . THR C 110 ? 0.4940 0.7063 0.5145 -0.0178 -0.0738 0.0133  112 THR C CA  
3823 C C   . THR C 110 ? 0.5054 0.7327 0.5299 -0.0211 -0.0737 0.0141  112 THR C C   
3824 O O   . THR C 110 ? 0.5224 0.7613 0.5501 -0.0228 -0.0718 0.0140  112 THR C O   
3825 C CB  . THR C 110 ? 0.4849 0.6874 0.4966 -0.0220 -0.0800 0.0183  112 THR C CB  
3826 O OG1 . THR C 110 ? 0.5447 0.7347 0.5526 -0.0182 -0.0799 0.0165  112 THR C OG1 
3827 C CG2 . THR C 110 ? 0.5911 0.7876 0.5977 -0.0244 -0.0866 0.0215  112 THR C CG2 
3828 N N   . SER C 111 ? 0.4892 0.7171 0.5135 -0.0213 -0.0758 0.0145  113 SER C N   
3829 C CA  . SER C 111 ? 0.4766 0.7189 0.5032 -0.0246 -0.0764 0.0157  113 SER C CA  
3830 C C   . SER C 111 ? 0.4701 0.7204 0.4926 -0.0317 -0.0798 0.0216  113 SER C C   
3831 O O   . SER C 111 ? 0.5041 0.7452 0.5196 -0.0361 -0.0856 0.0271  113 SER C O   
3832 C CB  . SER C 111 ? 0.4583 0.6960 0.4827 -0.0246 -0.0801 0.0168  113 SER C CB  
3833 O OG  . SER C 111 ? 0.3636 0.6007 0.3936 -0.0188 -0.0766 0.0114  113 SER C OG  
3834 N N   . PHE C 112 ? 0.5000 0.7684 0.5272 -0.0327 -0.0768 0.0202  114 PHE C N   
3835 C CA  . PHE C 112 ? 0.5282 0.8095 0.5533 -0.0388 -0.0787 0.0249  114 PHE C CA  
3836 C C   . PHE C 112 ? 0.5460 0.8515 0.5760 -0.0391 -0.0762 0.0227  114 PHE C C   
3837 O O   . PHE C 112 ? 0.4600 0.7712 0.4963 -0.0330 -0.0722 0.0156  114 PHE C O   
3838 C CB  . PHE C 112 ? 0.5761 0.8533 0.6020 -0.0369 -0.0766 0.0234  114 PHE C CB  
3839 C CG  . PHE C 112 ? 0.6929 0.9777 0.7153 -0.0436 -0.0796 0.0293  114 PHE C CG  
3840 C CD1 . PHE C 112 ? 0.8649 1.1434 0.8798 -0.0514 -0.0862 0.0375  114 PHE C CD1 
3841 C CD2 . PHE C 112 ? 0.8454 1.1422 0.8720 -0.0419 -0.0767 0.0268  114 PHE C CD2 
3842 C CE1 . PHE C 112 ? 0.9687 1.2546 0.9805 -0.0586 -0.0895 0.0437  114 PHE C CE1 
3843 C CE2 . PHE C 112 ? 0.9081 1.2133 0.9319 -0.0481 -0.0794 0.0323  114 PHE C CE2 
3844 C CZ  . PHE C 112 ? 0.9414 1.2417 0.9580 -0.0569 -0.0856 0.0411  114 PHE C CZ  
3845 N N   . LYS C 113 ? 0.6179 0.9379 0.6446 -0.0466 -0.0793 0.0290  115 LYS C N   
3846 C CA  . LYS C 113 ? 0.6700 1.0173 0.7005 -0.0474 -0.0771 0.0274  115 LYS C CA  
3847 C C   . LYS C 113 ? 0.7058 1.0605 0.7323 -0.0552 -0.0802 0.0350  115 LYS C C   
3848 O O   . LYS C 113 ? 0.7287 1.0788 0.7487 -0.0638 -0.0858 0.0440  115 LYS C O   
3849 C CB  . LYS C 113 ? 0.7064 1.0683 0.7363 -0.0502 -0.0782 0.0289  115 LYS C CB  
3850 C CG  . LYS C 113 ? 0.7083 1.0773 0.7447 -0.0419 -0.0740 0.0195  115 LYS C CG  
3851 C CD  . LYS C 113 ? 0.7840 1.1335 0.8202 -0.0388 -0.0745 0.0177  115 LYS C CD  
3852 C CE  . LYS C 113 ? 0.7187 1.0650 0.7621 -0.0295 -0.0702 0.0077  115 LYS C CE  
3853 N NZ  . LYS C 113 ? 0.7395 1.1079 0.7881 -0.0254 -0.0678 0.0010  115 LYS C NZ  
3854 N N   . GLY C 114 ? 0.7214 1.0858 0.7517 -0.0524 -0.0775 0.0317  116 GLY C N   
3855 C CA  . GLY C 114 ? 0.7421 1.1104 0.7690 -0.0595 -0.0805 0.0387  116 GLY C CA  
3856 C C   . GLY C 114 ? 0.7515 1.1362 0.7838 -0.0555 -0.0772 0.0341  116 GLY C C   
3857 O O   . GLY C 114 ? 0.7409 1.1447 0.7792 -0.0494 -0.0736 0.0269  116 GLY C O   
3858 N N   . LYS C 115 ? 0.7434 1.1196 0.7733 -0.0585 -0.0792 0.0379  117 LYS C N   
3859 C CA  . LYS C 115 ? 0.7380 1.1309 0.7716 -0.0576 -0.0779 0.0366  117 LYS C CA  
3860 C C   . LYS C 115 ? 0.6933 1.0903 0.7345 -0.0458 -0.0731 0.0252  117 LYS C C   
3861 O O   . LYS C 115 ? 0.6722 1.0922 0.7186 -0.0413 -0.0708 0.0195  117 LYS C O   
3862 C CB  . LYS C 115 ? 0.7795 1.1555 0.8082 -0.0625 -0.0815 0.0425  117 LYS C CB  
3863 C CG  . LYS C 115 ? 0.8189 1.1615 0.8437 -0.0591 -0.0822 0.0411  117 LYS C CG  
3864 C CD  . LYS C 115 ? 0.8488 1.1742 0.8655 -0.0671 -0.0885 0.0495  117 LYS C CD  
3865 C CE  . LYS C 115 ? 0.9050 1.2285 0.9159 -0.0757 -0.0941 0.0574  117 LYS C CE  
3866 N NZ  . LYS C 115 ? 0.9250 1.2206 0.9274 -0.0792 -0.1007 0.0621  117 LYS C NZ  
3867 N N   . TYR C 116 ? 0.6602 1.0346 0.7017 -0.0408 -0.0723 0.0219  118 TYR C N   
3868 C CA  . TYR C 116 ? 0.6377 1.0111 0.6857 -0.0306 -0.0692 0.0124  118 TYR C CA  
3869 C C   . TYR C 116 ? 0.6142 0.9737 0.6639 -0.0253 -0.0674 0.0071  118 TYR C C   
3870 O O   . TYR C 116 ? 0.6381 0.9778 0.6884 -0.0212 -0.0665 0.0045  118 TYR C O   
3871 C CB  . TYR C 116 ? 0.5967 0.9561 0.6441 -0.0290 -0.0698 0.0126  118 TYR C CB  
3872 C CG  . TYR C 116 ? 0.5947 0.9671 0.6406 -0.0348 -0.0721 0.0181  118 TYR C CG  
3873 C CD1 . TYR C 116 ? 0.5315 0.9291 0.5829 -0.0316 -0.0715 0.0144  118 TYR C CD1 
3874 C CD2 . TYR C 116 ? 0.4118 0.7715 0.4506 -0.0431 -0.0754 0.0268  118 TYR C CD2 
3875 C CE1 . TYR C 116 ? 0.6474 1.0592 0.6979 -0.0373 -0.0736 0.0198  118 TYR C CE1 
3876 C CE2 . TYR C 116 ? 0.5129 0.8843 0.5503 -0.0492 -0.0781 0.0324  118 TYR C CE2 
3877 C CZ  . TYR C 116 ? 0.5613 0.9596 0.6049 -0.0466 -0.0769 0.0292  118 TYR C CZ  
3878 O OH  . TYR C 116 ? 0.6631 1.0751 0.7059 -0.0529 -0.0795 0.0350  118 TYR C OH  
3879 N N   . GLY C 117 ? 0.6291 1.0003 0.6794 -0.0260 -0.0670 0.0063  119 GLY C N   
3880 C CA  . GLY C 117 ? 0.6027 0.9657 0.6556 -0.0208 -0.0654 0.0007  119 GLY C CA  
3881 C C   . GLY C 117 ? 0.6009 0.9482 0.6495 -0.0245 -0.0662 0.0049  119 GLY C C   
3882 O O   . GLY C 117 ? 0.5975 0.9382 0.6397 -0.0316 -0.0689 0.0128  119 GLY C O   
3883 N N   . SER C 118 ? 0.5522 0.8921 0.6042 -0.0192 -0.0646 -0.0006 120 SER C N   
3884 C CA  . SER C 118 ? 0.4783 0.8076 0.5278 -0.0211 -0.0652 0.0016  120 SER C CA  
3885 C C   . SER C 118 ? 0.4432 0.7505 0.4936 -0.0174 -0.0640 -0.0005 120 SER C C   
3886 O O   . SER C 118 ? 0.4077 0.7094 0.4623 -0.0126 -0.0623 -0.0050 120 SER C O   
3887 C CB  . SER C 118 ? 0.4816 0.8266 0.5342 -0.0191 -0.0647 -0.0025 120 SER C CB  
3888 O OG  . SER C 118 ? 0.5525 0.8961 0.6117 -0.0115 -0.0629 -0.0111 120 SER C OG  
3889 N N   . VAL C 119 ? 0.4182 0.7144 0.4648 -0.0198 -0.0653 0.0030  121 VAL C N   
3890 C CA  . VAL C 119 ? 0.3414 0.6221 0.3897 -0.0160 -0.0638 0.0005  121 VAL C CA  
3891 C C   . VAL C 119 ? 0.2941 0.5772 0.3425 -0.0163 -0.0648 0.0004  121 VAL C C   
3892 O O   . VAL C 119 ? 0.2973 0.5827 0.3406 -0.0210 -0.0679 0.0053  121 VAL C O   
3893 C CB  . VAL C 119 ? 0.3559 0.6192 0.3988 -0.0170 -0.0647 0.0042  121 VAL C CB  
3894 C CG1 . VAL C 119 ? 0.2965 0.5486 0.3418 -0.0128 -0.0627 0.0014  121 VAL C CG1 
3895 C CG2 . VAL C 119 ? 0.4149 0.6768 0.4571 -0.0172 -0.0642 0.0048  121 VAL C CG2 
3896 N N   . ASP C 120 ? 0.2241 0.5075 0.2784 -0.0120 -0.0628 -0.0049 122 ASP C N   
3897 C CA  . ASP C 120 ? 0.2831 0.5696 0.3383 -0.0119 -0.0637 -0.0057 122 ASP C CA  
3898 C C   . ASP C 120 ? 0.2716 0.5479 0.3307 -0.0083 -0.0622 -0.0085 122 ASP C C   
3899 O O   . ASP C 120 ? 0.2373 0.5119 0.3018 -0.0052 -0.0601 -0.0126 122 ASP C O   
3900 C CB  . ASP C 120 ? 0.3162 0.6193 0.3759 -0.0102 -0.0633 -0.0105 122 ASP C CB  
3901 C CG  . ASP C 120 ? 0.5069 0.8257 0.5644 -0.0128 -0.0641 -0.0091 122 ASP C CG  
3902 O OD1 . ASP C 120 ? 0.6403 0.9699 0.7022 -0.0091 -0.0630 -0.0147 122 ASP C OD1 
3903 O OD2 . ASP C 120 ? 0.7031 1.0235 0.7545 -0.0185 -0.0663 -0.0023 122 ASP C OD2 
3904 N N   . TYR C 121 ? 0.2597 0.5298 0.3161 -0.0088 -0.0638 -0.0063 123 TYR C N   
3905 C CA  . TYR C 121 ? 0.2323 0.4970 0.2932 -0.0055 -0.0624 -0.0090 123 TYR C CA  
3906 C C   . TYR C 121 ? 0.2304 0.5020 0.2927 -0.0056 -0.0641 -0.0101 123 TYR C C   
3907 O O   . TYR C 121 ? 0.2535 0.5282 0.3109 -0.0085 -0.0672 -0.0066 123 TYR C O   
3908 C CB  . TYR C 121 ? 0.2292 0.4813 0.2861 -0.0045 -0.0630 -0.0066 123 TYR C CB  
3909 C CG  . TYR C 121 ? 0.2054 0.4503 0.2610 -0.0038 -0.0610 -0.0060 123 TYR C CG  
3910 C CD1 . TYR C 121 ? 0.1737 0.4149 0.2331 -0.0010 -0.0581 -0.0080 123 TYR C CD1 
3911 C CD2 . TYR C 121 ? 0.2012 0.4440 0.2514 -0.0064 -0.0624 -0.0029 123 TYR C CD2 
3912 C CE1 . TYR C 121 ? 0.1649 0.4001 0.2223 -0.0006 -0.0565 -0.0069 123 TYR C CE1 
3913 C CE2 . TYR C 121 ? 0.2442 0.4805 0.2929 -0.0058 -0.0608 -0.0024 123 TYR C CE2 
3914 C CZ  . TYR C 121 ? 0.2735 0.5059 0.3258 -0.0027 -0.0578 -0.0045 123 TYR C CZ  
3915 O OH  . TYR C 121 ? 0.3160 0.5424 0.3663 -0.0022 -0.0563 -0.0037 123 TYR C OH  
3916 N N   . TRP C 122 ? 0.2018 0.4757 0.2708 -0.0028 -0.0626 -0.0143 124 TRP C N   
3917 C CA  . TRP C 122 ? 0.1990 0.4801 0.2697 -0.0027 -0.0643 -0.0158 124 TRP C CA  
3918 C C   . TRP C 122 ? 0.2693 0.5488 0.3471 0.0001  -0.0630 -0.0194 124 TRP C C   
3919 O O   . TRP C 122 ? 0.2797 0.5548 0.3617 0.0014  -0.0608 -0.0210 124 TRP C O   
3920 C CB  . TRP C 122 ? 0.2832 0.5782 0.3544 -0.0037 -0.0650 -0.0181 124 TRP C CB  
3921 C CG  . TRP C 122 ? 0.3876 0.6865 0.4630 -0.0015 -0.0633 -0.0228 124 TRP C CG  
3922 C CD1 . TRP C 122 ? 0.3830 0.6866 0.4561 -0.0023 -0.0630 -0.0222 124 TRP C CD1 
3923 C CD2 . TRP C 122 ? 0.3975 0.6960 0.4803 0.0019  -0.0629 -0.0287 124 TRP C CD2 
3924 N NE1 . TRP C 122 ? 0.3322 0.6376 0.4105 0.0012  -0.0625 -0.0279 124 TRP C NE1 
3925 C CE2 . TRP C 122 ? 0.4429 0.7443 0.5270 0.0035  -0.0628 -0.0318 124 TRP C CE2 
3926 C CE3 . TRP C 122 ? 0.4230 0.7184 0.5114 0.0034  -0.0633 -0.0314 124 TRP C CE3 
3927 C CZ2 . TRP C 122 ? 0.4182 0.7178 0.5086 0.0069  -0.0640 -0.0376 124 TRP C CZ2 
3928 C CZ3 . TRP C 122 ? 0.4160 0.7102 0.5108 0.0057  -0.0641 -0.0365 124 TRP C CZ3 
3929 C CH2 . TRP C 122 ? 0.4511 0.7464 0.5466 0.0075  -0.0649 -0.0396 124 TRP C CH2 
3930 N N   . VAL C 123 ? 0.2588 0.5418 0.3378 0.0005  -0.0647 -0.0201 125 VAL C N   
3931 C CA  . VAL C 123 ? 0.3053 0.5897 0.3917 0.0026  -0.0641 -0.0236 125 VAL C CA  
3932 C C   . VAL C 123 ? 0.3298 0.6244 0.4183 0.0025  -0.0659 -0.0271 125 VAL C C   
3933 O O   . VAL C 123 ? 0.3419 0.6422 0.4257 0.0011  -0.0680 -0.0254 125 VAL C O   
3934 C CB  . VAL C 123 ? 0.3261 0.6067 0.4127 0.0041  -0.0649 -0.0220 125 VAL C CB  
3935 C CG1 . VAL C 123 ? 0.2287 0.5136 0.3238 0.0055  -0.0645 -0.0254 125 VAL C CG1 
3936 C CG2 . VAL C 123 ? 0.2200 0.4919 0.3040 0.0053  -0.0634 -0.0195 125 VAL C CG2 
3937 N N   . LYS C 124 ? 0.3179 0.6145 0.4132 0.0039  -0.0656 -0.0318 126 LYS C N   
3938 C CA  . LYS C 124 ? 0.3340 0.6395 0.4321 0.0050  -0.0678 -0.0368 126 LYS C CA  
3939 C C   . LYS C 124 ? 0.3430 0.6472 0.4479 0.0056  -0.0688 -0.0387 126 LYS C C   
3940 O O   . LYS C 124 ? 0.3490 0.6470 0.4590 0.0054  -0.0677 -0.0385 126 LYS C O   
3941 C CB  . LYS C 124 ? 0.3543 0.6606 0.4552 0.0066  -0.0682 -0.0415 126 LYS C CB  
3942 C CG  . LYS C 124 ? 0.5204 0.8385 0.6206 0.0087  -0.0705 -0.0470 126 LYS C CG  
3943 C CD  . LYS C 124 ? 0.6340 0.9593 0.7286 0.0086  -0.0696 -0.0462 126 LYS C CD  
3944 C CE  . LYS C 124 ? 0.7299 1.0533 0.8276 0.0117  -0.0703 -0.0511 126 LYS C CE  
3945 N NZ  . LYS C 124 ? 0.6128 0.9503 0.7070 0.0137  -0.0707 -0.0541 126 LYS C NZ  
3946 N N   . ALA C 125 ? 0.3631 0.6738 0.4678 0.0059  -0.0708 -0.0398 127 ALA C N   
3947 C CA  . ALA C 125 ? 0.4030 0.7146 0.5145 0.0064  -0.0724 -0.0421 127 ALA C CA  
3948 C C   . ALA C 125 ? 0.4681 0.7857 0.5826 0.0077  -0.0754 -0.0485 127 ALA C C   
3949 O O   . ALA C 125 ? 0.4982 0.8240 0.6081 0.0086  -0.0764 -0.0507 127 ALA C O   
3950 C CB  . ALA C 125 ? 0.3697 0.6839 0.4791 0.0063  -0.0735 -0.0394 127 ALA C CB  
3951 N N   . PHE C 126 ? 0.5063 0.8206 0.6283 0.0077  -0.0771 -0.0514 128 PHE C N   
3952 C CA  . PHE C 126 ? 0.5605 0.8784 0.6862 0.0093  -0.0814 -0.0583 128 PHE C CA  
3953 C C   . PHE C 126 ? 0.5885 0.9086 0.7194 0.0084  -0.0838 -0.0590 128 PHE C C   
3954 O O   . PHE C 126 ? 0.6166 0.9328 0.7527 0.0062  -0.0828 -0.0555 128 PHE C O   
3955 C CB  . PHE C 126 ? 0.5519 0.8616 0.6824 0.0094  -0.0835 -0.0610 128 PHE C CB  
3956 C CG  . PHE C 126 ? 0.5593 0.8647 0.6861 0.0098  -0.0810 -0.0592 128 PHE C CG  
3957 C CD1 . PHE C 126 ? 0.6376 0.9473 0.7607 0.0131  -0.0823 -0.0640 128 PHE C CD1 
3958 C CD2 . PHE C 126 ? 0.5903 0.8888 0.7174 0.0072  -0.0774 -0.0530 128 PHE C CD2 
3959 C CE1 . PHE C 126 ? 0.5718 0.8783 0.6919 0.0135  -0.0802 -0.0623 128 PHE C CE1 
3960 C CE2 . PHE C 126 ? 0.5670 0.8614 0.6904 0.0075  -0.0753 -0.0513 128 PHE C CE2 
3961 C CZ  . PHE C 126 ? 0.5555 0.8534 0.6757 0.0104  -0.0768 -0.0558 128 PHE C CZ  
3962 N N   . LEU C 127 ? 0.6324 0.9604 0.7619 0.0102  -0.0868 -0.0635 129 LEU C N   
3963 C CA  . LEU C 127 ? 0.6658 0.9967 0.8002 0.0096  -0.0899 -0.0651 129 LEU C CA  
3964 C C   . LEU C 127 ? 0.7095 1.0378 0.8493 0.0107  -0.0954 -0.0723 129 LEU C C   
3965 O O   . LEU C 127 ? 0.7258 1.0587 0.8624 0.0141  -0.0983 -0.0788 129 LEU C O   
3966 C CB  . LEU C 127 ? 0.6307 0.9718 0.7595 0.0107  -0.0904 -0.0652 129 LEU C CB  
3967 C CG  . LEU C 127 ? 0.7139 1.0596 0.8462 0.0103  -0.0935 -0.0662 129 LEU C CG  
3968 C CD1 . LEU C 127 ? 0.5903 0.9312 0.7293 0.0082  -0.0923 -0.0616 129 LEU C CD1 
3969 C CD2 . LEU C 127 ? 0.6472 1.0021 0.7719 0.0108  -0.0937 -0.0644 129 LEU C CD2 
3970 N N   . ASP C 128 ? 0.7381 1.0591 0.8857 0.0078  -0.0974 -0.0710 130 ASP C N   
3971 C CA  . ASP C 128 ? 0.7705 1.0865 0.9233 0.0079  -0.1043 -0.0770 130 ASP C CA  
3972 C C   . ASP C 128 ? 0.8096 1.1316 0.9655 0.0079  -0.1083 -0.0801 130 ASP C C   
3973 O O   . ASP C 128 ? 0.8182 1.1447 0.9764 0.0055  -0.1060 -0.0753 130 ASP C O   
3974 C CB  . ASP C 128 ? 0.7607 1.0665 0.9207 0.0032  -0.1056 -0.0730 130 ASP C CB  
3975 C CG  . ASP C 128 ? 0.8520 1.1505 1.0093 0.0033  -0.1030 -0.0707 130 ASP C CG  
3976 O OD1 . ASP C 128 ? 0.9081 1.2008 1.0697 -0.0012 -0.1019 -0.0649 130 ASP C OD1 
3977 O OD2 . ASP C 128 ? 0.8658 1.1659 1.0170 0.0077  -0.1022 -0.0746 130 ASP C OD2 
3978 N N   . ARG C 129 ? 0.8490 1.1711 1.0047 0.0110  -0.1147 -0.0885 131 ARG C N   
3979 C CA  . ARG C 129 ? 0.8610 1.1880 1.0194 0.0111  -0.1197 -0.0923 131 ARG C CA  
3980 C C   . ARG C 129 ? 0.9036 1.2224 1.0665 0.0119  -0.1291 -0.1000 131 ARG C C   
3981 O O   . ARG C 129 ? 0.9146 1.2266 1.0758 0.0151  -0.1324 -0.1050 131 ARG C O   
3982 C CB  . ARG C 129 ? 0.8524 1.1926 1.0031 0.0152  -0.1180 -0.0954 131 ARG C CB  
3983 C CG  . ARG C 129 ? 0.7674 1.1141 0.9147 0.0133  -0.1115 -0.0875 131 ARG C CG  
3984 C CD  . ARG C 129 ? 0.8440 1.2024 0.9820 0.0164  -0.1099 -0.0893 131 ARG C CD  
3985 N NE  . ARG C 129 ? 0.8758 1.2433 1.0128 0.0172  -0.1133 -0.0921 131 ARG C NE  
3986 C CZ  . ARG C 129 ? 0.9102 1.2901 1.0395 0.0197  -0.1136 -0.0949 131 ARG C CZ  
3987 N NH1 . ARG C 129 ? 0.7849 1.1708 0.9071 0.0215  -0.1107 -0.0951 131 ARG C NH1 
3988 N NH2 . ARG C 129 ? 0.9184 1.3062 1.0468 0.0201  -0.1170 -0.0971 131 ARG C NH2 
3989 N N   . PRO C 130 ? 0.9305 1.2494 1.0992 0.0093  -0.1345 -0.1010 132 PRO C N   
3990 C CA  . PRO C 130 ? 0.9410 1.2513 1.1133 0.0102  -0.1451 -0.1089 132 PRO C CA  
3991 C C   . PRO C 130 ? 0.9541 1.2694 1.1192 0.0186  -0.1491 -0.1204 132 PRO C C   
3992 O O   . PRO C 130 ? 0.9274 1.2561 1.0876 0.0217  -0.1470 -0.1230 132 PRO C O   
3993 C CB  . PRO C 130 ? 0.9378 1.2504 1.1169 0.0053  -0.1486 -0.1066 132 PRO C CB  
3994 C CG  . PRO C 130 ? 0.9440 1.2643 1.1251 0.0012  -0.1398 -0.0964 132 PRO C CG  
3995 C CD  . PRO C 130 ? 0.9136 1.2401 1.0859 0.0055  -0.1318 -0.0953 132 PRO C CD  
3996 N N   . SER C 131 ? 0.9799 1.2854 1.1443 0.0224  -0.1550 -0.1270 133 SER C N   
3997 C CA  . SER C 131 ? 0.9979 1.3074 1.1565 0.0316  -0.1607 -0.1399 133 SER C CA  
3998 C C   . SER C 131 ? 0.9658 1.2911 1.1154 0.0375  -0.1530 -0.1418 133 SER C C   
3999 O O   . SER C 131 ? 0.9659 1.2980 1.1104 0.0457  -0.1567 -0.1524 133 SER C O   
4000 C CB  . SER C 131 ? 1.0220 1.3348 1.1816 0.0332  -0.1683 -0.1469 133 SER C CB  
4001 O OG  . SER C 131 ? 1.0499 1.3478 1.2181 0.0270  -0.1764 -0.1448 133 SER C OG  
4002 N N   . GLN C 132 ? 0.9267 1.2584 1.0745 0.0332  -0.1430 -0.1316 134 GLN C N   
4003 C CA  . GLN C 132 ? 0.9090 1.2555 1.0486 0.0366  -0.1357 -0.1309 134 GLN C CA  
4004 C C   . GLN C 132 ? 0.9018 1.2426 1.0403 0.0371  -0.1320 -0.1281 134 GLN C C   
4005 O O   . GLN C 132 ? 0.8892 1.2162 1.0329 0.0322  -0.1313 -0.1218 134 GLN C O   
4006 C CB  . GLN C 132 ? 0.8935 1.2496 1.0308 0.0318  -0.1284 -0.1216 134 GLN C CB  
4007 C CG  . GLN C 132 ? 0.9361 1.3026 1.0719 0.0326  -0.1312 -0.1248 134 GLN C CG  
4008 C CD  . GLN C 132 ? 0.9720 1.3561 1.0992 0.0386  -0.1314 -0.1319 134 GLN C CD  
4009 O OE1 . GLN C 132 ? 0.9693 1.3589 1.0955 0.0430  -0.1376 -0.1411 134 GLN C OE1 
4010 N NE2 . GLN C 132 ? 0.9234 1.3174 1.0442 0.0387  -0.1249 -0.1278 134 GLN C NE2 
4011 N N   . PRO C 133 ? 0.8997 1.2526 1.0313 0.0426  -0.1294 -0.1324 135 PRO C N   
4012 C CA  . PRO C 133 ? 0.8671 1.2163 0.9974 0.0422  -0.1246 -0.1280 135 PRO C CA  
4013 C C   . PRO C 133 ? 0.8346 1.1845 0.9641 0.0350  -0.1161 -0.1152 135 PRO C C   
4014 O O   . PRO C 133 ? 0.7806 1.1402 0.9073 0.0326  -0.1132 -0.1114 135 PRO C O   
4015 C CB  . PRO C 133 ? 0.8770 1.2438 1.0002 0.0494  -0.1237 -0.1353 135 PRO C CB  
4016 C CG  . PRO C 133 ? 0.8954 1.2788 1.0145 0.0507  -0.1240 -0.1384 135 PRO C CG  
4017 C CD  . PRO C 133 ? 0.9161 1.2882 1.0410 0.0491  -0.1304 -0.1407 135 PRO C CD  
4018 N N   . THR C 134 ? 0.8183 1.1572 0.9499 0.0318  -0.1131 -0.1089 136 THR C N   
4019 C CA  . THR C 134 ? 0.7833 1.1200 0.9148 0.0256  -0.1063 -0.0977 136 THR C CA  
4020 C C   . THR C 134 ? 0.7457 1.0944 0.8693 0.0258  -0.1003 -0.0939 136 THR C C   
4021 O O   . THR C 134 ? 0.7518 1.1057 0.8718 0.0292  -0.0996 -0.0970 136 THR C O   
4022 C CB  . THR C 134 ? 0.7740 1.0954 0.9104 0.0219  -0.1053 -0.0923 136 THR C CB  
4023 O OG1 . THR C 134 ? 0.8588 1.1773 0.9929 0.0251  -0.1055 -0.0950 136 THR C OG1 
4024 C CG2 . THR C 134 ? 0.8206 1.1307 0.9650 0.0197  -0.1118 -0.0941 136 THR C CG2 
4025 N N   . GLN C 135 ? 0.6866 1.0400 0.8078 0.0221  -0.0968 -0.0871 137 GLN C N   
4026 C CA  . GLN C 135 ? 0.6430 1.0067 0.7564 0.0209  -0.0924 -0.0821 137 GLN C CA  
4027 C C   . GLN C 135 ? 0.6138 0.9686 0.7261 0.0176  -0.0878 -0.0740 137 GLN C C   
4028 O O   . GLN C 135 ? 0.6060 0.9490 0.7231 0.0153  -0.0869 -0.0703 137 GLN C O   
4029 C CB  . GLN C 135 ? 0.6179 0.9892 0.7286 0.0187  -0.0926 -0.0788 137 GLN C CB  
4030 C CG  . GLN C 135 ? 0.6124 0.9946 0.7147 0.0163  -0.0900 -0.0729 137 GLN C CG  
4031 C CD  . GLN C 135 ? 0.5903 0.9786 0.6903 0.0143  -0.0917 -0.0702 137 GLN C CD  
4032 O OE1 . GLN C 135 ? 0.6345 1.0211 0.7393 0.0156  -0.0946 -0.0740 137 GLN C OE1 
4033 N NE2 . GLN C 135 ? 0.5398 0.9349 0.6325 0.0109  -0.0906 -0.0632 137 GLN C NE2 
4034 N N   . GLU C 136 ? 0.5872 0.9492 0.6930 0.0172  -0.0851 -0.0713 138 GLU C N   
4035 C CA  . GLU C 136 ? 0.5431 0.8978 0.6465 0.0142  -0.0812 -0.0639 138 GLU C CA  
4036 C C   . GLU C 136 ? 0.5281 0.8877 0.6245 0.0103  -0.0794 -0.0561 138 GLU C C   
4037 O O   . GLU C 136 ? 0.5154 0.8884 0.6069 0.0097  -0.0805 -0.0560 138 GLU C O   
4038 C CB  . GLU C 136 ? 0.5778 0.9350 0.6796 0.0164  -0.0803 -0.0667 138 GLU C CB  
4039 C CG  . GLU C 136 ? 0.6477 0.9935 0.7556 0.0190  -0.0820 -0.0712 138 GLU C CG  
4040 C CD  . GLU C 136 ? 0.6819 1.0292 0.7877 0.0210  -0.0809 -0.0724 138 GLU C CD  
4041 O OE1 . GLU C 136 ? 0.7140 1.0569 0.8236 0.0250  -0.0841 -0.0789 138 GLU C OE1 
4042 O OE2 . GLU C 136 ? 0.6370 0.9896 0.7373 0.0185  -0.0776 -0.0668 138 GLU C OE2 
4043 N N   . THR C 137 ? 0.4939 0.8425 0.5895 0.0076  -0.0772 -0.0493 139 THR C N   
4044 C CA  . THR C 137 ? 0.4407 0.7903 0.5288 0.0039  -0.0766 -0.0417 139 THR C CA  
4045 C C   . THR C 137 ? 0.4108 0.7493 0.4978 0.0028  -0.0741 -0.0375 139 THR C C   
4046 O O   . THR C 137 ? 0.4469 0.7751 0.5389 0.0042  -0.0727 -0.0386 139 THR C O   
4047 C CB  . THR C 137 ? 0.3984 0.7461 0.4848 0.0021  -0.0788 -0.0374 139 THR C CB  
4048 O OG1 . THR C 137 ? 0.4612 0.8095 0.5396 -0.0018 -0.0799 -0.0300 139 THR C OG1 
4049 C CG2 . THR C 137 ? 0.3192 0.6541 0.4108 0.0033  -0.0781 -0.0364 139 THR C CG2 
4050 N N   . LYS C 138 ? 0.4015 0.7430 0.4817 -0.0002 -0.0738 -0.0325 140 LYS C N   
4051 C CA  . LYS C 138 ? 0.4053 0.7372 0.4836 -0.0013 -0.0719 -0.0289 140 LYS C CA  
4052 C C   . LYS C 138 ? 0.4036 0.7312 0.4745 -0.0055 -0.0736 -0.0208 140 LYS C C   
4053 O O   . LYS C 138 ? 0.4111 0.7483 0.4767 -0.0089 -0.0760 -0.0175 140 LYS C O   
4054 C CB  . LYS C 138 ? 0.4093 0.7493 0.4873 -0.0005 -0.0705 -0.0318 140 LYS C CB  
4055 C CG  . LYS C 138 ? 0.4352 0.7682 0.5100 -0.0023 -0.0689 -0.0275 140 LYS C CG  
4056 C CD  . LYS C 138 ? 0.5251 0.8667 0.6013 -0.0002 -0.0679 -0.0318 140 LYS C CD  
4057 C CE  . LYS C 138 ? 0.5286 0.8703 0.5997 -0.0035 -0.0671 -0.0265 140 LYS C CE  
4058 N NZ  . LYS C 138 ? 0.5224 0.8777 0.5949 -0.0010 -0.0666 -0.0313 140 LYS C NZ  
4059 N N   . LYS C 139 ? 0.3605 0.6738 0.4307 -0.0053 -0.0732 -0.0178 141 LYS C N   
4060 C CA  . LYS C 139 ? 0.3086 0.6145 0.3713 -0.0087 -0.0759 -0.0107 141 LYS C CA  
4061 C C   . LYS C 139 ? 0.2763 0.5716 0.3376 -0.0085 -0.0741 -0.0091 141 LYS C C   
4062 O O   . LYS C 139 ? 0.2978 0.5858 0.3636 -0.0050 -0.0714 -0.0121 141 LYS C O   
4063 C CB  . LYS C 139 ? 0.3219 0.6196 0.3837 -0.0077 -0.0793 -0.0087 141 LYS C CB  
4064 C CG  . LYS C 139 ? 0.3311 0.6248 0.3841 -0.0123 -0.0848 -0.0014 141 LYS C CG  
4065 C CD  . LYS C 139 ? 0.3720 0.6572 0.4241 -0.0103 -0.0892 -0.0002 141 LYS C CD  
4066 C CE  . LYS C 139 ? 0.4543 0.7481 0.5031 -0.0140 -0.0935 0.0029  141 LYS C CE  
4067 N NZ  . LYS C 139 ? 0.4807 0.7648 0.5284 -0.0116 -0.0987 0.0042  141 LYS C NZ  
4068 N N   . ASN C 140 ? 0.2869 0.5828 0.3418 -0.0127 -0.0758 -0.0041 142 ASN C N   
4069 C CA  . ASN C 140 ? 0.2670 0.5537 0.3195 -0.0131 -0.0748 -0.0022 142 ASN C CA  
4070 C C   . ASN C 140 ? 0.2639 0.5346 0.3127 -0.0119 -0.0775 0.0005  142 ASN C C   
4071 O O   . ASN C 140 ? 0.2500 0.5177 0.2965 -0.0121 -0.0815 0.0024  142 ASN C O   
4072 C CB  . ASN C 140 ? 0.3044 0.5974 0.3508 -0.0188 -0.0768 0.0031  142 ASN C CB  
4073 C CG  . ASN C 140 ? 0.4706 0.7825 0.5200 -0.0193 -0.0743 0.0000  142 ASN C CG  
4074 O OD1 . ASN C 140 ? 0.6281 0.9533 0.6741 -0.0236 -0.0765 0.0032  142 ASN C OD1 
4075 N ND2 . ASN C 140 ? 0.4488 0.7625 0.5043 -0.0147 -0.0704 -0.0064 142 ASN C ND2 
4076 N N   . PHE C 141 ? 0.2535 0.5147 0.3014 -0.0103 -0.0760 0.0004  143 PHE C N   
4077 C CA  . PHE C 141 ? 0.2605 0.5071 0.3035 -0.0087 -0.0793 0.0025  143 PHE C CA  
4078 C C   . PHE C 141 ? 0.2608 0.5010 0.2992 -0.0106 -0.0794 0.0051  143 PHE C C   
4079 O O   . PHE C 141 ? 0.2659 0.5125 0.3071 -0.0115 -0.0754 0.0038  143 PHE C O   
4080 C CB  . PHE C 141 ? 0.2043 0.4461 0.2520 -0.0024 -0.0772 -0.0019 143 PHE C CB  
4081 C CG  . PHE C 141 ? 0.2419 0.4856 0.2956 0.0002  -0.0711 -0.0057 143 PHE C CG  
4082 C CD1 . PHE C 141 ? 0.2301 0.4830 0.2918 0.0010  -0.0674 -0.0094 143 PHE C CD1 
4083 C CD2 . PHE C 141 ? 0.2288 0.4643 0.2797 0.0018  -0.0699 -0.0054 143 PHE C CD2 
4084 C CE1 . PHE C 141 ? 0.1636 0.4170 0.2304 0.0025  -0.0632 -0.0118 143 PHE C CE1 
4085 C CE2 . PHE C 141 ? 0.2443 0.4816 0.3002 0.0035  -0.0649 -0.0078 143 PHE C CE2 
4086 C CZ  . PHE C 141 ? 0.1647 0.4107 0.2287 0.0035  -0.0617 -0.0107 143 PHE C CZ  
4087 N N   . GLU C 142 ? 0.2385 0.4656 0.2696 -0.0112 -0.0849 0.0085  144 GLU C N   
4088 C CA  . GLU C 142 ? 0.2249 0.4453 0.2506 -0.0138 -0.0862 0.0115  144 GLU C CA  
4089 C C   . GLU C 142 ? 0.2683 0.4787 0.2938 -0.0084 -0.0840 0.0082  144 GLU C C   
4090 O O   . GLU C 142 ? 0.2427 0.4465 0.2683 -0.0030 -0.0849 0.0052  144 GLU C O   
4091 C CB  . GLU C 142 ? 0.3319 0.5441 0.3487 -0.0194 -0.0948 0.0182  144 GLU C CB  
4092 C CG  . GLU C 142 ? 0.4239 0.6486 0.4401 -0.0262 -0.0971 0.0230  144 GLU C CG  
4093 C CD  . GLU C 142 ? 0.2523 0.4933 0.2716 -0.0301 -0.0922 0.0235  144 GLU C CD  
4094 O OE1 . GLU C 142 ? 0.3902 0.6288 0.4073 -0.0321 -0.0919 0.0252  144 GLU C OE1 
4095 O OE2 . GLU C 142 ? 0.4863 0.7429 0.5103 -0.0304 -0.0890 0.0216  144 GLU C OE2 
4096 N N   . VAL C 143 ? 0.2300 0.4406 0.2548 -0.0099 -0.0813 0.0087  145 VAL C N   
4097 C CA  . VAL C 143 ? 0.3104 0.5130 0.3343 -0.0055 -0.0788 0.0061  145 VAL C CA  
4098 C C   . VAL C 143 ? 0.3615 0.5551 0.3777 -0.0087 -0.0828 0.0098  145 VAL C C   
4099 O O   . VAL C 143 ? 0.3791 0.5777 0.3939 -0.0148 -0.0845 0.0139  145 VAL C O   
4100 C CB  . VAL C 143 ? 0.2988 0.5103 0.3304 -0.0040 -0.0714 0.0028  145 VAL C CB  
4101 C CG1 . VAL C 143 ? 0.4188 0.6241 0.4489 -0.0011 -0.0688 0.0014  145 VAL C CG1 
4102 C CG2 . VAL C 143 ? 0.2747 0.4933 0.3139 -0.0008 -0.0683 -0.0010 145 VAL C CG2 
4103 N N   . VAL C 144 ? 0.4098 0.5915 0.4212 -0.0046 -0.0847 0.0082  146 VAL C N   
4104 C CA  . VAL C 144 ? 0.4613 0.6342 0.4658 -0.0070 -0.0879 0.0108  146 VAL C CA  
4105 C C   . VAL C 144 ? 0.4903 0.6600 0.4948 -0.0014 -0.0835 0.0068  146 VAL C C   
4106 O O   . VAL C 144 ? 0.4341 0.6016 0.4391 0.0049  -0.0825 0.0026  146 VAL C O   
4107 C CB  . VAL C 144 ? 0.5169 0.6751 0.5121 -0.0086 -0.0981 0.0141  146 VAL C CB  
4108 C CG1 . VAL C 144 ? 0.5982 0.7464 0.5908 -0.0005 -0.1016 0.0094  146 VAL C CG1 
4109 C CG2 . VAL C 144 ? 0.5821 0.7308 0.5701 -0.0117 -0.1020 0.0169  146 VAL C CG2 
4110 N N   . ASP C 145 ? 0.5348 0.7059 0.5389 -0.0038 -0.0810 0.0081  147 ASP C N   
4111 C CA  . ASP C 145 ? 0.6035 0.7704 0.6057 0.0004  -0.0782 0.0054  147 ASP C CA  
4112 C C   . ASP C 145 ? 0.6399 0.7928 0.6320 0.0003  -0.0848 0.0068  147 ASP C C   
4113 O O   . ASP C 145 ? 0.6573 0.8068 0.6457 -0.0057 -0.0895 0.0113  147 ASP C O   
4114 C CB  . ASP C 145 ? 0.5926 0.7684 0.6005 -0.0013 -0.0717 0.0056  147 ASP C CB  
4115 C CG  . ASP C 145 ? 0.7305 0.9074 0.7399 0.0036  -0.0666 0.0024  147 ASP C CG  
4116 O OD1 . ASP C 145 ? 0.6225 0.8016 0.6339 0.0082  -0.0649 -0.0007 147 ASP C OD1 
4117 O OD2 . ASP C 145 ? 0.7850 0.9618 0.7938 0.0025  -0.0644 0.0033  147 ASP C OD2 
4118 N N   . PRO C 152 ? 0.8137 1.0160 0.8045 -0.0494 -0.0950 0.0415  154 PRO C N   
4119 C CA  . PRO C 152 ? 0.8066 1.0201 0.7974 -0.0563 -0.0981 0.0468  154 PRO C CA  
4120 C C   . PRO C 152 ? 0.7806 1.0180 0.7808 -0.0552 -0.0926 0.0447  154 PRO C C   
4121 O O   . PRO C 152 ? 0.7683 1.0089 0.7744 -0.0480 -0.0867 0.0385  154 PRO C O   
4122 C CB  . PRO C 152 ? 0.8139 1.0141 0.7999 -0.0549 -0.0998 0.0464  154 PRO C CB  
4123 C CG  . PRO C 152 ? 0.8305 1.0219 0.8179 -0.0458 -0.0941 0.0396  154 PRO C CG  
4124 C CD  . PRO C 152 ? 0.8214 1.0114 0.8106 -0.0427 -0.0921 0.0369  154 PRO C CD  
4125 N N   . ASP C 153 ? 0.7606 1.0146 0.7620 -0.0623 -0.0953 0.0499  155 ASP C N   
4126 C CA  . ASP C 153 ? 0.7167 0.9971 0.7265 -0.0615 -0.0914 0.0481  155 ASP C CA  
4127 C C   . ASP C 153 ? 0.6762 0.9571 0.6915 -0.0528 -0.0863 0.0410  155 ASP C C   
4128 O O   . ASP C 153 ? 0.6805 0.9496 0.6930 -0.0517 -0.0873 0.0411  155 ASP C O   
4129 C CB  . ASP C 153 ? 0.7322 1.0290 0.7412 -0.0708 -0.0958 0.0555  155 ASP C CB  
4130 C CG  . ASP C 153 ? 0.6848 1.0117 0.7026 -0.0688 -0.0919 0.0528  155 ASP C CG  
4131 O OD1 . ASP C 153 ? 0.6274 0.9646 0.6513 -0.0618 -0.0870 0.0461  155 ASP C OD1 
4132 O OD2 . ASP C 153 ? 0.7988 1.1402 0.8173 -0.0742 -0.0944 0.0572  155 ASP C OD2 
4133 N N   . LEU C 154 ? 0.6026 0.8970 0.6255 -0.0469 -0.0817 0.0351  156 LEU C N   
4134 C CA  . LEU C 154 ? 0.5645 0.8580 0.5931 -0.0384 -0.0779 0.0280  156 LEU C CA  
4135 C C   . LEU C 154 ? 0.5292 0.8339 0.5607 -0.0378 -0.0788 0.0278  156 LEU C C   
4136 O O   . LEU C 154 ? 0.4786 0.7758 0.5123 -0.0321 -0.0776 0.0239  156 LEU C O   
4137 C CB  . LEU C 154 ? 0.5872 0.8925 0.6225 -0.0329 -0.0745 0.0219  156 LEU C CB  
4138 C CG  . LEU C 154 ? 0.5687 0.8704 0.6101 -0.0239 -0.0716 0.0140  156 LEU C CG  
4139 C CD1 . LEU C 154 ? 0.6311 0.9361 0.6756 -0.0213 -0.0696 0.0103  156 LEU C CD1 
4140 C CD2 . LEU C 154 ? 0.5871 0.9071 0.6346 -0.0201 -0.0719 0.0102  156 LEU C CD2 
4141 N N   . MET C 155 ? 0.4789 0.8026 0.5108 -0.0439 -0.0812 0.0323  157 MET C N   
4142 C CA  . MET C 155 ? 0.4195 0.7569 0.4544 -0.0440 -0.0824 0.0327  157 MET C CA  
4143 C C   . MET C 155 ? 0.3905 0.7154 0.4184 -0.0509 -0.0868 0.0397  157 MET C C   
4144 O O   . MET C 155 ? 0.3823 0.7170 0.4120 -0.0520 -0.0884 0.0410  157 MET C O   
4145 C CB  . MET C 155 ? 0.4907 0.8604 0.5306 -0.0469 -0.0825 0.0338  157 MET C CB  
4146 C CG  . MET C 155 ? 0.5520 0.9374 0.5988 -0.0393 -0.0789 0.0259  157 MET C CG  
4147 S SD  . MET C 155 ? 0.7336 1.1191 0.7882 -0.0259 -0.0770 0.0148  157 MET C SD  
4148 C CE  . MET C 155 ? 0.5768 0.9279 0.6282 -0.0218 -0.0757 0.0123  157 MET C CE  
4149 N N   . ALA C 156 ? 0.3896 0.6933 0.4096 -0.0552 -0.0892 0.0438  158 ALA C N   
4150 C CA  . ALA C 156 ? 0.4116 0.7015 0.4240 -0.0614 -0.0945 0.0498  158 ALA C CA  
4151 C C   . ALA C 156 ? 0.4521 0.7241 0.4626 -0.0553 -0.0934 0.0461  158 ALA C C   
4152 O O   . ALA C 156 ? 0.4363 0.6980 0.4481 -0.0481 -0.0894 0.0405  158 ALA C O   
4153 C CB  . ALA C 156 ? 0.4805 0.7539 0.4846 -0.0675 -0.0990 0.0549  158 ALA C CB  
4154 N N   . PRO C 157 ? 0.4997 0.7680 0.5067 -0.0588 -0.0972 0.0496  159 PRO C N   
4155 C CA  . PRO C 157 ? 0.4955 0.7494 0.5004 -0.0535 -0.0963 0.0465  159 PRO C CA  
4156 C C   . PRO C 157 ? 0.5428 0.7720 0.5402 -0.0510 -0.0962 0.0452  159 PRO C C   
4157 O O   . PRO C 157 ? 0.5891 0.8088 0.5804 -0.0551 -0.0994 0.0481  159 PRO C O   
4158 C CB  . PRO C 157 ? 0.5275 0.7837 0.5292 -0.0597 -0.1017 0.0518  159 PRO C CB  
4159 C CG  . PRO C 157 ? 0.5904 0.8508 0.5884 -0.0695 -0.1068 0.0588  159 PRO C CG  
4160 C CD  . PRO C 157 ? 0.5186 0.7958 0.5228 -0.0688 -0.1031 0.0573  159 PRO C CD  
4161 N N   . VAL C 158 ? 0.5426 0.7620 0.5402 -0.0441 -0.0928 0.0408  160 VAL C N   
4162 C CA  . VAL C 158 ? 0.5372 0.7372 0.5287 -0.0408 -0.0915 0.0388  160 VAL C CA  
4163 C C   . VAL C 158 ? 0.5462 0.7336 0.5312 -0.0398 -0.0934 0.0393  160 VAL C C   
4164 O O   . VAL C 158 ? 0.4788 0.6717 0.4674 -0.0380 -0.0927 0.0387  160 VAL C O   
4165 C CB  . VAL C 158 ? 0.5273 0.7281 0.5245 -0.0342 -0.0856 0.0337  160 VAL C CB  
4166 C CG1 . VAL C 158 ? 0.6319 0.8161 0.6229 -0.0312 -0.0842 0.0320  160 VAL C CG1 
4167 C CG2 . VAL C 158 ? 0.5784 0.7922 0.5817 -0.0348 -0.0840 0.0326  160 VAL C CG2 
4168 N N   . SER C 159 ? 0.5328 0.7039 0.5084 -0.0403 -0.0962 0.0399  161 SER C N   
4169 C CA  . SER C 159 ? 0.5737 0.7337 0.5421 -0.0397 -0.0987 0.0404  161 SER C CA  
4170 C C   . SER C 159 ? 0.5714 0.7146 0.5307 -0.0363 -0.0992 0.0380  161 SER C C   
4171 O O   . SER C 159 ? 0.5384 0.6778 0.4964 -0.0355 -0.0992 0.0367  161 SER C O   
4172 C CB  . SER C 159 ? 0.5459 0.7073 0.5109 -0.0466 -0.1055 0.0452  161 SER C CB  
4173 O OG  . SER C 159 ? 0.7315 0.8822 0.6891 -0.0506 -0.1113 0.0473  161 SER C OG  
4174 N N   . ALA C 160 ? 0.5337 0.6683 0.4867 -0.0339 -0.0998 0.0372  162 ALA C N   
4175 C CA  . ALA C 160 ? 0.4761 0.5974 0.4200 -0.0296 -0.1002 0.0341  162 ALA C CA  
4176 C C   . ALA C 160 ? 0.4907 0.6048 0.4269 -0.0290 -0.1027 0.0344  162 ALA C C   
4177 O O   . ALA C 160 ? 0.4730 0.5931 0.4127 -0.0309 -0.1025 0.0367  162 ALA C O   
4178 C CB  . ALA C 160 ? 0.4725 0.5970 0.4202 -0.0242 -0.0931 0.0308  162 ALA C CB  
4179 N N   . LYS C 161 ? 0.5096 0.6114 0.4353 -0.0256 -0.1054 0.0315  163 LYS C N   
4180 C CA  . LYS C 161 ? 0.5081 0.6035 0.4255 -0.0238 -0.1073 0.0309  163 LYS C CA  
4181 C C   . LYS C 161 ? 0.5331 0.6224 0.4427 -0.0169 -0.1053 0.0259  163 LYS C C   
4182 O O   . LYS C 161 ? 0.5296 0.6148 0.4372 -0.0141 -0.1062 0.0227  163 LYS C O   
4183 C CB  . LYS C 161 ? 0.6069 0.6940 0.5178 -0.0286 -0.1163 0.0333  163 LYS C CB  
4184 C CG  . LYS C 161 ? 0.6996 0.7751 0.6042 -0.0302 -0.1240 0.0325  163 LYS C CG  
4185 C CD  . LYS C 161 ? 0.8965 0.9696 0.8001 -0.0385 -0.1324 0.0378  163 LYS C CD  
4186 C CE  . LYS C 161 ? 1.0392 1.0947 0.9324 -0.0399 -0.1432 0.0370  163 LYS C CE  
4187 N NZ  . LYS C 161 ? 1.0488 1.1006 0.9391 -0.0483 -0.1521 0.0424  163 LYS C NZ  
4188 N N   . LYS C 162 ? 0.4995 0.5899 0.4050 -0.0141 -0.1025 0.0252  164 LYS C N   
4189 C CA  . LYS C 162 ? 0.5100 0.5985 0.4078 -0.0075 -0.1001 0.0206  164 LYS C CA  
4190 C C   . LYS C 162 ? 0.5638 0.6486 0.4522 -0.0065 -0.1024 0.0206  164 LYS C C   
4191 O O   . LYS C 162 ? 0.5016 0.5898 0.3930 -0.0102 -0.1019 0.0248  164 LYS C O   
4192 C CB  . LYS C 162 ? 0.5007 0.6008 0.4059 -0.0054 -0.0914 0.0208  164 LYS C CB  
4193 C CG  . LYS C 162 ? 0.5730 0.6755 0.4726 0.0012  -0.0880 0.0160  164 LYS C CG  
4194 C CD  . LYS C 162 ? 0.5993 0.7051 0.5052 0.0030  -0.0855 0.0139  164 LYS C CD  
4195 C CE  . LYS C 162 ? 0.7535 0.8705 0.6614 0.0068  -0.0782 0.0125  164 LYS C CE  
4196 N NZ  . LYS C 162 ? 0.7823 0.9058 0.7008 0.0059  -0.0742 0.0130  164 LYS C NZ  
4197 N N   . GLU C 163 ? 0.6162 0.6937 0.4930 -0.0011 -0.1057 0.0154  165 GLU C N   
4198 C CA  . GLU C 163 ? 0.6434 0.7180 0.5100 0.0009  -0.1079 0.0144  165 GLU C CA  
4199 C C   . GLU C 163 ? 0.6780 0.7580 0.5376 0.0087  -0.1036 0.0090  165 GLU C C   
4200 O O   . GLU C 163 ? 0.6930 0.7710 0.5500 0.0141  -0.1044 0.0036  165 GLU C O   
4201 C CB  . GLU C 163 ? 0.6562 0.7158 0.5137 -0.0003 -0.1185 0.0128  165 GLU C CB  
4202 C CG  . GLU C 163 ? 0.7833 0.8385 0.6283 0.0031  -0.1217 0.0102  165 GLU C CG  
4203 C CD  . GLU C 163 ? 0.9385 0.9831 0.7793 -0.0022 -0.1307 0.0128  165 GLU C CD  
4204 O OE1 . GLU C 163 ? 0.9945 1.0279 0.8340 -0.0048 -0.1388 0.0124  165 GLU C OE1 
4205 O OE2 . GLU C 163 ? 0.9994 1.0469 0.8379 -0.0042 -0.1301 0.0156  165 GLU C OE2 
4206 N N   . LYS C 164 ? 0.6882 0.7766 0.5451 0.0091  -0.0992 0.0109  166 LYS C N   
4207 C CA  . LYS C 164 ? 0.6476 0.7454 0.4980 0.0158  -0.0945 0.0068  166 LYS C CA  
4208 C C   . LYS C 164 ? 0.6394 0.7357 0.4770 0.0183  -0.0975 0.0050  166 LYS C C   
4209 O O   . LYS C 164 ? 0.5582 0.6527 0.3956 0.0132  -0.0989 0.0102  166 LYS C O   
4210 C CB  . LYS C 164 ? 0.6086 0.7218 0.4680 0.0132  -0.0854 0.0117  166 LYS C CB  
4211 C CG  . LYS C 164 ? 0.7675 0.8935 0.6240 0.0197  -0.0799 0.0073  166 LYS C CG  
4212 C CD  . LYS C 164 ? 0.7971 0.9383 0.6624 0.0157  -0.0718 0.0134  166 LYS C CD  
4213 C CE  . LYS C 164 ? 0.7476 0.8995 0.6058 0.0151  -0.0688 0.0164  166 LYS C CE  
4214 N NZ  . LYS C 164 ? 0.7362 0.8958 0.6040 0.0077  -0.0643 0.0253  166 LYS C NZ  
4215 N N   . LYS C 165 ? 0.6396 0.7373 0.4666 0.0267  -0.0986 -0.0027 167 LYS C N   
4216 C CA  . LYS C 165 ? 0.6872 0.7869 0.5010 0.0310  -0.1005 -0.0059 167 LYS C CA  
4217 C C   . LYS C 165 ? 0.6691 0.7878 0.4848 0.0288  -0.0915 -0.0005 167 LYS C C   
4218 O O   . LYS C 165 ? 0.6325 0.7652 0.4533 0.0304  -0.0845 -0.0003 167 LYS C O   
4219 C CB  . LYS C 165 ? 0.7219 0.8189 0.5246 0.0420  -0.1046 -0.0170 167 LYS C CB  
4220 C CG  . LYS C 165 ? 0.8065 0.9047 0.5940 0.0481  -0.1079 -0.0224 167 LYS C CG  
4221 C CD  . LYS C 165 ? 0.9771 1.0768 0.7541 0.0610  -0.1110 -0.0347 167 LYS C CD  
4222 C CE  . LYS C 165 ? 1.0164 1.1422 0.7923 0.0666  -0.1010 -0.0368 167 LYS C CE  
4223 N NZ  . LYS C 165 ? 1.0025 1.1337 0.7630 0.0793  -0.1045 -0.0485 167 LYS C NZ  
4224 N N   . VAL C 166 ? 0.6776 0.7966 0.4894 0.0245  -0.0923 0.0046  168 VAL C N   
4225 C CA  . VAL C 166 ? 0.6110 0.7462 0.4230 0.0215  -0.0855 0.0107  168 VAL C CA  
4226 C C   . VAL C 166 ? 0.6593 0.7950 0.4567 0.0243  -0.0888 0.0086  168 VAL C C   
4227 O O   . VAL C 166 ? 0.6055 0.7337 0.4012 0.0194  -0.0927 0.0132  168 VAL C O   
4228 C CB  . VAL C 166 ? 0.5718 0.7061 0.3959 0.0118  -0.0836 0.0210  168 VAL C CB  
4229 C CG1 . VAL C 166 ? 0.5893 0.7392 0.4132 0.0081  -0.0778 0.0280  168 VAL C CG1 
4230 C CG2 . VAL C 166 ? 0.5326 0.6647 0.3707 0.0093  -0.0815 0.0222  168 VAL C CG2 
4231 N N   . SER C 167 ? 0.6949 0.8404 0.4818 0.0329  -0.0877 0.0009  169 SER C N   
4232 C CA  . SER C 167 ? 0.7142 0.8589 0.4856 0.0381  -0.0921 -0.0042 169 SER C CA  
4233 C C   . SER C 167 ? 0.7157 0.8795 0.4819 0.0356  -0.0864 0.0015  169 SER C C   
4234 O O   . SER C 167 ? 0.6838 0.8639 0.4573 0.0313  -0.0786 0.0081  169 SER C O   
4235 C CB  . SER C 167 ? 0.7598 0.9040 0.5212 0.0503  -0.0955 -0.0172 169 SER C CB  
4236 O OG  . SER C 167 ? 0.8048 0.9710 0.5672 0.0550  -0.0874 -0.0194 169 SER C OG  
4237 N N   . SER C 168 ? 0.7239 0.8852 0.4766 0.0383  -0.0910 -0.0012 170 SER C N   
4238 C CA  . SER C 168 ? 0.7266 0.9003 0.4723 0.0346  -0.0886 0.0050  170 SER C CA  
4239 C C   . SER C 168 ? 0.7768 0.9541 0.5049 0.0453  -0.0925 -0.0061 170 SER C C   
4240 O O   . SER C 168 ? 0.8126 0.9749 0.5357 0.0526  -0.0996 -0.0162 170 SER C O   
4241 C CB  . SER C 168 ? 0.7296 0.8860 0.4774 0.0268  -0.0946 0.0118  170 SER C CB  
4242 O OG  . SER C 168 ? 0.7801 0.9459 0.5295 0.0189  -0.0913 0.0225  170 SER C OG  
4243 N N   . MET C 169 ? 0.8152 1.0114 0.5331 0.0462  -0.0890 -0.0045 171 MET C N   
4244 C CA  . MET C 169 ? 0.8549 1.0523 0.5551 0.0563  -0.0942 -0.0153 171 MET C CA  
4245 C C   . MET C 169 ? 0.8609 1.0329 0.5554 0.0550  -0.1049 -0.0169 171 MET C C   
4246 O O   . MET C 169 ? 0.8575 1.0170 0.5420 0.0640  -0.1129 -0.0285 171 MET C O   
4247 C CB  . MET C 169 ? 0.8976 1.1222 0.5873 0.0570  -0.0884 -0.0126 171 MET C CB  
4248 C CG  . MET C 169 ? 0.8758 1.1026 0.5468 0.0687  -0.0940 -0.0252 171 MET C CG  
4249 S SD  . MET C 169 ? 1.0561 1.3194 0.7127 0.0716  -0.0871 -0.0244 171 MET C SD  
4250 C CE  . MET C 169 ? 0.9799 1.2488 0.6445 0.0539  -0.0823 -0.0039 171 MET C CE  
4251 N N   . PHE C 170 ? 0.8232 0.9873 0.5243 0.0439  -0.1056 -0.0054 172 PHE C N   
4252 C CA  . PHE C 170 ? 0.8808 1.0236 0.5773 0.0415  -0.1154 -0.0056 172 PHE C CA  
4253 C C   . PHE C 170 ? 0.8632 0.9832 0.5712 0.0375  -0.1212 -0.0050 172 PHE C C   
4254 O O   . PHE C 170 ? 0.8355 0.9374 0.5395 0.0366  -0.1304 -0.0069 172 PHE C O   
4255 C CB  . PHE C 170 ? 0.8699 1.0180 0.5642 0.0333  -0.1146 0.0050  172 PHE C CB  
4256 C CG  . PHE C 170 ? 0.9030 1.0722 0.5830 0.0373  -0.1110 0.0036  172 PHE C CG  
4257 C CD1 . PHE C 170 ? 1.0063 1.1749 0.6693 0.0474  -0.1166 -0.0080 172 PHE C CD1 
4258 C CD2 . PHE C 170 ? 0.8871 1.0777 0.5701 0.0312  -0.1026 0.0138  172 PHE C CD2 
4259 C CE1 . PHE C 170 ? 1.0919 1.2831 0.7411 0.0518  -0.1129 -0.0099 172 PHE C CE1 
4260 C CE2 . PHE C 170 ? 0.9443 1.1575 0.6137 0.0341  -0.0990 0.0134  172 PHE C CE2 
4261 C CZ  . PHE C 170 ? 1.0600 1.2747 0.7124 0.0448  -0.1038 0.0012  172 PHE C CZ  
4262 N N   . ILE C 171 ? 0.8192 0.9412 0.5413 0.0348  -0.1159 -0.0020 173 ILE C N   
4263 C CA  . ILE C 171 ? 0.8005 0.9039 0.5327 0.0322  -0.1209 -0.0026 173 ILE C CA  
4264 C C   . ILE C 171 ? 0.8133 0.9199 0.5486 0.0390  -0.1181 -0.0098 173 ILE C C   
4265 O O   . ILE C 171 ? 0.7977 0.9091 0.5463 0.0352  -0.1122 -0.0051 173 ILE C O   
4266 C CB  . ILE C 171 ? 0.7554 0.8564 0.5039 0.0213  -0.1181 0.0090  173 ILE C CB  
4267 C CG1 . ILE C 171 ? 0.7502 0.8537 0.4969 0.0149  -0.1188 0.0173  173 ILE C CG1 
4268 C CG2 . ILE C 171 ? 0.7764 0.8592 0.5329 0.0184  -0.1248 0.0081  173 ILE C CG2 
4269 C CD1 . ILE C 171 ? 0.7525 0.8575 0.5147 0.0060  -0.1152 0.0280  173 ILE C CD1 
4270 N N   . PRO C 172 ? 0.8330 0.9361 0.5560 0.0497  -0.1231 -0.0217 174 PRO C N   
4271 C CA  . PRO C 172 ? 0.8534 0.9602 0.5788 0.0572  -0.1210 -0.0292 174 PRO C CA  
4272 C C   . PRO C 172 ? 0.8543 0.9451 0.5922 0.0529  -0.1242 -0.0273 174 PRO C C   
4273 O O   . PRO C 172 ? 0.8832 0.9795 0.6279 0.0559  -0.1200 -0.0297 174 PRO C O   
4274 C CB  . PRO C 172 ? 0.9078 1.0082 0.6166 0.0696  -0.1293 -0.0429 174 PRO C CB  
4275 C CG  . PRO C 172 ? 0.9330 1.0358 0.6301 0.0687  -0.1318 -0.0418 174 PRO C CG  
4276 C CD  . PRO C 172 ? 0.8614 0.9563 0.5679 0.0557  -0.1318 -0.0293 174 PRO C CD  
4277 N N   . ASP C 173 ? 0.8653 0.9381 0.6059 0.0458  -0.1316 -0.0231 175 ASP C N   
4278 C CA  . ASP C 173 ? 0.8646 0.9229 0.6159 0.0410  -0.1357 -0.0210 175 ASP C CA  
4279 C C   . ASP C 173 ? 0.7756 0.8387 0.5425 0.0301  -0.1297 -0.0094 175 ASP C C   
4280 O O   . ASP C 173 ? 0.7550 0.8071 0.5303 0.0240  -0.1338 -0.0057 175 ASP C O   
4281 C CB  . ASP C 173 ? 0.9061 0.9417 0.6504 0.0402  -0.1491 -0.0243 175 ASP C CB  
4282 C CG  . ASP C 173 ? 1.0952 1.1225 0.8232 0.0517  -0.1573 -0.0368 175 ASP C CG  
4283 O OD1 . ASP C 173 ? 1.1482 1.1591 0.8672 0.0513  -0.1684 -0.0393 175 ASP C OD1 
4284 O OD2 . ASP C 173 ? 1.1922 1.2296 0.9166 0.0614  -0.1533 -0.0444 175 ASP C OD2 
4285 N N   . GLY C 174 ? 0.7276 0.8074 0.4980 0.0275  -0.1209 -0.0035 176 GLY C N   
4286 C CA  . GLY C 174 ? 0.6715 0.7563 0.4562 0.0187  -0.1155 0.0064  176 GLY C CA  
4287 C C   . GLY C 174 ? 0.6347 0.7192 0.4320 0.0176  -0.1125 0.0067  176 GLY C C   
4288 O O   . GLY C 174 ? 0.6539 0.7417 0.4496 0.0239  -0.1106 0.0005  176 GLY C O   
4289 N N   . ARG C 175 ? 0.6159 0.6974 0.4255 0.0100  -0.1124 0.0135  177 ARG C N   
4290 C CA  . ARG C 175 ? 0.5887 0.6690 0.4101 0.0082  -0.1106 0.0141  177 ARG C CA  
4291 C C   . ARG C 175 ? 0.5537 0.6388 0.3885 0.0008  -0.1071 0.0223  177 ARG C C   
4292 O O   . ARG C 175 ? 0.5343 0.6178 0.3696 -0.0036 -0.1096 0.0270  177 ARG C O   
4293 C CB  . ARG C 175 ? 0.6295 0.6943 0.4491 0.0079  -0.1196 0.0106  177 ARG C CB  
4294 C CG  . ARG C 175 ? 0.7351 0.7930 0.5428 0.0165  -0.1241 0.0012  177 ARG C CG  
4295 C CD  . ARG C 175 ? 0.9843 1.0243 0.7889 0.0157  -0.1349 -0.0018 177 ARG C CD  
4296 N NE  . ARG C 175 ? 1.0455 1.0787 0.8404 0.0251  -0.1392 -0.0115 177 ARG C NE  
4297 C CZ  . ARG C 175 ? 1.1288 1.1652 0.9278 0.0295  -0.1362 -0.0151 177 ARG C CZ  
4298 N NH1 . ARG C 175 ? 1.0357 1.0819 0.8482 0.0250  -0.1284 -0.0097 177 ARG C NH1 
4299 N NH2 . ARG C 175 ? 1.1607 1.1904 0.9501 0.0391  -0.1414 -0.0247 177 ARG C NH2 
4300 N N   . VAL C 176 ? 0.5657 0.6566 0.4115 0.0000  -0.1020 0.0234  178 VAL C N   
4301 C CA  . VAL C 176 ? 0.4897 0.5846 0.3490 -0.0058 -0.0993 0.0296  178 VAL C CA  
4302 C C   . VAL C 176 ? 0.4969 0.5884 0.3643 -0.0068 -0.1004 0.0280  178 VAL C C   
4303 O O   . VAL C 176 ? 0.4689 0.5613 0.3357 -0.0029 -0.0984 0.0238  178 VAL C O   
4304 C CB  . VAL C 176 ? 0.4891 0.5959 0.3539 -0.0064 -0.0918 0.0334  178 VAL C CB  
4305 C CG1 . VAL C 176 ? 0.4486 0.5581 0.3281 -0.0111 -0.0900 0.0382  178 VAL C CG1 
4306 C CG2 . VAL C 176 ? 0.4108 0.5214 0.2674 -0.0070 -0.0914 0.0365  178 VAL C CG2 
4307 N N   . SER C 177 ? 0.4967 0.5857 0.3716 -0.0118 -0.1038 0.0314  179 SER C N   
4308 C CA  . SER C 177 ? 0.5103 0.5975 0.3925 -0.0138 -0.1055 0.0307  179 SER C CA  
4309 C C   . SER C 177 ? 0.4806 0.5759 0.3763 -0.0179 -0.1028 0.0351  179 SER C C   
4310 O O   . SER C 177 ? 0.4127 0.5115 0.3112 -0.0197 -0.1025 0.0387  179 SER C O   
4311 C CB  . SER C 177 ? 0.5458 0.6224 0.4220 -0.0162 -0.1144 0.0299  179 SER C CB  
4312 O OG  . SER C 177 ? 0.7126 0.7916 0.5945 -0.0219 -0.1173 0.0347  179 SER C OG  
4313 N N   . VAL C 178 ? 0.4742 0.5728 0.3782 -0.0186 -0.1011 0.0345  180 VAL C N   
4314 C CA  . VAL C 178 ? 0.4091 0.5159 0.3258 -0.0218 -0.0995 0.0374  180 VAL C CA  
4315 C C   . VAL C 178 ? 0.4315 0.5384 0.3519 -0.0239 -0.1016 0.0365  180 VAL C C   
4316 O O   . VAL C 178 ? 0.4378 0.5405 0.3547 -0.0216 -0.1013 0.0335  180 VAL C O   
4317 C CB  . VAL C 178 ? 0.4537 0.5680 0.3782 -0.0200 -0.0930 0.0380  180 VAL C CB  
4318 C CG1 . VAL C 178 ? 0.4784 0.5931 0.4013 -0.0165 -0.0884 0.0349  180 VAL C CG1 
4319 C CG2 . VAL C 178 ? 0.4228 0.5451 0.3600 -0.0219 -0.0924 0.0395  180 VAL C CG2 
4320 N N   . SER C 179 ? 0.4344 0.5469 0.3615 -0.0282 -0.1045 0.0393  181 SER C N   
4321 C CA  . SER C 179 ? 0.4581 0.5749 0.3907 -0.0314 -0.1060 0.0399  181 SER C CA  
4322 C C   . SER C 179 ? 0.4526 0.5831 0.3972 -0.0326 -0.1034 0.0415  181 SER C C   
4323 O O   . SER C 179 ? 0.4381 0.5723 0.3848 -0.0330 -0.1045 0.0431  181 SER C O   
4324 C CB  . SER C 179 ? 0.4889 0.6004 0.4161 -0.0367 -0.1139 0.0421  181 SER C CB  
4325 O OG  . SER C 179 ? 0.5964 0.7149 0.5272 -0.0403 -0.1166 0.0455  181 SER C OG  
4326 N N   . ALA C 180 ? 0.3954 0.5336 0.3478 -0.0325 -0.1005 0.0406  182 ALA C N   
4327 C CA  . ALA C 180 ? 0.4070 0.5587 0.3709 -0.0319 -0.0979 0.0406  182 ALA C CA  
4328 C C   . ALA C 180 ? 0.4313 0.5923 0.4007 -0.0346 -0.0980 0.0407  182 ALA C C   
4329 O O   . ALA C 180 ? 0.4284 0.5835 0.3935 -0.0358 -0.0987 0.0405  182 ALA C O   
4330 C CB  . ALA C 180 ? 0.3992 0.5506 0.3670 -0.0271 -0.0926 0.0383  182 ALA C CB  
4331 N N   . ARG C 181 ? 0.4195 0.5955 0.3982 -0.0351 -0.0977 0.0410  183 ARG C N   
4332 C CA  . ARG C 181 ? 0.4710 0.6595 0.4553 -0.0380 -0.0977 0.0415  183 ARG C CA  
4333 C C   . ARG C 181 ? 0.4246 0.6285 0.4200 -0.0341 -0.0947 0.0385  183 ARG C C   
4334 O O   . ARG C 181 ? 0.3749 0.5830 0.3737 -0.0317 -0.0956 0.0378  183 ARG C O   
4335 C CB  . ARG C 181 ? 0.5259 0.7208 0.5082 -0.0451 -0.1034 0.0461  183 ARG C CB  
4336 C CG  . ARG C 181 ? 0.6222 0.8295 0.6081 -0.0500 -0.1042 0.0483  183 ARG C CG  
4337 C CD  . ARG C 181 ? 0.6576 0.8781 0.6446 -0.0577 -0.1095 0.0536  183 ARG C CD  
4338 N NE  . ARG C 181 ? 0.9183 1.1626 0.9144 -0.0594 -0.1078 0.0540  183 ARG C NE  
4339 C CZ  . ARG C 181 ? 0.9435 1.2038 0.9412 -0.0675 -0.1117 0.0595  183 ARG C CZ  
4340 N NH1 . ARG C 181 ? 1.0067 1.2601 0.9978 -0.0753 -0.1183 0.0655  183 ARG C NH1 
4341 N NH2 . ARG C 181 ? 0.8919 1.1761 0.8978 -0.0681 -0.1093 0.0592  183 ARG C NH2 
4342 N N   . ILE C 182 ? 0.4121 0.6235 0.4127 -0.0330 -0.0919 0.0364  184 ILE C N   
4343 C CA  . ILE C 182 ? 0.3939 0.6219 0.4049 -0.0293 -0.0900 0.0329  184 ILE C CA  
4344 C C   . ILE C 182 ? 0.3645 0.6097 0.3788 -0.0336 -0.0907 0.0344  184 ILE C C   
4345 O O   . ILE C 182 ? 0.3483 0.5888 0.3571 -0.0390 -0.0920 0.0379  184 ILE C O   
4346 C CB  . ILE C 182 ? 0.3699 0.5927 0.3846 -0.0235 -0.0861 0.0284  184 ILE C CB  
4347 C CG1 . ILE C 182 ? 0.3557 0.5708 0.3664 -0.0253 -0.0839 0.0289  184 ILE C CG1 
4348 C CG2 . ILE C 182 ? 0.3899 0.5997 0.4028 -0.0199 -0.0861 0.0278  184 ILE C CG2 
4349 C CD1 . ILE C 182 ? 0.3069 0.5196 0.3222 -0.0206 -0.0801 0.0249  184 ILE C CD1 
4350 N N   . ASP C 183 ? 0.3873 0.6527 0.4102 -0.0311 -0.0904 0.0318  185 ASP C N   
4351 C CA  . ASP C 183 ? 0.4410 0.7270 0.4668 -0.0362 -0.0914 0.0343  185 ASP C CA  
4352 C C   . ASP C 183 ? 0.4335 0.7238 0.4606 -0.0368 -0.0888 0.0332  185 ASP C C   
4353 O O   . ASP C 183 ? 0.3947 0.6980 0.4215 -0.0431 -0.0902 0.0372  185 ASP C O   
4354 C CB  . ASP C 183 ? 0.5042 0.8141 0.5382 -0.0335 -0.0924 0.0320  185 ASP C CB  
4355 C CG  . ASP C 183 ? 0.6779 0.9954 0.7202 -0.0238 -0.0899 0.0239  185 ASP C CG  
4356 O OD1 . ASP C 183 ? 0.8242 1.1525 0.8701 -0.0224 -0.0876 0.0211  185 ASP C OD1 
4357 O OD2 . ASP C 183 ? 0.8235 1.1364 0.8686 -0.0175 -0.0910 0.0203  185 ASP C OD2 
4358 N N   . ARG C 184 ? 0.3767 0.6567 0.4053 -0.0308 -0.0855 0.0284  186 ARG C N   
4359 C CA  . ARG C 184 ? 0.3514 0.6352 0.3816 -0.0308 -0.0830 0.0269  186 ARG C CA  
4360 C C   . ARG C 184 ? 0.3595 0.6242 0.3881 -0.0262 -0.0803 0.0237  186 ARG C C   
4361 O O   . ARG C 184 ? 0.3491 0.6011 0.3763 -0.0231 -0.0802 0.0227  186 ARG C O   
4362 C CB  . ARG C 184 ? 0.3277 0.6360 0.3667 -0.0271 -0.0818 0.0224  186 ARG C CB  
4363 C CG  . ARG C 184 ? 0.3588 0.6698 0.4045 -0.0182 -0.0814 0.0156  186 ARG C CG  
4364 C CD  . ARG C 184 ? 0.3768 0.7137 0.4304 -0.0140 -0.0812 0.0105  186 ARG C CD  
4365 N NE  . ARG C 184 ? 0.3807 0.7157 0.4406 -0.0039 -0.0815 0.0023  186 ARG C NE  
4366 C CZ  . ARG C 184 ? 0.4184 0.7563 0.4820 0.0015  -0.0843 -0.0010 186 ARG C CZ  
4367 N NH1 . ARG C 184 ? 0.4398 0.7835 0.5016 -0.0023 -0.0862 0.0034  186 ARG C NH1 
4368 N NH2 . ARG C 184 ? 0.3893 0.7233 0.4583 0.0106  -0.0859 -0.0085 186 ARG C NH2 
4369 N N   . LYS C 185 ? 0.3430 0.6066 0.3717 -0.0264 -0.0783 0.0228  187 LYS C N   
4370 C CA  . LYS C 185 ? 0.3558 0.6045 0.3840 -0.0224 -0.0756 0.0199  187 LYS C CA  
4371 C C   . LYS C 185 ? 0.3729 0.6295 0.4096 -0.0161 -0.0735 0.0136  187 LYS C C   
4372 O O   . LYS C 185 ? 0.3293 0.5747 0.3673 -0.0122 -0.0721 0.0110  187 LYS C O   
4373 C CB  . LYS C 185 ? 0.3689 0.6099 0.3916 -0.0261 -0.0755 0.0225  187 LYS C CB  
4374 C CG  . LYS C 185 ? 0.4493 0.6795 0.4724 -0.0223 -0.0724 0.0196  187 LYS C CG  
4375 C CD  . LYS C 185 ? 0.4438 0.6676 0.4615 -0.0255 -0.0733 0.0220  187 LYS C CD  
4376 C CE  . LYS C 185 ? 0.5804 0.7910 0.5962 -0.0221 -0.0709 0.0200  187 LYS C CE  
4377 N NZ  . LYS C 185 ? 0.7002 0.9015 0.7090 -0.0243 -0.0730 0.0221  187 LYS C NZ  
4378 N N   . GLY C 186 ? 0.3697 0.6459 0.4119 -0.0151 -0.0737 0.0111  188 GLY C N   
4379 C CA  . GLY C 186 ? 0.3169 0.6005 0.3665 -0.0088 -0.0726 0.0043  188 GLY C CA  
4380 C C   . GLY C 186 ? 0.3032 0.5949 0.3584 -0.0030 -0.0747 -0.0002 188 GLY C C   
4381 O O   . GLY C 186 ? 0.2991 0.6057 0.3554 -0.0041 -0.0763 0.0007  188 GLY C O   
4382 N N   . PHE C 187 ? 0.3134 0.5948 0.3723 0.0029  -0.0755 -0.0048 189 PHE C N   
4383 C CA  . PHE C 187 ? 0.3115 0.5972 0.3757 0.0095  -0.0790 -0.0098 189 PHE C CA  
4384 C C   . PHE C 187 ? 0.3140 0.6007 0.3846 0.0164  -0.0804 -0.0174 189 PHE C C   
4385 O O   . PHE C 187 ? 0.3495 0.6266 0.4196 0.0154  -0.0787 -0.0174 189 PHE C O   
4386 C CB  . PHE C 187 ? 0.3044 0.5711 0.3656 0.0092  -0.0808 -0.0068 189 PHE C CB  
4387 C CG  . PHE C 187 ? 0.3110 0.5762 0.3660 0.0036  -0.0806 -0.0005 189 PHE C CG  
4388 C CD1 . PHE C 187 ? 0.2743 0.5506 0.3311 0.0048  -0.0833 -0.0007 189 PHE C CD1 
4389 C CD2 . PHE C 187 ? 0.3178 0.5715 0.3654 -0.0026 -0.0783 0.0053  189 PHE C CD2 
4390 C CE1 . PHE C 187 ? 0.2973 0.5722 0.3483 -0.0010 -0.0838 0.0054  189 PHE C CE1 
4391 C CE2 . PHE C 187 ? 0.2112 0.4629 0.2527 -0.0077 -0.0791 0.0107  189 PHE C CE2 
4392 C CZ  . PHE C 187 ? 0.1918 0.4536 0.2350 -0.0073 -0.0819 0.0110  189 PHE C CZ  
4393 N N   . CYS C 188 ? 0.2963 0.5947 0.3728 0.0237  -0.0840 -0.0242 190 CYS C N   
4394 C CA  . CYS C 188 ? 0.3794 0.6775 0.4619 0.0316  -0.0872 -0.0326 190 CYS C CA  
4395 C C   . CYS C 188 ? 0.3415 0.6191 0.4253 0.0352  -0.0922 -0.0337 190 CYS C C   
4396 O O   . CYS C 188 ? 0.2905 0.5637 0.3730 0.0352  -0.0944 -0.0312 190 CYS C O   
4397 C CB  . CYS C 188 ? 0.4357 0.7588 0.5238 0.0391  -0.0895 -0.0405 190 CYS C CB  
4398 S SG  . CYS C 188 ? 0.6452 0.9978 0.7317 0.0337  -0.0843 -0.0379 190 CYS C SG  
4399 N N   . GLU C 189 ? 0.3443 0.6100 0.4307 0.0380  -0.0947 -0.0372 191 GLU C N   
4400 C CA  . GLU C 189 ? 0.4190 0.6646 0.5066 0.0403  -0.1006 -0.0373 191 GLU C CA  
4401 C C   . GLU C 189 ? 0.4616 0.7136 0.5531 0.0483  -0.1069 -0.0431 191 GLU C C   
4402 O O   . GLU C 189 ? 0.4937 0.7639 0.5898 0.0556  -0.1087 -0.0513 191 GLU C O   
4403 C CB  . GLU C 189 ? 0.4307 0.6652 0.5215 0.0421  -0.1035 -0.0408 191 GLU C CB  
4404 C CG  . GLU C 189 ? 0.5576 0.7962 0.6548 0.0523  -0.1110 -0.0514 191 GLU C CG  
4405 C CD  . GLU C 189 ? 0.7332 0.9677 0.8332 0.0537  -0.1125 -0.0558 191 GLU C CD  
4406 O OE1 . GLU C 189 ? 0.6849 0.9358 0.7884 0.0601  -0.1130 -0.0643 191 GLU C OE1 
4407 O OE2 . GLU C 189 ? 0.7278 0.9441 0.8268 0.0483  -0.1132 -0.0506 191 GLU C OE2 
4408 N N   . GLY C 190 ? 0.4846 0.7241 0.5739 0.0469  -0.1100 -0.0387 192 GLY C N   
4409 C CA  . GLY C 190 ? 0.4910 0.7342 0.5839 0.0548  -0.1169 -0.0439 192 GLY C CA  
4410 C C   . GLY C 190 ? 0.4964 0.7545 0.5872 0.0530  -0.1139 -0.0408 192 GLY C C   
4411 O O   . GLY C 190 ? 0.5385 0.7981 0.6314 0.0582  -0.1193 -0.0432 192 GLY C O   
4412 N N   . ASP C 191 ? 0.4558 0.7248 0.5427 0.0457  -0.1063 -0.0355 193 ASP C N   
4413 C CA  . ASP C 191 ? 0.4181 0.7007 0.5024 0.0420  -0.1036 -0.0313 193 ASP C CA  
4414 C C   . ASP C 191 ? 0.4214 0.6846 0.4995 0.0359  -0.1038 -0.0230 193 ASP C C   
4415 O O   . ASP C 191 ? 0.3868 0.6295 0.4621 0.0335  -0.1043 -0.0198 193 ASP C O   
4416 C CB  . ASP C 191 ? 0.4406 0.7385 0.5223 0.0355  -0.0968 -0.0280 193 ASP C CB  
4417 C CG  . ASP C 191 ? 0.5561 0.8810 0.6435 0.0410  -0.0966 -0.0355 193 ASP C CG  
4418 O OD1 . ASP C 191 ? 0.5670 0.8968 0.6605 0.0510  -0.1013 -0.0447 193 ASP C OD1 
4419 O OD2 . ASP C 191 ? 0.6447 0.9866 0.7303 0.0354  -0.0922 -0.0320 193 ASP C OD2 
4420 N N   . GLU C 192 ? 0.4121 0.6826 0.4881 0.0338  -0.1039 -0.0196 194 GLU C N   
4421 C CA  . GLU C 192 ? 0.4607 0.7143 0.5298 0.0277  -0.1036 -0.0116 194 GLU C CA  
4422 C C   . GLU C 192 ? 0.4215 0.6771 0.4837 0.0186  -0.0976 -0.0047 194 GLU C C   
4423 O O   . GLU C 192 ? 0.4433 0.7172 0.5065 0.0166  -0.0955 -0.0049 194 GLU C O   
4424 C CB  . GLU C 192 ? 0.5188 0.7752 0.5893 0.0312  -0.1087 -0.0121 194 GLU C CB  
4425 C CG  . GLU C 192 ? 0.6285 0.9059 0.6991 0.0289  -0.1072 -0.0107 194 GLU C CG  
4426 C CD  . GLU C 192 ? 0.7706 1.0484 0.8417 0.0313  -0.1121 -0.0099 194 GLU C CD  
4427 O OE1 . GLU C 192 ? 0.9307 1.2056 1.0070 0.0398  -0.1182 -0.0156 194 GLU C OE1 
4428 O OE2 . GLU C 192 ? 0.9010 1.1809 0.9672 0.0248  -0.1107 -0.0037 194 GLU C OE2 
4429 N N   . ILE C 193 ? 0.4141 0.6517 0.4692 0.0130  -0.0954 0.0012  195 ILE C N   
4430 C CA  . ILE C 193 ? 0.4031 0.6403 0.4507 0.0053  -0.0918 0.0074  195 ILE C CA  
4431 C C   . ILE C 193 ? 0.4479 0.6821 0.4918 0.0037  -0.0947 0.0111  195 ILE C C   
4432 O O   . ILE C 193 ? 0.4719 0.6917 0.5133 0.0045  -0.0968 0.0128  195 ILE C O   
4433 C CB  . ILE C 193 ? 0.3889 0.6099 0.4299 0.0009  -0.0881 0.0113  195 ILE C CB  
4434 C CG1 . ILE C 193 ? 0.4296 0.6512 0.4748 0.0029  -0.0859 0.0077  195 ILE C CG1 
4435 C CG2 . ILE C 193 ? 0.4054 0.6256 0.4384 -0.0058 -0.0858 0.0165  195 ILE C CG2 
4436 C CD1 . ILE C 193 ? 0.3265 0.5345 0.3664 -0.0007 -0.0823 0.0110  195 ILE C CD1 
4437 N N   . SER C 194 ? 0.3916 0.6396 0.4348 0.0007  -0.0950 0.0129  196 SER C N   
4438 C CA  . SER C 194 ? 0.4265 0.6730 0.4663 -0.0013 -0.0981 0.0164  196 SER C CA  
4439 C C   . SER C 194 ? 0.4020 0.6375 0.4319 -0.0090 -0.0962 0.0227  196 SER C C   
4440 O O   . SER C 194 ? 0.3882 0.6299 0.4160 -0.0137 -0.0944 0.0246  196 SER C O   
4441 C CB  . SER C 194 ? 0.4724 0.7426 0.5185 0.0001  -0.1003 0.0144  196 SER C CB  
4442 O OG  . SER C 194 ? 0.6215 0.8948 0.6633 -0.0053 -0.1021 0.0195  196 SER C OG  
4443 N N   . ILE C 195 ? 0.3963 0.6147 0.4196 -0.0099 -0.0970 0.0257  197 ILE C N   
4444 C CA  . ILE C 195 ? 0.3927 0.5986 0.4057 -0.0155 -0.0954 0.0302  197 ILE C CA  
4445 C C   . ILE C 195 ? 0.4387 0.6441 0.4463 -0.0192 -0.0989 0.0340  197 ILE C C   
4446 O O   . ILE C 195 ? 0.4009 0.6036 0.4087 -0.0171 -0.1017 0.0344  197 ILE C O   
4447 C CB  . ILE C 195 ? 0.4095 0.5980 0.4174 -0.0144 -0.0936 0.0311  197 ILE C CB  
4448 C CG1 . ILE C 195 ? 0.3791 0.5671 0.3927 -0.0111 -0.0909 0.0278  197 ILE C CG1 
4449 C CG2 . ILE C 195 ? 0.3356 0.5136 0.3327 -0.0187 -0.0921 0.0343  197 ILE C CG2 
4450 C CD1 . ILE C 195 ? 0.3945 0.5692 0.4052 -0.0103 -0.0900 0.0292  197 ILE C CD1 
4451 N N   . HIS C 196 ? 0.4237 0.6300 0.4259 -0.0250 -0.0995 0.0370  198 HIS C N   
4452 C CA  . HIS C 196 ? 0.4511 0.6529 0.4462 -0.0294 -0.1034 0.0409  198 HIS C CA  
4453 C C   . HIS C 196 ? 0.4171 0.6002 0.4008 -0.0312 -0.1029 0.0426  198 HIS C C   
4454 O O   . HIS C 196 ? 0.4182 0.5967 0.3987 -0.0326 -0.1011 0.0423  198 HIS C O   
4455 C CB  . HIS C 196 ? 0.4969 0.7127 0.4937 -0.0352 -0.1061 0.0436  198 HIS C CB  
4456 C CG  . HIS C 196 ? 0.5658 0.8040 0.5737 -0.0330 -0.1063 0.0415  198 HIS C CG  
4457 N ND1 . HIS C 196 ? 0.6426 0.8925 0.6538 -0.0334 -0.1100 0.0426  198 HIS C ND1 
4458 C CD2 . HIS C 196 ? 0.7065 0.9588 0.7229 -0.0295 -0.1036 0.0377  198 HIS C CD2 
4459 C CE1 . HIS C 196 ? 0.7073 0.9784 0.7287 -0.0300 -0.1094 0.0393  198 HIS C CE1 
4460 N NE2 . HIS C 196 ? 0.7742 1.0469 0.7986 -0.0274 -0.1056 0.0361  198 HIS C NE2 
4461 N N   . ALA C 197 ? 0.4003 0.5733 0.3778 -0.0306 -0.1047 0.0440  199 ALA C N   
4462 C CA  . ALA C 197 ? 0.3802 0.5374 0.3469 -0.0307 -0.1039 0.0445  199 ALA C CA  
4463 C C   . ALA C 197 ? 0.3798 0.5299 0.3384 -0.0324 -0.1081 0.0469  199 ALA C C   
4464 O O   . ALA C 197 ? 0.3362 0.4907 0.2982 -0.0316 -0.1102 0.0479  199 ALA C O   
4465 C CB  . ALA C 197 ? 0.3381 0.4902 0.3059 -0.0262 -0.0994 0.0428  199 ALA C CB  
4466 N N   . ASP C 198 ? 0.3758 0.5143 0.3234 -0.0338 -0.1096 0.0472  200 ASP C N   
4467 C CA  . ASP C 198 ? 0.4081 0.5385 0.3465 -0.0350 -0.1138 0.0488  200 ASP C CA  
4468 C C   . ASP C 198 ? 0.4113 0.5304 0.3399 -0.0318 -0.1114 0.0471  200 ASP C C   
4469 O O   . ASP C 198 ? 0.3611 0.4754 0.2859 -0.0307 -0.1097 0.0448  200 ASP C O   
4470 C CB  . ASP C 198 ? 0.4119 0.5394 0.3451 -0.0403 -0.1201 0.0505  200 ASP C CB  
4471 C CG  . ASP C 198 ? 0.5233 0.6650 0.4655 -0.0446 -0.1230 0.0532  200 ASP C CG  
4472 O OD1 . ASP C 198 ? 0.4487 0.6009 0.3988 -0.0429 -0.1222 0.0536  200 ASP C OD1 
4473 O OD2 . ASP C 198 ? 0.4680 0.6107 0.4090 -0.0498 -0.1268 0.0550  200 ASP C OD2 
4474 N N   . PHE C 199 ? 0.3722 0.4879 0.2964 -0.0302 -0.1115 0.0482  201 PHE C N   
4475 C CA  . PHE C 199 ? 0.3923 0.5009 0.3071 -0.0272 -0.1087 0.0471  201 PHE C CA  
4476 C C   . PHE C 199 ? 0.4379 0.5388 0.3408 -0.0277 -0.1134 0.0475  201 PHE C C   
4477 O O   . PHE C 199 ? 0.4039 0.5061 0.3078 -0.0297 -0.1172 0.0501  201 PHE C O   
4478 C CB  . PHE C 199 ? 0.3959 0.5081 0.3153 -0.0253 -0.1049 0.0489  201 PHE C CB  
4479 C CG  . PHE C 199 ? 0.4886 0.6078 0.4202 -0.0246 -0.1015 0.0485  201 PHE C CG  
4480 C CD1 . PHE C 199 ? 0.3647 0.4846 0.2976 -0.0229 -0.0965 0.0465  201 PHE C CD1 
4481 C CD2 . PHE C 199 ? 0.4082 0.5340 0.3499 -0.0250 -0.1036 0.0494  201 PHE C CD2 
4482 C CE1 . PHE C 199 ? 0.4563 0.5823 0.4003 -0.0222 -0.0939 0.0458  201 PHE C CE1 
4483 C CE2 . PHE C 199 ? 0.4053 0.5374 0.3576 -0.0235 -0.1011 0.0479  201 PHE C CE2 
4484 C CZ  . PHE C 199 ? 0.3430 0.4746 0.2963 -0.0224 -0.0964 0.0462  201 PHE C CZ  
4485 N N   . GLU C 200 ? 0.4633 0.5568 0.3551 -0.0254 -0.1137 0.0444  202 GLU C N   
4486 C CA  . GLU C 200 ? 0.5194 0.6052 0.3983 -0.0247 -0.1182 0.0436  202 GLU C CA  
4487 C C   . GLU C 200 ? 0.4990 0.5856 0.3701 -0.0205 -0.1135 0.0422  202 GLU C C   
4488 O O   . GLU C 200 ? 0.4607 0.5494 0.3317 -0.0173 -0.1089 0.0394  202 GLU C O   
4489 C CB  . GLU C 200 ? 0.5443 0.6203 0.4150 -0.0248 -0.1240 0.0400  202 GLU C CB  
4490 C CG  . GLU C 200 ? 0.7403 0.8112 0.6086 -0.0295 -0.1324 0.0420  202 GLU C CG  
4491 C CD  . GLU C 200 ? 0.6524 0.7096 0.5075 -0.0285 -0.1400 0.0381  202 GLU C CD  
4492 O OE1 . GLU C 200 ? 0.6794 0.7313 0.5235 -0.0229 -0.1394 0.0336  202 GLU C OE1 
4493 O OE2 . GLU C 200 ? 0.7193 0.7715 0.5750 -0.0335 -0.1471 0.0396  202 GLU C OE2 
4494 N N   . ASN C 201 ? 0.4511 0.5372 0.3157 -0.0206 -0.1149 0.0444  203 ASN C N   
4495 C CA  . ASN C 201 ? 0.4636 0.5524 0.3193 -0.0174 -0.1112 0.0440  203 ASN C CA  
4496 C C   . ASN C 201 ? 0.4795 0.5624 0.3207 -0.0159 -0.1163 0.0421  203 ASN C C   
4497 O O   . ASN C 201 ? 0.4800 0.5625 0.3194 -0.0183 -0.1191 0.0459  203 ASN C O   
4498 C CB  . ASN C 201 ? 0.4598 0.5558 0.3217 -0.0195 -0.1074 0.0500  203 ASN C CB  
4499 C CG  . ASN C 201 ? 0.4442 0.5456 0.2970 -0.0176 -0.1035 0.0508  203 ASN C CG  
4500 O OD1 . ASN C 201 ? 0.4860 0.5883 0.3297 -0.0135 -0.1020 0.0459  203 ASN C OD1 
4501 N ND2 . ASN C 201 ? 0.4248 0.5302 0.2792 -0.0205 -0.1026 0.0571  203 ASN C ND2 
4502 N N   . THR C 202 ? 0.5229 0.6012 0.3538 -0.0114 -0.1178 0.0358  204 THR C N   
4503 C CA  . THR C 202 ? 0.5894 0.6629 0.4052 -0.0085 -0.1224 0.0327  204 THR C CA  
4504 C C   . THR C 202 ? 0.6009 0.6838 0.4079 -0.0035 -0.1167 0.0305  204 THR C C   
4505 O O   . THR C 202 ? 0.6175 0.6989 0.4109 0.0008  -0.1195 0.0262  204 THR C O   
4506 C CB  . THR C 202 ? 0.6325 0.6935 0.4409 -0.0060 -0.1300 0.0262  204 THR C CB  
4507 O OG1 . THR C 202 ? 0.5776 0.6394 0.3871 -0.0016 -0.1270 0.0212  204 THR C OG1 
4508 C CG2 . THR C 202 ? 0.6786 0.7319 0.4944 -0.0122 -0.1365 0.0292  204 THR C CG2 
4509 N N   . SER C 203 ? 0.5923 0.6860 0.4069 -0.0038 -0.1090 0.0332  205 SER C N   
4510 C CA  . SER C 203 ? 0.5951 0.7011 0.4024 -0.0001 -0.1032 0.0322  205 SER C CA  
4511 C C   . SER C 203 ? 0.6106 0.7227 0.4147 -0.0041 -0.1023 0.0394  205 SER C C   
4512 O O   . SER C 203 ? 0.5800 0.6865 0.3895 -0.0092 -0.1058 0.0448  205 SER C O   
4513 C CB  . SER C 203 ? 0.5809 0.6967 0.3979 0.0000  -0.0958 0.0333  205 SER C CB  
4514 O OG  . SER C 203 ? 0.5659 0.6854 0.3937 -0.0065 -0.0932 0.0418  205 SER C OG  
4515 N N   . SER C 204 ? 0.5941 0.7193 0.3904 -0.0021 -0.0976 0.0400  206 SER C N   
4516 C CA  . SER C 204 ? 0.6433 0.7755 0.4355 -0.0065 -0.0969 0.0477  206 SER C CA  
4517 C C   . SER C 204 ? 0.6258 0.7632 0.4302 -0.0134 -0.0934 0.0573  206 SER C C   
4518 O O   . SER C 204 ? 0.6416 0.7833 0.4436 -0.0181 -0.0938 0.0650  206 SER C O   
4519 C CB  . SER C 204 ? 0.6775 0.8243 0.4560 -0.0023 -0.0935 0.0452  206 SER C CB  
4520 O OG  . SER C 204 ? 0.6528 0.8133 0.4353 -0.0006 -0.0864 0.0444  206 SER C OG  
4521 N N   . ARG C 205 ? 0.5846 0.7208 0.4016 -0.0141 -0.0907 0.0570  207 ARG C N   
4522 C CA  . ARG C 205 ? 0.5883 0.7295 0.4167 -0.0198 -0.0875 0.0648  207 ARG C CA  
4523 C C   . ARG C 205 ? 0.5523 0.6819 0.3918 -0.0233 -0.0923 0.0680  207 ARG C C   
4524 O O   . ARG C 205 ? 0.5346 0.6550 0.3751 -0.0213 -0.0963 0.0635  207 ARG C O   
4525 C CB  . ARG C 205 ? 0.5951 0.7434 0.4309 -0.0180 -0.0817 0.0621  207 ARG C CB  
4526 C CG  . ARG C 205 ? 0.6765 0.8417 0.5049 -0.0160 -0.0757 0.0615  207 ARG C CG  
4527 C CD  . ARG C 205 ? 0.7863 0.9528 0.6032 -0.0078 -0.0761 0.0515  207 ARG C CD  
4528 N NE  . ARG C 205 ? 0.8373 1.0224 0.6471 -0.0042 -0.0704 0.0493  207 ARG C NE  
4529 C CZ  . ARG C 205 ? 0.8699 1.0593 0.6687 0.0044  -0.0704 0.0397  207 ARG C CZ  
4530 N NH1 . ARG C 205 ? 0.7185 0.8925 0.5117 0.0094  -0.0767 0.0322  207 ARG C NH1 
4531 N NH2 . ARG C 205 ? 0.9287 1.1383 0.7222 0.0081  -0.0648 0.0376  207 ARG C NH2 
4532 N N   . ILE C 206 ? 0.5378 0.6685 0.3852 -0.0284 -0.0924 0.0757  208 ILE C N   
4533 C CA  . ILE C 206 ? 0.5231 0.6454 0.3830 -0.0306 -0.0962 0.0779  208 ILE C CA  
4534 C C   . ILE C 206 ? 0.5318 0.6570 0.4024 -0.0299 -0.0919 0.0756  208 ILE C C   
4535 O O   . ILE C 206 ? 0.5315 0.6648 0.4032 -0.0319 -0.0877 0.0790  208 ILE C O   
4536 C CB  . ILE C 206 ? 0.5125 0.6335 0.3750 -0.0357 -0.0997 0.0869  208 ILE C CB  
4537 C CG1 . ILE C 206 ? 0.5928 0.7123 0.4432 -0.0367 -0.1036 0.0898  208 ILE C CG1 
4538 C CG2 . ILE C 206 ? 0.5180 0.6307 0.3934 -0.0363 -0.1044 0.0876  208 ILE C CG2 
4539 C CD1 . ILE C 206 ? 0.6767 0.7960 0.5269 -0.0424 -0.1071 0.0998  208 ILE C CD1 
4540 N N   . VAL C 207 ? 0.5172 0.6371 0.3951 -0.0275 -0.0930 0.0704  209 VAL C N   
4541 C CA  . VAL C 207 ? 0.4490 0.5710 0.3368 -0.0262 -0.0894 0.0671  209 VAL C CA  
4542 C C   . VAL C 207 ? 0.4549 0.5728 0.3562 -0.0278 -0.0925 0.0689  209 VAL C C   
4543 O O   . VAL C 207 ? 0.4861 0.5993 0.3892 -0.0287 -0.0977 0.0710  209 VAL C O   
4544 C CB  . VAL C 207 ? 0.4531 0.5738 0.3375 -0.0219 -0.0883 0.0593  209 VAL C CB  
4545 C CG1 . VAL C 207 ? 0.4227 0.5467 0.2928 -0.0188 -0.0867 0.0563  209 VAL C CG1 
4546 C CG2 . VAL C 207 ? 0.3536 0.4668 0.2406 -0.0216 -0.0935 0.0566  209 VAL C CG2 
4547 N N   . VAL C 208 ? 0.4350 0.5556 0.3458 -0.0276 -0.0896 0.0678  210 VAL C N   
4548 C CA  . VAL C 208 ? 0.4562 0.5741 0.3792 -0.0285 -0.0925 0.0691  210 VAL C CA  
4549 C C   . VAL C 208 ? 0.4550 0.5749 0.3864 -0.0261 -0.0902 0.0637  210 VAL C C   
4550 O O   . VAL C 208 ? 0.4596 0.5837 0.3923 -0.0258 -0.0855 0.0624  210 VAL C O   
4551 C CB  . VAL C 208 ? 0.4580 0.5765 0.3847 -0.0320 -0.0927 0.0753  210 VAL C CB  
4552 C CG1 . VAL C 208 ? 0.4263 0.5400 0.3655 -0.0315 -0.0974 0.0753  210 VAL C CG1 
4553 C CG2 . VAL C 208 ? 0.5544 0.6721 0.4718 -0.0354 -0.0950 0.0820  210 VAL C CG2 
4554 N N   . PRO C 209 ? 0.4561 0.5747 0.3932 -0.0245 -0.0934 0.0606  211 PRO C N   
4555 C CA  . PRO C 209 ? 0.4095 0.5314 0.3544 -0.0228 -0.0916 0.0560  211 PRO C CA  
4556 C C   . PRO C 209 ? 0.4462 0.5695 0.4025 -0.0224 -0.0918 0.0562  211 PRO C C   
4557 O O   . PRO C 209 ? 0.3887 0.5092 0.3491 -0.0226 -0.0961 0.0588  211 PRO C O   
4558 C CB  . PRO C 209 ? 0.4270 0.5492 0.3729 -0.0222 -0.0955 0.0539  211 PRO C CB  
4559 C CG  . PRO C 209 ? 0.4425 0.5616 0.3871 -0.0229 -0.1004 0.0575  211 PRO C CG  
4560 C CD  . PRO C 209 ? 0.4723 0.5880 0.4093 -0.0246 -0.0991 0.0619  211 PRO C CD  
4561 N N   . LYS C 210 ? 0.4239 0.5509 0.3851 -0.0215 -0.0879 0.0533  212 LYS C N   
4562 C CA  . LYS C 210 ? 0.4025 0.5304 0.3738 -0.0210 -0.0883 0.0529  212 LYS C CA  
4563 C C   . LYS C 210 ? 0.3789 0.5120 0.3559 -0.0191 -0.0855 0.0478  212 LYS C C   
4564 O O   . LYS C 210 ? 0.3652 0.5000 0.3371 -0.0190 -0.0824 0.0459  212 LYS C O   
4565 C CB  . LYS C 210 ? 0.3505 0.4776 0.3199 -0.0237 -0.0858 0.0570  212 LYS C CB  
4566 C CG  . LYS C 210 ? 0.4236 0.5465 0.3877 -0.0267 -0.0888 0.0632  212 LYS C CG  
4567 C CD  . LYS C 210 ? 0.4491 0.5746 0.4092 -0.0304 -0.0856 0.0680  212 LYS C CD  
4568 C CE  . LYS C 210 ? 0.4695 0.5920 0.4234 -0.0342 -0.0889 0.0751  212 LYS C CE  
4569 N NZ  . LYS C 210 ? 0.5853 0.7135 0.5360 -0.0388 -0.0855 0.0806  212 LYS C NZ  
4570 N N   . ALA C 211 ? 0.3794 0.5147 0.3665 -0.0173 -0.0871 0.0455  213 ALA C N   
4571 C CA  . ALA C 211 ? 0.3559 0.4967 0.3485 -0.0158 -0.0841 0.0412  213 ALA C CA  
4572 C C   . ALA C 211 ? 0.3867 0.5271 0.3875 -0.0152 -0.0846 0.0406  213 ALA C C   
4573 O O   . ALA C 211 ? 0.4050 0.5405 0.4092 -0.0150 -0.0890 0.0425  213 ALA C O   
4574 C CB  . ALA C 211 ? 0.3381 0.4855 0.3347 -0.0139 -0.0858 0.0375  213 ALA C CB  
4575 N N   . ALA C 212 ? 0.3328 0.4773 0.3366 -0.0148 -0.0808 0.0379  214 ALA C N   
4576 C CA  . ALA C 212 ? 0.3291 0.4731 0.3404 -0.0145 -0.0813 0.0371  214 ALA C CA  
4577 C C   . ALA C 212 ? 0.3288 0.4796 0.3448 -0.0126 -0.0782 0.0323  214 ALA C C   
4578 O O   . ALA C 212 ? 0.3131 0.4671 0.3244 -0.0132 -0.0742 0.0315  214 ALA C O   
4579 C CB  . ALA C 212 ? 0.2891 0.4297 0.2968 -0.0183 -0.0792 0.0422  214 ALA C CB  
4580 N N   . ILE C 213 ? 0.3363 0.4887 0.3611 -0.0102 -0.0807 0.0288  215 ILE C N   
4581 C CA  . ILE C 213 ? 0.3564 0.5147 0.3859 -0.0090 -0.0779 0.0248  215 ILE C CA  
4582 C C   . ILE C 213 ? 0.3490 0.5044 0.3795 -0.0115 -0.0758 0.0271  215 ILE C C   
4583 O O   . ILE C 213 ? 0.3349 0.4842 0.3679 -0.0130 -0.0792 0.0298  215 ILE C O   
4584 C CB  . ILE C 213 ? 0.3733 0.5372 0.4115 -0.0045 -0.0814 0.0189  215 ILE C CB  
4585 C CG1 . ILE C 213 ? 0.3693 0.5405 0.4073 -0.0022 -0.0830 0.0167  215 ILE C CG1 
4586 C CG2 . ILE C 213 ? 0.3345 0.5047 0.3762 -0.0040 -0.0779 0.0155  215 ILE C CG2 
4587 C CD1 . ILE C 213 ? 0.4355 0.6125 0.4819 0.0035  -0.0882 0.0108  215 ILE C CD1 
4588 N N   . VAL C 214 ? 0.3369 0.4966 0.3650 -0.0124 -0.0708 0.0266  216 VAL C N   
4589 C CA  . VAL C 214 ? 0.3220 0.4816 0.3510 -0.0148 -0.0682 0.0288  216 VAL C CA  
4590 C C   . VAL C 214 ? 0.3156 0.4807 0.3504 -0.0131 -0.0663 0.0243  216 VAL C C   
4591 O O   . VAL C 214 ? 0.3308 0.5006 0.3644 -0.0112 -0.0645 0.0212  216 VAL C O   
4592 C CB  . VAL C 214 ? 0.3341 0.4945 0.3545 -0.0169 -0.0640 0.0323  216 VAL C CB  
4593 C CG1 . VAL C 214 ? 0.4308 0.5945 0.4526 -0.0194 -0.0611 0.0347  216 VAL C CG1 
4594 C CG2 . VAL C 214 ? 0.2954 0.4504 0.3101 -0.0187 -0.0666 0.0369  216 VAL C CG2 
4595 N N   . ALA C 215 ? 0.3480 0.5119 0.3892 -0.0141 -0.0680 0.0244  217 ALA C N   
4596 C CA  . ALA C 215 ? 0.3049 0.4734 0.3523 -0.0126 -0.0672 0.0202  217 ALA C CA  
4597 C C   . ALA C 215 ? 0.2864 0.4575 0.3334 -0.0156 -0.0634 0.0230  217 ALA C C   
4598 O O   . ALA C 215 ? 0.2792 0.4477 0.3257 -0.0195 -0.0641 0.0281  217 ALA C O   
4599 C CB  . ALA C 215 ? 0.2461 0.4107 0.3012 -0.0112 -0.0732 0.0178  217 ALA C CB  
4600 N N   . ARG C 216 ? 0.2429 0.4202 0.2901 -0.0141 -0.0597 0.0201  218 ARG C N   
4601 C CA  . ARG C 216 ? 0.2768 0.4586 0.3250 -0.0160 -0.0562 0.0216  218 ARG C CA  
4602 C C   . ARG C 216 ? 0.2544 0.4386 0.3102 -0.0148 -0.0576 0.0176  218 ARG C C   
4603 O O   . ARG C 216 ? 0.2417 0.4293 0.2977 -0.0117 -0.0567 0.0133  218 ARG C O   
4604 C CB  . ARG C 216 ? 0.2623 0.4486 0.3039 -0.0141 -0.0516 0.0207  218 ARG C CB  
4605 C CG  . ARG C 216 ? 0.5215 0.7055 0.5546 -0.0145 -0.0505 0.0235  218 ARG C CG  
4606 C CD  . ARG C 216 ? 0.6006 0.7867 0.6273 -0.0114 -0.0479 0.0211  218 ARG C CD  
4607 N NE  . ARG C 216 ? 0.6949 0.8771 0.7186 -0.0099 -0.0502 0.0189  218 ARG C NE  
4608 C CZ  . ARG C 216 ? 0.6488 0.8263 0.6673 -0.0103 -0.0520 0.0205  218 ARG C CZ  
4609 N NH1 . ARG C 216 ? 0.6139 0.7897 0.6292 -0.0120 -0.0517 0.0241  218 ARG C NH1 
4610 N NH2 . ARG C 216 ? 0.5244 0.7002 0.5408 -0.0096 -0.0542 0.0190  218 ARG C NH2 
4611 N N   . HIS C 217 ? 0.2475 0.4296 0.3092 -0.0175 -0.0605 0.0194  219 HIS C N   
4612 C CA  . HIS C 217 ? 0.2386 0.4223 0.3077 -0.0164 -0.0626 0.0154  219 HIS C CA  
4613 C C   . HIS C 217 ? 0.2494 0.4402 0.3198 -0.0181 -0.0584 0.0163  219 HIS C C   
4614 O O   . HIS C 217 ? 0.2561 0.4488 0.3266 -0.0224 -0.0574 0.0215  219 HIS C O   
4615 C CB  . HIS C 217 ? 0.2159 0.3918 0.2906 -0.0190 -0.0694 0.0170  219 HIS C CB  
4616 C CG  . HIS C 217 ? 0.2787 0.4467 0.3518 -0.0178 -0.0742 0.0173  219 HIS C CG  
4617 N ND1 . HIS C 217 ? 0.3626 0.5282 0.4387 -0.0126 -0.0787 0.0111  219 HIS C ND1 
4618 C CD2 . HIS C 217 ? 0.2014 0.3644 0.2699 -0.0205 -0.0751 0.0228  219 HIS C CD2 
4619 C CE1 . HIS C 217 ? 0.4103 0.5695 0.4842 -0.0120 -0.0825 0.0126  219 HIS C CE1 
4620 N NE2 . HIS C 217 ? 0.3955 0.5523 0.4647 -0.0171 -0.0805 0.0199  219 HIS C NE2 
4621 N N   . THR C 218 ? 0.2754 0.4715 0.3472 -0.0149 -0.0565 0.0116  220 THR C N   
4622 C CA  . THR C 218 ? 0.2846 0.4880 0.3586 -0.0158 -0.0532 0.0118  220 THR C CA  
4623 C C   . THR C 218 ? 0.3090 0.5118 0.3912 -0.0172 -0.0570 0.0102  220 THR C C   
4624 O O   . THR C 218 ? 0.2651 0.4653 0.3504 -0.0145 -0.0606 0.0054  220 THR C O   
4625 C CB  . THR C 218 ? 0.2719 0.4800 0.3424 -0.0120 -0.0499 0.0084  220 THR C CB  
4626 O OG1 . THR C 218 ? 0.3097 0.5165 0.3721 -0.0109 -0.0476 0.0099  220 THR C OG1 
4627 C CG2 . THR C 218 ? 0.4082 0.6235 0.4814 -0.0121 -0.0473 0.0080  220 THR C CG2 
4628 N N   . TYR C 219 ? 0.3123 0.5183 0.3979 -0.0216 -0.0566 0.0143  221 TYR C N   
4629 C CA  . TYR C 219 ? 0.3618 0.5665 0.4553 -0.0240 -0.0610 0.0136  221 TYR C CA  
4630 C C   . TYR C 219 ? 0.3822 0.5970 0.4787 -0.0269 -0.0576 0.0161  221 TYR C C   
4631 O O   . TYR C 219 ? 0.3903 0.6129 0.4827 -0.0269 -0.0521 0.0187  221 TYR C O   
4632 C CB  . TYR C 219 ? 0.4082 0.6033 0.5039 -0.0282 -0.0675 0.0174  221 TYR C CB  
4633 C CG  . TYR C 219 ? 0.4721 0.6695 0.5663 -0.0349 -0.0662 0.0260  221 TYR C CG  
4634 C CD1 . TYR C 219 ? 0.4828 0.6817 0.5696 -0.0348 -0.0623 0.0293  221 TYR C CD1 
4635 C CD2 . TYR C 219 ? 0.5704 0.7692 0.6703 -0.0418 -0.0695 0.0312  221 TYR C CD2 
4636 C CE1 . TYR C 219 ? 0.4630 0.6664 0.5480 -0.0410 -0.0611 0.0374  221 TYR C CE1 
4637 C CE2 . TYR C 219 ? 0.4563 0.6600 0.5549 -0.0489 -0.0685 0.0400  221 TYR C CE2 
4638 C CZ  . TYR C 219 ? 0.5594 0.7660 0.6503 -0.0482 -0.0640 0.0429  221 TYR C CZ  
4639 O OH  . TYR C 219 ? 0.5346 0.7482 0.6237 -0.0553 -0.0628 0.0517  221 TYR C OH  
4640 N N   . LEU C 220 ? 0.4120 0.6274 0.5156 -0.0286 -0.0610 0.0147  222 LEU C N   
4641 C CA  . LEU C 220 ? 0.3939 0.6197 0.5019 -0.0312 -0.0585 0.0164  222 LEU C CA  
4642 C C   . LEU C 220 ? 0.4381 0.6635 0.5511 -0.0393 -0.0625 0.0232  222 LEU C C   
4643 O O   . LEU C 220 ? 0.4548 0.6696 0.5712 -0.0418 -0.0697 0.0235  222 LEU C O   
4644 C CB  . LEU C 220 ? 0.3842 0.6113 0.4967 -0.0279 -0.0602 0.0101  222 LEU C CB  
4645 C CG  . LEU C 220 ? 0.4474 0.6763 0.5557 -0.0210 -0.0571 0.0039  222 LEU C CG  
4646 C CD1 . LEU C 220 ? 0.4347 0.6653 0.5475 -0.0187 -0.0595 -0.0015 222 LEU C CD1 
4647 C CD2 . LEU C 220 ? 0.4173 0.6543 0.5206 -0.0188 -0.0509 0.0049  222 LEU C CD2 
4648 N N   . ALA C 221 ? 0.4985 0.7360 0.6118 -0.0434 -0.0583 0.0289  223 ALA C N   
4649 C CA  . ALA C 221 ? 0.6179 0.8577 0.7358 -0.0528 -0.0620 0.0370  223 ALA C CA  
4650 C C   . ALA C 221 ? 0.6721 0.9313 0.7924 -0.0557 -0.0564 0.0408  223 ALA C C   
4651 O O   . ALA C 221 ? 0.7187 0.9876 0.8352 -0.0497 -0.0497 0.0373  223 ALA C O   
4652 C CB  . ALA C 221 ? 0.6316 0.8650 0.7450 -0.0567 -0.0639 0.0430  223 ALA C CB  
4653 N N   . ASN C 222 ? 0.7571 1.0217 0.8837 -0.0648 -0.0599 0.0479  224 ASN C N   
4654 C CA  . ASN C 222 ? 0.7726 1.0585 0.9027 -0.0679 -0.0549 0.0516  224 ASN C CA  
4655 C C   . ASN C 222 ? 0.7695 1.0581 0.9006 -0.0592 -0.0517 0.0426  224 ASN C C   
4656 O O   . ASN C 222 ? 0.7961 1.0732 0.9302 -0.0570 -0.0564 0.0374  224 ASN C O   
4657 C CB  . ASN C 222 ? 0.8000 1.0995 0.9233 -0.0668 -0.0477 0.0549  224 ASN C CB  
4658 C CG  . ASN C 222 ? 0.8793 1.2013 1.0064 -0.0748 -0.0450 0.0634  224 ASN C CG  
4659 O OD1 . ASN C 222 ? 0.9178 1.2424 1.0522 -0.0842 -0.0500 0.0698  224 ASN C OD1 
4660 N ND2 . ASN C 222 ? 0.9418 1.2807 1.0637 -0.0709 -0.0375 0.0635  224 ASN C ND2 
4661 N N   . GLY C 223 ? 0.7253 1.0285 0.8531 -0.0536 -0.0443 0.0402  225 GLY C N   
4662 C CA  . GLY C 223 ? 0.6324 0.9371 0.7596 -0.0447 -0.0416 0.0318  225 GLY C CA  
4663 C C   . GLY C 223 ? 0.5954 0.8972 0.7132 -0.0364 -0.0372 0.0274  225 GLY C C   
4664 O O   . GLY C 223 ? 0.5717 0.8813 0.6871 -0.0296 -0.0333 0.0229  225 GLY C O   
4665 N N   . GLN C 224 ? 0.5307 0.8200 0.6430 -0.0370 -0.0388 0.0286  226 GLN C N   
4666 C CA  . GLN C 224 ? 0.5019 0.7865 0.6051 -0.0303 -0.0357 0.0251  226 GLN C CA  
4667 C C   . GLN C 224 ? 0.4565 0.7230 0.5565 -0.0284 -0.0395 0.0221  226 GLN C C   
4668 O O   . GLN C 224 ? 0.3846 0.6415 0.4884 -0.0325 -0.0447 0.0235  226 GLN C O   
4669 C CB  . GLN C 224 ? 0.5019 0.7936 0.5997 -0.0325 -0.0326 0.0304  226 GLN C CB  
4670 C CG  . GLN C 224 ? 0.5089 0.8228 0.6093 -0.0353 -0.0284 0.0346  226 GLN C CG  
4671 C CD  . GLN C 224 ? 0.5362 0.8560 0.6321 -0.0404 -0.0269 0.0417  226 GLN C CD  
4672 O OE1 . GLN C 224 ? 0.4205 0.7499 0.5212 -0.0494 -0.0280 0.0497  226 GLN C OE1 
4673 N NE2 . GLN C 224 ? 0.4303 0.7437 0.5169 -0.0354 -0.0252 0.0395  226 GLN C NE2 
4674 N N   . THR C 225 ? 0.4620 0.7245 0.5548 -0.0218 -0.0374 0.0177  227 THR C N   
4675 C CA  . THR C 225 ? 0.4588 0.7083 0.5464 -0.0203 -0.0395 0.0164  227 THR C CA  
4676 C C   . THR C 225 ? 0.4685 0.7184 0.5505 -0.0226 -0.0379 0.0213  227 THR C C   
4677 O O   . THR C 225 ? 0.4437 0.7026 0.5211 -0.0203 -0.0337 0.0218  227 THR C O   
4678 C CB  . THR C 225 ? 0.4809 0.7271 0.5629 -0.0135 -0.0383 0.0108  227 THR C CB  
4679 O OG1 . THR C 225 ? 0.4598 0.7078 0.5467 -0.0118 -0.0396 0.0070  227 THR C OG1 
4680 C CG2 . THR C 225 ? 0.4291 0.6640 0.5066 -0.0125 -0.0406 0.0097  227 THR C CG2 
4681 N N   . LYS C 226 ? 0.4431 0.6838 0.5256 -0.0267 -0.0416 0.0245  228 LYS C N   
4682 C CA  . LYS C 226 ? 0.4159 0.6550 0.4926 -0.0291 -0.0410 0.0294  228 LYS C CA  
4683 C C   . LYS C 226 ? 0.4400 0.6657 0.5122 -0.0267 -0.0438 0.0273  228 LYS C C   
4684 O O   . LYS C 226 ? 0.3935 0.6122 0.4681 -0.0241 -0.0467 0.0228  228 LYS C O   
4685 C CB  . LYS C 226 ? 0.4530 0.6943 0.5344 -0.0376 -0.0438 0.0370  228 LYS C CB  
4686 C CG  . LYS C 226 ? 0.4865 0.7430 0.5736 -0.0414 -0.0416 0.0401  228 LYS C CG  
4687 C CD  . LYS C 226 ? 0.5368 0.7926 0.6292 -0.0513 -0.0464 0.0482  228 LYS C CD  
4688 C CE  . LYS C 226 ? 0.6436 0.9186 0.7403 -0.0568 -0.0434 0.0537  228 LYS C CE  
4689 N NZ  . LYS C 226 ? 0.5547 0.8307 0.6524 -0.0674 -0.0473 0.0642  228 LYS C NZ  
4690 N N   . VAL C 227 ? 0.3906 0.6145 0.4563 -0.0275 -0.0430 0.0306  229 VAL C N   
4691 C CA  . VAL C 227 ? 0.3865 0.5993 0.4475 -0.0254 -0.0455 0.0292  229 VAL C CA  
4692 C C   . VAL C 227 ? 0.4227 0.6309 0.4831 -0.0309 -0.0486 0.0356  229 VAL C C   
4693 O O   . VAL C 227 ? 0.4046 0.6202 0.4620 -0.0343 -0.0461 0.0410  229 VAL C O   
4694 C CB  . VAL C 227 ? 0.4101 0.6239 0.4622 -0.0205 -0.0420 0.0266  229 VAL C CB  
4695 C CG1 . VAL C 227 ? 0.3812 0.5848 0.4290 -0.0192 -0.0448 0.0258  229 VAL C CG1 
4696 C CG2 . VAL C 227 ? 0.3729 0.5904 0.4247 -0.0154 -0.0398 0.0210  229 VAL C CG2 
4697 N N   . LEU C 228 ? 0.4180 0.6150 0.4815 -0.0316 -0.0546 0.0352  230 LEU C N   
4698 C CA  . LEU C 228 ? 0.3669 0.5566 0.4289 -0.0360 -0.0590 0.0409  230 LEU C CA  
4699 C C   . LEU C 228 ? 0.3182 0.5014 0.3744 -0.0317 -0.0595 0.0383  230 LEU C C   
4700 O O   . LEU C 228 ? 0.3223 0.5012 0.3804 -0.0271 -0.0614 0.0324  230 LEU C O   
4701 C CB  . LEU C 228 ? 0.3876 0.5680 0.4571 -0.0393 -0.0669 0.0421  230 LEU C CB  
4702 C CG  . LEU C 228 ? 0.3770 0.5464 0.4442 -0.0417 -0.0730 0.0463  230 LEU C CG  
4703 C CD1 . LEU C 228 ? 0.5201 0.6922 0.5860 -0.0504 -0.0739 0.0564  230 LEU C CD1 
4704 C CD2 . LEU C 228 ? 0.4873 0.6437 0.5600 -0.0398 -0.0819 0.0427  230 LEU C CD2 
4705 N N   . THR C 229 ? 0.2713 0.4553 0.3203 -0.0334 -0.0578 0.0427  231 THR C N   
4706 C CA  . THR C 229 ? 0.3256 0.5040 0.3684 -0.0301 -0.0583 0.0410  231 THR C CA  
4707 C C   . THR C 229 ? 0.3142 0.4825 0.3580 -0.0332 -0.0650 0.0452  231 THR C C   
4708 O O   . THR C 229 ? 0.3308 0.4984 0.3751 -0.0393 -0.0674 0.0522  231 THR C O   
4709 C CB  . THR C 229 ? 0.3563 0.5414 0.3899 -0.0288 -0.0527 0.0420  231 THR C CB  
4710 O OG1 . THR C 229 ? 0.4207 0.6139 0.4544 -0.0255 -0.0481 0.0378  231 THR C OG1 
4711 C CG2 . THR C 229 ? 0.4207 0.5999 0.4482 -0.0251 -0.0536 0.0394  231 THR C CG2 
4712 N N   . GLN C 230 ? 0.3180 0.4792 0.3624 -0.0291 -0.0686 0.0411  232 GLN C N   
4713 C CA  . GLN C 230 ? 0.3315 0.4822 0.3779 -0.0303 -0.0763 0.0433  232 GLN C CA  
4714 C C   . GLN C 230 ? 0.3482 0.4957 0.3899 -0.0265 -0.0772 0.0411  232 GLN C C   
4715 O O   . GLN C 230 ? 0.3327 0.4831 0.3750 -0.0214 -0.0757 0.0350  232 GLN C O   
4716 C CB  . GLN C 230 ? 0.3949 0.5405 0.4503 -0.0284 -0.0821 0.0389  232 GLN C CB  
4717 C CG  . GLN C 230 ? 0.4097 0.5438 0.4679 -0.0269 -0.0913 0.0382  232 GLN C CG  
4718 C CD  . GLN C 230 ? 0.5361 0.6654 0.6027 -0.0234 -0.0977 0.0321  232 GLN C CD  
4719 O OE1 . GLN C 230 ? 0.4872 0.6233 0.5570 -0.0192 -0.0947 0.0255  232 GLN C OE1 
4720 N NE2 . GLN C 230 ? 0.5858 0.7029 0.6557 -0.0248 -0.1074 0.0340  232 GLN C NE2 
4721 N N   . LYS C 231 ? 0.3656 0.5077 0.4028 -0.0294 -0.0801 0.0467  233 LYS C N   
4722 C CA  . LYS C 231 ? 0.3613 0.4992 0.3950 -0.0260 -0.0826 0.0451  233 LYS C CA  
4723 C C   . LYS C 231 ? 0.4173 0.5482 0.4581 -0.0221 -0.0904 0.0407  233 LYS C C   
4724 O O   . LYS C 231 ? 0.3503 0.4727 0.3949 -0.0243 -0.0972 0.0435  233 LYS C O   
4725 C CB  . LYS C 231 ? 0.4138 0.5479 0.4408 -0.0304 -0.0841 0.0526  233 LYS C CB  
4726 C CG  . LYS C 231 ? 0.5012 0.6321 0.5234 -0.0275 -0.0861 0.0517  233 LYS C CG  
4727 C CD  . LYS C 231 ? 0.5294 0.6595 0.5430 -0.0323 -0.0853 0.0594  233 LYS C CD  
4728 C CE  . LYS C 231 ? 0.5326 0.6552 0.5435 -0.0315 -0.0910 0.0611  233 LYS C CE  
4729 N NZ  . LYS C 231 ? 0.6627 0.7855 0.6649 -0.0368 -0.0903 0.0690  233 LYS C NZ  
4730 N N   . LEU C 232 ? 0.3618 0.4968 0.4044 -0.0161 -0.0899 0.0338  234 LEU C N   
4731 C CA  . LEU C 232 ? 0.4386 0.5697 0.4874 -0.0110 -0.0972 0.0286  234 LEU C CA  
4732 C C   . LEU C 232 ? 0.4918 0.6187 0.5368 -0.0098 -0.1010 0.0305  234 LEU C C   
4733 O O   . LEU C 232 ? 0.5299 0.6496 0.5705 -0.0142 -0.1032 0.0374  234 LEU C O   
4734 C CB  . LEU C 232 ? 0.3598 0.5009 0.4130 -0.0053 -0.0949 0.0203  234 LEU C CB  
4735 C CG  . LEU C 232 ? 0.4400 0.5855 0.4959 -0.0068 -0.0906 0.0189  234 LEU C CG  
4736 C CD1 . LEU C 232 ? 0.3293 0.4856 0.3886 -0.0020 -0.0882 0.0116  234 LEU C CD1 
4737 C CD2 . LEU C 232 ? 0.3922 0.5292 0.4535 -0.0085 -0.0965 0.0200  234 LEU C CD2 
4738 N N   . SER C 233 ? 0.4698 0.6025 0.5164 -0.0042 -0.1018 0.0249  235 SER C N   
4739 C CA  . SER C 233 ? 0.4710 0.6004 0.5152 -0.0026 -0.1061 0.0261  235 SER C CA  
4740 C C   . SER C 233 ? 0.4668 0.5979 0.5017 -0.0070 -0.1007 0.0316  235 SER C C   
4741 O O   . SER C 233 ? 0.4484 0.5863 0.4797 -0.0088 -0.0936 0.0316  235 SER C O   
4742 C CB  . SER C 233 ? 0.4965 0.6352 0.5455 0.0045  -0.1081 0.0184  235 SER C CB  
4743 O OG  . SER C 233 ? 0.5732 0.7236 0.6236 0.0053  -0.1020 0.0144  235 SER C OG  
4744 N N   . SER C 234 ? 0.4762 0.6005 0.5071 -0.0084 -0.1047 0.0361  236 SER C N   
4745 C CA  . SER C 234 ? 0.4305 0.5561 0.4523 -0.0114 -0.1008 0.0404  236 SER C CA  
4746 C C   . SER C 234 ? 0.4992 0.6220 0.5199 -0.0092 -0.1065 0.0408  236 SER C C   
4747 O O   . SER C 234 ? 0.4313 0.5488 0.4576 -0.0059 -0.1140 0.0391  236 SER C O   
4748 C CB  . SER C 234 ? 0.4521 0.5734 0.4674 -0.0177 -0.0982 0.0477  236 SER C CB  
4749 O OG  . SER C 234 ? 0.5151 0.6269 0.5321 -0.0203 -0.1047 0.0525  236 SER C OG  
4750 N N   . VAL C 235 ? 0.4597 0.5859 0.4732 -0.0106 -0.1034 0.0425  237 VAL C N   
4751 C CA  . VAL C 235 ? 0.4957 0.6189 0.5060 -0.0098 -0.1081 0.0445  237 VAL C CA  
4752 C C   . VAL C 235 ? 0.4992 0.6194 0.4985 -0.0147 -0.1052 0.0506  237 VAL C C   
4753 O O   . VAL C 235 ? 0.4311 0.5541 0.4250 -0.0173 -0.0990 0.0516  237 VAL C O   
4754 C CB  . VAL C 235 ? 0.4704 0.6035 0.4841 -0.0056 -0.1088 0.0392  237 VAL C CB  
4755 C CG1 . VAL C 235 ? 0.5910 0.7285 0.6155 0.0008  -0.1135 0.0327  237 VAL C CG1 
4756 C CG2 . VAL C 235 ? 0.4632 0.6046 0.4734 -0.0073 -0.1022 0.0377  237 VAL C CG2 
4757 N N   . ARG C 236 ? 0.5323 0.6473 0.5283 -0.0151 -0.1102 0.0540  238 ARG C N   
4758 C CA  . ARG C 236 ? 0.5888 0.7011 0.5739 -0.0190 -0.1088 0.0595  238 ARG C CA  
4759 C C   . ARG C 236 ? 0.5935 0.7076 0.5766 -0.0169 -0.1120 0.0581  238 ARG C C   
4760 O O   . ARG C 236 ? 0.5722 0.6858 0.5618 -0.0133 -0.1180 0.0562  238 ARG C O   
4761 C CB  . ARG C 236 ? 0.6109 0.7142 0.5939 -0.0225 -0.1134 0.0663  238 ARG C CB  
4762 C CG  . ARG C 236 ? 0.7424 0.8449 0.7141 -0.0275 -0.1109 0.0729  238 ARG C CG  
4763 C CD  . ARG C 236 ? 0.8093 0.9034 0.7799 -0.0316 -0.1170 0.0805  238 ARG C CD  
4764 N NE  . ARG C 236 ? 0.9415 1.0382 0.9024 -0.0376 -0.1131 0.0874  238 ARG C NE  
4765 C CZ  . ARG C 236 ? 1.0502 1.1472 1.0010 -0.0399 -0.1133 0.0917  238 ARG C CZ  
4766 N NH1 . ARG C 236 ? 1.0591 1.1525 1.0083 -0.0370 -0.1176 0.0901  238 ARG C NH1 
4767 N NH2 . ARG C 236 ? 1.1081 1.2103 1.0503 -0.0449 -0.1093 0.0974  238 ARG C NH2 
4768 N N   . GLY C 237 ? 0.5573 0.6738 0.5318 -0.0187 -0.1087 0.0589  239 GLY C N   
4769 C CA  . GLY C 237 ? 0.5058 0.6234 0.4776 -0.0179 -0.1123 0.0588  239 GLY C CA  
4770 C C   . GLY C 237 ? 0.5223 0.6329 0.4853 -0.0206 -0.1153 0.0648  239 GLY C C   
4771 O O   . GLY C 237 ? 0.5171 0.6233 0.4759 -0.0236 -0.1141 0.0693  239 GLY C O   
4772 N N   . ASN C 238 ? 0.5204 0.6311 0.4805 -0.0201 -0.1191 0.0652  240 ASN C N   
4773 C CA  . ASN C 238 ? 0.5432 0.6478 0.4937 -0.0228 -0.1219 0.0709  240 ASN C CA  
4774 C C   . ASN C 238 ? 0.5048 0.6095 0.4436 -0.0259 -0.1163 0.0725  240 ASN C C   
4775 O O   . ASN C 238 ? 0.4972 0.6061 0.4348 -0.0253 -0.1117 0.0684  240 ASN C O   
4776 C CB  . ASN C 238 ? 0.5473 0.6533 0.4970 -0.0215 -0.1269 0.0703  240 ASN C CB  
4777 C CG  . ASN C 238 ? 0.7013 0.8109 0.6631 -0.0170 -0.1322 0.0670  240 ASN C CG  
4778 O OD1 . ASN C 238 ? 0.6558 0.7738 0.6218 -0.0151 -0.1328 0.0631  240 ASN C OD1 
4779 N ND2 . ASN C 238 ? 0.6411 0.7447 0.6082 -0.0153 -0.1369 0.0686  240 ASN C ND2 
4780 N N   . HIS C 239 ? 0.5483 0.6493 0.4786 -0.0289 -0.1169 0.0782  241 HIS C N   
4781 C CA  . HIS C 239 ? 0.5967 0.6995 0.5143 -0.0308 -0.1124 0.0792  241 HIS C CA  
4782 C C   . HIS C 239 ? 0.5840 0.6872 0.4955 -0.0294 -0.1134 0.0754  241 HIS C C   
4783 O O   . HIS C 239 ? 0.5655 0.6673 0.4800 -0.0286 -0.1185 0.0750  241 HIS C O   
4784 C CB  . HIS C 239 ? 0.6682 0.7686 0.5773 -0.0344 -0.1145 0.0865  241 HIS C CB  
4785 C CG  . HIS C 239 ? 0.8924 0.9932 0.8041 -0.0378 -0.1133 0.0918  241 HIS C CG  
4786 N ND1 . HIS C 239 ? 1.0817 1.1778 1.0044 -0.0381 -0.1175 0.0935  241 HIS C ND1 
4787 C CD2 . HIS C 239 ? 1.0167 1.1227 0.9213 -0.0414 -0.1091 0.0961  241 HIS C CD2 
4788 C CE1 . HIS C 239 ? 1.0317 1.1285 0.9540 -0.0424 -0.1163 0.0991  241 HIS C CE1 
4789 N NE2 . HIS C 239 ? 1.0069 1.1110 0.9185 -0.0448 -0.1108 0.1012  241 HIS C NE2 
4790 N N   . ILE C 240 ? 0.5507 0.6556 0.4537 -0.0289 -0.1092 0.0725  242 ILE C N   
4791 C CA  . ILE C 240 ? 0.4792 0.5825 0.3756 -0.0280 -0.1110 0.0689  242 ILE C CA  
4792 C C   . ILE C 240 ? 0.5162 0.6184 0.3978 -0.0282 -0.1104 0.0699  242 ILE C C   
4793 O O   . ILE C 240 ? 0.5076 0.6131 0.3834 -0.0271 -0.1057 0.0684  242 ILE C O   
4794 C CB  . ILE C 240 ? 0.4581 0.5632 0.3577 -0.0263 -0.1081 0.0633  242 ILE C CB  
4795 C CG1 . ILE C 240 ? 0.4825 0.5908 0.3964 -0.0260 -0.1087 0.0621  242 ILE C CG1 
4796 C CG2 . ILE C 240 ? 0.4346 0.5358 0.3259 -0.0262 -0.1116 0.0600  242 ILE C CG2 
4797 C CD1 . ILE C 240 ? 0.4444 0.5553 0.3620 -0.0252 -0.1063 0.0573  242 ILE C CD1 
4798 N N   . ILE C 241 ? 0.5307 0.6297 0.4062 -0.0292 -0.1154 0.0722  243 ILE C N   
4799 C CA  . ILE C 241 ? 0.5061 0.6052 0.3675 -0.0295 -0.1153 0.0738  243 ILE C CA  
4800 C C   . ILE C 241 ? 0.5218 0.6190 0.3735 -0.0267 -0.1152 0.0674  243 ILE C C   
4801 O O   . ILE C 241 ? 0.4867 0.5806 0.3427 -0.0260 -0.1171 0.0634  243 ILE C O   
4802 C CB  . ILE C 241 ? 0.5808 0.6768 0.4387 -0.0316 -0.1211 0.0788  243 ILE C CB  
4803 C CG1 . ILE C 241 ? 0.4747 0.5662 0.3330 -0.0311 -0.1270 0.0760  243 ILE C CG1 
4804 C CG2 . ILE C 241 ? 0.5452 0.6410 0.4128 -0.0338 -0.1228 0.0849  243 ILE C CG2 
4805 C CD1 . ILE C 241 ? 0.4897 0.5782 0.3416 -0.0328 -0.1333 0.0804  243 ILE C CD1 
4806 N N   . SER C 242 ? 0.4850 0.5844 0.3235 -0.0252 -0.1137 0.0665  244 SER C N   
4807 C CA  . SER C 242 ? 0.5409 0.6372 0.3685 -0.0215 -0.1149 0.0597  244 SER C CA  
4808 C C   . SER C 242 ? 0.5592 0.6467 0.3856 -0.0224 -0.1224 0.0580  244 SER C C   
4809 O O   . SER C 242 ? 0.5789 0.6647 0.4044 -0.0249 -0.1266 0.0622  244 SER C O   
4810 C CB  . SER C 242 ? 0.5796 0.6811 0.3926 -0.0195 -0.1134 0.0596  244 SER C CB  
4811 O OG  . SER C 242 ? 0.5967 0.6945 0.3984 -0.0146 -0.1156 0.0518  244 SER C OG  
4812 N N   . GLY C 243 ? 0.5323 0.6143 0.3590 -0.0209 -0.1246 0.0526  245 GLY C N   
4813 C CA  . GLY C 243 ? 0.5845 0.6585 0.4090 -0.0227 -0.1324 0.0513  245 GLY C CA  
4814 C C   . GLY C 243 ? 0.5702 0.6453 0.4085 -0.0269 -0.1349 0.0549  245 GLY C C   
4815 O O   . GLY C 243 ? 0.5865 0.6587 0.4243 -0.0296 -0.1411 0.0566  245 GLY C O   
4816 N N   . THR C 244 ? 0.5371 0.6177 0.3878 -0.0273 -0.1302 0.0559  246 THR C N   
4817 C CA  . THR C 244 ? 0.4777 0.5620 0.3419 -0.0303 -0.1322 0.0581  246 THR C CA  
4818 C C   . THR C 244 ? 0.5082 0.5958 0.3814 -0.0299 -0.1284 0.0558  246 THR C C   
4819 O O   . THR C 244 ? 0.5491 0.6364 0.4197 -0.0273 -0.1236 0.0533  246 THR C O   
4820 C CB  . THR C 244 ? 0.4887 0.5784 0.3614 -0.0309 -0.1315 0.0628  246 THR C CB  
4821 O OG1 . THR C 244 ? 0.4709 0.5638 0.3473 -0.0292 -0.1252 0.0636  246 THR C OG1 
4822 C CG2 . THR C 244 ? 0.4699 0.5567 0.3343 -0.0316 -0.1358 0.0661  246 THR C CG2 
4823 N N   . CYS C 245 ? 0.5056 0.5979 0.3895 -0.0325 -0.1306 0.0567  247 CYS C N   
4824 C CA  . CYS C 245 ? 0.4784 0.5760 0.3724 -0.0328 -0.1275 0.0553  247 CYS C CA  
4825 C C   . CYS C 245 ? 0.4610 0.5682 0.3684 -0.0327 -0.1263 0.0575  247 CYS C C   
4826 O O   . CYS C 245 ? 0.4796 0.5887 0.3888 -0.0331 -0.1296 0.0600  247 CYS C O   
4827 C CB  . CYS C 245 ? 0.5195 0.6163 0.4138 -0.0364 -0.1323 0.0546  247 CYS C CB  
4828 S SG  . CYS C 245 ? 0.5960 0.6790 0.4750 -0.0365 -0.1369 0.0513  247 CYS C SG  
4829 N N   . ALA C 246 ? 0.4466 0.5596 0.3634 -0.0316 -0.1221 0.0561  248 ALA C N   
4830 C CA  . ALA C 246 ? 0.4463 0.5690 0.3763 -0.0306 -0.1220 0.0567  248 ALA C CA  
4831 C C   . ALA C 246 ? 0.4227 0.5524 0.3606 -0.0310 -0.1195 0.0545  248 ALA C C   
4832 O O   . ALA C 246 ? 0.4517 0.5773 0.3851 -0.0317 -0.1173 0.0529  248 ALA C O   
4833 C CB  . ALA C 246 ? 0.4496 0.5709 0.3825 -0.0276 -0.1193 0.0578  248 ALA C CB  
4834 N N   . SER C 247 ? 0.4041 0.5451 0.3538 -0.0301 -0.1201 0.0540  249 SER C N   
4835 C CA  . SER C 247 ? 0.4020 0.5532 0.3596 -0.0309 -0.1184 0.0521  249 SER C CA  
4836 C C   . SER C 247 ? 0.4172 0.5766 0.3863 -0.0265 -0.1164 0.0500  249 SER C C   
4837 O O   . SER C 247 ? 0.4021 0.5634 0.3752 -0.0237 -0.1191 0.0502  249 SER C O   
4838 C CB  . SER C 247 ? 0.4247 0.5861 0.3853 -0.0348 -0.1231 0.0537  249 SER C CB  
4839 O OG  . SER C 247 ? 0.5498 0.7044 0.5013 -0.0398 -0.1258 0.0554  249 SER C OG  
4840 N N   . TRP C 248 ? 0.3997 0.5637 0.3741 -0.0255 -0.1126 0.0475  250 TRP C N   
4841 C CA  . TRP C 248 ? 0.4075 0.5818 0.3938 -0.0210 -0.1120 0.0445  250 TRP C CA  
4842 C C   . TRP C 248 ? 0.3869 0.5783 0.3800 -0.0228 -0.1128 0.0433  250 TRP C C   
4843 O O   . TRP C 248 ? 0.3854 0.5781 0.3753 -0.0271 -0.1115 0.0444  250 TRP C O   
4844 C CB  . TRP C 248 ? 0.4381 0.6078 0.4266 -0.0185 -0.1075 0.0423  250 TRP C CB  
4845 C CG  . TRP C 248 ? 0.4123 0.5683 0.3955 -0.0174 -0.1065 0.0441  250 TRP C CG  
4846 C CD1 . TRP C 248 ? 0.4066 0.5548 0.3847 -0.0174 -0.1094 0.0471  250 TRP C CD1 
4847 C CD2 . TRP C 248 ? 0.3773 0.5280 0.3604 -0.0167 -0.1023 0.0434  250 TRP C CD2 
4848 N NE1 . TRP C 248 ? 0.3429 0.4819 0.3174 -0.0174 -0.1072 0.0489  250 TRP C NE1 
4849 C CE2 . TRP C 248 ? 0.3808 0.5216 0.3587 -0.0169 -0.1028 0.0466  250 TRP C CE2 
4850 C CE3 . TRP C 248 ? 0.4084 0.5626 0.3951 -0.0163 -0.0983 0.0408  250 TRP C CE3 
4851 C CZ2 . TRP C 248 ? 0.4220 0.5577 0.3986 -0.0171 -0.0994 0.0475  250 TRP C CZ2 
4852 C CZ3 . TRP C 248 ? 0.3074 0.4555 0.2931 -0.0159 -0.0949 0.0411  250 TRP C CZ3 
4853 C CH2 . TRP C 248 ? 0.3165 0.4561 0.2973 -0.0165 -0.0954 0.0446  250 TRP C CH2 
4854 N N   . ARG C 249 ? 0.4254 0.6307 0.4277 -0.0194 -0.1153 0.0412  251 ARG C N   
4855 C CA  . ARG C 249 ? 0.5032 0.7288 0.5122 -0.0212 -0.1160 0.0405  251 ARG C CA  
4856 C C   . ARG C 249 ? 0.5172 0.7559 0.5369 -0.0151 -0.1142 0.0350  251 ARG C C   
4857 O O   . ARG C 249 ? 0.5546 0.8072 0.5826 -0.0101 -0.1169 0.0317  251 ARG C O   
4858 C CB  . ARG C 249 ? 0.5040 0.7400 0.5148 -0.0224 -0.1209 0.0423  251 ARG C CB  
4859 C CG  . ARG C 249 ? 0.5832 0.8067 0.5833 -0.0285 -0.1236 0.0474  251 ARG C CG  
4860 C CD  . ARG C 249 ? 0.8381 1.0711 0.8406 -0.0289 -0.1290 0.0491  251 ARG C CD  
4861 N NE  . ARG C 249 ? 0.8163 1.0338 0.8076 -0.0334 -0.1319 0.0532  251 ARG C NE  
4862 C CZ  . ARG C 249 ? 0.8805 1.0967 0.8655 -0.0410 -0.1344 0.0571  251 ARG C CZ  
4863 N NH1 . ARG C 249 ? 0.7484 0.9784 0.7373 -0.0459 -0.1343 0.0584  251 ARG C NH1 
4864 N NH2 . ARG C 249 ? 0.8723 1.0731 0.8466 -0.0438 -0.1376 0.0598  251 ARG C NH2 
4865 N N   . GLY C 250 ? 0.5109 0.7453 0.5304 -0.0150 -0.1100 0.0335  252 GLY C N   
4866 C CA  . GLY C 250 ? 0.5176 0.7629 0.5464 -0.0092 -0.1084 0.0279  252 GLY C CA  
4867 C C   . GLY C 250 ? 0.5420 0.7746 0.5728 -0.0027 -0.1098 0.0249  252 GLY C C   
4868 O O   . GLY C 250 ? 0.5877 0.8284 0.6267 0.0041  -0.1126 0.0200  252 GLY C O   
4869 N N   . LYS C 251 ? 0.5140 0.7269 0.5373 -0.0049 -0.1083 0.0280  253 LYS C N   
4870 C CA  . LYS C 251 ? 0.4983 0.6990 0.5232 -0.0004 -0.1099 0.0266  253 LYS C CA  
4871 C C   . LYS C 251 ? 0.4958 0.6993 0.5264 0.0024  -0.1071 0.0223  253 LYS C C   
4872 O O   . LYS C 251 ? 0.4676 0.6724 0.4955 -0.0012 -0.1025 0.0231  253 LYS C O   
4873 C CB  . LYS C 251 ? 0.5123 0.6950 0.5270 -0.0046 -0.1087 0.0319  253 LYS C CB  
4874 C CG  . LYS C 251 ? 0.5879 0.7588 0.6022 -0.0037 -0.1073 0.0321  253 LYS C CG  
4875 C CD  . LYS C 251 ? 0.5309 0.6923 0.5455 -0.0015 -0.1123 0.0337  253 LYS C CD  
4876 C CE  . LYS C 251 ? 0.3781 0.5277 0.3821 -0.0061 -0.1115 0.0398  253 LYS C CE  
4877 N NZ  . LYS C 251 ? 0.5388 0.6863 0.5422 -0.0047 -0.1175 0.0415  253 LYS C NZ  
4878 N N   . SER C 252 ? 0.5134 0.7168 0.5513 0.0089  -0.1106 0.0177  254 SER C N   
4879 C CA  . SER C 252 ? 0.5327 0.7407 0.5769 0.0124  -0.1089 0.0125  254 SER C CA  
4880 C C   . SER C 252 ? 0.5420 0.7335 0.5849 0.0121  -0.1086 0.0135  254 SER C C   
4881 O O   . SER C 252 ? 0.5265 0.7042 0.5677 0.0124  -0.1126 0.0160  254 SER C O   
4882 C CB  . SER C 252 ? 0.5495 0.7717 0.6035 0.0207  -0.1135 0.0050  254 SER C CB  
4883 O OG  . SER C 252 ? 0.6987 0.9222 0.7540 0.0240  -0.1190 0.0049  254 SER C OG  
4884 N N   . LEU C 253 ? 0.5020 0.6958 0.5461 0.0109  -0.1042 0.0120  255 LEU C N   
4885 C CA  . LEU C 253 ? 0.5000 0.6815 0.5446 0.0107  -0.1040 0.0123  255 LEU C CA  
4886 C C   . LEU C 253 ? 0.5115 0.7013 0.5645 0.0160  -0.1049 0.0051  255 LEU C C   
4887 O O   . LEU C 253 ? 0.4359 0.6405 0.4910 0.0165  -0.1015 0.0021  255 LEU C O   
4888 C CB  . LEU C 253 ? 0.5261 0.7016 0.5631 0.0041  -0.0978 0.0174  255 LEU C CB  
4889 C CG  . LEU C 253 ? 0.4648 0.6272 0.4991 0.0012  -0.0966 0.0210  255 LEU C CG  
4890 C CD1 . LEU C 253 ? 0.5641 0.7156 0.6005 0.0027  -0.1030 0.0224  255 LEU C CD1 
4891 C CD2 . LEU C 253 ? 0.4836 0.6415 0.5084 -0.0041 -0.0925 0.0265  255 LEU C CD2 
4892 N N   . ARG C 254 ? 0.5625 0.7429 0.6199 0.0198  -0.1099 0.0025  256 ARG C N   
4893 C CA  . ARG C 254 ? 0.5980 0.7853 0.6630 0.0257  -0.1119 -0.0053 256 ARG C CA  
4894 C C   . ARG C 254 ? 0.5943 0.7792 0.6592 0.0224  -0.1072 -0.0048 256 ARG C C   
4895 O O   . ARG C 254 ? 0.5800 0.7512 0.6416 0.0175  -0.1063 0.0004  256 ARG C O   
4896 C CB  . ARG C 254 ? 0.6572 0.8363 0.7279 0.0329  -0.1215 -0.0101 256 ARG C CB  
4897 C CG  . ARG C 254 ? 0.7090 0.9027 0.7879 0.0423  -0.1248 -0.0208 256 ARG C CG  
4898 C CD  . ARG C 254 ? 0.9005 1.0976 0.9839 0.0510  -0.1332 -0.0265 256 ARG C CD  
4899 N NE  . ARG C 254 ? 0.9944 1.2012 1.0748 0.0491  -0.1309 -0.0230 256 ARG C NE  
4900 C CZ  . ARG C 254 ? 1.0355 1.2655 1.1186 0.0521  -0.1284 -0.0269 256 ARG C CZ  
4901 N NH1 . ARG C 254 ? 1.0165 1.2533 1.0968 0.0491  -0.1270 -0.0226 256 ARG C NH1 
4902 N NH2 . ARG C 254 ? 1.0358 1.2836 1.1247 0.0579  -0.1275 -0.0349 256 ARG C NH2 
4903 N N   . VAL C 255 ? 0.5901 0.7899 0.6585 0.0249  -0.1042 -0.0100 257 VAL C N   
4904 C CA  . VAL C 255 ? 0.5819 0.7809 0.6514 0.0231  -0.1007 -0.0110 257 VAL C CA  
4905 C C   . VAL C 255 ? 0.6386 0.8324 0.7149 0.0294  -0.1075 -0.0175 257 VAL C C   
4906 O O   . VAL C 255 ? 0.6392 0.8448 0.7208 0.0367  -0.1107 -0.0254 257 VAL C O   
4907 C CB  . VAL C 255 ? 0.5647 0.7822 0.6349 0.0230  -0.0956 -0.0138 257 VAL C CB  
4908 C CG1 . VAL C 255 ? 0.6384 0.8534 0.7085 0.0202  -0.0917 -0.0135 257 VAL C CG1 
4909 C CG2 . VAL C 255 ? 0.4633 0.6876 0.5277 0.0179  -0.0914 -0.0085 257 VAL C CG2 
4910 N N   . GLN C 256 ? 0.7145 0.8914 0.7906 0.0268  -0.1104 -0.0144 258 GLN C N   
4911 C CA  . GLN C 256 ? 0.7987 0.9688 0.8812 0.0327  -0.1186 -0.0208 258 GLN C CA  
4912 C C   . GLN C 256 ? 0.8297 1.0023 0.9153 0.0325  -0.1165 -0.0242 258 GLN C C   
4913 O O   . GLN C 256 ? 0.8346 1.0120 0.9172 0.0270  -0.1086 -0.0204 258 GLN C O   
4914 C CB  . GLN C 256 ? 0.8177 0.9676 0.8999 0.0314  -0.1269 -0.0168 258 GLN C CB  
4915 C CG  . GLN C 256 ? 0.8788 1.0204 0.9539 0.0232  -0.1237 -0.0063 258 GLN C CG  
4916 C CD  . GLN C 256 ? 0.9787 1.1127 1.0506 0.0147  -0.1194 0.0011  258 GLN C CD  
4917 O OE1 . GLN C 256 ? 1.0506 1.1741 1.1180 0.0087  -0.1203 0.0092  258 GLN C OE1 
4918 N NE2 . GLN C 256 ? 0.9582 1.0986 1.0323 0.0142  -0.1149 -0.0016 258 GLN C NE2 
4919 N N   . LYS C 257 ? 0.8819 1.0508 0.9733 0.0391  -0.1242 -0.0317 259 LYS C N   
4920 C CA  . LYS C 257 ? 0.9191 1.0892 1.0140 0.0398  -0.1240 -0.0360 259 LYS C CA  
4921 C C   . LYS C 257 ? 0.9179 1.0937 1.0097 0.0324  -0.1141 -0.0307 259 LYS C C   
4922 O O   . LYS C 257 ? 0.9179 1.0828 1.0081 0.0255  -0.1128 -0.0243 259 LYS C O   
4923 C CB  . LYS C 257 ? 0.9499 1.1000 1.0479 0.0399  -0.1339 -0.0362 259 LYS C CB  
4924 C CG  . LYS C 257 ? 0.9878 1.1391 1.0906 0.0435  -0.1369 -0.0435 259 LYS C CG  
4925 C CD  . LYS C 257 ? 1.0225 1.1750 1.1305 0.0555  -0.1470 -0.0555 259 LYS C CD  
4926 C CE  . LYS C 257 ? 1.0931 1.2219 1.2029 0.0565  -0.1603 -0.0550 259 LYS C CE  
4927 N NZ  . LYS C 257 ? 1.1657 1.2911 1.2809 0.0672  -0.1714 -0.0674 259 LYS C NZ  
4928 N N   . GLY C 264 ? 0.8051 0.9481 0.9228 -0.0245 -0.1125 0.0027  266 GLY C N   
4929 C CA  . GLY C 264 ? 0.7920 0.9359 0.9104 -0.0146 -0.1148 -0.0085 266 GLY C CA  
4930 C C   . GLY C 264 ? 0.7610 0.9190 0.8798 -0.0112 -0.1075 -0.0137 266 GLY C C   
4931 O O   . GLY C 264 ? 0.7440 0.9122 0.8583 -0.0085 -0.0993 -0.0144 266 GLY C O   
4932 N N   . SER C 265 ? 0.7378 0.8958 0.8616 -0.0117 -0.1111 -0.0168 267 SER C N   
4933 C CA  . SER C 265 ? 0.7110 0.8817 0.8354 -0.0086 -0.1053 -0.0217 267 SER C CA  
4934 C C   . SER C 265 ? 0.6493 0.8314 0.7707 -0.0124 -0.0947 -0.0158 267 SER C C   
4935 O O   . SER C 265 ? 0.6243 0.8169 0.7439 -0.0090 -0.0890 -0.0193 267 SER C O   
4936 C CB  . SER C 265 ? 0.7127 0.8801 0.8432 -0.0098 -0.1119 -0.0249 267 SER C CB  
4937 O OG  . SER C 265 ? 0.8159 0.9782 0.9482 -0.0022 -0.1201 -0.0348 267 SER C OG  
4938 N N   . ASN C 266 ? 0.6116 0.7918 0.7321 -0.0194 -0.0926 -0.0069 268 ASN C N   
4939 C CA  . ASN C 266 ? 0.5727 0.7637 0.6899 -0.0217 -0.0834 -0.0022 268 ASN C CA  
4940 C C   . ASN C 266 ? 0.5442 0.7367 0.6542 -0.0192 -0.0781 -0.0009 268 ASN C C   
4941 O O   . ASN C 266 ? 0.5255 0.7255 0.6318 -0.0202 -0.0712 0.0023  268 ASN C O   
4942 C CB  . ASN C 266 ? 0.6445 0.8374 0.7645 -0.0300 -0.0829 0.0062  268 ASN C CB  
4943 C CG  . ASN C 266 ? 0.7462 0.9289 0.8662 -0.0357 -0.0886 0.0128  268 ASN C CG  
4944 O OD1 . ASN C 266 ? 0.8415 1.0122 0.9619 -0.0335 -0.0961 0.0100  268 ASN C OD1 
4945 N ND2 . ASN C 266 ? 0.8348 1.0230 0.9542 -0.0429 -0.0855 0.0217  268 ASN C ND2 
4946 N N   . ILE C 267 ? 0.4780 0.6638 0.5860 -0.0156 -0.0819 -0.0039 269 ILE C N   
4947 C CA  . ILE C 267 ? 0.5010 0.6893 0.6025 -0.0125 -0.0773 -0.0040 269 ILE C CA  
4948 C C   . ILE C 267 ? 0.4770 0.6747 0.5762 -0.0074 -0.0731 -0.0095 269 ILE C C   
4949 O O   . ILE C 267 ? 0.5159 0.7158 0.6175 -0.0030 -0.0763 -0.0161 269 ILE C O   
4950 C CB  . ILE C 267 ? 0.4494 0.6287 0.5495 -0.0109 -0.0826 -0.0042 269 ILE C CB  
4951 C CG1 . ILE C 267 ? 0.5062 0.6880 0.5992 -0.0104 -0.0773 -0.0014 269 ILE C CG1 
4952 C CG2 . ILE C 267 ? 0.6085 0.7863 0.7119 -0.0045 -0.0886 -0.0128 269 ILE C CG2 
4953 C CD1 . ILE C 267 ? 0.5020 0.6850 0.5932 -0.0047 -0.0788 -0.0065 269 ILE C CD1 
4954 N N   . LEU C 268 ? 0.3864 0.5898 0.4806 -0.0081 -0.0667 -0.0067 270 LEU C N   
4955 C CA  . LEU C 268 ? 0.3022 0.5136 0.3939 -0.0050 -0.0634 -0.0101 270 LEU C CA  
4956 C C   . LEU C 268 ? 0.2462 0.4587 0.3327 -0.0026 -0.0626 -0.0110 270 LEU C C   
4957 O O   . LEU C 268 ? 0.1931 0.4120 0.2795 0.0004  -0.0631 -0.0152 270 LEU C O   
4958 C CB  . LEU C 268 ? 0.3158 0.5317 0.4049 -0.0068 -0.0582 -0.0069 270 LEU C CB  
4959 C CG  . LEU C 268 ? 0.4179 0.6386 0.5122 -0.0074 -0.0581 -0.0084 270 LEU C CG  
4960 C CD1 . LEU C 268 ? 0.5009 0.7175 0.6017 -0.0106 -0.0620 -0.0072 270 LEU C CD1 
4961 C CD2 . LEU C 268 ? 0.4358 0.6613 0.5273 -0.0081 -0.0533 -0.0057 270 LEU C CD2 
4962 N N   . ARG C 269 ? 0.2135 0.4213 0.2955 -0.0043 -0.0613 -0.0066 271 ARG C N   
4963 C CA  . ARG C 269 ? 0.2320 0.4407 0.3092 -0.0026 -0.0610 -0.0069 271 ARG C CA  
4964 C C   . ARG C 269 ? 0.2034 0.4049 0.2772 -0.0044 -0.0614 -0.0026 271 ARG C C   
4965 O O   . ARG C 269 ? 0.2097 0.4067 0.2840 -0.0074 -0.0613 0.0012  271 ARG C O   
4966 C CB  . ARG C 269 ? 0.2627 0.4763 0.3342 -0.0027 -0.0573 -0.0060 271 ARG C CB  
4967 C CG  . ARG C 269 ? 0.3453 0.5573 0.4137 -0.0046 -0.0538 -0.0025 271 ARG C CG  
4968 C CD  . ARG C 269 ? 0.4309 0.6447 0.4928 -0.0041 -0.0521 -0.0018 271 ARG C CD  
4969 N NE  . ARG C 269 ? 0.5225 0.7332 0.5794 -0.0045 -0.0496 0.0009  271 ARG C NE  
4970 C CZ  . ARG C 269 ? 0.4974 0.7103 0.5560 -0.0042 -0.0476 0.0011  271 ARG C CZ  
4971 N NH1 . ARG C 269 ? 0.2986 0.5158 0.3643 -0.0044 -0.0480 -0.0008 271 ARG C NH1 
4972 N NH2 . ARG C 269 ? 0.6152 0.8269 0.6686 -0.0034 -0.0456 0.0027  271 ARG C NH2 
4973 N N   . VAL C 270 ? 0.2571 0.4589 0.3275 -0.0030 -0.0623 -0.0030 272 VAL C N   
4974 C CA  . VAL C 270 ? 0.2976 0.4927 0.3639 -0.0046 -0.0627 0.0011  272 VAL C CA  
4975 C C   . VAL C 270 ? 0.3386 0.5364 0.3983 -0.0043 -0.0606 0.0021  272 VAL C C   
4976 O O   . VAL C 270 ? 0.3413 0.5455 0.4015 -0.0025 -0.0615 -0.0009 272 VAL C O   
4977 C CB  . VAL C 270 ? 0.2748 0.4654 0.3445 -0.0028 -0.0681 -0.0004 272 VAL C CB  
4978 C CG1 . VAL C 270 ? 0.2477 0.4302 0.3131 -0.0054 -0.0689 0.0050  272 VAL C CG1 
4979 C CG2 . VAL C 270 ? 0.3554 0.5430 0.4322 -0.0020 -0.0725 -0.0032 272 VAL C CG2 
4980 N N   . GLU C 271 ? 0.3235 0.5172 0.3769 -0.0064 -0.0581 0.0064  273 GLU C N   
4981 C CA  . GLU C 271 ? 0.3409 0.5344 0.3870 -0.0067 -0.0572 0.0078  273 GLU C CA  
4982 C C   . GLU C 271 ? 0.3316 0.5196 0.3746 -0.0074 -0.0589 0.0106  273 GLU C C   
4983 O O   . GLU C 271 ? 0.2854 0.4687 0.3283 -0.0089 -0.0588 0.0134  273 GLU C O   
4984 C CB  . GLU C 271 ? 0.3531 0.5457 0.3936 -0.0073 -0.0541 0.0094  273 GLU C CB  
4985 C CG  . GLU C 271 ? 0.5115 0.7090 0.5548 -0.0064 -0.0530 0.0069  273 GLU C CG  
4986 C CD  . GLU C 271 ? 0.6514 0.8477 0.6898 -0.0059 -0.0507 0.0077  273 GLU C CD  
4987 O OE1 . GLU C 271 ? 0.7329 0.9254 0.7658 -0.0059 -0.0497 0.0098  273 GLU C OE1 
4988 O OE2 . GLU C 271 ? 0.7944 0.9940 0.8342 -0.0050 -0.0503 0.0059  273 GLU C OE2 
4989 N N   . TYR C 272 ? 0.3207 0.5103 0.3612 -0.0069 -0.0606 0.0102  274 TYR C N   
4990 C CA  . TYR C 272 ? 0.3230 0.5087 0.3618 -0.0071 -0.0630 0.0121  274 TYR C CA  
4991 C C   . TYR C 272 ? 0.3282 0.5115 0.3584 -0.0086 -0.0623 0.0147  274 TYR C C   
4992 O O   . TYR C 272 ? 0.3123 0.4987 0.3396 -0.0092 -0.0618 0.0142  274 TYR C O   
4993 C CB  . TYR C 272 ? 0.3216 0.5130 0.3657 -0.0046 -0.0664 0.0086  274 TYR C CB  
4994 C CG  . TYR C 272 ? 0.3494 0.5420 0.4018 -0.0018 -0.0689 0.0047  274 TYR C CG  
4995 C CD1 . TYR C 272 ? 0.3073 0.4928 0.3626 -0.0009 -0.0730 0.0050  274 TYR C CD1 
4996 C CD2 . TYR C 272 ? 0.3493 0.5495 0.4062 -0.0001 -0.0683 0.0005  274 TYR C CD2 
4997 C CE1 . TYR C 272 ? 0.3313 0.5157 0.3936 0.0018  -0.0768 0.0011  274 TYR C CE1 
4998 C CE2 . TYR C 272 ? 0.2729 0.4732 0.3369 0.0029  -0.0715 -0.0038 274 TYR C CE2 
4999 C CZ  . TYR C 272 ? 0.3820 0.5738 0.4486 0.0040  -0.0761 -0.0036 274 TYR C CZ  
5000 O OH  . TYR C 272 ? 0.3766 0.5657 0.4497 0.0070  -0.0810 -0.0078 274 TYR C OH  
5001 N N   . SER C 273 ? 0.3383 0.5155 0.3642 -0.0096 -0.0629 0.0178  275 SER C N   
5002 C CA  . SER C 273 ? 0.2684 0.4425 0.2861 -0.0107 -0.0634 0.0199  275 SER C CA  
5003 C C   . SER C 273 ? 0.2900 0.4612 0.3073 -0.0109 -0.0663 0.0217  275 SER C C   
5004 O O   . SER C 273 ? 0.2653 0.4336 0.2860 -0.0107 -0.0675 0.0227  275 SER C O   
5005 C CB  . SER C 273 ? 0.3446 0.5141 0.3556 -0.0112 -0.0607 0.0218  275 SER C CB  
5006 O OG  . SER C 273 ? 0.4759 0.6471 0.4854 -0.0104 -0.0589 0.0199  275 SER C OG  
5007 N N   . LEU C 274 ? 0.2789 0.4503 0.2918 -0.0117 -0.0682 0.0226  276 LEU C N   
5008 C CA  . LEU C 274 ? 0.2834 0.4513 0.2941 -0.0120 -0.0710 0.0248  276 LEU C CA  
5009 C C   . LEU C 274 ? 0.2796 0.4404 0.2804 -0.0135 -0.0700 0.0278  276 LEU C C   
5010 O O   . LEU C 274 ? 0.3128 0.4725 0.3076 -0.0143 -0.0699 0.0276  276 LEU C O   
5011 C CB  . LEU C 274 ? 0.3048 0.4788 0.3166 -0.0122 -0.0739 0.0241  276 LEU C CB  
5012 C CG  . LEU C 274 ? 0.3027 0.4740 0.3110 -0.0128 -0.0771 0.0264  276 LEU C CG  
5013 C CD1 . LEU C 274 ? 0.3526 0.5217 0.3659 -0.0105 -0.0795 0.0263  276 LEU C CD1 
5014 C CD2 . LEU C 274 ? 0.3170 0.4975 0.3266 -0.0138 -0.0795 0.0258  276 LEU C CD2 
5015 N N   . LEU C 275 ? 0.2921 0.4483 0.2910 -0.0140 -0.0698 0.0304  277 LEU C N   
5016 C CA  . LEU C 275 ? 0.3178 0.4692 0.3068 -0.0149 -0.0689 0.0330  277 LEU C CA  
5017 C C   . LEU C 275 ? 0.3441 0.4926 0.3298 -0.0156 -0.0726 0.0349  277 LEU C C   
5018 O O   . LEU C 275 ? 0.4056 0.5536 0.3962 -0.0156 -0.0752 0.0361  277 LEU C O   
5019 C CB  . LEU C 275 ? 0.3245 0.4752 0.3126 -0.0159 -0.0665 0.0357  277 LEU C CB  
5020 C CG  . LEU C 275 ? 0.3901 0.5451 0.3824 -0.0153 -0.0629 0.0339  277 LEU C CG  
5021 C CD1 . LEU C 275 ? 0.4889 0.6453 0.4800 -0.0172 -0.0608 0.0375  277 LEU C CD1 
5022 C CD2 . LEU C 275 ? 0.3684 0.5244 0.3555 -0.0134 -0.0610 0.0308  277 LEU C CD2 
5023 N N   . ILE C 276 ? 0.3234 0.4693 0.3011 -0.0161 -0.0737 0.0349  278 ILE C N   
5024 C CA  . ILE C 276 ? 0.3565 0.4987 0.3289 -0.0171 -0.0772 0.0372  278 ILE C CA  
5025 C C   . ILE C 276 ? 0.3756 0.5131 0.3372 -0.0170 -0.0760 0.0383  278 ILE C C   
5026 O O   . ILE C 276 ? 0.3953 0.5311 0.3510 -0.0160 -0.0752 0.0360  278 ILE C O   
5027 C CB  . ILE C 276 ? 0.3768 0.5208 0.3491 -0.0182 -0.0807 0.0364  278 ILE C CB  
5028 C CG1 . ILE C 276 ? 0.3359 0.4884 0.3189 -0.0177 -0.0811 0.0344  278 ILE C CG1 
5029 C CG2 . ILE C 276 ? 0.3754 0.5162 0.3431 -0.0193 -0.0847 0.0390  278 ILE C CG2 
5030 C CD1 . ILE C 276 ? 0.4071 0.5649 0.3906 -0.0195 -0.0828 0.0336  278 ILE C CD1 
5031 N N   . TYR C 277 ? 0.3730 0.5088 0.3319 -0.0178 -0.0761 0.0415  279 TYR C N   
5032 C CA  . TYR C 277 ? 0.4085 0.5428 0.3571 -0.0173 -0.0744 0.0424  279 TYR C CA  
5033 C C   . TYR C 277 ? 0.4131 0.5442 0.3554 -0.0188 -0.0770 0.0461  279 TYR C C   
5034 O O   . TYR C 277 ? 0.3962 0.5257 0.3431 -0.0202 -0.0803 0.0487  279 TYR C O   
5035 C CB  . TYR C 277 ? 0.4053 0.5445 0.3551 -0.0170 -0.0696 0.0429  279 TYR C CB  
5036 C CG  . TYR C 277 ? 0.4330 0.5740 0.3902 -0.0196 -0.0695 0.0471  279 TYR C CG  
5037 C CD1 . TYR C 277 ? 0.3968 0.5382 0.3652 -0.0198 -0.0705 0.0461  279 TYR C CD1 
5038 C CD2 . TYR C 277 ? 0.4478 0.5899 0.4005 -0.0221 -0.0692 0.0521  279 TYR C CD2 
5039 C CE1 . TYR C 277 ? 0.3088 0.4495 0.2836 -0.0220 -0.0721 0.0497  279 TYR C CE1 
5040 C CE2 . TYR C 277 ? 0.4066 0.5485 0.3656 -0.0254 -0.0706 0.0569  279 TYR C CE2 
5041 C CZ  . TYR C 277 ? 0.3501 0.4902 0.3201 -0.0252 -0.0724 0.0555  279 TYR C CZ  
5042 O OH  . TYR C 277 ? 0.5355 0.6733 0.5110 -0.0285 -0.0754 0.0601  279 TYR C OH  
5043 N N   . VAL C 278 ? 0.3985 0.5290 0.3300 -0.0177 -0.0760 0.0459  280 VAL C N   
5044 C CA  . VAL C 278 ? 0.4267 0.5551 0.3508 -0.0192 -0.0782 0.0496  280 VAL C CA  
5045 C C   . VAL C 278 ? 0.4474 0.5820 0.3666 -0.0196 -0.0742 0.0522  280 VAL C C   
5046 O O   . VAL C 278 ? 0.4175 0.5565 0.3313 -0.0168 -0.0708 0.0489  280 VAL C O   
5047 C CB  . VAL C 278 ? 0.4440 0.5670 0.3584 -0.0178 -0.0819 0.0471  280 VAL C CB  
5048 C CG1 . VAL C 278 ? 0.4135 0.5351 0.3199 -0.0191 -0.0840 0.0508  280 VAL C CG1 
5049 C CG2 . VAL C 278 ? 0.3994 0.5188 0.3195 -0.0188 -0.0860 0.0459  280 VAL C CG2 
5050 N N   . SER C 279 ? 0.4979 0.6336 0.4192 -0.0232 -0.0750 0.0583  281 SER C N   
5051 C CA  . SER C 279 ? 0.5295 0.6726 0.4451 -0.0252 -0.0719 0.0626  281 SER C CA  
5052 C C   . SER C 279 ? 0.5292 0.6728 0.4316 -0.0244 -0.0730 0.0630  281 SER C C   
5053 O O   . SER C 279 ? 0.5099 0.6472 0.4100 -0.0258 -0.0776 0.0655  281 SER C O   
5054 C CB  . SER C 279 ? 0.5814 0.7241 0.5038 -0.0305 -0.0739 0.0700  281 SER C CB  
5055 O OG  . SER C 279 ? 0.6417 0.7835 0.5758 -0.0307 -0.0735 0.0687  281 SER C OG  
5056 N N   . VAL C 280 ? 0.5265 0.6784 0.4203 -0.0216 -0.0691 0.0603  282 VAL C N   
5057 C CA  . VAL C 280 ? 0.5335 0.6878 0.4138 -0.0195 -0.0697 0.0593  282 VAL C CA  
5058 C C   . VAL C 280 ? 0.5825 0.7509 0.4585 -0.0225 -0.0657 0.0649  282 VAL C C   
5059 O O   . VAL C 280 ? 0.6142 0.7940 0.4903 -0.0204 -0.0607 0.0626  282 VAL C O   
5060 C CB  . VAL C 280 ? 0.5521 0.7056 0.4250 -0.0124 -0.0692 0.0500  282 VAL C CB  
5061 C CG1 . VAL C 280 ? 0.5380 0.6933 0.3961 -0.0093 -0.0708 0.0477  282 VAL C CG1 
5062 C CG2 . VAL C 280 ? 0.5452 0.6863 0.4232 -0.0110 -0.0732 0.0457  282 VAL C CG2 
5063 N N   . PRO C 281 ? 0.6360 0.8048 0.5087 -0.0277 -0.0680 0.0727  283 PRO C N   
5064 C CA  . PRO C 281 ? 0.6585 0.8420 0.5269 -0.0324 -0.0649 0.0800  283 PRO C CA  
5065 C C   . PRO C 281 ? 0.7041 0.9033 0.5612 -0.0276 -0.0600 0.0755  283 PRO C C   
5066 O O   . PRO C 281 ? 0.7116 0.9086 0.5584 -0.0221 -0.0614 0.0695  283 PRO C O   
5067 C CB  . PRO C 281 ? 0.7040 0.8815 0.5681 -0.0373 -0.0701 0.0875  283 PRO C CB  
5068 C CG  . PRO C 281 ? 0.6798 0.8403 0.5525 -0.0370 -0.0756 0.0861  283 PRO C CG  
5069 C CD  . PRO C 281 ? 0.6248 0.7810 0.4982 -0.0300 -0.0743 0.0757  283 PRO C CD  
5070 N N   . GLY C 282 ? 0.7675 0.9832 0.6270 -0.0295 -0.0546 0.0780  284 GLY C N   
5071 C CA  . GLY C 282 ? 0.7947 1.0291 0.6452 -0.0238 -0.0493 0.0727  284 GLY C CA  
5072 C C   . GLY C 282 ? 0.8060 1.0368 0.6556 -0.0138 -0.0483 0.0602  284 GLY C C   
5073 O O   . GLY C 282 ? 0.8486 1.0908 0.6888 -0.0066 -0.0459 0.0533  284 GLY C O   
5074 N N   . SER C 283 ? 0.7931 1.0084 0.6525 -0.0130 -0.0506 0.0572  285 SER C N   
5075 C CA  . SER C 283 ? 0.7721 0.9829 0.6316 -0.0047 -0.0505 0.0466  285 SER C CA  
5076 C C   . SER C 283 ? 0.7198 0.9242 0.5934 -0.0068 -0.0499 0.0470  285 SER C C   
5077 O O   . SER C 283 ? 0.7062 0.9079 0.5890 -0.0140 -0.0503 0.0545  285 SER C O   
5078 C CB  . SER C 283 ? 0.7776 0.9724 0.6292 0.0001  -0.0564 0.0404  285 SER C CB  
5079 O OG  . SER C 283 ? 0.8604 1.0504 0.7097 0.0081  -0.0576 0.0305  285 SER C OG  
5080 N N   . LYS C 284 ? 0.7008 0.9025 0.5759 -0.0003 -0.0496 0.0387  286 LYS C N   
5081 C CA  . LYS C 284 ? 0.6839 0.8799 0.5718 -0.0020 -0.0492 0.0386  286 LYS C CA  
5082 C C   . LYS C 284 ? 0.6502 0.8283 0.5429 -0.0049 -0.0545 0.0398  286 LYS C C   
5083 O O   . LYS C 284 ? 0.6761 0.8450 0.5617 -0.0037 -0.0589 0.0383  286 LYS C O   
5084 C CB  . LYS C 284 ? 0.6681 0.8665 0.5559 0.0055  -0.0478 0.0299  286 LYS C CB  
5085 C CG  . LYS C 284 ? 0.7214 0.9411 0.6079 0.0083  -0.0418 0.0288  286 LYS C CG  
5086 C CD  . LYS C 284 ? 0.7986 1.0206 0.6888 0.0150  -0.0405 0.0212  286 LYS C CD  
5087 C CE  . LYS C 284 ? 0.8921 1.1017 0.7737 0.0238  -0.0457 0.0113  286 LYS C CE  
5088 N NZ  . LYS C 284 ? 0.8816 1.0958 0.7647 0.0315  -0.0449 0.0035  286 LYS C NZ  
5089 N N   . LYS C 285 ? 0.5933 0.7678 0.4982 -0.0085 -0.0544 0.0424  287 LYS C N   
5090 C CA  . LYS C 285 ? 0.5287 0.6898 0.4395 -0.0104 -0.0589 0.0426  287 LYS C CA  
5091 C C   . LYS C 285 ? 0.5242 0.6769 0.4318 -0.0056 -0.0618 0.0356  287 LYS C C   
5092 O O   . LYS C 285 ? 0.5162 0.6721 0.4213 -0.0009 -0.0601 0.0302  287 LYS C O   
5093 C CB  . LYS C 285 ? 0.5047 0.6662 0.4289 -0.0141 -0.0579 0.0456  287 LYS C CB  
5094 C CG  . LYS C 285 ? 0.4507 0.6165 0.3790 -0.0201 -0.0574 0.0536  287 LYS C CG  
5095 C CD  . LYS C 285 ? 0.4775 0.6424 0.4188 -0.0228 -0.0574 0.0551  287 LYS C CD  
5096 C CE  . LYS C 285 ? 0.5905 0.7573 0.5354 -0.0290 -0.0587 0.0632  287 LYS C CE  
5097 N NZ  . LYS C 285 ? 0.6993 0.8797 0.6395 -0.0315 -0.0544 0.0672  287 LYS C NZ  
5098 N N   . VAL C 286 ? 0.5223 0.6645 0.4301 -0.0071 -0.0668 0.0358  288 VAL C N   
5099 C CA  . VAL C 286 ? 0.4840 0.6181 0.3921 -0.0050 -0.0703 0.0310  288 VAL C CA  
5100 C C   . VAL C 286 ? 0.4618 0.5951 0.3825 -0.0083 -0.0705 0.0329  288 VAL C C   
5101 O O   . VAL C 286 ? 0.4145 0.5466 0.3405 -0.0118 -0.0721 0.0367  288 VAL C O   
5102 C CB  . VAL C 286 ? 0.5033 0.6277 0.4012 -0.0036 -0.0762 0.0287  288 VAL C CB  
5103 C CG1 . VAL C 286 ? 0.5029 0.6281 0.3936 -0.0049 -0.0772 0.0319  288 VAL C CG1 
5104 C CG2 . VAL C 286 ? 0.5179 0.6343 0.4203 -0.0063 -0.0812 0.0287  288 VAL C CG2 
5105 N N   . ILE C 287 ? 0.4329 0.5677 0.3580 -0.0064 -0.0688 0.0297  289 ILE C N   
5106 C CA  . ILE C 287 ? 0.4096 0.5473 0.3470 -0.0088 -0.0674 0.0309  289 ILE C CA  
5107 C C   . ILE C 287 ? 0.4283 0.5617 0.3681 -0.0086 -0.0704 0.0282  289 ILE C C   
5108 O O   . ILE C 287 ? 0.4575 0.5880 0.3923 -0.0056 -0.0713 0.0244  289 ILE C O   
5109 C CB  . ILE C 287 ? 0.4545 0.6004 0.3968 -0.0079 -0.0622 0.0308  289 ILE C CB  
5110 C CG1 . ILE C 287 ? 0.4652 0.6173 0.4056 -0.0095 -0.0594 0.0349  289 ILE C CG1 
5111 C CG2 . ILE C 287 ? 0.3845 0.5328 0.3394 -0.0100 -0.0613 0.0315  289 ILE C CG2 
5112 C CD1 . ILE C 287 ? 0.4483 0.6107 0.3914 -0.0086 -0.0543 0.0346  289 ILE C CD1 
5113 N N   . LEU C 288 ? 0.4133 0.5471 0.3608 -0.0117 -0.0722 0.0300  290 LEU C N   
5114 C CA  . LEU C 288 ? 0.4079 0.5418 0.3601 -0.0127 -0.0741 0.0284  290 LEU C CA  
5115 C C   . LEU C 288 ? 0.4222 0.5634 0.3853 -0.0129 -0.0706 0.0284  290 LEU C C   
5116 O O   . LEU C 288 ? 0.4433 0.5876 0.4122 -0.0138 -0.0696 0.0303  290 LEU C O   
5117 C CB  . LEU C 288 ? 0.4279 0.5607 0.3812 -0.0160 -0.0789 0.0303  290 LEU C CB  
5118 C CG  . LEU C 288 ? 0.4670 0.5923 0.4103 -0.0169 -0.0835 0.0312  290 LEU C CG  
5119 C CD1 . LEU C 288 ? 0.3276 0.4552 0.2744 -0.0207 -0.0876 0.0336  290 LEU C CD1 
5120 C CD2 . LEU C 288 ? 0.3390 0.4566 0.2737 -0.0151 -0.0864 0.0283  290 LEU C CD2 
5121 N N   . ASP C 289 ? 0.4094 0.5521 0.3749 -0.0119 -0.0697 0.0260  291 ASP C N   
5122 C CA  . ASP C 289 ? 0.4034 0.5528 0.3789 -0.0120 -0.0669 0.0253  291 ASP C CA  
5123 C C   . ASP C 289 ? 0.3846 0.5362 0.3635 -0.0137 -0.0696 0.0246  291 ASP C C   
5124 O O   . ASP C 289 ? 0.3458 0.4941 0.3205 -0.0136 -0.0713 0.0234  291 ASP C O   
5125 C CB  . ASP C 289 ? 0.4492 0.6002 0.4242 -0.0093 -0.0632 0.0232  291 ASP C CB  
5126 C CG  . ASP C 289 ? 0.4727 0.6303 0.4577 -0.0094 -0.0605 0.0225  291 ASP C CG  
5127 O OD1 . ASP C 289 ? 0.4473 0.6079 0.4389 -0.0108 -0.0617 0.0223  291 ASP C OD1 
5128 O OD2 . ASP C 289 ? 0.4905 0.6511 0.4765 -0.0080 -0.0571 0.0220  291 ASP C OD2 
5129 N N   . LEU C 290 ? 0.3611 0.5189 0.3473 -0.0153 -0.0704 0.0253  292 LEU C N   
5130 C CA  . LEU C 290 ? 0.3654 0.5294 0.3557 -0.0173 -0.0723 0.0250  292 LEU C CA  
5131 C C   . LEU C 290 ? 0.3821 0.5538 0.3815 -0.0158 -0.0694 0.0228  292 LEU C C   
5132 O O   . LEU C 290 ? 0.3468 0.5221 0.3525 -0.0144 -0.0685 0.0220  292 LEU C O   
5133 C CB  . LEU C 290 ? 0.3363 0.5055 0.3289 -0.0194 -0.0753 0.0267  292 LEU C CB  
5134 C CG  . LEU C 290 ? 0.4166 0.5792 0.4016 -0.0210 -0.0785 0.0292  292 LEU C CG  
5135 C CD1 . LEU C 290 ? 0.3842 0.5553 0.3731 -0.0233 -0.0816 0.0307  292 LEU C CD1 
5136 C CD2 . LEU C 290 ? 0.4847 0.6386 0.4605 -0.0225 -0.0811 0.0297  292 LEU C CD2 
5137 N N   . PRO C 291 ? 0.3919 0.5652 0.3918 -0.0159 -0.0687 0.0216  293 PRO C N   
5138 C CA  . PRO C 291 ? 0.3865 0.5675 0.3947 -0.0146 -0.0664 0.0192  293 PRO C CA  
5139 C C   . PRO C 291 ? 0.3391 0.5311 0.3540 -0.0153 -0.0678 0.0184  293 PRO C C   
5140 O O   . PRO C 291 ? 0.4026 0.5990 0.4156 -0.0181 -0.0706 0.0203  293 PRO C O   
5141 C CB  . PRO C 291 ? 0.4293 0.6093 0.4347 -0.0154 -0.0669 0.0189  293 PRO C CB  
5142 C CG  . PRO C 291 ? 0.4692 0.6382 0.4649 -0.0150 -0.0683 0.0199  293 PRO C CG  
5143 C CD  . PRO C 291 ? 0.4319 0.5990 0.4244 -0.0171 -0.0710 0.0222  293 PRO C CD  
5144 N N   . LEU C 292 ? 0.2725 0.4695 0.2951 -0.0126 -0.0663 0.0156  294 LEU C N   
5145 C CA  . LEU C 292 ? 0.2609 0.4694 0.2905 -0.0112 -0.0677 0.0132  294 LEU C CA  
5146 C C   . LEU C 292 ? 0.2800 0.4962 0.3157 -0.0095 -0.0663 0.0096  294 LEU C C   
5147 O O   . LEU C 292 ? 0.2788 0.4898 0.3147 -0.0090 -0.0642 0.0090  294 LEU C O   
5148 C CB  . LEU C 292 ? 0.2480 0.4539 0.2814 -0.0084 -0.0690 0.0119  294 LEU C CB  
5149 C CG  . LEU C 292 ? 0.3505 0.5500 0.3790 -0.0094 -0.0709 0.0150  294 LEU C CG  
5150 C CD1 . LEU C 292 ? 0.3164 0.5131 0.3498 -0.0062 -0.0728 0.0134  294 LEU C CD1 
5151 C CD2 . LEU C 292 ? 0.3021 0.5094 0.3287 -0.0116 -0.0733 0.0165  294 LEU C CD2 
5152 N N   . VAL C 293 ? 0.2989 0.5287 0.3396 -0.0084 -0.0676 0.0070  295 VAL C N   
5153 C CA  . VAL C 293 ? 0.2804 0.5189 0.3275 -0.0056 -0.0668 0.0026  295 VAL C CA  
5154 C C   . VAL C 293 ? 0.2569 0.5001 0.3104 -0.0006 -0.0692 -0.0020 295 VAL C C   
5155 O O   . VAL C 293 ? 0.2896 0.5395 0.3435 0.0000  -0.0712 -0.0020 295 VAL C O   
5156 C CB  . VAL C 293 ? 0.2912 0.5439 0.3377 -0.0084 -0.0669 0.0033  295 VAL C CB  
5157 C CG1 . VAL C 293 ? 0.2651 0.5310 0.3185 -0.0047 -0.0666 -0.0023 295 VAL C CG1 
5158 C CG2 . VAL C 293 ? 0.2940 0.5391 0.3344 -0.0126 -0.0659 0.0073  295 VAL C CG2 
5159 N N   . ILE C 294 ? 0.2504 0.4891 0.3089 0.0031  -0.0698 -0.0059 296 ILE C N   
5160 C CA  . ILE C 294 ? 0.2664 0.5077 0.3308 0.0086  -0.0737 -0.0109 296 ILE C CA  
5161 C C   . ILE C 294 ? 0.2741 0.5240 0.3446 0.0129  -0.0747 -0.0174 296 ILE C C   
5162 O O   . ILE C 294 ? 0.2378 0.4817 0.3092 0.0122  -0.0735 -0.0177 296 ILE C O   
5163 C CB  . ILE C 294 ? 0.3085 0.5332 0.3724 0.0089  -0.0759 -0.0089 296 ILE C CB  
5164 C CG1 . ILE C 294 ? 0.3416 0.5623 0.3996 0.0059  -0.0757 -0.0037 296 ILE C CG1 
5165 C CG2 . ILE C 294 ? 0.2789 0.5025 0.3493 0.0150  -0.0815 -0.0145 296 ILE C CG2 
5166 C CD1 . ILE C 294 ? 0.5452 0.7511 0.6013 0.0051  -0.0776 -0.0005 296 ILE C CD1 
5167 N N   . GLY C 295 ? 0.3044 0.5700 0.3790 0.0177  -0.0769 -0.0229 297 GLY C N   
5168 C CA  . GLY C 295 ? 0.3324 0.6089 0.4120 0.0225  -0.0781 -0.0300 297 GLY C CA  
5169 C C   . GLY C 295 ? 0.3852 0.6623 0.4707 0.0309  -0.0839 -0.0378 297 GLY C C   
5170 O O   . GLY C 295 ? 0.3712 0.6470 0.4572 0.0332  -0.0868 -0.0380 297 GLY C O   
5171 N N   . SER C 296 ? 0.4063 0.6842 0.4963 0.0357  -0.0865 -0.0446 298 SER C N   
5172 C CA  . SER C 296 ? 0.4546 0.7337 0.5502 0.0451  -0.0935 -0.0537 298 SER C CA  
5173 C C   . SER C 296 ? 0.4685 0.7746 0.5668 0.0515  -0.0937 -0.0613 298 SER C C   
5174 O O   . SER C 296 ? 0.4284 0.7511 0.5248 0.0479  -0.0885 -0.0594 298 SER C O   
5175 C CB  . SER C 296 ? 0.4813 0.7466 0.5802 0.0472  -0.0974 -0.0575 298 SER C CB  
5176 O OG  . SER C 296 ? 0.4709 0.7480 0.5702 0.0469  -0.0941 -0.0602 298 SER C OG  
5177 N N   . ARG C 297 ? 0.5053 0.8160 0.6081 0.0610  -0.1000 -0.0697 299 ARG C N   
5178 C CA  . ARG C 297 ? 0.5430 0.8815 0.6489 0.0687  -0.1010 -0.0780 299 ARG C CA  
5179 C C   . ARG C 297 ? 0.5897 0.9369 0.6992 0.0762  -0.1038 -0.0883 299 ARG C C   
5180 O O   . ARG C 297 ? 0.6143 0.9620 0.7221 0.0717  -0.1000 -0.0863 299 ARG C O   
5181 C CB  . ARG C 297 ? 0.5982 0.9379 0.7072 0.0766  -0.1071 -0.0829 299 ARG C CB  
5182 C CG  . ARG C 297 ? 0.6066 0.9288 0.7123 0.0702  -0.1068 -0.0736 299 ARG C CG  
5183 C CD  . ARG C 297 ? 0.8205 1.1522 0.9286 0.0766  -0.1110 -0.0771 299 ARG C CD  
5184 N NE  . ARG C 297 ? 0.8358 1.1889 0.9417 0.0712  -0.1051 -0.0716 299 ARG C NE  
5185 C CZ  . ARG C 297 ? 0.7951 1.1437 0.8984 0.0666  -0.1045 -0.0646 299 ARG C CZ  
5186 N NH1 . ARG C 297 ? 0.6424 0.9666 0.7447 0.0668  -0.1089 -0.0621 299 ARG C NH1 
5187 N NH2 . ARG C 297 ? 0.7719 1.1410 0.8734 0.0613  -0.0999 -0.0596 299 ARG C NH2 
5188 N N   . MET D 1   ? 0.6290 0.6879 0.6549 -0.1232 -0.1706 0.0496  1   MET D N   
5189 C CA  . MET D 1   ? 0.5670 0.6387 0.6069 -0.1178 -0.1471 0.0520  1   MET D CA  
5190 C C   . MET D 1   ? 0.5314 0.6156 0.5839 -0.0964 -0.1548 0.0534  1   MET D C   
5191 O O   . MET D 1   ? 0.5572 0.6497 0.6235 -0.0859 -0.1792 0.0496  1   MET D O   
5192 C CB  . MET D 1   ? 0.5839 0.6946 0.6623 -0.1311 -0.1371 0.0400  1   MET D CB  
5193 C CG  . MET D 1   ? 0.7425 0.8385 0.8107 -0.1567 -0.1267 0.0373  1   MET D CG  
5194 S SD  . MET D 1   ? 0.7697 0.8042 0.7854 -0.1611 -0.1047 0.0529  1   MET D SD  
5195 C CE  . MET D 1   ? 0.6448 0.6898 0.6642 -0.1527 -0.0813 0.0633  1   MET D CE  
5196 N N   . VAL D 2   ? 0.5153 0.5997 0.5628 -0.0902 -0.1350 0.0585  2   VAL D N   
5197 C CA  . VAL D 2   ? 0.4697 0.5658 0.5281 -0.0718 -0.1380 0.0572  2   VAL D CA  
5198 C C   . VAL D 2   ? 0.4856 0.6228 0.5758 -0.0709 -0.1222 0.0466  2   VAL D C   
5199 O O   . VAL D 2   ? 0.4342 0.5726 0.5133 -0.0823 -0.0997 0.0515  2   VAL D O   
5200 C CB  . VAL D 2   ? 0.4495 0.5160 0.4721 -0.0664 -0.1281 0.0697  2   VAL D CB  
5201 C CG1 . VAL D 2   ? 0.3199 0.4001 0.3532 -0.0513 -0.1275 0.0661  2   VAL D CG1 
5202 C CG2 . VAL D 2   ? 0.3843 0.4166 0.3764 -0.0686 -0.1416 0.0772  2   VAL D CG2 
5203 N N   . LYS D 3   ? 0.4638 0.6331 0.5916 -0.0576 -0.1337 0.0318  3   LYS D N   
5204 C CA  . LYS D 3   ? 0.4714 0.6859 0.6299 -0.0573 -0.1164 0.0175  3   LYS D CA  
5205 C C   . LYS D 3   ? 0.4512 0.6633 0.5957 -0.0455 -0.1056 0.0185  3   LYS D C   
5206 O O   . LYS D 3   ? 0.4399 0.6348 0.5813 -0.0298 -0.1209 0.0179  3   LYS D O   
5207 C CB  . LYS D 3   ? 0.5352 0.7937 0.7487 -0.0468 -0.1325 -0.0051 3   LYS D CB  
5208 C CG  . LYS D 3   ? 0.5828 0.8959 0.8325 -0.0452 -0.1132 -0.0257 3   LYS D CG  
5209 C CD  . LYS D 3   ? 0.6118 0.9637 0.9187 -0.0240 -0.1337 -0.0510 3   LYS D CD  
5210 C CE  . LYS D 3   ? 0.6262 1.0490 0.9823 -0.0321 -0.1144 -0.0767 3   LYS D CE  
5211 N NZ  . LYS D 3   ? 0.6144 1.0476 0.9432 -0.0542 -0.0774 -0.0709 3   LYS D NZ  
5212 N N   . GLN D 4   ? 0.4594 0.6877 0.5933 -0.0553 -0.0802 0.0203  4   GLN D N   
5213 C CA  . GLN D 4   ? 0.4748 0.7098 0.5955 -0.0465 -0.0692 0.0187  4   GLN D CA  
5214 C C   . GLN D 4   ? 0.4907 0.7727 0.6512 -0.0363 -0.0670 -0.0074 4   GLN D C   
5215 O O   . GLN D 4   ? 0.5267 0.8510 0.7139 -0.0463 -0.0535 -0.0208 4   GLN D O   
5216 C CB  . GLN D 4   ? 0.4784 0.7096 0.5650 -0.0612 -0.0448 0.0332  4   GLN D CB  
5217 C CG  . GLN D 4   ? 0.5607 0.7918 0.6228 -0.0514 -0.0383 0.0359  4   GLN D CG  
5218 C CD  . GLN D 4   ? 0.6043 0.7934 0.6347 -0.0431 -0.0487 0.0526  4   GLN D CD  
5219 O OE1 . GLN D 4   ? 0.6046 0.7623 0.6158 -0.0492 -0.0498 0.0683  4   GLN D OE1 
5220 N NE2 . GLN D 4   ? 0.4565 0.6476 0.4831 -0.0302 -0.0551 0.0466  4   GLN D NE2 
5221 N N   . ILE D 5   ? 0.4900 0.7650 0.6544 -0.0180 -0.0785 -0.0161 5   ILE D N   
5222 C CA  . ILE D 5   ? 0.5257 0.8397 0.7268 -0.0047 -0.0770 -0.0443 5   ILE D CA  
5223 C C   . ILE D 5   ? 0.5645 0.8970 0.7429 -0.0081 -0.0550 -0.0491 5   ILE D C   
5224 O O   . ILE D 5   ? 0.5092 0.8146 0.6563 -0.0037 -0.0580 -0.0397 5   ILE D O   
5225 C CB  . ILE D 5   ? 0.5307 0.8198 0.7486 0.0172  -0.1042 -0.0532 5   ILE D CB  
5226 C CG1 . ILE D 5   ? 0.4217 0.6924 0.6571 0.0212  -0.1296 -0.0470 5   ILE D CG1 
5227 C CG2 . ILE D 5   ? 0.5315 0.8563 0.7872 0.0334  -0.1020 -0.0855 5   ILE D CG2 
5228 C CD1 . ILE D 5   ? 0.4748 0.7947 0.7591 0.0200  -0.1298 -0.0646 5   ILE D CD1 
5229 N N   . GLU D 6   ? 0.6202 1.0027 0.8146 -0.0174 -0.0330 -0.0651 6   GLU D N   
5230 C CA  . GLU D 6   ? 0.6534 1.0564 0.8175 -0.0257 -0.0098 -0.0669 6   GLU D CA  
5231 C C   . GLU D 6   ? 0.6867 1.1244 0.8769 -0.0107 -0.0075 -0.1009 6   GLU D C   
5232 O O   . GLU D 6   ? 0.7343 1.1903 0.8980 -0.0155 0.0088  -0.1068 6   GLU D O   
5233 C CB  . GLU D 6   ? 0.6890 1.1211 0.8412 -0.0514 0.0171  -0.0601 6   GLU D CB  
5234 C CG  . GLU D 6   ? 0.7298 1.1211 0.8484 -0.0684 0.0181  -0.0264 6   GLU D CG  
5235 C CD  . GLU D 6   ? 0.8409 1.1865 0.9026 -0.0670 0.0159  0.0020  6   GLU D CD  
5236 O OE1 . GLU D 6   ? 0.7675 1.1112 0.8155 -0.0532 0.0102  -0.0027 6   GLU D OE1 
5237 O OE2 . GLU D 6   ? 0.8481 1.1599 0.8809 -0.0792 0.0189  0.0275  6   GLU D OE2 
5238 N N   . SER D 7   ? 0.6749 1.1178 0.9147 0.0088  -0.0261 -0.1233 7   SER D N   
5239 C CA  . SER D 7   ? 0.7041 1.1827 0.9804 0.0254  -0.0238 -0.1618 7   SER D CA  
5240 C C   . SER D 7   ? 0.7228 1.1737 1.0373 0.0529  -0.0549 -0.1764 7   SER D C   
5241 O O   . SER D 7   ? 0.7174 1.1301 1.0349 0.0574  -0.0780 -0.1574 7   SER D O   
5242 C CB  . SER D 7   ? 0.7612 1.3093 1.0756 0.0162  -0.0010 -0.1863 7   SER D CB  
5243 O OG  . SER D 7   ? 0.7966 1.3760 1.1756 0.0399  -0.0121 -0.2237 7   SER D OG  
5244 N N   . LYS D 8   ? 0.7615 1.2298 1.1031 0.0708  -0.0557 -0.2107 8   LYS D N   
5245 C CA  . LYS D 8   ? 0.8074 1.2460 1.1873 0.0991  -0.0856 -0.2274 8   LYS D CA  
5246 C C   . LYS D 8   ? 0.8430 1.3209 1.2905 0.1161  -0.0957 -0.2506 8   LYS D C   
5247 O O   . LYS D 8   ? 0.8314 1.2777 1.3090 0.1397  -0.1275 -0.2541 8   LYS D O   
5248 C CB  . LYS D 8   ? 0.8496 1.2878 1.2330 0.1123  -0.0824 -0.2585 8   LYS D CB  
5249 C CG  . LYS D 8   ? 0.9286 1.3021 1.3198 0.1335  -0.1146 -0.2604 8   LYS D CG  
5250 C CD  . LYS D 8   ? 0.8393 1.2010 1.2154 0.1368  -0.1086 -0.2839 8   LYS D CD  
5251 C CE  . LYS D 8   ? 1.0180 1.4220 1.4476 0.1591  -0.1024 -0.3355 8   LYS D CE  
5252 N NZ  . LYS D 8   ? 1.1256 1.4984 1.6078 0.1910  -0.1344 -0.3495 8   LYS D NZ  
5253 N N   . THR D 9   ? 0.8540 1.4025 1.3241 0.1033  -0.0686 -0.2672 9   THR D N   
5254 C CA  . THR D 9   ? 0.8889 1.4917 1.4255 0.1133  -0.0725 -0.2905 9   THR D CA  
5255 C C   . THR D 9   ? 0.8641 1.4472 1.3936 0.1007  -0.0879 -0.2574 9   THR D C   
5256 O O   . THR D 9   ? 0.9027 1.4908 1.4786 0.1190  -0.1146 -0.2647 9   THR D O   
5257 C CB  . THR D 9   ? 0.9290 1.6190 1.4881 0.0972  -0.0326 -0.3212 9   THR D CB  
5258 O OG1 . THR D 9   ? 0.9333 1.6465 1.5115 0.1152  -0.0233 -0.3610 9   THR D OG1 
5259 C CG2 . THR D 9   ? 0.9732 1.7302 1.6004 0.0980  -0.0318 -0.3417 9   THR D CG2 
5260 N N   . ALA D 10  ? 0.7926 1.3513 1.2633 0.0711  -0.0729 -0.2220 10  ALA D N   
5261 C CA  . ALA D 10  ? 0.7208 1.2555 1.1770 0.0564  -0.0848 -0.1916 10  ALA D CA  
5262 C C   . ALA D 10  ? 0.6780 1.1422 1.1171 0.0732  -0.1215 -0.1706 10  ALA D C   
5263 O O   . ALA D 10  ? 0.6535 1.1039 1.1028 0.0744  -0.1437 -0.1584 10  ALA D O   
5264 C CB  . ALA D 10  ? 0.7028 1.2249 1.1007 0.0234  -0.0588 -0.1621 10  ALA D CB  
5265 N N   . PHE D 11  ? 0.6670 1.0875 1.0781 0.0841  -0.1278 -0.1673 11  PHE D N   
5266 C CA  . PHE D 11  ? 0.6497 1.0031 1.0439 0.0977  -0.1608 -0.1493 11  PHE D CA  
5267 C C   . PHE D 11  ? 0.7147 1.0718 1.1638 0.1263  -0.1924 -0.1681 11  PHE D C   
5268 O O   . PHE D 11  ? 0.7364 1.0631 1.1819 0.1295  -0.2196 -0.1495 11  PHE D O   
5269 C CB  . PHE D 11  ? 0.6487 0.9590 1.0078 0.1012  -0.1600 -0.1464 11  PHE D CB  
5270 C CG  . PHE D 11  ? 0.6145 0.8524 0.9388 0.1022  -0.1859 -0.1191 11  PHE D CG  
5271 C CD1 . PHE D 11  ? 0.6117 0.8239 0.8969 0.0833  -0.1873 -0.0866 11  PHE D CD1 
5272 C CD2 . PHE D 11  ? 0.7389 0.9327 1.0686 0.1207  -0.2083 -0.1269 11  PHE D CD2 
5273 C CE1 . PHE D 11  ? 0.7048 0.8549 0.9557 0.0812  -0.2083 -0.0630 11  PHE D CE1 
5274 C CE2 . PHE D 11  ? 0.7305 0.8559 1.0233 0.1168  -0.2305 -0.1000 11  PHE D CE2 
5275 C CZ  . PHE D 11  ? 0.7130 0.8200 0.9661 0.0964  -0.2294 -0.0685 11  PHE D CZ  
5276 N N   . GLN D 12  ? 0.7685 1.1637 1.2676 0.1479  -0.1898 -0.2059 12  GLN D N   
5277 C CA  . GLN D 12  ? 0.8222 1.2264 1.3829 0.1814  -0.2214 -0.2289 12  GLN D CA  
5278 C C   . GLN D 12  ? 0.8370 1.2810 1.4322 0.1789  -0.2337 -0.2261 12  GLN D C   
5279 O O   . GLN D 12  ? 0.8952 1.3076 1.5001 0.1951  -0.2717 -0.2142 12  GLN D O   
5280 C CB  . GLN D 12  ? 0.8766 1.3336 1.4916 0.2023  -0.2074 -0.2768 12  GLN D CB  
5281 C CG  . GLN D 12  ? 1.0238 1.4608 1.6910 0.2450  -0.2434 -0.3014 12  GLN D CG  
5282 C CD  . GLN D 12  ? 1.1169 1.4517 1.7400 0.2545  -0.2764 -0.2730 12  GLN D CD  
5283 O OE1 . GLN D 12  ? 1.0869 1.3771 1.6847 0.2508  -0.3034 -0.2391 12  GLN D OE1 
5284 N NE2 . GLN D 12  ? 1.1565 1.4544 1.7688 0.2645  -0.2739 -0.2879 12  GLN D NE2 
5285 N N   . GLU D 13  ? 0.8013 1.3144 1.4122 0.1565  -0.2015 -0.2370 13  GLU D N   
5286 C CA  . GLU D 13  ? 0.8141 1.3735 1.4558 0.1449  -0.2053 -0.2366 13  GLU D CA  
5287 C C   . GLU D 13  ? 0.7979 1.3026 1.3947 0.1310  -0.2281 -0.1969 13  GLU D C   
5288 O O   . GLU D 13  ? 0.8409 1.3683 1.4684 0.1335  -0.2495 -0.1983 13  GLU D O   
5289 C CB  . GLU D 13  ? 0.7923 1.4189 1.4376 0.1127  -0.1598 -0.2476 13  GLU D CB  
5290 C CG  . GLU D 13  ? 0.9075 1.5949 1.5937 0.0956  -0.1575 -0.2550 13  GLU D CG  
5291 C CD  . GLU D 13  ? 1.0147 1.7572 1.7875 0.1274  -0.1858 -0.2896 13  GLU D CD  
5292 O OE1 . GLU D 13  ? 1.0420 1.8145 1.8432 0.1194  -0.2007 -0.2888 13  GLU D OE1 
5293 O OE2 . GLU D 13  ? 1.0728 1.8289 1.8865 0.1611  -0.1945 -0.3191 13  GLU D OE2 
5294 N N   . ALA D 14  ? 0.7529 1.1904 1.2787 0.1162  -0.2235 -0.1643 14  ALA D N   
5295 C CA  . ALA D 14  ? 0.7374 1.1246 1.2174 0.1018  -0.2413 -0.1297 14  ALA D CA  
5296 C C   . ALA D 14  ? 0.7838 1.1178 1.2609 0.1265  -0.2864 -0.1190 14  ALA D C   
5297 O O   . ALA D 14  ? 0.8259 1.1481 1.2969 0.1235  -0.3113 -0.1047 14  ALA D O   
5298 C CB  . ALA D 14  ? 0.6546 0.9969 1.0642 0.0772  -0.2180 -0.1017 14  ALA D CB  
5299 N N   . LEU D 15  ? 0.8151 1.1143 1.2929 0.1492  -0.2973 -0.1257 15  LEU D N   
5300 C CA  . LEU D 15  ? 0.8931 1.1284 1.3603 0.1718  -0.3398 -0.1127 15  LEU D CA  
5301 C C   . LEU D 15  ? 0.9872 1.2529 1.5158 0.2008  -0.3757 -0.1302 15  LEU D C   
5302 O O   . LEU D 15  ? 1.0460 1.2666 1.5584 0.2114  -0.4150 -0.1105 15  LEU D O   
5303 C CB  . LEU D 15  ? 0.9007 1.0945 1.3613 0.1883  -0.3398 -0.1215 15  LEU D CB  
5304 C CG  . LEU D 15  ? 0.9280 1.0528 1.3202 0.1706  -0.3309 -0.0960 15  LEU D CG  
5305 C CD1 . LEU D 15  ? 0.7788 0.8978 1.1156 0.1355  -0.3089 -0.0676 15  LEU D CD1 
5306 C CD2 . LEU D 15  ? 0.7510 0.8870 1.1552 0.1765  -0.3078 -0.1211 15  LEU D CD2 
5307 N N   . ASP D 16  ? 1.0023 1.3469 1.6011 0.2136  -0.3622 -0.1682 16  ASP D N   
5308 C CA  . ASP D 16  ? 1.0804 1.4708 1.7529 0.2450  -0.3937 -0.1935 16  ASP D CA  
5309 C C   . ASP D 16  ? 1.0806 1.5244 1.7711 0.2268  -0.3980 -0.1904 16  ASP D C   
5310 O O   . ASP D 16  ? 1.1533 1.6056 1.8753 0.2473  -0.4386 -0.1921 16  ASP D O   
5311 C CB  . ASP D 16  ? 1.0984 1.5572 1.8445 0.2675  -0.3752 -0.2418 16  ASP D CB  
5312 C CG  . ASP D 16  ? 1.1497 1.5563 1.8824 0.2869  -0.3728 -0.2508 16  ASP D CG  
5313 O OD1 . ASP D 16  ? 1.1504 1.4641 1.8299 0.2917  -0.3969 -0.2215 16  ASP D OD1 
5314 O OD2 . ASP D 16  ? 1.0714 1.5321 1.8463 0.2949  -0.3451 -0.2891 16  ASP D OD2 
5315 N N   . ALA D 17  ? 1.0098 1.4872 1.6796 0.1886  -0.3580 -0.1861 17  ALA D N   
5316 C CA  . ALA D 17  ? 0.9931 1.5122 1.6719 0.1648  -0.3591 -0.1821 17  ALA D CA  
5317 C C   . ALA D 17  ? 1.0067 1.4586 1.6274 0.1579  -0.3917 -0.1455 17  ALA D C   
5318 O O   . ALA D 17  ? 1.0350 1.5131 1.6718 0.1524  -0.4135 -0.1450 17  ALA D O   
5319 C CB  . ALA D 17  ? 0.9268 1.4795 1.5861 0.1236  -0.3087 -0.1816 17  ALA D CB  
5320 N N   . ALA D 18  ? 0.9901 1.3590 1.5418 0.1550  -0.3935 -0.1162 18  ALA D N   
5321 C CA  . ALA D 18  ? 1.0151 1.3166 1.5100 0.1518  -0.4267 -0.0831 18  ALA D CA  
5322 C C   . ALA D 18  ? 1.1131 1.4017 1.6429 0.1915  -0.4778 -0.0887 18  ALA D C   
5323 O O   . ALA D 18  ? 1.1741 1.4717 1.7492 0.2221  -0.4832 -0.1106 18  ALA D O   
5324 C CB  . ALA D 18  ? 0.9778 1.2014 1.3961 0.1375  -0.4123 -0.0543 18  ALA D CB  
5325 N N   . GLY D 19  ? 1.1688 1.4360 1.6776 0.1925  -0.5165 -0.0704 19  GLY D N   
5326 C CA  . GLY D 19  ? 1.2622 1.5202 1.8059 0.2325  -0.5707 -0.0743 19  GLY D CA  
5327 C C   . GLY D 19  ? 1.3186 1.4729 1.7974 0.2425  -0.5936 -0.0427 19  GLY D C   
5328 O O   . GLY D 19  ? 1.2849 1.4052 1.7606 0.2522  -0.5776 -0.0469 19  GLY D O   
5329 N N   . ASP D 20  ? 1.3771 1.4820 1.8011 0.2366  -0.6302 -0.0115 20  ASP D N   
5330 C CA  . ASP D 20  ? 1.4376 1.4391 1.7818 0.2332  -0.6481 0.0256  20  ASP D CA  
5331 C C   . ASP D 20  ? 1.3490 1.3189 1.6104 0.1868  -0.6173 0.0522  20  ASP D C   
5332 O O   . ASP D 20  ? 1.4168 1.3085 1.5993 0.1735  -0.6346 0.0872  20  ASP D O   
5333 C CB  . ASP D 20  ? 1.5971 1.5600 1.9292 0.2585  -0.7121 0.0443  20  ASP D CB  
5334 C CG  . ASP D 20  ? 1.6669 1.6951 2.0224 0.2541  -0.7337 0.0371  20  ASP D CG  
5335 O OD1 . ASP D 20  ? 1.9163 1.9337 2.2795 0.2805  -0.7895 0.0453  20  ASP D OD1 
5336 O OD2 . ASP D 20  ? 1.6088 1.6978 1.9751 0.2244  -0.6969 0.0231  20  ASP D OD2 
5337 N N   . LYS D 21  ? 1.2102 1.2420 1.4902 0.1618  -0.5709 0.0346  21  LYS D N   
5338 C CA  . LYS D 21  ? 1.1455 1.1525 1.3557 0.1218  -0.5409 0.0550  21  LYS D CA  
5339 C C   . LYS D 21  ? 1.0915 1.0512 1.2643 0.1115  -0.5094 0.0651  21  LYS D C   
5340 O O   . LYS D 21  ? 1.0547 1.0254 1.2666 0.1282  -0.4952 0.0474  21  LYS D O   
5341 C CB  . LYS D 21  ? 1.0669 1.1441 1.3040 0.0990  -0.5071 0.0362  21  LYS D CB  
5342 C CG  . LYS D 21  ? 1.0438 1.2023 1.3729 0.1185  -0.5017 -0.0001 21  LYS D CG  
5343 C CD  . LYS D 21  ? 1.1646 1.3790 1.5321 0.1195  -0.5292 -0.0128 21  LYS D CD  
5344 C CE  . LYS D 21  ? 1.0394 1.2859 1.3912 0.0803  -0.4974 -0.0158 21  LYS D CE  
5345 N NZ  . LYS D 21  ? 0.9832 1.2738 1.3679 0.0666  -0.4457 -0.0354 21  LYS D NZ  
5346 N N   . LEU D 22  ? 1.0780 0.9884 1.1759 0.0837  -0.4999 0.0914  22  LEU D N   
5347 C CA  . LEU D 22  ? 1.0260 0.9044 1.0873 0.0666  -0.4656 0.0996  22  LEU D CA  
5348 C C   . LEU D 22  ? 0.9002 0.8348 0.9963 0.0585  -0.4209 0.0779  22  LEU D C   
5349 O O   . LEU D 22  ? 0.8140 0.7946 0.9255 0.0468  -0.4067 0.0685  22  LEU D O   
5350 C CB  . LEU D 22  ? 1.0423 0.8738 1.0229 0.0358  -0.4609 0.1271  22  LEU D CB  
5351 C CG  . LEU D 22  ? 1.0450 0.8400 0.9844 0.0174  -0.4308 0.1375  22  LEU D CG  
5352 C CD1 . LEU D 22  ? 1.0513 0.7897 0.9821 0.0306  -0.4506 0.1470  22  LEU D CD1 
5353 C CD2 . LEU D 22  ? 0.9626 0.7324 0.8322 -0.0149 -0.4190 0.1570  22  LEU D CD2 
5354 N N   . VAL D 23  ? 0.8867 0.8146 0.9932 0.0643  -0.4005 0.0702  23  VAL D N   
5355 C CA  . VAL D 23  ? 0.7799 0.7524 0.9084 0.0565  -0.3595 0.0537  23  VAL D CA  
5356 C C   . VAL D 23  ? 0.7567 0.6888 0.8374 0.0408  -0.3391 0.0676  23  VAL D C   
5357 O O   . VAL D 23  ? 0.7615 0.6507 0.8298 0.0481  -0.3514 0.0729  23  VAL D O   
5358 C CB  . VAL D 23  ? 0.7891 0.8025 0.9829 0.0816  -0.3566 0.0249  23  VAL D CB  
5359 C CG1 . VAL D 23  ? 0.6442 0.7012 0.8514 0.0710