data_4LL4
# 
_entry.id   4LL4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4LL4         
RCSB  RCSB080765   
WWPDB D_1000080765 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4GFX 'Crystal structure of the N-terminal domain of TXNIP' unspecified 
PDB 4LL1 .                                                     unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4LL4 
_pdbx_database_status.recvd_initial_deposition_date   2013-07-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hwang, J.' 1 
'Kim, M.H.' 2 
# 
_citation.id                        primary 
_citation.title                     
'The structural basis for the negative regulation of thioredoxin by thioredoxin-interacting protein' 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_volume            5 
_citation.page_first                2958 
_citation.page_last                 2958 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24389582 
_citation.pdbx_database_id_DOI      10.1038/ncomms3958 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hwang, J.'    1  
primary 'Suh, H.W.'    2  
primary 'Jeon, Y.H.'   3  
primary 'Hwang, E.'    4  
primary 'Nguyen, L.T.' 5  
primary 'Yeom, J.'     6  
primary 'Lee, S.G.'    7  
primary 'Lee, C.'      8  
primary 'Kim, K.J.'    9  
primary 'Kang, B.S.'   10 
primary 'Jeong, J.O.'  11 
primary 'Oh, T.K.'     12 
primary 'Choi, I.'     13 
primary 'Lee, J.O.'    14 
primary 'Kim, M.H.'    15 
# 
_cell.entry_id           4LL4 
_cell.length_a           79.826 
_cell.length_b           64.990 
_cell.length_c           88.416 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.88 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4LL4 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Thioredoxin-interacting protein' 35037.496 2  ? 'C170S, C205S, C267S' 'UNP residues 3-317' ? 
2 polymer man Thioredoxin                       11718.413 2  ? C35A                  ?                    ? 
3 water   nat water                             18.015    59 ? ?                     ?                    ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Thioredoxin-binding protein 2, Vitamin D3 up-regulated protein 1'          
2 'Trx, ATL-derived factor, ADF, Surface-associated sulphydryl protein, SASP' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQP
TGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSA
KKEKKVSSMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTSSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHI
ISGTCASWRGKSLRVQKIRPSILGSNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEM
;
;MFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQP
TGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSA
KKEKKVSSMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTSSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHI
ISGTCASWRGKSLRVQKIRPSILGSNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEM
;
A,C ? 
2 'polypeptide(L)' no no 
;MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFF
KKGQKVGEFSGANKEKLEATINELV
;
;MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFF
KKGQKVGEFSGANKEKLEATINELV
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PHE n 
1 3   LYS n 
1 4   LYS n 
1 5   ILE n 
1 6   LYS n 
1 7   SER n 
1 8   PHE n 
1 9   GLU n 
1 10  VAL n 
1 11  VAL n 
1 12  PHE n 
1 13  ASN n 
1 14  ASP n 
1 15  PRO n 
1 16  GLU n 
1 17  LYS n 
1 18  VAL n 
1 19  TYR n 
1 20  GLY n 
1 21  SER n 
1 22  GLY n 
1 23  GLU n 
1 24  LYS n 
1 25  VAL n 
1 26  ALA n 
1 27  GLY n 
1 28  ARG n 
1 29  VAL n 
1 30  ILE n 
1 31  VAL n 
1 32  GLU n 
1 33  VAL n 
1 34  CYS n 
1 35  GLU n 
1 36  VAL n 
1 37  THR n 
1 38  ARG n 
1 39  VAL n 
1 40  LYS n 
1 41  ALA n 
1 42  VAL n 
1 43  ARG n 
1 44  ILE n 
1 45  LEU n 
1 46  ALA n 
1 47  CYS n 
1 48  GLY n 
1 49  VAL n 
1 50  ALA n 
1 51  LYS n 
1 52  VAL n 
1 53  LEU n 
1 54  TRP n 
1 55  MET n 
1 56  GLN n 
1 57  GLY n 
1 58  SER n 
1 59  GLN n 
1 60  GLN n 
1 61  CYS n 
1 62  LYS n 
1 63  GLN n 
1 64  THR n 
1 65  SER n 
1 66  GLU n 
1 67  TYR n 
1 68  LEU n 
1 69  ARG n 
1 70  TYR n 
1 71  GLU n 
1 72  ASP n 
1 73  THR n 
1 74  LEU n 
1 75  LEU n 
1 76  LEU n 
1 77  GLU n 
1 78  ASP n 
1 79  GLN n 
1 80  PRO n 
1 81  THR n 
1 82  GLY n 
1 83  GLU n 
1 84  ASN n 
1 85  GLU n 
1 86  MET n 
1 87  VAL n 
1 88  ILE n 
1 89  MET n 
1 90  ARG n 
1 91  PRO n 
1 92  GLY n 
1 93  ASN n 
1 94  LYS n 
1 95  TYR n 
1 96  GLU n 
1 97  TYR n 
1 98  LYS n 
1 99  PHE n 
1 100 GLY n 
1 101 PHE n 
1 102 GLU n 
1 103 LEU n 
1 104 PRO n 
1 105 GLN n 
1 106 GLY n 
1 107 PRO n 
1 108 LEU n 
1 109 GLY n 
1 110 THR n 
1 111 SER n 
1 112 PHE n 
1 113 LYS n 
1 114 GLY n 
1 115 LYS n 
1 116 TYR n 
1 117 GLY n 
1 118 CYS n 
1 119 VAL n 
1 120 ASP n 
1 121 TYR n 
1 122 TRP n 
1 123 VAL n 
1 124 LYS n 
1 125 ALA n 
1 126 PHE n 
1 127 LEU n 
1 128 ASP n 
1 129 ARG n 
1 130 PRO n 
1 131 SER n 
1 132 GLN n 
1 133 PRO n 
1 134 THR n 
1 135 GLN n 
1 136 GLU n 
1 137 THR n 
1 138 LYS n 
1 139 LYS n 
1 140 ASN n 
1 141 PHE n 
1 142 GLU n 
1 143 VAL n 
1 144 VAL n 
1 145 ASP n 
1 146 LEU n 
1 147 VAL n 
1 148 ASP n 
1 149 VAL n 
1 150 ASN n 
1 151 THR n 
1 152 PRO n 
1 153 ASP n 
1 154 LEU n 
1 155 MET n 
1 156 ALA n 
1 157 PRO n 
1 158 VAL n 
1 159 SER n 
1 160 ALA n 
1 161 LYS n 
1 162 LYS n 
1 163 GLU n 
1 164 LYS n 
1 165 LYS n 
1 166 VAL n 
1 167 SER n 
1 168 SER n 
1 169 MET n 
1 170 PHE n 
1 171 ILE n 
1 172 PRO n 
1 173 ASP n 
1 174 GLY n 
1 175 ARG n 
1 176 VAL n 
1 177 SER n 
1 178 VAL n 
1 179 SER n 
1 180 ALA n 
1 181 ARG n 
1 182 ILE n 
1 183 ASP n 
1 184 ARG n 
1 185 LYS n 
1 186 GLY n 
1 187 PHE n 
1 188 CYS n 
1 189 GLU n 
1 190 GLY n 
1 191 ASP n 
1 192 GLU n 
1 193 ILE n 
1 194 SER n 
1 195 ILE n 
1 196 HIS n 
1 197 ALA n 
1 198 ASP n 
1 199 PHE n 
1 200 GLU n 
1 201 ASN n 
1 202 THR n 
1 203 SER n 
1 204 SER n 
1 205 ARG n 
1 206 ILE n 
1 207 VAL n 
1 208 VAL n 
1 209 PRO n 
1 210 LYS n 
1 211 ALA n 
1 212 ALA n 
1 213 ILE n 
1 214 VAL n 
1 215 ALA n 
1 216 ARG n 
1 217 HIS n 
1 218 THR n 
1 219 TYR n 
1 220 LEU n 
1 221 ALA n 
1 222 ASN n 
1 223 GLY n 
1 224 GLN n 
1 225 THR n 
1 226 LYS n 
1 227 VAL n 
1 228 LEU n 
1 229 THR n 
1 230 GLN n 
1 231 LYS n 
1 232 LEU n 
1 233 SER n 
1 234 SER n 
1 235 VAL n 
1 236 ARG n 
1 237 GLY n 
1 238 ASN n 
1 239 HIS n 
1 240 ILE n 
1 241 ILE n 
1 242 SER n 
1 243 GLY n 
1 244 THR n 
1 245 CYS n 
1 246 ALA n 
1 247 SER n 
1 248 TRP n 
1 249 ARG n 
1 250 GLY n 
1 251 LYS n 
1 252 SER n 
1 253 LEU n 
1 254 ARG n 
1 255 VAL n 
1 256 GLN n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 PRO n 
1 261 SER n 
1 262 ILE n 
1 263 LEU n 
1 264 GLY n 
1 265 SER n 
1 266 ASN n 
1 267 ILE n 
1 268 LEU n 
1 269 ARG n 
1 270 VAL n 
1 271 GLU n 
1 272 TYR n 
1 273 SER n 
1 274 LEU n 
1 275 LEU n 
1 276 ILE n 
1 277 TYR n 
1 278 VAL n 
1 279 SER n 
1 280 VAL n 
1 281 PRO n 
1 282 GLY n 
1 283 SER n 
1 284 LYS n 
1 285 LYS n 
1 286 VAL n 
1 287 ILE n 
1 288 LEU n 
1 289 ASP n 
1 290 LEU n 
1 291 PRO n 
1 292 LEU n 
1 293 VAL n 
1 294 ILE n 
1 295 GLY n 
1 296 SER n 
1 297 ARG n 
1 298 SER n 
1 299 GLY n 
1 300 LEU n 
1 301 SER n 
1 302 SER n 
1 303 ARG n 
1 304 THR n 
1 305 SER n 
1 306 SER n 
1 307 MET n 
1 308 ALA n 
1 309 SER n 
1 310 ARG n 
1 311 THR n 
1 312 SER n 
1 313 SER n 
1 314 GLU n 
1 315 MET n 
2 1   MET n 
2 2   VAL n 
2 3   LYS n 
2 4   GLN n 
2 5   ILE n 
2 6   GLU n 
2 7   SER n 
2 8   LYS n 
2 9   THR n 
2 10  ALA n 
2 11  PHE n 
2 12  GLN n 
2 13  GLU n 
2 14  ALA n 
2 15  LEU n 
2 16  ASP n 
2 17  ALA n 
2 18  ALA n 
2 19  GLY n 
2 20  ASP n 
2 21  LYS n 
2 22  LEU n 
2 23  VAL n 
2 24  VAL n 
2 25  VAL n 
2 26  ASP n 
2 27  PHE n 
2 28  SER n 
2 29  ALA n 
2 30  THR n 
2 31  TRP n 
2 32  CYS n 
2 33  GLY n 
2 34  PRO n 
2 35  ALA n 
2 36  LYS n 
2 37  MET n 
2 38  ILE n 
2 39  LYS n 
2 40  PRO n 
2 41  PHE n 
2 42  PHE n 
2 43  HIS n 
2 44  SER n 
2 45  LEU n 
2 46  SER n 
2 47  GLU n 
2 48  LYS n 
2 49  TYR n 
2 50  SER n 
2 51  ASN n 
2 52  VAL n 
2 53  ILE n 
2 54  PHE n 
2 55  LEU n 
2 56  GLU n 
2 57  VAL n 
2 58  ASP n 
2 59  VAL n 
2 60  ASP n 
2 61  ASP n 
2 62  CYS n 
2 63  GLN n 
2 64  ASP n 
2 65  VAL n 
2 66  ALA n 
2 67  SER n 
2 68  GLU n 
2 69  CYS n 
2 70  GLU n 
2 71  VAL n 
2 72  LYS n 
2 73  CYS n 
2 74  MET n 
2 75  PRO n 
2 76  THR n 
2 77  PHE n 
2 78  GLN n 
2 79  PHE n 
2 80  PHE n 
2 81  LYS n 
2 82  LYS n 
2 83  GLY n 
2 84  GLN n 
2 85  LYS n 
2 86  VAL n 
2 87  GLY n 
2 88  GLU n 
2 89  PHE n 
2 90  SER n 
2 91  GLY n 
2 92  ALA n 
2 93  ASN n 
2 94  LYS n 
2 95  GLU n 
2 96  LYS n 
2 97  LEU n 
2 98  GLU n 
2 99  ALA n 
2 100 THR n 
2 101 ILE n 
2 102 ASN n 
2 103 GLU n 
2 104 LEU n 
2 105 VAL n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? TXNIP ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? 
2 1 sample ? ? ? human ? TRX   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TXNIP_HUMAN Q9H3M7 1 
;MFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQP
TGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSA
KKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHI
ISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEM
;
3 ? 
2 UNP THIO_HUMAN  P10599 2 
;MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFF
KKGQKVGEFSGANKEKLEATINELV
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4LL4 A 1 ? 315 ? Q9H3M7 3 ? 317 ? 3 317 
2 2 4LL4 B 1 ? 105 ? P10599 1 ? 105 ? 1 105 
3 1 4LL4 C 1 ? 315 ? Q9H3M7 3 ? 317 ? 3 317 
4 2 4LL4 D 1 ? 105 ? P10599 1 ? 105 ? 1 105 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4LL4 SER A 168 ? UNP Q9H3M7 CYS 170 'ENGINEERED MUTATION' 170 1 
1 4LL4 SER A 203 ? UNP Q9H3M7 CYS 205 'ENGINEERED MUTATION' 205 2 
1 4LL4 SER A 265 ? UNP Q9H3M7 CYS 267 'ENGINEERED MUTATION' 267 3 
2 4LL4 ALA B 35  ? UNP P10599 CYS 35  'ENGINEERED MUTATION' 35  4 
3 4LL4 SER C 168 ? UNP Q9H3M7 CYS 170 'ENGINEERED MUTATION' 170 5 
3 4LL4 SER C 203 ? UNP Q9H3M7 CYS 205 'ENGINEERED MUTATION' 205 6 
3 4LL4 SER C 265 ? UNP Q9H3M7 CYS 267 'ENGINEERED MUTATION' 267 7 
4 4LL4 ALA D 35  ? UNP P10599 CYS 35  'ENGINEERED MUTATION' 35  8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4LL4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.84 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            294.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'0.16M tri-sodium citrate, 16% PEG3350, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 294.15K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           173.15 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2009-07-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.100 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PAL/PLS BEAMLINE 5C (4A)' 
_diffrn_source.pdbx_synchrotron_site       PAL/PLS 
_diffrn_source.pdbx_synchrotron_beamline   '5C (4A)' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.100 
# 
_reflns.entry_id                     4LL4 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   24910 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.7 
_reflns_shell.d_res_low                   2.8 
_reflns_shell.percent_possible_all        99.9 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4LL4 
_refine.ls_number_reflns_obs                     22957 
_refine.ls_number_reflns_all                     24910 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    99.49 
_refine.ls_R_factor_obs                          0.20130 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19589 
_refine.ls_R_factor_R_free                       0.26401 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.8 
_refine.ls_number_reflns_R_free                  1942 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.946 
_refine.correlation_coeff_Fo_to_Fc_free          0.905 
_refine.B_iso_mean                               55.593 
_refine.aniso_B[1][1]                            -1.63 
_refine.aniso_B[2][2]                            3.94 
_refine.aniso_B[3][3]                            -2.37 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -1.91 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ID 4LL1' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.378 
_refine.overall_SU_ML                            0.275 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             28.731 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6011 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             59 
_refine_hist.number_atoms_total               6070 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d         0.022  0.022  ? 6125 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg      2.148  1.967  ? 8250 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg   8.426  5.000  ? 760  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg   37.838 24.440 ? 259  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg   22.704 15.000 ? 1135 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg   19.359 15.000 ? 34   ? 'X-RAY DIFFRACTION' 
r_chiral_restr           0.134  0.200  ? 926  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined     0.007  0.020  ? 4504 ? 'X-RAY DIFFRACTION' 
r_nbd_refined            0.268  0.200  ? 2664 ? 'X-RAY DIFFRACTION' 
r_nbtor_refined          0.331  0.200  ? 4090 ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined    0.189  0.200  ? 243  ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined   0.274  0.200  ? 69   ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined 0.155  0.200  ? 8    ? 'X-RAY DIFFRACTION' 
r_mcbond_it              1.252  1.500  ? 3896 ? 'X-RAY DIFFRACTION' 
r_mcangle_it             1.865  2.000  ? 6168 ? 'X-RAY DIFFRACTION' 
r_scbond_it              2.866  3.000  ? 2498 ? 'X-RAY DIFFRACTION' 
r_scangle_it             4.375  4.500  ? 2082 ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.704 
_refine_ls_shell.d_res_low                        2.774 
_refine_ls_shell.number_reflns_R_work             1568 
_refine_ls_shell.R_factor_R_work                  0.253 
_refine_ls_shell.percent_reflns_obs               93.89 
_refine_ls_shell.R_factor_R_free                  0.348 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             139 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  4LL4 
_struct.title                     'The structure of the TRX and TXNIP complex' 
_struct.pdbx_descriptor           'Thioredoxin-interacting protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4LL4 
_struct_keywords.pdbx_keywords   'ANTITUMOR PROTEIN/PROTEIN BINDING' 
_struct_keywords.text            'Arrestin-like domain, ANTITUMOR PROTEIN-PROTEIN BINDING complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER B 7  ? ALA B 18  ? SER B 7  ALA B 18  1 ? 12 
HELX_P HELX_P2 2 CYS B 32 ? TYR B 49  ? CYS B 32 TYR B 49  1 ? 18 
HELX_P HELX_P3 3 CYS B 62 ? CYS B 69  ? CYS B 62 CYS B 69  1 ? 8  
HELX_P HELX_P4 4 ASN B 93 ? GLU B 103 ? ASN B 93 GLU B 103 1 ? 11 
HELX_P HELX_P5 5 SER D 7  ? ALA D 18  ? SER D 7  ALA D 18  1 ? 12 
HELX_P HELX_P6 6 CYS D 32 ? TYR D 49  ? CYS D 32 TYR D 49  1 ? 18 
HELX_P HELX_P7 7 CYS D 62 ? CYS D 69  ? CYS D 62 CYS D 69  1 ? 8  
HELX_P HELX_P8 8 ASN D 93 ? VAL D 105 ? ASN D 93 VAL D 105 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 61  SG ? ? ? 1_555 A CYS 188 SG ? ? A CYS 63  A CYS 190 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf2 disulf ? ? A CYS 245 SG ? ? ? 1_555 B CYS 32  SG ? ? A CYS 247 B CYS 32  1_555 ? ? ? ? ? ? ? 2.676 ? 
disulf3 disulf ? ? C CYS 61  SG ? ? ? 1_555 C CYS 188 SG ? ? C CYS 63  C CYS 190 1_555 ? ? ? ? ? ? ? 2.079 ? 
disulf4 disulf ? ? C CYS 245 SG ? ? ? 1_555 D CYS 32  SG ? ? C CYS 247 D CYS 32  1_555 ? ? ? ? ? ? ? 2.159 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 224 A . ? GLN 226 A THR 225 A ? THR 227 A 1 20.49  
2 MET 74  B . ? MET 74  B PRO 75  B ? PRO 75  B 1 -14.84 
3 ASN 222 C . ? ASN 224 C GLY 223 C ? GLY 225 C 1 -5.11  
4 MET 74  D . ? MET 74  D PRO 75  D ? PRO 75  D 1 -7.41  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 4 ? 
D ? 4 ? 
E ? 5 ? 
F ? 5 ? 
G ? 3 ? 
H ? 5 ? 
I ? 4 ? 
J ? 2 ? 
K ? 4 ? 
L ? 5 ? 
M ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? parallel      
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
M 1 2 ? parallel      
M 2 3 ? parallel      
M 3 4 ? anti-parallel 
M 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 7   ? PHE A 12  ? SER A 9   PHE A 14  
A 2 LYS A 24  ? GLU A 32  ? LYS A 26  GLU A 34  
A 3 TYR A 95  ? GLU A 102 ? TYR A 97  GLU A 104 
B 1 THR A 37  ? VAL A 39  ? THR A 39  VAL A 41  
B 2 VAL A 87  ? MET A 89  ? VAL A 89  MET A 91  
C 1 GLN A 60  ? LEU A 74  ? GLN A 62  LEU A 76  
C 2 ALA A 41  ? MET A 55  ? ALA A 43  MET A 57  
C 3 GLY A 117 ? ASP A 128 ? GLY A 119 ASP A 130 
C 4 GLN A 135 ? PHE A 141 ? GLN A 137 PHE A 143 
D 1 VAL A 158 ? LYS A 165 ? VAL A 160 LYS A 167 
D 2 ARG A 175 ? ILE A 182 ? ARG A 177 ILE A 184 
D 3 GLU A 192 ? ASN A 201 ? GLU A 194 ASN A 203 
D 4 THR A 244 ? ARG A 254 ? THR A 246 ARG A 256 
E 1 GLY A 186 ? CYS A 188 ? GLY A 188 CYS A 190 
E 2 VAL A 286 ? GLY A 295 ? VAL A 288 GLY A 297 
E 3 ILE A 267 ? SER A 279 ? ILE A 269 SER A 281 
E 4 VAL A 208 ? ALA A 221 ? VAL A 210 ALA A 223 
E 5 GLN A 224 ? ARG A 236 ? GLN A 226 ARG A 238 
F 1 VAL B 2   ? LYS B 3   ? VAL B 2   LYS B 3   
F 2 ILE B 53  ? ASP B 58  ? ILE B 53  ASP B 58  
F 3 VAL B 23  ? SER B 28  ? VAL B 23  SER B 28  
F 4 THR B 76  ? LYS B 81  ? THR B 76  LYS B 81  
F 5 GLN B 84  ? SER B 90  ? GLN B 84  SER B 90  
G 1 SER C 7   ? PHE C 12  ? SER C 9   PHE C 14  
G 2 LYS C 24  ? GLU C 32  ? LYS C 26  GLU C 34  
G 3 TYR C 95  ? GLU C 102 ? TYR C 97  GLU C 104 
H 1 VAL C 18  ? GLY C 20  ? VAL C 20  GLY C 22  
H 2 GLN C 135 ? VAL C 144 ? GLN C 137 VAL C 146 
H 3 GLY C 117 ? ASP C 128 ? GLY C 119 ASP C 130 
H 4 ALA C 41  ? GLN C 56  ? ALA C 43  GLN C 58  
H 5 GLN C 59  ? LEU C 74  ? GLN C 61  LEU C 76  
I 1 VAL C 18  ? GLY C 20  ? VAL C 20  GLY C 22  
I 2 GLN C 135 ? VAL C 144 ? GLN C 137 VAL C 146 
I 3 GLY C 117 ? ASP C 128 ? GLY C 119 ASP C 130 
I 4 PHE C 112 ? GLY C 114 ? PHE C 114 GLY C 116 
J 1 THR C 37  ? VAL C 39  ? THR C 39  VAL C 41  
J 2 VAL C 87  ? MET C 89  ? VAL C 89  MET C 91  
K 1 VAL C 158 ? LYS C 165 ? VAL C 160 LYS C 167 
K 2 ARG C 175 ? ILE C 182 ? ARG C 177 ILE C 184 
K 3 GLU C 192 ? ASN C 201 ? GLU C 194 ASN C 203 
K 4 THR C 244 ? ARG C 254 ? THR C 246 ARG C 256 
L 1 GLY C 186 ? CYS C 188 ? GLY C 188 CYS C 190 
L 2 VAL C 286 ? GLY C 295 ? VAL C 288 GLY C 297 
L 3 ILE C 267 ? SER C 279 ? ILE C 269 SER C 281 
L 4 VAL C 208 ? ALA C 221 ? VAL C 210 ALA C 223 
L 5 GLN C 224 ? ARG C 236 ? GLN C 226 ARG C 238 
M 1 LYS D 3   ? ILE D 5   ? LYS D 3   ILE D 5   
M 2 VAL D 52  ? ASP D 58  ? VAL D 52  ASP D 58  
M 3 LEU D 22  ? SER D 28  ? LEU D 22  SER D 28  
M 4 THR D 76  ? LYS D 81  ? THR D 76  LYS D 81  
M 5 GLN D 84  ? SER D 90  ? GLN D 84  SER D 90  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 11  ? N VAL A 13  O ARG A 28  ? O ARG A 30  
A 2 3 N VAL A 31  ? N VAL A 33  O TYR A 95  ? O TYR A 97  
B 1 2 N THR A 37  ? N THR A 39  O MET A 89  ? O MET A 91  
C 1 2 O ASP A 72  ? O ASP A 74  N ILE A 44  ? N ILE A 46  
C 2 3 N LEU A 45  ? N LEU A 47  O LYS A 124 ? O LYS A 126 
C 3 4 N VAL A 123 ? N VAL A 125 O LYS A 139 ? O LYS A 141 
D 1 2 N ALA A 160 ? N ALA A 162 O ALA A 180 ? O ALA A 182 
D 2 3 N ARG A 181 ? N ARG A 183 O HIS A 196 ? O HIS A 198 
D 3 4 N ILE A 193 ? N ILE A 195 O LEU A 253 ? O LEU A 255 
E 1 2 N PHE A 187 ? N PHE A 189 O VAL A 293 ? O VAL A 295 
E 2 3 O LEU A 290 ? O LEU A 292 N LEU A 274 ? N LEU A 276 
E 3 4 O GLU A 271 ? O GLU A 273 N ARG A 216 ? N ARG A 218 
E 4 5 N TYR A 219 ? N TYR A 221 O LYS A 226 ? O LYS A 228 
F 1 2 N LYS B 3   ? N LYS B 3   O GLU B 56  ? O GLU B 56  
F 2 3 O VAL B 57  ? O VAL B 57  N ASP B 26  ? N ASP B 26  
F 3 4 N VAL B 23  ? N VAL B 23  O PHE B 80  ? O PHE B 80  
F 4 5 N PHE B 79  ? N PHE B 79  O VAL B 86  ? O VAL B 86  
G 1 2 N GLU C 9   ? N GLU C 11  O ILE C 30  ? O ILE C 32  
G 2 3 N VAL C 25  ? N VAL C 27  O PHE C 101 ? O PHE C 103 
H 1 2 N TYR C 19  ? N TYR C 21  O GLU C 142 ? O GLU C 144 
H 2 3 O THR C 137 ? O THR C 139 N ALA C 125 ? N ALA C 127 
H 3 4 O LYS C 124 ? O LYS C 126 N LEU C 45  ? N LEU C 47  
H 4 5 N GLN C 56  ? N GLN C 58  O GLN C 59  ? O GLN C 61  
I 1 2 N TYR C 19  ? N TYR C 21  O GLU C 142 ? O GLU C 144 
I 2 3 O THR C 137 ? O THR C 139 N ALA C 125 ? N ALA C 127 
I 3 4 O GLY C 117 ? O GLY C 119 N GLY C 114 ? N GLY C 116 
J 1 2 N THR C 37  ? N THR C 39  O MET C 89  ? O MET C 91  
K 1 2 N LYS C 164 ? N LYS C 166 O VAL C 176 ? O VAL C 178 
K 2 3 N SER C 179 ? N SER C 181 O ASP C 198 ? O ASP C 200 
K 3 4 N ILE C 195 ? N ILE C 197 O LYS C 251 ? O LYS C 253 
L 1 2 N PHE C 187 ? N PHE C 189 O VAL C 293 ? O VAL C 295 
L 2 3 O LEU C 290 ? O LEU C 292 N LEU C 274 ? N LEU C 276 
L 3 4 O LEU C 275 ? O LEU C 277 N ALA C 212 ? N ALA C 214 
L 4 5 N HIS C 217 ? N HIS C 219 O LEU C 228 ? O LEU C 230 
M 1 2 N ILE D 5   ? N ILE D 5   O GLU D 56  ? O GLU D 56  
M 2 3 O ILE D 53  ? O ILE D 53  N VAL D 24  ? N VAL D 24  
M 3 4 N PHE D 27  ? N PHE D 27  O THR D 76  ? O THR D 76  
M 4 5 N PHE D 79  ? N PHE D 79  O VAL D 86  ? O VAL D 86  
# 
_database_PDB_matrix.entry_id          4LL4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4LL4 
_atom_sites.fract_transf_matrix[1][1]   0.012527 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000192 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015387 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011312 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 5   ? 29.005  -11.559 73.910 1.00 68.76  ? 7   ILE A N   1 
ATOM   2    C CA  . ILE A 1 5   ? 29.311  -10.223 73.301 1.00 68.06  ? 7   ILE A CA  1 
ATOM   3    C C   . ILE A 1 5   ? 28.456  -9.244  74.025 1.00 69.81  ? 7   ILE A C   1 
ATOM   4    O O   . ILE A 1 5   ? 27.313  -9.533  74.280 1.00 70.78  ? 7   ILE A O   1 
ATOM   5    C CB  . ILE A 1 5   ? 28.895  -10.129 71.823 1.00 66.48  ? 7   ILE A CB  1 
ATOM   6    C CG1 . ILE A 1 5   ? 29.763  -11.010 70.939 1.00 63.46  ? 7   ILE A CG1 1 
ATOM   7    C CG2 . ILE A 1 5   ? 29.039  -8.710  71.335 1.00 66.85  ? 7   ILE A CG2 1 
ATOM   8    C CD1 . ILE A 1 5   ? 31.179  -10.517 70.774 1.00 61.70  ? 7   ILE A CD1 1 
ATOM   9    N N   . LYS A 1 6   ? 29.010  -8.075  74.312 1.00 71.09  ? 8   LYS A N   1 
ATOM   10   C CA  . LYS A 1 6   ? 28.400  -7.083  75.213 1.00 73.42  ? 8   LYS A CA  1 
ATOM   11   C C   . LYS A 1 6   ? 27.358  -6.211  74.551 1.00 73.97  ? 8   LYS A C   1 
ATOM   12   O O   . LYS A 1 6   ? 26.444  -5.724  75.235 1.00 76.17  ? 8   LYS A O   1 
ATOM   13   C CB  . LYS A 1 6   ? 29.473  -6.158  75.782 1.00 74.28  ? 8   LYS A CB  1 
ATOM   14   C CG  . LYS A 1 6   ? 29.041  -5.333  76.934 1.00 78.12  ? 8   LYS A CG  1 
ATOM   15   C CD  . LYS A 1 6   ? 30.125  -4.325  77.304 1.00 80.97  ? 8   LYS A CD  1 
ATOM   16   C CE  . LYS A 1 6   ? 29.528  -3.212  78.158 1.00 82.47  ? 8   LYS A CE  1 
ATOM   17   N NZ  . LYS A 1 6   ? 29.573  -1.968  77.352 1.00 82.76  ? 8   LYS A NZ  1 
ATOM   18   N N   . SER A 1 7   ? 27.529  -5.978  73.245 1.00 72.05  ? 9   SER A N   1 
ATOM   19   C CA  . SER A 1 7   ? 26.678  -5.075  72.451 1.00 71.66  ? 9   SER A CA  1 
ATOM   20   C C   . SER A 1 7   ? 27.099  -5.049  70.981 1.00 70.03  ? 9   SER A C   1 
ATOM   21   O O   . SER A 1 7   ? 28.275  -4.818  70.674 1.00 69.74  ? 9   SER A O   1 
ATOM   22   C CB  . SER A 1 7   ? 26.708  -3.637  72.976 1.00 73.26  ? 9   SER A CB  1 
ATOM   23   O OG  . SER A 1 7   ? 26.693  -2.738  71.878 1.00 73.00  ? 9   SER A OG  1 
ATOM   24   N N   . PHE A 1 8   ? 26.107  -5.234  70.099 1.00 69.29  ? 10  PHE A N   1 
ATOM   25   C CA  . PHE A 1 8   ? 26.254  -5.286  68.648 1.00 67.06  ? 10  PHE A CA  1 
ATOM   26   C C   . PHE A 1 8   ? 25.088  -4.568  67.971 1.00 68.02  ? 10  PHE A C   1 
ATOM   27   O O   . PHE A 1 8   ? 23.977  -5.117  67.894 1.00 67.95  ? 10  PHE A O   1 
ATOM   28   C CB  . PHE A 1 8   ? 26.227  -6.758  68.236 1.00 65.62  ? 10  PHE A CB  1 
ATOM   29   C CG  . PHE A 1 8   ? 26.580  -6.991  66.816 1.00 61.15  ? 10  PHE A CG  1 
ATOM   30   C CD1 . PHE A 1 8   ? 27.624  -6.325  66.237 1.00 57.85  ? 10  PHE A CD1 1 
ATOM   31   C CD2 . PHE A 1 8   ? 25.887  -7.892  66.074 1.00 59.88  ? 10  PHE A CD2 1 
ATOM   32   C CE1 . PHE A 1 8   ? 27.952  -6.542  64.946 1.00 57.45  ? 10  PHE A CE1 1 
ATOM   33   C CE2 . PHE A 1 8   ? 26.235  -8.121  64.746 1.00 58.47  ? 10  PHE A CE2 1 
ATOM   34   C CZ  . PHE A 1 8   ? 27.250  -7.436  64.185 1.00 55.78  ? 10  PHE A CZ  1 
ATOM   35   N N   . GLU A 1 9   ? 25.296  -3.346  67.486 1.00 68.51  ? 11  GLU A N   1 
ATOM   36   C CA  . GLU A 1 9   ? 24.127  -2.576  67.024 1.00 69.79  ? 11  GLU A CA  1 
ATOM   37   C C   . GLU A 1 9   ? 24.331  -1.848  65.701 1.00 68.79  ? 11  GLU A C   1 
ATOM   38   O O   . GLU A 1 9   ? 25.452  -1.467  65.356 1.00 68.32  ? 11  GLU A O   1 
ATOM   39   C CB  . GLU A 1 9   ? 23.632  -1.592  68.116 1.00 72.37  ? 11  GLU A CB  1 
ATOM   40   C CG  . GLU A 1 9   ? 23.187  -2.256  69.456 1.00 76.01  ? 11  GLU A CG  1 
ATOM   41   C CD  . GLU A 1 9   ? 21.869  -3.051  69.340 1.00 77.67  ? 11  GLU A CD  1 
ATOM   42   O OE1 . GLU A 1 9   ? 20.986  -2.629  68.566 1.00 78.61  ? 11  GLU A OE1 1 
ATOM   43   O OE2 . GLU A 1 9   ? 21.710  -4.099  70.012 1.00 77.91  ? 11  GLU A OE2 1 
ATOM   44   N N   . VAL A 1 10  ? 23.234  -1.648  64.974 1.00 68.40  ? 12  VAL A N   1 
ATOM   45   C CA  . VAL A 1 10  ? 23.268  -0.924  63.734 1.00 67.49  ? 12  VAL A CA  1 
ATOM   46   C C   . VAL A 1 10  ? 22.714  0.425   64.073 1.00 70.16  ? 12  VAL A C   1 
ATOM   47   O O   . VAL A 1 10  ? 21.613  0.507   64.576 1.00 71.75  ? 12  VAL A O   1 
ATOM   48   C CB  . VAL A 1 10  ? 22.400  -1.645  62.665 1.00 66.72  ? 12  VAL A CB  1 
ATOM   49   C CG1 . VAL A 1 10  ? 22.041  -0.733  61.403 1.00 65.89  ? 12  VAL A CG1 1 
ATOM   50   C CG2 . VAL A 1 10  ? 23.053  -2.987  62.231 1.00 63.38  ? 12  VAL A CG2 1 
ATOM   51   N N   . VAL A 1 11  ? 23.461  1.498   63.844 1.00 71.33  ? 13  VAL A N   1 
ATOM   52   C CA  . VAL A 1 11  ? 22.901  2.810   64.157 1.00 74.33  ? 13  VAL A CA  1 
ATOM   53   C C   . VAL A 1 11  ? 23.071  3.837   63.048 1.00 74.90  ? 13  VAL A C   1 
ATOM   54   O O   . VAL A 1 11  ? 24.190  4.048   62.539 1.00 74.78  ? 13  VAL A O   1 
ATOM   55   C CB  . VAL A 1 11  ? 23.462  3.349   65.448 1.00 76.99  ? 13  VAL A CB  1 
ATOM   56   C CG1 . VAL A 1 11  ? 22.466  4.386   66.129 1.00 78.90  ? 13  VAL A CG1 1 
ATOM   57   C CG2 . VAL A 1 11  ? 23.786  2.175   66.367 1.00 77.11  ? 13  VAL A CG2 1 
ATOM   58   N N   . PHE A 1 12  ? 21.945  4.461   62.676 1.00 75.32  ? 14  PHE A N   1 
ATOM   59   C CA  . PHE A 1 12  ? 21.911  5.330   61.505 1.00 74.95  ? 14  PHE A CA  1 
ATOM   60   C C   . PHE A 1 12  ? 22.214  6.678   62.031 1.00 77.71  ? 14  PHE A C   1 
ATOM   61   O O   . PHE A 1 12  ? 21.925  6.950   63.185 1.00 79.92  ? 14  PHE A O   1 
ATOM   62   C CB  . PHE A 1 12  ? 20.541  5.318   60.801 1.00 74.25  ? 14  PHE A CB  1 
ATOM   63   C CG  . PHE A 1 12  ? 20.123  3.959   60.274 1.00 70.13  ? 14  PHE A CG  1 
ATOM   64   C CD1 . PHE A 1 12  ? 20.616  3.481   59.073 1.00 67.88  ? 14  PHE A CD1 1 
ATOM   65   C CD2 . PHE A 1 12  ? 19.231  3.164   60.989 1.00 69.84  ? 14  PHE A CD2 1 
ATOM   66   C CE1 . PHE A 1 12  ? 20.248  2.222   58.589 1.00 66.11  ? 14  PHE A CE1 1 
ATOM   67   C CE2 . PHE A 1 12  ? 18.829  1.905   60.512 1.00 68.46  ? 14  PHE A CE2 1 
ATOM   68   C CZ  . PHE A 1 12  ? 19.352  1.428   59.302 1.00 66.79  ? 14  PHE A CZ  1 
ATOM   69   N N   . ASN A 1 13  ? 22.784  7.531   61.196 1.00 78.66  ? 15  ASN A N   1 
ATOM   70   C CA  . ASN A 1 13  ? 23.081  8.893   61.631 1.00 81.88  ? 15  ASN A CA  1 
ATOM   71   C C   . ASN A 1 13  ? 21.919  9.746   62.070 1.00 84.90  ? 15  ASN A C   1 
ATOM   72   O O   . ASN A 1 13  ? 22.045  10.441  63.063 1.00 88.04  ? 15  ASN A O   1 
ATOM   73   C CB  . ASN A 1 13  ? 23.923  9.564   60.588 1.00 81.24  ? 15  ASN A CB  1 
ATOM   74   C CG  . ASN A 1 13  ? 25.106  8.704   60.239 1.00 77.33  ? 15  ASN A CG  1 
ATOM   75   O OD1 . ASN A 1 13  ? 25.669  8.000   61.145 1.00 71.34  ? 15  ASN A OD1 1 
ATOM   76   N ND2 . ASN A 1 13  ? 25.477  8.680   58.937 1.00 74.59  ? 15  ASN A ND2 1 
ATOM   77   N N   . ASP A 1 14  ? 20.810  9.683   61.340 1.00 85.35  ? 16  ASP A N   1 
ATOM   78   C CA  . ASP A 1 14  ? 19.526  10.175  61.830 1.00 89.06  ? 16  ASP A CA  1 
ATOM   79   C C   . ASP A 1 14  ? 18.643  8.974   62.109 1.00 88.00  ? 16  ASP A C   1 
ATOM   80   O O   . ASP A 1 14  ? 17.982  8.465   61.194 1.00 85.71  ? 16  ASP A O   1 
ATOM   81   C CB  . ASP A 1 14  ? 18.826  11.116  60.824 1.00 90.76  ? 16  ASP A CB  1 
ATOM   82   C CG  . ASP A 1 14  ? 17.414  11.608  61.310 1.00 93.64  ? 16  ASP A CG  1 
ATOM   83   O OD1 . ASP A 1 14  ? 16.827  11.072  62.297 1.00 96.17  ? 16  ASP A OD1 1 
ATOM   84   O OD2 . ASP A 1 14  ? 16.877  12.545  60.671 1.00 94.90  ? 16  ASP A OD2 1 
ATOM   85   N N   . PRO A 1 15  ? 18.634  8.519   63.379 1.00 89.76  ? 17  PRO A N   1 
ATOM   86   C CA  . PRO A 1 15  ? 17.874  7.329   63.787 1.00 88.85  ? 17  PRO A CA  1 
ATOM   87   C C   . PRO A 1 15  ? 16.359  7.479   63.585 1.00 90.16  ? 17  PRO A C   1 
ATOM   88   O O   . PRO A 1 15  ? 15.631  6.471   63.529 1.00 89.23  ? 17  PRO A O   1 
ATOM   89   C CB  . PRO A 1 15  ? 18.249  7.175   65.279 1.00 90.64  ? 17  PRO A CB  1 
ATOM   90   C CG  . PRO A 1 15  ? 19.628  7.897   65.401 1.00 90.98  ? 17  PRO A CG  1 
ATOM   91   C CD  . PRO A 1 15  ? 19.390  9.101   64.516 1.00 92.09  ? 17  PRO A CD  1 
ATOM   92   N N   . GLU A 1 16  ? 15.903  8.722   63.430 1.00 92.83  ? 18  GLU A N   1 
ATOM   93   C CA  . GLU A 1 16  ? 14.479  9.034   63.260 1.00 94.16  ? 18  GLU A CA  1 
ATOM   94   C C   . GLU A 1 16  ? 14.034  9.276   61.793 1.00 93.10  ? 18  GLU A C   1 
ATOM   95   O O   . GLU A 1 16  ? 12.859  9.621   61.533 1.00 94.51  ? 18  GLU A O   1 
ATOM   96   C CB  . GLU A 1 16  ? 14.078  10.223  64.167 1.00 98.25  ? 18  GLU A CB  1 
ATOM   97   C CG  . GLU A 1 16  ? 13.975  9.873   65.674 1.00 99.27  ? 18  GLU A CG  1 
ATOM   98   C CD  . GLU A 1 16  ? 12.565  10.080  66.254 1.00 100.72 ? 18  GLU A CD  1 
ATOM   99   O OE1 . GLU A 1 16  ? 11.603  10.288  65.463 1.00 100.14 ? 18  GLU A OE1 1 
ATOM   100  O OE2 . GLU A 1 16  ? 12.415  10.016  67.503 1.00 101.23 ? 18  GLU A OE2 1 
ATOM   101  N N   . LYS A 1 17  ? 14.958  9.077   60.848 1.00 90.73  ? 19  LYS A N   1 
ATOM   102  C CA  . LYS A 1 17  ? 14.722  9.367   59.442 1.00 89.35  ? 19  LYS A CA  1 
ATOM   103  C C   . LYS A 1 17  ? 14.047  8.238   58.741 1.00 87.43  ? 19  LYS A C   1 
ATOM   104  O O   . LYS A 1 17  ? 14.340  7.069   58.993 1.00 85.36  ? 19  LYS A O   1 
ATOM   105  C CB  . LYS A 1 17  ? 16.028  9.646   58.721 1.00 88.43  ? 19  LYS A CB  1 
ATOM   106  C CG  . LYS A 1 17  ? 15.922  9.768   57.214 1.00 86.81  ? 19  LYS A CG  1 
ATOM   107  C CD  . LYS A 1 17  ? 15.495  11.173  56.772 1.00 90.80  ? 19  LYS A CD  1 
ATOM   108  C CE  . LYS A 1 17  ? 15.601  11.319  55.238 1.00 89.85  ? 19  LYS A CE  1 
ATOM   109  N NZ  . LYS A 1 17  ? 17.024  11.494  54.828 1.00 90.55  ? 19  LYS A NZ  1 
ATOM   110  N N   . VAL A 1 18  ? 13.136  8.625   57.855 1.00 88.94  ? 20  VAL A N   1 
ATOM   111  C CA  . VAL A 1 18  ? 12.550  7.773   56.836 1.00 87.52  ? 20  VAL A CA  1 
ATOM   112  C C   . VAL A 1 18  ? 13.079  8.340   55.527 1.00 87.65  ? 20  VAL A C   1 
ATOM   113  O O   . VAL A 1 18  ? 13.136  9.561   55.346 1.00 89.40  ? 20  VAL A O   1 
ATOM   114  C CB  . VAL A 1 18  ? 11.006  7.812   56.916 1.00 88.52  ? 20  VAL A CB  1 
ATOM   115  C CG1 . VAL A 1 18  ? 10.338  7.360   55.613 1.00 86.91  ? 20  VAL A CG1 1 
ATOM   116  C CG2 . VAL A 1 18  ? 10.525  6.981   58.091 1.00 88.36  ? 20  VAL A CG2 1 
ATOM   117  N N   . TYR A 1 19  ? 13.467  7.445   54.623 1.00 86.56  ? 21  TYR A N   1 
ATOM   118  C CA  . TYR A 1 19  ? 14.332  7.817   53.503 1.00 87.34  ? 21  TYR A CA  1 
ATOM   119  C C   . TYR A 1 19  ? 13.619  7.844   52.130 1.00 87.06  ? 21  TYR A C   1 
ATOM   120  O O   . TYR A 1 19  ? 12.544  7.219   51.954 1.00 85.46  ? 21  TYR A O   1 
ATOM   121  C CB  . TYR A 1 19  ? 15.580  6.897   53.469 1.00 85.69  ? 21  TYR A CB  1 
ATOM   122  C CG  . TYR A 1 19  ? 16.407  6.823   54.766 1.00 86.68  ? 21  TYR A CG  1 
ATOM   123  C CD1 . TYR A 1 19  ? 17.689  7.373   54.837 1.00 86.02  ? 21  TYR A CD1 1 
ATOM   124  C CD2 . TYR A 1 19  ? 15.916  6.146   55.897 1.00 88.54  ? 21  TYR A CD2 1 
ATOM   125  C CE1 . TYR A 1 19  ? 18.442  7.285   56.005 1.00 87.86  ? 21  TYR A CE1 1 
ATOM   126  C CE2 . TYR A 1 19  ? 16.661  6.060   57.075 1.00 89.89  ? 21  TYR A CE2 1 
ATOM   127  C CZ  . TYR A 1 19  ? 17.917  6.640   57.124 1.00 89.42  ? 21  TYR A CZ  1 
ATOM   128  O OH  . TYR A 1 19  ? 18.630  6.568   58.299 1.00 90.80  ? 21  TYR A OH  1 
ATOM   129  N N   . GLY A 1 20  ? 14.230  8.561   51.170 1.00 88.38  ? 22  GLY A N   1 
ATOM   130  C CA  . GLY A 1 20  ? 13.669  8.674   49.803 1.00 89.46  ? 22  GLY A CA  1 
ATOM   131  C C   . GLY A 1 20  ? 14.484  8.303   48.559 1.00 88.71  ? 22  GLY A C   1 
ATOM   132  O O   . GLY A 1 20  ? 15.715  8.234   48.615 1.00 89.33  ? 22  GLY A O   1 
ATOM   133  N N   . SER A 1 21  ? 13.780  8.096   47.435 1.00 88.26  ? 23  SER A N   1 
ATOM   134  C CA  . SER A 1 21  ? 14.358  7.594   46.168 1.00 87.63  ? 23  SER A CA  1 
ATOM   135  C C   . SER A 1 21  ? 15.629  8.345   45.784 1.00 89.05  ? 23  SER A C   1 
ATOM   136  O O   . SER A 1 21  ? 15.693  9.574   45.901 1.00 91.65  ? 23  SER A O   1 
ATOM   137  C CB  . SER A 1 21  ? 13.322  7.646   45.028 1.00 86.78  ? 23  SER A CB  1 
ATOM   138  O OG  . SER A 1 21  ? 13.938  7.523   43.748 1.00 86.71  ? 23  SER A OG  1 
ATOM   139  N N   . GLY A 1 22  ? 16.649  7.601   45.363 1.00 88.30  ? 24  GLY A N   1 
ATOM   140  C CA  . GLY A 1 22  ? 17.969  8.199   45.149 1.00 90.15  ? 24  GLY A CA  1 
ATOM   141  C C   . GLY A 1 22  ? 18.749  8.663   46.383 1.00 91.84  ? 24  GLY A C   1 
ATOM   142  O O   . GLY A 1 22  ? 19.916  9.044   46.242 1.00 93.16  ? 24  GLY A O   1 
ATOM   143  N N   . GLU A 1 23  ? 18.163  8.602   47.573 1.00 92.15  ? 25  GLU A N   1 
ATOM   144  C CA  . GLU A 1 23  ? 18.842  9.089   48.782 1.00 93.55  ? 25  GLU A CA  1 
ATOM   145  C C   . GLU A 1 23  ? 19.799  8.128   49.509 1.00 91.64  ? 25  GLU A C   1 
ATOM   146  O O   . GLU A 1 23  ? 19.751  6.925   49.312 1.00 89.19  ? 25  GLU A O   1 
ATOM   147  C CB  . GLU A 1 23  ? 17.834  9.644   49.772 1.00 95.04  ? 25  GLU A CB  1 
ATOM   148  C CG  . GLU A 1 23  ? 18.490  10.410  50.889 1.00 99.72  ? 25  GLU A CG  1 
ATOM   149  C CD  . GLU A 1 23  ? 18.109  11.863  50.892 1.00 106.04 ? 25  GLU A CD  1 
ATOM   150  O OE1 . GLU A 1 23  ? 17.036  12.181  51.418 1.00 108.52 ? 25  GLU A OE1 1 
ATOM   151  O OE2 . GLU A 1 23  ? 18.873  12.695  50.374 1.00 109.19 ? 25  GLU A OE2 1 
ATOM   152  N N   . LYS A 1 24  ? 20.649  8.685   50.373 1.00 91.88  ? 26  LYS A N   1 
ATOM   153  C CA  . LYS A 1 24  ? 21.776  7.966   50.968 1.00 90.46  ? 26  LYS A CA  1 
ATOM   154  C C   . LYS A 1 24  ? 21.706  7.581   52.436 1.00 88.89  ? 26  LYS A C   1 
ATOM   155  O O   . LYS A 1 24  ? 21.784  8.428   53.292 1.00 90.34  ? 26  LYS A O   1 
ATOM   156  C CB  . LYS A 1 24  ? 23.034  8.788   50.796 1.00 30.22  ? 26  LYS A CB  1 
ATOM   157  C CG  . LYS A 1 24  ? 24.260  8.118   51.323 1.00 29.96  ? 26  LYS A CG  1 
ATOM   158  C CD  . LYS A 1 24  ? 25.345  8.104   50.262 1.00 30.04  ? 26  LYS A CD  1 
ATOM   159  C CE  . LYS A 1 24  ? 26.562  7.284   50.680 1.00 29.70  ? 26  LYS A CE  1 
ATOM   160  N NZ  . LYS A 1 24  ? 27.476  6.986   49.556 1.00 29.64  ? 26  LYS A NZ  1 
ATOM   161  N N   . VAL A 1 25  ? 21.634  6.286   52.710 1.00 85.34  ? 27  VAL A N   1 
ATOM   162  C CA  . VAL A 1 25  ? 21.557  5.760   54.062 1.00 83.54  ? 27  VAL A CA  1 
ATOM   163  C C   . VAL A 1 25  ? 22.906  5.396   54.630 1.00 82.48  ? 27  VAL A C   1 
ATOM   164  O O   . VAL A 1 25  ? 23.617  4.624   54.038 1.00 81.87  ? 27  VAL A O   1 
ATOM   165  C CB  . VAL A 1 25  ? 20.799  4.490   54.047 1.00 81.57  ? 27  VAL A CB  1 
ATOM   166  C CG1 . VAL A 1 25  ? 20.429  4.104   55.443 1.00 81.59  ? 27  VAL A CG1 1 
ATOM   167  C CG2 . VAL A 1 25  ? 19.597  4.646   53.202 1.00 80.83  ? 27  VAL A CG2 1 
ATOM   168  N N   . ALA A 1 26  ? 23.244  5.937   55.788 1.00 81.92  ? 28  ALA A N   1 
ATOM   169  C CA  . ALA A 1 26  ? 24.592  5.784   56.368 1.00 80.60  ? 28  ALA A CA  1 
ATOM   170  C C   . ALA A 1 26  ? 24.593  5.744   57.888 1.00 80.45  ? 28  ALA A C   1 
ATOM   171  O O   . ALA A 1 26  ? 23.616  6.141   58.555 1.00 81.73  ? 28  ALA A O   1 
ATOM   172  C CB  . ALA A 1 26  ? 25.546  6.894   55.882 1.00 82.03  ? 28  ALA A CB  1 
ATOM   173  N N   . GLY A 1 27  ? 25.712  5.279   58.437 1.00 78.83  ? 29  GLY A N   1 
ATOM   174  C CA  . GLY A 1 27  ? 25.866  5.211   59.886 1.00 77.05  ? 29  GLY A CA  1 
ATOM   175  C C   . GLY A 1 27  ? 26.892  4.194   60.290 1.00 73.87  ? 29  GLY A C   1 
ATOM   176  O O   . GLY A 1 27  ? 27.964  4.079   59.699 1.00 73.66  ? 29  GLY A O   1 
ATOM   177  N N   . ARG A 1 28  ? 26.594  3.428   61.305 1.00 71.62  ? 30  ARG A N   1 
ATOM   178  C CA  . ARG A 1 28  ? 27.611  2.495   61.683 1.00 69.91  ? 30  ARG A CA  1 
ATOM   179  C C   . ARG A 1 28  ? 27.141  1.321   62.490 1.00 67.95  ? 30  ARG A C   1 
ATOM   180  O O   . ARG A 1 28  ? 26.045  1.297   63.052 1.00 69.22  ? 30  ARG A O   1 
ATOM   181  C CB  . ARG A 1 28  ? 28.772  3.207   62.357 1.00 71.44  ? 30  ARG A CB  1 
ATOM   182  C CG  . ARG A 1 28  ? 28.371  3.995   63.520 1.00 74.77  ? 30  ARG A CG  1 
ATOM   183  C CD  . ARG A 1 28  ? 29.212  5.278   63.707 1.00 79.17  ? 30  ARG A CD  1 
ATOM   184  N NE  . ARG A 1 28  ? 28.750  5.892   64.954 1.00 84.13  ? 30  ARG A NE  1 
ATOM   185  C CZ  . ARG A 1 28  ? 27.505  6.349   65.133 1.00 87.52  ? 30  ARG A CZ  1 
ATOM   186  N NH1 . ARG A 1 28  ? 26.610  6.276   64.120 1.00 87.67  ? 30  ARG A NH1 1 
ATOM   187  N NH2 . ARG A 1 28  ? 27.148  6.872   66.313 1.00 86.63  ? 30  ARG A NH2 1 
ATOM   188  N N   . VAL A 1 29  ? 27.971  0.308   62.472 1.00 65.15  ? 31  VAL A N   1 
ATOM   189  C CA  . VAL A 1 29  ? 27.750  -0.845  63.266 1.00 62.98  ? 31  VAL A CA  1 
ATOM   190  C C   . VAL A 1 29  ? 28.716  -0.675  64.432 1.00 63.56  ? 31  VAL A C   1 
ATOM   191  O O   . VAL A 1 29  ? 29.897  -0.315  64.249 1.00 64.42  ? 31  VAL A O   1 
ATOM   192  C CB  . VAL A 1 29  ? 28.106  -2.039  62.444 1.00 61.14  ? 31  VAL A CB  1 
ATOM   193  C CG1 . VAL A 1 29  ? 27.961  -3.327  63.259 1.00 59.43  ? 31  VAL A CG1 1 
ATOM   194  C CG2 . VAL A 1 29  ? 27.259  -2.032  61.183 1.00 59.28  ? 31  VAL A CG2 1 
ATOM   195  N N   . ILE A 1 30  ? 28.227  -0.885  65.636 1.00 63.27  ? 32  ILE A N   1 
ATOM   196  C CA  . ILE A 1 30  ? 29.069  -0.639  66.774 1.00 64.19  ? 32  ILE A CA  1 
ATOM   197  C C   . ILE A 1 30  ? 29.101  -1.908  67.606 1.00 64.10  ? 32  ILE A C   1 
ATOM   198  O O   . ILE A 1 30  ? 28.057  -2.544  67.840 1.00 63.82  ? 32  ILE A O   1 
ATOM   199  C CB  . ILE A 1 30  ? 28.591  0.607   67.557 1.00 65.63  ? 32  ILE A CB  1 
ATOM   200  C CG1 . ILE A 1 30  ? 28.650  1.822   66.661 1.00 65.60  ? 32  ILE A CG1 1 
ATOM   201  C CG2 . ILE A 1 30  ? 29.577  1.014   68.611 1.00 65.58  ? 32  ILE A CG2 1 
ATOM   202  C CD1 . ILE A 1 30  ? 27.558  2.767   66.984 1.00 67.84  ? 32  ILE A CD1 1 
ATOM   203  N N   . VAL A 1 31  ? 30.325  -2.272  68.005 1.00 65.02  ? 33  VAL A N   1 
ATOM   204  C CA  . VAL A 1 31  ? 30.640  -3.521  68.726 1.00 65.38  ? 33  VAL A CA  1 
ATOM   205  C C   . VAL A 1 31  ? 31.455  -3.194  69.991 1.00 67.47  ? 33  VAL A C   1 
ATOM   206  O O   . VAL A 1 31  ? 32.427  -2.414  69.943 1.00 66.92  ? 33  VAL A O   1 
ATOM   207  C CB  . VAL A 1 31  ? 31.407  -4.563  67.792 1.00 63.35  ? 33  VAL A CB  1 
ATOM   208  C CG1 . VAL A 1 31  ? 31.386  -5.967  68.345 1.00 60.12  ? 33  VAL A CG1 1 
ATOM   209  C CG2 . VAL A 1 31  ? 30.790  -4.589  66.418 1.00 63.01  ? 33  VAL A CG2 1 
ATOM   210  N N   . GLU A 1 32  ? 31.004  -3.792  71.097 1.00 70.15  ? 34  GLU A N   1 
ATOM   211  C CA  . GLU A 1 32  ? 31.687  -3.822  72.405 1.00 74.36  ? 34  GLU A CA  1 
ATOM   212  C C   . GLU A 1 32  ? 31.669  -5.259  72.972 1.00 74.45  ? 34  GLU A C   1 
ATOM   213  O O   . GLU A 1 32  ? 30.628  -5.944  72.909 1.00 74.05  ? 34  GLU A O   1 
ATOM   214  C CB  . GLU A 1 32  ? 31.004  -2.887  73.405 1.00 76.51  ? 34  GLU A CB  1 
ATOM   215  C CG  . GLU A 1 32  ? 31.388  -1.399  73.279 1.00 82.39  ? 34  GLU A CG  1 
ATOM   216  C CD  . GLU A 1 32  ? 30.421  -0.457  74.057 1.00 90.11  ? 34  GLU A CD  1 
ATOM   217  O OE1 . GLU A 1 32  ? 29.632  -0.936  74.912 1.00 92.01  ? 34  GLU A OE1 1 
ATOM   218  O OE2 . GLU A 1 32  ? 30.437  0.771   73.815 1.00 92.77  ? 34  GLU A OE2 1 
ATOM   219  N N   . VAL A 1 33  ? 32.805  -5.724  73.499 1.00 75.47  ? 35  VAL A N   1 
ATOM   220  C CA  . VAL A 1 33  ? 32.833  -7.045  74.113 1.00 76.69  ? 35  VAL A CA  1 
ATOM   221  C C   . VAL A 1 33  ? 33.209  -6.948  75.563 1.00 79.24  ? 35  VAL A C   1 
ATOM   222  O O   . VAL A 1 33  ? 33.910  -6.007  75.982 1.00 80.43  ? 35  VAL A O   1 
ATOM   223  C CB  . VAL A 1 33  ? 33.870  -8.014  73.512 1.00 75.38  ? 35  VAL A CB  1 
ATOM   224  C CG1 . VAL A 1 33  ? 33.305  -9.482  73.577 1.00 75.97  ? 35  VAL A CG1 1 
ATOM   225  C CG2 . VAL A 1 33  ? 34.310  -7.601  72.124 1.00 73.32  ? 35  VAL A CG2 1 
ATOM   226  N N   . CYS A 1 34  ? 32.785  -7.960  76.321 1.00 80.59  ? 36  CYS A N   1 
ATOM   227  C CA  . CYS A 1 34  ? 33.228  -8.120  77.729 1.00 83.03  ? 36  CYS A CA  1 
ATOM   228  C C   . CYS A 1 34  ? 34.735  -8.434  77.797 1.00 81.73  ? 36  CYS A C   1 
ATOM   229  O O   . CYS A 1 34  ? 35.537  -7.588  78.199 1.00 82.75  ? 36  CYS A O   1 
ATOM   230  C CB  . CYS A 1 34  ? 32.397  -9.193  78.453 1.00 82.96  ? 36  CYS A CB  1 
ATOM   231  S SG  . CYS A 1 34  ? 30.656  -9.017  78.065 1.00 88.85  ? 36  CYS A SG  1 
ATOM   232  N N   . GLU A 1 35  ? 35.097  -9.646  77.384 1.00 80.03  ? 37  GLU A N   1 
ATOM   233  C CA  . GLU A 1 35  ? 36.479  -10.082 77.330 1.00 78.50  ? 37  GLU A CA  1 
ATOM   234  C C   . GLU A 1 35  ? 37.026  -9.971  75.907 1.00 75.82  ? 37  GLU A C   1 
ATOM   235  O O   . GLU A 1 35  ? 36.251  -9.978  74.937 1.00 74.55  ? 37  GLU A O   1 
ATOM   236  C CB  . GLU A 1 35  ? 36.570  -11.517 77.834 1.00 78.67  ? 37  GLU A CB  1 
ATOM   237  C CG  . GLU A 1 35  ? 35.284  -12.274 77.654 1.00 81.98  ? 37  GLU A CG  1 
ATOM   238  C CD  . GLU A 1 35  ? 35.519  -13.533 76.869 1.00 86.42  ? 37  GLU A CD  1 
ATOM   239  O OE1 . GLU A 1 35  ? 35.591  -14.615 77.515 1.00 88.02  ? 37  GLU A OE1 1 
ATOM   240  O OE2 . GLU A 1 35  ? 35.684  -13.431 75.615 1.00 86.96  ? 37  GLU A OE2 1 
ATOM   241  N N   . VAL A 1 36  ? 38.359  -9.867  75.798 1.00 74.04  ? 38  VAL A N   1 
ATOM   242  C CA  . VAL A 1 36  ? 39.041  -9.835  74.502 1.00 71.21  ? 38  VAL A CA  1 
ATOM   243  C C   . VAL A 1 36  ? 38.408  -10.806 73.497 1.00 69.83  ? 38  VAL A C   1 
ATOM   244  O O   . VAL A 1 36  ? 37.948  -11.924 73.852 1.00 69.10  ? 38  VAL A O   1 
ATOM   245  C CB  . VAL A 1 36  ? 40.563  -10.130 74.565 1.00 70.39  ? 38  VAL A CB  1 
ATOM   246  C CG1 . VAL A 1 36  ? 41.147  -9.756  75.898 1.00 70.87  ? 38  VAL A CG1 1 
ATOM   247  C CG2 . VAL A 1 36  ? 40.839  -11.571 74.215 1.00 68.29  ? 38  VAL A CG2 1 
ATOM   248  N N   . THR A 1 37  ? 38.371  -10.349 72.241 1.00 68.01  ? 39  THR A N   1 
ATOM   249  C CA  . THR A 1 37  ? 37.801  -11.142 71.190 1.00 65.59  ? 39  THR A CA  1 
ATOM   250  C C   . THR A 1 37  ? 38.511  -10.984 69.852 1.00 63.55  ? 39  THR A C   1 
ATOM   251  O O   . THR A 1 37  ? 38.723  -9.889  69.345 1.00 63.72  ? 39  THR A O   1 
ATOM   252  C CB  . THR A 1 37  ? 36.290  -10.891 71.078 1.00 65.96  ? 39  THR A CB  1 
ATOM   253  O OG1 . THR A 1 37  ? 35.673  -11.068 72.371 1.00 66.89  ? 39  THR A OG1 1 
ATOM   254  C CG2 . THR A 1 37  ? 35.653  -11.880 70.085 1.00 66.05  ? 39  THR A CG2 1 
ATOM   255  N N   . ARG A 1 38  ? 38.919  -12.114 69.324 1.00 60.97  ? 40  ARG A N   1 
ATOM   256  C CA  . ARG A 1 38  ? 39.311  -12.183 67.964 1.00 59.66  ? 40  ARG A CA  1 
ATOM   257  C C   . ARG A 1 38  ? 38.006  -12.179 67.161 1.00 57.52  ? 40  ARG A C   1 
ATOM   258  O O   . ARG A 1 38  ? 37.085  -12.970 67.413 1.00 57.52  ? 40  ARG A O   1 
ATOM   259  C CB  . ARG A 1 38  ? 40.163  -13.449 67.703 1.00 59.83  ? 40  ARG A CB  1 
ATOM   260  C CG  . ARG A 1 38  ? 41.610  -13.351 68.236 1.00 62.62  ? 40  ARG A CG  1 
ATOM   261  C CD  . ARG A 1 38  ? 42.120  -14.663 68.891 1.00 68.65  ? 40  ARG A CD  1 
ATOM   262  N NE  . ARG A 1 38  ? 41.644  -15.871 68.189 1.00 71.85  ? 40  ARG A NE  1 
ATOM   263  C CZ  . ARG A 1 38  ? 42.216  -16.376 67.095 1.00 71.06  ? 40  ARG A CZ  1 
ATOM   264  N NH1 . ARG A 1 38  ? 43.296  -15.791 66.571 1.00 72.81  ? 40  ARG A NH1 1 
ATOM   265  N NH2 . ARG A 1 38  ? 41.697  -17.446 66.511 1.00 70.81  ? 40  ARG A NH2 1 
ATOM   266  N N   . VAL A 1 39  ? 37.948  -11.252 66.209 1.00 55.25  ? 41  VAL A N   1 
ATOM   267  C CA  . VAL A 1 39  ? 36.833  -11.031 65.326 1.00 51.91  ? 41  VAL A CA  1 
ATOM   268  C C   . VAL A 1 39  ? 37.281  -11.301 63.890 1.00 51.15  ? 41  VAL A C   1 
ATOM   269  O O   . VAL A 1 39  ? 38.327  -10.850 63.443 1.00 51.36  ? 41  VAL A O   1 
ATOM   270  C CB  . VAL A 1 39  ? 36.374  -9.572  65.430 1.00 52.26  ? 41  VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 39  ? 35.434  -9.215  64.278 1.00 50.42  ? 41  VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 39  ? 35.705  -9.326  66.784 1.00 51.01  ? 41  VAL A CG2 1 
ATOM   273  N N   . LYS A 1 40  ? 36.463  -12.016 63.151 1.00 49.35  ? 42  LYS A N   1 
ATOM   274  C CA  . LYS A 1 40  ? 36.850  -12.423 61.840 1.00 48.77  ? 42  LYS A CA  1 
ATOM   275  C C   . LYS A 1 40  ? 36.330  -11.449 60.778 1.00 47.65  ? 42  LYS A C   1 
ATOM   276  O O   . LYS A 1 40  ? 36.936  -11.318 59.740 1.00 48.50  ? 42  LYS A O   1 
ATOM   277  C CB  . LYS A 1 40  ? 36.378  -13.869 61.610 1.00 49.27  ? 42  LYS A CB  1 
ATOM   278  C CG  . LYS A 1 40  ? 36.968  -14.580 60.403 1.00 50.51  ? 42  LYS A CG  1 
ATOM   279  C CD  . LYS A 1 40  ? 36.901  -16.095 60.557 1.00 48.68  ? 42  LYS A CD  1 
ATOM   280  C CE  . LYS A 1 40  ? 35.796  -16.657 59.753 1.00 50.05  ? 42  LYS A CE  1 
ATOM   281  N NZ  . LYS A 1 40  ? 36.315  -17.146 58.459 1.00 54.82  ? 42  LYS A NZ  1 
ATOM   282  N N   . ALA A 1 41  ? 35.220  -10.760 61.016 1.00 46.30  ? 43  ALA A N   1 
ATOM   283  C CA  . ALA A 1 41  ? 34.670  -9.807  60.027 1.00 44.26  ? 43  ALA A CA  1 
ATOM   284  C C   . ALA A 1 41  ? 33.428  -9.115  60.553 1.00 43.82  ? 43  ALA A C   1 
ATOM   285  O O   . ALA A 1 41  ? 32.794  -9.591  61.490 1.00 42.18  ? 43  ALA A O   1 
ATOM   286  C CB  . ALA A 1 41  ? 34.367  -10.500 58.708 1.00 43.08  ? 43  ALA A CB  1 
ATOM   287  N N   . VAL A 1 42  ? 33.071  -7.975  59.969 1.00 44.91  ? 44  VAL A N   1 
ATOM   288  C CA  . VAL A 1 42  ? 31.748  -7.404  60.270 1.00 45.24  ? 44  VAL A CA  1 
ATOM   289  C C   . VAL A 1 42  ? 31.184  -7.169  58.931 1.00 44.46  ? 44  VAL A C   1 
ATOM   290  O O   . VAL A 1 42  ? 31.877  -6.631  58.116 1.00 44.82  ? 44  VAL A O   1 
ATOM   291  C CB  . VAL A 1 42  ? 31.870  -6.109  61.069 1.00 46.66  ? 44  VAL A CB  1 
ATOM   292  C CG1 . VAL A 1 42  ? 30.518  -5.428  61.226 1.00 46.68  ? 44  VAL A CG1 1 
ATOM   293  C CG2 . VAL A 1 42  ? 32.438  -6.426  62.458 1.00 47.21  ? 44  VAL A CG2 1 
ATOM   294  N N   . ARG A 1 43  ? 29.979  -7.638  58.641 1.00 44.84  ? 45  ARG A N   1 
ATOM   295  C CA  . ARG A 1 43  ? 29.447  -7.463  57.241 1.00 45.98  ? 45  ARG A CA  1 
ATOM   296  C C   . ARG A 1 43  ? 28.022  -6.982  57.206 1.00 46.55  ? 45  ARG A C   1 
ATOM   297  O O   . ARG A 1 43  ? 27.314  -7.172  58.175 1.00 46.94  ? 45  ARG A O   1 
ATOM   298  C CB  . ARG A 1 43  ? 29.683  -8.660  56.280 1.00 44.33  ? 45  ARG A CB  1 
ATOM   299  C CG  . ARG A 1 43  ? 30.230  -9.885  56.918 1.00 44.87  ? 45  ARG A CG  1 
ATOM   300  C CD  . ARG A 1 43  ? 30.157  -11.133 56.040 1.00 46.26  ? 45  ARG A CD  1 
ATOM   301  N NE  . ARG A 1 43  ? 29.795  -12.224 56.927 1.00 46.64  ? 45  ARG A NE  1 
ATOM   302  C CZ  . ARG A 1 43  ? 28.623  -12.846 56.899 1.00 45.46  ? 45  ARG A CZ  1 
ATOM   303  N NH1 . ARG A 1 43  ? 27.738  -12.538 55.963 1.00 45.20  ? 45  ARG A NH1 1 
ATOM   304  N NH2 . ARG A 1 43  ? 28.353  -13.788 57.796 1.00 41.52  ? 45  ARG A NH2 1 
ATOM   305  N N   . ILE A 1 44  ? 27.619  -6.305  56.132 1.00 47.99  ? 46  ILE A N   1 
ATOM   306  C CA  . ILE A 1 44  ? 26.230  -5.793  56.081 1.00 50.07  ? 46  ILE A CA  1 
ATOM   307  C C   . ILE A 1 44  ? 25.496  -6.286  54.864 1.00 49.85  ? 46  ILE A C   1 
ATOM   308  O O   . ILE A 1 44  ? 26.112  -6.471  53.792 1.00 49.41  ? 46  ILE A O   1 
ATOM   309  C CB  . ILE A 1 44  ? 26.074  -4.214  56.158 1.00 50.71  ? 46  ILE A CB  1 
ATOM   310  C CG1 . ILE A 1 44  ? 26.685  -3.549  54.941 1.00 51.84  ? 46  ILE A CG1 1 
ATOM   311  C CG2 . ILE A 1 44  ? 26.714  -3.635  57.415 1.00 52.25  ? 46  ILE A CG2 1 
ATOM   312  C CD1 . ILE A 1 44  ? 26.503  -2.060  54.956 1.00 56.20  ? 46  ILE A CD1 1 
ATOM   313  N N   . LEU A 1 45  ? 24.192  -6.495  55.062 1.00 50.04  ? 47  LEU A N   1 
ATOM   314  C CA  . LEU A 1 45  ? 23.240  -6.678  53.988 1.00 50.28  ? 47  LEU A CA  1 
ATOM   315  C C   . LEU A 1 45  ? 22.095  -5.652  54.162 1.00 52.25  ? 47  LEU A C   1 
ATOM   316  O O   . LEU A 1 45  ? 21.545  -5.443  55.258 1.00 53.13  ? 47  LEU A O   1 
ATOM   317  C CB  . LEU A 1 45  ? 22.731  -8.094  54.044 1.00 49.42  ? 47  LEU A CB  1 
ATOM   318  C CG  . LEU A 1 45  ? 21.836  -8.563  52.903 1.00 49.34  ? 47  LEU A CG  1 
ATOM   319  C CD1 . LEU A 1 45  ? 22.473  -8.427  51.504 1.00 51.19  ? 47  LEU A CD1 1 
ATOM   320  C CD2 . LEU A 1 45  ? 21.382  -9.980  53.139 1.00 49.12  ? 47  LEU A CD2 1 
ATOM   321  N N   . ALA A 1 46  ? 21.765  -4.950  53.103 1.00 53.37  ? 48  ALA A N   1 
ATOM   322  C CA  . ALA A 1 46  ? 20.635  -4.045  53.178 1.00 55.65  ? 48  ALA A CA  1 
ATOM   323  C C   . ALA A 1 46  ? 19.667  -4.478  52.121 1.00 56.45  ? 48  ALA A C   1 
ATOM   324  O O   . ALA A 1 46  ? 20.073  -4.706  50.994 1.00 55.33  ? 48  ALA A O   1 
ATOM   325  C CB  . ALA A 1 46  ? 21.083  -2.630  52.941 1.00 56.22  ? 48  ALA A CB  1 
ATOM   326  N N   . CYS A 1 47  ? 18.398  -4.623  52.476 1.00 59.51  ? 49  CYS A N   1 
ATOM   327  C CA  . CYS A 1 47  ? 17.390  -5.039  51.492 1.00 63.03  ? 49  CYS A CA  1 
ATOM   328  C C   . CYS A 1 47  ? 16.204  -4.138  51.458 1.00 64.53  ? 49  CYS A C   1 
ATOM   329  O O   . CYS A 1 47  ? 15.880  -3.496  52.459 1.00 67.36  ? 49  CYS A O   1 
ATOM   330  C CB  . CYS A 1 47  ? 16.847  -6.413  51.828 1.00 63.10  ? 49  CYS A CB  1 
ATOM   331  S SG  . CYS A 1 47  ? 18.150  -7.646  51.999 1.00 71.94  ? 49  CYS A SG  1 
ATOM   332  N N   . GLY A 1 48  ? 15.530  -4.125  50.316 1.00 64.91  ? 50  GLY A N   1 
ATOM   333  C CA  . GLY A 1 48  ? 14.181  -3.556  50.200 1.00 65.24  ? 50  GLY A CA  1 
ATOM   334  C C   . GLY A 1 48  ? 13.314  -4.595  49.518 1.00 64.17  ? 50  GLY A C   1 
ATOM   335  O O   . GLY A 1 48  ? 13.670  -5.080  48.473 1.00 63.74  ? 50  GLY A O   1 
ATOM   336  N N   . VAL A 1 49  ? 12.203  -4.999  50.107 1.00 64.70  ? 51  VAL A N   1 
ATOM   337  C CA  . VAL A 1 49  ? 11.359  -5.976  49.412 1.00 63.96  ? 51  VAL A CA  1 
ATOM   338  C C   . VAL A 1 49  ? 9.882   -5.618  49.526 1.00 64.94  ? 51  VAL A C   1 
ATOM   339  O O   . VAL A 1 49  ? 9.306   -5.776  50.610 1.00 66.09  ? 51  VAL A O   1 
ATOM   340  C CB  . VAL A 1 49  ? 11.522  -7.433  49.968 1.00 63.44  ? 51  VAL A CB  1 
ATOM   341  C CG1 . VAL A 1 49  ? 10.475  -8.334  49.357 1.00 61.97  ? 51  VAL A CG1 1 
ATOM   342  C CG2 . VAL A 1 49  ? 12.860  -7.992  49.667 1.00 61.58  ? 51  VAL A CG2 1 
ATOM   343  N N   . ALA A 1 50  ? 9.255   -5.153  48.443 1.00 64.12  ? 52  ALA A N   1 
ATOM   344  C CA  . ALA A 1 50  ? 7.784   -5.132  48.455 1.00 64.83  ? 52  ALA A CA  1 
ATOM   345  C C   . ALA A 1 50  ? 7.168   -6.500  48.116 1.00 64.57  ? 52  ALA A C   1 
ATOM   346  O O   . ALA A 1 50  ? 7.701   -7.313  47.346 1.00 63.83  ? 52  ALA A O   1 
ATOM   347  C CB  . ALA A 1 50  ? 7.223   -4.038  47.620 1.00 64.20  ? 52  ALA A CB  1 
ATOM   348  N N   . LYS A 1 51  ? 6.052   -6.772  48.743 1.00 65.67  ? 53  LYS A N   1 
ATOM   349  C CA  . LYS A 1 51  ? 5.442   -8.061  48.603 1.00 66.47  ? 53  LYS A CA  1 
ATOM   350  C C   . LYS A 1 51  ? 3.937   -7.758  48.401 1.00 67.58  ? 53  LYS A C   1 
ATOM   351  O O   . LYS A 1 51  ? 3.272   -7.127  49.267 1.00 68.72  ? 53  LYS A O   1 
ATOM   352  C CB  . LYS A 1 51  ? 5.779   -8.885  49.853 1.00 67.45  ? 53  LYS A CB  1 
ATOM   353  C CG  . LYS A 1 51  ? 5.012   -10.161 50.047 1.00 71.87  ? 53  LYS A CG  1 
ATOM   354  C CD  . LYS A 1 51  ? 5.653   -11.046 51.146 1.00 79.71  ? 53  LYS A CD  1 
ATOM   355  C CE  . LYS A 1 51  ? 4.582   -11.990 51.837 1.00 85.73  ? 53  LYS A CE  1 
ATOM   356  N NZ  . LYS A 1 51  ? 5.166   -13.166 52.646 1.00 87.35  ? 53  LYS A NZ  1 
ATOM   357  N N   . VAL A 1 52  ? 3.425   -8.127  47.225 1.00 66.02  ? 54  VAL A N   1 
ATOM   358  C CA  . VAL A 1 52  ? 2.037   -7.837  46.893 1.00 66.91  ? 54  VAL A CA  1 
ATOM   359  C C   . VAL A 1 52  ? 1.257   -9.145  46.918 1.00 68.61  ? 54  VAL A C   1 
ATOM   360  O O   . VAL A 1 52  ? 1.682   -10.121 46.296 1.00 67.41  ? 54  VAL A O   1 
ATOM   361  C CB  . VAL A 1 52  ? 1.929   -7.075  45.528 1.00 65.38  ? 54  VAL A CB  1 
ATOM   362  C CG1 . VAL A 1 52  ? 0.478   -6.793  45.156 1.00 63.97  ? 54  VAL A CG1 1 
ATOM   363  C CG2 . VAL A 1 52  ? 2.746   -5.749  45.581 1.00 64.00  ? 54  VAL A CG2 1 
ATOM   364  N N   . LEU A 1 53  ? 0.153   -9.190  47.674 1.00 71.91  ? 55  LEU A N   1 
ATOM   365  C CA  . LEU A 1 53  ? -0.635  -10.454 47.802 1.00 74.71  ? 55  LEU A CA  1 
ATOM   366  C C   . LEU A 1 53  ? -2.153  -10.338 47.969 1.00 76.96  ? 55  LEU A C   1 
ATOM   367  O O   . LEU A 1 53  ? -2.654  -9.399  48.562 1.00 78.24  ? 55  LEU A O   1 
ATOM   368  C CB  . LEU A 1 53  ? -0.044  -11.375 48.880 1.00 76.16  ? 55  LEU A CB  1 
ATOM   369  C CG  . LEU A 1 53  ? -0.263  -11.234 50.393 1.00 78.87  ? 55  LEU A CG  1 
ATOM   370  C CD1 . LEU A 1 53  ? 0.919   -11.972 51.027 1.00 79.93  ? 55  LEU A CD1 1 
ATOM   371  C CD2 . LEU A 1 53  ? -0.336  -9.788  50.901 1.00 78.56  ? 55  LEU A CD2 1 
ATOM   372  N N   . TRP A 1 54  ? -2.890  -11.293 47.431 1.00 78.60  ? 56  TRP A N   1 
ATOM   373  C CA  . TRP A 1 54  ? -4.337  -11.165 47.446 1.00 82.04  ? 56  TRP A CA  1 
ATOM   374  C C   . TRP A 1 54  ? -4.921  -12.544 47.278 1.00 85.37  ? 56  TRP A C   1 
ATOM   375  O O   . TRP A 1 54  ? -4.172  -13.483 47.008 1.00 84.54  ? 56  TRP A O   1 
ATOM   376  C CB  . TRP A 1 54  ? -4.831  -10.188 46.356 1.00 80.07  ? 56  TRP A CB  1 
ATOM   377  C CG  . TRP A 1 54  ? -4.698  -10.705 44.895 1.00 76.64  ? 56  TRP A CG  1 
ATOM   378  C CD1 . TRP A 1 54  ? -5.652  -11.372 44.169 1.00 75.78  ? 56  TRP A CD1 1 
ATOM   379  C CD2 . TRP A 1 54  ? -3.568  -10.566 44.022 1.00 71.84  ? 56  TRP A CD2 1 
ATOM   380  N NE1 . TRP A 1 54  ? -5.190  -11.661 42.911 1.00 72.55  ? 56  TRP A NE1 1 
ATOM   381  C CE2 . TRP A 1 54  ? -3.913  -11.183 42.789 1.00 72.51  ? 56  TRP A CE2 1 
ATOM   382  C CE3 . TRP A 1 54  ? -2.293  -9.993  44.162 1.00 67.41  ? 56  TRP A CE3 1 
ATOM   383  C CZ2 . TRP A 1 54  ? -3.017  -11.246 41.697 1.00 69.77  ? 56  TRP A CZ2 1 
ATOM   384  C CZ3 . TRP A 1 54  ? -1.409  -10.046 43.087 1.00 64.48  ? 56  TRP A CZ3 1 
ATOM   385  C CH2 . TRP A 1 54  ? -1.768  -10.667 41.870 1.00 66.29  ? 56  TRP A CH2 1 
ATOM   386  N N   . MET A 1 55  ? -6.244  -12.646 47.460 1.00 90.40  ? 57  MET A N   1 
ATOM   387  C CA  . MET A 1 55  ? -7.007  -13.904 47.359 1.00 95.32  ? 57  MET A CA  1 
ATOM   388  C C   . MET A 1 55  ? -8.093  -13.771 46.293 1.00 96.62  ? 57  MET A C   1 
ATOM   389  O O   . MET A 1 55  ? -9.079  -13.048 46.483 1.00 98.03  ? 57  MET A O   1 
ATOM   390  C CB  . MET A 1 55  ? -7.653  -14.293 48.715 1.00 99.09  ? 57  MET A CB  1 
ATOM   391  C CG  . MET A 1 55  ? -6.683  -14.451 49.904 1.00 102.42 ? 57  MET A CG  1 
ATOM   392  S SD  . MET A 1 55  ? -5.923  -16.103 50.074 1.00 111.23 ? 57  MET A SD  1 
ATOM   393  C CE  . MET A 1 55  ? -4.191  -15.697 50.487 1.00 105.74 ? 57  MET A CE  1 
ATOM   394  N N   . GLN A 1 56  ? -7.903  -14.454 45.167 1.00 97.49  ? 58  GLN A N   1 
ATOM   395  C CA  . GLN A 1 56  ? -8.866  -14.404 44.044 1.00 99.12  ? 58  GLN A CA  1 
ATOM   396  C C   . GLN A 1 56  ? -9.976  -15.383 44.410 1.00 102.68 ? 58  GLN A C   1 
ATOM   397  O O   . GLN A 1 56  ? -9.662  -16.544 44.765 1.00 104.40 ? 58  GLN A O   1 
ATOM   398  C CB  . GLN A 1 56  ? -8.190  -14.866 42.746 1.00 97.44  ? 58  GLN A CB  1 
ATOM   399  C CG  . GLN A 1 56  ? -8.849  -14.394 41.475 1.00 99.06  ? 58  GLN A CG  1 
ATOM   400  C CD  . GLN A 1 56  ? -8.179  -13.134 40.887 1.00 100.45 ? 58  GLN A CD  1 
ATOM   401  O OE1 . GLN A 1 56  ? -7.113  -13.208 40.246 1.00 98.95  ? 58  GLN A OE1 1 
ATOM   402  N NE2 . GLN A 1 56  ? -8.830  -11.973 41.072 1.00 101.85 ? 58  GLN A NE2 1 
ATOM   403  N N   . GLY A 1 57  ? -11.243 -14.939 44.334 1.00 104.24 ? 59  GLY A N   1 
ATOM   404  C CA  . GLY A 1 57  ? -12.363 -15.695 44.902 1.00 107.61 ? 59  GLY A CA  1 
ATOM   405  C C   . GLY A 1 57  ? -12.048 -16.026 46.371 1.00 109.54 ? 59  GLY A C   1 
ATOM   406  O O   . GLY A 1 57  ? -12.606 -15.413 47.278 1.00 111.88 ? 59  GLY A O   1 
ATOM   407  N N   . SER A 1 58  ? -11.160 -17.002 46.593 1.00 108.59 ? 60  SER A N   1 
ATOM   408  C CA  . SER A 1 58  ? -10.500 -17.231 47.879 1.00 108.88 ? 60  SER A CA  1 
ATOM   409  C C   . SER A 1 58  ? -9.231  -18.066 47.609 1.00 106.80 ? 60  SER A C   1 
ATOM   410  O O   . SER A 1 58  ? -9.119  -19.221 48.061 1.00 108.29 ? 60  SER A O   1 
ATOM   411  C CB  . SER A 1 58  ? -11.450 -17.943 48.856 1.00 113.51 ? 60  SER A CB  1 
ATOM   412  O OG  . SER A 1 58  ? -11.013 -17.878 50.212 1.00 115.12 ? 60  SER A OG  1 
ATOM   413  N N   . GLN A 1 59  ? -8.280  -17.483 46.859 1.00 102.63 ? 61  GLN A N   1 
ATOM   414  C CA  . GLN A 1 59  ? -7.083  -18.213 46.411 1.00 99.73  ? 61  GLN A CA  1 
ATOM   415  C C   . GLN A 1 59  ? -5.753  -17.507 46.750 1.00 96.49  ? 61  GLN A C   1 
ATOM   416  O O   . GLN A 1 59  ? -5.710  -16.286 46.815 1.00 95.38  ? 61  GLN A O   1 
ATOM   417  C CB  . GLN A 1 59  ? -7.199  -18.497 44.920 1.00 98.10  ? 61  GLN A CB  1 
ATOM   418  C CG  . GLN A 1 59  ? -6.819  -19.926 44.580 1.00 100.01 ? 61  GLN A CG  1 
ATOM   419  C CD  . GLN A 1 59  ? -5.527  -20.051 43.746 1.00 98.48  ? 61  GLN A CD  1 
ATOM   420  O OE1 . GLN A 1 59  ? -4.538  -20.678 44.176 1.00 96.66  ? 61  GLN A OE1 1 
ATOM   421  N NE2 . GLN A 1 59  ? -5.549  -19.471 42.534 1.00 95.86  ? 61  GLN A NE2 1 
ATOM   422  N N   . GLN A 1 60  ? -4.677  -18.274 46.957 1.00 94.88  ? 62  GLN A N   1 
ATOM   423  C CA  . GLN A 1 60  ? -3.354  -17.726 47.373 1.00 91.39  ? 62  GLN A CA  1 
ATOM   424  C C   . GLN A 1 60  ? -2.527  -17.138 46.229 1.00 86.74  ? 62  GLN A C   1 
ATOM   425  O O   . GLN A 1 60  ? -1.817  -17.860 45.498 1.00 86.36  ? 62  GLN A O   1 
ATOM   426  C CB  . GLN A 1 60  ? -2.534  -18.781 48.141 1.00 92.48  ? 62  GLN A CB  1 
ATOM   427  C CG  . GLN A 1 60  ? -2.721  -18.697 49.662 1.00 96.03  ? 62  GLN A CG  1 
ATOM   428  C CD  . GLN A 1 60  ? -3.023  -20.058 50.351 1.00 99.71  ? 62  GLN A CD  1 
ATOM   429  O OE1 . GLN A 1 60  ? -3.666  -20.954 49.765 1.00 101.22 ? 62  GLN A OE1 1 
ATOM   430  N NE2 . GLN A 1 60  ? -2.560  -20.201 51.603 1.00 97.25  ? 62  GLN A NE2 1 
ATOM   431  N N   . CYS A 1 61  ? -2.588  -15.823 46.095 1.00 82.64  ? 63  CYS A N   1 
ATOM   432  C CA  . CYS A 1 61  ? -1.964  -15.203 44.959 1.00 78.32  ? 63  CYS A CA  1 
ATOM   433  C C   . CYS A 1 61  ? -0.985  -14.095 45.304 1.00 75.37  ? 63  CYS A C   1 
ATOM   434  O O   . CYS A 1 61  ? -1.388  -13.085 45.872 1.00 75.63  ? 63  CYS A O   1 
ATOM   435  C CB  . CYS A 1 61  ? -3.035  -14.706 44.012 1.00 77.88  ? 63  CYS A CB  1 
ATOM   436  S SG  . CYS A 1 61  ? -2.491  -15.049 42.395 1.00 76.11  ? 63  CYS A SG  1 
ATOM   437  N N   . LYS A 1 62  ? 0.289   -14.277 44.940 1.00 72.38  ? 64  LYS A N   1 
ATOM   438  C CA  . LYS A 1 62  ? 1.349   -13.408 45.436 1.00 70.26  ? 64  LYS A CA  1 
ATOM   439  C C   . LYS A 1 62  ? 2.592   -13.152 44.559 1.00 67.72  ? 64  LYS A C   1 
ATOM   440  O O   . LYS A 1 62  ? 3.159   -14.079 43.989 1.00 67.10  ? 64  LYS A O   1 
ATOM   441  C CB  . LYS A 1 62  ? 1.816   -13.945 46.763 1.00 71.70  ? 64  LYS A CB  1 
ATOM   442  C CG  . LYS A 1 62  ? 2.762   -12.995 47.425 1.00 73.60  ? 64  LYS A CG  1 
ATOM   443  C CD  . LYS A 1 62  ? 3.399   -13.575 48.640 1.00 78.11  ? 64  LYS A CD  1 
ATOM   444  C CE  . LYS A 1 62  ? 4.430   -14.616 48.299 1.00 77.41  ? 64  LYS A CE  1 
ATOM   445  N NZ  . LYS A 1 62  ? 5.402   -14.483 49.404 1.00 80.06  ? 64  LYS A NZ  1 
ATOM   446  N N   . GLN A 1 63  ? 3.012   -11.881 44.473 1.00 66.13  ? 65  GLN A N   1 
ATOM   447  C CA  . GLN A 1 63  ? 4.290   -11.482 43.833 1.00 64.15  ? 65  GLN A CA  1 
ATOM   448  C C   . GLN A 1 63  ? 5.245   -10.719 44.767 1.00 62.87  ? 65  GLN A C   1 
ATOM   449  O O   . GLN A 1 63  ? 4.837   -9.820  45.498 1.00 63.57  ? 65  GLN A O   1 
ATOM   450  C CB  . GLN A 1 63  ? 4.061   -10.671 42.533 1.00 63.75  ? 65  GLN A CB  1 
ATOM   451  C CG  . GLN A 1 63  ? 4.935   -9.336  42.364 1.00 63.41  ? 65  GLN A CG  1 
ATOM   452  C CD  . GLN A 1 63  ? 4.757   -8.634  40.981 1.00 63.19  ? 65  GLN A CD  1 
ATOM   453  O OE1 . GLN A 1 63  ? 3.970   -7.684  40.845 1.00 61.49  ? 65  GLN A OE1 1 
ATOM   454  N NE2 . GLN A 1 63  ? 5.485   -9.116  39.960 1.00 61.18  ? 65  GLN A NE2 1 
ATOM   455  N N   . THR A 1 64  ? 6.530   -11.054 44.679 1.00 61.01  ? 66  THR A N   1 
ATOM   456  C CA  . THR A 1 64  ? 7.589   -10.493 45.537 1.00 58.88  ? 66  THR A CA  1 
ATOM   457  C C   . THR A 1 64  ? 8.555   -9.709  44.657 1.00 56.46  ? 66  THR A C   1 
ATOM   458  O O   . THR A 1 64  ? 8.915   -10.199 43.611 1.00 55.39  ? 66  THR A O   1 
ATOM   459  C CB  . THR A 1 64  ? 8.321   -11.672 46.171 1.00 59.27  ? 66  THR A CB  1 
ATOM   460  O OG1 . THR A 1 64  ? 7.349   -12.517 46.798 1.00 60.66  ? 66  THR A OG1 1 
ATOM   461  C CG2 . THR A 1 64  ? 9.360   -11.227 47.167 1.00 58.51  ? 66  THR A CG2 1 
ATOM   462  N N   . SER A 1 65  ? 8.969   -8.502  45.027 1.00 55.75  ? 67  SER A N   1 
ATOM   463  C CA  . SER A 1 65  ? 9.855   -7.728  44.126 1.00 54.85  ? 67  SER A CA  1 
ATOM   464  C C   . SER A 1 65  ? 10.885  -6.938  44.923 1.00 55.96  ? 67  SER A C   1 
ATOM   465  O O   . SER A 1 65  ? 10.508  -6.143  45.802 1.00 57.89  ? 67  SER A O   1 
ATOM   466  C CB  . SER A 1 65  ? 9.085   -6.747  43.228 1.00 54.29  ? 67  SER A CB  1 
ATOM   467  O OG  . SER A 1 65  ? 7.832   -7.234  42.768 1.00 52.75  ? 67  SER A OG  1 
ATOM   468  N N   . GLU A 1 66  ? 12.170  -7.117  44.621 1.00 55.23  ? 68  GLU A N   1 
ATOM   469  C CA  . GLU A 1 66  ? 13.211  -6.402  45.362 1.00 55.56  ? 68  GLU A CA  1 
ATOM   470  C C   . GLU A 1 66  ? 13.554  -5.080  44.732 1.00 55.08  ? 68  GLU A C   1 
ATOM   471  O O   . GLU A 1 66  ? 13.207  -4.844  43.586 1.00 54.86  ? 68  GLU A O   1 
ATOM   472  C CB  . GLU A 1 66  ? 14.472  -7.248  45.516 1.00 56.11  ? 68  GLU A CB  1 
ATOM   473  C CG  . GLU A 1 66  ? 14.201  -8.729  45.965 1.00 57.81  ? 68  GLU A CG  1 
ATOM   474  C CD  . GLU A 1 66  ? 15.459  -9.561  45.985 1.00 59.30  ? 68  GLU A CD  1 
ATOM   475  O OE1 . GLU A 1 66  ? 16.486  -9.144  45.379 1.00 57.91  ? 68  GLU A OE1 1 
ATOM   476  O OE2 . GLU A 1 66  ? 15.416  -10.620 46.632 1.00 62.79  ? 68  GLU A OE2 1 
ATOM   477  N N   . TYR A 1 67  ? 14.232  -4.221  45.498 1.00 55.22  ? 69  TYR A N   1 
ATOM   478  C CA  . TYR A 1 67  ? 14.577  -2.865  45.084 1.00 55.18  ? 69  TYR A CA  1 
ATOM   479  C C   . TYR A 1 67  ? 15.912  -2.476  45.654 1.00 55.65  ? 69  TYR A C   1 
ATOM   480  O O   . TYR A 1 67  ? 16.505  -1.434  45.259 1.00 55.46  ? 69  TYR A O   1 
ATOM   481  C CB  . TYR A 1 67  ? 13.530  -1.893  45.558 1.00 55.48  ? 69  TYR A CB  1 
ATOM   482  C CG  . TYR A 1 67  ? 12.247  -2.068  44.820 1.00 56.03  ? 69  TYR A CG  1 
ATOM   483  C CD1 . TYR A 1 67  ? 11.353  -3.107  45.147 1.00 54.37  ? 69  TYR A CD1 1 
ATOM   484  C CD2 . TYR A 1 67  ? 11.922  -1.218  43.772 1.00 55.45  ? 69  TYR A CD2 1 
ATOM   485  C CE1 . TYR A 1 67  ? 10.168  -3.283  44.444 1.00 53.48  ? 69  TYR A CE1 1 
ATOM   486  C CE2 . TYR A 1 67  ? 10.743  -1.378  43.077 1.00 55.03  ? 69  TYR A CE2 1 
ATOM   487  C CZ  . TYR A 1 67  ? 9.876   -2.401  43.413 1.00 54.79  ? 69  TYR A CZ  1 
ATOM   488  O OH  . TYR A 1 67  ? 8.708   -2.515  42.698 1.00 56.21  ? 69  TYR A OH  1 
ATOM   489  N N   . LEU A 1 68  ? 16.378  -3.313  46.588 1.00 55.01  ? 70  LEU A N   1 
ATOM   490  C CA  . LEU A 1 68  ? 17.714  -3.162  47.146 1.00 55.19  ? 70  LEU A CA  1 
ATOM   491  C C   . LEU A 1 68  ? 18.317  -4.506  47.481 1.00 55.98  ? 70  LEU A C   1 
ATOM   492  O O   . LEU A 1 68  ? 17.652  -5.346  48.083 1.00 57.31  ? 70  LEU A O   1 
ATOM   493  C CB  . LEU A 1 68  ? 17.625  -2.336  48.413 1.00 55.35  ? 70  LEU A CB  1 
ATOM   494  C CG  . LEU A 1 68  ? 18.907  -1.615  48.840 1.00 52.05  ? 70  LEU A CG  1 
ATOM   495  C CD1 . LEU A 1 68  ? 19.474  -0.730  47.754 1.00 53.14  ? 70  LEU A CD1 1 
ATOM   496  C CD2 . LEU A 1 68  ? 18.556  -0.775  50.020 1.00 51.38  ? 70  LEU A CD2 1 
ATOM   497  N N   . ARG A 1 69  ? 19.557  -4.730  47.063 1.00 56.81  ? 71  ARG A N   1 
ATOM   498  C CA  . ARG A 1 69  ? 20.377  -5.887  47.521 1.00 57.47  ? 71  ARG A CA  1 
ATOM   499  C C   . ARG A 1 69  ? 21.728  -5.269  47.605 1.00 57.04  ? 71  ARG A C   1 
ATOM   500  O O   . ARG A 1 69  ? 22.297  -4.891  46.591 1.00 57.98  ? 71  ARG A O   1 
ATOM   501  C CB  . ARG A 1 69  ? 20.459  -7.046  46.534 1.00 57.23  ? 71  ARG A CB  1 
ATOM   502  C CG  . ARG A 1 69  ? 19.597  -8.265  46.898 1.00 62.74  ? 71  ARG A CG  1 
ATOM   503  C CD  . ARG A 1 69  ? 19.813  -9.414  45.858 1.00 69.56  ? 71  ARG A CD  1 
ATOM   504  N NE  . ARG A 1 69  ? 18.763  -10.447 45.874 1.00 73.77  ? 71  ARG A NE  1 
ATOM   505  C CZ  . ARG A 1 69  ? 18.681  -11.475 45.021 1.00 75.36  ? 71  ARG A CZ  1 
ATOM   506  N NH1 . ARG A 1 69  ? 19.568  -11.642 44.054 1.00 76.50  ? 71  ARG A NH1 1 
ATOM   507  N NH2 . ARG A 1 69  ? 17.696  -12.353 45.141 1.00 77.82  ? 71  ARG A NH2 1 
ATOM   508  N N   . TYR A 1 70  ? 22.216  -5.077  48.815 1.00 56.31  ? 72  TYR A N   1 
ATOM   509  C CA  . TYR A 1 70  ? 23.461  -4.386  48.967 1.00 55.39  ? 72  TYR A CA  1 
ATOM   510  C C   . TYR A 1 70  ? 24.226  -5.097  50.065 1.00 54.83  ? 72  TYR A C   1 
ATOM   511  O O   . TYR A 1 70  ? 23.692  -5.419  51.126 1.00 53.49  ? 72  TYR A O   1 
ATOM   512  C CB  . TYR A 1 70  ? 23.223  -2.882  49.213 1.00 56.30  ? 72  TYR A CB  1 
ATOM   513  C CG  . TYR A 1 70  ? 24.483  -2.157  49.535 1.00 56.98  ? 72  TYR A CG  1 
ATOM   514  C CD1 . TYR A 1 70  ? 25.195  -1.471  48.538 1.00 58.01  ? 72  TYR A CD1 1 
ATOM   515  C CD2 . TYR A 1 70  ? 25.009  -2.211  50.825 1.00 54.97  ? 72  TYR A CD2 1 
ATOM   516  C CE1 . TYR A 1 70  ? 26.386  -0.836  48.835 1.00 59.55  ? 72  TYR A CE1 1 
ATOM   517  C CE2 . TYR A 1 70  ? 26.190  -1.606  51.128 1.00 57.66  ? 72  TYR A CE2 1 
ATOM   518  C CZ  . TYR A 1 70  ? 26.866  -0.915  50.148 1.00 59.81  ? 72  TYR A CZ  1 
ATOM   519  O OH  . TYR A 1 70  ? 28.025  -0.320  50.501 1.00 62.01  ? 72  TYR A OH  1 
ATOM   520  N N   . GLU A 1 71  ? 25.476  -5.408  49.772 1.00 55.66  ? 73  GLU A N   1 
ATOM   521  C CA  . GLU A 1 71  ? 26.294  -6.124  50.735 1.00 56.46  ? 73  GLU A CA  1 
ATOM   522  C C   . GLU A 1 71  ? 27.686  -5.643  50.641 1.00 56.93  ? 73  GLU A C   1 
ATOM   523  O O   . GLU A 1 71  ? 28.156  -5.308  49.554 1.00 57.91  ? 73  GLU A O   1 
ATOM   524  C CB  . GLU A 1 71  ? 26.202  -7.649  50.610 1.00 55.98  ? 73  GLU A CB  1 
ATOM   525  C CG  . GLU A 1 71  ? 26.047  -8.149  49.212 1.00 58.58  ? 73  GLU A CG  1 
ATOM   526  C CD  . GLU A 1 71  ? 25.656  -9.609  49.166 1.00 61.51  ? 73  GLU A CD  1 
ATOM   527  O OE1 . GLU A 1 71  ? 25.712  -10.295 50.206 1.00 62.85  ? 73  GLU A OE1 1 
ATOM   528  O OE2 . GLU A 1 71  ? 25.286  -10.088 48.081 1.00 62.93  ? 73  GLU A OE2 1 
ATOM   529  N N   . ASP A 1 72  ? 28.307  -5.553  51.814 1.00 57.27  ? 74  ASP A N   1 
ATOM   530  C CA  . ASP A 1 72  ? 29.634  -4.993  51.979 1.00 57.90  ? 74  ASP A CA  1 
ATOM   531  C C   . ASP A 1 72  ? 30.242  -5.547  53.254 1.00 56.56  ? 74  ASP A C   1 
ATOM   532  O O   . ASP A 1 72  ? 29.556  -5.909  54.220 1.00 55.36  ? 74  ASP A O   1 
ATOM   533  C CB  . ASP A 1 72  ? 29.548  -3.455  52.047 1.00 60.33  ? 74  ASP A CB  1 
ATOM   534  C CG  . ASP A 1 72  ? 30.885  -2.723  51.651 1.00 65.87  ? 74  ASP A CG  1 
ATOM   535  O OD1 . ASP A 1 72  ? 31.576  -3.140  50.673 1.00 71.03  ? 74  ASP A OD1 1 
ATOM   536  O OD2 . ASP A 1 72  ? 31.218  -1.685  52.306 1.00 70.70  ? 74  ASP A OD2 1 
ATOM   537  N N   . THR A 1 73  ? 31.551  -5.627  53.233 1.00 56.15  ? 75  THR A N   1 
ATOM   538  C CA  . THR A 1 73  ? 32.280  -6.009  54.380 1.00 55.42  ? 75  THR A CA  1 
ATOM   539  C C   . THR A 1 73  ? 32.907  -4.710  54.829 1.00 56.58  ? 75  THR A C   1 
ATOM   540  O O   . THR A 1 73  ? 33.461  -4.006  53.989 1.00 57.05  ? 75  THR A O   1 
ATOM   541  C CB  . THR A 1 73  ? 33.285  -7.051  53.985 1.00 55.12  ? 75  THR A CB  1 
ATOM   542  O OG1 . THR A 1 73  ? 32.551  -8.140  53.444 1.00 53.34  ? 75  THR A OG1 1 
ATOM   543  C CG2 . THR A 1 73  ? 34.021  -7.559  55.175 1.00 54.46  ? 75  THR A CG2 1 
ATOM   544  N N   . LEU A 1 74  ? 32.781  -4.412  56.130 1.00 55.55  ? 76  LEU A N   1 
ATOM   545  C CA  . LEU A 1 74  ? 33.199  -3.158  56.717 1.00 57.22  ? 76  LEU A CA  1 
ATOM   546  C C   . LEU A 1 74  ? 34.541  -3.241  57.452 1.00 59.43  ? 76  LEU A C   1 
ATOM   547  O O   . LEU A 1 74  ? 34.969  -4.330  57.840 1.00 58.62  ? 76  LEU A O   1 
ATOM   548  C CB  . LEU A 1 74  ? 32.125  -2.637  57.667 1.00 55.93  ? 76  LEU A CB  1 
ATOM   549  C CG  . LEU A 1 74  ? 30.732  -2.549  57.058 1.00 55.18  ? 76  LEU A CG  1 
ATOM   550  C CD1 . LEU A 1 74  ? 29.784  -1.861  58.021 1.00 54.04  ? 76  LEU A CD1 1 
ATOM   551  C CD2 . LEU A 1 74  ? 30.720  -1.890  55.655 1.00 50.41  ? 76  LEU A CD2 1 
ATOM   552  N N   . LEU A 1 75  ? 35.178  -2.081  57.690 1.00 62.35  ? 77  LEU A N   1 
ATOM   553  C CA  . LEU A 1 75  ? 36.596  -2.034  58.079 1.00 64.44  ? 77  LEU A CA  1 
ATOM   554  C C   . LEU A 1 75  ? 36.882  -0.940  59.042 1.00 66.76  ? 77  LEU A C   1 
ATOM   555  O O   . LEU A 1 75  ? 36.603  0.211   58.763 1.00 68.25  ? 77  LEU A O   1 
ATOM   556  C CB  . LEU A 1 75  ? 37.440  -1.723  56.858 1.00 64.92  ? 77  LEU A CB  1 
ATOM   557  C CG  . LEU A 1 75  ? 37.241  -2.625  55.651 1.00 64.32  ? 77  LEU A CG  1 
ATOM   558  C CD1 . LEU A 1 75  ? 38.070  -2.029  54.525 1.00 64.98  ? 77  LEU A CD1 1 
ATOM   559  C CD2 . LEU A 1 75  ? 37.644  -4.111  55.958 1.00 61.83  ? 77  LEU A CD2 1 
ATOM   560  N N   . LEU A 1 76  ? 37.501  -1.272  60.166 1.00 68.77  ? 78  LEU A N   1 
ATOM   561  C CA  . LEU A 1 76  ? 37.856  -0.245  61.142 1.00 71.23  ? 78  LEU A CA  1 
ATOM   562  C C   . LEU A 1 76  ? 38.901  0.629   60.501 1.00 74.93  ? 78  LEU A C   1 
ATOM   563  O O   . LEU A 1 76  ? 39.802  0.120   59.792 1.00 74.86  ? 78  LEU A O   1 
ATOM   564  C CB  . LEU A 1 76  ? 38.473  -0.853  62.376 1.00 70.10  ? 78  LEU A CB  1 
ATOM   565  C CG  . LEU A 1 76  ? 37.776  -1.883  63.212 1.00 68.01  ? 78  LEU A CG  1 
ATOM   566  C CD1 . LEU A 1 76  ? 38.806  -2.310  64.159 1.00 68.60  ? 78  LEU A CD1 1 
ATOM   567  C CD2 . LEU A 1 76  ? 36.592  -1.295  63.962 1.00 71.09  ? 78  LEU A CD2 1 
ATOM   568  N N   . GLU A 1 77  ? 38.802  1.934   60.758 1.00 78.94  ? 79  GLU A N   1 
ATOM   569  C CA  . GLU A 1 77  ? 39.795  2.901   60.271 1.00 82.81  ? 79  GLU A CA  1 
ATOM   570  C C   . GLU A 1 77  ? 41.228  2.626   60.789 1.00 83.91  ? 79  GLU A C   1 
ATOM   571  O O   . GLU A 1 77  ? 42.170  2.525   59.988 1.00 84.88  ? 79  GLU A O   1 
ATOM   572  C CB  . GLU A 1 77  ? 39.306  4.308   60.568 1.00 85.41  ? 79  GLU A CB  1 
ATOM   573  C CG  . GLU A 1 77  ? 37.951  4.605   59.868 1.00 88.36  ? 79  GLU A CG  1 
ATOM   574  C CD  . GLU A 1 77  ? 37.333  5.961   60.273 1.00 95.37  ? 79  GLU A CD  1 
ATOM   575  O OE1 . GLU A 1 77  ? 36.260  5.951   60.943 1.00 96.30  ? 79  GLU A OE1 1 
ATOM   576  O OE2 . GLU A 1 77  ? 37.921  7.028   59.930 1.00 97.11  ? 79  GLU A OE2 1 
ATOM   577  N N   . ASP A 1 78  ? 41.395  2.425   62.096 1.00 84.13  ? 80  ASP A N   1 
ATOM   578  C CA  . ASP A 1 78  ? 42.735  2.080   62.623 1.00 85.91  ? 80  ASP A CA  1 
ATOM   579  C C   . ASP A 1 78  ? 43.206  0.623   62.402 1.00 84.41  ? 80  ASP A C   1 
ATOM   580  O O   . ASP A 1 78  ? 44.053  0.107   63.144 1.00 84.73  ? 80  ASP A O   1 
ATOM   581  C CB  . ASP A 1 78  ? 42.837  2.393   64.120 1.00 86.60  ? 80  ASP A CB  1 
ATOM   582  C CG  . ASP A 1 78  ? 44.230  2.070   64.689 1.00 88.83  ? 80  ASP A CG  1 
ATOM   583  O OD1 . ASP A 1 78  ? 45.187  2.832   64.377 1.00 91.09  ? 80  ASP A OD1 1 
ATOM   584  O OD2 . ASP A 1 78  ? 44.367  1.051   65.430 1.00 87.12  ? 80  ASP A OD2 1 
ATOM   585  N N   . GLN A 1 79  ? 42.670  -0.057  61.404 1.00 83.00  ? 81  GLN A N   1 
ATOM   586  C CA  . GLN A 1 79  ? 43.006  -1.468  61.222 1.00 81.80  ? 81  GLN A CA  1 
ATOM   587  C C   . GLN A 1 79  ? 43.311  -1.778  59.742 1.00 81.84  ? 81  GLN A C   1 
ATOM   588  O O   . GLN A 1 79  ? 42.768  -2.748  59.164 1.00 80.30  ? 81  GLN A O   1 
ATOM   589  C CB  . GLN A 1 79  ? 41.884  -2.346  61.780 1.00 80.06  ? 81  GLN A CB  1 
ATOM   590  C CG  . GLN A 1 79  ? 41.920  -3.814  61.351 1.00 81.08  ? 81  GLN A CG  1 
ATOM   591  C CD  . GLN A 1 79  ? 43.003  -4.660  62.065 1.00 86.89  ? 81  GLN A CD  1 
ATOM   592  O OE1 . GLN A 1 79  ? 42.953  -5.906  61.999 1.00 87.47  ? 81  GLN A OE1 1 
ATOM   593  N NE2 . GLN A 1 79  ? 43.974  -3.997  62.760 1.00 88.33  ? 81  GLN A NE2 1 
ATOM   594  N N   . PRO A 1 80  ? 44.219  -0.978  59.131 1.00 82.99  ? 82  PRO A N   1 
ATOM   595  C CA  . PRO A 1 80  ? 44.266  -0.928  57.689 1.00 82.92  ? 82  PRO A CA  1 
ATOM   596  C C   . PRO A 1 80  ? 44.651  -2.266  57.005 1.00 81.27  ? 82  PRO A C   1 
ATOM   597  O O   . PRO A 1 80  ? 44.469  -2.389  55.792 1.00 82.07  ? 82  PRO A O   1 
ATOM   598  C CB  . PRO A 1 80  ? 45.318  0.151   57.431 1.00 85.57  ? 82  PRO A CB  1 
ATOM   599  C CG  . PRO A 1 80  ? 46.231  0.000   58.586 1.00 86.28  ? 82  PRO A CG  1 
ATOM   600  C CD  . PRO A 1 80  ? 45.284  -0.151  59.723 1.00 84.98  ? 82  PRO A CD  1 
ATOM   601  N N   . THR A 1 81  ? 45.130  -3.260  57.751 1.00 78.95  ? 83  THR A N   1 
ATOM   602  C CA  . THR A 1 81  ? 45.745  -4.452  57.118 1.00 77.58  ? 83  THR A CA  1 
ATOM   603  C C   . THR A 1 81  ? 44.900  -5.301  56.093 1.00 75.27  ? 83  THR A C   1 
ATOM   604  O O   . THR A 1 81  ? 45.404  -5.615  55.013 1.00 76.95  ? 83  THR A O   1 
ATOM   605  C CB  . THR A 1 81  ? 46.532  -5.286  58.133 1.00 77.01  ? 83  THR A CB  1 
ATOM   606  O OG1 . THR A 1 81  ? 45.723  -5.484  59.298 1.00 76.27  ? 83  THR A OG1 1 
ATOM   607  C CG2 . THR A 1 81  ? 47.772  -4.521  58.552 1.00 78.75  ? 83  THR A CG2 1 
ATOM   608  N N   . GLY A 1 82  ? 43.647  -5.651  56.376 1.00 71.54  ? 84  GLY A N   1 
ATOM   609  C CA  . GLY A 1 82  ? 42.883  -6.444  55.410 1.00 67.88  ? 84  GLY A CA  1 
ATOM   610  C C   . GLY A 1 82  ? 42.117  -7.618  55.960 1.00 64.44  ? 84  GLY A C   1 
ATOM   611  O O   . GLY A 1 82  ? 42.301  -8.012  57.089 1.00 64.72  ? 84  GLY A O   1 
ATOM   612  N N   . GLU A 1 83  ? 41.242  -8.188  55.151 1.00 62.15  ? 85  GLU A N   1 
ATOM   613  C CA  . GLU A 1 83  ? 40.313  -9.198  55.615 1.00 58.70  ? 85  GLU A CA  1 
ATOM   614  C C   . GLU A 1 83  ? 40.944  -10.573 55.772 1.00 57.46  ? 85  GLU A C   1 
ATOM   615  O O   . GLU A 1 83  ? 40.242  -11.560 55.935 1.00 56.78  ? 85  GLU A O   1 
ATOM   616  C CB  . GLU A 1 83  ? 39.197  -9.331  54.618 1.00 57.87  ? 85  GLU A CB  1 
ATOM   617  C CG  . GLU A 1 83  ? 38.498  -8.047  54.265 1.00 60.24  ? 85  GLU A CG  1 
ATOM   618  C CD  . GLU A 1 83  ? 37.654  -8.217  52.998 1.00 60.09  ? 85  GLU A CD  1 
ATOM   619  O OE1 . GLU A 1 83  ? 37.099  -9.323  52.826 1.00 59.72  ? 85  GLU A OE1 1 
ATOM   620  O OE2 . GLU A 1 83  ? 37.560  -7.269  52.184 1.00 59.52  ? 85  GLU A OE2 1 
ATOM   621  N N   . ASN A 1 84  ? 42.256  -10.668 55.684 1.00 56.70  ? 86  ASN A N   1 
ATOM   622  C CA  . ASN A 1 84  ? 42.879  -11.943 55.928 1.00 54.91  ? 86  ASN A CA  1 
ATOM   623  C C   . ASN A 1 84  ? 43.763  -11.848 57.154 1.00 55.36  ? 86  ASN A C   1 
ATOM   624  O O   . ASN A 1 84  ? 44.703  -12.616 57.303 1.00 55.06  ? 86  ASN A O   1 
ATOM   625  C CB  . ASN A 1 84  ? 43.666  -12.401 54.706 1.00 55.64  ? 86  ASN A CB  1 
ATOM   626  C CG  . ASN A 1 84  ? 44.744  -11.403 54.290 1.00 54.36  ? 86  ASN A CG  1 
ATOM   627  O OD1 . ASN A 1 84  ? 44.645  -10.184 54.528 1.00 51.05  ? 86  ASN A OD1 1 
ATOM   628  N ND2 . ASN A 1 84  ? 45.774  -11.913 53.656 1.00 50.46  ? 86  ASN A ND2 1 
ATOM   629  N N   . GLU A 1 85  ? 43.432  -10.879 58.006 1.00 55.00  ? 87  GLU A N   1 
ATOM   630  C CA  . GLU A 1 85  ? 44.030  -10.684 59.305 1.00 56.74  ? 87  GLU A CA  1 
ATOM   631  C C   . GLU A 1 85  ? 42.909  -10.330 60.272 1.00 55.88  ? 87  GLU A C   1 
ATOM   632  O O   . GLU A 1 85  ? 42.234  -9.308  60.102 1.00 55.92  ? 87  GLU A O   1 
ATOM   633  C CB  . GLU A 1 85  ? 44.940  -9.490  59.268 1.00 58.79  ? 87  GLU A CB  1 
ATOM   634  C CG  . GLU A 1 85  ? 45.639  -9.230  60.584 1.00 64.10  ? 87  GLU A CG  1 
ATOM   635  C CD  . GLU A 1 85  ? 47.139  -9.532  60.482 1.00 74.74  ? 87  GLU A CD  1 
ATOM   636  O OE1 . GLU A 1 85  ? 47.530  -10.687 60.045 1.00 75.39  ? 87  GLU A OE1 1 
ATOM   637  O OE2 . GLU A 1 85  ? 47.908  -8.575  60.812 1.00 75.84  ? 87  GLU A OE2 1 
ATOM   638  N N   . MET A 1 86  ? 42.692  -11.157 61.288 1.00 55.27  ? 88  MET A N   1 
ATOM   639  C CA  . MET A 1 86  ? 41.621  -10.880 62.225 1.00 54.27  ? 88  MET A CA  1 
ATOM   640  C C   . MET A 1 86  ? 41.997  -9.755  63.175 1.00 54.56  ? 88  MET A C   1 
ATOM   641  O O   . MET A 1 86  ? 43.175  -9.463  63.422 1.00 55.80  ? 88  MET A O   1 
ATOM   642  C CB  . MET A 1 86  ? 41.287  -12.132 63.024 1.00 53.53  ? 88  MET A CB  1 
ATOM   643  C CG  . MET A 1 86  ? 40.293  -13.008 62.322 1.00 53.91  ? 88  MET A CG  1 
ATOM   644  S SD  . MET A 1 86  ? 40.286  -14.627 63.044 1.00 51.37  ? 88  MET A SD  1 
ATOM   645  C CE  . MET A 1 86  ? 41.932  -15.100 62.737 1.00 49.65  ? 88  MET A CE  1 
ATOM   646  N N   . VAL A 1 87  ? 40.976  -9.174  63.753 1.00 53.89  ? 89  VAL A N   1 
ATOM   647  C CA  . VAL A 1 87  ? 41.116  -8.041  64.631 1.00 54.43  ? 89  VAL A CA  1 
ATOM   648  C C   . VAL A 1 87  ? 40.980  -8.437  66.086 1.00 55.16  ? 89  VAL A C   1 
ATOM   649  O O   . VAL A 1 87  ? 40.187  -9.335  66.430 1.00 54.12  ? 89  VAL A O   1 
ATOM   650  C CB  . VAL A 1 87  ? 40.040  -7.057  64.299 1.00 53.55  ? 89  VAL A CB  1 
ATOM   651  C CG1 . VAL A 1 87  ? 39.984  -5.923  65.299 1.00 52.45  ? 89  VAL A CG1 1 
ATOM   652  C CG2 . VAL A 1 87  ? 40.291  -6.568  62.891 1.00 54.18  ? 89  VAL A CG2 1 
ATOM   653  N N   . ILE A 1 88  ? 41.768  -7.797  66.948 1.00 56.49  ? 90  ILE A N   1 
ATOM   654  C CA  . ILE A 1 88  ? 41.619  -8.108  68.360 1.00 57.61  ? 90  ILE A CA  1 
ATOM   655  C C   . ILE A 1 88  ? 40.802  -7.035  69.015 1.00 57.83  ? 90  ILE A C   1 
ATOM   656  O O   . ILE A 1 88  ? 41.188  -5.889  69.002 1.00 58.58  ? 90  ILE A O   1 
ATOM   657  C CB  . ILE A 1 88  ? 42.987  -8.397  69.062 1.00 58.41  ? 90  ILE A CB  1 
ATOM   658  C CG1 . ILE A 1 88  ? 43.780  -9.356  68.188 1.00 57.59  ? 90  ILE A CG1 1 
ATOM   659  C CG2 . ILE A 1 88  ? 42.777  -8.968  70.480 1.00 57.37  ? 90  ILE A CG2 1 
ATOM   660  C CD1 . ILE A 1 88  ? 44.769  -10.170 68.921 1.00 57.18  ? 90  ILE A CD1 1 
ATOM   661  N N   . MET A 1 89  ? 39.644  -7.405  69.539 1.00 58.37  ? 91  MET A N   1 
ATOM   662  C CA  . MET A 1 89  ? 38.795  -6.417  70.184 1.00 60.91  ? 91  MET A CA  1 
ATOM   663  C C   . MET A 1 89  ? 38.993  -6.495  71.668 1.00 62.68  ? 91  MET A C   1 
ATOM   664  O O   . MET A 1 89  ? 39.302  -7.560  72.203 1.00 62.28  ? 91  MET A O   1 
ATOM   665  C CB  . MET A 1 89  ? 37.323  -6.599  69.800 1.00 59.70  ? 91  MET A CB  1 
ATOM   666  C CG  . MET A 1 89  ? 36.983  -6.059  68.394 1.00 59.92  ? 91  MET A CG  1 
ATOM   667  S SD  . MET A 1 89  ? 35.183  -5.985  68.057 1.00 61.06  ? 91  MET A SD  1 
ATOM   668  C CE  . MET A 1 89  ? 35.125  -5.358  66.392 1.00 58.22  ? 91  MET A CE  1 
ATOM   669  N N   . ARG A 1 90  ? 38.801  -5.382  72.346 1.00 66.03  ? 92  ARG A N   1 
ATOM   670  C CA  . ARG A 1 90  ? 38.933  -5.375  73.819 1.00 69.27  ? 92  ARG A CA  1 
ATOM   671  C C   . ARG A 1 90  ? 37.861  -4.646  74.628 1.00 71.44  ? 92  ARG A C   1 
ATOM   672  O O   . ARG A 1 90  ? 37.326  -3.578  74.209 1.00 72.59  ? 92  ARG A O   1 
ATOM   673  C CB  . ARG A 1 90  ? 40.288  -4.812  74.238 1.00 70.09  ? 92  ARG A CB  1 
ATOM   674  C CG  . ARG A 1 90  ? 41.329  -5.845  74.376 1.00 70.90  ? 92  ARG A CG  1 
ATOM   675  C CD  . ARG A 1 90  ? 42.604  -5.258  73.912 1.00 75.96  ? 92  ARG A CD  1 
ATOM   676  N NE  . ARG A 1 90  ? 43.425  -6.275  73.268 1.00 78.49  ? 92  ARG A NE  1 
ATOM   677  C CZ  . ARG A 1 90  ? 44.655  -6.034  72.846 1.00 79.83  ? 92  ARG A CZ  1 
ATOM   678  N NH1 . ARG A 1 90  ? 45.137  -4.808  73.019 1.00 81.90  ? 92  ARG A NH1 1 
ATOM   679  N NH2 . ARG A 1 90  ? 45.390  -6.992  72.270 1.00 77.79  ? 92  ARG A NH2 1 
ATOM   680  N N   . PRO A 1 91  ? 37.586  -5.178  75.833 1.00 72.75  ? 93  PRO A N   1 
ATOM   681  C CA  . PRO A 1 91  ? 36.682  -4.464  76.747 1.00 74.92  ? 93  PRO A CA  1 
ATOM   682  C C   . PRO A 1 91  ? 37.063  -2.990  76.742 1.00 77.34  ? 93  PRO A C   1 
ATOM   683  O O   . PRO A 1 91  ? 38.227  -2.684  76.544 1.00 77.83  ? 93  PRO A O   1 
ATOM   684  C CB  . PRO A 1 91  ? 37.024  -5.065  78.110 1.00 75.55  ? 93  PRO A CB  1 
ATOM   685  C CG  . PRO A 1 91  ? 38.120  -6.142  77.849 1.00 72.90  ? 93  PRO A CG  1 
ATOM   686  C CD  . PRO A 1 91  ? 38.097  -6.439  76.411 1.00 71.36  ? 93  PRO A CD  1 
ATOM   687  N N   . GLY A 1 92  ? 36.113  -2.081  76.927 1.00 79.78  ? 94  GLY A N   1 
ATOM   688  C CA  . GLY A 1 92  ? 36.467  -0.687  77.183 1.00 82.51  ? 94  GLY A CA  1 
ATOM   689  C C   . GLY A 1 92  ? 36.203  0.193   75.992 1.00 83.76  ? 94  GLY A C   1 
ATOM   690  O O   . GLY A 1 92  ? 35.192  0.915   75.955 1.00 85.35  ? 94  GLY A O   1 
ATOM   691  N N   . ASN A 1 93  ? 37.099  0.146   75.009 1.00 82.74  ? 95  ASN A N   1 
ATOM   692  C CA  . ASN A 1 93  ? 36.829  0.842   73.768 1.00 82.80  ? 95  ASN A CA  1 
ATOM   693  C C   . ASN A 1 93  ? 35.629  0.237   73.060 1.00 80.84  ? 95  ASN A C   1 
ATOM   694  O O   . ASN A 1 93  ? 35.146  -0.838  73.435 1.00 79.87  ? 95  ASN A O   1 
ATOM   695  C CB  . ASN A 1 93  ? 38.064  0.914   72.875 1.00 83.12  ? 95  ASN A CB  1 
ATOM   696  C CG  . ASN A 1 93  ? 39.092  -0.171  73.206 1.00 83.64  ? 95  ASN A CG  1 
ATOM   697  O OD1 . ASN A 1 93  ? 38.755  -1.341  73.447 1.00 82.47  ? 95  ASN A OD1 1 
ATOM   698  N ND2 . ASN A 1 93  ? 40.359  0.223   73.210 1.00 87.69  ? 95  ASN A ND2 1 
ATOM   699  N N   . LYS A 1 94  ? 35.182  0.943   72.023 1.00 80.43  ? 96  LYS A N   1 
ATOM   700  C CA  . LYS A 1 94  ? 33.848  0.848   71.436 1.00 78.36  ? 96  LYS A CA  1 
ATOM   701  C C   . LYS A 1 94  ? 34.169  0.932   69.965 1.00 75.90  ? 96  LYS A C   1 
ATOM   702  O O   . LYS A 1 94  ? 34.589  1.981   69.490 1.00 76.18  ? 96  LYS A O   1 
ATOM   703  C CB  . LYS A 1 94  ? 33.048  2.094   71.898 1.00 81.74  ? 96  LYS A CB  1 
ATOM   704  C CG  . LYS A 1 94  ? 31.491  2.155   71.704 1.00 82.79  ? 96  LYS A CG  1 
ATOM   705  C CD  . LYS A 1 94  ? 30.854  3.383   72.454 1.00 87.44  ? 96  LYS A CD  1 
ATOM   706  C CE  . LYS A 1 94  ? 29.307  3.570   72.208 1.00 89.74  ? 96  LYS A CE  1 
ATOM   707  N NZ  . LYS A 1 94  ? 28.872  4.451   71.016 1.00 89.08  ? 96  LYS A NZ  1 
ATOM   708  N N   . TYR A 1 95  ? 34.010  -0.191  69.257 1.00 73.10  ? 97  TYR A N   1 
ATOM   709  C CA  . TYR A 1 95  ? 34.571  -0.377  67.906 1.00 70.65  ? 97  TYR A CA  1 
ATOM   710  C C   . TYR A 1 95  ? 33.526  -0.042  66.850 1.00 70.17  ? 97  TYR A C   1 
ATOM   711  O O   . TYR A 1 95  ? 32.424  -0.599  66.857 1.00 68.68  ? 97  TYR A O   1 
ATOM   712  C CB  . TYR A 1 95  ? 35.068  -1.816  67.741 1.00 68.78  ? 97  TYR A CB  1 
ATOM   713  C CG  . TYR A 1 95  ? 36.253  -2.191  68.622 1.00 68.14  ? 97  TYR A CG  1 
ATOM   714  C CD1 . TYR A 1 95  ? 37.562  -1.923  68.219 1.00 67.76  ? 97  TYR A CD1 1 
ATOM   715  C CD2 . TYR A 1 95  ? 36.068  -2.798  69.852 1.00 67.15  ? 97  TYR A CD2 1 
ATOM   716  C CE1 . TYR A 1 95  ? 38.638  -2.236  68.999 1.00 64.50  ? 97  TYR A CE1 1 
ATOM   717  C CE2 . TYR A 1 95  ? 37.153  -3.110  70.650 1.00 66.89  ? 97  TYR A CE2 1 
ATOM   718  C CZ  . TYR A 1 95  ? 38.442  -2.836  70.214 1.00 67.07  ? 97  TYR A CZ  1 
ATOM   719  O OH  . TYR A 1 95  ? 39.553  -3.194  70.999 1.00 70.40  ? 97  TYR A OH  1 
ATOM   720  N N   . GLU A 1 96  ? 33.879  0.875   65.951 1.00 71.07  ? 98  GLU A N   1 
ATOM   721  C CA  . GLU A 1 96  ? 32.886  1.568   65.098 1.00 71.83  ? 98  GLU A CA  1 
ATOM   722  C C   . GLU A 1 96  ? 33.163  1.358   63.633 1.00 70.34  ? 98  GLU A C   1 
ATOM   723  O O   . GLU A 1 96  ? 34.269  1.672   63.132 1.00 71.01  ? 98  GLU A O   1 
ATOM   724  C CB  . GLU A 1 96  ? 32.805  3.064   65.427 1.00 74.26  ? 98  GLU A CB  1 
ATOM   725  C CG  . GLU A 1 96  ? 32.101  3.314   66.760 1.00 79.71  ? 98  GLU A CG  1 
ATOM   726  C CD  . GLU A 1 96  ? 32.035  4.772   67.143 1.00 89.55  ? 98  GLU A CD  1 
ATOM   727  O OE1 . GLU A 1 96  ? 33.075  5.480   67.051 1.00 92.71  ? 98  GLU A OE1 1 
ATOM   728  O OE2 . GLU A 1 96  ? 30.933  5.215   67.549 1.00 93.47  ? 98  GLU A OE2 1 
ATOM   729  N N   . TYR A 1 97  ? 32.165  0.793   62.956 1.00 68.06  ? 99  TYR A N   1 
ATOM   730  C CA  . TYR A 1 97  ? 32.331  0.411   61.560 1.00 66.31  ? 99  TYR A CA  1 
ATOM   731  C C   . TYR A 1 97  ? 31.374  1.276   60.756 1.00 67.16  ? 99  TYR A C   1 
ATOM   732  O O   . TYR A 1 97  ? 30.164  1.224   60.991 1.00 66.90  ? 99  TYR A O   1 
ATOM   733  C CB  . TYR A 1 97  ? 31.964  -1.064  61.357 1.00 63.61  ? 99  TYR A CB  1 
ATOM   734  C CG  . TYR A 1 97  ? 32.913  -2.108  61.912 1.00 61.12  ? 99  TYR A CG  1 
ATOM   735  C CD1 . TYR A 1 97  ? 33.801  -2.756  61.088 1.00 60.48  ? 99  TYR A CD1 1 
ATOM   736  C CD2 . TYR A 1 97  ? 32.893  -2.477  63.243 1.00 58.92  ? 99  TYR A CD2 1 
ATOM   737  C CE1 . TYR A 1 97  ? 34.648  -3.703  61.561 1.00 55.89  ? 99  TYR A CE1 1 
ATOM   738  C CE2 . TYR A 1 97  ? 33.744  -3.420  63.718 1.00 55.51  ? 99  TYR A CE2 1 
ATOM   739  C CZ  . TYR A 1 97  ? 34.624  -4.034  62.869 1.00 54.02  ? 99  TYR A CZ  1 
ATOM   740  O OH  . TYR A 1 97  ? 35.489  -5.017  63.303 1.00 52.61  ? 99  TYR A OH  1 
ATOM   741  N N   . LYS A 1 98  ? 31.890  2.062   59.815 1.00 68.01  ? 100 LYS A N   1 
ATOM   742  C CA  . LYS A 1 98  ? 31.014  2.859   58.952 1.00 69.30  ? 100 LYS A CA  1 
ATOM   743  C C   . LYS A 1 98  ? 30.422  2.069   57.772 1.00 67.69  ? 100 LYS A C   1 
ATOM   744  O O   . LYS A 1 98  ? 31.122  1.327   57.079 1.00 67.23  ? 100 LYS A O   1 
ATOM   745  C CB  . LYS A 1 98  ? 31.786  4.025   58.351 1.00 71.17  ? 100 LYS A CB  1 
ATOM   746  C CG  . LYS A 1 98  ? 32.296  5.042   59.328 1.00 75.01  ? 100 LYS A CG  1 
ATOM   747  C CD  . LYS A 1 98  ? 33.325  5.873   58.587 1.00 79.50  ? 100 LYS A CD  1 
ATOM   748  C CE  . LYS A 1 98  ? 33.151  7.372   58.847 1.00 83.18  ? 100 LYS A CE  1 
ATOM   749  N NZ  . LYS A 1 98  ? 34.186  8.123   58.057 1.00 84.94  ? 100 LYS A NZ  1 
ATOM   750  N N   . PHE A 1 99  ? 29.149  2.272   57.492 1.00 67.20  ? 101 PHE A N   1 
ATOM   751  C CA  . PHE A 1 99  ? 28.639  1.852   56.200 1.00 65.76  ? 101 PHE A CA  1 
ATOM   752  C C   . PHE A 1 99  ? 27.876  2.974   55.523 1.00 67.39  ? 101 PHE A C   1 
ATOM   753  O O   . PHE A 1 99  ? 27.346  3.895   56.201 1.00 68.75  ? 101 PHE A O   1 
ATOM   754  C CB  . PHE A 1 99  ? 27.697  0.681   56.354 1.00 63.52  ? 101 PHE A CB  1 
ATOM   755  C CG  . PHE A 1 99  ? 26.475  1.004   57.120 1.00 62.92  ? 101 PHE A CG  1 
ATOM   756  C CD1 . PHE A 1 99  ? 25.364  1.537   56.479 1.00 63.58  ? 101 PHE A CD1 1 
ATOM   757  C CD2 . PHE A 1 99  ? 26.428  0.788   58.490 1.00 61.49  ? 101 PHE A CD2 1 
ATOM   758  C CE1 . PHE A 1 99  ? 24.207  1.845   57.182 1.00 62.62  ? 101 PHE A CE1 1 
ATOM   759  C CE2 . PHE A 1 99  ? 25.266  1.052   59.203 1.00 63.36  ? 101 PHE A CE2 1 
ATOM   760  C CZ  . PHE A 1 99  ? 24.140  1.599   58.537 1.00 62.66  ? 101 PHE A CZ  1 
ATOM   761  N N   . GLY A 1 100 ? 27.798  2.859   54.194 1.00 66.54  ? 102 GLY A N   1 
ATOM   762  C CA  . GLY A 1 100 ? 27.037  3.795   53.367 1.00 67.22  ? 102 GLY A CA  1 
ATOM   763  C C   . GLY A 1 100 ? 26.524  3.246   52.046 1.00 64.99  ? 102 GLY A C   1 
ATOM   764  O O   . GLY A 1 100 ? 27.275  2.828   51.177 1.00 64.35  ? 102 GLY A O   1 
ATOM   765  N N   . PHE A 1 101 ? 25.227  3.244   51.902 1.00 64.30  ? 103 PHE A N   1 
ATOM   766  C CA  . PHE A 1 101 ? 24.656  2.891   50.640 1.00 64.30  ? 103 PHE A CA  1 
ATOM   767  C C   . PHE A 1 101 ? 23.541  3.885   50.307 1.00 66.37  ? 103 PHE A C   1 
ATOM   768  O O   . PHE A 1 101 ? 23.039  4.617   51.171 1.00 66.67  ? 103 PHE A O   1 
ATOM   769  C CB  . PHE A 1 101 ? 24.154  1.453   50.658 1.00 61.29  ? 103 PHE A CB  1 
ATOM   770  C CG  . PHE A 1 101 ? 23.070  1.223   51.642 1.00 59.05  ? 103 PHE A CG  1 
ATOM   771  C CD1 . PHE A 1 101 ? 21.746  1.439   51.291 1.00 55.15  ? 103 PHE A CD1 1 
ATOM   772  C CD2 . PHE A 1 101 ? 23.373  0.818   52.946 1.00 57.87  ? 103 PHE A CD2 1 
ATOM   773  C CE1 . PHE A 1 101 ? 20.742  1.237   52.224 1.00 56.84  ? 103 PHE A CE1 1 
ATOM   774  C CE2 . PHE A 1 101 ? 22.374  0.600   53.887 1.00 56.80  ? 103 PHE A CE2 1 
ATOM   775  C CZ  . PHE A 1 101 ? 21.062  0.809   53.537 1.00 56.74  ? 103 PHE A CZ  1 
ATOM   776  N N   . GLU A 1 102 ? 23.184  3.919   49.034 1.00 68.14  ? 104 GLU A N   1 
ATOM   777  C CA  . GLU A 1 102 ? 22.304  4.970   48.539 1.00 71.68  ? 104 GLU A CA  1 
ATOM   778  C C   . GLU A 1 102 ? 21.289  4.345   47.606 1.00 70.43  ? 104 GLU A C   1 
ATOM   779  O O   . GLU A 1 102 ? 21.657  3.728   46.593 1.00 69.91  ? 104 GLU A O   1 
ATOM   780  C CB  . GLU A 1 102 ? 23.094  6.114   47.864 1.00 73.40  ? 104 GLU A CB  1 
ATOM   781  C CG  . GLU A 1 102 ? 23.233  6.020   46.355 1.00 75.90  ? 104 GLU A CG  1 
ATOM   782  C CD  . GLU A 1 102 ? 24.171  7.085   45.833 1.00 84.28  ? 104 GLU A CD  1 
ATOM   783  O OE1 . GLU A 1 102 ? 23.735  7.980   45.059 1.00 85.57  ? 104 GLU A OE1 1 
ATOM   784  O OE2 . GLU A 1 102 ? 25.359  7.055   46.237 1.00 88.21  ? 104 GLU A OE2 1 
ATOM   785  N N   . LEU A 1 103 ? 20.021  4.503   47.979 1.00 70.77  ? 105 LEU A N   1 
ATOM   786  C CA  . LEU A 1 103 ? 18.921  3.833   47.306 1.00 69.76  ? 105 LEU A CA  1 
ATOM   787  C C   . LEU A 1 103 ? 18.884  4.148   45.807 1.00 70.29  ? 105 LEU A C   1 
ATOM   788  O O   . LEU A 1 103 ? 19.446  5.184   45.356 1.00 71.26  ? 105 LEU A O   1 
ATOM   789  C CB  . LEU A 1 103 ? 17.602  4.214   47.986 1.00 70.11  ? 105 LEU A CB  1 
ATOM   790  C CG  . LEU A 1 103 ? 17.604  3.915   49.498 1.00 70.19  ? 105 LEU A CG  1 
ATOM   791  C CD1 . LEU A 1 103 ? 17.030  5.069   50.308 1.00 70.03  ? 105 LEU A CD1 1 
ATOM   792  C CD2 . LEU A 1 103 ? 16.889  2.582   49.813 1.00 67.88  ? 105 LEU A CD2 1 
ATOM   793  N N   . PRO A 1 104 ? 18.243  3.245   45.021 1.00 69.26  ? 106 PRO A N   1 
ATOM   794  C CA  . PRO A 1 104 ? 18.004  3.537   43.621 1.00 69.42  ? 106 PRO A CA  1 
ATOM   795  C C   . PRO A 1 104 ? 16.912  4.581   43.522 1.00 70.22  ? 106 PRO A C   1 
ATOM   796  O O   . PRO A 1 104 ? 15.948  4.581   44.274 1.00 70.17  ? 106 PRO A O   1 
ATOM   797  C CB  . PRO A 1 104 ? 17.475  2.217   43.085 1.00 67.73  ? 106 PRO A CB  1 
ATOM   798  C CG  . PRO A 1 104 ? 16.755  1.651   44.228 1.00 66.57  ? 106 PRO A CG  1 
ATOM   799  C CD  . PRO A 1 104 ? 17.681  1.933   45.382 1.00 67.86  ? 106 PRO A CD  1 
ATOM   800  N N   . GLN A 1 105 ? 17.089  5.495   42.599 1.00 71.70  ? 107 GLN A N   1 
ATOM   801  C CA  . GLN A 1 105 ? 16.022  6.363   42.175 1.00 72.18  ? 107 GLN A CA  1 
ATOM   802  C C   . GLN A 1 105 ? 14.987  5.505   41.476 1.00 72.26  ? 107 GLN A C   1 
ATOM   803  O O   . GLN A 1 105 ? 15.276  4.355   41.055 1.00 71.49  ? 107 GLN A O   1 
ATOM   804  C CB  . GLN A 1 105 ? 16.617  7.297   41.160 1.00 71.21  ? 107 GLN A CB  1 
ATOM   805  C CG  . GLN A 1 105 ? 18.110  7.396   41.452 1.00 68.03  ? 107 GLN A CG  1 
ATOM   806  C CD  . GLN A 1 105 ? 18.524  8.811   41.297 1.00 67.57  ? 107 GLN A CD  1 
ATOM   807  O OE1 . GLN A 1 105 ? 18.547  9.597   42.288 1.00 64.28  ? 107 GLN A OE1 1 
ATOM   808  N NE2 . GLN A 1 105 ? 18.799  9.206   40.029 1.00 68.24  ? 107 GLN A NE2 1 
ATOM   809  N N   . GLY A 1 106 ? 13.794  6.059   41.306 1.00 73.52  ? 108 GLY A N   1 
ATOM   810  C CA  . GLY A 1 106 ? 12.728  5.259   40.746 1.00 73.53  ? 108 GLY A CA  1 
ATOM   811  C C   . GLY A 1 106 ? 11.926  4.701   41.908 1.00 74.22  ? 108 GLY A C   1 
ATOM   812  O O   . GLY A 1 106 ? 12.025  5.207   43.037 1.00 74.64  ? 108 GLY A O   1 
ATOM   813  N N   . PRO A 1 107 ? 11.128  3.645   41.643 1.00 73.83  ? 109 PRO A N   1 
ATOM   814  C CA  . PRO A 1 107 ? 10.190  3.241   42.696 1.00 74.22  ? 109 PRO A CA  1 
ATOM   815  C C   . PRO A 1 107 ? 10.979  2.549   43.785 1.00 73.69  ? 109 PRO A C   1 
ATOM   816  O O   . PRO A 1 107 ? 12.051  1.978   43.524 1.00 73.33  ? 109 PRO A O   1 
ATOM   817  C CB  . PRO A 1 107 ? 9.232   2.233   41.994 1.00 73.05  ? 109 PRO A CB  1 
ATOM   818  C CG  . PRO A 1 107 ? 10.017  1.686   40.811 1.00 71.78  ? 109 PRO A CG  1 
ATOM   819  C CD  . PRO A 1 107 ? 11.096  2.741   40.463 1.00 72.66  ? 109 PRO A CD  1 
ATOM   820  N N   . LEU A 1 108 ? 10.470  2.638   45.001 1.00 73.91  ? 110 LEU A N   1 
ATOM   821  C CA  . LEU A 1 108 ? 10.984  1.822   46.076 1.00 72.74  ? 110 LEU A CA  1 
ATOM   822  C C   . LEU A 1 108 ? 9.895   0.789   46.356 1.00 71.37  ? 110 LEU A C   1 
ATOM   823  O O   . LEU A 1 108 ? 10.011  -0.093  47.211 1.00 69.76  ? 110 LEU A O   1 
ATOM   824  C CB  . LEU A 1 108 ? 11.402  2.716   47.244 1.00 74.32  ? 110 LEU A CB  1 
ATOM   825  C CG  . LEU A 1 108 ? 12.481  3.674   46.673 1.00 75.53  ? 110 LEU A CG  1 
ATOM   826  C CD1 . LEU A 1 108 ? 12.698  4.943   47.482 1.00 75.89  ? 110 LEU A CD1 1 
ATOM   827  C CD2 . LEU A 1 108 ? 13.828  2.964   46.369 1.00 74.14  ? 110 LEU A CD2 1 
ATOM   828  N N   . GLY A 1 109 ? 8.845   0.900   45.552 1.00 71.11  ? 111 GLY A N   1 
ATOM   829  C CA  . GLY A 1 109 ? 7.781   -0.087  45.548 1.00 71.36  ? 111 GLY A CA  1 
ATOM   830  C C   . GLY A 1 109 ? 6.866   -0.109  46.770 1.00 72.23  ? 111 GLY A C   1 
ATOM   831  O O   . GLY A 1 109 ? 6.410   -1.190  47.180 1.00 72.25  ? 111 GLY A O   1 
ATOM   832  N N   . THR A 1 110 ? 6.610   1.073   47.344 1.00 72.85  ? 112 THR A N   1 
ATOM   833  C CA  . THR A 1 110 ? 5.570   1.280   48.367 1.00 72.70  ? 112 THR A CA  1 
ATOM   834  C C   . THR A 1 110 ? 4.222   1.042   47.684 1.00 75.46  ? 112 THR A C   1 
ATOM   835  O O   . THR A 1 110 ? 3.259   0.600   48.314 1.00 75.55  ? 112 THR A O   1 
ATOM   836  C CB  . THR A 1 110 ? 5.535   2.779   48.824 1.00 72.32  ? 112 THR A CB  1 
ATOM   837  O OG1 . THR A 1 110 ? 5.376   3.597   47.651 1.00 63.03  ? 112 THR A OG1 1 
ATOM   838  C CG2 . THR A 1 110 ? 6.849   3.212   49.587 1.00 70.75  ? 112 THR A CG2 1 
ATOM   839  N N   . SER A 1 111 ? 4.193   1.367   46.377 1.00 77.08  ? 113 SER A N   1 
ATOM   840  C CA  . SER A 1 111 ? 2.977   1.627   45.584 1.00 79.66  ? 113 SER A CA  1 
ATOM   841  C C   . SER A 1 111 ? 1.692   1.068   46.196 1.00 82.51  ? 113 SER A C   1 
ATOM   842  O O   . SER A 1 111 ? 0.761   1.841   46.507 1.00 85.07  ? 113 SER A O   1 
ATOM   843  C CB  . SER A 1 111 ? 3.162   1.184   44.121 1.00 77.56  ? 113 SER A CB  1 
ATOM   844  O OG  . SER A 1 111 ? 3.722   -0.115  44.037 1.00 76.98  ? 113 SER A OG  1 
ATOM   845  N N   . PHE A 1 112 ? 1.665   -0.257  46.395 1.00 83.65  ? 114 PHE A N   1 
ATOM   846  C CA  . PHE A 1 112 ? 0.537   -0.948  47.048 1.00 86.02  ? 114 PHE A CA  1 
ATOM   847  C C   . PHE A 1 112 ? 0.824   -1.350  48.480 1.00 87.95  ? 114 PHE A C   1 
ATOM   848  O O   . PHE A 1 112 ? 0.248   -2.341  48.952 1.00 89.17  ? 114 PHE A O   1 
ATOM   849  C CB  . PHE A 1 112 ? 0.130   -2.208  46.290 1.00 85.00  ? 114 PHE A CB  1 
ATOM   850  C CG  . PHE A 1 112 ? -0.187  -1.975  44.853 1.00 83.52  ? 114 PHE A CG  1 
ATOM   851  C CD1 . PHE A 1 112 ? -1.504  -1.960  44.426 1.00 84.58  ? 114 PHE A CD1 1 
ATOM   852  C CD2 . PHE A 1 112 ? 0.832   -1.778  43.928 1.00 82.14  ? 114 PHE A CD2 1 
ATOM   853  C CE1 . PHE A 1 112 ? -1.807  -1.750  43.104 1.00 84.06  ? 114 PHE A CE1 1 
ATOM   854  C CE2 . PHE A 1 112 ? 0.546   -1.569  42.597 1.00 82.50  ? 114 PHE A CE2 1 
ATOM   855  C CZ  . PHE A 1 112 ? -0.778  -1.565  42.177 1.00 83.20  ? 114 PHE A CZ  1 
ATOM   856  N N   . LYS A 1 113 ? 1.701   -0.603  49.167 1.00 88.75  ? 115 LYS A N   1 
ATOM   857  C CA  . LYS A 1 113 ? 1.748   -0.651  50.644 1.00 90.71  ? 115 LYS A CA  1 
ATOM   858  C C   . LYS A 1 113 ? 0.368   -0.165  51.091 1.00 92.53  ? 115 LYS A C   1 
ATOM   859  O O   . LYS A 1 113 ? 0.196   0.985   51.548 1.00 94.86  ? 115 LYS A O   1 
ATOM   860  C CB  . LYS A 1 113 ? 2.878   0.213   51.267 1.00 91.04  ? 115 LYS A CB  1 
ATOM   861  C CG  . LYS A 1 113 ? 2.756   1.743   51.064 1.00 92.55  ? 115 LYS A CG  1 
ATOM   862  C CD  . LYS A 1 113 ? 3.375   2.567   52.203 1.00 95.75  ? 115 LYS A CD  1 
ATOM   863  C CE  . LYS A 1 113 ? 3.474   4.064   51.789 1.00 96.81  ? 115 LYS A CE  1 
ATOM   864  N NZ  . LYS A 1 113 ? 2.950   4.950   52.897 1.00 98.13  ? 115 LYS A NZ  1 
ATOM   865  N N   . GLY A 1 114 ? -0.617  -1.037  50.911 1.00 91.37  ? 116 GLY A N   1 
ATOM   866  C CA  . GLY A 1 114 ? -1.983  -0.699  51.202 1.00 92.11  ? 116 GLY A CA  1 
ATOM   867  C C   . GLY A 1 114 ? -2.593  -1.944  51.761 1.00 92.02  ? 116 GLY A C   1 
ATOM   868  O O   . GLY A 1 114 ? -1.906  -2.788  52.338 1.00 91.56  ? 116 GLY A O   1 
ATOM   869  N N   . LYS A 1 115 ? -3.895  -2.056  51.558 1.00 92.36  ? 117 LYS A N   1 
ATOM   870  C CA  . LYS A 1 115 ? -4.661  -3.244  51.898 1.00 92.37  ? 117 LYS A CA  1 
ATOM   871  C C   . LYS A 1 115 ? -4.059  -4.517  51.239 1.00 89.51  ? 117 LYS A C   1 
ATOM   872  O O   . LYS A 1 115 ? -4.273  -5.636  51.716 1.00 89.98  ? 117 LYS A O   1 
ATOM   873  C CB  . LYS A 1 115 ? -6.128  -2.981  51.495 1.00 93.37  ? 117 LYS A CB  1 
ATOM   874  C CG  . LYS A 1 115 ? -6.912  -4.148  50.956 1.00 92.78  ? 117 LYS A CG  1 
ATOM   875  C CD  . LYS A 1 115 ? -7.977  -3.658  49.968 1.00 91.96  ? 117 LYS A CD  1 
ATOM   876  C CE  . LYS A 1 115 ? -9.275  -4.443  50.122 1.00 94.50  ? 117 LYS A CE  1 
ATOM   877  N NZ  . LYS A 1 115 ? -9.044  -5.849  50.623 1.00 93.22  ? 117 LYS A NZ  1 
ATOM   878  N N   . TYR A 1 116 ? -3.292  -4.336  50.163 1.00 86.19  ? 118 TYR A N   1 
ATOM   879  C CA  . TYR A 1 116 ? -2.911  -5.457  49.320 1.00 84.20  ? 118 TYR A CA  1 
ATOM   880  C C   . TYR A 1 116 ? -1.441  -5.823  49.440 1.00 83.26  ? 118 TYR A C   1 
ATOM   881  O O   . TYR A 1 116 ? -1.077  -6.980  49.323 1.00 82.34  ? 118 TYR A O   1 
ATOM   882  C CB  . TYR A 1 116 ? -3.291  -5.192  47.857 1.00 82.15  ? 118 TYR A CB  1 
ATOM   883  C CG  . TYR A 1 116 ? -4.769  -5.353  47.566 1.00 80.93  ? 118 TYR A CG  1 
ATOM   884  C CD1 . TYR A 1 116 ? -5.374  -6.611  47.639 1.00 80.10  ? 118 TYR A CD1 1 
ATOM   885  C CD2 . TYR A 1 116 ? -5.559  -4.257  47.194 1.00 79.51  ? 118 TYR A CD2 1 
ATOM   886  C CE1 . TYR A 1 116 ? -6.716  -6.782  47.396 1.00 79.59  ? 118 TYR A CE1 1 
ATOM   887  C CE2 . TYR A 1 116 ? -6.913  -4.422  46.919 1.00 80.04  ? 118 TYR A CE2 1 
ATOM   888  C CZ  . TYR A 1 116 ? -7.477  -5.692  47.039 1.00 81.91  ? 118 TYR A CZ  1 
ATOM   889  O OH  . TYR A 1 116 ? -8.812  -5.898  46.783 1.00 85.31  ? 118 TYR A OH  1 
ATOM   890  N N   . GLY A 1 117 ? -0.597  -4.826  49.671 1.00 83.60  ? 119 GLY A N   1 
ATOM   891  C CA  . GLY A 1 117 ? 0.831   -5.076  49.792 1.00 82.89  ? 119 GLY A CA  1 
ATOM   892  C C   . GLY A 1 117 ? 1.479   -4.448  51.015 1.00 84.27  ? 119 GLY A C   1 
ATOM   893  O O   . GLY A 1 117 ? 0.801   -3.833  51.850 1.00 86.04  ? 119 GLY A O   1 
ATOM   894  N N   . CYS A 1 118 ? 2.805   -4.621  51.093 1.00 83.23  ? 120 CYS A N   1 
ATOM   895  C CA  . CYS A 1 118 ? 3.662   -4.027  52.129 1.00 83.94  ? 120 CYS A CA  1 
ATOM   896  C C   . CYS A 1 118 ? 5.134   -4.089  51.693 1.00 81.07  ? 120 CYS A C   1 
ATOM   897  O O   . CYS A 1 118 ? 5.492   -4.898  50.835 1.00 79.65  ? 120 CYS A O   1 
ATOM   898  C CB  . CYS A 1 118 ? 3.491   -4.738  53.462 1.00 85.45  ? 120 CYS A CB  1 
ATOM   899  S SG  . CYS A 1 118 ? 3.938   -6.451  53.304 1.00 88.98  ? 120 CYS A SG  1 
ATOM   900  N N   . VAL A 1 119 ? 5.958   -3.238  52.313 1.00 80.36  ? 121 VAL A N   1 
ATOM   901  C CA  . VAL A 1 119 ? 7.322   -2.939  51.889 1.00 78.16  ? 121 VAL A CA  1 
ATOM   902  C C   . VAL A 1 119 ? 8.354   -3.058  53.067 1.00 78.47  ? 121 VAL A C   1 
ATOM   903  O O   . VAL A 1 119 ? 8.260   -2.353  54.090 1.00 80.59  ? 121 VAL A O   1 
ATOM   904  C CB  . VAL A 1 119 ? 7.375   -1.541  51.195 1.00 77.81  ? 121 VAL A CB  1 
ATOM   905  C CG1 . VAL A 1 119 ? 6.990   -0.427  52.171 1.00 80.53  ? 121 VAL A CG1 1 
ATOM   906  C CG2 . VAL A 1 119 ? 8.723   -1.264  50.588 1.00 75.05  ? 121 VAL A CG2 1 
ATOM   907  N N   . ASP A 1 120 ? 9.334   -3.953  52.918 1.00 76.02  ? 122 ASP A N   1 
ATOM   908  C CA  . ASP A 1 120 ? 10.304  -4.220  53.990 1.00 74.83  ? 122 ASP A CA  1 
ATOM   909  C C   . ASP A 1 120 ? 11.692  -3.683  53.686 1.00 71.81  ? 122 ASP A C   1 
ATOM   910  O O   . ASP A 1 120 ? 12.355  -4.138  52.752 1.00 70.83  ? 122 ASP A O   1 
ATOM   911  C CB  . ASP A 1 120 ? 10.401  -5.725  54.297 1.00 75.10  ? 122 ASP A CB  1 
ATOM   912  C CG  . ASP A 1 120 ? 9.319   -6.212  55.252 1.00 78.91  ? 122 ASP A CG  1 
ATOM   913  O OD1 . ASP A 1 120 ? 9.287   -7.446  55.501 1.00 81.97  ? 122 ASP A OD1 1 
ATOM   914  O OD2 . ASP A 1 120 ? 8.509   -5.379  55.750 1.00 82.69  ? 122 ASP A OD2 1 
ATOM   915  N N   . TYR A 1 121 ? 12.127  -2.718  54.475 1.00 69.94  ? 123 TYR A N   1 
ATOM   916  C CA  . TYR A 1 121 ? 13.509  -2.343  54.453 1.00 67.36  ? 123 TYR A CA  1 
ATOM   917  C C   . TYR A 1 121 ? 14.175  -2.673  55.781 1.00 66.47  ? 123 TYR A C   1 
ATOM   918  O O   . TYR A 1 121 ? 13.521  -2.746  56.829 1.00 67.87  ? 123 TYR A O   1 
ATOM   919  C CB  . TYR A 1 121 ? 13.660  -0.876  54.084 1.00 67.83  ? 123 TYR A CB  1 
ATOM   920  C CG  . TYR A 1 121 ? 13.480  -0.623  52.624 1.00 67.14  ? 123 TYR A CG  1 
ATOM   921  C CD1 . TYR A 1 121 ? 14.458  0.008   51.889 1.00 69.46  ? 123 TYR A CD1 1 
ATOM   922  C CD2 . TYR A 1 121 ? 12.337  -1.019  51.972 1.00 68.90  ? 123 TYR A CD2 1 
ATOM   923  C CE1 . TYR A 1 121 ? 14.302  0.257   50.529 1.00 69.45  ? 123 TYR A CE1 1 
ATOM   924  C CE2 . TYR A 1 121 ? 12.163  -0.794  50.618 1.00 69.63  ? 123 TYR A CE2 1 
ATOM   925  C CZ  . TYR A 1 121 ? 13.147  -0.149  49.894 1.00 70.05  ? 123 TYR A CZ  1 
ATOM   926  O OH  . TYR A 1 121 ? 12.959  0.099   48.540 1.00 68.53  ? 123 TYR A OH  1 
ATOM   927  N N   . TRP A 1 122 ? 15.472  -2.924  55.703 1.00 63.51  ? 124 TRP A N   1 
ATOM   928  C CA  . TRP A 1 122 ? 16.321  -3.085  56.868 1.00 62.48  ? 124 TRP A CA  1 
ATOM   929  C C   . TRP A 1 122 ? 17.747  -3.306  56.462 1.00 59.81  ? 124 TRP A C   1 
ATOM   930  O O   . TRP A 1 122 ? 18.078  -3.376  55.266 1.00 58.85  ? 124 TRP A O   1 
ATOM   931  C CB  . TRP A 1 122 ? 15.908  -4.252  57.717 1.00 63.24  ? 124 TRP A CB  1 
ATOM   932  C CG  . TRP A 1 122 ? 15.496  -5.421  56.963 1.00 64.50  ? 124 TRP A CG  1 
ATOM   933  C CD1 . TRP A 1 122 ? 14.223  -5.807  56.735 1.00 67.55  ? 124 TRP A CD1 1 
ATOM   934  C CD2 . TRP A 1 122 ? 16.338  -6.388  56.316 1.00 65.12  ? 124 TRP A CD2 1 
ATOM   935  N NE1 . TRP A 1 122 ? 14.202  -6.960  55.984 1.00 67.63  ? 124 TRP A NE1 1 
ATOM   936  C CE2 . TRP A 1 122 ? 15.486  -7.353  55.732 1.00 64.51  ? 124 TRP A CE2 1 
ATOM   937  C CE3 . TRP A 1 122 ? 17.724  -6.550  56.191 1.00 66.20  ? 124 TRP A CE3 1 
ATOM   938  C CZ2 . TRP A 1 122 ? 15.963  -8.449  55.019 1.00 61.04  ? 124 TRP A CZ2 1 
ATOM   939  C CZ3 . TRP A 1 122 ? 18.202  -7.667  55.476 1.00 64.24  ? 124 TRP A CZ3 1 
ATOM   940  C CH2 . TRP A 1 122 ? 17.312  -8.589  54.903 1.00 61.98  ? 124 TRP A CH2 1 
ATOM   941  N N   . VAL A 1 123 ? 18.579  -3.422  57.486 1.00 58.29  ? 125 VAL A N   1 
ATOM   942  C CA  . VAL A 1 123 ? 19.999  -3.676  57.352 1.00 55.65  ? 125 VAL A CA  1 
ATOM   943  C C   . VAL A 1 123 ? 20.289  -4.783  58.347 1.00 55.57  ? 125 VAL A C   1 
ATOM   944  O O   . VAL A 1 123 ? 19.973  -4.638  59.522 1.00 56.64  ? 125 VAL A O   1 
ATOM   945  C CB  . VAL A 1 123 ? 20.783  -2.419  57.745 1.00 55.69  ? 125 VAL A CB  1 
ATOM   946  C CG1 . VAL A 1 123 ? 22.216  -2.694  57.839 1.00 54.01  ? 125 VAL A CG1 1 
ATOM   947  C CG2 . VAL A 1 123 ? 20.515  -1.289  56.781 1.00 54.84  ? 125 VAL A CG2 1 
ATOM   948  N N   . LYS A 1 124 ? 20.824  -5.912  57.895 1.00 54.36  ? 126 LYS A N   1 
ATOM   949  C CA  . LYS A 1 124 ? 21.467  -6.840  58.832 1.00 53.93  ? 126 LYS A CA  1 
ATOM   950  C C   . LYS A 1 124 ? 22.947  -6.555  58.814 1.00 52.81  ? 126 LYS A C   1 
ATOM   951  O O   . LYS A 1 124 ? 23.486  -6.215  57.754 1.00 52.50  ? 126 LYS A O   1 
ATOM   952  C CB  . LYS A 1 124 ? 21.238  -8.262  58.428 1.00 53.05  ? 126 LYS A CB  1 
ATOM   953  C CG  . LYS A 1 124 ? 19.797  -8.666  58.521 1.00 58.27  ? 126 LYS A CG  1 
ATOM   954  C CD  . LYS A 1 124 ? 19.736  -10.189 58.480 1.00 66.00  ? 126 LYS A CD  1 
ATOM   955  C CE  . LYS A 1 124 ? 18.284  -10.739 58.441 1.00 70.71  ? 126 LYS A CE  1 
ATOM   956  N NZ  . LYS A 1 124 ? 17.689  -10.623 57.051 1.00 71.26  ? 126 LYS A NZ  1 
ATOM   957  N N   . ALA A 1 125 ? 23.586  -6.628  59.987 1.00 52.55  ? 127 ALA A N   1 
ATOM   958  C CA  . ALA A 1 125 ? 25.058  -6.663  60.114 1.00 51.16  ? 127 ALA A CA  1 
ATOM   959  C C   . ALA A 1 125 ? 25.395  -8.008  60.645 1.00 50.12  ? 127 ALA A C   1 
ATOM   960  O O   . ALA A 1 125 ? 24.597  -8.585  61.356 1.00 49.97  ? 127 ALA A O   1 
ATOM   961  C CB  . ALA A 1 125 ? 25.543  -5.654  61.060 1.00 51.40  ? 127 ALA A CB  1 
ATOM   962  N N   . PHE A 1 126 ? 26.577  -8.511  60.316 1.00 49.73  ? 128 PHE A N   1 
ATOM   963  C CA  . PHE A 1 126 ? 26.982  -9.833  60.783 1.00 49.78  ? 128 PHE A CA  1 
ATOM   964  C C   . PHE A 1 126 ? 28.337  -9.784  61.435 1.00 50.14  ? 128 PHE A C   1 
ATOM   965  O O   . PHE A 1 126 ? 29.248  -9.117  60.921 1.00 51.02  ? 128 PHE A O   1 
ATOM   966  C CB  . PHE A 1 126 ? 27.012  -10.815 59.652 1.00 48.76  ? 128 PHE A CB  1 
ATOM   967  C CG  . PHE A 1 126 ? 25.730  -10.893 58.870 1.00 50.64  ? 128 PHE A CG  1 
ATOM   968  C CD1 . PHE A 1 126 ? 24.807  -11.892 59.127 1.00 51.82  ? 128 PHE A CD1 1 
ATOM   969  C CD2 . PHE A 1 126 ? 25.451  -9.971  57.838 1.00 52.03  ? 128 PHE A CD2 1 
ATOM   970  C CE1 . PHE A 1 126 ? 23.629  -12.002 58.353 1.00 51.19  ? 128 PHE A CE1 1 
ATOM   971  C CE2 . PHE A 1 126 ? 24.275  -10.069 57.062 1.00 50.50  ? 128 PHE A CE2 1 
ATOM   972  C CZ  . PHE A 1 126 ? 23.373  -11.108 57.323 1.00 50.86  ? 128 PHE A CZ  1 
ATOM   973  N N   . LEU A 1 127 ? 28.445  -10.443 62.588 1.00 49.95  ? 129 LEU A N   1 
ATOM   974  C CA  . LEU A 1 127 ? 29.718  -10.630 63.275 1.00 50.45  ? 129 LEU A CA  1 
ATOM   975  C C   . LEU A 1 127 ? 30.233  -12.069 63.116 1.00 51.11  ? 129 LEU A C   1 
ATOM   976  O O   . LEU A 1 127 ? 29.595  -13.077 63.578 1.00 51.60  ? 129 LEU A O   1 
ATOM   977  C CB  . LEU A 1 127 ? 29.565  -10.323 64.738 1.00 50.96  ? 129 LEU A CB  1 
ATOM   978  C CG  . LEU A 1 127 ? 30.855  -10.323 65.532 1.00 53.28  ? 129 LEU A CG  1 
ATOM   979  C CD1 . LEU A 1 127 ? 31.740  -9.131  65.168 1.00 55.48  ? 129 LEU A CD1 1 
ATOM   980  C CD2 . LEU A 1 127 ? 30.556  -10.284 67.026 1.00 56.06  ? 129 LEU A CD2 1 
ATOM   981  N N   . ASP A 1 128 ? 31.373  -12.169 62.444 1.00 50.84  ? 130 ASP A N   1 
ATOM   982  C CA  . ASP A 1 128 ? 31.926  -13.444 62.116 1.00 51.78  ? 130 ASP A CA  1 
ATOM   983  C C   . ASP A 1 128 ? 33.035  -13.567 63.139 1.00 53.28  ? 130 ASP A C   1 
ATOM   984  O O   . ASP A 1 128 ? 33.789  -12.629 63.305 1.00 53.48  ? 130 ASP A O   1 
ATOM   985  C CB  . ASP A 1 128 ? 32.482  -13.409 60.691 1.00 51.46  ? 130 ASP A CB  1 
ATOM   986  C CG  . ASP A 1 128 ? 31.388  -13.409 59.608 1.00 52.57  ? 130 ASP A CG  1 
ATOM   987  O OD1 . ASP A 1 128 ? 30.295  -13.927 59.906 1.00 52.93  ? 130 ASP A OD1 1 
ATOM   988  O OD2 . ASP A 1 128 ? 31.621  -12.902 58.454 1.00 52.11  ? 130 ASP A OD2 1 
ATOM   989  N N   . ARG A 1 129 ? 33.108  -14.684 63.863 1.00 55.18  ? 131 ARG A N   1 
ATOM   990  C CA  . ARG A 1 129 ? 34.154  -14.896 64.882 1.00 57.49  ? 131 ARG A CA  1 
ATOM   991  C C   . ARG A 1 129 ? 34.627  -16.323 64.809 1.00 58.96  ? 131 ARG A C   1 
ATOM   992  O O   . ARG A 1 129 ? 33.782  -17.223 64.716 1.00 60.49  ? 131 ARG A O   1 
ATOM   993  C CB  . ARG A 1 129 ? 33.600  -14.727 66.285 1.00 58.15  ? 131 ARG A CB  1 
ATOM   994  C CG  . ARG A 1 129 ? 33.682  -13.326 66.873 1.00 60.64  ? 131 ARG A CG  1 
ATOM   995  C CD  . ARG A 1 129 ? 32.606  -13.196 67.940 1.00 61.61  ? 131 ARG A CD  1 
ATOM   996  N NE  . ARG A 1 129 ? 32.836  -14.214 68.939 1.00 61.91  ? 131 ARG A NE  1 
ATOM   997  C CZ  . ARG A 1 129 ? 31.978  -14.553 69.888 1.00 64.84  ? 131 ARG A CZ  1 
ATOM   998  N NH1 . ARG A 1 129 ? 30.801  -13.944 69.985 1.00 62.58  ? 131 ARG A NH1 1 
ATOM   999  N NH2 . ARG A 1 129 ? 32.314  -15.520 70.741 1.00 66.01  ? 131 ARG A NH2 1 
ATOM   1000 N N   . PRO A 1 130 ? 35.952  -16.559 64.938 1.00 59.52  ? 132 PRO A N   1 
ATOM   1001 C CA  . PRO A 1 130 ? 36.495  -17.887 64.686 1.00 60.26  ? 132 PRO A CA  1 
ATOM   1002 C C   . PRO A 1 130 ? 35.796  -18.998 65.510 1.00 61.65  ? 132 PRO A C   1 
ATOM   1003 O O   . PRO A 1 130 ? 35.544  -18.810 66.705 1.00 61.79  ? 132 PRO A O   1 
ATOM   1004 C CB  . PRO A 1 130 ? 37.976  -17.723 65.083 1.00 60.44  ? 132 PRO A CB  1 
ATOM   1005 C CG  . PRO A 1 130 ? 38.041  -16.528 65.928 1.00 59.25  ? 132 PRO A CG  1 
ATOM   1006 C CD  . PRO A 1 130 ? 37.011  -15.623 65.373 1.00 59.65  ? 132 PRO A CD  1 
ATOM   1007 N N   . SER A 1 131 ? 35.478  -20.126 64.868 1.00 62.93  ? 133 SER A N   1 
ATOM   1008 C CA  . SER A 1 131 ? 34.775  -21.238 65.522 1.00 65.52  ? 133 SER A CA  1 
ATOM   1009 C C   . SER A 1 131 ? 33.477  -20.826 66.223 1.00 66.50  ? 133 SER A C   1 
ATOM   1010 O O   . SER A 1 131 ? 33.103  -21.424 67.249 1.00 68.04  ? 133 SER A O   1 
ATOM   1011 C CB  . SER A 1 131 ? 35.649  -21.932 66.561 1.00 66.04  ? 133 SER A CB  1 
ATOM   1012 O OG  . SER A 1 131 ? 36.963  -22.210 66.089 1.00 69.17  ? 133 SER A OG  1 
ATOM   1013 N N   . GLN A 1 132 ? 32.791  -19.814 65.692 1.00 65.54  ? 134 GLN A N   1 
ATOM   1014 C CA  . GLN A 1 132 ? 31.506  -19.419 66.243 1.00 65.66  ? 134 GLN A CA  1 
ATOM   1015 C C   . GLN A 1 132 ? 30.448  -19.374 65.173 1.00 64.60  ? 134 GLN A C   1 
ATOM   1016 O O   . GLN A 1 132 ? 30.773  -19.201 64.006 1.00 64.15  ? 134 GLN A O   1 
ATOM   1017 C CB  . GLN A 1 132 ? 31.629  -18.053 66.856 1.00 65.35  ? 134 GLN A CB  1 
ATOM   1018 C CG  . GLN A 1 132 ? 32.567  -18.049 68.033 1.00 69.50  ? 134 GLN A CG  1 
ATOM   1019 C CD  . GLN A 1 132 ? 31.959  -18.676 69.275 1.00 74.30  ? 134 GLN A CD  1 
ATOM   1020 O OE1 . GLN A 1 132 ? 30.774  -19.081 69.309 1.00 73.88  ? 134 GLN A OE1 1 
ATOM   1021 N NE2 . GLN A 1 132 ? 32.773  -18.754 70.319 1.00 76.57  ? 134 GLN A NE2 1 
ATOM   1022 N N   . PRO A 1 133 ? 29.170  -19.555 65.545 1.00 64.89  ? 135 PRO A N   1 
ATOM   1023 C CA  . PRO A 1 133 ? 28.236  -19.176 64.476 1.00 63.97  ? 135 PRO A CA  1 
ATOM   1024 C C   . PRO A 1 133 ? 28.173  -17.644 64.382 1.00 62.62  ? 135 PRO A C   1 
ATOM   1025 O O   . PRO A 1 133 ? 28.271  -16.898 65.378 1.00 61.64  ? 135 PRO A O   1 
ATOM   1026 C CB  . PRO A 1 133 ? 26.893  -19.819 64.899 1.00 64.67  ? 135 PRO A CB  1 
ATOM   1027 C CG  . PRO A 1 133 ? 27.233  -20.664 66.161 1.00 66.99  ? 135 PRO A CG  1 
ATOM   1028 C CD  . PRO A 1 133 ? 28.480  -20.063 66.745 1.00 65.56  ? 135 PRO A CD  1 
ATOM   1029 N N   . THR A 1 134 ? 28.065  -17.157 63.173 1.00 61.80  ? 136 THR A N   1 
ATOM   1030 C CA  . THR A 1 134 ? 28.037  -15.731 63.080 1.00 61.95  ? 136 THR A CA  1 
ATOM   1031 C C   . THR A 1 134 ? 26.825  -15.305 63.897 1.00 62.63  ? 136 THR A C   1 
ATOM   1032 O O   . THR A 1 134 ? 25.764  -15.938 63.845 1.00 62.57  ? 136 THR A O   1 
ATOM   1033 C CB  . THR A 1 134 ? 27.955  -15.235 61.615 1.00 61.51  ? 136 THR A CB  1 
ATOM   1034 O OG1 . THR A 1 134 ? 26.632  -14.762 61.328 1.00 59.36  ? 136 THR A OG1 1 
ATOM   1035 C CG2 . THR A 1 134 ? 28.433  -16.358 60.588 1.00 61.56  ? 136 THR A CG2 1 
ATOM   1036 N N   . GLN A 1 135 ? 27.003  -14.247 64.672 1.00 62.99  ? 137 GLN A N   1 
ATOM   1037 C CA  . GLN A 1 135 ? 25.903  -13.616 65.362 1.00 63.32  ? 137 GLN A CA  1 
ATOM   1038 C C   . GLN A 1 135 ? 25.281  -12.633 64.390 1.00 62.65  ? 137 GLN A C   1 
ATOM   1039 O O   . GLN A 1 135 ? 25.984  -12.157 63.513 1.00 62.52  ? 137 GLN A O   1 
ATOM   1040 C CB  . GLN A 1 135 ? 26.454  -12.871 66.551 1.00 63.93  ? 137 GLN A CB  1 
ATOM   1041 C CG  . GLN A 1 135 ? 25.372  -12.340 67.492 1.00 67.41  ? 137 GLN A CG  1 
ATOM   1042 C CD  . GLN A 1 135 ? 25.951  -11.511 68.611 1.00 68.51  ? 137 GLN A CD  1 
ATOM   1043 O OE1 . GLN A 1 135 ? 27.134  -11.666 68.971 1.00 69.05  ? 137 GLN A OE1 1 
ATOM   1044 N NE2 . GLN A 1 135 ? 25.143  -10.612 69.154 1.00 68.87  ? 137 GLN A NE2 1 
ATOM   1045 N N   . GLU A 1 136 ? 23.994  -12.315 64.514 1.00 62.90  ? 138 GLU A N   1 
ATOM   1046 C CA  . GLU A 1 136 ? 23.468  -11.238 63.682 1.00 62.90  ? 138 GLU A CA  1 
ATOM   1047 C C   . GLU A 1 136 ? 22.516  -10.217 64.367 1.00 63.71  ? 138 GLU A C   1 
ATOM   1048 O O   . GLU A 1 136 ? 21.853  -10.530 65.344 1.00 65.08  ? 138 GLU A O   1 
ATOM   1049 C CB  . GLU A 1 136 ? 22.905  -11.784 62.362 1.00 62.56  ? 138 GLU A CB  1 
ATOM   1050 C CG  . GLU A 1 136 ? 21.401  -11.889 62.268 1.00 66.07  ? 138 GLU A CG  1 
ATOM   1051 C CD  . GLU A 1 136 ? 20.946  -13.016 61.324 1.00 72.25  ? 138 GLU A CD  1 
ATOM   1052 O OE1 . GLU A 1 136 ? 21.134  -14.231 61.654 1.00 73.98  ? 138 GLU A OE1 1 
ATOM   1053 O OE2 . GLU A 1 136 ? 20.391  -12.687 60.244 1.00 75.06  ? 138 GLU A OE2 1 
ATOM   1054 N N   . THR A 1 137 ? 22.490  -8.993  63.840 1.00 62.73  ? 139 THR A N   1 
ATOM   1055 C CA  . THR A 1 137 ? 21.601  -7.933  64.282 1.00 62.71  ? 139 THR A CA  1 
ATOM   1056 C C   . THR A 1 137 ? 20.836  -7.305  63.095 1.00 62.89  ? 139 THR A C   1 
ATOM   1057 O O   . THR A 1 137 ? 21.433  -6.848  62.112 1.00 62.41  ? 139 THR A O   1 
ATOM   1058 C CB  . THR A 1 137 ? 22.368  -6.849  65.032 1.00 62.99  ? 139 THR A CB  1 
ATOM   1059 O OG1 . THR A 1 137 ? 21.441  -6.012  65.706 1.00 62.40  ? 139 THR A OG1 1 
ATOM   1060 C CG2 . THR A 1 137 ? 23.136  -5.989  64.101 1.00 61.56  ? 139 THR A CG2 1 
ATOM   1061 N N   . LYS A 1 138 ? 19.513  -7.266  63.192 1.00 63.64  ? 140 LYS A N   1 
ATOM   1062 C CA  . LYS A 1 138 ? 18.677  -6.840  62.071 1.00 63.42  ? 140 LYS A CA  1 
ATOM   1063 C C   . LYS A 1 138 ? 18.009  -5.525  62.455 1.00 64.18  ? 140 LYS A C   1 
ATOM   1064 O O   . LYS A 1 138 ? 17.394  -5.452  63.510 1.00 66.16  ? 140 LYS A O   1 
ATOM   1065 C CB  . LYS A 1 138 ? 17.623  -7.947  61.744 1.00 63.75  ? 140 LYS A CB  1 
ATOM   1066 C CG  . LYS A 1 138 ? 16.680  -7.636  60.577 1.00 62.87  ? 140 LYS A CG  1 
ATOM   1067 C CD  . LYS A 1 138 ? 15.453  -8.553  60.492 1.00 64.81  ? 140 LYS A CD  1 
ATOM   1068 C CE  . LYS A 1 138 ? 14.692  -8.232  59.179 1.00 64.45  ? 140 LYS A CE  1 
ATOM   1069 N NZ  . LYS A 1 138 ? 13.239  -8.544  59.225 1.00 66.55  ? 140 LYS A NZ  1 
ATOM   1070 N N   . LYS A 1 139 ? 18.115  -4.503  61.613 1.00 63.31  ? 141 LYS A N   1 
ATOM   1071 C CA  . LYS A 1 139 ? 17.495  -3.196  61.920 1.00 65.42  ? 141 LYS A CA  1 
ATOM   1072 C C   . LYS A 1 139 ? 16.670  -2.537  60.775 1.00 66.19  ? 141 LYS A C   1 
ATOM   1073 O O   . LYS A 1 139 ? 17.239  -2.120  59.723 1.00 65.80  ? 141 LYS A O   1 
ATOM   1074 C CB  . LYS A 1 139 ? 18.542  -2.211  62.429 1.00 64.81  ? 141 LYS A CB  1 
ATOM   1075 C CG  . LYS A 1 139 ? 18.004  -0.841  62.704 1.00 65.04  ? 141 LYS A CG  1 
ATOM   1076 C CD  . LYS A 1 139 ? 17.408  -0.798  64.085 1.00 64.83  ? 141 LYS A CD  1 
ATOM   1077 C CE  . LYS A 1 139 ? 17.747  0.486   64.737 1.00 62.74  ? 141 LYS A CE  1 
ATOM   1078 N NZ  . LYS A 1 139 ? 17.928  0.180   66.146 1.00 64.19  ? 141 LYS A NZ  1 
ATOM   1079 N N   . ASN A 1 140 ? 15.358  -2.385  61.007 1.00 67.42  ? 142 ASN A N   1 
ATOM   1080 C CA  . ASN A 1 140 ? 14.449  -1.921  59.970 1.00 67.43  ? 142 ASN A CA  1 
ATOM   1081 C C   . ASN A 1 140 ? 14.674  -0.513  59.576 1.00 68.86  ? 142 ASN A C   1 
ATOM   1082 O O   . ASN A 1 140 ? 15.365  0.214   60.271 1.00 70.79  ? 142 ASN A O   1 
ATOM   1083 C CB  . ASN A 1 140 ? 13.029  -2.102  60.404 1.00 68.15  ? 142 ASN A CB  1 
ATOM   1084 C CG  . ASN A 1 140 ? 12.623  -3.524  60.329 1.00 68.52  ? 142 ASN A CG  1 
ATOM   1085 O OD1 . ASN A 1 140 ? 12.633  -4.134  59.238 1.00 70.72  ? 142 ASN A OD1 1 
ATOM   1086 N ND2 . ASN A 1 140 ? 12.302  -4.106  61.483 1.00 68.90  ? 142 ASN A ND2 1 
ATOM   1087 N N   . PHE A 1 141 ? 14.144  -0.136  58.424 1.00 69.56  ? 143 PHE A N   1 
ATOM   1088 C CA  . PHE A 1 141 ? 14.072  1.287   58.053 1.00 71.91  ? 143 PHE A CA  1 
ATOM   1089 C C   . PHE A 1 141 ? 12.895  1.595   57.109 1.00 72.45  ? 143 PHE A C   1 
ATOM   1090 O O   . PHE A 1 141 ? 12.192  0.692   56.625 1.00 70.57  ? 143 PHE A O   1 
ATOM   1091 C CB  . PHE A 1 141 ? 15.435  1.893   57.598 1.00 71.35  ? 143 PHE A CB  1 
ATOM   1092 C CG  . PHE A 1 141 ? 15.938  1.393   56.255 1.00 70.26  ? 143 PHE A CG  1 
ATOM   1093 C CD1 . PHE A 1 141 ? 15.876  2.220   55.121 1.00 72.09  ? 143 PHE A CD1 1 
ATOM   1094 C CD2 . PHE A 1 141 ? 16.498  0.116   56.124 1.00 67.50  ? 143 PHE A CD2 1 
ATOM   1095 C CE1 . PHE A 1 141 ? 16.349  1.769   53.880 1.00 69.39  ? 143 PHE A CE1 1 
ATOM   1096 C CE2 . PHE A 1 141 ? 16.990  -0.346  54.897 1.00 66.20  ? 143 PHE A CE2 1 
ATOM   1097 C CZ  . PHE A 1 141 ? 16.916  0.469   53.774 1.00 67.36  ? 143 PHE A CZ  1 
ATOM   1098 N N   . GLU A 1 142 ? 12.667  2.875   56.893 1.00 75.39  ? 144 GLU A N   1 
ATOM   1099 C CA  . GLU A 1 142 ? 11.510  3.314   56.166 1.00 77.61  ? 144 GLU A CA  1 
ATOM   1100 C C   . GLU A 1 142 ? 11.855  4.244   55.027 1.00 78.20  ? 144 GLU A C   1 
ATOM   1101 O O   . GLU A 1 142 ? 12.848  4.937   55.032 1.00 77.91  ? 144 GLU A O   1 
ATOM   1102 C CB  . GLU A 1 142 ? 10.508  3.979   57.108 1.00 20.00  ? 144 GLU A CB  1 
ATOM   1103 C CG  . GLU A 1 142 ? 10.269  3.235   58.404 1.00 20.00  ? 144 GLU A CG  1 
ATOM   1104 C CD  . GLU A 1 142 ? 8.921   2.581   58.479 1.00 20.00  ? 144 GLU A CD  1 
ATOM   1105 O OE1 . GLU A 1 142 ? 7.928   3.289   58.631 1.00 20.00  ? 144 GLU A OE1 1 
ATOM   1106 O OE2 . GLU A 1 142 ? 8.847   1.355   58.412 1.00 20.00  ? 144 GLU A OE2 1 
ATOM   1107 N N   . VAL A 1 143 ? 10.969  4.245   54.055 1.00 79.49  ? 145 VAL A N   1 
ATOM   1108 C CA  . VAL A 1 143 ? 11.120  4.965   52.845 1.00 81.08  ? 145 VAL A CA  1 
ATOM   1109 C C   . VAL A 1 143 ? 9.731   5.448   52.449 1.00 82.00  ? 145 VAL A C   1 
ATOM   1110 O O   . VAL A 1 143 ? 8.741   4.880   52.939 1.00 83.06  ? 145 VAL A O   1 
ATOM   1111 C CB  . VAL A 1 143 ? 11.597  3.971   51.841 1.00 79.26  ? 145 VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 143 ? 10.617  2.738   51.819 1.00 80.66  ? 145 VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 143 ? 11.740  4.633   50.494 1.00 81.37  ? 145 VAL A CG2 1 
ATOM   1114 N N   . ASP A 1 153 ? -7.628  1.661   43.091 1.00 75.72  ? 155 ASP A N   1 
ATOM   1115 C CA  . ASP A 1 153 ? -7.388  0.510   43.990 1.00 75.52  ? 155 ASP A CA  1 
ATOM   1116 C C   . ASP A 1 153 ? -6.316  -0.366  43.381 1.00 71.72  ? 155 ASP A C   1 
ATOM   1117 O O   . ASP A 1 153 ? -5.145  -0.079  43.539 1.00 72.33  ? 155 ASP A O   1 
ATOM   1118 C CB  . ASP A 1 153 ? -8.676  -0.317  44.255 1.00 77.64  ? 155 ASP A CB  1 
ATOM   1119 C CG  . ASP A 1 153 ? -8.468  -1.454  45.293 1.00 80.16  ? 155 ASP A CG  1 
ATOM   1120 O OD1 . ASP A 1 153 ? -8.690  -2.654  44.969 1.00 79.36  ? 155 ASP A OD1 1 
ATOM   1121 O OD2 . ASP A 1 153 ? -8.100  -1.148  46.460 1.00 85.60  ? 155 ASP A OD2 1 
ATOM   1122 N N   . LEU A 1 154 ? -6.699  -1.417  42.660 1.00 68.33  ? 156 LEU A N   1 
ATOM   1123 C CA  . LEU A 1 154 ? -5.751  -2.482  42.311 1.00 64.68  ? 156 LEU A CA  1 
ATOM   1124 C C   . LEU A 1 154 ? -6.518  -3.706  41.802 1.00 63.05  ? 156 LEU A C   1 
ATOM   1125 O O   . LEU A 1 154 ? -6.067  -4.476  40.898 1.00 59.98  ? 156 LEU A O   1 
ATOM   1126 C CB  . LEU A 1 154 ? -4.897  -2.910  43.501 1.00 64.33  ? 156 LEU A CB  1 
ATOM   1127 C CG  . LEU A 1 154 ? -4.473  -4.369  43.195 1.00 62.69  ? 156 LEU A CG  1 
ATOM   1128 C CD1 . LEU A 1 154 ? -3.368  -4.503  42.148 1.00 58.67  ? 156 LEU A CD1 1 
ATOM   1129 C CD2 . LEU A 1 154 ? -4.062  -5.068  44.426 1.00 65.46  ? 156 LEU A CD2 1 
ATOM   1130 N N   . MET A 1 155 ? -7.675  -3.885  42.422 1.00 63.27  ? 157 MET A N   1 
ATOM   1131 C CA  . MET A 1 155 ? -8.678  -4.749  41.879 1.00 62.95  ? 157 MET A CA  1 
ATOM   1132 C C   . MET A 1 155 ? -9.692  -3.927  41.104 1.00 62.34  ? 157 MET A C   1 
ATOM   1133 O O   . MET A 1 155 ? -10.618 -4.500  40.522 1.00 62.89  ? 157 MET A O   1 
ATOM   1134 C CB  . MET A 1 155 ? -9.294  -5.582  42.972 1.00 64.88  ? 157 MET A CB  1 
ATOM   1135 C CG  . MET A 1 155 ? -8.231  -6.355  43.703 1.00 68.28  ? 157 MET A CG  1 
ATOM   1136 S SD  . MET A 1 155 ? -7.860  -7.924  42.873 1.00 73.75  ? 157 MET A SD  1 
ATOM   1137 C CE  . MET A 1 155 ? -6.311  -7.666  42.066 1.00 69.13  ? 157 MET A CE  1 
ATOM   1138 N N   . ALA A 1 156 ? -9.481  -2.599  41.084 1.00 61.80  ? 158 ALA A N   1 
ATOM   1139 C CA  . ALA A 1 156 ? -10.226 -1.651  40.225 1.00 62.04  ? 158 ALA A CA  1 
ATOM   1140 C C   . ALA A 1 156 ? -9.918  -1.865  38.748 1.00 60.50  ? 158 ALA A C   1 
ATOM   1141 O O   . ALA A 1 156 ? -8.757  -2.194  38.367 1.00 58.95  ? 158 ALA A O   1 
ATOM   1142 C CB  . ALA A 1 156 ? -9.903  -0.235  40.594 1.00 61.82  ? 158 ALA A CB  1 
ATOM   1143 N N   . PRO A 1 157 ? -10.944 -1.732  37.904 1.00 60.24  ? 159 PRO A N   1 
ATOM   1144 C CA  . PRO A 1 157 ? -10.733 -1.703  36.471 1.00 58.27  ? 159 PRO A CA  1 
ATOM   1145 C C   . PRO A 1 157 ? -9.733  -0.656  36.029 1.00 57.19  ? 159 PRO A C   1 
ATOM   1146 O O   . PRO A 1 157 ? -9.615  0.430   36.634 1.00 57.30  ? 159 PRO A O   1 
ATOM   1147 C CB  . PRO A 1 157 ? -12.119 -1.378  35.926 1.00 58.58  ? 159 PRO A CB  1 
ATOM   1148 C CG  . PRO A 1 157 ? -12.983 -2.009  36.849 1.00 61.32  ? 159 PRO A CG  1 
ATOM   1149 C CD  . PRO A 1 157 ? -12.369 -1.736  38.207 1.00 62.51  ? 159 PRO A CD  1 
ATOM   1150 N N   . VAL A 1 158 ? -9.023  -1.030  34.971 1.00 55.75  ? 160 VAL A N   1 
ATOM   1151 C CA  . VAL A 1 158 ? -8.142  -0.145  34.256 1.00 54.95  ? 160 VAL A CA  1 
ATOM   1152 C C   . VAL A 1 158 ? -8.724  0.045   32.899 1.00 54.39  ? 160 VAL A C   1 
ATOM   1153 O O   . VAL A 1 158 ? -9.312  -0.868  32.318 1.00 54.78  ? 160 VAL A O   1 
ATOM   1154 C CB  . VAL A 1 158 ? -6.779  -0.731  34.037 1.00 54.07  ? 160 VAL A CB  1 
ATOM   1155 C CG1 . VAL A 1 158 ? -5.788  0.411   33.739 1.00 54.74  ? 160 VAL A CG1 1 
ATOM   1156 C CG2 . VAL A 1 158 ? -6.340  -1.592  35.260 1.00 53.54  ? 160 VAL A CG2 1 
ATOM   1157 N N   . SER A 1 159 ? -8.566  1.259   32.404 1.00 53.90  ? 161 SER A N   1 
ATOM   1158 C CA  . SER A 1 159 ? -9.042  1.632   31.096 1.00 52.10  ? 161 SER A CA  1 
ATOM   1159 C C   . SER A 1 159 ? -8.120  2.768   30.665 1.00 51.13  ? 161 SER A C   1 
ATOM   1160 O O   . SER A 1 159 ? -7.627  3.517   31.523 1.00 51.17  ? 161 SER A O   1 
ATOM   1161 C CB  . SER A 1 159 ? -10.415 2.189   31.218 1.00 53.34  ? 161 SER A CB  1 
ATOM   1162 O OG  . SER A 1 159 ? -10.208 3.532   31.535 1.00 55.49  ? 161 SER A OG  1 
ATOM   1163 N N   . ALA A 1 160 ? -7.872  2.877   29.349 1.00 48.72  ? 162 ALA A N   1 
ATOM   1164 C CA  . ALA A 1 160 ? -6.943  3.869   28.807 1.00 46.57  ? 162 ALA A CA  1 
ATOM   1165 C C   . ALA A 1 160 ? -7.309  4.164   27.363 1.00 45.98  ? 162 ALA A C   1 
ATOM   1166 O O   . ALA A 1 160 ? -7.917  3.327   26.673 1.00 44.94  ? 162 ALA A O   1 
ATOM   1167 C CB  . ALA A 1 160 ? -5.531  3.380   28.918 1.00 44.63  ? 162 ALA A CB  1 
ATOM   1168 N N   . LYS A 1 161 ? -6.947  5.356   26.890 1.00 46.15  ? 163 LYS A N   1 
ATOM   1169 C CA  . LYS A 1 161 ? -7.161  5.673   25.496 1.00 45.44  ? 163 LYS A CA  1 
ATOM   1170 C C   . LYS A 1 161 ? -6.021  6.439   24.841 1.00 44.05  ? 163 LYS A C   1 
ATOM   1171 O O   . LYS A 1 161 ? -5.299  7.135   25.488 1.00 44.51  ? 163 LYS A O   1 
ATOM   1172 C CB  . LYS A 1 161 ? -8.557  6.265   25.305 1.00 46.66  ? 163 LYS A CB  1 
ATOM   1173 C CG  . LYS A 1 161 ? -8.625  7.735   25.019 1.00 54.97  ? 163 LYS A CG  1 
ATOM   1174 C CD  . LYS A 1 161 ? -8.944  8.617   26.230 1.00 64.66  ? 163 LYS A CD  1 
ATOM   1175 C CE  . LYS A 1 161 ? -8.880  10.121  25.844 1.00 71.16  ? 163 LYS A CE  1 
ATOM   1176 N NZ  . LYS A 1 161 ? -9.379  10.375  24.420 1.00 72.75  ? 163 LYS A NZ  1 
ATOM   1177 N N   . LYS A 1 162 ? -5.816  6.271   23.546 1.00 43.76  ? 164 LYS A N   1 
ATOM   1178 C CA  . LYS A 1 162 ? -4.792  7.055   22.811 1.00 44.09  ? 164 LYS A CA  1 
ATOM   1179 C C   . LYS A 1 162 ? -5.211  7.289   21.375 1.00 44.31  ? 164 LYS A C   1 
ATOM   1180 O O   . LYS A 1 162 ? -5.750  6.379   20.716 1.00 42.94  ? 164 LYS A O   1 
ATOM   1181 C CB  . LYS A 1 162 ? -3.432  6.403   22.806 1.00 42.65  ? 164 LYS A CB  1 
ATOM   1182 C CG  . LYS A 1 162 ? -2.281  7.357   22.589 1.00 46.51  ? 164 LYS A CG  1 
ATOM   1183 C CD  . LYS A 1 162 ? -1.455  7.503   23.896 1.00 54.63  ? 164 LYS A CD  1 
ATOM   1184 C CE  . LYS A 1 162 ? 0.104   7.570   23.687 1.00 57.10  ? 164 LYS A CE  1 
ATOM   1185 N NZ  . LYS A 1 162 ? 0.723   6.200   23.487 1.00 56.48  ? 164 LYS A NZ  1 
ATOM   1186 N N   . GLU A 1 163 ? -4.977  8.531   20.923 1.00 45.98  ? 165 GLU A N   1 
ATOM   1187 C CA  . GLU A 1 163 ? -5.198  8.963   19.554 1.00 46.12  ? 165 GLU A CA  1 
ATOM   1188 C C   . GLU A 1 163 ? -3.959  9.529   18.946 1.00 46.39  ? 165 GLU A C   1 
ATOM   1189 O O   . GLU A 1 163 ? -3.168  10.153  19.625 1.00 47.50  ? 165 GLU A O   1 
ATOM   1190 C CB  . GLU A 1 163 ? -6.255  10.014  19.481 1.00 47.63  ? 165 GLU A CB  1 
ATOM   1191 C CG  . GLU A 1 163 ? -7.071  9.817   18.242 1.00 52.62  ? 165 GLU A CG  1 
ATOM   1192 C CD  . GLU A 1 163 ? -8.161  10.814  18.126 1.00 60.76  ? 165 GLU A CD  1 
ATOM   1193 O OE1 . GLU A 1 163 ? -8.067  11.789  18.908 1.00 67.69  ? 165 GLU A OE1 1 
ATOM   1194 O OE2 . GLU A 1 163 ? -9.075  10.638  17.269 1.00 60.65  ? 165 GLU A OE2 1 
ATOM   1195 N N   . LYS A 1 164 ? -3.780  9.297   17.655 1.00 46.43  ? 166 LYS A N   1 
ATOM   1196 C CA  . LYS A 1 164 ? -2.612  9.803   16.927 1.00 48.04  ? 166 LYS A CA  1 
ATOM   1197 C C   . LYS A 1 164 ? -3.089  10.260  15.585 1.00 47.22  ? 166 LYS A C   1 
ATOM   1198 O O   . LYS A 1 164 ? -3.800  9.540   14.904 1.00 46.62  ? 166 LYS A O   1 
ATOM   1199 C CB  . LYS A 1 164 ? -1.515  8.733   16.754 1.00 48.00  ? 166 LYS A CB  1 
ATOM   1200 C CG  . LYS A 1 164 ? -0.330  9.187   15.917 1.00 53.04  ? 166 LYS A CG  1 
ATOM   1201 C CD  . LYS A 1 164 ? 0.973   9.414   16.701 1.00 60.74  ? 166 LYS A CD  1 
ATOM   1202 C CE  . LYS A 1 164 ? 1.842   8.089   16.816 1.00 64.46  ? 166 LYS A CE  1 
ATOM   1203 N NZ  . LYS A 1 164 ? 2.193   7.424   15.481 1.00 64.67  ? 166 LYS A NZ  1 
ATOM   1204 N N   . LYS A 1 165 ? -2.718  11.480  15.246 1.00 47.90  ? 167 LYS A N   1 
ATOM   1205 C CA  . LYS A 1 165 ? -2.961  12.057  13.960 1.00 47.63  ? 167 LYS A CA  1 
ATOM   1206 C C   . LYS A 1 165 ? -2.155  11.273  12.939 1.00 46.17  ? 167 LYS A C   1 
ATOM   1207 O O   . LYS A 1 165 ? -0.987  11.003  13.130 1.00 46.88  ? 167 LYS A O   1 
ATOM   1208 C CB  . LYS A 1 165 ? -2.508  13.507  14.006 1.00 49.44  ? 167 LYS A CB  1 
ATOM   1209 C CG  . LYS A 1 165 ? -2.493  14.174  12.670 1.00 55.06  ? 167 LYS A CG  1 
ATOM   1210 C CD  . LYS A 1 165 ? -1.823  15.570  12.746 1.00 62.68  ? 167 LYS A CD  1 
ATOM   1211 C CE  . LYS A 1 165 ? -2.354  16.544  11.648 1.00 64.26  ? 167 LYS A CE  1 
ATOM   1212 N NZ  . LYS A 1 165 ? -1.332  17.624  11.469 1.00 68.72  ? 167 LYS A NZ  1 
ATOM   1213 N N   . VAL A 1 166 ? -2.783  10.882  11.853 1.00 44.60  ? 168 VAL A N   1 
ATOM   1214 C CA  . VAL A 1 166 ? -2.086  10.139  10.830 1.00 43.85  ? 168 VAL A CA  1 
ATOM   1215 C C   . VAL A 1 166 ? -2.660  10.646  9.522  1.00 45.49  ? 168 VAL A C   1 
ATOM   1216 O O   . VAL A 1 166 ? -3.698  10.194  9.050  1.00 44.09  ? 168 VAL A O   1 
ATOM   1217 C CB  . VAL A 1 166 ? -2.282  8.619   10.992 1.00 42.32  ? 168 VAL A CB  1 
ATOM   1218 C CG1 . VAL A 1 166 ? -1.928  7.868   9.689  1.00 40.54  ? 168 VAL A CG1 1 
ATOM   1219 C CG2 . VAL A 1 166 ? -1.537  8.104   12.207 1.00 35.74  ? 168 VAL A CG2 1 
ATOM   1220 N N   . SER A 1 167 ? -1.967  11.633  8.967  1.00 48.77  ? 169 SER A N   1 
ATOM   1221 C CA  . SER A 1 167 ? -2.497  12.462  7.910  1.00 50.18  ? 169 SER A CA  1 
ATOM   1222 C C   . SER A 1 167 ? -2.047  12.031  6.529  1.00 51.27  ? 169 SER A C   1 
ATOM   1223 O O   . SER A 1 167 ? -1.117  11.205  6.351  1.00 51.92  ? 169 SER A O   1 
ATOM   1224 C CB  . SER A 1 167 ? -2.041  13.874  8.124  1.00 52.59  ? 169 SER A CB  1 
ATOM   1225 O OG  . SER A 1 167 ? -0.771  13.991  7.534  1.00 53.76  ? 169 SER A OG  1 
ATOM   1226 N N   . SER A 1 168 ? -2.701  12.655  5.559  1.00 51.78  ? 170 SER A N   1 
ATOM   1227 C CA  . SER A 1 168 ? -2.693  12.234  4.182  1.00 52.42  ? 170 SER A CA  1 
ATOM   1228 C C   . SER A 1 168 ? -2.965  13.492  3.379  1.00 54.07  ? 170 SER A C   1 
ATOM   1229 O O   . SER A 1 168 ? -3.586  14.437  3.893  1.00 54.37  ? 170 SER A O   1 
ATOM   1230 C CB  . SER A 1 168 ? -3.845  11.276  3.973  1.00 49.94  ? 170 SER A CB  1 
ATOM   1231 O OG  . SER A 1 168 ? -3.340  10.166  3.298  1.00 52.89  ? 170 SER A OG  1 
ATOM   1232 N N   . MET A 1 169 ? -2.558  13.528  2.124  1.00 55.10  ? 171 MET A N   1 
ATOM   1233 C CA  . MET A 1 169 ? -2.890  14.707  1.325  1.00 57.36  ? 171 MET A CA  1 
ATOM   1234 C C   . MET A 1 169 ? -4.427  14.834  1.228  1.00 55.89  ? 171 MET A C   1 
ATOM   1235 O O   . MET A 1 169 ? -4.988  15.882  1.500  1.00 56.07  ? 171 MET A O   1 
ATOM   1236 C CB  . MET A 1 169 ? -2.146  14.678  -0.033 1.00 59.58  ? 171 MET A CB  1 
ATOM   1237 C CG  . MET A 1 169 ? -2.524  15.754  -1.046 1.00 62.28  ? 171 MET A CG  1 
ATOM   1238 S SD  . MET A 1 169 ? -1.283  16.061  -2.352 1.00 65.03  ? 171 MET A SD  1 
ATOM   1239 C CE  . MET A 1 169 ? -2.492  16.308  -3.669 1.00 65.65  ? 171 MET A CE  1 
ATOM   1240 N N   . PHE A 1 170 ? -5.109  13.742  0.909  1.00 54.85  ? 172 PHE A N   1 
ATOM   1241 C CA  . PHE A 1 170 ? -6.566  13.768  0.880  1.00 54.73  ? 172 PHE A CA  1 
ATOM   1242 C C   . PHE A 1 170 ? -7.280  13.567  2.221  1.00 53.22  ? 172 PHE A C   1 
ATOM   1243 O O   . PHE A 1 170 ? -8.459  13.818  2.305  1.00 52.30  ? 172 PHE A O   1 
ATOM   1244 C CB  . PHE A 1 170 ? -7.091  12.851  -0.227 1.00 54.72  ? 172 PHE A CB  1 
ATOM   1245 C CG  . PHE A 1 170 ? -6.518  13.195  -1.604 1.00 59.71  ? 172 PHE A CG  1 
ATOM   1246 C CD1 . PHE A 1 170 ? -6.988  14.294  -2.323 1.00 62.71  ? 172 PHE A CD1 1 
ATOM   1247 C CD2 . PHE A 1 170 ? -5.487  12.436  -2.165 1.00 62.93  ? 172 PHE A CD2 1 
ATOM   1248 C CE1 . PHE A 1 170 ? -6.438  14.616  -3.585 1.00 68.07  ? 172 PHE A CE1 1 
ATOM   1249 C CE2 . PHE A 1 170 ? -4.942  12.757  -3.437 1.00 67.34  ? 172 PHE A CE2 1 
ATOM   1250 C CZ  . PHE A 1 170 ? -5.422  13.841  -4.146 1.00 68.66  ? 172 PHE A CZ  1 
ATOM   1251 N N   . ILE A 1 171 ? -6.559  13.163  3.276  1.00 53.88  ? 173 ILE A N   1 
ATOM   1252 C CA  . ILE A 1 171 ? -7.122  13.062  4.631  1.00 51.78  ? 173 ILE A CA  1 
ATOM   1253 C C   . ILE A 1 171 ? -6.216  13.762  5.640  1.00 53.64  ? 173 ILE A C   1 
ATOM   1254 O O   . ILE A 1 171 ? -5.713  13.142  6.568  1.00 52.63  ? 173 ILE A O   1 
ATOM   1255 C CB  . ILE A 1 171 ? -7.400  11.585  5.056  1.00 49.12  ? 173 ILE A CB  1 
ATOM   1256 C CG1 . ILE A 1 171 ? -8.151  10.824  3.963  1.00 47.94  ? 173 ILE A CG1 1 
ATOM   1257 C CG2 . ILE A 1 171 ? -8.244  11.557  6.245  1.00 45.28  ? 173 ILE A CG2 1 
ATOM   1258 C CD1 . ILE A 1 171 ? -8.048  9.311   4.061  1.00 44.64  ? 173 ILE A CD1 1 
ATOM   1259 N N   . PRO A 1 172 ? -6.050  15.091  5.508  1.00 56.53  ? 174 PRO A N   1 
ATOM   1260 C CA  . PRO A 1 172 ? -5.083  15.797  6.369  1.00 58.51  ? 174 PRO A CA  1 
ATOM   1261 C C   . PRO A 1 172 ? -5.440  15.712  7.863  1.00 58.24  ? 174 PRO A C   1 
ATOM   1262 O O   . PRO A 1 172 ? -4.611  15.982  8.721  1.00 59.61  ? 174 PRO A O   1 
ATOM   1263 C CB  . PRO A 1 172 ? -5.177  17.240  5.875  1.00 60.19  ? 174 PRO A CB  1 
ATOM   1264 C CG  . PRO A 1 172 ? -6.490  17.349  5.294  1.00 58.89  ? 174 PRO A CG  1 
ATOM   1265 C CD  . PRO A 1 172 ? -6.777  16.035  4.641  1.00 57.82  ? 174 PRO A CD  1 
ATOM   1266 N N   . ASP A 1 173 ? -6.666  15.311  8.173  1.00 57.83  ? 175 ASP A N   1 
ATOM   1267 C CA  . ASP A 1 173 ? -7.087  15.143  9.579  1.00 56.62  ? 175 ASP A CA  1 
ATOM   1268 C C   . ASP A 1 173 ? -7.293  13.699  10.010 1.00 52.29  ? 175 ASP A C   1 
ATOM   1269 O O   . ASP A 1 173 ? -8.089  13.462  10.901 1.00 49.70  ? 175 ASP A O   1 
ATOM   1270 C CB  . ASP A 1 173 ? -8.390  15.889  9.808  1.00 58.19  ? 175 ASP A CB  1 
ATOM   1271 C CG  . ASP A 1 173 ? -8.342  16.741  11.055 1.00 66.04  ? 175 ASP A CG  1 
ATOM   1272 O OD1 . ASP A 1 173 ? -8.446  16.173  12.193 1.00 71.18  ? 175 ASP A OD1 1 
ATOM   1273 O OD2 . ASP A 1 173 ? -8.206  17.987  10.891 1.00 74.00  ? 175 ASP A OD2 1 
ATOM   1274 N N   . GLY A 1 174 ? -6.609  12.755  9.343  1.00 50.76  ? 176 GLY A N   1 
ATOM   1275 C CA  . GLY A 1 174 ? -6.723  11.305  9.606  1.00 47.24  ? 176 GLY A CA  1 
ATOM   1276 C C   . GLY A 1 174 ? -6.222  10.947  10.993 1.00 46.79  ? 176 GLY A C   1 
ATOM   1277 O O   . GLY A 1 174 ? -5.226  11.510  11.500 1.00 48.52  ? 176 GLY A O   1 
ATOM   1278 N N   . ARG A 1 175 ? -6.953  10.059  11.653 1.00 44.47  ? 177 ARG A N   1 
ATOM   1279 C CA  . ARG A 1 175 ? -6.657  9.752   13.034 1.00 44.06  ? 177 ARG A CA  1 
ATOM   1280 C C   . ARG A 1 175 ? -6.595  8.275   13.191 1.00 40.41  ? 177 ARG A C   1 
ATOM   1281 O O   . ARG A 1 175 ? -7.162  7.555   12.426 1.00 38.99  ? 177 ARG A O   1 
ATOM   1282 C CB  . ARG A 1 175 ? -7.684  10.400  13.986 1.00 45.10  ? 177 ARG A CB  1 
ATOM   1283 C CG  . ARG A 1 175 ? -7.733  11.910  13.782 1.00 53.71  ? 177 ARG A CG  1 
ATOM   1284 C CD  . ARG A 1 175 ? -7.730  12.768  15.096 1.00 66.19  ? 177 ARG A CD  1 
ATOM   1285 N NE  . ARG A 1 175 ? -7.703  14.231  14.872 1.00 72.49  ? 177 ARG A NE  1 
ATOM   1286 C CZ  . ARG A 1 175 ? -8.244  15.118  15.719 1.00 79.78  ? 177 ARG A CZ  1 
ATOM   1287 N NH1 . ARG A 1 175 ? -8.856  14.685  16.821 1.00 80.58  ? 177 ARG A NH1 1 
ATOM   1288 N NH2 . ARG A 1 175 ? -8.192  16.440  15.482 1.00 83.16  ? 177 ARG A NH2 1 
ATOM   1289 N N   . VAL A 1 176 ? -5.872  7.817   14.182 1.00 39.26  ? 178 VAL A N   1 
ATOM   1290 C CA  . VAL A 1 176 ? -6.006  6.432   14.604 1.00 37.36  ? 178 VAL A CA  1 
ATOM   1291 C C   . VAL A 1 176 ? -6.152  6.343   16.108 1.00 37.24  ? 178 VAL A C   1 
ATOM   1292 O O   . VAL A 1 176 ? -5.397  6.951   16.834 1.00 37.67  ? 178 VAL A O   1 
ATOM   1293 C CB  . VAL A 1 176 ? -4.810  5.610   14.207 1.00 36.48  ? 178 VAL A CB  1 
ATOM   1294 C CG1 . VAL A 1 176 ? -4.862  4.320   14.926 1.00 36.04  ? 178 VAL A CG1 1 
ATOM   1295 C CG2 . VAL A 1 176 ? -4.857  5.376   12.731 1.00 37.09  ? 178 VAL A CG2 1 
ATOM   1296 N N   . SER A 1 177 ? -7.124  5.606   16.593 1.00 36.88  ? 179 SER A N   1 
ATOM   1297 C CA  . SER A 1 177 ? -7.164  5.470   17.999 1.00 38.12  ? 179 SER A CA  1 
ATOM   1298 C C   . SER A 1 177 ? -7.490  4.100   18.516 1.00 37.43  ? 179 SER A C   1 
ATOM   1299 O O   . SER A 1 177 ? -7.992  3.206   17.841 1.00 35.64  ? 179 SER A O   1 
ATOM   1300 C CB  . SER A 1 177 ? -8.114  6.482   18.603 1.00 39.11  ? 179 SER A CB  1 
ATOM   1301 O OG  . SER A 1 177 ? -9.389  6.226   18.078 1.00 44.09  ? 179 SER A OG  1 
ATOM   1302 N N   . VAL A 1 178 ? -7.158  3.979   19.784 1.00 38.06  ? 180 VAL A N   1 
ATOM   1303 C CA  . VAL A 1 178 ? -7.314  2.772   20.514 1.00 37.35  ? 180 VAL A CA  1 
ATOM   1304 C C   . VAL A 1 178 ? -7.711  3.211   21.906 1.00 37.13  ? 180 VAL A C   1 
ATOM   1305 O O   . VAL A 1 178 ? -7.089  4.075   22.497 1.00 36.89  ? 180 VAL A O   1 
ATOM   1306 C CB  . VAL A 1 178 ? -5.993  1.991   20.541 1.00 37.26  ? 180 VAL A CB  1 
ATOM   1307 C CG1 . VAL A 1 178 ? -4.820  2.928   20.918 1.00 38.09  ? 180 VAL A CG1 1 
ATOM   1308 C CG2 . VAL A 1 178 ? -6.105  0.802   21.493 1.00 36.69  ? 180 VAL A CG2 1 
ATOM   1309 N N   . SER A 1 179 ? -8.768  2.581   22.390 1.00 37.21  ? 181 SER A N   1 
ATOM   1310 C CA  . SER A 1 179 ? -9.312  2.775   23.713 1.00 37.49  ? 181 SER A CA  1 
ATOM   1311 C C   . SER A 1 179 ? -9.505  1.359   24.280 1.00 37.13  ? 181 SER A C   1 
ATOM   1312 O O   . SER A 1 179 ? -10.062 0.511   23.618 1.00 36.94  ? 181 SER A O   1 
ATOM   1313 C CB  . SER A 1 179 ? -10.617 3.466   23.547 1.00 36.88  ? 181 SER A CB  1 
ATOM   1314 O OG  . SER A 1 179 ? -11.236 3.491   24.770 1.00 41.45  ? 181 SER A OG  1 
ATOM   1315 N N   . ALA A 1 180 ? -9.034  1.107   25.490 1.00 37.74  ? 182 ALA A N   1 
ATOM   1316 C CA  . ALA A 1 180 ? -8.887  -0.267  26.012 1.00 37.64  ? 182 ALA A CA  1 
ATOM   1317 C C   . ALA A 1 180 ? -9.395  -0.351  27.412 1.00 38.63  ? 182 ALA A C   1 
ATOM   1318 O O   . ALA A 1 180 ? -9.210  0.618   28.146 1.00 39.11  ? 182 ALA A O   1 
ATOM   1319 C CB  . ALA A 1 180 ? -7.438  -0.665  26.016 1.00 35.93  ? 182 ALA A CB  1 
ATOM   1320 N N   . ARG A 1 181 ? -9.995  -1.493  27.800 1.00 39.41  ? 183 ARG A N   1 
ATOM   1321 C CA  . ARG A 1 181 ? -10.296 -1.780  29.238 1.00 40.94  ? 183 ARG A CA  1 
ATOM   1322 C C   . ARG A 1 181 ? -10.167 -3.219  29.649 1.00 41.65  ? 183 ARG A C   1 
ATOM   1323 O O   . ARG A 1 181 ? -10.445 -4.168  28.867 1.00 42.32  ? 183 ARG A O   1 
ATOM   1324 C CB  . ARG A 1 181 ? -11.676 -1.406  29.655 1.00 40.95  ? 183 ARG A CB  1 
ATOM   1325 C CG  . ARG A 1 181 ? -12.322 -0.479  28.820 1.00 43.96  ? 183 ARG A CG  1 
ATOM   1326 C CD  . ARG A 1 181 ? -13.825 -0.564  29.049 1.00 49.92  ? 183 ARG A CD  1 
ATOM   1327 N NE  . ARG A 1 181 ? -14.174 0.192   30.241 1.00 58.50  ? 183 ARG A NE  1 
ATOM   1328 C CZ  . ARG A 1 181 ? -14.591 1.460   30.214 1.00 59.89  ? 183 ARG A CZ  1 
ATOM   1329 N NH1 . ARG A 1 181 ? -14.730 2.077   29.036 1.00 57.33  ? 183 ARG A NH1 1 
ATOM   1330 N NH2 . ARG A 1 181 ? -14.890 2.082   31.351 1.00 57.76  ? 183 ARG A NH2 1 
ATOM   1331 N N   . ILE A 1 182 ? -9.734  -3.368  30.903 1.00 42.52  ? 184 ILE A N   1 
ATOM   1332 C CA  . ILE A 1 182 ? -9.552  -4.669  31.578 1.00 41.66  ? 184 ILE A CA  1 
ATOM   1333 C C   . ILE A 1 182 ? -9.997  -4.568  33.009 1.00 43.39  ? 184 ILE A C   1 
ATOM   1334 O O   . ILE A 1 182 ? -10.208 -3.496  33.542 1.00 43.80  ? 184 ILE A O   1 
ATOM   1335 C CB  . ILE A 1 182 ? -8.122  -5.117  31.572 1.00 39.49  ? 184 ILE A CB  1 
ATOM   1336 C CG1 . ILE A 1 182 ? -7.285  -4.085  32.307 1.00 38.62  ? 184 ILE A CG1 1 
ATOM   1337 C CG2 . ILE A 1 182 ? -7.668  -5.292  30.154 1.00 35.49  ? 184 ILE A CG2 1 
ATOM   1338 C CD1 . ILE A 1 182 ? -5.843  -4.523  32.644 1.00 40.24  ? 184 ILE A CD1 1 
ATOM   1339 N N   . ASP A 1 183 ? -10.113 -5.713  33.637 1.00 45.82  ? 185 ASP A N   1 
ATOM   1340 C CA  . ASP A 1 183 ? -10.922 -5.841  34.867 1.00 48.80  ? 185 ASP A CA  1 
ATOM   1341 C C   . ASP A 1 183 ? -10.246 -5.363  36.122 1.00 49.22  ? 185 ASP A C   1 
ATOM   1342 O O   . ASP A 1 183 ? -10.912 -5.137  37.111 1.00 51.74  ? 185 ASP A O   1 
ATOM   1343 C CB  . ASP A 1 183 ? -11.314 -7.298  35.088 1.00 49.75  ? 185 ASP A CB  1 
ATOM   1344 C CG  . ASP A 1 183 ? -12.203 -7.826  34.009 1.00 51.54  ? 185 ASP A CG  1 
ATOM   1345 O OD1 . ASP A 1 183 ? -12.521 -9.029  34.000 1.00 55.86  ? 185 ASP A OD1 1 
ATOM   1346 O OD2 . ASP A 1 183 ? -12.639 -7.043  33.168 1.00 56.77  ? 185 ASP A OD2 1 
ATOM   1347 N N   . ARG A 1 184 ? -8.935  -5.251  36.087 1.00 47.88  ? 186 ARG A N   1 
ATOM   1348 C CA  . ARG A 1 184 ? -8.184  -4.996  37.279 1.00 49.66  ? 186 ARG A CA  1 
ATOM   1349 C C   . ARG A 1 184 ? -6.745  -5.110  36.920 1.00 48.60  ? 186 ARG A C   1 
ATOM   1350 O O   . ARG A 1 184 ? -6.400  -5.611  35.867 1.00 47.45  ? 186 ARG A O   1 
ATOM   1351 C CB  . ARG A 1 184 ? -8.477  -6.047  38.329 1.00 51.69  ? 186 ARG A CB  1 
ATOM   1352 C CG  . ARG A 1 184 ? -8.062  -7.508  37.937 1.00 51.13  ? 186 ARG A CG  1 
ATOM   1353 C CD  . ARG A 1 184 ? -8.656  -8.421  38.967 1.00 51.11  ? 186 ARG A CD  1 
ATOM   1354 N NE  . ARG A 1 184 ? -8.242  -9.777  38.747 1.00 55.68  ? 186 ARG A NE  1 
ATOM   1355 C CZ  . ARG A 1 184 ? -8.855  -10.613 37.910 1.00 58.45  ? 186 ARG A CZ  1 
ATOM   1356 N NH1 . ARG A 1 184 ? -9.919  -10.183 37.225 1.00 57.06  ? 186 ARG A NH1 1 
ATOM   1357 N NH2 . ARG A 1 184 ? -8.411  -11.876 37.769 1.00 57.67  ? 186 ARG A NH2 1 
ATOM   1358 N N   . LYS A 1 185 ? -5.908  -4.663  37.826 1.00 49.79  ? 187 LYS A N   1 
ATOM   1359 C CA  . LYS A 1 185 ? -4.514  -4.527  37.557 1.00 49.36  ? 187 LYS A CA  1 
ATOM   1360 C C   . LYS A 1 185 ? -3.763  -5.782  37.997 1.00 49.39  ? 187 LYS A C   1 
ATOM   1361 O O   . LYS A 1 185 ? -2.590  -5.935  37.654 1.00 48.88  ? 187 LYS A O   1 
ATOM   1362 C CB  . LYS A 1 185 ? -4.037  -3.328  38.348 1.00 50.45  ? 187 LYS A CB  1 
ATOM   1363 C CG  . LYS A 1 185 ? -2.700  -2.816  37.939 1.00 53.70  ? 187 LYS A CG  1 
ATOM   1364 C CD  . LYS A 1 185 ? -2.299  -1.477  38.639 1.00 59.20  ? 187 LYS A CD  1 
ATOM   1365 C CE  . LYS A 1 185 ? -0.750  -1.323  38.488 1.00 62.72  ? 187 LYS A CE  1 
ATOM   1366 N NZ  . LYS A 1 185 ? -0.063  -0.270  39.330 1.00 66.55  ? 187 LYS A NZ  1 
ATOM   1367 N N   . GLY A 1 186 ? -4.427  -6.677  38.753 1.00 50.45  ? 188 GLY A N   1 
ATOM   1368 C CA  . GLY A 1 186 ? -3.727  -7.746  39.474 1.00 50.37  ? 188 GLY A CA  1 
ATOM   1369 C C   . GLY A 1 186 ? -4.129  -9.127  39.028 1.00 51.54  ? 188 GLY A C   1 
ATOM   1370 O O   . GLY A 1 186 ? -5.283  -9.464  39.184 1.00 54.08  ? 188 GLY A O   1 
ATOM   1371 N N   . PHE A 1 187 ? -3.206  -9.936  38.478 1.00 50.72  ? 189 PHE A N   1 
ATOM   1372 C CA  . PHE A 1 187 ? -3.577  -11.261 37.948 1.00 51.73  ? 189 PHE A CA  1 
ATOM   1373 C C   . PHE A 1 187 ? -2.707  -12.435 38.412 1.00 53.26  ? 189 PHE A C   1 
ATOM   1374 O O   . PHE A 1 187 ? -1.514  -12.296 38.640 1.00 51.34  ? 189 PHE A O   1 
ATOM   1375 C CB  . PHE A 1 187 ? -3.625  -11.272 36.391 1.00 50.67  ? 189 PHE A CB  1 
ATOM   1376 C CG  . PHE A 1 187 ? -4.642  -10.314 35.773 1.00 46.92  ? 189 PHE A CG  1 
ATOM   1377 C CD1 . PHE A 1 187 ? -5.947  -10.741 35.502 1.00 47.34  ? 189 PHE A CD1 1 
ATOM   1378 C CD2 . PHE A 1 187 ? -4.280  -9.000  35.453 1.00 42.91  ? 189 PHE A CD2 1 
ATOM   1379 C CE1 . PHE A 1 187 ? -6.893  -9.866  34.929 1.00 48.16  ? 189 PHE A CE1 1 
ATOM   1380 C CE2 . PHE A 1 187 ? -5.195  -8.109  34.858 1.00 43.13  ? 189 PHE A CE2 1 
ATOM   1381 C CZ  . PHE A 1 187 ? -6.507  -8.535  34.595 1.00 46.85  ? 189 PHE A CZ  1 
ATOM   1382 N N   . CYS A 1 188 ? -3.322  -13.609 38.517 1.00 56.53  ? 190 CYS A N   1 
ATOM   1383 C CA  . CYS A 1 188 ? -2.617  -14.798 38.921 1.00 59.34  ? 190 CYS A CA  1 
ATOM   1384 C C   . CYS A 1 188 ? -2.172  -15.465 37.657 1.00 58.49  ? 190 CYS A C   1 
ATOM   1385 O O   . CYS A 1 188 ? -2.984  -15.587 36.723 1.00 58.64  ? 190 CYS A O   1 
ATOM   1386 C CB  . CYS A 1 188 ? -3.596  -15.759 39.589 1.00 62.84  ? 190 CYS A CB  1 
ATOM   1387 S SG  . CYS A 1 188 ? -4.177  -15.488 41.325 1.00 72.44  ? 190 CYS A SG  1 
ATOM   1388 N N   . GLU A 1 189 ? -0.924  -15.932 37.623 1.00 57.68  ? 191 GLU A N   1 
ATOM   1389 C CA  . GLU A 1 189 ? -0.492  -16.920 36.624 1.00 58.58  ? 191 GLU A CA  1 
ATOM   1390 C C   . GLU A 1 189 ? -1.568  -17.932 36.229 1.00 60.30  ? 191 GLU A C   1 
ATOM   1391 O O   . GLU A 1 189 ? -2.261  -18.489 37.115 1.00 63.21  ? 191 GLU A O   1 
ATOM   1392 C CB  . GLU A 1 189 ? 0.676   -17.713 37.177 1.00 59.57  ? 191 GLU A CB  1 
ATOM   1393 C CG  . GLU A 1 189 ? 1.975   -17.041 36.847 1.00 62.03  ? 191 GLU A CG  1 
ATOM   1394 C CD  . GLU A 1 189 ? 3.133   -17.531 37.658 1.00 65.36  ? 191 GLU A CD  1 
ATOM   1395 O OE1 . GLU A 1 189 ? 4.211   -16.872 37.518 1.00 61.81  ? 191 GLU A OE1 1 
ATOM   1396 O OE2 . GLU A 1 189 ? 2.946   -18.543 38.412 1.00 69.07  ? 191 GLU A OE2 1 
ATOM   1397 N N   . GLY A 1 190 ? -1.700  -18.213 34.933 1.00 59.02  ? 192 GLY A N   1 
ATOM   1398 C CA  . GLY A 1 190 ? -2.791  -19.074 34.454 1.00 59.81  ? 192 GLY A CA  1 
ATOM   1399 C C   . GLY A 1 190 ? -4.078  -18.333 34.061 1.00 60.07  ? 192 GLY A C   1 
ATOM   1400 O O   . GLY A 1 190 ? -4.912  -18.873 33.298 1.00 60.48  ? 192 GLY A O   1 
ATOM   1401 N N   . ASP A 1 191 ? -4.259  -17.095 34.537 1.00 57.64  ? 193 ASP A N   1 
ATOM   1402 C CA  . ASP A 1 191 ? -5.467  -16.413 34.204 1.00 57.35  ? 193 ASP A CA  1 
ATOM   1403 C C   . ASP A 1 191 ? -5.553  -16.000 32.779 1.00 56.45  ? 193 ASP A C   1 
ATOM   1404 O O   . ASP A 1 191 ? -4.576  -16.007 32.034 1.00 56.97  ? 193 ASP A O   1 
ATOM   1405 C CB  . ASP A 1 191 ? -5.573  -15.175 35.020 1.00 57.87  ? 193 ASP A CB  1 
ATOM   1406 C CG  . ASP A 1 191 ? -5.997  -15.461 36.406 1.00 59.27  ? 193 ASP A CG  1 
ATOM   1407 O OD1 . ASP A 1 191 ? -6.145  -16.654 36.691 1.00 64.15  ? 193 ASP A OD1 1 
ATOM   1408 O OD2 . ASP A 1 191 ? -6.173  -14.518 37.191 1.00 56.88  ? 193 ASP A OD2 1 
ATOM   1409 N N   . GLU A 1 192 ? -6.749  -15.643 32.389 1.00 56.28  ? 194 GLU A N   1 
ATOM   1410 C CA  . GLU A 1 192 ? -6.958  -14.995 31.146 1.00 55.28  ? 194 GLU A CA  1 
ATOM   1411 C C   . GLU A 1 192 ? -7.068  -13.503 31.496 1.00 53.25  ? 194 GLU A C   1 
ATOM   1412 O O   . GLU A 1 192 ? -7.787  -13.138 32.398 1.00 53.97  ? 194 GLU A O   1 
ATOM   1413 C CB  . GLU A 1 192 ? -8.280  -15.462 30.557 1.00 57.05  ? 194 GLU A CB  1 
ATOM   1414 C CG  . GLU A 1 192 ? -8.165  -16.040 29.155 1.00 61.96  ? 194 GLU A CG  1 
ATOM   1415 C CD  . GLU A 1 192 ? -8.223  -17.576 29.149 1.00 72.51  ? 194 GLU A CD  1 
ATOM   1416 O OE1 . GLU A 1 192 ? -9.315  -18.123 28.837 1.00 75.83  ? 194 GLU A OE1 1 
ATOM   1417 O OE2 . GLU A 1 192 ? -7.188  -18.244 29.475 1.00 76.41  ? 194 GLU A OE2 1 
ATOM   1418 N N   . ILE A 1 193 ? -6.349  -12.628 30.814 1.00 50.78  ? 195 ILE A N   1 
ATOM   1419 C CA  . ILE A 1 193 ? -6.742  -11.238 30.847 1.00 49.05  ? 195 ILE A CA  1 
ATOM   1420 C C   . ILE A 1 193 ? -7.745  -11.005 29.717 1.00 48.83  ? 195 ILE A C   1 
ATOM   1421 O O   . ILE A 1 193 ? -7.538  -11.400 28.542 1.00 48.59  ? 195 ILE A O   1 
ATOM   1422 C CB  . ILE A 1 193 ? -5.574  -10.328 30.677 1.00 47.45  ? 195 ILE A CB  1 
ATOM   1423 C CG1 . ILE A 1 193 ? -4.593  -10.519 31.832 1.00 47.58  ? 195 ILE A CG1 1 
ATOM   1424 C CG2 . ILE A 1 193 ? -6.060  -8.902  30.588 1.00 47.23  ? 195 ILE A CG2 1 
ATOM   1425 C CD1 . ILE A 1 193 ? -3.293  -9.708  31.674 1.00 46.24  ? 195 ILE A CD1 1 
ATOM   1426 N N   . SER A 1 194 ? -8.834  -10.365 30.070 1.00 48.51  ? 196 SER A N   1 
ATOM   1427 C CA  . SER A 1 194 ? -9.926  -10.220 29.130 1.00 48.68  ? 196 SER A CA  1 
ATOM   1428 C C   . SER A 1 194 ? -9.994  -8.777  28.680 1.00 46.68  ? 196 SER A C   1 
ATOM   1429 O O   . SER A 1 194 ? -9.962  -7.883  29.526 1.00 47.04  ? 196 SER A O   1 
ATOM   1430 C CB  . SER A 1 194 ? -11.252 -10.615 29.763 1.00 49.73  ? 196 SER A CB  1 
ATOM   1431 O OG  . SER A 1 194 ? -12.153 -10.873 28.713 1.00 51.92  ? 196 SER A OG  1 
ATOM   1432 N N   . ILE A 1 195 ? -10.094 -8.561  27.364 1.00 44.56  ? 197 ILE A N   1 
ATOM   1433 C CA  . ILE A 1 195 ? -9.926  -7.239  26.812 1.00 42.77  ? 197 ILE A CA  1 
ATOM   1434 C C   . ILE A 1 195 ? -11.117 -6.695  26.045 1.00 43.59  ? 197 ILE A C   1 
ATOM   1435 O O   . ILE A 1 195 ? -11.672 -7.353  25.144 1.00 42.69  ? 197 ILE A O   1 
ATOM   1436 C CB  . ILE A 1 195 ? -8.702  -7.119  25.900 1.00 40.96  ? 197 ILE A CB  1 
ATOM   1437 C CG1 . ILE A 1 195 ? -7.452  -7.699  26.569 1.00 41.66  ? 197 ILE A CG1 1 
ATOM   1438 C CG2 . ILE A 1 195 ? -8.467  -5.660  25.584 1.00 37.68  ? 197 ILE A CG2 1 
ATOM   1439 C CD1 . ILE A 1 195 ? -6.168  -7.699  25.706 1.00 36.44  ? 197 ILE A CD1 1 
ATOM   1440 N N   . HIS A 1 196 ? -11.446 -5.457  26.409 1.00 43.64  ? 198 HIS A N   1 
ATOM   1441 C CA  . HIS A 1 196 ? -12.462 -4.667  25.789 1.00 44.27  ? 198 HIS A CA  1 
ATOM   1442 C C   . HIS A 1 196 ? -11.740 -3.504  25.150 1.00 43.97  ? 198 HIS A C   1 
ATOM   1443 O O   . HIS A 1 196 ? -11.042 -2.722  25.838 1.00 45.65  ? 198 HIS A O   1 
ATOM   1444 C CB  . HIS A 1 196 ? -13.392 -4.120  26.868 1.00 45.78  ? 198 HIS A CB  1 
ATOM   1445 C CG  . HIS A 1 196 ? -14.625 -3.474  26.316 1.00 49.50  ? 198 HIS A CG  1 
ATOM   1446 N ND1 . HIS A 1 196 ? -14.762 -2.104  26.197 1.00 51.96  ? 198 HIS A ND1 1 
ATOM   1447 C CD2 . HIS A 1 196 ? -15.762 -4.012  25.804 1.00 50.20  ? 198 HIS A CD2 1 
ATOM   1448 C CE1 . HIS A 1 196 ? -15.942 -1.825  25.667 1.00 50.96  ? 198 HIS A CE1 1 
ATOM   1449 N NE2 . HIS A 1 196 ? -16.552 -2.965  25.393 1.00 50.35  ? 198 HIS A NE2 1 
ATOM   1450 N N   . ALA A 1 197 ? -11.860 -3.380  23.837 1.00 42.58  ? 199 ALA A N   1 
ATOM   1451 C CA  . ALA A 1 197 ? -11.133 -2.327  23.122 1.00 40.66  ? 199 ALA A CA  1 
ATOM   1452 C C   . ALA A 1 197 ? -11.849 -1.863  21.838 1.00 40.06  ? 199 ALA A C   1 
ATOM   1453 O O   . ALA A 1 197 ? -12.521 -2.657  21.150 1.00 39.88  ? 199 ALA A O   1 
ATOM   1454 C CB  . ALA A 1 197 ? -9.704  -2.733  22.851 1.00 39.27  ? 199 ALA A CB  1 
ATOM   1455 N N   . ASP A 1 198 ? -11.764 -0.561  21.593 1.00 38.68  ? 200 ASP A N   1 
ATOM   1456 C CA  . ASP A 1 198 ? -12.321 0.003   20.424 1.00 38.82  ? 200 ASP A CA  1 
ATOM   1457 C C   . ASP A 1 198 ? -11.168 0.648   19.621 1.00 38.98  ? 200 ASP A C   1 
ATOM   1458 O O   . ASP A 1 198 ? -10.282 1.336   20.187 1.00 39.56  ? 200 ASP A O   1 
ATOM   1459 C CB  . ASP A 1 198 ? -13.388 1.055   20.752 1.00 39.63  ? 200 ASP A CB  1 
ATOM   1460 C CG  . ASP A 1 198 ? -14.569 0.542   21.648 1.00 41.21  ? 200 ASP A CG  1 
ATOM   1461 O OD1 . ASP A 1 198 ? -15.019 -0.620  21.581 1.00 40.47  ? 200 ASP A OD1 1 
ATOM   1462 O OD2 . ASP A 1 198 ? -15.093 1.393   22.418 1.00 45.06  ? 200 ASP A OD2 1 
ATOM   1463 N N   . PHE A 1 199 ? -11.172 0.424   18.309 1.00 37.79  ? 201 PHE A N   1 
ATOM   1464 C CA  . PHE A 1 199 ? -10.168 0.998   17.456 1.00 37.63  ? 201 PHE A CA  1 
ATOM   1465 C C   . PHE A 1 199 ? -10.809 1.840   16.372 1.00 37.52  ? 201 PHE A C   1 
ATOM   1466 O O   . PHE A 1 199 ? -11.666 1.353   15.713 1.00 38.70  ? 201 PHE A O   1 
ATOM   1467 C CB  . PHE A 1 199 ? -9.392  -0.141  16.809 1.00 37.61  ? 201 PHE A CB  1 
ATOM   1468 C CG  . PHE A 1 199 ? -8.767  -1.090  17.793 1.00 36.34  ? 201 PHE A CG  1 
ATOM   1469 C CD1 . PHE A 1 199 ? -7.538  -0.836  18.317 1.00 33.83  ? 201 PHE A CD1 1 
ATOM   1470 C CD2 . PHE A 1 199 ? -9.418  -2.271  18.147 1.00 37.12  ? 201 PHE A CD2 1 
ATOM   1471 C CE1 . PHE A 1 199 ? -6.963  -1.725  19.197 1.00 33.99  ? 201 PHE A CE1 1 
ATOM   1472 C CE2 . PHE A 1 199 ? -8.872  -3.166  19.002 1.00 34.62  ? 201 PHE A CE2 1 
ATOM   1473 C CZ  . PHE A 1 199 ? -7.635  -2.889  19.544 1.00 36.06  ? 201 PHE A CZ  1 
ATOM   1474 N N   . GLU A 1 200 ? -10.408 3.083   16.173 1.00 38.00  ? 202 GLU A N   1 
ATOM   1475 C CA  . GLU A 1 200 ? -10.854 3.837   14.980 1.00 39.07  ? 202 GLU A CA  1 
ATOM   1476 C C   . GLU A 1 200 ? -9.750  4.035   13.966 1.00 37.45  ? 202 GLU A C   1 
ATOM   1477 O O   . GLU A 1 200 ? -8.618  4.194   14.347 1.00 37.57  ? 202 GLU A O   1 
ATOM   1478 C CB  . GLU A 1 200 ? -11.236 5.265   15.305 1.00 41.16  ? 202 GLU A CB  1 
ATOM   1479 C CG  . GLU A 1 200 ? -12.192 5.586   16.442 1.00 47.17  ? 202 GLU A CG  1 
ATOM   1480 C CD  . GLU A 1 200 ? -13.039 6.828   16.059 1.00 54.59  ? 202 GLU A CD  1 
ATOM   1481 O OE1 . GLU A 1 200 ? -12.719 7.512   15.037 1.00 53.19  ? 202 GLU A OE1 1 
ATOM   1482 O OE2 . GLU A 1 200 ? -14.049 7.090   16.758 1.00 59.15  ? 202 GLU A OE2 1 
ATOM   1483 N N   . ASN A 1 201 ? -10.086 4.110   12.684 1.00 36.05  ? 203 ASN A N   1 
ATOM   1484 C CA  . ASN A 1 201 ? -9.107  4.419   11.659 1.00 35.09  ? 203 ASN A CA  1 
ATOM   1485 C C   . ASN A 1 201 ? -9.718  5.218   10.518 1.00 36.51  ? 203 ASN A C   1 
ATOM   1486 O O   . ASN A 1 201 ? -10.335 4.656   9.591  1.00 37.11  ? 203 ASN A O   1 
ATOM   1487 C CB  . ASN A 1 201 ? -8.486  3.155   11.127 1.00 33.47  ? 203 ASN A CB  1 
ATOM   1488 C CG  . ASN A 1 201 ? -7.559  3.396   9.974  1.00 32.85  ? 203 ASN A CG  1 
ATOM   1489 O OD1 . ASN A 1 201 ? -7.054  4.504   9.732  1.00 31.58  ? 203 ASN A OD1 1 
ATOM   1490 N ND2 . ASN A 1 201 ? -7.318  2.341   9.242  1.00 28.65  ? 203 ASN A ND2 1 
ATOM   1491 N N   . THR A 1 202 ? -9.516  6.531   10.595 1.00 37.19  ? 204 THR A N   1 
ATOM   1492 C CA  . THR A 1 202 ? -9.954  7.475   9.591  1.00 37.76  ? 204 THR A CA  1 
ATOM   1493 C C   . THR A 1 202 ? -8.806  7.972   8.743  1.00 38.71  ? 204 THR A C   1 
ATOM   1494 O O   . THR A 1 202 ? -9.029  8.822   7.889  1.00 40.49  ? 204 THR A O   1 
ATOM   1495 C CB  . THR A 1 202 ? -10.645 8.697   10.205 1.00 38.12  ? 204 THR A CB  1 
ATOM   1496 O OG1 . THR A 1 202 ? -9.753  9.333   11.110 1.00 41.00  ? 204 THR A OG1 1 
ATOM   1497 C CG2 . THR A 1 202 ? -11.892 8.277   10.987 1.00 38.88  ? 204 THR A CG2 1 
ATOM   1498 N N   . SER A 1 203 ? -7.608  7.435   8.974  1.00 38.44  ? 205 SER A N   1 
ATOM   1499 C CA  . SER A 1 203 ? -6.437  7.637   8.156  1.00 39.64  ? 205 SER A CA  1 
ATOM   1500 C C   . SER A 1 203 ? -6.565  6.793   6.885  1.00 40.40  ? 205 SER A C   1 
ATOM   1501 O O   . SER A 1 203 ? -7.379  5.870   6.814  1.00 39.49  ? 205 SER A O   1 
ATOM   1502 C CB  . SER A 1 203 ? -5.226  7.078   8.880  1.00 39.69  ? 205 SER A CB  1 
ATOM   1503 O OG  . SER A 1 203 ? -5.085  5.694   8.536  1.00 39.04  ? 205 SER A OG  1 
ATOM   1504 N N   . SER A 1 204 ? -5.706  7.084   5.907  1.00 42.64  ? 206 SER A N   1 
ATOM   1505 C CA  . SER A 1 204 ? -5.654  6.355   4.641  1.00 42.50  ? 206 SER A CA  1 
ATOM   1506 C C   . SER A 1 204 ? -4.921  5.007   4.729  1.00 43.37  ? 206 SER A C   1 
ATOM   1507 O O   . SER A 1 204 ? -4.792  4.319   3.743  1.00 44.36  ? 206 SER A O   1 
ATOM   1508 C CB  . SER A 1 204 ? -4.985  7.237   3.582  1.00 43.12  ? 206 SER A CB  1 
ATOM   1509 O OG  . SER A 1 204 ? -3.636  7.502   3.894  1.00 43.72  ? 206 SER A OG  1 
ATOM   1510 N N   . ARG A 1 205 ? -4.397  4.621   5.881  1.00 44.04  ? 207 ARG A N   1 
ATOM   1511 C CA  . ARG A 1 205 ? -3.652  3.352   5.916  1.00 44.94  ? 207 ARG A CA  1 
ATOM   1512 C C   . ARG A 1 205 ? -4.534  2.207   6.389  1.00 42.23  ? 207 ARG A C   1 
ATOM   1513 O O   . ARG A 1 205 ? -5.459  2.433   7.132  1.00 43.05  ? 207 ARG A O   1 
ATOM   1514 C CB  . ARG A 1 205 ? -2.394  3.433   6.800  1.00 45.49  ? 207 ARG A CB  1 
ATOM   1515 C CG  . ARG A 1 205 ? -1.716  4.785   6.847  1.00 49.76  ? 207 ARG A CG  1 
ATOM   1516 C CD  . ARG A 1 205 ? -0.774  4.982   5.676  1.00 58.69  ? 207 ARG A CD  1 
ATOM   1517 N NE  . ARG A 1 205 ? 0.107   6.145   5.884  1.00 64.47  ? 207 ARG A NE  1 
ATOM   1518 C CZ  . ARG A 1 205 ? -0.307  7.424   5.908  1.00 65.84  ? 207 ARG A CZ  1 
ATOM   1519 N NH1 . ARG A 1 205 ? -1.607  7.759   5.730  1.00 59.99  ? 207 ARG A NH1 1 
ATOM   1520 N NH2 . ARG A 1 205 ? 0.589   8.386   6.127  1.00 70.26  ? 207 ARG A NH2 1 
ATOM   1521 N N   . ILE A 1 206 ? -4.249  0.992   5.947  1.00 40.99  ? 208 ILE A N   1 
ATOM   1522 C CA  . ILE A 1 206 ? -4.744  -0.198  6.601  1.00 38.83  ? 208 ILE A CA  1 
ATOM   1523 C C   . ILE A 1 206 ? -3.896  -0.418  7.856  1.00 39.49  ? 208 ILE A C   1 
ATOM   1524 O O   . ILE A 1 206 ? -2.628  -0.457  7.752  1.00 41.19  ? 208 ILE A O   1 
ATOM   1525 C CB  . ILE A 1 206 ? -4.575  -1.400  5.690  1.00 39.07  ? 208 ILE A CB  1 
ATOM   1526 C CG1 . ILE A 1 206 ? -5.599  -1.346  4.557  1.00 36.12  ? 208 ILE A CG1 1 
ATOM   1527 C CG2 . ILE A 1 206 ? -4.741  -2.733  6.505  1.00 41.10  ? 208 ILE A CG2 1 
ATOM   1528 C CD1 . ILE A 1 206 ? -5.241  -2.231  3.337  1.00 28.24  ? 208 ILE A CD1 1 
ATOM   1529 N N   . VAL A 1 207 ? -4.542  -0.584  9.024  1.00 37.36  ? 209 VAL A N   1 
ATOM   1530 C CA  . VAL A 1 207 ? -3.799  -0.664  10.312 1.00 36.57  ? 209 VAL A CA  1 
ATOM   1531 C C   . VAL A 1 207 ? -4.137  -1.965  11.054 1.00 37.44  ? 209 VAL A C   1 
ATOM   1532 O O   . VAL A 1 207 ? -5.203  -2.521  10.826 1.00 38.35  ? 209 VAL A O   1 
ATOM   1533 C CB  . VAL A 1 207 ? -4.090  0.560   11.229 1.00 36.20  ? 209 VAL A CB  1 
ATOM   1534 C CG1 . VAL A 1 207 ? -3.726  1.877   10.550 1.00 34.95  ? 209 VAL A CG1 1 
ATOM   1535 C CG2 . VAL A 1 207 ? -5.557  0.566   11.772 1.00 32.31  ? 209 VAL A CG2 1 
ATOM   1536 N N   . VAL A 1 208 ? -3.270  -2.454  11.939 1.00 37.49  ? 210 VAL A N   1 
ATOM   1537 C CA  . VAL A 1 208 ? -3.516  -3.727  12.572 1.00 37.16  ? 210 VAL A CA  1 
ATOM   1538 C C   . VAL A 1 208 ? -3.417  -3.579  14.082 1.00 36.68  ? 210 VAL A C   1 
ATOM   1539 O O   . VAL A 1 208 ? -2.442  -3.060  14.569 1.00 37.37  ? 210 VAL A O   1 
ATOM   1540 C CB  . VAL A 1 208 ? -2.473  -4.692  12.126 1.00 38.92  ? 210 VAL A CB  1 
ATOM   1541 C CG1 . VAL A 1 208 ? -2.726  -6.118  12.695 1.00 38.71  ? 210 VAL A CG1 1 
ATOM   1542 C CG2 . VAL A 1 208 ? -2.471  -4.707  10.664 1.00 40.96  ? 210 VAL A CG2 1 
ATOM   1543 N N   . PRO A 1 209 ? -4.445  -4.012  14.827 1.00 36.19  ? 211 PRO A N   1 
ATOM   1544 C CA  . PRO A 1 209 ? -4.358  -3.865  16.277 1.00 35.05  ? 211 PRO A CA  1 
ATOM   1545 C C   . PRO A 1 209 ? -3.727  -5.116  16.880 1.00 35.51  ? 211 PRO A C   1 
ATOM   1546 O O   . PRO A 1 209 ? -3.938  -6.229  16.365 1.00 36.36  ? 211 PRO A O   1 
ATOM   1547 C CB  . PRO A 1 209 ? -5.819  -3.764  16.681 1.00 34.45  ? 211 PRO A CB  1 
ATOM   1548 C CG  . PRO A 1 209 ? -6.625  -4.534  15.590 1.00 33.64  ? 211 PRO A CG  1 
ATOM   1549 C CD  . PRO A 1 209 ? -5.736  -4.624  14.388 1.00 35.97  ? 211 PRO A CD  1 
ATOM   1550 N N   . LYS A 1 210 ? -2.957  -4.946  17.958 1.00 34.96  ? 212 LYS A N   1 
ATOM   1551 C CA  . LYS A 1 210 ? -2.231  -6.066  18.601 1.00 34.57  ? 212 LYS A CA  1 
ATOM   1552 C C   . LYS A 1 210 ? -2.164  -5.900  20.122 1.00 35.22  ? 212 LYS A C   1 
ATOM   1553 O O   . LYS A 1 210 ? -2.416  -4.782  20.703 1.00 34.39  ? 212 LYS A O   1 
ATOM   1554 C CB  . LYS A 1 210 ? -0.817  -6.231  18.029 1.00 34.92  ? 212 LYS A CB  1 
ATOM   1555 C CG  . LYS A 1 210 ? -0.717  -6.406  16.507 1.00 33.86  ? 212 LYS A CG  1 
ATOM   1556 C CD  . LYS A 1 210 ? 0.724   -6.360  16.079 1.00 35.81  ? 212 LYS A CD  1 
ATOM   1557 C CE  . LYS A 1 210 ? 0.882   -6.128  14.583 1.00 38.47  ? 212 LYS A CE  1 
ATOM   1558 N NZ  . LYS A 1 210 ? 2.233   -6.488  14.003 1.00 43.16  ? 212 LYS A NZ  1 
ATOM   1559 N N   . ALA A 1 211 ? -1.857  -7.008  20.800 1.00 34.66  ? 213 ALA A N   1 
ATOM   1560 C CA  . ALA A 1 211 ? -1.653  -6.882  22.256 1.00 33.35  ? 213 ALA A CA  1 
ATOM   1561 C C   . ALA A 1 211 ? -0.582  -7.846  22.691 1.00 34.43  ? 213 ALA A C   1 
ATOM   1562 O O   . ALA A 1 211 ? -0.386  -8.947  22.068 1.00 34.29  ? 213 ALA A O   1 
ATOM   1563 C CB  . ALA A 1 211 ? -2.919  -7.179  22.994 1.00 32.56  ? 213 ALA A CB  1 
ATOM   1564 N N   . ALA A 1 212 ? 0.132   -7.461  23.745 1.00 33.37  ? 214 ALA A N   1 
ATOM   1565 C CA  . ALA A 1 212 ? 1.103   -8.406  24.295 1.00 34.60  ? 214 ALA A CA  1 
ATOM   1566 C C   . ALA A 1 212 ? 1.292   -8.105  25.695 1.00 34.36  ? 214 ALA A C   1 
ATOM   1567 O O   . ALA A 1 212 ? 1.118   -6.936  26.104 1.00 33.71  ? 214 ALA A O   1 
ATOM   1568 C CB  . ALA A 1 212 ? 2.462   -8.383  23.577 1.00 34.41  ? 214 ALA A CB  1 
ATOM   1569 N N   . ILE A 1 213 ? 1.593   -9.176  26.439 1.00 35.15  ? 215 ILE A N   1 
ATOM   1570 C CA  . ILE A 1 213 ? 1.997   -9.049  27.831 1.00 35.92  ? 215 ILE A CA  1 
ATOM   1571 C C   . ILE A 1 213 ? 3.518   -9.034  27.772 1.00 35.97  ? 215 ILE A C   1 
ATOM   1572 O O   . ILE A 1 213 ? 4.153   -9.917  27.193 1.00 35.73  ? 215 ILE A O   1 
ATOM   1573 C CB  . ILE A 1 213 ? 1.444   -10.236 28.722 1.00 37.29  ? 215 ILE A CB  1 
ATOM   1574 C CG1 . ILE A 1 213 ? -0.015  -10.018 29.116 1.00 36.51  ? 215 ILE A CG1 1 
ATOM   1575 C CG2 . ILE A 1 213 ? 2.277   -10.420 29.976 1.00 35.96  ? 215 ILE A CG2 1 
ATOM   1576 C CD1 . ILE A 1 213 ? -0.703  -11.290 29.663 1.00 34.21  ? 215 ILE A CD1 1 
ATOM   1577 N N   . VAL A 1 214 ? 4.109   -8.028  28.360 1.00 35.90  ? 216 VAL A N   1 
ATOM   1578 C CA  . VAL A 1 214 ? 5.555   -7.997  28.361 1.00 37.87  ? 216 VAL A CA  1 
ATOM   1579 C C   . VAL A 1 214 ? 6.135   -8.047  29.785 1.00 38.66  ? 216 VAL A C   1 
ATOM   1580 O O   . VAL A 1 214 ? 5.491   -7.676  30.770 1.00 37.34  ? 216 VAL A O   1 
ATOM   1581 C CB  . VAL A 1 214 ? 6.091   -6.812  27.545 1.00 38.78  ? 216 VAL A CB  1 
ATOM   1582 C CG1 . VAL A 1 214 ? 5.814   -7.044  26.027 1.00 40.28  ? 216 VAL A CG1 1 
ATOM   1583 C CG2 . VAL A 1 214 ? 5.462   -5.510  27.984 1.00 37.05  ? 216 VAL A CG2 1 
ATOM   1584 N N   . ALA A 1 215 ? 7.338   -8.578  29.892 1.00 40.95  ? 217 ALA A N   1 
ATOM   1585 C CA  . ALA A 1 215 ? 7.962   -8.795  31.201 1.00 42.44  ? 217 ALA A CA  1 
ATOM   1586 C C   . ALA A 1 215 ? 9.247   -8.004  31.147 1.00 43.50  ? 217 ALA A C   1 
ATOM   1587 O O   . ALA A 1 215 ? 10.050  -8.198  30.190 1.00 44.85  ? 217 ALA A O   1 
ATOM   1588 C CB  . ALA A 1 215 ? 8.243   -10.268 31.393 1.00 42.36  ? 217 ALA A CB  1 
ATOM   1589 N N   . ARG A 1 216 ? 9.415   -7.076  32.089 1.00 43.66  ? 218 ARG A N   1 
ATOM   1590 C CA  . ARG A 1 216 ? 10.703  -6.374  32.256 1.00 45.74  ? 218 ARG A CA  1 
ATOM   1591 C C   . ARG A 1 216 ? 11.518  -6.852  33.466 1.00 46.70  ? 218 ARG A C   1 
ATOM   1592 O O   . ARG A 1 216 ? 11.220  -6.486  34.586 1.00 46.39  ? 218 ARG A O   1 
ATOM   1593 C CB  . ARG A 1 216 ? 10.474  -4.892  32.328 1.00 44.76  ? 218 ARG A CB  1 
ATOM   1594 C CG  . ARG A 1 216 ? 9.627   -4.460  31.205 1.00 47.46  ? 218 ARG A CG  1 
ATOM   1595 C CD  . ARG A 1 216 ? 9.335   -2.983  31.284 1.00 53.42  ? 218 ARG A CD  1 
ATOM   1596 N NE  . ARG A 1 216 ? 8.587   -2.541  30.108 1.00 55.03  ? 218 ARG A NE  1 
ATOM   1597 C CZ  . ARG A 1 216 ? 7.260   -2.417  30.076 1.00 55.63  ? 218 ARG A CZ  1 
ATOM   1598 N NH1 . ARG A 1 216 ? 6.509   -2.710  31.163 1.00 52.48  ? 218 ARG A NH1 1 
ATOM   1599 N NH2 . ARG A 1 216 ? 6.689   -2.004  28.946 1.00 51.85  ? 218 ARG A NH2 1 
ATOM   1600 N N   . HIS A 1 217 ? 12.514  -7.707  33.243 1.00 48.68  ? 219 HIS A N   1 
ATOM   1601 C CA  . HIS A 1 217 ? 13.331  -8.189  34.363 1.00 50.29  ? 219 HIS A CA  1 
ATOM   1602 C C   . HIS A 1 217 ? 14.384  -7.183  34.647 1.00 51.54  ? 219 HIS A C   1 
ATOM   1603 O O   . HIS A 1 217 ? 15.153  -6.809  33.764 1.00 51.92  ? 219 HIS A O   1 
ATOM   1604 C CB  . HIS A 1 217 ? 14.052  -9.450  34.023 1.00 51.02  ? 219 HIS A CB  1 
ATOM   1605 C CG  . HIS A 1 217 ? 13.216  -10.401 33.266 1.00 53.40  ? 219 HIS A CG  1 
ATOM   1606 N ND1 . HIS A 1 217 ? 12.562  -11.447 33.870 1.00 55.06  ? 219 HIS A ND1 1 
ATOM   1607 C CD2 . HIS A 1 217 ? 12.891  -10.449 31.957 1.00 56.86  ? 219 HIS A CD2 1 
ATOM   1608 C CE1 . HIS A 1 217 ? 11.873  -12.113 32.964 1.00 56.96  ? 219 HIS A CE1 1 
ATOM   1609 N NE2 . HIS A 1 217 ? 12.050  -11.523 31.795 1.00 60.21  ? 219 HIS A NE2 1 
ATOM   1610 N N   . THR A 1 218 ? 14.400  -6.738  35.892 1.00 53.18  ? 220 THR A N   1 
ATOM   1611 C CA  . THR A 1 218 ? 15.468  -5.910  36.400 1.00 55.09  ? 220 THR A CA  1 
ATOM   1612 C C   . THR A 1 218 ? 16.359  -6.940  37.090 1.00 56.80  ? 220 THR A C   1 
ATOM   1613 O O   . THR A 1 218 ? 15.889  -7.757  37.946 1.00 56.27  ? 220 THR A O   1 
ATOM   1614 C CB  . THR A 1 218 ? 14.928  -4.879  37.391 1.00 54.51  ? 220 THR A CB  1 
ATOM   1615 O OG1 . THR A 1 218 ? 13.540  -4.670  37.102 1.00 54.11  ? 220 THR A OG1 1 
ATOM   1616 C CG2 . THR A 1 218 ? 15.717  -3.577  37.302 1.00 54.16  ? 220 THR A CG2 1 
ATOM   1617 N N   . TYR A 1 219 ? 17.628  -6.943  36.685 1.00 58.87  ? 221 TYR A N   1 
ATOM   1618 C CA  . TYR A 1 219 ? 18.535  -7.995  37.153 1.00 61.62  ? 221 TYR A CA  1 
ATOM   1619 C C   . TYR A 1 219 ? 19.884  -7.432  37.487 1.00 63.20  ? 221 TYR A C   1 
ATOM   1620 O O   . TYR A 1 219 ? 20.325  -6.368  36.942 1.00 63.61  ? 221 TYR A O   1 
ATOM   1621 C CB  . TYR A 1 219 ? 18.655  -9.213  36.181 1.00 61.66  ? 221 TYR A CB  1 
ATOM   1622 C CG  . TYR A 1 219 ? 19.299  -8.891  34.846 1.00 63.05  ? 221 TYR A CG  1 
ATOM   1623 C CD1 . TYR A 1 219 ? 20.610  -9.251  34.565 1.00 67.08  ? 221 TYR A CD1 1 
ATOM   1624 C CD2 . TYR A 1 219 ? 18.595  -8.213  33.871 1.00 63.93  ? 221 TYR A CD2 1 
ATOM   1625 C CE1 . TYR A 1 219 ? 21.194  -8.952  33.324 1.00 69.50  ? 221 TYR A CE1 1 
ATOM   1626 C CE2 . TYR A 1 219 ? 19.142  -7.909  32.657 1.00 67.28  ? 221 TYR A CE2 1 
ATOM   1627 C CZ  . TYR A 1 219 ? 20.435  -8.279  32.380 1.00 71.15  ? 221 TYR A CZ  1 
ATOM   1628 O OH  . TYR A 1 219 ? 20.938  -7.945  31.145 1.00 74.40  ? 221 TYR A OH  1 
ATOM   1629 N N   . LEU A 1 220 ? 20.509  -8.178  38.397 1.00 64.67  ? 222 LEU A N   1 
ATOM   1630 C CA  . LEU A 1 220 ? 21.871  -7.910  38.847 1.00 67.61  ? 222 LEU A CA  1 
ATOM   1631 C C   . LEU A 1 220 ? 22.940  -8.569  37.953 1.00 69.85  ? 222 LEU A C   1 
ATOM   1632 O O   . LEU A 1 220 ? 23.067  -9.826  37.951 1.00 70.19  ? 222 LEU A O   1 
ATOM   1633 C CB  . LEU A 1 220 ? 22.028  -8.341  40.309 1.00 66.58  ? 222 LEU A CB  1 
ATOM   1634 C CG  . LEU A 1 220 ? 21.282  -7.473  41.325 1.00 65.98  ? 222 LEU A CG  1 
ATOM   1635 C CD1 . LEU A 1 220 ? 21.463  -8.070  42.756 1.00 64.21  ? 222 LEU A CD1 1 
ATOM   1636 C CD2 . LEU A 1 220 ? 21.629  -5.923  41.201 1.00 64.21  ? 222 LEU A CD2 1 
ATOM   1637 N N   . ALA A 1 221 ? 23.675  -7.738  37.191 1.00 71.68  ? 223 ALA A N   1 
ATOM   1638 C CA  . ALA A 1 221 ? 24.806  -8.256  36.397 1.00 75.43  ? 223 ALA A CA  1 
ATOM   1639 C C   . ALA A 1 221 ? 25.945  -7.268  36.082 1.00 78.37  ? 223 ALA A C   1 
ATOM   1640 O O   . ALA A 1 221 ? 25.702  -6.130  35.604 1.00 78.68  ? 223 ALA A O   1 
ATOM   1641 C CB  . ALA A 1 221 ? 24.325  -8.974  35.082 1.00 75.54  ? 223 ALA A CB  1 
ATOM   1642 N N   . ASN A 1 222 ? 27.180  -7.743  36.334 1.00 80.52  ? 224 ASN A N   1 
ATOM   1643 C CA  . ASN A 1 222 ? 28.422  -7.067  35.924 1.00 83.17  ? 224 ASN A CA  1 
ATOM   1644 C C   . ASN A 1 222 ? 28.523  -5.627  36.432 1.00 83.76  ? 224 ASN A C   1 
ATOM   1645 O O   . ASN A 1 222 ? 28.812  -4.686  35.644 1.00 85.01  ? 224 ASN A O   1 
ATOM   1646 C CB  . ASN A 1 222 ? 28.609  -7.127  34.394 1.00 85.53  ? 224 ASN A CB  1 
ATOM   1647 C CG  . ASN A 1 222 ? 28.792  -8.579  33.863 1.00 87.24  ? 224 ASN A CG  1 
ATOM   1648 O OD1 . ASN A 1 222 ? 29.156  -9.501  34.610 1.00 86.49  ? 224 ASN A OD1 1 
ATOM   1649 N ND2 . ASN A 1 222 ? 28.545  -8.766  32.563 1.00 87.89  ? 224 ASN A ND2 1 
ATOM   1650 N N   . GLY A 1 223 ? 28.281  -5.487  37.750 1.00 82.64  ? 225 GLY A N   1 
ATOM   1651 C CA  . GLY A 1 223 ? 28.253  -4.201  38.458 1.00 82.42  ? 225 GLY A CA  1 
ATOM   1652 C C   . GLY A 1 223 ? 26.932  -3.433  38.426 1.00 81.72  ? 225 GLY A C   1 
ATOM   1653 O O   . GLY A 1 223 ? 26.842  -2.307  38.961 1.00 81.49  ? 225 GLY A O   1 
ATOM   1654 N N   . GLN A 1 224 ? 25.907  -4.061  37.829 1.00 81.04  ? 226 GLN A N   1 
ATOM   1655 C CA  . GLN A 1 224 ? 24.671  -3.394  37.362 1.00 80.45  ? 226 GLN A CA  1 
ATOM   1656 C C   . GLN A 1 224 ? 23.371  -4.095  37.873 1.00 78.30  ? 226 GLN A C   1 
ATOM   1657 O O   . GLN A 1 224 ? 23.447  -5.282  38.244 1.00 78.65  ? 226 GLN A O   1 
ATOM   1658 C CB  . GLN A 1 224 ? 24.744  -3.359  35.829 1.00 81.62  ? 226 GLN A CB  1 
ATOM   1659 C CG  . GLN A 1 224 ? 25.667  -2.273  35.182 1.00 85.03  ? 226 GLN A CG  1 
ATOM   1660 C CD  . GLN A 1 224 ? 26.768  -1.728  36.106 1.00 88.74  ? 226 GLN A CD  1 
ATOM   1661 O OE1 . GLN A 1 224 ? 27.884  -2.262  36.129 1.00 91.88  ? 226 GLN A OE1 1 
ATOM   1662 N NE2 . GLN A 1 224 ? 26.456  -0.665  36.873 1.00 87.13  ? 226 GLN A NE2 1 
ATOM   1663 N N   . THR A 1 225 ? 22.165  -3.495  37.855 1.00 76.74  ? 227 THR A N   1 
ATOM   1664 C CA  . THR A 1 225 ? 21.636  -2.335  37.069 1.00 75.53  ? 227 THR A CA  1 
ATOM   1665 C C   . THR A 1 225 ? 21.082  -2.624  35.639 1.00 73.64  ? 227 THR A C   1 
ATOM   1666 O O   . THR A 1 225 ? 21.101  -1.717  34.782 1.00 75.14  ? 227 THR A O   1 
ATOM   1667 C CB  . THR A 1 225 ? 22.551  -1.053  37.047 1.00 76.95  ? 227 THR A CB  1 
ATOM   1668 O OG1 . THR A 1 225 ? 21.757  0.075   36.628 1.00 79.27  ? 227 THR A OG1 1 
ATOM   1669 C CG2 . THR A 1 225 ? 23.570  -1.146  36.006 1.00 77.65  ? 227 THR A CG2 1 
ATOM   1670 N N   . LYS A 1 226 ? 20.589  -3.826  35.347 1.00 69.79  ? 228 LYS A N   1 
ATOM   1671 C CA  . LYS A 1 226 ? 19.964  -3.975  34.000 1.00 67.30  ? 228 LYS A CA  1 
ATOM   1672 C C   . LYS A 1 226 ? 18.507  -4.445  33.954 1.00 64.35  ? 228 LYS A C   1 
ATOM   1673 O O   . LYS A 1 226 ? 17.979  -5.094  34.887 1.00 63.24  ? 228 LYS A O   1 
ATOM   1674 C CB  . LYS A 1 226 ? 20.804  -4.844  33.050 1.00 68.79  ? 228 LYS A CB  1 
ATOM   1675 C CG  . LYS A 1 226 ? 22.098  -4.230  32.467 1.00 68.56  ? 228 LYS A CG  1 
ATOM   1676 C CD  . LYS A 1 226 ? 22.955  -5.411  31.970 1.00 64.98  ? 228 LYS A CD  1 
ATOM   1677 C CE  . LYS A 1 226 ? 24.170  -4.978  31.177 1.00 64.41  ? 228 LYS A CE  1 
ATOM   1678 N NZ  . LYS A 1 226 ? 24.423  -5.872  30.016 1.00 62.00  ? 228 LYS A NZ  1 
ATOM   1679 N N   . VAL A 1 227 ? 17.860  -4.115  32.847 1.00 62.22  ? 229 VAL A N   1 
ATOM   1680 C CA  . VAL A 1 227 ? 16.484  -4.554  32.597 1.00 58.63  ? 229 VAL A CA  1 
ATOM   1681 C C   . VAL A 1 227 ? 16.396  -5.168  31.226 1.00 57.85  ? 229 VAL A C   1 
ATOM   1682 O O   . VAL A 1 227 ? 16.830  -4.559  30.251 1.00 59.09  ? 229 VAL A O   1 
ATOM   1683 C CB  . VAL A 1 227 ? 15.409  -3.428  32.784 1.00 57.85  ? 229 VAL A CB  1 
ATOM   1684 C CG1 . VAL A 1 227 ? 15.824  -2.102  32.190 1.00 55.54  ? 229 VAL A CG1 1 
ATOM   1685 C CG2 . VAL A 1 227 ? 14.101  -3.892  32.190 1.00 58.09  ? 229 VAL A CG2 1 
ATOM   1686 N N   . LEU A 1 228 ? 15.890  -6.395  31.166 1.00 55.83  ? 230 LEU A N   1 
ATOM   1687 C CA  . LEU A 1 228 ? 15.632  -7.094  29.908 1.00 54.85  ? 230 LEU A CA  1 
ATOM   1688 C C   . LEU A 1 228 ? 14.110  -7.204  29.647 1.00 53.28  ? 230 LEU A C   1 
ATOM   1689 O O   . LEU A 1 228 ? 13.334  -7.569  30.563 1.00 52.44  ? 230 LEU A O   1 
ATOM   1690 C CB  . LEU A 1 228 ? 16.228  -8.483  29.994 1.00 55.52  ? 230 LEU A CB  1 
ATOM   1691 C CG  . LEU A 1 228 ? 15.756  -9.453  28.929 1.00 57.47  ? 230 LEU A CG  1 
ATOM   1692 C CD1 . LEU A 1 228 ? 16.859  -9.730  27.918 1.00 61.06  ? 230 LEU A CD1 1 
ATOM   1693 C CD2 . LEU A 1 228 ? 15.323  -10.714 29.589 1.00 59.21  ? 230 LEU A CD2 1 
ATOM   1694 N N   . THR A 1 229 ? 13.682  -6.891  28.423 1.00 51.97  ? 231 THR A N   1 
ATOM   1695 C CA  . THR A 1 229 ? 12.282  -7.056  28.023 1.00 50.72  ? 231 THR A CA  1 
ATOM   1696 C C   . THR A 1 229 ? 11.983  -8.359  27.252 1.00 50.68  ? 231 THR A C   1 
ATOM   1697 O O   . THR A 1 229 ? 12.531  -8.636  26.171 1.00 51.50  ? 231 THR A O   1 
ATOM   1698 C CB  . THR A 1 229 ? 11.853  -5.884  27.196 1.00 50.67  ? 231 THR A CB  1 
ATOM   1699 O OG1 . THR A 1 229 ? 12.403  -4.718  27.795 1.00 53.94  ? 231 THR A OG1 1 
ATOM   1700 C CG2 . THR A 1 229 ? 10.366  -5.733  27.201 1.00 49.92  ? 231 THR A CG2 1 
ATOM   1701 N N   . GLN A 1 230 ? 11.087  -9.135  27.834 1.00 49.24  ? 232 GLN A N   1 
ATOM   1702 C CA  . GLN A 1 230 ? 10.631  -10.390 27.291 1.00 49.51  ? 232 GLN A CA  1 
ATOM   1703 C C   . GLN A 1 230 ? 9.165   -10.185 26.865 1.00 48.03  ? 232 GLN A C   1 
ATOM   1704 O O   . GLN A 1 230 ? 8.414   -9.466  27.515 1.00 47.68  ? 232 GLN A O   1 
ATOM   1705 C CB  . GLN A 1 230 ? 10.701  -11.442 28.386 1.00 50.19  ? 232 GLN A CB  1 
ATOM   1706 C CG  . GLN A 1 230 ? 10.869  -12.865 27.933 1.00 55.47  ? 232 GLN A CG  1 
ATOM   1707 C CD  . GLN A 1 230 ? 10.427  -13.951 28.989 1.00 60.18  ? 232 GLN A CD  1 
ATOM   1708 O OE1 . GLN A 1 230 ? 10.582  -13.797 30.211 1.00 60.93  ? 232 GLN A OE1 1 
ATOM   1709 N NE2 . GLN A 1 230 ? 9.888   -15.060 28.481 1.00 62.08  ? 232 GLN A NE2 1 
ATOM   1710 N N   . LYS A 1 231 ? 8.796   -10.779 25.737 1.00 47.47  ? 233 LYS A N   1 
ATOM   1711 C CA  . LYS A 1 231 ? 7.449   -10.802 25.209 1.00 44.81  ? 233 LYS A CA  1 
ATOM   1712 C C   . LYS A 1 231 ? 6.836   -12.160 25.553 1.00 45.06  ? 233 LYS A C   1 
ATOM   1713 O O   . LYS A 1 231 ? 7.376   -13.217 25.135 1.00 45.28  ? 233 LYS A O   1 
ATOM   1714 C CB  . LYS A 1 231 ? 7.541   -10.650 23.694 1.00 44.70  ? 233 LYS A CB  1 
ATOM   1715 C CG  . LYS A 1 231 ? 6.201   -10.465 22.986 1.00 42.24  ? 233 LYS A CG  1 
ATOM   1716 C CD  . LYS A 1 231 ? 6.449   -10.779 21.540 1.00 39.97  ? 233 LYS A CD  1 
ATOM   1717 C CE  . LYS A 1 231 ? 5.343   -10.304 20.659 1.00 43.54  ? 233 LYS A CE  1 
ATOM   1718 N NZ  . LYS A 1 231 ? 5.263   -11.016 19.331 1.00 45.58  ? 233 LYS A NZ  1 
ATOM   1719 N N   . LEU A 1 232 ? 5.742   -12.147 26.321 1.00 43.86  ? 234 LEU A N   1 
ATOM   1720 C CA  . LEU A 1 232 ? 5.030   -13.395 26.657 1.00 44.78  ? 234 LEU A CA  1 
ATOM   1721 C C   . LEU A 1 232 ? 3.845   -13.625 25.682 1.00 45.40  ? 234 LEU A C   1 
ATOM   1722 O O   . LEU A 1 232 ? 4.059   -13.609 24.493 1.00 46.40  ? 234 LEU A O   1 
ATOM   1723 C CB  . LEU A 1 232 ? 4.645   -13.464 28.141 1.00 44.60  ? 234 LEU A CB  1 
ATOM   1724 C CG  . LEU A 1 232 ? 5.768   -13.215 29.184 1.00 43.12  ? 234 LEU A CG  1 
ATOM   1725 C CD1 . LEU A 1 232 ? 5.254   -13.223 30.626 1.00 39.66  ? 234 LEU A CD1 1 
ATOM   1726 C CD2 . LEU A 1 232 ? 6.801   -14.237 29.047 1.00 44.00  ? 234 LEU A CD2 1 
ATOM   1727 N N   . SER A 1 233 ? 2.610   -13.821 26.126 1.00 45.23  ? 235 SER A N   1 
ATOM   1728 C CA  . SER A 1 233 ? 1.548   -14.123 25.150 1.00 45.15  ? 235 SER A CA  1 
ATOM   1729 C C   . SER A 1 233 ? 1.173   -12.933 24.287 1.00 42.49  ? 235 SER A C   1 
ATOM   1730 O O   . SER A 1 233 ? 1.436   -11.830 24.633 1.00 41.18  ? 235 SER A O   1 
ATOM   1731 C CB  . SER A 1 233 ? 0.333   -14.860 25.770 1.00 46.69  ? 235 SER A CB  1 
ATOM   1732 O OG  . SER A 1 233 ? 0.133   -14.594 27.159 1.00 50.29  ? 235 SER A OG  1 
ATOM   1733 N N   . SER A 1 234 ? 0.622   -13.175 23.117 1.00 42.72  ? 236 SER A N   1 
ATOM   1734 C CA  . SER A 1 234 ? 0.203   -12.081 22.260 1.00 41.88  ? 236 SER A CA  1 
ATOM   1735 C C   . SER A 1 234 ? -0.837  -12.538 21.290 1.00 43.09  ? 236 SER A C   1 
ATOM   1736 O O   . SER A 1 234 ? -0.903  -13.715 20.993 1.00 45.58  ? 236 SER A O   1 
ATOM   1737 C CB  . SER A 1 234 ? 1.374   -11.454 21.501 1.00 41.80  ? 236 SER A CB  1 
ATOM   1738 O OG  . SER A 1 234 ? 1.886   -12.270 20.483 1.00 39.81  ? 236 SER A OG  1 
ATOM   1739 N N   . VAL A 1 235 ? -1.677  -11.603 20.853 1.00 43.20  ? 237 VAL A N   1 
ATOM   1740 C CA  . VAL A 1 235 ? -2.679  -11.784 19.827 1.00 43.53  ? 237 VAL A CA  1 
ATOM   1741 C C   . VAL A 1 235 ? -2.552  -10.616 18.877 1.00 44.62  ? 237 VAL A C   1 
ATOM   1742 O O   . VAL A 1 235 ? -1.937  -9.550  19.217 1.00 45.26  ? 237 VAL A O   1 
ATOM   1743 C CB  . VAL A 1 235 ? -4.070  -11.634 20.379 1.00 43.30  ? 237 VAL A CB  1 
ATOM   1744 C CG1 . VAL A 1 235 ? -4.531  -12.905 21.083 1.00 47.28  ? 237 VAL A CG1 1 
ATOM   1745 C CG2 . VAL A 1 235 ? -4.148  -10.468 21.321 1.00 38.77  ? 237 VAL A CG2 1 
ATOM   1746 N N   . ARG A 1 236 ? -3.247  -10.788 17.748 1.00 45.37  ? 238 ARG A N   1 
ATOM   1747 C CA  . ARG A 1 236 ? -3.229  -9.952  16.563 1.00 44.79  ? 238 ARG A CA  1 
ATOM   1748 C C   . ARG A 1 236 ? -4.697  -9.892  16.139 1.00 44.98  ? 238 ARG A C   1 
ATOM   1749 O O   . ARG A 1 236 ? -5.389  -10.925 16.131 1.00 45.10  ? 238 ARG A O   1 
ATOM   1750 C CB  . ARG A 1 236 ? -2.466  -10.727 15.519 1.00 46.24  ? 238 ARG A CB  1 
ATOM   1751 C CG  . ARG A 1 236 ? -2.163  -9.977  14.340 1.00 48.66  ? 238 ARG A CG  1 
ATOM   1752 C CD  . ARG A 1 236 ? -1.646  -10.830 13.162 1.00 52.46  ? 238 ARG A CD  1 
ATOM   1753 N NE  . ARG A 1 236 ? -1.739  -9.916  12.012 1.00 54.63  ? 238 ARG A NE  1 
ATOM   1754 C CZ  . ARG A 1 236 ? -0.716  -9.408  11.316 1.00 53.74  ? 238 ARG A CZ  1 
ATOM   1755 N NH1 . ARG A 1 236 ? -0.978  -8.533  10.353 1.00 51.79  ? 238 ARG A NH1 1 
ATOM   1756 N NH2 . ARG A 1 236 ? 0.548   -9.793  11.544 1.00 54.28  ? 238 ARG A NH2 1 
ATOM   1757 N N   . GLY A 1 237 ? -5.217  -8.697  15.829 1.00 43.37  ? 239 GLY A N   1 
ATOM   1758 C CA  . GLY A 1 237 ? -6.610  -8.621  15.380 1.00 41.77  ? 239 GLY A CA  1 
ATOM   1759 C C   . GLY A 1 237 ? -6.658  -8.596  13.882 1.00 42.46  ? 239 GLY A C   1 
ATOM   1760 O O   . GLY A 1 237 ? -5.624  -8.536  13.243 1.00 42.54  ? 239 GLY A O   1 
ATOM   1761 N N   . ASN A 1 238 ? -7.856  -8.629  13.304 1.00 43.46  ? 240 ASN A N   1 
ATOM   1762 C CA  . ASN A 1 238 ? -8.018  -8.416  11.851 1.00 45.07  ? 240 ASN A CA  1 
ATOM   1763 C C   . ASN A 1 238 ? -7.571  -7.053  11.396 1.00 44.72  ? 240 ASN A C   1 
ATOM   1764 O O   . ASN A 1 238 ? -7.832  -6.040  12.103 1.00 44.35  ? 240 ASN A O   1 
ATOM   1765 C CB  . ASN A 1 238 ? -9.477  -8.539  11.493 1.00 45.12  ? 240 ASN A CB  1 
ATOM   1766 C CG  . ASN A 1 238 ? -9.971  -9.863  11.778 1.00 49.85  ? 240 ASN A CG  1 
ATOM   1767 O OD1 . ASN A 1 238 ? -9.413  -10.825 11.262 1.00 54.88  ? 240 ASN A OD1 1 
ATOM   1768 N ND2 . ASN A 1 238 ? -10.969 -9.978  12.660 1.00 51.31  ? 240 ASN A ND2 1 
ATOM   1769 N N   . HIS A 1 239 ? -6.930  -6.986  10.230 1.00 45.59  ? 241 HIS A N   1 
ATOM   1770 C CA  . HIS A 1 239 ? -6.515  -5.670  9.738  1.00 46.03  ? 241 HIS A CA  1 
ATOM   1771 C C   . HIS A 1 239 ? -7.745  -4.748  9.734  1.00 43.59  ? 241 HIS A C   1 
ATOM   1772 O O   . HIS A 1 239 ? -8.850  -5.242  9.645  1.00 44.31  ? 241 HIS A O   1 
ATOM   1773 C CB  . HIS A 1 239 ? -5.860  -5.787  8.381  1.00 48.14  ? 241 HIS A CB  1 
ATOM   1774 C CG  . HIS A 1 239 ? -6.769  -6.323  7.319  1.00 56.46  ? 241 HIS A CG  1 
ATOM   1775 N ND1 . HIS A 1 239 ? -6.670  -7.616  6.832  1.00 59.48  ? 241 HIS A ND1 1 
ATOM   1776 C CD2 . HIS A 1 239 ? -7.807  -5.740  6.653  1.00 59.73  ? 241 HIS A CD2 1 
ATOM   1777 C CE1 . HIS A 1 239 ? -7.598  -7.800  5.907  1.00 61.64  ? 241 HIS A CE1 1 
ATOM   1778 N NE2 . HIS A 1 239 ? -8.303  -6.682  5.783  1.00 62.46  ? 241 HIS A NE2 1 
ATOM   1779 N N   . ILE A 1 240 ? -7.581  -3.441  9.920  1.00 41.88  ? 242 ILE A N   1 
ATOM   1780 C CA  . ILE A 1 240 ? -8.720  -2.486  9.890  1.00 39.43  ? 242 ILE A CA  1 
ATOM   1781 C C   . ILE A 1 240 ? -8.529  -1.536  8.731  1.00 39.15  ? 242 ILE A C   1 
ATOM   1782 O O   . ILE A 1 240 ? -7.591  -0.739  8.706  1.00 39.06  ? 242 ILE A O   1 
ATOM   1783 C CB  . ILE A 1 240 ? -8.793  -1.665  11.180 1.00 39.01  ? 242 ILE A CB  1 
ATOM   1784 C CG1 . ILE A 1 240 ? -9.162  -2.558  12.350 1.00 38.35  ? 242 ILE A CG1 1 
ATOM   1785 C CG2 . ILE A 1 240 ? -9.808  -0.563  11.077 1.00 37.57  ? 242 ILE A CG2 1 
ATOM   1786 C CD1 . ILE A 1 240 ? -8.308  -2.363  13.538 1.00 38.98  ? 242 ILE A CD1 1 
ATOM   1787 N N   . ILE A 1 241 ? -9.401  -1.631  7.742  1.00 38.48  ? 243 ILE A N   1 
ATOM   1788 C CA  . ILE A 1 241 ? -9.269  -0.774  6.584  1.00 37.58  ? 243 ILE A CA  1 
ATOM   1789 C C   . ILE A 1 241 ? -9.615  0.693   6.877  1.00 38.54  ? 243 ILE A C   1 
ATOM   1790 O O   . ILE A 1 241 ? -10.311 1.014   7.882  1.00 37.78  ? 243 ILE A O   1 
ATOM   1791 C CB  . ILE A 1 241 ? -10.127 -1.290  5.454  1.00 37.21  ? 243 ILE A CB  1 
ATOM   1792 C CG1 . ILE A 1 241 ? -11.611 -1.229  5.775  1.00 36.26  ? 243 ILE A CG1 1 
ATOM   1793 C CG2 . ILE A 1 241 ? -9.765  -2.640  5.146  1.00 34.33  ? 243 ILE A CG2 1 
ATOM   1794 C CD1 . ILE A 1 241 ? -12.510 -1.520  4.495  1.00 34.44  ? 243 ILE A CD1 1 
ATOM   1795 N N   . SER A 1 242 ? -9.132  1.584   5.998  1.00 39.51  ? 244 SER A N   1 
ATOM   1796 C CA  . SER A 1 242 ? -9.387  3.018   6.137  1.00 40.94  ? 244 SER A CA  1 
ATOM   1797 C C   . SER A 1 242 ? -10.892 3.301   6.235  1.00 40.04  ? 244 SER A C   1 
ATOM   1798 O O   . SER A 1 242 ? -11.687 2.593   5.628  1.00 40.49  ? 244 SER A O   1 
ATOM   1799 C CB  . SER A 1 242 ? -8.761  3.802   4.978  1.00 42.53  ? 244 SER A CB  1 
ATOM   1800 O OG  . SER A 1 242 ? -9.345  5.118   4.840  1.00 45.39  ? 244 SER A OG  1 
ATOM   1801 N N   . GLY A 1 243 ? -11.283 4.318   6.996  1.00 39.71  ? 245 GLY A N   1 
ATOM   1802 C CA  . GLY A 1 243 ? -12.669 4.646   7.155  1.00 38.78  ? 245 GLY A CA  1 
ATOM   1803 C C   . GLY A 1 243 ? -13.456 3.560   7.867  1.00 39.68  ? 245 GLY A C   1 
ATOM   1804 O O   . GLY A 1 243 ? -14.634 3.445   7.616  1.00 40.49  ? 245 GLY A O   1 
ATOM   1805 N N   . THR A 1 244 ? -12.844 2.747   8.750  1.00 39.95  ? 246 THR A N   1 
ATOM   1806 C CA  . THR A 1 244 ? -13.628 1.841   9.614  1.00 39.57  ? 246 THR A CA  1 
ATOM   1807 C C   . THR A 1 244 ? -13.109 1.785   11.033 1.00 39.78  ? 246 THR A C   1 
ATOM   1808 O O   . THR A 1 244 ? -12.081 2.370   11.332 1.00 39.69  ? 246 THR A O   1 
ATOM   1809 C CB  . THR A 1 244 ? -13.665 0.404   9.115  1.00 40.08  ? 246 THR A CB  1 
ATOM   1810 O OG1 . THR A 1 244 ? -12.327 -0.033  8.893  1.00 41.80  ? 246 THR A OG1 1 
ATOM   1811 C CG2 . THR A 1 244 ? -14.449 0.298   7.838  1.00 39.77  ? 246 THR A CG2 1 
ATOM   1812 N N   . CYS A 1 245 ? -13.872 1.102   11.897 1.00 40.67  ? 247 CYS A N   1 
ATOM   1813 C CA  . CYS A 1 245 ? -13.503 0.759   13.288 1.00 41.51  ? 247 CYS A CA  1 
ATOM   1814 C C   . CYS A 1 245 ? -13.824 -0.695  13.506 1.00 41.51  ? 247 CYS A C   1 
ATOM   1815 O O   . CYS A 1 245 ? -14.743 -1.231  12.866 1.00 41.78  ? 247 CYS A O   1 
ATOM   1816 C CB  . CYS A 1 245 ? -14.357 1.494   14.321 1.00 41.44  ? 247 CYS A CB  1 
ATOM   1817 S SG  . CYS A 1 245 ? -14.498 3.261   14.158 1.00 45.73  ? 247 CYS A SG  1 
ATOM   1818 N N   . ALA A 1 246 ? -13.111 -1.308  14.447 1.00 41.08  ? 248 ALA A N   1 
ATOM   1819 C CA  . ALA A 1 246 ? -13.432 -2.653  14.912 1.00 40.83  ? 248 ALA A CA  1 
ATOM   1820 C C   . ALA A 1 246 ? -13.214 -2.684  16.403 1.00 40.78  ? 248 ALA A C   1 
ATOM   1821 O O   . ALA A 1 246 ? -12.684 -1.717  16.971 1.00 40.55  ? 248 ALA A O   1 
ATOM   1822 C CB  . ALA A 1 246 ? -12.570 -3.700  14.227 1.00 40.87  ? 248 ALA A CB  1 
ATOM   1823 N N   . SER A 1 247 ? -13.592 -3.827  16.998 1.00 40.91  ? 249 SER A N   1 
ATOM   1824 C CA  . SER A 1 247 ? -13.786 -4.035  18.443 1.00 39.75  ? 249 SER A CA  1 
ATOM   1825 C C   . SER A 1 247 ? -13.245 -5.351  18.972 1.00 39.54  ? 249 SER A C   1 
ATOM   1826 O O   . SER A 1 247 ? -13.285 -6.361  18.268 1.00 38.24  ? 249 SER A O   1 
ATOM   1827 C CB  . SER A 1 247 ? -15.255 -4.071  18.719 1.00 39.72  ? 249 SER A CB  1 
ATOM   1828 O OG  . SER A 1 247 ? -15.639 -2.776  18.970 1.00 41.51  ? 249 SER A OG  1 
ATOM   1829 N N   . TRP A 1 248 ? -12.738 -5.319  20.211 1.00 39.52  ? 250 TRP A N   1 
ATOM   1830 C CA  . TRP A 1 248 ? -12.508 -6.551  20.948 1.00 40.78  ? 250 TRP A CA  1 
ATOM   1831 C C   . TRP A 1 248 ? -13.504 -6.587  22.076 1.00 41.88  ? 250 TRP A C   1 
ATOM   1832 O O   . TRP A 1 248 ? -13.761 -5.587  22.727 1.00 41.96  ? 250 TRP A O   1 
ATOM   1833 C CB  . TRP A 1 248 ? -11.057 -6.689  21.483 1.00 40.27  ? 250 TRP A CB  1 
ATOM   1834 C CG  . TRP A 1 248 ? -10.047 -6.794  20.429 1.00 38.92  ? 250 TRP A CG  1 
ATOM   1835 C CD1 . TRP A 1 248 ? -10.281 -6.986  19.075 1.00 38.41  ? 250 TRP A CD1 1 
ATOM   1836 C CD2 . TRP A 1 248 ? -8.634  -6.687  20.578 1.00 37.99  ? 250 TRP A CD2 1 
ATOM   1837 N NE1 . TRP A 1 248 ? -9.090  -7.008  18.383 1.00 38.70  ? 250 TRP A NE1 1 
ATOM   1838 C CE2 . TRP A 1 248 ? -8.059  -6.836  19.278 1.00 38.49  ? 250 TRP A CE2 1 
ATOM   1839 C CE3 . TRP A 1 248 ? -7.785  -6.528  21.668 1.00 37.27  ? 250 TRP A CE3 1 
ATOM   1840 C CZ2 . TRP A 1 248 ? -6.670  -6.818  19.060 1.00 34.87  ? 250 TRP A CZ2 1 
ATOM   1841 C CZ3 . TRP A 1 248 ? -6.379  -6.544  21.430 1.00 34.40  ? 250 TRP A CZ3 1 
ATOM   1842 C CH2 . TRP A 1 248 ? -5.862  -6.659  20.143 1.00 32.21  ? 250 TRP A CH2 1 
ATOM   1843 N N   . ARG A 1 249 ? -14.077 -7.750  22.305 1.00 44.00  ? 251 ARG A N   1 
ATOM   1844 C CA  . ARG A 1 249 ? -15.141 -7.882  23.311 1.00 45.93  ? 251 ARG A CA  1 
ATOM   1845 C C   . ARG A 1 249 ? -14.872 -9.144  24.023 1.00 47.71  ? 251 ARG A C   1 
ATOM   1846 O O   . ARG A 1 249 ? -15.343 -10.185 23.616 1.00 49.58  ? 251 ARG A O   1 
ATOM   1847 C CB  . ARG A 1 249 ? -16.511 -7.966  22.633 1.00 45.55  ? 251 ARG A CB  1 
ATOM   1848 C CG  . ARG A 1 249 ? -16.900 -6.675  22.014 1.00 41.61  ? 251 ARG A CG  1 
ATOM   1849 C CD  . ARG A 1 249 ? -17.206 -5.717  23.066 1.00 42.03  ? 251 ARG A CD  1 
ATOM   1850 N NE  . ARG A 1 249 ? -17.660 -4.464  22.521 1.00 46.66  ? 251 ARG A NE  1 
ATOM   1851 C CZ  . ARG A 1 249 ? -16.867 -3.428  22.289 1.00 46.64  ? 251 ARG A CZ  1 
ATOM   1852 N NH1 . ARG A 1 249 ? -15.577 -3.515  22.538 1.00 51.46  ? 251 ARG A NH1 1 
ATOM   1853 N NH2 . ARG A 1 249 ? -17.348 -2.305  21.814 1.00 46.91  ? 251 ARG A NH2 1 
ATOM   1854 N N   . GLY A 1 250 ? -14.016 -9.075  25.020 1.00 48.92  ? 252 GLY A N   1 
ATOM   1855 C CA  . GLY A 1 250 ? -13.658 -10.279 25.771 1.00 51.42  ? 252 GLY A CA  1 
ATOM   1856 C C   . GLY A 1 250 ? -12.513 -11.075 25.172 1.00 51.12  ? 252 GLY A C   1 
ATOM   1857 O O   . GLY A 1 250 ? -12.158 -12.135 25.691 1.00 53.53  ? 252 GLY A O   1 
ATOM   1858 N N   . LYS A 1 251 ? -11.954 -10.576 24.086 1.00 48.59  ? 253 LYS A N   1 
ATOM   1859 C CA  . LYS A 1 251 ? -10.784 -11.153 23.526 1.00 48.75  ? 253 LYS A CA  1 
ATOM   1860 C C   . LYS A 1 251 ? -9.765  -11.206 24.642 1.00 49.08  ? 253 LYS A C   1 
ATOM   1861 O O   . LYS A 1 251 ? -9.634  -10.263 25.423 1.00 49.41  ? 253 LYS A O   1 
ATOM   1862 C CB  . LYS A 1 251 ? -10.260 -10.270 22.410 1.00 47.63  ? 253 LYS A CB  1 
ATOM   1863 C CG  . LYS A 1 251 ? -8.828  -10.527 22.084 1.00 48.00  ? 253 LYS A CG  1 
ATOM   1864 C CD  . LYS A 1 251 ? -8.687  -11.222 20.765 1.00 49.95  ? 253 LYS A CD  1 
ATOM   1865 C CE  . LYS A 1 251 ? -8.865  -10.251 19.621 1.00 48.09  ? 253 LYS A CE  1 
ATOM   1866 N NZ  . LYS A 1 251 ? -8.980  -11.072 18.436 1.00 52.18  ? 253 LYS A NZ  1 
ATOM   1867 N N   . SER A 1 252 ? -9.046  -12.319 24.721 1.00 49.73  ? 254 SER A N   1 
ATOM   1868 C CA  . SER A 1 252 ? -8.394  -12.692 25.973 1.00 49.60  ? 254 SER A CA  1 
ATOM   1869 C C   . SER A 1 252 ? -6.907  -13.145 25.809 1.00 47.80  ? 254 SER A C   1 
ATOM   1870 O O   . SER A 1 252 ? -6.579  -13.813 24.847 1.00 46.76  ? 254 SER A O   1 
ATOM   1871 C CB  . SER A 1 252 ? -9.280  -13.722 26.725 1.00 51.71  ? 254 SER A CB  1 
ATOM   1872 O OG  . SER A 1 252 ? -8.917  -15.077 26.487 1.00 55.15  ? 254 SER A OG  1 
ATOM   1873 N N   . LEU A 1 253 ? -6.031  -12.741 26.736 1.00 46.03  ? 255 LEU A N   1 
ATOM   1874 C CA  . LEU A 1 253 ? -4.649  -13.184 26.722 1.00 45.07  ? 255 LEU A CA  1 
ATOM   1875 C C   . LEU A 1 253 ? -4.390  -13.950 27.982 1.00 46.76  ? 255 LEU A C   1 
ATOM   1876 O O   . LEU A 1 253 ? -4.828  -13.514 29.050 1.00 46.35  ? 255 LEU A O   1 
ATOM   1877 C CB  . LEU A 1 253 ? -3.716  -11.998 26.771 1.00 43.05  ? 255 LEU A CB  1 
ATOM   1878 C CG  . LEU A 1 253 ? -3.293  -11.348 25.513 1.00 39.15  ? 255 LEU A CG  1 
ATOM   1879 C CD1 . LEU A 1 253 ? -2.474  -10.226 25.949 1.00 38.06  ? 255 LEU A CD1 1 
ATOM   1880 C CD2 . LEU A 1 253 ? -2.475  -12.332 24.818 1.00 41.19  ? 255 LEU A CD2 1 
ATOM   1881 N N   . ARG A 1 254 ? -3.625  -15.031 27.844 1.00 48.18  ? 256 ARG A N   1 
ATOM   1882 C CA  . ARG A 1 254 ? -3.276  -15.947 28.911 1.00 50.58  ? 256 ARG A CA  1 
ATOM   1883 C C   . ARG A 1 254 ? -2.134  -15.357 29.727 1.00 50.26  ? 256 ARG A C   1 
ATOM   1884 O O   . ARG A 1 254 ? -1.203  -14.780 29.157 1.00 48.73  ? 256 ARG A O   1 
ATOM   1885 C CB  . ARG A 1 254 ? -2.830  -17.297 28.258 1.00 52.26  ? 256 ARG A CB  1 
ATOM   1886 C CG  . ARG A 1 254 ? -2.176  -18.358 29.165 1.00 53.17  ? 256 ARG A CG  1 
ATOM   1887 C CD  . ARG A 1 254 ? -3.105  -18.740 30.328 1.00 62.62  ? 256 ARG A CD  1 
ATOM   1888 N NE  . ARG A 1 254 ? -4.314  -19.480 29.927 1.00 67.85  ? 256 ARG A NE  1 
ATOM   1889 C CZ  . ARG A 1 254 ? -4.358  -20.799 29.664 1.00 72.67  ? 256 ARG A CZ  1 
ATOM   1890 N NH1 . ARG A 1 254 ? -3.254  -21.544 29.710 1.00 70.24  ? 256 ARG A NH1 1 
ATOM   1891 N NH2 . ARG A 1 254 ? -5.516  -21.377 29.303 1.00 76.50  ? 256 ARG A NH2 1 
ATOM   1892 N N   . VAL A 1 255 ? -2.141  -15.565 31.041 1.00 51.92  ? 257 VAL A N   1 
ATOM   1893 C CA  . VAL A 1 255 ? -0.953  -15.190 31.825 1.00 52.83  ? 257 VAL A CA  1 
ATOM   1894 C C   . VAL A 1 255 ? -0.074  -16.388 32.111 1.00 56.14  ? 257 VAL A C   1 
ATOM   1895 O O   . VAL A 1 255 ? -0.395  -17.204 32.982 1.00 58.56  ? 257 VAL A O   1 
ATOM   1896 C CB  . VAL A 1 255 ? -1.338  -14.528 33.140 1.00 51.80  ? 257 VAL A CB  1 
ATOM   1897 C CG1 . VAL A 1 255 ? -0.137  -13.858 33.744 1.00 49.53  ? 257 VAL A CG1 1 
ATOM   1898 C CG2 . VAL A 1 255 ? -2.417  -13.523 32.887 1.00 49.95  ? 257 VAL A CG2 1 
ATOM   1899 N N   . GLN A 1 256 ? 1.034   -16.513 31.392 1.00 58.35  ? 258 GLN A N   1 
ATOM   1900 C CA  . GLN A 1 256 ? 1.902   -17.698 31.557 1.00 61.49  ? 258 GLN A CA  1 
ATOM   1901 C C   . GLN A 1 256 ? 2.940   -17.512 32.678 1.00 62.65  ? 258 GLN A C   1 
ATOM   1902 O O   . GLN A 1 256 ? 3.409   -16.366 32.922 1.00 60.32  ? 258 GLN A O   1 
ATOM   1903 C CB  . GLN A 1 256 ? 2.561   -18.081 30.242 1.00 61.35  ? 258 GLN A CB  1 
ATOM   1904 C CG  . GLN A 1 256 ? 2.391   -17.033 29.162 1.00 63.09  ? 258 GLN A CG  1 
ATOM   1905 C CD  . GLN A 1 256 ? 3.068   -17.378 27.849 1.00 64.60  ? 258 GLN A CD  1 
ATOM   1906 O OE1 . GLN A 1 256 ? 2.630   -18.265 27.101 1.00 67.72  ? 258 GLN A OE1 1 
ATOM   1907 N NE2 . GLN A 1 256 ? 4.124   -16.650 27.545 1.00 63.07  ? 258 GLN A NE2 1 
ATOM   1908 N N   . LYS A 1 257 ? 3.230   -18.625 33.390 1.00 66.05  ? 259 LYS A N   1 
ATOM   1909 C CA  . LYS A 1 257 ? 4.351   -18.717 34.355 1.00 68.08  ? 259 LYS A CA  1 
ATOM   1910 C C   . LYS A 1 257 ? 5.639   -18.417 33.608 1.00 68.42  ? 259 LYS A C   1 
ATOM   1911 O O   . LYS A 1 257 ? 5.760   -18.741 32.441 1.00 68.22  ? 259 LYS A O   1 
ATOM   1912 C CB  . LYS A 1 257 ? 4.489   -20.133 34.927 1.00 70.35  ? 259 LYS A CB  1 
ATOM   1913 C CG  . LYS A 1 257 ? 3.181   -20.858 35.292 1.00 75.17  ? 259 LYS A CG  1 
ATOM   1914 C CD  . LYS A 1 257 ? 3.209   -22.414 34.966 1.00 80.24  ? 259 LYS A CD  1 
ATOM   1915 C CE  . LYS A 1 257 ? 2.865   -22.696 33.437 1.00 81.35  ? 259 LYS A CE  1 
ATOM   1916 N NZ  . LYS A 1 257 ? 2.104   -23.982 33.228 1.00 82.49  ? 259 LYS A NZ  1 
ATOM   1917 N N   . ILE A 1 258 ? 6.623   -17.815 34.256 1.00 69.91  ? 260 ILE A N   1 
ATOM   1918 C CA  . ILE A 1 258 ? 7.957   -17.731 33.615 1.00 71.48  ? 260 ILE A CA  1 
ATOM   1919 C C   . ILE A 1 258 ? 8.797   -18.928 34.078 1.00 74.22  ? 260 ILE A C   1 
ATOM   1920 O O   . ILE A 1 258 ? 8.321   -19.714 34.917 1.00 75.48  ? 260 ILE A O   1 
ATOM   1921 C CB  . ILE A 1 258 ? 8.680   -16.412 33.929 1.00 70.08  ? 260 ILE A CB  1 
ATOM   1922 C CG1 . ILE A 1 258 ? 7.735   -15.232 33.603 1.00 68.53  ? 260 ILE A CG1 1 
ATOM   1923 C CG2 . ILE A 1 258 ? 10.098  -16.391 33.249 1.00 69.69  ? 260 ILE A CG2 1 
ATOM   1924 C CD1 . ILE A 1 258 ? 8.311   -14.169 32.710 1.00 66.80  ? 260 ILE A CD1 1 
ATOM   1925 N N   . ARG A 1 259 ? 10.020  -19.073 33.546 1.00 75.87  ? 261 ARG A N   1 
ATOM   1926 C CA  . ARG A 1 259 ? 10.980  -20.095 34.029 1.00 77.99  ? 261 ARG A CA  1 
ATOM   1927 C C   . ARG A 1 259 ? 11.887  -19.595 35.164 1.00 76.95  ? 261 ARG A C   1 
ATOM   1928 O O   . ARG A 1 259 ? 11.736  -20.010 36.324 1.00 76.85  ? 261 ARG A O   1 
ATOM   1929 C CB  . ARG A 1 259 ? 11.797  -20.668 32.873 1.00 79.31  ? 261 ARG A CB  1 
ATOM   1930 C CG  . ARG A 1 259 ? 11.626  -22.188 32.693 1.00 84.83  ? 261 ARG A CG  1 
ATOM   1931 C CD  . ARG A 1 259 ? 12.576  -23.014 33.637 1.00 89.42  ? 261 ARG A CD  1 
ATOM   1932 N NE  . ARG A 1 259 ? 13.753  -22.226 34.056 1.00 89.19  ? 261 ARG A NE  1 
ATOM   1933 C CZ  . ARG A 1 259 ? 14.934  -22.218 33.429 1.00 89.61  ? 261 ARG A CZ  1 
ATOM   1934 N NH1 . ARG A 1 259 ? 15.127  -22.978 32.351 1.00 90.92  ? 261 ARG A NH1 1 
ATOM   1935 N NH2 . ARG A 1 259 ? 15.930  -21.448 33.878 1.00 87.06  ? 261 ARG A NH2 1 
ATOM   1936 N N   . ASN A 1 266 ? 19.389  -13.865 40.743 1.00 69.10  ? 268 ASN A N   1 
ATOM   1937 C CA  . ASN A 1 266 ? 19.999  -12.556 40.441 1.00 68.73  ? 268 ASN A CA  1 
ATOM   1938 C C   . ASN A 1 266 ? 19.090  -11.465 39.800 1.00 67.67  ? 268 ASN A C   1 
ATOM   1939 O O   . ASN A 1 266 ? 19.542  -10.370 39.410 1.00 67.81  ? 268 ASN A O   1 
ATOM   1940 C CB  . ASN A 1 266 ? 21.320  -12.719 39.665 1.00 69.51  ? 268 ASN A CB  1 
ATOM   1941 C CG  . ASN A 1 266 ? 22.543  -12.273 40.502 1.00 70.76  ? 268 ASN A CG  1 
ATOM   1942 O OD1 . ASN A 1 266 ? 22.425  -12.044 41.713 1.00 66.33  ? 268 ASN A OD1 1 
ATOM   1943 N ND2 . ASN A 1 266 ? 23.714  -12.125 39.849 1.00 72.99  ? 268 ASN A ND2 1 
ATOM   1944 N N   . ILE A 1 267 ? 17.810  -11.758 39.696 1.00 66.25  ? 269 ILE A N   1 
ATOM   1945 C CA  . ILE A 1 267 ? 16.891  -10.737 39.232 1.00 65.22  ? 269 ILE A CA  1 
ATOM   1946 C C   . ILE A 1 267 ? 16.302  -10.116 40.493 1.00 62.99  ? 269 ILE A C   1 
ATOM   1947 O O   . ILE A 1 267 ? 16.033  -10.875 41.436 1.00 63.60  ? 269 ILE A O   1 
ATOM   1948 C CB  . ILE A 1 267 ? 15.777  -11.347 38.329 1.00 65.78  ? 269 ILE A CB  1 
ATOM   1949 C CG1 . ILE A 1 267 ? 15.199  -12.604 38.978 1.00 66.35  ? 269 ILE A CG1 1 
ATOM   1950 C CG2 . ILE A 1 267 ? 16.335  -11.704 36.918 1.00 66.90  ? 269 ILE A CG2 1 
ATOM   1951 C CD1 . ILE A 1 267 ? 13.722  -12.739 38.713 1.00 70.69  ? 269 ILE A CD1 1 
ATOM   1952 N N   . LEU A 1 268 ? 16.116  -8.781  40.531 1.00 59.81  ? 270 LEU A N   1 
ATOM   1953 C CA  . LEU A 1 268 ? 15.429  -8.125  41.682 1.00 56.44  ? 270 LEU A CA  1 
ATOM   1954 C C   . LEU A 1 268 ? 13.952  -8.319  41.523 1.00 55.15  ? 270 LEU A C   1 
ATOM   1955 O O   . LEU A 1 268 ? 13.319  -8.941  42.362 1.00 54.31  ? 270 LEU A O   1 
ATOM   1956 C CB  . LEU A 1 268 ? 15.749  -6.642  41.782 1.00 55.83  ? 270 LEU A CB  1 
ATOM   1957 C CG  . LEU A 1 268 ? 17.256  -6.393  41.727 1.00 53.23  ? 270 LEU A CG  1 
ATOM   1958 C CD1 . LEU A 1 268 ? 17.613  -5.326  40.779 1.00 50.74  ? 270 LEU A CD1 1 
ATOM   1959 C CD2 . LEU A 1 268 ? 17.757  -6.037  43.050 1.00 51.41  ? 270 LEU A CD2 1 
ATOM   1960 N N   . ARG A 1 269 ? 13.419  -7.847  40.400 1.00 54.15  ? 271 ARG A N   1 
ATOM   1961 C CA  . ARG A 1 269 ? 11.988  -7.963  40.119 1.00 53.44  ? 271 ARG A CA  1 
ATOM   1962 C C   . ARG A 1 269 ? 11.668  -8.167  38.641 1.00 53.75  ? 271 ARG A C   1 
ATOM   1963 O O   . ARG A 1 269 ? 12.533  -7.961  37.752 1.00 54.51  ? 271 ARG A O   1 
ATOM   1964 C CB  . ARG A 1 269 ? 11.320  -6.685  40.553 1.00 53.33  ? 271 ARG A CB  1 
ATOM   1965 C CG  . ARG A 1 269 ? 11.940  -5.508  39.894 1.00 52.31  ? 271 ARG A CG  1 
ATOM   1966 C CD  . ARG A 1 269 ? 11.430  -4.269  40.478 1.00 50.39  ? 271 ARG A CD  1 
ATOM   1967 N NE  . ARG A 1 269 ? 12.615  -3.546  40.882 1.00 54.61  ? 271 ARG A NE  1 
ATOM   1968 C CZ  . ARG A 1 269 ? 13.045  -2.419  40.343 1.00 54.39  ? 271 ARG A CZ  1 
ATOM   1969 N NH1 . ARG A 1 269 ? 12.361  -1.823  39.386 1.00 54.99  ? 271 ARG A NH1 1 
ATOM   1970 N NH2 . ARG A 1 269 ? 14.160  -1.867  40.799 1.00 57.23  ? 271 ARG A NH2 1 
ATOM   1971 N N   . VAL A 1 270 ? 10.422  -8.550  38.372 1.00 52.99  ? 272 VAL A N   1 
ATOM   1972 C CA  . VAL A 1 270 ? 9.910   -8.525  37.003 1.00 52.79  ? 272 VAL A CA  1 
ATOM   1973 C C   . VAL A 1 270 ? 8.732   -7.561  36.966 1.00 52.41  ? 272 VAL A C   1 
ATOM   1974 O O   . VAL A 1 270 ? 7.758   -7.794  37.617 1.00 54.24  ? 272 VAL A O   1 
ATOM   1975 C CB  . VAL A 1 270 ? 9.376   -9.891  36.558 1.00 52.61  ? 272 VAL A CB  1 
ATOM   1976 C CG1 . VAL A 1 270 ? 9.344   -9.972  35.081 1.00 51.98  ? 272 VAL A CG1 1 
ATOM   1977 C CG2 . VAL A 1 270 ? 10.214  -10.962 37.088 1.00 53.13  ? 272 VAL A CG2 1 
ATOM   1978 N N   . GLU A 1 271 ? 8.806   -6.484  36.221 1.00 51.48  ? 273 GLU A N   1 
ATOM   1979 C CA  . GLU A 1 271 ? 7.632   -5.675  35.993 1.00 50.68  ? 273 GLU A CA  1 
ATOM   1980 C C   . GLU A 1 271 ? 6.912   -6.091  34.704 1.00 48.79  ? 273 GLU A C   1 
ATOM   1981 O O   . GLU A 1 271 ? 7.523   -6.298  33.674 1.00 48.16  ? 273 GLU A O   1 
ATOM   1982 C CB  . GLU A 1 271 ? 8.023   -4.215  35.875 1.00 52.04  ? 273 GLU A CB  1 
ATOM   1983 C CG  . GLU A 1 271 ? 8.561   -3.585  37.162 1.00 55.89  ? 273 GLU A CG  1 
ATOM   1984 C CD  . GLU A 1 271 ? 9.350   -2.319  36.861 1.00 62.01  ? 273 GLU A CD  1 
ATOM   1985 O OE1 . GLU A 1 271 ? 9.164   -1.723  35.712 1.00 65.93  ? 273 GLU A OE1 1 
ATOM   1986 O OE2 . GLU A 1 271 ? 10.144  -1.941  37.770 1.00 57.43  ? 273 GLU A OE2 1 
ATOM   1987 N N   . TYR A 1 272 ? 5.595   -6.154  34.784 1.00 47.49  ? 274 TYR A N   1 
ATOM   1988 C CA  . TYR A 1 272 ? 4.713   -6.653  33.743 1.00 45.03  ? 274 TYR A CA  1 
ATOM   1989 C C   . TYR A 1 272 ? 3.795   -5.606  33.142 1.00 43.22  ? 274 TYR A C   1 
ATOM   1990 O O   . TYR A 1 272 ? 3.422   -4.661  33.814 1.00 44.41  ? 274 TYR A O   1 
ATOM   1991 C CB  . TYR A 1 272 ? 3.842   -7.655  34.388 1.00 45.35  ? 274 TYR A CB  1 
ATOM   1992 C CG  . TYR A 1 272 ? 4.557   -8.878  34.791 1.00 45.69  ? 274 TYR A CG  1 
ATOM   1993 C CD1 . TYR A 1 272 ? 4.716   -9.930  33.887 1.00 46.15  ? 274 TYR A CD1 1 
ATOM   1994 C CD2 . TYR A 1 272 ? 5.025   -9.037  36.091 1.00 48.43  ? 274 TYR A CD2 1 
ATOM   1995 C CE1 . TYR A 1 272 ? 5.360   -11.106 34.260 1.00 45.91  ? 274 TYR A CE1 1 
ATOM   1996 C CE2 . TYR A 1 272 ? 5.686   -10.231 36.479 1.00 47.85  ? 274 TYR A CE2 1 
ATOM   1997 C CZ  . TYR A 1 272 ? 5.833   -11.238 35.549 1.00 45.93  ? 274 TYR A CZ  1 
ATOM   1998 O OH  . TYR A 1 272 ? 6.433   -12.393 35.896 1.00 51.16  ? 274 TYR A OH  1 
ATOM   1999 N N   . SER A 1 273 ? 3.444   -5.744  31.877 1.00 40.79  ? 275 SER A N   1 
ATOM   2000 C CA  . SER A 1 273 ? 2.585   -4.750  31.263 1.00 40.23  ? 275 SER A CA  1 
ATOM   2001 C C   . SER A 1 273 ? 1.752   -5.414  30.256 1.00 38.45  ? 275 SER A C   1 
ATOM   2002 O O   . SER A 1 273 ? 2.181   -6.387  29.631 1.00 39.42  ? 275 SER A O   1 
ATOM   2003 C CB  . SER A 1 273 ? 3.388   -3.650  30.532 1.00 41.14  ? 275 SER A CB  1 
ATOM   2004 O OG  . SER A 1 273 ? 3.662   -2.507  31.341 1.00 42.96  ? 275 SER A OG  1 
ATOM   2005 N N   . LEU A 1 274 ? 0.560   -4.885  30.079 1.00 36.70  ? 276 LEU A N   1 
ATOM   2006 C CA  . LEU A 1 274 ? -0.228  -5.198  28.937 1.00 35.51  ? 276 LEU A CA  1 
ATOM   2007 C C   . LEU A 1 274 ? -0.120  -4.043  27.951 1.00 35.94  ? 276 LEU A C   1 
ATOM   2008 O O   . LEU A 1 274 ? -0.392  -2.887  28.277 1.00 35.61  ? 276 LEU A O   1 
ATOM   2009 C CB  . LEU A 1 274 ? -1.660  -5.396  29.355 1.00 35.58  ? 276 LEU A CB  1 
ATOM   2010 C CG  . LEU A 1 274 ? -2.694  -5.653  28.256 1.00 33.74  ? 276 LEU A CG  1 
ATOM   2011 C CD1 . LEU A 1 274 ? -2.365  -6.856  27.323 1.00 29.09  ? 276 LEU A CD1 1 
ATOM   2012 C CD2 . LEU A 1 274 ? -3.866  -5.920  29.039 1.00 28.35  ? 276 LEU A CD2 1 
ATOM   2013 N N   . LEU A 1 275 ? 0.330   -4.388  26.755 1.00 36.07  ? 277 LEU A N   1 
ATOM   2014 C CA  . LEU A 1 275 ? 0.483   -3.476  25.671 1.00 36.22  ? 277 LEU A CA  1 
ATOM   2015 C C   . LEU A 1 275 ? -0.631  -3.716  24.704 1.00 36.27  ? 277 LEU A C   1 
ATOM   2016 O O   . LEU A 1 275 ? -0.812  -4.813  24.223 1.00 37.58  ? 277 LEU A O   1 
ATOM   2017 C CB  . LEU A 1 275 ? 1.837   -3.720  24.982 1.00 36.80  ? 277 LEU A CB  1 
ATOM   2018 C CG  . LEU A 1 275 ? 3.067   -2.851  25.387 1.00 37.43  ? 277 LEU A CG  1 
ATOM   2019 C CD1 . LEU A 1 275 ? 3.094   -2.412  26.844 1.00 33.00  ? 277 LEU A CD1 1 
ATOM   2020 C CD2 . LEU A 1 275 ? 4.318   -3.616  25.078 1.00 39.92  ? 277 LEU A CD2 1 
ATOM   2021 N N   . ILE A 1 276 ? -1.400  -2.675  24.433 1.00 37.24  ? 278 ILE A N   1 
ATOM   2022 C CA  . ILE A 1 276 ? -2.403  -2.687  23.370 1.00 36.68  ? 278 ILE A CA  1 
ATOM   2023 C C   . ILE A 1 276 ? -1.949  -1.600  22.385 1.00 36.02  ? 278 ILE A C   1 
ATOM   2024 O O   . ILE A 1 276 ? -1.775  -0.441  22.764 1.00 36.23  ? 278 ILE A O   1 
ATOM   2025 C CB  . ILE A 1 276 ? -3.815  -2.408  23.911 1.00 36.91  ? 278 ILE A CB  1 
ATOM   2026 C CG1 . ILE A 1 276 ? -4.271  -3.546  24.806 1.00 39.31  ? 278 ILE A CG1 1 
ATOM   2027 C CG2 . ILE A 1 276 ? -4.804  -2.498  22.808 1.00 38.33  ? 278 ILE A CG2 1 
ATOM   2028 C CD1 . ILE A 1 276 ? -5.018  -3.045  26.038 1.00 39.94  ? 278 ILE A CD1 1 
ATOM   2029 N N   . TYR A 1 277 ? -1.713  -1.988  21.139 1.00 34.90  ? 279 TYR A N   1 
ATOM   2030 C CA  . TYR A 1 277 ? -1.108  -1.083  20.191 1.00 34.94  ? 279 TYR A CA  1 
ATOM   2031 C C   . TYR A 1 277 ? -1.745  -1.247  18.820 1.00 34.41  ? 279 TYR A C   1 
ATOM   2032 O O   . TYR A 1 277 ? -2.409  -2.215  18.526 1.00 34.39  ? 279 TYR A O   1 
ATOM   2033 C CB  . TYR A 1 277 ? 0.457   -1.129  20.229 1.00 35.28  ? 279 TYR A CB  1 
ATOM   2034 C CG  . TYR A 1 277 ? 1.147   -2.493  19.924 1.00 39.20  ? 279 TYR A CG  1 
ATOM   2035 C CD1 . TYR A 1 277 ? 1.082   -3.585  20.843 1.00 38.38  ? 279 TYR A CD1 1 
ATOM   2036 C CD2 . TYR A 1 277 ? 1.874   -2.694  18.704 1.00 36.34  ? 279 TYR A CD2 1 
ATOM   2037 C CE1 . TYR A 1 277 ? 1.703   -4.842  20.525 1.00 39.18  ? 279 TYR A CE1 1 
ATOM   2038 C CE2 . TYR A 1 277 ? 2.492   -3.900  18.417 1.00 36.38  ? 279 TYR A CE2 1 
ATOM   2039 C CZ  . TYR A 1 277 ? 2.402   -4.974  19.315 1.00 38.66  ? 279 TYR A CZ  1 
ATOM   2040 O OH  . TYR A 1 277 ? 2.991   -6.175  18.994 1.00 40.00  ? 279 TYR A OH  1 
ATOM   2041 N N   . VAL A 1 278 ? -1.660  -0.238  18.000 1.00 34.22  ? 280 VAL A N   1 
ATOM   2042 C CA  . VAL A 1 278 ? -2.184  -0.394  16.681 1.00 33.19  ? 280 VAL A CA  1 
ATOM   2043 C C   . VAL A 1 278 ? -0.975  -0.107  15.901 1.00 33.47  ? 280 VAL A C   1 
ATOM   2044 O O   . VAL A 1 278 ? -0.380  0.959   16.002 1.00 34.48  ? 280 VAL A O   1 
ATOM   2045 C CB  . VAL A 1 278 ? -3.213  0.704   16.265 1.00 33.30  ? 280 VAL A CB  1 
ATOM   2046 C CG1 . VAL A 1 278 ? -3.640  0.486   14.804 1.00 32.36  ? 280 VAL A CG1 1 
ATOM   2047 C CG2 . VAL A 1 278 ? -4.381  0.690   17.135 1.00 30.68  ? 280 VAL A CG2 1 
ATOM   2048 N N   . SER A 1 279 ? -0.601  -1.041  15.089 1.00 33.98  ? 281 SER A N   1 
ATOM   2049 C CA  . SER A 1 279 ? 0.550   -0.806  14.270 1.00 35.66  ? 281 SER A CA  1 
ATOM   2050 C C   . SER A 1 279 ? 0.163   -0.118  12.933 1.00 36.65  ? 281 SER A C   1 
ATOM   2051 O O   . SER A 1 279 ? -0.828  -0.457  12.301 1.00 34.49  ? 281 SER A O   1 
ATOM   2052 C CB  . SER A 1 279 ? 1.280   -2.126  14.138 1.00 35.40  ? 281 SER A CB  1 
ATOM   2053 O OG  . SER A 1 279 ? 1.525   -2.327  12.821 1.00 37.71  ? 281 SER A OG  1 
ATOM   2054 N N   . VAL A 1 280 ? 0.933   0.890   12.532 1.00 40.67  ? 282 VAL A N   1 
ATOM   2055 C CA  . VAL A 1 280 ? 0.544   1.795   11.376 1.00 42.81  ? 282 VAL A CA  1 
ATOM   2056 C C   . VAL A 1 280 ? 1.618   1.865   10.281 1.00 45.47  ? 282 VAL A C   1 
ATOM   2057 O O   . VAL A 1 280 ? 2.672   2.428   10.502 1.00 46.50  ? 282 VAL A O   1 
ATOM   2058 C CB  . VAL A 1 280 ? 0.241   3.234   11.852 1.00 41.74  ? 282 VAL A CB  1 
ATOM   2059 C CG1 . VAL A 1 280 ? -0.140  4.060   10.706 1.00 43.35  ? 282 VAL A CG1 1 
ATOM   2060 C CG2 . VAL A 1 280 ? -0.888  3.240   12.853 1.00 40.82  ? 282 VAL A CG2 1 
ATOM   2061 N N   . PRO A 1 281 ? 1.359   1.273   9.107  1.00 47.37  ? 283 PRO A N   1 
ATOM   2062 C CA  . PRO A 1 281 ? 2.446   1.188   8.125  1.00 50.99  ? 283 PRO A CA  1 
ATOM   2063 C C   . PRO A 1 281 ? 2.923   2.572   7.706  1.00 53.47  ? 283 PRO A C   1 
ATOM   2064 O O   . PRO A 1 281 ? 2.080   3.413   7.429  1.00 53.94  ? 283 PRO A O   1 
ATOM   2065 C CB  . PRO A 1 281 ? 1.808   0.426   6.947  1.00 50.04  ? 283 PRO A CB  1 
ATOM   2066 C CG  . PRO A 1 281 ? 0.691   -0.318  7.537  1.00 48.06  ? 283 PRO A CG  1 
ATOM   2067 C CD  . PRO A 1 281 ? 0.143   0.614   8.610  1.00 46.63  ? 283 PRO A CD  1 
ATOM   2068 N N   . GLY A 1 282 ? 4.251   2.790   7.681  1.00 56.30  ? 284 GLY A N   1 
ATOM   2069 C CA  . GLY A 1 282 ? 4.847   4.106   7.456  1.00 58.56  ? 284 GLY A CA  1 
ATOM   2070 C C   . GLY A 1 282 ? 4.948   5.028   8.682  1.00 59.69  ? 284 GLY A C   1 
ATOM   2071 O O   . GLY A 1 282 ? 5.427   6.172   8.549  1.00 61.70  ? 284 GLY A O   1 
ATOM   2072 N N   . SER A 1 283 ? 4.532   4.567   9.874  1.00 57.31  ? 285 SER A N   1 
ATOM   2073 C CA  . SER A 1 283 ? 4.489   5.441   11.050 1.00 57.61  ? 285 SER A CA  1 
ATOM   2074 C C   . SER A 1 283 ? 4.760   4.727   12.388 1.00 56.43  ? 285 SER A C   1 
ATOM   2075 O O   . SER A 1 283 ? 4.842   3.493   12.446 1.00 56.83  ? 285 SER A O   1 
ATOM   2076 C CB  . SER A 1 283 ? 3.147   6.189   11.143 1.00 57.45  ? 285 SER A CB  1 
ATOM   2077 O OG  . SER A 1 283 ? 2.951   7.040   10.023 1.00 62.81  ? 285 SER A OG  1 
ATOM   2078 N N   . LYS A 1 284 ? 4.903   5.494   13.470 1.00 54.91  ? 286 LYS A N   1 
ATOM   2079 C CA  . LYS A 1 284 ? 5.153   4.880   14.765 1.00 52.79  ? 286 LYS A CA  1 
ATOM   2080 C C   . LYS A 1 284 ? 3.864   4.210   15.306 1.00 49.13  ? 286 LYS A C   1 
ATOM   2081 O O   . LYS A 1 284 ? 2.792   4.686   15.044 1.00 48.12  ? 286 LYS A O   1 
ATOM   2082 C CB  . LYS A 1 284 ? 5.716   5.932   15.748 1.00 54.09  ? 286 LYS A CB  1 
ATOM   2083 C CG  . LYS A 1 284 ? 7.166   6.329   15.515 1.00 57.62  ? 286 LYS A CG  1 
ATOM   2084 C CD  . LYS A 1 284 ? 7.328   7.832   15.650 1.00 62.87  ? 286 LYS A CD  1 
ATOM   2085 C CE  . LYS A 1 284 ? 8.794   8.193   15.763 1.00 67.21  ? 286 LYS A CE  1 
ATOM   2086 N NZ  . LYS A 1 284 ? 9.293   7.856   17.152 1.00 71.46  ? 286 LYS A NZ  1 
ATOM   2087 N N   . LYS A 1 285 ? 3.976   3.117   16.049 1.00 46.86  ? 287 LYS A N   1 
ATOM   2088 C CA  . LYS A 1 285 ? 2.820   2.518   16.704 1.00 44.63  ? 287 LYS A CA  1 
ATOM   2089 C C   . LYS A 1 285 ? 2.030   3.552   17.527 1.00 44.36  ? 287 LYS A C   1 
ATOM   2090 O O   . LYS A 1 285 ? 2.588   4.623   17.903 1.00 46.13  ? 287 LYS A O   1 
ATOM   2091 C CB  . LYS A 1 285 ? 3.261   1.366   17.608 1.00 42.94  ? 287 LYS A CB  1 
ATOM   2092 C CG  . LYS A 1 285 ? 3.917   0.244   16.828 1.00 45.71  ? 287 LYS A CG  1 
ATOM   2093 C CD  . LYS A 1 285 ? 4.637   -0.754  17.738 1.00 45.67  ? 287 LYS A CD  1 
ATOM   2094 C CE  . LYS A 1 285 ? 5.183   -1.900  16.921 1.00 46.62  ? 287 LYS A CE  1 
ATOM   2095 N NZ  . LYS A 1 285 ? 6.625   -1.768  16.445 1.00 53.51  ? 287 LYS A NZ  1 
ATOM   2096 N N   . VAL A 1 286 ? 0.742   3.252   17.763 1.00 41.45  ? 288 VAL A N   1 
ATOM   2097 C CA  . VAL A 1 286 ? -0.073  3.947   18.772 1.00 39.87  ? 288 VAL A CA  1 
ATOM   2098 C C   . VAL A 1 286 ? -0.233  2.857   19.803 1.00 38.96  ? 288 VAL A C   1 
ATOM   2099 O O   . VAL A 1 286 ? -0.896  1.826   19.539 1.00 37.91  ? 288 VAL A O   1 
ATOM   2100 C CB  . VAL A 1 286 ? -1.494  4.375   18.245 1.00 39.44  ? 288 VAL A CB  1 
ATOM   2101 C CG1 . VAL A 1 286 ? -2.272  5.199   19.261 1.00 35.85  ? 288 VAL A CG1 1 
ATOM   2102 C CG2 . VAL A 1 286 ? -1.384  5.101   16.937 1.00 40.00  ? 288 VAL A CG2 1 
ATOM   2103 N N   . ILE A 1 287 ? 0.366   3.107   20.966 1.00 38.80  ? 289 ILE A N   1 
ATOM   2104 C CA  . ILE A 1 287 ? 0.675   2.116   22.012 1.00 37.41  ? 289 ILE A CA  1 
ATOM   2105 C C   . ILE A 1 287 ? 0.015   2.603   23.308 1.00 38.40  ? 289 ILE A C   1 
ATOM   2106 O O   . ILE A 1 287 ? 0.338   3.740   23.784 1.00 40.24  ? 289 ILE A O   1 
ATOM   2107 C CB  . ILE A 1 287 ? 2.240   2.119   22.333 1.00 37.27  ? 289 ILE A CB  1 
ATOM   2108 C CG1 . ILE A 1 287 ? 3.115   1.540   21.249 1.00 36.30  ? 289 ILE A CG1 1 
ATOM   2109 C CG2 . ILE A 1 287 ? 2.549   1.342   23.543 1.00 37.14  ? 289 ILE A CG2 1 
ATOM   2110 C CD1 . ILE A 1 287 ? 4.489   2.180   21.267 1.00 34.66  ? 289 ILE A CD1 1 
ATOM   2111 N N   . LEU A 1 288 ? -0.894  1.792   23.871 1.00 37.50  ? 290 LEU A N   1 
ATOM   2112 C CA  . LEU A 1 288 ? -1.181  1.803   25.323 1.00 37.44  ? 290 LEU A CA  1 
ATOM   2113 C C   . LEU A 1 288 ? -0.337  0.775   26.106 1.00 37.44  ? 290 LEU A C   1 
ATOM   2114 O O   . LEU A 1 288 ? -0.247  -0.423  25.742 1.00 36.29  ? 290 LEU A O   1 
ATOM   2115 C CB  . LEU A 1 288 ? -2.623  1.455   25.574 1.00 37.06  ? 290 LEU A CB  1 
ATOM   2116 C CG  . LEU A 1 288 ? -3.716  2.126   24.774 1.00 38.34  ? 290 LEU A CG  1 
ATOM   2117 C CD1 . LEU A 1 288 ? -5.004  1.384   25.096 1.00 35.92  ? 290 LEU A CD1 1 
ATOM   2118 C CD2 . LEU A 1 288 ? -3.861  3.687   25.045 1.00 38.33  ? 290 LEU A CD2 1 
ATOM   2119 N N   . ASP A 1 289 ? 0.259   1.234   27.201 1.00 38.44  ? 291 ASP A N   1 
ATOM   2120 C CA  . ASP A 1 289 ? 1.023   0.386   28.126 1.00 37.67  ? 291 ASP A CA  1 
ATOM   2121 C C   . ASP A 1 289 ? 0.285   0.378   29.440 1.00 37.82  ? 291 ASP A C   1 
ATOM   2122 O O   . ASP A 1 289 ? 0.286   1.370   30.140 1.00 38.91  ? 291 ASP A O   1 
ATOM   2123 C CB  . ASP A 1 289 ? 2.358   1.021   28.341 1.00 37.43  ? 291 ASP A CB  1 
ATOM   2124 C CG  . ASP A 1 289 ? 3.238   0.242   29.272 1.00 42.63  ? 291 ASP A CG  1 
ATOM   2125 O OD1 . ASP A 1 289 ? 2.740   -0.328  30.299 1.00 47.82  ? 291 ASP A OD1 1 
ATOM   2126 O OD2 . ASP A 1 289 ? 4.472   0.209   28.988 1.00 44.23  ? 291 ASP A OD2 1 
ATOM   2127 N N   . LEU A 1 290 ? -0.325  -0.745  29.794 1.00 37.96  ? 292 LEU A N   1 
ATOM   2128 C CA  . LEU A 1 290 ? -1.106  -0.858  31.013 1.00 38.33  ? 292 LEU A CA  1 
ATOM   2129 C C   . LEU A 1 290 ? -0.434  -1.676  32.062 1.00 40.26  ? 292 LEU A C   1 
ATOM   2130 O O   . LEU A 1 290 ? -0.395  -2.870  31.951 1.00 41.01  ? 292 LEU A O   1 
ATOM   2131 C CB  . LEU A 1 290 ? -2.366  -1.600  30.679 1.00 37.04  ? 292 LEU A CB  1 
ATOM   2132 C CG  . LEU A 1 290 ? -3.609  -0.781  30.457 1.00 34.30  ? 292 LEU A CG  1 
ATOM   2133 C CD1 . LEU A 1 290 ? -3.184  0.571   30.078 1.00 35.48  ? 292 LEU A CD1 1 
ATOM   2134 C CD2 . LEU A 1 290 ? -4.455  -1.412  29.379 1.00 29.14  ? 292 LEU A CD2 1 
ATOM   2135 N N   . PRO A 1 291 ? 0.074   -1.056  33.127 1.00 42.69  ? 293 PRO A N   1 
ATOM   2136 C CA  . PRO A 1 291 ? 0.837   -1.879  34.121 1.00 42.60  ? 293 PRO A CA  1 
ATOM   2137 C C   . PRO A 1 291 ? 0.057   -2.998  34.821 1.00 42.65  ? 293 PRO A C   1 
ATOM   2138 O O   . PRO A 1 291 ? -1.062  -2.812  35.293 1.00 43.28  ? 293 PRO A O   1 
ATOM   2139 C CB  . PRO A 1 291 ? 1.274   -0.842  35.153 1.00 43.29  ? 293 PRO A CB  1 
ATOM   2140 C CG  . PRO A 1 291 ? 1.242   0.497   34.386 1.00 44.85  ? 293 PRO A CG  1 
ATOM   2141 C CD  . PRO A 1 291 ? 0.028   0.370   33.508 1.00 43.98  ? 293 PRO A CD  1 
ATOM   2142 N N   . LEU A 1 292 ? 0.674   -4.154  34.920 1.00 41.98  ? 294 LEU A N   1 
ATOM   2143 C CA  . LEU A 1 292 ? 0.121   -5.218  35.727 1.00 42.12  ? 294 LEU A CA  1 
ATOM   2144 C C   . LEU A 1 292 ? 1.014   -5.550  36.915 1.00 43.02  ? 294 LEU A C   1 
ATOM   2145 O O   . LEU A 1 292 ? 2.198   -5.178  36.994 1.00 42.25  ? 294 LEU A O   1 
ATOM   2146 C CB  . LEU A 1 292 ? -0.087  -6.490  34.905 1.00 40.83  ? 294 LEU A CB  1 
ATOM   2147 C CG  . LEU A 1 292 ? -0.595  -6.278  33.490 1.00 41.00  ? 294 LEU A CG  1 
ATOM   2148 C CD1 . LEU A 1 292 ? -0.246  -7.378  32.512 1.00 41.17  ? 294 LEU A CD1 1 
ATOM   2149 C CD2 . LEU A 1 292 ? -2.071  -5.972  33.462 1.00 42.90  ? 294 LEU A CD2 1 
ATOM   2150 N N   . VAL A 1 293 ? 0.380   -6.249  37.843 1.00 44.29  ? 295 VAL A N   1 
ATOM   2151 C CA  . VAL A 1 293 ? 1.000   -6.984  38.890 1.00 44.81  ? 295 VAL A CA  1 
ATOM   2152 C C   . VAL A 1 293 ? 0.590   -8.446  38.693 1.00 46.30  ? 295 VAL A C   1 
ATOM   2153 O O   . VAL A 1 293 ? -0.617  -8.772  38.626 1.00 45.61  ? 295 VAL A O   1 
ATOM   2154 C CB  . VAL A 1 293 ? 0.398   -6.573  40.210 1.00 45.75  ? 295 VAL A CB  1 
ATOM   2155 C CG1 . VAL A 1 293 ? 0.703   -7.638  41.259 1.00 45.72  ? 295 VAL A CG1 1 
ATOM   2156 C CG2 . VAL A 1 293 ? 0.902   -5.220  40.616 1.00 44.06  ? 295 VAL A CG2 1 
ATOM   2157 N N   . ILE A 1 294 ? 1.588   -9.327  38.653 1.00 48.00  ? 296 ILE A N   1 
ATOM   2158 C CA  . ILE A 1 294 ? 1.339   -10.769 38.388 1.00 50.33  ? 296 ILE A CA  1 
ATOM   2159 C C   . ILE A 1 294 ? 1.955   -11.741 39.377 1.00 51.31  ? 296 ILE A C   1 
ATOM   2160 O O   . ILE A 1 294 ? 3.166   -11.888 39.436 1.00 51.94  ? 296 ILE A O   1 
ATOM   2161 C CB  . ILE A 1 294 ? 1.685   -11.109 36.916 1.00 50.28  ? 296 ILE A CB  1 
ATOM   2162 C CG1 . ILE A 1 294 ? 0.525   -10.592 36.039 1.00 49.68  ? 296 ILE A CG1 1 
ATOM   2163 C CG2 . ILE A 1 294 ? 1.887   -12.647 36.701 1.00 49.72  ? 296 ILE A CG2 1 
ATOM   2164 C CD1 . ILE A 1 294 ? 1.004   -9.989  34.822 1.00 51.15  ? 296 ILE A CD1 1 
ATOM   2165 N N   . GLY A 1 295 ? 1.130   -12.381 40.183 1.00 53.62  ? 297 GLY A N   1 
ATOM   2166 C CA  . GLY A 1 295 ? 1.651   -13.292 41.212 1.00 56.16  ? 297 GLY A CA  1 
ATOM   2167 C C   . GLY A 1 295 ? 1.351   -14.764 40.995 1.00 58.48  ? 297 GLY A C   1 
ATOM   2168 O O   . GLY A 1 295 ? 0.695   -15.155 40.020 1.00 59.05  ? 297 GLY A O   1 
ATOM   2169 N N   . SER A 1 296 ? 1.804   -15.590 41.931 1.00 61.08  ? 298 SER A N   1 
ATOM   2170 C CA  . SER A 1 296 ? 1.527   -17.035 41.884 1.00 63.33  ? 298 SER A CA  1 
ATOM   2171 C C   . SER A 1 296 ? 0.872   -17.590 43.154 1.00 66.42  ? 298 SER A C   1 
ATOM   2172 O O   . SER A 1 296 ? 0.408   -18.767 43.172 1.00 70.23  ? 298 SER A O   1 
ATOM   2173 C CB  . SER A 1 296 ? 2.813   -17.753 41.619 1.00 62.49  ? 298 SER A CB  1 
ATOM   2174 O OG  . SER A 1 296 ? 3.833   -17.040 42.274 1.00 59.96  ? 298 SER A OG  1 
ATOM   2175 N N   . MET B 2 1   ? -36.842 6.337   4.770  1.00 90.74  ? 1   MET B N   1 
ATOM   2176 C CA  . MET B 2 1   ? -36.659 6.309   6.262  1.00 91.16  ? 1   MET B CA  1 
ATOM   2177 C C   . MET B 2 1   ? -36.073 5.007   6.852  1.00 87.95  ? 1   MET B C   1 
ATOM   2178 O O   . MET B 2 1   ? -36.260 3.917   6.292  1.00 88.48  ? 1   MET B O   1 
ATOM   2179 C CB  . MET B 2 1   ? -37.961 6.677   6.950  1.00 97.52  ? 1   MET B CB  1 
ATOM   2180 C CG  . MET B 2 1   ? -38.025 8.129   7.316  1.00 102.53 ? 1   MET B CG  1 
ATOM   2181 S SD  . MET B 2 1   ? -38.639 8.229   9.014  1.00 115.89 ? 1   MET B SD  1 
ATOM   2182 C CE  . MET B 2 1   ? -37.197 7.632   9.954  1.00 108.27 ? 1   MET B CE  1 
ATOM   2183 N N   . VAL B 2 2   ? -35.377 5.132   7.989  1.00 84.95  ? 2   VAL B N   1 
ATOM   2184 C CA  . VAL B 2 2   ? -34.536 4.047   8.532  1.00 80.99  ? 2   VAL B CA  1 
ATOM   2185 C C   . VAL B 2 2   ? -35.029 3.516   9.867  1.00 83.30  ? 2   VAL B C   1 
ATOM   2186 O O   . VAL B 2 2   ? -34.996 4.228   10.869 1.00 83.62  ? 2   VAL B O   1 
ATOM   2187 C CB  . VAL B 2 2   ? -33.067 4.509   8.752  1.00 76.14  ? 2   VAL B CB  1 
ATOM   2188 C CG1 . VAL B 2 2   ? -32.161 3.314   9.003  1.00 73.65  ? 2   VAL B CG1 1 
ATOM   2189 C CG2 . VAL B 2 2   ? -32.551 5.323   7.568  1.00 74.35  ? 2   VAL B CG2 1 
ATOM   2190 N N   . LYS B 2 3   ? -35.453 2.254   9.874  1.00 84.81  ? 3   LYS B N   1 
ATOM   2191 C CA  . LYS B 2 3   ? -35.959 1.610   11.087 1.00 88.47  ? 3   LYS B CA  1 
ATOM   2192 C C   . LYS B 2 3   ? -34.768 1.237   11.955 1.00 84.14  ? 3   LYS B C   1 
ATOM   2193 O O   . LYS B 2 3   ? -33.981 0.373   11.568 1.00 81.55  ? 3   LYS B O   1 
ATOM   2194 C CB  . LYS B 2 3   ? -36.806 0.364   10.765 1.00 92.42  ? 3   LYS B CB  1 
ATOM   2195 C CG  . LYS B 2 3   ? -38.148 0.670   10.092 1.00 98.63  ? 3   LYS B CG  1 
ATOM   2196 C CD  . LYS B 2 3   ? -38.471 -0.304  8.927  1.00 100.95 ? 3   LYS B CD  1 
ATOM   2197 C CE  . LYS B 2 3   ? -39.869 -0.055  8.386  1.00 107.48 ? 3   LYS B CE  1 
ATOM   2198 N NZ  . LYS B 2 3   ? -39.927 -0.208  6.895  1.00 108.71 ? 3   LYS B NZ  1 
ATOM   2199 N N   . GLN B 2 4   ? -34.625 1.917   13.097 1.00 83.39  ? 4   GLN B N   1 
ATOM   2200 C CA  . GLN B 2 4   ? -33.734 1.465   14.161 1.00 80.69  ? 4   GLN B CA  1 
ATOM   2201 C C   . GLN B 2 4   ? -34.163 0.040   14.454 1.00 85.00  ? 4   GLN B C   1 
ATOM   2202 O O   . GLN B 2 4   ? -35.245 -0.362  14.023 1.00 88.88  ? 4   GLN B O   1 
ATOM   2203 C CB  . GLN B 2 4   ? -33.839 2.390   15.382 1.00 77.84  ? 4   GLN B CB  1 
ATOM   2204 C CG  . GLN B 2 4   ? -33.088 3.743   15.107 1.00 72.47  ? 4   GLN B CG  1 
ATOM   2205 C CD  . GLN B 2 4   ? -33.937 5.010   15.369 1.00 71.15  ? 4   GLN B CD  1 
ATOM   2206 O OE1 . GLN B 2 4   ? -34.916 4.985   16.183 1.00 74.50  ? 4   GLN B OE1 1 
ATOM   2207 N NE2 . GLN B 2 4   ? -33.574 6.143   14.683 1.00 66.68  ? 4   GLN B NE2 1 
ATOM   2208 N N   . ILE B 2 5   ? -33.309 -0.750  15.096 1.00 84.89  ? 5   ILE B N   1 
ATOM   2209 C CA  . ILE B 2 5   ? -33.603 -2.184  15.257 1.00 89.75  ? 5   ILE B CA  1 
ATOM   2210 C C   . ILE B 2 5   ? -32.909 -2.765  16.499 1.00 92.30  ? 5   ILE B C   1 
ATOM   2211 O O   . ILE B 2 5   ? -31.721 -2.468  16.710 1.00 88.78  ? 5   ILE B O   1 
ATOM   2212 C CB  . ILE B 2 5   ? -33.240 -2.991  13.978 1.00 86.81  ? 5   ILE B CB  1 
ATOM   2213 C CG1 . ILE B 2 5   ? -34.417 -2.975  12.994 1.00 87.99  ? 5   ILE B CG1 1 
ATOM   2214 C CG2 . ILE B 2 5   ? -32.755 -4.426  14.335 1.00 87.68  ? 5   ILE B CG2 1 
ATOM   2215 C CD1 . ILE B 2 5   ? -34.309 -4.032  11.901 1.00 87.94  ? 5   ILE B CD1 1 
ATOM   2216 N N   . GLU B 2 6   ? -33.627 -3.588  17.294 1.00 99.46  ? 6   GLU B N   1 
ATOM   2217 C CA  . GLU B 2 6   ? -33.110 -4.073  18.597 1.00 102.91 ? 6   GLU B CA  1 
ATOM   2218 C C   . GLU B 2 6   ? -33.151 -5.566  18.962 1.00 107.24 ? 6   GLU B C   1 
ATOM   2219 O O   . GLU B 2 6   ? -32.664 -5.932  20.041 1.00 109.20 ? 6   GLU B O   1 
ATOM   2220 C CB  . GLU B 2 6   ? -33.721 -3.280  19.767 1.00 107.68 ? 6   GLU B CB  1 
ATOM   2221 C CG  . GLU B 2 6   ? -33.250 -1.837  19.867 1.00 106.42 ? 6   GLU B CG  1 
ATOM   2222 C CD  . GLU B 2 6   ? -34.204 -0.883  19.153 1.00 110.70 ? 6   GLU B CD  1 
ATOM   2223 O OE1 . GLU B 2 6   ? -35.445 -1.230  19.099 1.00 116.96 ? 6   GLU B OE1 1 
ATOM   2224 O OE2 . GLU B 2 6   ? -33.717 0.210   18.659 1.00 107.49 ? 6   GLU B OE2 1 
ATOM   2225 N N   . SER B 2 7   ? -33.715 -6.432  18.124 1.00 109.35 ? 7   SER B N   1 
ATOM   2226 C CA  . SER B 2 7   ? -33.684 -7.873  18.452 1.00 114.36 ? 7   SER B CA  1 
ATOM   2227 C C   . SER B 2 7   ? -33.402 -8.703  17.216 1.00 113.00 ? 7   SER B C   1 
ATOM   2228 O O   . SER B 2 7   ? -33.599 -8.206  16.110 1.00 109.71 ? 7   SER B O   1 
ATOM   2229 C CB  . SER B 2 7   ? -34.987 -8.338  19.161 1.00 123.00 ? 7   SER B CB  1 
ATOM   2230 O OG  . SER B 2 7   ? -35.991 -8.785  18.263 1.00 124.46 ? 7   SER B OG  1 
ATOM   2231 N N   . LYS B 2 8   ? -32.939 -9.949  17.378 1.00 116.17 ? 8   LYS B N   1 
ATOM   2232 C CA  . LYS B 2 8   ? -32.902 -10.835 16.215 1.00 117.23 ? 8   LYS B CA  1 
ATOM   2233 C C   . LYS B 2 8   ? -34.315 -11.139 15.691 1.00 123.32 ? 8   LYS B C   1 
ATOM   2234 O O   . LYS B 2 8   ? -34.496 -11.274 14.471 1.00 122.26 ? 8   LYS B O   1 
ATOM   2235 C CB  . LYS B 2 8   ? -32.116 -12.123 16.464 1.00 119.90 ? 8   LYS B CB  1 
ATOM   2236 C CG  . LYS B 2 8   ? -32.020 -13.021 15.209 1.00 121.32 ? 8   LYS B CG  1 
ATOM   2237 C CD  . LYS B 2 8   ? -31.465 -14.383 15.533 1.00 127.43 ? 8   LYS B CD  1 
ATOM   2238 C CE  . LYS B 2 8   ? -30.047 -14.256 16.073 1.00 124.32 ? 8   LYS B CE  1 
ATOM   2239 N NZ  . LYS B 2 8   ? -29.569 -15.559 16.614 1.00 130.62 ? 8   LYS B NZ  1 
ATOM   2240 N N   . THR B 2 9   ? -35.308 -11.247 16.592 1.00 130.24 ? 9   THR B N   1 
ATOM   2241 C CA  . THR B 2 9   ? -36.704 -11.459 16.143 1.00 136.13 ? 9   THR B CA  1 
ATOM   2242 C C   . THR B 2 9   ? -37.268 -10.209 15.436 1.00 132.95 ? 9   THR B C   1 
ATOM   2243 O O   . THR B 2 9   ? -38.019 -10.337 14.446 1.00 134.43 ? 9   THR B O   1 
ATOM   2244 C CB  . THR B 2 9   ? -37.705 -12.048 17.233 1.00 145.25 ? 9   THR B CB  1 
ATOM   2245 O OG1 . THR B 2 9   ? -37.654 -11.297 18.454 1.00 144.83 ? 9   THR B OG1 1 
ATOM   2246 C CG2 . THR B 2 9   ? -37.395 -13.498 17.525 1.00 149.57 ? 9   THR B CG2 1 
ATOM   2247 N N   . ALA B 2 10  ? -36.888 -9.018  15.927 1.00 128.79 ? 10  ALA B N   1 
ATOM   2248 C CA  . ALA B 2 10  ? -37.198 -7.755  15.226 1.00 125.03 ? 10  ALA B CA  1 
ATOM   2249 C C   . ALA B 2 10  ? -36.543 -7.726  13.822 1.00 119.44 ? 10  ALA B C   1 
ATOM   2250 O O   . ALA B 2 10  ? -37.153 -7.260  12.833 1.00 118.84 ? 10  ALA B O   1 
ATOM   2251 C CB  . ALA B 2 10  ? -36.817 -6.518  16.076 1.00 121.62 ? 10  ALA B CB  1 
ATOM   2252 N N   . PHE B 2 11  ? -35.332 -8.279  13.740 1.00 116.14 ? 11  PHE B N   1 
ATOM   2253 C CA  . PHE B 2 11  ? -34.617 -8.455  12.469 1.00 111.96 ? 11  PHE B CA  1 
ATOM   2254 C C   . PHE B 2 11  ? -35.307 -9.402  11.513 1.00 116.23 ? 11  PHE B C   1 
ATOM   2255 O O   . PHE B 2 11  ? -35.538 -9.039  10.364 1.00 114.06 ? 11  PHE B O   1 
ATOM   2256 C CB  . PHE B 2 11  ? -33.205 -8.967  12.718 1.00 108.93 ? 11  PHE B CB  1 
ATOM   2257 C CG  . PHE B 2 11  ? -32.281 -8.769  11.561 1.00 102.90 ? 11  PHE B CG  1 
ATOM   2258 C CD1 . PHE B 2 11  ? -32.109 -7.505  11.000 1.00 96.85  ? 11  PHE B CD1 1 
ATOM   2259 C CD2 . PHE B 2 11  ? -31.562 -9.845  11.040 1.00 103.32 ? 11  PHE B CD2 1 
ATOM   2260 C CE1 . PHE B 2 11  ? -31.233 -7.317  9.932  1.00 92.14  ? 11  PHE B CE1 1 
ATOM   2261 C CE2 . PHE B 2 11  ? -30.683 -9.668  9.966  1.00 97.56  ? 11  PHE B CE2 1 
ATOM   2262 C CZ  . PHE B 2 11  ? -30.518 -8.402  9.408  1.00 91.61  ? 11  PHE B CZ  1 
ATOM   2263 N N   . GLN B 2 12  ? -35.616 -10.612 11.990 1.00 123.17 ? 12  GLN B N   1 
ATOM   2264 C CA  . GLN B 2 12  ? -36.420 -11.581 11.218 1.00 129.40 ? 12  GLN B CA  1 
ATOM   2265 C C   . GLN B 2 12  ? -37.626 -10.898 10.579 1.00 131.01 ? 12  GLN B C   1 
ATOM   2266 O O   . GLN B 2 12  ? -37.847 -11.040 9.370  1.00 130.44 ? 12  GLN B O   1 
ATOM   2267 C CB  . GLN B 2 12  ? -36.862 -12.798 12.053 1.00 137.16 ? 12  GLN B CB  1 
ATOM   2268 C CG  . GLN B 2 12  ? -35.762 -13.833 12.416 1.00 138.25 ? 12  GLN B CG  1 
ATOM   2269 C CD  . GLN B 2 12  ? -34.857 -14.317 11.248 1.00 135.10 ? 12  GLN B CD  1 
ATOM   2270 O OE1 . GLN B 2 12  ? -35.208 -14.241 10.063 1.00 132.25 ? 12  GLN B OE1 1 
ATOM   2271 N NE2 . GLN B 2 12  ? -33.676 -14.830 11.612 1.00 134.17 ? 12  GLN B NE2 1 
ATOM   2272 N N   . GLU B 2 13  ? -38.366 -10.135 11.389 1.00 133.42 ? 13  GLU B N   1 
ATOM   2273 C CA  . GLU B 2 13  ? -39.495 -9.350  10.898 1.00 135.83 ? 13  GLU B CA  1 
ATOM   2274 C C   . GLU B 2 13  ? -39.202 -8.661  9.587  1.00 130.82 ? 13  GLU B C   1 
ATOM   2275 O O   . GLU B 2 13  ? -39.853 -8.973  8.593  1.00 133.89 ? 13  GLU B O   1 
ATOM   2276 C CB  . GLU B 2 13  ? -39.950 -8.282  11.883 1.00 136.60 ? 13  GLU B CB  1 
ATOM   2277 C CG  . GLU B 2 13  ? -41.255 -8.594  12.571 1.00 145.04 ? 13  GLU B CG  1 
ATOM   2278 C CD  . GLU B 2 13  ? -41.037 -8.978  14.022 1.00 149.18 ? 13  GLU B CD  1 
ATOM   2279 O OE1 . GLU B 2 13  ? -40.250 -8.292  14.726 1.00 146.32 ? 13  GLU B OE1 1 
ATOM   2280 O OE2 . GLU B 2 13  ? -41.656 -9.960  14.475 1.00 156.83 ? 13  GLU B OE2 1 
ATOM   2281 N N   . ALA B 2 14  ? -38.251 -7.723  9.569  1.00 123.96 ? 14  ALA B N   1 
ATOM   2282 C CA  . ALA B 2 14  ? -38.038 -6.936  8.338  1.00 119.77 ? 14  ALA B CA  1 
ATOM   2283 C C   . ALA B 2 14  ? -37.757 -7.796  7.083  1.00 119.82 ? 14  ALA B C   1 
ATOM   2284 O O   . ALA B 2 14  ? -38.258 -7.506  5.974  1.00 119.56 ? 14  ALA B O   1 
ATOM   2285 C CB  . ALA B 2 14  ? -36.962 -5.886  8.540  1.00 113.12 ? 14  ALA B CB  1 
ATOM   2286 N N   . LEU B 2 15  ? -36.980 -8.861  7.292  1.00 120.50 ? 15  LEU B N   1 
ATOM   2287 C CA  . LEU B 2 15  ? -36.656 -9.859  6.267  1.00 122.20 ? 15  LEU B CA  1 
ATOM   2288 C C   . LEU B 2 15  ? -37.923 -10.377 5.603  1.00 128.46 ? 15  LEU B C   1 
ATOM   2289 O O   . LEU B 2 15  ? -37.920 -10.770 4.431  1.00 129.02 ? 15  LEU B O   1 
ATOM   2290 C CB  . LEU B 2 15  ? -35.852 -10.998 6.905  1.00 123.94 ? 15  LEU B CB  1 
ATOM   2291 C CG  . LEU B 2 15  ? -34.544 -10.508 7.566  1.00 118.18 ? 15  LEU B CG  1 
ATOM   2292 C CD1 . LEU B 2 15  ? -34.107 -11.372 8.749  1.00 120.52 ? 15  LEU B CD1 1 
ATOM   2293 C CD2 . LEU B 2 15  ? -33.392 -10.320 6.541  1.00 112.67 ? 15  LEU B CD2 1 
ATOM   2294 N N   . ASP B 2 16  ? -39.005 -10.346 6.379  1.00 133.48 ? 16  ASP B N   1 
ATOM   2295 C CA  . ASP B 2 16  ? -40.365 -10.550 5.885  1.00 139.58 ? 16  ASP B CA  1 
ATOM   2296 C C   . ASP B 2 16  ? -40.976 -9.246  5.363  1.00 137.12 ? 16  ASP B C   1 
ATOM   2297 O O   . ASP B 2 16  ? -41.431 -9.201  4.219  1.00 137.90 ? 16  ASP B O   1 
ATOM   2298 C CB  . ASP B 2 16  ? -41.245 -11.147 6.992  1.00 146.91 ? 16  ASP B CB  1 
ATOM   2299 C CG  . ASP B 2 16  ? -40.544 -12.285 7.736  1.00 149.93 ? 16  ASP B CG  1 
ATOM   2300 O OD1 . ASP B 2 16  ? -39.286 -12.371 7.646  1.00 144.73 ? 16  ASP B OD1 1 
ATOM   2301 O OD2 . ASP B 2 16  ? -41.253 -13.091 8.398  1.00 158.03 ? 16  ASP B OD2 1 
ATOM   2302 N N   . ALA B 2 17  ? -40.967 -8.202  6.207  1.00 134.61 ? 17  ALA B N   1 
ATOM   2303 C CA  . ALA B 2 17  ? -41.568 -6.874  5.922  1.00 133.10 ? 17  ALA B CA  1 
ATOM   2304 C C   . ALA B 2 17  ? -41.409 -6.445  4.465  1.00 129.89 ? 17  ALA B C   1 
ATOM   2305 O O   . ALA B 2 17  ? -42.406 -6.260  3.762  1.00 133.34 ? 17  ALA B O   1 
ATOM   2306 C CB  . ALA B 2 17  ? -41.005 -5.789  6.880  1.00 128.87 ? 17  ALA B CB  1 
ATOM   2307 N N   . ALA B 2 18  ? -40.154 -6.294  4.028  1.00 123.68 ? 18  ALA B N   1 
ATOM   2308 C CA  . ALA B 2 18  ? -39.821 -6.099  2.606  1.00 120.69 ? 18  ALA B CA  1 
ATOM   2309 C C   . ALA B 2 18  ? -40.185 -7.344  1.787  1.00 124.65 ? 18  ALA B C   1 
ATOM   2310 O O   . ALA B 2 18  ? -39.877 -8.485  2.167  1.00 126.95 ? 18  ALA B O   1 
ATOM   2311 C CB  . ALA B 2 18  ? -38.328 -5.779  2.443  1.00 114.06 ? 18  ALA B CB  1 
ATOM   2312 N N   . GLY B 2 19  ? -40.850 -7.124  0.664  1.00 125.83 ? 19  GLY B N   1 
ATOM   2313 C CA  . GLY B 2 19  ? -41.193 -8.230  -0.214 1.00 129.11 ? 19  GLY B CA  1 
ATOM   2314 C C   . GLY B 2 19  ? -39.953 -8.593  -1.004 1.00 124.29 ? 19  GLY B C   1 
ATOM   2315 O O   . GLY B 2 19  ? -38.878 -8.792  -0.441 1.00 119.92 ? 19  GLY B O   1 
ATOM   2316 N N   . ASP B 2 20  ? -40.120 -8.666  -2.320 1.00 124.93 ? 20  ASP B N   1 
ATOM   2317 C CA  . ASP B 2 20  ? -39.006 -8.827  -3.233 1.00 121.27 ? 20  ASP B CA  1 
ATOM   2318 C C   . ASP B 2 20  ? -37.992 -7.667  -3.125 1.00 113.54 ? 20  ASP B C   1 
ATOM   2319 O O   . ASP B 2 20  ? -36.908 -7.739  -3.740 1.00 110.76 ? 20  ASP B O   1 
ATOM   2320 C CB  . ASP B 2 20  ? -39.515 -8.938  -4.675 1.00 124.96 ? 20  ASP B CB  1 
ATOM   2321 C CG  . ASP B 2 20  ? -39.942 -10.352 -5.049 1.00 131.95 ? 20  ASP B CG  1 
ATOM   2322 O OD1 . ASP B 2 20  ? -41.062 -10.486 -5.593 1.00 136.80 ? 20  ASP B OD1 1 
ATOM   2323 O OD2 . ASP B 2 20  ? -39.165 -11.320 -4.827 1.00 132.25 ? 20  ASP B OD2 1 
ATOM   2324 N N   . LYS B 2 21  ? -38.328 -6.622  -2.349 1.00 109.66 ? 21  LYS B N   1 
ATOM   2325 C CA  . LYS B 2 21  ? -37.454 -5.438  -2.230 1.00 102.30 ? 21  LYS B CA  1 
ATOM   2326 C C   . LYS B 2 21  ? -36.074 -5.641  -1.488 1.00 96.74  ? 21  LYS B C   1 
ATOM   2327 O O   . LYS B 2 21  ? -35.994 -6.220  -0.392 1.00 96.90  ? 21  LYS B O   1 
ATOM   2328 C CB  . LYS B 2 21  ? -38.231 -4.174  -1.772 1.00 101.91 ? 21  LYS B CB  1 
ATOM   2329 C CG  . LYS B 2 21  ? -39.541 -4.404  -0.995 1.00 106.43 ? 21  LYS B CG  1 
ATOM   2330 C CD  . LYS B 2 21  ? -40.266 -2.979  -0.728 1.00 107.44 ? 21  LYS B CD  1 
ATOM   2331 C CE  . LYS B 2 21  ? -41.765 -3.390  0.034  1.00 115.58 ? 21  LYS B CE  1 
ATOM   2332 N NZ  . LYS B 2 21  ? -42.144 -2.153  1.016  1.00 114.57 ? 21  LYS B NZ  1 
ATOM   2333 N N   . LEU B 2 22  ? -34.998 -5.183  -2.143 1.00 91.52  ? 22  LEU B N   1 
ATOM   2334 C CA  . LEU B 2 22  ? -33.651 -5.204  -1.598 1.00 85.51  ? 22  LEU B CA  1 
ATOM   2335 C C   . LEU B 2 22  ? -33.660 -4.401  -0.338 1.00 82.64  ? 22  LEU B C   1 
ATOM   2336 O O   . LEU B 2 22  ? -34.374 -3.397  -0.184 1.00 82.37  ? 22  LEU B O   1 
ATOM   2337 C CB  . LEU B 2 22  ? -32.604 -4.667  -2.590 1.00 82.25  ? 22  LEU B CB  1 
ATOM   2338 C CG  . LEU B 2 22  ? -31.218 -4.091  -2.188 1.00 74.70  ? 22  LEU B CG  1 
ATOM   2339 C CD1 . LEU B 2 22  ? -30.061 -4.705  -2.969 1.00 73.09  ? 22  LEU B CD1 1 
ATOM   2340 C CD2 . LEU B 2 22  ? -31.168 -2.589  -2.354 1.00 69.76  ? 22  LEU B CD2 1 
ATOM   2341 N N   . VAL B 2 23  ? -32.873 -4.892  0.592  1.00 80.78  ? 23  VAL B N   1 
ATOM   2342 C CA  . VAL B 2 23  ? -32.826 -4.293  1.913  1.00 78.32  ? 23  VAL B CA  1 
ATOM   2343 C C   . VAL B 2 23  ? -31.340 -4.129  2.297  1.00 72.39  ? 23  VAL B C   1 
ATOM   2344 O O   . VAL B 2 23  ? -30.533 -5.043  2.141  1.00 71.75  ? 23  VAL B O   1 
ATOM   2345 C CB  . VAL B 2 23  ? -33.774 -5.071  2.929  1.00 82.54  ? 23  VAL B CB  1 
ATOM   2346 C CG1 . VAL B 2 23  ? -33.534 -6.570  2.862  1.00 85.83  ? 23  VAL B CG1 1 
ATOM   2347 C CG2 . VAL B 2 23  ? -33.634 -4.572  4.320  1.00 80.77  ? 23  VAL B CG2 1 
ATOM   2348 N N   . VAL B 2 24  ? -31.002 -2.907  2.689  1.00 67.69  ? 24  VAL B N   1 
ATOM   2349 C CA  . VAL B 2 24  ? -29.658 -2.516  3.027  1.00 61.86  ? 24  VAL B CA  1 
ATOM   2350 C C   . VAL B 2 24  ? -29.633 -2.411  4.545  1.00 60.84  ? 24  VAL B C   1 
ATOM   2351 O O   . VAL B 2 24  ? -30.602 -2.008  5.183  1.00 63.17  ? 24  VAL B O   1 
ATOM   2352 C CB  . VAL B 2 24  ? -29.306 -1.176  2.328  1.00 58.93  ? 24  VAL B CB  1 
ATOM   2353 C CG1 . VAL B 2 24  ? -30.238 -0.096  2.768  1.00 58.35  ? 24  VAL B CG1 1 
ATOM   2354 C CG2 . VAL B 2 24  ? -27.823 -0.760  2.547  1.00 55.06  ? 24  VAL B CG2 1 
ATOM   2355 N N   . VAL B 2 25  ? -28.544 -2.841  5.139  1.00 58.19  ? 25  VAL B N   1 
ATOM   2356 C CA  . VAL B 2 25  ? -28.430 -2.763  6.579  1.00 57.47  ? 25  VAL B CA  1 
ATOM   2357 C C   . VAL B 2 25  ? -27.119 -2.109  6.924  1.00 53.28  ? 25  VAL B C   1 
ATOM   2358 O O   . VAL B 2 25  ? -26.053 -2.542  6.482  1.00 52.36  ? 25  VAL B O   1 
ATOM   2359 C CB  . VAL B 2 25  ? -28.444 -4.156  7.222  1.00 60.27  ? 25  VAL B CB  1 
ATOM   2360 C CG1 . VAL B 2 25  ? -28.436 -4.050  8.753  1.00 58.47  ? 25  VAL B CG1 1 
ATOM   2361 C CG2 . VAL B 2 25  ? -29.633 -4.964  6.702  1.00 64.17  ? 25  VAL B CG2 1 
ATOM   2362 N N   . ASP B 2 26  ? -27.216 -1.058  7.700  1.00 51.31  ? 26  ASP B N   1 
ATOM   2363 C CA  . ASP B 2 26  ? -26.077 -0.443  8.294  1.00 47.93  ? 26  ASP B CA  1 
ATOM   2364 C C   . ASP B 2 26  ? -25.863 -1.104  9.697  1.00 49.06  ? 26  ASP B C   1 
ATOM   2365 O O   . ASP B 2 26  ? -26.680 -0.923  10.631 1.00 51.10  ? 26  ASP B O   1 
ATOM   2366 C CB  . ASP B 2 26  ? -26.377 1.065   8.385  1.00 46.93  ? 26  ASP B CB  1 
ATOM   2367 C CG  . ASP B 2 26  ? -25.223 1.882   8.934  1.00 45.25  ? 26  ASP B CG  1 
ATOM   2368 O OD1 . ASP B 2 26  ? -24.403 1.342   9.720  1.00 44.02  ? 26  ASP B OD1 1 
ATOM   2369 O OD2 . ASP B 2 26  ? -25.155 3.088   8.592  1.00 45.85  ? 26  ASP B OD2 1 
ATOM   2370 N N   . PHE B 2 27  ? -24.788 -1.883  9.837  1.00 46.93  ? 27  PHE B N   1 
ATOM   2371 C CA  . PHE B 2 27  ? -24.309 -2.263  11.150 1.00 46.61  ? 27  PHE B CA  1 
ATOM   2372 C C   . PHE B 2 27  ? -23.380 -1.212  11.579 1.00 43.06  ? 27  PHE B C   1 
ATOM   2373 O O   . PHE B 2 27  ? -22.249 -1.140  11.138 1.00 40.66  ? 27  PHE B O   1 
ATOM   2374 C CB  . PHE B 2 27  ? -23.564 -3.565  11.101 1.00 48.25  ? 27  PHE B CB  1 
ATOM   2375 C CG  . PHE B 2 27  ? -24.420 -4.722  10.699 1.00 53.48  ? 27  PHE B CG  1 
ATOM   2376 C CD1 . PHE B 2 27  ? -25.017 -5.535  11.671 1.00 56.08  ? 27  PHE B CD1 1 
ATOM   2377 C CD2 . PHE B 2 27  ? -24.653 -4.990  9.348  1.00 52.66  ? 27  PHE B CD2 1 
ATOM   2378 C CE1 . PHE B 2 27  ? -25.787 -6.613  11.314 1.00 58.92  ? 27  PHE B CE1 1 
ATOM   2379 C CE2 . PHE B 2 27  ? -25.439 -6.060  8.989  1.00 57.55  ? 27  PHE B CE2 1 
ATOM   2380 C CZ  . PHE B 2 27  ? -26.013 -6.878  9.986  1.00 60.72  ? 27  PHE B CZ  1 
ATOM   2381 N N   . SER B 2 28  ? -23.895 -0.390  12.458 1.00 43.93  ? 28  SER B N   1 
ATOM   2382 C CA  . SER B 2 28  ? -23.291 0.831   12.874 1.00 41.68  ? 28  SER B CA  1 
ATOM   2383 C C   . SER B 2 28  ? -22.722 0.709   14.300 1.00 42.11  ? 28  SER B C   1 
ATOM   2384 O O   . SER B 2 28  ? -22.823 -0.342  14.962 1.00 43.67  ? 28  SER B O   1 
ATOM   2385 C CB  . SER B 2 28  ? -24.446 1.812   12.871 1.00 43.37  ? 28  SER B CB  1 
ATOM   2386 O OG  . SER B 2 28  ? -24.078 3.081   13.361 1.00 46.77  ? 28  SER B OG  1 
ATOM   2387 N N   . ALA B 2 29  ? -22.156 1.811   14.789 1.00 40.54  ? 29  ALA B N   1 
ATOM   2388 C CA  . ALA B 2 29  ? -21.822 1.949   16.216 1.00 41.23  ? 29  ALA B CA  1 
ATOM   2389 C C   . ALA B 2 29  ? -21.636 3.406   16.663 1.00 40.29  ? 29  ALA B C   1 
ATOM   2390 O O   . ALA B 2 29  ? -20.955 4.197   16.022 1.00 38.49  ? 29  ALA B O   1 
ATOM   2391 C CB  . ALA B 2 29  ? -20.570 1.105   16.589 1.00 40.05  ? 29  ALA B CB  1 
ATOM   2392 N N   . THR B 2 30  ? -22.272 3.706   17.774 1.00 42.45  ? 30  THR B N   1 
ATOM   2393 C CA  . THR B 2 30  ? -22.214 4.929   18.546 1.00 43.19  ? 30  THR B CA  1 
ATOM   2394 C C   . THR B 2 30  ? -20.921 5.732   18.590 1.00 40.36  ? 30  THR B C   1 
ATOM   2395 O O   . THR B 2 30  ? -20.940 6.967   18.413 1.00 40.02  ? 30  THR B O   1 
ATOM   2396 C CB  . THR B 2 30  ? -22.559 4.482   20.003 1.00 48.34  ? 30  THR B CB  1 
ATOM   2397 O OG1 . THR B 2 30  ? -23.962 4.219   20.053 1.00 49.70  ? 30  THR B OG1 1 
ATOM   2398 C CG2 . THR B 2 30  ? -21.990 5.429   21.209 1.00 47.23  ? 30  THR B CG2 1 
ATOM   2399 N N   . TRP B 2 31  ? -19.832 5.028   18.915 1.00 37.53  ? 31  TRP B N   1 
ATOM   2400 C CA  . TRP B 2 31  ? -18.532 5.638   19.253 1.00 34.78  ? 31  TRP B CA  1 
ATOM   2401 C C   . TRP B 2 31  ? -17.635 5.723   18.013 1.00 30.86  ? 31  TRP B C   1 
ATOM   2402 O O   . TRP B 2 31  ? -16.547 6.260   18.082 1.00 28.17  ? 31  TRP B O   1 
ATOM   2403 C CB  . TRP B 2 31  ? -17.854 4.841   20.394 1.00 35.28  ? 31  TRP B CB  1 
ATOM   2404 C CG  . TRP B 2 31  ? -17.881 3.320   20.135 1.00 35.14  ? 31  TRP B CG  1 
ATOM   2405 C CD1 . TRP B 2 31  ? -18.817 2.424   20.589 1.00 37.76  ? 31  TRP B CD1 1 
ATOM   2406 C CD2 . TRP B 2 31  ? -16.997 2.570   19.276 1.00 30.36  ? 31  TRP B CD2 1 
ATOM   2407 N NE1 . TRP B 2 31  ? -18.543 1.151   20.118 1.00 36.67  ? 31  TRP B NE1 1 
ATOM   2408 C CE2 . TRP B 2 31  ? -17.436 1.210   19.303 1.00 36.54  ? 31  TRP B CE2 1 
ATOM   2409 C CE3 . TRP B 2 31  ? -15.880 2.899   18.513 1.00 23.03  ? 31  TRP B CE3 1 
ATOM   2410 C CZ2 . TRP B 2 31  ? -16.758 0.176   18.584 1.00 34.13  ? 31  TRP B CZ2 1 
ATOM   2411 C CZ3 . TRP B 2 31  ? -15.210 1.896   17.831 1.00 26.65  ? 31  TRP B CZ3 1 
ATOM   2412 C CH2 . TRP B 2 31  ? -15.651 0.545   17.852 1.00 28.18  ? 31  TRP B CH2 1 
ATOM   2413 N N   . CYS B 2 32  ? -18.124 5.193   16.891 1.00 30.75  ? 32  CYS B N   1 
ATOM   2414 C CA  . CYS B 2 32  ? -17.386 5.118   15.654 1.00 29.95  ? 32  CYS B CA  1 
ATOM   2415 C C   . CYS B 2 32  ? -17.506 6.384   14.787 1.00 30.49  ? 32  CYS B C   1 
ATOM   2416 O O   . CYS B 2 32  ? -18.544 6.655   14.188 1.00 31.98  ? 32  CYS B O   1 
ATOM   2417 C CB  . CYS B 2 32  ? -17.862 3.907   14.880 1.00 30.40  ? 32  CYS B CB  1 
ATOM   2418 S SG  . CYS B 2 32  ? -17.001 3.580   13.268 1.00 31.90  ? 32  CYS B SG  1 
ATOM   2419 N N   . GLY B 2 33  ? -16.413 7.137   14.690 1.00 30.53  ? 33  GLY B N   1 
ATOM   2420 C CA  . GLY B 2 33  ? -16.335 8.340   13.860 1.00 31.18  ? 33  GLY B CA  1 
ATOM   2421 C C   . GLY B 2 33  ? -16.904 8.099   12.483 1.00 31.48  ? 33  GLY B C   1 
ATOM   2422 O O   . GLY B 2 33  ? -17.879 8.756   12.119 1.00 33.97  ? 33  GLY B O   1 
ATOM   2423 N N   . PRO B 2 34  ? -16.327 7.133   11.726 1.00 29.42  ? 34  PRO B N   1 
ATOM   2424 C CA  . PRO B 2 34  ? -16.801 6.893   10.365 1.00 28.98  ? 34  PRO B CA  1 
ATOM   2425 C C   . PRO B 2 34  ? -18.249 6.440   10.253 1.00 29.64  ? 34  PRO B C   1 
ATOM   2426 O O   . PRO B 2 34  ? -18.845 6.658   9.208  1.00 31.02  ? 34  PRO B O   1 
ATOM   2427 C CB  . PRO B 2 34  ? -15.830 5.818   9.804  1.00 27.75  ? 34  PRO B CB  1 
ATOM   2428 C CG  . PRO B 2 34  ? -14.658 5.844   10.750 1.00 26.88  ? 34  PRO B CG  1 
ATOM   2429 C CD  . PRO B 2 34  ? -15.189 6.264   12.074 1.00 27.75  ? 34  PRO B CD  1 
ATOM   2430 N N   . ALA B 2 35  ? -18.830 5.819   11.269 1.00 29.39  ? 35  ALA B N   1 
ATOM   2431 C CA  . ALA B 2 35  ? -20.198 5.373   11.075 1.00 30.14  ? 35  ALA B CA  1 
ATOM   2432 C C   . ALA B 2 35  ? -21.125 6.514   11.397 1.00 32.07  ? 35  ALA B C   1 
ATOM   2433 O O   . ALA B 2 35  ? -22.213 6.604   10.841 1.00 34.01  ? 35  ALA B O   1 
ATOM   2434 C CB  . ALA B 2 35  ? -20.511 4.200   11.900 1.00 31.29  ? 35  ALA B CB  1 
ATOM   2435 N N   . LYS B 2 36  ? -20.684 7.376   12.304 1.00 32.11  ? 36  LYS B N   1 
ATOM   2436 C CA  . LYS B 2 36  ? -21.390 8.593   12.617 1.00 34.69  ? 36  LYS B CA  1 
ATOM   2437 C C   . LYS B 2 36  ? -21.418 9.531   11.432 1.00 35.07  ? 36  LYS B C   1 
ATOM   2438 O O   . LYS B 2 36  ? -22.446 10.130  11.140 1.00 36.95  ? 36  LYS B O   1 
ATOM   2439 C CB  . LYS B 2 36  ? -20.760 9.298   13.820 1.00 35.57  ? 36  LYS B CB  1 
ATOM   2440 C CG  . LYS B 2 36  ? -21.262 8.746   15.141 1.00 39.18  ? 36  LYS B CG  1 
ATOM   2441 C CD  . LYS B 2 36  ? -20.754 9.525   16.354 1.00 44.08  ? 36  LYS B CD  1 
ATOM   2442 C CE  . LYS B 2 36  ? -19.301 9.154   16.715 1.00 41.01  ? 36  LYS B CE  1 
ATOM   2443 N NZ  . LYS B 2 36  ? -18.990 9.623   18.087 1.00 44.68  ? 36  LYS B NZ  1 
ATOM   2444 N N   . MET B 2 37  ? -20.292 9.673   10.749 1.00 33.78  ? 37  MET B N   1 
ATOM   2445 C CA  . MET B 2 37  ? -20.273 10.476  9.551  1.00 36.06  ? 37  MET B CA  1 
ATOM   2446 C C   . MET B 2 37  ? -21.237 9.950   8.442  1.00 37.10  ? 37  MET B C   1 
ATOM   2447 O O   . MET B 2 37  ? -21.752 10.723  7.662  1.00 40.18  ? 37  MET B O   1 
ATOM   2448 C CB  . MET B 2 37  ? -18.838 10.641  9.055  1.00 34.53  ? 37  MET B CB  1 
ATOM   2449 C CG  . MET B 2 37  ? -18.669 11.258  7.662  1.00 38.00  ? 37  MET B CG  1 
ATOM   2450 S SD  . MET B 2 37  ? -18.840 10.183  6.149  1.00 46.57  ? 37  MET B SD  1 
ATOM   2451 C CE  . MET B 2 37  ? -17.180 9.476   5.998  1.00 35.74  ? 37  MET B CE  1 
ATOM   2452 N N   . ILE B 2 38  ? -21.509 8.658   8.379  1.00 36.22  ? 38  ILE B N   1 
ATOM   2453 C CA  . ILE B 2 38  ? -22.183 8.126   7.221  1.00 36.41  ? 38  ILE B CA  1 
ATOM   2454 C C   . ILE B 2 38  ? -23.692 8.021   7.474  1.00 40.05  ? 38  ILE B C   1 
ATOM   2455 O O   . ILE B 2 38  ? -24.495 8.070   6.505  1.00 41.18  ? 38  ILE B O   1 
ATOM   2456 C CB  . ILE B 2 38  ? -21.586 6.767   6.832  1.00 34.52  ? 38  ILE B CB  1 
ATOM   2457 C CG1 . ILE B 2 38  ? -22.024 6.350   5.431  1.00 34.79  ? 38  ILE B CG1 1 
ATOM   2458 C CG2 . ILE B 2 38  ? -22.030 5.704   7.814  1.00 34.09  ? 38  ILE B CG2 1 
ATOM   2459 C CD1 . ILE B 2 38  ? -21.112 6.726   4.325  1.00 33.14  ? 38  ILE B CD1 1 
ATOM   2460 N N   . LYS B 2 39  ? -24.076 7.861   8.759  1.00 41.29  ? 39  LYS B N   1 
ATOM   2461 C CA  . LYS B 2 39  ? -25.505 7.927   9.205  1.00 44.51  ? 39  LYS B CA  1 
ATOM   2462 C C   . LYS B 2 39  ? -26.326 8.966   8.464  1.00 46.41  ? 39  LYS B C   1 
ATOM   2463 O O   . LYS B 2 39  ? -27.318 8.615   7.831  1.00 49.17  ? 39  LYS B O   1 
ATOM   2464 C CB  . LYS B 2 39  ? -25.659 8.220   10.701 1.00 46.09  ? 39  LYS B CB  1 
ATOM   2465 C CG  . LYS B 2 39  ? -25.798 6.995   11.603 1.00 49.89  ? 39  LYS B CG  1 
ATOM   2466 C CD  . LYS B 2 39  ? -26.731 7.237   12.848 1.00 57.92  ? 39  LYS B CD  1 
ATOM   2467 C CE  . LYS B 2 39  ? -26.896 8.757   13.268 1.00 62.68  ? 39  LYS B CE  1 
ATOM   2468 N NZ  . LYS B 2 39  ? -25.670 9.547   13.683 1.00 59.41  ? 39  LYS B NZ  1 
ATOM   2469 N N   . PRO B 2 40  ? -25.935 10.257  8.525  1.00 46.42  ? 40  PRO B N   1 
ATOM   2470 C CA  . PRO B 2 40  ? -26.807 11.154  7.721  1.00 48.72  ? 40  PRO B CA  1 
ATOM   2471 C C   . PRO B 2 40  ? -27.001 10.685  6.261  1.00 47.78  ? 40  PRO B C   1 
ATOM   2472 O O   . PRO B 2 40  ? -28.141 10.645  5.787  1.00 49.47  ? 40  PRO B O   1 
ATOM   2473 C CB  . PRO B 2 40  ? -26.105 12.521  7.786  1.00 49.05  ? 40  PRO B CB  1 
ATOM   2474 C CG  . PRO B 2 40  ? -25.115 12.402  8.929  1.00 47.86  ? 40  PRO B CG  1 
ATOM   2475 C CD  . PRO B 2 40  ? -24.834 10.963  9.212  1.00 44.23  ? 40  PRO B CD  1 
ATOM   2476 N N   . PHE B 2 41  ? -25.914 10.308  5.570  1.00 44.34  ? 41  PHE B N   1 
ATOM   2477 C CA  . PHE B 2 41  ? -26.026 9.990   4.142  1.00 44.27  ? 41  PHE B CA  1 
ATOM   2478 C C   . PHE B 2 41  ? -26.850 8.738   3.963  1.00 44.40  ? 41  PHE B C   1 
ATOM   2479 O O   . PHE B 2 41  ? -27.591 8.595   2.970  1.00 46.83  ? 41  PHE B O   1 
ATOM   2480 C CB  . PHE B 2 41  ? -24.663 9.896   3.448  1.00 42.65  ? 41  PHE B CB  1 
ATOM   2481 C CG  . PHE B 2 41  ? -23.827 11.142  3.609  1.00 45.15  ? 41  PHE B CG  1 
ATOM   2482 C CD1 . PHE B 2 41  ? -22.791 11.188  4.558  1.00 44.13  ? 41  PHE B CD1 1 
ATOM   2483 C CD2 . PHE B 2 41  ? -24.112 12.292  2.854  1.00 47.35  ? 41  PHE B CD2 1 
ATOM   2484 C CE1 . PHE B 2 41  ? -22.054 12.367  4.743  1.00 46.71  ? 41  PHE B CE1 1 
ATOM   2485 C CE2 . PHE B 2 41  ? -23.374 13.465  3.013  1.00 47.37  ? 41  PHE B CE2 1 
ATOM   2486 C CZ  . PHE B 2 41  ? -22.351 13.520  3.956  1.00 48.21  ? 41  PHE B CZ  1 
ATOM   2487 N N   . PHE B 2 42  ? -26.758 7.849   4.940  1.00 42.11  ? 42  PHE B N   1 
ATOM   2488 C CA  . PHE B 2 42  ? -27.584 6.697   4.954  1.00 42.80  ? 42  PHE B CA  1 
ATOM   2489 C C   . PHE B 2 42  ? -29.055 7.088   5.069  1.00 47.74  ? 42  PHE B C   1 
ATOM   2490 O O   . PHE B 2 42  ? -29.924 6.456   4.421  1.00 49.21  ? 42  PHE B O   1 
ATOM   2491 C CB  . PHE B 2 42  ? -27.159 5.761   6.081  1.00 41.47  ? 42  PHE B CB  1 
ATOM   2492 C CG  . PHE B 2 42  ? -27.799 4.401   6.007  1.00 41.62  ? 42  PHE B CG  1 
ATOM   2493 C CD1 . PHE B 2 42  ? -27.535 3.550   4.950  1.00 40.41  ? 42  PHE B CD1 1 
ATOM   2494 C CD2 . PHE B 2 42  ? -28.683 3.988   6.981  1.00 45.11  ? 42  PHE B CD2 1 
ATOM   2495 C CE1 . PHE B 2 42  ? -28.128 2.300   4.868  1.00 43.34  ? 42  PHE B CE1 1 
ATOM   2496 C CE2 . PHE B 2 42  ? -29.276 2.719   6.927  1.00 48.73  ? 42  PHE B CE2 1 
ATOM   2497 C CZ  . PHE B 2 42  ? -29.003 1.879   5.851  1.00 47.98  ? 42  PHE B CZ  1 
ATOM   2498 N N   . HIS B 2 43  ? -29.345 8.138   5.862  1.00 50.49  ? 43  HIS B N   1 
ATOM   2499 C CA  . HIS B 2 43  ? -30.751 8.619   6.039  1.00 55.72  ? 43  HIS B CA  1 
ATOM   2500 C C   . HIS B 2 43  ? -31.366 9.207   4.752  1.00 57.48  ? 43  HIS B C   1 
ATOM   2501 O O   . HIS B 2 43  ? -32.470 8.809   4.369  1.00 60.56  ? 43  HIS B O   1 
ATOM   2502 C CB  . HIS B 2 43  ? -30.919 9.596   7.236  1.00 58.28  ? 43  HIS B CB  1 
ATOM   2503 C CG  . HIS B 2 43  ? -32.361 9.841   7.641  1.00 66.81  ? 43  HIS B CG  1 
ATOM   2504 N ND1 . HIS B 2 43  ? -33.196 10.728  6.976  1.00 72.16  ? 43  HIS B ND1 1 
ATOM   2505 C CD2 . HIS B 2 43  ? -33.110 9.311   8.647  1.00 70.50  ? 43  HIS B CD2 1 
ATOM   2506 C CE1 . HIS B 2 43  ? -34.395 10.712  7.535  1.00 76.57  ? 43  HIS B CE1 1 
ATOM   2507 N NE2 . HIS B 2 43  ? -34.367 9.868   8.555  1.00 76.97  ? 43  HIS B NE2 1 
ATOM   2508 N N   . SER B 2 44  ? -30.676 10.144  4.099  1.00 56.09  ? 44  SER B N   1 
ATOM   2509 C CA  . SER B 2 44  ? -31.204 10.737  2.877  1.00 58.68  ? 44  SER B CA  1 
ATOM   2510 C C   . SER B 2 44  ? -31.454 9.659   1.797  1.00 59.06  ? 44  SER B C   1 
ATOM   2511 O O   . SER B 2 44  ? -32.538 9.590   1.224  1.00 61.52  ? 44  SER B O   1 
ATOM   2512 C CB  . SER B 2 44  ? -30.274 11.807  2.346  1.00 57.42  ? 44  SER B CB  1 
ATOM   2513 O OG  . SER B 2 44  ? -29.452 12.290  3.368  1.00 55.70  ? 44  SER B OG  1 
ATOM   2514 N N   . LEU B 2 45  ? -30.465 8.796   1.548  1.00 56.43  ? 45  LEU B N   1 
ATOM   2515 C CA  . LEU B 2 45  ? -30.669 7.704   0.598  1.00 56.91  ? 45  LEU B CA  1 
ATOM   2516 C C   . LEU B 2 45  ? -31.953 6.950   0.899  1.00 59.92  ? 45  LEU B C   1 
ATOM   2517 O O   . LEU B 2 45  ? -32.579 6.466   -0.027 1.00 62.89  ? 45  LEU B O   1 
ATOM   2518 C CB  . LEU B 2 45  ? -29.470 6.737   0.537  1.00 53.57  ? 45  LEU B CB  1 
ATOM   2519 C CG  . LEU B 2 45  ? -28.119 7.271   -0.016 1.00 52.60  ? 45  LEU B CG  1 
ATOM   2520 C CD1 . LEU B 2 45  ? -26.876 6.335   0.130  1.00 48.94  ? 45  LEU B CD1 1 
ATOM   2521 C CD2 . LEU B 2 45  ? -28.238 7.731   -1.464 1.00 55.09  ? 45  LEU B CD2 1 
ATOM   2522 N N   . SER B 2 46  ? -32.367 6.851   2.167  1.00 60.26  ? 46  SER B N   1 
ATOM   2523 C CA  . SER B 2 46  ? -33.639 6.191   2.473  1.00 63.42  ? 46  SER B CA  1 
ATOM   2524 C C   . SER B 2 46  ? -34.846 7.015   2.020  1.00 68.11  ? 46  SER B C   1 
ATOM   2525 O O   . SER B 2 46  ? -35.901 6.459   1.711  1.00 70.83  ? 46  SER B O   1 
ATOM   2526 C CB  . SER B 2 46  ? -33.744 5.809   3.947  1.00 63.49  ? 46  SER B CB  1 
ATOM   2527 O OG  . SER B 2 46  ? -33.978 6.938   4.790  1.00 64.00  ? 46  SER B OG  1 
ATOM   2528 N N   . GLU B 2 47  ? -34.680 8.336   1.991  1.00 69.30  ? 47  GLU B N   1 
ATOM   2529 C CA  . GLU B 2 47  ? -35.706 9.231   1.429  1.00 74.99  ? 47  GLU B CA  1 
ATOM   2530 C C   . GLU B 2 47  ? -35.773 9.012   -0.086 1.00 75.55  ? 47  GLU B C   1 
ATOM   2531 O O   . GLU B 2 47  ? -36.836 8.700   -0.601 1.00 79.63  ? 47  GLU B O   1 
ATOM   2532 C CB  . GLU B 2 47  ? -35.494 10.727  1.786  1.00 76.27  ? 47  GLU B CB  1 
ATOM   2533 C CG  . GLU B 2 47  ? -35.195 11.052  3.266  1.00 78.28  ? 47  GLU B CG  1 
ATOM   2534 C CD  . GLU B 2 47  ? -36.432 11.068  4.206  1.00 88.40  ? 47  GLU B CD  1 
ATOM   2535 O OE1 . GLU B 2 47  ? -36.708 12.169  4.776  1.00 94.71  ? 47  GLU B OE1 1 
ATOM   2536 O OE2 . GLU B 2 47  ? -37.105 10.010  4.408  1.00 88.27  ? 47  GLU B OE2 1 
ATOM   2537 N N   . LYS B 2 48  ? -34.652 9.134   -0.797 1.00 72.63  ? 48  LYS B N   1 
ATOM   2538 C CA  . LYS B 2 48  ? -34.618 8.758   -2.230 1.00 73.45  ? 48  LYS B CA  1 
ATOM   2539 C C   . LYS B 2 48  ? -35.179 7.362   -2.564 1.00 75.00  ? 48  LYS B C   1 
ATOM   2540 O O   . LYS B 2 48  ? -36.132 7.256   -3.327 1.00 78.47  ? 48  LYS B O   1 
ATOM   2541 C CB  . LYS B 2 48  ? -33.221 8.888   -2.819 1.00 69.68  ? 48  LYS B CB  1 
ATOM   2542 C CG  . LYS B 2 48  ? -33.025 10.026  -3.796 1.00 70.61  ? 48  LYS B CG  1 
ATOM   2543 C CD  . LYS B 2 48  ? -32.010 9.564   -4.889 1.00 68.53  ? 48  LYS B CD  1 
ATOM   2544 C CE  . LYS B 2 48  ? -31.772 10.597  -5.991 1.00 68.09  ? 48  LYS B CE  1 
ATOM   2545 N NZ  . LYS B 2 48  ? -32.767 10.496  -7.104 1.00 72.01  ? 48  LYS B NZ  1 
ATOM   2546 N N   . TYR B 2 49  ? -34.607 6.301   -1.987 1.00 73.33  ? 49  TYR B N   1 
ATOM   2547 C CA  . TYR B 2 49  ? -34.877 4.925   -2.456 1.00 75.11  ? 49  TYR B CA  1 
ATOM   2548 C C   . TYR B 2 49  ? -35.962 4.199   -1.670 1.00 77.87  ? 49  TYR B C   1 
ATOM   2549 O O   . TYR B 2 49  ? -35.717 3.209   -0.997 1.00 77.16  ? 49  TYR B O   1 
ATOM   2550 C CB  . TYR B 2 49  ? -33.571 4.109   -2.566 1.00 71.62  ? 49  TYR B CB  1 
ATOM   2551 C CG  . TYR B 2 49  ? -32.556 4.728   -3.523 1.00 71.95  ? 49  TYR B CG  1 
ATOM   2552 C CD1 . TYR B 2 49  ? -32.650 4.532   -4.915 1.00 74.86  ? 49  TYR B CD1 1 
ATOM   2553 C CD2 . TYR B 2 49  ? -31.512 5.521   -3.044 1.00 72.11  ? 49  TYR B CD2 1 
ATOM   2554 C CE1 . TYR B 2 49  ? -31.734 5.104   -5.804 1.00 73.89  ? 49  TYR B CE1 1 
ATOM   2555 C CE2 . TYR B 2 49  ? -30.582 6.123   -3.930 1.00 72.41  ? 49  TYR B CE2 1 
ATOM   2556 C CZ  . TYR B 2 49  ? -30.704 5.903   -5.314 1.00 75.14  ? 49  TYR B CZ  1 
ATOM   2557 O OH  . TYR B 2 49  ? -29.779 6.481   -6.180 1.00 75.62  ? 49  TYR B OH  1 
ATOM   2558 N N   . SER B 2 50  ? -37.181 4.694   -1.766 1.00 82.31  ? 50  SER B N   1 
ATOM   2559 C CA  . SER B 2 50  ? -38.263 4.139   -0.958 1.00 86.74  ? 50  SER B CA  1 
ATOM   2560 C C   . SER B 2 50  ? -38.845 2.878   -1.584 1.00 89.64  ? 50  SER B C   1 
ATOM   2561 O O   . SER B 2 50  ? -39.784 2.263   -1.061 1.00 92.75  ? 50  SER B O   1 
ATOM   2562 C CB  . SER B 2 50  ? -39.321 5.200   -0.701 1.00 90.45  ? 50  SER B CB  1 
ATOM   2563 O OG  . SER B 2 50  ? -39.237 6.171   -1.732 1.00 92.47  ? 50  SER B OG  1 
ATOM   2564 N N   . ASN B 2 51  ? -38.249 2.489   -2.696 1.00 88.81  ? 51  ASN B N   1 
ATOM   2565 C CA  . ASN B 2 51  ? -38.489 1.186   -3.257 1.00 92.09  ? 51  ASN B CA  1 
ATOM   2566 C C   . ASN B 2 51  ? -37.623 0.153   -2.557 1.00 89.12  ? 51  ASN B C   1 
ATOM   2567 O O   . ASN B 2 51  ? -37.733 -1.050  -2.807 1.00 90.78  ? 51  ASN B O   1 
ATOM   2568 C CB  . ASN B 2 51  ? -38.230 1.212   -4.771 1.00 93.78  ? 51  ASN B CB  1 
ATOM   2569 C CG  . ASN B 2 51  ? -36.854 1.831   -5.159 1.00 91.91  ? 51  ASN B CG  1 
ATOM   2570 O OD1 . ASN B 2 51  ? -36.435 2.900   -4.647 1.00 90.22  ? 51  ASN B OD1 1 
ATOM   2571 N ND2 . ASN B 2 51  ? -36.166 1.160   -6.112 1.00 92.71  ? 51  ASN B ND2 1 
ATOM   2572 N N   . VAL B 2 52  ? -36.776 0.665   -1.660 1.00 85.44  ? 52  VAL B N   1 
ATOM   2573 C CA  . VAL B 2 52  ? -35.756 -0.095  -0.904 1.00 82.07  ? 52  VAL B CA  1 
ATOM   2574 C C   . VAL B 2 52  ? -35.956 0.087   0.602  1.00 81.91  ? 52  VAL B C   1 
ATOM   2575 O O   . VAL B 2 52  ? -36.334 1.185   1.078  1.00 81.40  ? 52  VAL B O   1 
ATOM   2576 C CB  . VAL B 2 52  ? -34.338 0.419   -1.225 1.00 77.23  ? 52  VAL B CB  1 
ATOM   2577 C CG1 . VAL B 2 52  ? -33.293 -0.507  -0.664 1.00 74.03  ? 52  VAL B CG1 1 
ATOM   2578 C CG2 . VAL B 2 52  ? -34.163 0.623   -2.732 1.00 78.16  ? 52  VAL B CG2 1 
ATOM   2579 N N   . ILE B 2 53  ? -35.682 -0.986  1.341  1.00 82.47  ? 53  ILE B N   1 
ATOM   2580 C CA  . ILE B 2 53  ? -35.809 -0.975  2.803  1.00 83.31  ? 53  ILE B CA  1 
ATOM   2581 C C   . ILE B 2 53  ? -34.469 -0.785  3.447  1.00 78.95  ? 53  ILE B C   1 
ATOM   2582 O O   . ILE B 2 53  ? -33.547 -1.567  3.199  1.00 76.93  ? 53  ILE B O   1 
ATOM   2583 C CB  . ILE B 2 53  ? -36.425 -2.282  3.375  1.00 87.35  ? 53  ILE B CB  1 
ATOM   2584 C CG1 . ILE B 2 53  ? -37.854 -2.495  2.838  1.00 93.16  ? 53  ILE B CG1 1 
ATOM   2585 C CG2 . ILE B 2 53  ? -36.375 -2.266  4.898  1.00 86.44  ? 53  ILE B CG2 1 
ATOM   2586 C CD1 . ILE B 2 53  ? -38.729 -1.211  2.711  1.00 94.46  ? 53  ILE B CD1 1 
ATOM   2587 N N   . PHE B 2 54  ? -34.370 0.258   4.268  1.00 77.97  ? 54  PHE B N   1 
ATOM   2588 C CA  . PHE B 2 54  ? -33.156 0.510   5.039  1.00 74.39  ? 54  PHE B CA  1 
ATOM   2589 C C   . PHE B 2 54  ? -33.374 0.127   6.479  1.00 75.47  ? 54  PHE B C   1 
ATOM   2590 O O   . PHE B 2 54  ? -34.457 0.329   7.031  1.00 79.45  ? 54  PHE B O   1 
ATOM   2591 C CB  . PHE B 2 54  ? -32.781 1.984   5.007  1.00 72.48  ? 54  PHE B CB  1 
ATOM   2592 C CG  . PHE B 2 54  ? -32.589 2.525   3.645  1.00 72.77  ? 54  PHE B CG  1 
ATOM   2593 C CD1 . PHE B 2 54  ? -33.639 2.526   2.731  1.00 77.56  ? 54  PHE B CD1 1 
ATOM   2594 C CD2 . PHE B 2 54  ? -31.357 3.074   3.278  1.00 70.26  ? 54  PHE B CD2 1 
ATOM   2595 C CE1 . PHE B 2 54  ? -33.469 3.049   1.446  1.00 78.20  ? 54  PHE B CE1 1 
ATOM   2596 C CE2 . PHE B 2 54  ? -31.165 3.607   1.997  1.00 70.64  ? 54  PHE B CE2 1 
ATOM   2597 C CZ  . PHE B 2 54  ? -32.232 3.592   1.077  1.00 74.83  ? 54  PHE B CZ  1 
ATOM   2598 N N   . LEU B 2 55  ? -32.323 -0.395  7.089  1.00 72.43  ? 55  LEU B N   1 
ATOM   2599 C CA  . LEU B 2 55  ? -32.340 -0.711  8.500  1.00 73.29  ? 55  LEU B CA  1 
ATOM   2600 C C   . LEU B 2 55  ? -30.976 -0.375  9.131  1.00 68.93  ? 55  LEU B C   1 
ATOM   2601 O O   . LEU B 2 55  ? -29.946 -0.345  8.427  1.00 65.68  ? 55  LEU B O   1 
ATOM   2602 C CB  . LEU B 2 55  ? -32.666 -2.193  8.690  1.00 76.53  ? 55  LEU B CB  1 
ATOM   2603 C CG  . LEU B 2 55  ? -33.850 -2.846  7.960  1.00 80.10  ? 55  LEU B CG  1 
ATOM   2604 C CD1 . LEU B 2 55  ? -33.675 -4.384  7.959  1.00 80.26  ? 55  LEU B CD1 1 
ATOM   2605 C CD2 . LEU B 2 55  ? -35.215 -2.431  8.552  1.00 83.38  ? 55  LEU B CD2 1 
ATOM   2606 N N   . GLU B 2 56  ? -31.001 -0.102  10.441 1.00 68.96  ? 56  GLU B N   1 
ATOM   2607 C CA  . GLU B 2 56  ? -29.821 0.066   11.272 1.00 65.46  ? 56  GLU B CA  1 
ATOM   2608 C C   . GLU B 2 56  ? -29.763 -1.018  12.321 1.00 67.30  ? 56  GLU B C   1 
ATOM   2609 O O   . GLU B 2 56  ? -30.781 -1.412  12.850 1.00 72.15  ? 56  GLU B O   1 
ATOM   2610 C CB  . GLU B 2 56  ? -29.856 1.404   12.005 1.00 65.63  ? 56  GLU B CB  1 
ATOM   2611 C CG  . GLU B 2 56  ? -28.481 1.803   12.634 1.00 63.28  ? 56  GLU B CG  1 
ATOM   2612 C CD  . GLU B 2 56  ? -28.281 3.314   12.612 1.00 65.07  ? 56  GLU B CD  1 
ATOM   2613 O OE1 . GLU B 2 56  ? -29.332 3.985   12.510 1.00 72.90  ? 56  GLU B OE1 1 
ATOM   2614 O OE2 . GLU B 2 56  ? -27.130 3.837   12.671 1.00 60.45  ? 56  GLU B OE2 1 
ATOM   2615 N N   . VAL B 2 57  ? -28.557 -1.487  12.617 1.00 64.15  ? 57  VAL B N   1 
ATOM   2616 C CA  . VAL B 2 57  ? -28.265 -2.325  13.776 1.00 64.79  ? 57  VAL B CA  1 
ATOM   2617 C C   . VAL B 2 57  ? -27.015 -1.813  14.493 1.00 61.21  ? 57  VAL B C   1 
ATOM   2618 O O   . VAL B 2 57  ? -25.944 -1.676  13.898 1.00 55.95  ? 57  VAL B O   1 
ATOM   2619 C CB  . VAL B 2 57  ? -27.964 -3.768  13.373 1.00 66.19  ? 57  VAL B CB  1 
ATOM   2620 C CG1 . VAL B 2 57  ? -27.641 -4.605  14.636 1.00 68.33  ? 57  VAL B CG1 1 
ATOM   2621 C CG2 . VAL B 2 57  ? -29.116 -4.364  12.542 1.00 68.65  ? 57  VAL B CG2 1 
ATOM   2622 N N   . ASP B 2 58  ? -27.164 -1.544  15.782 1.00 63.52  ? 58  ASP B N   1 
ATOM   2623 C CA  . ASP B 2 58  ? -26.040 -1.191  16.613 1.00 61.37  ? 58  ASP B CA  1 
ATOM   2624 C C   . ASP B 2 58  ? -25.340 -2.462  17.109 1.00 63.02  ? 58  ASP B C   1 
ATOM   2625 O O   . ASP B 2 58  ? -25.886 -3.204  17.921 1.00 67.34  ? 58  ASP B O   1 
ATOM   2626 C CB  . ASP B 2 58  ? -26.477 -0.319  17.767 1.00 62.82  ? 58  ASP B CB  1 
ATOM   2627 C CG  . ASP B 2 58  ? -25.317 0.271   18.489 1.00 61.95  ? 58  ASP B CG  1 
ATOM   2628 O OD1 . ASP B 2 58  ? -24.505 -0.492  19.057 1.00 65.59  ? 58  ASP B OD1 1 
ATOM   2629 O OD2 . ASP B 2 58  ? -25.187 1.505   18.502 1.00 61.29  ? 58  ASP B OD2 1 
ATOM   2630 N N   . VAL B 2 59  ? -24.120 -2.682  16.608 1.00 59.67  ? 59  VAL B N   1 
ATOM   2631 C CA  . VAL B 2 59  ? -23.305 -3.851  16.930 1.00 60.80  ? 59  VAL B CA  1 
ATOM   2632 C C   . VAL B 2 59  ? -23.122 -4.064  18.426 1.00 64.52  ? 59  VAL B C   1 
ATOM   2633 O O   . VAL B 2 59  ? -22.917 -5.192  18.894 1.00 66.95  ? 59  VAL B O   1 
ATOM   2634 C CB  . VAL B 2 59  ? -21.883 -3.763  16.278 1.00 56.29  ? 59  VAL B CB  1 
ATOM   2635 C CG1 . VAL B 2 59  ? -21.980 -3.760  14.792 1.00 52.84  ? 59  VAL B CG1 1 
ATOM   2636 C CG2 . VAL B 2 59  ? -21.116 -2.540  16.773 1.00 52.56  ? 59  VAL B CG2 1 
ATOM   2637 N N   . ASP B 2 60  ? -23.154 -2.970  19.171 1.00 65.26  ? 60  ASP B N   1 
ATOM   2638 C CA  . ASP B 2 60  ? -23.072 -3.066  20.614 1.00 70.04  ? 60  ASP B CA  1 
ATOM   2639 C C   . ASP B 2 60  ? -24.426 -3.430  21.231 1.00 76.29  ? 60  ASP B C   1 
ATOM   2640 O O   . ASP B 2 60  ? -24.474 -4.026  22.303 1.00 80.65  ? 60  ASP B O   1 
ATOM   2641 C CB  . ASP B 2 60  ? -22.497 -1.770  21.199 1.00 68.01  ? 60  ASP B CB  1 
ATOM   2642 C CG  . ASP B 2 60  ? -20.985 -1.643  20.971 1.00 64.74  ? 60  ASP B CG  1 
ATOM   2643 O OD1 . ASP B 2 60  ? -20.517 -0.541  20.618 1.00 62.09  ? 60  ASP B OD1 1 
ATOM   2644 O OD2 . ASP B 2 60  ? -20.262 -2.647  21.143 1.00 66.20  ? 60  ASP B OD2 1 
ATOM   2645 N N   . ASP B 2 61  ? -25.521 -3.080  20.558 1.00 77.72  ? 61  ASP B N   1 
ATOM   2646 C CA  . ASP B 2 61  ? -26.845 -3.310  21.138 1.00 84.90  ? 61  ASP B CA  1 
ATOM   2647 C C   . ASP B 2 61  ? -27.289 -4.693  20.830 1.00 88.72  ? 61  ASP B C   1 
ATOM   2648 O O   . ASP B 2 61  ? -27.979 -5.310  21.627 1.00 95.28  ? 61  ASP B O   1 
ATOM   2649 C CB  . ASP B 2 61  ? -27.904 -2.361  20.593 1.00 85.42  ? 61  ASP B CB  1 
ATOM   2650 C CG  . ASP B 2 61  ? -27.932 -1.044  21.323 1.00 87.11  ? 61  ASP B CG  1 
ATOM   2651 O OD1 . ASP B 2 61  ? -27.386 -0.984  22.461 1.00 88.72  ? 61  ASP B OD1 1 
ATOM   2652 O OD2 . ASP B 2 61  ? -28.504 -0.081  20.744 1.00 87.30  ? 61  ASP B OD2 1 
ATOM   2653 N N   . CYS B 2 62  ? -26.903 -5.175  19.659 1.00 85.85  ? 62  CYS B N   1 
ATOM   2654 C CA  . CYS B 2 62  ? -27.287 -6.490  19.220 1.00 89.41  ? 62  CYS B CA  1 
ATOM   2655 C C   . CYS B 2 62  ? -26.036 -7.280  18.987 1.00 87.19  ? 62  CYS B C   1 
ATOM   2656 O O   . CYS B 2 62  ? -25.817 -7.776  17.876 1.00 85.80  ? 62  CYS B O   1 
ATOM   2657 C CB  . CYS B 2 62  ? -28.075 -6.392  17.926 1.00 88.61  ? 62  CYS B CB  1 
ATOM   2658 S SG  . CYS B 2 62  ? -29.471 -5.242  18.014 1.00 93.65  ? 62  CYS B SG  1 
ATOM   2659 N N   . GLN B 2 63  ? -25.201 -7.391  20.023 1.00 87.37  ? 63  GLN B N   1 
ATOM   2660 C CA  . GLN B 2 63  ? -23.995 -8.197  19.907 1.00 85.97  ? 63  GLN B CA  1 
ATOM   2661 C C   . GLN B 2 63  ? -24.440 -9.460  19.121 1.00 89.08  ? 63  GLN B C   1 
ATOM   2662 O O   . GLN B 2 63  ? -23.789 -9.855  18.137 1.00 86.82  ? 63  GLN B O   1 
ATOM   2663 C CB  . GLN B 2 63  ? -23.371 -8.485  21.289 1.00 88.27  ? 63  GLN B CB  1 
ATOM   2664 C CG  . GLN B 2 63  ? -21.834 -8.279  21.379 1.00 85.83  ? 63  GLN B CG  1 
ATOM   2665 C CD  . GLN B 2 63  ? -21.369 -6.951  22.090 1.00 86.02  ? 63  GLN B CD  1 
ATOM   2666 O OE1 . GLN B 2 63  ? -21.420 -6.844  23.319 1.00 89.14  ? 63  GLN B OE1 1 
ATOM   2667 N NE2 . GLN B 2 63  ? -20.882 -5.958  21.301 1.00 80.27  ? 63  GLN B NE2 1 
ATOM   2668 N N   . ASP B 2 64  ? -25.611 -10.006 19.477 1.00 94.22  ? 64  ASP B N   1 
ATOM   2669 C CA  . ASP B 2 64  ? -26.112 -11.252 18.854 1.00 98.38  ? 64  ASP B CA  1 
ATOM   2670 C C   . ASP B 2 64  ? -26.345 -11.239 17.319 1.00 95.11  ? 64  ASP B C   1 
ATOM   2671 O O   . ASP B 2 64  ? -25.922 -12.169 16.620 1.00 96.31  ? 64  ASP B O   1 
ATOM   2672 C CB  . ASP B 2 64  ? -27.288 -11.888 19.655 1.00 106.12 ? 64  ASP B CB  1 
ATOM   2673 C CG  . ASP B 2 64  ? -28.585 -11.080 19.581 1.00 107.75 ? 64  ASP B CG  1 
ATOM   2674 O OD1 . ASP B 2 64  ? -28.543 -9.834  19.497 1.00 103.39 ? 64  ASP B OD1 1 
ATOM   2675 O OD2 . ASP B 2 64  ? -29.676 -11.699 19.618 1.00 116.24 ? 64  ASP B OD2 1 
ATOM   2676 N N   . VAL B 2 65  ? -26.956 -10.200 16.767 1.00 91.26  ? 65  VAL B N   1 
ATOM   2677 C CA  . VAL B 2 65  ? -27.155 -10.223 15.312 1.00 89.57  ? 65  VAL B CA  1 
ATOM   2678 C C   . VAL B 2 65  ? -25.849 -9.956  14.555 1.00 84.41  ? 65  VAL B C   1 
ATOM   2679 O O   . VAL B 2 65  ? -25.561 -10.580 13.507 1.00 84.18  ? 65  VAL B O   1 
ATOM   2680 C CB  . VAL B 2 65  ? -28.330 -9.316  14.828 1.00 88.93  ? 65  VAL B CB  1 
ATOM   2681 C CG1 . VAL B 2 65  ? -27.902 -7.888  14.661 1.00 83.58  ? 65  VAL B CG1 1 
ATOM   2682 C CG2 . VAL B 2 65  ? -28.867 -9.824  13.519 1.00 90.27  ? 65  VAL B CG2 1 
ATOM   2683 N N   . ALA B 2 66  ? -25.055 -9.037  15.112 1.00 80.53  ? 66  ALA B N   1 
ATOM   2684 C CA  . ALA B 2 66  ? -23.712 -8.769  14.622 1.00 76.28  ? 66  ALA B CA  1 
ATOM   2685 C C   . ALA B 2 66  ? -22.990 -10.085 14.407 1.00 78.85  ? 66  ALA B C   1 
ATOM   2686 O O   . ALA B 2 66  ? -22.378 -10.300 13.355 1.00 77.29  ? 66  ALA B O   1 
ATOM   2687 C CB  . ALA B 2 66  ? -22.934 -7.863  15.597 1.00 73.40  ? 66  ALA B CB  1 
ATOM   2688 N N   . SER B 2 67  ? -23.097 -10.983 15.380 1.00 83.86  ? 67  SER B N   1 
ATOM   2689 C CA  . SER B 2 67  ? -22.426 -12.255 15.234 1.00 87.95  ? 67  SER B CA  1 
ATOM   2690 C C   . SER B 2 67  ? -23.063 -13.224 14.247 1.00 91.65  ? 67  SER B C   1 
ATOM   2691 O O   . SER B 2 67  ? -22.359 -13.740 13.362 1.00 91.23  ? 67  SER B O   1 
ATOM   2692 C CB  . SER B 2 67  ? -22.171 -12.908 16.570 1.00 92.71  ? 67  SER B CB  1 
ATOM   2693 O OG  . SER B 2 67  ? -20.953 -13.635 16.464 1.00 95.72  ? 67  SER B OG  1 
ATOM   2694 N N   . GLU B 2 68  ? -24.375 -13.454 14.380 1.00 95.54  ? 68  GLU B N   1 
ATOM   2695 C CA  . GLU B 2 68  ? -25.128 -14.209 13.361 1.00 99.44  ? 68  GLU B CA  1 
ATOM   2696 C C   . GLU B 2 68  ? -24.749 -13.790 11.927 1.00 95.39  ? 68  GLU B C   1 
ATOM   2697 O O   . GLU B 2 68  ? -24.884 -14.591 10.985 1.00 98.53  ? 68  GLU B O   1 
ATOM   2698 C CB  . GLU B 2 68  ? -26.650 -14.094 13.569 1.00 102.78 ? 68  GLU B CB  1 
ATOM   2699 C CG  . GLU B 2 68  ? -27.361 -15.416 13.985 1.00 111.64 ? 68  GLU B CG  1 
ATOM   2700 C CD  . GLU B 2 68  ? -28.141 -16.118 12.829 1.00 115.72 ? 68  GLU B CD  1 
ATOM   2701 O OE1 . GLU B 2 68  ? -28.527 -15.446 11.833 1.00 110.33 ? 68  GLU B OE1 1 
ATOM   2702 O OE2 . GLU B 2 68  ? -28.378 -17.355 12.932 1.00 122.26 ? 68  GLU B OE2 1 
ATOM   2703 N N   . CYS B 2 69  ? -24.265 -12.544 11.780 1.00 88.84  ? 69  CYS B N   1 
ATOM   2704 C CA  . CYS B 2 69  ? -23.932 -11.961 10.471 1.00 84.34  ? 69  CYS B CA  1 
ATOM   2705 C C   . CYS B 2 69  ? -22.452 -11.722 10.216 1.00 79.97  ? 69  CYS B C   1 
ATOM   2706 O O   . CYS B 2 69  ? -22.124 -10.895 9.366  1.00 75.11  ? 69  CYS B O   1 
ATOM   2707 C CB  . CYS B 2 69  ? -24.591 -10.595 10.331 1.00 81.05  ? 69  CYS B CB  1 
ATOM   2708 S SG  . CYS B 2 69  ? -26.364 -10.564 10.068 1.00 84.68  ? 69  CYS B SG  1 
ATOM   2709 N N   . GLU B 2 70  ? -21.579 -12.415 10.951 1.00 81.10  ? 70  GLU B N   1 
ATOM   2710 C CA  . GLU B 2 70  ? -20.119 -12.186 10.896 1.00 77.28  ? 70  GLU B CA  1 
ATOM   2711 C C   . GLU B 2 70  ? -19.684 -10.748 10.609 1.00 69.75  ? 70  GLU B C   1 
ATOM   2712 O O   . GLU B 2 70  ? -18.937 -10.487 9.660  1.00 66.92  ? 70  GLU B O   1 
ATOM   2713 C CB  . GLU B 2 70  ? -19.463 -13.105 9.871  1.00 80.03  ? 70  GLU B CB  1 
ATOM   2714 C CG  . GLU B 2 70  ? -19.260 -14.488 10.369 1.00 88.01  ? 70  GLU B CG  1 
ATOM   2715 C CD  . GLU B 2 70  ? -19.743 -15.480 9.362  1.00 94.74  ? 70  GLU B CD  1 
ATOM   2716 O OE1 . GLU B 2 70  ? -19.163 -15.481 8.256  1.00 94.81  ? 70  GLU B OE1 1 
ATOM   2717 O OE2 . GLU B 2 70  ? -20.711 -16.225 9.663  1.00 99.10  ? 70  GLU B OE2 1 
ATOM   2718 N N   . VAL B 2 71  ? -20.121 -9.811  11.420 1.00 65.99  ? 71  VAL B N   1 
ATOM   2719 C CA  . VAL B 2 71  ? -19.679 -8.472  11.143 1.00 60.72  ? 71  VAL B CA  1 
ATOM   2720 C C   . VAL B 2 71  ? -18.381 -8.187  11.865 1.00 57.33  ? 71  VAL B C   1 
ATOM   2721 O O   . VAL B 2 71  ? -18.254 -8.459  13.039 1.00 58.44  ? 71  VAL B O   1 
ATOM   2722 C CB  . VAL B 2 71  ? -20.756 -7.428  11.457 1.00 60.15  ? 71  VAL B CB  1 
ATOM   2723 C CG1 . VAL B 2 71  ? -20.148 -6.019  11.449 1.00 57.16  ? 71  VAL B CG1 1 
ATOM   2724 C CG2 . VAL B 2 71  ? -21.894 -7.531  10.440 1.00 61.46  ? 71  VAL B CG2 1 
ATOM   2725 N N   . LYS B 2 72  ? -17.413 -7.624  11.157 1.00 53.36  ? 72  LYS B N   1 
ATOM   2726 C CA  . LYS B 2 72  ? -16.097 -7.473  11.739 1.00 50.75  ? 72  LYS B CA  1 
ATOM   2727 C C   . LYS B 2 72  ? -15.816 -6.049  12.079 1.00 45.67  ? 72  LYS B C   1 
ATOM   2728 O O   . LYS B 2 72  ? -15.094 -5.760  13.024 1.00 45.13  ? 72  LYS B O   1 
ATOM   2729 C CB  . LYS B 2 72  ? -15.056 -8.031  10.808 1.00 51.58  ? 72  LYS B CB  1 
ATOM   2730 C CG  . LYS B 2 72  ? -15.140 -9.547  10.779 1.00 59.85  ? 72  LYS B CG  1 
ATOM   2731 C CD  . LYS B 2 72  ? -14.221 -10.194 11.835 1.00 65.83  ? 72  LYS B CD  1 
ATOM   2732 C CE  . LYS B 2 72  ? -14.852 -11.403 12.531 1.00 71.77  ? 72  LYS B CE  1 
ATOM   2733 N NZ  . LYS B 2 72  ? -13.816 -11.950 13.470 1.00 73.92  ? 72  LYS B NZ  1 
ATOM   2734 N N   . CYS B 2 73  ? -16.430 -5.143  11.349 1.00 42.38  ? 73  CYS B N   1 
ATOM   2735 C CA  . CYS B 2 73  ? -16.122 -3.754  11.539 1.00 38.53  ? 73  CYS B CA  1 
ATOM   2736 C C   . CYS B 2 73  ? -17.281 -2.890  11.131 1.00 35.72  ? 73  CYS B C   1 
ATOM   2737 O O   . CYS B 2 73  ? -18.238 -3.352  10.557 1.00 37.49  ? 73  CYS B O   1 
ATOM   2738 C CB  . CYS B 2 73  ? -14.848 -3.396  10.752 1.00 37.78  ? 73  CYS B CB  1 
ATOM   2739 S SG  . CYS B 2 73  ? -15.116 -3.521  8.946  1.00 42.55  ? 73  CYS B SG  1 
ATOM   2740 N N   . MET B 2 74  ? -17.179 -1.612  11.419 1.00 32.59  ? 74  MET B N   1 
ATOM   2741 C CA  . MET B 2 74  ? -18.315 -0.691  11.308 1.00 31.69  ? 74  MET B CA  1 
ATOM   2742 C C   . MET B 2 74  ? -17.728 0.477   10.593 1.00 28.83  ? 74  MET B C   1 
ATOM   2743 O O   . MET B 2 74  ? -16.555 0.751   10.792 1.00 27.57  ? 74  MET B O   1 
ATOM   2744 C CB  . MET B 2 74  ? -18.796 -0.181  12.698 1.00 31.83  ? 74  MET B CB  1 
ATOM   2745 C CG  . MET B 2 74  ? -19.350 -1.180  13.650 1.00 33.14  ? 74  MET B CG  1 
ATOM   2746 S SD  . MET B 2 74  ? -18.161 -2.425  14.244 1.00 41.35  ? 74  MET B SD  1 
ATOM   2747 C CE  . MET B 2 74  ? -17.188 -1.695  15.580 1.00 31.50  ? 74  MET B CE  1 
ATOM   2748 N N   . PRO B 2 75  ? -18.511 1.156   9.754  1.00 28.64  ? 75  PRO B N   1 
ATOM   2749 C CA  . PRO B 2 75  ? -19.793 0.723   9.219  1.00 30.28  ? 75  PRO B CA  1 
ATOM   2750 C C   . PRO B 2 75  ? -19.558 -0.409  8.250  1.00 31.09  ? 75  PRO B C   1 
ATOM   2751 O O   . PRO B 2 75  ? -18.608 -0.321  7.449  1.00 30.30  ? 75  PRO B O   1 
ATOM   2752 C CB  . PRO B 2 75  ? -20.271 1.926   8.394  1.00 29.84  ? 75  PRO B CB  1 
ATOM   2753 C CG  . PRO B 2 75  ? -19.283 2.994   8.551  1.00 29.43  ? 75  PRO B CG  1 
ATOM   2754 C CD  . PRO B 2 75  ? -18.103 2.495   9.286  1.00 27.28  ? 75  PRO B CD  1 
ATOM   2755 N N   . THR B 2 76  ? -20.367 -1.469  8.344  1.00 32.94  ? 76  THR B N   1 
ATOM   2756 C CA  . THR B 2 76  ? -20.468 -2.492  7.284  1.00 33.88  ? 76  THR B CA  1 
ATOM   2757 C C   . THR B 2 76  ? -21.890 -2.506  6.777  1.00 35.74  ? 76  THR B C   1 
ATOM   2758 O O   . THR B 2 76  ? -22.838 -2.499  7.544  1.00 36.85  ? 76  THR B O   1 
ATOM   2759 C CB  . THR B 2 76  ? -20.219 -3.937  7.802  1.00 36.76  ? 76  THR B CB  1 
ATOM   2760 O OG1 . THR B 2 76  ? -18.842 -4.144  8.065  1.00 32.36  ? 76  THR B OG1 1 
ATOM   2761 C CG2 . THR B 2 76  ? -20.702 -5.020  6.752  1.00 39.57  ? 76  THR B CG2 1 
ATOM   2762 N N   . PHE B 2 77  ? -22.053 -2.587  5.480  1.00 36.55  ? 77  PHE B N   1 
ATOM   2763 C CA  . PHE B 2 77  ? -23.386 -2.600  4.938  1.00 38.80  ? 77  PHE B CA  1 
ATOM   2764 C C   . PHE B 2 77  ? -23.690 -3.945  4.285  1.00 43.77  ? 77  PHE B C   1 
ATOM   2765 O O   . PHE B 2 77  ? -22.889 -4.490  3.523  1.00 44.62  ? 77  PHE B O   1 
ATOM   2766 C CB  . PHE B 2 77  ? -23.501 -1.507  3.920  1.00 36.18  ? 77  PHE B CB  1 
ATOM   2767 C CG  . PHE B 2 77  ? -23.389 -0.158  4.471  1.00 31.51  ? 77  PHE B CG  1 
ATOM   2768 C CD1 . PHE B 2 77  ? -24.498 0.476   4.999  1.00 34.04  ? 77  PHE B CD1 1 
ATOM   2769 C CD2 . PHE B 2 77  ? -22.192 0.522   4.409  1.00 28.33  ? 77  PHE B CD2 1 
ATOM   2770 C CE1 . PHE B 2 77  ? -24.418 1.777   5.506  1.00 33.78  ? 77  PHE B CE1 1 
ATOM   2771 C CE2 . PHE B 2 77  ? -22.085 1.825   4.885  1.00 29.45  ? 77  PHE B CE2 1 
ATOM   2772 C CZ  . PHE B 2 77  ? -23.207 2.463   5.449  1.00 31.80  ? 77  PHE B CZ  1 
ATOM   2773 N N   . GLN B 2 78  ? -24.850 -4.500  4.570  1.00 48.38  ? 78  GLN B N   1 
ATOM   2774 C CA  . GLN B 2 78  ? -25.184 -5.760  3.909  1.00 54.26  ? 78  GLN B CA  1 
ATOM   2775 C C   . GLN B 2 78  ? -26.493 -5.683  3.117  1.00 57.68  ? 78  GLN B C   1 
ATOM   2776 O O   . GLN B 2 78  ? -27.478 -5.088  3.586  1.00 57.90  ? 78  GLN B O   1 
ATOM   2777 C CB  . GLN B 2 78  ? -25.242 -6.886  4.930  1.00 57.13  ? 78  GLN B CB  1 
ATOM   2778 C CG  . GLN B 2 78  ? -23.957 -7.128  5.682  1.00 56.85  ? 78  GLN B CG  1 
ATOM   2779 C CD  . GLN B 2 78  ? -23.946 -8.461  6.428  1.00 62.10  ? 78  GLN B CD  1 
ATOM   2780 O OE1 . GLN B 2 78  ? -22.893 -8.940  6.847  1.00 63.89  ? 78  GLN B OE1 1 
ATOM   2781 N NE2 . GLN B 2 78  ? -25.119 -9.068  6.590  1.00 67.91  ? 78  GLN B NE2 1 
ATOM   2782 N N   . PHE B 2 79  ? -26.497 -6.288  1.926  1.00 61.48  ? 79  PHE B N   1 
ATOM   2783 C CA  . PHE B 2 79  ? -27.671 -6.250  1.038  1.00 65.65  ? 79  PHE B CA  1 
ATOM   2784 C C   . PHE B 2 79  ? -28.238 -7.618  0.809  1.00 71.49  ? 79  PHE B C   1 
ATOM   2785 O O   . PHE B 2 79  ? -27.512 -8.573  0.513  1.00 72.99  ? 79  PHE B O   1 
ATOM   2786 C CB  . PHE B 2 79  ? -27.331 -5.608  -0.304 1.00 64.58  ? 79  PHE B CB  1 
ATOM   2787 C CG  . PHE B 2 79  ? -26.751 -4.213  -0.187 1.00 61.26  ? 79  PHE B CG  1 
ATOM   2788 C CD1 . PHE B 2 79  ? -25.607 -3.978  0.543  1.00 58.55  ? 79  PHE B CD1 1 
ATOM   2789 C CD2 . PHE B 2 79  ? -27.356 -3.135  -0.831 1.00 63.48  ? 79  PHE B CD2 1 
ATOM   2790 C CE1 . PHE B 2 79  ? -25.074 -2.703  0.644  1.00 57.22  ? 79  PHE B CE1 1 
ATOM   2791 C CE2 . PHE B 2 79  ? -26.840 -1.849  -0.738 1.00 60.16  ? 79  PHE B CE2 1 
ATOM   2792 C CZ  . PHE B 2 79  ? -25.696 -1.631  0.009  1.00 59.11  ? 79  PHE B CZ  1 
ATOM   2793 N N   . PHE B 2 80  ? -29.557 -7.669  0.941  1.00 76.34  ? 80  PHE B N   1 
ATOM   2794 C CA  . PHE B 2 80  ? -30.404 -8.852  0.695  1.00 83.73  ? 80  PHE B CA  1 
ATOM   2795 C C   . PHE B 2 80  ? -31.551 -8.562  -0.292 1.00 87.58  ? 80  PHE B C   1 
ATOM   2796 O O   . PHE B 2 80  ? -32.139 -7.457  -0.324 1.00 85.53  ? 80  PHE B O   1 
ATOM   2797 C CB  . PHE B 2 80  ? -31.012 -9.358  2.005  1.00 85.64  ? 80  PHE B CB  1 
ATOM   2798 C CG  . PHE B 2 80  ? -30.055 -9.352  3.125  1.00 84.20  ? 80  PHE B CG  1 
ATOM   2799 C CD1 . PHE B 2 80  ? -29.756 -8.168  3.790  1.00 79.56  ? 80  PHE B CD1 1 
ATOM   2800 C CD2 . PHE B 2 80  ? -29.401 -10.521 3.498  1.00 88.05  ? 80  PHE B CD2 1 
ATOM   2801 C CE1 . PHE B 2 80  ? -28.837 -8.146  4.831  1.00 76.56  ? 80  PHE B CE1 1 
ATOM   2802 C CE2 . PHE B 2 80  ? -28.463 -10.524 4.554  1.00 84.24  ? 80  PHE B CE2 1 
ATOM   2803 C CZ  . PHE B 2 80  ? -28.193 -9.333  5.226  1.00 78.98  ? 80  PHE B CZ  1 
ATOM   2804 N N   . LYS B 2 81  ? -31.849 -9.590  -1.090 1.00 94.05  ? 81  LYS B N   1 
ATOM   2805 C CA  . LYS B 2 81  ? -33.074 -9.701  -1.883 1.00 98.93  ? 81  LYS B CA  1 
ATOM   2806 C C   . LYS B 2 81  ? -33.652 -11.068 -1.521 1.00 105.49 ? 81  LYS B C   1 
ATOM   2807 O O   . LYS B 2 81  ? -32.928 -12.066 -1.457 1.00 107.32 ? 81  LYS B O   1 
ATOM   2808 C CB  . LYS B 2 81  ? -32.754 -9.634  -3.384 1.00 99.56  ? 81  LYS B CB  1 
ATOM   2809 C CG  . LYS B 2 81  ? -33.752 -8.796  -4.242 1.00 100.28 ? 81  LYS B CG  1 
ATOM   2810 C CD  . LYS B 2 81  ? -32.973 -7.934  -5.291 1.00 97.57  ? 81  LYS B CD  1 
ATOM   2811 C CE  . LYS B 2 81  ? -31.767 -8.728  -6.007 1.00 98.21  ? 81  LYS B CE  1 
ATOM   2812 N NZ  . LYS B 2 81  ? -31.275 -7.975  -7.313 1.00 96.27  ? 81  LYS B NZ  1 
ATOM   2813 N N   . LYS B 2 82  ? -34.956 -11.106 -1.273 1.00 110.06 ? 82  LYS B N   1 
ATOM   2814 C CA  . LYS B 2 82  ? -35.670 -12.358 -0.924 1.00 117.25 ? 82  LYS B CA  1 
ATOM   2815 C C   . LYS B 2 82  ? -35.375 -12.807 0.507  1.00 117.62 ? 82  LYS B C   1 
ATOM   2816 O O   . LYS B 2 82  ? -36.164 -13.541 1.092  1.00 123.67 ? 82  LYS B O   1 
ATOM   2817 C CB  . LYS B 2 82  ? -35.403 -13.512 -1.930 1.00 121.59 ? 82  LYS B CB  1 
ATOM   2818 C CG  . LYS B 2 82  ? -35.953 -13.289 -3.366 1.00 122.70 ? 82  LYS B CG  1 
ATOM   2819 C CD  . LYS B 2 82  ? -37.164 -14.175 -3.720 1.00 128.93 ? 82  LYS B CD  1 
ATOM   2820 C CE  . LYS B 2 82  ? -37.475 -14.176 -5.254 1.00 129.29 ? 82  LYS B CE  1 
ATOM   2821 N NZ  . LYS B 2 82  ? -38.782 -14.787 -5.616 1.00 133.15 ? 82  LYS B NZ  1 
ATOM   2822 N N   . GLY B 2 83  ? -34.263 -12.356 1.075  1.00 112.25 ? 83  GLY B N   1 
ATOM   2823 C CA  . GLY B 2 83  ? -33.868 -12.795 2.410  1.00 112.55 ? 83  GLY B CA  1 
ATOM   2824 C C   . GLY B 2 83  ? -32.394 -13.137 2.442  1.00 109.79 ? 83  GLY B C   1 
ATOM   2825 O O   . GLY B 2 83  ? -31.772 -13.187 3.504  1.00 108.06 ? 83  GLY B O   1 
ATOM   2826 N N   . GLN B 2 84  ? -31.820 -13.356 1.269  1.00 109.54 ? 84  GLN B N   1 
ATOM   2827 C CA  . GLN B 2 84  ? -30.454 -13.844 1.206  1.00 108.39 ? 84  GLN B CA  1 
ATOM   2828 C C   . GLN B 2 84  ? -29.482 -12.758 0.748  1.00 101.42 ? 84  GLN B C   1 
ATOM   2829 O O   . GLN B 2 84  ? -29.710 -12.112 -0.283 1.00 100.51 ? 84  GLN B O   1 
ATOM   2830 C CB  . GLN B 2 84  ? -30.416 -15.100 0.326  1.00 114.78 ? 84  GLN B CB  1 
ATOM   2831 C CG  . GLN B 2 84  ? -31.399 -16.197 0.813  1.00 123.10 ? 84  GLN B CG  1 
ATOM   2832 C CD  . GLN B 2 84  ? -31.110 -16.716 2.259  1.00 125.61 ? 84  GLN B CD  1 
ATOM   2833 O OE1 . GLN B 2 84  ? -31.011 -17.930 2.478  1.00 130.76 ? 84  GLN B OE1 1 
ATOM   2834 N NE2 . GLN B 2 84  ? -30.984 -15.793 3.237  1.00 120.00 ? 84  GLN B NE2 1 
ATOM   2835 N N   . LYS B 2 85  ? -28.422 -12.534 1.525  1.00 96.74  ? 85  LYS B N   1 
ATOM   2836 C CA  . LYS B 2 85  ? -27.433 -11.511 1.177  1.00 90.02  ? 85  LYS B CA  1 
ATOM   2837 C C   . LYS B 2 85  ? -27.090 -11.605 -0.299 1.00 90.46  ? 85  LYS B C   1 
ATOM   2838 O O   . LYS B 2 85  ? -27.008 -12.698 -0.857 1.00 95.58  ? 85  LYS B O   1 
ATOM   2839 C CB  . LYS B 2 85  ? -26.146 -11.680 2.001  1.00 87.84  ? 85  LYS B CB  1 
ATOM   2840 C CG  . LYS B 2 85  ? -25.200 -10.451 1.941  1.00 81.45  ? 85  LYS B CG  1 
ATOM   2841 C CD  . LYS B 2 85  ? -23.856 -10.675 2.610  1.00 79.10  ? 85  LYS B CD  1 
ATOM   2842 C CE  . LYS B 2 85  ? -24.039 -11.096 4.073  1.00 79.78  ? 85  LYS B CE  1 
ATOM   2843 N NZ  . LYS B 2 85  ? -22.812 -11.737 4.611  1.00 78.09  ? 85  LYS B NZ  1 
ATOM   2844 N N   . VAL B 2 86  ? -26.916 -10.473 -0.953 1.00 85.66  ? 86  VAL B N   1 
ATOM   2845 C CA  . VAL B 2 86  ? -26.347 -10.525 -2.295 1.00 86.06  ? 86  VAL B CA  1 
ATOM   2846 C C   . VAL B 2 86  ? -25.218 -9.516  -2.337 1.00 81.12  ? 86  VAL B C   1 
ATOM   2847 O O   . VAL B 2 86  ? -24.328 -9.601  -3.188 1.00 81.82  ? 86  VAL B O   1 
ATOM   2848 C CB  . VAL B 2 86  ? -27.390 -10.347 -3.482 1.00 88.45  ? 86  VAL B CB  1 
ATOM   2849 C CG1 . VAL B 2 86  ? -28.824 -10.607 -3.029 1.00 91.03  ? 86  VAL B CG1 1 
ATOM   2850 C CG2 . VAL B 2 86  ? -27.285 -9.001  -4.151 1.00 83.70  ? 86  VAL B CG2 1 
ATOM   2851 N N   . GLY B 2 87  ? -25.247 -8.569  -1.399 1.00 76.20  ? 87  GLY B N   1 
ATOM   2852 C CA  . GLY B 2 87  ? -24.204 -7.546  -1.359 1.00 71.03  ? 87  GLY B CA  1 
ATOM   2853 C C   . GLY B 2 87  ? -23.670 -7.306  0.030  1.00 67.14  ? 87  GLY B C   1 
ATOM   2854 O O   . GLY B 2 87  ? -24.349 -7.619  1.039  1.00 68.14  ? 87  GLY B O   1 
ATOM   2855 N N   . GLU B 2 88  ? -22.455 -6.763  0.086  1.00 62.46  ? 88  GLU B N   1 
ATOM   2856 C CA  . GLU B 2 88  ? -21.901 -6.349  1.350  1.00 58.46  ? 88  GLU B CA  1 
ATOM   2857 C C   . GLU B 2 88  ? -20.513 -5.792  1.236  1.00 54.53  ? 88  GLU B C   1 
ATOM   2858 O O   . GLU B 2 88  ? -19.673 -6.346  0.555  1.00 56.26  ? 88  GLU B O   1 
ATOM   2859 C CB  . GLU B 2 88  ? -21.897 -7.504  2.310  1.00 61.34  ? 88  GLU B CB  1 
ATOM   2860 C CG  . GLU B 2 88  ? -21.390 -7.148  3.651  1.00 61.91  ? 88  GLU B CG  1 
ATOM   2861 C CD  . GLU B 2 88  ? -20.437 -8.211  4.091  1.00 70.47  ? 88  GLU B CD  1 
ATOM   2862 O OE1 . GLU B 2 88  ? -20.284 -9.183  3.261  1.00 75.70  ? 88  GLU B OE1 1 
ATOM   2863 O OE2 . GLU B 2 88  ? -19.844 -8.070  5.214  1.00 67.07  ? 88  GLU B OE2 1 
ATOM   2864 N N   . PHE B 2 89  ? -20.294 -4.675  1.919  1.00 49.53  ? 89  PHE B N   1 
ATOM   2865 C CA  . PHE B 2 89  ? -19.021 -3.984  1.941  1.00 45.77  ? 89  PHE B CA  1 
ATOM   2866 C C   . PHE B 2 89  ? -18.932 -3.188  3.227  1.00 42.03  ? 89  PHE B C   1 
ATOM   2867 O O   . PHE B 2 89  ? -19.963 -2.827  3.826  1.00 41.44  ? 89  PHE B O   1 
ATOM   2868 C CB  . PHE B 2 89  ? -18.844 -3.050  0.724  1.00 45.39  ? 89  PHE B CB  1 
ATOM   2869 C CG  . PHE B 2 89  ? -19.537 -1.705  0.855  1.00 43.16  ? 89  PHE B CG  1 
ATOM   2870 C CD1 . PHE B 2 89  ? -18.838 -0.581  1.263  1.00 40.56  ? 89  PHE B CD1 1 
ATOM   2871 C CD2 . PHE B 2 89  ? -20.893 -1.563  0.554  1.00 44.84  ? 89  PHE B CD2 1 
ATOM   2872 C CE1 . PHE B 2 89  ? -19.499 0.697   1.415  1.00 40.81  ? 89  PHE B CE1 1 
ATOM   2873 C CE2 . PHE B 2 89  ? -21.559 -0.283  0.658  1.00 42.88  ? 89  PHE B CE2 1 
ATOM   2874 C CZ  . PHE B 2 89  ? -20.865 0.835   1.105  1.00 39.17  ? 89  PHE B CZ  1 
ATOM   2875 N N   . SER B 2 90  ? -17.687 -2.896  3.615  1.00 38.72  ? 90  SER B N   1 
ATOM   2876 C CA  . SER B 2 90  ? -17.377 -2.103  4.789  1.00 34.32  ? 90  SER B CA  1 
ATOM   2877 C C   . SER B 2 90  ? -16.722 -0.783  4.434  1.00 31.11  ? 90  SER B C   1 
ATOM   2878 O O   . SER B 2 90  ? -16.080 -0.656  3.418  1.00 30.42  ? 90  SER B O   1 
ATOM   2879 C CB  . SER B 2 90  ? -16.461 -2.910  5.681  1.00 34.54  ? 90  SER B CB  1 
ATOM   2880 O OG  . SER B 2 90  ? -17.207 -3.971  6.228  1.00 37.52  ? 90  SER B OG  1 
ATOM   2881 N N   . GLY B 2 91  ? -16.907 0.203   5.289  1.00 28.66  ? 91  GLY B N   1 
ATOM   2882 C CA  . GLY B 2 91  ? -16.211 1.459   5.146  1.00 27.28  ? 91  GLY B CA  1 
ATOM   2883 C C   . GLY B 2 91  ? -17.211 2.567   4.957  1.00 26.79  ? 91  GLY B C   1 
ATOM   2884 O O   . GLY B 2 91  ? -18.219 2.346   4.345  1.00 27.45  ? 91  GLY B O   1 
ATOM   2885 N N   . ALA B 2 92  ? -16.914 3.776   5.428  1.00 26.45  ? 92  ALA B N   1 
ATOM   2886 C CA  . ALA B 2 92  ? -17.855 4.909   5.267  1.00 27.54  ? 92  ALA B CA  1 
ATOM   2887 C C   . ALA B 2 92  ? -17.765 5.581   3.939  1.00 28.53  ? 92  ALA B C   1 
ATOM   2888 O O   . ALA B 2 92  ? -17.407 6.700   3.879  1.00 31.04  ? 92  ALA B O   1 
ATOM   2889 C CB  . ALA B 2 92  ? -17.684 5.948   6.386  1.00 26.02  ? 92  ALA B CB  1 
ATOM   2890 N N   . ASN B 2 93  ? -18.131 4.947   2.859  1.00 30.04  ? 93  ASN B N   1 
ATOM   2891 C CA  . ASN B 2 93  ? -17.968 5.598   1.585  1.00 31.47  ? 93  ASN B CA  1 
ATOM   2892 C C   . ASN B 2 93  ? -19.354 5.838   0.962  1.00 33.37  ? 93  ASN B C   1 
ATOM   2893 O O   . ASN B 2 93  ? -19.979 4.907   0.448  1.00 34.11  ? 93  ASN B O   1 
ATOM   2894 C CB  . ASN B 2 93  ? -17.094 4.674   0.752  1.00 32.54  ? 93  ASN B CB  1 
ATOM   2895 C CG  . ASN B 2 93  ? -16.867 5.154   -0.668 1.00 37.30  ? 93  ASN B CG  1 
ATOM   2896 O OD1 . ASN B 2 93  ? -17.589 6.006   -1.228 1.00 41.47  ? 93  ASN B OD1 1 
ATOM   2897 N ND2 . ASN B 2 93  ? -15.857 4.584   -1.274 1.00 39.83  ? 93  ASN B ND2 1 
ATOM   2898 N N   . LYS B 2 94  ? -19.861 7.072   1.019  1.00 34.47  ? 94  LYS B N   1 
ATOM   2899 C CA  . LYS B 2 94  ? -21.230 7.328   0.493  1.00 37.05  ? 94  LYS B CA  1 
ATOM   2900 C C   . LYS B 2 94  ? -21.413 6.722   -0.900 1.00 38.51  ? 94  LYS B C   1 
ATOM   2901 O O   . LYS B 2 94  ? -22.328 5.906   -1.117 1.00 38.90  ? 94  LYS B O   1 
ATOM   2902 C CB  . LYS B 2 94  ? -21.583 8.821   0.379  1.00 39.08  ? 94  LYS B CB  1 
ATOM   2903 C CG  . LYS B 2 94  ? -20.934 9.760   1.378  1.00 41.48  ? 94  LYS B CG  1 
ATOM   2904 C CD  . LYS B 2 94  ? -21.357 11.190  1.118  1.00 46.75  ? 94  LYS B CD  1 
ATOM   2905 C CE  . LYS B 2 94  ? -20.933 11.640  -0.264 1.00 52.21  ? 94  LYS B CE  1 
ATOM   2906 N NZ  . LYS B 2 94  ? -19.462 11.886  -0.322 1.00 52.71  ? 94  LYS B NZ  1 
ATOM   2907 N N   . GLU B 2 95  ? -20.508 7.140   -1.811 1.00 38.87  ? 95  GLU B N   1 
ATOM   2908 C CA  . GLU B 2 95  ? -20.532 6.866   -3.259 1.00 39.94  ? 95  GLU B CA  1 
ATOM   2909 C C   . GLU B 2 95  ? -20.656 5.407   -3.521 1.00 38.83  ? 95  GLU B C   1 
ATOM   2910 O O   . GLU B 2 95  ? -21.527 4.971   -4.285 1.00 40.28  ? 95  GLU B O   1 
ATOM   2911 C CB  . GLU B 2 95  ? -19.241 7.331   -3.936 1.00 41.59  ? 95  GLU B CB  1 
ATOM   2912 C CG  . GLU B 2 95  ? -19.011 8.829   -4.092 1.00 45.25  ? 95  GLU B CG  1 
ATOM   2913 C CD  . GLU B 2 95  ? -18.692 9.562   -2.772 1.00 49.05  ? 95  GLU B CD  1 
ATOM   2914 O OE1 . GLU B 2 95  ? -18.289 8.917   -1.725 1.00 45.77  ? 95  GLU B OE1 1 
ATOM   2915 O OE2 . GLU B 2 95  ? -18.886 10.806  -2.806 1.00 51.43  ? 95  GLU B OE2 1 
ATOM   2916 N N   . LYS B 2 96  ? -19.769 4.660   -2.885 1.00 36.44  ? 96  LYS B N   1 
ATOM   2917 C CA  . LYS B 2 96  ? -19.813 3.220   -2.933 1.00 37.77  ? 96  LYS B CA  1 
ATOM   2918 C C   . LYS B 2 96  ? -21.167 2.702   -2.487 1.00 37.81  ? 96  LYS B C   1 
ATOM   2919 O O   . LYS B 2 96  ? -21.731 1.821   -3.114 1.00 39.29  ? 96  LYS B O   1 
ATOM   2920 C CB  . LYS B 2 96  ? -18.726 2.604   -2.069 1.00 35.69  ? 96  LYS B CB  1 
ATOM   2921 C CG  . LYS B 2 96  ? -18.936 1.093   -1.886 1.00 40.14  ? 96  LYS B CG  1 
ATOM   2922 C CD  . LYS B 2 96  ? -18.908 0.286   -3.199 1.00 48.43  ? 96  LYS B CD  1 
ATOM   2923 C CE  . LYS B 2 96  ? -18.247 -1.111  -3.028 1.00 53.54  ? 96  LYS B CE  1 
ATOM   2924 N NZ  . LYS B 2 96  ? -17.092 -1.110  -1.997 1.00 52.15  ? 96  LYS B NZ  1 
ATOM   2925 N N   . LEU B 2 97  ? -21.695 3.275   -1.422 1.00 36.55  ? 97  LEU B N   1 
ATOM   2926 C CA  . LEU B 2 97  ? -22.996 2.849   -0.935 1.00 39.23  ? 97  LEU B CA  1 
ATOM   2927 C C   . LEU B 2 97  ? -24.170 3.062   -1.924 1.00 42.45  ? 97  LEU B C   1 
ATOM   2928 O O   . LEU B 2 97  ? -24.958 2.124   -2.146 1.00 45.34  ? 97  LEU B O   1 
ATOM   2929 C CB  . LEU B 2 97  ? -23.305 3.514   0.422  1.00 38.07  ? 97  LEU B CB  1 
ATOM   2930 C CG  . LEU B 2 97  ? -24.692 3.296   1.011  1.00 38.92  ? 97  LEU B CG  1 
ATOM   2931 C CD1 . LEU B 2 97  ? -25.019 1.826   1.344  1.00 39.02  ? 97  LEU B CD1 1 
ATOM   2932 C CD2 . LEU B 2 97  ? -24.710 4.150   2.235  1.00 38.98  ? 97  LEU B CD2 1 
ATOM   2933 N N   . GLU B 2 98  ? -24.311 4.279   -2.477 1.00 42.57  ? 98  GLU B N   1 
ATOM   2934 C CA  . GLU B 2 98  ? -25.309 4.533   -3.511 1.00 44.64  ? 98  GLU B CA  1 
ATOM   2935 C C   . GLU B 2 98  ? -24.968 3.657   -4.672 1.00 47.10  ? 98  GLU B C   1 
ATOM   2936 O O   . GLU B 2 98  ? -25.761 2.842   -5.088 1.00 49.58  ? 98  GLU B O   1 
ATOM   2937 C CB  . GLU B 2 98  ? -25.332 5.990   -3.929 1.00 44.37  ? 98  GLU B CB  1 
ATOM   2938 C CG  . GLU B 2 98  ? -26.527 6.338   -4.764 1.00 46.53  ? 98  GLU B CG  1 
ATOM   2939 C CD  . GLU B 2 98  ? -26.657 7.837   -5.076 1.00 48.74  ? 98  GLU B CD  1 
ATOM   2940 O OE1 . GLU B 2 98  ? -25.683 8.617   -4.814 1.00 45.01  ? 98  GLU B OE1 1 
ATOM   2941 O OE2 . GLU B 2 98  ? -27.754 8.214   -5.604 1.00 49.53  ? 98  GLU B OE2 1 
ATOM   2942 N N   . ALA B 2 99  ? -23.749 3.775   -5.166 1.00 47.96  ? 99  ALA B N   1 
ATOM   2943 C CA  . ALA B 2 99  ? -23.321 2.879   -6.244 1.00 51.08  ? 99  ALA B CA  1 
ATOM   2944 C C   . ALA B 2 99  ? -23.751 1.438   -5.989 1.00 51.97  ? 99  ALA B C   1 
ATOM   2945 O O   . ALA B 2 99  ? -24.317 0.831   -6.878 1.00 56.08  ? 99  ALA B O   1 
ATOM   2946 C CB  . ALA B 2 99  ? -21.816 2.965   -6.502 1.00 49.71  ? 99  ALA B CB  1 
ATOM   2947 N N   . THR B 2 100 ? -23.531 0.897   -4.792 1.00 49.39  ? 100 THR B N   1 
ATOM   2948 C CA  . THR B 2 100 ? -23.860 -0.512  -4.588 1.00 50.99  ? 100 THR B CA  1 
ATOM   2949 C C   . THR B 2 100 ? -25.366 -0.651  -4.585 1.00 54.28  ? 100 THR B C   1 
ATOM   2950 O O   . THR B 2 100 ? -25.897 -1.631  -5.112 1.00 57.42  ? 100 THR B O   1 
ATOM   2951 C CB  . THR B 2 100 ? -23.239 -1.145  -3.276 1.00 48.35  ? 100 THR B CB  1 
ATOM   2952 O OG1 . THR B 2 100 ? -21.803 -1.125  -3.314 1.00 45.51  ? 100 THR B OG1 1 
ATOM   2953 C CG2 . THR B 2 100 ? -23.680 -2.564  -3.088 1.00 48.91  ? 100 THR B CG2 1 
ATOM   2954 N N   . ILE B 2 101 ? -26.053 0.345   -4.011 1.00 54.59  ? 101 ILE B N   1 
ATOM   2955 C CA  . ILE B 2 101 ? -27.507 0.284   -3.859 1.00 58.15  ? 101 ILE B CA  1 
ATOM   2956 C C   . ILE B 2 101 ? -28.133 0.171   -5.207 1.00 63.16  ? 101 ILE B C   1 
ATOM   2957 O O   . ILE B 2 101 ? -28.837 -0.805  -5.488 1.00 66.41  ? 101 ILE B O   1 
ATOM   2958 C CB  . ILE B 2 101 ? -28.079 1.537   -3.221 1.00 56.97  ? 101 ILE B CB  1 
ATOM   2959 C CG1 . ILE B 2 101 ? -27.997 1.408   -1.702 1.00 55.52  ? 101 ILE B CG1 1 
ATOM   2960 C CG2 . ILE B 2 101 ? -29.560 1.799   -3.739 1.00 59.44  ? 101 ILE B CG2 1 
ATOM   2961 C CD1 . ILE B 2 101 ? -28.500 2.625   -0.956 1.00 54.85  ? 101 ILE B CD1 1 
ATOM   2962 N N   . ASN B 2 102 ? -27.874 1.189   -6.029 1.00 64.76  ? 102 ASN B N   1 
ATOM   2963 C CA  . ASN B 2 102 ? -28.311 1.192   -7.389 1.00 69.99  ? 102 ASN B CA  1 
ATOM   2964 C C   . ASN B 2 102 ? -27.903 -0.163  -7.910 1.00 73.11  ? 102 ASN B C   1 
ATOM   2965 O O   . ASN B 2 102 ? -28.760 -1.019  -8.120 1.00 76.49  ? 102 ASN B O   1 
ATOM   2966 C CB  . ASN B 2 102 ? -27.591 2.284   -8.184 1.00 70.18  ? 102 ASN B CB  1 
ATOM   2967 C CG  . ASN B 2 102 ? -28.010 3.670   -7.778 1.00 68.39  ? 102 ASN B CG  1 
ATOM   2968 O OD1 . ASN B 2 102 ? -29.187 3.970   -7.703 1.00 70.16  ? 102 ASN B OD1 1 
ATOM   2969 N ND2 . ASN B 2 102 ? -27.042 4.527   -7.530 1.00 67.44  ? 102 ASN B ND2 1 
ATOM   2970 N N   . GLU B 2 103 ? -26.591 -0.380  -8.035 1.00 72.82  ? 103 GLU B N   1 
ATOM   2971 C CA  . GLU B 2 103 ? -26.053 -1.579  -8.686 1.00 76.76  ? 103 GLU B CA  1 
ATOM   2972 C C   . GLU B 2 103 ? -26.582 -2.913  -8.106 1.00 78.72  ? 103 GLU B C   1 
ATOM   2973 O O   . GLU B 2 103 ? -26.040 -3.974  -8.406 1.00 81.07  ? 103 GLU B O   1 
ATOM   2974 C CB  . GLU B 2 103 ? -24.510 -1.558  -8.707 1.00 75.23  ? 103 GLU B CB  1 
ATOM   2975 C CG  . GLU B 2 103 ? -23.865 -2.555  -9.683 1.00 79.56  ? 103 GLU B CG  1 
ATOM   2976 C CD  . GLU B 2 103 ? -22.897 -3.560  -9.008 1.00 80.03  ? 103 GLU B CD  1 
ATOM   2977 O OE1 . GLU B 2 103 ? -22.548 -4.585  -9.681 1.00 85.14  ? 103 GLU B OE1 1 
ATOM   2978 O OE2 . GLU B 2 103 ? -22.495 -3.341  -7.832 1.00 71.08  ? 103 GLU B OE2 1 
ATOM   2979 N N   . LEU B 2 104 ? -27.629 -2.871  -7.288 1.00 78.63  ? 104 LEU B N   1 
ATOM   2980 C CA  . LEU B 2 104 ? -28.179 -4.099  -6.744 1.00 81.30  ? 104 LEU B CA  1 
ATOM   2981 C C   . LEU B 2 104 ? -29.687 -4.137  -6.627 1.00 84.50  ? 104 LEU B C   1 
ATOM   2982 O O   . LEU B 2 104 ? -30.239 -5.227  -6.470 1.00 87.68  ? 104 LEU B O   1 
ATOM   2983 C CB  . LEU B 2 104 ? -27.584 -4.383  -5.378 1.00 78.01  ? 104 LEU B CB  1 
ATOM   2984 C CG  . LEU B 2 104 ? -26.374 -5.298  -5.240 1.00 78.27  ? 104 LEU B CG  1 
ATOM   2985 C CD1 . LEU B 2 104 ? -26.346 -5.656  -3.758 1.00 77.26  ? 104 LEU B CD1 1 
ATOM   2986 C CD2 . LEU B 2 104 ? -26.419 -6.558  -6.125 1.00 80.22  ? 104 LEU B CD2 1 
ATOM   2987 N N   . VAL B 2 105 ? -30.336 -2.961  -6.667 1.00 84.56  ? 105 VAL B N   1 
ATOM   2988 C CA  . VAL B 2 105 ? -31.801 -2.833  -6.545 1.00 88.13  ? 105 VAL B CA  1 
ATOM   2989 C C   . VAL B 2 105 ? -32.476 -4.043  -7.192 1.00 94.00  ? 105 VAL B C   1 
ATOM   2990 O O   . VAL B 2 105 ? -33.424 -4.644  -6.652 1.00 97.07  ? 105 VAL B O   1 
ATOM   2991 C CB  . VAL B 2 105 ? -32.353 -1.557  -7.236 1.00 88.37  ? 105 VAL B CB  1 
ATOM   2992 C CG1 . VAL B 2 105 ? -33.831 -1.423  -6.979 1.00 91.44  ? 105 VAL B CG1 1 
ATOM   2993 C CG2 . VAL B 2 105 ? -31.660 -0.326  -6.736 1.00 84.68  ? 105 VAL B CG2 1 
ATOM   2994 O OXT . VAL B 2 105 ? -32.060 -4.448  -8.289 1.00 96.62  ? 105 VAL B OXT 1 
ATOM   2995 N N   . LYS C 1 6   ? 25.142  3.286   6.181  1.00 77.11  ? 8   LYS C N   1 
ATOM   2996 C CA  . LYS C 1 6   ? 25.219  4.732   5.770  1.00 78.26  ? 8   LYS C CA  1 
ATOM   2997 C C   . LYS C 1 6   ? 25.748  5.761   6.839  1.00 77.10  ? 8   LYS C C   1 
ATOM   2998 O O   . LYS C 1 6   ? 26.891  6.192   6.729  1.00 77.97  ? 8   LYS C O   1 
ATOM   2999 C CB  . LYS C 1 6   ? 23.895  5.178   5.169  1.00 79.18  ? 8   LYS C CB  1 
ATOM   3000 C CG  . LYS C 1 6   ? 23.985  6.495   4.380  1.00 81.97  ? 8   LYS C CG  1 
ATOM   3001 C CD  . LYS C 1 6   ? 23.576  7.741   5.210  1.00 81.59  ? 8   LYS C CD  1 
ATOM   3002 C CE  . LYS C 1 6   ? 23.269  8.914   4.268  1.00 84.78  ? 8   LYS C CE  1 
ATOM   3003 N NZ  . LYS C 1 6   ? 22.638  10.100  4.933  1.00 84.23  ? 8   LYS C NZ  1 
ATOM   3004 N N   . SER C 1 7   ? 24.932  6.203   7.810  1.00 75.31  ? 9   SER C N   1 
ATOM   3005 C CA  . SER C 1 7   ? 25.466  6.883   9.015  1.00 73.25  ? 9   SER C CA  1 
ATOM   3006 C C   . SER C 1 7   ? 25.214  5.914   10.148 1.00 71.80  ? 9   SER C C   1 
ATOM   3007 O O   . SER C 1 7   ? 24.187  5.217   10.149 1.00 72.78  ? 9   SER C O   1 
ATOM   3008 C CB  . SER C 1 7   ? 24.759  8.203   9.379  1.00 73.04  ? 9   SER C CB  1 
ATOM   3009 O OG  . SER C 1 7   ? 24.001  8.731   8.313  1.00 74.91  ? 9   SER C OG  1 
ATOM   3010 N N   . PHE C 1 8   ? 26.135  5.894   11.108 1.00 69.36  ? 10  PHE C N   1 
ATOM   3011 C CA  . PHE C 1 8   ? 26.089  5.036   12.272 1.00 67.06  ? 10  PHE C CA  1 
ATOM   3012 C C   . PHE C 1 8   ? 27.042  5.656   13.294 1.00 66.23  ? 10  PHE C C   1 
ATOM   3013 O O   . PHE C 1 8   ? 28.260  5.370   13.314 1.00 66.42  ? 10  PHE C O   1 
ATOM   3014 C CB  . PHE C 1 8   ? 26.543  3.631   11.906 1.00 66.74  ? 10  PHE C CB  1 
ATOM   3015 C CG  . PHE C 1 8   ? 26.554  2.666   13.068 1.00 64.81  ? 10  PHE C CG  1 
ATOM   3016 C CD1 . PHE C 1 8   ? 25.445  2.544   13.911 1.00 64.49  ? 10  PHE C CD1 1 
ATOM   3017 C CD2 . PHE C 1 8   ? 27.663  1.855   13.298 1.00 62.02  ? 10  PHE C CD2 1 
ATOM   3018 C CE1 . PHE C 1 8   ? 25.462  1.633   14.980 1.00 62.84  ? 10  PHE C CE1 1 
ATOM   3019 C CE2 . PHE C 1 8   ? 27.692  0.936   14.341 1.00 59.60  ? 10  PHE C CE2 1 
ATOM   3020 C CZ  . PHE C 1 8   ? 26.598  0.829   15.190 1.00 61.79  ? 10  PHE C CZ  1 
ATOM   3021 N N   . GLU C 1 9   ? 26.496  6.498   14.158 1.00 64.74  ? 11  GLU C N   1 
ATOM   3022 C CA  . GLU C 1 9   ? 27.350  7.428   14.851 1.00 63.24  ? 11  GLU C CA  1 
ATOM   3023 C C   . GLU C 1 9   ? 26.980  7.497   16.359 1.00 60.67  ? 11  GLU C C   1 
ATOM   3024 O O   . GLU C 1 9   ? 25.793  7.508   16.722 1.00 60.75  ? 11  GLU C O   1 
ATOM   3025 C CB  . GLU C 1 9   ? 27.209  8.763   14.129 1.00 64.65  ? 11  GLU C CB  1 
ATOM   3026 C CG  . GLU C 1 9   ? 28.504  9.342   13.580 1.00 69.60  ? 11  GLU C CG  1 
ATOM   3027 C CD  . GLU C 1 9   ? 29.038  10.535  14.429 1.00 72.78  ? 11  GLU C CD  1 
ATOM   3028 O OE1 . GLU C 1 9   ? 28.267  11.525  14.666 1.00 69.22  ? 11  GLU C OE1 1 
ATOM   3029 O OE2 . GLU C 1 9   ? 30.236  10.460  14.841 1.00 72.14  ? 11  GLU C OE2 1 
ATOM   3030 N N   . VAL C 1 10  ? 28.004  7.462   17.226 1.00 57.28  ? 12  VAL C N   1 
ATOM   3031 C CA  . VAL C 1 10  ? 27.817  7.605   18.663 1.00 52.88  ? 12  VAL C CA  1 
ATOM   3032 C C   . VAL C 1 10  ? 27.879  9.087   18.968 1.00 51.94  ? 12  VAL C C   1 
ATOM   3033 O O   . VAL C 1 10  ? 28.867  9.742   18.692 1.00 51.89  ? 12  VAL C O   1 
ATOM   3034 C CB  . VAL C 1 10  ? 28.909  6.899   19.443 1.00 51.46  ? 12  VAL C CB  1 
ATOM   3035 C CG1 . VAL C 1 10  ? 28.812  7.272   20.903 1.00 51.64  ? 12  VAL C CG1 1 
ATOM   3036 C CG2 . VAL C 1 10  ? 28.775  5.438   19.315 1.00 48.70  ? 12  VAL C CG2 1 
ATOM   3037 N N   . VAL C 1 11  ? 26.816  9.617   19.539 1.00 50.14  ? 13  VAL C N   1 
ATOM   3038 C CA  . VAL C 1 11  ? 26.682  11.036  19.710 1.00 48.35  ? 13  VAL C CA  1 
ATOM   3039 C C   . VAL C 1 11  ? 26.350  11.311  21.154 1.00 46.62  ? 13  VAL C C   1 
ATOM   3040 O O   . VAL C 1 11  ? 25.299  10.942  21.642 1.00 45.74  ? 13  VAL C O   1 
ATOM   3041 C CB  . VAL C 1 11  ? 25.560  11.527  18.799 1.00 49.73  ? 13  VAL C CB  1 
ATOM   3042 C CG1 . VAL C 1 11  ? 25.348  13.021  18.911 1.00 49.12  ? 13  VAL C CG1 1 
ATOM   3043 C CG2 . VAL C 1 11  ? 25.932  11.168  17.395 1.00 52.15  ? 13  VAL C CG2 1 
ATOM   3044 N N   . PHE C 1 12  ? 27.256  11.994  21.824 1.00 45.65  ? 14  PHE C N   1 
ATOM   3045 C CA  . PHE C 1 12  ? 27.057  12.415  23.207 1.00 45.19  ? 14  PHE C CA  1 
ATOM   3046 C C   . PHE C 1 12  ? 26.252  13.686  23.316 1.00 46.77  ? 14  PHE C C   1 
ATOM   3047 O O   . PHE C 1 12  ? 26.345  14.567  22.452 1.00 47.70  ? 14  PHE C O   1 
ATOM   3048 C CB  . PHE C 1 12  ? 28.417  12.650  23.879 1.00 43.76  ? 14  PHE C CB  1 
ATOM   3049 C CG  . PHE C 1 12  ? 29.274  11.449  23.887 1.00 39.74  ? 14  PHE C CG  1 
ATOM   3050 C CD1 . PHE C 1 12  ? 29.112  10.471  24.904 1.00 36.43  ? 14  PHE C CD1 1 
ATOM   3051 C CD2 . PHE C 1 12  ? 30.179  11.238  22.863 1.00 37.36  ? 14  PHE C CD2 1 
ATOM   3052 C CE1 . PHE C 1 12  ? 29.884  9.321   24.943 1.00 35.21  ? 14  PHE C CE1 1 
ATOM   3053 C CE2 . PHE C 1 12  ? 30.982  10.053  22.864 1.00 40.79  ? 14  PHE C CE2 1 
ATOM   3054 C CZ  . PHE C 1 12  ? 30.847  9.081   23.937 1.00 35.29  ? 14  PHE C CZ  1 
ATOM   3055 N N   . ASN C 1 13  ? 25.494  13.791  24.404 1.00 47.19  ? 15  ASN C N   1 
ATOM   3056 C CA  . ASN C 1 13  ? 24.764  15.000  24.694 1.00 48.62  ? 15  ASN C CA  1 
ATOM   3057 C C   . ASN C 1 13  ? 25.590  16.206  24.966 1.00 50.45  ? 15  ASN C C   1 
ATOM   3058 O O   . ASN C 1 13  ? 25.199  17.256  24.569 1.00 53.44  ? 15  ASN C O   1 
ATOM   3059 C CB  . ASN C 1 13  ? 23.856  14.745  25.825 1.00 48.32  ? 15  ASN C CB  1 
ATOM   3060 C CG  . ASN C 1 13  ? 22.810  13.735  25.466 1.00 49.75  ? 15  ASN C CG  1 
ATOM   3061 O OD1 . ASN C 1 13  ? 22.114  13.235  26.324 1.00 49.73  ? 15  ASN C OD1 1 
ATOM   3062 N ND2 . ASN C 1 13  ? 22.689  13.416  24.166 1.00 55.27  ? 15  ASN C ND2 1 
ATOM   3063 N N   . ASP C 1 14  ? 26.732  16.062  25.634 1.00 50.78  ? 16  ASP C N   1 
ATOM   3064 C CA  . ASP C 1 14  ? 27.702  17.136  25.847 1.00 52.06  ? 16  ASP C CA  1 
ATOM   3065 C C   . ASP C 1 14  ? 28.983  16.773  25.127 1.00 50.90  ? 16  ASP C C   1 
ATOM   3066 O O   . ASP C 1 14  ? 29.883  16.114  25.654 1.00 49.67  ? 16  ASP C O   1 
ATOM   3067 C CB  . ASP C 1 14  ? 27.951  17.311  27.334 1.00 53.51  ? 16  ASP C CB  1 
ATOM   3068 C CG  . ASP C 1 14  ? 26.648  17.307  28.140 1.00 58.99  ? 16  ASP C CG  1 
ATOM   3069 O OD1 . ASP C 1 14  ? 26.514  16.520  29.131 1.00 62.99  ? 16  ASP C OD1 1 
ATOM   3070 O OD2 . ASP C 1 14  ? 25.737  18.088  27.756 1.00 66.90  ? 16  ASP C OD2 1 
ATOM   3071 N N   . PRO C 1 15  ? 29.042  17.092  23.856 1.00 51.75  ? 17  PRO C N   1 
ATOM   3072 C CA  . PRO C 1 15  ? 30.243  16.633  23.157 1.00 51.03  ? 17  PRO C CA  1 
ATOM   3073 C C   . PRO C 1 15  ? 31.556  17.121  23.754 1.00 51.38  ? 17  PRO C C   1 
ATOM   3074 O O   . PRO C 1 15  ? 32.602  16.511  23.508 1.00 50.21  ? 17  PRO C O   1 
ATOM   3075 C CB  . PRO C 1 15  ? 30.043  17.203  21.762 1.00 52.31  ? 17  PRO C CB  1 
ATOM   3076 C CG  . PRO C 1 15  ? 28.527  17.235  21.638 1.00 51.89  ? 17  PRO C CG  1 
ATOM   3077 C CD  . PRO C 1 15  ? 28.065  17.718  22.952 1.00 52.88  ? 17  PRO C CD  1 
ATOM   3078 N N   . GLU C 1 16  ? 31.534  18.219  24.514 1.00 52.52  ? 18  GLU C N   1 
ATOM   3079 C CA  . GLU C 1 16  ? 32.806  18.716  25.063 1.00 52.97  ? 18  GLU C CA  1 
ATOM   3080 C C   . GLU C 1 16  ? 33.091  18.519  26.567 1.00 52.12  ? 18  GLU C C   1 
ATOM   3081 O O   . GLU C 1 16  ? 34.069  19.079  27.103 1.00 53.62  ? 18  GLU C O   1 
ATOM   3082 C CB  . GLU C 1 16  ? 33.087  20.155  24.623 1.00 54.82  ? 18  GLU C CB  1 
ATOM   3083 C CG  . GLU C 1 16  ? 33.776  20.214  23.295 1.00 56.07  ? 18  GLU C CG  1 
ATOM   3084 C CD  . GLU C 1 16  ? 32.896  19.661  22.182 1.00 60.07  ? 18  GLU C CD  1 
ATOM   3085 O OE1 . GLU C 1 16  ? 31.876  20.318  21.898 1.00 62.25  ? 18  GLU C OE1 1 
ATOM   3086 O OE2 . GLU C 1 16  ? 33.193  18.569  21.610 1.00 60.02  ? 18  GLU C OE2 1 
ATOM   3087 N N   . LYS C 1 17  ? 32.283  17.723  27.248 1.00 50.41  ? 19  LYS C N   1 
ATOM   3088 C CA  . LYS C 1 17  ? 32.416  17.668  28.665 1.00 50.07  ? 19  LYS C CA  1 
ATOM   3089 C C   . LYS C 1 17  ? 33.596  16.801  29.056 1.00 48.68  ? 19  LYS C C   1 
ATOM   3090 O O   . LYS C 1 17  ? 33.912  15.813  28.361 1.00 48.73  ? 19  LYS C O   1 
ATOM   3091 C CB  . LYS C 1 17  ? 31.131  17.169  29.286 1.00 50.63  ? 19  LYS C CB  1 
ATOM   3092 C CG  . LYS C 1 17  ? 31.138  17.280  30.800 1.00 52.06  ? 19  LYS C CG  1 
ATOM   3093 C CD  . LYS C 1 17  ? 29.992  16.534  31.432 1.00 52.84  ? 19  LYS C CD  1 
ATOM   3094 C CE  . LYS C 1 17  ? 30.110  16.704  32.920 1.00 55.68  ? 19  LYS C CE  1 
ATOM   3095 N NZ  . LYS C 1 17  ? 29.002  15.960  33.506 1.00 57.42  ? 19  LYS C NZ  1 
ATOM   3096 N N   . VAL C 1 18  ? 34.288  17.186  30.124 1.00 47.30  ? 20  VAL C N   1 
ATOM   3097 C CA  . VAL C 1 18  ? 35.197  16.241  30.769 1.00 44.60  ? 20  VAL C CA  1 
ATOM   3098 C C   . VAL C 1 18  ? 34.452  15.653  31.979 1.00 44.36  ? 20  VAL C C   1 
ATOM   3099 O O   . VAL C 1 18  ? 34.139  16.366  32.923 1.00 45.92  ? 20  VAL C O   1 
ATOM   3100 C CB  . VAL C 1 18  ? 36.482  16.880  31.295 1.00 43.98  ? 20  VAL C CB  1 
ATOM   3101 C CG1 . VAL C 1 18  ? 37.449  15.757  31.716 1.00 39.53  ? 20  VAL C CG1 1 
ATOM   3102 C CG2 . VAL C 1 18  ? 37.083  17.810  30.268 1.00 43.63  ? 20  VAL C CG2 1 
ATOM   3103 N N   . TYR C 1 19  ? 34.174  14.358  31.963 1.00 42.40  ? 21  TYR C N   1 
ATOM   3104 C CA  . TYR C 1 19  ? 33.354  13.771  32.992 1.00 40.69  ? 21  TYR C CA  1 
ATOM   3105 C C   . TYR C 1 19  ? 34.196  13.487  34.231 1.00 39.99  ? 21  TYR C C   1 
ATOM   3106 O O   . TYR C 1 19  ? 35.384  13.129  34.142 1.00 38.99  ? 21  TYR C O   1 
ATOM   3107 C CB  . TYR C 1 19  ? 32.604  12.537  32.463 1.00 39.78  ? 21  TYR C CB  1 
ATOM   3108 C CG  . TYR C 1 19  ? 31.676  12.807  31.288 1.00 39.89  ? 21  TYR C CG  1 
ATOM   3109 C CD1 . TYR C 1 19  ? 30.300  13.042  31.473 1.00 40.01  ? 21  TYR C CD1 1 
ATOM   3110 C CD2 . TYR C 1 19  ? 32.176  12.859  29.989 1.00 39.89  ? 21  TYR C CD2 1 
ATOM   3111 C CE1 . TYR C 1 19  ? 29.463  13.303  30.406 1.00 41.21  ? 21  TYR C CE1 1 
ATOM   3112 C CE2 . TYR C 1 19  ? 31.338  13.132  28.891 1.00 42.57  ? 21  TYR C CE2 1 
ATOM   3113 C CZ  . TYR C 1 19  ? 29.993  13.340  29.105 1.00 45.83  ? 21  TYR C CZ  1 
ATOM   3114 O OH  . TYR C 1 19  ? 29.204  13.580  27.988 1.00 52.19  ? 21  TYR C OH  1 
ATOM   3115 N N   . GLY C 1 20  ? 33.581  13.689  35.391 1.00 40.22  ? 22  GLY C N   1 
ATOM   3116 C CA  . GLY C 1 20  ? 34.258  13.512  36.637 1.00 40.53  ? 22  GLY C CA  1 
ATOM   3117 C C   . GLY C 1 20  ? 33.813  12.230  37.291 1.00 41.16  ? 22  GLY C C   1 
ATOM   3118 O O   . GLY C 1 20  ? 32.796  11.623  36.918 1.00 41.00  ? 22  GLY C O   1 
ATOM   3119 N N   . SER C 1 21  ? 34.571  11.793  38.279 1.00 41.63  ? 23  SER C N   1 
ATOM   3120 C CA  . SER C 1 21  ? 34.136  10.626  38.994 1.00 43.71  ? 23  SER C CA  1 
ATOM   3121 C C   . SER C 1 21  ? 32.664  10.768  39.386 1.00 45.51  ? 23  SER C C   1 
ATOM   3122 O O   . SER C 1 21  ? 32.204  11.869  39.663 1.00 47.33  ? 23  SER C O   1 
ATOM   3123 C CB  . SER C 1 21  ? 35.018  10.397  40.202 1.00 43.30  ? 23  SER C CB  1 
ATOM   3124 O OG  . SER C 1 21  ? 34.642  9.154   40.751 1.00 47.26  ? 23  SER C OG  1 
ATOM   3125 N N   . GLY C 1 22  ? 31.919  9.669   39.347 1.00 46.66  ? 24  GLY C N   1 
ATOM   3126 C CA  . GLY C 1 22  ? 30.492  9.670   39.690 1.00 48.64  ? 24  GLY C CA  1 
ATOM   3127 C C   . GLY C 1 22  ? 29.434  10.124  38.694 1.00 50.65  ? 24  GLY C C   1 
ATOM   3128 O O   . GLY C 1 22  ? 28.351  9.556   38.679 1.00 52.58  ? 24  GLY C O   1 
ATOM   3129 N N   . GLU C 1 23  ? 29.745  11.125  37.889 1.00 51.17  ? 25  GLU C N   1 
ATOM   3130 C CA  . GLU C 1 23  ? 28.811  11.673  36.938 1.00 51.73  ? 25  GLU C CA  1 
ATOM   3131 C C   . GLU C 1 23  ? 28.293  10.571  36.089 1.00 51.89  ? 25  GLU C C   1 
ATOM   3132 O O   . GLU C 1 23  ? 28.625  9.437   36.283 1.00 50.99  ? 25  GLU C O   1 
ATOM   3133 C CB  . GLU C 1 23  ? 29.449  12.729  36.049 1.00 51.02  ? 25  GLU C CB  1 
ATOM   3134 C CG  . GLU C 1 23  ? 30.546  13.524  36.663 1.00 52.30  ? 25  GLU C CG  1 
ATOM   3135 C CD  . GLU C 1 23  ? 30.559  14.953  36.215 1.00 58.19  ? 25  GLU C CD  1 
ATOM   3136 O OE1 . GLU C 1 23  ? 31.570  15.427  35.705 1.00 59.56  ? 25  GLU C OE1 1 
ATOM   3137 O OE2 . GLU C 1 23  ? 29.555  15.631  36.388 1.00 63.21  ? 25  GLU C OE2 1 
ATOM   3138 N N   . LYS C 1 24  ? 27.465  10.929  35.135 1.00 53.63  ? 26  LYS C N   1 
ATOM   3139 C CA  . LYS C 1 24  ? 26.789  9.971   34.305 1.00 54.58  ? 26  LYS C CA  1 
ATOM   3140 C C   . LYS C 1 24  ? 26.963  10.358  32.883 1.00 52.93  ? 26  LYS C C   1 
ATOM   3141 O O   . LYS C 1 24  ? 26.911  11.513  32.562 1.00 53.77  ? 26  LYS C O   1 
ATOM   3142 C CB  . LYS C 1 24  ? 25.320  9.975   34.649 1.00 20.06  ? 26  LYS C CB  1 
ATOM   3143 C CG  . LYS C 1 24  ? 24.412  9.956   33.479 1.00 20.42  ? 26  LYS C CG  1 
ATOM   3144 C CD  . LYS C 1 24  ? 23.019  9.641   33.933 1.00 21.25  ? 26  LYS C CD  1 
ATOM   3145 C CE  . LYS C 1 24  ? 22.344  8.642   33.040 1.00 21.34  ? 26  LYS C CE  1 
ATOM   3146 N NZ  . LYS C 1 24  ? 22.163  7.324   33.697 1.00 21.36  ? 26  LYS C NZ  1 
ATOM   3147 N N   . VAL C 1 25  ? 27.185  9.382   32.030 1.00 50.46  ? 27  VAL C N   1 
ATOM   3148 C CA  . VAL C 1 25  ? 27.550  9.686   30.628 1.00 48.94  ? 27  VAL C CA  1 
ATOM   3149 C C   . VAL C 1 25  ? 26.415  9.271   29.762 1.00 49.58  ? 27  VAL C C   1 
ATOM   3150 O O   . VAL C 1 25  ? 25.956  8.123   29.888 1.00 49.77  ? 27  VAL C O   1 
ATOM   3151 C CB  . VAL C 1 25  ? 28.838  9.017   30.131 1.00 46.79  ? 27  VAL C CB  1 
ATOM   3152 C CG1 . VAL C 1 25  ? 28.929  9.042   28.586 1.00 45.00  ? 27  VAL C CG1 1 
ATOM   3153 C CG2 . VAL C 1 25  ? 30.003  9.696   30.731 1.00 45.92  ? 27  VAL C CG2 1 
ATOM   3154 N N   . ALA C 1 26  ? 25.964  10.196  28.902 1.00 49.76  ? 28  ALA C N   1 
ATOM   3155 C CA  . ALA C 1 26  ? 24.737  9.991   28.105 1.00 49.96  ? 28  ALA C CA  1 
ATOM   3156 C C   . ALA C 1 26  ? 24.774  10.565  26.708 1.00 49.56  ? 28  ALA C C   1 
ATOM   3157 O O   . ALA C 1 26  ? 25.387  11.636  26.447 1.00 49.90  ? 28  ALA C O   1 
ATOM   3158 C CB  . ALA C 1 26  ? 23.482  10.517  28.865 1.00 50.70  ? 28  ALA C CB  1 
ATOM   3159 N N   . GLY C 1 27  ? 24.078  9.850   25.829 1.00 48.54  ? 29  GLY C N   1 
ATOM   3160 C CA  . GLY C 1 27  ? 24.011  10.200  24.448 1.00 48.47  ? 29  GLY C CA  1 
ATOM   3161 C C   . GLY C 1 27  ? 22.993  9.374   23.708 1.00 49.21  ? 29  GLY C C   1 
ATOM   3162 O O   . GLY C 1 27  ? 22.013  8.913   24.282 1.00 50.43  ? 29  GLY C O   1 
ATOM   3163 N N   . ARG C 1 28  ? 23.241  9.212   22.418 1.00 49.22  ? 30  ARG C N   1 
ATOM   3164 C CA  . ARG C 1 28  ? 22.377  8.531   21.507 1.00 50.62  ? 30  ARG C CA  1 
ATOM   3165 C C   . ARG C 1 28  ? 23.271  7.785   20.504 1.00 51.02  ? 30  ARG C C   1 
ATOM   3166 O O   . ARG C 1 28  ? 24.392  8.206   20.209 1.00 51.26  ? 30  ARG C O   1 
ATOM   3167 C CB  . ARG C 1 28  ? 21.515  9.573   20.780 1.00 52.44  ? 30  ARG C CB  1 
ATOM   3168 C CG  . ARG C 1 28  ? 20.186  10.023  21.463 1.00 54.52  ? 30  ARG C CG  1 
ATOM   3169 C CD  . ARG C 1 28  ? 19.953  11.554  21.411 1.00 57.32  ? 30  ARG C CD  1 
ATOM   3170 N NE  . ARG C 1 28  ? 20.489  12.149  20.190 1.00 61.15  ? 30  ARG C NE  1 
ATOM   3171 C CZ  . ARG C 1 28  ? 21.075  13.343  20.103 1.00 64.90  ? 30  ARG C CZ  1 
ATOM   3172 N NH1 . ARG C 1 28  ? 21.201  14.120  21.184 1.00 68.51  ? 30  ARG C NH1 1 
ATOM   3173 N NH2 . ARG C 1 28  ? 21.562  13.761  18.932 1.00 63.42  ? 30  ARG C NH2 1 
ATOM   3174 N N   . VAL C 1 29  ? 22.821  6.642   19.997 1.00 52.37  ? 31  VAL C N   1 
ATOM   3175 C CA  . VAL C 1 29  ? 23.464  6.074   18.813 1.00 52.61  ? 31  VAL C CA  1 
ATOM   3176 C C   . VAL C 1 29  ? 22.559  6.369   17.640 1.00 55.33  ? 31  VAL C C   1 
ATOM   3177 O O   . VAL C 1 29  ? 21.355  6.164   17.701 1.00 55.23  ? 31  VAL C O   1 
ATOM   3178 C CB  . VAL C 1 29  ? 23.715  4.614   18.912 1.00 51.65  ? 31  VAL C CB  1 
ATOM   3179 C CG1 . VAL C 1 29  ? 24.722  4.260   17.881 1.00 51.49  ? 31  VAL C CG1 1 
ATOM   3180 C CG2 . VAL C 1 29  ? 24.285  4.302   20.232 1.00 49.15  ? 31  VAL C CG2 1 
ATOM   3181 N N   . ILE C 1 30  ? 23.125  6.935   16.590 1.00 58.23  ? 32  ILE C N   1 
ATOM   3182 C CA  . ILE C 1 30  ? 22.256  7.496   15.580 1.00 61.94  ? 32  ILE C CA  1 
ATOM   3183 C C   . ILE C 1 30  ? 22.549  6.878   14.224 1.00 64.45  ? 32  ILE C C   1 
ATOM   3184 O O   . ILE C 1 30  ? 23.689  6.971   13.686 1.00 64.63  ? 32  ILE C O   1 
ATOM   3185 C CB  . ILE C 1 30  ? 22.202  9.044   15.569 1.00 62.23  ? 32  ILE C CB  1 
ATOM   3186 C CG1 . ILE C 1 30  ? 21.923  9.605   16.989 1.00 60.23  ? 32  ILE C CG1 1 
ATOM   3187 C CG2 . ILE C 1 30  ? 21.144  9.493   14.544 1.00 63.82  ? 32  ILE C CG2 1 
ATOM   3188 C CD1 . ILE C 1 30  ? 21.540  11.096  17.059 1.00 56.11  ? 32  ILE C CD1 1 
ATOM   3189 N N   . VAL C 1 31  ? 21.483  6.258   13.710 1.00 66.81  ? 33  VAL C N   1 
ATOM   3190 C CA  . VAL C 1 31  ? 21.541  5.329   12.615 1.00 69.54  ? 33  VAL C CA  1 
ATOM   3191 C C   . VAL C 1 31  ? 20.715  5.853   11.478 1.00 72.65  ? 33  VAL C C   1 
ATOM   3192 O O   . VAL C 1 31  ? 19.532  6.146   11.629 1.00 73.35  ? 33  VAL C O   1 
ATOM   3193 C CB  . VAL C 1 31  ? 21.008  3.942   13.003 1.00 69.52  ? 33  VAL C CB  1 
ATOM   3194 C CG1 . VAL C 1 31  ? 21.601  2.882   12.087 1.00 71.34  ? 33  VAL C CG1 1 
ATOM   3195 C CG2 . VAL C 1 31  ? 21.361  3.591   14.418 1.00 67.95  ? 33  VAL C CG2 1 
ATOM   3196 N N   . GLU C 1 32  ? 21.367  5.996   10.335 1.00 76.17  ? 34  GLU C N   1 
ATOM   3197 C CA  . GLU C 1 32  ? 20.700  6.427   9.125  1.00 80.19  ? 34  GLU C CA  1 
ATOM   3198 C C   . GLU C 1 32  ? 21.051  5.475   8.016  1.00 82.59  ? 34  GLU C C   1 
ATOM   3199 O O   . GLU C 1 32  ? 22.138  4.872   8.034  1.00 82.10  ? 34  GLU C O   1 
ATOM   3200 C CB  . GLU C 1 32  ? 21.073  7.846   8.790  1.00 80.26  ? 34  GLU C CB  1 
ATOM   3201 C CG  . GLU C 1 32  ? 20.576  8.787   9.839  1.00 81.58  ? 34  GLU C CG  1 
ATOM   3202 C CD  . GLU C 1 32  ? 19.889  9.991   9.244  1.00 86.64  ? 34  GLU C CD  1 
ATOM   3203 O OE1 . GLU C 1 32  ? 19.924  10.138  7.989  1.00 88.33  ? 34  GLU C OE1 1 
ATOM   3204 O OE2 . GLU C 1 32  ? 19.306  10.778  10.030 1.00 86.44  ? 34  GLU C OE2 1 
ATOM   3205 N N   . VAL C 1 33  ? 20.106  5.336   7.078  1.00 86.37  ? 35  VAL C N   1 
ATOM   3206 C CA  . VAL C 1 33  ? 20.136  4.321   5.988  1.00 89.62  ? 35  VAL C CA  1 
ATOM   3207 C C   . VAL C 1 33  ? 19.641  4.849   4.605  1.00 92.75  ? 35  VAL C C   1 
ATOM   3208 O O   . VAL C 1 33  ? 18.710  5.696   4.534  1.00 93.31  ? 35  VAL C O   1 
ATOM   3209 C CB  . VAL C 1 33  ? 19.426  2.965   6.425  1.00 89.45  ? 35  VAL C CB  1 
ATOM   3210 C CG1 . VAL C 1 33  ? 18.488  2.408   5.351  1.00 90.34  ? 35  VAL C CG1 1 
ATOM   3211 C CG2 . VAL C 1 33  ? 20.468  1.929   6.809  1.00 88.45  ? 35  VAL C CG2 1 
ATOM   3212 N N   . CYS C 1 34  ? 20.278  4.346   3.529  1.00 95.39  ? 36  CYS C N   1 
ATOM   3213 C CA  . CYS C 1 34  ? 19.890  4.681   2.131  1.00 98.53  ? 36  CYS C CA  1 
ATOM   3214 C C   . CYS C 1 34  ? 19.036  3.676   1.352  1.00 99.87  ? 36  CYS C C   1 
ATOM   3215 O O   . CYS C 1 34  ? 18.489  4.017   0.293  1.00 100.71 ? 36  CYS C O   1 
ATOM   3216 C CB  . CYS C 1 34  ? 21.081  5.193   1.311  1.00 99.45  ? 36  CYS C CB  1 
ATOM   3217 S SG  . CYS C 1 34  ? 21.168  7.008   1.503  1.00 101.72 ? 36  CYS C SG  1 
ATOM   3218 N N   . GLU C 1 35  ? 18.940  2.454   1.893  1.00 100.23 ? 37  GLU C N   1 
ATOM   3219 C CA  . GLU C 1 35  ? 17.882  1.478   1.536  1.00 101.78 ? 37  GLU C CA  1 
ATOM   3220 C C   . GLU C 1 35  ? 17.474  0.499   2.667  1.00 101.15 ? 37  GLU C C   1 
ATOM   3221 O O   . GLU C 1 35  ? 18.325  -0.015  3.399  1.00 100.37 ? 37  GLU C O   1 
ATOM   3222 C CB  . GLU C 1 35  ? 18.205  0.726   0.235  1.00 103.72 ? 37  GLU C CB  1 
ATOM   3223 C CG  . GLU C 1 35  ? 18.208  -0.796  0.360  1.00 104.44 ? 37  GLU C CG  1 
ATOM   3224 C CD  . GLU C 1 35  ? 19.598  -1.312  0.617  1.00 103.88 ? 37  GLU C CD  1 
ATOM   3225 O OE1 . GLU C 1 35  ? 19.909  -1.634  1.789  1.00 100.39 ? 37  GLU C OE1 1 
ATOM   3226 O OE2 . GLU C 1 35  ? 20.388  -1.349  -0.362 1.00 104.77 ? 37  GLU C OE2 1 
ATOM   3227 N N   . VAL C 1 36  ? 16.153  0.310   2.791  1.00 101.56 ? 38  VAL C N   1 
ATOM   3228 C CA  . VAL C 1 36  ? 15.460  -0.683  3.638  1.00 101.27 ? 38  VAL C CA  1 
ATOM   3229 C C   . VAL C 1 36  ? 16.331  -1.833  4.230  1.00 100.96 ? 38  VAL C C   1 
ATOM   3230 O O   . VAL C 1 36  ? 16.924  -2.627  3.477  1.00 102.24 ? 38  VAL C O   1 
ATOM   3231 C CB  . VAL C 1 36  ? 14.170  -1.225  2.866  1.00 103.05 ? 38  VAL C CB  1 
ATOM   3232 C CG1 . VAL C 1 36  ? 14.549  -2.117  1.655  1.00 105.25 ? 38  VAL C CG1 1 
ATOM   3233 C CG2 . VAL C 1 36  ? 13.173  -1.941  3.792  1.00 102.52 ? 38  VAL C CG2 1 
ATOM   3234 N N   . THR C 1 37  ? 16.379  -1.930  5.571  1.00 99.25  ? 39  THR C N   1 
ATOM   3235 C CA  . THR C 1 37  ? 17.199  -2.938  6.279  1.00 98.15  ? 39  THR C CA  1 
ATOM   3236 C C   . THR C 1 37  ? 16.551  -3.576  7.518  1.00 98.20  ? 39  THR C C   1 
ATOM   3237 O O   . THR C 1 37  ? 15.840  -2.898  8.275  1.00 98.35  ? 39  THR C O   1 
ATOM   3238 C CB  . THR C 1 37  ? 18.474  -2.282  6.770  1.00 96.45  ? 39  THR C CB  1 
ATOM   3239 O OG1 . THR C 1 37  ? 18.948  -1.378  5.758  1.00 95.95  ? 39  THR C OG1 1 
ATOM   3240 C CG2 . THR C 1 37  ? 19.532  -3.336  7.135  1.00 95.46  ? 39  THR C CG2 1 
ATOM   3241 N N   . ARG C 1 38  ? 16.835  -4.858  7.760  1.00 98.34  ? 40  ARG C N   1 
ATOM   3242 C CA  . ARG C 1 38  ? 16.335  -5.541  8.968  1.00 97.69  ? 40  ARG C CA  1 
ATOM   3243 C C   . ARG C 1 38  ? 17.424  -5.660  10.065 1.00 95.36  ? 40  ARG C C   1 
ATOM   3244 O O   . ARG C 1 38  ? 18.472  -6.278  9.827  1.00 95.83  ? 40  ARG C O   1 
ATOM   3245 C CB  . ARG C 1 38  ? 15.752  -6.909  8.603  1.00 99.55  ? 40  ARG C CB  1 
ATOM   3246 C CG  . ARG C 1 38  ? 14.522  -7.257  9.400  1.00 101.69 ? 40  ARG C CG  1 
ATOM   3247 C CD  . ARG C 1 38  ? 13.555  -8.202  8.657  1.00 104.58 ? 40  ARG C CD  1 
ATOM   3248 N NE  . ARG C 1 38  ? 12.529  -8.729  9.569  1.00 105.18 ? 40  ARG C NE  1 
ATOM   3249 C CZ  . ARG C 1 38  ? 12.583  -9.935  10.144 1.00 105.87 ? 40  ARG C CZ  1 
ATOM   3250 N NH1 . ARG C 1 38  ? 13.606  -10.751 9.890  1.00 106.92 ? 40  ARG C NH1 1 
ATOM   3251 N NH2 . ARG C 1 38  ? 11.620  -10.333 10.970 1.00 104.96 ? 40  ARG C NH2 1 
ATOM   3252 N N   . VAL C 1 39  ? 17.168  -5.105  11.260 1.00 92.11  ? 41  VAL C N   1 
ATOM   3253 C CA  . VAL C 1 39  ? 18.180  -5.054  12.326 1.00 88.37  ? 41  VAL C CA  1 
ATOM   3254 C C   . VAL C 1 39  ? 17.958  -5.959  13.532 1.00 87.67  ? 41  VAL C C   1 
ATOM   3255 O O   . VAL C 1 39  ? 17.042  -5.757  14.325 1.00 87.75  ? 41  VAL C O   1 
ATOM   3256 C CB  . VAL C 1 39  ? 18.346  -3.622  12.826 1.00 86.88  ? 41  VAL C CB  1 
ATOM   3257 C CG1 . VAL C 1 39  ? 19.221  -3.581  14.090 1.00 85.14  ? 41  VAL C CG1 1 
ATOM   3258 C CG2 . VAL C 1 39  ? 18.932  -2.782  11.715 1.00 86.37  ? 41  VAL C CG2 1 
ATOM   3259 N N   . LYS C 1 40  ? 18.838  -6.937  13.695 1.00 86.80  ? 42  LYS C N   1 
ATOM   3260 C CA  . LYS C 1 40  ? 18.734  -7.888  14.817 1.00 86.36  ? 42  LYS C CA  1 
ATOM   3261 C C   . LYS C 1 40  ? 18.933  -7.248  16.223 1.00 83.64  ? 42  LYS C C   1 
ATOM   3262 O O   . LYS C 1 40  ? 18.282  -7.651  17.204 1.00 83.60  ? 42  LYS C O   1 
ATOM   3263 C CB  . LYS C 1 40  ? 19.659  -9.109  14.586 1.00 87.18  ? 42  LYS C CB  1 
ATOM   3264 C CG  . LYS C 1 40  ? 19.871  -10.044 15.827 1.00 88.58  ? 42  LYS C CG  1 
ATOM   3265 C CD  . LYS C 1 40  ? 20.684  -11.334 15.521 1.00 89.40  ? 42  LYS C CD  1 
ATOM   3266 C CE  . LYS C 1 40  ? 19.802  -12.513 15.093 1.00 91.63  ? 42  LYS C CE  1 
ATOM   3267 N NZ  . LYS C 1 40  ? 20.607  -13.647 14.526 1.00 93.52  ? 42  LYS C NZ  1 
ATOM   3268 N N   . ALA C 1 41  ? 19.817  -6.247  16.293 1.00 80.56  ? 43  ALA C N   1 
ATOM   3269 C CA  . ALA C 1 41  ? 20.196  -5.587  17.548 1.00 77.36  ? 43  ALA C CA  1 
ATOM   3270 C C   . ALA C 1 41  ? 21.022  -4.329  17.299 1.00 75.02  ? 43  ALA C C   1 
ATOM   3271 O O   . ALA C 1 41  ? 21.814  -4.271  16.332 1.00 75.25  ? 43  ALA C O   1 
ATOM   3272 C CB  . ALA C 1 41  ? 20.973  -6.558  18.458 1.00 77.12  ? 43  ALA C CB  1 
ATOM   3273 N N   . VAL C 1 42  ? 20.829  -3.320  18.159 1.00 72.90  ? 44  VAL C N   1 
ATOM   3274 C CA  . VAL C 1 42  ? 21.849  -2.237  18.374 1.00 69.75  ? 44  VAL C CA  1 
ATOM   3275 C C   . VAL C 1 42  ? 22.436  -2.299  19.820 1.00 68.10  ? 44  VAL C C   1 
ATOM   3276 O O   . VAL C 1 42  ? 21.700  -2.099  20.809 1.00 68.09  ? 44  VAL C O   1 
ATOM   3277 C CB  . VAL C 1 42  ? 21.333  -0.811  17.925 1.00 69.12  ? 44  VAL C CB  1 
ATOM   3278 C CG1 . VAL C 1 42  ? 22.041  0.313   18.620 1.00 67.38  ? 44  VAL C CG1 1 
ATOM   3279 C CG2 . VAL C 1 42  ? 21.507  -0.648  16.450 1.00 68.48  ? 44  VAL C CG2 1 
ATOM   3280 N N   . ARG C 1 43  ? 23.738  -2.623  19.932 1.00 66.45  ? 45  ARG C N   1 
ATOM   3281 C CA  . ARG C 1 43  ? 24.430  -2.808  21.251 1.00 65.02  ? 45  ARG C CA  1 
ATOM   3282 C C   . ARG C 1 43  ? 25.478  -1.739  21.510 1.00 61.79  ? 45  ARG C C   1 
ATOM   3283 O O   . ARG C 1 43  ? 25.989  -1.137  20.570 1.00 61.40  ? 45  ARG C O   1 
ATOM   3284 C CB  . ARG C 1 43  ? 25.141  -4.174  21.341 1.00 66.09  ? 45  ARG C CB  1 
ATOM   3285 C CG  . ARG C 1 43  ? 24.369  -5.336  21.987 1.00 69.71  ? 45  ARG C CG  1 
ATOM   3286 C CD  . ARG C 1 43  ? 24.978  -6.699  21.568 1.00 74.51  ? 45  ARG C CD  1 
ATOM   3287 N NE  . ARG C 1 43  ? 25.324  -6.703  20.131 1.00 78.84  ? 45  ARG C NE  1 
ATOM   3288 C CZ  . ARG C 1 43  ? 26.546  -6.927  19.628 1.00 78.57  ? 45  ARG C CZ  1 
ATOM   3289 N NH1 . ARG C 1 43  ? 27.565  -7.225  20.430 1.00 76.18  ? 45  ARG C NH1 1 
ATOM   3290 N NH2 . ARG C 1 43  ? 26.737  -6.880  18.304 1.00 79.34  ? 45  ARG C NH2 1 
ATOM   3291 N N   . ILE C 1 44  ? 25.809  -1.537  22.778 1.00 59.22  ? 46  ILE C N   1 
ATOM   3292 C CA  . ILE C 1 44  ? 26.993  -0.793  23.145 1.00 56.93  ? 46  ILE C CA  1 
ATOM   3293 C C   . ILE C 1 44  ? 27.805  -1.407  24.280 1.00 56.33  ? 46  ILE C C   1 
ATOM   3294 O O   . ILE C 1 44  ? 27.280  -1.967  25.260 1.00 57.58  ? 46  ILE C O   1 
ATOM   3295 C CB  . ILE C 1 44  ? 26.700  0.655   23.617 1.00 56.17  ? 46  ILE C CB  1 
ATOM   3296 C CG1 . ILE C 1 44  ? 25.780  0.672   24.837 1.00 55.96  ? 46  ILE C CG1 1 
ATOM   3297 C CG2 . ILE C 1 44  ? 26.238  1.558   22.491 1.00 56.18  ? 46  ILE C CG2 1 
ATOM   3298 C CD1 . ILE C 1 44  ? 25.939  1.933   25.649 1.00 53.15  ? 46  ILE C CD1 1 
ATOM   3299 N N   . LEU C 1 45  ? 29.111  -1.232  24.164 1.00 54.62  ? 47  LEU C N   1 
ATOM   3300 C CA  . LEU C 1 45  ? 30.019  -1.422  25.276 1.00 51.71  ? 47  LEU C CA  1 
ATOM   3301 C C   . LEU C 1 45  ? 30.805  -0.119  25.458 1.00 49.78  ? 47  LEU C C   1 
ATOM   3302 O O   . LEU C 1 45  ? 31.172  0.555   24.475 1.00 48.66  ? 47  LEU C O   1 
ATOM   3303 C CB  . LEU C 1 45  ? 30.908  -2.598  24.965 1.00 51.78  ? 47  LEU C CB  1 
ATOM   3304 C CG  . LEU C 1 45  ? 32.267  -2.680  25.599 1.00 52.67  ? 47  LEU C CG  1 
ATOM   3305 C CD1 . LEU C 1 45  ? 32.241  -2.962  27.097 1.00 51.95  ? 47  LEU C CD1 1 
ATOM   3306 C CD2 . LEU C 1 45  ? 33.002  -3.755  24.861 1.00 56.01  ? 47  LEU C CD2 1 
ATOM   3307 N N   . ALA C 1 46  ? 31.011  0.236   26.725 1.00 48.69  ? 48  ALA C N   1 
ATOM   3308 C CA  . ALA C 1 46  ? 31.700  1.432   27.130 1.00 48.06  ? 48  ALA C CA  1 
ATOM   3309 C C   . ALA C 1 46  ? 32.805  1.092   28.116 1.00 47.73  ? 48  ALA C C   1 
ATOM   3310 O O   . ALA C 1 46  ? 32.546  0.562   29.182 1.00 48.46  ? 48  ALA C O   1 
ATOM   3311 C CB  . ALA C 1 46  ? 30.710  2.399   27.755 1.00 47.80  ? 48  ALA C CB  1 
ATOM   3312 N N   . CYS C 1 47  ? 34.043  1.414   27.796 1.00 47.53  ? 49  CYS C N   1 
ATOM   3313 C CA  . CYS C 1 47  ? 35.122  1.031   28.698 1.00 47.90  ? 49  CYS C CA  1 
ATOM   3314 C C   . CYS C 1 47  ? 35.917  2.175   29.156 1.00 46.21  ? 49  CYS C C   1 
ATOM   3315 O O   . CYS C 1 47  ? 35.902  3.264   28.537 1.00 47.37  ? 49  CYS C O   1 
ATOM   3316 C CB  . CYS C 1 47  ? 36.090  0.059   28.028 1.00 49.22  ? 49  CYS C CB  1 
ATOM   3317 S SG  . CYS C 1 47  ? 35.204  -1.388  27.438 1.00 57.96  ? 49  CYS C SG  1 
ATOM   3318 N N   . GLY C 1 48  ? 36.640  1.911   30.232 1.00 44.06  ? 50  GLY C N   1 
ATOM   3319 C CA  . GLY C 1 48  ? 37.665  2.810   30.715 1.00 42.90  ? 50  GLY C CA  1 
ATOM   3320 C C   . GLY C 1 48  ? 38.772  1.915   31.196 1.00 42.45  ? 50  GLY C C   1 
ATOM   3321 O O   . GLY C 1 48  ? 38.555  0.978   31.978 1.00 42.23  ? 50  GLY C O   1 
ATOM   3322 N N   . VAL C 1 49  ? 39.969  2.166   30.704 1.00 42.12  ? 51  VAL C N   1 
ATOM   3323 C CA  . VAL C 1 49  ? 41.066  1.331   31.121 1.00 40.94  ? 51  VAL C CA  1 
ATOM   3324 C C   . VAL C 1 49  ? 42.365  2.082   31.140 1.00 40.25  ? 51  VAL C C   1 
ATOM   3325 O O   . VAL C 1 49  ? 42.584  2.936   30.327 1.00 40.56  ? 51  VAL C O   1 
ATOM   3326 C CB  . VAL C 1 49  ? 41.139  0.057   30.286 1.00 41.36  ? 51  VAL C CB  1 
ATOM   3327 C CG1 . VAL C 1 49  ? 40.946  0.389   28.868 1.00 41.05  ? 51  VAL C CG1 1 
ATOM   3328 C CG2 . VAL C 1 49  ? 42.472  -0.637  30.542 1.00 40.89  ? 51  VAL C CG2 1 
ATOM   3329 N N   . ALA C 1 50  ? 43.189  1.777   32.133 1.00 40.71  ? 52  ALA C N   1 
ATOM   3330 C CA  . ALA C 1 50  ? 44.584  2.265   32.259 1.00 40.86  ? 52  ALA C CA  1 
ATOM   3331 C C   . ALA C 1 50  ? 45.613  1.170   32.016 1.00 41.76  ? 52  ALA C C   1 
ATOM   3332 O O   . ALA C 1 50  ? 45.430  0.028   32.385 1.00 41.40  ? 52  ALA C O   1 
ATOM   3333 C CB  . ALA C 1 50  ? 44.818  2.904   33.616 1.00 38.85  ? 52  ALA C CB  1 
ATOM   3334 N N   . LYS C 1 51  ? 46.680  1.535   31.335 1.00 44.30  ? 53  LYS C N   1 
ATOM   3335 C CA  . LYS C 1 51  ? 47.858  0.684   31.226 1.00 47.31  ? 53  LYS C CA  1 
ATOM   3336 C C   . LYS C 1 51  ? 49.028  1.481   31.739 1.00 47.99  ? 53  LYS C C   1 
ATOM   3337 O O   . LYS C 1 51  ? 49.391  2.475   31.136 1.00 49.68  ? 53  LYS C O   1 
ATOM   3338 C CB  . LYS C 1 51  ? 48.136  0.298   29.779 1.00 48.57  ? 53  LYS C CB  1 
ATOM   3339 C CG  . LYS C 1 51  ? 47.260  -0.772  29.291 1.00 50.77  ? 53  LYS C CG  1 
ATOM   3340 C CD  . LYS C 1 51  ? 46.798  -0.497  27.880 1.00 54.87  ? 53  LYS C CD  1 
ATOM   3341 C CE  . LYS C 1 51  ? 45.825  -1.590  27.424 1.00 57.39  ? 53  LYS C CE  1 
ATOM   3342 N NZ  . LYS C 1 51  ? 44.835  -1.004  26.454 1.00 59.33  ? 53  LYS C NZ  1 
ATOM   3343 N N   . VAL C 1 52  ? 49.602  1.082   32.861 1.00 48.06  ? 54  VAL C N   1 
ATOM   3344 C CA  . VAL C 1 52  ? 50.912  1.601   33.213 1.00 48.61  ? 54  VAL C CA  1 
ATOM   3345 C C   . VAL C 1 52  ? 51.985  0.590   32.731 1.00 49.74  ? 54  VAL C C   1 
ATOM   3346 O O   . VAL C 1 52  ? 51.840  -0.620  32.893 1.00 50.64  ? 54  VAL C O   1 
ATOM   3347 C CB  . VAL C 1 52  ? 51.020  1.914   34.708 1.00 47.95  ? 54  VAL C CB  1 
ATOM   3348 C CG1 . VAL C 1 52  ? 52.076  2.972   34.938 1.00 48.14  ? 54  VAL C CG1 1 
ATOM   3349 C CG2 . VAL C 1 52  ? 49.663  2.414   35.283 1.00 47.66  ? 54  VAL C CG2 1 
ATOM   3350 N N   . LEU C 1 53  ? 53.048  1.089   32.114 1.00 50.24  ? 55  LEU C N   1 
ATOM   3351 C CA  . LEU C 1 53  ? 53.978  0.238   31.375 1.00 51.26  ? 55  LEU C CA  1 
ATOM   3352 C C   . LEU C 1 53  ? 55.399  0.842   31.495 1.00 50.77  ? 55  LEU C C   1 
ATOM   3353 O O   . LEU C 1 53  ? 55.561  2.065   31.349 1.00 50.84  ? 55  LEU C O   1 
ATOM   3354 C CB  . LEU C 1 53  ? 53.506  0.181   29.912 1.00 53.01  ? 55  LEU C CB  1 
ATOM   3355 C CG  . LEU C 1 53  ? 54.168  -0.775  28.907 1.00 57.65  ? 55  LEU C CG  1 
ATOM   3356 C CD1 . LEU C 1 53  ? 53.241  -2.010  28.526 1.00 59.86  ? 55  LEU C CD1 1 
ATOM   3357 C CD2 . LEU C 1 53  ? 54.634  -0.023  27.647 1.00 59.47  ? 55  LEU C CD2 1 
ATOM   3358 N N   . TRP C 1 54  ? 56.409  0.020   31.800 1.00 49.46  ? 56  TRP C N   1 
ATOM   3359 C CA  . TRP C 1 54  ? 57.807  0.522   31.981 1.00 48.66  ? 56  TRP C CA  1 
ATOM   3360 C C   . TRP C 1 54  ? 58.857  -0.558  31.840 1.00 49.44  ? 56  TRP C C   1 
ATOM   3361 O O   . TRP C 1 54  ? 58.558  -1.734  31.927 1.00 49.14  ? 56  TRP C O   1 
ATOM   3362 C CB  . TRP C 1 54  ? 58.015  1.321   33.282 1.00 46.29  ? 56  TRP C CB  1 
ATOM   3363 C CG  . TRP C 1 54  ? 58.068  0.513   34.535 1.00 46.24  ? 56  TRP C CG  1 
ATOM   3364 C CD1 . TRP C 1 54  ? 59.182  0.126   35.181 1.00 45.88  ? 56  TRP C CD1 1 
ATOM   3365 C CD2 . TRP C 1 54  ? 56.944  0.005   35.329 1.00 45.01  ? 56  TRP C CD2 1 
ATOM   3366 N NE1 . TRP C 1 54  ? 58.842  -0.598  36.312 1.00 46.52  ? 56  TRP C NE1 1 
ATOM   3367 C CE2 . TRP C 1 54  ? 57.478  -0.688  36.410 1.00 42.98  ? 56  TRP C CE2 1 
ATOM   3368 C CE3 . TRP C 1 54  ? 55.558  0.030   35.185 1.00 44.67  ? 56  TRP C CE3 1 
ATOM   3369 C CZ2 . TRP C 1 54  ? 56.681  -1.323  37.365 1.00 42.49  ? 56  TRP C CZ2 1 
ATOM   3370 C CZ3 . TRP C 1 54  ? 54.769  -0.622  36.148 1.00 44.25  ? 56  TRP C CZ3 1 
ATOM   3371 C CH2 . TRP C 1 54  ? 55.336  -1.289  37.205 1.00 41.06  ? 56  TRP C CH2 1 
ATOM   3372 N N   . MET C 1 55  ? 60.080  -0.149  31.569 1.00 50.77  ? 57  MET C N   1 
ATOM   3373 C CA  . MET C 1 55  ? 61.196  -1.089  31.586 1.00 51.98  ? 57  MET C CA  1 
ATOM   3374 C C   . MET C 1 55  ? 61.855  -1.096  32.947 1.00 50.90  ? 57  MET C C   1 
ATOM   3375 O O   . MET C 1 55  ? 61.945  -0.056  33.598 1.00 49.41  ? 57  MET C O   1 
ATOM   3376 C CB  . MET C 1 55  ? 62.215  -0.677  30.548 1.00 54.77  ? 57  MET C CB  1 
ATOM   3377 C CG  . MET C 1 55  ? 61.677  -0.635  29.155 1.00 51.53  ? 57  MET C CG  1 
ATOM   3378 S SD  . MET C 1 55  ? 61.057  -2.244  28.674 1.00 52.69  ? 57  MET C SD  1 
ATOM   3379 C CE  . MET C 1 55  ? 62.344  -3.459  28.609 1.00 51.33  ? 57  MET C CE  1 
ATOM   3380 N N   . GLN C 1 56  ? 62.260  -2.274  33.393 1.00 51.36  ? 58  GLN C N   1 
ATOM   3381 C CA  . GLN C 1 56  ? 63.022  -2.408  34.613 1.00 52.05  ? 58  GLN C CA  1 
ATOM   3382 C C   . GLN C 1 56  ? 64.153  -3.225  34.072 1.00 54.07  ? 58  GLN C C   1 
ATOM   3383 O O   . GLN C 1 56  ? 64.027  -4.441  33.884 1.00 55.09  ? 58  GLN C O   1 
ATOM   3384 C CB  . GLN C 1 56  ? 62.240  -3.175  35.694 1.00 51.81  ? 58  GLN C CB  1 
ATOM   3385 C CG  . GLN C 1 56  ? 62.686  -2.928  37.184 1.00 55.60  ? 58  GLN C CG  1 
ATOM   3386 C CD  . GLN C 1 56  ? 62.076  -1.632  37.779 1.00 60.79  ? 58  GLN C CD  1 
ATOM   3387 O OE1 . GLN C 1 56  ? 60.852  -1.538  38.042 1.00 62.21  ? 58  GLN C OE1 1 
ATOM   3388 N NE2 . GLN C 1 56  ? 62.929  -0.640  38.020 1.00 62.59  ? 58  GLN C NE2 1 
ATOM   3389 N N   . GLY C 1 57  ? 65.240  -2.530  33.742 1.00 55.40  ? 59  GLY C N   1 
ATOM   3390 C CA  . GLY C 1 57  ? 66.317  -3.102  32.985 1.00 57.75  ? 59  GLY C CA  1 
ATOM   3391 C C   . GLY C 1 57  ? 65.775  -3.769  31.755 1.00 59.88  ? 59  GLY C C   1 
ATOM   3392 O O   . GLY C 1 57  ? 65.038  -3.176  30.978 1.00 59.29  ? 59  GLY C O   1 
ATOM   3393 N N   . SER C 1 58  ? 66.135  -5.024  31.578 1.00 62.80  ? 60  SER C N   1 
ATOM   3394 C CA  . SER C 1 58  ? 65.921  -5.756  30.332 1.00 65.65  ? 60  SER C CA  1 
ATOM   3395 C C   . SER C 1 58  ? 64.462  -6.159  30.084 1.00 64.35  ? 60  SER C C   1 
ATOM   3396 O O   . SER C 1 58  ? 64.128  -6.665  29.030 1.00 65.71  ? 60  SER C O   1 
ATOM   3397 C CB  . SER C 1 58  ? 66.816  -6.992  30.402 1.00 67.86  ? 60  SER C CB  1 
ATOM   3398 O OG  . SER C 1 58  ? 66.356  -8.042  29.566 1.00 73.91  ? 60  SER C OG  1 
ATOM   3399 N N   . GLN C 1 59  ? 63.604  -5.912  31.076 1.00 62.91  ? 61  GLN C N   1 
ATOM   3400 C CA  . GLN C 1 59  ? 62.313  -6.578  31.257 1.00 62.09  ? 61  GLN C CA  1 
ATOM   3401 C C   . GLN C 1 59  ? 61.212  -5.531  31.434 1.00 58.93  ? 61  GLN C C   1 
ATOM   3402 O O   . GLN C 1 59  ? 61.387  -4.535  32.163 1.00 57.26  ? 61  GLN C O   1 
ATOM   3403 C CB  . GLN C 1 59  ? 62.424  -7.405  32.546 1.00 62.32  ? 61  GLN C CB  1 
ATOM   3404 C CG  . GLN C 1 59  ? 61.195  -8.228  32.930 1.00 66.70  ? 61  GLN C CG  1 
ATOM   3405 C CD  . GLN C 1 59  ? 61.349  -9.702  32.630 1.00 75.55  ? 61  GLN C CD  1 
ATOM   3406 O OE1 . GLN C 1 59  ? 60.477  -10.335 31.981 1.00 78.42  ? 61  GLN C OE1 1 
ATOM   3407 N NE2 . GLN C 1 59  ? 62.470  -10.271 33.094 1.00 78.09  ? 61  GLN C NE2 1 
ATOM   3408 N N   . GLN C 1 60  ? 60.067  -5.768  30.812 1.00 58.19  ? 62  GLN C N   1 
ATOM   3409 C CA  . GLN C 1 60  ? 58.951  -4.821  30.871 1.00 55.53  ? 62  GLN C CA  1 
ATOM   3410 C C   . GLN C 1 60  ? 57.980  -5.203  31.952 1.00 52.82  ? 62  GLN C C   1 
ATOM   3411 O O   . GLN C 1 60  ? 57.730  -6.380  32.151 1.00 54.01  ? 62  GLN C O   1 
ATOM   3412 C CB  . GLN C 1 60  ? 58.224  -4.813  29.548 1.00 56.21  ? 62  GLN C CB  1 
ATOM   3413 C CG  . GLN C 1 60  ? 57.192  -3.745  29.418 1.00 58.15  ? 62  GLN C CG  1 
ATOM   3414 C CD  . GLN C 1 60  ? 56.507  -3.842  28.086 1.00 64.75  ? 62  GLN C CD  1 
ATOM   3415 O OE1 . GLN C 1 60  ? 56.476  -4.925  27.486 1.00 69.29  ? 62  GLN C OE1 1 
ATOM   3416 N NE2 . GLN C 1 60  ? 55.987  -2.724  27.584 1.00 62.79  ? 62  GLN C NE2 1 
ATOM   3417 N N   . CYS C 1 61  ? 57.425  -4.214  32.644 1.00 50.07  ? 63  CYS C N   1 
ATOM   3418 C CA  . CYS C 1 61  ? 56.469  -4.471  33.701 1.00 48.60  ? 63  CYS C CA  1 
ATOM   3419 C C   . CYS C 1 61  ? 55.234  -3.690  33.367 1.00 46.65  ? 63  CYS C C   1 
ATOM   3420 O O   . CYS C 1 61  ? 55.306  -2.496  33.090 1.00 46.67  ? 63  CYS C O   1 
ATOM   3421 C CB  . CYS C 1 61  ? 57.016  -4.067  35.089 1.00 47.46  ? 63  CYS C CB  1 
ATOM   3422 S SG  . CYS C 1 61  ? 58.576  -4.896  35.398 1.00 55.33  ? 63  CYS C SG  1 
ATOM   3423 N N   . LYS C 1 62  ? 54.093  -4.359  33.431 1.00 45.36  ? 64  LYS C N   1 
ATOM   3424 C CA  . LYS C 1 62  ? 52.821  -3.748  33.069 1.00 44.20  ? 64  LYS C CA  1 
ATOM   3425 C C   . LYS C 1 62  ? 51.762  -3.937  34.158 1.00 40.86  ? 64  LYS C C   1 
ATOM   3426 O O   . LYS C 1 62  ? 51.586  -5.039  34.625 1.00 40.71  ? 64  LYS C O   1 
ATOM   3427 C CB  . LYS C 1 62  ? 52.368  -4.407  31.769 1.00 46.75  ? 64  LYS C CB  1 
ATOM   3428 C CG  . LYS C 1 62  ? 51.100  -3.875  31.159 1.00 50.23  ? 64  LYS C CG  1 
ATOM   3429 C CD  . LYS C 1 62  ? 50.796  -4.700  29.942 1.00 56.72  ? 64  LYS C CD  1 
ATOM   3430 C CE  . LYS C 1 62  ? 49.542  -4.179  29.251 1.00 60.26  ? 64  LYS C CE  1 
ATOM   3431 N NZ  . LYS C 1 62  ? 49.490  -4.717  27.830 1.00 65.18  ? 64  LYS C NZ  1 
ATOM   3432 N N   . GLN C 1 63  ? 51.114  -2.859  34.596 1.00 38.26  ? 65  GLN C N   1 
ATOM   3433 C CA  . GLN C 1 63  ? 49.840  -2.964  35.330 1.00 36.50  ? 65  GLN C CA  1 
ATOM   3434 C C   . GLN C 1 63  ? 48.659  -2.470  34.472 1.00 36.24  ? 65  GLN C C   1 
ATOM   3435 O O   . GLN C 1 63  ? 48.738  -1.378  33.865 1.00 35.22  ? 65  GLN C O   1 
ATOM   3436 C CB  . GLN C 1 63  ? 49.888  -2.184  36.632 1.00 34.79  ? 65  GLN C CB  1 
ATOM   3437 C CG  . GLN C 1 63  ? 48.650  -2.409  37.491 1.00 34.31  ? 65  GLN C CG  1 
ATOM   3438 C CD  . GLN C 1 63  ? 48.674  -1.658  38.824 1.00 32.87  ? 65  GLN C CD  1 
ATOM   3439 O OE1 . GLN C 1 63  ? 49.513  -0.818  39.044 1.00 34.76  ? 65  GLN C OE1 1 
ATOM   3440 N NE2 . GLN C 1 63  ? 47.716  -1.949  39.691 1.00 27.51  ? 65  GLN C NE2 1 
ATOM   3441 N N   . THR C 1 64  ? 47.579  -3.271  34.424 1.00 35.78  ? 66  THR C N   1 
ATOM   3442 C CA  . THR C 1 64  ? 46.335  -2.897  33.715 1.00 34.85  ? 66  THR C CA  1 
ATOM   3443 C C   . THR C 1 64  ? 45.141  -2.622  34.698 1.00 34.32  ? 66  THR C C   1 
ATOM   3444 O O   . THR C 1 64  ? 44.869  -3.403  35.579 1.00 35.40  ? 66  THR C O   1 
ATOM   3445 C CB  . THR C 1 64  ? 45.956  -3.983  32.705 1.00 35.62  ? 66  THR C CB  1 
ATOM   3446 O OG1 . THR C 1 64  ? 46.932  -4.059  31.661 1.00 39.01  ? 66  THR C OG1 1 
ATOM   3447 C CG2 . THR C 1 64  ? 44.671  -3.688  32.072 1.00 34.70  ? 66  THR C CG2 1 
ATOM   3448 N N   . SER C 1 65  ? 44.445  -1.511  34.568 1.00 33.41  ? 67  SER C N   1 
ATOM   3449 C CA  . SER C 1 65  ? 43.310  -1.262  35.396 1.00 33.53  ? 67  SER C CA  1 
ATOM   3450 C C   . SER C 1 65  ? 42.031  -0.902  34.644 1.00 36.04  ? 67  SER C C   1 
ATOM   3451 O O   . SER C 1 65  ? 42.007  0.136   33.977 1.00 36.88  ? 67  SER C O   1 
ATOM   3452 C CB  . SER C 1 65  ? 43.613  -0.089  36.236 1.00 31.45  ? 67  SER C CB  1 
ATOM   3453 O OG  . SER C 1 65  ? 44.647  -0.428  37.053 1.00 33.15  ? 67  SER C OG  1 
ATOM   3454 N N   . GLU C 1 66  ? 40.955  -1.694  34.809 1.00 37.95  ? 68  GLU C N   1 
ATOM   3455 C CA  . GLU C 1 66  ? 39.630  -1.345  34.289 1.00 39.43  ? 68  GLU C CA  1 
ATOM   3456 C C   . GLU C 1 66  ? 38.905  -0.470  35.283 1.00 40.48  ? 68  GLU C C   1 
ATOM   3457 O O   . GLU C 1 66  ? 38.798  -0.844  36.474 1.00 41.46  ? 68  GLU C O   1 
ATOM   3458 C CB  . GLU C 1 66  ? 38.795  -2.579  34.037 1.00 39.74  ? 68  GLU C CB  1 
ATOM   3459 C CG  . GLU C 1 66  ? 39.055  -3.164  32.716 1.00 41.87  ? 68  GLU C CG  1 
ATOM   3460 C CD  . GLU C 1 66  ? 38.175  -4.342  32.446 1.00 47.21  ? 68  GLU C CD  1 
ATOM   3461 O OE1 . GLU C 1 66  ? 36.979  -4.171  32.104 1.00 49.35  ? 68  GLU C OE1 1 
ATOM   3462 O OE2 . GLU C 1 66  ? 38.700  -5.463  32.573 1.00 50.46  ? 68  GLU C OE2 1 
ATOM   3463 N N   . TYR C 1 67  ? 38.428  0.695   34.819 1.00 41.04  ? 69  TYR C N   1 
ATOM   3464 C CA  . TYR C 1 67  ? 37.596  1.569   35.666 1.00 41.03  ? 69  TYR C CA  1 
ATOM   3465 C C   . TYR C 1 67  ? 36.136  1.498   35.353 1.00 43.10  ? 69  TYR C C   1 
ATOM   3466 O O   . TYR C 1 67  ? 35.327  1.958   36.175 1.00 43.87  ? 69  TYR C O   1 
ATOM   3467 C CB  . TYR C 1 67  ? 38.043  3.000   35.612 1.00 40.04  ? 69  TYR C CB  1 
ATOM   3468 C CG  . TYR C 1 67  ? 39.355  3.126   36.249 1.00 39.14  ? 69  TYR C CG  1 
ATOM   3469 C CD1 . TYR C 1 67  ? 40.523  2.933   35.518 1.00 39.11  ? 69  TYR C CD1 1 
ATOM   3470 C CD2 . TYR C 1 67  ? 39.454  3.362   37.614 1.00 40.76  ? 69  TYR C CD2 1 
ATOM   3471 C CE1 . TYR C 1 67  ? 41.786  3.022   36.120 1.00 36.55  ? 69  TYR C CE1 1 
ATOM   3472 C CE2 . TYR C 1 67  ? 40.713  3.429   38.241 1.00 38.94  ? 69  TYR C CE2 1 
ATOM   3473 C CZ  . TYR C 1 67  ? 41.844  3.262   37.468 1.00 35.72  ? 69  TYR C CZ  1 
ATOM   3474 O OH  . TYR C 1 67  ? 43.007  3.322   38.073 1.00 37.76  ? 69  TYR C OH  1 
ATOM   3475 N N   . LEU C 1 68  ? 35.792  0.888   34.207 1.00 44.55  ? 70  LEU C N   1 
ATOM   3476 C CA  . LEU C 1 68  ? 34.457  0.951   33.706 1.00 46.23  ? 70  LEU C CA  1 
ATOM   3477 C C   . LEU C 1 68  ? 34.185  -0.118  32.704 1.00 48.93  ? 70  LEU C C   1 
ATOM   3478 O O   . LEU C 1 68  ? 34.473  0.050   31.547 1.00 50.17  ? 70  LEU C O   1 
ATOM   3479 C CB  . LEU C 1 68  ? 34.220  2.303   33.033 1.00 45.61  ? 70  LEU C CB  1 
ATOM   3480 C CG  . LEU C 1 68  ? 32.890  2.304   32.246 1.00 46.39  ? 70  LEU C CG  1 
ATOM   3481 C CD1 . LEU C 1 68  ? 31.647  2.385   33.216 1.00 46.75  ? 70  LEU C CD1 1 
ATOM   3482 C CD2 . LEU C 1 68  ? 32.840  3.359   31.182 1.00 42.48  ? 70  LEU C CD2 1 
ATOM   3483 N N   . ARG C 1 69  ? 33.580  -1.209  33.132 1.00 52.89  ? 71  ARG C N   1 
ATOM   3484 C CA  . ARG C 1 69  ? 33.131  -2.235  32.210 1.00 56.72  ? 71  ARG C CA  1 
ATOM   3485 C C   . ARG C 1 69  ? 31.613  -2.321  32.184 1.00 60.27  ? 71  ARG C C   1 
ATOM   3486 O O   . ARG C 1 69  ? 30.965  -2.895  33.086 1.00 62.26  ? 71  ARG C O   1 
ATOM   3487 C CB  . ARG C 1 69  ? 33.709  -3.603  32.501 1.00 56.35  ? 71  ARG C CB  1 
ATOM   3488 C CG  . ARG C 1 69  ? 33.572  -4.399  31.261 1.00 57.58  ? 71  ARG C CG  1 
ATOM   3489 C CD  . ARG C 1 69  ? 33.758  -5.805  31.510 1.00 59.28  ? 71  ARG C CD  1 
ATOM   3490 N NE  . ARG C 1 69  ? 34.929  -6.030  32.314 1.00 56.54  ? 71  ARG C NE  1 
ATOM   3491 C CZ  . ARG C 1 69  ? 34.987  -6.976  33.229 1.00 58.85  ? 71  ARG C CZ  1 
ATOM   3492 N NH1 . ARG C 1 69  ? 33.939  -7.746  33.456 1.00 61.46  ? 71  ARG C NH1 1 
ATOM   3493 N NH2 . ARG C 1 69  ? 36.082  -7.140  33.934 1.00 59.75  ? 71  ARG C NH2 1 
ATOM   3494 N N   . TYR C 1 70  ? 31.054  -1.778  31.114 1.00 62.50  ? 72  TYR C N   1 
ATOM   3495 C CA  . TYR C 1 70  ? 29.642  -1.477  31.066 1.00 64.72  ? 72  TYR C CA  1 
ATOM   3496 C C   . TYR C 1 70  ? 29.198  -1.954  29.694 1.00 65.68  ? 72  TYR C C   1 
ATOM   3497 O O   . TYR C 1 70  ? 29.708  -1.466  28.695 1.00 65.99  ? 72  TYR C O   1 
ATOM   3498 C CB  . TYR C 1 70  ? 29.441  0.058   31.291 1.00 64.53  ? 72  TYR C CB  1 
ATOM   3499 C CG  . TYR C 1 70  ? 27.997  0.463   31.149 1.00 67.54  ? 72  TYR C CG  1 
ATOM   3500 C CD1 . TYR C 1 70  ? 27.176  0.654   32.269 1.00 69.48  ? 72  TYR C CD1 1 
ATOM   3501 C CD2 . TYR C 1 70  ? 27.423  0.564   29.878 1.00 68.97  ? 72  TYR C CD2 1 
ATOM   3502 C CE1 . TYR C 1 70  ? 25.819  0.959   32.089 1.00 73.01  ? 72  TYR C CE1 1 
ATOM   3503 C CE2 . TYR C 1 70  ? 26.084  0.868   29.694 1.00 70.95  ? 72  TYR C CE2 1 
ATOM   3504 C CZ  . TYR C 1 70  ? 25.290  1.066   30.777 1.00 71.45  ? 72  TYR C CZ  1 
ATOM   3505 O OH  . TYR C 1 70  ? 23.984  1.358   30.515 1.00 71.10  ? 72  TYR C OH  1 
ATOM   3506 N N   . GLU C 1 71  ? 28.314  -2.949  29.623 1.00 67.44  ? 73  GLU C N   1 
ATOM   3507 C CA  . GLU C 1 71  ? 27.804  -3.423  28.312 1.00 68.38  ? 73  GLU C CA  1 
ATOM   3508 C C   . GLU C 1 71  ? 26.294  -3.260  28.323 1.00 68.54  ? 73  GLU C C   1 
ATOM   3509 O O   . GLU C 1 71  ? 25.721  -3.021  29.383 1.00 68.93  ? 73  GLU C O   1 
ATOM   3510 C CB  . GLU C 1 71  ? 28.214  -4.876  27.993 1.00 70.02  ? 73  GLU C CB  1 
ATOM   3511 C CG  . GLU C 1 71  ? 27.954  -5.304  26.487 1.00 74.11  ? 73  GLU C CG  1 
ATOM   3512 C CD  . GLU C 1 71  ? 28.966  -6.358  25.908 1.00 78.81  ? 73  GLU C CD  1 
ATOM   3513 O OE1 . GLU C 1 71  ? 29.755  -7.020  26.653 1.00 78.42  ? 73  GLU C OE1 1 
ATOM   3514 O OE2 . GLU C 1 71  ? 28.968  -6.504  24.664 1.00 80.93  ? 73  GLU C OE2 1 
ATOM   3515 N N   . ASP C 1 72  ? 25.638  -3.327  27.161 1.00 68.08  ? 74  ASP C N   1 
ATOM   3516 C CA  . ASP C 1 72  ? 24.178  -3.146  27.158 1.00 68.02  ? 74  ASP C CA  1 
ATOM   3517 C C   . ASP C 1 72  ? 23.554  -3.126  25.769 1.00 67.42  ? 74  ASP C C   1 
ATOM   3518 O O   . ASP C 1 72  ? 24.257  -2.757  24.825 1.00 67.58  ? 74  ASP C O   1 
ATOM   3519 C CB  . ASP C 1 72  ? 23.797  -1.874  27.932 1.00 67.79  ? 74  ASP C CB  1 
ATOM   3520 C CG  . ASP C 1 72  ? 22.320  -1.811  28.230 1.00 69.16  ? 74  ASP C CG  1 
ATOM   3521 O OD1 . ASP C 1 72  ? 21.593  -2.697  27.683 1.00 67.70  ? 74  ASP C OD1 1 
ATOM   3522 O OD2 . ASP C 1 72  ? 21.910  -0.882  28.980 1.00 66.87  ? 74  ASP C OD2 1 
ATOM   3523 N N   . THR C 1 73  ? 22.267  -3.537  25.648 1.00 66.54  ? 75  THR C N   1 
ATOM   3524 C CA  . THR C 1 73  ? 21.521  -3.494  24.352 1.00 65.21  ? 75  THR C CA  1 
ATOM   3525 C C   . THR C 1 73  ? 20.511  -2.389  24.329 1.00 64.14  ? 75  THR C C   1 
ATOM   3526 O O   . THR C 1 73  ? 19.658  -2.318  25.207 1.00 64.52  ? 75  THR C O   1 
ATOM   3527 C CB  . THR C 1 73  ? 20.661  -4.721  24.054 1.00 67.00  ? 75  THR C CB  1 
ATOM   3528 O OG1 . THR C 1 73  ? 21.253  -5.893  24.616 1.00 67.36  ? 75  THR C OG1 1 
ATOM   3529 C CG2 . THR C 1 73  ? 20.484  -4.867  22.547 1.00 67.19  ? 75  THR C CG2 1 
ATOM   3530 N N   . LEU C 1 74  ? 20.574  -1.571  23.285 1.00 62.05  ? 76  LEU C N   1 
ATOM   3531 C CA  . LEU C 1 74  ? 19.689  -0.427  23.131 1.00 60.52  ? 76  LEU C CA  1 
ATOM   3532 C C   . LEU C 1 74  ? 18.360  -0.712  22.445 1.00 61.60  ? 76  LEU C C   1 
ATOM   3533 O O   . LEU C 1 74  ? 18.288  -1.393  21.428 1.00 60.99  ? 76  LEU C O   1 
ATOM   3534 C CB  . LEU C 1 74  ? 20.411  0.646   22.366 1.00 59.35  ? 76  LEU C CB  1 
ATOM   3535 C CG  . LEU C 1 74  ? 21.274  1.594   23.183 1.00 57.69  ? 76  LEU C CG  1 
ATOM   3536 C CD1 . LEU C 1 74  ? 21.937  0.961   24.418 1.00 55.72  ? 76  LEU C CD1 1 
ATOM   3537 C CD2 . LEU C 1 74  ? 22.250  2.152   22.238 1.00 52.16  ? 76  LEU C CD2 1 
ATOM   3538 N N   . LEU C 1 75  ? 17.318  -0.130  23.035 1.00 62.90  ? 77  LEU C N   1 
ATOM   3539 C CA  . LEU C 1 75  ? 15.917  -0.243  22.608 1.00 64.44  ? 77  LEU C CA  1 
ATOM   3540 C C   . LEU C 1 75  ? 15.378  1.057   22.047 1.00 63.84  ? 77  LEU C C   1 
ATOM   3541 O O   . LEU C 1 75  ? 15.572  2.084   22.658 1.00 63.94  ? 77  LEU C O   1 
ATOM   3542 C CB  . LEU C 1 75  ? 15.053  -0.584  23.834 1.00 65.93  ? 77  LEU C CB  1 
ATOM   3543 C CG  . LEU C 1 75  ? 14.583  -2.037  23.982 1.00 67.45  ? 77  LEU C CG  1 
ATOM   3544 C CD1 . LEU C 1 75  ? 13.224  -2.073  24.717 1.00 70.10  ? 77  LEU C CD1 1 
ATOM   3545 C CD2 . LEU C 1 75  ? 14.495  -2.714  22.587 1.00 68.27  ? 77  LEU C CD2 1 
ATOM   3546 N N   . LEU C 1 76  ? 14.681  1.018   20.926 1.00 64.47  ? 78  LEU C N   1 
ATOM   3547 C CA  . LEU C 1 76  ? 13.972  2.201   20.448 1.00 65.40  ? 78  LEU C CA  1 
ATOM   3548 C C   . LEU C 1 76  ? 12.590  2.251   21.044 1.00 67.67  ? 78  LEU C C   1 
ATOM   3549 O O   . LEU C 1 76  ? 11.953  1.198   21.284 1.00 69.37  ? 78  LEU C O   1 
ATOM   3550 C CB  . LEU C 1 76  ? 13.830  2.223   18.918 1.00 65.80  ? 78  LEU C CB  1 
ATOM   3551 C CG  . LEU C 1 76  ? 14.097  3.535   18.126 1.00 67.54  ? 78  LEU C CG  1 
ATOM   3552 C CD1 . LEU C 1 76  ? 14.070  4.901   18.955 1.00 67.32  ? 78  LEU C CD1 1 
ATOM   3553 C CD2 . LEU C 1 76  ? 15.396  3.443   17.322 1.00 65.21  ? 78  LEU C CD2 1 
ATOM   3554 N N   . GLU C 1 77  ? 12.112  3.477   21.261 1.00 68.29  ? 79  GLU C N   1 
ATOM   3555 C CA  . GLU C 1 77  ? 10.734  3.758   21.707 1.00 70.45  ? 79  GLU C CA  1 
ATOM   3556 C C   . GLU C 1 77  ? 9.620   3.000   20.939 1.00 71.17  ? 79  GLU C C   1 
ATOM   3557 O O   . GLU C 1 77  ? 8.601   2.654   21.489 1.00 72.45  ? 79  GLU C O   1 
ATOM   3558 C CB  . GLU C 1 77  ? 10.506  5.230   21.534 1.00 70.58  ? 79  GLU C CB  1 
ATOM   3559 C CG  . GLU C 1 77  ? 10.773  6.001   22.748 1.00 75.09  ? 79  GLU C CG  1 
ATOM   3560 C CD  . GLU C 1 77  ? 9.645   6.993   22.964 1.00 85.05  ? 79  GLU C CD  1 
ATOM   3561 O OE1 . GLU C 1 77  ? 9.606   8.046   22.231 1.00 86.23  ? 79  GLU C OE1 1 
ATOM   3562 O OE2 . GLU C 1 77  ? 8.770   6.689   23.833 1.00 87.18  ? 79  GLU C OE2 1 
ATOM   3563 N N   . ASP C 1 78  ? 9.833   2.763   19.655 1.00 70.29  ? 80  ASP C N   1 
ATOM   3564 C CA  . ASP C 1 78  ? 8.857   2.081   18.828 1.00 71.79  ? 80  ASP C CA  1 
ATOM   3565 C C   . ASP C 1 78  ? 8.971   0.535   18.906 1.00 71.71  ? 80  ASP C C   1 
ATOM   3566 O O   . ASP C 1 78  ? 8.251   -0.163  18.211 1.00 71.91  ? 80  ASP C O   1 
ATOM   3567 C CB  . ASP C 1 78  ? 9.006   2.569   17.376 1.00 71.35  ? 80  ASP C CB  1 
ATOM   3568 C CG  . ASP C 1 78  ? 7.697   2.489   16.578 1.00 74.25  ? 80  ASP C CG  1 
ATOM   3569 O OD1 . ASP C 1 78  ? 6.584   2.547   17.174 1.00 74.85  ? 80  ASP C OD1 1 
ATOM   3570 O OD2 . ASP C 1 78  ? 7.792   2.389   15.327 1.00 75.96  ? 80  ASP C OD2 1 
ATOM   3571 N N   . GLN C 1 79  ? 9.877   0.027   19.754 1.00 70.85  ? 81  GLN C N   1 
ATOM   3572 C CA  . GLN C 1 79  ? 10.109  -1.427  19.979 1.00 71.26  ? 81  GLN C CA  1 
ATOM   3573 C C   . GLN C 1 79  ? 9.505   -1.852  21.310 1.00 71.56  ? 81  GLN C C   1 
ATOM   3574 O O   . GLN C 1 79  ? 10.242  -2.284  22.186 1.00 70.75  ? 81  GLN C O   1 
ATOM   3575 C CB  . GLN C 1 79  ? 11.625  -1.706  20.130 1.00 69.35  ? 81  GLN C CB  1 
ATOM   3576 C CG  . GLN C 1 79  ? 12.509  -1.806  18.867 1.00 70.60  ? 81  GLN C CG  1 
ATOM   3577 C CD  . GLN C 1 79  ? 13.989  -2.210  19.223 1.00 72.71  ? 81  GLN C CD  1 
ATOM   3578 O OE1 . GLN C 1 79  ? 14.949  -1.457  18.953 1.00 67.79  ? 81  GLN C OE1 1 
ATOM   3579 N NE2 . GLN C 1 79  ? 14.154  -3.407  19.843 1.00 75.22  ? 81  GLN C NE2 1 
ATOM   3580 N N   . PRO C 1 80  ? 8.198   -1.717  21.500 1.00 72.96  ? 82  PRO C N   1 
ATOM   3581 C CA  . PRO C 1 80  ? 7.745   -1.904  22.863 1.00 74.66  ? 82  PRO C CA  1 
ATOM   3582 C C   . PRO C 1 80  ? 7.774   -3.366  23.358 1.00 76.44  ? 82  PRO C C   1 
ATOM   3583 O O   . PRO C 1 80  ? 7.771   -3.617  24.563 1.00 76.91  ? 82  PRO C O   1 
ATOM   3584 C CB  . PRO C 1 80  ? 6.328   -1.380  22.814 1.00 76.78  ? 82  PRO C CB  1 
ATOM   3585 C CG  . PRO C 1 80  ? 5.889   -1.659  21.450 1.00 77.12  ? 82  PRO C CG  1 
ATOM   3586 C CD  . PRO C 1 80  ? 7.083   -1.445  20.591 1.00 74.95  ? 82  PRO C CD  1 
ATOM   3587 N N   . THR C 1 81  ? 7.851   -4.310  22.432 1.00 77.95  ? 83  THR C N   1 
ATOM   3588 C CA  . THR C 1 81  ? 7.948   -5.729  22.761 1.00 80.57  ? 83  THR C CA  1 
ATOM   3589 C C   . THR C 1 81  ? 9.384   -6.120  23.019 1.00 79.50  ? 83  THR C C   1 
ATOM   3590 O O   . THR C 1 81  ? 9.724   -7.292  23.074 1.00 79.87  ? 83  THR C O   1 
ATOM   3591 C CB  . THR C 1 81  ? 7.397   -6.573  21.631 1.00 81.57  ? 83  THR C CB  1 
ATOM   3592 O OG1 . THR C 1 81  ? 7.750   -5.932  20.393 1.00 80.25  ? 83  THR C OG1 1 
ATOM   3593 C CG2 . THR C 1 81  ? 5.875   -6.659  21.758 1.00 82.80  ? 83  THR C CG2 1 
ATOM   3594 N N   . GLY C 1 82  ? 10.228  -5.120  23.168 1.00 79.08  ? 84  GLY C N   1 
ATOM   3595 C CA  . GLY C 1 82  ? 11.613  -5.343  23.502 1.00 80.33  ? 84  GLY C CA  1 
ATOM   3596 C C   . GLY C 1 82  ? 12.480  -5.913  22.403 1.00 81.96  ? 84  GLY C C   1 
ATOM   3597 O O   . GLY C 1 82  ? 12.201  -5.797  21.192 1.00 81.96  ? 84  GLY C O   1 
ATOM   3598 N N   . GLU C 1 83  ? 13.527  -6.586  22.861 1.00 84.35  ? 85  GLU C N   1 
ATOM   3599 C CA  . GLU C 1 83  ? 14.759  -6.755  22.093 1.00 85.96  ? 85  GLU C CA  1 
ATOM   3600 C C   . GLU C 1 83  ? 14.988  -8.140  21.466 1.00 89.46  ? 85  GLU C C   1 
ATOM   3601 O O   . GLU C 1 83  ? 15.849  -8.276  20.573 1.00 88.90  ? 85  GLU C O   1 
ATOM   3602 C CB  . GLU C 1 83  ? 15.942  -6.383  22.998 1.00 84.16  ? 85  GLU C CB  1 
ATOM   3603 C CG  . GLU C 1 83  ? 15.921  -7.131  24.363 1.00 85.97  ? 85  GLU C CG  1 
ATOM   3604 C CD  . GLU C 1 83  ? 16.089  -6.193  25.532 1.00 84.23  ? 85  GLU C CD  1 
ATOM   3605 O OE1 . GLU C 1 83  ? 17.229  -6.118  26.022 1.00 83.93  ? 85  GLU C OE1 1 
ATOM   3606 O OE2 . GLU C 1 83  ? 15.102  -5.528  25.942 1.00 83.24  ? 85  GLU C OE2 1 
ATOM   3607 N N   . ASN C 1 84  ? 14.266  -9.176  21.928 1.00 94.80  ? 86  ASN C N   1 
ATOM   3608 C CA  . ASN C 1 84  ? 14.200  -10.404 21.085 1.00 98.65  ? 86  ASN C CA  1 
ATOM   3609 C C   . ASN C 1 84  ? 13.240  -10.234 19.922 1.00 100.37 ? 86  ASN C C   1 
ATOM   3610 O O   . ASN C 1 84  ? 12.862  -11.213 19.262 1.00 102.37 ? 86  ASN C O   1 
ATOM   3611 C CB  . ASN C 1 84  ? 13.979  -11.703 21.861 1.00 101.28 ? 86  ASN C CB  1 
ATOM   3612 C CG  . ASN C 1 84  ? 15.232  -12.602 21.852 1.00 103.51 ? 86  ASN C CG  1 
ATOM   3613 O OD1 . ASN C 1 84  ? 15.363  -13.509 22.684 1.00 108.14 ? 86  ASN C OD1 1 
ATOM   3614 N ND2 . ASN C 1 84  ? 16.151  -12.351 20.909 1.00 102.81 ? 86  ASN C ND2 1 
ATOM   3615 N N   . GLU C 1 85  ? 12.917  -8.956  19.670 1.00 99.87  ? 87  GLU C N   1 
ATOM   3616 C CA  . GLU C 1 85  ? 12.096  -8.536  18.567 1.00 101.09 ? 87  GLU C CA  1 
ATOM   3617 C C   . GLU C 1 85  ? 12.963  -7.668  17.690 1.00 99.04  ? 87  GLU C C   1 
ATOM   3618 O O   . GLU C 1 85  ? 13.949  -7.074  18.160 1.00 96.96  ? 87  GLU C O   1 
ATOM   3619 C CB  . GLU C 1 85  ? 10.936  -7.750  19.115 1.00 101.83 ? 87  GLU C CB  1 
ATOM   3620 C CG  . GLU C 1 85  ? 10.491  -8.344  20.411 1.00 104.83 ? 87  GLU C CG  1 
ATOM   3621 C CD  . GLU C 1 85  ? 9.540   -9.502  20.199 1.00 110.82 ? 87  GLU C CD  1 
ATOM   3622 O OE1 . GLU C 1 85  ? 8.332   -9.193  20.141 1.00 113.79 ? 87  GLU C OE1 1 
ATOM   3623 O OE2 . GLU C 1 85  ? 9.964   -10.690 20.078 1.00 111.68 ? 87  GLU C OE2 1 
ATOM   3624 N N   . MET C 1 86  ? 12.564  -7.602  16.426 1.00 100.04 ? 88  MET C N   1 
ATOM   3625 C CA  . MET C 1 86  ? 13.382  -7.073  15.353 1.00 99.03  ? 88  MET C CA  1 
ATOM   3626 C C   . MET C 1 86  ? 12.759  -5.899  14.645 1.00 98.50  ? 88  MET C C   1 
ATOM   3627 O O   . MET C 1 86  ? 11.536  -5.773  14.557 1.00 99.76  ? 88  MET C O   1 
ATOM   3628 C CB  . MET C 1 86  ? 13.642  -8.168  14.335 1.00 100.70 ? 88  MET C CB  1 
ATOM   3629 C CG  . MET C 1 86  ? 14.894  -8.950  14.637 1.00 101.37 ? 88  MET C CG  1 
ATOM   3630 S SD  . MET C 1 86  ? 15.727  -9.462  13.114 1.00 105.35 ? 88  MET C SD  1 
ATOM   3631 C CE  . MET C 1 86  ? 15.387  -8.083  12.009 1.00 102.46 ? 88  MET C CE  1 
ATOM   3632 N N   . VAL C 1 87  ? 13.637  -5.073  14.099 1.00 96.68  ? 89  VAL C N   1 
ATOM   3633 C CA  . VAL C 1 87  ? 13.276  -3.774  13.558 1.00 96.36  ? 89  VAL C CA  1 
ATOM   3634 C C   . VAL C 1 87  ? 13.476  -3.702  12.055 1.00 97.16  ? 89  VAL C C   1 
ATOM   3635 O O   . VAL C 1 87  ? 14.063  -4.618  11.455 1.00 97.73  ? 89  VAL C O   1 
ATOM   3636 C CB  . VAL C 1 87  ? 14.072  -2.653  14.254 1.00 94.22  ? 89  VAL C CB  1 
ATOM   3637 C CG1 . VAL C 1 87  ? 15.264  -3.233  14.993 1.00 93.09  ? 89  VAL C CG1 1 
ATOM   3638 C CG2 . VAL C 1 87  ? 14.511  -1.562  13.256 1.00 92.78  ? 89  VAL C CG2 1 
ATOM   3639 N N   . ILE C 1 88  ? 13.014  -2.580  11.481 1.00 97.45  ? 90  ILE C N   1 
ATOM   3640 C CA  . ILE C 1 88  ? 12.709  -2.420  10.046 1.00 98.54  ? 90  ILE C CA  1 
ATOM   3641 C C   . ILE C 1 88  ? 13.026  -0.989  9.569  1.00 97.63  ? 90  ILE C C   1 
ATOM   3642 O O   . ILE C 1 88  ? 12.193  -0.082  9.703  1.00 97.59  ? 90  ILE C O   1 
ATOM   3643 C CB  . ILE C 1 88  ? 11.190  -2.796  9.758  1.00 100.60 ? 90  ILE C CB  1 
ATOM   3644 C CG1 . ILE C 1 88  ? 11.029  -4.287  9.354  1.00 102.02 ? 90  ILE C CG1 1 
ATOM   3645 C CG2 . ILE C 1 88  ? 10.568  -1.865  8.712  1.00 101.03 ? 90  ILE C CG2 1 
ATOM   3646 C CD1 . ILE C 1 88  ? 11.116  -5.349  10.509 1.00 101.70 ? 90  ILE C CD1 1 
ATOM   3647 N N   . MET C 1 89  ? 14.222  -0.803  8.997  1.00 97.16  ? 91  MET C N   1 
ATOM   3648 C CA  . MET C 1 89  ? 14.780  0.550   8.736  1.00 96.66  ? 91  MET C CA  1 
ATOM   3649 C C   . MET C 1 89  ? 14.749  1.106   7.282  1.00 97.70  ? 91  MET C C   1 
ATOM   3650 O O   . MET C 1 89  ? 15.641  0.843   6.451  1.00 97.63  ? 91  MET C O   1 
ATOM   3651 C CB  . MET C 1 89  ? 16.181  0.711   9.389  1.00 95.30  ? 91  MET C CB  1 
ATOM   3652 C CG  . MET C 1 89  ? 16.163  1.310   10.852 1.00 94.76  ? 91  MET C CG  1 
ATOM   3653 S SD  . MET C 1 89  ? 17.730  1.871   11.641 1.00 92.56  ? 91  MET C SD  1 
ATOM   3654 C CE  . MET C 1 89  ? 18.552  0.308   11.852 1.00 90.44  ? 91  MET C CE  1 
ATOM   3655 N N   . ARG C 1 90  ? 13.715  1.902   7.015  1.00 98.73  ? 92  ARG C N   1 
ATOM   3656 C CA  . ARG C 1 90  ? 13.558  2.620   5.749  1.00 99.91  ? 92  ARG C CA  1 
ATOM   3657 C C   . ARG C 1 90  ? 14.341  3.928   5.788  1.00 98.55  ? 92  ARG C C   1 
ATOM   3658 O O   . ARG C 1 90  ? 14.524  4.503   6.873  1.00 97.58  ? 92  ARG C O   1 
ATOM   3659 C CB  . ARG C 1 90  ? 12.055  2.877   5.428  1.00 101.96 ? 92  ARG C CB  1 
ATOM   3660 C CG  . ARG C 1 90  ? 11.357  4.122   6.092  1.00 103.18 ? 92  ARG C CG  1 
ATOM   3661 C CD  . ARG C 1 90  ? 9.907   3.819   6.612  1.00 106.38 ? 92  ARG C CD  1 
ATOM   3662 N NE  . ARG C 1 90  ? 9.020   3.184   5.615  1.00 110.53 ? 92  ARG C NE  1 
ATOM   3663 C CZ  . ARG C 1 90  ? 8.658   1.889   5.599  1.00 110.92 ? 92  ARG C CZ  1 
ATOM   3664 N NH1 . ARG C 1 90  ? 9.107   1.048   6.532  1.00 109.63 ? 92  ARG C NH1 1 
ATOM   3665 N NH2 . ARG C 1 90  ? 7.839   1.428   4.642  1.00 110.88 ? 92  ARG C NH2 1 
ATOM   3666 N N   . PRO C 1 91  ? 14.829  4.390   4.614  1.00 98.66  ? 93  PRO C N   1 
ATOM   3667 C CA  . PRO C 1 91  ? 15.481  5.716   4.468  1.00 97.87  ? 93  PRO C CA  1 
ATOM   3668 C C   . PRO C 1 91  ? 14.685  6.913   5.014  1.00 97.42  ? 93  PRO C C   1 
ATOM   3669 O O   . PRO C 1 91  ? 13.553  6.750   5.461  1.00 98.08  ? 93  PRO C O   1 
ATOM   3670 C CB  . PRO C 1 91  ? 15.684  5.833   2.949  1.00 98.96  ? 93  PRO C CB  1 
ATOM   3671 C CG  . PRO C 1 91  ? 15.865  4.414   2.504  1.00 99.20  ? 93  PRO C CG  1 
ATOM   3672 C CD  . PRO C 1 91  ? 14.876  3.624   3.349  1.00 99.61  ? 93  PRO C CD  1 
ATOM   3673 N N   . GLY C 1 92  ? 15.301  8.091   5.021  1.00 96.55  ? 94  GLY C N   1 
ATOM   3674 C CA  . GLY C 1 92  ? 14.580  9.339   5.284  1.00 96.02  ? 94  GLY C CA  1 
ATOM   3675 C C   . GLY C 1 92  ? 14.190  9.756   6.704  1.00 94.91  ? 94  GLY C C   1 
ATOM   3676 O O   . GLY C 1 92  ? 13.670  10.869  6.864  1.00 95.67  ? 94  GLY C O   1 
ATOM   3677 N N   . ASN C 1 93  ? 14.395  8.904   7.727  1.00 92.73  ? 95  ASN C N   1 
ATOM   3678 C CA  . ASN C 1 93  ? 14.225  9.346   9.161  1.00 91.53  ? 95  ASN C CA  1 
ATOM   3679 C C   . ASN C 1 93  ? 15.357  8.913   10.087 1.00 88.85  ? 95  ASN C C   1 
ATOM   3680 O O   . ASN C 1 93  ? 15.950  7.843   9.902  1.00 88.42  ? 95  ASN C O   1 
ATOM   3681 C CB  . ASN C 1 93  ? 12.881  8.917   9.796  1.00 92.49  ? 95  ASN C CB  1 
ATOM   3682 C CG  . ASN C 1 93  ? 11.681  9.174   8.889  1.00 94.32  ? 95  ASN C CG  1 
ATOM   3683 O OD1 . ASN C 1 93  ? 10.830  10.029  9.187  1.00 96.05  ? 95  ASN C OD1 1 
ATOM   3684 N ND2 . ASN C 1 93  ? 11.608  8.433   7.776  1.00 91.87  ? 95  ASN C ND2 1 
ATOM   3685 N N   . LYS C 1 94  ? 15.651  9.728   11.096 1.00 86.83  ? 96  LYS C N   1 
ATOM   3686 C CA  . LYS C 1 94  ? 16.826  9.450   11.948 1.00 83.42  ? 96  LYS C CA  1 
ATOM   3687 C C   . LYS C 1 94  ? 16.471  8.491   13.097 1.00 81.30  ? 96  LYS C C   1 
ATOM   3688 O O   . LYS C 1 94  ? 15.564  8.786   13.885 1.00 81.96  ? 96  LYS C O   1 
ATOM   3689 C CB  . LYS C 1 94  ? 17.485  10.750  12.460 1.00 83.18  ? 96  LYS C CB  1 
ATOM   3690 C CG  . LYS C 1 94  ? 16.796  12.083  12.046 1.00 85.38  ? 96  LYS C CG  1 
ATOM   3691 C CD  . LYS C 1 94  ? 17.592  13.369  12.441 1.00 85.77  ? 96  LYS C CD  1 
ATOM   3692 C CE  . LYS C 1 94  ? 19.133  13.332  12.111 1.00 85.52  ? 96  LYS C CE  1 
ATOM   3693 N NZ  . LYS C 1 94  ? 19.512  13.481  10.648 1.00 85.13  ? 96  LYS C NZ  1 
ATOM   3694 N N   . TYR C 1 95  ? 17.158  7.349   13.169 1.00 77.97  ? 97  TYR C N   1 
ATOM   3695 C CA  . TYR C 1 95  ? 16.933  6.378   14.248 1.00 76.10  ? 97  TYR C CA  1 
ATOM   3696 C C   . TYR C 1 95  ? 17.878  6.607   15.437 1.00 72.60  ? 97  TYR C C   1 
ATOM   3697 O O   . TYR C 1 95  ? 19.090  6.487   15.349 1.00 70.95  ? 97  TYR C O   1 
ATOM   3698 C CB  . TYR C 1 95  ? 16.967  4.918   13.739 1.00 77.02  ? 97  TYR C CB  1 
ATOM   3699 C CG  . TYR C 1 95  ? 16.108  4.724   12.513 1.00 82.55  ? 97  TYR C CG  1 
ATOM   3700 C CD1 . TYR C 1 95  ? 14.705  4.644   12.613 1.00 86.20  ? 97  TYR C CD1 1 
ATOM   3701 C CD2 . TYR C 1 95  ? 16.682  4.692   11.226 1.00 85.45  ? 97  TYR C CD2 1 
ATOM   3702 C CE1 . TYR C 1 95  ? 13.896  4.510   11.457 1.00 88.68  ? 97  TYR C CE1 1 
ATOM   3703 C CE2 . TYR C 1 95  ? 15.878  4.541   10.058 1.00 87.10  ? 97  TYR C CE2 1 
ATOM   3704 C CZ  . TYR C 1 95  ? 14.493  4.455   10.186 1.00 89.88  ? 97  TYR C CZ  1 
ATOM   3705 O OH  . TYR C 1 95  ? 13.709  4.313   9.052  1.00 92.87  ? 97  TYR C OH  1 
ATOM   3706 N N   . GLU C 1 96  ? 17.277  6.957   16.560 1.00 70.92  ? 98  GLU C N   1 
ATOM   3707 C CA  . GLU C 1 96  ? 18.000  7.387   17.730 1.00 67.75  ? 98  GLU C CA  1 
ATOM   3708 C C   . GLU C 1 96  ? 17.800  6.423   18.878 1.00 65.90  ? 98  GLU C C   1 
ATOM   3709 O O   . GLU C 1 96  ? 16.730  6.331   19.421 1.00 66.85  ? 98  GLU C O   1 
ATOM   3710 C CB  . GLU C 1 96  ? 17.531  8.761   18.130 1.00 68.01  ? 98  GLU C CB  1 
ATOM   3711 C CG  . GLU C 1 96  ? 17.759  9.802   17.074 1.00 69.54  ? 98  GLU C CG  1 
ATOM   3712 C CD  . GLU C 1 96  ? 17.327  11.161  17.585 1.00 75.22  ? 98  GLU C CD  1 
ATOM   3713 O OE1 . GLU C 1 96  ? 16.503  11.212  18.531 1.00 74.23  ? 98  GLU C OE1 1 
ATOM   3714 O OE2 . GLU C 1 96  ? 17.826  12.192  17.072 1.00 78.98  ? 98  GLU C OE2 1 
ATOM   3715 N N   . TYR C 1 97  ? 18.862  5.716   19.238 1.00 62.89  ? 99  TYR C N   1 
ATOM   3716 C CA  . TYR C 1 97  ? 18.894  4.831   20.377 1.00 60.67  ? 99  TYR C CA  1 
ATOM   3717 C C   . TYR C 1 97  ? 19.495  5.524   21.606 1.00 58.73  ? 99  TYR C C   1 
ATOM   3718 O O   . TYR C 1 97  ? 20.652  5.892   21.608 1.00 58.08  ? 99  TYR C O   1 
ATOM   3719 C CB  . TYR C 1 97  ? 19.792  3.690   19.998 1.00 59.65  ? 99  TYR C CB  1 
ATOM   3720 C CG  . TYR C 1 97  ? 19.170  2.720   19.067 1.00 61.46  ? 99  TYR C CG  1 
ATOM   3721 C CD1 . TYR C 1 97  ? 18.546  1.586   19.579 1.00 63.61  ? 99  TYR C CD1 1 
ATOM   3722 C CD2 . TYR C 1 97  ? 19.196  2.906   17.671 1.00 61.06  ? 99  TYR C CD2 1 
ATOM   3723 C CE1 . TYR C 1 97  ? 17.965  0.665   18.760 1.00 64.68  ? 99  TYR C CE1 1 
ATOM   3724 C CE2 . TYR C 1 97  ? 18.607  1.971   16.827 1.00 61.14  ? 99  TYR C CE2 1 
ATOM   3725 C CZ  . TYR C 1 97  ? 17.985  0.857   17.396 1.00 64.09  ? 99  TYR C CZ  1 
ATOM   3726 O OH  . TYR C 1 97  ? 17.385  -0.134  16.664 1.00 66.49  ? 99  TYR C OH  1 
ATOM   3727 N N   . LYS C 1 98  ? 18.747  5.686   22.674 1.00 58.35  ? 100 LYS C N   1 
ATOM   3728 C CA  . LYS C 1 98  ? 19.309  6.397   23.838 1.00 57.03  ? 100 LYS C CA  1 
ATOM   3729 C C   . LYS C 1 98  ? 20.141  5.510   24.742 1.00 54.41  ? 100 LYS C C   1 
ATOM   3730 O O   . LYS C 1 98  ? 19.794  4.344   24.936 1.00 53.75  ? 100 LYS C O   1 
ATOM   3731 C CB  . LYS C 1 98  ? 18.215  7.073   24.667 1.00 58.49  ? 100 LYS C CB  1 
ATOM   3732 C CG  . LYS C 1 98  ? 17.797  8.401   24.107 1.00 62.14  ? 100 LYS C CG  1 
ATOM   3733 C CD  . LYS C 1 98  ? 16.296  8.584   24.334 1.00 70.93  ? 100 LYS C CD  1 
ATOM   3734 C CE  . LYS C 1 98  ? 16.021  9.349   25.633 1.00 74.99  ? 100 LYS C CE  1 
ATOM   3735 N NZ  . LYS C 1 98  ? 14.630  9.853   25.612 1.00 78.64  ? 100 LYS C NZ  1 
ATOM   3736 N N   . PHE C 1 99  ? 21.229  6.057   25.302 1.00 51.96  ? 101 PHE C N   1 
ATOM   3737 C CA  . PHE C 1 99  ? 22.022  5.292   26.260 1.00 49.84  ? 101 PHE C CA  1 
ATOM   3738 C C   . PHE C 1 99  ? 22.554  6.177   27.328 1.00 49.84  ? 101 PHE C C   1 
ATOM   3739 O O   . PHE C 1 99  ? 22.805  7.364   27.099 1.00 49.28  ? 101 PHE C O   1 
ATOM   3740 C CB  . PHE C 1 99  ? 23.204  4.593   25.589 1.00 47.64  ? 101 PHE C CB  1 
ATOM   3741 C CG  . PHE C 1 99  ? 24.260  5.524   25.150 1.00 43.57  ? 101 PHE C CG  1 
ATOM   3742 C CD1 . PHE C 1 99  ? 25.228  5.961   26.050 1.00 39.66  ? 101 PHE C CD1 1 
ATOM   3743 C CD2 . PHE C 1 99  ? 24.298  5.985   23.827 1.00 42.91  ? 101 PHE C CD2 1 
ATOM   3744 C CE1 . PHE C 1 99  ? 26.251  6.843   25.642 1.00 38.88  ? 101 PHE C CE1 1 
ATOM   3745 C CE2 . PHE C 1 99  ? 25.314  6.889   23.387 1.00 41.19  ? 101 PHE C CE2 1 
ATOM   3746 C CZ  . PHE C 1 99  ? 26.290  7.335   24.309 1.00 38.31  ? 101 PHE C CZ  1 
ATOM   3747 N N   . GLY C 1 100 ? 22.765  5.562   28.486 1.00 50.25  ? 102 GLY C N   1 
ATOM   3748 C CA  . GLY C 1 100 ? 23.326  6.247   29.648 1.00 51.19  ? 102 GLY C CA  1 
ATOM   3749 C C   . GLY C 1 100 ? 24.038  5.281   30.585 1.00 51.54  ? 102 GLY C C   1 
ATOM   3750 O O   . GLY C 1 100 ? 23.835  4.063   30.519 1.00 52.09  ? 102 GLY C O   1 
ATOM   3751 N N   . PHE C 1 101 ? 24.932  5.822   31.410 1.00 51.59  ? 103 PHE C N   1 
ATOM   3752 C CA  . PHE C 1 101 ? 25.570  5.077   32.523 1.00 51.31  ? 103 PHE C CA  1 
ATOM   3753 C C   . PHE C 1 101 ? 26.346  6.066   33.381 1.00 52.22  ? 103 PHE C C   1 
ATOM   3754 O O   . PHE C 1 101 ? 26.655  7.230   32.981 1.00 51.08  ? 103 PHE C O   1 
ATOM   3755 C CB  . PHE C 1 101 ? 26.489  4.007   32.017 1.00 48.46  ? 103 PHE C CB  1 
ATOM   3756 C CG  . PHE C 1 101 ? 27.437  4.517   31.014 1.00 46.66  ? 103 PHE C CG  1 
ATOM   3757 C CD1 . PHE C 1 101 ? 28.617  5.176   31.422 1.00 41.98  ? 103 PHE C CD1 1 
ATOM   3758 C CD2 . PHE C 1 101 ? 27.139  4.433   29.650 1.00 41.80  ? 103 PHE C CD2 1 
ATOM   3759 C CE1 . PHE C 1 101 ? 29.468  5.697   30.479 1.00 38.27  ? 103 PHE C CE1 1 
ATOM   3760 C CE2 . PHE C 1 101 ? 28.007  4.961   28.705 1.00 35.82  ? 103 PHE C CE2 1 
ATOM   3761 C CZ  . PHE C 1 101 ? 29.161  5.566   29.117 1.00 37.40  ? 103 PHE C CZ  1 
ATOM   3762 N N   . GLU C 1 102 ? 26.648  5.609   34.580 1.00 54.47  ? 104 GLU C N   1 
ATOM   3763 C CA  . GLU C 1 102 ? 27.466  6.434   35.430 1.00 56.27  ? 104 GLU C CA  1 
ATOM   3764 C C   . GLU C 1 102 ? 28.887  5.964   35.491 1.00 55.05  ? 104 GLU C C   1 
ATOM   3765 O O   . GLU C 1 102 ? 29.224  4.797   35.254 1.00 54.63  ? 104 GLU C O   1 
ATOM   3766 C CB  . GLU C 1 102 ? 26.876  6.570   36.813 1.00 58.07  ? 104 GLU C CB  1 
ATOM   3767 C CG  . GLU C 1 102 ? 25.475  7.221   36.787 1.00 64.11  ? 104 GLU C CG  1 
ATOM   3768 C CD  . GLU C 1 102 ? 24.787  7.157   38.150 1.00 70.82  ? 104 GLU C CD  1 
ATOM   3769 O OE1 . GLU C 1 102 ? 25.523  7.190   39.196 1.00 73.05  ? 104 GLU C OE1 1 
ATOM   3770 O OE2 . GLU C 1 102 ? 23.527  7.053   38.167 1.00 72.24  ? 104 GLU C OE2 1 
ATOM   3771 N N   . LEU C 1 103 ? 29.737  6.923   35.777 1.00 55.20  ? 105 LEU C N   1 
ATOM   3772 C CA  . LEU C 1 103 ? 31.082  6.597   36.088 1.00 54.59  ? 105 LEU C CA  1 
ATOM   3773 C C   . LEU C 1 103 ? 31.109  6.129   37.547 1.00 56.30  ? 105 LEU C C   1 
ATOM   3774 O O   . LEU C 1 103 ? 30.470  6.754   38.441 1.00 56.47  ? 105 LEU C O   1 
ATOM   3775 C CB  . LEU C 1 103 ? 31.972  7.808   35.830 1.00 53.49  ? 105 LEU C CB  1 
ATOM   3776 C CG  . LEU C 1 103 ? 31.996  8.164   34.339 1.00 51.23  ? 105 LEU C CG  1 
ATOM   3777 C CD1 . LEU C 1 103 ? 32.873  9.364   34.098 1.00 47.48  ? 105 LEU C CD1 1 
ATOM   3778 C CD2 . LEU C 1 103 ? 32.455  6.937   33.556 1.00 48.07  ? 105 LEU C CD2 1 
ATOM   3779 N N   . PRO C 1 104 ? 31.836  5.024   37.778 1.00 56.95  ? 106 PRO C N   1 
ATOM   3780 C CA  . PRO C 1 104 ? 32.108  4.484   39.089 1.00 57.77  ? 106 PRO C CA  1 
ATOM   3781 C C   . PRO C 1 104 ? 32.569  5.570   40.034 1.00 57.89  ? 106 PRO C C   1 
ATOM   3782 O O   . PRO C 1 104 ? 32.935  6.684   39.626 1.00 56.48  ? 106 PRO C O   1 
ATOM   3783 C CB  . PRO C 1 104 ? 33.266  3.485   38.850 1.00 57.09  ? 106 PRO C CB  1 
ATOM   3784 C CG  . PRO C 1 104 ? 33.111  3.031   37.476 1.00 57.27  ? 106 PRO C CG  1 
ATOM   3785 C CD  . PRO C 1 104 ? 32.516  4.247   36.721 1.00 57.02  ? 106 PRO C CD  1 
ATOM   3786 N N   . GLN C 1 105 ? 32.556  5.178   41.298 1.00 59.55  ? 107 GLN C N   1 
ATOM   3787 C CA  . GLN C 1 105 ? 32.639  6.061   42.423 1.00 61.45  ? 107 GLN C CA  1 
ATOM   3788 C C   . GLN C 1 105 ? 34.007  6.595   42.641 1.00 61.05  ? 107 GLN C C   1 
ATOM   3789 O O   . GLN C 1 105 ? 34.162  7.763   43.025 1.00 61.18  ? 107 GLN C O   1 
ATOM   3790 C CB  . GLN C 1 105 ? 32.193  5.323   43.694 1.00 62.58  ? 107 GLN C CB  1 
ATOM   3791 C CG  . GLN C 1 105 ? 30.787  5.704   44.065 1.00 67.32  ? 107 GLN C CG  1 
ATOM   3792 C CD  . GLN C 1 105 ? 30.517  7.164   43.656 1.00 71.69  ? 107 GLN C CD  1 
ATOM   3793 O OE1 . GLN C 1 105 ? 31.368  8.036   43.877 1.00 72.94  ? 107 GLN C OE1 1 
ATOM   3794 N NE2 . GLN C 1 105 ? 29.363  7.423   43.010 1.00 72.80  ? 107 GLN C NE2 1 
ATOM   3795 N N   . GLY C 1 106 ? 34.986  5.738   42.365 1.00 60.40  ? 108 GLY C N   1 
ATOM   3796 C CA  . GLY C 1 106 ? 36.241  5.795   43.071 1.00 61.30  ? 108 GLY C CA  1 
ATOM   3797 C C   . GLY C 1 106 ? 37.159  6.791   42.447 1.00 61.27  ? 108 GLY C C   1 
ATOM   3798 O O   . GLY C 1 106 ? 36.739  7.847   42.041 1.00 62.23  ? 108 GLY C O   1 
ATOM   3799 N N   . PRO C 1 107 ? 38.435  6.448   42.376 1.00 60.90  ? 109 PRO C N   1 
ATOM   3800 C CA  . PRO C 1 107 ? 39.366  7.224   41.593 1.00 60.42  ? 109 PRO C CA  1 
ATOM   3801 C C   . PRO C 1 107 ? 39.428  6.616   40.192 1.00 60.55  ? 109 PRO C C   1 
ATOM   3802 O O   . PRO C 1 107 ? 39.608  5.401   40.044 1.00 61.00  ? 109 PRO C O   1 
ATOM   3803 C CB  . PRO C 1 107 ? 40.675  6.985   42.327 1.00 60.02  ? 109 PRO C CB  1 
ATOM   3804 C CG  . PRO C 1 107 ? 40.553  5.521   42.801 1.00 59.94  ? 109 PRO C CG  1 
ATOM   3805 C CD  . PRO C 1 107 ? 39.064  5.283   43.041 1.00 60.66  ? 109 PRO C CD  1 
ATOM   3806 N N   . LEU C 1 108 ? 39.273  7.435   39.164 1.00 60.58  ? 110 LEU C N   1 
ATOM   3807 C CA  . LEU C 1 108 ? 39.367  6.957   37.786 1.00 60.24  ? 110 LEU C CA  1 
ATOM   3808 C C   . LEU C 1 108 ? 40.746  7.276   37.184 1.00 61.01  ? 110 LEU C C   1 
ATOM   3809 O O   . LEU C 1 108 ? 41.407  8.230   37.617 1.00 62.85  ? 110 LEU C O   1 
ATOM   3810 C CB  . LEU C 1 108 ? 38.278  7.610   36.984 1.00 60.27  ? 110 LEU C CB  1 
ATOM   3811 C CG  . LEU C 1 108 ? 36.962  7.742   37.746 1.00 59.50  ? 110 LEU C CG  1 
ATOM   3812 C CD1 . LEU C 1 108 ? 35.924  8.200   36.768 1.00 57.25  ? 110 LEU C CD1 1 
ATOM   3813 C CD2 . LEU C 1 108 ? 36.525  6.446   38.464 1.00 59.79  ? 110 LEU C CD2 1 
ATOM   3814 N N   . GLY C 1 109 ? 41.200  6.525   36.182 1.00 60.26  ? 111 GLY C N   1 
ATOM   3815 C CA  . GLY C 1 109 ? 42.634  6.603   35.803 1.00 59.24  ? 111 GLY C CA  1 
ATOM   3816 C C   . GLY C 1 109 ? 43.135  8.008   35.442 1.00 59.06  ? 111 GLY C C   1 
ATOM   3817 O O   . GLY C 1 109 ? 44.350  8.316   35.541 1.00 60.60  ? 111 GLY C O   1 
ATOM   3818 N N   . THR C 1 110 ? 42.184  8.838   35.011 1.00 57.36  ? 112 THR C N   1 
ATOM   3819 C CA  . THR C 1 110 ? 42.359  10.227  34.515 1.00 55.36  ? 112 THR C CA  1 
ATOM   3820 C C   . THR C 1 110 ? 43.002  10.546  33.119 1.00 59.02  ? 112 THR C C   1 
ATOM   3821 O O   . THR C 1 110 ? 44.123  11.091  33.077 1.00 60.84  ? 112 THR C O   1 
ATOM   3822 C CB  . THR C 1 110 ? 42.902  11.180  35.606 1.00 51.20  ? 112 THR C CB  1 
ATOM   3823 O OG1 . THR C 1 110 ? 43.638  12.255  34.990 1.00 44.74  ? 112 THR C OG1 1 
ATOM   3824 C CG2 . THR C 1 110 ? 43.819  10.459  36.588 1.00 47.26  ? 112 THR C CG2 1 
ATOM   3825 N N   . SER C 1 111 ? 42.279  10.271  32.010 1.00 60.78  ? 113 SER C N   1 
ATOM   3826 C CA  . SER C 1 111 ? 42.717  10.535  30.605 1.00 63.44  ? 113 SER C CA  1 
ATOM   3827 C C   . SER C 1 111 ? 44.147  11.127  30.395 1.00 65.72  ? 113 SER C C   1 
ATOM   3828 O O   . SER C 1 111 ? 44.402  12.285  30.747 1.00 66.83  ? 113 SER C O   1 
ATOM   3829 C CB  . SER C 1 111 ? 41.625  11.315  29.837 1.00 64.60  ? 113 SER C CB  1 
ATOM   3830 O OG  . SER C 1 111 ? 40.533  10.463  29.460 1.00 61.35  ? 113 SER C OG  1 
ATOM   3831 N N   . PHE C 1 112 ? 45.048  10.312  29.808 1.00 67.40  ? 114 PHE C N   1 
ATOM   3832 C CA  . PHE C 1 112 ? 46.531  10.455  29.881 1.00 69.69  ? 114 PHE C CA  1 
ATOM   3833 C C   . PHE C 1 112 ? 46.994  9.816   28.567 1.00 70.98  ? 114 PHE C C   1 
ATOM   3834 O O   . PHE C 1 112 ? 46.277  9.006   27.983 1.00 70.71  ? 114 PHE C O   1 
ATOM   3835 C CB  . PHE C 1 112 ? 47.046  9.634   31.118 1.00 69.27  ? 114 PHE C CB  1 
ATOM   3836 C CG  . PHE C 1 112 ? 48.491  9.925   31.612 1.00 71.26  ? 114 PHE C CG  1 
ATOM   3837 C CD1 . PHE C 1 112 ? 49.615  9.764   30.789 1.00 74.27  ? 114 PHE C CD1 1 
ATOM   3838 C CD2 . PHE C 1 112 ? 48.714  10.224  32.975 1.00 72.23  ? 114 PHE C CD2 1 
ATOM   3839 C CE1 . PHE C 1 112 ? 50.959  9.992   31.294 1.00 75.24  ? 114 PHE C CE1 1 
ATOM   3840 C CE2 . PHE C 1 112 ? 50.048  10.452  33.499 1.00 72.30  ? 114 PHE C CE2 1 
ATOM   3841 C CZ  . PHE C 1 112 ? 51.166  10.336  32.646 1.00 74.47  ? 114 PHE C CZ  1 
ATOM   3842 N N   . LYS C 1 113 ? 48.173  10.194  28.084 1.00 73.16  ? 115 LYS C N   1 
ATOM   3843 C CA  . LYS C 1 113 ? 48.884  9.492   26.997 1.00 74.59  ? 115 LYS C CA  1 
ATOM   3844 C C   . LYS C 1 113 ? 50.294  9.992   27.110 1.00 75.50  ? 115 LYS C C   1 
ATOM   3845 O O   . LYS C 1 113 ? 50.740  10.754  26.278 1.00 77.87  ? 115 LYS C O   1 
ATOM   3846 C CB  . LYS C 1 113 ? 48.325  9.828   25.614 1.00 75.52  ? 115 LYS C CB  1 
ATOM   3847 C CG  . LYS C 1 113 ? 47.398  8.789   25.070 1.00 76.39  ? 115 LYS C CG  1 
ATOM   3848 C CD  . LYS C 1 113 ? 47.149  9.078   23.624 1.00 81.24  ? 115 LYS C CD  1 
ATOM   3849 C CE  . LYS C 1 113 ? 47.675  7.948   22.776 1.00 84.59  ? 115 LYS C CE  1 
ATOM   3850 N NZ  . LYS C 1 113 ? 48.696  8.498   21.834 1.00 87.86  ? 115 LYS C NZ  1 
ATOM   3851 N N   . GLY C 1 114 ? 50.976  9.572   28.167 1.00 74.82  ? 116 GLY C N   1 
ATOM   3852 C CA  . GLY C 1 114 ? 52.252  10.175  28.587 1.00 74.82  ? 116 GLY C CA  1 
ATOM   3853 C C   . GLY C 1 114 ? 53.353  9.145   28.772 1.00 74.22  ? 116 GLY C C   1 
ATOM   3854 O O   . GLY C 1 114 ? 53.466  8.189   27.977 1.00 74.91  ? 116 GLY C O   1 
ATOM   3855 N N   . LYS C 1 115 ? 54.176  9.319   29.806 1.00 72.51  ? 117 LYS C N   1 
ATOM   3856 C CA  . LYS C 1 115 ? 55.423  8.567   29.780 1.00 71.44  ? 117 LYS C CA  1 
ATOM   3857 C C   . LYS C 1 115 ? 55.192  7.061   29.966 1.00 68.42  ? 117 LYS C C   1 
ATOM   3858 O O   . LYS C 1 115 ? 55.496  6.253   29.064 1.00 68.76  ? 117 LYS C O   1 
ATOM   3859 C CB  . LYS C 1 115 ? 56.478  9.144   30.733 1.00 72.59  ? 117 LYS C CB  1 
ATOM   3860 C CG  . LYS C 1 115 ? 57.909  9.040   30.143 1.00 75.66  ? 117 LYS C CG  1 
ATOM   3861 C CD  . LYS C 1 115 ? 58.992  8.848   31.206 1.00 78.26  ? 117 LYS C CD  1 
ATOM   3862 C CE  . LYS C 1 115 ? 59.295  10.144  31.985 1.00 80.66  ? 117 LYS C CE  1 
ATOM   3863 N NZ  . LYS C 1 115 ? 60.769  10.272  32.326 1.00 84.31  ? 117 LYS C NZ  1 
ATOM   3864 N N   . TYR C 1 116 ? 54.609  6.681   31.092 1.00 63.83  ? 118 TYR C N   1 
ATOM   3865 C CA  . TYR C 1 116 ? 54.375  5.260   31.300 1.00 61.56  ? 118 TYR C CA  1 
ATOM   3866 C C   . TYR C 1 116 ? 52.952  4.782   30.990 1.00 59.93  ? 118 TYR C C   1 
ATOM   3867 O O   . TYR C 1 116 ? 52.330  4.089   31.747 1.00 57.80  ? 118 TYR C O   1 
ATOM   3868 C CB  . TYR C 1 116 ? 54.825  4.872   32.686 1.00 59.86  ? 118 TYR C CB  1 
ATOM   3869 C CG  . TYR C 1 116 ? 56.153  5.465   33.088 1.00 57.99  ? 118 TYR C CG  1 
ATOM   3870 C CD1 . TYR C 1 116 ? 57.332  4.805   32.827 1.00 59.09  ? 118 TYR C CD1 1 
ATOM   3871 C CD2 . TYR C 1 116 ? 56.217  6.674   33.760 1.00 56.27  ? 118 TYR C CD2 1 
ATOM   3872 C CE1 . TYR C 1 116 ? 58.552  5.339   33.229 1.00 61.87  ? 118 TYR C CE1 1 
ATOM   3873 C CE2 . TYR C 1 116 ? 57.407  7.210   34.171 1.00 55.98  ? 118 TYR C CE2 1 
ATOM   3874 C CZ  . TYR C 1 116 ? 58.569  6.544   33.903 1.00 60.06  ? 118 TYR C CZ  1 
ATOM   3875 O OH  . TYR C 1 116 ? 59.760  7.079   34.302 1.00 63.61  ? 118 TYR C OH  1 
ATOM   3876 N N   . GLY C 1 117 ? 52.455  5.180   29.832 1.00 61.64  ? 119 GLY C N   1 
ATOM   3877 C CA  . GLY C 1 117 ? 51.171  4.712   29.318 1.00 61.04  ? 119 GLY C CA  1 
ATOM   3878 C C   . GLY C 1 117 ? 49.999  5.659   29.442 1.00 60.01  ? 119 GLY C C   1 
ATOM   3879 O O   . GLY C 1 117 ? 50.143  6.853   29.765 1.00 60.08  ? 119 GLY C O   1 
ATOM   3880 N N   . CYS C 1 118 ? 48.819  5.086   29.226 1.00 58.88  ? 120 CYS C N   1 
ATOM   3881 C CA  . CYS C 1 118 ? 47.592  5.862   28.997 1.00 57.61  ? 120 CYS C CA  1 
ATOM   3882 C C   . CYS C 1 118 ? 46.352  5.384   29.714 1.00 54.59  ? 120 CYS C C   1 
ATOM   3883 O O   . CYS C 1 118 ? 46.345  4.343   30.358 1.00 54.34  ? 120 CYS C O   1 
ATOM   3884 C CB  . CYS C 1 118 ? 47.295  5.787   27.520 1.00 59.29  ? 120 CYS C CB  1 
ATOM   3885 S SG  . CYS C 1 118 ? 47.729  4.172   27.036 1.00 62.79  ? 120 CYS C SG  1 
ATOM   3886 N N   . VAL C 1 119 ? 45.293  6.164   29.566 1.00 52.41  ? 121 VAL C N   1 
ATOM   3887 C CA  . VAL C 1 119 ? 43.984  5.830   30.097 1.00 49.89  ? 121 VAL C CA  1 
ATOM   3888 C C   . VAL C 1 119 ? 42.985  6.239   29.051 1.00 49.02  ? 121 VAL C C   1 
ATOM   3889 O O   . VAL C 1 119 ? 42.912  7.440   28.748 1.00 50.67  ? 121 VAL C O   1 
ATOM   3890 C CB  . VAL C 1 119 ? 43.655  6.693   31.313 1.00 49.55  ? 121 VAL C CB  1 
ATOM   3891 C CG1 . VAL C 1 119 ? 42.387  6.211   31.917 1.00 48.72  ? 121 VAL C CG1 1 
ATOM   3892 C CG2 . VAL C 1 119 ? 44.790  6.678   32.341 1.00 49.53  ? 121 VAL C CG2 1 
ATOM   3893 N N   . ASP C 1 120 ? 42.211  5.308   28.494 1.00 46.57  ? 122 ASP C N   1 
ATOM   3894 C CA  . ASP C 1 120 ? 41.167  5.688   27.537 1.00 45.17  ? 122 ASP C CA  1 
ATOM   3895 C C   . ASP C 1 120 ? 39.800  5.224   27.980 1.00 42.87  ? 122 ASP C C   1 
ATOM   3896 O O   . ASP C 1 120 ? 39.644  4.102   28.509 1.00 42.07  ? 122 ASP C O   1 
ATOM   3897 C CB  . ASP C 1 120 ? 41.447  5.125   26.150 1.00 47.34  ? 122 ASP C CB  1 
ATOM   3898 C CG  . ASP C 1 120 ? 42.889  4.853   25.951 1.00 52.71  ? 122 ASP C CG  1 
ATOM   3899 O OD1 . ASP C 1 120 ? 43.371  3.783   26.443 1.00 57.13  ? 122 ASP C OD1 1 
ATOM   3900 O OD2 . ASP C 1 120 ? 43.566  5.740   25.381 1.00 56.61  ? 122 ASP C OD2 1 
ATOM   3901 N N   . TYR C 1 121 ? 38.822  6.110   27.774 1.00 40.19  ? 123 TYR C N   1 
ATOM   3902 C CA  . TYR C 1 121 ? 37.434  5.793   27.905 1.00 37.63  ? 123 TYR C CA  1 
ATOM   3903 C C   . TYR C 1 121 ? 36.844  6.108   26.539 1.00 37.86  ? 123 TYR C C   1 
ATOM   3904 O O   . TYR C 1 121 ? 37.243  7.087   25.875 1.00 36.63  ? 123 TYR C O   1 
ATOM   3905 C CB  . TYR C 1 121 ? 36.796  6.683   28.947 1.00 37.14  ? 123 TYR C CB  1 
ATOM   3906 C CG  . TYR C 1 121 ? 37.291  6.549   30.379 1.00 36.72  ? 123 TYR C CG  1 
ATOM   3907 C CD1 . TYR C 1 121 ? 36.482  5.987   31.346 1.00 38.01  ? 123 TYR C CD1 1 
ATOM   3908 C CD2 . TYR C 1 121 ? 38.541  7.040   30.792 1.00 37.53  ? 123 TYR C CD2 1 
ATOM   3909 C CE1 . TYR C 1 121 ? 36.885  5.885   32.698 1.00 38.05  ? 123 TYR C CE1 1 
ATOM   3910 C CE2 . TYR C 1 121 ? 38.955  6.939   32.133 1.00 37.29  ? 123 TYR C CE2 1 
ATOM   3911 C CZ  . TYR C 1 121 ? 38.098  6.334   33.081 1.00 38.59  ? 123 TYR C CZ  1 
ATOM   3912 O OH  . TYR C 1 121 ? 38.441  6.176   34.416 1.00 39.59  ? 123 TYR C OH  1 
ATOM   3913 N N   . TRP C 1 122 ? 35.899  5.263   26.127 1.00 37.19  ? 124 TRP C N   1 
ATOM   3914 C CA  . TRP C 1 122 ? 35.227  5.371   24.843 1.00 37.60  ? 124 TRP C CA  1 
ATOM   3915 C C   . TRP C 1 122 ? 33.930  4.562   24.909 1.00 36.98  ? 124 TRP C C   1 
ATOM   3916 O O   . TRP C 1 122 ? 33.703  3.798   25.815 1.00 35.69  ? 124 TRP C O   1 
ATOM   3917 C CB  . TRP C 1 122 ? 36.105  4.814   23.714 1.00 38.14  ? 124 TRP C CB  1 
ATOM   3918 C CG  . TRP C 1 122 ? 36.821  3.513   24.072 1.00 43.32  ? 124 TRP C CG  1 
ATOM   3919 C CD1 . TRP C 1 122 ? 38.099  3.412   24.467 1.00 45.29  ? 124 TRP C CD1 1 
ATOM   3920 C CD2 . TRP C 1 122 ? 36.297  2.154   24.109 1.00 46.67  ? 124 TRP C CD2 1 
ATOM   3921 N NE1 . TRP C 1 122 ? 38.422  2.117   24.747 1.00 44.61  ? 124 TRP C NE1 1 
ATOM   3922 C CE2 . TRP C 1 122 ? 37.353  1.316   24.527 1.00 44.77  ? 124 TRP C CE2 1 
ATOM   3923 C CE3 . TRP C 1 122 ? 35.051  1.572   23.833 1.00 49.24  ? 124 TRP C CE3 1 
ATOM   3924 C CZ2 . TRP C 1 122 ? 37.235  -0.070  24.661 1.00 46.85  ? 124 TRP C CZ2 1 
ATOM   3925 C CZ3 . TRP C 1 122 ? 34.929  0.153   23.964 1.00 51.06  ? 124 TRP C CZ3 1 
ATOM   3926 C CH2 . TRP C 1 122 ? 36.036  -0.641  24.359 1.00 48.75  ? 124 TRP C CH2 1 
ATOM   3927 N N   . VAL C 1 123 ? 33.086  4.722   23.916 1.00 38.47  ? 125 VAL C N   1 
ATOM   3928 C CA  . VAL C 1 123 ? 31.884  3.923   23.814 1.00 39.87  ? 125 VAL C CA  1 
ATOM   3929 C C   . VAL C 1 123 ? 31.914  3.321   22.431 1.00 43.02  ? 125 VAL C C   1 
ATOM   3930 O O   . VAL C 1 123 ? 32.238  4.012   21.456 1.00 42.94  ? 125 VAL C O   1 
ATOM   3931 C CB  . VAL C 1 123 ? 30.632  4.774   23.970 1.00 39.51  ? 125 VAL C CB  1 
ATOM   3932 C CG1 . VAL C 1 123 ? 29.456  4.054   23.491 1.00 37.45  ? 125 VAL C CG1 1 
ATOM   3933 C CG2 . VAL C 1 123 ? 30.491  5.256   25.417 1.00 36.52  ? 125 VAL C CG2 1 
ATOM   3934 N N   . LYS C 1 124 ? 31.651  2.014   22.398 1.00 46.42  ? 126 LYS C N   1 
ATOM   3935 C CA  . LYS C 1 124 ? 31.643  1.209   21.188 1.00 50.81  ? 126 LYS C CA  1 
ATOM   3936 C C   . LYS C 1 124 ? 30.189  0.846   20.908 1.00 53.07  ? 126 LYS C C   1 
ATOM   3937 O O   . LYS C 1 124 ? 29.458  0.418   21.841 1.00 52.53  ? 126 LYS C O   1 
ATOM   3938 C CB  . LYS C 1 124 ? 32.431  -0.091  21.407 1.00 51.73  ? 126 LYS C CB  1 
ATOM   3939 C CG  . LYS C 1 124 ? 33.256  -0.601  20.202 1.00 55.23  ? 126 LYS C CG  1 
ATOM   3940 C CD  . LYS C 1 124 ? 34.694  -0.041  20.177 1.00 58.20  ? 126 LYS C CD  1 
ATOM   3941 C CE  . LYS C 1 124 ? 35.743  -1.005  20.762 1.00 61.04  ? 126 LYS C CE  1 
ATOM   3942 N NZ  . LYS C 1 124 ? 36.447  -1.846  19.714 1.00 66.02  ? 126 LYS C NZ  1 
ATOM   3943 N N   . ALA C 1 125 ? 29.778  1.049   19.645 1.00 55.11  ? 127 ALA C N   1 
ATOM   3944 C CA  . ALA C 1 125 ? 28.443  0.693   19.176 1.00 57.67  ? 127 ALA C CA  1 
ATOM   3945 C C   . ALA C 1 125 ? 28.531  -0.373  18.086 1.00 60.59  ? 127 ALA C C   1 
ATOM   3946 O O   . ALA C 1 125 ? 29.095  -0.150  16.999 1.00 61.36  ? 127 ALA C O   1 
ATOM   3947 C CB  . ALA C 1 125 ? 27.722  1.892   18.679 1.00 56.84  ? 127 ALA C CB  1 
ATOM   3948 N N   . PHE C 1 126 ? 28.005  -1.546  18.398 1.00 62.91  ? 128 PHE C N   1 
ATOM   3949 C CA  . PHE C 1 126 ? 27.931  -2.612  17.427 1.00 66.33  ? 128 PHE C CA  1 
ATOM   3950 C C   . PHE C 1 126 ? 26.593  -2.608  16.777 1.00 68.16  ? 128 PHE C C   1 
ATOM   3951 O O   . PHE C 1 126 ? 25.593  -2.509  17.476 1.00 68.98  ? 128 PHE C O   1 
ATOM   3952 C CB  . PHE C 1 126 ? 27.991  -3.917  18.168 1.00 67.78  ? 128 PHE C CB  1 
ATOM   3953 C CG  . PHE C 1 126 ? 29.083  -3.984  19.170 1.00 68.04  ? 128 PHE C CG  1 
ATOM   3954 C CD1 . PHE C 1 126 ? 30.275  -4.619  18.860 1.00 68.92  ? 128 PHE C CD1 1 
ATOM   3955 C CD2 . PHE C 1 126 ? 28.915  -3.433  20.418 1.00 66.73  ? 128 PHE C CD2 1 
ATOM   3956 C CE1 . PHE C 1 126 ? 31.279  -4.715  19.792 1.00 69.91  ? 128 PHE C CE1 1 
ATOM   3957 C CE2 . PHE C 1 126 ? 29.914  -3.526  21.360 1.00 67.70  ? 128 PHE C CE2 1 
ATOM   3958 C CZ  . PHE C 1 126 ? 31.104  -4.170  21.048 1.00 68.00  ? 128 PHE C CZ  1 
ATOM   3959 N N   . LEU C 1 127 ? 26.540  -2.751  15.458 1.00 70.54  ? 129 LEU C N   1 
ATOM   3960 C CA  . LEU C 1 127 ? 25.250  -2.988  14.768 1.00 72.67  ? 129 LEU C CA  1 
ATOM   3961 C C   . LEU C 1 127 ? 25.099  -4.445  14.158 1.00 75.38  ? 129 LEU C C   1 
ATOM   3962 O O   . LEU C 1 127 ? 26.091  -5.127  13.847 1.00 75.39  ? 129 LEU C O   1 
ATOM   3963 C CB  . LEU C 1 127 ? 25.044  -1.893  13.734 1.00 71.97  ? 129 LEU C CB  1 
ATOM   3964 C CG  . LEU C 1 127 ? 24.264  -2.266  12.492 1.00 74.43  ? 129 LEU C CG  1 
ATOM   3965 C CD1 . LEU C 1 127 ? 22.818  -2.208  12.866 1.00 75.56  ? 129 LEU C CD1 1 
ATOM   3966 C CD2 . LEU C 1 127 ? 24.569  -1.273  11.363 1.00 76.56  ? 129 LEU C CD2 1 
ATOM   3967 N N   . ASP C 1 128 ? 23.868  -4.934  14.024 1.00 77.74  ? 130 ASP C N   1 
ATOM   3968 C CA  . ASP C 1 128 ? 23.634  -6.274  13.417 1.00 80.73  ? 130 ASP C CA  1 
ATOM   3969 C C   . ASP C 1 128 ? 22.516  -6.296  12.326 1.00 82.16  ? 130 ASP C C   1 
ATOM   3970 O O   . ASP C 1 128 ? 21.353  -6.566  12.640 1.00 83.21  ? 130 ASP C O   1 
ATOM   3971 C CB  . ASP C 1 128 ? 23.443  -7.347  14.519 1.00 80.75  ? 130 ASP C CB  1 
ATOM   3972 C CG  . ASP C 1 128 ? 24.411  -7.142  15.693 1.00 80.88  ? 130 ASP C CG  1 
ATOM   3973 O OD1 . ASP C 1 128 ? 24.281  -7.768  16.789 1.00 81.52  ? 130 ASP C OD1 1 
ATOM   3974 O OD2 . ASP C 1 128 ? 25.324  -6.313  15.516 1.00 78.94  ? 130 ASP C OD2 1 
ATOM   3975 N N   . ARG C 1 129 ? 22.896  -5.968  11.075 1.00 82.64  ? 131 ARG C N   1 
ATOM   3976 C CA  . ARG C 1 129 ? 22.058  -6.053  9.849  1.00 83.96  ? 131 ARG C CA  1 
ATOM   3977 C C   . ARG C 1 129 ? 21.452  -7.501  9.612  1.00 85.98  ? 131 ARG C C   1 
ATOM   3978 O O   . ARG C 1 129 ? 21.684  -8.432  10.478 1.00 86.50  ? 131 ARG C O   1 
ATOM   3979 C CB  . ARG C 1 129 ? 22.899  -5.637  8.611  1.00 84.75  ? 131 ARG C CB  1 
ATOM   3980 C CG  . ARG C 1 129 ? 22.887  -4.151  8.160  1.00 84.39  ? 131 ARG C CG  1 
ATOM   3981 C CD  . ARG C 1 129 ? 23.320  -4.036  6.646  1.00 89.96  ? 131 ARG C CD  1 
ATOM   3982 N NE  . ARG C 1 129 ? 23.206  -2.666  6.057  1.00 92.93  ? 131 ARG C NE  1 
ATOM   3983 C CZ  . ARG C 1 129 ? 22.624  -2.340  4.876  1.00 93.46  ? 131 ARG C CZ  1 
ATOM   3984 N NH1 . ARG C 1 129 ? 22.091  -3.278  4.094  1.00 93.16  ? 131 ARG C NH1 1 
ATOM   3985 N NH2 . ARG C 1 129 ? 22.576  -1.059  4.461  1.00 91.66  ? 131 ARG C NH2 1 
ATOM   3986 N N   . PRO C 1 130 ? 20.670  -7.703  8.473  1.00 86.16  ? 132 PRO C N   1 
ATOM   3987 C CA  . PRO C 1 130 ? 20.060  -8.987  7.983  1.00 88.26  ? 132 PRO C CA  1 
ATOM   3988 C C   . PRO C 1 130 ? 20.706  -10.294 8.443  1.00 89.71  ? 132 PRO C C   1 
ATOM   3989 O O   . PRO C 1 130 ? 20.269  -10.910 9.453  1.00 90.11  ? 132 PRO C O   1 
ATOM   3990 C CB  . PRO C 1 130 ? 20.206  -8.869  6.449  1.00 81.58  ? 132 PRO C CB  1 
ATOM   3991 C CG  . PRO C 1 130 ? 19.905  -7.349  6.175  1.00 80.14  ? 132 PRO C CG  1 
ATOM   3992 C CD  . PRO C 1 130 ? 20.247  -6.604  7.571  1.00 77.88  ? 132 PRO C CD  1 
ATOM   3993 N N   . SER C 1 131 ? 21.736  -10.682 7.689  1.00 90.67  ? 133 SER C N   1 
ATOM   3994 C CA  . SER C 1 131 ? 22.491  -11.885 7.930  1.00 92.31  ? 133 SER C CA  1 
ATOM   3995 C C   . SER C 1 131 ? 23.974  -11.587 7.821  1.00 91.21  ? 133 SER C C   1 
ATOM   3996 O O   . SER C 1 131 ? 24.694  -12.254 7.080  1.00 93.15  ? 133 SER C O   1 
ATOM   3997 C CB  . SER C 1 131 ? 22.086  -12.926 6.886  1.00 95.61  ? 133 SER C CB  1 
ATOM   3998 O OG  . SER C 1 131 ? 20.949  -13.672 7.313  1.00 97.78  ? 133 SER C OG  1 
ATOM   3999 N N   . GLN C 1 132 ? 24.427  -10.605 8.592  1.00 88.55  ? 134 GLN C N   1 
ATOM   4000 C CA  . GLN C 1 132 ? 25.708  -9.927  8.362  1.00 87.30  ? 134 GLN C CA  1 
ATOM   4001 C C   . GLN C 1 132 ? 26.632  -9.918  9.592  1.00 85.84  ? 134 GLN C C   1 
ATOM   4002 O O   . GLN C 1 132 ? 26.162  -10.072 10.735 1.00 85.26  ? 134 GLN C O   1 
ATOM   4003 C CB  . GLN C 1 132 ? 25.411  -8.487  7.960  1.00 85.82  ? 134 GLN C CB  1 
ATOM   4004 C CG  . GLN C 1 132 ? 24.464  -8.376  6.801  1.00 86.63  ? 134 GLN C CG  1 
ATOM   4005 C CD  . GLN C 1 132 ? 25.207  -8.241  5.500  1.00 87.44  ? 134 GLN C CD  1 
ATOM   4006 O OE1 . GLN C 1 132 ? 24.859  -8.877  4.509  1.00 84.84  ? 134 GLN C OE1 1 
ATOM   4007 N NE2 . GLN C 1 132 ? 26.267  -7.410  5.503  1.00 88.01  ? 134 GLN C NE2 1 
ATOM   4008 N N   . PRO C 1 133 ? 27.946  -9.679  9.388  1.00 85.47  ? 135 PRO C N   1 
ATOM   4009 C CA  . PRO C 1 133 ? 28.695  -9.675  10.634 1.00 83.75  ? 135 PRO C CA  1 
ATOM   4010 C C   . PRO C 1 133 ? 28.477  -8.286  11.261 1.00 81.43  ? 135 PRO C C   1 
ATOM   4011 O O   . PRO C 1 133 ? 27.882  -7.351  10.616 1.00 80.93  ? 135 PRO C O   1 
ATOM   4012 C CB  . PRO C 1 133 ? 30.148  -9.898  10.201 1.00 84.55  ? 135 PRO C CB  1 
ATOM   4013 C CG  . PRO C 1 133 ? 30.197  -9.586  8.718  1.00 85.87  ? 135 PRO C CG  1 
ATOM   4014 C CD  . PRO C 1 133 ? 28.784  -9.327  8.225  1.00 86.41  ? 135 PRO C CD  1 
ATOM   4015 N N   . THR C 1 134 ? 28.907  -8.155  12.511 1.00 78.59  ? 136 THR C N   1 
ATOM   4016 C CA  . THR C 1 134 ? 28.459  -7.036  13.307 1.00 75.23  ? 136 THR C CA  1 
ATOM   4017 C C   . THR C 1 134 ? 29.379  -5.860  13.030 1.00 73.07  ? 136 THR C C   1 
ATOM   4018 O O   . THR C 1 134 ? 30.558  -5.896  13.386 1.00 72.54  ? 136 THR C O   1 
ATOM   4019 C CB  . THR C 1 134 ? 28.327  -7.407  14.852 1.00 74.97  ? 136 THR C CB  1 
ATOM   4020 O OG1 . THR C 1 134 ? 29.624  -7.397  15.491 1.00 74.77  ? 136 THR C OG1 1 
ATOM   4021 C CG2 . THR C 1 134 ? 27.558  -8.797  15.093 1.00 75.74  ? 136 THR C CG2 1 
ATOM   4022 N N   . GLN C 1 135 ? 28.842  -4.837  12.371 1.00 71.39  ? 137 GLN C N   1 
ATOM   4023 C CA  . GLN C 1 135 ? 29.570  -3.590  12.118 1.00 69.54  ? 137 GLN C CA  1 
ATOM   4024 C C   . GLN C 1 135 ? 29.956  -2.802  13.406 1.00 67.22  ? 137 GLN C C   1 
ATOM   4025 O O   . GLN C 1 135 ? 29.366  -3.042  14.473 1.00 66.64  ? 137 GLN C O   1 
ATOM   4026 C CB  . GLN C 1 135 ? 28.737  -2.713  11.197 1.00 69.31  ? 137 GLN C CB  1 
ATOM   4027 C CG  . GLN C 1 135 ? 29.361  -1.377  10.879 1.00 67.44  ? 137 GLN C CG  1 
ATOM   4028 C CD  . GLN C 1 135 ? 28.591  -0.727  9.824  1.00 67.30  ? 137 GLN C CD  1 
ATOM   4029 O OE1 . GLN C 1 135 ? 27.601  -1.290  9.384  1.00 72.68  ? 137 GLN C OE1 1 
ATOM   4030 N NE2 . GLN C 1 135 ? 29.001  0.455   9.387  1.00 65.96  ? 137 GLN C NE2 1 
ATOM   4031 N N   . GLU C 1 136 ? 30.912  -1.860  13.291 1.00 65.61  ? 138 GLU C N   1 
ATOM   4032 C CA  . GLU C 1 136 ? 31.431  -1.091  14.447 1.00 63.63  ? 138 GLU C CA  1 
ATOM   4033 C C   . GLU C 1 136 ? 31.592  0.414   14.290 1.00 61.87  ? 138 GLU C C   1 
ATOM   4034 O O   . GLU C 1 136 ? 31.828  0.929   13.203 1.00 63.44  ? 138 GLU C O   1 
ATOM   4035 C CB  . GLU C 1 136 ? 32.791  -1.604  14.850 1.00 64.15  ? 138 GLU C CB  1 
ATOM   4036 C CG  . GLU C 1 136 ? 32.738  -2.660  15.916 1.00 67.34  ? 138 GLU C CG  1 
ATOM   4037 C CD  . GLU C 1 136 ? 34.104  -2.891  16.509 1.00 70.95  ? 138 GLU C CD  1 
ATOM   4038 O OE1 . GLU C 1 136 ? 34.507  -4.072  16.571 1.00 74.42  ? 138 GLU C OE1 1 
ATOM   4039 O OE2 . GLU C 1 136 ? 34.774  -1.894  16.885 1.00 70.92  ? 138 GLU C OE2 1 
ATOM   4040 N N   . THR C 1 137 ? 31.448  1.113   15.407 1.00 58.74  ? 139 THR C N   1 
ATOM   4041 C CA  . THR C 1 137 ? 31.836  2.512   15.541 1.00 55.91  ? 139 THR C CA  1 
ATOM   4042 C C   . THR C 1 137 ? 32.237  2.701   17.006 1.00 53.36  ? 139 THR C C   1 
ATOM   4043 O O   . THR C 1 137 ? 31.611  2.133   17.913 1.00 53.81  ? 139 THR C O   1 
ATOM   4044 C CB  . THR C 1 137 ? 30.703  3.492   15.122 1.00 56.23  ? 139 THR C CB  1 
ATOM   4045 O OG1 . THR C 1 137 ? 31.190  4.825   15.161 1.00 56.62  ? 139 THR C OG1 1 
ATOM   4046 C CG2 . THR C 1 137 ? 29.540  3.448   16.064 1.00 54.31  ? 139 THR C CG2 1 
ATOM   4047 N N   . LYS C 1 138 ? 33.288  3.473   17.240 1.00 51.16  ? 140 LYS C N   1 
ATOM   4048 C CA  . LYS C 1 138 ? 33.846  3.712   18.588 1.00 48.30  ? 140 LYS C CA  1 
ATOM   4049 C C   . LYS C 1 138 ? 34.059  5.232   18.818 1.00 46.16  ? 140 LYS C C   1 
ATOM   4050 O O   . LYS C 1 138 ? 34.537  5.897   17.932 1.00 47.88  ? 140 LYS C O   1 
ATOM   4051 C CB  . LYS C 1 138 ? 35.160  2.956   18.711 1.00 47.77  ? 140 LYS C CB  1 
ATOM   4052 C CG  . LYS C 1 138 ? 36.156  3.617   19.553 1.00 49.01  ? 140 LYS C CG  1 
ATOM   4053 C CD  . LYS C 1 138 ? 37.177  2.617   20.081 1.00 52.92  ? 140 LYS C CD  1 
ATOM   4054 C CE  . LYS C 1 138 ? 38.509  3.298   20.358 1.00 57.19  ? 140 LYS C CE  1 
ATOM   4055 N NZ  . LYS C 1 138 ? 39.615  2.320   20.373 1.00 63.89  ? 140 LYS C NZ  1 
ATOM   4056 N N   . LYS C 1 139 ? 33.706  5.807   19.959 1.00 42.51  ? 141 LYS C N   1 
ATOM   4057 C CA  . LYS C 1 139 ? 34.014  7.240   20.110 1.00 39.96  ? 141 LYS C CA  1 
ATOM   4058 C C   . LYS C 1 139 ? 34.529  7.588   21.511 1.00 37.74  ? 141 LYS C C   1 
ATOM   4059 O O   . LYS C 1 139 ? 33.963  7.142   22.511 1.00 36.47  ? 141 LYS C O   1 
ATOM   4060 C CB  . LYS C 1 139 ? 32.796  8.059   19.765 1.00 40.27  ? 141 LYS C CB  1 
ATOM   4061 C CG  . LYS C 1 139 ? 33.119  9.448   19.566 1.00 40.54  ? 141 LYS C CG  1 
ATOM   4062 C CD  . LYS C 1 139 ? 31.910  10.303  19.412 1.00 40.22  ? 141 LYS C CD  1 
ATOM   4063 C CE  . LYS C 1 139 ? 31.520  10.322  17.942 1.00 43.57  ? 141 LYS C CE  1 
ATOM   4064 N NZ  . LYS C 1 139 ? 30.650  11.481  17.556 1.00 44.21  ? 141 LYS C NZ  1 
ATOM   4065 N N   . ASN C 1 140 ? 35.626  8.313   21.599 1.00 36.38  ? 142 ASN C N   1 
ATOM   4066 C CA  . ASN C 1 140 ? 36.209  8.557   22.912 1.00 35.69  ? 142 ASN C CA  1 
ATOM   4067 C C   . ASN C 1 140 ? 35.438  9.592   23.686 1.00 35.12  ? 142 ASN C C   1 
ATOM   4068 O O   . ASN C 1 140 ? 34.738  10.419  23.099 1.00 36.24  ? 142 ASN C O   1 
ATOM   4069 C CB  . ASN C 1 140 ? 37.663  8.993   22.833 1.00 35.12  ? 142 ASN C CB  1 
ATOM   4070 C CG  . ASN C 1 140 ? 38.534  7.945   22.234 1.00 39.76  ? 142 ASN C CG  1 
ATOM   4071 O OD1 . ASN C 1 140 ? 38.679  6.840   22.768 1.00 42.83  ? 142 ASN C OD1 1 
ATOM   4072 N ND2 . ASN C 1 140 ? 39.134  8.277   21.092 1.00 47.76  ? 142 ASN C ND2 1 
ATOM   4073 N N   . PHE C 1 141 ? 35.526  9.490   25.001 1.00 32.97  ? 143 PHE C N   1 
ATOM   4074 C CA  . PHE C 1 141 ? 35.205  10.579  25.845 1.00 32.36  ? 143 PHE C CA  1 
ATOM   4075 C C   . PHE C 1 141 ? 36.309  10.797  26.913 1.00 33.22  ? 143 PHE C C   1 
ATOM   4076 O O   . PHE C 1 141 ? 37.150  9.915   27.167 1.00 29.93  ? 143 PHE C O   1 
ATOM   4077 C CB  . PHE C 1 141 ? 33.802  10.430  26.418 1.00 32.44  ? 143 PHE C CB  1 
ATOM   4078 C CG  . PHE C 1 141 ? 33.635  9.294   27.360 1.00 29.20  ? 143 PHE C CG  1 
ATOM   4079 C CD1 . PHE C 1 141 ? 33.399  7.983   26.875 1.00 29.12  ? 143 PHE C CD1 1 
ATOM   4080 C CD2 . PHE C 1 141 ? 33.685  9.509   28.707 1.00 24.68  ? 143 PHE C CD2 1 
ATOM   4081 C CE1 . PHE C 1 141 ? 33.247  6.931   27.728 1.00 22.90  ? 143 PHE C CE1 1 
ATOM   4082 C CE2 . PHE C 1 141 ? 33.546  8.448   29.600 1.00 22.02  ? 143 PHE C CE2 1 
ATOM   4083 C CZ  . PHE C 1 141 ? 33.300  7.168   29.107 1.00 23.39  ? 143 PHE C CZ  1 
ATOM   4084 N N   . GLU C 1 142 ? 36.308  12.028  27.458 1.00 35.97  ? 144 GLU C N   1 
ATOM   4085 C CA  . GLU C 1 142 ? 37.310  12.540  28.404 1.00 37.22  ? 144 GLU C CA  1 
ATOM   4086 C C   . GLU C 1 142 ? 36.838  12.514  29.836 1.00 37.37  ? 144 GLU C C   1 
ATOM   4087 O O   . GLU C 1 142 ? 35.673  12.675  30.119 1.00 36.27  ? 144 GLU C O   1 
ATOM   4088 C CB  . GLU C 1 142 ? 37.735  13.937  28.015 1.00 38.04  ? 144 GLU C CB  1 
ATOM   4089 C CG  . GLU C 1 142 ? 38.538  13.947  26.716 1.00 45.03  ? 144 GLU C CG  1 
ATOM   4090 C CD  . GLU C 1 142 ? 39.820  13.068  26.748 1.00 47.21  ? 144 GLU C CD  1 
ATOM   4091 O OE1 . GLU C 1 142 ? 40.767  13.330  27.565 1.00 44.84  ? 144 GLU C OE1 1 
ATOM   4092 O OE2 . GLU C 1 142 ? 39.840  12.110  25.936 1.00 48.05  ? 144 GLU C OE2 1 
ATOM   4093 N N   . VAL C 1 143 ? 37.788  12.291  30.732 1.00 39.93  ? 145 VAL C N   1 
ATOM   4094 C CA  . VAL C 1 143 ? 37.517  11.909  32.106 1.00 42.67  ? 145 VAL C CA  1 
ATOM   4095 C C   . VAL C 1 143 ? 38.626  12.542  32.907 1.00 45.59  ? 145 VAL C C   1 
ATOM   4096 O O   . VAL C 1 143 ? 39.684  12.749  32.325 1.00 46.37  ? 145 VAL C O   1 
ATOM   4097 C CB  . VAL C 1 143 ? 37.538  10.377  32.257 1.00 40.95  ? 145 VAL C CB  1 
ATOM   4098 C CG1 . VAL C 1 143 ? 37.810  9.970   33.678 1.00 40.67  ? 145 VAL C CG1 1 
ATOM   4099 C CG2 . VAL C 1 143 ? 36.230  9.804   31.802 1.00 40.43  ? 145 VAL C CG2 1 
ATOM   4100 N N   . VAL C 1 144 ? 38.390  12.852  34.202 1.00 48.92  ? 146 VAL C N   1 
ATOM   4101 C CA  . VAL C 1 144 ? 39.365  13.554  35.040 1.00 52.56  ? 146 VAL C CA  1 
ATOM   4102 C C   . VAL C 1 144 ? 39.230  13.308  36.525 1.00 55.44  ? 146 VAL C C   1 
ATOM   4103 O O   . VAL C 1 144 ? 38.239  13.682  37.154 1.00 56.36  ? 146 VAL C O   1 
ATOM   4104 C CB  . VAL C 1 144 ? 39.262  15.069  34.888 1.00 53.60  ? 146 VAL C CB  1 
ATOM   4105 C CG1 . VAL C 1 144 ? 37.885  15.595  35.386 1.00 55.48  ? 146 VAL C CG1 1 
ATOM   4106 C CG2 . VAL C 1 144 ? 40.372  15.724  35.661 1.00 53.71  ? 146 VAL C CG2 1 
ATOM   4107 N N   . ASP C 1 145 ? 40.272  12.764  37.129 1.00 58.96  ? 147 ASP C N   1 
ATOM   4108 C CA  . ASP C 1 145 ? 40.213  12.586  38.576 1.00 62.23  ? 147 ASP C CA  1 
ATOM   4109 C C   . ASP C 1 145 ? 40.579  13.890  39.325 1.00 64.46  ? 147 ASP C C   1 
ATOM   4110 O O   . ASP C 1 145 ? 41.550  14.564  38.935 1.00 65.60  ? 147 ASP C O   1 
ATOM   4111 C CB  . ASP C 1 145 ? 40.968  11.334  39.053 1.00 61.09  ? 147 ASP C CB  1 
ATOM   4112 C CG  . ASP C 1 145 ? 40.202  10.610  40.151 1.00 63.13  ? 147 ASP C CG  1 
ATOM   4113 O OD1 . ASP C 1 145 ? 39.120  10.052  39.869 1.00 63.31  ? 147 ASP C OD1 1 
ATOM   4114 O OD2 . ASP C 1 145 ? 40.647  10.652  41.321 1.00 68.32  ? 147 ASP C OD2 1 
ATOM   4115 N N   . LEU C 1 146 ? 39.783  14.210  40.369 1.00 66.72  ? 148 LEU C N   1 
ATOM   4116 C CA  . LEU C 1 146 ? 39.559  15.575  40.961 1.00 69.37  ? 148 LEU C CA  1 
ATOM   4117 C C   . LEU C 1 146 ? 40.734  16.160  41.777 1.00 69.77  ? 148 LEU C C   1 
ATOM   4118 O O   . LEU C 1 146 ? 41.862  15.639  41.748 1.00 68.65  ? 148 LEU C O   1 
ATOM   4119 C CB  . LEU C 1 146 ? 38.221  15.585  41.790 1.00 70.82  ? 148 LEU C CB  1 
ATOM   4120 C CG  . LEU C 1 146 ? 37.710  16.609  42.855 1.00 73.64  ? 148 LEU C CG  1 
ATOM   4121 C CD1 . LEU C 1 146 ? 37.889  18.084  42.410 1.00 74.57  ? 148 LEU C CD1 1 
ATOM   4122 C CD2 . LEU C 1 146 ? 36.227  16.341  43.303 1.00 72.55  ? 148 LEU C CD2 1 
ATOM   4123 N N   . PRO C 1 152 ? 52.732  13.255  39.944 1.00 61.17  ? 154 PRO C N   1 
ATOM   4124 C CA  . PRO C 1 152 ? 53.924  12.615  40.526 1.00 60.38  ? 154 PRO C CA  1 
ATOM   4125 C C   . PRO C 1 152 ? 54.436  11.544  39.572 1.00 59.69  ? 154 PRO C C   1 
ATOM   4126 O O   . PRO C 1 152 ? 53.612  10.757  39.077 1.00 59.62  ? 154 PRO C O   1 
ATOM   4127 C CB  . PRO C 1 152 ? 53.385  11.966  41.807 1.00 58.66  ? 154 PRO C CB  1 
ATOM   4128 C CG  . PRO C 1 152 ? 51.940  11.609  41.465 1.00 59.46  ? 154 PRO C CG  1 
ATOM   4129 C CD  . PRO C 1 152 ? 51.491  12.532  40.288 1.00 60.32  ? 154 PRO C CD  1 
ATOM   4130 N N   . ASP C 1 153 ? 55.756  11.521  39.312 1.00 59.28  ? 155 ASP C N   1 
ATOM   4131 C CA  . ASP C 1 153 ? 56.345  10.614  38.323 1.00 58.15  ? 155 ASP C CA  1 
ATOM   4132 C C   . ASP C 1 153 ? 56.623  9.253   38.907 1.00 56.68  ? 155 ASP C C   1 
ATOM   4133 O O   . ASP C 1 153 ? 57.349  9.129   39.895 1.00 58.39  ? 155 ASP C O   1 
ATOM   4134 C CB  . ASP C 1 153 ? 57.680  11.113  37.754 1.00 59.90  ? 155 ASP C CB  1 
ATOM   4135 C CG  . ASP C 1 153 ? 58.412  10.004  36.939 1.00 60.48  ? 155 ASP C CG  1 
ATOM   4136 O OD1 . ASP C 1 153 ? 57.721  9.364   36.115 1.00 62.91  ? 155 ASP C OD1 1 
ATOM   4137 O OD2 . ASP C 1 153 ? 59.628  9.734   37.110 1.00 56.62  ? 155 ASP C OD2 1 
ATOM   4138 N N   . LEU C 1 154 ? 56.127  8.232   38.228 1.00 53.84  ? 156 LEU C N   1 
ATOM   4139 C CA  . LEU C 1 154 ? 56.372  6.837   38.542 1.00 51.04  ? 156 LEU C CA  1 
ATOM   4140 C C   . LEU C 1 154 ? 57.725  6.467   39.084 1.00 50.44  ? 156 LEU C C   1 
ATOM   4141 O O   . LEU C 1 154 ? 57.844  5.489   39.798 1.00 50.40  ? 156 LEU C O   1 
ATOM   4142 C CB  . LEU C 1 154 ? 56.142  5.998   37.289 1.00 51.53  ? 156 LEU C CB  1 
ATOM   4143 C CG  . LEU C 1 154 ? 55.915  4.500   37.439 1.00 51.29  ? 156 LEU C CG  1 
ATOM   4144 C CD1 . LEU C 1 154 ? 54.855  4.197   38.463 1.00 49.73  ? 156 LEU C CD1 1 
ATOM   4145 C CD2 . LEU C 1 154 ? 55.472  3.927   36.157 1.00 52.47  ? 156 LEU C CD2 1 
ATOM   4146 N N   . MET C 1 155 ? 58.763  7.194   38.735 1.00 50.57  ? 157 MET C N   1 
ATOM   4147 C CA  . MET C 1 155 ? 60.078  6.730   39.155 1.00 50.74  ? 157 MET C CA  1 
ATOM   4148 C C   . MET C 1 155 ? 60.749  7.632   40.189 1.00 50.26  ? 157 MET C C   1 
ATOM   4149 O O   . MET C 1 155 ? 61.839  7.323   40.664 1.00 50.08  ? 157 MET C O   1 
ATOM   4150 C CB  . MET C 1 155 ? 60.985  6.485   37.968 1.00 52.31  ? 157 MET C CB  1 
ATOM   4151 C CG  . MET C 1 155 ? 60.489  5.428   37.036 1.00 54.96  ? 157 MET C CG  1 
ATOM   4152 S SD  . MET C 1 155 ? 60.967  3.725   37.430 1.00 60.10  ? 157 MET C SD  1 
ATOM   4153 C CE  . MET C 1 155 ? 59.490  3.090   38.229 1.00 58.00  ? 157 MET C CE  1 
ATOM   4154 N N   . ALA C 1 156 ? 60.084  8.726   40.561 1.00 49.40  ? 158 ALA C N   1 
ATOM   4155 C CA  . ALA C 1 156 ? 60.585  9.583   41.635 1.00 49.36  ? 158 ALA C CA  1 
ATOM   4156 C C   . ALA C 1 156 ? 60.454  8.896   43.042 1.00 48.09  ? 158 ALA C C   1 
ATOM   4157 O O   . ALA C 1 156 ? 59.663  7.996   43.233 1.00 46.32  ? 158 ALA C O   1 
ATOM   4158 C CB  . ALA C 1 156 ? 59.867  10.926  41.584 1.00 48.52  ? 158 ALA C CB  1 
ATOM   4159 N N   . PRO C 1 157 ? 61.217  9.343   44.029 1.00 48.73  ? 159 PRO C N   1 
ATOM   4160 C CA  . PRO C 1 157 ? 61.114  8.712   45.291 1.00 48.06  ? 159 PRO C CA  1 
ATOM   4161 C C   . PRO C 1 157 ? 59.852  9.200   45.949 1.00 48.57  ? 159 PRO C C   1 
ATOM   4162 O O   . PRO C 1 157 ? 59.467  10.341  45.735 1.00 50.16  ? 159 PRO C O   1 
ATOM   4163 C CB  . PRO C 1 157 ? 62.300  9.280   46.056 1.00 48.64  ? 159 PRO C CB  1 
ATOM   4164 C CG  . PRO C 1 157 ? 63.078  10.052  45.138 1.00 50.23  ? 159 PRO C CG  1 
ATOM   4165 C CD  . PRO C 1 157 ? 62.158  10.468  44.070 1.00 51.11  ? 159 PRO C CD  1 
ATOM   4166 N N   . VAL C 1 158 ? 59.221  8.346   46.747 1.00 48.25  ? 160 VAL C N   1 
ATOM   4167 C CA  . VAL C 1 158 ? 57.998  8.666   47.467 1.00 48.12  ? 160 VAL C CA  1 
ATOM   4168 C C   . VAL C 1 158 ? 58.327  8.613   48.955 1.00 47.85  ? 160 VAL C C   1 
ATOM   4169 O O   . VAL C 1 158 ? 59.197  7.846   49.397 1.00 48.00  ? 160 VAL C O   1 
ATOM   4170 C CB  . VAL C 1 158 ? 56.880  7.635   47.120 1.00 47.91  ? 160 VAL C CB  1 
ATOM   4171 C CG1 . VAL C 1 158 ? 55.606  7.825   47.968 1.00 47.73  ? 160 VAL C CG1 1 
ATOM   4172 C CG2 . VAL C 1 158 ? 56.538  7.683   45.653 1.00 49.62  ? 160 VAL C CG2 1 
ATOM   4173 N N   . SER C 1 159 ? 57.632  9.419   49.738 1.00 47.96  ? 161 SER C N   1 
ATOM   4174 C CA  . SER C 1 159 ? 58.026  9.595   51.155 1.00 48.26  ? 161 SER C CA  1 
ATOM   4175 C C   . SER C 1 159 ? 57.043  10.448  51.961 1.00 47.99  ? 161 SER C C   1 
ATOM   4176 O O   . SER C 1 159 ? 56.343  11.307  51.419 1.00 49.14  ? 161 SER C O   1 
ATOM   4177 C CB  . SER C 1 159 ? 59.362  10.285  51.212 1.00 48.65  ? 161 SER C CB  1 
ATOM   4178 O OG  . SER C 1 159 ? 59.125  11.614  50.867 1.00 48.62  ? 161 SER C OG  1 
ATOM   4179 N N   . ALA C 1 160 ? 57.033  10.248  53.262 1.00 46.44  ? 162 ALA C N   1 
ATOM   4180 C CA  . ALA C 1 160 ? 56.021  10.891  54.085 1.00 45.53  ? 162 ALA C CA  1 
ATOM   4181 C C   . ALA C 1 160 ? 56.572  10.844  55.499 1.00 45.11  ? 162 ALA C C   1 
ATOM   4182 O O   . ALA C 1 160 ? 57.548  10.108  55.745 1.00 44.32  ? 162 ALA C O   1 
ATOM   4183 C CB  . ALA C 1 160 ? 54.679  10.142  53.973 1.00 43.37  ? 162 ALA C CB  1 
ATOM   4184 N N   . LYS C 1 161 ? 55.992  11.649  56.389 1.00 45.10  ? 163 LYS C N   1 
ATOM   4185 C CA  . LYS C 1 161 ? 56.281  11.572  57.805 1.00 46.29  ? 163 LYS C CA  1 
ATOM   4186 C C   . LYS C 1 161 ? 55.044  11.894  58.602 1.00 46.67  ? 163 LYS C C   1 
ATOM   4187 O O   . LYS C 1 161 ? 54.167  12.646  58.155 1.00 47.36  ? 163 LYS C O   1 
ATOM   4188 C CB  . LYS C 1 161 ? 57.472  12.464  58.243 1.00 48.56  ? 163 LYS C CB  1 
ATOM   4189 C CG  . LYS C 1 161 ? 57.575  13.887  57.630 1.00 51.50  ? 163 LYS C CG  1 
ATOM   4190 C CD  . LYS C 1 161 ? 56.279  14.725  57.891 1.00 56.85  ? 163 LYS C CD  1 
ATOM   4191 C CE  . LYS C 1 161 ? 56.515  16.235  57.920 1.00 61.34  ? 163 LYS C CE  1 
ATOM   4192 N NZ  . LYS C 1 161 ? 57.258  16.740  56.703 1.00 63.25  ? 163 LYS C NZ  1 
ATOM   4193 N N   . LYS C 1 162 ? 54.955  11.303  59.782 1.00 45.85  ? 164 LYS C N   1 
ATOM   4194 C CA  . LYS C 1 162 ? 53.832  11.568  60.636 1.00 45.60  ? 164 LYS C CA  1 
ATOM   4195 C C   . LYS C 1 162 ? 54.239  11.501  62.087 1.00 45.18  ? 164 LYS C C   1 
ATOM   4196 O O   . LYS C 1 162 ? 55.174  10.815  62.442 1.00 44.11  ? 164 LYS C O   1 
ATOM   4197 C CB  . LYS C 1 162 ? 52.690  10.607  60.321 1.00 45.90  ? 164 LYS C CB  1 
ATOM   4198 C CG  . LYS C 1 162 ? 51.453  10.783  61.190 1.00 47.95  ? 164 LYS C CG  1 
ATOM   4199 C CD  . LYS C 1 162 ? 50.238  10.829  60.321 1.00 51.20  ? 164 LYS C CD  1 
ATOM   4200 C CE  . LYS C 1 162 ? 49.711  9.448   60.091 1.00 52.07  ? 164 LYS C CE  1 
ATOM   4201 N NZ  . LYS C 1 162 ? 48.458  9.535   59.320 1.00 54.32  ? 164 LYS C NZ  1 
ATOM   4202 N N   . GLU C 1 163 ? 53.516  12.249  62.901 1.00 45.73  ? 165 GLU C N   1 
ATOM   4203 C CA  . GLU C 1 163 ? 53.791  12.434  64.297 1.00 46.68  ? 165 GLU C CA  1 
ATOM   4204 C C   . GLU C 1 163 ? 52.441  12.387  65.105 1.00 47.27  ? 165 GLU C C   1 
ATOM   4205 O O   . GLU C 1 163 ? 51.446  12.989  64.728 1.00 47.77  ? 165 GLU C O   1 
ATOM   4206 C CB  . GLU C 1 163 ? 54.556  13.742  64.426 1.00 47.33  ? 165 GLU C CB  1 
ATOM   4207 C CG  . GLU C 1 163 ? 54.999  14.097  65.828 1.00 54.59  ? 165 GLU C CG  1 
ATOM   4208 C CD  . GLU C 1 163 ? 56.376  14.758  65.867 1.00 60.52  ? 165 GLU C CD  1 
ATOM   4209 O OE1 . GLU C 1 163 ? 56.641  15.616  64.993 1.00 64.03  ? 165 GLU C OE1 1 
ATOM   4210 O OE2 . GLU C 1 163 ? 57.192  14.404  66.761 1.00 62.84  ? 165 GLU C OE2 1 
ATOM   4211 N N   . LYS C 1 164 ? 52.389  11.601  66.174 1.00 47.84  ? 166 LYS C N   1 
ATOM   4212 C CA  . LYS C 1 164 ? 51.228  11.562  67.083 1.00 48.57  ? 166 LYS C CA  1 
ATOM   4213 C C   . LYS C 1 164 ? 51.677  11.717  68.530 1.00 48.91  ? 166 LYS C C   1 
ATOM   4214 O O   . LYS C 1 164 ? 52.729  11.222  68.952 1.00 48.73  ? 166 LYS C O   1 
ATOM   4215 C CB  . LYS C 1 164 ? 50.378  10.296  66.927 1.00 48.28  ? 166 LYS C CB  1 
ATOM   4216 C CG  . LYS C 1 164 ? 48.899  10.491  67.367 1.00 54.22  ? 166 LYS C CG  1 
ATOM   4217 C CD  . LYS C 1 164 ? 47.987  9.242   67.232 1.00 59.66  ? 166 LYS C CD  1 
ATOM   4218 C CE  . LYS C 1 164 ? 48.465  8.033   68.107 1.00 62.83  ? 166 LYS C CE  1 
ATOM   4219 N NZ  . LYS C 1 164 ? 47.375  7.458   69.009 1.00 65.45  ? 166 LYS C NZ  1 
ATOM   4220 N N   . LYS C 1 165 ? 50.851  12.442  69.265 1.00 49.99  ? 167 LYS C N   1 
ATOM   4221 C CA  . LYS C 1 165 ? 51.025  12.776  70.649 1.00 50.69  ? 167 LYS C CA  1 
ATOM   4222 C C   . LYS C 1 165 ? 50.551  11.512  71.335 1.00 49.35  ? 167 LYS C C   1 
ATOM   4223 O O   . LYS C 1 165 ? 49.440  11.091  71.089 1.00 49.96  ? 167 LYS C O   1 
ATOM   4224 C CB  . LYS C 1 165 ? 50.114  13.959  70.956 1.00 52.51  ? 167 LYS C CB  1 
ATOM   4225 C CG  . LYS C 1 165 ? 50.611  14.847  72.092 1.00 61.00  ? 167 LYS C CG  1 
ATOM   4226 C CD  . LYS C 1 165 ? 49.932  16.259  72.120 1.00 66.98  ? 167 LYS C CD  1 
ATOM   4227 C CE  . LYS C 1 165 ? 48.793  16.348  73.175 1.00 72.27  ? 167 LYS C CE  1 
ATOM   4228 N NZ  . LYS C 1 165 ? 49.251  16.875  74.523 1.00 77.43  ? 167 LYS C NZ  1 
ATOM   4229 N N   . VAL C 1 166 ? 51.411  10.870  72.128 1.00 47.74  ? 168 VAL C N   1 
ATOM   4230 C CA  . VAL C 1 166 ? 51.023  9.723   72.939 1.00 46.63  ? 168 VAL C CA  1 
ATOM   4231 C C   . VAL C 1 166 ? 51.350  10.075  74.366 1.00 48.38  ? 168 VAL C C   1 
ATOM   4232 O O   . VAL C 1 166 ? 52.472  9.908   74.831 1.00 48.26  ? 168 VAL C O   1 
ATOM   4233 C CB  . VAL C 1 166 ? 51.753  8.417   72.546 1.00 44.95  ? 168 VAL C CB  1 
ATOM   4234 C CG1 . VAL C 1 166 ? 51.309  7.297   73.473 1.00 46.66  ? 168 VAL C CG1 1 
ATOM   4235 C CG2 . VAL C 1 166 ? 51.478  8.023   71.115 1.00 40.91  ? 168 VAL C CG2 1 
ATOM   4236 N N   . SER C 1 167 ? 50.395  10.625  75.086 1.00 51.07  ? 169 SER C N   1 
ATOM   4237 C CA  . SER C 1 167 ? 50.823  11.276  76.303 1.00 52.65  ? 169 SER C CA  1 
ATOM   4238 C C   . SER C 1 167 ? 50.580  10.403  77.466 1.00 53.97  ? 169 SER C C   1 
ATOM   4239 O O   . SER C 1 167 ? 49.895  9.387   77.356 1.00 54.38  ? 169 SER C O   1 
ATOM   4240 C CB  . SER C 1 167 ? 50.161  12.608  76.499 1.00 54.52  ? 169 SER C CB  1 
ATOM   4241 O OG  . SER C 1 167 ? 48.819  12.366  76.658 1.00 56.60  ? 169 SER C OG  1 
ATOM   4242 N N   . SER C 1 168 ? 51.130  10.862  78.579 1.00 55.43  ? 170 SER C N   1 
ATOM   4243 C CA  . SER C 1 168 ? 51.475  10.099  79.751 1.00 56.28  ? 170 SER C CA  1 
ATOM   4244 C C   . SER C 1 168 ? 51.200  11.154  80.801 1.00 59.02  ? 170 SER C C   1 
ATOM   4245 O O   . SER C 1 168 ? 51.318  12.368  80.544 1.00 59.97  ? 170 SER C O   1 
ATOM   4246 C CB  . SER C 1 168 ? 52.985  9.841   79.680 1.00 54.80  ? 170 SER C CB  1 
ATOM   4247 O OG  . SER C 1 168 ? 53.428  8.641   80.273 1.00 55.77  ? 170 SER C OG  1 
ATOM   4248 N N   . MET C 1 169 ? 50.821  10.736  81.989 1.00 61.58  ? 171 MET C N   1 
ATOM   4249 C CA  . MET C 1 169 ? 50.805  11.700  83.080 1.00 64.56  ? 171 MET C CA  1 
ATOM   4250 C C   . MET C 1 169 ? 52.212  12.281  83.359 1.00 63.90  ? 171 MET C C   1 
ATOM   4251 O O   . MET C 1 169 ? 52.360  13.473  83.660 1.00 64.59  ? 171 MET C O   1 
ATOM   4252 C CB  . MET C 1 169 ? 50.209  11.100  84.338 1.00 67.07  ? 171 MET C CB  1 
ATOM   4253 C CG  . MET C 1 169 ? 50.337  12.069  85.529 1.00 71.02  ? 171 MET C CG  1 
ATOM   4254 S SD  . MET C 1 169 ? 49.722  11.420  87.095 1.00 75.68  ? 171 MET C SD  1 
ATOM   4255 C CE  . MET C 1 169 ? 50.201  12.843  88.150 1.00 81.92  ? 171 MET C CE  1 
ATOM   4256 N N   . PHE C 1 170 ? 53.238  11.440  83.240 1.00 62.51  ? 172 PHE C N   1 
ATOM   4257 C CA  . PHE C 1 170 ? 54.596  11.889  83.529 1.00 62.28  ? 172 PHE C CA  1 
ATOM   4258 C C   . PHE C 1 170 ? 55.371  12.257  82.276 1.00 59.16  ? 172 PHE C C   1 
ATOM   4259 O O   . PHE C 1 170 ? 56.383  12.929  82.340 1.00 57.95  ? 172 PHE C O   1 
ATOM   4260 C CB  . PHE C 1 170 ? 55.328  10.875  84.414 1.00 63.27  ? 172 PHE C CB  1 
ATOM   4261 C CG  . PHE C 1 170 ? 54.698  10.712  85.784 1.00 68.37  ? 172 PHE C CG  1 
ATOM   4262 C CD1 . PHE C 1 170 ? 54.661  11.795  86.694 1.00 73.45  ? 172 PHE C CD1 1 
ATOM   4263 C CD2 . PHE C 1 170 ? 54.138  9.499   86.175 1.00 70.90  ? 172 PHE C CD2 1 
ATOM   4264 C CE1 . PHE C 1 170 ? 54.071  11.676  87.971 1.00 75.80  ? 172 PHE C CE1 1 
ATOM   4265 C CE2 . PHE C 1 170 ? 53.541  9.354   87.478 1.00 75.71  ? 172 PHE C CE2 1 
ATOM   4266 C CZ  . PHE C 1 170 ? 53.516  10.457  88.366 1.00 78.47  ? 172 PHE C CZ  1 
ATOM   4267 N N   . ILE C 1 171 ? 54.866  11.868  81.114 1.00 57.43  ? 173 ILE C N   1 
ATOM   4268 C CA  . ILE C 1 171 ? 55.404  12.464  79.890 1.00 54.97  ? 173 ILE C CA  1 
ATOM   4269 C C   . ILE C 1 171 ? 54.298  13.198  79.086 1.00 55.08  ? 173 ILE C C   1 
ATOM   4270 O O   . ILE C 1 171 ? 53.851  12.693  78.079 1.00 54.06  ? 173 ILE C O   1 
ATOM   4271 C CB  . ILE C 1 171 ? 56.250  11.431  79.036 1.00 52.18  ? 173 ILE C CB  1 
ATOM   4272 C CG1 . ILE C 1 171 ? 57.266  10.699  79.921 1.00 50.90  ? 173 ILE C CG1 1 
ATOM   4273 C CG2 . ILE C 1 171 ? 57.048  12.128  77.938 1.00 48.96  ? 173 ILE C CG2 1 
ATOM   4274 C CD1 . ILE C 1 171 ? 57.560  9.283   79.432 1.00 46.90  ? 173 ILE C CD1 1 
ATOM   4275 N N   . PRO C 1 172 ? 53.847  14.395  79.535 1.00 57.17  ? 174 PRO C N   1 
ATOM   4276 C CA  . PRO C 1 172 ? 52.739  15.003  78.769 1.00 57.59  ? 174 PRO C CA  1 
ATOM   4277 C C   . PRO C 1 172 ? 53.058  15.250  77.312 1.00 55.74  ? 174 PRO C C   1 
ATOM   4278 O O   . PRO C 1 172 ? 52.188  15.164  76.493 1.00 54.93  ? 174 PRO C O   1 
ATOM   4279 C CB  . PRO C 1 172 ? 52.486  16.319  79.502 1.00 58.91  ? 174 PRO C CB  1 
ATOM   4280 C CG  . PRO C 1 172 ? 52.958  16.027  80.864 1.00 60.93  ? 174 PRO C CG  1 
ATOM   4281 C CD  . PRO C 1 172 ? 54.187  15.231  80.705 1.00 58.69  ? 174 PRO C CD  1 
ATOM   4282 N N   . ASP C 1 173 ? 54.310  15.526  76.977 1.00 56.69  ? 175 ASP C N   1 
ATOM   4283 C CA  . ASP C 1 173 ? 54.653  15.886  75.598 1.00 55.53  ? 175 ASP C CA  1 
ATOM   4284 C C   . ASP C 1 173 ? 55.136  14.649  74.861 1.00 52.18  ? 175 ASP C C   1 
ATOM   4285 O O   . ASP C 1 173 ? 55.788  14.757  73.830 1.00 50.69  ? 175 ASP C O   1 
ATOM   4286 C CB  . ASP C 1 173 ? 55.721  17.004  75.600 1.00 57.58  ? 175 ASP C CB  1 
ATOM   4287 C CG  . ASP C 1 173 ? 55.298  18.247  76.445 1.00 64.70  ? 175 ASP C CG  1 
ATOM   4288 O OD1 . ASP C 1 173 ? 56.138  18.798  77.204 1.00 70.79  ? 175 ASP C OD1 1 
ATOM   4289 O OD2 . ASP C 1 173 ? 54.122  18.694  76.369 1.00 70.99  ? 175 ASP C OD2 1 
ATOM   4290 N N   . GLY C 1 174 ? 54.825  13.479  75.400 1.00 51.24  ? 176 GLY C N   1 
ATOM   4291 C CA  . GLY C 1 174 ? 55.118  12.232  74.744 1.00 50.18  ? 176 GLY C CA  1 
ATOM   4292 C C   . GLY C 1 174 ? 54.630  12.164  73.303 1.00 50.09  ? 176 GLY C C   1 
ATOM   4293 O O   . GLY C 1 174 ? 53.489  12.535  72.969 1.00 51.09  ? 176 GLY C O   1 
ATOM   4294 N N   . ARG C 1 175 ? 55.515  11.720  72.416 1.00 49.34  ? 177 ARG C N   1 
ATOM   4295 C CA  . ARG C 1 175 ? 55.201  11.656  70.979 1.00 48.09  ? 177 ARG C CA  1 
ATOM   4296 C C   . ARG C 1 175 ? 55.793  10.410  70.324 1.00 45.65  ? 177 ARG C C   1 
ATOM   4297 O O   . ARG C 1 175 ? 56.787  9.853   70.799 1.00 45.70  ? 177 ARG C O   1 
ATOM   4298 C CB  . ARG C 1 175 ? 55.689  12.908  70.299 1.00 48.70  ? 177 ARG C CB  1 
ATOM   4299 C CG  . ARG C 1 175 ? 54.915  14.119  70.831 1.00 56.67  ? 177 ARG C CG  1 
ATOM   4300 C CD  . ARG C 1 175 ? 55.450  15.461  70.371 1.00 65.25  ? 177 ARG C CD  1 
ATOM   4301 N NE  . ARG C 1 175 ? 54.398  16.500  70.361 1.00 73.13  ? 177 ARG C NE  1 
ATOM   4302 C CZ  . ARG C 1 175 ? 53.472  16.649  69.397 1.00 76.34  ? 177 ARG C CZ  1 
ATOM   4303 N NH1 . ARG C 1 175 ? 53.404  15.817  68.344 1.00 72.92  ? 177 ARG C NH1 1 
ATOM   4304 N NH2 . ARG C 1 175 ? 52.595  17.643  69.491 1.00 80.53  ? 177 ARG C NH2 1 
ATOM   4305 N N   . VAL C 1 176 ? 55.115  9.937   69.285 1.00 43.37  ? 178 VAL C N   1 
ATOM   4306 C CA  . VAL C 1 176 ? 55.614  8.872   68.427 1.00 39.81  ? 178 VAL C CA  1 
ATOM   4307 C C   . VAL C 1 176 ? 55.554  9.414   67.029 1.00 37.81  ? 178 VAL C C   1 
ATOM   4308 O O   . VAL C 1 176 ? 54.589  10.060  66.657 1.00 36.60  ? 178 VAL C O   1 
ATOM   4309 C CB  . VAL C 1 176 ? 54.743  7.614   68.523 1.00 39.55  ? 178 VAL C CB  1 
ATOM   4310 C CG1 . VAL C 1 176 ? 55.239  6.535   67.600 1.00 36.34  ? 178 VAL C CG1 1 
ATOM   4311 C CG2 . VAL C 1 176 ? 54.760  7.112   69.924 1.00 40.83  ? 178 VAL C CG2 1 
ATOM   4312 N N   . SER C 1 177 ? 56.608  9.167   66.269 1.00 36.15  ? 179 SER C N   1 
ATOM   4313 C CA  . SER C 1 177 ? 56.686  9.688   64.923 1.00 35.19  ? 179 SER C CA  1 
ATOM   4314 C C   . SER C 1 177 ? 57.481  8.748   64.086 1.00 33.87  ? 179 SER C C   1 
ATOM   4315 O O   . SER C 1 177 ? 58.327  8.015   64.617 1.00 33.43  ? 179 SER C O   1 
ATOM   4316 C CB  . SER C 1 177 ? 57.420  11.017  64.884 1.00 35.26  ? 179 SER C CB  1 
ATOM   4317 O OG  . SER C 1 177 ? 58.715  10.705  64.427 1.00 37.47  ? 179 SER C OG  1 
ATOM   4318 N N   . VAL C 1 178 ? 57.248  8.841   62.769 1.00 32.96  ? 180 VAL C N   1 
ATOM   4319 C CA  . VAL C 1 178 ? 57.878  8.000   61.784 1.00 32.38  ? 180 VAL C CA  1 
ATOM   4320 C C   . VAL C 1 178 ? 58.059  8.738   60.493 1.00 33.48  ? 180 VAL C C   1 
ATOM   4321 O O   . VAL C 1 178 ? 57.169  9.464   60.044 1.00 35.87  ? 180 VAL C O   1 
ATOM   4322 C CB  . VAL C 1 178 ? 57.025  6.720   61.535 1.00 32.41  ? 180 VAL C CB  1 
ATOM   4323 C CG1 . VAL C 1 178 ? 55.541  7.052   61.527 1.00 31.13  ? 180 VAL C CG1 1 
ATOM   4324 C CG2 . VAL C 1 178 ? 57.482  5.928   60.285 1.00 30.19  ? 180 VAL C CG2 1 
ATOM   4325 N N   . SER C 1 179 ? 59.181  8.563   59.834 1.00 33.56  ? 181 SER C N   1 
ATOM   4326 C CA  . SER C 1 179 ? 59.156  8.983   58.467 1.00 34.22  ? 181 SER C CA  1 
ATOM   4327 C C   . SER C 1 179 ? 59.905  7.983   57.654 1.00 34.65  ? 181 SER C C   1 
ATOM   4328 O O   . SER C 1 179 ? 60.887  7.411   58.129 1.00 36.32  ? 181 SER C O   1 
ATOM   4329 C CB  . SER C 1 179 ? 59.723  10.365  58.316 1.00 34.26  ? 181 SER C CB  1 
ATOM   4330 O OG  . SER C 1 179 ? 61.052  10.353  58.709 1.00 35.47  ? 181 SER C OG  1 
ATOM   4331 N N   . ALA C 1 180 ? 59.460  7.794   56.424 1.00 34.64  ? 182 ALA C N   1 
ATOM   4332 C CA  . ALA C 1 180 ? 59.964  6.746   55.565 1.00 34.48  ? 182 ALA C CA  1 
ATOM   4333 C C   . ALA C 1 180 ? 60.077  7.318   54.200 1.00 36.36  ? 182 ALA C C   1 
ATOM   4334 O O   . ALA C 1 180 ? 59.346  8.288   53.842 1.00 37.36  ? 182 ALA C O   1 
ATOM   4335 C CB  . ALA C 1 180 ? 59.023  5.660   55.505 1.00 32.81  ? 182 ALA C CB  1 
ATOM   4336 N N   . ARG C 1 181 ? 60.938  6.652   53.421 1.00 37.28  ? 183 ARG C N   1 
ATOM   4337 C CA  . ARG C 1 181 ? 61.235  6.958   52.028 1.00 37.38  ? 183 ARG C CA  1 
ATOM   4338 C C   . ARG C 1 181 ? 61.465  5.636   51.239 1.00 36.77  ? 183 ARG C C   1 
ATOM   4339 O O   . ARG C 1 181 ? 62.059  4.693   51.759 1.00 36.96  ? 183 ARG C O   1 
ATOM   4340 C CB  . ARG C 1 181 ? 62.467  7.850   51.985 1.00 38.35  ? 183 ARG C CB  1 
ATOM   4341 C CG  . ARG C 1 181 ? 62.849  8.392   50.586 1.00 44.25  ? 183 ARG C CG  1 
ATOM   4342 C CD  . ARG C 1 181 ? 64.376  8.550   50.561 1.00 52.81  ? 183 ARG C CD  1 
ATOM   4343 N NE  . ARG C 1 181 ? 65.011  8.732   49.239 1.00 60.64  ? 183 ARG C NE  1 
ATOM   4344 C CZ  . ARG C 1 181 ? 64.894  9.798   48.434 1.00 63.32  ? 183 ARG C CZ  1 
ATOM   4345 N NH1 . ARG C 1 181 ? 64.078  10.819  48.742 1.00 64.73  ? 183 ARG C NH1 1 
ATOM   4346 N NH2 . ARG C 1 181 ? 65.582  9.827   47.286 1.00 62.88  ? 183 ARG C NH2 1 
ATOM   4347 N N   . ILE C 1 182 ? 60.951  5.569   50.005 1.00 36.09  ? 184 ILE C N   1 
ATOM   4348 C CA  . ILE C 1 182 ? 61.278  4.510   49.039 1.00 35.63  ? 184 ILE C CA  1 
ATOM   4349 C C   . ILE C 1 182 ? 61.772  5.151   47.734 1.00 37.25  ? 184 ILE C C   1 
ATOM   4350 O O   . ILE C 1 182 ? 61.499  6.325   47.502 1.00 36.37  ? 184 ILE C O   1 
ATOM   4351 C CB  . ILE C 1 182 ? 60.095  3.588   48.792 1.00 33.37  ? 184 ILE C CB  1 
ATOM   4352 C CG1 . ILE C 1 182 ? 58.861  4.414   48.426 1.00 32.77  ? 184 ILE C CG1 1 
ATOM   4353 C CG2 . ILE C 1 182 ? 59.819  2.827   50.051 1.00 33.01  ? 184 ILE C CG2 1 
ATOM   4354 C CD1 . ILE C 1 182 ? 57.675  3.658   47.815 1.00 25.70  ? 184 ILE C CD1 1 
ATOM   4355 N N   . ASP C 1 183 ? 62.495  4.396   46.898 1.00 39.72  ? 185 ASP C N   1 
ATOM   4356 C CA  . ASP C 1 183 ? 63.178  5.006   45.742 1.00 42.95  ? 185 ASP C CA  1 
ATOM   4357 C C   . ASP C 1 183 ? 62.304  5.400   44.509 1.00 42.82  ? 185 ASP C C   1 
ATOM   4358 O O   . ASP C 1 183 ? 62.522  6.460   43.897 1.00 45.42  ? 185 ASP C O   1 
ATOM   4359 C CB  . ASP C 1 183 ? 64.541  4.352   45.413 1.00 45.31  ? 185 ASP C CB  1 
ATOM   4360 C CG  . ASP C 1 183 ? 64.440  3.068   44.568 1.00 52.82  ? 185 ASP C CG  1 
ATOM   4361 O OD1 . ASP C 1 183 ? 63.966  3.109   43.381 1.00 59.55  ? 185 ASP C OD1 1 
ATOM   4362 O OD2 . ASP C 1 183 ? 64.927  2.006   45.058 1.00 58.89  ? 185 ASP C OD2 1 
ATOM   4363 N N   . ARG C 1 184 ? 61.303  4.580   44.190 1.00 40.41  ? 186 ARG C N   1 
ATOM   4364 C CA  . ARG C 1 184 ? 60.365  4.836   43.107 1.00 38.17  ? 186 ARG C CA  1 
ATOM   4365 C C   . ARG C 1 184 ? 58.971  4.424   43.608 1.00 35.63  ? 186 ARG C C   1 
ATOM   4366 O O   . ARG C 1 184 ? 58.834  3.951   44.755 1.00 34.70  ? 186 ARG C O   1 
ATOM   4367 C CB  . ARG C 1 184 ? 60.763  3.996   41.914 1.00 39.03  ? 186 ARG C CB  1 
ATOM   4368 C CG  . ARG C 1 184 ? 61.000  2.592   42.291 1.00 37.95  ? 186 ARG C CG  1 
ATOM   4369 C CD  . ARG C 1 184 ? 61.746  1.892   41.229 1.00 41.76  ? 186 ARG C CD  1 
ATOM   4370 N NE  . ARG C 1 184 ? 62.284  0.654   41.812 1.00 46.69  ? 186 ARG C NE  1 
ATOM   4371 C CZ  . ARG C 1 184 ? 61.939  -0.585  41.441 1.00 47.04  ? 186 ARG C CZ  1 
ATOM   4372 N NH1 . ARG C 1 184 ? 61.057  -0.786  40.446 1.00 49.13  ? 186 ARG C NH1 1 
ATOM   4373 N NH2 . ARG C 1 184 ? 62.476  -1.635  42.062 1.00 43.79  ? 186 ARG C NH2 1 
ATOM   4374 N N   . LYS C 1 185 ? 57.955  4.572   42.773 1.00 32.86  ? 187 LYS C N   1 
ATOM   4375 C CA  . LYS C 1 185 ? 56.666  4.088   43.166 1.00 31.89  ? 187 LYS C CA  1 
ATOM   4376 C C   . LYS C 1 185 ? 56.255  2.778   42.428 1.00 31.54  ? 187 LYS C C   1 
ATOM   4377 O O   . LYS C 1 185 ? 55.282  2.128   42.787 1.00 31.00  ? 187 LYS C O   1 
ATOM   4378 C CB  . LYS C 1 185 ? 55.677  5.207   42.983 1.00 31.83  ? 187 LYS C CB  1 
ATOM   4379 C CG  . LYS C 1 185 ? 54.216  4.787   42.750 1.00 36.94  ? 187 LYS C CG  1 
ATOM   4380 C CD  . LYS C 1 185 ? 53.359  5.946   42.182 1.00 39.30  ? 187 LYS C CD  1 
ATOM   4381 C CE  . LYS C 1 185 ? 51.916  5.801   42.536 1.00 41.32  ? 187 LYS C CE  1 
ATOM   4382 N NZ  . LYS C 1 185 ? 51.433  7.193   42.609 1.00 44.88  ? 187 LYS C NZ  1 
ATOM   4383 N N   . GLY C 1 186 ? 57.006  2.383   41.405 1.00 31.59  ? 188 GLY C N   1 
ATOM   4384 C CA  . GLY C 1 186 ? 56.602  1.296   40.566 1.00 30.52  ? 188 GLY C CA  1 
ATOM   4385 C C   . GLY C 1 186 ? 57.526  0.134   40.798 1.00 31.11  ? 188 GLY C C   1 
ATOM   4386 O O   . GLY C 1 186 ? 58.734  0.242   40.671 1.00 31.56  ? 188 GLY C O   1 
ATOM   4387 N N   . PHE C 1 187 ? 56.958  -1.004  41.136 1.00 30.82  ? 189 PHE C N   1 
ATOM   4388 C CA  . PHE C 1 187 ? 57.750  -2.210  41.270 1.00 31.60  ? 189 PHE C CA  1 
ATOM   4389 C C   . PHE C 1 187 ? 57.153  -3.292  40.431 1.00 33.08  ? 189 PHE C C   1 
ATOM   4390 O O   . PHE C 1 187 ? 55.977  -3.236  40.120 1.00 33.63  ? 189 PHE C O   1 
ATOM   4391 C CB  . PHE C 1 187 ? 57.840  -2.613  42.705 1.00 29.18  ? 189 PHE C CB  1 
ATOM   4392 C CG  . PHE C 1 187 ? 58.413  -1.551  43.562 1.00 28.02  ? 189 PHE C CG  1 
ATOM   4393 C CD1 . PHE C 1 187 ? 59.800  -1.482  43.785 1.00 28.16  ? 189 PHE C CD1 1 
ATOM   4394 C CD2 . PHE C 1 187 ? 57.613  -0.598  44.142 1.00 22.17  ? 189 PHE C CD2 1 
ATOM   4395 C CE1 . PHE C 1 187 ? 60.381  -0.493  44.554 1.00 20.02  ? 189 PHE C CE1 1 
ATOM   4396 C CE2 . PHE C 1 187 ? 58.206  0.376   44.935 1.00 21.62  ? 189 PHE C CE2 1 
ATOM   4397 C CZ  . PHE C 1 187 ? 59.618  0.430   45.114 1.00 20.37  ? 189 PHE C CZ  1 
ATOM   4398 N N   . CYS C 1 188 ? 58.005  -4.185  39.975 1.00 36.07  ? 190 CYS C N   1 
ATOM   4399 C CA  . CYS C 1 188 ? 57.606  -5.402  39.327 1.00 40.13  ? 190 CYS C CA  1 
ATOM   4400 C C   . CYS C 1 188 ? 57.481  -6.495  40.359 1.00 39.73  ? 190 CYS C C   1 
ATOM   4401 O O   . CYS C 1 188 ? 58.266  -6.565  41.290 1.00 38.27  ? 190 CYS C O   1 
ATOM   4402 C CB  . CYS C 1 188 ? 58.674  -5.852  38.328 1.00 42.72  ? 190 CYS C CB  1 
ATOM   4403 S SG  . CYS C 1 188 ? 59.344  -4.529  37.295 1.00 52.18  ? 190 CYS C SG  1 
ATOM   4404 N N   . GLU C 1 189 ? 56.537  -7.397  40.139 1.00 41.21  ? 191 GLU C N   1 
ATOM   4405 C CA  . GLU C 1 189 ? 56.384  -8.526  41.044 1.00 42.98  ? 191 GLU C CA  1 
ATOM   4406 C C   . GLU C 1 189 ? 57.737  -9.190  41.056 1.00 44.32  ? 191 GLU C C   1 
ATOM   4407 O O   . GLU C 1 189 ? 58.323  -9.367  40.002 1.00 46.05  ? 191 GLU C O   1 
ATOM   4408 C CB  . GLU C 1 189 ? 55.272  -9.461  40.610 1.00 43.27  ? 191 GLU C CB  1 
ATOM   4409 C CG  . GLU C 1 189 ? 55.761  -10.605 39.783 1.00 51.71  ? 191 GLU C CG  1 
ATOM   4410 C CD  . GLU C 1 189 ? 54.691  -11.134 38.830 1.00 58.11  ? 191 GLU C CD  1 
ATOM   4411 O OE1 . GLU C 1 189 ? 54.914  -11.088 37.563 1.00 57.91  ? 191 GLU C OE1 1 
ATOM   4412 O OE2 . GLU C 1 189 ? 53.641  -11.580 39.378 1.00 58.89  ? 191 GLU C OE2 1 
ATOM   4413 N N   . GLY C 1 190 ? 58.248  -9.457  42.258 1.00 43.97  ? 192 GLY C N   1 
ATOM   4414 C CA  . GLY C 1 190 ? 59.498  -10.112 42.465 1.00 46.30  ? 192 GLY C CA  1 
ATOM   4415 C C   . GLY C 1 190 ? 60.573  -9.230  43.047 1.00 47.02  ? 192 GLY C C   1 
ATOM   4416 O O   . GLY C 1 190 ? 61.458  -9.702  43.753 1.00 48.23  ? 192 GLY C O   1 
ATOM   4417 N N   . ASP C 1 191 ? 60.523  -7.941  42.753 1.00 47.42  ? 193 ASP C N   1 
ATOM   4418 C CA  . ASP C 1 191 ? 61.545  -7.028  43.230 1.00 47.98  ? 193 ASP C CA  1 
ATOM   4419 C C   . ASP C 1 191 ? 61.243  -6.878  44.670 1.00 46.97  ? 193 ASP C C   1 
ATOM   4420 O O   . ASP C 1 191 ? 60.145  -7.215  45.133 1.00 45.33  ? 193 ASP C O   1 
ATOM   4421 C CB  . ASP C 1 191 ? 61.425  -5.632  42.602 1.00 47.81  ? 193 ASP C CB  1 
ATOM   4422 C CG  . ASP C 1 191 ? 61.830  -5.566  41.116 1.00 52.17  ? 193 ASP C CG  1 
ATOM   4423 O OD1 . ASP C 1 191 ? 62.631  -6.412  40.620 1.00 54.26  ? 193 ASP C OD1 1 
ATOM   4424 O OD2 . ASP C 1 191 ? 61.337  -4.598  40.461 1.00 55.62  ? 193 ASP C OD2 1 
ATOM   4425 N N   . GLU C 1 192 ? 62.197  -6.336  45.401 1.00 47.75  ? 194 GLU C N   1 
ATOM   4426 C CA  . GLU C 1 192 ? 61.871  -5.976  46.757 1.00 47.19  ? 194 GLU C CA  1 
ATOM   4427 C C   . GLU C 1 192 ? 61.740  -4.508  46.934 1.00 44.74  ? 194 GLU C C   1 
ATOM   4428 O O   . GLU C 1 192 ? 62.364  -3.741  46.224 1.00 45.12  ? 194 GLU C O   1 
ATOM   4429 C CB  . GLU C 1 192 ? 62.919  -6.495  47.705 1.00 49.62  ? 194 GLU C CB  1 
ATOM   4430 C CG  . GLU C 1 192 ? 64.338  -6.283  47.279 1.00 55.24  ? 194 GLU C CG  1 
ATOM   4431 C CD  . GLU C 1 192 ? 65.285  -7.062  48.185 1.00 61.63  ? 194 GLU C CD  1 
ATOM   4432 O OE1 . GLU C 1 192 ? 65.116  -8.316  48.268 1.00 61.70  ? 194 GLU C OE1 1 
ATOM   4433 O OE2 . GLU C 1 192 ? 66.162  -6.407  48.822 1.00 62.76  ? 194 GLU C OE2 1 
ATOM   4434 N N   . ILE C 1 193 ? 60.909  -4.093  47.884 1.00 42.51  ? 195 ILE C N   1 
ATOM   4435 C CA  . ILE C 1 193 ? 60.929  -2.687  48.275 1.00 39.48  ? 195 ILE C CA  1 
ATOM   4436 C C   . ILE C 1 193 ? 61.907  -2.533  49.413 1.00 39.18  ? 195 ILE C C   1 
ATOM   4437 O O   . ILE C 1 193 ? 61.787  -3.187  50.437 1.00 39.67  ? 195 ILE C O   1 
ATOM   4438 C CB  . ILE C 1 193 ? 59.575  -2.197  48.664 1.00 37.45  ? 195 ILE C CB  1 
ATOM   4439 C CG1 . ILE C 1 193 ? 58.633  -2.425  47.506 1.00 36.55  ? 195 ILE C CG1 1 
ATOM   4440 C CG2 . ILE C 1 193 ? 59.638  -0.683  48.973 1.00 36.81  ? 195 ILE C CG2 1 
ATOM   4441 C CD1 . ILE C 1 193 ? 57.243  -2.109  47.843 1.00 36.31  ? 195 ILE C CD1 1 
ATOM   4442 N N   . SER C 1 194 ? 62.882  -1.673  49.196 1.00 38.87  ? 196 SER C N   1 
ATOM   4443 C CA  . SER C 1 194 ? 63.959  -1.314  50.126 1.00 38.69  ? 196 SER C CA  1 
ATOM   4444 C C   . SER C 1 194 ? 63.465  -0.101  50.923 1.00 36.95  ? 196 SER C C   1 
ATOM   4445 O O   . SER C 1 194 ? 63.384  1.018   50.381 1.00 37.99  ? 196 SER C O   1 
ATOM   4446 C CB  . SER C 1 194 ? 65.146  -0.887  49.221 1.00 39.45  ? 196 SER C CB  1 
ATOM   4447 O OG  . SER C 1 194 ? 66.384  -1.067  49.814 1.00 42.40  ? 196 SER C OG  1 
ATOM   4448 N N   . ILE C 1 195 ? 63.094  -0.277  52.180 1.00 36.16  ? 197 ILE C N   1 
ATOM   4449 C CA  . ILE C 1 195 ? 62.530  0.881   52.964 1.00 34.98  ? 197 ILE C CA  1 
ATOM   4450 C C   . ILE C 1 195 ? 63.584  1.565   53.887 1.00 36.35  ? 197 ILE C C   1 
ATOM   4451 O O   . ILE C 1 195 ? 64.229  0.901   54.734 1.00 35.78  ? 197 ILE C O   1 
ATOM   4452 C CB  . ILE C 1 195 ? 61.317  0.502   53.847 1.00 33.31  ? 197 ILE C CB  1 
ATOM   4453 C CG1 . ILE C 1 195 ? 60.355  -0.412  53.075 1.00 33.82  ? 197 ILE C CG1 1 
ATOM   4454 C CG2 . ILE C 1 195 ? 60.628  1.757   54.373 1.00 28.69  ? 197 ILE C CG2 1 
ATOM   4455 C CD1 . ILE C 1 195 ? 59.127  -0.845  53.859 1.00 33.66  ? 197 ILE C CD1 1 
ATOM   4456 N N   . HIS C 1 196 ? 63.736  2.875   53.689 1.00 36.80  ? 198 HIS C N   1 
ATOM   4457 C CA  . HIS C 1 196 ? 64.522  3.770   54.564 1.00 38.08  ? 198 HIS C CA  1 
ATOM   4458 C C   . HIS C 1 196 ? 63.594  4.517   55.496 1.00 36.11  ? 198 HIS C C   1 
ATOM   4459 O O   . HIS C 1 196 ? 62.738  5.244   55.030 1.00 36.52  ? 198 HIS C O   1 
ATOM   4460 C CB  . HIS C 1 196 ? 65.342  4.758   53.709 1.00 39.50  ? 198 HIS C CB  1 
ATOM   4461 C CG  . HIS C 1 196 ? 66.525  4.117   53.032 1.00 44.21  ? 198 HIS C CG  1 
ATOM   4462 N ND1 . HIS C 1 196 ? 66.411  3.379   51.869 1.00 46.68  ? 198 HIS C ND1 1 
ATOM   4463 C CD2 . HIS C 1 196 ? 67.842  4.075   53.379 1.00 46.17  ? 198 HIS C CD2 1 
ATOM   4464 C CE1 . HIS C 1 196 ? 67.607  2.933   51.514 1.00 48.13  ? 198 HIS C CE1 1 
ATOM   4465 N NE2 . HIS C 1 196 ? 68.490  3.332   52.416 1.00 47.68  ? 198 HIS C NE2 1 
ATOM   4466 N N   . ALA C 1 197 ? 63.707  4.290   56.801 1.00 35.34  ? 199 ALA C N   1 
ATOM   4467 C CA  . ALA C 1 197 ? 62.733  4.853   57.791 1.00 34.00  ? 199 ALA C CA  1 
ATOM   4468 C C   . ALA C 1 197 ? 63.378  5.224   59.123 1.00 34.34  ? 199 ALA C C   1 
ATOM   4469 O O   . ALA C 1 197 ? 64.273  4.538   59.623 1.00 34.84  ? 199 ALA C O   1 
ATOM   4470 C CB  . ALA C 1 197 ? 61.568  3.903   58.020 1.00 31.82  ? 199 ALA C CB  1 
ATOM   4471 N N   . ASP C 1 198 ? 62.955  6.346   59.677 1.00 34.66  ? 200 ASP C N   1 
ATOM   4472 C CA  . ASP C 1 198 ? 63.426  6.762   60.995 1.00 34.24  ? 200 ASP C CA  1 
ATOM   4473 C C   . ASP C 1 198 ? 62.231  6.934   61.876 1.00 33.22  ? 200 ASP C C   1 
ATOM   4474 O O   . ASP C 1 198 ? 61.289  7.578   61.500 1.00 32.48  ? 200 ASP C O   1 
ATOM   4475 C CB  . ASP C 1 198 ? 64.186  8.074   60.936 1.00 34.65  ? 200 ASP C CB  1 
ATOM   4476 C CG  . ASP C 1 198 ? 65.442  7.970   60.163 1.00 37.68  ? 200 ASP C CG  1 
ATOM   4477 O OD1 . ASP C 1 198 ? 66.047  6.881   60.065 1.00 40.48  ? 200 ASP C OD1 1 
ATOM   4478 O OD2 . ASP C 1 198 ? 65.839  9.017   59.646 1.00 43.67  ? 200 ASP C OD2 1 
ATOM   4479 N N   . PHE C 1 199 ? 62.314  6.311   63.038 1.00 33.87  ? 201 PHE C N   1 
ATOM   4480 C CA  . PHE C 1 199 ? 61.288  6.246   64.058 1.00 34.68  ? 201 PHE C CA  1 
ATOM   4481 C C   . PHE C 1 199 ? 61.838  6.839   65.379 1.00 35.95  ? 201 PHE C C   1 
ATOM   4482 O O   . PHE C 1 199 ? 62.910  6.458   65.799 1.00 36.26  ? 201 PHE C O   1 
ATOM   4483 C CB  . PHE C 1 199 ? 60.941  4.791   64.342 1.00 34.33  ? 201 PHE C CB  1 
ATOM   4484 C CG  . PHE C 1 199 ? 60.678  3.943   63.117 1.00 34.26  ? 201 PHE C CG  1 
ATOM   4485 C CD1 . PHE C 1 199 ? 59.411  3.819   62.591 1.00 35.35  ? 201 PHE C CD1 1 
ATOM   4486 C CD2 . PHE C 1 199 ? 61.676  3.233   62.528 1.00 36.50  ? 201 PHE C CD2 1 
ATOM   4487 C CE1 . PHE C 1 199 ? 59.161  3.017   61.485 1.00 34.32  ? 201 PHE C CE1 1 
ATOM   4488 C CE2 . PHE C 1 199 ? 61.421  2.417   61.405 1.00 38.32  ? 201 PHE C CE2 1 
ATOM   4489 C CZ  . PHE C 1 199 ? 60.159  2.307   60.909 1.00 34.74  ? 201 PHE C CZ  1 
ATOM   4490 N N   . GLU C 1 200 ? 61.074  7.745   66.004 1.00 36.73  ? 202 GLU C N   1 
ATOM   4491 C CA  . GLU C 1 200 ? 61.354  8.358   67.290 1.00 38.22  ? 202 GLU C CA  1 
ATOM   4492 C C   . GLU C 1 200 ? 60.198  8.077   68.271 1.00 37.84  ? 202 GLU C C   1 
ATOM   4493 O O   . GLU C 1 200 ? 59.013  8.221   67.931 1.00 37.63  ? 202 GLU C O   1 
ATOM   4494 C CB  . GLU C 1 200 ? 61.534  9.878   67.090 1.00 40.14  ? 202 GLU C CB  1 
ATOM   4495 C CG  . GLU C 1 200 ? 61.612  10.727  68.381 1.00 45.34  ? 202 GLU C CG  1 
ATOM   4496 C CD  . GLU C 1 200 ? 62.134  12.147  68.095 1.00 52.32  ? 202 GLU C CD  1 
ATOM   4497 O OE1 . GLU C 1 200 ? 61.864  13.076  68.902 1.00 53.21  ? 202 GLU C OE1 1 
ATOM   4498 O OE2 . GLU C 1 200 ? 62.793  12.337  67.037 1.00 55.27  ? 202 GLU C OE2 1 
ATOM   4499 N N   . ASN C 1 201 ? 60.539  7.689   69.492 1.00 37.22  ? 203 ASN C N   1 
ATOM   4500 C CA  . ASN C 1 201 ? 59.533  7.403   70.512 1.00 35.90  ? 203 ASN C CA  1 
ATOM   4501 C C   . ASN C 1 201 ? 59.916  8.061   71.824 1.00 36.41  ? 203 ASN C C   1 
ATOM   4502 O O   . ASN C 1 201 ? 60.814  7.552   72.521 1.00 36.68  ? 203 ASN C O   1 
ATOM   4503 C CB  . ASN C 1 201 ? 59.389  5.888   70.708 1.00 34.69  ? 203 ASN C CB  1 
ATOM   4504 C CG  . ASN C 1 201 ? 58.491  5.510   71.920 1.00 35.12  ? 203 ASN C CG  1 
ATOM   4505 O OD1 . ASN C 1 201 ? 57.800  6.348   72.525 1.00 31.62  ? 203 ASN C OD1 1 
ATOM   4506 N ND2 . ASN C 1 201 ? 58.485  4.233   72.246 1.00 30.60  ? 203 ASN C ND2 1 
ATOM   4507 N N   . THR C 1 202 ? 59.277  9.186   72.149 1.00 36.01  ? 204 THR C N   1 
ATOM   4508 C CA  . THR C 1 202 ? 59.466  9.826   73.472 1.00 37.42  ? 204 THR C CA  1 
ATOM   4509 C C   . THR C 1 202 ? 58.272  9.553   74.406 1.00 39.06  ? 204 THR C C   1 
ATOM   4510 O O   . THR C 1 202 ? 58.042  10.257  75.388 1.00 39.92  ? 204 THR C O   1 
ATOM   4511 C CB  . THR C 1 202 ? 59.634  11.359  73.359 1.00 37.70  ? 204 THR C CB  1 
ATOM   4512 O OG1 . THR C 1 202 ? 58.498  11.899  72.672 1.00 40.22  ? 204 THR C OG1 1 
ATOM   4513 C CG2 . THR C 1 202 ? 60.881  11.719  72.614 1.00 34.62  ? 204 THR C CG2 1 
ATOM   4514 N N   . SER C 1 203 ? 57.480  8.551   74.074 1.00 39.45  ? 205 SER C N   1 
ATOM   4515 C CA  . SER C 1 203 ? 56.273  8.317   74.805 1.00 41.73  ? 205 SER C CA  1 
ATOM   4516 C C   . SER C 1 203 ? 56.659  7.306   75.877 1.00 43.77  ? 205 SER C C   1 
ATOM   4517 O O   . SER C 1 203 ? 57.821  6.904   75.959 1.00 43.70  ? 205 SER C O   1 
ATOM   4518 C CB  . SER C 1 203 ? 55.277  7.705   73.876 1.00 40.27  ? 205 SER C CB  1 
ATOM   4519 O OG  . SER C 1 203 ? 55.449  6.297   73.931 1.00 40.64  ? 205 SER C OG  1 
ATOM   4520 N N   . SER C 1 204 ? 55.705  6.871   76.693 1.00 46.28  ? 206 SER C N   1 
ATOM   4521 C CA  . SER C 1 204 ? 56.042  5.970   77.781 1.00 48.26  ? 206 SER C CA  1 
ATOM   4522 C C   . SER C 1 204 ? 55.850  4.525   77.365 1.00 49.00  ? 206 SER C C   1 
ATOM   4523 O O   . SER C 1 204 ? 56.159  3.593   78.135 1.00 49.97  ? 206 SER C O   1 
ATOM   4524 C CB  . SER C 1 204 ? 55.173  6.262   78.980 1.00 50.23  ? 206 SER C CB  1 
ATOM   4525 O OG  . SER C 1 204 ? 53.926  5.696   78.720 1.00 52.85  ? 206 SER C OG  1 
ATOM   4526 N N   . ARG C 1 205 ? 55.332  4.312   76.152 1.00 48.81  ? 207 ARG C N   1 
ATOM   4527 C CA  . ARG C 1 205 ? 55.176  2.943   75.716 1.00 49.29  ? 207 ARG C CA  1 
ATOM   4528 C C   . ARG C 1 205 ? 56.364  2.433   74.923 1.00 47.52  ? 207 ARG C C   1 
ATOM   4529 O O   . ARG C 1 205 ? 57.205  3.208   74.492 1.00 46.49  ? 207 ARG C O   1 
ATOM   4530 C CB  . ARG C 1 205 ? 53.863  2.667   74.984 1.00 49.99  ? 207 ARG C CB  1 
ATOM   4531 C CG  . ARG C 1 205 ? 52.989  3.823   74.700 1.00 52.02  ? 207 ARG C CG  1 
ATOM   4532 C CD  . ARG C 1 205 ? 51.869  3.912   75.737 1.00 58.94  ? 207 ARG C CD  1 
ATOM   4533 N NE  . ARG C 1 205 ? 51.755  5.336   76.066 1.00 65.43  ? 207 ARG C NE  1 
ATOM   4534 C CZ  . ARG C 1 205 ? 50.717  5.917   76.652 1.00 69.29  ? 207 ARG C CZ  1 
ATOM   4535 N NH1 . ARG C 1 205 ? 49.653  5.197   77.002 1.00 69.33  ? 207 ARG C NH1 1 
ATOM   4536 N NH2 . ARG C 1 205 ? 50.760  7.229   76.877 1.00 70.80  ? 207 ARG C NH2 1 
ATOM   4537 N N   . ILE C 1 206 ? 56.418  1.108   74.802 1.00 46.62  ? 208 ILE C N   1 
ATOM   4538 C CA  . ILE C 1 206 ? 57.261  0.425   73.888 1.00 44.39  ? 208 ILE C CA  1 
ATOM   4539 C C   . ILE C 1 206 ? 56.453  0.237   72.630 1.00 43.42  ? 208 ILE C C   1 
ATOM   4540 O O   . ILE C 1 206 ? 55.376  -0.335  72.660 1.00 45.30  ? 208 ILE C O   1 
ATOM   4541 C CB  . ILE C 1 206 ? 57.562  -0.942  74.420 1.00 45.72  ? 208 ILE C CB  1 
ATOM   4542 C CG1 . ILE C 1 206 ? 58.462  -0.823  75.678 1.00 45.51  ? 208 ILE C CG1 1 
ATOM   4543 C CG2 . ILE C 1 206 ? 58.098  -1.827  73.274 1.00 42.65  ? 208 ILE C CG2 1 
ATOM   4544 C CD1 . ILE C 1 206 ? 58.558  -2.110  76.489 1.00 48.38  ? 208 ILE C CD1 1 
ATOM   4545 N N   . VAL C 1 207 ? 56.983  0.707   71.513 1.00 40.83  ? 209 VAL C N   1 
ATOM   4546 C CA  . VAL C 1 207 ? 56.253  0.746   70.264 1.00 37.67  ? 209 VAL C CA  1 
ATOM   4547 C C   . VAL C 1 207 ? 56.938  -0.166  69.281 1.00 37.93  ? 209 VAL C C   1 
ATOM   4548 O O   . VAL C 1 207 ? 58.109  -0.511  69.437 1.00 39.52  ? 209 VAL C O   1 
ATOM   4549 C CB  . VAL C 1 207 ? 56.167  2.196   69.751 1.00 36.68  ? 209 VAL C CB  1 
ATOM   4550 C CG1 . VAL C 1 207 ? 55.361  3.076   70.754 1.00 34.32  ? 209 VAL C CG1 1 
ATOM   4551 C CG2 . VAL C 1 207 ? 57.546  2.773   69.495 1.00 32.15  ? 209 VAL C CG2 1 
ATOM   4552 N N   . VAL C 1 208 ? 56.201  -0.607  68.287 1.00 37.87  ? 210 VAL C N   1 
ATOM   4553 C CA  . VAL C 1 208 ? 56.697  -1.583  67.352 1.00 37.27  ? 210 VAL C CA  1 
ATOM   4554 C C   . VAL C 1 208 ? 56.441  -1.107  65.907 1.00 37.45  ? 210 VAL C C   1 
ATOM   4555 O O   . VAL C 1 208 ? 55.274  -1.055  65.462 1.00 38.34  ? 210 VAL C O   1 
ATOM   4556 C CB  . VAL C 1 208 ? 55.976  -2.897  67.540 1.00 37.58  ? 210 VAL C CB  1 
ATOM   4557 C CG1 . VAL C 1 208 ? 56.597  -3.962  66.609 1.00 37.27  ? 210 VAL C CG1 1 
ATOM   4558 C CG2 . VAL C 1 208 ? 56.010  -3.288  68.962 1.00 35.69  ? 210 VAL C CG2 1 
ATOM   4559 N N   . PRO C 1 209 ? 57.520  -0.796  65.167 1.00 36.96  ? 211 PRO C N   1 
ATOM   4560 C CA  . PRO C 1 209 ? 57.366  -0.398  63.765 1.00 36.47  ? 211 PRO C CA  1 
ATOM   4561 C C   . PRO C 1 209 ? 57.153  -1.660  62.888 1.00 37.57  ? 211 PRO C C   1 
ATOM   4562 O O   . PRO C 1 209 ? 57.789  -2.689  63.119 1.00 38.89  ? 211 PRO C O   1 
ATOM   4563 C CB  . PRO C 1 209 ? 58.691  0.263   63.448 1.00 35.44  ? 211 PRO C CB  1 
ATOM   4564 C CG  . PRO C 1 209 ? 59.697  -0.490  64.332 1.00 35.72  ? 211 PRO C CG  1 
ATOM   4565 C CD  . PRO C 1 209 ? 58.942  -0.880  65.579 1.00 36.84  ? 211 PRO C CD  1 
ATOM   4566 N N   . LYS C 1 210 ? 56.261  -1.556  61.902 1.00 36.87  ? 212 LYS C N   1 
ATOM   4567 C CA  . LYS C 1 210 ? 55.876  -2.640  61.042 1.00 35.43  ? 212 LYS C CA  1 
ATOM   4568 C C   . LYS C 1 210 ? 55.722  -2.050  59.683 1.00 34.79  ? 212 LYS C C   1 
ATOM   4569 O O   . LYS C 1 210 ? 55.535  -0.860  59.598 1.00 34.69  ? 212 LYS C O   1 
ATOM   4570 C CB  . LYS C 1 210 ? 54.558  -3.114  61.479 1.00 35.23  ? 212 LYS C CB  1 
ATOM   4571 C CG  . LYS C 1 210 ? 54.642  -3.753  62.785 1.00 36.74  ? 212 LYS C CG  1 
ATOM   4572 C CD  . LYS C 1 210 ? 53.449  -4.600  63.019 1.00 34.66  ? 212 LYS C CD  1 
ATOM   4573 C CE  . LYS C 1 210 ? 53.530  -5.077  64.392 1.00 36.80  ? 212 LYS C CE  1 
ATOM   4574 N NZ  . LYS C 1 210 ? 52.143  -5.015  64.818 1.00 43.89  ? 212 LYS C NZ  1 
ATOM   4575 N N   . ALA C 1 211 ? 55.831  -2.856  58.617 1.00 35.08  ? 213 ALA C N   1 
ATOM   4576 C CA  . ALA C 1 211 ? 55.402  -2.426  57.277 1.00 34.15  ? 213 ALA C CA  1 
ATOM   4577 C C   . ALA C 1 211 ? 54.743  -3.566  56.539 1.00 34.49  ? 213 ALA C C   1 
ATOM   4578 O O   . ALA C 1 211 ? 54.812  -4.659  56.996 1.00 36.06  ? 213 ALA C O   1 
ATOM   4579 C CB  . ALA C 1 211 ? 56.521  -1.811  56.485 1.00 33.46  ? 213 ALA C CB  1 
ATOM   4580 N N   . ALA C 1 212 ? 54.065  -3.291  55.426 1.00 34.21  ? 214 ALA C N   1 
ATOM   4581 C CA  . ALA C 1 212 ? 53.143  -4.245  54.776 1.00 34.12  ? 214 ALA C CA  1 
ATOM   4582 C C   . ALA C 1 212 ? 52.687  -3.689  53.472 1.00 32.91  ? 214 ALA C C   1 
ATOM   4583 O O   . ALA C 1 212 ? 52.396  -2.509  53.344 1.00 31.62  ? 214 ALA C O   1 
ATOM   4584 C CB  . ALA C 1 212 ? 51.890  -4.508  55.636 1.00 34.65  ? 214 ALA C CB  1 
ATOM   4585 N N   . ILE C 1 213 ? 52.623  -4.565  52.491 1.00 33.94  ? 215 ILE C N   1 
ATOM   4586 C CA  . ILE C 1 213 ? 51.959  -4.219  51.258 1.00 33.72  ? 215 ILE C CA  1 
ATOM   4587 C C   . ILE C 1 213 ? 50.491  -4.543  51.390 1.00 33.76  ? 215 ILE C C   1 
ATOM   4588 O O   . ILE C 1 213 ? 50.124  -5.667  51.701 1.00 35.74  ? 215 ILE C O   1 
ATOM   4589 C CB  . ILE C 1 213 ? 52.577  -4.968  50.088 1.00 34.07  ? 215 ILE C CB  1 
ATOM   4590 C CG1 . ILE C 1 213 ? 54.015  -4.487  49.864 1.00 33.08  ? 215 ILE C CG1 1 
ATOM   4591 C CG2 . ILE C 1 213 ? 51.760  -4.749  48.869 1.00 33.10  ? 215 ILE C CG2 1 
ATOM   4592 C CD1 . ILE C 1 213 ? 54.723  -5.190  48.699 1.00 35.55  ? 215 ILE C CD1 1 
ATOM   4593 N N   . VAL C 1 214 ? 49.627  -3.590  51.173 1.00 32.97  ? 216 VAL C N   1 
ATOM   4594 C CA  . VAL C 1 214 ? 48.230  -3.975  51.156 1.00 34.52  ? 216 VAL C CA  1 
ATOM   4595 C C   . VAL C 1 214 ? 47.529  -3.734  49.821 1.00 34.48  ? 216 VAL C C   1 
ATOM   4596 O O   . VAL C 1 214 ? 47.680  -2.671  49.220 1.00 34.05  ? 216 VAL C O   1 
ATOM   4597 C CB  . VAL C 1 214 ? 47.519  -3.334  52.271 1.00 35.50  ? 216 VAL C CB  1 
ATOM   4598 C CG1 . VAL C 1 214 ? 46.001  -3.514  52.087 1.00 38.12  ? 216 VAL C CG1 1 
ATOM   4599 C CG2 . VAL C 1 214 ? 48.003  -3.986  53.579 1.00 34.76  ? 216 VAL C CG2 1 
ATOM   4600 N N   . ALA C 1 215 ? 46.779  -4.731  49.344 1.00 35.85  ? 217 ALA C N   1 
ATOM   4601 C CA  . ALA C 1 215 ? 46.152  -4.663  47.998 1.00 35.67  ? 217 ALA C CA  1 
ATOM   4602 C C   . ALA C 1 215 ? 44.665  -4.503  48.068 1.00 35.85  ? 217 ALA C C   1 
ATOM   4603 O O   . ALA C 1 215 ? 43.998  -5.242  48.768 1.00 37.33  ? 217 ALA C O   1 
ATOM   4604 C CB  . ALA C 1 215 ? 46.485  -5.927  47.183 1.00 37.39  ? 217 ALA C CB  1 
ATOM   4605 N N   . ARG C 1 216 ? 44.116  -3.544  47.351 1.00 35.67  ? 218 ARG C N   1 
ATOM   4606 C CA  . ARG C 1 216 ? 42.639  -3.507  47.214 1.00 36.99  ? 218 ARG C CA  1 
ATOM   4607 C C   . ARG C 1 216 ? 42.179  -3.968  45.835 1.00 35.61  ? 218 ARG C C   1 
ATOM   4608 O O   . ARG C 1 216 ? 42.470  -3.323  44.837 1.00 34.27  ? 218 ARG C O   1 
ATOM   4609 C CB  . ARG C 1 216 ? 42.101  -2.144  47.585 1.00 36.85  ? 218 ARG C CB  1 
ATOM   4610 C CG  . ARG C 1 216 ? 42.546  -1.734  48.987 1.00 43.66  ? 218 ARG C CG  1 
ATOM   4611 C CD  . ARG C 1 216 ? 42.504  -0.207  49.253 1.00 51.66  ? 218 ARG C CD  1 
ATOM   4612 N NE  . ARG C 1 216 ? 43.508  0.577   48.482 1.00 58.53  ? 218 ARG C NE  1 
ATOM   4613 C CZ  . ARG C 1 216 ? 44.722  0.959   48.921 1.00 57.52  ? 218 ARG C CZ  1 
ATOM   4614 N NH1 . ARG C 1 216 ? 45.146  0.616   50.140 1.00 58.05  ? 218 ARG C NH1 1 
ATOM   4615 N NH2 . ARG C 1 216 ? 45.507  1.692   48.132 1.00 53.80  ? 218 ARG C NH2 1 
ATOM   4616 N N   . HIS C 1 217 ? 41.537  -5.133  45.799 1.00 35.85  ? 219 HIS C N   1 
ATOM   4617 C CA  . HIS C 1 217 ? 41.004  -5.722  44.561 1.00 35.73  ? 219 HIS C CA  1 
ATOM   4618 C C   . HIS C 1 217 ? 39.583  -5.230  44.327 1.00 35.87  ? 219 HIS C C   1 
ATOM   4619 O O   . HIS C 1 217 ? 38.758  -5.434  45.202 1.00 35.95  ? 219 HIS C O   1 
ATOM   4620 C CB  . HIS C 1 217 ? 41.024  -7.264  44.611 1.00 35.76  ? 219 HIS C CB  1 
ATOM   4621 C CG  . HIS C 1 217 ? 42.376  -7.822  44.910 1.00 33.34  ? 219 HIS C CG  1 
ATOM   4622 N ND1 . HIS C 1 217 ? 42.879  -7.897  46.198 1.00 34.02  ? 219 HIS C ND1 1 
ATOM   4623 C CD2 . HIS C 1 217 ? 43.347  -8.298  44.099 1.00 30.27  ? 219 HIS C CD2 1 
ATOM   4624 C CE1 . HIS C 1 217 ? 44.106  -8.380  46.165 1.00 30.00  ? 219 HIS C CE1 1 
ATOM   4625 N NE2 . HIS C 1 217 ? 44.417  -8.624  44.906 1.00 32.19  ? 219 HIS C NE2 1 
ATOM   4626 N N   . THR C 1 218 ? 39.334  -4.564  43.185 1.00 35.57  ? 220 THR C N   1 
ATOM   4627 C CA  . THR C 1 218 ? 37.994  -4.080  42.849 1.00 37.12  ? 220 THR C CA  1 
ATOM   4628 C C   . THR C 1 218 ? 37.408  -5.059  41.904 1.00 39.86  ? 220 THR C C   1 
ATOM   4629 O O   . THR C 1 218 ? 38.037  -5.428  40.926 1.00 40.30  ? 220 THR C O   1 
ATOM   4630 C CB  . THR C 1 218 ? 37.967  -2.759  42.153 1.00 34.78  ? 220 THR C CB  1 
ATOM   4631 O OG1 . THR C 1 218 ? 38.396  -1.751  43.056 1.00 34.90  ? 220 THR C OG1 1 
ATOM   4632 C CG2 . THR C 1 218 ? 36.584  -2.444  41.830 1.00 33.59  ? 220 THR C CG2 1 
ATOM   4633 N N   . TYR C 1 219 ? 36.224  -5.557  42.199 1.00 42.55  ? 221 TYR C N   1 
ATOM   4634 C CA  . TYR C 1 219 ? 35.740  -6.596  41.331 1.00 46.13  ? 221 TYR C CA  1 
ATOM   4635 C C   . TYR C 1 219 ? 34.239  -6.497  41.288 1.00 47.81  ? 221 TYR C C   1 
ATOM   4636 O O   . TYR C 1 219 ? 33.662  -5.772  42.105 1.00 48.31  ? 221 TYR C O   1 
ATOM   4637 C CB  . TYR C 1 219 ? 36.249  -7.955  41.823 1.00 46.83  ? 221 TYR C CB  1 
ATOM   4638 C CG  . TYR C 1 219 ? 35.563  -8.311  43.091 1.00 50.68  ? 221 TYR C CG  1 
ATOM   4639 C CD1 . TYR C 1 219 ? 35.957  -7.741  44.315 1.00 49.55  ? 221 TYR C CD1 1 
ATOM   4640 C CD2 . TYR C 1 219 ? 34.430  -9.153  43.068 1.00 54.56  ? 221 TYR C CD2 1 
ATOM   4641 C CE1 . TYR C 1 219 ? 35.274  -8.050  45.498 1.00 51.62  ? 221 TYR C CE1 1 
ATOM   4642 C CE2 . TYR C 1 219 ? 33.750  -9.485  44.247 1.00 54.52  ? 221 TYR C CE2 1 
ATOM   4643 C CZ  . TYR C 1 219 ? 34.174  -8.942  45.447 1.00 54.38  ? 221 TYR C CZ  1 
ATOM   4644 O OH  . TYR C 1 219 ? 33.473  -9.298  46.578 1.00 56.35  ? 221 TYR C OH  1 
ATOM   4645 N N   . LEU C 1 220 ? 33.624  -7.196  40.329 1.00 51.02  ? 222 LEU C N   1 
ATOM   4646 C CA  . LEU C 1 220 ? 32.134  -7.197  40.096 1.00 54.09  ? 222 LEU C CA  1 
ATOM   4647 C C   . LEU C 1 220 ? 31.506  -8.434  40.692 1.00 57.92  ? 222 LEU C C   1 
ATOM   4648 O O   . LEU C 1 220 ? 31.706  -9.559  40.218 1.00 58.88  ? 222 LEU C O   1 
ATOM   4649 C CB  . LEU C 1 220 ? 31.745  -7.110  38.609 1.00 52.56  ? 222 LEU C CB  1 
ATOM   4650 C CG  . LEU C 1 220 ? 32.235  -5.887  37.833 1.00 52.30  ? 222 LEU C CG  1 
ATOM   4651 C CD1 . LEU C 1 220 ? 31.891  -5.918  36.355 1.00 53.15  ? 222 LEU C CD1 1 
ATOM   4652 C CD2 . LEU C 1 220 ? 31.821  -4.510  38.432 1.00 53.36  ? 222 LEU C CD2 1 
ATOM   4653 N N   . ALA C 1 221 ? 30.801  -8.226  41.789 1.00 61.73  ? 223 ALA C N   1 
ATOM   4654 C CA  . ALA C 1 221 ? 29.907  -9.246  42.296 1.00 67.48  ? 223 ALA C CA  1 
ATOM   4655 C C   . ALA C 1 221 ? 28.622  -8.516  42.079 1.00 70.22  ? 223 ALA C C   1 
ATOM   4656 O O   . ALA C 1 221 ? 28.631  -7.372  41.567 1.00 68.86  ? 223 ALA C O   1 
ATOM   4657 C CB  . ALA C 1 221 ? 30.144  -9.543  43.771 1.00 68.01  ? 223 ALA C CB  1 
ATOM   4658 N N   . ASN C 1 222 ? 27.519  -9.140  42.461 1.00 74.74  ? 224 ASN C N   1 
ATOM   4659 C CA  . ASN C 1 222 ? 26.257  -8.645  41.963 1.00 77.73  ? 224 ASN C CA  1 
ATOM   4660 C C   . ASN C 1 222 ? 25.306  -7.964  42.960 1.00 79.53  ? 224 ASN C C   1 
ATOM   4661 O O   . ASN C 1 222 ? 25.154  -8.390  44.131 1.00 81.85  ? 224 ASN C O   1 
ATOM   4662 C CB  . ASN C 1 222 ? 25.603  -9.745  41.145 1.00 80.19  ? 224 ASN C CB  1 
ATOM   4663 C CG  . ASN C 1 222 ? 26.641  -10.577 40.427 1.00 82.50  ? 224 ASN C CG  1 
ATOM   4664 O OD1 . ASN C 1 222 ? 27.447  -10.031 39.643 1.00 84.02  ? 224 ASN C OD1 1 
ATOM   4665 N ND2 . ASN C 1 222 ? 26.689  -11.887 40.739 1.00 85.75  ? 224 ASN C ND2 1 
ATOM   4666 N N   . GLY C 1 223 ? 24.701  -6.870  42.480 1.00 78.90  ? 225 GLY C N   1 
ATOM   4667 C CA  . GLY C 1 223 ? 25.032  -6.325  41.149 1.00 75.30  ? 225 GLY C CA  1 
ATOM   4668 C C   . GLY C 1 223 ? 25.932  -5.163  41.445 1.00 72.16  ? 225 GLY C C   1 
ATOM   4669 O O   . GLY C 1 223 ? 25.543  -4.012  41.307 1.00 72.05  ? 225 GLY C O   1 
ATOM   4670 N N   . GLN C 1 224 ? 27.123  -5.442  41.932 1.00 69.89  ? 226 GLN C N   1 
ATOM   4671 C CA  . GLN C 1 224 ? 27.937  -4.331  42.363 1.00 67.29  ? 226 GLN C CA  1 
ATOM   4672 C C   . GLN C 1 224 ? 29.429  -4.457  42.083 1.00 64.56  ? 226 GLN C C   1 
ATOM   4673 O O   . GLN C 1 224 ? 29.960  -5.504  41.676 1.00 63.42  ? 226 GLN C O   1 
ATOM   4674 C CB  . GLN C 1 224 ? 27.638  -3.936  43.837 1.00 69.01  ? 226 GLN C CB  1 
ATOM   4675 C CG  . GLN C 1 224 ? 26.720  -4.943  44.682 1.00 72.90  ? 226 GLN C CG  1 
ATOM   4676 C CD  . GLN C 1 224 ? 26.709  -4.680  46.225 1.00 73.26  ? 226 GLN C CD  1 
ATOM   4677 O OE1 . GLN C 1 224 ? 26.078  -5.425  46.996 1.00 76.28  ? 226 GLN C OE1 1 
ATOM   4678 N NE2 . GLN C 1 224 ? 27.401  -3.634  46.658 1.00 70.48  ? 226 GLN C NE2 1 
ATOM   4679 N N   . THR C 1 225 ? 30.062  -3.311  42.238 1.00 62.48  ? 227 THR C N   1 
ATOM   4680 C CA  . THR C 1 225 ? 31.487  -3.201  42.313 1.00 60.99  ? 227 THR C CA  1 
ATOM   4681 C C   . THR C 1 225 ? 31.791  -3.353  43.797 1.00 60.64  ? 227 THR C C   1 
ATOM   4682 O O   . THR C 1 225 ? 31.435  -2.455  44.588 1.00 61.05  ? 227 THR C O   1 
ATOM   4683 C CB  . THR C 1 225 ? 31.882  -1.787  41.916 1.00 59.42  ? 227 THR C CB  1 
ATOM   4684 O OG1 . THR C 1 225 ? 31.143  -1.416  40.754 1.00 62.14  ? 227 THR C OG1 1 
ATOM   4685 C CG2 . THR C 1 225 ? 33.354  -1.694  41.618 1.00 57.89  ? 227 THR C CG2 1 
ATOM   4686 N N   . LYS C 1 226 ? 32.408  -4.467  44.198 1.00 59.08  ? 228 LYS C N   1 
ATOM   4687 C CA  . LYS C 1 226 ? 32.882  -4.561  45.608 1.00 57.91  ? 228 LYS C CA  1 
ATOM   4688 C C   . LYS C 1 226 ? 34.408  -4.297  45.711 1.00 53.86  ? 228 LYS C C   1 
ATOM   4689 O O   . LYS C 1 226 ? 35.059  -4.066  44.691 1.00 53.18  ? 228 LYS C O   1 
ATOM   4690 C CB  . LYS C 1 226 ? 32.417  -5.871  46.285 1.00 59.94  ? 228 LYS C CB  1 
ATOM   4691 C CG  . LYS C 1 226 ? 31.045  -6.335  45.784 1.00 62.50  ? 228 LYS C CG  1 
ATOM   4692 C CD  . LYS C 1 226 ? 30.551  -7.519  46.559 1.00 67.09  ? 228 LYS C CD  1 
ATOM   4693 C CE  . LYS C 1 226 ? 29.487  -7.102  47.534 1.00 73.11  ? 228 LYS C CE  1 
ATOM   4694 N NZ  . LYS C 1 226 ? 29.382  -8.059  48.702 1.00 79.71  ? 228 LYS C NZ  1 
ATOM   4695 N N   . VAL C 1 227 ? 34.962  -4.261  46.917 1.00 50.70  ? 229 VAL C N   1 
ATOM   4696 C CA  . VAL C 1 227 ? 36.401  -4.090  47.090 1.00 46.68  ? 229 VAL C CA  1 
ATOM   4697 C C   . VAL C 1 227 ? 36.855  -5.138  48.057 1.00 46.27  ? 229 VAL C C   1 
ATOM   4698 O O   . VAL C 1 227 ? 36.364  -5.145  49.156 1.00 48.06  ? 229 VAL C O   1 
ATOM   4699 C CB  . VAL C 1 227 ? 36.774  -2.679  47.617 1.00 45.68  ? 229 VAL C CB  1 
ATOM   4700 C CG1 . VAL C 1 227 ? 38.086  -2.680  48.388 1.00 44.05  ? 229 VAL C CG1 1 
ATOM   4701 C CG2 . VAL C 1 227 ? 36.841  -1.676  46.480 1.00 42.73  ? 229 VAL C CG2 1 
ATOM   4702 N N   . LEU C 1 228 ? 37.756  -6.034  47.646 1.00 44.20  ? 230 LEU C N   1 
ATOM   4703 C CA  . LEU C 1 228 ? 38.394  -6.978  48.561 1.00 43.26  ? 230 LEU C CA  1 
ATOM   4704 C C   . LEU C 1 228 ? 39.811  -6.477  48.911 1.00 40.66  ? 230 LEU C C   1 
ATOM   4705 O O   . LEU C 1 228 ? 40.586  -6.214  48.033 1.00 40.87  ? 230 LEU C O   1 
ATOM   4706 C CB  . LEU C 1 228 ? 38.473  -8.372  47.950 1.00 43.39  ? 230 LEU C CB  1 
ATOM   4707 C CG  . LEU C 1 228 ? 39.492  -9.223  48.725 1.00 44.04  ? 230 LEU C CG  1 
ATOM   4708 C CD1 . LEU C 1 228 ? 38.942  -9.611  50.054 1.00 46.83  ? 230 LEU C CD1 1 
ATOM   4709 C CD2 . LEU C 1 228 ? 39.959  -10.454 48.029 1.00 43.86  ? 230 LEU C CD2 1 
ATOM   4710 N N   . THR C 1 229 ? 40.130  -6.389  50.188 1.00 39.26  ? 231 THR C N   1 
ATOM   4711 C CA  . THR C 1 229 ? 41.419  -5.944  50.717 1.00 37.18  ? 231 THR C CA  1 
ATOM   4712 C C   . THR C 1 229 ? 42.230  -7.098  51.344 1.00 38.24  ? 231 THR C C   1 
ATOM   4713 O O   . THR C 1 229 ? 41.720  -7.982  52.022 1.00 40.07  ? 231 THR C O   1 
ATOM   4714 C CB  . THR C 1 229 ? 41.192  -4.839  51.768 1.00 36.41  ? 231 THR C CB  1 
ATOM   4715 O OG1 . THR C 1 229 ? 40.618  -3.698  51.130 1.00 35.20  ? 231 THR C OG1 1 
ATOM   4716 C CG2 . THR C 1 229 ? 42.440  -4.413  52.329 1.00 34.76  ? 231 THR C CG2 1 
ATOM   4717 N N   . GLN C 1 230 ? 43.516  -7.095  51.099 1.00 38.03  ? 232 GLN C N   1 
ATOM   4718 C CA  . GLN C 1 230 ? 44.341  -8.223  51.405 1.00 40.29  ? 232 GLN C CA  1 
ATOM   4719 C C   . GLN C 1 230 ? 45.700  -7.687  51.852 1.00 39.49  ? 232 GLN C C   1 
ATOM   4720 O O   . GLN C 1 230 ? 46.335  -6.859  51.154 1.00 38.77  ? 232 GLN C O   1 
ATOM   4721 C CB  . GLN C 1 230 ? 44.489  -9.042  50.128 1.00 40.64  ? 232 GLN C CB  1 
ATOM   4722 C CG  . GLN C 1 230 ? 44.660  -10.512 50.307 1.00 47.56  ? 232 GLN C CG  1 
ATOM   4723 C CD  . GLN C 1 230 ? 45.181  -11.223 49.023 1.00 55.35  ? 232 GLN C CD  1 
ATOM   4724 O OE1 . GLN C 1 230 ? 45.003  -10.740 47.893 1.00 56.50  ? 232 GLN C OE1 1 
ATOM   4725 N NE2 . GLN C 1 230 ? 45.826  -12.383 49.206 1.00 58.26  ? 232 GLN C NE2 1 
ATOM   4726 N N   . LYS C 1 231 ? 46.143  -8.132  53.016 1.00 40.58  ? 233 LYS C N   1 
ATOM   4727 C CA  . LYS C 1 231 ? 47.497  -7.903  53.433 1.00 40.68  ? 233 LYS C CA  1 
ATOM   4728 C C   . LYS C 1 231 ? 48.399  -8.949  52.784 1.00 41.89  ? 233 LYS C C   1 
ATOM   4729 O O   . LYS C 1 231 ? 48.229  -10.171 52.949 1.00 43.53  ? 233 LYS C O   1 
ATOM   4730 C CB  . LYS C 1 231 ? 47.617  -7.968  54.926 1.00 42.05  ? 233 LYS C CB  1 
ATOM   4731 C CG  . LYS C 1 231 ? 49.093  -7.855  55.432 1.00 43.97  ? 233 LYS C CG  1 
ATOM   4732 C CD  . LYS C 1 231 ? 49.115  -7.643  56.944 1.00 44.81  ? 233 LYS C CD  1 
ATOM   4733 C CE  . LYS C 1 231 ? 50.052  -8.641  57.560 1.00 45.39  ? 233 LYS C CE  1 
ATOM   4734 N NZ  . LYS C 1 231 ? 49.688  -8.680  58.994 1.00 50.11  ? 233 LYS C NZ  1 
ATOM   4735 N N   . LEU C 1 232 ? 49.379  -8.450  52.067 1.00 40.44  ? 234 LEU C N   1 
ATOM   4736 C CA  . LEU C 1 232 ? 50.015  -9.253  51.101 1.00 41.65  ? 234 LEU C CA  1 
ATOM   4737 C C   . LEU C 1 232 ? 51.463  -9.481  51.372 1.00 44.43  ? 234 LEU C C   1 
ATOM   4738 O O   . LEU C 1 232 ? 52.135  -9.883  50.424 1.00 48.58  ? 234 LEU C O   1 
ATOM   4739 C CB  . LEU C 1 232 ? 50.031  -8.505  49.785 1.00 38.83  ? 234 LEU C CB  1 
ATOM   4740 C CG  . LEU C 1 232 ? 49.081  -8.811  48.632 1.00 37.87  ? 234 LEU C CG  1 
ATOM   4741 C CD1 . LEU C 1 232 ? 49.633  -8.093  47.419 1.00 30.12  ? 234 LEU C CD1 1 
ATOM   4742 C CD2 . LEU C 1 232 ? 49.011  -10.366 48.402 1.00 37.84  ? 234 LEU C CD2 1 
ATOM   4743 N N   . SER C 1 233 ? 51.997  -9.279  52.575 1.00 43.54  ? 235 SER C N   1 
ATOM   4744 C CA  . SER C 1 233 ? 53.440  -9.319  52.678 1.00 42.45  ? 235 SER C CA  1 
ATOM   4745 C C   . SER C 1 233 ? 53.876  -8.281  53.652 1.00 42.97  ? 235 SER C C   1 
ATOM   4746 O O   . SER C 1 233 ? 53.578  -7.086  53.424 1.00 42.53  ? 235 SER C O   1 
ATOM   4747 C CB  . SER C 1 233 ? 54.040  -8.839  51.356 1.00 41.39  ? 235 SER C CB  1 
ATOM   4748 O OG  . SER C 1 233 ? 55.474  -9.053  51.290 1.00 36.43  ? 235 SER C OG  1 
ATOM   4749 N N   . SER C 1 234 ? 54.585  -8.682  54.710 1.00 43.35  ? 236 SER C N   1 
ATOM   4750 C CA  . SER C 1 234 ? 54.945  -7.698  55.734 1.00 43.37  ? 236 SER C CA  1 
ATOM   4751 C C   . SER C 1 234 ? 56.184  -8.023  56.548 1.00 44.52  ? 236 SER C C   1 
ATOM   4752 O O   . SER C 1 234 ? 56.782  -9.106  56.402 1.00 45.70  ? 236 SER C O   1 
ATOM   4753 C CB  . SER C 1 234 ? 53.778  -7.388  56.647 1.00 41.99  ? 236 SER C CB  1 
ATOM   4754 O OG  . SER C 1 234 ? 53.332  -8.569  57.230 1.00 44.54  ? 236 SER C OG  1 
ATOM   4755 N N   . VAL C 1 235 ? 56.590  -7.031  57.340 1.00 44.53  ? 237 VAL C N   1 
ATOM   4756 C CA  . VAL C 1 235 ? 57.788  -7.086  58.149 1.00 46.22  ? 237 VAL C CA  1 
ATOM   4757 C C   . VAL C 1 235 ? 57.558  -6.423  59.463 1.00 46.97  ? 237 VAL C C   1 
ATOM   4758 O O   . VAL C 1 235 ? 56.628  -5.616  59.648 1.00 46.03  ? 237 VAL C O   1 
ATOM   4759 C CB  . VAL C 1 235 ? 59.042  -6.469  57.473 1.00 45.32  ? 237 VAL C CB  1 
ATOM   4760 C CG1 . VAL C 1 235 ? 59.593  -7.390  56.440 1.00 47.79  ? 237 VAL C CG1 1 
ATOM   4761 C CG2 . VAL C 1 235 ? 58.746  -5.168  56.850 1.00 43.35  ? 237 VAL C CG2 1 
ATOM   4762 N N   . ARG C 1 236 ? 58.432  -6.792  60.380 1.00 49.24  ? 238 ARG C N   1 
ATOM   4763 C CA  . ARG C 1 236 ? 58.325  -6.375  61.763 1.00 51.22  ? 238 ARG C CA  1 
ATOM   4764 C C   . ARG C 1 236 ? 59.714  -5.966  62.231 1.00 50.32  ? 238 ARG C C   1 
ATOM   4765 O O   . ARG C 1 236 ? 60.644  -6.778  62.164 1.00 51.85  ? 238 ARG C O   1 
ATOM   4766 C CB  . ARG C 1 236 ? 57.841  -7.578  62.575 1.00 53.70  ? 238 ARG C CB  1 
ATOM   4767 C CG  . ARG C 1 236 ? 57.349  -7.224  63.962 1.00 58.45  ? 238 ARG C CG  1 
ATOM   4768 C CD  . ARG C 1 236 ? 57.255  -8.483  64.795 1.00 66.41  ? 238 ARG C CD  1 
ATOM   4769 N NE  . ARG C 1 236 ? 56.974  -8.162  66.186 1.00 72.61  ? 238 ARG C NE  1 
ATOM   4770 C CZ  . ARG C 1 236 ? 57.891  -7.728  67.062 1.00 76.20  ? 238 ARG C CZ  1 
ATOM   4771 N NH1 . ARG C 1 236 ? 59.176  -7.555  66.690 1.00 73.96  ? 238 ARG C NH1 1 
ATOM   4772 N NH2 . ARG C 1 236 ? 57.510  -7.462  68.324 1.00 77.52  ? 238 ARG C NH2 1 
ATOM   4773 N N   . GLY C 1 237 ? 59.884  -4.721  62.664 1.00 48.68  ? 239 GLY C N   1 
ATOM   4774 C CA  . GLY C 1 237 ? 61.179  -4.281  63.172 1.00 47.13  ? 239 GLY C CA  1 
ATOM   4775 C C   . GLY C 1 237 ? 61.301  -4.685  64.628 1.00 47.64  ? 239 GLY C C   1 
ATOM   4776 O O   . GLY C 1 237 ? 60.401  -5.284  65.179 1.00 48.66  ? 239 GLY C O   1 
ATOM   4777 N N   . ASN C 1 238 ? 62.426  -4.366  65.246 1.00 47.34  ? 240 ASN C N   1 
ATOM   4778 C CA  . ASN C 1 238 ? 62.570  -4.367  66.694 1.00 47.82  ? 240 ASN C CA  1 
ATOM   4779 C C   . ASN C 1 238 ? 61.723  -3.409  67.536 1.00 45.97  ? 240 ASN C C   1 
ATOM   4780 O O   . ASN C 1 238 ? 61.616  -2.246  67.174 1.00 44.65  ? 240 ASN C O   1 
ATOM   4781 C CB  . ASN C 1 238 ? 63.978  -3.946  66.962 1.00 48.78  ? 240 ASN C CB  1 
ATOM   4782 C CG  . ASN C 1 238 ? 64.920  -4.985  66.643 1.00 52.57  ? 240 ASN C CG  1 
ATOM   4783 O OD1 . ASN C 1 238 ? 64.612  -6.184  66.823 1.00 58.48  ? 240 ASN C OD1 1 
ATOM   4784 N ND2 . ASN C 1 238 ? 66.112  -4.579  66.190 1.00 52.91  ? 240 ASN C ND2 1 
ATOM   4785 N N   . HIS C 1 239 ? 61.215  -3.894  68.680 1.00 45.89  ? 241 HIS C N   1 
ATOM   4786 C CA  . HIS C 1 239 ? 60.539  -3.081  69.709 1.00 46.15  ? 241 HIS C CA  1 
ATOM   4787 C C   . HIS C 1 239 ? 61.376  -1.807  69.894 1.00 43.62  ? 241 HIS C C   1 
ATOM   4788 O O   . HIS C 1 239 ? 62.585  -1.902  70.079 1.00 43.77  ? 241 HIS C O   1 
ATOM   4789 C CB  . HIS C 1 239 ? 60.493  -3.821  71.069 1.00 49.18  ? 241 HIS C CB  1 
ATOM   4790 C CG  . HIS C 1 239 ? 59.616  -5.048  71.100 1.00 57.16  ? 241 HIS C CG  1 
ATOM   4791 N ND1 . HIS C 1 239 ? 58.606  -5.222  72.029 1.00 64.39  ? 241 HIS C ND1 1 
ATOM   4792 C CD2 . HIS C 1 239 ? 59.618  -6.179  70.346 1.00 62.17  ? 241 HIS C CD2 1 
ATOM   4793 C CE1 . HIS C 1 239 ? 58.014  -6.390  71.838 1.00 65.13  ? 241 HIS C CE1 1 
ATOM   4794 N NE2 . HIS C 1 239 ? 58.610  -6.991  70.822 1.00 64.55  ? 241 HIS C NE2 1 
ATOM   4795 N N   . ILE C 1 240 ? 60.776  -0.630  69.812 1.00 40.45  ? 242 ILE C N   1 
ATOM   4796 C CA  . ILE C 1 240 ? 61.532  0.581   70.104 1.00 38.97  ? 242 ILE C CA  1 
ATOM   4797 C C   . ILE C 1 240 ? 61.137  1.062   71.478 1.00 38.98  ? 242 ILE C C   1 
ATOM   4798 O O   . ILE C 1 240 ? 59.970  1.375   71.710 1.00 39.23  ? 242 ILE C O   1 
ATOM   4799 C CB  . ILE C 1 240 ? 61.235  1.720   69.113 1.00 38.73  ? 242 ILE C CB  1 
ATOM   4800 C CG1 . ILE C 1 240 ? 61.639  1.324   67.680 1.00 38.77  ? 242 ILE C CG1 1 
ATOM   4801 C CG2 . ILE C 1 240 ? 61.936  3.022   69.548 1.00 36.30  ? 242 ILE C CG2 1 
ATOM   4802 C CD1 . ILE C 1 240 ? 60.949  2.140   66.625 1.00 35.31  ? 242 ILE C CD1 1 
ATOM   4803 N N   . ILE C 1 241 ? 62.090  1.101   72.406 1.00 38.23  ? 243 ILE C N   1 
ATOM   4804 C CA  . ILE C 1 241 ? 61.718  1.375   73.797 1.00 37.04  ? 243 ILE C CA  1 
ATOM   4805 C C   . ILE C 1 241 ? 61.620  2.849   74.032 1.00 37.75  ? 243 ILE C C   1 
ATOM   4806 O O   . ILE C 1 241 ? 62.237  3.661   73.324 1.00 36.67  ? 243 ILE C O   1 
ATOM   4807 C CB  . ILE C 1 241 ? 62.702  0.786   74.869 1.00 37.68  ? 243 ILE C CB  1 
ATOM   4808 C CG1 . ILE C 1 241 ? 63.940  1.688   75.062 1.00 34.49  ? 243 ILE C CG1 1 
ATOM   4809 C CG2 . ILE C 1 241 ? 62.948  -0.717  74.670 1.00 34.25  ? 243 ILE C CG2 1 
ATOM   4810 C CD1 . ILE C 1 241 ? 64.850  1.264   76.239 1.00 33.01  ? 243 ILE C CD1 1 
ATOM   4811 N N   . SER C 1 242 ? 60.883  3.184   75.088 1.00 39.36  ? 244 SER C N   1 
ATOM   4812 C CA  . SER C 1 242 ? 60.655  4.566   75.474 1.00 39.09  ? 244 SER C CA  1 
ATOM   4813 C C   . SER C 1 242 ? 61.935  5.361   75.573 1.00 38.32  ? 244 SER C C   1 
ATOM   4814 O O   . SER C 1 242 ? 62.926  4.891   76.060 1.00 38.20  ? 244 SER C O   1 
ATOM   4815 C CB  . SER C 1 242 ? 59.958  4.600   76.796 1.00 40.53  ? 244 SER C CB  1 
ATOM   4816 O OG  . SER C 1 242 ? 59.921  5.950   77.189 1.00 44.59  ? 244 SER C OG  1 
ATOM   4817 N N   . GLY C 1 243 ? 61.917  6.567   75.055 1.00 39.06  ? 245 GLY C N   1 
ATOM   4818 C CA  . GLY C 1 243 ? 63.105  7.415   75.037 1.00 39.38  ? 245 GLY C CA  1 
ATOM   4819 C C   . GLY C 1 243 ? 64.193  7.035   74.048 1.00 39.23  ? 245 GLY C C   1 
ATOM   4820 O O   . GLY C 1 243 ? 65.370  7.155   74.394 1.00 39.94  ? 245 GLY C O   1 
ATOM   4821 N N   . THR C 1 244 ? 63.833  6.600   72.838 1.00 38.13  ? 246 THR C N   1 
ATOM   4822 C CA  . THR C 1 244 ? 64.824  6.288   71.835 1.00 38.91  ? 246 THR C CA  1 
ATOM   4823 C C   . THR C 1 244 ? 64.332  6.459   70.410 1.00 39.50  ? 246 THR C C   1 
ATOM   4824 O O   . THR C 1 244 ? 63.114  6.624   70.141 1.00 39.75  ? 246 THR C O   1 
ATOM   4825 C CB  . THR C 1 244 ? 65.368  4.831   71.926 1.00 39.50  ? 246 THR C CB  1 
ATOM   4826 O OG1 . THR C 1 244 ? 64.401  3.934   71.406 1.00 40.49  ? 246 THR C OG1 1 
ATOM   4827 C CG2 . THR C 1 244 ? 65.694  4.405   73.328 1.00 39.71  ? 246 THR C CG2 1 
ATOM   4828 N N   . CYS C 1 245 ? 65.284  6.397   69.488 1.00 39.95  ? 247 CYS C N   1 
ATOM   4829 C CA  . CYS C 1 245 ? 64.999  6.430   68.073 1.00 40.43  ? 247 CYS C CA  1 
ATOM   4830 C C   . CYS C 1 245 ? 65.643  5.207   67.483 1.00 40.90  ? 247 CYS C C   1 
ATOM   4831 O O   . CYS C 1 245 ? 66.445  4.534   68.151 1.00 42.58  ? 247 CYS C O   1 
ATOM   4832 C CB  . CYS C 1 245 ? 65.569  7.688   67.419 1.00 40.98  ? 247 CYS C CB  1 
ATOM   4833 S SG  . CYS C 1 245 ? 65.096  9.272   68.207 1.00 45.84  ? 247 CYS C SG  1 
ATOM   4834 N N   . ALA C 1 246 ? 65.278  4.895   66.245 1.00 40.76  ? 248 ALA C N   1 
ATOM   4835 C CA  . ALA C 1 246 ? 65.821  3.719   65.539 1.00 41.02  ? 248 ALA C CA  1 
ATOM   4836 C C   . ALA C 1 246 ? 65.611  3.946   64.037 1.00 40.75  ? 248 ALA C C   1 
ATOM   4837 O O   . ALA C 1 246 ? 64.826  4.804   63.672 1.00 40.06  ? 248 ALA C O   1 
ATOM   4838 C CB  . ALA C 1 246 ? 65.156  2.439   66.027 1.00 40.53  ? 248 ALA C CB  1 
ATOM   4839 N N   . SER C 1 247 ? 66.318  3.228   63.166 1.00 41.19  ? 249 SER C N   1 
ATOM   4840 C CA  . SER C 1 247 ? 66.210  3.513   61.743 1.00 41.63  ? 249 SER C CA  1 
ATOM   4841 C C   . SER C 1 247 ? 66.277  2.293   60.887 1.00 42.41  ? 249 SER C C   1 
ATOM   4842 O O   . SER C 1 247 ? 67.170  1.462   61.081 1.00 45.20  ? 249 SER C O   1 
ATOM   4843 C CB  . SER C 1 247 ? 67.380  4.342   61.293 1.00 42.42  ? 249 SER C CB  1 
ATOM   4844 O OG  . SER C 1 247 ? 67.508  5.493   62.070 1.00 45.06  ? 249 SER C OG  1 
ATOM   4845 N N   . TRP C 1 248 ? 65.422  2.203   59.870 1.00 40.97  ? 250 TRP C N   1 
ATOM   4846 C CA  . TRP C 1 248 ? 65.634  1.188   58.839 1.00 39.68  ? 250 TRP C CA  1 
ATOM   4847 C C   . TRP C 1 248 ? 66.500  1.725   57.714 1.00 39.94  ? 250 TRP C C   1 
ATOM   4848 O O   . TRP C 1 248 ? 66.226  2.778   57.153 1.00 38.65  ? 250 TRP C O   1 
ATOM   4849 C CB  . TRP C 1 248 ? 64.301  0.698   58.311 1.00 39.11  ? 250 TRP C CB  1 
ATOM   4850 C CG  . TRP C 1 248 ? 63.487  -0.047  59.291 1.00 37.76  ? 250 TRP C CG  1 
ATOM   4851 C CD1 . TRP C 1 248 ? 63.883  -0.510  60.506 1.00 36.34  ? 250 TRP C CD1 1 
ATOM   4852 C CD2 . TRP C 1 248 ? 62.132  -0.477  59.120 1.00 36.12  ? 250 TRP C CD2 1 
ATOM   4853 N NE1 . TRP C 1 248 ? 62.855  -1.189  61.107 1.00 36.22  ? 250 TRP C NE1 1 
ATOM   4854 C CE2 . TRP C 1 248 ? 61.774  -1.191  60.270 1.00 35.70  ? 250 TRP C CE2 1 
ATOM   4855 C CE3 . TRP C 1 248 ? 61.182  -0.313  58.106 1.00 33.91  ? 250 TRP C CE3 1 
ATOM   4856 C CZ2 . TRP C 1 248 ? 60.495  -1.724  60.446 1.00 37.22  ? 250 TRP C CZ2 1 
ATOM   4857 C CZ3 . TRP C 1 248 ? 59.924  -0.857  58.267 1.00 31.08  ? 250 TRP C CZ3 1 
ATOM   4858 C CH2 . TRP C 1 248 ? 59.580  -1.540  59.431 1.00 34.40  ? 250 TRP C CH2 1 
ATOM   4859 N N   . ARG C 1 249 ? 67.582  1.025   57.413 1.00 42.07  ? 251 ARG C N   1 
ATOM   4860 C CA  . ARG C 1 249 ? 68.484  1.483   56.334 1.00 44.10  ? 251 ARG C CA  1 
ATOM   4861 C C   . ARG C 1 249 ? 68.312  0.537   55.171 1.00 45.59  ? 251 ARG C C   1 
ATOM   4862 O O   . ARG C 1 249 ? 69.162  -0.336  54.895 1.00 47.16  ? 251 ARG C O   1 
ATOM   4863 C CB  . ARG C 1 249 ? 69.938  1.517   56.771 1.00 43.96  ? 251 ARG C CB  1 
ATOM   4864 C CG  . ARG C 1 249 ? 70.216  2.543   57.859 1.00 45.82  ? 251 ARG C CG  1 
ATOM   4865 C CD  . ARG C 1 249 ? 71.684  2.488   58.435 1.00 50.29  ? 251 ARG C CD  1 
ATOM   4866 N NE  . ARG C 1 249 ? 71.800  2.975   59.824 1.00 54.16  ? 251 ARG C NE  1 
ATOM   4867 C CZ  . ARG C 1 249 ? 71.765  4.267   60.215 1.00 55.36  ? 251 ARG C CZ  1 
ATOM   4868 N NH1 . ARG C 1 249 ? 71.611  5.273   59.335 1.00 48.79  ? 251 ARG C NH1 1 
ATOM   4869 N NH2 . ARG C 1 249 ? 71.867  4.547   61.518 1.00 56.69  ? 251 ARG C NH2 1 
ATOM   4870 N N   . GLY C 1 250 ? 67.170  0.668   54.512 1.00 44.99  ? 252 GLY C N   1 
ATOM   4871 C CA  . GLY C 1 250 ? 66.878  -0.233  53.402 1.00 45.47  ? 252 GLY C CA  1 
ATOM   4872 C C   . GLY C 1 250 ? 66.387  -1.600  53.839 1.00 44.95  ? 252 GLY C C   1 
ATOM   4873 O O   . GLY C 1 250 ? 66.753  -2.605  53.248 1.00 46.32  ? 252 GLY C O   1 
ATOM   4874 N N   . LYS C 1 251 ? 65.529  -1.627  54.854 1.00 43.96  ? 253 LYS C N   1 
ATOM   4875 C CA  . LYS C 1 251 ? 64.816  -2.843  55.253 1.00 44.12  ? 253 LYS C CA  1 
ATOM   4876 C C   . LYS C 1 251 ? 64.008  -3.260  54.019 1.00 44.56  ? 253 LYS C C   1 
ATOM   4877 O O   . LYS C 1 251 ? 63.291  -2.447  53.390 1.00 43.64  ? 253 LYS C O   1 
ATOM   4878 C CB  . LYS C 1 251 ? 63.942  -2.557  56.492 1.00 42.90  ? 253 LYS C CB  1 
ATOM   4879 C CG  . LYS C 1 251 ? 62.904  -3.619  56.940 1.00 44.71  ? 253 LYS C CG  1 
ATOM   4880 C CD  . LYS C 1 251 ? 63.432  -4.762  57.894 1.00 50.41  ? 253 LYS C CD  1 
ATOM   4881 C CE  . LYS C 1 251 ? 63.502  -4.404  59.386 1.00 50.92  ? 253 LYS C CE  1 
ATOM   4882 N NZ  . LYS C 1 251 ? 64.935  -4.185  59.875 1.00 53.15  ? 253 LYS C NZ  1 
ATOM   4883 N N   . SER C 1 252 ? 64.160  -4.509  53.630 1.00 44.77  ? 254 SER C N   1 
ATOM   4884 C CA  . SER C 1 252 ? 63.662  -4.863  52.365 1.00 44.94  ? 254 SER C CA  1 
ATOM   4885 C C   . SER C 1 252 ? 62.341  -5.637  52.492 1.00 44.49  ? 254 SER C C   1 
ATOM   4886 O O   . SER C 1 252 ? 62.088  -6.278  53.513 1.00 43.89  ? 254 SER C O   1 
ATOM   4887 C CB  . SER C 1 252 ? 64.747  -5.625  51.627 1.00 47.08  ? 254 SER C CB  1 
ATOM   4888 O OG  . SER C 1 252 ? 64.322  -6.947  51.430 1.00 50.80  ? 254 SER C OG  1 
ATOM   4889 N N   . LEU C 1 253 ? 61.505  -5.570  51.451 1.00 43.97  ? 255 LEU C N   1 
ATOM   4890 C CA  . LEU C 1 253 ? 60.162  -6.139  51.485 1.00 43.87  ? 255 LEU C CA  1 
ATOM   4891 C C   . LEU C 1 253 ? 59.749  -6.612  50.111 1.00 45.31  ? 255 LEU C C   1 
ATOM   4892 O O   . LEU C 1 253 ? 59.542  -5.821  49.228 1.00 44.79  ? 255 LEU C O   1 
ATOM   4893 C CB  . LEU C 1 253 ? 59.184  -5.107  52.010 1.00 41.65  ? 255 LEU C CB  1 
ATOM   4894 C CG  . LEU C 1 253 ? 57.700  -5.417  52.001 1.00 41.33  ? 255 LEU C CG  1 
ATOM   4895 C CD1 . LEU C 1 253 ? 57.477  -6.839  52.478 1.00 45.27  ? 255 LEU C CD1 1 
ATOM   4896 C CD2 . LEU C 1 253 ? 56.915  -4.462  52.890 1.00 38.71  ? 255 LEU C CD2 1 
ATOM   4897 N N   . ARG C 1 254 ? 59.648  -7.916  49.941 1.00 48.64  ? 256 ARG C N   1 
ATOM   4898 C CA  . ARG C 1 254 ? 59.407  -8.500  48.648 1.00 52.07  ? 256 ARG C CA  1 
ATOM   4899 C C   . ARG C 1 254 ? 58.008  -8.250  48.173 1.00 52.36  ? 256 ARG C C   1 
ATOM   4900 O O   . ARG C 1 254 ? 57.091  -8.143  48.991 1.00 52.89  ? 256 ARG C O   1 
ATOM   4901 C CB  . ARG C 1 254 ? 59.652  -10.004 48.682 1.00 54.85  ? 256 ARG C CB  1 
ATOM   4902 C CG  . ARG C 1 254 ? 59.845  -10.582 47.279 1.00 59.14  ? 256 ARG C CG  1 
ATOM   4903 C CD  . ARG C 1 254 ? 60.905  -11.648 47.204 1.00 67.49  ? 256 ARG C CD  1 
ATOM   4904 N NE  . ARG C 1 254 ? 62.272  -11.191 47.509 1.00 69.42  ? 256 ARG C NE  1 
ATOM   4905 C CZ  . ARG C 1 254 ? 63.131  -10.702 46.612 1.00 72.07  ? 256 ARG C CZ  1 
ATOM   4906 N NH1 . ARG C 1 254 ? 64.357  -10.346 46.986 1.00 73.56  ? 256 ARG C NH1 1 
ATOM   4907 N NH2 . ARG C 1 254 ? 62.769  -10.549 45.343 1.00 72.78  ? 256 ARG C NH2 1 
ATOM   4908 N N   . VAL C 1 255 ? 57.854  -8.148  46.848 1.00 53.66  ? 257 VAL C N   1 
ATOM   4909 C CA  . VAL C 1 255 ? 56.559  -8.023  46.163 1.00 54.06  ? 257 VAL C CA  1 
ATOM   4910 C C   . VAL C 1 255 ? 56.271  -9.308  45.413 1.00 57.17  ? 257 VAL C C   1 
ATOM   4911 O O   . VAL C 1 255 ? 57.017  -9.602  44.510 1.00 58.70  ? 257 VAL C O   1 
ATOM   4912 C CB  . VAL C 1 255 ? 56.662  -6.949  45.063 1.00 53.25  ? 257 VAL C CB  1 
ATOM   4913 C CG1 . VAL C 1 255 ? 55.368  -6.817  44.347 1.00 52.89  ? 257 VAL C CG1 1 
ATOM   4914 C CG2 . VAL C 1 255 ? 57.107  -5.607  45.611 1.00 50.99  ? 257 VAL C CG2 1 
ATOM   4915 N N   . GLN C 1 256 ? 55.231  -10.086 45.736 1.00 59.80  ? 258 GLN C N   1 
ATOM   4916 C CA  . GLN C 1 256 ? 54.858  -11.237 44.834 1.00 64.02  ? 258 GLN C CA  1 
ATOM   4917 C C   . GLN C 1 256 ? 53.484  -11.155 44.130 1.00 64.02  ? 258 GLN C C   1 
ATOM   4918 O O   . GLN C 1 256 ? 53.228  -11.925 43.169 1.00 65.95  ? 258 GLN C O   1 
ATOM   4919 C CB  . GLN C 1 256 ? 55.118  -12.674 45.410 1.00 66.77  ? 258 GLN C CB  1 
ATOM   4920 C CG  . GLN C 1 256 ? 55.208  -12.833 46.939 1.00 69.97  ? 258 GLN C CG  1 
ATOM   4921 C CD  . GLN C 1 256 ? 54.224  -11.956 47.705 1.00 73.61  ? 258 GLN C CD  1 
ATOM   4922 O OE1 . GLN C 1 256 ? 54.285  -11.880 48.937 1.00 76.39  ? 258 GLN C OE1 1 
ATOM   4923 N NE2 . GLN C 1 256 ? 53.315  -11.278 46.985 1.00 73.89  ? 258 GLN C NE2 1 
ATOM   4924 N N   . LEU C 1 263 ? 40.078  -13.758 43.199 1.00 79.96  ? 265 LEU C N   1 
ATOM   4925 C CA  . LEU C 1 263 ? 38.836  -14.188 42.530 1.00 81.42  ? 265 LEU C CA  1 
ATOM   4926 C C   . LEU C 1 263 ? 38.960  -14.340 40.976 1.00 80.75  ? 265 LEU C C   1 
ATOM   4927 O O   . LEU C 1 263 ? 40.001  -14.836 40.515 1.00 81.74  ? 265 LEU C O   1 
ATOM   4928 C CB  . LEU C 1 263 ? 37.609  -13.373 43.014 1.00 81.29  ? 265 LEU C CB  1 
ATOM   4929 C CG  . LEU C 1 263 ? 37.467  -11.841 43.117 1.00 78.58  ? 265 LEU C CG  1 
ATOM   4930 C CD1 . LEU C 1 263 ? 36.023  -11.534 42.856 1.00 78.20  ? 265 LEU C CD1 1 
ATOM   4931 C CD2 . LEU C 1 263 ? 37.890  -11.270 44.473 1.00 76.08  ? 265 LEU C CD2 1 
ATOM   4932 N N   . GLY C 1 264 ? 37.950  -13.942 40.183 1.00 79.26  ? 266 GLY C N   1 
ATOM   4933 C CA  . GLY C 1 264 ? 37.959  -14.221 38.715 1.00 78.14  ? 266 GLY C CA  1 
ATOM   4934 C C   . GLY C 1 264 ? 38.118  -13.083 37.715 1.00 74.75  ? 266 GLY C C   1 
ATOM   4935 O O   . GLY C 1 264 ? 38.612  -12.038 38.051 1.00 73.26  ? 266 GLY C O   1 
ATOM   4936 N N   . SER C 1 265 ? 37.678  -13.282 36.473 1.00 74.61  ? 267 SER C N   1 
ATOM   4937 C CA  . SER C 1 265 ? 37.717  -12.206 35.423 1.00 71.60  ? 267 SER C CA  1 
ATOM   4938 C C   . SER C 1 265 ? 36.639  -11.108 35.628 1.00 69.34  ? 267 SER C C   1 
ATOM   4939 O O   . SER C 1 265 ? 36.404  -10.245 34.768 1.00 68.24  ? 267 SER C O   1 
ATOM   4940 C CB  . SER C 1 265 ? 37.620  -12.785 33.992 1.00 72.89  ? 267 SER C CB  1 
ATOM   4941 O OG  . SER C 1 265 ? 36.282  -13.080 33.631 1.00 71.88  ? 267 SER C OG  1 
ATOM   4942 N N   . ASN C 1 266 ? 35.955  -11.195 36.761 1.00 67.92  ? 268 ASN C N   1 
ATOM   4943 C CA  . ASN C 1 266 ? 35.224  -10.077 37.322 1.00 64.47  ? 268 ASN C CA  1 
ATOM   4944 C C   . ASN C 1 266 ? 36.190  -9.138  38.085 1.00 60.43  ? 268 ASN C C   1 
ATOM   4945 O O   . ASN C 1 266 ? 35.749  -8.094  38.553 1.00 59.36  ? 268 ASN C O   1 
ATOM   4946 C CB  . ASN C 1 266 ? 34.063  -10.577 38.211 1.00 66.47  ? 268 ASN C CB  1 
ATOM   4947 C CG  . ASN C 1 266 ? 34.395  -11.903 38.970 1.00 69.27  ? 268 ASN C CG  1 
ATOM   4948 O OD1 . ASN C 1 266 ? 35.552  -12.389 38.997 1.00 68.00  ? 268 ASN C OD1 1 
ATOM   4949 N ND2 . ASN C 1 266 ? 33.365  -12.482 39.586 1.00 71.00  ? 268 ASN C ND2 1 
ATOM   4950 N N   . ILE C 1 267 ? 37.485  -9.516  38.181 1.00 57.01  ? 269 ILE C N   1 
ATOM   4951 C CA  . ILE C 1 267 ? 38.598  -8.672  38.716 1.00 52.90  ? 269 ILE C CA  1 
ATOM   4952 C C   . ILE C 1 267 ? 39.043  -7.421  37.819 1.00 48.73  ? 269 ILE C C   1 
ATOM   4953 O O   . ILE C 1 267 ? 39.755  -7.568  36.830 1.00 48.12  ? 269 ILE C O   1 
ATOM   4954 C CB  . ILE C 1 267 ? 39.803  -9.583  39.009 1.00 53.49  ? 269 ILE C CB  1 
ATOM   4955 C CG1 . ILE C 1 267 ? 40.885  -8.856  39.788 1.00 51.91  ? 269 ILE C CG1 1 
ATOM   4956 C CG2 . ILE C 1 267 ? 40.392  -10.182 37.675 1.00 55.09  ? 269 ILE C CG2 1 
ATOM   4957 C CD1 . ILE C 1 267 ? 42.245  -9.595  39.675 1.00 54.98  ? 269 ILE C CD1 1 
ATOM   4958 N N   . LEU C 1 268 ? 38.637  -6.212  38.198 1.00 44.19  ? 270 LEU C N   1 
ATOM   4959 C CA  . LEU C 1 268 ? 38.784  -5.032  37.350 1.00 39.86  ? 270 LEU C CA  1 
ATOM   4960 C C   . LEU C 1 268 ? 40.110  -4.388  37.427 1.00 36.85  ? 270 LEU C C   1 
ATOM   4961 O O   . LEU C 1 268 ? 40.708  -4.065  36.407 1.00 35.63  ? 270 LEU C O   1 
ATOM   4962 C CB  . LEU C 1 268 ? 37.725  -3.975  37.665 1.00 39.62  ? 270 LEU C CB  1 
ATOM   4963 C CG  . LEU C 1 268 ? 36.586  -3.933  36.637 1.00 42.69  ? 270 LEU C CG  1 
ATOM   4964 C CD1 . LEU C 1 268 ? 35.874  -5.305  36.633 1.00 42.41  ? 270 LEU C CD1 1 
ATOM   4965 C CD2 . LEU C 1 268 ? 35.603  -2.723  36.836 1.00 42.36  ? 270 LEU C CD2 1 
ATOM   4966 N N   . ARG C 1 269 ? 40.538  -4.150  38.651 1.00 34.81  ? 271 ARG C N   1 
ATOM   4967 C CA  . ARG C 1 269 ? 41.830  -3.562  38.939 1.00 33.74  ? 271 ARG C CA  1 
ATOM   4968 C C   . ARG C 1 269 ? 42.216  -3.840  40.373 1.00 32.24  ? 271 ARG C C   1 
ATOM   4969 O O   . ARG C 1 269 ? 41.396  -4.274  41.164 1.00 30.96  ? 271 ARG C O   1 
ATOM   4970 C CB  . ARG C 1 269 ? 41.767  -2.071  38.717 1.00 33.53  ? 271 ARG C CB  1 
ATOM   4971 C CG  . ARG C 1 269 ? 40.669  -1.398  39.446 1.00 35.91  ? 271 ARG C CG  1 
ATOM   4972 C CD  . ARG C 1 269 ? 40.823  0.101   39.247 1.00 44.12  ? 271 ARG C CD  1 
ATOM   4973 N NE  . ARG C 1 269 ? 40.016  0.842   40.217 1.00 45.50  ? 271 ARG C NE  1 
ATOM   4974 C CZ  . ARG C 1 269 ? 38.686  0.826   40.238 1.00 46.75  ? 271 ARG C CZ  1 
ATOM   4975 N NH1 . ARG C 1 269 ? 37.989  0.120   39.327 1.00 39.79  ? 271 ARG C NH1 1 
ATOM   4976 N NH2 . ARG C 1 269 ? 38.061  1.526   41.188 1.00 51.76  ? 271 ARG C NH2 1 
ATOM   4977 N N   . VAL C 1 270 ? 43.479  -3.613  40.688 1.00 31.92  ? 272 VAL C N   1 
ATOM   4978 C CA  . VAL C 1 270 ? 44.000  -3.838  42.047 1.00 32.42  ? 272 VAL C CA  1 
ATOM   4979 C C   . VAL C 1 270 ? 44.724  -2.560  42.436 1.00 32.05  ? 272 VAL C C   1 
ATOM   4980 O O   . VAL C 1 270 ? 45.402  -2.011  41.637 1.00 32.42  ? 272 VAL C O   1 
ATOM   4981 C CB  . VAL C 1 270 ? 44.963  -5.127  42.182 1.00 33.15  ? 272 VAL C CB  1 
ATOM   4982 C CG1 . VAL C 1 270 ? 45.074  -5.523  43.607 1.00 30.91  ? 272 VAL C CG1 1 
ATOM   4983 C CG2 . VAL C 1 270 ? 44.435  -6.377  41.414 1.00 32.32  ? 272 VAL C CG2 1 
ATOM   4984 N N   . GLU C 1 271 ? 44.537  -2.019  43.618 1.00 33.37  ? 273 GLU C N   1 
ATOM   4985 C CA  . GLU C 1 271 ? 45.374  -0.851  43.995 1.00 34.97  ? 273 GLU C CA  1 
ATOM   4986 C C   . GLU C 1 271 ? 46.285  -1.185  45.156 1.00 34.62  ? 273 GLU C C   1 
ATOM   4987 O O   . GLU C 1 271 ? 45.936  -2.014  45.963 1.00 36.57  ? 273 GLU C O   1 
ATOM   4988 C CB  . GLU C 1 271 ? 44.531  0.338   44.305 1.00 34.17  ? 273 GLU C CB  1 
ATOM   4989 C CG  . GLU C 1 271 ? 43.720  0.673   43.139 1.00 40.45  ? 273 GLU C CG  1 
ATOM   4990 C CD  . GLU C 1 271 ? 42.754  1.730   43.473 1.00 50.90  ? 273 GLU C CD  1 
ATOM   4991 O OE1 . GLU C 1 271 ? 42.867  2.194   44.631 1.00 56.17  ? 273 GLU C OE1 1 
ATOM   4992 O OE2 . GLU C 1 271 ? 41.898  2.096   42.616 1.00 55.74  ? 273 GLU C OE2 1 
ATOM   4993 N N   . TYR C 1 272 ? 47.468  -0.609  45.217 1.00 34.04  ? 274 TYR C N   1 
ATOM   4994 C CA  . TYR C 1 272 ? 48.427  -1.074  46.215 1.00 33.57  ? 274 TYR C CA  1 
ATOM   4995 C C   . TYR C 1 272 ? 49.001  0.075   47.024 1.00 33.60  ? 274 TYR C C   1 
ATOM   4996 O O   . TYR C 1 272 ? 49.254  1.174   46.528 1.00 33.81  ? 274 TYR C O   1 
ATOM   4997 C CB  . TYR C 1 272 ? 49.570  -1.830  45.574 1.00 33.45  ? 274 TYR C CB  1 
ATOM   4998 C CG  . TYR C 1 272 ? 49.297  -3.066  44.735 1.00 32.53  ? 274 TYR C CG  1 
ATOM   4999 C CD1 . TYR C 1 272 ? 49.458  -4.357  45.277 1.00 34.24  ? 274 TYR C CD1 1 
ATOM   5000 C CD2 . TYR C 1 272 ? 48.977  -2.958  43.386 1.00 31.54  ? 274 TYR C CD2 1 
ATOM   5001 C CE1 . TYR C 1 272 ? 49.232  -5.536  44.494 1.00 33.68  ? 274 TYR C CE1 1 
ATOM   5002 C CE2 . TYR C 1 272 ? 48.775  -4.092  42.594 1.00 29.73  ? 274 TYR C CE2 1 
ATOM   5003 C CZ  . TYR C 1 272 ? 48.912  -5.360  43.151 1.00 33.41  ? 274 TYR C CZ  1 
ATOM   5004 O OH  . TYR C 1 272 ? 48.721  -6.432  42.367 1.00 33.11  ? 274 TYR C OH  1 
ATOM   5005 N N   . SER C 1 273 ? 49.178  -0.167  48.307 1.00 34.10  ? 275 SER C N   1 
ATOM   5006 C CA  . SER C 1 273 ? 49.876  0.784   49.139 1.00 33.29  ? 275 SER C CA  1 
ATOM   5007 C C   . SER C 1 273 ? 50.928  0.039   49.875 1.00 32.76  ? 275 SER C C   1 
ATOM   5008 O O   . SER C 1 273 ? 50.730  -1.119  50.250 1.00 31.97  ? 275 SER C O   1 
ATOM   5009 C CB  . SER C 1 273 ? 48.917  1.396   50.128 1.00 33.38  ? 275 SER C CB  1 
ATOM   5010 O OG  . SER C 1 273 ? 47.764  1.733   49.411 1.00 35.43  ? 275 SER C OG  1 
ATOM   5011 N N   . LEU C 1 274 ? 52.068  0.699   50.052 1.00 32.86  ? 276 LEU C N   1 
ATOM   5012 C CA  . LEU C 1 274 ? 52.961  0.286   51.095 1.00 33.17  ? 276 LEU C CA  1 
ATOM   5013 C C   . LEU C 1 274 ? 52.566  1.016   52.385 1.00 33.37  ? 276 LEU C C   1 
ATOM   5014 O O   . LEU C 1 274 ? 52.454  2.251   52.433 1.00 33.06  ? 276 LEU C O   1 
ATOM   5015 C CB  . LEU C 1 274 ? 54.379  0.562   50.716 1.00 33.04  ? 276 LEU C CB  1 
ATOM   5016 C CG  . LEU C 1 274 ? 55.352  0.364   51.883 1.00 34.42  ? 276 LEU C CG  1 
ATOM   5017 C CD1 . LEU C 1 274 ? 55.248  -1.011  52.508 1.00 35.57  ? 276 LEU C CD1 1 
ATOM   5018 C CD2 . LEU C 1 274 ? 56.722  0.609   51.390 1.00 32.61  ? 276 LEU C CD2 1 
ATOM   5019 N N   . LEU C 1 275 ? 52.319  0.235   53.421 1.00 33.60  ? 277 LEU C N   1 
ATOM   5020 C CA  . LEU C 1 275 ? 51.999  0.810   54.708 1.00 33.81  ? 277 LEU C CA  1 
ATOM   5021 C C   . LEU C 1 275 ? 53.216  0.647   55.513 1.00 34.05  ? 277 LEU C C   1 
ATOM   5022 O O   . LEU C 1 275 ? 53.740  -0.463  55.572 1.00 33.80  ? 277 LEU C O   1 
ATOM   5023 C CB  . LEU C 1 275 ? 50.869  0.050   55.397 1.00 33.74  ? 277 LEU C CB  1 
ATOM   5024 C CG  . LEU C 1 275 ? 49.568  0.216   54.646 1.00 33.82  ? 277 LEU C CG  1 
ATOM   5025 C CD1 . LEU C 1 275 ? 48.533  -0.262  55.520 1.00 35.73  ? 277 LEU C CD1 1 
ATOM   5026 C CD2 . LEU C 1 275 ? 49.288  1.677   54.310 1.00 33.00  ? 277 LEU C CD2 1 
ATOM   5027 N N   . ILE C 1 276 ? 53.666  1.762   56.096 1.00 34.01  ? 278 ILE C N   1 
ATOM   5028 C CA  . ILE C 1 276 ? 54.704  1.771   57.086 1.00 34.66  ? 278 ILE C CA  1 
ATOM   5029 C C   . ILE C 1 276 ? 54.097  2.472   58.248 1.00 35.80  ? 278 ILE C C   1 
ATOM   5030 O O   . ILE C 1 276 ? 53.829  3.695   58.192 1.00 36.60  ? 278 ILE C O   1 
ATOM   5031 C CB  . ILE C 1 276 ? 55.869  2.561   56.650 1.00 34.81  ? 278 ILE C CB  1 
ATOM   5032 C CG1 . ILE C 1 276 ? 56.325  2.052   55.277 1.00 36.42  ? 278 ILE C CG1 1 
ATOM   5033 C CG2 . ILE C 1 276 ? 56.950  2.394   57.662 1.00 35.30  ? 278 ILE C CG2 1 
ATOM   5034 C CD1 . ILE C 1 276 ? 56.999  3.064   54.447 1.00 36.90  ? 278 ILE C CD1 1 
ATOM   5035 N N   . TYR C 1 277 ? 53.819  1.684   59.291 1.00 36.44  ? 279 TYR C N   1 
ATOM   5036 C CA  . TYR C 1 277 ? 53.205  2.205   60.507 1.00 36.75  ? 279 TYR C CA  1 
ATOM   5037 C C   . TYR C 1 277 ? 53.929  1.760   61.816 1.00 38.12  ? 279 TYR C C   1 
ATOM   5038 O O   . TYR C 1 277 ? 54.819  0.866   61.815 1.00 37.30  ? 279 TYR C O   1 
ATOM   5039 C CB  . TYR C 1 277 ? 51.768  1.802   60.545 1.00 36.14  ? 279 TYR C CB  1 
ATOM   5040 C CG  . TYR C 1 277 ? 51.636  0.331   60.545 1.00 37.07  ? 279 TYR C CG  1 
ATOM   5041 C CD1 . TYR C 1 277 ? 51.903  -0.403  59.396 1.00 36.49  ? 279 TYR C CD1 1 
ATOM   5042 C CD2 . TYR C 1 277 ? 51.262  -0.365  61.711 1.00 36.22  ? 279 TYR C CD2 1 
ATOM   5043 C CE1 . TYR C 1 277 ? 51.769  -1.811  59.403 1.00 36.79  ? 279 TYR C CE1 1 
ATOM   5044 C CE2 . TYR C 1 277 ? 51.128  -1.740  61.717 1.00 35.11  ? 279 TYR C CE2 1 
ATOM   5045 C CZ  . TYR C 1 277 ? 51.377  -2.460  60.561 1.00 36.93  ? 279 TYR C CZ  1 
ATOM   5046 O OH  . TYR C 1 277 ? 51.281  -3.832  60.555 1.00 41.35  ? 279 TYR C OH  1 
ATOM   5047 N N   . VAL C 1 278 ? 53.557  2.440   62.909 1.00 38.78  ? 280 VAL C N   1 
ATOM   5048 C CA  . VAL C 1 278 ? 54.011  2.120   64.238 1.00 39.47  ? 280 VAL C CA  1 
ATOM   5049 C C   . VAL C 1 278 ? 52.878  1.756   65.165 1.00 41.44  ? 280 VAL C C   1 
ATOM   5050 O O   . VAL C 1 278 ? 51.898  2.489   65.264 1.00 41.05  ? 280 VAL C O   1 
ATOM   5051 C CB  . VAL C 1 278 ? 54.761  3.262   64.822 1.00 38.79  ? 280 VAL C CB  1 
ATOM   5052 C CG1 . VAL C 1 278 ? 55.063  2.975   66.277 1.00 39.12  ? 280 VAL C CG1 1 
ATOM   5053 C CG2 . VAL C 1 278 ? 56.055  3.369   64.086 1.00 38.84  ? 280 VAL C CG2 1 
ATOM   5054 N N   . SER C 1 279 ? 53.023  0.627   65.855 1.00 43.45  ? 281 SER C N   1 
ATOM   5055 C CA  . SER C 1 279 ? 52.010  0.229   66.831 1.00 46.73  ? 281 SER C CA  1 
ATOM   5056 C C   . SER C 1 279 ? 52.361  0.783   68.186 1.00 47.62  ? 281 SER C C   1 
ATOM   5057 O O   . SER C 1 279 ? 53.460  0.570   68.657 1.00 48.09  ? 281 SER C O   1 
ATOM   5058 C CB  . SER C 1 279 ? 51.873  -1.290  66.930 1.00 47.89  ? 281 SER C CB  1 
ATOM   5059 O OG  . SER C 1 279 ? 51.616  -1.878  65.652 1.00 50.79  ? 281 SER C OG  1 
ATOM   5060 N N   . VAL C 1 280 ? 51.407  1.479   68.790 1.00 48.27  ? 282 VAL C N   1 
ATOM   5061 C CA  . VAL C 1 280 ? 51.491  1.991   70.120 1.00 49.37  ? 282 VAL C CA  1 
ATOM   5062 C C   . VAL C 1 280 ? 50.506  1.169   70.972 1.00 52.48  ? 282 VAL C C   1 
ATOM   5063 O O   . VAL C 1 280 ? 49.323  1.290   70.771 1.00 53.69  ? 282 VAL C O   1 
ATOM   5064 C CB  . VAL C 1 280 ? 51.015  3.480   70.104 1.00 49.69  ? 282 VAL C CB  1 
ATOM   5065 C CG1 . VAL C 1 280 ? 51.146  4.104   71.485 1.00 50.81  ? 282 VAL C CG1 1 
ATOM   5066 C CG2 . VAL C 1 280 ? 51.748  4.307   69.018 1.00 45.41  ? 282 VAL C CG2 1 
ATOM   5067 N N   . PRO C 1 281 ? 50.962  0.331   71.925 1.00 54.80  ? 283 PRO C N   1 
ATOM   5068 C CA  . PRO C 1 281 ? 49.918  -0.352  72.740 1.00 58.05  ? 283 PRO C CA  1 
ATOM   5069 C C   . PRO C 1 281 ? 48.972  0.613   73.502 1.00 60.67  ? 283 PRO C C   1 
ATOM   5070 O O   . PRO C 1 281 ? 49.440  1.565   74.125 1.00 61.51  ? 283 PRO C O   1 
ATOM   5071 C CB  . PRO C 1 281 ? 50.737  -1.210  73.713 1.00 58.50  ? 283 PRO C CB  1 
ATOM   5072 C CG  . PRO C 1 281 ? 52.053  -1.417  73.000 1.00 55.62  ? 283 PRO C CG  1 
ATOM   5073 C CD  . PRO C 1 281 ? 52.314  -0.097  72.323 1.00 53.96  ? 283 PRO C CD  1 
ATOM   5074 N N   . GLY C 1 282 ? 47.654  0.380   73.413 1.00 62.74  ? 284 GLY C N   1 
ATOM   5075 C CA  . GLY C 1 282 ? 46.647  1.226   74.071 1.00 65.34  ? 284 GLY C CA  1 
ATOM   5076 C C   . GLY C 1 282 ? 46.496  2.635   73.500 1.00 65.02  ? 284 GLY C C   1 
ATOM   5077 O O   . GLY C 1 282 ? 46.403  3.620   74.235 1.00 67.49  ? 284 GLY C O   1 
ATOM   5078 N N   . SER C 1 283 ? 46.454  2.739   72.178 1.00 62.83  ? 285 SER C N   1 
ATOM   5079 C CA  . SER C 1 283 ? 46.380  4.035   71.487 1.00 60.68  ? 285 SER C CA  1 
ATOM   5080 C C   . SER C 1 283 ? 46.316  3.764   69.970 1.00 57.49  ? 285 SER C C   1 
ATOM   5081 O O   . SER C 1 283 ? 46.641  2.685   69.531 1.00 56.43  ? 285 SER C O   1 
ATOM   5082 C CB  . SER C 1 283 ? 47.563  4.903   71.887 1.00 59.10  ? 285 SER C CB  1 
ATOM   5083 O OG  . SER C 1 283 ? 47.719  5.947   70.972 1.00 60.26  ? 285 SER C OG  1 
ATOM   5084 N N   . LYS C 1 284 ? 45.854  4.689   69.158 1.00 56.40  ? 286 LYS C N   1 
ATOM   5085 C CA  . LYS C 1 284 ? 45.786  4.339   67.718 1.00 55.46  ? 286 LYS C CA  1 
ATOM   5086 C C   . LYS C 1 284 ? 47.177  4.227   67.017 1.00 51.66  ? 286 LYS C C   1 
ATOM   5087 O O   . LYS C 1 284 ? 48.111  4.918   67.405 1.00 51.03  ? 286 LYS C O   1 
ATOM   5088 C CB  . LYS C 1 284 ? 44.785  5.226   66.925 1.00 55.66  ? 286 LYS C CB  1 
ATOM   5089 C CG  . LYS C 1 284 ? 43.332  4.765   67.133 1.00 59.44  ? 286 LYS C CG  1 
ATOM   5090 C CD  . LYS C 1 284 ? 42.291  5.563   66.310 1.00 66.01  ? 286 LYS C CD  1 
ATOM   5091 C CE  . LYS C 1 284 ? 42.033  6.988   66.846 1.00 67.35  ? 286 LYS C CE  1 
ATOM   5092 N NZ  . LYS C 1 284 ? 43.092  7.928   66.364 1.00 69.24  ? 286 LYS C NZ  1 
ATOM   5093 N N   . LYS C 1 285 ? 47.288  3.351   66.016 1.00 48.54  ? 287 LYS C N   1 
ATOM   5094 C CA  . LYS C 1 285 ? 48.488  3.257   65.176 1.00 45.30  ? 287 LYS C CA  1 
ATOM   5095 C C   . LYS C 1 285 ? 48.900  4.607   64.540 1.00 43.21  ? 287 LYS C C   1 
ATOM   5096 O O   . LYS C 1 285 ? 48.072  5.501   64.327 1.00 43.55  ? 287 LYS C O   1 
ATOM   5097 C CB  . LYS C 1 285 ? 48.306  2.191   64.070 1.00 44.35  ? 287 LYS C CB  1 
ATOM   5098 C CG  . LYS C 1 285 ? 48.356  0.748   64.522 1.00 44.94  ? 287 LYS C CG  1 
ATOM   5099 C CD  . LYS C 1 285 ? 47.792  -0.095  63.459 1.00 48.84  ? 287 LYS C CD  1 
ATOM   5100 C CE  . LYS C 1 285 ? 47.723  -1.539  63.843 1.00 53.00  ? 287 LYS C CE  1 
ATOM   5101 N NZ  . LYS C 1 285 ? 46.761  -1.752  64.928 1.00 58.10  ? 287 LYS C NZ  1 
ATOM   5102 N N   . VAL C 1 286 ? 50.183  4.762   64.247 1.00 41.01  ? 288 VAL C N   1 
ATOM   5103 C CA  . VAL C 1 286 ? 50.597  5.859   63.359 1.00 38.99  ? 288 VAL C CA  1 
ATOM   5104 C C   . VAL C 1 286 ? 51.044  5.317   62.024 1.00 37.03  ? 288 VAL C C   1 
ATOM   5105 O O   . VAL C 1 286 ? 51.995  4.529   61.933 1.00 35.76  ? 288 VAL C O   1 
ATOM   5106 C CB  . VAL C 1 286 ? 51.500  6.962   64.039 1.00 38.91  ? 288 VAL C CB  1 
ATOM   5107 C CG1 . VAL C 1 286 ? 51.921  6.545   65.397 1.00 38.29  ? 288 VAL C CG1 1 
ATOM   5108 C CG2 . VAL C 1 286 ? 52.670  7.343   63.211 1.00 40.25  ? 288 VAL C CG2 1 
ATOM   5109 N N   . ILE C 1 287 ? 50.298  5.746   61.002 1.00 37.05  ? 289 ILE C N   1 
ATOM   5110 C CA  . ILE C 1 287 ? 50.321  5.186   59.642 1.00 36.06  ? 289 ILE C CA  1 
ATOM   5111 C C   . ILE C 1 287 ? 50.796  6.145   58.542 1.00 36.06  ? 289 ILE C C   1 
ATOM   5112 O O   . ILE C 1 287 ? 50.254  7.234   58.358 1.00 36.70  ? 289 ILE C O   1 
ATOM   5113 C CB  . ILE C 1 287 ? 48.942  4.674   59.284 1.00 36.37  ? 289 ILE C CB  1 
ATOM   5114 C CG1 . ILE C 1 287 ? 48.583  3.535   60.243 1.00 37.07  ? 289 ILE C CG1 1 
ATOM   5115 C CG2 . ILE C 1 287 ? 48.910  4.206   57.833 1.00 35.83  ? 289 ILE C CG2 1 
ATOM   5116 C CD1 . ILE C 1 287 ? 47.174  3.430   60.585 1.00 36.20  ? 289 ILE C CD1 1 
ATOM   5117 N N   . LEU C 1 288 ? 51.826  5.747   57.810 1.00 35.51  ? 290 LEU C N   1 
ATOM   5118 C CA  . LEU C 1 288 ? 52.132  6.428   56.582 1.00 34.12  ? 290 LEU C CA  1 
ATOM   5119 C C   . LEU C 1 288 ? 51.528  5.481   55.614 1.00 34.97  ? 290 LEU C C   1 
ATOM   5120 O O   . LEU C 1 288 ? 51.579  4.279   55.825 1.00 36.05  ? 290 LEU C O   1 
ATOM   5121 C CB  . LEU C 1 288 ? 53.635  6.489   56.375 1.00 33.72  ? 290 LEU C CB  1 
ATOM   5122 C CG  . LEU C 1 288 ? 54.549  7.048   57.480 1.00 31.59  ? 290 LEU C CG  1 
ATOM   5123 C CD1 . LEU C 1 288 ? 55.900  7.133   56.923 1.00 26.97  ? 290 LEU C CD1 1 
ATOM   5124 C CD2 . LEU C 1 288 ? 54.169  8.448   57.918 1.00 30.86  ? 290 LEU C CD2 1 
ATOM   5125 N N   . ASP C 1 289 ? 50.935  6.008   54.554 1.00 35.84  ? 291 ASP C N   1 
ATOM   5126 C CA  . ASP C 1 289 ? 50.450  5.212   53.442 1.00 35.53  ? 291 ASP C CA  1 
ATOM   5127 C C   . ASP C 1 289 ? 51.015  5.746   52.128 1.00 34.75  ? 291 ASP C C   1 
ATOM   5128 O O   . ASP C 1 289 ? 50.759  6.842   51.705 1.00 35.22  ? 291 ASP C O   1 
ATOM   5129 C CB  . ASP C 1 289 ? 48.936  5.265   53.438 1.00 36.64  ? 291 ASP C CB  1 
ATOM   5130 C CG  . ASP C 1 289 ? 48.315  4.479   52.288 1.00 40.16  ? 291 ASP C CG  1 
ATOM   5131 O OD1 . ASP C 1 289 ? 48.896  4.412   51.177 1.00 43.06  ? 291 ASP C OD1 1 
ATOM   5132 O OD2 . ASP C 1 289 ? 47.202  3.947   52.490 1.00 46.29  ? 291 ASP C OD2 1 
ATOM   5133 N N   . LEU C 1 290 ? 51.788  4.935   51.455 1.00 35.29  ? 292 LEU C N   1 
ATOM   5134 C CA  . LEU C 1 290 ? 52.439  5.349   50.221 1.00 34.75  ? 292 LEU C CA  1 
ATOM   5135 C C   . LEU C 1 290 ? 51.918  4.529   49.069 1.00 34.73  ? 292 LEU C C   1 
ATOM   5136 O O   . LEU C 1 290 ? 52.166  3.313   49.041 1.00 37.31  ? 292 LEU C O   1 
ATOM   5137 C CB  . LEU C 1 290 ? 53.940  5.055   50.336 1.00 34.49  ? 292 LEU C CB  1 
ATOM   5138 C CG  . LEU C 1 290 ? 54.715  5.498   51.560 1.00 32.23  ? 292 LEU C CG  1 
ATOM   5139 C CD1 . LEU C 1 290 ? 56.120  5.495   51.148 1.00 27.44  ? 292 LEU C CD1 1 
ATOM   5140 C CD2 . LEU C 1 290 ? 54.327  6.873   51.914 1.00 31.89  ? 292 LEU C CD2 1 
ATOM   5141 N N   . PRO C 1 291 ? 51.259  5.156   48.084 1.00 33.63  ? 293 PRO C N   1 
ATOM   5142 C CA  . PRO C 1 291 ? 50.642  4.336   47.050 1.00 32.74  ? 293 PRO C CA  1 
ATOM   5143 C C   . PRO C 1 291 ? 51.689  3.688   46.128 1.00 32.21  ? 293 PRO C C   1 
ATOM   5144 O O   . PRO C 1 291 ? 52.836  4.062   46.143 1.00 33.35  ? 293 PRO C O   1 
ATOM   5145 C CB  . PRO C 1 291 ? 49.771  5.365   46.314 1.00 33.95  ? 293 PRO C CB  1 
ATOM   5146 C CG  . PRO C 1 291 ? 49.569  6.523   47.384 1.00 33.43  ? 293 PRO C CG  1 
ATOM   5147 C CD  . PRO C 1 291 ? 51.009  6.571   47.825 1.00 33.48  ? 293 PRO C CD  1 
ATOM   5148 N N   . LEU C 1 292 ? 51.332  2.654   45.402 1.00 31.25  ? 294 LEU C N   1 
ATOM   5149 C CA  . LEU C 1 292 ? 52.279  1.998   44.507 1.00 30.98  ? 294 LEU C CA  1 
ATOM   5150 C C   . LEU C 1 292 ? 51.568  1.499   43.260 1.00 30.92  ? 294 LEU C C   1 
ATOM   5151 O O   . LEU C 1 292 ? 50.313  1.501   43.161 1.00 30.36  ? 294 LEU C O   1 
ATOM   5152 C CB  . LEU C 1 292 ? 52.992  0.818   45.153 1.00 31.12  ? 294 LEU C CB  1 
ATOM   5153 C CG  . LEU C 1 292 ? 53.381  0.800   46.637 1.00 33.60  ? 294 LEU C CG  1 
ATOM   5154 C CD1 . LEU C 1 292 ? 53.172  -0.592  47.143 1.00 36.56  ? 294 LEU C CD1 1 
ATOM   5155 C CD2 . LEU C 1 292 ? 54.799  1.184   46.872 1.00 32.07  ? 294 LEU C CD2 1 
ATOM   5156 N N   . VAL C 1 293 ? 52.391  1.123   42.282 1.00 30.07  ? 295 VAL C N   1 
ATOM   5157 C CA  . VAL C 1 293 ? 51.908  0.576   41.051 1.00 28.29  ? 295 VAL C CA  1 
ATOM   5158 C C   . VAL C 1 293 ? 52.585  -0.733  41.051 1.00 29.67  ? 295 VAL C C   1 
ATOM   5159 O O   . VAL C 1 293 ? 53.766  -0.793  41.381 1.00 29.92  ? 295 VAL C O   1 
ATOM   5160 C CB  . VAL C 1 293 ? 52.373  1.420   39.897 1.00 28.77  ? 295 VAL C CB  1 
ATOM   5161 C CG1 . VAL C 1 293 ? 52.294  0.689   38.571 1.00 25.46  ? 295 VAL C CG1 1 
ATOM   5162 C CG2 . VAL C 1 293 ? 51.592  2.768   39.883 1.00 26.09  ? 295 VAL C CG2 1 
ATOM   5163 N N   . ILE C 1 294 ? 51.880  -1.821  40.733 1.00 30.67  ? 296 ILE C N   1 
ATOM   5164 C CA  . ILE C 1 294 ? 52.632  -3.074  40.706 1.00 32.44  ? 296 ILE C CA  1 
ATOM   5165 C C   . ILE C 1 294 ? 52.333  -3.844  39.492 1.00 32.52  ? 296 ILE C C   1 
ATOM   5166 O O   . ILE C 1 294 ? 51.253  -4.350  39.326 1.00 32.30  ? 296 ILE C O   1 
ATOM   5167 C CB  . ILE C 1 294 ? 52.523  -3.901  42.035 1.00 32.89  ? 296 ILE C CB  1 
ATOM   5168 C CG1 . ILE C 1 294 ? 53.465  -3.301  43.060 1.00 32.09  ? 296 ILE C CG1 1 
ATOM   5169 C CG2 . ILE C 1 294 ? 53.048  -5.298  41.851 1.00 35.66  ? 296 ILE C CG2 1 
ATOM   5170 C CD1 . ILE C 1 294 ? 52.855  -3.090  44.347 1.00 33.58  ? 296 ILE C CD1 1 
ATOM   5171 N N   . GLY C 1 295 ? 53.315  -3.896  38.624 1.00 33.91  ? 297 GLY C N   1 
ATOM   5172 C CA  . GLY C 1 295 ? 53.124  -4.606  37.375 1.00 36.71  ? 297 GLY C CA  1 
ATOM   5173 C C   . GLY C 1 295 ? 53.720  -5.997  37.361 1.00 39.14  ? 297 GLY C C   1 
ATOM   5174 O O   . GLY C 1 295 ? 54.540  -6.346  38.223 1.00 40.09  ? 297 GLY C O   1 
ATOM   5175 N N   . SER C 1 296 ? 53.316  -6.786  36.374 1.00 41.03  ? 298 SER C N   1 
ATOM   5176 C CA  . SER C 1 296 ? 53.825  -8.133  36.203 1.00 44.06  ? 298 SER C CA  1 
ATOM   5177 C C   . SER C 1 296 ? 54.903  -8.229  35.107 1.00 46.95  ? 298 SER C C   1 
ATOM   5178 O O   . SER C 1 296 ? 55.099  -7.280  34.304 1.00 44.97  ? 298 SER C O   1 
ATOM   5179 C CB  . SER C 1 296 ? 52.667  -9.103  35.933 1.00 45.06  ? 298 SER C CB  1 
ATOM   5180 O OG  . SER C 1 296 ? 51.597  -8.436  35.300 1.00 43.45  ? 298 SER C OG  1 
ATOM   5181 N N   . ARG C 1 297 ? 55.604  -9.381  35.119 1.00 50.86  ? 299 ARG C N   1 
ATOM   5182 C CA  . ARG C 1 297 ? 56.668  -9.702  34.165 1.00 54.71  ? 299 ARG C CA  1 
ATOM   5183 C C   . ARG C 1 297 ? 56.042  -10.204 32.917 1.00 55.91  ? 299 ARG C C   1 
ATOM   5184 O O   . ARG C 1 297 ? 56.052  -9.480  31.937 1.00 57.40  ? 299 ARG C O   1 
ATOM   5185 C CB  . ARG C 1 297 ? 57.621  -10.764 34.701 1.00 57.46  ? 299 ARG C CB  1 
ATOM   5186 C CG  . ARG C 1 297 ? 58.068  -10.516 36.150 1.00 60.40  ? 299 ARG C CG  1 
ATOM   5187 C CD  . ARG C 1 297 ? 59.466  -11.050 36.458 1.00 67.46  ? 299 ARG C CD  1 
ATOM   5188 N NE  . ARG C 1 297 ? 60.482  -9.982  36.510 1.00 70.94  ? 299 ARG C NE  1 
ATOM   5189 C CZ  . ARG C 1 297 ? 60.823  -9.296  37.607 1.00 68.92  ? 299 ARG C CZ  1 
ATOM   5190 N NH1 . ARG C 1 297 ? 60.231  -9.548  38.772 1.00 67.40  ? 299 ARG C NH1 1 
ATOM   5191 N NH2 . ARG C 1 297 ? 61.760  -8.349  37.537 1.00 68.09  ? 299 ARG C NH2 1 
ATOM   5192 N N   . MET D 2 1   ? 84.926  16.828  78.667 1.00 46.93  ? 1   MET D N   1 
ATOM   5193 C CA  . MET D 2 1   ? 84.714  16.943  77.187 1.00 45.55  ? 1   MET D CA  1 
ATOM   5194 C C   . MET D 2 1   ? 84.440  15.597  76.594 1.00 41.66  ? 1   MET D C   1 
ATOM   5195 O O   . MET D 2 1   ? 84.957  14.607  77.098 1.00 41.30  ? 1   MET D O   1 
ATOM   5196 C CB  . MET D 2 1   ? 85.951  17.520  76.502 1.00 49.23  ? 1   MET D CB  1 
ATOM   5197 C CG  . MET D 2 1   ? 86.196  18.980  76.860 1.00 56.49  ? 1   MET D CG  1 
ATOM   5198 S SD  . MET D 2 1   ? 84.935  20.190  76.305 1.00 62.07  ? 1   MET D SD  1 
ATOM   5199 C CE  . MET D 2 1   ? 84.882  19.827  74.543 1.00 58.47  ? 1   MET D CE  1 
ATOM   5200 N N   . VAL D 2 2   ? 83.624  15.563  75.534 1.00 39.16  ? 2   VAL D N   1 
ATOM   5201 C CA  . VAL D 2 2   ? 83.408  14.337  74.756 1.00 36.46  ? 2   VAL D CA  1 
ATOM   5202 C C   . VAL D 2 2   ? 84.201  14.317  73.429 1.00 37.88  ? 2   VAL D C   1 
ATOM   5203 O O   . VAL D 2 2   ? 84.171  15.270  72.681 1.00 38.52  ? 2   VAL D O   1 
ATOM   5204 C CB  . VAL D 2 2   ? 81.929  14.130  74.496 1.00 33.84  ? 2   VAL D CB  1 
ATOM   5205 C CG1 . VAL D 2 2   ? 81.681  12.780  73.812 1.00 31.97  ? 2   VAL D CG1 1 
ATOM   5206 C CG2 . VAL D 2 2   ? 81.155  14.208  75.805 1.00 32.04  ? 2   VAL D CG2 1 
ATOM   5207 N N   . LYS D 2 3   ? 84.909  13.224  73.133 1.00 38.28  ? 3   LYS D N   1 
ATOM   5208 C CA  . LYS D 2 3   ? 85.642  13.126  71.864 1.00 39.82  ? 3   LYS D CA  1 
ATOM   5209 C C   . LYS D 2 3   ? 84.763  12.497  70.800 1.00 38.02  ? 3   LYS D C   1 
ATOM   5210 O O   . LYS D 2 3   ? 84.127  11.469  71.066 1.00 36.53  ? 3   LYS D O   1 
ATOM   5211 C CB  . LYS D 2 3   ? 86.879  12.260  72.024 1.00 42.41  ? 3   LYS D CB  1 
ATOM   5212 C CG  . LYS D 2 3   ? 87.937  12.544  70.967 1.00 47.75  ? 3   LYS D CG  1 
ATOM   5213 C CD  . LYS D 2 3   ? 88.625  11.271  70.451 1.00 50.73  ? 3   LYS D CD  1 
ATOM   5214 C CE  . LYS D 2 3   ? 89.936  11.640  69.740 1.00 58.39  ? 3   LYS D CE  1 
ATOM   5215 N NZ  . LYS D 2 3   ? 89.732  11.934  68.295 1.00 60.51  ? 3   LYS D NZ  1 
ATOM   5216 N N   . GLN D 2 4   ? 84.761  13.092  69.609 1.00 38.87  ? 4   GLN D N   1 
ATOM   5217 C CA  . GLN D 2 4   ? 83.937  12.681  68.499 1.00 39.21  ? 4   GLN D CA  1 
ATOM   5218 C C   . GLN D 2 4   ? 84.617  11.598  67.623 1.00 42.17  ? 4   GLN D C   1 
ATOM   5219 O O   . GLN D 2 4   ? 85.594  11.866  66.948 1.00 46.55  ? 4   GLN D O   1 
ATOM   5220 C CB  . GLN D 2 4   ? 83.518  13.913  67.694 1.00 39.83  ? 4   GLN D CB  1 
ATOM   5221 C CG  . GLN D 2 4   ? 82.511  13.668  66.528 1.00 44.97  ? 4   GLN D CG  1 
ATOM   5222 C CD  . GLN D 2 4   ? 80.989  13.494  66.929 1.00 45.83  ? 4   GLN D CD  1 
ATOM   5223 O OE1 . GLN D 2 4   ? 80.346  14.420  67.460 1.00 47.09  ? 4   GLN D OE1 1 
ATOM   5224 N NE2 . GLN D 2 4   ? 80.425  12.307  66.633 1.00 43.95  ? 4   GLN D NE2 1 
ATOM   5225 N N   . ILE D 2 5   ? 84.125  10.364  67.622 1.00 41.41  ? 5   ILE D N   1 
ATOM   5226 C CA  . ILE D 2 5   ? 84.792  9.400   66.776 1.00 45.21  ? 5   ILE D CA  1 
ATOM   5227 C C   . ILE D 2 5   ? 84.386  9.582   65.323 1.00 48.98  ? 5   ILE D C   1 
ATOM   5228 O O   . ILE D 2 5   ? 83.203  9.646   65.003 1.00 48.57  ? 5   ILE D O   1 
ATOM   5229 C CB  . ILE D 2 5   ? 84.546  8.007   67.194 1.00 43.30  ? 5   ILE D CB  1 
ATOM   5230 C CG1 . ILE D 2 5   ? 85.291  7.759   68.502 1.00 42.86  ? 5   ILE D CG1 1 
ATOM   5231 C CG2 . ILE D 2 5   ? 84.932  7.064   66.067 1.00 45.51  ? 5   ILE D CG2 1 
ATOM   5232 C CD1 . ILE D 2 5   ? 86.665  8.289   68.561 1.00 44.79  ? 5   ILE D CD1 1 
ATOM   5233 N N   . GLU D 2 6   ? 85.349  9.692   64.430 1.00 54.01  ? 6   GLU D N   1 
ATOM   5234 C CA  . GLU D 2 6   ? 84.927  9.906   63.080 1.00 57.15  ? 6   GLU D CA  1 
ATOM   5235 C C   . GLU D 2 6   ? 84.981  8.639   62.255 1.00 59.27  ? 6   GLU D C   1 
ATOM   5236 O O   . GLU D 2 6   ? 84.503  8.640   61.138 1.00 61.00  ? 6   GLU D O   1 
ATOM   5237 C CB  . GLU D 2 6   ? 85.691  11.075  62.437 1.00 62.14  ? 6   GLU D CB  1 
ATOM   5238 C CG  . GLU D 2 6   ? 85.101  12.489  62.726 1.00 63.69  ? 6   GLU D CG  1 
ATOM   5239 C CD  . GLU D 2 6   ? 83.568  12.618  62.464 1.00 66.59  ? 6   GLU D CD  1 
ATOM   5240 O OE1 . GLU D 2 6   ? 83.047  12.007  61.502 1.00 69.23  ? 6   GLU D OE1 1 
ATOM   5241 O OE2 . GLU D 2 6   ? 82.877  13.350  63.222 1.00 65.21  ? 6   GLU D OE2 1 
ATOM   5242 N N   . SER D 2 7   ? 85.525  7.555   62.821 1.00 59.50  ? 7   SER D N   1 
ATOM   5243 C CA  . SER D 2 7   ? 85.713  6.306   62.066 1.00 62.77  ? 7   SER D CA  1 
ATOM   5244 C C   . SER D 2 7   ? 86.112  5.089   62.885 1.00 62.17  ? 7   SER D C   1 
ATOM   5245 O O   . SER D 2 7   ? 86.435  5.187   64.054 1.00 59.47  ? 7   SER D O   1 
ATOM   5246 C CB  . SER D 2 7   ? 86.797  6.487   61.024 1.00 68.52  ? 7   SER D CB  1 
ATOM   5247 O OG  . SER D 2 7   ? 88.013  6.765   61.682 1.00 70.05  ? 7   SER D OG  1 
ATOM   5248 N N   . LYS D 2 8   ? 86.121  3.942   62.209 1.00 65.18  ? 8   LYS D N   1 
ATOM   5249 C CA  . LYS D 2 8   ? 86.557  2.693   62.795 1.00 66.13  ? 8   LYS D CA  1 
ATOM   5250 C C   . LYS D 2 8   ? 88.004  2.786   63.294 1.00 68.51  ? 8   LYS D C   1 
ATOM   5251 O O   . LYS D 2 8   ? 88.356  2.301   64.368 1.00 67.50  ? 8   LYS D O   1 
ATOM   5252 C CB  . LYS D 2 8   ? 86.420  1.587   61.768 1.00 70.24  ? 8   LYS D CB  1 
ATOM   5253 C CG  . LYS D 2 8   ? 86.105  0.237   62.402 1.00 70.60  ? 8   LYS D CG  1 
ATOM   5254 C CD  . LYS D 2 8   ? 84.882  -0.463  61.738 1.00 69.11  ? 8   LYS D CD  1 
ATOM   5255 C CE  . LYS D 2 8   ? 85.281  -1.432  60.660 1.00 75.35  ? 8   LYS D CE  1 
ATOM   5256 N NZ  . LYS D 2 8   ? 86.250  -2.402  61.233 1.00 79.53  ? 8   LYS D NZ  1 
ATOM   5257 N N   . THR D 2 9   ? 88.854  3.417   62.507 1.00 71.94  ? 9   THR D N   1 
ATOM   5258 C CA  . THR D 2 9   ? 90.199  3.698   62.979 1.00 74.26  ? 9   THR D CA  1 
ATOM   5259 C C   . THR D 2 9   ? 90.174  4.527   64.273 1.00 69.98  ? 9   THR D C   1 
ATOM   5260 O O   . THR D 2 9   ? 90.660  4.072   65.306 1.00 69.82  ? 9   THR D O   1 
ATOM   5261 C CB  . THR D 2 9   ? 91.015  4.353   61.863 1.00 78.97  ? 9   THR D CB  1 
ATOM   5262 O OG1 . THR D 2 9   ? 91.053  3.441   60.770 1.00 83.75  ? 9   THR D OG1 1 
ATOM   5263 C CG2 . THR D 2 9   ? 92.434  4.651   62.285 1.00 82.54  ? 9   THR D CG2 1 
ATOM   5264 N N   . ALA D 2 10  ? 89.561  5.715   64.232 1.00 67.43  ? 10  ALA D N   1 
ATOM   5265 C CA  . ALA D 2 10  ? 89.572  6.640   65.387 1.00 63.60  ? 10  ALA D CA  1 
ATOM   5266 C C   . ALA D 2 10  ? 89.133  5.861   66.603 1.00 59.87  ? 10  ALA D C   1 
ATOM   5267 O O   . ALA D 2 10  ? 89.663  6.058   67.688 1.00 59.35  ? 10  ALA D O   1 
ATOM   5268 C CB  . ALA D 2 10  ? 88.661  7.880   65.152 1.00 60.53  ? 10  ALA D CB  1 
ATOM   5269 N N   . PHE D 2 11  ? 88.198  4.945   66.372 1.00 57.97  ? 11  PHE D N   1 
ATOM   5270 C CA  . PHE D 2 11  ? 87.647  4.119   67.399 1.00 55.40  ? 11  PHE D CA  1 
ATOM   5271 C C   . PHE D 2 11  ? 88.653  3.244   68.063 1.00 58.60  ? 11  PHE D C   1 
ATOM   5272 O O   . PHE D 2 11  ? 88.701  3.196   69.291 1.00 57.54  ? 11  PHE D O   1 
ATOM   5273 C CB  . PHE D 2 11  ? 86.645  3.183   66.823 1.00 54.92  ? 11  PHE D CB  1 
ATOM   5274 C CG  . PHE D 2 11  ? 85.674  2.713   67.821 1.00 53.71  ? 11  PHE D CG  1 
ATOM   5275 C CD1 . PHE D 2 11  ? 85.190  3.614   68.811 1.00 51.78  ? 11  PHE D CD1 1 
ATOM   5276 C CD2 . PHE D 2 11  ? 85.200  1.408   67.791 1.00 54.04  ? 11  PHE D CD2 1 
ATOM   5277 C CE1 . PHE D 2 11  ? 84.244  3.196   69.770 1.00 49.42  ? 11  PHE D CE1 1 
ATOM   5278 C CE2 . PHE D 2 11  ? 84.262  0.986   68.745 1.00 52.54  ? 11  PHE D CE2 1 
ATOM   5279 C CZ  . PHE D 2 11  ? 83.781  1.879   69.735 1.00 49.79  ? 11  PHE D CZ  1 
ATOM   5280 N N   . GLN D 2 12  ? 89.424  2.520   67.251 1.00 63.21  ? 12  GLN D N   1 
ATOM   5281 C CA  . GLN D 2 12  ? 90.423  1.601   67.753 1.00 66.63  ? 12  GLN D CA  1 
ATOM   5282 C C   . GLN D 2 12  ? 91.475  2.341   68.571 1.00 67.59  ? 12  GLN D C   1 
ATOM   5283 O O   . GLN D 2 12  ? 91.822  1.946   69.683 1.00 67.82  ? 12  GLN D O   1 
ATOM   5284 C CB  . GLN D 2 12  ? 91.084  0.841   66.605 1.00 72.44  ? 12  GLN D CB  1 
ATOM   5285 C CG  . GLN D 2 12  ? 91.643  -0.495  67.060 1.00 77.00  ? 12  GLN D CG  1 
ATOM   5286 C CD  . GLN D 2 12  ? 90.661  -1.219  67.985 1.00 74.86  ? 12  GLN D CD  1 
ATOM   5287 O OE1 . GLN D 2 12  ? 90.147  -2.282  67.656 1.00 76.85  ? 12  GLN D OE1 1 
ATOM   5288 N NE2 . GLN D 2 12  ? 90.362  -0.611  69.128 1.00 71.49  ? 12  GLN D NE2 1 
ATOM   5289 N N   . GLU D 2 13  ? 91.958  3.438   68.015 1.00 68.10  ? 13  GLU D N   1 
ATOM   5290 C CA  . GLU D 2 13  ? 92.946  4.225   68.675 1.00 69.75  ? 13  GLU D CA  1 
ATOM   5291 C C   . GLU D 2 13  ? 92.421  4.675   70.014 1.00 65.64  ? 13  GLU D C   1 
ATOM   5292 O O   . GLU D 2 13  ? 93.093  4.507   71.040 1.00 68.18  ? 13  GLU D O   1 
ATOM   5293 C CB  . GLU D 2 13  ? 93.381  5.377   67.788 1.00 71.36  ? 13  GLU D CB  1 
ATOM   5294 C CG  . GLU D 2 13  ? 94.196  4.824   66.631 1.00 78.25  ? 13  GLU D CG  1 
ATOM   5295 C CD  . GLU D 2 13  ? 95.481  4.079   67.112 1.00 86.93  ? 13  GLU D CD  1 
ATOM   5296 O OE1 . GLU D 2 13  ? 96.260  4.723   67.871 1.00 85.44  ? 13  GLU D OE1 1 
ATOM   5297 O OE2 . GLU D 2 13  ? 95.715  2.877   66.733 1.00 90.64  ? 13  GLU D OE2 1 
ATOM   5298 N N   . ALA D 2 14  ? 91.208  5.199   70.031 1.00 60.16  ? 14  ALA D N   1 
ATOM   5299 C CA  . ALA D 2 14  ? 90.601  5.553   71.298 1.00 56.39  ? 14  ALA D CA  1 
ATOM   5300 C C   . ALA D 2 14  ? 90.677  4.384   72.296 1.00 57.61  ? 14  ALA D C   1 
ATOM   5301 O O   . ALA D 2 14  ? 91.226  4.558   73.387 1.00 59.52  ? 14  ALA D O   1 
ATOM   5302 C CB  . ALA D 2 14  ? 89.167  6.048   71.108 1.00 50.62  ? 14  ALA D CB  1 
ATOM   5303 N N   . LEU D 2 15  ? 90.169  3.209   71.913 1.00 58.00  ? 15  LEU D N   1 
ATOM   5304 C CA  . LEU D 2 15  ? 90.025  2.047   72.813 1.00 60.08  ? 15  LEU D CA  1 
ATOM   5305 C C   . LEU D 2 15  ? 91.314  1.587   73.521 1.00 66.61  ? 15  LEU D C   1 
ATOM   5306 O O   . LEU D 2 15  ? 91.274  1.114   74.658 1.00 67.22  ? 15  LEU D O   1 
ATOM   5307 C CB  . LEU D 2 15  ? 89.455  0.861   72.028 1.00 60.69  ? 15  LEU D CB  1 
ATOM   5308 C CG  . LEU D 2 15  ? 87.987  0.451   72.212 1.00 58.10  ? 15  LEU D CG  1 
ATOM   5309 C CD1 . LEU D 2 15  ? 87.042  1.715   72.302 1.00 54.11  ? 15  LEU D CD1 1 
ATOM   5310 C CD2 . LEU D 2 15  ? 87.503  -0.591  71.161 1.00 56.22  ? 15  LEU D CD2 1 
ATOM   5311 N N   . ASP D 2 16  ? 92.444  1.723   72.823 1.00 71.84  ? 16  ASP D N   1 
ATOM   5312 C CA  . ASP D 2 16  ? 93.714  1.188   73.257 1.00 78.47  ? 16  ASP D CA  1 
ATOM   5313 C C   . ASP D 2 16  ? 94.517  2.295   73.927 1.00 79.90  ? 16  ASP D C   1 
ATOM   5314 O O   . ASP D 2 16  ? 95.254  2.046   74.876 1.00 83.48  ? 16  ASP D O   1 
ATOM   5315 C CB  . ASP D 2 16  ? 94.496  0.657   72.036 1.00 83.99  ? 16  ASP D CB  1 
ATOM   5316 C CG  . ASP D 2 16  ? 93.690  -0.340  71.168 1.00 84.07  ? 16  ASP D CG  1 
ATOM   5317 O OD1 . ASP D 2 16  ? 92.719  -0.961  71.682 1.00 82.54  ? 16  ASP D OD1 1 
ATOM   5318 O OD2 . ASP D 2 16  ? 94.054  -0.512  69.971 1.00 85.22  ? 16  ASP D OD2 1 
ATOM   5319 N N   . ALA D 2 17  ? 94.411  3.515   73.401 1.00 77.87  ? 17  ALA D N   1 
ATOM   5320 C CA  . ALA D 2 17  ? 95.081  4.667   74.020 1.00 79.57  ? 17  ALA D CA  1 
ATOM   5321 C C   . ALA D 2 17  ? 94.441  4.926   75.375 1.00 76.69  ? 17  ALA D C   1 
ATOM   5322 O O   . ALA D 2 17  ? 95.051  5.539   76.239 1.00 78.97  ? 17  ALA D O   1 
ATOM   5323 C CB  . ALA D 2 17  ? 95.009  5.919   73.134 1.00 77.92  ? 17  ALA D CB  1 
ATOM   5324 N N   . ALA D 2 18  ? 93.202  4.461   75.549 1.00 72.20  ? 18  ALA D N   1 
ATOM   5325 C CA  . ALA D 2 18  ? 92.588  4.413   76.866 1.00 70.56  ? 18  ALA D CA  1 
ATOM   5326 C C   . ALA D 2 18  ? 93.524  3.540   77.694 1.00 76.47  ? 18  ALA D C   1 
ATOM   5327 O O   . ALA D 2 18  ? 94.454  2.937   77.153 1.00 81.62  ? 18  ALA D O   1 
ATOM   5328 C CB  . ALA D 2 18  ? 91.193  3.809   76.769 1.00 65.27  ? 18  ALA D CB  1 
ATOM   5329 N N   . GLY D 2 19  ? 93.342  3.436   78.989 1.00 77.10  ? 19  GLY D N   1 
ATOM   5330 C CA  . GLY D 2 19  ? 94.376  2.660   79.670 1.00 84.69  ? 19  GLY D CA  1 
ATOM   5331 C C   . GLY D 2 19  ? 93.712  1.481   80.280 1.00 85.02  ? 19  GLY D C   1 
ATOM   5332 O O   . GLY D 2 19  ? 93.041  0.689   79.594 1.00 83.34  ? 19  GLY D O   1 
ATOM   5333 N N   . ASP D 2 20  ? 93.880  1.375   81.588 1.00 87.45  ? 20  ASP D N   1 
ATOM   5334 C CA  . ASP D 2 20  ? 92.881  0.637   82.330 1.00 85.75  ? 20  ASP D CA  1 
ATOM   5335 C C   . ASP D 2 20  ? 91.534  1.437   82.403 1.00 77.81  ? 20  ASP D C   1 
ATOM   5336 O O   . ASP D 2 20  ? 90.525  0.979   82.973 1.00 75.77  ? 20  ASP D O   1 
ATOM   5337 C CB  . ASP D 2 20  ? 93.455  0.236   83.704 1.00 91.71  ? 20  ASP D CB  1 
ATOM   5338 C CG  . ASP D 2 20  ? 94.033  -1.234  83.693 1.00 100.59 ? 20  ASP D CG  1 
ATOM   5339 O OD1 . ASP D 2 20  ? 95.051  -1.575  84.433 1.00 105.97 ? 20  ASP D OD1 1 
ATOM   5340 O OD2 . ASP D 2 20  ? 93.406  -2.047  82.939 1.00 98.55  ? 20  ASP D OD2 1 
ATOM   5341 N N   . LYS D 2 21  ? 91.491  2.618   81.797 1.00 73.18  ? 21  LYS D N   1 
ATOM   5342 C CA  . LYS D 2 21  ? 90.390  3.537   82.104 1.00 67.81  ? 21  LYS D CA  1 
ATOM   5343 C C   . LYS D 2 21  ? 89.015  3.117   81.525 1.00 62.33  ? 21  LYS D C   1 
ATOM   5344 O O   . LYS D 2 21  ? 88.920  2.380   80.517 1.00 61.36  ? 21  LYS D O   1 
ATOM   5345 C CB  . LYS D 2 21  ? 90.744  4.950   81.650 1.00 66.44  ? 21  LYS D CB  1 
ATOM   5346 C CG  . LYS D 2 21  ? 92.225  5.251   81.565 1.00 73.29  ? 21  LYS D CG  1 
ATOM   5347 C CD  . LYS D 2 21  ? 92.524  6.654   82.106 1.00 76.42  ? 21  LYS D CD  1 
ATOM   5348 C CE  . LYS D 2 21  ? 92.351  7.762   81.051 1.00 76.93  ? 21  LYS D CE  1 
ATOM   5349 N NZ  . LYS D 2 21  ? 93.404  7.758   79.945 1.00 80.58  ? 21  LYS D NZ  1 
ATOM   5350 N N   . LEU D 2 22  ? 87.937  3.566   82.156 1.00 58.32  ? 22  LEU D N   1 
ATOM   5351 C CA  . LEU D 2 22  ? 86.629  3.249   81.633 1.00 53.25  ? 22  LEU D CA  1 
ATOM   5352 C C   . LEU D 2 22  ? 86.316  4.209   80.476 1.00 50.04  ? 22  LEU D C   1 
ATOM   5353 O O   . LEU D 2 22  ? 86.544  5.416   80.591 1.00 49.71  ? 22  LEU D O   1 
ATOM   5354 C CB  . LEU D 2 22  ? 85.587  3.348   82.729 1.00 51.98  ? 22  LEU D CB  1 
ATOM   5355 C CG  . LEU D 2 22  ? 84.106  3.286   82.349 1.00 46.63  ? 22  LEU D CG  1 
ATOM   5356 C CD1 . LEU D 2 22  ? 83.501  1.874   82.280 1.00 42.04  ? 22  LEU D CD1 1 
ATOM   5357 C CD2 . LEU D 2 22  ? 83.431  4.100   83.391 1.00 47.49  ? 22  LEU D CD2 1 
ATOM   5358 N N   . VAL D 2 23  ? 85.836  3.647   79.362 1.00 47.40  ? 23  VAL D N   1 
ATOM   5359 C CA  . VAL D 2 23  ? 85.412  4.403   78.199 1.00 44.32  ? 23  VAL D CA  1 
ATOM   5360 C C   . VAL D 2 23  ? 83.888  4.324   78.080 1.00 40.12  ? 23  VAL D C   1 
ATOM   5361 O O   . VAL D 2 23  ? 83.324  3.231   78.036 1.00 40.21  ? 23  VAL D O   1 
ATOM   5362 C CB  . VAL D 2 23  ? 85.906  3.764   76.873 1.00 45.68  ? 23  VAL D CB  1 
ATOM   5363 C CG1 . VAL D 2 23  ? 85.744  4.756   75.737 1.00 44.32  ? 23  VAL D CG1 1 
ATOM   5364 C CG2 . VAL D 2 23  ? 87.299  3.282   76.964 1.00 49.17  ? 23  VAL D CG2 1 
ATOM   5365 N N   . VAL D 2 24  ? 83.225  5.455   77.977 1.00 35.95  ? 24  VAL D N   1 
ATOM   5366 C CA  . VAL D 2 24  ? 81.837  5.363   77.661 1.00 34.00  ? 24  VAL D CA  1 
ATOM   5367 C C   . VAL D 2 24  ? 81.608  5.958   76.236 1.00 32.59  ? 24  VAL D C   1 
ATOM   5368 O O   . VAL D 2 24  ? 82.339  6.854   75.839 1.00 34.00  ? 24  VAL D O   1 
ATOM   5369 C CB  . VAL D 2 24  ? 80.983  5.915   78.832 1.00 32.57  ? 24  VAL D CB  1 
ATOM   5370 C CG1 . VAL D 2 24  ? 81.566  7.178   79.332 1.00 34.80  ? 24  VAL D CG1 1 
ATOM   5371 C CG2 . VAL D 2 24  ? 79.577  6.142   78.416 1.00 29.68  ? 24  VAL D CG2 1 
ATOM   5372 N N   . VAL D 2 25  ? 80.678  5.397   75.455 1.00 31.36  ? 25  VAL D N   1 
ATOM   5373 C CA  . VAL D 2 25  ? 80.417  5.777   74.054 1.00 30.34  ? 25  VAL D CA  1 
ATOM   5374 C C   . VAL D 2 25  ? 78.951  5.993   73.919 1.00 28.25  ? 25  VAL D C   1 
ATOM   5375 O O   . VAL D 2 25  ? 78.154  5.104   74.144 1.00 28.93  ? 25  VAL D O   1 
ATOM   5376 C CB  . VAL D 2 25  ? 80.647  4.602   73.096 1.00 32.23  ? 25  VAL D CB  1 
ATOM   5377 C CG1 . VAL D 2 25  ? 80.584  5.073   71.656 1.00 32.22  ? 25  VAL D CG1 1 
ATOM   5378 C CG2 . VAL D 2 25  ? 81.956  3.925   73.373 1.00 36.90  ? 25  VAL D CG2 1 
ATOM   5379 N N   . ASP D 2 26  ? 78.569  7.170   73.509 1.00 27.64  ? 26  ASP D N   1 
ATOM   5380 C CA  . ASP D 2 26  ? 77.159  7.435   73.311 1.00 25.94  ? 26  ASP D CA  1 
ATOM   5381 C C   . ASP D 2 26  ? 76.925  7.306   71.824 1.00 25.80  ? 26  ASP D C   1 
ATOM   5382 O O   . ASP D 2 26  ? 77.364  8.171   71.063 1.00 26.31  ? 26  ASP D O   1 
ATOM   5383 C CB  . ASP D 2 26  ? 76.859  8.826   73.852 1.00 25.54  ? 26  ASP D CB  1 
ATOM   5384 C CG  . ASP D 2 26  ? 75.676  9.489   73.217 1.00 27.23  ? 26  ASP D CG  1 
ATOM   5385 O OD1 . ASP D 2 26  ? 74.760  8.803   72.747 1.00 32.59  ? 26  ASP D OD1 1 
ATOM   5386 O OD2 . ASP D 2 26  ? 75.665  10.738  73.208 1.00 31.65  ? 26  ASP D OD2 1 
ATOM   5387 N N   . PHE D 2 27  ? 76.319  6.197   71.410 1.00 25.33  ? 27  PHE D N   1 
ATOM   5388 C CA  . PHE D 2 27  ? 75.920  6.053   70.018 1.00 26.73  ? 27  PHE D CA  1 
ATOM   5389 C C   . PHE D 2 27  ? 74.692  6.855   69.870 1.00 26.48  ? 27  PHE D C   1 
ATOM   5390 O O   . PHE D 2 27  ? 73.699  6.629   70.554 1.00 25.66  ? 27  PHE D O   1 
ATOM   5391 C CB  . PHE D 2 27  ? 75.677  4.621   69.596 1.00 28.08  ? 27  PHE D CB  1 
ATOM   5392 C CG  . PHE D 2 27  ? 76.924  3.793   69.569 1.00 30.68  ? 27  PHE D CG  1 
ATOM   5393 C CD1 . PHE D 2 27  ? 77.685  3.696   68.421 1.00 32.62  ? 27  PHE D CD1 1 
ATOM   5394 C CD2 . PHE D 2 27  ? 77.339  3.102   70.691 1.00 32.22  ? 27  PHE D CD2 1 
ATOM   5395 C CE1 . PHE D 2 27  ? 78.799  2.922   68.368 1.00 32.00  ? 27  PHE D CE1 1 
ATOM   5396 C CE2 . PHE D 2 27  ? 78.481  2.290   70.650 1.00 35.64  ? 27  PHE D CE2 1 
ATOM   5397 C CZ  . PHE D 2 27  ? 79.199  2.208   69.491 1.00 36.36  ? 27  PHE D CZ  1 
ATOM   5398 N N   . SER D 2 28  ? 74.812  7.816   68.957 1.00 27.73  ? 28  SER D N   1 
ATOM   5399 C CA  . SER D 2 28  ? 73.947  8.945   68.813 1.00 27.13  ? 28  SER D CA  1 
ATOM   5400 C C   . SER D 2 28  ? 73.560  9.199   67.326 1.00 30.30  ? 28  SER D C   1 
ATOM   5401 O O   . SER D 2 28  ? 74.178  8.584   66.349 1.00 31.48  ? 28  SER D O   1 
ATOM   5402 C CB  . SER D 2 28  ? 74.704  10.128  69.372 1.00 26.01  ? 28  SER D CB  1 
ATOM   5403 O OG  . SER D 2 28  ? 73.787  11.137  69.635 1.00 28.91  ? 28  SER D OG  1 
ATOM   5404 N N   . ALA D 2 29  ? 72.569  10.108  67.156 1.00 29.93  ? 29  ALA D N   1 
ATOM   5405 C CA  . ALA D 2 29  ? 72.146  10.583  65.850 1.00 32.59  ? 29  ALA D CA  1 
ATOM   5406 C C   . ALA D 2 29  ? 71.677  12.015  65.994 1.00 34.13  ? 29  ALA D C   1 
ATOM   5407 O O   . ALA D 2 29  ? 71.048  12.322  67.012 1.00 32.60  ? 29  ALA D O   1 
ATOM   5408 C CB  . ALA D 2 29  ? 71.057  9.754   65.355 1.00 34.26  ? 29  ALA D CB  1 
ATOM   5409 N N   . THR D 2 30  ? 71.926  12.896  65.001 1.00 36.52  ? 30  THR D N   1 
ATOM   5410 C CA  . THR D 2 30  ? 71.659  14.328  65.255 1.00 37.53  ? 30  THR D CA  1 
ATOM   5411 C C   . THR D 2 30  ? 70.192  14.727  65.126 1.00 38.97  ? 30  THR D C   1 
ATOM   5412 O O   . THR D 2 30  ? 69.839  15.866  65.499 1.00 39.79  ? 30  THR D O   1 
ATOM   5413 C CB  . THR D 2 30  ? 72.502  15.315  64.391 1.00 40.75  ? 30  THR D CB  1 
ATOM   5414 O OG1 . THR D 2 30  ? 71.823  15.536  63.152 1.00 49.41  ? 30  THR D OG1 1 
ATOM   5415 C CG2 . THR D 2 30  ? 73.932  14.831  64.091 1.00 41.42  ? 30  THR D CG2 1 
ATOM   5416 N N   . TRP D 2 31  ? 69.349  13.822  64.590 1.00 40.01  ? 31  TRP D N   1 
ATOM   5417 C CA  . TRP D 2 31  ? 67.900  14.073  64.375 1.00 42.91  ? 31  TRP D CA  1 
ATOM   5418 C C   . TRP D 2 31  ? 66.969  13.528  65.492 1.00 41.95  ? 31  TRP D C   1 
ATOM   5419 O O   . TRP D 2 31  ? 65.779  13.873  65.557 1.00 44.70  ? 31  TRP D O   1 
ATOM   5420 C CB  . TRP D 2 31  ? 67.469  13.532  63.016 1.00 46.01  ? 31  TRP D CB  1 
ATOM   5421 C CG  . TRP D 2 31  ? 67.898  12.098  62.808 1.00 45.10  ? 31  TRP D CG  1 
ATOM   5422 C CD1 . TRP D 2 31  ? 69.038  11.662  62.182 1.00 43.90  ? 31  TRP D CD1 1 
ATOM   5423 C CD2 . TRP D 2 31  ? 67.200  10.916  63.231 1.00 42.73  ? 31  TRP D CD2 1 
ATOM   5424 N NE1 . TRP D 2 31  ? 69.104  10.289  62.204 1.00 42.61  ? 31  TRP D NE1 1 
ATOM   5425 C CE2 . TRP D 2 31  ? 67.996  9.796   62.834 1.00 43.00  ? 31  TRP D CE2 1 
ATOM   5426 C CE3 . TRP D 2 31  ? 65.994  10.692  63.918 1.00 40.69  ? 31  TRP D CE3 1 
ATOM   5427 C CZ2 . TRP D 2 31  ? 67.630  8.461   63.106 1.00 42.95  ? 31  TRP D CZ2 1 
ATOM   5428 C CZ3 . TRP D 2 31  ? 65.603  9.360   64.161 1.00 44.15  ? 31  TRP D CZ3 1 
ATOM   5429 C CH2 . TRP D 2 31  ? 66.433  8.255   63.762 1.00 42.86  ? 31  TRP D CH2 1 
ATOM   5430 N N   . CYS D 2 32  ? 67.539  12.685  66.357 1.00 39.50  ? 32  CYS D N   1 
ATOM   5431 C CA  . CYS D 2 32  ? 66.879  11.982  67.494 1.00 38.87  ? 32  CYS D CA  1 
ATOM   5432 C C   . CYS D 2 32  ? 66.637  12.843  68.746 1.00 37.71  ? 32  CYS D C   1 
ATOM   5433 O O   . CYS D 2 32  ? 67.584  13.190  69.464 1.00 36.16  ? 32  CYS D O   1 
ATOM   5434 C CB  . CYS D 2 32  ? 67.753  10.792  67.962 1.00 35.88  ? 32  CYS D CB  1 
ATOM   5435 S SG  . CYS D 2 32  ? 66.902  9.798   69.266 1.00 38.95  ? 32  CYS D SG  1 
ATOM   5436 N N   . GLY D 2 33  ? 65.382  13.135  69.050 1.00 39.64  ? 33  GLY D N   1 
ATOM   5437 C CA  . GLY D 2 33  ? 65.064  13.967  70.193 1.00 39.29  ? 33  GLY D CA  1 
ATOM   5438 C C   . GLY D 2 33  ? 65.790  13.450  71.400 1.00 36.35  ? 33  GLY D C   1 
ATOM   5439 O O   . GLY D 2 33  ? 66.593  14.198  71.980 1.00 36.56  ? 33  GLY D O   1 
ATOM   5440 N N   . PRO D 2 34  ? 65.550  12.177  71.776 1.00 34.44  ? 34  PRO D N   1 
ATOM   5441 C CA  . PRO D 2 34  ? 66.189  11.656  72.988 1.00 32.30  ? 34  PRO D CA  1 
ATOM   5442 C C   . PRO D 2 34  ? 67.698  11.740  72.931 1.00 30.26  ? 34  PRO D C   1 
ATOM   5443 O O   . PRO D 2 34  ? 68.325  12.181  73.896 1.00 30.07  ? 34  PRO D O   1 
ATOM   5444 C CB  . PRO D 2 34  ? 65.729  10.178  73.073 1.00 33.47  ? 34  PRO D CB  1 
ATOM   5445 C CG  . PRO D 2 34  ? 64.796  9.943   71.891 1.00 34.72  ? 34  PRO D CG  1 
ATOM   5446 C CD  . PRO D 2 34  ? 64.648  11.212  71.120 1.00 36.00  ? 34  PRO D CD  1 
ATOM   5447 N N   . ALA D 2 35  ? 68.316  11.314  71.842 1.00 30.50  ? 35  ALA D N   1 
ATOM   5448 C CA  . ALA D 2 35  ? 69.777  11.547  71.744 1.00 29.81  ? 35  ALA D CA  1 
ATOM   5449 C C   . ALA D 2 35  ? 70.160  13.035  71.948 1.00 30.49  ? 35  ALA D C   1 
ATOM   5450 O O   . ALA D 2 35  ? 71.084  13.307  72.685 1.00 30.53  ? 35  ALA D O   1 
ATOM   5451 C CB  . ALA D 2 35  ? 70.379  10.993  70.472 1.00 28.95  ? 35  ALA D CB  1 
ATOM   5452 N N   . LYS D 2 36  ? 69.448  13.970  71.321 1.00 32.95  ? 36  LYS D N   1 
ATOM   5453 C CA  . LYS D 2 36  ? 69.672  15.409  71.556 1.00 34.66  ? 36  LYS D CA  1 
ATOM   5454 C C   . LYS D 2 36  ? 69.493  15.799  73.019 1.00 34.44  ? 36  LYS D C   1 
ATOM   5455 O O   . LYS D 2 36  ? 70.277  16.601  73.555 1.00 35.53  ? 36  LYS D O   1 
ATOM   5456 C CB  . LYS D 2 36  ? 68.710  16.295  70.742 1.00 37.93  ? 36  LYS D CB  1 
ATOM   5457 C CG  . LYS D 2 36  ? 69.233  16.812  69.429 1.00 38.59  ? 36  LYS D CG  1 
ATOM   5458 C CD  . LYS D 2 36  ? 68.138  17.699  68.773 1.00 48.95  ? 36  LYS D CD  1 
ATOM   5459 C CE  . LYS D 2 36  ? 66.912  16.895  68.187 1.00 50.62  ? 36  LYS D CE  1 
ATOM   5460 N NZ  . LYS D 2 36  ? 65.801  17.763  67.578 1.00 55.86  ? 36  LYS D NZ  1 
ATOM   5461 N N   . MET D 2 37  ? 68.457  15.271  73.659 1.00 33.55  ? 37  MET D N   1 
ATOM   5462 C CA  . MET D 2 37  ? 68.190  15.663  75.027 1.00 33.80  ? 37  MET D CA  1 
ATOM   5463 C C   . MET D 2 37  ? 69.393  15.346  75.929 1.00 31.39  ? 37  MET D C   1 
ATOM   5464 O O   . MET D 2 37  ? 69.857  16.188  76.660 1.00 33.34  ? 37  MET D O   1 
ATOM   5465 C CB  . MET D 2 37  ? 66.879  15.048  75.531 1.00 34.31  ? 37  MET D CB  1 
ATOM   5466 C CG  . MET D 2 37  ? 66.504  15.416  76.962 1.00 39.98  ? 37  MET D CG  1 
ATOM   5467 S SD  . MET D 2 37  ? 67.118  14.241  78.255 1.00 44.91  ? 37  MET D SD  1 
ATOM   5468 C CE  . MET D 2 37  ? 65.951  12.899  77.970 1.00 45.31  ? 37  MET D CE  1 
ATOM   5469 N N   . ILE D 2 38  ? 69.929  14.146  75.848 1.00 28.69  ? 38  ILE D N   1 
ATOM   5470 C CA  . ILE D 2 38  ? 70.894  13.701  76.834 1.00 26.05  ? 38  ILE D CA  1 
ATOM   5471 C C   . ILE D 2 38  ? 72.308  14.205  76.524 1.00 25.66  ? 38  ILE D C   1 
ATOM   5472 O O   . ILE D 2 38  ? 73.235  14.059  77.345 1.00 24.58  ? 38  ILE D O   1 
ATOM   5473 C CB  . ILE D 2 38  ? 70.871  12.175  76.871 1.00 24.78  ? 38  ILE D CB  1 
ATOM   5474 C CG1 . ILE D 2 38  ? 71.504  11.667  78.161 1.00 25.74  ? 38  ILE D CG1 1 
ATOM   5475 C CG2 . ILE D 2 38  ? 71.554  11.630  75.673 1.00 20.04  ? 38  ILE D CG2 1 
ATOM   5476 C CD1 . ILE D 2 38  ? 70.844  10.461  78.738 1.00 27.19  ? 38  ILE D CD1 1 
ATOM   5477 N N   . LYS D 2 39  ? 72.495  14.821  75.350 1.00 26.02  ? 39  LYS D N   1 
ATOM   5478 C CA  . LYS D 2 39  ? 73.864  15.267  75.005 1.00 26.25  ? 39  LYS D CA  1 
ATOM   5479 C C   . LYS D 2 39  ? 74.496  16.176  76.025 1.00 25.79  ? 39  LYS D C   1 
ATOM   5480 O O   . LYS D 2 39  ? 75.572  15.869  76.492 1.00 25.35  ? 39  LYS D O   1 
ATOM   5481 C CB  . LYS D 2 39  ? 73.998  15.807  73.609 1.00 27.00  ? 39  LYS D CB  1 
ATOM   5482 C CG  . LYS D 2 39  ? 74.211  14.693  72.611 1.00 30.65  ? 39  LYS D CG  1 
ATOM   5483 C CD  . LYS D 2 39  ? 74.688  15.278  71.306 1.00 39.03  ? 39  LYS D CD  1 
ATOM   5484 C CE  . LYS D 2 39  ? 75.390  16.600  71.570 1.00 42.30  ? 39  LYS D CE  1 
ATOM   5485 N NZ  . LYS D 2 39  ? 76.537  16.908  70.638 1.00 47.98  ? 39  LYS D NZ  1 
ATOM   5486 N N   . PRO D 2 40  ? 73.798  17.250  76.420 1.00 27.25  ? 40  PRO D N   1 
ATOM   5487 C CA  . PRO D 2 40  ? 74.426  18.103  77.415 1.00 29.25  ? 40  PRO D CA  1 
ATOM   5488 C C   . PRO D 2 40  ? 74.778  17.321  78.686 1.00 29.76  ? 40  PRO D C   1 
ATOM   5489 O O   . PRO D 2 40  ? 75.791  17.600  79.339 1.00 31.81  ? 40  PRO D O   1 
ATOM   5490 C CB  . PRO D 2 40  ? 73.387  19.174  77.707 1.00 30.89  ? 40  PRO D CB  1 
ATOM   5491 C CG  . PRO D 2 40  ? 72.278  18.977  76.751 1.00 30.26  ? 40  PRO D CG  1 
ATOM   5492 C CD  . PRO D 2 40  ? 72.473  17.730  75.989 1.00 27.91  ? 40  PRO D CD  1 
ATOM   5493 N N   . PHE D 2 41  ? 73.976  16.320  79.040 1.00 28.41  ? 41  PHE D N   1 
ATOM   5494 C CA  . PHE D 2 41  ? 74.241  15.642  80.280 1.00 26.85  ? 41  PHE D CA  1 
ATOM   5495 C C   . PHE D 2 41  ? 75.399  14.783  80.058 1.00 25.39  ? 41  PHE D C   1 
ATOM   5496 O O   . PHE D 2 41  ? 76.268  14.737  80.918 1.00 27.95  ? 41  PHE D O   1 
ATOM   5497 C CB  . PHE D 2 41  ? 73.024  14.927  80.859 1.00 26.95  ? 41  PHE D CB  1 
ATOM   5498 C CG  . PHE D 2 41  ? 71.888  15.866  81.169 1.00 30.63  ? 41  PHE D CG  1 
ATOM   5499 C CD1 . PHE D 2 41  ? 72.071  16.954  82.070 1.00 35.43  ? 41  PHE D CD1 1 
ATOM   5500 C CD2 . PHE D 2 41  ? 70.662  15.742  80.525 1.00 33.61  ? 41  PHE D CD2 1 
ATOM   5501 C CE1 . PHE D 2 41  ? 71.068  17.858  82.337 1.00 34.15  ? 41  PHE D CE1 1 
ATOM   5502 C CE2 . PHE D 2 41  ? 69.620  16.664  80.791 1.00 37.72  ? 41  PHE D CE2 1 
ATOM   5503 C CZ  . PHE D 2 41  ? 69.833  17.720  81.700 1.00 37.17  ? 41  PHE D CZ  1 
ATOM   5504 N N   . PHE D 2 42  ? 75.495  14.160  78.897 1.00 23.08  ? 42  PHE D N   1 
ATOM   5505 C CA  . PHE D 2 42  ? 76.656  13.297  78.675 1.00 23.46  ? 42  PHE D CA  1 
ATOM   5506 C C   . PHE D 2 42  ? 77.882  14.107  78.893 1.00 26.09  ? 42  PHE D C   1 
ATOM   5507 O O   . PHE D 2 42  ? 78.839  13.644  79.528 1.00 28.51  ? 42  PHE D O   1 
ATOM   5508 C CB  . PHE D 2 42  ? 76.716  12.831  77.268 1.00 22.24  ? 42  PHE D CB  1 
ATOM   5509 C CG  . PHE D 2 42  ? 77.610  11.686  77.041 1.00 21.48  ? 42  PHE D CG  1 
ATOM   5510 C CD1 . PHE D 2 42  ? 77.363  10.467  77.659 1.00 25.70  ? 42  PHE D CD1 1 
ATOM   5511 C CD2 . PHE D 2 42  ? 78.638  11.773  76.110 1.00 24.05  ? 42  PHE D CD2 1 
ATOM   5512 C CE1 . PHE D 2 42  ? 78.187  9.331   77.430 1.00 26.55  ? 42  PHE D CE1 1 
ATOM   5513 C CE2 . PHE D 2 42  ? 79.448  10.658  75.816 1.00 28.32  ? 42  PHE D CE2 1 
ATOM   5514 C CZ  . PHE D 2 42  ? 79.229  9.421   76.501 1.00 28.46  ? 42  PHE D CZ  1 
ATOM   5515 N N   . HIS D 2 43  ? 77.830  15.338  78.384 1.00 27.01  ? 43  HIS D N   1 
ATOM   5516 C CA  . HIS D 2 43  ? 78.920  16.297  78.483 1.00 29.18  ? 43  HIS D CA  1 
ATOM   5517 C C   . HIS D 2 43  ? 79.267  16.844  79.881 1.00 31.97  ? 43  HIS D C   1 
ATOM   5518 O O   . HIS D 2 43  ? 80.442  17.048  80.198 1.00 35.30  ? 43  HIS D O   1 
ATOM   5519 C CB  . HIS D 2 43  ? 78.637  17.503  77.605 1.00 29.68  ? 43  HIS D CB  1 
ATOM   5520 C CG  . HIS D 2 43  ? 79.721  18.503  77.687 1.00 33.80  ? 43  HIS D CG  1 
ATOM   5521 N ND1 . HIS D 2 43  ? 80.878  18.395  76.940 1.00 37.19  ? 43  HIS D ND1 1 
ATOM   5522 C CD2 . HIS D 2 43  ? 79.889  19.566  78.512 1.00 39.18  ? 43  HIS D CD2 1 
ATOM   5523 C CE1 . HIS D 2 43  ? 81.690  19.389  77.266 1.00 43.49  ? 43  HIS D CE1 1 
ATOM   5524 N NE2 . HIS D 2 43  ? 81.112  20.116  78.212 1.00 42.79  ? 43  HIS D NE2 1 
ATOM   5525 N N   . SER D 2 44  ? 78.267  17.175  80.685 1.00 31.85  ? 44  SER D N   1 
ATOM   5526 C CA  . SER D 2 44  ? 78.536  17.601  82.036 1.00 35.02  ? 44  SER D CA  1 
ATOM   5527 C C   . SER D 2 44  ? 79.290  16.481  82.816 1.00 35.29  ? 44  SER D C   1 
ATOM   5528 O O   . SER D 2 44  ? 80.299  16.740  83.506 1.00 37.24  ? 44  SER D O   1 
ATOM   5529 C CB  . SER D 2 44  ? 77.213  17.892  82.716 1.00 36.49  ? 44  SER D CB  1 
ATOM   5530 O OG  . SER D 2 44  ? 76.539  18.968  82.122 1.00 38.43  ? 44  SER D OG  1 
ATOM   5531 N N   . LEU D 2 45  ? 78.780  15.248  82.668 1.00 31.87  ? 45  LEU D N   1 
ATOM   5532 C CA  . LEU D 2 45  ? 79.422  14.052  83.158 1.00 31.51  ? 45  LEU D CA  1 
ATOM   5533 C C   . LEU D 2 45  ? 80.880  13.933  82.742 1.00 32.43  ? 45  LEU D C   1 
ATOM   5534 O O   . LEU D 2 45  ? 81.758  13.696  83.588 1.00 35.13  ? 45  LEU D O   1 
ATOM   5535 C CB  . LEU D 2 45  ? 78.632  12.816  82.712 1.00 29.26  ? 45  LEU D CB  1 
ATOM   5536 C CG  . LEU D 2 45  ? 77.667  12.046  83.686 1.00 28.90  ? 45  LEU D CG  1 
ATOM   5537 C CD1 . LEU D 2 45  ? 77.138  12.824  84.893 1.00 27.60  ? 45  LEU D CD1 1 
ATOM   5538 C CD2 . LEU D 2 45  ? 76.499  11.398  82.949 1.00 23.46  ? 45  LEU D CD2 1 
ATOM   5539 N N   . SER D 2 46  ? 81.154  14.136  81.460 1.00 30.63  ? 46  SER D N   1 
ATOM   5540 C CA  . SER D 2 46  ? 82.531  14.040  80.980 1.00 31.79  ? 46  SER D CA  1 
ATOM   5541 C C   . SER D 2 46  ? 83.449  15.019  81.726 1.00 36.21  ? 46  SER D C   1 
ATOM   5542 O O   . SER D 2 46  ? 84.587  14.659  82.085 1.00 37.84  ? 46  SER D O   1 
ATOM   5543 C CB  . SER D 2 46  ? 82.640  14.204  79.454 1.00 28.94  ? 46  SER D CB  1 
ATOM   5544 O OG  . SER D 2 46  ? 82.707  15.583  79.103 1.00 32.57  ? 46  SER D OG  1 
ATOM   5545 N N   . GLU D 2 47  ? 82.964  16.250  81.930 1.00 37.90  ? 47  GLU D N   1 
ATOM   5546 C CA  . GLU D 2 47  ? 83.707  17.207  82.728 1.00 42.48  ? 47  GLU D CA  1 
ATOM   5547 C C   . GLU D 2 47  ? 83.803  16.692  84.151 1.00 45.48  ? 47  GLU D C   1 
ATOM   5548 O O   . GLU D 2 47  ? 84.891  16.743  84.725 1.00 50.51  ? 47  GLU D O   1 
ATOM   5549 C CB  . GLU D 2 47  ? 83.120  18.631  82.685 1.00 44.35  ? 47  GLU D CB  1 
ATOM   5550 C CG  . GLU D 2 47  ? 83.299  19.402  81.381 1.00 42.39  ? 47  GLU D CG  1 
ATOM   5551 C CD  . GLU D 2 47  ? 84.779  19.614  81.052 1.00 49.85  ? 47  GLU D CD  1 
ATOM   5552 O OE1 . GLU D 2 47  ? 85.534  20.045  81.959 1.00 58.16  ? 47  GLU D OE1 1 
ATOM   5553 O OE2 . GLU D 2 47  ? 85.225  19.359  79.899 1.00 49.58  ? 47  GLU D OE2 1 
ATOM   5554 N N   . LYS D 2 48  ? 82.736  16.148  84.735 1.00 44.06  ? 48  LYS D N   1 
ATOM   5555 C CA  . LYS D 2 48  ? 82.910  15.649  86.126 1.00 48.03  ? 48  LYS D CA  1 
ATOM   5556 C C   . LYS D 2 48  ? 83.793  14.424  86.277 1.00 49.41  ? 48  LYS D C   1 
ATOM   5557 O O   . LYS D 2 48  ? 84.713  14.453  87.038 1.00 54.34  ? 48  LYS D O   1 
ATOM   5558 C CB  . LYS D 2 48  ? 81.606  15.487  86.912 1.00 47.45  ? 48  LYS D CB  1 
ATOM   5559 C CG  . LYS D 2 48  ? 81.753  14.829  88.308 1.00 49.08  ? 48  LYS D CG  1 
ATOM   5560 C CD  . LYS D 2 48  ? 80.460  13.976  88.572 1.00 48.02  ? 48  LYS D CD  1 
ATOM   5561 C CE  . LYS D 2 48  ? 80.006  13.843  90.060 1.00 52.01  ? 48  LYS D CE  1 
ATOM   5562 N NZ  . LYS D 2 48  ? 80.111  15.045  90.964 1.00 54.18  ? 48  LYS D NZ  1 
ATOM   5563 N N   . TYR D 2 49  ? 83.522  13.360  85.557 1.00 47.02  ? 49  TYR D N   1 
ATOM   5564 C CA  . TYR D 2 49  ? 84.287  12.143  85.729 1.00 49.91  ? 49  TYR D CA  1 
ATOM   5565 C C   . TYR D 2 49  ? 85.504  12.143  84.851 1.00 50.94  ? 49  TYR D C   1 
ATOM   5566 O O   . TYR D 2 49  ? 85.596  11.370  83.894 1.00 49.06  ? 49  TYR D O   1 
ATOM   5567 C CB  . TYR D 2 49  ? 83.418  10.907  85.435 1.00 47.39  ? 49  TYR D CB  1 
ATOM   5568 C CG  . TYR D 2 49  ? 82.295  10.770  86.439 1.00 50.05  ? 49  TYR D CG  1 
ATOM   5569 C CD1 . TYR D 2 49  ? 82.497  10.134  87.664 1.00 53.27  ? 49  TYR D CD1 1 
ATOM   5570 C CD2 . TYR D 2 49  ? 81.034  11.290  86.176 1.00 48.02  ? 49  TYR D CD2 1 
ATOM   5571 C CE1 . TYR D 2 49  ? 81.457  10.029  88.602 1.00 54.98  ? 49  TYR D CE1 1 
ATOM   5572 C CE2 . TYR D 2 49  ? 79.996  11.173  87.121 1.00 49.95  ? 49  TYR D CE2 1 
ATOM   5573 C CZ  . TYR D 2 49  ? 80.212  10.547  88.323 1.00 50.62  ? 49  TYR D CZ  1 
ATOM   5574 O OH  . TYR D 2 49  ? 79.177  10.436  89.225 1.00 48.29  ? 49  TYR D OH  1 
ATOM   5575 N N   . SER D 2 50  ? 86.451  12.993  85.195 1.00 55.88  ? 50  SER D N   1 
ATOM   5576 C CA  . SER D 2 50  ? 87.593  13.240  84.337 1.00 58.99  ? 50  SER D CA  1 
ATOM   5577 C C   . SER D 2 50  ? 88.562  12.068  84.213 1.00 61.47  ? 50  SER D C   1 
ATOM   5578 O O   . SER D 2 50  ? 89.534  12.156  83.429 1.00 63.11  ? 50  SER D O   1 
ATOM   5579 C CB  . SER D 2 50  ? 88.346  14.476  84.820 1.00 63.98  ? 50  SER D CB  1 
ATOM   5580 O OG  . SER D 2 50  ? 88.731  14.315  86.183 1.00 70.65  ? 50  SER D OG  1 
ATOM   5581 N N   . ASN D 2 51  ? 88.300  10.995  84.972 1.00 62.17  ? 51  ASN D N   1 
ATOM   5582 C CA  . ASN D 2 51  ? 89.066  9.733   84.890 1.00 64.39  ? 51  ASN D CA  1 
ATOM   5583 C C   . ASN D 2 51  ? 88.410  8.646   84.060 1.00 59.55  ? 51  ASN D C   1 
ATOM   5584 O O   . ASN D 2 51  ? 88.815  7.499   84.096 1.00 61.66  ? 51  ASN D O   1 
ATOM   5585 C CB  . ASN D 2 51  ? 89.302  9.172   86.287 1.00 70.10  ? 51  ASN D CB  1 
ATOM   5586 C CG  . ASN D 2 51  ? 88.166  9.535   87.280 1.00 72.76  ? 51  ASN D CG  1 
ATOM   5587 O OD1 . ASN D 2 51  ? 86.967  9.648   86.907 1.00 67.03  ? 51  ASN D OD1 1 
ATOM   5588 N ND2 . ASN D 2 51  ? 88.560  9.743   88.560 1.00 79.31  ? 51  ASN D ND2 1 
ATOM   5589 N N   . VAL D 2 52  ? 87.388  9.014   83.316 1.00 53.85  ? 52  VAL D N   1 
ATOM   5590 C CA  . VAL D 2 52  ? 86.630  8.098   82.511 1.00 49.42  ? 52  VAL D CA  1 
ATOM   5591 C C   . VAL D 2 52  ? 86.786  8.786   81.184 1.00 47.86  ? 52  VAL D C   1 
ATOM   5592 O O   . VAL D 2 52  ? 86.930  10.008  81.161 1.00 49.28  ? 52  VAL D O   1 
ATOM   5593 C CB  . VAL D 2 52  ? 85.166  8.158   82.941 1.00 46.13  ? 52  VAL D CB  1 
ATOM   5594 C CG1 . VAL D 2 52  ? 84.252  7.451   81.973 1.00 42.85  ? 52  VAL D CG1 1 
ATOM   5595 C CG2 . VAL D 2 52  ? 84.991  7.560   84.284 1.00 47.77  ? 52  VAL D CG2 1 
ATOM   5596 N N   . ILE D 2 53  ? 86.812  8.024   80.089 1.00 45.97  ? 53  ILE D N   1 
ATOM   5597 C CA  . ILE D 2 53  ? 86.920  8.585   78.737 1.00 43.76  ? 53  ILE D CA  1 
ATOM   5598 C C   . ILE D 2 53  ? 85.581  8.470   78.017 1.00 39.14  ? 53  ILE D C   1 
ATOM   5599 O O   . ILE D 2 53  ? 84.901  7.422   78.078 1.00 37.76  ? 53  ILE D O   1 
ATOM   5600 C CB  . ILE D 2 53  ? 88.096  7.932   77.891 1.00 47.19  ? 53  ILE D CB  1 
ATOM   5601 C CG1 . ILE D 2 53  ? 89.452  8.485   78.312 1.00 50.45  ? 53  ILE D CG1 1 
ATOM   5602 C CG2 . ILE D 2 53  ? 87.932  8.161   76.384 1.00 43.55  ? 53  ILE D CG2 1 
ATOM   5603 C CD1 . ILE D 2 53  ? 90.611  7.606   77.887 1.00 55.48  ? 53  ILE D CD1 1 
ATOM   5604 N N   . PHE D 2 54  ? 85.238  9.554   77.323 1.00 36.30  ? 54  PHE D N   1 
ATOM   5605 C CA  . PHE D 2 54  ? 83.921  9.759   76.811 1.00 32.89  ? 54  PHE D CA  1 
ATOM   5606 C C   . PHE D 2 54  ? 83.961  9.946   75.305 1.00 33.06  ? 54  PHE D C   1 
ATOM   5607 O O   . PHE D 2 54  ? 84.545  10.918  74.769 1.00 35.11  ? 54  PHE D O   1 
ATOM   5608 C CB  . PHE D 2 54  ? 83.325  11.003  77.452 1.00 32.01  ? 54  PHE D CB  1 
ATOM   5609 C CG  . PHE D 2 54  ? 82.936  10.840  78.883 1.00 32.91  ? 54  PHE D CG  1 
ATOM   5610 C CD1 . PHE D 2 54  ? 83.883  10.842  79.889 1.00 35.79  ? 54  PHE D CD1 1 
ATOM   5611 C CD2 . PHE D 2 54  ? 81.600  10.728  79.249 1.00 33.58  ? 54  PHE D CD2 1 
ATOM   5612 C CE1 . PHE D 2 54  ? 83.501  10.704  81.220 1.00 33.73  ? 54  PHE D CE1 1 
ATOM   5613 C CE2 . PHE D 2 54  ? 81.213  10.599  80.635 1.00 30.84  ? 54  PHE D CE2 1 
ATOM   5614 C CZ  . PHE D 2 54  ? 82.154  10.588  81.572 1.00 32.22  ? 54  PHE D CZ  1 
ATOM   5615 N N   . LEU D 2 55  ? 83.315  9.050   74.599 1.00 31.68  ? 55  LEU D N   1 
ATOM   5616 C CA  . LEU D 2 55  ? 83.318  9.161   73.160 1.00 33.72  ? 55  LEU D CA  1 
ATOM   5617 C C   . LEU D 2 55  ? 81.897  9.345   72.694 1.00 32.08  ? 55  LEU D C   1 
ATOM   5618 O O   . LEU D 2 55  ? 80.933  8.965   73.399 1.00 30.47  ? 55  LEU D O   1 
ATOM   5619 C CB  . LEU D 2 55  ? 83.927  7.907   72.494 1.00 36.15  ? 55  LEU D CB  1 
ATOM   5620 C CG  . LEU D 2 55  ? 85.248  7.430   73.120 1.00 39.00  ? 55  LEU D CG  1 
ATOM   5621 C CD1 . LEU D 2 55  ? 85.861  6.195   72.443 1.00 37.27  ? 55  LEU D CD1 1 
ATOM   5622 C CD2 . LEU D 2 55  ? 86.194  8.650   73.096 1.00 41.27  ? 55  LEU D CD2 1 
ATOM   5623 N N   . GLU D 2 56  ? 81.763  9.968   71.528 1.00 32.82  ? 56  GLU D N   1 
ATOM   5624 C CA  . GLU D 2 56  ? 80.503  9.954   70.840 1.00 32.21  ? 56  GLU D CA  1 
ATOM   5625 C C   . GLU D 2 56  ? 80.679  9.366   69.428 1.00 34.22  ? 56  GLU D C   1 
ATOM   5626 O O   . GLU D 2 56  ? 81.742  9.593   68.745 1.00 37.14  ? 56  GLU D O   1 
ATOM   5627 C CB  . GLU D 2 56  ? 79.949  11.331  70.739 1.00 31.35  ? 56  GLU D CB  1 
ATOM   5628 C CG  . GLU D 2 56  ? 78.471  11.277  70.523 1.00 35.81  ? 56  GLU D CG  1 
ATOM   5629 C CD  . GLU D 2 56  ? 77.937  12.453  69.746 1.00 42.34  ? 56  GLU D CD  1 
ATOM   5630 O OE1 . GLU D 2 56  ? 77.354  13.383  70.351 1.00 45.20  ? 56  GLU D OE1 1 
ATOM   5631 O OE2 . GLU D 2 56  ? 78.107  12.444  68.521 1.00 48.89  ? 56  GLU D OE2 1 
ATOM   5632 N N   . VAL D 2 57  ? 79.655  8.615   69.000 1.00 31.44  ? 57  VAL D N   1 
ATOM   5633 C CA  . VAL D 2 57  ? 79.611  8.097   67.661 1.00 32.53  ? 57  VAL D CA  1 
ATOM   5634 C C   . VAL D 2 57  ? 78.285  8.404   66.965 1.00 33.05  ? 57  VAL D C   1 
ATOM   5635 O O   . VAL D 2 57  ? 77.221  8.004   67.417 1.00 31.26  ? 57  VAL D O   1 
ATOM   5636 C CB  . VAL D 2 57  ? 79.828  6.581   67.642 1.00 33.15  ? 57  VAL D CB  1 
ATOM   5637 C CG1 . VAL D 2 57  ? 79.586  6.048   66.269 1.00 33.46  ? 57  VAL D CG1 1 
ATOM   5638 C CG2 . VAL D 2 57  ? 81.202  6.232   68.130 1.00 32.02  ? 57  VAL D CG2 1 
ATOM   5639 N N   . ASP D 2 58  ? 78.361  9.071   65.824 1.00 35.72  ? 58  ASP D N   1 
ATOM   5640 C CA  . ASP D 2 58  ? 77.181  9.242   65.027 1.00 37.22  ? 58  ASP D CA  1 
ATOM   5641 C C   . ASP D 2 58  ? 76.906  8.007   64.205 1.00 39.54  ? 58  ASP D C   1 
ATOM   5642 O O   . ASP D 2 58  ? 77.706  7.636   63.330 1.00 42.82  ? 58  ASP D O   1 
ATOM   5643 C CB  . ASP D 2 58  ? 77.307  10.437  64.128 1.00 39.26  ? 58  ASP D CB  1 
ATOM   5644 C CG  . ASP D 2 58  ? 75.966  10.912  63.643 1.00 41.87  ? 58  ASP D CG  1 
ATOM   5645 O OD1 . ASP D 2 58  ? 75.441  10.319  62.695 1.00 47.70  ? 58  ASP D OD1 1 
ATOM   5646 O OD2 . ASP D 2 58  ? 75.423  11.881  64.220 1.00 43.92  ? 58  ASP D OD2 1 
ATOM   5647 N N   . VAL D 2 59  ? 75.776  7.365   64.496 1.00 38.41  ? 59  VAL D N   1 
ATOM   5648 C CA  . VAL D 2 59  ? 75.404  6.138   63.782 1.00 39.87  ? 59  VAL D CA  1 
ATOM   5649 C C   . VAL D 2 59  ? 75.170  6.415   62.312 1.00 44.35  ? 59  VAL D C   1 
ATOM   5650 O O   . VAL D 2 59  ? 75.222  5.479   61.511 1.00 48.57  ? 59  VAL D O   1 
ATOM   5651 C CB  . VAL D 2 59  ? 74.150  5.450   64.383 1.00 38.59  ? 59  VAL D CB  1 
ATOM   5652 C CG1 . VAL D 2 59  ? 74.380  5.191   65.846 1.00 33.69  ? 59  VAL D CG1 1 
ATOM   5653 C CG2 . VAL D 2 59  ? 72.859  6.317   64.179 1.00 36.72  ? 59  VAL D CG2 1 
ATOM   5654 N N   . ASP D 2 60  ? 74.887  7.668   61.938 1.00 44.30  ? 60  ASP D N   1 
ATOM   5655 C CA  . ASP D 2 60  ? 74.704  7.953   60.514 1.00 49.34  ? 60  ASP D CA  1 
ATOM   5656 C C   . ASP D 2 60  ? 76.048  8.190   59.851 1.00 52.91  ? 60  ASP D C   1 
ATOM   5657 O O   . ASP D 2 60  ? 76.281  7.731   58.721 1.00 58.05  ? 60  ASP D O   1 
ATOM   5658 C CB  . ASP D 2 60  ? 73.659  9.009   60.223 1.00 49.02  ? 60  ASP D CB  1 
ATOM   5659 C CG  . ASP D 2 60  ? 72.246  8.536   60.581 1.00 50.22  ? 60  ASP D CG  1 
ATOM   5660 O OD1 . ASP D 2 60  ? 71.433  9.287   61.133 1.00 48.96  ? 60  ASP D OD1 1 
ATOM   5661 O OD2 . ASP D 2 60  ? 71.915  7.374   60.336 1.00 55.44  ? 60  ASP D OD2 1 
ATOM   5662 N N   . ASP D 2 61  ? 76.962  8.836   60.563 1.00 51.44  ? 61  ASP D N   1 
ATOM   5663 C CA  . ASP D 2 61  ? 78.277  9.053   60.000 1.00 55.86  ? 61  ASP D CA  1 
ATOM   5664 C C   . ASP D 2 61  ? 79.061  7.750   59.922 1.00 58.64  ? 61  ASP D C   1 
ATOM   5665 O O   . ASP D 2 61  ? 79.621  7.412   58.863 1.00 64.07  ? 61  ASP D O   1 
ATOM   5666 C CB  . ASP D 2 61  ? 79.035  10.124  60.770 1.00 53.69  ? 61  ASP D CB  1 
ATOM   5667 C CG  . ASP D 2 61  ? 78.313  11.461  60.763 1.00 53.09  ? 61  ASP D CG  1 
ATOM   5668 O OD1 . ASP D 2 61  ? 77.468  11.723  59.867 1.00 55.48  ? 61  ASP D OD1 1 
ATOM   5669 O OD2 . ASP D 2 61  ? 78.611  12.258  61.666 1.00 48.32  ? 61  ASP D OD2 1 
ATOM   5670 N N   . CYS D 2 62  ? 79.063  6.994   61.013 1.00 56.23  ? 62  CYS D N   1 
ATOM   5671 C CA  . CYS D 2 62  ? 79.756  5.733   61.025 1.00 59.28  ? 62  CYS D CA  1 
ATOM   5672 C C   . CYS D 2 62  ? 78.842  4.567   61.187 1.00 58.69  ? 62  CYS D C   1 
ATOM   5673 O O   . CYS D 2 62  ? 78.886  3.917   62.216 1.00 56.47  ? 62  CYS D O   1 
ATOM   5674 C CB  . CYS D 2 62  ? 80.703  5.722   62.211 1.00 57.56  ? 62  CYS D CB  1 
ATOM   5675 S SG  . CYS D 2 62  ? 81.637  7.235   62.260 1.00 64.12  ? 62  CYS D SG  1 
ATOM   5676 N N   . GLN D 2 63  ? 78.023  4.240   60.205 1.00 61.95  ? 63  GLN D N   1 
ATOM   5677 C CA  . GLN D 2 63  ? 77.216  3.047   60.413 1.00 62.87  ? 63  GLN D CA  1 
ATOM   5678 C C   . GLN D 2 63  ? 78.058  1.805   60.632 1.00 63.80  ? 63  GLN D C   1 
ATOM   5679 O O   . GLN D 2 63  ? 77.553  0.787   61.071 1.00 63.94  ? 63  GLN D O   1 
ATOM   5680 C CB  . GLN D 2 63  ? 76.225  2.794   59.299 1.00 66.68  ? 63  GLN D CB  1 
ATOM   5681 C CG  . GLN D 2 63  ? 75.410  3.979   58.938 1.00 70.81  ? 63  GLN D CG  1 
ATOM   5682 C CD  . GLN D 2 63  ? 75.780  4.552   57.567 1.00 80.62  ? 63  GLN D CD  1 
ATOM   5683 O OE1 . GLN D 2 63  ? 74.908  4.672   56.665 1.00 80.59  ? 63  GLN D OE1 1 
ATOM   5684 N NE2 . GLN D 2 63  ? 77.086  4.926   57.401 1.00 83.04  ? 63  GLN D NE2 1 
ATOM   5685 N N   . ASP D 2 64  ? 79.338  1.865   60.323 1.00 66.14  ? 64  ASP D N   1 
ATOM   5686 C CA  . ASP D 2 64  ? 80.133  0.625   60.395 1.00 69.50  ? 64  ASP D CA  1 
ATOM   5687 C C   . ASP D 2 64  ? 80.567  0.333   61.807 1.00 65.41  ? 64  ASP D C   1 
ATOM   5688 O O   . ASP D 2 64  ? 80.475  -0.830  62.252 1.00 66.41  ? 64  ASP D O   1 
ATOM   5689 C CB  . ASP D 2 64  ? 81.280  0.535   59.369 1.00 74.67  ? 64  ASP D CB  1 
ATOM   5690 C CG  . ASP D 2 64  ? 82.071  1.807   59.258 1.00 75.49  ? 64  ASP D CG  1 
ATOM   5691 O OD1 . ASP D 2 64  ? 81.601  2.866   59.757 1.00 71.78  ? 64  ASP D OD1 1 
ATOM   5692 O OD2 . ASP D 2 64  ? 83.186  1.736   58.669 1.00 80.39  ? 64  ASP D OD2 1 
ATOM   5693 N N   . VAL D 2 65  ? 80.959  1.396   62.525 1.00 61.24  ? 65  VAL D N   1 
ATOM   5694 C CA  . VAL D 2 65  ? 81.217  1.309   63.968 1.00 56.88  ? 65  VAL D CA  1 
ATOM   5695 C C   . VAL D 2 65  ? 79.905  0.858   64.594 1.00 53.52  ? 65  VAL D C   1 
ATOM   5696 O O   . VAL D 2 65  ? 79.865  -0.158  65.297 1.00 54.02  ? 65  VAL D O   1 
ATOM   5697 C CB  . VAL D 2 65  ? 81.729  2.638   64.556 1.00 53.90  ? 65  VAL D CB  1 
ATOM   5698 C CG1 . VAL D 2 65  ? 81.872  2.552   66.072 1.00 51.97  ? 65  VAL D CG1 1 
ATOM   5699 C CG2 . VAL D 2 65  ? 83.064  2.985   63.977 1.00 58.47  ? 65  VAL D CG2 1 
ATOM   5700 N N   . ALA D 2 66  ? 78.836  1.579   64.263 1.00 50.91  ? 66  ALA D N   1 
ATOM   5701 C CA  . ALA D 2 66  ? 77.461  1.248   64.664 1.00 49.11  ? 66  ALA D CA  1 
ATOM   5702 C C   . ALA D 2 66  ? 77.038  -0.236  64.568 1.00 51.76  ? 66  ALA D C   1 
ATOM   5703 O O   . ALA D 2 66  ? 76.461  -0.800  65.505 1.00 50.72  ? 66  ALA D O   1 
ATOM   5704 C CB  . ALA D 2 66  ? 76.482  2.120   63.900 1.00 48.64  ? 66  ALA D CB  1 
ATOM   5705 N N   . SER D 2 67  ? 77.314  -0.889  63.456 1.00 56.05  ? 67  SER D N   1 
ATOM   5706 C CA  . SER D 2 67  ? 76.835  -2.248  63.340 1.00 59.85  ? 67  SER D CA  1 
ATOM   5707 C C   . SER D 2 67  ? 77.869  -3.244  63.825 1.00 62.04  ? 67  SER D C   1 
ATOM   5708 O O   . SER D 2 67  ? 77.552  -4.428  64.105 1.00 64.63  ? 67  SER D O   1 
ATOM   5709 C CB  . SER D 2 67  ? 76.464  -2.563  61.900 1.00 64.65  ? 67  SER D CB  1 
ATOM   5710 O OG  . SER D 2 67  ? 77.647  -2.429  61.170 1.00 67.75  ? 67  SER D OG  1 
ATOM   5711 N N   . GLU D 2 68  ? 79.114  -2.803  63.889 1.00 61.16  ? 68  GLU D N   1 
ATOM   5712 C CA  . GLU D 2 68  ? 80.085  -3.700  64.409 1.00 63.96  ? 68  GLU D CA  1 
ATOM   5713 C C   . GLU D 2 68  ? 79.823  -3.807  65.896 1.00 60.00  ? 68  GLU D C   1 
ATOM   5714 O O   . GLU D 2 68  ? 79.937  -4.888  66.483 1.00 62.26  ? 68  GLU D O   1 
ATOM   5715 C CB  . GLU D 2 68  ? 81.459  -3.171  64.132 1.00 66.31  ? 68  GLU D CB  1 
ATOM   5716 C CG  . GLU D 2 68  ? 82.552  -4.223  64.103 1.00 74.18  ? 68  GLU D CG  1 
ATOM   5717 C CD  . GLU D 2 68  ? 83.703  -3.756  63.242 1.00 82.57  ? 68  GLU D CD  1 
ATOM   5718 O OE1 . GLU D 2 68  ? 83.448  -3.668  62.003 1.00 88.13  ? 68  GLU D OE1 1 
ATOM   5719 O OE2 . GLU D 2 68  ? 84.823  -3.463  63.797 1.00 83.09  ? 68  GLU D OE2 1 
ATOM   5720 N N   . CYS D 2 69  ? 79.420  -2.683  66.486 1.00 54.26  ? 69  CYS D N   1 
ATOM   5721 C CA  . CYS D 2 69  ? 78.966  -2.650  67.848 1.00 49.90  ? 69  CYS D CA  1 
ATOM   5722 C C   . CYS D 2 69  ? 77.521  -3.074  68.053 1.00 49.11  ? 69  CYS D C   1 
ATOM   5723 O O   . CYS D 2 69  ? 77.044  -3.143  69.186 1.00 47.46  ? 69  CYS D O   1 
ATOM   5724 C CB  . CYS D 2 69  ? 79.156  -1.263  68.362 1.00 46.25  ? 69  CYS D CB  1 
ATOM   5725 S SG  . CYS D 2 69  ? 80.897  -0.770  68.434 1.00 49.50  ? 69  CYS D SG  1 
ATOM   5726 N N   . GLU D 2 70  ? 76.792  -3.352  66.985 1.00 51.28  ? 70  GLU D N   1 
ATOM   5727 C CA  . GLU D 2 70  ? 75.419  -3.886  67.145 1.00 52.40  ? 70  GLU D CA  1 
ATOM   5728 C C   . GLU D 2 70  ? 74.430  -2.868  67.762 1.00 47.48  ? 70  GLU D C   1 
ATOM   5729 O O   . GLU D 2 70  ? 73.419  -3.229  68.365 1.00 47.64  ? 70  GLU D O   1 
ATOM   5730 C CB  . GLU D 2 70  ? 75.389  -5.226  67.928 1.00 55.26  ? 70  GLU D CB  1 
ATOM   5731 C CG  . GLU D 2 70  ? 76.094  -6.402  67.232 1.00 62.21  ? 70  GLU D CG  1 
ATOM   5732 C CD  . GLU D 2 70  ? 75.864  -7.748  67.960 1.00 67.59  ? 70  GLU D CD  1 
ATOM   5733 O OE1 . GLU D 2 70  ? 76.416  -7.945  69.068 1.00 65.68  ? 70  GLU D OE1 1 
ATOM   5734 O OE2 . GLU D 2 70  ? 75.121  -8.602  67.421 1.00 72.43  ? 70  GLU D OE2 1 
ATOM   5735 N N   . VAL D 2 71  ? 74.696  -1.594  67.552 1.00 43.46  ? 71  VAL D N   1 
ATOM   5736 C CA  . VAL D 2 71  ? 73.760  -0.591  67.982 1.00 39.83  ? 71  VAL D CA  1 
ATOM   5737 C C   . VAL D 2 71  ? 72.444  -0.736  67.223 1.00 41.67  ? 71  VAL D C   1 
ATOM   5738 O O   . VAL D 2 71  ? 72.439  -0.949  66.017 1.00 44.29  ? 71  VAL D O   1 
ATOM   5739 C CB  . VAL D 2 71  ? 74.380  0.773   67.856 1.00 36.53  ? 71  VAL D CB  1 
ATOM   5740 C CG1 . VAL D 2 71  ? 73.449  1.841   68.317 1.00 33.11  ? 71  VAL D CG1 1 
ATOM   5741 C CG2 . VAL D 2 71  ? 75.572  0.781   68.740 1.00 36.67  ? 71  VAL D CG2 1 
ATOM   5742 N N   . LYS D 2 72  ? 71.335  -0.671  67.943 1.00 40.94  ? 72  LYS D N   1 
ATOM   5743 C CA  . LYS D 2 72  ? 70.036  -0.846  67.292 1.00 44.65  ? 72  LYS D CA  1 
ATOM   5744 C C   . LYS D 2 72  ? 69.101  0.348   67.390 1.00 42.54  ? 72  LYS D C   1 
ATOM   5745 O O   . LYS D 2 72  ? 68.194  0.515   66.567 1.00 45.68  ? 72  LYS D O   1 
ATOM   5746 C CB  . LYS D 2 72  ? 69.351  -2.148  67.745 1.00 47.81  ? 72  LYS D CB  1 
ATOM   5747 C CG  . LYS D 2 72  ? 69.937  -3.351  67.024 1.00 53.42  ? 72  LYS D CG  1 
ATOM   5748 C CD  . LYS D 2 72  ? 69.954  -4.606  67.861 1.00 58.42  ? 72  LYS D CD  1 
ATOM   5749 C CE  . LYS D 2 72  ? 70.158  -5.780  66.902 1.00 65.11  ? 72  LYS D CE  1 
ATOM   5750 N NZ  . LYS D 2 72  ? 70.461  -7.006  67.655 1.00 70.40  ? 72  LYS D NZ  1 
ATOM   5751 N N   . CYS D 2 73  ? 69.324  1.168   68.394 1.00 37.66  ? 73  CYS D N   1 
ATOM   5752 C CA  . CYS D 2 73  ? 68.547  2.336   68.559 1.00 36.25  ? 73  CYS D CA  1 
ATOM   5753 C C   . CYS D 2 73  ? 69.444  3.319   69.218 1.00 32.56  ? 73  CYS D C   1 
ATOM   5754 O O   . CYS D 2 73  ? 70.560  2.991   69.616 1.00 30.59  ? 73  CYS D O   1 
ATOM   5755 C CB  . CYS D 2 73  ? 67.388  2.060   69.466 1.00 36.85  ? 73  CYS D CB  1 
ATOM   5756 S SG  . CYS D 2 73  ? 67.937  1.464   71.013 1.00 38.36  ? 73  CYS D SG  1 
ATOM   5757 N N   . MET D 2 74  ? 68.948  4.532   69.331 1.00 31.42  ? 74  MET D N   1 
ATOM   5758 C CA  . MET D 2 74  ? 69.708  5.585   69.961 1.00 29.43  ? 74  MET D CA  1 
ATOM   5759 C C   . MET D 2 74  ? 68.810  6.353   70.957 1.00 28.04  ? 74  MET D C   1 
ATOM   5760 O O   . MET D 2 74  ? 67.586  6.430   70.754 1.00 29.85  ? 74  MET D O   1 
ATOM   5761 C CB  . MET D 2 74  ? 70.290  6.547   68.893 1.00 30.24  ? 74  MET D CB  1 
ATOM   5762 C CG  . MET D 2 74  ? 71.246  5.901   67.867 1.00 33.39  ? 74  MET D CG  1 
ATOM   5763 S SD  . MET D 2 74  ? 70.493  4.839   66.572 1.00 42.38  ? 74  MET D SD  1 
ATOM   5764 C CE  . MET D 2 74  ? 69.711  6.035   65.493 1.00 35.94  ? 74  MET D CE  1 
ATOM   5765 N N   . PRO D 2 75  ? 69.421  6.948   72.003 1.00 25.07  ? 75  PRO D N   1 
ATOM   5766 C CA  . PRO D 2 75  ? 70.845  6.754   72.298 1.00 23.09  ? 75  PRO D CA  1 
ATOM   5767 C C   . PRO D 2 75  ? 71.079  5.384   72.912 1.00 22.84  ? 75  PRO D C   1 
ATOM   5768 O O   . PRO D 2 75  ? 70.300  4.995   73.780 1.00 22.83  ? 75  PRO D O   1 
ATOM   5769 C CB  . PRO D 2 75  ? 71.137  7.812   73.380 1.00 21.57  ? 75  PRO D CB  1 
ATOM   5770 C CG  . PRO D 2 75  ? 69.867  7.993   74.095 1.00 23.12  ? 75  PRO D CG  1 
ATOM   5771 C CD  . PRO D 2 75  ? 68.798  7.904   72.937 1.00 24.86  ? 75  PRO D CD  1 
ATOM   5772 N N   . THR D 2 76  ? 72.150  4.701   72.485 1.00 22.66  ? 76  THR D N   1 
ATOM   5773 C CA  . THR D 2 76  ? 72.684  3.523   73.165 1.00 23.66  ? 76  THR D CA  1 
ATOM   5774 C C   . THR D 2 76  ? 74.099  3.796   73.717 1.00 23.44  ? 76  THR D C   1 
ATOM   5775 O O   . THR D 2 76  ? 74.953  4.343   73.015 1.00 22.63  ? 76  THR D O   1 
ATOM   5776 C CB  . THR D 2 76  ? 72.668  2.260   72.218 1.00 26.39  ? 76  THR D CB  1 
ATOM   5777 O OG1 . THR D 2 76  ? 71.324  1.773   72.081 1.00 26.87  ? 76  THR D OG1 1 
ATOM   5778 C CG2 . THR D 2 76  ? 73.564  1.112   72.751 1.00 26.30  ? 76  THR D CG2 1 
ATOM   5779 N N   . PHE D 2 77  ? 74.348  3.353   74.955 1.00 24.15  ? 77  PHE D N   1 
ATOM   5780 C CA  . PHE D 2 77  ? 75.598  3.621   75.669 1.00 24.06  ? 77  PHE D CA  1 
ATOM   5781 C C   . PHE D 2 77  ? 76.368  2.361   75.930 1.00 27.63  ? 77  PHE D C   1 
ATOM   5782 O O   . PHE D 2 77  ? 75.815  1.428   76.516 1.00 29.33  ? 77  PHE D O   1 
ATOM   5783 C CB  . PHE D 2 77  ? 75.291  4.267   77.016 1.00 23.16  ? 77  PHE D CB  1 
ATOM   5784 C CG  . PHE D 2 77  ? 74.780  5.611   76.885 1.00 21.00  ? 77  PHE D CG  1 
ATOM   5785 C CD1 . PHE D 2 77  ? 75.640  6.659   76.670 1.00 17.95  ? 77  PHE D CD1 1 
ATOM   5786 C CD2 . PHE D 2 77  ? 73.414  5.838   76.857 1.00 23.26  ? 77  PHE D CD2 1 
ATOM   5787 C CE1 . PHE D 2 77  ? 75.149  7.942   76.495 1.00 20.44  ? 77  PHE D CE1 1 
ATOM   5788 C CE2 . PHE D 2 77  ? 72.915  7.169   76.660 1.00 23.44  ? 77  PHE D CE2 1 
ATOM   5789 C CZ  . PHE D 2 77  ? 73.780  8.202   76.472 1.00 17.27  ? 77  PHE D CZ  1 
ATOM   5790 N N   . GLN D 2 78  ? 77.629  2.324   75.508 1.00 28.79  ? 78  GLN D N   1 
ATOM   5791 C CA  . GLN D 2 78  ? 78.397  1.133   75.689 1.00 33.45  ? 78  GLN D CA  1 
ATOM   5792 C C   . GLN D 2 78  ? 79.647  1.487   76.447 1.00 35.91  ? 78  GLN D C   1 
ATOM   5793 O O   . GLN D 2 78  ? 80.155  2.636   76.331 1.00 34.71  ? 78  GLN D O   1 
ATOM   5794 C CB  . GLN D 2 78  ? 78.759  0.509   74.359 1.00 35.15  ? 78  GLN D CB  1 
ATOM   5795 C CG  . GLN D 2 78  ? 77.575  0.029   73.632 1.00 36.72  ? 78  GLN D CG  1 
ATOM   5796 C CD  . GLN D 2 78  ? 77.896  -0.859  72.469 1.00 39.36  ? 78  GLN D CD  1 
ATOM   5797 O OE1 . GLN D 2 78  ? 78.977  -0.796  71.875 1.00 40.59  ? 78  GLN D OE1 1 
ATOM   5798 N NE2 . GLN D 2 78  ? 76.933  -1.689  72.118 1.00 37.37  ? 78  GLN D NE2 1 
ATOM   5799 N N   . PHE D 2 79  ? 80.141  0.492   77.192 1.00 39.09  ? 79  PHE D N   1 
ATOM   5800 C CA  . PHE D 2 79  ? 81.132  0.710   78.225 1.00 41.66  ? 79  PHE D CA  1 
ATOM   5801 C C   . PHE D 2 79  ? 82.260  -0.218  78.042 1.00 46.46  ? 79  PHE D C   1 
ATOM   5802 O O   . PHE D 2 79  ? 82.082  -1.439  77.967 1.00 49.73  ? 79  PHE D O   1 
ATOM   5803 C CB  . PHE D 2 79  ? 80.521  0.394   79.552 1.00 42.55  ? 79  PHE D CB  1 
ATOM   5804 C CG  . PHE D 2 79  ? 79.539  1.376   79.956 1.00 40.30  ? 79  PHE D CG  1 
ATOM   5805 C CD1 . PHE D 2 79  ? 78.233  1.253   79.564 1.00 40.14  ? 79  PHE D CD1 1 
ATOM   5806 C CD2 . PHE D 2 79  ? 79.925  2.490   80.670 1.00 38.06  ? 79  PHE D CD2 1 
ATOM   5807 C CE1 . PHE D 2 79  ? 77.313  2.245   79.937 1.00 40.80  ? 79  PHE D CE1 1 
ATOM   5808 C CE2 . PHE D 2 79  ? 79.011  3.459   81.059 1.00 36.54  ? 79  PHE D CE2 1 
ATOM   5809 C CZ  . PHE D 2 79  ? 77.722  3.366   80.678 1.00 34.97  ? 79  PHE D CZ  1 
ATOM   5810 N N   . PHE D 2 80  ? 83.447  0.335   77.981 1.00 48.44  ? 80  PHE D N   1 
ATOM   5811 C CA  . PHE D 2 80  ? 84.581  -0.497  77.664 1.00 53.14  ? 80  PHE D CA  1 
ATOM   5812 C C   . PHE D 2 80  ? 85.724  -0.396  78.668 1.00 57.93  ? 80  PHE D C   1 
ATOM   5813 O O   . PHE D 2 80  ? 85.707  0.445   79.573 1.00 57.93  ? 80  PHE D O   1 
ATOM   5814 C CB  . PHE D 2 80  ? 85.084  -0.123  76.302 1.00 52.41  ? 80  PHE D CB  1 
ATOM   5815 C CG  . PHE D 2 80  ? 84.134  -0.398  75.199 1.00 48.17  ? 80  PHE D CG  1 
ATOM   5816 C CD1 . PHE D 2 80  ? 83.174  0.544   74.846 1.00 42.18  ? 80  PHE D CD1 1 
ATOM   5817 C CD2 . PHE D 2 80  ? 84.241  -1.582  74.455 1.00 49.91  ? 80  PHE D CD2 1 
ATOM   5818 C CE1 . PHE D 2 80  ? 82.317  0.305   73.762 1.00 41.13  ? 80  PHE D CE1 1 
ATOM   5819 C CE2 . PHE D 2 80  ? 83.388  -1.842  73.386 1.00 45.43  ? 80  PHE D CE2 1 
ATOM   5820 C CZ  . PHE D 2 80  ? 82.425  -0.885  73.030 1.00 42.33  ? 80  PHE D CZ  1 
ATOM   5821 N N   . LYS D 2 81  ? 86.705  -1.281  78.483 1.00 64.21  ? 81  LYS D N   1 
ATOM   5822 C CA  . LYS D 2 81  ? 87.858  -1.530  79.376 1.00 69.91  ? 81  LYS D CA  1 
ATOM   5823 C C   . LYS D 2 81  ? 88.778  -2.469  78.609 1.00 74.88  ? 81  LYS D C   1 
ATOM   5824 O O   . LYS D 2 81  ? 88.368  -3.581  78.240 1.00 76.08  ? 81  LYS D O   1 
ATOM   5825 C CB  . LYS D 2 81  ? 87.439  -2.216  80.681 1.00 71.75  ? 81  LYS D CB  1 
ATOM   5826 C CG  . LYS D 2 81  ? 87.411  -1.301  81.892 1.00 72.64  ? 81  LYS D CG  1 
ATOM   5827 C CD  . LYS D 2 81  ? 86.857  -1.996  83.182 1.00 76.97  ? 81  LYS D CD  1 
ATOM   5828 C CE  . LYS D 2 81  ? 86.763  -0.972  84.348 1.00 77.23  ? 81  LYS D CE  1 
ATOM   5829 N NZ  . LYS D 2 81  ? 88.157  -0.573  84.862 1.00 81.86  ? 81  LYS D NZ  1 
ATOM   5830 N N   . LYS D 2 82  ? 90.002  -2.006  78.336 1.00 78.33  ? 82  LYS D N   1 
ATOM   5831 C CA  . LYS D 2 82  ? 91.013  -2.855  77.725 1.00 84.02  ? 82  LYS D CA  1 
ATOM   5832 C C   . LYS D 2 82  ? 90.552  -3.435  76.369 1.00 83.71  ? 82  LYS D C   1 
ATOM   5833 O O   . LYS D 2 82  ? 90.937  -4.545  75.992 1.00 88.65  ? 82  LYS D O   1 
ATOM   5834 C CB  . LYS D 2 82  ? 91.346  -3.973  78.717 1.00 89.25  ? 82  LYS D CB  1 
ATOM   5835 C CG  . LYS D 2 82  ? 92.369  -3.608  79.807 1.00 92.09  ? 82  LYS D CG  1 
ATOM   5836 C CD  . LYS D 2 82  ? 93.679  -4.401  79.606 1.00 96.99  ? 82  LYS D CD  1 
ATOM   5837 C CE  . LYS D 2 82  ? 93.384  -5.868  79.183 1.00 98.80  ? 82  LYS D CE  1 
ATOM   5838 N NZ  . LYS D 2 82  ? 94.366  -6.859  79.716 1.00 106.74 ? 82  LYS D NZ  1 
ATOM   5839 N N   . GLY D 2 83  ? 89.713  -2.677  75.654 1.00 79.01  ? 83  GLY D N   1 
ATOM   5840 C CA  . GLY D 2 83  ? 89.190  -3.068  74.327 1.00 78.68  ? 83  GLY D CA  1 
ATOM   5841 C C   . GLY D 2 83  ? 87.875  -3.845  74.334 1.00 76.76  ? 83  GLY D C   1 
ATOM   5842 O O   . GLY D 2 83  ? 87.357  -4.211  73.269 1.00 76.31  ? 83  GLY D O   1 
ATOM   5843 N N   . GLN D 2 84  ? 87.319  -4.041  75.532 1.00 75.78  ? 84  GLN D N   1 
ATOM   5844 C CA  . GLN D 2 84  ? 86.322  -5.079  75.806 1.00 76.39  ? 84  GLN D CA  1 
ATOM   5845 C C   . GLN D 2 84  ? 85.076  -4.561  76.533 1.00 71.18  ? 84  GLN D C   1 
ATOM   5846 O O   . GLN D 2 84  ? 85.209  -3.866  77.552 1.00 70.33  ? 84  GLN D O   1 
ATOM   5847 C CB  . GLN D 2 84  ? 86.970  -6.108  76.705 1.00 82.07  ? 84  GLN D CB  1 
ATOM   5848 C CG  . GLN D 2 84  ? 88.000  -6.942  76.030 1.00 90.37  ? 84  GLN D CG  1 
ATOM   5849 C CD  . GLN D 2 84  ? 87.376  -8.208  75.468 1.00 96.41  ? 84  GLN D CD  1 
ATOM   5850 O OE1 . GLN D 2 84  ? 86.806  -8.196  74.372 1.00 94.93  ? 84  GLN D OE1 1 
ATOM   5851 N NE2 . GLN D 2 84  ? 87.460  -9.306  76.227 1.00 100.46 ? 84  GLN D NE2 1 
ATOM   5852 N N   . LYS D 2 85  ? 83.880  -4.942  76.057 1.00 68.22  ? 85  LYS D N   1 
ATOM   5853 C CA  . LYS D 2 85  ? 82.607  -4.391  76.586 1.00 62.74  ? 85  LYS D CA  1 
ATOM   5854 C C   . LYS D 2 85  ? 82.173  -4.955  77.917 1.00 63.59  ? 85  LYS D C   1 
ATOM   5855 O O   . LYS D 2 85  ? 82.017  -6.164  78.065 1.00 67.38  ? 85  LYS D O   1 
ATOM   5856 C CB  . LYS D 2 85  ? 81.460  -4.573  75.595 1.00 61.00  ? 85  LYS D CB  1 
ATOM   5857 C CG  . LYS D 2 85  ? 80.075  -4.547  76.241 1.00 58.25  ? 85  LYS D CG  1 
ATOM   5858 C CD  . LYS D 2 85  ? 79.023  -4.071  75.282 1.00 54.65  ? 85  LYS D CD  1 
ATOM   5859 C CE  . LYS D 2 85  ? 78.644  -5.165  74.312 1.00 60.24  ? 85  LYS D CE  1 
ATOM   5860 N NZ  . LYS D 2 85  ? 78.477  -4.524  72.934 1.00 61.61  ? 85  LYS D NZ  1 
ATOM   5861 N N   . VAL D 2 86  ? 81.932  -4.071  78.875 1.00 60.57  ? 86  VAL D N   1 
ATOM   5862 C CA  . VAL D 2 86  ? 81.552  -4.493  80.225 1.00 62.01  ? 86  VAL D CA  1 
ATOM   5863 C C   . VAL D 2 86  ? 80.173  -3.979  80.597 1.00 58.44  ? 86  VAL D C   1 
ATOM   5864 O O   . VAL D 2 86  ? 79.628  -4.270  81.679 1.00 60.81  ? 86  VAL D O   1 
ATOM   5865 C CB  . VAL D 2 86  ? 82.570  -4.030  81.269 1.00 63.60  ? 86  VAL D CB  1 
ATOM   5866 C CG1 . VAL D 2 86  ? 83.862  -4.823  81.140 1.00 68.88  ? 86  VAL D CG1 1 
ATOM   5867 C CG2 . VAL D 2 86  ? 82.853  -2.557  81.111 1.00 60.04  ? 86  VAL D CG2 1 
ATOM   5868 N N   . GLY D 2 87  ? 79.593  -3.222  79.694 1.00 53.67  ? 87  GLY D N   1 
ATOM   5869 C CA  . GLY D 2 87  ? 78.340  -2.595  80.008 1.00 50.76  ? 87  GLY D CA  1 
ATOM   5870 C C   . GLY D 2 87  ? 77.649  -2.097  78.770 1.00 47.20  ? 87  GLY D C   1 
ATOM   5871 O O   . GLY D 2 87  ? 78.292  -1.805  77.727 1.00 45.96  ? 87  GLY D O   1 
ATOM   5872 N N   . GLU D 2 88  ? 76.328  -1.994  78.911 1.00 45.53  ? 88  GLU D N   1 
ATOM   5873 C CA  . GLU D 2 88  ? 75.471  -1.496  77.857 1.00 42.71  ? 88  GLU D CA  1 
ATOM   5874 C C   . GLU D 2 88  ? 74.065  -1.297  78.299 1.00 40.44  ? 88  GLU D C   1 
ATOM   5875 O O   . GLU D 2 88  ? 73.513  -2.126  78.998 1.00 43.79  ? 88  GLU D O   1 
ATOM   5876 C CB  . GLU D 2 88  ? 75.423  -2.472  76.701 1.00 45.12  ? 88  GLU D CB  1 
ATOM   5877 C CG  . GLU D 2 88  ? 75.126  -1.764  75.406 1.00 47.34  ? 88  GLU D CG  1 
ATOM   5878 C CD  . GLU D 2 88  ? 74.986  -2.712  74.232 1.00 52.76  ? 88  GLU D CD  1 
ATOM   5879 O OE1 . GLU D 2 88  ? 75.475  -3.875  74.330 1.00 56.67  ? 88  GLU D OE1 1 
ATOM   5880 O OE2 . GLU D 2 88  ? 74.363  -2.291  73.224 1.00 51.77  ? 88  GLU D OE2 1 
ATOM   5881 N N   . PHE D 2 89  ? 73.464  -0.210  77.846 1.00 36.40  ? 89  PHE D N   1 
ATOM   5882 C CA  . PHE D 2 89  ? 72.032  -0.059  77.944 1.00 34.16  ? 89  PHE D CA  1 
ATOM   5883 C C   . PHE D 2 89  ? 71.635  0.978   76.988 1.00 30.35  ? 89  PHE D C   1 
ATOM   5884 O O   . PHE D 2 89  ? 72.500  1.668   76.445 1.00 27.93  ? 89  PHE D O   1 
ATOM   5885 C CB  . PHE D 2 89  ? 71.637  0.382   79.325 1.00 34.90  ? 89  PHE D CB  1 
ATOM   5886 C CG  . PHE D 2 89  ? 71.895  1.814   79.584 1.00 32.12  ? 89  PHE D CG  1 
ATOM   5887 C CD1 . PHE D 2 89  ? 70.955  2.792   79.178 1.00 29.08  ? 89  PHE D CD1 1 
ATOM   5888 C CD2 . PHE D 2 89  ? 73.059  2.198   80.232 1.00 29.03  ? 89  PHE D CD2 1 
ATOM   5889 C CE1 . PHE D 2 89  ? 71.186  4.102   79.424 1.00 27.25  ? 89  PHE D CE1 1 
ATOM   5890 C CE2 . PHE D 2 89  ? 73.314  3.531   80.499 1.00 27.54  ? 89  PHE D CE2 1 
ATOM   5891 C CZ  . PHE D 2 89  ? 72.386  4.489   80.120 1.00 28.55  ? 89  PHE D CZ  1 
ATOM   5892 N N   . SER D 2 90  ? 70.328  1.097   76.784 1.00 29.88  ? 90  SER D N   1 
ATOM   5893 C CA  . SER D 2 90  ? 69.825  2.083   75.840 1.00 28.90  ? 90  SER D CA  1 
ATOM   5894 C C   . SER D 2 90  ? 68.818  3.071   76.428 1.00 28.21  ? 90  SER D C   1 
ATOM   5895 O O   . SER D 2 90  ? 68.161  2.797   77.441 1.00 29.66  ? 90  SER D O   1 
ATOM   5896 C CB  . SER D 2 90  ? 69.277  1.388   74.606 1.00 30.74  ? 90  SER D CB  1 
ATOM   5897 O OG  . SER D 2 90  ? 70.150  0.339   74.238 1.00 34.24  ? 90  SER D OG  1 
ATOM   5898 N N   . GLY D 2 91  ? 68.735  4.243   75.816 1.00 26.53  ? 91  GLY D N   1 
ATOM   5899 C CA  . GLY D 2 91  ? 67.703  5.189   76.198 1.00 29.17  ? 91  GLY D CA  1 
ATOM   5900 C C   . GLY D 2 91  ? 68.195  6.435   76.855 1.00 28.96  ? 91  GLY D C   1 
ATOM   5901 O O   . GLY D 2 91  ? 69.226  6.435   77.507 1.00 27.77  ? 91  GLY D O   1 
ATOM   5902 N N   . ALA D 2 92  ? 67.471  7.528   76.673 1.00 31.29  ? 92  ALA D N   1 
ATOM   5903 C CA  . ALA D 2 92  ? 67.956  8.786   77.201 1.00 32.77  ? 92  ALA D CA  1 
ATOM   5904 C C   . ALA D 2 92  ? 67.679  8.886   78.709 1.00 36.07  ? 92  ALA D C   1 
ATOM   5905 O O   . ALA D 2 92  ? 66.704  9.538   79.122 1.00 40.43  ? 92  ALA D O   1 
ATOM   5906 C CB  . ALA D 2 92  ? 67.345  9.900   76.481 1.00 33.25  ? 92  ALA D CB  1 
ATOM   5907 N N   . ASN D 2 93  ? 68.540  8.272   79.531 1.00 35.91  ? 93  ASN D N   1 
ATOM   5908 C CA  . ASN D 2 93  ? 68.312  8.183   80.971 1.00 37.34  ? 93  ASN D CA  1 
ATOM   5909 C C   . ASN D 2 93  ? 69.506  8.624   81.848 1.00 37.11  ? 93  ASN D C   1 
ATOM   5910 O O   . ASN D 2 93  ? 70.332  7.803   82.235 1.00 36.62  ? 93  ASN D O   1 
ATOM   5911 C CB  . ASN D 2 93  ? 67.950  6.741   81.289 1.00 39.25  ? 93  ASN D CB  1 
ATOM   5912 C CG  . ASN D 2 93  ? 67.436  6.564   82.698 1.00 42.53  ? 93  ASN D CG  1 
ATOM   5913 O OD1 . ASN D 2 93  ? 67.736  7.335   83.604 1.00 46.94  ? 93  ASN D OD1 1 
ATOM   5914 N ND2 . ASN D 2 93  ? 66.655  5.547   82.886 1.00 43.61  ? 93  ASN D ND2 1 
ATOM   5915 N N   . LYS D 2 94  ? 69.565  9.914   82.182 1.00 38.24  ? 94  LYS D N   1 
ATOM   5916 C CA  . LYS D 2 94  ? 70.670  10.488  82.964 1.00 39.34  ? 94  LYS D CA  1 
ATOM   5917 C C   . LYS D 2 94  ? 71.019  9.618   84.155 1.00 40.58  ? 94  LYS D C   1 
ATOM   5918 O O   . LYS D 2 94  ? 72.186  9.261   84.356 1.00 41.52  ? 94  LYS D O   1 
ATOM   5919 C CB  . LYS D 2 94  ? 70.319  11.883  83.490 1.00 41.81  ? 94  LYS D CB  1 
ATOM   5920 C CG  . LYS D 2 94  ? 69.861  12.903  82.463 1.00 44.22  ? 94  LYS D CG  1 
ATOM   5921 C CD  . LYS D 2 94  ? 69.251  14.137  83.172 1.00 50.34  ? 94  LYS D CD  1 
ATOM   5922 C CE  . LYS D 2 94  ? 67.809  13.901  83.697 1.00 55.03  ? 94  LYS D CE  1 
ATOM   5923 N NZ  . LYS D 2 94  ? 67.455  14.912  84.744 1.00 57.61  ? 94  LYS D NZ  1 
ATOM   5924 N N   . GLU D 2 95  ? 70.008  9.290   84.949 1.00 41.67  ? 95  GLU D N   1 
ATOM   5925 C CA  . GLU D 2 95  ? 70.212  8.578   86.197 1.00 43.94  ? 95  GLU D CA  1 
ATOM   5926 C C   . GLU D 2 95  ? 70.851  7.242   85.916 1.00 41.46  ? 95  GLU D C   1 
ATOM   5927 O O   . GLU D 2 95  ? 71.867  6.925   86.496 1.00 42.93  ? 95  GLU D O   1 
ATOM   5928 C CB  . GLU D 2 95  ? 68.889  8.383   86.962 1.00 48.31  ? 95  GLU D CB  1 
ATOM   5929 C CG  . GLU D 2 95  ? 68.291  9.646   87.593 1.00 52.74  ? 95  GLU D CG  1 
ATOM   5930 C CD  . GLU D 2 95  ? 68.015  10.747  86.588 1.00 54.78  ? 95  GLU D CD  1 
ATOM   5931 O OE1 . GLU D 2 95  ? 67.885  10.479  85.373 1.00 54.55  ? 95  GLU D OE1 1 
ATOM   5932 O OE2 . GLU D 2 95  ? 67.930  11.909  87.004 1.00 59.38  ? 95  GLU D OE2 1 
ATOM   5933 N N   . LYS D 2 96  ? 70.286  6.478   84.990 1.00 38.64  ? 96  LYS D N   1 
ATOM   5934 C CA  . LYS D 2 96  ? 70.831  5.151   84.674 1.00 37.09  ? 96  LYS D CA  1 
ATOM   5935 C C   . LYS D 2 96  ? 72.276  5.211   84.204 1.00 33.88  ? 96  LYS D C   1 
ATOM   5936 O O   . LYS D 2 96  ? 73.117  4.372   84.614 1.00 34.05  ? 96  LYS D O   1 
ATOM   5937 C CB  . LYS D 2 96  ? 69.941  4.380   83.670 1.00 36.61  ? 96  LYS D CB  1 
ATOM   5938 C CG  . LYS D 2 96  ? 70.480  2.987   83.441 1.00 37.83  ? 96  LYS D CG  1 
ATOM   5939 C CD  . LYS D 2 96  ? 69.561  2.081   82.736 1.00 42.39  ? 96  LYS D CD  1 
ATOM   5940 C CE  . LYS D 2 96  ? 69.954  0.634   83.061 1.00 48.21  ? 96  LYS D CE  1 
ATOM   5941 N NZ  . LYS D 2 96  ? 69.106  -0.245  82.198 1.00 51.85  ? 96  LYS D NZ  1 
ATOM   5942 N N   . LEU D 2 97  ? 72.520  6.204   83.346 1.00 30.44  ? 97  LEU D N   1 
ATOM   5943 C CA  . LEU D 2 97  ? 73.838  6.604   82.866 1.00 29.54  ? 97  LEU D CA  1 
ATOM   5944 C C   . LEU D 2 97  ? 74.848  6.858   83.987 1.00 31.82  ? 97  LEU D C   1 
ATOM   5945 O O   . LEU D 2 97  ? 75.971  6.271   83.993 1.00 33.30  ? 97  LEU D O   1 
ATOM   5946 C CB  . LEU D 2 97  ? 73.704  7.847   82.017 1.00 27.78  ? 97  LEU D CB  1 
ATOM   5947 C CG  . LEU D 2 97  ? 74.967  8.457   81.455 1.00 28.32  ? 97  LEU D CG  1 
ATOM   5948 C CD1 . LEU D 2 97  ? 75.760  7.485   80.629 1.00 27.47  ? 97  LEU D CD1 1 
ATOM   5949 C CD2 . LEU D 2 97  ? 74.642  9.697   80.636 1.00 26.60  ? 97  LEU D CD2 1 
ATOM   5950 N N   . GLU D 2 98  ? 74.460  7.666   84.974 1.00 32.71  ? 98  GLU D N   1 
ATOM   5951 C CA  . GLU D 2 98  ? 75.428  7.970   86.052 1.00 34.89  ? 98  GLU D CA  1 
ATOM   5952 C C   . GLU D 2 98  ? 75.709  6.741   86.913 1.00 36.89  ? 98  GLU D C   1 
ATOM   5953 O O   . GLU D 2 98  ? 76.859  6.468   87.268 1.00 38.80  ? 98  GLU D O   1 
ATOM   5954 C CB  . GLU D 2 98  ? 75.055  9.225   86.877 1.00 36.00  ? 98  GLU D CB  1 
ATOM   5955 C CG  . GLU D 2 98  ? 76.154  9.632   87.778 1.00 37.93  ? 98  GLU D CG  1 
ATOM   5956 C CD  . GLU D 2 98  ? 75.996  11.044  88.410 1.00 43.99  ? 98  GLU D CD  1 
ATOM   5957 O OE1 . GLU D 2 98  ? 74.875  11.659  88.371 1.00 39.67  ? 98  GLU D OE1 1 
ATOM   5958 O OE2 . GLU D 2 98  ? 77.025  11.514  89.006 1.00 44.57  ? 98  GLU D OE2 1 
ATOM   5959 N N   . ALA D 2 99  ? 74.663  5.985   87.215 1.00 37.40  ? 99  ALA D N   1 
ATOM   5960 C CA  . ALA D 2 99  ? 74.814  4.721   87.944 1.00 39.91  ? 99  ALA D CA  1 
ATOM   5961 C C   . ALA D 2 99  ? 75.781  3.778   87.224 1.00 38.76  ? 99  ALA D C   1 
ATOM   5962 O O   . ALA D 2 99  ? 76.777  3.359   87.776 1.00 40.87  ? 99  ALA D O   1 
ATOM   5963 C CB  . ALA D 2 99  ? 73.439  4.047   88.203 1.00 40.29  ? 99  ALA D CB  1 
ATOM   5964 N N   . THR D 2 100 ? 75.533  3.461   85.975 1.00 37.05  ? 100 THR D N   1 
ATOM   5965 C CA  . THR D 2 100 ? 76.444  2.494   85.328 1.00 38.54  ? 100 THR D CA  1 
ATOM   5966 C C   . THR D 2 100 ? 77.874  3.034   85.405 1.00 40.52  ? 100 THR D C   1 
ATOM   5967 O O   . THR D 2 100 ? 78.811  2.251   85.542 1.00 43.38  ? 100 THR D O   1 
ATOM   5968 C CB  . THR D 2 100 ? 76.097  2.232   83.809 1.00 35.46  ? 100 THR D CB  1 
ATOM   5969 O OG1 . THR D 2 100 ? 74.692  2.050   83.631 1.00 32.98  ? 100 THR D OG1 1 
ATOM   5970 C CG2 . THR D 2 100 ? 76.831  1.045   83.292 1.00 34.79  ? 100 THR D CG2 1 
ATOM   5971 N N   . ILE D 2 101 ? 78.052  4.366   85.252 1.00 40.19  ? 101 ILE D N   1 
ATOM   5972 C CA  . ILE D 2 101 ? 79.402  4.933   85.282 1.00 41.05  ? 101 ILE D CA  1 
ATOM   5973 C C   . ILE D 2 101 ? 80.077  4.571   86.593 1.00 46.84  ? 101 ILE D C   1 
ATOM   5974 O O   . ILE D 2 101 ? 81.122  3.871   86.601 1.00 49.17  ? 101 ILE D O   1 
ATOM   5975 C CB  . ILE D 2 101 ? 79.432  6.432   85.020 1.00 38.92  ? 101 ILE D CB  1 
ATOM   5976 C CG1 . ILE D 2 101 ? 79.168  6.702   83.533 1.00 35.83  ? 101 ILE D CG1 1 
ATOM   5977 C CG2 . ILE D 2 101 ? 80.799  7.006   85.385 1.00 37.74  ? 101 ILE D CG2 1 
ATOM   5978 C CD1 . ILE D 2 101 ? 79.231  8.184   83.138 1.00 34.22  ? 101 ILE D CD1 1 
ATOM   5979 N N   . ASN D 2 102 ? 79.470  5.027   87.690 1.00 49.36  ? 102 ASN D N   1 
ATOM   5980 C CA  . ASN D 2 102 ? 79.939  4.710   89.043 1.00 55.38  ? 102 ASN D CA  1 
ATOM   5981 C C   . ASN D 2 102 ? 79.933  3.248   89.377 1.00 58.97  ? 102 ASN D C   1 
ATOM   5982 O O   . ASN D 2 102 ? 80.447  2.825   90.432 1.00 65.41  ? 102 ASN D O   1 
ATOM   5983 C CB  . ASN D 2 102 ? 79.023  5.333   90.053 1.00 56.39  ? 102 ASN D CB  1 
ATOM   5984 C CG  . ASN D 2 102 ? 79.026  6.783   89.963 1.00 55.94  ? 102 ASN D CG  1 
ATOM   5985 O OD1 . ASN D 2 102 ? 80.104  7.417   89.928 1.00 57.11  ? 102 ASN D OD1 1 
ATOM   5986 N ND2 . ASN D 2 102 ? 77.823  7.367   89.930 1.00 54.10  ? 102 ASN D ND2 1 
ATOM   5987 N N   . GLU D 2 103 ? 79.303  2.463   88.543 1.00 56.66  ? 103 GLU D N   1 
ATOM   5988 C CA  . GLU D 2 103 ? 79.184  1.085   88.911 1.00 61.33  ? 103 GLU D CA  1 
ATOM   5989 C C   . GLU D 2 103 ? 80.249  0.332   88.185 1.00 62.00  ? 103 GLU D C   1 
ATOM   5990 O O   . GLU D 2 103 ? 80.565  -0.772  88.552 1.00 67.16  ? 103 GLU D O   1 
ATOM   5991 C CB  . GLU D 2 103 ? 77.753  0.580   88.690 1.00 59.69  ? 103 GLU D CB  1 
ATOM   5992 C CG  . GLU D 2 103 ? 77.547  -0.872  88.506 1.00 63.15  ? 103 GLU D CG  1 
ATOM   5993 C CD  . GLU D 2 103 ? 76.070  -1.175  88.168 1.00 67.07  ? 103 GLU D CD  1 
ATOM   5994 O OE1 . GLU D 2 103 ? 75.620  -0.914  87.007 1.00 62.10  ? 103 GLU D OE1 1 
ATOM   5995 O OE2 . GLU D 2 103 ? 75.357  -1.684  89.084 1.00 73.35  ? 103 GLU D OE2 1 
ATOM   5996 N N   . LEU D 2 104 ? 80.868  0.961   87.215 1.00 59.34  ? 104 LEU D N   1 
ATOM   5997 C CA  . LEU D 2 104 ? 81.794  0.248   86.359 1.00 61.18  ? 104 LEU D CA  1 
ATOM   5998 C C   . LEU D 2 104 ? 83.185  0.921   86.219 1.00 63.73  ? 104 LEU D C   1 
ATOM   5999 O O   . LEU D 2 104 ? 84.089  0.348   85.599 1.00 65.55  ? 104 LEU D O   1 
ATOM   6000 C CB  . LEU D 2 104 ? 81.135  0.000   84.987 1.00 56.47  ? 104 LEU D CB  1 
ATOM   6001 C CG  . LEU D 2 104 ? 80.080  -1.124  84.865 1.00 55.89  ? 104 LEU D CG  1 
ATOM   6002 C CD1 . LEU D 2 104 ? 79.249  -1.065  83.561 1.00 53.02  ? 104 LEU D CD1 1 
ATOM   6003 C CD2 . LEU D 2 104 ? 80.696  -2.476  84.972 1.00 55.83  ? 104 LEU D CD2 1 
ATOM   6004 N N   . VAL D 2 105 ? 83.345  2.137   86.762 1.00 64.81  ? 105 VAL D N   1 
ATOM   6005 C CA  . VAL D 2 105 ? 84.660  2.744   86.881 1.00 68.40  ? 105 VAL D CA  1 
ATOM   6006 C C   . VAL D 2 105 ? 85.545  1.684   87.488 1.00 75.48  ? 105 VAL D C   1 
ATOM   6007 O O   . VAL D 2 105 ? 85.188  1.144   88.551 1.00 79.77  ? 105 VAL D O   1 
ATOM   6008 C CB  . VAL D 2 105 ? 84.705  4.009   87.804 1.00 69.52  ? 105 VAL D CB  1 
ATOM   6009 C CG1 . VAL D 2 105 ? 84.377  5.220   87.024 1.00 64.88  ? 105 VAL D CG1 1 
ATOM   6010 C CG2 . VAL D 2 105 ? 83.774  3.891   89.027 1.00 71.45  ? 105 VAL D CG2 1 
ATOM   6011 O OXT . VAL D 2 105 ? 86.607  1.324   86.944 1.00 78.55  ? 105 VAL D OXT 1 
HETATM 6012 O O   . HOH E 3 .   ? -6.567  -1.075  39.601 1.00 48.41  ? 401 HOH A O   1 
HETATM 6013 O O   . HOH E 3 .   ? 3.726   -1.516  11.028 1.00 49.02  ? 402 HOH A O   1 
HETATM 6014 O O   . HOH E 3 .   ? -5.447  10.545  23.498 1.00 60.19  ? 403 HOH A O   1 
HETATM 6015 O O   . HOH E 3 .   ? 3.940   -2.384  35.612 1.00 56.99  ? 404 HOH A O   1 
HETATM 6016 O O   . HOH E 3 .   ? 32.939  9.613   56.336 1.00 56.41  ? 405 HOH A O   1 
HETATM 6017 O O   . HOH E 3 .   ? 8.127   3.993   45.577 1.00 61.50  ? 406 HOH A O   1 
HETATM 6018 O O   . HOH E 3 .   ? -11.862 -2.809  8.483  1.00 37.42  ? 407 HOH A O   1 
HETATM 6019 O O   . HOH E 3 .   ? 1.888   5.546   21.102 1.00 52.27  ? 408 HOH A O   1 
HETATM 6020 O O   . HOH E 3 .   ? 36.922  -5.894  61.506 1.00 58.23  ? 409 HOH A O   1 
HETATM 6021 O O   . HOH E 3 .   ? 35.666  -7.168  58.643 1.00 49.17  ? 410 HOH A O   1 
HETATM 6022 O O   . HOH E 3 .   ? 34.313  -3.508  73.662 1.00 64.71  ? 411 HOH A O   1 
HETATM 6023 O O   . HOH E 3 .   ? -3.958  -9.288  11.266 1.00 36.47  ? 412 HOH A O   1 
HETATM 6024 O O   . HOH E 3 .   ? 2.265   -8.666  19.774 1.00 43.62  ? 413 HOH A O   1 
HETATM 6025 O O   . HOH E 3 .   ? -17.084 0.827   23.894 1.00 61.02  ? 414 HOH A O   1 
HETATM 6026 O O   . HOH E 3 .   ? 4.919   -5.480  15.458 1.00 50.27  ? 415 HOH A O   1 
HETATM 6027 O O   . HOH E 3 .   ? -13.896 -11.885 22.190 1.00 57.91  ? 416 HOH A O   1 
HETATM 6028 O O   . HOH E 3 .   ? 27.378  -3.564  33.013 1.00 63.91  ? 417 HOH A O   1 
HETATM 6029 O O   . HOH E 3 .   ? -11.652 9.545   14.652 1.00 53.68  ? 418 HOH A O   1 
HETATM 6030 O O   . HOH E 3 .   ? 4.655   -7.555  16.943 1.00 47.96  ? 419 HOH A O   1 
HETATM 6031 O O   . HOH E 3 .   ? 34.377  -15.491 79.535 1.00 51.16  ? 420 HOH A O   1 
HETATM 6032 O O   . HOH E 3 .   ? 39.907  -8.439  59.469 1.00 52.78  ? 421 HOH A O   1 
HETATM 6033 O O   . HOH E 3 .   ? 22.813  -6.800  69.133 1.00 64.46  ? 422 HOH A O   1 
HETATM 6034 O O   . HOH F 3 .   ? -15.844 -5.890  15.377 1.00 41.81  ? 201 HOH B O   1 
HETATM 6035 O O   . HOH F 3 .   ? -18.515 9.366   2.804  1.00 47.74  ? 202 HOH B O   1 
HETATM 6036 O O   . HOH F 3 .   ? -40.824 -11.103 2.765  1.00 73.03  ? 203 HOH B O   1 
HETATM 6037 O O   . HOH F 3 .   ? -21.804 -17.554 11.518 1.00 55.95  ? 204 HOH B O   1 
HETATM 6038 O O   . HOH G 3 .   ? 47.966  -6.060  35.393 1.00 48.18  ? 401 HOH C O   1 
HETATM 6039 O O   . HOH G 3 .   ? 6.672   0.388   14.030 1.00 41.55  ? 402 HOH C O   1 
HETATM 6040 O O   . HOH G 3 .   ? 5.628   -0.439  4.663  1.00 55.87  ? 403 HOH C O   1 
HETATM 6041 O O   . HOH G 3 .   ? 45.358  -3.554  38.212 1.00 34.07  ? 404 HOH C O   1 
HETATM 6042 O O   . HOH G 3 .   ? 45.121  7.285   70.045 1.00 64.82  ? 405 HOH C O   1 
HETATM 6043 O O   . HOH G 3 .   ? 47.749  8.547   75.599 1.00 59.35  ? 406 HOH C O   1 
HETATM 6044 O O   . HOH G 3 .   ? 39.596  8.994   27.527 1.00 43.10  ? 407 HOH C O   1 
HETATM 6045 O O   . HOH G 3 .   ? 43.617  -6.151  35.157 1.00 57.64  ? 408 HOH C O   1 
HETATM 6046 O O   . HOH G 3 .   ? 37.186  9.325   18.814 1.00 40.10  ? 409 HOH C O   1 
HETATM 6047 O O   . HOH G 3 .   ? 48.846  7.560   43.080 1.00 50.65  ? 410 HOH C O   1 
HETATM 6048 O O   . HOH G 3 .   ? 29.653  20.248  25.483 1.00 61.05  ? 411 HOH C O   1 
HETATM 6049 O O   . HOH G 3 .   ? 70.724  2.059   62.594 1.00 48.47  ? 412 HOH C O   1 
HETATM 6050 O O   . HOH G 3 .   ? 48.180  0.154   42.773 1.00 55.63  ? 413 HOH C O   1 
HETATM 6051 O O   . HOH G 3 .   ? 48.272  6.898   61.888 1.00 41.18  ? 414 HOH C O   1 
HETATM 6052 O O   . HOH G 3 .   ? 35.195  -14.459 41.813 1.00 60.27  ? 415 HOH C O   1 
HETATM 6053 O O   . HOH G 3 .   ? 39.646  13.154  43.227 1.00 61.49  ? 416 HOH C O   1 
HETATM 6054 O O   . HOH G 3 .   ? 68.062  -2.357  57.650 1.00 54.39  ? 417 HOH C O   1 
HETATM 6055 O O   . HOH G 3 .   ? 67.097  -5.607  58.150 1.00 57.46  ? 418 HOH C O   1 
HETATM 6056 O O   . HOH G 3 .   ? 17.083  -3.214  17.851 1.00 53.84  ? 419 HOH C O   1 
HETATM 6057 O O   . HOH G 3 .   ? 49.295  -5.449  62.385 1.00 55.41  ? 420 HOH C O   1 
HETATM 6058 O O   . HOH G 3 .   ? 8.206   -3.817  18.442 1.00 46.33  ? 421 HOH C O   1 
HETATM 6059 O O   . HOH G 3 .   ? 46.111  9.126   37.252 1.00 54.06  ? 422 HOH C O   1 
HETATM 6060 O O   . HOH G 3 .   ? 58.934  -5.185  25.295 1.00 56.46  ? 423 HOH C O   1 
HETATM 6061 O O   . HOH G 3 .   ? 42.687  -14.538 40.831 1.00 51.18  ? 424 HOH C O   1 
HETATM 6062 O O   . HOH G 3 .   ? 66.416  -3.356  61.916 1.00 72.73  ? 425 HOH C O   1 
HETATM 6063 O O   . HOH G 3 .   ? 26.192  13.054  29.194 1.00 55.35  ? 426 HOH C O   1 
HETATM 6064 O O   . HOH H 3 .   ? 63.204  15.546  66.578 1.00 47.81  ? 201 HOH D O   1 
HETATM 6065 O O   . HOH H 3 .   ? 77.795  14.771  74.566 1.00 41.95  ? 202 HOH D O   1 
HETATM 6066 O O   . HOH H 3 .   ? 81.720  8.777   92.289 1.00 49.47  ? 203 HOH D O   1 
HETATM 6067 O O   . HOH H 3 .   ? 68.676  -1.114  77.523 1.00 59.81  ? 204 HOH D O   1 
HETATM 6068 O O   . HOH H 3 .   ? 80.578  10.353  64.873 1.00 47.77  ? 205 HOH D O   1 
HETATM 6069 O O   . HOH H 3 .   ? 84.343  0.018   90.735 1.00 61.39  ? 206 HOH D O   1 
HETATM 6070 O O   . HOH H 3 .   ? 68.754  1.887   64.409 1.00 37.37  ? 207 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ILE A 5   ? 0.8468 0.9677 0.7980 0.1292  0.0054  -0.0115 7   ILE A N   
2    C CA  . ILE A 5   ? 0.8484 0.9476 0.7901 0.1337  0.0013  -0.0227 7   ILE A CA  
3    C C   . ILE A 5   ? 0.8714 0.9820 0.7991 0.1487  -0.0019 -0.0284 7   ILE A C   
4    O O   . ILE A 5   ? 0.8762 1.0103 0.8030 0.1536  0.0015  -0.0234 7   ILE A O   
5    C CB  . ILE A 5   ? 0.8308 0.9189 0.7762 0.1277  0.0034  -0.0231 7   ILE A CB  
6    C CG1 . ILE A 5   ? 0.7923 0.8687 0.7503 0.1149  0.0057  -0.0195 7   ILE A CG1 
7    C CG2 . ILE A 5   ? 0.8452 0.9145 0.7802 0.1327  -0.0022 -0.0330 7   ILE A CG2 
8    C CD1 . ILE A 5   ? 0.7763 0.8340 0.7340 0.1114  0.0020  -0.0249 7   ILE A CD1 
9    N N   . LYS A 6   ? 0.8968 0.9909 0.8133 0.1563  -0.0094 -0.0387 8   LYS A N   
10   C CA  . LYS A 6   ? 0.9289 1.0314 0.8293 0.1739  -0.0154 -0.0467 8   LYS A CA  
11   C C   . LYS A 6   ? 0.9397 1.0398 0.8311 0.1821  -0.0179 -0.0526 8   LYS A C   
12   O O   . LYS A 6   ? 0.9653 1.0835 0.8452 0.1980  -0.0202 -0.0569 8   LYS A O   
13   C CB  . LYS A 6   ? 0.9501 1.0311 0.8413 0.1789  -0.0256 -0.0560 8   LYS A CB  
14   C CG  . LYS A 6   ? 1.0010 1.0913 0.8758 0.1982  -0.0331 -0.0646 8   LYS A CG  
15   C CD  . LYS A 6   ? 1.0496 1.1117 0.9151 0.2018  -0.0460 -0.0742 8   LYS A CD  
16   C CE  . LYS A 6   ? 1.0746 1.1389 0.9200 0.2241  -0.0572 -0.0865 8   LYS A CE  
17   N NZ  . LYS A 6   ? 1.0919 1.1244 0.9282 0.2260  -0.0697 -0.0955 8   LYS A NZ  
18   N N   . SER A 7   ? 0.9209 0.9998 0.8169 0.1723  -0.0181 -0.0532 9   SER A N   
19   C CA  . SER A 7   ? 0.9213 0.9922 0.8092 0.1781  -0.0216 -0.0591 9   SER A CA  
20   C C   . SER A 7   ? 0.9051 0.9542 0.8016 0.1637  -0.0205 -0.0572 9   SER A C   
21   O O   . SER A 7   ? 0.9073 0.9358 0.8069 0.1551  -0.0247 -0.0581 9   SER A O   
22   C CB  . SER A 7   ? 0.9524 1.0085 0.8225 0.1934  -0.0349 -0.0720 9   SER A CB  
23   O OG  . SER A 7   ? 0.9588 0.9896 0.8254 0.1902  -0.0415 -0.0769 9   SER A OG  
24   N N   . PHE A 8   ? 0.8926 0.9483 0.7919 0.1619  -0.0153 -0.0544 10  PHE A N   
25   C CA  . PHE A 8   ? 0.8668 0.9074 0.7739 0.1498  -0.0130 -0.0522 10  PHE A CA  
26   C C   . PHE A 8   ? 0.8817 0.9214 0.7814 0.1563  -0.0146 -0.0561 10  PHE A C   
27   O O   . PHE A 8   ? 0.8732 0.9333 0.7753 0.1590  -0.0079 -0.0517 10  PHE A O   
28   C CB  . PHE A 8   ? 0.8391 0.8928 0.7615 0.1385  -0.0027 -0.0418 10  PHE A CB  
29   C CG  . PHE A 8   ? 0.7841 0.8243 0.7151 0.1265  -0.0002 -0.0397 10  PHE A CG  
30   C CD1 . PHE A 8   ? 0.7491 0.7689 0.6799 0.1207  -0.0053 -0.0431 10  PHE A CD1 
31   C CD2 . PHE A 8   ? 0.7621 0.8115 0.7017 0.1209  0.0065  -0.0335 10  PHE A CD2 
32   C CE1 . PHE A 8   ? 0.7441 0.7562 0.6825 0.1107  -0.0027 -0.0407 10  PHE A CE1 
33   C CE2 . PHE A 8   ? 0.7456 0.7836 0.6925 0.1113  0.0085  -0.0323 10  PHE A CE2 
34   C CZ  . PHE A 8   ? 0.7174 0.7385 0.6635 0.1068  0.0045  -0.0361 10  PHE A CZ  
35   N N   . GLU A 9   ? 0.8984 0.9152 0.7894 0.1585  -0.0243 -0.0636 11  GLU A N   
36   C CA  . GLU A 9   ? 0.9179 0.9341 0.7996 0.1676  -0.0274 -0.0688 11  GLU A CA  
37   C C   . GLU A 9   ? 0.9131 0.9053 0.7953 0.1593  -0.0325 -0.0704 11  GLU A C   
38   O O   . GLU A 9   ? 0.9129 0.8853 0.7976 0.1500  -0.0385 -0.0700 11  GLU A O   
39   C CB  . GLU A 9   ? 0.9557 0.9742 0.8199 0.1875  -0.0376 -0.0791 11  GLU A CB  
40   C CG  . GLU A 9   ? 0.9920 1.0418 0.8543 0.1984  -0.0322 -0.0772 11  GLU A CG  
41   C CD  . GLU A 9   ? 1.0007 1.0824 0.8680 0.2007  -0.0211 -0.0700 11  GLU A CD  
42   O OE1 . GLU A 9   ? 1.0141 1.0947 0.8781 0.2036  -0.0213 -0.0721 11  GLU A OE1 
43   O OE2 . GLU A 9   ? 0.9923 1.1005 0.8673 0.1987  -0.0130 -0.0611 11  GLU A OE2 
44   N N   . VAL A 10  ? 0.9077 0.9035 0.7876 0.1623  -0.0303 -0.0712 12  VAL A N   
45   C CA  . VAL A 10  ? 0.9032 0.8785 0.7827 0.1554  -0.0353 -0.0725 12  VAL A CA  
46   C C   . VAL A 10  ? 0.9469 0.9094 0.8094 0.1702  -0.0490 -0.0831 12  VAL A C   
47   O O   . VAL A 10  ? 0.9644 0.9429 0.8188 0.1845  -0.0478 -0.0874 12  VAL A O   
48   C CB  . VAL A 10  ? 0.8864 0.8736 0.7749 0.1492  -0.0241 -0.0666 12  VAL A CB  
49   C CG1 . VAL A 10  ? 0.8832 0.8522 0.7682 0.1460  -0.0297 -0.0693 12  VAL A CG1 
50   C CG2 . VAL A 10  ? 0.8359 0.8315 0.7407 0.1349  -0.0132 -0.0572 12  VAL A CG2 
51   N N   . VAL A 11  ? 0.9731 0.9077 0.8294 0.1674  -0.0634 -0.0872 13  VAL A N   
52   C CA  . VAL A 11  ? 1.0222 0.9411 0.8610 0.1827  -0.0795 -0.0983 13  VAL A CA  
53   C C   . VAL A 11  ? 1.0397 0.9303 0.8758 0.1749  -0.0918 -0.0990 13  VAL A C   
54   O O   . VAL A 11  ? 1.0416 0.9154 0.8844 0.1595  -0.0972 -0.0932 13  VAL A O   
55   C CB  . VAL A 11  ? 1.0623 0.9731 0.8899 0.1941  -0.0919 -0.1058 13  VAL A CB  
56   C CG1 . VAL A 11  ? 1.0946 1.0019 0.9014 0.2184  -0.1055 -0.1199 13  VAL A CG1 
57   C CG2 . VAL A 11  ? 1.0527 0.9888 0.8882 0.1937  -0.0788 -0.1007 13  VAL A CG2 
58   N N   . PHE A 12  ? 1.0492 0.9369 0.8758 0.1853  -0.0964 -0.1054 14  PHE A N   
59   C CA  . PHE A 12  ? 1.0529 0.9168 0.8781 0.1772  -0.1065 -0.1049 14  PHE A CA  
60   C C   . PHE A 12  ? 1.1029 0.9376 0.9123 0.1866  -0.1306 -0.1142 14  PHE A C   
61   O O   . PHE A 12  ? 1.1341 0.9717 0.9307 0.2051  -0.1374 -0.1241 14  PHE A O   
62   C CB  . PHE A 12  ? 1.0413 0.9156 0.8644 0.1835  -0.1000 -0.1070 14  PHE A CB  
63   C CG  . PHE A 12  ? 0.9747 0.8770 0.8130 0.1749  -0.0778 -0.0978 14  PHE A CG  
64   C CD1 . PHE A 12  ? 0.9423 0.8422 0.7947 0.1559  -0.0700 -0.0880 14  PHE A CD1 
65   C CD2 . PHE A 12  ? 0.9611 0.8931 0.7992 0.1862  -0.0660 -0.0984 14  PHE A CD2 
66   C CE1 . PHE A 12  ? 0.9080 0.8306 0.7733 0.1490  -0.0520 -0.0805 14  PHE A CE1 
67   C CE2 . PHE A 12  ? 0.9313 0.8867 0.7834 0.1775  -0.0482 -0.0891 14  PHE A CE2 
68   C CZ  . PHE A 12  ? 0.9080 0.8565 0.7733 0.1591  -0.0418 -0.0808 14  PHE A CZ  
69   N N   . ASN A 13  ? 1.1240 0.9309 0.9336 0.1743  -0.1449 -0.1108 15  ASN A N   
70   C CA  . ASN A 13  ? 1.1812 0.9548 0.9752 0.1820  -0.1721 -0.1191 15  ASN A CA  
71   C C   . ASN A 13  ? 1.2288 0.9940 1.0032 0.2060  -0.1853 -0.1344 15  ASN A C   
72   O O   . ASN A 13  ? 1.2785 1.0288 1.0379 0.2215  -0.2028 -0.1450 15  ASN A O   
73   C CB  . ASN A 13  ? 1.1793 0.9278 0.9797 0.1613  -0.1850 -0.1094 15  ASN A CB  
74   C CG  . ASN A 13  ? 1.1192 0.8809 0.9382 0.1401  -0.1718 -0.0951 15  ASN A CG  
75   O OD1 . ASN A 13  ? 1.0375 0.8130 0.8601 0.1422  -0.1637 -0.0948 15  ASN A OD1 
76   N ND2 . ASN A 13  ? 1.0806 0.8418 0.9117 0.1205  -0.1686 -0.0832 15  ASN A ND2 
77   N N   . ASP A 14  ? 1.2313 1.0064 1.0053 0.2100  -0.1775 -0.1358 16  ASP A N   
78   C CA  . ASP A 14  ? 1.2823 1.0624 1.0391 0.2356  -0.1835 -0.1502 16  ASP A CA  
79   C C   . ASP A 14  ? 1.2521 1.0756 1.0157 0.2427  -0.1580 -0.1482 16  ASP A C   
80   O O   . ASP A 14  ? 1.2154 1.0532 0.9881 0.2352  -0.1438 -0.1419 16  ASP A O   
81   C CB  . ASP A 14  ? 1.3134 1.0718 1.0632 0.2366  -0.1964 -0.1538 16  ASP A CB  
82   C CG  . ASP A 14  ? 1.3532 1.1202 1.0845 0.2655  -0.2021 -0.1697 16  ASP A CG  
83   O OD1 . ASP A 14  ? 1.3766 1.1744 1.1028 0.2837  -0.1917 -0.1758 16  ASP A OD1 
84   O OD2 . ASP A 14  ? 1.3799 1.1243 1.1018 0.2700  -0.2174 -0.1755 16  ASP A OD2 
85   N N   . PRO A 15  ? 1.2689 1.1137 1.0280 0.2565  -0.1532 -0.1526 17  PRO A N   
86   C CA  . PRO A 15  ? 1.2404 1.1288 1.0067 0.2619  -0.1305 -0.1484 17  PRO A CA  
87   C C   . PRO A 15  ? 1.2531 1.1609 1.0115 0.2781  -0.1269 -0.1544 17  PRO A C   
88   O O   . PRO A 15  ? 1.2265 1.1695 0.9943 0.2769  -0.1076 -0.1470 17  PRO A O   
89   C CB  . PRO A 15  ? 1.2614 1.1624 1.0203 0.2759  -0.1331 -0.1540 17  PRO A CB  
90   C CG  . PRO A 15  ? 1.2794 1.1419 1.0357 0.2668  -0.1514 -0.1553 17  PRO A CG  
91   C CD  . PRO A 15  ? 1.3076 1.1362 1.0550 0.2669  -0.1702 -0.1609 17  PRO A CD  
92   N N   . GLU A 16  ? 1.3004 1.1846 1.0420 0.2922  -0.1464 -0.1667 18  GLU A N   
93   C CA  . GLU A 16  ? 1.3153 1.2156 1.0468 0.3103  -0.1460 -0.1744 18  GLU A CA  
94   C C   . GLU A 16  ? 1.3047 1.1902 1.0424 0.2973  -0.1449 -0.1698 18  GLU A C   
95   O O   . GLU A 16  ? 1.3222 1.2175 1.0514 0.3114  -0.1459 -0.1762 18  GLU A O   
96   C CB  . GLU A 16  ? 1.3793 1.2682 1.0857 0.3401  -0.1689 -0.1936 18  GLU A CB  
97   C CG  . GLU A 16  ? 1.3845 1.3048 1.0826 0.3606  -0.1658 -0.1997 18  GLU A CG  
98   C CD  . GLU A 16  ? 1.3963 1.3512 1.0793 0.3906  -0.1653 -0.2108 18  GLU A CD  
99   O OE1 . GLU A 16  ? 1.3878 1.3474 1.0696 0.3935  -0.1631 -0.2118 18  GLU A OE1 
100  O OE2 . GLU A 16  ? 1.3978 1.3782 1.0702 0.4115  -0.1666 -0.2181 18  GLU A OE2 
101  N N   . LYS A 17  ? 1.2768 1.1415 1.0289 0.2714  -0.1425 -0.1585 19  LYS A N   
102  C CA  . LYS A 17  ? 1.2629 1.1111 1.0208 0.2575  -0.1431 -0.1535 19  LYS A CA  
103  C C   . LYS A 17  ? 1.2235 1.1020 0.9966 0.2478  -0.1194 -0.1430 19  LYS A C   
104  O O   . LYS A 17  ? 1.1848 1.0873 0.9712 0.2389  -0.1021 -0.1337 19  LYS A O   
105  C CB  . LYS A 17  ? 1.2585 1.0759 1.0255 0.2342  -0.1511 -0.1449 19  LYS A CB  
106  C CG  . LYS A 17  ? 1.2388 1.0445 1.0150 0.2166  -0.1488 -0.1367 19  LYS A CG  
107  C CD  . LYS A 17  ? 1.3050 1.0787 1.0664 0.2243  -0.1723 -0.1456 19  LYS A CD  
108  C CE  . LYS A 17  ? 1.2936 1.0545 1.0656 0.2034  -0.1711 -0.1352 19  LYS A CE  
109  N NZ  . LYS A 17  ? 1.3058 1.0474 1.0874 0.1811  -0.1787 -0.1242 19  LYS A NZ  
110  N N   . VAL A 18  ? 1.2446 1.1196 1.0149 0.2498  -0.1205 -0.1448 20  VAL A N   
111  C CA  . VAL A 18  ? 1.2158 1.1091 1.0004 0.2371  -0.1021 -0.1346 20  VAL A CA  
112  C C   . VAL A 18  ? 1.2263 1.0884 1.0157 0.2192  -0.1100 -0.1300 20  VAL A C   
113  O O   . VAL A 18  ? 1.2624 1.0948 1.0397 0.2243  -0.1302 -0.1376 20  VAL A O   
114  C CB  . VAL A 18  ? 1.2232 1.1405 0.9998 0.2553  -0.0977 -0.1404 20  VAL A CB  
115  C CG1 . VAL A 18  ? 1.1969 1.1206 0.9846 0.2427  -0.0858 -0.1322 20  VAL A CG1 
116  C CG2 . VAL A 18  ? 1.2078 1.1650 0.9845 0.2681  -0.0859 -0.1397 20  VAL A CG2 
117  N N   . TYR A 19  ? 1.2041 1.0737 1.0110 0.1988  -0.0949 -0.1174 21  TYR A N   
118  C CA  . TYR A 19  ? 1.2197 1.0651 1.0339 0.1790  -0.1008 -0.1103 21  TYR A CA  
119  C C   . TYR A 19  ? 1.2147 1.0592 1.0338 0.1712  -0.0958 -0.1063 21  TYR A C   
120  O O   . TYR A 19  ? 1.1863 1.0531 1.0078 0.1770  -0.0827 -0.1061 21  TYR A O   
121  C CB  . TYR A 19  ? 1.1913 1.0436 1.0208 0.1615  -0.0905 -0.0995 21  TYR A CB  
122  C CG  . TYR A 19  ? 1.2050 1.0575 1.0312 0.1669  -0.0950 -0.1022 21  TYR A CG  
123  C CD1 . TYR A 19  ? 1.2037 1.0343 1.0304 0.1568  -0.1078 -0.0995 21  TYR A CD1 
124  C CD2 . TYR A 19  ? 1.2212 1.0983 1.0449 0.1808  -0.0860 -0.1060 21  TYR A CD2 
125  C CE1 . TYR A 19  ? 1.2280 1.0586 1.0519 0.1614  -0.1118 -0.1018 21  TYR A CE1 
126  C CE2 . TYR A 19  ? 1.2388 1.1170 1.0595 0.1857  -0.0898 -0.1084 21  TYR A CE2 
127  C CZ  . TYR A 19  ? 1.2411 1.0948 1.0616 0.1764  -0.1027 -0.1069 21  TYR A CZ  
128  O OH  . TYR A 19  ? 1.2595 1.1138 1.0766 0.1818  -0.1068 -0.1096 21  TYR A OH  
129  N N   . GLY A 20  ? 1.2390 1.0590 1.0600 0.1573  -0.1067 -0.1019 22  GLY A N   
130  C CA  . GLY A 20  ? 1.2520 1.0693 1.0776 0.1486  -0.1034 -0.0975 22  GLY A CA  
131  C C   . GLY A 20  ? 1.2378 1.0546 1.0784 0.1259  -0.0969 -0.0848 22  GLY A C   
132  O O   . GLY A 20  ? 1.2449 1.0573 1.0918 0.1140  -0.0996 -0.0782 22  GLY A O   
133  N N   . SER A 21  ? 1.2285 1.0512 1.0739 0.1209  -0.0889 -0.0815 23  SER A N   
134  C CA  . SER A 21  ? 1.2137 1.0426 1.0732 0.1020  -0.0800 -0.0701 23  SER A CA  
135  C C   . SER A 21  ? 1.2367 1.0484 1.0985 0.0872  -0.0939 -0.0627 23  SER A C   
136  O O   . SER A 21  ? 1.2813 1.0681 1.1330 0.0887  -0.1140 -0.0656 23  SER A O   
137  C CB  . SER A 21  ? 1.2020 1.0330 1.0623 0.1010  -0.0754 -0.0696 23  SER A CB  
138  O OG  . SER A 21  ? 1.1972 1.0295 1.0679 0.0836  -0.0722 -0.0594 23  SER A OG  
139  N N   . GLY A 22  ? 1.2182 1.0438 1.0931 0.0733  -0.0843 -0.0530 24  GLY A N   
140  C CA  . GLY A 22  ? 1.2437 1.0594 1.1223 0.0589  -0.0964 -0.0441 24  GLY A CA  
141  C C   . GLY A 22  ? 1.2714 1.0741 1.1439 0.0623  -0.1093 -0.0468 24  GLY A C   
142  O O   . GLY A 22  ? 1.2883 1.0858 1.1655 0.0490  -0.1185 -0.0378 24  GLY A O   
143  N N   . GLU A 23  ? 1.2795 1.0795 1.1424 0.0795  -0.1099 -0.0580 25  GLU A N   
144  C CA  . GLU A 23  ? 1.3041 1.0905 1.1598 0.0848  -0.1233 -0.0620 25  GLU A CA  
145  C C   . GLU A 23  ? 1.2715 1.0748 1.1356 0.0817  -0.1123 -0.0585 25  GLU A C   
146  O O   . GLU A 23  ? 1.2291 1.0564 1.1034 0.0798  -0.0927 -0.0556 25  GLU A O   
147  C CB  . GLU A 23  ? 1.3323 1.1074 1.1714 0.1065  -0.1325 -0.0765 25  GLU A CB  
148  C CG  . GLU A 23  ? 1.4018 1.1566 1.2307 0.1127  -0.1516 -0.0817 25  GLU A CG  
149  C CD  . GLU A 23  ? 1.4978 1.2198 1.3112 0.1199  -0.1778 -0.0889 25  GLU A CD  
150  O OE1 . GLU A 23  ? 1.5347 1.2537 1.3347 0.1402  -0.1819 -0.1020 25  GLU A OE1 
151  O OE2 . GLU A 23  ? 1.5448 1.2447 1.3592 0.1056  -0.1956 -0.0811 25  GLU A OE2 
152  N N   . LYS A 24  ? 1.2809 1.0698 1.1403 0.0817  -0.1266 -0.0592 26  LYS A N   
153  C CA  . LYS A 24  ? 1.2560 1.0574 1.1238 0.0758  -0.1197 -0.0541 26  LYS A CA  
154  C C   . LYS A 24  ? 1.2369 1.0423 1.0984 0.0907  -0.1173 -0.0631 26  LYS A C   
155  O O   . LYS A 24  ? 1.2656 1.0516 1.1151 0.0995  -0.1343 -0.0699 26  LYS A O   
156  C CB  . LYS A 24  ? 0.4976 0.2831 0.3676 0.0608  -0.1371 -0.0448 26  LYS A CB  
157  C CG  . LYS A 24  ? 0.4869 0.2856 0.3660 0.0537  -0.1309 -0.0387 26  LYS A CG  
158  C CD  . LYS A 24  ? 0.4801 0.2888 0.3724 0.0327  -0.1307 -0.0231 26  LYS A CD  
159  C CE  . LYS A 24  ? 0.4662 0.2935 0.3689 0.0260  -0.1218 -0.0169 26  LYS A CE  
160  N NZ  . LYS A 24  ? 0.4540 0.3017 0.3706 0.0086  -0.1161 -0.0025 26  LYS A NZ  
161  N N   . VAL A 25  ? 1.1806 1.0113 1.0504 0.0929  -0.0974 -0.0624 27  VAL A N   
162  C CA  . VAL A 25  ? 1.1561 0.9961 1.0219 0.1057  -0.0928 -0.0689 27  VAL A CA  
163  C C   . VAL A 25  ? 1.1396 0.9823 1.0121 0.0978  -0.0928 -0.0636 27  VAL A C   
164  O O   . VAL A 25  ? 1.1230 0.9793 1.0086 0.0852  -0.0821 -0.0549 27  VAL A O   
165  C CB  . VAL A 25  ? 1.1201 0.9863 0.9927 0.1103  -0.0725 -0.0688 27  VAL A CB  
166  C CG1 . VAL A 25  ? 1.1188 0.9958 0.9853 0.1253  -0.0695 -0.0755 27  VAL A CG1 
167  C CG2 . VAL A 25  ? 1.1110 0.9786 0.9813 0.1136  -0.0693 -0.0708 27  VAL A CG2 
168  N N   . ALA A 26  ? 1.1397 0.9702 1.0027 0.1063  -0.1051 -0.0695 28  ALA A N   
169  C CA  . ALA A 26  ? 1.1218 0.9509 0.9898 0.0984  -0.1084 -0.0645 28  ALA A CA  
170  C C   . ALA A 26  ? 1.1229 0.9518 0.9819 0.1133  -0.1120 -0.0732 28  ALA A C   
171  O O   . ALA A 26  ? 1.1447 0.9701 0.9905 0.1310  -0.1170 -0.0839 28  ALA A O   
172  C CB  . ALA A 26  ? 1.1477 0.9539 1.0153 0.0850  -0.1279 -0.0578 28  ALA A CB  
173  N N   . GLY A 27  ? 1.0985 0.9325 0.9642 0.1068  -0.1097 -0.0685 29  GLY A N   
174  C CA  . GLY A 27  ? 1.0784 0.9129 0.9364 0.1194  -0.1132 -0.0756 29  GLY A CA  
175  C C   . GLY A 27  ? 1.0288 0.8791 0.8986 0.1113  -0.1019 -0.0690 29  GLY A C   
176  O O   . GLY A 27  ? 1.0229 0.8728 0.9032 0.0954  -0.1019 -0.0595 29  GLY A O   
177  N N   . ARG A 28  ? 0.9953 0.8619 0.8639 0.1221  -0.0925 -0.0733 30  ARG A N   
178  C CA  . ARG A 28  ? 0.9658 0.8451 0.8454 0.1142  -0.0835 -0.0671 30  ARG A CA  
179  C C   . ARG A 28  ? 0.9320 0.8351 0.8146 0.1226  -0.0687 -0.0685 30  ARG A C   
180  O O   . ARG A 28  ? 0.9479 0.8598 0.8224 0.1369  -0.0666 -0.0748 30  ARG A O   
181  C CB  . ARG A 28  ? 0.9922 0.8542 0.8679 0.1111  -0.0988 -0.0669 30  ARG A CB  
182  C CG  . ARG A 28  ? 1.0442 0.8931 0.9035 0.1280  -0.1125 -0.0779 30  ARG A CG  
183  C CD  . ARG A 28  ? 1.1127 0.9313 0.9641 0.1244  -0.1364 -0.0786 30  ARG A CD  
184  N NE  . ARG A 28  ? 1.1847 0.9930 1.0188 0.1445  -0.1489 -0.0915 30  ARG A NE  
185  C CZ  . ARG A 28  ? 1.2326 1.0393 1.0534 0.1621  -0.1529 -0.1022 30  ARG A CZ  
186  N NH1 . ARG A 28  ? 1.2316 1.0444 1.0551 0.1602  -0.1454 -0.1008 30  ARG A NH1 
187  N NH2 . ARG A 28  ? 1.2288 1.0296 1.0333 0.1824  -0.1645 -0.1146 30  ARG A NH2 
188  N N   . VAL A 29  ? 0.8883 0.8039 0.7833 0.1131  -0.0585 -0.0617 31  VAL A N   
189  C CA  . VAL A 29  ? 0.8524 0.7886 0.7518 0.1183  -0.0467 -0.0611 31  VAL A CA  
190  C C   . VAL A 29  ? 0.8625 0.7937 0.7587 0.1207  -0.0537 -0.0628 31  VAL A C   
191  O O   . VAL A 29  ? 0.8763 0.7957 0.7759 0.1108  -0.0605 -0.0593 31  VAL A O   
192  C CB  . VAL A 29  ? 0.8197 0.7693 0.7342 0.1066  -0.0336 -0.0532 31  VAL A CB  
193  C CG1 . VAL A 29  ? 0.7895 0.7587 0.7098 0.1101  -0.0231 -0.0511 31  VAL A CG1 
194  C CG2 . VAL A 29  ? 0.7949 0.7456 0.7118 0.1036  -0.0291 -0.0518 31  VAL A CG2 
195  N N   . ILE A 30  ? 0.8577 0.7991 0.7471 0.1336  -0.0527 -0.0675 32  ILE A N   
196  C CA  . ILE A 30  ? 0.8728 0.8086 0.7575 0.1375  -0.0603 -0.0702 32  ILE A CA  
197  C C   . ILE A 30  ? 0.8616 0.8205 0.7532 0.1393  -0.0482 -0.0667 32  ILE A C   
198  O O   . ILE A 30  ? 0.8514 0.8302 0.7432 0.1462  -0.0394 -0.0661 32  ILE A O   
199  C CB  . ILE A 30  ? 0.9019 0.8237 0.7682 0.1536  -0.0759 -0.0810 32  ILE A CB  
200  C CG1 . ILE A 30  ? 0.9120 0.8078 0.7727 0.1494  -0.0901 -0.0830 32  ILE A CG1 
201  C CG2 . ILE A 30  ? 0.9068 0.8174 0.7676 0.1565  -0.0869 -0.0841 32  ILE A CG2 
202  C CD1 . ILE A 30  ? 0.9485 0.8366 0.7924 0.1670  -0.1008 -0.0939 32  ILE A CD1 
203  N N   . VAL A 31  ? 0.8719 0.8287 0.7699 0.1319  -0.0485 -0.0632 33  VAL A N   
204  C CA  . VAL A 31  ? 0.8675 0.8429 0.7739 0.1306  -0.0384 -0.0586 33  VAL A CA  
205  C C   . VAL A 31  ? 0.8977 0.8680 0.7980 0.1359  -0.0463 -0.0620 33  VAL A C   
206  O O   . VAL A 31  ? 0.8977 0.8490 0.7957 0.1312  -0.0569 -0.0632 33  VAL A O   
207  C CB  . VAL A 31  ? 0.8348 0.8149 0.7574 0.1154  -0.0290 -0.0503 33  VAL A CB  
208  C CG1 . VAL A 31  ? 0.7846 0.7838 0.7159 0.1147  -0.0190 -0.0455 33  VAL A CG1 
209  C CG2 . VAL A 31  ? 0.8293 0.8088 0.7561 0.1100  -0.0248 -0.0482 33  VAL A CG2 
210  N N   . GLU A 32  ? 0.9262 0.9150 0.8242 0.1452  -0.0415 -0.0626 34  GLU A N   
211  C CA  . GLU A 32  ? 0.9801 0.9708 0.8742 0.1507  -0.0457 -0.0646 34  GLU A CA  
212  C C   . GLU A 32  ? 0.9698 0.9846 0.8743 0.1480  -0.0336 -0.0573 34  GLU A C   
213  O O   . GLU A 32  ? 0.9573 0.9917 0.8647 0.1505  -0.0254 -0.0535 34  GLU A O   
214  C CB  . GLU A 32  ? 1.0132 1.0040 0.8898 0.1694  -0.0554 -0.0744 34  GLU A CB  
215  C CG  . GLU A 32  ? 1.1018 1.0629 0.9660 0.1734  -0.0731 -0.0828 34  GLU A CG  
216  C CD  . GLU A 32  ? 1.2058 1.1672 1.0507 0.1953  -0.0836 -0.0946 34  GLU A CD  
217  O OE1 . GLU A 32  ? 1.2224 1.2104 1.0633 0.2081  -0.0769 -0.0960 34  GLU A OE1 
218  O OE2 . GLU A 32  ? 1.2517 1.1879 1.0852 0.2003  -0.0995 -0.1023 34  GLU A OE2 
219  N N   . VAL A 33  ? 0.9813 0.9943 0.8917 0.1421  -0.0336 -0.0545 35  VAL A N   
220  C CA  . VAL A 33  ? 0.9870 1.0203 0.9064 0.1397  -0.0246 -0.0476 35  VAL A CA  
221  C C   . VAL A 33  ? 1.0195 1.0589 0.9324 0.1482  -0.0287 -0.0502 35  VAL A C   
222  O O   . VAL A 33  ? 1.0429 1.0657 0.9474 0.1521  -0.0388 -0.0566 35  VAL A O   
223  C CB  . VAL A 33  ? 0.9665 0.9967 0.9007 0.1253  -0.0193 -0.0411 35  VAL A CB  
224  C CG1 . VAL A 33  ? 0.9639 1.0142 0.9084 0.1218  -0.0100 -0.0330 35  VAL A CG1 
225  C CG2 . VAL A 33  ? 0.9442 0.9588 0.8826 0.1161  -0.0206 -0.0413 35  VAL A CG2 
226  N N   . CYS A 34  ? 1.0272 1.0903 0.9445 0.1501  -0.0218 -0.0442 36  CYS A N   
227  C CA  . CYS A 34  ? 1.0562 1.1290 0.9697 0.1566  -0.0241 -0.0447 36  CYS A CA  
228  C C   . CYS A 34  ? 1.0420 1.1002 0.9632 0.1464  -0.0258 -0.0432 36  CYS A C   
229  O O   . CYS A 34  ? 1.0626 1.1049 0.9767 0.1494  -0.0344 -0.0493 36  CYS A O   
230  C CB  . CYS A 34  ? 1.0432 1.1475 0.9614 0.1589  -0.0166 -0.0361 36  CYS A CB  
231  S SG  . CYS A 34  ? 1.1127 1.2373 1.0260 0.1670  -0.0130 -0.0347 36  CYS A SG  
232  N N   . GLU A 35  ? 1.0140 1.0776 0.9494 0.1348  -0.0186 -0.0350 37  GLU A N   
233  C CA  . GLU A 35  ? 0.9953 1.0484 0.9391 0.1254  -0.0192 -0.0332 37  GLU A CA  
234  C C   . GLU A 35  ? 0.9640 1.0021 0.9146 0.1153  -0.0186 -0.0331 37  GLU A C   
235  O O   . GLU A 35  ? 0.9473 0.9859 0.8994 0.1136  -0.0155 -0.0323 37  GLU A O   
236  C CB  . GLU A 35  ? 0.9886 1.0576 0.9428 0.1207  -0.0134 -0.0250 37  GLU A CB  
237  C CG  . GLU A 35  ? 1.0233 1.1104 0.9812 0.1209  -0.0080 -0.0184 37  GLU A CG  
238  C CD  . GLU A 35  ? 1.0753 1.1614 1.0471 0.1098  -0.0042 -0.0116 37  GLU A CD  
239  O OE1 . GLU A 35  ? 1.0895 1.1868 1.0682 0.1065  -0.0034 -0.0044 37  GLU A OE1 
240  O OE2 . GLU A 35  ? 1.0850 1.1587 1.0604 0.1046  -0.0033 -0.0138 37  GLU A OE2 
241  N N   . VAL A 36  ? 0.9437 0.9709 0.8985 0.1088  -0.0218 -0.0334 38  VAL A N   
242  C CA  . VAL A 36  ? 0.9083 0.9268 0.8705 0.0991  -0.0211 -0.0320 38  VAL A CA  
243  C C   . VAL A 36  ? 0.8854 0.9119 0.8561 0.0951  -0.0133 -0.0283 38  VAL A C   
244  O O   . VAL A 36  ? 0.8705 0.9087 0.8464 0.0957  -0.0087 -0.0244 38  VAL A O   
245  C CB  . VAL A 36  ? 0.8966 0.9121 0.8660 0.0920  -0.0226 -0.0300 38  VAL A CB  
246  C CG1 . VAL A 36  ? 0.9056 0.9179 0.8692 0.0963  -0.0284 -0.0320 38  VAL A CG1 
247  C CG2 . VAL A 36  ? 0.8625 0.8883 0.8438 0.0875  -0.0156 -0.0258 38  VAL A CG2 
248  N N   . THR A 37  ? 0.8641 0.8841 0.8361 0.0908  -0.0133 -0.0290 39  THR A N   
249  C CA  . THR A 37  ? 0.8292 0.8547 0.8082 0.0876  -0.0073 -0.0266 39  THR A CA  
250  C C   . THR A 37  ? 0.8028 0.8245 0.7874 0.0806  -0.0069 -0.0263 39  THR A C   
251  O O   . THR A 37  ? 0.8089 0.8227 0.7894 0.0784  -0.0112 -0.0275 39  THR A O   
252  C CB  . THR A 37  ? 0.8348 0.8634 0.8080 0.0929  -0.0056 -0.0272 39  THR A CB  
253  O OG1 . THR A 37  ? 0.8451 0.8832 0.8134 0.1000  -0.0058 -0.0265 39  THR A OG1 
254  C CG2 . THR A 37  ? 0.8314 0.8658 0.8124 0.0894  0.0000  -0.0239 39  THR A CG2 
255  N N   . ARG A 38  ? 0.7648 0.7932 0.7586 0.0776  -0.0030 -0.0243 40  ARG A N   
256  C CA  . ARG A 38  ? 0.7459 0.7761 0.7448 0.0734  -0.0013 -0.0241 40  ARG A CA  
257  C C   . ARG A 38  ? 0.7197 0.7489 0.7168 0.0748  0.0016  -0.0246 40  ARG A C   
258  O O   . ARG A 38  ? 0.7184 0.7505 0.7165 0.0776  0.0039  -0.0235 40  ARG A O   
259  C CB  . ARG A 38  ? 0.7424 0.7805 0.7505 0.0725  0.0008  -0.0236 40  ARG A CB  
260  C CG  . ARG A 38  ? 0.7759 0.8170 0.7865 0.0704  -0.0018 -0.0229 40  ARG A CG  
261  C CD  . ARG A 38  ? 0.8489 0.8944 0.8652 0.0727  -0.0015 -0.0230 40  ARG A CD  
262  N NE  . ARG A 38  ? 0.8870 0.9349 0.9082 0.0751  0.0002  -0.0240 40  ARG A NE  
263  C CZ  . ARG A 38  ? 0.8732 0.9276 0.8992 0.0760  0.0007  -0.0262 40  ARG A CZ  
264  N NH1 . ARG A 38  ? 0.8920 0.9549 0.9195 0.0739  0.0010  -0.0262 40  ARG A NH1 
265  N NH2 . ARG A 38  ? 0.8693 0.9228 0.8983 0.0792  0.0001  -0.0279 40  ARG A NH2 
266  N N   . VAL A 39  ? 0.6930 0.7186 0.6877 0.0720  0.0005  -0.0252 41  VAL A N   
267  C CA  . VAL A 39  ? 0.6520 0.6758 0.6445 0.0727  0.0026  -0.0258 41  VAL A CA  
268  C C   . VAL A 39  ? 0.6384 0.6678 0.6371 0.0688  0.0050  -0.0253 41  VAL A C   
269  O O   . VAL A 39  ? 0.6391 0.6721 0.6401 0.0644  0.0031  -0.0238 41  VAL A O   
270  C CB  . VAL A 39  ? 0.6627 0.6768 0.6459 0.0734  -0.0023 -0.0273 41  VAL A CB  
271  C CG1 . VAL A 39  ? 0.6406 0.6527 0.6222 0.0728  -0.0005 -0.0278 41  VAL A CG1 
272  C CG2 . VAL A 39  ? 0.6505 0.6619 0.6259 0.0805  -0.0045 -0.0293 41  VAL A CG2 
273  N N   . LYS A 40  ? 0.6141 0.6457 0.6153 0.0705  0.0085  -0.0259 42  LYS A N   
274  C CA  . LYS A 40  ? 0.6028 0.6412 0.6091 0.0690  0.0106  -0.0264 42  LYS A CA  
275  C C   . LYS A 40  ? 0.5903 0.6268 0.5935 0.0662  0.0108  -0.0260 42  LYS A C   
276  O O   . LYS A 40  ? 0.5972 0.6419 0.6036 0.0636  0.0115  -0.0252 42  LYS A O   
277  C CB  . LYS A 40  ? 0.6069 0.6472 0.6179 0.0728  0.0121  -0.0278 42  LYS A CB  
278  C CG  . LYS A 40  ? 0.6182 0.6666 0.6343 0.0745  0.0128  -0.0302 42  LYS A CG  
279  C CD  . LYS A 40  ? 0.5940 0.6411 0.6145 0.0790  0.0105  -0.0322 42  LYS A CD  
280  C CE  . LYS A 40  ? 0.6129 0.6553 0.6336 0.0809  0.0100  -0.0332 42  LYS A CE  
281  N NZ  . LYS A 40  ? 0.6701 0.7195 0.6931 0.0851  0.0094  -0.0378 42  LYS A NZ  
282  N N   . ALA A 41  ? 0.5783 0.6060 0.5750 0.0673  0.0101  -0.0263 43  ALA A N   
283  C CA  . ALA A 41  ? 0.5548 0.5788 0.5480 0.0648  0.0094  -0.0261 43  ALA A CA  
284  C C   . ALA A 41  ? 0.5552 0.5696 0.5402 0.0682  0.0077  -0.0276 43  ALA A C   
285  O O   . ALA A 41  ? 0.5350 0.5495 0.5182 0.0731  0.0088  -0.0283 43  ALA A O   
286  C CB  . ALA A 41  ? 0.5360 0.5669 0.5339 0.0648  0.0136  -0.0266 43  ALA A CB  
287  N N   . VAL A 42  ? 0.5731 0.5805 0.5529 0.0662  0.0043  -0.0277 44  VAL A N   
288  C CA  . VAL A 42  ? 0.5824 0.5824 0.5541 0.0715  0.0029  -0.0303 44  VAL A CA  
289  C C   . VAL A 42  ? 0.5724 0.5720 0.5450 0.0687  0.0047  -0.0298 44  VAL A C   
290  O O   . VAL A 42  ? 0.5764 0.5757 0.5508 0.0626  0.0022  -0.0276 44  VAL A O   
291  C CB  . VAL A 42  ? 0.6075 0.5957 0.5698 0.0735  -0.0060 -0.0324 44  VAL A CB  
292  C CG1 . VAL A 42  ? 0.6130 0.5948 0.5657 0.0807  -0.0084 -0.0362 44  VAL A CG1 
293  C CG2 . VAL A 42  ? 0.6142 0.6040 0.5756 0.0771  -0.0075 -0.0331 44  VAL A CG2 
294  N N   . ARG A 43  ? 0.5766 0.5783 0.5487 0.0724  0.0091  -0.0308 45  ARG A N   
295  C CA  . ARG A 43  ? 0.5908 0.5923 0.5641 0.0696  0.0111  -0.0304 45  ARG A CA  
296  C C   . ARG A 43  ? 0.6018 0.5985 0.5685 0.0742  0.0109  -0.0323 45  ARG A C   
297  O O   . ARG A 43  ? 0.6071 0.6060 0.5702 0.0803  0.0113  -0.0333 45  ARG A O   
298  C CB  . ARG A 43  ? 0.5637 0.5746 0.5459 0.0676  0.0166  -0.0293 45  ARG A CB  
299  C CG  . ARG A 43  ? 0.5667 0.5837 0.5545 0.0693  0.0185  -0.0289 45  ARG A CG  
300  C CD  . ARG A 43  ? 0.5801 0.6029 0.5746 0.0701  0.0215  -0.0294 45  ARG A CD  
301  N NE  . ARG A 43  ? 0.5839 0.6070 0.5810 0.0729  0.0213  -0.0284 45  ARG A NE  
302  C CZ  . ARG A 43  ? 0.5691 0.5911 0.5669 0.0744  0.0218  -0.0267 45  ARG A CZ  
303  N NH1 . ARG A 43  ? 0.5671 0.5872 0.5632 0.0741  0.0232  -0.0271 45  ARG A NH1 
304  N NH2 . ARG A 43  ? 0.5177 0.5414 0.5185 0.0754  0.0202  -0.0237 45  ARG A NH2 
305  N N   . ILE A 44  ? 0.6222 0.6144 0.5869 0.0716  0.0098  -0.0325 46  ILE A N   
306  C CA  . ILE A 44  ? 0.6523 0.6402 0.6101 0.0768  0.0092  -0.0348 46  ILE A CA  
307  C C   . ILE A 44  ? 0.6468 0.6385 0.6087 0.0749  0.0144  -0.0337 46  ILE A C   
308  O O   . ILE A 44  ? 0.6387 0.6327 0.6061 0.0691  0.0159  -0.0320 46  ILE A O   
309  C CB  . ILE A 44  ? 0.6684 0.6423 0.6159 0.0783  0.0000  -0.0377 46  ILE A CB  
310  C CG1 . ILE A 44  ? 0.6838 0.6524 0.6336 0.0694  -0.0036 -0.0349 46  ILE A CG1 
311  C CG2 . ILE A 44  ? 0.6921 0.6596 0.6337 0.0817  -0.0074 -0.0398 46  ILE A CG2 
312  C CD1 . ILE A 44  ? 0.7477 0.7000 0.6878 0.0698  -0.0150 -0.0367 46  ILE A CD1 
313  N N   . LEU A 45  ? 0.6492 0.6437 0.6084 0.0802  0.0168  -0.0343 47  LEU A N   
314  C CA  . LEU A 45  ? 0.6515 0.6470 0.6120 0.0794  0.0200  -0.0337 47  LEU A CA  
315  C C   . LEU A 45  ? 0.6811 0.6722 0.6321 0.0853  0.0170  -0.0365 47  LEU A C   
316  O O   . LEU A 45  ? 0.6929 0.6878 0.6381 0.0927  0.0154  -0.0380 47  LEU A O   
317  C CB  . LEU A 45  ? 0.6351 0.6401 0.6027 0.0798  0.0249  -0.0306 47  LEU A CB  
318  C CG  . LEU A 45  ? 0.6326 0.6387 0.6033 0.0782  0.0278  -0.0293 47  LEU A CG  
319  C CD1 . LEU A 45  ? 0.6564 0.6586 0.6299 0.0735  0.0283  -0.0307 47  LEU A CD1 
320  C CD2 . LEU A 45  ? 0.6252 0.6384 0.6027 0.0780  0.0295  -0.0251 47  LEU A CD2 
321  N N   . ALA A 46  ? 0.6984 0.6824 0.6471 0.0829  0.0154  -0.0376 48  ALA A N   
322  C CA  . ALA A 46  ? 0.7317 0.7113 0.6713 0.0894  0.0121  -0.0408 48  ALA A CA  
323  C C   . ALA A 46  ? 0.7394 0.7231 0.6824 0.0878  0.0172  -0.0391 48  ALA A C   
324  O O   . ALA A 46  ? 0.7241 0.7057 0.6725 0.0809  0.0192  -0.0374 48  ALA A O   
325  C CB  . ALA A 46  ? 0.7467 0.7107 0.6788 0.0882  0.0027  -0.0438 48  ALA A CB  
326  N N   . CYS A 47  ? 0.7766 0.7681 0.7165 0.0944  0.0193  -0.0392 49  CYS A N   
327  C CA  . CYS A 47  ? 0.8188 0.8142 0.7620 0.0928  0.0236  -0.0370 49  CYS A CA  
328  C C   . CYS A 47  ? 0.8409 0.8356 0.7753 0.0999  0.0212  -0.0401 49  CYS A C   
329  O O   . CYS A 47  ? 0.8787 0.8759 0.8046 0.1090  0.0172  -0.0436 49  CYS A O   
330  C CB  . CYS A 47  ? 0.8123 0.8221 0.7632 0.0923  0.0288  -0.0313 49  CYS A CB  
331  S SG  . CYS A 47  ? 0.9206 0.9313 0.8814 0.0859  0.0303  -0.0282 49  CYS A SG  
332  N N   . GLY A 48  ? 0.8459 0.8384 0.7820 0.0970  0.0232  -0.0393 50  GLY A N   
333  C CA  . GLY A 48  ? 0.8512 0.8470 0.7806 0.1040  0.0225  -0.0412 50  GLY A CA  
334  C C   . GLY A 48  ? 0.8316 0.8376 0.7689 0.1003  0.0288  -0.0355 50  GLY A C   
335  O O   . GLY A 48  ? 0.8259 0.8262 0.7697 0.0926  0.0310  -0.0338 50  GLY A O   
336  N N   . VAL A 49  ? 0.8329 0.8554 0.7700 0.1056  0.0311  -0.0320 51  VAL A N   
337  C CA  . VAL A 49  ? 0.8181 0.8488 0.7632 0.1007  0.0352  -0.0253 51  VAL A CA  
338  C C   . VAL A 49  ? 0.8275 0.8719 0.7680 0.1076  0.0359  -0.0239 51  VAL A C   
339  O O   . VAL A 49  ? 0.8361 0.9001 0.7749 0.1140  0.0364  -0.0204 51  VAL A O   
340  C CB  . VAL A 49  ? 0.8044 0.8467 0.7596 0.0957  0.0372  -0.0170 51  VAL A CB  
341  C CG1 . VAL A 49  ? 0.7808 0.8310 0.7429 0.0912  0.0386  -0.0094 51  VAL A CG1 
342  C CG2 . VAL A 49  ? 0.7829 0.8132 0.7437 0.0892  0.0367  -0.0182 51  VAL A CG2 
343  N N   . ALA A 50  ? 0.8203 0.8572 0.7587 0.1069  0.0360  -0.0261 52  ALA A N   
344  C CA  . ALA A 50  ? 0.8243 0.8777 0.7611 0.1119  0.0376  -0.0226 52  ALA A CA  
345  C C   . ALA A 50  ? 0.8134 0.8784 0.7617 0.1039  0.0406  -0.0117 52  ALA A C   
346  O O   . ALA A 50  ? 0.8052 0.8588 0.7614 0.0947  0.0409  -0.0094 52  ALA A O   
347  C CB  . ALA A 50  ? 0.8225 0.8654 0.7514 0.1160  0.0355  -0.0291 52  ALA A CB  
348  N N   . LYS A 51  ? 0.8191 0.9080 0.7680 0.1078  0.0417  -0.0046 53  LYS A N   
349  C CA  . LYS A 51  ? 0.8214 0.9227 0.7814 0.0995  0.0423  0.0078  53  LYS A CA  
350  C C   . LYS A 51  ? 0.8300 0.9498 0.7879 0.1038  0.0435  0.0120  53  LYS A C   
351  O O   . LYS A 51  ? 0.8395 0.9813 0.7904 0.1146  0.0442  0.0117  53  LYS A O   
352  C CB  . LYS A 51  ? 0.8266 0.9444 0.7919 0.0978  0.0414  0.0159  53  LYS A CB  
353  C CG  . LYS A 51  ? 0.8727 1.0089 0.8491 0.0896  0.0397  0.0315  53  LYS A CG  
354  C CD  . LYS A 51  ? 0.9669 1.1125 0.9494 0.0856  0.0374  0.0391  53  LYS A CD  
355  C CE  . LYS A 51  ? 1.0295 1.2071 1.0208 0.0803  0.0349  0.0576  53  LYS A CE  
356  N NZ  . LYS A 51  ? 1.0454 1.2278 1.0459 0.0719  0.0301  0.0682  53  LYS A NZ  
357  N N   . VAL A 52  ? 0.8116 0.9225 0.7744 0.0970  0.0434  0.0147  54  VAL A N   
358  C CA  . VAL A 52  ? 0.8182 0.9446 0.7794 0.1002  0.0445  0.0186  54  VAL A CA  
359  C C   . VAL A 52  ? 0.8300 0.9736 0.8032 0.0906  0.0427  0.0348  54  VAL A C   
360  O O   . VAL A 52  ? 0.8173 0.9449 0.7990 0.0800  0.0395  0.0387  54  VAL A O   
361  C CB  . VAL A 52  ? 0.8080 0.9119 0.7643 0.1006  0.0449  0.0093  54  VAL A CB  
362  C CG1 . VAL A 52  ? 0.7853 0.9050 0.7402 0.1040  0.0460  0.0132  54  VAL A CG1 
363  C CG2 . VAL A 52  ? 0.8001 0.8867 0.7449 0.1087  0.0441  -0.0048 54  VAL A CG2 
364  N N   . LEU A 53  ? 0.8604 1.0375 0.8343 0.0944  0.0434  0.0448  55  LEU A N   
365  C CA  . LEU A 53  ? 0.8851 1.0821 0.8716 0.0835  0.0400  0.0635  55  LEU A CA  
366  C C   . LEU A 53  ? 0.9017 1.1332 0.8891 0.0862  0.0410  0.0744  55  LEU A C   
367  O O   . LEU A 53  ? 0.9136 1.1672 0.8919 0.0995  0.0448  0.0700  55  LEU A O   
368  C CB  . LEU A 53  ? 0.8974 1.1054 0.8910 0.0779  0.0369  0.0732  55  LEU A CB  
369  C CG  . LEU A 53  ? 0.9203 1.1646 0.9119 0.0849  0.0387  0.0800  55  LEU A CG  
370  C CD1 . LEU A 53  ? 0.9357 1.1690 0.9322 0.0789  0.0356  0.0816  55  LEU A CD1 
371  C CD2 . LEU A 53  ? 0.9179 1.1722 0.8947 0.1031  0.0439  0.0662  55  LEU A CD2 
372  N N   . TRP A 54  ? 0.9172 1.1537 0.9155 0.0743  0.0367  0.0886  56  TRP A N   
373  C CA  . TRP A 54  ? 0.9494 1.2185 0.9492 0.0760  0.0376  0.0994  56  TRP A CA  
374  C C   . TRP A 54  ? 0.9836 1.2618 0.9983 0.0592  0.0298  0.1204  56  TRP A C   
375  O O   . TRP A 54  ? 0.9790 1.2321 1.0009 0.0482  0.0233  0.1228  56  TRP A O   
376  C CB  . TRP A 54  ? 0.9321 1.1867 0.9236 0.0831  0.0411  0.0871  56  TRP A CB  
377  C CG  . TRP A 54  ? 0.8986 1.1181 0.8954 0.0720  0.0374  0.0852  56  TRP A CG  
378  C CD1 . TRP A 54  ? 0.8836 1.1072 0.8886 0.0624  0.0332  0.0971  56  TRP A CD1 
379  C CD2 . TRP A 54  ? 0.8525 1.0310 0.8461 0.0705  0.0371  0.0707  56  TRP A CD2 
380  N NE1 . TRP A 54  ? 0.8545 1.0410 0.8609 0.0561  0.0301  0.0898  56  TRP A NE1 
381  C CE2 . TRP A 54  ? 0.8651 1.0253 0.8647 0.0611  0.0329  0.0738  56  TRP A CE2 
382  C CE3 . TRP A 54  ? 0.8058 0.9631 0.7923 0.0760  0.0395  0.0562  56  TRP A CE3 
383  C CZ2 . TRP A 54  ? 0.8430 0.9670 0.8412 0.0585  0.0316  0.0623  56  TRP A CZ2 
384  C CZ3 . TRP A 54  ? 0.7805 0.9033 0.7664 0.0721  0.0384  0.0462  56  TRP A CZ3 
385  C CH2 . TRP A 54  ? 0.8065 0.9142 0.7980 0.0641  0.0348  0.0489  56  TRP A CH2 
386  N N   . MET A 55  ? 1.0337 1.3484 1.0527 0.0579  0.0293  0.1354  57  MET A N   
387  C CA  . MET A 55  ? 1.0862 1.4154 1.1201 0.0410  0.0202  0.1588  57  MET A CA  
388  C C   . MET A 55  ? 1.1022 1.4313 1.1376 0.0383  0.0194  0.1619  57  MET A C   
389  O O   . MET A 55  ? 1.1107 1.4725 1.1417 0.0473  0.0250  0.1640  57  MET A O   
390  C CB  . MET A 55  ? 1.1141 1.4965 1.1544 0.0390  0.0190  0.1797  57  MET A CB  
391  C CG  . MET A 55  ? 1.1545 1.5433 1.1939 0.0417  0.0197  0.1789  57  MET A CG  
392  S SD  . MET A 55  ? 1.2680 1.6357 1.3223 0.0207  0.0060  0.1942  57  MET A SD  
393  C CE  . MET A 55  ? 1.2126 1.5474 1.2575 0.0302  0.0108  0.1720  57  MET A CE  
394  N N   . GLN A 56  ? 1.1236 1.4162 1.1644 0.0272  0.0120  0.1613  58  GLN A N   
395  C CA  . GLN A 56  ? 1.1454 1.4328 1.1879 0.0236  0.0102  0.1637  58  GLN A CA  
396  C C   . GLN A 56  ? 1.1747 1.4957 1.2311 0.0096  0.0011  0.1915  58  GLN A C   
397  O O   . GLN A 56  ? 1.1944 1.5110 1.2613 -0.0040 -0.0101 0.2056  58  GLN A O   
398  C CB  . GLN A 56  ? 1.1407 1.3775 1.1840 0.0173  0.0042  0.1532  58  GLN A CB  
399  C CG  . GLN A 56  ? 1.1670 1.3899 1.2067 0.0192  0.0061  0.1462  58  GLN A CG  
400  C CD  . GLN A 56  ? 1.1970 1.3967 1.2229 0.0331  0.0163  0.1216  58  GLN A CD  
401  O OE1 . GLN A 56  ? 1.1909 1.3548 1.2137 0.0332  0.0153  0.1082  58  GLN A OE1 
402  N NE2 . GLN A 56  ? 1.2104 1.4315 1.2279 0.0450  0.0250  0.1161  58  GLN A NE2 
403  N N   . GLY A 57  ? 1.1832 1.5377 1.2397 0.0125  0.0046  0.1999  59  GLY A N   
404  C CA  . GLY A 57  ? 1.2068 1.6057 1.2761 0.0007  -0.0025 0.2285  59  GLY A CA  
405  C C   . GLY A 57  ? 1.2187 1.6516 1.2918 -0.0001 -0.0028 0.2407  59  GLY A C   
406  O O   . GLY A 57  ? 1.2334 1.7145 1.3029 0.0104  0.0050  0.2455  59  GLY A O   
407  N N   . SER A 58  ? 1.2125 1.6210 1.2926 -0.0116 -0.0124 0.2454  60  SER A N   
408  C CA  . SER A 58  ? 1.2094 1.6367 1.2907 -0.0107 -0.0119 0.2505  60  SER A CA  
409  C C   . SER A 58  ? 1.1987 1.5762 1.2829 -0.0194 -0.0212 0.2437  60  SER A C   
410  O O   . SER A 58  ? 1.2129 1.5927 1.3090 -0.0348 -0.0344 0.2625  60  SER A O   
411  C CB  . SER A 58  ? 1.2451 1.7284 1.3394 -0.0224 -0.0186 0.2823  60  SER A CB  
412  O OG  . SER A 58  ? 1.2553 1.7698 1.3487 -0.0172 -0.0145 0.2866  60  SER A OG  
413  N N   . GLN A 59  ? 1.1642 1.4976 1.2377 -0.0094 -0.0153 0.2173  61  GLN A N   
414  C CA  . GLN A 59  ? 1.1429 1.4285 1.2179 -0.0153 -0.0237 0.2083  61  GLN A CA  
415  C C   . GLN A 59  ? 1.1118 1.3786 1.1757 -0.0021 -0.0140 0.1860  61  GLN A C   
416  O O   . GLN A 59  ? 1.0991 1.3733 1.1517 0.0127  -0.0012 0.1711  61  GLN A O   
417  C CB  . GLN A 59  ? 1.1351 1.3818 1.2104 -0.0198 -0.0303 0.2011  61  GLN A CB  
418  C CG  . GLN A 59  ? 1.1660 1.3829 1.2512 -0.0348 -0.0490 0.2105  61  GLN A CG  
419  C CD  . GLN A 59  ? 1.1655 1.3321 1.2441 -0.0295 -0.0510 0.1881  61  GLN A CD  
420  O OE1 . GLN A 59  ? 1.1473 1.2977 1.2277 -0.0316 -0.0574 0.1861  61  GLN A OE1 
421  N NE2 . GLN A 59  ? 1.1424 1.2861 1.2136 -0.0224 -0.0458 0.1719  61  GLN A NE2 
422  N N   . GLN A 60  ? 1.0986 1.3405 1.1657 -0.0074 -0.0214 0.1840  62  GLN A N   
423  C CA  . GLN A 60  ? 1.0627 1.2887 1.1209 0.0033  -0.0136 0.1654  62  GLN A CA  
424  C C   . GLN A 60  ? 1.0205 1.2059 1.0694 0.0113  -0.0087 0.1416  62  GLN A C   
425  O O   . GLN A 60  ? 1.0264 1.1773 1.0776 0.0064  -0.0170 0.1361  62  GLN A O   
426  C CB  . GLN A 60  ? 1.0763 1.2959 1.1418 -0.0053 -0.0233 0.1738  62  GLN A CB  
427  C CG  . GLN A 60  ? 1.1062 1.3685 1.1740 -0.0044 -0.0198 0.1869  62  GLN A CG  
428  C CD  . GLN A 60  ? 1.1428 1.4207 1.2251 -0.0214 -0.0349 0.2128  62  GLN A CD  
429  O OE1 . GLN A 60  ? 1.1612 1.4316 1.2530 -0.0350 -0.0483 0.2273  62  GLN A OE1 
430  N NE2 . GLN A 60  ? 1.1041 1.4031 1.1879 -0.0211 -0.0338 0.2192  62  GLN A NE2 
431  N N   . CYS A 61  ? 0.9705 1.1612 1.0084 0.0243  0.0037  0.1275  63  CYS A N   
432  C CA  . CYS A 61  ? 0.9295 1.0868 0.9594 0.0305  0.0079  0.1078  63  CYS A CA  
433  C C   . CYS A 61  ? 0.8981 1.0487 0.9169 0.0428  0.0176  0.0902  63  CYS A C   
434  O O   . CYS A 61  ? 0.8967 1.0685 0.9083 0.0525  0.0250  0.0871  63  CYS A O   
435  C CB  . CYS A 61  ? 0.9239 1.0836 0.9517 0.0318  0.0103  0.1073  63  CYS A CB  
436  S SG  . CYS A 61  ? 0.9160 1.0325 0.9432 0.0287  0.0055  0.0954  63  CYS A SG  
437  N N   . LYS A 62  ? 0.8705 0.9919 0.8876 0.0429  0.0163  0.0788  64  LYS A N   
438  C CA  . LYS A 62  ? 0.8484 0.9644 0.8569 0.0520  0.0231  0.0654  64  LYS A CA  
439  C C   . LYS A 62  ? 0.8283 0.9124 0.8324 0.0542  0.0242  0.0496  64  LYS A C   
440  O O   . LYS A 62  ? 0.8249 0.8903 0.8341 0.0485  0.0179  0.0493  64  LYS A O   
441  C CB  . LYS A 62  ? 0.8604 0.9910 0.8729 0.0502  0.0209  0.0731  64  LYS A CB  
442  C CG  . LYS A 62  ? 0.8880 1.0170 0.8915 0.0600  0.0275  0.0607  64  LYS A CG  
443  C CD  . LYS A 62  ? 0.9405 1.0796 0.9477 0.0581  0.0251  0.0667  64  LYS A CD  
444  C CE  . LYS A 62  ? 0.9378 1.0523 0.9513 0.0506  0.0184  0.0658  64  LYS A CE  
445  N NZ  . LYS A 62  ? 0.9706 1.0893 0.9818 0.0543  0.0204  0.0628  64  LYS A NZ  
446  N N   . GLN A 63  ? 0.8130 0.8925 0.8072 0.0629  0.0312  0.0369  65  GLN A N   
447  C CA  . GLN A 63  ? 0.7973 0.8529 0.7872 0.0649  0.0328  0.0235  65  GLN A CA  
448  C C   . GLN A 63  ? 0.7826 0.8398 0.7663 0.0710  0.0362  0.0166  65  GLN A C   
449  O O   . GLN A 63  ? 0.7891 0.8600 0.7663 0.0781  0.0392  0.0152  65  GLN A O   
450  C CB  . GLN A 63  ? 0.7985 0.8409 0.7830 0.0671  0.0355  0.0149  65  GLN A CB  
451  C CG  . GLN A 63  ? 0.8008 0.8326 0.7758 0.0732  0.0397  0.0023  65  GLN A CG  
452  C CD  . GLN A 63  ? 0.8039 0.8224 0.7748 0.0734  0.0411  -0.0045 65  GLN A CD  
453  O OE1 . GLN A 63  ? 0.7830 0.8054 0.7479 0.0777  0.0429  -0.0065 65  GLN A OE1 
454  N NE2 . GLN A 63  ? 0.7822 0.7865 0.7560 0.0695  0.0398  -0.0081 65  GLN A NE2 
455  N N   . THR A 64  ? 0.7634 0.8061 0.7485 0.0692  0.0349  0.0114  66  THR A N   
456  C CA  . THR A 64  ? 0.7381 0.7803 0.7188 0.0734  0.0368  0.0057  66  THR A CA  
457  C C   . THR A 64  ? 0.7151 0.7395 0.6907 0.0746  0.0384  -0.0053 66  THR A C   
458  O O   . THR A 64  ? 0.7042 0.7173 0.6831 0.0710  0.0372  -0.0074 66  THR A O   
459  C CB  . THR A 64  ? 0.7406 0.7828 0.7285 0.0690  0.0330  0.0107  66  THR A CB  
460  O OG1 . THR A 64  ? 0.7507 0.8094 0.7449 0.0652  0.0297  0.0235  66  THR A OG1 
461  C CG2 . THR A 64  ? 0.7317 0.7753 0.7160 0.0727  0.0346  0.0063  66  THR A CG2 
462  N N   . SER A 65  ? 0.7094 0.7319 0.6770 0.0797  0.0401  -0.0118 67  SER A N   
463  C CA  . SER A 65  ? 0.7043 0.7117 0.6681 0.0789  0.0404  -0.0196 67  SER A CA  
464  C C   . SER A 65  ? 0.7211 0.7254 0.6799 0.0816  0.0393  -0.0242 67  SER A C   
465  O O   . SER A 65  ? 0.7461 0.7552 0.6981 0.0878  0.0382  -0.0257 67  SER A O   
466  C CB  . SER A 65  ? 0.7007 0.7032 0.6589 0.0805  0.0409  -0.0229 67  SER A CB  
467  O OG  . SER A 65  ? 0.6783 0.6869 0.6393 0.0798  0.0417  -0.0182 67  SER A OG  
468  N N   . GLU A 66  ? 0.7134 0.7103 0.6747 0.0779  0.0388  -0.0266 68  GLU A N   
469  C CA  . GLU A 66  ? 0.7201 0.7137 0.6774 0.0793  0.0368  -0.0298 68  GLU A CA  
470  C C   . GLU A 66  ? 0.7195 0.7027 0.6704 0.0785  0.0341  -0.0341 68  GLU A C   
471  O O   . GLU A 66  ? 0.7181 0.6973 0.6691 0.0759  0.0347  -0.0346 68  GLU A O   
472  C CB  . GLU A 66  ? 0.7249 0.7187 0.6884 0.0758  0.0370  -0.0292 68  GLU A CB  
473  C CG  . GLU A 66  ? 0.7415 0.7425 0.7124 0.0751  0.0375  -0.0242 68  GLU A CG  
474  C CD  . GLU A 66  ? 0.7591 0.7585 0.7354 0.0728  0.0365  -0.0250 68  GLU A CD  
475  O OE1 . GLU A 66  ? 0.7430 0.7387 0.7187 0.0713  0.0367  -0.0288 68  GLU A OE1 
476  O OE2 . GLU A 66  ? 0.8003 0.8037 0.7817 0.0724  0.0349  -0.0210 68  GLU A OE2 
477  N N   . TYR A 67  ? 0.7247 0.7033 0.6703 0.0804  0.0300  -0.0367 69  TYR A N   
478  C CA  . TYR A 67  ? 0.7304 0.6970 0.6693 0.0791  0.0241  -0.0396 69  TYR A CA  
479  C C   . TYR A 67  ? 0.7381 0.7002 0.6764 0.0764  0.0197  -0.0399 69  TYR A C   
480  O O   . TYR A 67  ? 0.7402 0.6922 0.6749 0.0723  0.0131  -0.0402 69  TYR A O   
481  C CB  . TYR A 67  ? 0.7388 0.7012 0.6678 0.0871  0.0196  -0.0433 69  TYR A CB  
482  C CG  . TYR A 67  ? 0.7444 0.7108 0.6736 0.0888  0.0231  -0.0427 69  TYR A CG  
483  C CD1 . TYR A 67  ? 0.7171 0.6978 0.6508 0.0916  0.0290  -0.0393 69  TYR A CD1 
484  C CD2 . TYR A 67  ? 0.7416 0.6980 0.6673 0.0866  0.0199  -0.0443 69  TYR A CD2 
485  C CE1 . TYR A 67  ? 0.7042 0.6890 0.6387 0.0923  0.0316  -0.0377 69  TYR A CE1 
486  C CE2 . TYR A 67  ? 0.7351 0.6950 0.6609 0.0880  0.0232  -0.0437 69  TYR A CE2 
487  C CZ  . TYR A 67  ? 0.7258 0.6999 0.6561 0.0910  0.0291  -0.0406 69  TYR A CZ  
488  O OH  . TYR A 67  ? 0.7426 0.7201 0.6732 0.0918  0.0316  -0.0393 69  TYR A OH  
489  N N   . LEU A 68  ? 0.7260 0.6957 0.6682 0.0780  0.0224  -0.0388 70  LEU A N   
490  C CA  . LEU A 68  ? 0.7288 0.6963 0.6720 0.0751  0.0192  -0.0385 70  LEU A CA  
491  C C   . LEU A 68  ? 0.7326 0.7103 0.6842 0.0737  0.0246  -0.0361 70  LEU A C   
492  O O   . LEU A 68  ? 0.7463 0.7312 0.6999 0.0776  0.0280  -0.0351 70  LEU A O   
493  C CB  . LEU A 68  ? 0.7356 0.6975 0.6700 0.0819  0.0128  -0.0420 70  LEU A CB  
494  C CG  . LEU A 68  ? 0.6974 0.6506 0.6297 0.0784  0.0054  -0.0421 70  LEU A CG  
495  C CD1 . LEU A 68  ? 0.7144 0.6582 0.6466 0.0699  -0.0005 -0.0398 70  LEU A CD1 
496  C CD2 . LEU A 68  ? 0.6950 0.6408 0.6166 0.0877  -0.0023 -0.0472 70  LEU A CD2 
497  N N   . ARG A 69  ? 0.7408 0.7203 0.6975 0.0680  0.0247  -0.0346 71  ARG A N   
498  C CA  . ARG A 69  ? 0.7442 0.7316 0.7077 0.0676  0.0278  -0.0334 71  ARG A CA  
499  C C   . ARG A 69  ? 0.7391 0.7255 0.7027 0.0632  0.0240  -0.0325 71  ARG A C   
500  O O   . ARG A 69  ? 0.7496 0.7383 0.7150 0.0578  0.0232  -0.0307 71  ARG A O   
501  C CB  . ARG A 69  ? 0.7365 0.7306 0.7072 0.0662  0.0319  -0.0328 71  ARG A CB  
502  C CG  . ARG A 69  ? 0.8043 0.8011 0.7785 0.0696  0.0341  -0.0319 71  ARG A CG  
503  C CD  . ARG A 69  ? 0.8875 0.8874 0.8679 0.0691  0.0352  -0.0325 71  ARG A CD  
504  N NE  . ARG A 69  ? 0.9402 0.9393 0.9235 0.0707  0.0347  -0.0306 71  ARG A NE  
505  C CZ  . ARG A 69  ? 0.9592 0.9575 0.9467 0.0714  0.0333  -0.0316 71  ARG A CZ  
506  N NH1 . ARG A 69  ? 0.9724 0.9731 0.9610 0.0724  0.0333  -0.0355 71  ARG A NH1 
507  N NH2 . ARG A 69  ? 0.9902 0.9862 0.9805 0.0715  0.0308  -0.0283 71  ARG A NH2 
508  N N   . TYR A 70  ? 0.7313 0.7156 0.6926 0.0650  0.0211  -0.0330 72  TYR A N   
509  C CA  . TYR A 70  ? 0.7204 0.7027 0.6815 0.0601  0.0161  -0.0313 72  TYR A CA  
510  C C   . TYR A 70  ? 0.7107 0.6978 0.6748 0.0621  0.0172  -0.0314 72  TYR A C   
511  O O   . TYR A 70  ? 0.6949 0.6811 0.6566 0.0678  0.0178  -0.0332 72  TYR A O   
512  C CB  . TYR A 70  ? 0.7395 0.7079 0.6917 0.0598  0.0070  -0.0321 72  TYR A CB  
513  C CG  . TYR A 70  ? 0.7495 0.7141 0.7014 0.0540  -0.0006 -0.0291 72  TYR A CG  
514  C CD1 . TYR A 70  ? 0.7614 0.7270 0.7157 0.0444  -0.0052 -0.0235 72  TYR A CD1 
515  C CD2 . TYR A 70  ? 0.7255 0.6876 0.6754 0.0572  -0.0034 -0.0306 72  TYR A CD2 
516  C CE1 . TYR A 70  ? 0.7812 0.7451 0.7364 0.0376  -0.0132 -0.0187 72  TYR A CE1 
517  C CE2 . TYR A 70  ? 0.7606 0.7194 0.7109 0.0514  -0.0108 -0.0273 72  TYR A CE2 
518  C CZ  . TYR A 70  ? 0.7866 0.7461 0.7396 0.0413  -0.0161 -0.0210 72  TYR A CZ  
519  O OH  . TYR A 70  ? 0.8150 0.7722 0.7689 0.0344  -0.0246 -0.0161 72  TYR A OH  
520  N N   . GLU A 71  ? 0.7167 0.7116 0.6866 0.0574  0.0176  -0.0289 73  GLU A N   
521  C CA  . GLU A 71  ? 0.7241 0.7237 0.6974 0.0590  0.0186  -0.0290 73  GLU A CA  
522  C C   . GLU A 71  ? 0.7278 0.7319 0.7035 0.0530  0.0149  -0.0256 73  GLU A C   
523  O O   . GLU A 71  ? 0.7369 0.7482 0.7153 0.0475  0.0145  -0.0223 73  GLU A O   
524  C CB  . GLU A 71  ? 0.7130 0.7211 0.6927 0.0624  0.0243  -0.0302 73  GLU A CB  
525  C CG  . GLU A 71  ? 0.7426 0.7570 0.7261 0.0617  0.0274  -0.0305 73  GLU A CG  
526  C CD  . GLU A 71  ? 0.7774 0.7944 0.7653 0.0662  0.0300  -0.0324 73  GLU A CD  
527  O OE1 . GLU A 71  ? 0.7943 0.8102 0.7837 0.0685  0.0294  -0.0323 73  GLU A OE1 
528  O OE2 . GLU A 71  ? 0.7940 0.8135 0.7837 0.0673  0.0315  -0.0337 73  GLU A OE2 
529  N N   . ASP A 72  ? 0.7335 0.7347 0.7080 0.0538  0.0118  -0.0257 74  ASP A N   
530  C CA  . ASP A 72  ? 0.7399 0.7440 0.7162 0.0476  0.0067  -0.0216 74  ASP A CA  
531  C C   . ASP A 72  ? 0.7223 0.7271 0.6996 0.0509  0.0069  -0.0230 74  ASP A C   
532  O O   . ASP A 72  ? 0.7101 0.7093 0.6841 0.0573  0.0082  -0.0267 74  ASP A O   
533  C CB  . ASP A 72  ? 0.7776 0.7677 0.7469 0.0432  -0.0035 -0.0195 74  ASP A CB  
534  C CG  . ASP A 72  ? 0.8447 0.8404 0.8177 0.0326  -0.0105 -0.0115 74  ASP A CG  
535  O OD1 . ASP A 72  ? 0.9013 0.9157 0.8818 0.0277  -0.0061 -0.0068 74  ASP A OD1 
536  O OD2 . ASP A 72  ? 0.9121 0.8942 0.8800 0.0293  -0.0215 -0.0096 74  ASP A OD2 
537  N N   . THR A 73  ? 0.7122 0.7267 0.6946 0.0462  0.0057  -0.0194 75  THR A N   
538  C CA  . THR A 73  ? 0.7024 0.7174 0.6859 0.0480  0.0048  -0.0200 75  THR A CA  
539  C C   . THR A 73  ? 0.7214 0.7273 0.7009 0.0421  -0.0052 -0.0163 75  THR A C   
540  O O   . THR A 73  ? 0.7252 0.7357 0.7068 0.0340  -0.0094 -0.0103 75  THR A O   
541  C CB  . THR A 73  ? 0.6899 0.7225 0.6818 0.0476  0.0097  -0.0188 75  THR A CB  
542  O OG1 . THR A 73  ? 0.6653 0.7019 0.6596 0.0533  0.0160  -0.0227 75  THR A OG1 
543  C CG2 . THR A 73  ? 0.6809 0.7142 0.6744 0.0499  0.0092  -0.0197 75  THR A CG2 
544  N N   . LEU A 74  ? 0.7145 0.7082 0.6880 0.0463  -0.0097 -0.0194 76  LEU A N   
545  C CA  . LEU A 74  ? 0.7424 0.7221 0.7097 0.0429  -0.0218 -0.0176 76  LEU A CA  
546  C C   . LEU A 74  ? 0.7676 0.7517 0.7387 0.0391  -0.0253 -0.0142 76  LEU A C   
547  O O   . LEU A 74  ? 0.7518 0.7474 0.7283 0.0421  -0.0177 -0.0154 76  LEU A O   
548  C CB  . LEU A 74  ? 0.7352 0.6984 0.6915 0.0522  -0.0265 -0.0245 76  LEU A CB  
549  C CG  . LEU A 74  ? 0.7281 0.6881 0.6803 0.0571  -0.0232 -0.0280 76  LEU A CG  
550  C CD1 . LEU A 74  ? 0.7223 0.6686 0.6624 0.0673  -0.0297 -0.0348 76  LEU A CD1 
551  C CD2 . LEU A 74  ? 0.6675 0.6263 0.6215 0.0487  -0.0262 -0.0234 76  LEU A CD2 
552  N N   . LEU A 75  ? 0.8094 0.7825 0.7771 0.0326  -0.0381 -0.0099 77  LEU A N   
553  C CA  . LEU A 75  ? 0.8319 0.8118 0.8048 0.0256  -0.0425 -0.0038 77  LEU A CA  
554  C C   . LEU A 75  ? 0.8708 0.8301 0.8358 0.0245  -0.0576 -0.0037 77  LEU A C   
555  O O   . LEU A 75  ? 0.8969 0.8402 0.8560 0.0206  -0.0699 -0.0018 77  LEU A O   
556  C CB  . LEU A 75  ? 0.8300 0.8255 0.8111 0.0132  -0.0443 0.0069  77  LEU A CB  
557  C CG  . LEU A 75  ? 0.8128 0.8299 0.8010 0.0140  -0.0317 0.0074  77  LEU A CG  
558  C CD1 . LEU A 75  ? 0.8135 0.8471 0.8082 0.0015  -0.0362 0.0192  77  LEU A CD1 
559  C CD2 . LEU A 75  ? 0.7738 0.8075 0.7681 0.0211  -0.0198 0.0030  77  LEU A CD2 
560  N N   . LEU A 76  ? 0.8965 0.8552 0.8614 0.0277  -0.0582 -0.0056 78  LEU A N   
561  C CA  . LEU A 76  ? 0.9371 0.8753 0.8939 0.0274  -0.0741 -0.0062 78  LEU A CA  
562  C C   . LEU A 76  ? 0.9823 0.9206 0.9440 0.0122  -0.0862 0.0058  78  LEU A C   
563  O O   . LEU A 76  ? 0.9699 0.9315 0.9430 0.0032  -0.0796 0.0146  78  LEU A O   
564  C CB  . LEU A 76  ? 0.9216 0.8628 0.8790 0.0323  -0.0716 -0.0091 78  LEU A CB  
565  C CG  . LEU A 76  ? 0.8941 0.8405 0.8493 0.0451  -0.0601 -0.0178 78  LEU A CG  
566  C CD1 . LEU A 76  ? 0.8990 0.8500 0.8575 0.0445  -0.0603 -0.0166 78  LEU A CD1 
567  C CD2 . LEU A 76  ? 0.9433 0.8728 0.8849 0.0572  -0.0659 -0.0269 78  LEU A CD2 
568  N N   . GLU A 77  ? 1.0444 0.9579 0.9972 0.0095  -0.1049 0.0067  79  GLU A N   
569  C CA  . GLU A 77  ? 1.0931 1.0034 1.0500 -0.0068 -0.1208 0.0200  79  GLU A CA  
570  C C   . GLU A 77  ? 1.1001 1.0230 1.0650 -0.0145 -0.1224 0.0280  79  GLU A C   
571  O O   . GLU A 77  ? 1.1010 1.0466 1.0775 -0.0277 -0.1208 0.0410  79  GLU A O   
572  C CB  . GLU A 77  ? 1.1415 1.0179 1.0857 -0.0062 -0.1430 0.0177  79  GLU A CB  
573  C CG  . GLU A 77  ? 1.1841 1.0514 1.1216 0.0002  -0.1414 0.0113  79  GLU A CG  
574  C CD  . GLU A 77  ? 1.2900 1.1212 1.2125 0.0049  -0.1644 0.0057  79  GLU A CD  
575  O OE1 . GLU A 77  ? 1.3100 1.1287 1.2205 0.0223  -0.1630 -0.0088 79  GLU A OE1 
576  O OE2 . GLU A 77  ? 1.3170 1.1332 1.2394 -0.0083 -0.1849 0.0159  79  GLU A OE2 
577  N N   . ASP A 78  ? 1.1083 1.0207 1.0677 -0.0058 -0.1242 0.0204  80  ASP A N   
578  C CA  . ASP A 78  ? 1.1240 1.0491 1.0912 -0.0124 -0.1245 0.0273  80  ASP A CA  
579  C C   . ASP A 78  ? 1.0904 1.0479 1.0690 -0.0103 -0.1035 0.0276  80  ASP A C   
580  O O   . ASP A 78  ? 1.0904 1.0560 1.0728 -0.0098 -0.1010 0.0282  80  ASP A O   
581  C CB  . ASP A 78  ? 1.1435 1.0461 1.1009 -0.0040 -0.1349 0.0195  80  ASP A CB  
582  C CG  . ASP A 78  ? 1.1652 1.0797 1.1304 -0.0111 -0.1360 0.0268  80  ASP A CG  
583  O OD1 . ASP A 78  ? 1.1922 1.1064 1.1624 -0.0262 -0.1503 0.0401  80  ASP A OD1 
584  O OD2 . ASP A 78  ? 1.1392 1.0645 1.1063 -0.0023 -0.1232 0.0203  80  ASP A OD2 
585  N N   . GLN A 79  ? 1.0652 1.0400 1.0486 -0.0083 -0.0895 0.0266  81  GLN A N   
586  C CA  . GLN A 79  ? 1.0381 1.0395 1.0303 -0.0038 -0.0718 0.0246  81  GLN A CA  
587  C C   . GLN A 79  ? 1.0262 1.0552 1.0282 -0.0108 -0.0644 0.0327  81  GLN A C   
588  O O   . GLN A 79  ? 1.0016 1.0435 1.0061 -0.0035 -0.0507 0.0270  81  GLN A O   
589  C CB  . GLN A 79  ? 1.0202 1.0149 1.0069 0.0112  -0.0606 0.0113  81  GLN A CB  
590  C CG  . GLN A 79  ? 1.0227 1.0405 1.0174 0.0166  -0.0440 0.0084  81  GLN A CG  
591  C CD  . GLN A 79  ? 1.0900 1.1208 1.0907 0.0177  -0.0400 0.0090  81  GLN A CD  
592  O OE1 . GLN A 79  ? 1.0915 1.1353 1.0967 0.0245  -0.0289 0.0044  81  GLN A OE1 
593  N NE2 . GLN A 79  ? 1.1098 1.1358 1.1105 0.0113  -0.0503 0.0144  81  GLN A NE2 
594  N N   . PRO A 80  ? 1.0352 1.0751 1.0429 -0.0252 -0.0742 0.0467  82  PRO A N   
595  C CA  . PRO A 80  ? 1.0244 1.0873 1.0387 -0.0322 -0.0704 0.0550  82  PRO A CA  
596  C C   . PRO A 80  ? 0.9892 1.0867 1.0122 -0.0262 -0.0534 0.0532  82  PRO A C   
597  O O   . PRO A 80  ? 0.9915 1.1082 1.0184 -0.0280 -0.0481 0.0567  82  PRO A O   
598  C CB  . PRO A 80  ? 1.0540 1.1239 1.0735 -0.0497 -0.0859 0.0723  82  PRO A CB  
599  C CG  . PRO A 80  ? 1.0636 1.1307 1.0840 -0.0497 -0.0899 0.0727  82  PRO A CG  
600  C CD  . PRO A 80  ? 1.0617 1.0964 1.0707 -0.0362 -0.0894 0.0568  82  PRO A CD  
601  N N   . THR A 81  ? 0.9566 1.0612 0.9818 -0.0181 -0.0459 0.0470  83  THR A N   
602  C CA  . THR A 81  ? 0.9254 1.0637 0.9587 -0.0126 -0.0335 0.0461  83  THR A CA  
603  C C   . THR A 81  ? 0.8928 1.0411 0.9261 -0.0031 -0.0219 0.0384  83  THR A C   
604  O O   . THR A 81  ? 0.9016 1.0810 0.9411 -0.0039 -0.0172 0.0432  83  THR A O   
605  C CB  . THR A 81  ? 0.9158 1.0588 0.9515 -0.0067 -0.0302 0.0419  83  THR A CB  
606  O OG1 . THR A 81  ? 0.9193 1.0315 0.9470 0.0012  -0.0303 0.0311  83  THR A OG1 
607  C CG2 . THR A 81  ? 0.9337 1.0847 0.9738 -0.0187 -0.0405 0.0543  83  THR A CG2 
608  N N   . GLY A 82  ? 0.8556 0.9806 0.8821 0.0057  -0.0179 0.0273  84  GLY A N   
609  C CA  . GLY A 82  ? 0.8063 0.9396 0.8331 0.0138  -0.0087 0.0208  84  GLY A CA  
610  C C   . GLY A 82  ? 0.7680 0.8888 0.7918 0.0265  -0.0016 0.0084  84  GLY A C   
611  O O   . GLY A 82  ? 0.7752 0.8860 0.7979 0.0301  -0.0020 0.0046  84  GLY A O   
612  N N   . GLU A 83  ? 0.7389 0.8607 0.7617 0.0327  0.0042  0.0029  85  GLU A N   
613  C CA  . GLU A 83  ? 0.7011 0.8084 0.7210 0.0427  0.0088  -0.0070 85  GLU A CA  
614  C C   . GLU A 83  ? 0.6798 0.7995 0.7041 0.0513  0.0127  -0.0122 85  GLU A C   
615  O O   . GLU A 83  ? 0.6745 0.7852 0.6977 0.0591  0.0153  -0.0193 85  GLU A O   
616  C CB  . GLU A 83  ? 0.6922 0.7964 0.7100 0.0457  0.0122  -0.0102 85  GLU A CB  
617  C CG  . GLU A 83  ? 0.7275 0.8203 0.7409 0.0384  0.0082  -0.0059 85  GLU A CG  
618  C CD  . GLU A 83  ? 0.7244 0.8215 0.7374 0.0407  0.0122  -0.0078 85  GLU A CD  
619  O OE1 . GLU A 83  ? 0.7198 0.8160 0.7331 0.0493  0.0171  -0.0148 85  GLU A OE1 
620  O OE2 . GLU A 83  ? 0.7161 0.8168 0.7285 0.0336  0.0095  -0.0020 85  GLU A OE2 
621  N N   . ASN A 84  ? 0.6613 0.8024 0.6907 0.0499  0.0121  -0.0084 86  ASN A N   
622  C CA  . ASN A 84  ? 0.6343 0.7853 0.6668 0.0592  0.0144  -0.0143 86  ASN A CA  
623  C C   . ASN A 84  ? 0.6402 0.7889 0.6743 0.0563  0.0114  -0.0118 86  ASN A C   
624  O O   . ASN A 84  ? 0.6302 0.7937 0.6680 0.0616  0.0121  -0.0137 86  ASN A O   
625  C CB  . ASN A 84  ? 0.6315 0.8141 0.6684 0.0642  0.0168  -0.0143 86  ASN A CB  
626  C CG  . ASN A 84  ? 0.6055 0.8134 0.6466 0.0546  0.0151  -0.0029 86  ASN A CG  
627  O OD1 . ASN A 84  ? 0.5669 0.7657 0.6070 0.0426  0.0110  0.0056  86  ASN A OD1 
628  N ND2 . ASN A 84  ? 0.5437 0.7843 0.5893 0.0600  0.0169  -0.0023 86  ASN A ND2 
629  N N   . GLU A 85  ? 0.6433 0.7728 0.6736 0.0489  0.0074  -0.0080 87  GLU A N   
630  C CA  . GLU A 85  ? 0.6682 0.7894 0.6981 0.0464  0.0037  -0.0063 87  GLU A CA  
631  C C   . GLU A 85  ? 0.6690 0.7625 0.6918 0.0469  0.0017  -0.0095 87  GLU A C   
632  O O   . GLU A 85  ? 0.6749 0.7568 0.6929 0.0423  -0.0016 -0.0073 87  GLU A O   
633  C CB  . GLU A 85  ? 0.6908 0.8204 0.7225 0.0354  -0.0022 0.0037  87  GLU A CB  
634  C CG  . GLU A 85  ? 0.7612 0.8821 0.7923 0.0325  -0.0073 0.0057  87  GLU A CG  
635  C CD  . GLU A 85  ? 0.8846 1.0320 0.9233 0.0304  -0.0073 0.0109  87  GLU A CD  
636  O OE1 . GLU A 85  ? 0.8851 1.0513 0.9280 0.0390  -0.0013 0.0062  87  GLU A OE1 
637  O OE2 . GLU A 85  ? 0.8974 1.0468 0.9375 0.0204  -0.0145 0.0200  87  GLU A OE2 
638  N N   . MET A 86  ? 0.6647 0.7490 0.6865 0.0529  0.0029  -0.0145 88  MET A N   
639  C CA  . MET A 86  ? 0.6609 0.7248 0.6761 0.0547  0.0015  -0.0171 88  MET A CA  
640  C C   . MET A 86  ? 0.6696 0.7231 0.6802 0.0500  -0.0054 -0.0140 88  MET A C   
641  O O   . MET A 86  ? 0.6820 0.7425 0.6956 0.0454  -0.0089 -0.0099 88  MET A O   
642  C CB  . MET A 86  ? 0.6525 0.7127 0.6687 0.0616  0.0041  -0.0215 88  MET A CB  
643  C CG  . MET A 86  ? 0.6571 0.7167 0.6743 0.0663  0.0077  -0.0248 88  MET A CG  
644  S SD  . MET A 86  ? 0.6241 0.6826 0.6451 0.0724  0.0078  -0.0278 88  MET A SD  
645  C CE  . MET A 86  ? 0.5952 0.6694 0.6221 0.0737  0.0071  -0.0287 88  MET A CE  
646  N N   . VAL A 87  ? 0.6691 0.7065 0.6720 0.0521  -0.0079 -0.0163 89  VAL A N   
647  C CA  . VAL A 87  ? 0.6828 0.7067 0.6788 0.0501  -0.0163 -0.0153 89  VAL A CA  
648  C C   . VAL A 87  ? 0.6953 0.7129 0.6877 0.0564  -0.0167 -0.0190 89  VAL A C   
649  O O   . VAL A 87  ? 0.6816 0.7009 0.6739 0.0626  -0.0110 -0.0221 89  VAL A O   
650  C CB  . VAL A 87  ? 0.6785 0.6894 0.6667 0.0506  -0.0203 -0.0167 89  VAL A CB  
651  C CG1 . VAL A 87  ? 0.6736 0.6671 0.6523 0.0518  -0.0310 -0.0182 89  VAL A CG1 
652  C CG2 . VAL A 87  ? 0.6829 0.7006 0.6750 0.0429  -0.0211 -0.0117 89  VAL A CG2 
653  N N   . ILE A 88  ? 0.7152 0.7265 0.7048 0.0543  -0.0240 -0.0176 90  ILE A N   
654  C CA  . ILE A 88  ? 0.7324 0.7388 0.7177 0.0609  -0.0247 -0.0212 90  ILE A CA  
655  C C   . ILE A 88  ? 0.7443 0.7352 0.7176 0.0661  -0.0322 -0.0250 90  ILE A C   
656  O O   . ILE A 88  ? 0.7594 0.7387 0.7279 0.0625  -0.0424 -0.0239 90  ILE A O   
657  C CB  . ILE A 88  ? 0.7393 0.7506 0.7294 0.0579  -0.0268 -0.0187 90  ILE A CB  
658  C CG1 . ILE A 88  ? 0.7196 0.7480 0.7207 0.0541  -0.0203 -0.0157 90  ILE A CG1 
659  C CG2 . ILE A 88  ? 0.7279 0.7373 0.7147 0.0652  -0.0257 -0.0221 90  ILE A CG2 
660  C CD1 . ILE A 88  ? 0.7101 0.7461 0.7164 0.0549  -0.0189 -0.0152 90  ILE A CD1 
661  N N   . MET A 89  ? 0.7526 0.7443 0.7210 0.0748  -0.0282 -0.0291 91  MET A N   
662  C CA  . MET A 89  ? 0.7929 0.7730 0.7486 0.0827  -0.0354 -0.0341 91  MET A CA  
663  C C   . MET A 89  ? 0.8170 0.7970 0.7674 0.0897  -0.0384 -0.0369 91  MET A C   
664  O O   . MET A 89  ? 0.8061 0.7974 0.7628 0.0899  -0.0319 -0.0349 91  MET A O   
665  C CB  . MET A 89  ? 0.7771 0.7615 0.7295 0.0887  -0.0299 -0.0365 91  MET A CB  
666  C CG  . MET A 89  ? 0.7814 0.7606 0.7348 0.0833  -0.0305 -0.0353 91  MET A CG  
667  S SD  . MET A 89  ? 0.7971 0.7786 0.7441 0.0916  -0.0265 -0.0389 91  MET A SD  
668  C CE  . MET A 89  ? 0.7626 0.7372 0.7122 0.0832  -0.0279 -0.0367 91  MET A CE  
669  N N   . ARG A 90  ? 0.8679 0.8347 0.8062 0.0964  -0.0492 -0.0419 92  ARG A N   
670  C CA  . ARG A 90  ? 0.9111 0.8784 0.8425 0.1052  -0.0529 -0.0457 92  ARG A CA  
671  C C   . ARG A 90  ? 0.9447 0.9087 0.8610 0.1202  -0.0591 -0.0535 92  ARG A C   
672  O O   . ARG A 90  ? 0.9669 0.9172 0.8740 0.1241  -0.0679 -0.0580 92  ARG A O   
673  C CB  . ARG A 90  ? 0.9256 0.8807 0.8568 0.0998  -0.0631 -0.0445 92  ARG A CB  
674  C CG  . ARG A 90  ? 0.9281 0.8946 0.8714 0.0923  -0.0559 -0.0390 92  ARG A CG  
675  C CD  . ARG A 90  ? 0.9935 0.9512 0.9413 0.0813  -0.0638 -0.0343 92  ARG A CD  
676  N NE  . ARG A 90  ? 1.0159 0.9886 0.9778 0.0723  -0.0544 -0.0280 92  ARG A NE  
677  C CZ  . ARG A 90  ? 1.0304 1.0039 0.9990 0.0621  -0.0586 -0.0220 92  ARG A CZ  
678  N NH1 . ARG A 90  ? 1.0637 1.0216 1.0265 0.0582  -0.0728 -0.0206 92  ARG A NH1 
679  N NH2 . ARG A 90  ? 0.9950 0.9851 0.9756 0.0563  -0.0501 -0.0174 92  ARG A NH2 
680  N N   . PRO A 91  ? 0.9580 0.9352 0.8710 0.1294  -0.0558 -0.0553 93  PRO A N   
681  C CA  . PRO A 91  ? 0.9904 0.9686 0.8878 0.1461  -0.0625 -0.0635 93  PRO A CA  
682  C C   . PRO A 91  ? 1.0339 0.9853 0.9193 0.1495  -0.0800 -0.0704 93  PRO A C   
683  O O   . PRO A 91  ? 1.0437 0.9802 0.9334 0.1392  -0.0867 -0.0674 93  PRO A O   
684  C CB  . PRO A 91  ? 0.9941 0.9855 0.8908 0.1519  -0.0605 -0.0632 93  PRO A CB  
685  C CG  . PRO A 91  ? 0.9539 0.9493 0.8668 0.1371  -0.0526 -0.0547 93  PRO A CG  
686  C CD  . PRO A 91  ? 0.9318 0.9248 0.8548 0.1256  -0.0468 -0.0499 93  PRO A CD  
687  N N   . GLY A 92  ? 1.0717 1.0171 0.9425 0.1634  -0.0885 -0.0789 94  GLY A N   
688  C CA  . GLY A 92  ? 1.1200 1.0378 0.9771 0.1693  -0.1087 -0.0868 94  GLY A CA  
689  C C   . GLY A 92  ? 1.1430 1.0414 0.9981 0.1638  -0.1169 -0.0872 94  GLY A C   
690  O O   . GLY A 92  ? 1.1691 1.0623 1.0115 0.1768  -0.1239 -0.0953 94  GLY A O   
691  N N   . ASN A 93  ? 1.1290 1.0184 0.9964 0.1451  -0.1165 -0.0782 95  ASN A N   
692  C CA  . ASN A 93  ? 1.1343 1.0097 1.0020 0.1377  -0.1222 -0.0763 95  ASN A CA  
693  C C   . ASN A 93  ? 1.1023 0.9957 0.9737 0.1404  -0.1074 -0.0759 95  ASN A C   
694  O O   . ASN A 93  ? 1.0804 0.9978 0.9567 0.1446  -0.0923 -0.0747 95  ASN A O   
695  C CB  . ASN A 93  ? 1.1368 1.0042 1.0173 0.1172  -0.1249 -0.0654 95  ASN A CB  
696  C CG  . ASN A 93  ? 1.1334 1.0174 1.0271 0.1086  -0.1134 -0.0583 95  ASN A CG  
697  O OD1 . ASN A 93  ? 1.1091 1.0151 1.0092 0.1116  -0.0971 -0.0576 95  ASN A OD1 
698  N ND2 . ASN A 93  ? 1.1869 1.0602 1.0849 0.0974  -0.1233 -0.0524 95  ASN A ND2 
699  N N   . LYS A 94  ? 1.1020 0.9828 0.9712 0.1369  -0.1131 -0.0759 96  LYS A N   
700  C CA  . LYS A 94  ? 1.0735 0.9636 0.9401 0.1436  -0.1057 -0.0788 96  LYS A CA  
701  C C   . LYS A 94  ? 1.0409 0.9250 0.9181 0.1268  -0.1039 -0.0705 96  LYS A C   
702  O O   . LYS A 94  ? 1.0531 0.9149 0.9265 0.1208  -0.1193 -0.0697 96  LYS A O   
703  C CB  . LYS A 94  ? 1.1285 1.0015 0.9756 0.1608  -0.1227 -0.0907 96  LYS A CB  
704  C CG  . LYS A 94  ? 1.1406 1.0253 0.9797 0.1748  -0.1176 -0.0972 96  LYS A CG  
705  C CD  . LYS A 94  ? 1.2121 1.0810 1.0293 0.1961  -0.1366 -0.1114 96  LYS A CD  
706  C CE  . LYS A 94  ? 1.2400 1.1212 1.0483 0.2111  -0.1332 -0.1182 96  LYS A CE  
707  N NZ  . LYS A 94  ? 1.2400 1.0996 1.0450 0.2070  -0.1427 -0.1195 96  LYS A NZ  
708  N N   . TYR A 95  ? 0.9942 0.8985 0.8846 0.1190  -0.0863 -0.0639 97  TYR A N   
709  C CA  . TYR A 95  ? 0.9588 0.8638 0.8618 0.1024  -0.0820 -0.0549 97  TYR A CA  
710  C C   . TYR A 95  ? 0.9541 0.8570 0.8551 0.1030  -0.0805 -0.0559 97  TYR A C   
711  O O   . TYR A 95  ? 0.9313 0.8473 0.8311 0.1111  -0.0704 -0.0590 97  TYR A O   
712  C CB  . TYR A 95  ? 0.9230 0.8497 0.8406 0.0953  -0.0655 -0.0485 97  TYR A CB  
713  C CG  . TYR A 95  ? 0.9127 0.8419 0.8343 0.0924  -0.0667 -0.0462 97  TYR A CG  
714  C CD1 . TYR A 95  ? 0.9072 0.8316 0.8358 0.0797  -0.0723 -0.0394 97  TYR A CD1 
715  C CD2 . TYR A 95  ? 0.8981 0.8364 0.8168 0.1021  -0.0624 -0.0499 97  TYR A CD2 
716  C CE1 . TYR A 95  ? 0.8638 0.7908 0.7960 0.0770  -0.0736 -0.0372 97  TYR A CE1 
717  C CE2 . TYR A 95  ? 0.8932 0.8329 0.8153 0.0994  -0.0639 -0.0479 97  TYR A CE2 
718  C CZ  . TYR A 95  ? 0.8954 0.8288 0.8243 0.0870  -0.0693 -0.0419 97  TYR A CZ  
719  O OH  . TYR A 95  ? 0.9352 0.8715 0.8682 0.0841  -0.0703 -0.0395 97  TYR A OH  
720  N N   . GLU A 96  ? 0.9708 0.8579 0.8716 0.0936  -0.0912 -0.0524 98  GLU A N   
721  C CA  . GLU A 96  ? 0.9854 0.8635 0.8804 0.0957  -0.0954 -0.0549 98  GLU A CA  
722  C C   . GLU A 96  ? 0.9604 0.8449 0.8672 0.0808  -0.0893 -0.0457 98  GLU A C   
723  O O   . GLU A 96  ? 0.9678 0.8488 0.8814 0.0671  -0.0954 -0.0373 98  GLU A O   
724  C CB  . GLU A 96  ? 1.0305 0.8803 0.9108 0.1012  -0.1180 -0.0606 98  GLU A CB  
725  C CG  . GLU A 96  ? 1.1057 0.9519 0.9709 0.1215  -0.1235 -0.0729 98  GLU A CG  
726  C CD  . GLU A 96  ? 1.2458 1.0618 1.0948 0.1295  -0.1482 -0.0806 98  GLU A CD  
727  O OE1 . GLU A 96  ? 1.2922 1.0884 1.1421 0.1185  -0.1640 -0.0755 98  GLU A OE1 
728  O OE2 . GLU A 96  ? 1.3012 1.1138 1.1364 0.1472  -0.1531 -0.0917 98  GLU A OE2 
729  N N   . TYR A 97  ? 0.9268 0.8230 0.8362 0.0836  -0.0772 -0.0468 99  TYR A N   
730  C CA  . TYR A 97  ? 0.8976 0.8037 0.8181 0.0716  -0.0691 -0.0392 99  TYR A CA  
731  C C   . TYR A 97  ? 0.9146 0.8088 0.8284 0.0730  -0.0754 -0.0414 99  TYR A C   
732  O O   . TYR A 97  ? 0.9135 0.8083 0.8201 0.0848  -0.0721 -0.0485 99  TYR A O   
733  C CB  . TYR A 97  ? 0.8529 0.7815 0.7827 0.0733  -0.0505 -0.0384 99  TYR A CB  
734  C CG  . TYR A 97  ? 0.8139 0.7561 0.7524 0.0707  -0.0429 -0.0354 99  TYR A CG  
735  C CD1 . TYR A 97  ? 0.7976 0.7524 0.7479 0.0606  -0.0366 -0.0287 99  TYR A CD1 
736  C CD2 . TYR A 97  ? 0.7866 0.7308 0.7213 0.0792  -0.0422 -0.0395 99  TYR A CD2 
737  C CE1 . TYR A 97  ? 0.7331 0.6997 0.6907 0.0593  -0.0306 -0.0268 99  TYR A CE1 
738  C CE2 . TYR A 97  ? 0.7371 0.6925 0.6797 0.0766  -0.0361 -0.0367 99  TYR A CE2 
739  C CZ  . TYR A 97  ? 0.7108 0.6766 0.6649 0.0667  -0.0306 -0.0306 99  TYR A CZ  
740  O OH  . TYR A 97  ? 0.6867 0.6638 0.6485 0.0650  -0.0250 -0.0284 99  TYR A OH  
741  N N   . LYS A 98  ? 0.9275 0.8127 0.8437 0.0610  -0.0848 -0.0346 100 LYS A N   
742  C CA  . LYS A 98  ? 0.9495 0.8234 0.8603 0.0610  -0.0910 -0.0358 100 LYS A CA  
743  C C   . LYS A 98  ? 0.9204 0.8118 0.8396 0.0577  -0.0753 -0.0329 100 LYS A C   
744  O O   . LYS A 98  ? 0.9049 0.8136 0.8361 0.0481  -0.0657 -0.0256 100 LYS A O   
745  C CB  . LYS A 98  ? 0.9785 0.8363 0.8892 0.0478  -0.1086 -0.0277 100 LYS A CB  
746  C CG  . LYS A 98  ? 1.0383 0.8723 0.9393 0.0500  -0.1292 -0.0301 100 LYS A CG  
747  C CD  . LYS A 98  ? 1.0960 0.9219 1.0026 0.0315  -0.1440 -0.0170 100 LYS A CD  
748  C CE  . LYS A 98  ? 1.1585 0.9499 1.0518 0.0327  -0.1710 -0.0195 100 LYS A CE  
749  N NZ  . LYS A 98  ? 1.1800 0.9665 1.0810 0.0117  -0.1860 -0.0034 100 LYS A NZ  
750  N N   . PHE A 99  ? 0.9178 0.8050 0.8304 0.0658  -0.0739 -0.0388 101 PHE A N   
751  C CA  . PHE A 99  ? 0.8936 0.7918 0.8131 0.0606  -0.0638 -0.0351 101 PHE A CA  
752  C C   . PHE A 99  ? 0.9225 0.8039 0.8340 0.0607  -0.0747 -0.0367 101 PHE A C   
753  O O   . PHE A 99  ? 0.9504 0.8128 0.8490 0.0703  -0.0878 -0.0440 101 PHE A O   
754  C CB  . PHE A 99  ? 0.8591 0.7733 0.7809 0.0696  -0.0479 -0.0396 101 PHE A CB  
755  C CG  . PHE A 99  ? 0.8574 0.7657 0.7677 0.0842  -0.0505 -0.0484 101 PHE A CG  
756  C CD1 . PHE A 99  ? 0.8697 0.7719 0.7741 0.0883  -0.0525 -0.0516 101 PHE A CD1 
757  C CD2 . PHE A 99  ? 0.8403 0.7510 0.7451 0.0946  -0.0510 -0.0535 101 PHE A CD2 
758  C CE1 . PHE A 99  ? 0.8619 0.7623 0.7551 0.1033  -0.0549 -0.0599 101 PHE A CE1 
759  C CE2 . PHE A 99  ? 0.8675 0.7786 0.7614 0.1097  -0.0527 -0.0614 101 PHE A CE2 
760  C CZ  . PHE A 99  ? 0.8621 0.7685 0.7500 0.1145  -0.0548 -0.0648 101 PHE A CZ  
761  N N   . GLY A 100 ? 0.9068 0.7960 0.8255 0.0515  -0.0695 -0.0305 102 GLY A N   
762  C CA  . GLY A 100 ? 0.9218 0.7976 0.8348 0.0503  -0.0779 -0.0309 102 GLY A CA  
763  C C   . GLY A 100 ? 0.8862 0.7764 0.8066 0.0455  -0.0658 -0.0273 102 GLY A C   
764  O O   . GLY A 100 ? 0.8696 0.7749 0.8006 0.0345  -0.0600 -0.0189 102 GLY A O   
765  N N   . PHE A 101 ? 0.8805 0.7677 0.7951 0.0549  -0.0622 -0.0340 103 PHE A N   
766  C CA  . PHE A 101 ? 0.8754 0.7723 0.7954 0.0508  -0.0533 -0.0312 103 PHE A CA  
767  C C   . PHE A 101 ? 0.9106 0.7906 0.8204 0.0559  -0.0624 -0.0359 103 PHE A C   
768  O O   . PHE A 101 ? 0.9237 0.7875 0.8218 0.0662  -0.0731 -0.0434 103 PHE A O   
769  C CB  . PHE A 101 ? 0.8287 0.7450 0.7550 0.0564  -0.0355 -0.0336 103 PHE A CB  
770  C CG  . PHE A 101 ? 0.8032 0.7184 0.7221 0.0705  -0.0329 -0.0418 103 PHE A CG  
771  C CD1 . PHE A 101 ? 0.7565 0.6693 0.6698 0.0774  -0.0316 -0.0460 103 PHE A CD1 
772  C CD2 . PHE A 101 ? 0.7877 0.7063 0.7049 0.0771  -0.0320 -0.0448 103 PHE A CD2 
773  C CE1 . PHE A 101 ? 0.7787 0.6956 0.6853 0.0907  -0.0292 -0.0525 103 PHE A CE1 
774  C CE2 . PHE A 101 ? 0.7750 0.6975 0.6854 0.0903  -0.0295 -0.0511 103 PHE A CE2 
775  C CZ  . PHE A 101 ? 0.7758 0.6989 0.6811 0.0973  -0.0281 -0.0547 103 PHE A CZ  
776  N N   . GLU A 102 ? 0.9302 0.8145 0.8442 0.0493  -0.0589 -0.0317 104 GLU A N   
777  C CA  . GLU A 102 ? 0.9837 0.8508 0.8890 0.0514  -0.0694 -0.0344 104 GLU A CA  
778  C C   . GLU A 102 ? 0.9628 0.8417 0.8716 0.0534  -0.0564 -0.0354 104 GLU A C   
779  O O   . GLU A 102 ? 0.9477 0.8419 0.8666 0.0443  -0.0471 -0.0287 104 GLU A O   
780  C CB  . GLU A 102 ? 1.0099 0.8633 0.9155 0.0375  -0.0858 -0.0256 104 GLU A CB  
781  C CG  . GLU A 102 ? 1.0345 0.9004 0.9491 0.0248  -0.0807 -0.0161 104 GLU A CG  
782  C CD  . GLU A 102 ? 1.1429 1.0000 1.0594 0.0092  -0.0975 -0.0046 104 GLU A CD  
783  O OE1 . GLU A 102 ? 1.1646 1.0091 1.0776 0.0040  -0.1083 -0.0014 104 GLU A OE1 
784  O OE2 . GLU A 102 ? 1.1892 1.0517 1.1107 0.0017  -0.1014 0.0021  104 GLU A OE2 
785  N N   . LEU A 103 ? 0.9719 0.8451 0.8719 0.0662  -0.0563 -0.0440 105 LEU A N   
786  C CA  . LEU A 103 ? 0.9544 0.8391 0.8570 0.0699  -0.0439 -0.0456 105 LEU A CA  
787  C C   . LEU A 103 ? 0.9600 0.8439 0.8670 0.0592  -0.0443 -0.0396 105 LEU A C   
788  O O   . LEU A 103 ? 0.9773 0.8479 0.8824 0.0504  -0.0575 -0.0349 105 LEU A O   
789  C CB  . LEU A 103 ? 0.9647 0.8436 0.8558 0.0855  -0.0470 -0.0550 105 LEU A CB  
790  C CG  . LEU A 103 ? 0.9657 0.8495 0.8519 0.0972  -0.0466 -0.0606 105 LEU A CG  
791  C CD1 . LEU A 103 ? 0.9743 0.8418 0.8447 0.1110  -0.0615 -0.0700 105 LEU A CD1 
792  C CD2 . LEU A 103 ? 0.9266 0.8338 0.8187 0.1028  -0.0303 -0.0605 105 LEU A CD2 
793  N N   . PRO A 104 ? 0.9399 0.8384 0.8532 0.0592  -0.0308 -0.0388 106 PRO A N   
794  C CA  . PRO A 104 ? 0.9409 0.8395 0.8571 0.0514  -0.0306 -0.0344 106 PRO A CA  
795  C C   . PRO A 104 ? 0.9604 0.8419 0.8659 0.0574  -0.0402 -0.0395 106 PRO A C   
796  O O   . PRO A 104 ? 0.9630 0.8418 0.8612 0.0702  -0.0397 -0.0472 106 PRO A O   
797  C CB  . PRO A 104 ? 0.9110 0.8276 0.8347 0.0533  -0.0147 -0.0346 106 PRO A CB  
798  C CG  . PRO A 104 ? 0.8965 0.8160 0.8169 0.0650  -0.0102 -0.0406 106 PRO A CG  
799  C CD  . PRO A 104 ? 0.9153 0.8299 0.8331 0.0661  -0.0167 -0.0414 106 PRO A CD  
800  N N   . GLN A 105 ? 0.9828 0.8541 0.8874 0.0485  -0.0498 -0.0347 107 GLN A N   
801  C CA  . GLN A 105 ? 0.9966 0.8532 0.8927 0.0528  -0.0576 -0.0387 107 GLN A CA  
802  C C   . GLN A 105 ? 0.9915 0.8623 0.8916 0.0566  -0.0428 -0.0404 107 GLN A C   
803  O O   . GLN A 105 ? 0.9721 0.8618 0.8822 0.0527  -0.0291 -0.0368 107 GLN A O   
804  C CB  . GLN A 105 ? 0.9868 0.8341 0.8846 0.0387  -0.0694 -0.0299 107 GLN A CB  
805  C CG  . GLN A 105 ? 0.9438 0.7939 0.8472 0.0280  -0.0750 -0.0217 107 GLN A CG  
806  C CD  . GLN A 105 ? 0.9472 0.7752 0.8452 0.0195  -0.0970 -0.0165 107 GLN A CD  
807  O OE1 . GLN A 105 ? 0.9162 0.7221 0.8041 0.0258  -0.1125 -0.0220 107 GLN A OE1 
808  N NE2 . GLN A 105 ? 0.9522 0.7847 0.8559 0.0054  -0.1004 -0.0057 107 GLN A NE2 
809  N N   . GLY A 106 ? 1.0133 0.8746 0.9054 0.0643  -0.0468 -0.0460 108 GLY A N   
810  C CA  . GLY A 106 ? 1.0080 0.8824 0.9034 0.0685  -0.0337 -0.0476 108 GLY A CA  
811  C C   . GLY A 106 ? 1.0155 0.8979 0.9068 0.0827  -0.0279 -0.0545 108 GLY A C   
812  O O   . GLY A 106 ? 1.0258 0.9010 0.9091 0.0912  -0.0361 -0.0597 108 GLY A O   
813  N N   . PRO A 107 ? 1.0031 0.9020 0.9000 0.0853  -0.0147 -0.0538 109 PRO A N   
814  C CA  . PRO A 107 ? 1.0059 0.9153 0.8987 0.0984  -0.0107 -0.0586 109 PRO A CA  
815  C C   . PRO A 107 ? 0.9950 0.9132 0.8914 0.0994  -0.0073 -0.0575 109 PRO A C   
816  O O   . PRO A 107 ? 0.9868 0.9076 0.8917 0.0897  -0.0037 -0.0526 109 PRO A O   
817  C CB  . PRO A 107 ? 0.9838 0.9082 0.8837 0.0974  0.0013  -0.0554 109 PRO A CB  
818  C CG  . PRO A 107 ? 0.9642 0.8890 0.8741 0.0843  0.0062  -0.0495 109 PRO A CG  
819  C CD  . PRO A 107 ? 0.9812 0.8910 0.8884 0.0768  -0.0040 -0.0484 109 PRO A CD  
820  N N   . LEU A 108 ? 0.9982 0.9223 0.8877 0.1118  -0.0091 -0.0623 110 LEU A N   
821  C CA  . LEU A 108 ? 0.9780 0.9145 0.8714 0.1137  -0.0042 -0.0607 110 LEU A CA  
822  C C   . LEU A 108 ? 0.9517 0.9106 0.8494 0.1188  0.0061  -0.0580 110 LEU A C   
823  O O   . LEU A 108 ? 0.9248 0.8986 0.8271 0.1203  0.0114  -0.0549 110 LEU A O   
824  C CB  . LEU A 108 ? 1.0047 0.9320 0.8874 0.1228  -0.0152 -0.0671 110 LEU A CB  
825  C CG  . LEU A 108 ? 1.0283 0.9324 0.9093 0.1135  -0.0265 -0.0667 110 LEU A CG  
826  C CD1 . LEU A 108 ? 1.0434 0.9291 0.9110 0.1223  -0.0431 -0.0741 110 LEU A CD1 
827  C CD2 . LEU A 108 ? 1.0058 0.9129 0.8984 0.0996  -0.0213 -0.0593 110 LEU A CD2 
828  N N   . GLY A 109 ? 0.9481 0.9088 0.8450 0.1199  0.0081  -0.0578 111 GLY A N   
829  C CA  . GLY A 109 ? 0.9424 0.9237 0.8451 0.1216  0.0169  -0.0529 111 GLY A CA  
830  C C   . GLY A 109 ? 0.9486 0.9502 0.8456 0.1349  0.0173  -0.0541 111 GLY A C   
831  O O   . GLY A 109 ? 0.9394 0.9620 0.8438 0.1339  0.0243  -0.0469 111 GLY A O   
832  N N   . THR A 110 ? 0.9628 0.9589 0.8464 0.1476  0.0086  -0.0627 112 THR A N   
833  C CA  . THR A 110 ? 0.9563 0.9743 0.8317 0.1638  0.0079  -0.0656 112 THR A CA  
834  C C   . THR A 110 ? 0.9857 1.0180 0.8633 0.1651  0.0130  -0.0620 112 THR A C   
835  O O   . THR A 110 ? 0.9772 1.0383 0.8552 0.1729  0.0174  -0.0580 112 THR A O   
836  C CB  . THR A 110 ? 0.9621 0.9651 0.8205 0.1787  -0.0055 -0.0783 112 THR A CB  
837  O OG1 . THR A 110 ? 0.8533 0.8335 0.7082 0.1749  -0.0115 -0.0819 112 THR A OG1 
838  C CG2 . THR A 110 ? 0.9492 0.9356 0.8033 0.1790  -0.0137 -0.0828 112 THR A CG2 
839  N N   . SER A 111 ? 1.0121 1.0253 0.8914 0.1570  0.0119  -0.0627 113 SER A N   
840  C CA  . SER A 111 ? 1.0440 1.0615 0.9213 0.1600  0.0130  -0.0629 113 SER A CA  
841  C C   . SER A 111 ? 1.0684 1.1199 0.9467 0.1688  0.0189  -0.0579 113 SER A C   
842  O O   . SER A 111 ? 1.1011 1.1626 0.9687 0.1837  0.0147  -0.0640 113 SER A O   
843  C CB  . SER A 111 ? 1.0186 1.0226 0.9056 0.1445  0.0173  -0.0578 113 SER A CB  
844  O OG  . SER A 111 ? 1.0048 1.0154 0.9048 0.1328  0.0248  -0.0491 113 SER A OG  
845  N N   . PHE A 112 ? 1.0725 1.1426 0.9634 0.1599  0.0272  -0.0466 114 PHE A N   
846  C CA  . PHE A 112 ? 1.0891 1.1955 0.9836 0.1651  0.0323  -0.0379 114 PHE A CA  
847  C C   . PHE A 112 ? 1.1062 1.2348 1.0006 0.1709  0.0331  -0.0348 114 PHE A C   
848  O O   . PHE A 112 ? 1.1090 1.2668 1.0120 0.1678  0.0382  -0.0227 114 PHE A O   
849  C CB  . PHE A 112 ? 1.0688 1.1826 0.9780 0.1504  0.0388  -0.0251 114 PHE A CB  
850  C CG  . PHE A 112 ? 1.0561 1.1508 0.9665 0.1439  0.0388  -0.0269 114 PHE A CG  
851  C CD1 . PHE A 112 ? 1.0642 1.1746 0.9748 0.1469  0.0406  -0.0231 114 PHE A CD1 
852  C CD2 . PHE A 112 ? 1.0484 1.1122 0.9602 0.1349  0.0371  -0.0317 114 PHE A CD2 
853  C CE1 . PHE A 112 ? 1.0631 1.1561 0.9748 0.1411  0.0406  -0.0248 114 PHE A CE1 
854  C CE2 . PHE A 112 ? 1.0577 1.1063 0.9707 0.1291  0.0373  -0.0330 114 PHE A CE2 
855  C CZ  . PHE A 112 ? 1.0621 1.1240 0.9750 0.1321  0.0390  -0.0298 114 PHE A CZ  
856  N N   . LYS A 113 ? 1.1239 1.2391 1.0090 0.1786  0.0273  -0.0446 115 LYS A N   
857  C CA  . LYS A 113 ? 1.1422 1.2817 1.0226 0.1902  0.0266  -0.0447 115 LYS A CA  
858  C C   . LYS A 113 ? 1.1579 1.3284 1.0295 0.2074  0.0259  -0.0464 115 LYS A C   
859  O O   . LYS A 113 ? 1.1934 1.3613 1.0493 0.2255  0.0182  -0.0594 115 LYS A O   
860  C CB  . LYS A 113 ? 1.1573 1.2745 1.0274 0.1972  0.0184  -0.0565 115 LYS A CB  
861  C CG  . LYS A 113 ? 1.1891 1.2848 1.0427 0.2109  0.0072  -0.0716 115 LYS A CG  
862  C CD  . LYS A 113 ? 1.2361 1.3257 1.0763 0.2255  -0.0026 -0.0826 115 LYS A CD  
863  C CE  . LYS A 113 ? 1.2654 1.3226 1.0904 0.2350  -0.0173 -0.0971 115 LYS A CE  
864  N NZ  . LYS A 113 ? 1.2839 1.3535 1.0910 0.2607  -0.0271 -0.1093 115 LYS A NZ  
865  N N   . GLY A 114 ? 1.1305 1.3296 1.0118 0.2020  0.0329  -0.0334 116 GLY A N   
866  C CA  . GLY A 114 ? 1.1306 1.3636 1.0057 0.2165  0.0334  -0.0326 116 GLY A CA  
867  C C   . GLY A 114 ? 1.1114 1.3856 0.9992 0.2096  0.0404  -0.0141 116 GLY A C   
868  O O   . GLY A 114 ? 1.1012 1.3798 0.9976 0.2003  0.0425  -0.0060 116 GLY A O   
869  N N   . LYS A 115 ? 1.1052 1.4096 0.9946 0.2133  0.0431  -0.0067 117 LYS A N   
870  C CA  . LYS A 115 ? 1.0872 1.4322 0.9903 0.2041  0.0484  0.0139  117 LYS A CA  
871  C C   . LYS A 115 ? 1.0522 1.3762 0.9727 0.1790  0.0503  0.0265  117 LYS A C   
872  O O   . LYS A 115 ? 1.0454 1.3952 0.9782 0.1685  0.0520  0.0440  117 LYS A O   
873  C CB  . LYS A 115 ? 1.0909 1.4645 0.9923 0.2113  0.0499  0.0180  117 LYS A CB  
874  C CG  . LYS A 115 ? 1.0715 1.4641 0.9897 0.1935  0.0535  0.0387  117 LYS A CG  
875  C CD  . LYS A 115 ? 1.0618 1.4550 0.9771 0.1970  0.0538  0.0365  117 LYS A CD  
876  C CE  . LYS A 115 ? 1.0740 1.5164 1.0001 0.1919  0.0567  0.0575  117 LYS A CE  
877  N NZ  . LYS A 115 ? 1.0466 1.5060 0.9892 0.1735  0.0571  0.0787  117 LYS A NZ  
878  N N   . TYR A 116 ? 1.0252 1.3034 0.9462 0.1702  0.0488  0.0177  118 TYR A N   
879  C CA  . TYR A 116 ? 1.0018 1.2603 0.9374 0.1495  0.0496  0.0276  118 TYR A CA  
880  C C   . TYR A 116 ? 0.9983 1.2283 0.9370 0.1414  0.0483  0.0237  118 TYR A C   
881  O O   . TYR A 116 ? 0.9838 1.2100 0.9347 0.1271  0.0481  0.0343  118 TYR A O   
882  C CB  . TYR A 116 ? 0.9838 1.2179 0.9198 0.1442  0.0495  0.0234  118 TYR A CB  
883  C CG  . TYR A 116 ? 0.9577 1.2206 0.8969 0.1451  0.0511  0.0334  118 TYR A CG  
884  C CD1 . TYR A 116 ? 0.9346 1.2206 0.8880 0.1322  0.0513  0.0529  118 TYR A CD1 
885  C CD2 . TYR A 116 ? 0.9422 1.2083 0.8704 0.1583  0.0509  0.0239  118 TYR A CD2 
886  C CE1 . TYR A 116 ? 0.9175 1.2319 0.8746 0.1319  0.0521  0.0639  118 TYR A CE1 
887  C CE2 . TYR A 116 ? 0.9385 1.2328 0.8700 0.1591  0.0525  0.0335  118 TYR A CE2 
888  C CZ  . TYR A 116 ? 0.9487 1.2683 0.8950 0.1455  0.0534  0.0540  118 TYR A CZ  
889  O OH  . TYR A 116 ? 0.9804 1.3300 0.9311 0.1448  0.0544  0.0656  118 TYR A OH  
890  N N   . GLY A 117 ? 1.0132 1.2228 0.9405 0.1508  0.0463  0.0084  119 GLY A N   
891  C CA  . GLY A 117 ? 1.0118 1.1960 0.9415 0.1439  0.0450  0.0044  119 GLY A CA  
892  C C   . GLY A 117 ? 1.0309 1.2200 0.9511 0.1559  0.0427  -0.0035 119 GLY A C   
893  O O   . GLY A 117 ? 1.0479 1.2624 0.9589 0.1713  0.0419  -0.0062 119 GLY A O   
894  N N   . CYS A 118 ? 1.0249 1.1904 0.9472 0.1495  0.0414  -0.0072 120 CYS A N   
895  C CA  . CYS A 118 ? 1.0378 1.2000 0.9515 0.1587  0.0382  -0.0156 120 CYS A CA  
896  C C   . CYS A 118 ? 1.0117 1.1400 0.9284 0.1488  0.0365  -0.0205 120 CYS A C   
897  O O   . CYS A 118 ? 0.9945 1.1100 0.9217 0.1350  0.0387  -0.0151 120 CYS A O   
898  C CB  . CYS A 118 ? 1.0445 1.2404 0.9619 0.1617  0.0402  -0.0061 120 CYS A CB  
899  S SG  . CYS A 118 ? 1.0827 1.2794 1.0187 0.1415  0.0431  0.0099  120 CYS A SG  
900  N N   . VAL A 119 ? 1.0101 1.1261 0.9173 0.1567  0.0316  -0.0306 121 VAL A N   
901  C CA  . VAL A 119 ? 0.9927 1.0772 0.8999 0.1496  0.0284  -0.0367 121 VAL A CA  
902  C C   . VAL A 119 ? 0.9966 1.0823 0.9027 0.1518  0.0264  -0.0380 121 VAL A C   
903  O O   . VAL A 119 ? 1.0242 1.1183 0.9196 0.1655  0.0221  -0.0442 121 VAL A O   
904  C CB  . VAL A 119 ? 1.0000 1.0602 0.8961 0.1549  0.0213  -0.0481 121 VAL A CB  
905  C CG1 . VAL A 119 ? 1.0378 1.1036 0.9184 0.1734  0.0139  -0.0578 121 VAL A CG1 
906  C CG2 . VAL A 119 ? 0.9741 1.0053 0.8722 0.1449  0.0179  -0.0514 121 VAL A CG2 
907  N N   . ASP A 120 ? 0.9648 1.0424 0.8813 0.1394  0.0291  -0.0329 122 ASP A N   
908  C CA  . ASP A 120 ? 0.9488 1.0285 0.8659 0.1400  0.0280  -0.0328 122 ASP A CA  
909  C C   . ASP A 120 ? 0.9203 0.9725 0.8356 0.1353  0.0236  -0.0395 122 ASP A C   
910  O O   . ASP A 120 ? 0.9098 0.9484 0.8331 0.1237  0.0255  -0.0372 122 ASP A O   
911  C CB  . ASP A 120 ? 0.9428 1.0377 0.8731 0.1306  0.0330  -0.0209 122 ASP A CB  
912  C CG  . ASP A 120 ? 0.9793 1.1084 0.9106 0.1365  0.0353  -0.0124 122 ASP A CG  
913  O OD1 . ASP A 120 ? 1.0101 1.1520 0.9525 0.1278  0.0376  -0.0008 122 ASP A OD1 
914  O OD2 . ASP A 120 ? 1.0256 1.1697 0.9465 0.1501  0.0339  -0.0167 122 ASP A OD2 
915  N N   . TYR A 121 ? 0.9025 0.9480 0.8070 0.1446  0.0169  -0.0474 123 TYR A N   
916  C CA  . TYR A 121 ? 0.8770 0.9011 0.7811 0.1393  0.0121  -0.0512 123 TYR A CA  
917  C C   . TYR A 121 ? 0.8629 0.8959 0.7667 0.1429  0.0115  -0.0506 123 TYR A C   
918  O O   . TYR A 121 ? 0.8754 0.9290 0.7744 0.1537  0.0120  -0.0505 123 TYR A O   
919  C CB  . TYR A 121 ? 0.8943 0.8961 0.7870 0.1441  0.0018  -0.0603 123 TYR A CB  
920  C CG  . TYR A 121 ? 0.8890 0.8773 0.7847 0.1356  0.0022  -0.0594 123 TYR A CG  
921  C CD1 . TYR A 121 ? 0.9256 0.8918 0.8215 0.1270  -0.0039 -0.0608 123 TYR A CD1 
922  C CD2 . TYR A 121 ? 0.9066 0.9060 0.8053 0.1357  0.0082  -0.0563 123 TYR A CD2 
923  C CE1 . TYR A 121 ? 0.9280 0.8842 0.8267 0.1192  -0.0036 -0.0592 123 TYR A CE1 
924  C CE2 . TYR A 121 ? 0.9189 0.9064 0.8203 0.1283  0.0085  -0.0556 123 TYR A CE2 
925  C CZ  . TYR A 121 ? 0.9313 0.8977 0.8325 0.1202  0.0028  -0.0572 123 TYR A CZ  
926  O OH  . TYR A 121 ? 0.9144 0.8715 0.8180 0.1130  0.0031  -0.0560 123 TYR A OH  
927  N N   . TRP A 122 ? 0.8279 0.8479 0.7372 0.1338  0.0108  -0.0496 124 TRP A N   
928  C CA  . TRP A 122 ? 0.8141 0.8371 0.7226 0.1362  0.0088  -0.0502 124 TRP A CA  
929  C C   . TRP A 122 ? 0.7833 0.7907 0.6987 0.1247  0.0081  -0.0488 124 TRP A C   
930  O O   . TRP A 122 ? 0.7726 0.7696 0.6937 0.1151  0.0095  -0.0470 124 TRP A O   
931  C CB  . TRP A 122 ? 0.8132 0.8614 0.7281 0.1373  0.0156  -0.0427 124 TRP A CB  
932  C CG  . TRP A 122 ? 0.8225 0.8789 0.7495 0.1275  0.0226  -0.0339 124 TRP A CG  
933  C CD1 . TRP A 122 ? 0.8549 0.9279 0.7839 0.1291  0.0263  -0.0288 124 TRP A CD1 
934  C CD2 . TRP A 122 ? 0.8292 0.8775 0.7677 0.1150  0.0256  -0.0293 124 TRP A CD2 
935  N NE1 . TRP A 122 ? 0.8516 0.9251 0.7928 0.1177  0.0304  -0.0209 124 TRP A NE1 
936  C CE2 . TRP A 122 ? 0.8153 0.8737 0.7620 0.1099  0.0299  -0.0218 124 TRP A CE2 
937  C CE3 . TRP A 122 ? 0.8460 0.8808 0.7885 0.1084  0.0243  -0.0307 124 TRP A CE3 
938  C CZ2 . TRP A 122 ? 0.7696 0.8225 0.7271 0.0997  0.0317  -0.0171 124 TRP A CZ2 
939  C CZ3 . TRP A 122 ? 0.8182 0.8508 0.7718 0.0988  0.0275  -0.0260 124 TRP A CZ3 
940  C CH2 . TRP A 122 ? 0.7848 0.8251 0.7451 0.0952  0.0306  -0.0200 124 TRP A CH2 
941  N N   . VAL A 123 ? 0.7638 0.7724 0.6785 0.1263  0.0060  -0.0493 125 VAL A N   
942  C CA  . VAL A 123 ? 0.7317 0.7299 0.6528 0.1168  0.0052  -0.0476 125 VAL A CA  
943  C C   . VAL A 123 ? 0.7235 0.7371 0.6508 0.1168  0.0101  -0.0431 125 VAL A C   
944  O O   . VAL A 123 ? 0.7357 0.7595 0.6568 0.1262  0.0084  -0.0447 125 VAL A O   
945  C CB  . VAL A 123 ? 0.7413 0.7217 0.6531 0.1197  -0.0058 -0.0538 125 VAL A CB  
946  C CG1 . VAL A 123 ? 0.7199 0.6942 0.6380 0.1110  -0.0067 -0.0511 125 VAL A CG1 
947  C CG2 . VAL A 123 ? 0.7381 0.7016 0.6437 0.1187  -0.0130 -0.0573 125 VAL A CG2 
948  N N   . LYS A 124 ? 0.7034 0.7199 0.6423 0.1074  0.0156  -0.0374 126 LYS A N   
949  C CA  . LYS A 124 ? 0.6931 0.7185 0.6377 0.1060  0.0175  -0.0336 126 LYS A CA  
950  C C   . LYS A 124 ? 0.6826 0.6953 0.6285 0.1010  0.0141  -0.0359 126 LYS A C   
951  O O   . LYS A 124 ? 0.6816 0.6836 0.6296 0.0947  0.0131  -0.0368 126 LYS A O   
952  C CB  . LYS A 124 ? 0.6751 0.7095 0.6310 0.0995  0.0229  -0.0266 126 LYS A CB  
953  C CG  . LYS A 124 ? 0.7360 0.7855 0.6923 0.1026  0.0255  -0.0217 126 LYS A CG  
954  C CD  . LYS A 124 ? 0.8275 0.8851 0.7953 0.0956  0.0277  -0.0132 126 LYS A CD  
955  C CE  . LYS A 124 ? 0.8808 0.9545 0.8513 0.0957  0.0292  -0.0054 126 LYS A CE  
956  N NZ  . LYS A 124 ? 0.8903 0.9554 0.8619 0.0927  0.0303  -0.0066 126 LYS A NZ  
957  N N   . ALA A 125 ? 0.6789 0.6945 0.6233 0.1039  0.0121  -0.0364 127 ALA A N   
958  C CA  . ALA A 125 ? 0.6627 0.6704 0.6107 0.0983  0.0097  -0.0366 127 ALA A CA  
959  C C   . ALA A 125 ? 0.6430 0.6617 0.5997 0.0957  0.0143  -0.0318 127 ALA A C   
960  O O   . ALA A 125 ? 0.6367 0.6683 0.5937 0.0998  0.0165  -0.0286 127 ALA A O   
961  C CB  . ALA A 125 ? 0.6714 0.6714 0.6102 0.1037  0.0023  -0.0412 127 ALA A CB  
962  N N   . PHE A 126 ? 0.6369 0.6520 0.6006 0.0892  0.0148  -0.0306 128 PHE A N   
963  C CA  . PHE A 126 ? 0.6321 0.6553 0.6041 0.0870  0.0174  -0.0267 128 PHE A CA  
964  C C   . PHE A 126 ? 0.6372 0.6575 0.6103 0.0855  0.0149  -0.0277 128 PHE A C   
965  O O   . PHE A 126 ? 0.6511 0.6639 0.6236 0.0820  0.0125  -0.0298 128 PHE A O   
966  C CB  . PHE A 126 ? 0.6162 0.6397 0.5967 0.0819  0.0202  -0.0246 128 PHE A CB  
967  C CG  . PHE A 126 ? 0.6396 0.6646 0.6197 0.0824  0.0222  -0.0233 128 PHE A CG  
968  C CD1 . PHE A 126 ? 0.6504 0.6837 0.6347 0.0824  0.0231  -0.0179 128 PHE A CD1 
969  C CD2 . PHE A 126 ? 0.6608 0.6791 0.6369 0.0817  0.0222  -0.0264 128 PHE A CD2 
970  C CE1 . PHE A 126 ? 0.6417 0.6768 0.6264 0.0821  0.0245  -0.0159 128 PHE A CE1 
971  C CE2 . PHE A 126 ? 0.6410 0.6607 0.6171 0.0820  0.0242  -0.0253 128 PHE A CE2 
972  C CZ  . PHE A 126 ? 0.6412 0.6693 0.6218 0.0823  0.0255  -0.0201 128 PHE A CZ  
973  N N   . LEU A 127 ? 0.6319 0.6596 0.6065 0.0877  0.0151  -0.0253 129 LEU A N   
974  C CA  . LEU A 127 ? 0.6379 0.6642 0.6148 0.0862  0.0132  -0.0256 129 LEU A CA  
975  C C   . LEU A 127 ? 0.6415 0.6721 0.6285 0.0822  0.0150  -0.0223 129 LEU A C   
976  O O   . LEU A 127 ? 0.6439 0.6819 0.6349 0.0826  0.0156  -0.0177 129 LEU A O   
977  C CB  . LEU A 127 ? 0.6448 0.6760 0.6156 0.0922  0.0110  -0.0259 129 LEU A CB  
978  C CG  . LEU A 127 ? 0.6747 0.7032 0.6464 0.0911  0.0083  -0.0267 129 LEU A CG  
979  C CD1 . LEU A 127 ? 0.7084 0.7242 0.6756 0.0891  0.0033  -0.0307 129 LEU A CD1 
980  C CD2 . LEU A 127 ? 0.7089 0.7457 0.6753 0.0979  0.0068  -0.0263 129 LEU A CD2 
981  N N   . ASP A 128 ? 0.6379 0.6648 0.6291 0.0786  0.0146  -0.0242 130 ASP A N   
982  C CA  . ASP A 128 ? 0.6462 0.6757 0.6456 0.0768  0.0149  -0.0232 130 ASP A CA  
983  C C   . ASP A 128 ? 0.6643 0.6953 0.6648 0.0769  0.0131  -0.0231 130 ASP A C   
984  O O   . ASP A 128 ? 0.6688 0.6973 0.6659 0.0760  0.0118  -0.0249 130 ASP A O   
985  C CB  . ASP A 128 ? 0.6414 0.6703 0.6437 0.0748  0.0158  -0.0259 130 ASP A CB  
986  C CG  . ASP A 128 ? 0.6562 0.6835 0.6579 0.0748  0.0175  -0.0261 130 ASP A CG  
987  O OD1 . ASP A 128 ? 0.6606 0.6879 0.6625 0.0759  0.0175  -0.0233 130 ASP A OD1 
988  O OD2 . ASP A 128 ? 0.6503 0.6779 0.6518 0.0733  0.0186  -0.0281 130 ASP A OD2 
989  N N   . ARG A 129 ? 0.6858 0.7199 0.6909 0.0774  0.0118  -0.0204 131 ARG A N   
990  C CA  . ARG A 129 ? 0.7141 0.7496 0.7205 0.0776  0.0100  -0.0202 131 ARG A CA  
991  C C   . ARG A 129 ? 0.7299 0.7662 0.7440 0.0771  0.0075  -0.0192 131 ARG A C   
992  O O   . ARG A 129 ? 0.7484 0.7844 0.7656 0.0767  0.0056  -0.0158 131 ARG A O   
993  C CB  . ARG A 129 ? 0.7225 0.7621 0.7249 0.0798  0.0093  -0.0170 131 ARG A CB  
994  C CG  . ARG A 129 ? 0.7577 0.7951 0.7511 0.0826  0.0087  -0.0199 131 ARG A CG  
995  C CD  . ARG A 129 ? 0.7691 0.8146 0.7573 0.0875  0.0087  -0.0172 131 ARG A CD  
996  N NE  . ARG A 129 ? 0.7687 0.8219 0.7616 0.0869  0.0079  -0.0125 131 ARG A NE  
997  C CZ  . ARG A 129 ? 0.8020 0.8679 0.7937 0.0896  0.0080  -0.0071 131 ARG A CZ  
998  N NH1 . ARG A 129 ? 0.7727 0.8468 0.7581 0.0943  0.0093  -0.0065 131 ARG A NH1 
999  N NH2 . ARG A 129 ? 0.8128 0.8854 0.8099 0.0876  0.0064  -0.0017 131 ARG A NH2 
1000 N N   . PRO A 130 ? 0.7358 0.7729 0.7528 0.0772  0.0062  -0.0217 132 PRO A N   
1001 C CA  . PRO A 130 ? 0.7433 0.7799 0.7666 0.0786  0.0025  -0.0227 132 PRO A CA  
1002 C C   . PRO A 130 ? 0.7605 0.7949 0.7871 0.0778  -0.0020 -0.0173 132 PRO A C   
1003 O O   . PRO A 130 ? 0.7617 0.7994 0.7866 0.0766  -0.0017 -0.0128 132 PRO A O   
1004 C CB  . PRO A 130 ? 0.7438 0.7842 0.7683 0.0792  0.0023  -0.0252 132 PRO A CB  
1005 C CG  . PRO A 130 ? 0.7304 0.7711 0.7497 0.0772  0.0043  -0.0236 132 PRO A CG  
1006 C CD  . PRO A 130 ? 0.7379 0.7763 0.7522 0.0765  0.0068  -0.0233 132 PRO A CD  
1007 N N   . SER A 131 ? 0.7770 0.8064 0.8078 0.0785  -0.0073 -0.0172 133 SER A N   
1008 C CA  . SER A 131 ? 0.8094 0.8358 0.8443 0.0759  -0.0142 -0.0101 133 SER A CA  
1009 C C   . SER A 131 ? 0.8203 0.8535 0.8532 0.0722  -0.0117 -0.0017 133 SER A C   
1010 O O   . SER A 131 ? 0.8373 0.8749 0.8730 0.0691  -0.0157 0.0065  133 SER A O   
1011 C CB  . SER A 131 ? 0.8151 0.8412 0.8532 0.0758  -0.0189 -0.0085 133 SER A CB  
1012 O OG  . SER A 131 ? 0.8551 0.8787 0.8944 0.0804  -0.0205 -0.0165 133 SER A OG  
1013 N N   . GLN A 132 ? 0.8088 0.8448 0.8368 0.0729  -0.0056 -0.0032 134 GLN A N   
1014 C CA  . GLN A 132 ? 0.8081 0.8531 0.8336 0.0713  -0.0034 0.0038  134 GLN A CA  
1015 C C   . GLN A 132 ? 0.7954 0.8383 0.8206 0.0704  -0.0029 0.0045  134 GLN A C   
1016 O O   . GLN A 132 ? 0.7924 0.8276 0.8172 0.0720  -0.0018 -0.0023 134 GLN A O   
1017 C CB  . GLN A 132 ? 0.8047 0.8557 0.8225 0.0746  0.0026  0.0007  134 GLN A CB  
1018 C CG  . GLN A 132 ? 0.8566 0.9103 0.8739 0.0756  0.0018  0.0007  134 GLN A CG  
1019 C CD  . GLN A 132 ? 0.9127 0.9784 0.9321 0.0740  -0.0008 0.0102  134 GLN A CD  
1020 O OE1 . GLN A 132 ? 0.9039 0.9781 0.9253 0.0718  -0.0020 0.0181  134 GLN A OE1 
1021 N NE2 . GLN A 132 ? 0.9406 1.0089 0.9599 0.0748  -0.0018 0.0105  134 GLN A NE2 
1022 N N   . PRO A 133 ? 0.7959 0.8479 0.8219 0.0679  -0.0037 0.0134  135 PRO A N   
1023 C CA  . PRO A 133 ? 0.7854 0.8356 0.8095 0.0680  -0.0015 0.0123  135 PRO A CA  
1024 C C   . PRO A 133 ? 0.7702 0.8235 0.7856 0.0726  0.0062  0.0059  135 PRO A C   
1025 O O   . PRO A 133 ? 0.7569 0.8180 0.7671 0.0757  0.0089  0.0057  135 PRO A O   
1026 C CB  . PRO A 133 ? 0.7893 0.8506 0.8172 0.0634  -0.0052 0.0248  135 PRO A CB  
1027 C CG  . PRO A 133 ? 0.8148 0.8830 0.8476 0.0601  -0.0106 0.0331  135 PRO A CG  
1028 C CD  . PRO A 133 ? 0.7988 0.8648 0.8275 0.0647  -0.0066 0.0250  135 PRO A CD  
1029 N N   . THR A 134 ? 0.7629 0.8088 0.7763 0.0734  0.0085  0.0002  136 THR A N   
1030 C CA  . THR A 134 ? 0.7674 0.8137 0.7728 0.0770  0.0134  -0.0052 136 THR A CA  
1031 C C   . THR A 134 ? 0.7732 0.8324 0.7742 0.0796  0.0148  0.0000  136 THR A C   
1032 O O   . THR A 134 ? 0.7687 0.8357 0.7731 0.0773  0.0137  0.0073  136 THR A O   
1033 C CB  . THR A 134 ? 0.7650 0.8032 0.7690 0.0768  0.0153  -0.0106 136 THR A CB  
1034 O OG1 . THR A 134 ? 0.7376 0.7797 0.7380 0.0778  0.0172  -0.0084 136 THR A OG1 
1035 C CG2 . THR A 134 ? 0.7656 0.7968 0.7766 0.0747  0.0122  -0.0121 136 THR A CG2 
1036 N N   . GLN A 135 ? 0.7792 0.8418 0.7723 0.0847  0.0163  -0.0036 137 GLN A N   
1037 C CA  . GLN A 135 ? 0.7811 0.8573 0.7674 0.0904  0.0176  -0.0014 137 GLN A CA  
1038 C C   . GLN A 135 ? 0.7767 0.8467 0.7571 0.0931  0.0192  -0.0067 137 GLN A C   
1039 O O   . GLN A 135 ? 0.7803 0.8354 0.7599 0.0911  0.0191  -0.0127 137 GLN A O   
1040 C CB  . GLN A 135 ? 0.7902 0.8698 0.7692 0.0967  0.0166  -0.0051 137 GLN A CB  
1041 C CG  . GLN A 135 ? 0.8305 0.9291 0.8018 0.1053  0.0171  -0.0032 137 GLN A CG  
1042 C CD  . GLN A 135 ? 0.8471 0.9466 0.8093 0.1134  0.0147  -0.0090 137 GLN A CD  
1043 O OE1 . GLN A 135 ? 0.8562 0.9466 0.8206 0.1107  0.0130  -0.0109 137 GLN A OE1 
1044 N NE2 . GLN A 135 ? 0.8517 0.9621 0.8031 0.1244  0.0138  -0.0125 137 GLN A NE2 
1045 N N   . GLU A 136 ? 0.7771 0.8594 0.7533 0.0974  0.0205  -0.0040 138 GLU A N   
1046 C CA  . GLU A 136 ? 0.7820 0.8569 0.7511 0.1011  0.0212  -0.0103 138 GLU A CA  
1047 C C   . GLU A 136 ? 0.7920 0.8788 0.7498 0.1121  0.0206  -0.0131 138 GLU A C   
1048 O O   . GLU A 136 ? 0.8025 0.9107 0.7595 0.1166  0.0213  -0.0075 138 GLU A O   
1049 C CB  . GLU A 136 ? 0.7771 0.8473 0.7525 0.0949  0.0228  -0.0075 138 GLU A CB  
1050 C CG  . GLU A 136 ? 0.8167 0.9018 0.7916 0.0969  0.0244  -0.0019 138 GLU A CG  
1051 C CD  . GLU A 136 ? 0.8924 0.9756 0.8771 0.0886  0.0242  0.0048  138 GLU A CD  
1052 O OE1 . GLU A 136 ? 0.9102 0.9972 0.9035 0.0829  0.0216  0.0124  138 GLU A OE1 
1053 O OE2 . GLU A 136 ? 0.9305 1.0073 0.9141 0.0880  0.0254  0.0024  138 GLU A OE2 
1054 N N   . THR A 137 ? 0.7869 0.8607 0.7359 0.1167  0.0184  -0.0216 139 THR A N   
1055 C CA  . THR A 137 ? 0.7883 0.8692 0.7251 0.1288  0.0160  -0.0266 139 THR A CA  
1056 C C   . THR A 137 ? 0.7944 0.8668 0.7281 0.1290  0.0160  -0.0299 139 THR A C   
1057 O O   . THR A 137 ? 0.7950 0.8470 0.7293 0.1234  0.0141  -0.0339 139 THR A O   
1058 C CB  . THR A 137 ? 0.7992 0.8689 0.7253 0.1366  0.0093  -0.0356 139 THR A CB  
1059 O OG1 . THR A 137 ? 0.7921 0.8731 0.7056 0.1513  0.0059  -0.0407 139 THR A OG1 
1060 C CG2 . THR A 137 ? 0.7906 0.8339 0.7143 0.1320  0.0045  -0.0418 139 THR A CG2 
1061 N N   . LYS A 138 ? 0.7991 0.8894 0.7297 0.1355  0.0180  -0.0274 140 LYS A N   
1062 C CA  . LYS A 138 ? 0.7986 0.8835 0.7276 0.1352  0.0187  -0.0292 140 LYS A CA  
1063 C C   . LYS A 138 ? 0.8128 0.8991 0.7267 0.1500  0.0136  -0.0381 140 LYS A C   
1064 O O   . LYS A 138 ? 0.8325 0.9410 0.7404 0.1612  0.0133  -0.0377 140 LYS A O   
1065 C CB  . LYS A 138 ? 0.7931 0.8975 0.7315 0.1299  0.0244  -0.0183 140 LYS A CB  
1066 C CG  . LYS A 138 ? 0.7835 0.8841 0.7212 0.1291  0.0257  -0.0190 140 LYS A CG  
1067 C CD  . LYS A 138 ? 0.7979 0.9219 0.7428 0.1262  0.0296  -0.0077 140 LYS A CD  
1068 C CE  . LYS A 138 ? 0.7963 0.9115 0.7410 0.1241  0.0307  -0.0094 140 LYS A CE  
1069 N NZ  . LYS A 138 ? 0.8139 0.9544 0.7601 0.1266  0.0330  -0.0013 140 LYS A NZ  
1070 N N   . LYS A 139 ? 0.8113 0.8756 0.7188 0.1508  0.0086  -0.0458 141 LYS A N   
1071 C CA  . LYS A 139 ? 0.8441 0.9055 0.7362 0.1659  0.0010  -0.0556 141 LYS A CA  
1072 C C   . LYS A 139 ? 0.8583 0.9102 0.7466 0.1667  -0.0006 -0.0589 141 LYS A C   
1073 O O   . LYS A 139 ? 0.8607 0.8884 0.7511 0.1575  -0.0036 -0.0607 141 LYS A O   
1074 C CB  . LYS A 139 ? 0.8468 0.8863 0.7295 0.1703  -0.0096 -0.0645 141 LYS A CB  
1075 C CG  . LYS A 139 ? 0.8582 0.8891 0.7240 0.1863  -0.0208 -0.0759 141 LYS A CG  
1076 C CD  . LYS A 139 ? 0.8503 0.9062 0.7066 0.2039  -0.0219 -0.0794 141 LYS A CD  
1077 C CE  . LYS A 139 ? 0.8355 0.8734 0.6750 0.2183  -0.0369 -0.0924 141 LYS A CE  
1078 N NZ  . LYS A 139 ? 0.8484 0.9064 0.6840 0.2286  -0.0366 -0.0932 141 LYS A NZ  
1079 N N   . ASN A 140 ? 0.8689 0.9414 0.7514 0.1781  0.0009  -0.0595 142 ASN A N   
1080 C CA  . ASN A 140 ? 0.8715 0.9392 0.7514 0.1789  0.0007  -0.0614 142 ASN A CA  
1081 C C   . ASN A 140 ? 0.9028 0.9430 0.7705 0.1849  -0.0109 -0.0727 142 ASN A C   
1082 O O   . ASN A 140 ? 0.9347 0.9618 0.7934 0.1916  -0.0204 -0.0801 142 ASN A O   
1083 C CB  . ASN A 140 ? 0.8711 0.9706 0.7476 0.1903  0.0047  -0.0589 142 ASN A CB  
1084 C CG  . ASN A 140 ? 0.8630 0.9861 0.7543 0.1796  0.0150  -0.0447 142 ASN A CG  
1085 O OD1 . ASN A 140 ? 0.8905 1.0041 0.7924 0.1658  0.0194  -0.0387 142 ASN A OD1 
1086 N ND2 . ASN A 140 ? 0.8572 1.0109 0.7496 0.1853  0.0180  -0.0386 142 ASN A ND2 
1087 N N   . PHE A 141 ? 0.9153 0.9447 0.7830 0.1813  -0.0114 -0.0736 143 PHE A N   
1088 C CA  . PHE A 141 ? 0.9575 0.9625 0.8121 0.1888  -0.0244 -0.0841 143 PHE A CA  
1089 C C   . PHE A 141 ? 0.9645 0.9715 0.8169 0.1913  -0.0231 -0.0850 143 PHE A C   
1090 O O   . PHE A 141 ? 0.9312 0.9568 0.7933 0.1854  -0.0118 -0.0769 143 PHE A O   
1091 C CB  . PHE A 141 ? 0.9612 0.9335 0.8164 0.1777  -0.0336 -0.0858 143 PHE A CB  
1092 C CG  . PHE A 141 ? 0.9459 0.9090 0.8146 0.1586  -0.0272 -0.0776 143 PHE A CG  
1093 C CD1 . PHE A 141 ? 0.9767 0.9194 0.8430 0.1533  -0.0338 -0.0793 143 PHE A CD1 
1094 C CD2 . PHE A 141 ? 0.9022 0.8771 0.7854 0.1466  -0.0157 -0.0687 143 PHE A CD2 
1095 C CE1 . PHE A 141 ? 0.9403 0.8780 0.8184 0.1369  -0.0279 -0.0719 143 PHE A CE1 
1096 C CE2 . PHE A 141 ? 0.8843 0.8525 0.7786 0.1315  -0.0106 -0.0626 143 PHE A CE2 
1097 C CZ  . PHE A 141 ? 0.9054 0.8567 0.7972 0.1268  -0.0161 -0.0640 143 PHE A CZ  
1098 N N   . GLU A 142 ? 1.0127 1.0004 0.8515 0.2011  -0.0360 -0.0951 144 GLU A N   
1099 C CA  . GLU A 142 ? 1.0414 1.0309 0.8765 0.2056  -0.0360 -0.0973 144 GLU A CA  
1100 C C   . GLU A 142 ? 1.0609 1.0167 0.8936 0.1973  -0.0462 -0.1003 144 GLU A C   
1101 O O   . GLU A 142 ? 1.0670 0.9969 0.8963 0.1927  -0.0577 -0.1031 144 GLU A O   
1107 N N   . VAL A 143 ? 1.0759 1.0343 0.9100 0.1960  -0.0425 -0.0990 145 VAL A N   
1108 C CA  . VAL A 143 ? 1.1049 1.0373 0.9386 0.1870  -0.0496 -0.0996 145 VAL A CA  
1109 C C   . VAL A 143 ? 1.1173 1.0555 0.9429 0.1986  -0.0512 -0.1047 145 VAL A C   
1110 O O   . VAL A 143 ? 1.1209 1.0886 0.9464 0.2087  -0.0422 -0.1039 145 VAL A O   
1111 C CB  . VAL A 143 ? 1.0751 1.0107 0.9258 0.1670  -0.0370 -0.0882 145 VAL A CB  
1112 C CG1 . VAL A 143 ? 1.0795 1.0462 0.9391 0.1675  -0.0210 -0.0816 145 VAL A CG1 
1113 C CG2 . VAL A 143 ? 1.1088 1.0222 0.9605 0.1565  -0.0428 -0.0871 145 VAL A CG2 
1114 N N   . ASP A 153 ? 0.9446 1.1159 0.8164 0.2040  0.0332  -0.0413 155 ASP A N   
1115 C CA  . ASP A 153 ? 0.9300 1.1271 0.8124 0.1976  0.0388  -0.0287 155 ASP A CA  
1116 C C   . ASP A 153 ? 0.8867 1.0571 0.7812 0.1772  0.0413  -0.0229 155 ASP A C   
1117 O O   . ASP A 153 ? 0.9035 1.0496 0.7950 0.1754  0.0382  -0.0301 155 ASP A O   
1118 C CB  . ASP A 153 ? 0.9390 1.1811 0.8299 0.1969  0.0444  -0.0131 155 ASP A CB  
1119 C CG  . ASP A 153 ? 0.9576 1.2291 0.8590 0.1905  0.0482  0.0013  155 ASP A CG  
1120 O OD1 . ASP A 153 ? 0.9395 1.2197 0.8560 0.1737  0.0515  0.0174  155 ASP A OD1 
1121 O OD2 . ASP A 153 ? 1.0241 1.3101 0.9183 0.2024  0.0467  -0.0032 155 ASP A OD2 
1122 N N   . LEU A 154 ? 0.8379 1.0124 0.7458 0.1623  0.0457  -0.0104 156 LEU A N   
1123 C CA  . LEU A 154 ? 0.7935 0.9508 0.7134 0.1451  0.0474  -0.0036 156 LEU A CA  
1124 C C   . LEU A 154 ? 0.7635 0.9350 0.6971 0.1323  0.0500  0.0121  156 LEU A C   
1125 O O   . LEU A 154 ? 0.7288 0.8788 0.6712 0.1182  0.0499  0.0157  156 LEU A O   
1126 C CB  . LEU A 154 ? 0.7857 0.9513 0.7073 0.1455  0.0474  -0.0013 156 LEU A CB  
1127 C CG  . LEU A 154 ? 0.7612 0.9226 0.6981 0.1278  0.0491  0.0112  156 LEU A CG  
1128 C CD1 . LEU A 154 ? 0.7221 0.8455 0.6616 0.1175  0.0481  0.0050  156 LEU A CD1 
1129 C CD2 . LEU A 154 ? 0.7883 0.9689 0.7298 0.1269  0.0494  0.0188  156 LEU A CD2 
1130 N N   . MET A 155 ? 0.7533 0.9624 0.6882 0.1378  0.0514  0.0215  157 MET A N   
1131 C CA  . MET A 155 ? 0.7405 0.9652 0.6862 0.1278  0.0521  0.0360  157 MET A CA  
1132 C C   . MET A 155 ? 0.7344 0.9607 0.6737 0.1352  0.0526  0.0308  157 MET A C   
1133 O O   . MET A 155 ? 0.7348 0.9726 0.6820 0.1276  0.0529  0.0418  157 MET A O   
1134 C CB  . MET A 155 ? 0.7479 1.0155 0.7017 0.1262  0.0526  0.0531  157 MET A CB  
1135 C CG  . MET A 155 ? 0.7907 1.0532 0.7504 0.1189  0.0514  0.0574  157 MET A CG  
1136 S SD  . MET A 155 ? 0.8619 1.1022 0.8382 0.0960  0.0471  0.0702  157 MET A SD  
1137 C CE  . MET A 155 ? 0.8217 1.0112 0.7936 0.0933  0.0467  0.0531  157 MET A CE  
1138 N N   . ALA A 156 ? 0.7369 0.9494 0.6618 0.1493  0.0513  0.0141  158 ALA A N   
1139 C CA  . ALA A 156 ? 0.7456 0.9496 0.6622 0.1567  0.0502  0.0057  158 ALA A CA  
1140 C C   . ALA A 156 ? 0.7360 0.9051 0.6578 0.1430  0.0500  0.0042  158 ALA A C   
1141 O O   . ALA A 156 ? 0.7245 0.8655 0.6499 0.1331  0.0494  0.0015  158 ALA A O   
1142 C CB  . ALA A 156 ? 0.7522 0.9444 0.6523 0.1739  0.0459  -0.0118 158 ALA A CB  
1143 N N   . PRO A 157 ? 0.7312 0.9040 0.6537 0.1424  0.0505  0.0065  159 PRO A N   
1144 C CA  . PRO A 157 ? 0.7162 0.8569 0.6409 0.1327  0.0499  0.0028  159 PRO A CA  
1145 C C   . PRO A 157 ? 0.7173 0.8237 0.6321 0.1360  0.0468  -0.0125 159 PRO A C   
1146 O O   . PRO A 157 ? 0.7229 0.8285 0.6256 0.1496  0.0432  -0.0229 159 PRO A O   
1147 C CB  . PRO A 157 ? 0.7158 0.8713 0.6388 0.1371  0.0504  0.0053  159 PRO A CB  
1148 C CG  . PRO A 157 ? 0.7348 0.9317 0.6635 0.1394  0.0523  0.0185  159 PRO A CG  
1149 C CD  . PRO A 157 ? 0.7473 0.9575 0.6702 0.1495  0.0519  0.0145  159 PRO A CD  
1150 N N   . VAL A 158 ? 0.7062 0.7856 0.6263 0.1235  0.0470  -0.0130 160 VAL A N   
1151 C CA  . VAL A 158 ? 0.7087 0.7570 0.6220 0.1228  0.0439  -0.0241 160 VAL A CA  
1152 C C   . VAL A 158 ? 0.7054 0.7417 0.6194 0.1182  0.0439  -0.0247 160 VAL A C   
1153 O O   . VAL A 158 ? 0.7052 0.7481 0.6280 0.1104  0.0467  -0.0162 160 VAL A O   
1154 C CB  . VAL A 158 ? 0.7015 0.7321 0.6207 0.1124  0.0444  -0.0238 160 VAL A CB  
1155 C CG1 . VAL A 158 ? 0.7212 0.7269 0.6316 0.1141  0.0398  -0.0346 160 VAL A CG1 
1156 C CG2 . VAL A 158 ? 0.6876 0.7345 0.6123 0.1118  0.0460  -0.0177 160 VAL A CG2 
1157 N N   . SER A 159 ? 0.7087 0.7264 0.6130 0.1229  0.0396  -0.0346 161 SER A N   
1158 C CA  . SER A 159 ? 0.6907 0.6949 0.5941 0.1191  0.0388  -0.0363 161 SER A CA  
1159 C C   . SER A 159 ? 0.6901 0.6676 0.5852 0.1190  0.0327  -0.0456 161 SER A C   
1160 O O   . SER A 159 ? 0.6945 0.6680 0.5817 0.1268  0.0274  -0.0518 161 SER A O   
1161 C CB  . SER A 159 ? 0.7033 0.7227 0.6008 0.1298  0.0378  -0.0375 161 SER A CB  
1162 O OG  . SER A 159 ? 0.7389 0.7462 0.6234 0.1407  0.0305  -0.0485 161 SER A OG  
1163 N N   . ALA A 160 ? 0.6646 0.6248 0.5619 0.1100  0.0324  -0.0458 162 ALA A N   
1164 C CA  . ALA A 160 ? 0.6470 0.5839 0.5387 0.1066  0.0260  -0.0514 162 ALA A CA  
1165 C C   . ALA A 160 ? 0.6431 0.5687 0.5352 0.1004  0.0255  -0.0511 162 ALA A C   
1166 O O   . ALA A 160 ? 0.6250 0.5582 0.5241 0.0959  0.0314  -0.0461 162 ALA A O   
1167 C CB  . ALA A 160 ? 0.6225 0.5538 0.5195 0.0983  0.0274  -0.0494 162 ALA A CB  
1168 N N   . LYS A 161 ? 0.6539 0.5609 0.5386 0.0997  0.0173  -0.0558 163 LYS A N   
1169 C CA  . LYS A 161 ? 0.6483 0.5448 0.5336 0.0927  0.0164  -0.0547 163 LYS A CA  
1170 C C   . LYS A 161 ? 0.6370 0.5160 0.5207 0.0838  0.0096  -0.0546 163 LYS A C   
1171 O O   . LYS A 161 ? 0.6476 0.5175 0.5262 0.0852  0.0020  -0.0571 163 LYS A O   
1172 C CB  . LYS A 161 ? 0.6654 0.5631 0.5445 0.1012  0.0138  -0.0580 163 LYS A CB  
1173 C CG  . LYS A 161 ? 0.7807 0.6589 0.6490 0.1047  0.0018  -0.0640 163 LYS A CG  
1174 C CD  . LYS A 161 ? 0.9079 0.7843 0.7646 0.1199  -0.0074 -0.0720 163 LYS A CD  
1175 C CE  . LYS A 161 ? 1.0025 0.8534 0.8480 0.1222  -0.0231 -0.0781 163 LYS A CE  
1176 N NZ  . LYS A 161 ? 1.0249 0.8673 0.8721 0.1145  -0.0232 -0.0755 163 LYS A NZ  
1177 N N   . LYS A 162 ? 0.6328 0.5088 0.5212 0.0741  0.0120  -0.0507 164 LYS A N   
1178 C CA  . LYS A 162 ? 0.6415 0.5051 0.5288 0.0644  0.0051  -0.0484 164 LYS A CA  
1179 C C   . LYS A 162 ? 0.6451 0.5052 0.5334 0.0581  0.0052  -0.0458 164 LYS A C   
1180 O O   . LYS A 162 ? 0.6226 0.4925 0.5165 0.0572  0.0140  -0.0442 164 LYS A O   
1181 C CB  . LYS A 162 ? 0.6186 0.4891 0.5129 0.0565  0.0090  -0.0440 164 LYS A CB  
1182 C CG  . LYS A 162 ? 0.6714 0.5322 0.5637 0.0481  -0.0005 -0.0407 164 LYS A CG  
1183 C CD  . LYS A 162 ? 0.7756 0.6340 0.6660 0.0509  -0.0047 -0.0423 164 LYS A CD  
1184 C CE  . LYS A 162 ? 0.8044 0.6657 0.6995 0.0398  -0.0072 -0.0358 164 LYS A CE  
1185 N NZ  . LYS A 162 ? 0.7871 0.6673 0.6916 0.0374  0.0052  -0.0332 164 LYS A NZ  
1186 N N   . GLU A 163 ? 0.6731 0.5182 0.5557 0.0537  -0.0060 -0.0452 165 GLU A N   
1187 C CA  . GLU A 163 ? 0.6762 0.5169 0.5593 0.0461  -0.0081 -0.0416 165 GLU A CA  
1188 C C   . GLU A 163 ? 0.6799 0.5176 0.5650 0.0336  -0.0147 -0.0345 165 GLU A C   
1189 O O   . GLU A 163 ? 0.6976 0.5273 0.5799 0.0316  -0.0238 -0.0335 165 GLU A O   
1190 C CB  . GLU A 163 ? 0.7032 0.5290 0.5773 0.0521  -0.0175 -0.0461 165 GLU A CB  
1191 C CG  . GLU A 163 ? 0.7646 0.5936 0.6411 0.0493  -0.0126 -0.0444 165 GLU A CG  
1192 C CD  . GLU A 163 ? 0.8754 0.6903 0.7431 0.0558  -0.0216 -0.0491 165 GLU A CD  
1193 O OE1 . GLU A 163 ? 0.9708 0.7711 0.8299 0.0612  -0.0343 -0.0534 165 GLU A OE1 
1194 O OE2 . GLU A 163 ? 0.8726 0.6904 0.7413 0.0560  -0.0172 -0.0490 165 GLU A OE2 
1195 N N   . LYS A 164 ? 0.6760 0.5222 0.5661 0.0250  -0.0106 -0.0289 166 LYS A N   
1196 C CA  . LYS A 164 ? 0.6941 0.5439 0.5872 0.0120  -0.0163 -0.0198 166 LYS A CA  
1197 C C   . LYS A 164 ? 0.6841 0.5331 0.5770 0.0058  -0.0185 -0.0157 166 LYS A C   
1198 O O   . LYS A 164 ? 0.6729 0.5302 0.5682 0.0090  -0.0089 -0.0179 166 LYS A O   
1199 C CB  . LYS A 164 ? 0.6834 0.5553 0.5850 0.0081  -0.0061 -0.0158 166 LYS A CB  
1200 C CG  . LYS A 164 ? 0.7422 0.6254 0.6478 -0.0051 -0.0107 -0.0050 166 LYS A CG  
1201 C CD  . LYS A 164 ? 0.8379 0.7244 0.7454 -0.0103 -0.0160 -0.0002 166 LYS A CD  
1202 C CE  . LYS A 164 ? 0.8747 0.7850 0.7894 -0.0078 -0.0034 -0.0005 166 LYS A CE  
1203 N NZ  . LYS A 164 ? 0.8674 0.8023 0.7876 -0.0111 0.0048  0.0038  166 LYS A NZ  
1204 N N   . LYS A 165 ? 0.6974 0.5352 0.5872 -0.0034 -0.0325 -0.0094 167 LYS A N   
1205 C CA  . LYS A 165 ? 0.6940 0.5316 0.5840 -0.0119 -0.0369 -0.0030 167 LYS A CA  
1206 C C   . LYS A 165 ? 0.6634 0.5288 0.5621 -0.0196 -0.0265 0.0047  167 LYS A C   
1207 O O   . LYS A 165 ? 0.6659 0.5459 0.5693 -0.0248 -0.0251 0.0102  167 LYS A O   
1208 C CB  . LYS A 165 ? 0.7245 0.5441 0.6101 -0.0216 -0.0567 0.0040  167 LYS A CB  
1209 C CG  . LYS A 165 ? 0.7943 0.6164 0.6814 -0.0340 -0.0633 0.0141  167 LYS A CG  
1210 C CD  . LYS A 165 ? 0.8974 0.7024 0.7816 -0.0466 -0.0855 0.0241  167 LYS A CD  
1211 C CE  . LYS A 165 ? 0.9219 0.7162 0.8036 -0.0555 -0.0975 0.0309  167 LYS A CE  
1212 N NZ  . LYS A 165 ? 0.9797 0.7685 0.8630 -0.0730 -0.1173 0.0463  167 LYS A NZ  
1213 N N   . VAL A 166 ? 0.6400 0.5142 0.5403 -0.0191 -0.0194 0.0045  168 VAL A N   
1214 C CA  . VAL A 166 ? 0.6191 0.5209 0.5261 -0.0238 -0.0103 0.0103  168 VAL A CA  
1215 C C   . VAL A 166 ? 0.6397 0.5428 0.5458 -0.0295 -0.0129 0.0149  168 VAL A C   
1216 O O   . VAL A 166 ? 0.6235 0.5235 0.5281 -0.0227 -0.0065 0.0086  168 VAL A O   
1217 C CB  . VAL A 166 ? 0.5945 0.5086 0.5047 -0.0127 0.0044  0.0018  168 VAL A CB  
1218 C CG1 . VAL A 166 ? 0.5620 0.5017 0.4767 -0.0139 0.0126  0.0048  168 VAL A CG1 
1219 C CG2 . VAL A 166 ? 0.5100 0.4261 0.4220 -0.0087 0.0067  -0.0009 168 VAL A CG2 
1220 N N   . SER A 167 ? 0.6796 0.5869 0.5867 -0.0430 -0.0236 0.0272  169 SER A N   
1221 C CA  . SER A 167 ? 0.6995 0.6022 0.6048 -0.0506 -0.0309 0.0333  169 SER A CA  
1222 C C   . SER A 167 ? 0.7010 0.6353 0.6118 -0.0563 -0.0235 0.0413  169 SER A C   
1223 O O   . SER A 167 ? 0.6980 0.6606 0.6140 -0.0554 -0.0146 0.0437  169 SER A O   
1224 C CB  . SER A 167 ? 0.7360 0.6232 0.6391 -0.0632 -0.0500 0.0435  169 SER A CB  
1225 O OG  . SER A 167 ? 0.7394 0.6538 0.6493 -0.0764 -0.0519 0.0584  169 SER A OG  
1226 N N   . SER A 168 ? 0.7096 0.6395 0.6185 -0.0616 -0.0284 0.0455  170 SER A N   
1227 C CA  . SER A 168 ? 0.7078 0.6639 0.6199 -0.0636 -0.0208 0.0500  170 SER A CA  
1228 C C   . SER A 168 ? 0.7318 0.6802 0.6424 -0.0767 -0.0341 0.0611  170 SER A C   
1229 O O   . SER A 168 ? 0.7480 0.6645 0.6534 -0.0786 -0.0467 0.0595  170 SER A O   
1230 C CB  . SER A 168 ? 0.6793 0.6292 0.5889 -0.0495 -0.0091 0.0361  170 SER A CB  
1231 O OG  . SER A 168 ? 0.7054 0.6854 0.6189 -0.0444 0.0028  0.0350  170 SER A OG  
1232 N N   . MET A 169 ? 0.7340 0.7111 0.6485 -0.0847 -0.0323 0.0720  171 MET A N   
1233 C CA  . MET A 169 ? 0.7656 0.7349 0.6789 -0.0977 -0.0455 0.0833  171 MET A CA  
1234 C C   . MET A 169 ? 0.7592 0.6983 0.6660 -0.0890 -0.0455 0.0712  171 MET A C   
1235 O O   . MET A 169 ? 0.7730 0.6823 0.6750 -0.0935 -0.0599 0.0721  171 MET A O   
1236 C CB  . MET A 169 ? 0.7777 0.7892 0.6969 -0.1079 -0.0429 0.0984  171 MET A CB  
1237 C CG  . MET A 169 ? 0.8129 0.8218 0.7318 -0.1216 -0.0549 0.1111  171 MET A CG  
1238 S SD  . MET A 169 ? 0.8269 0.8897 0.7542 -0.1391 -0.0574 0.1358  171 MET A SD  
1239 C CE  . MET A 169 ? 0.8374 0.8959 0.7613 -0.1390 -0.0566 0.1347  171 MET A CE  
1240 N N   . PHE A 170 ? 0.7441 0.6898 0.6502 -0.0757 -0.0304 0.0593  172 PHE A N   
1241 C CA  . PHE A 170 ? 0.7531 0.6729 0.6537 -0.0670 -0.0294 0.0481  172 PHE A CA  
1242 C C   . PHE A 170 ? 0.7448 0.6367 0.6408 -0.0550 -0.0288 0.0345  172 PHE A C   
1243 O O   . PHE A 170 ? 0.7419 0.6123 0.6331 -0.0489 -0.0309 0.0270  172 PHE A O   
1244 C CB  . PHE A 170 ? 0.7465 0.6845 0.6482 -0.0604 -0.0165 0.0437  172 PHE A CB  
1245 C CG  . PHE A 170 ? 0.7990 0.7655 0.7041 -0.0716 -0.0183 0.0575  172 PHE A CG  
1246 C CD1 . PHE A 170 ? 0.8410 0.7976 0.7442 -0.0822 -0.0294 0.0660  172 PHE A CD1 
1247 C CD2 . PHE A 170 ? 0.8254 0.8305 0.7352 -0.0712 -0.0096 0.0622  172 PHE A CD2 
1248 C CE1 . PHE A 170 ? 0.8977 0.8840 0.8045 -0.0935 -0.0312 0.0804  172 PHE A CE1 
1249 C CE2 . PHE A 170 ? 0.8696 0.9068 0.7824 -0.0809 -0.0110 0.0757  172 PHE A CE2 
1250 C CZ  . PHE A 170 ? 0.8896 0.9180 0.8013 -0.0926 -0.0215 0.0855  172 PHE A CZ  
1251 N N   . ILE A 171 ? 0.7519 0.6459 0.6495 -0.0516 -0.0266 0.0319  173 ILE A N   
1252 C CA  . ILE A 171 ? 0.7345 0.6052 0.6279 -0.0409 -0.0273 0.0206  173 ILE A CA  
1253 C C   . ILE A 171 ? 0.7613 0.6230 0.6539 -0.0463 -0.0386 0.0251  173 ILE A C   
1254 O O   . ILE A 171 ? 0.7466 0.6124 0.6408 -0.0408 -0.0332 0.0208  173 ILE A O   
1255 C CB  . ILE A 171 ? 0.6968 0.5771 0.5925 -0.0278 -0.0115 0.0100  173 ILE A CB  
1256 C CG1 . ILE A 171 ? 0.6780 0.5685 0.5750 -0.0234 -0.0018 0.0068  173 ILE A CG1 
1257 C CG2 . ILE A 171 ? 0.6566 0.5159 0.5479 -0.0173 -0.0123 -0.0001 173 ILE A CG2 
1258 C CD1 . ILE A 171 ? 0.6300 0.5353 0.5307 -0.0139 0.0113  0.0000  173 ILE A CD1 
1259 N N   . PRO A 172 ? 0.8040 0.6504 0.6936 -0.0571 -0.0560 0.0335  174 PRO A N   
1260 C CA  . PRO A 172 ? 0.8321 0.6698 0.7213 -0.0641 -0.0692 0.0395  174 PRO A CA  
1261 C C   . PRO A 172 ? 0.8377 0.6540 0.7212 -0.0510 -0.0707 0.0267  174 PRO A C   
1262 O O   . PRO A 172 ? 0.8566 0.6684 0.7401 -0.0537 -0.0779 0.0291  174 PRO A O   
1263 C CB  . PRO A 172 ? 0.8607 0.6797 0.7464 -0.0766 -0.0900 0.0493  174 PRO A CB  
1264 C CG  . PRO A 172 ? 0.8498 0.6567 0.7309 -0.0700 -0.0883 0.0422  174 PRO A CG  
1265 C CD  . PRO A 172 ? 0.8259 0.6589 0.7119 -0.0632 -0.0666 0.0376  174 PRO A CD  
1266 N N   . ASP A 173 ? 0.8374 0.6432 0.7164 -0.0368 -0.0637 0.0137  175 ASP A N   
1267 C CA  . ASP A 173 ? 0.8287 0.6202 0.7025 -0.0229 -0.0635 0.0018  175 ASP A CA  
1268 C C   . ASP A 173 ? 0.7667 0.5753 0.6447 -0.0123 -0.0445 -0.0058 175 ASP A C   
1269 O O   . ASP A 173 ? 0.7381 0.5383 0.6120 0.0004  -0.0419 -0.0157 175 ASP A O   
1270 C CB  . ASP A 173 ? 0.8599 0.6268 0.7243 -0.0134 -0.0726 -0.0071 175 ASP A CB  
1271 C CG  . ASP A 173 ? 0.9700 0.7133 0.8257 -0.0067 -0.0882 -0.0129 175 ASP A CG  
1272 O OD1 . ASP A 173 ? 1.0347 0.7806 0.8890 0.0052  -0.0816 -0.0215 175 ASP A OD1 
1273 O OD2 . ASP A 173 ? 1.0799 0.8019 0.9301 -0.0133 -0.1083 -0.0088 175 ASP A OD2 
1274 N N   . GLY A 174 ? 0.7364 0.5699 0.6224 -0.0172 -0.0324 -0.0007 176 GLY A N   
1275 C CA  . GLY A 174 ? 0.6850 0.5342 0.5756 -0.0083 -0.0162 -0.0069 176 GLY A CA  
1276 C C   . GLY A 174 ? 0.6799 0.5275 0.5705 -0.0025 -0.0150 -0.0111 176 GLY A C   
1277 O O   . GLY A 174 ? 0.7026 0.5477 0.5931 -0.0085 -0.0231 -0.0063 176 GLY A O   
1278 N N   . ARG A 175 ? 0.6502 0.4986 0.5409 0.0088  -0.0062 -0.0193 177 ARG A N   
1279 C CA  . ARG A 175 ? 0.6459 0.4924 0.5360 0.0153  -0.0053 -0.0236 177 ARG A CA  
1280 C C   . ARG A 175 ? 0.5923 0.4547 0.4886 0.0202  0.0078  -0.0261 177 ARG A C   
1281 O O   . ARG A 175 ? 0.5710 0.4405 0.4701 0.0217  0.0149  -0.0269 177 ARG A O   
1282 C CB  . ARG A 175 ? 0.6674 0.4967 0.5495 0.0254  -0.0120 -0.0310 177 ARG A CB  
1283 C CG  . ARG A 175 ? 0.7854 0.5950 0.6602 0.0213  -0.0283 -0.0294 177 ARG A CG  
1284 C CD  . ARG A 175 ? 0.9521 0.7443 0.8185 0.0289  -0.0408 -0.0351 177 ARG A CD  
1285 N NE  . ARG A 175 ? 1.0420 0.8116 0.9007 0.0247  -0.0598 -0.0335 177 ARG A NE  
1286 C CZ  . ARG A 175 ? 1.1443 0.8943 0.9925 0.0353  -0.0731 -0.0415 177 ARG A CZ  
1287 N NH1 . ARG A 175 ? 1.1543 0.9086 0.9988 0.0506  -0.0677 -0.0509 177 ARG A NH1 
1288 N NH2 . ARG A 175 ? 1.1974 0.9239 1.0382 0.0313  -0.0930 -0.0402 177 ARG A NH2 
1289 N N   . VAL A 176 ? 0.5755 0.4424 0.4739 0.0225  0.0099  -0.0271 178 VAL A N   
1290 C CA  . VAL A 176 ? 0.5462 0.4239 0.4495 0.0287  0.0200  -0.0303 178 VAL A CA  
1291 C C   . VAL A 176 ? 0.5467 0.4202 0.4480 0.0361  0.0192  -0.0343 178 VAL A C   
1292 O O   . VAL A 176 ? 0.5546 0.4232 0.4535 0.0347  0.0134  -0.0337 178 VAL A O   
1293 C CB  . VAL A 176 ? 0.5278 0.4212 0.4371 0.0247  0.0252  -0.0272 178 VAL A CB  
1294 C CG1 . VAL A 176 ? 0.5188 0.4183 0.4320 0.0314  0.0321  -0.0309 178 VAL A CG1 
1295 C CG2 . VAL A 176 ? 0.5318 0.4343 0.4432 0.0209  0.0281  -0.0248 178 VAL A CG2 
1296 N N   . SER A 177 ? 0.5408 0.4172 0.4431 0.0437  0.0244  -0.0376 179 SER A N   
1297 C CA  . SER A 177 ? 0.5568 0.4338 0.4578 0.0503  0.0241  -0.0402 179 SER A CA  
1298 C C   . SER A 177 ? 0.5422 0.4307 0.4492 0.0544  0.0318  -0.0400 179 SER A C   
1299 O O   . SER A 177 ? 0.5163 0.4100 0.4279 0.0535  0.0366  -0.0387 179 SER A O   
1300 C CB  . SER A 177 ? 0.5752 0.4428 0.4680 0.0577  0.0175  -0.0443 179 SER A CB  
1301 O OG  . SER A 177 ? 0.6372 0.5077 0.5303 0.0611  0.0208  -0.0448 179 SER A OG  
1302 N N   . VAL A 178 ? 0.5494 0.4407 0.4559 0.0585  0.0314  -0.0411 180 VAL A N   
1303 C CA  . VAL A 178 ? 0.5350 0.4371 0.4472 0.0616  0.0368  -0.0398 180 VAL A CA  
1304 C C   . VAL A 178 ? 0.5328 0.4375 0.4404 0.0696  0.0343  -0.0418 180 VAL A C   
1305 O O   . VAL A 178 ? 0.5338 0.4318 0.4360 0.0713  0.0291  -0.0446 180 VAL A O   
1306 C CB  . VAL A 178 ? 0.5307 0.4368 0.4483 0.0571  0.0392  -0.0383 180 VAL A CB  
1307 C CG1 . VAL A 178 ? 0.5442 0.4449 0.4580 0.0545  0.0346  -0.0391 180 VAL A CG1 
1308 C CG2 . VAL A 178 ? 0.5186 0.4338 0.4415 0.0602  0.0427  -0.0367 180 VAL A CG2 
1309 N N   . SER A 179 ? 0.5293 0.4452 0.4393 0.0745  0.0375  -0.0399 181 SER A N   
1310 C CA  . SER A 179 ? 0.5307 0.4565 0.4373 0.0835  0.0366  -0.0408 181 SER A CA  
1311 C C   . SER A 179 ? 0.5179 0.4593 0.4334 0.0822  0.0417  -0.0345 181 SER A C   
1312 O O   . SER A 179 ? 0.5123 0.4573 0.4340 0.0779  0.0442  -0.0299 181 SER A O   
1313 C CB  . SER A 179 ? 0.5240 0.4521 0.4250 0.0903  0.0345  -0.0428 181 SER A CB  
1314 O OG  . SER A 179 ? 0.5776 0.5212 0.4760 0.1001  0.0344  -0.0429 181 SER A OG  
1315 N N   . ALA A 180 ? 0.5228 0.4723 0.4389 0.0854  0.0420  -0.0339 182 ALA A N   
1316 C CA  . ALA A 180 ? 0.5146 0.4758 0.4398 0.0819  0.0452  -0.0272 182 ALA A CA  
1317 C C   . ALA A 180 ? 0.5211 0.5011 0.4457 0.0890  0.0456  -0.0243 182 ALA A C   
1318 O O   . ALA A 180 ? 0.5299 0.5098 0.4463 0.0969  0.0431  -0.0299 182 ALA A O   
1319 C CB  . ALA A 180 ? 0.4949 0.4474 0.4229 0.0767  0.0454  -0.0286 182 ALA A CB  
1320 N N   . ARG A 181 ? 0.5227 0.5190 0.4555 0.0864  0.0474  -0.0151 183 ARG A N   
1321 C CA  . ARG A 181 ? 0.5341 0.5531 0.4681 0.0917  0.0480  -0.0100 183 ARG A CA  
1322 C C   . ARG A 181 ? 0.5362 0.5650 0.4812 0.0841  0.0481  0.0004  183 ARG A C   
1323 O O   . ARG A 181 ? 0.5437 0.5679 0.4964 0.0758  0.0468  0.0064  183 ARG A O   
1324 C CB  . ARG A 181 ? 0.5278 0.5691 0.4591 0.0996  0.0484  -0.0066 183 ARG A CB  
1325 C CG  . ARG A 181 ? 0.5709 0.6041 0.4955 0.1036  0.0474  -0.0124 183 ARG A CG  
1326 C CD  . ARG A 181 ? 0.6371 0.6967 0.5630 0.1086  0.0484  -0.0055 183 ARG A CD  
1327 N NE  . ARG A 181 ? 0.7417 0.8217 0.6594 0.1229  0.0477  -0.0090 183 ARG A NE  
1328 C CZ  . ARG A 181 ? 0.7642 0.8414 0.6699 0.1354  0.0447  -0.0192 183 ARG A CZ  
1329 N NH1 . ARG A 181 ? 0.7404 0.7954 0.6423 0.1332  0.0427  -0.0251 183 ARG A NH1 
1330 N NH2 . ARG A 181 ? 0.7335 0.8304 0.6308 0.1504  0.0430  -0.0234 183 ARG A NH2 
1331 N N   . ILE A 182 ? 0.5431 0.5842 0.4882 0.0874  0.0484  0.0022  184 ILE A N   
1332 C CA  . ILE A 182 ? 0.5251 0.5776 0.4801 0.0809  0.0474  0.0127  184 ILE A CA  
1333 C C   . ILE A 182 ? 0.5378 0.6189 0.4920 0.0878  0.0484  0.0182  184 ILE A C   
1334 O O   . ILE A 182 ? 0.5434 0.6328 0.4882 0.0990  0.0496  0.0115  184 ILE A O   
1335 C CB  . ILE A 182 ? 0.5029 0.5376 0.4599 0.0764  0.0464  0.0087  184 ILE A CB  
1336 C CG1 . ILE A 182 ? 0.4959 0.5275 0.4442 0.0842  0.0479  -0.0006 184 ILE A CG1 
1337 C CG2 . ILE A 182 ? 0.4597 0.4710 0.4176 0.0707  0.0454  0.0037  184 ILE A CG2 
1338 C CD1 . ILE A 182 ? 0.5193 0.5397 0.4698 0.0806  0.0473  -0.0032 184 ILE A CD1 
1339 N N   . ASP A 183 ? 0.5603 0.6566 0.5240 0.0813  0.0466  0.0305  185 ASP A N   
1340 C CA  . ASP A 183 ? 0.5853 0.7180 0.5509 0.0858  0.0473  0.0408  185 ASP A CA  
1341 C C   . ASP A 183 ? 0.5892 0.7319 0.5489 0.0947  0.0491  0.0359  185 ASP A C   
1342 O O   . ASP A 183 ? 0.6113 0.7856 0.5691 0.1027  0.0503  0.0409  185 ASP A O   
1343 C CB  . ASP A 183 ? 0.5882 0.7346 0.5674 0.0735  0.0430  0.0586  185 ASP A CB  
1344 C CG  . ASP A 183 ? 0.6103 0.7521 0.5958 0.0652  0.0396  0.0659  185 ASP A CG  
1345 O OD1 . ASP A 183 ? 0.6597 0.8066 0.6563 0.0537  0.0334  0.0803  185 ASP A OD1 
1346 O OD2 . ASP A 183 ? 0.6815 0.8146 0.6609 0.0697  0.0420  0.0580  185 ASP A OD2 
1347 N N   . ARG A 184 ? 0.5813 0.6995 0.5384 0.0936  0.0488  0.0268  186 ARG A N   
1348 C CA  . ARG A 184 ? 0.6027 0.7281 0.5559 0.0999  0.0494  0.0234  186 ARG A CA  
1349 C C   . ARG A 184 ? 0.5993 0.6949 0.5525 0.0947  0.0486  0.0156  186 ARG A C   
1350 O O   . ARG A 184 ? 0.5900 0.6652 0.5477 0.0861  0.0474  0.0152  186 ARG A O   
1351 C CB  . ARG A 184 ? 0.6160 0.7697 0.5783 0.0956  0.0486  0.0384  186 ARG A CB  
1352 C CG  . ARG A 184 ? 0.6086 0.7503 0.5837 0.0800  0.0445  0.0486  186 ARG A CG  
1353 C CD  . ARG A 184 ? 0.5945 0.7687 0.5786 0.0754  0.0422  0.0660  186 ARG A CD  
1354 N NE  . ARG A 184 ? 0.6528 0.8146 0.6482 0.0616  0.0357  0.0755  186 ARG A NE  
1355 C CZ  . ARG A 184 ? 0.6872 0.8426 0.6908 0.0511  0.0299  0.0848  186 ARG A CZ  
1356 N NH1 . ARG A 184 ? 0.6679 0.8302 0.6700 0.0527  0.0314  0.0861  186 ARG A NH1 
1357 N NH2 . ARG A 184 ? 0.6790 0.8203 0.6920 0.0396  0.0214  0.0926  186 ARG A NH2 
1358 N N   . LYS A 185 ? 0.6162 0.7114 0.5640 0.1007  0.0488  0.0097  187 LYS A N   
1359 C CA  . LYS A 185 ? 0.6199 0.6895 0.5661 0.0976  0.0480  0.0014  187 LYS A CA  
1360 C C   . LYS A 185 ? 0.6169 0.6870 0.5727 0.0892  0.0471  0.0086  187 LYS A C   
1361 O O   . LYS A 185 ? 0.6167 0.6671 0.5733 0.0851  0.0465  0.0033  187 LYS A O   
1362 C CB  . LYS A 185 ? 0.6379 0.7061 0.5728 0.1088  0.0471  -0.0086 187 LYS A CB  
1363 C CG  . LYS A 185 ? 0.6892 0.7306 0.6204 0.1063  0.0454  -0.0178 187 LYS A CG  
1364 C CD  . LYS A 185 ? 0.7648 0.8007 0.6837 0.1173  0.0416  -0.0280 187 LYS A CD  
1365 C CE  . LYS A 185 ? 0.8167 0.8308 0.7356 0.1115  0.0395  -0.0328 187 LYS A CE  
1366 N NZ  . LYS A 185 ? 0.8710 0.8777 0.7800 0.1195  0.0341  -0.0409 187 LYS A NZ  
1367 N N   . GLY A 186 ? 0.6200 0.7138 0.5831 0.0865  0.0464  0.0213  188 GLY A N   
1368 C CA  . GLY A 186 ? 0.6154 0.7122 0.5863 0.0802  0.0442  0.0283  188 GLY A CA  
1369 C C   . GLY A 186 ? 0.6264 0.7231 0.6090 0.0685  0.0393  0.0406  188 GLY A C   
1370 O O   . GLY A 186 ? 0.6499 0.7676 0.6371 0.0662  0.0380  0.0521  188 GLY A O   
1371 N N   . PHE A 187 ? 0.6219 0.6961 0.6092 0.0616  0.0355  0.0386  189 PHE A N   
1372 C CA  . PHE A 187 ? 0.6332 0.7020 0.6305 0.0513  0.0278  0.0489  189 PHE A CA  
1373 C C   . PHE A 187 ? 0.6527 0.7139 0.6569 0.0452  0.0211  0.0534  189 PHE A C   
1374 O O   . PHE A 187 ? 0.6333 0.6832 0.6344 0.0482  0.0229  0.0446  189 PHE A O   
1375 C CB  . PHE A 187 ? 0.6278 0.6735 0.6240 0.0494  0.0262  0.0419  189 PHE A CB  
1376 C CG  . PHE A 187 ? 0.5801 0.6315 0.5710 0.0534  0.0308  0.0395  189 PHE A CG  
1377 C CD1 . PHE A 187 ? 0.5796 0.6432 0.5759 0.0488  0.0275  0.0508  189 PHE A CD1 
1378 C CD2 . PHE A 187 ? 0.5351 0.5793 0.5161 0.0613  0.0372  0.0266  189 PHE A CD2 
1379 C CE1 . PHE A 187 ? 0.5896 0.6590 0.5810 0.0530  0.0317  0.0483  189 PHE A CE1 
1380 C CE2 . PHE A 187 ? 0.5385 0.5858 0.5143 0.0654  0.0402  0.0238  189 PHE A CE2 
1381 C CZ  . PHE A 187 ? 0.5797 0.6400 0.5604 0.0618  0.0381  0.0341  189 PHE A CZ  
1382 N N   . CYS A 188 ? 0.6891 0.7557 0.7030 0.0360  0.0121  0.0677  190 CYS A N   
1383 C CA  . CYS A 188 ? 0.7255 0.7830 0.7461 0.0297  0.0030  0.0731  190 CYS A CA  
1384 C C   . CYS A 188 ? 0.7245 0.7519 0.7459 0.0274  -0.0045 0.0660  190 CYS A C   
1385 O O   . CYS A 188 ? 0.7280 0.7498 0.7505 0.0248  -0.0079 0.0681  190 CYS A O   
1386 C CB  . CYS A 188 ? 0.7597 0.8373 0.7908 0.0197  -0.0060 0.0939  190 CYS A CB  
1387 S SG  . CYS A 188 ? 0.8656 0.9875 0.8994 0.0201  -0.0012 0.1087  190 CYS A SG  
1388 N N   . GLU A 189 ? 0.7204 0.7300 0.7411 0.0291  -0.0079 0.0579  191 GLU A N   
1389 C CA  . GLU A 189 ? 0.7399 0.7235 0.7625 0.0274  -0.0191 0.0533  191 GLU A CA  
1390 C C   . GLU A 189 ? 0.7605 0.7399 0.7906 0.0186  -0.0328 0.0664  191 GLU A C   
1391 O O   . GLU A 189 ? 0.7896 0.7847 0.8274 0.0101  -0.0391 0.0833  191 GLU A O   
1392 C CB  . GLU A 189 ? 0.7551 0.7287 0.7797 0.0277  -0.0257 0.0510  191 GLU A CB  
1393 C CG  . GLU A 189 ? 0.7917 0.7567 0.8085 0.0368  -0.0171 0.0342  191 GLU A CG  
1394 C CD  . GLU A 189 ? 0.8344 0.7965 0.8524 0.0380  -0.0198 0.0320  191 GLU A CD  
1395 O OE1 . GLU A 189 ? 0.7922 0.7518 0.8044 0.0449  -0.0118 0.0198  191 GLU A OE1 
1396 O OE2 . GLU A 189 ? 0.8787 0.8418 0.9038 0.0316  -0.0304 0.0434  191 GLU A OE2 
1397 N N   . GLY A 190 ? 0.7516 0.7111 0.7797 0.0199  -0.0385 0.0597  192 GLY A N   
1398 C CA  . GLY A 190 ? 0.7615 0.7152 0.7960 0.0116  -0.0523 0.0716  192 GLY A CA  
1399 C C   . GLY A 190 ? 0.7597 0.7285 0.7941 0.0096  -0.0453 0.0774  192 GLY A C   
1400 O O   . GLY A 190 ? 0.7668 0.7267 0.8045 0.0044  -0.0553 0.0833  192 GLY A O   
1401 N N   . ASP A 191 ? 0.7233 0.7135 0.7531 0.0143  -0.0294 0.0750  193 ASP A N   
1402 C CA  . ASP A 191 ? 0.7149 0.7199 0.7441 0.0136  -0.0236 0.0798  193 ASP A CA  
1403 C C   . ASP A 191 ? 0.7115 0.6986 0.7349 0.0180  -0.0215 0.0679  193 ASP A C   
1404 O O   . ASP A 191 ? 0.7266 0.6930 0.7449 0.0237  -0.0214 0.0538  193 ASP A O   
1405 C CB  . ASP A 191 ? 0.7150 0.7445 0.7392 0.0199  -0.0091 0.0778  193 ASP A CB  
1406 C CG  . ASP A 191 ? 0.7214 0.7788 0.7517 0.0154  -0.0103 0.0933  193 ASP A CG  
1407 O OD1 . ASP A 191 ? 0.7808 0.8367 0.8201 0.0057  -0.0230 0.1065  193 ASP A OD1 
1408 O OD2 . ASP A 191 ? 0.6849 0.7654 0.7108 0.0217  0.0001  0.0924  193 ASP A OD2 
1409 N N   . GLU A 192 ? 0.7055 0.7030 0.7298 0.0157  -0.0197 0.0742  194 GLU A N   
1410 C CA  . GLU A 192 ? 0.6988 0.6847 0.7170 0.0204  -0.0150 0.0635  194 GLU A CA  
1411 C C   . GLU A 192 ? 0.6698 0.6728 0.6807 0.0279  0.0004  0.0573  194 GLU A C   
1412 O O   . GLU A 192 ? 0.6701 0.6980 0.6826 0.0274  0.0042  0.0665  194 GLU A O   
1413 C CB  . GLU A 192 ? 0.7188 0.7065 0.7424 0.0133  -0.0229 0.0749  194 GLU A CB  
1414 C CG  . GLU A 192 ? 0.7909 0.7503 0.8130 0.0135  -0.0320 0.0673  194 GLU A CG  
1415 C CD  . GLU A 192 ? 0.9269 0.8711 0.9569 0.0054  -0.0517 0.0770  194 GLU A CD  
1416 O OE1 . GLU A 192 ? 0.9669 0.9114 1.0028 -0.0028 -0.0619 0.0895  194 GLU A OE1 
1417 O OE2 . GLU A 192 ? 0.9806 0.9118 1.0107 0.0069  -0.0583 0.0727  194 GLU A OE2 
1418 N N   . ILE A 193 ? 0.6454 0.6362 0.6478 0.0351  0.0080  0.0420  195 ILE A N   
1419 C CA  . ILE A 193 ? 0.6220 0.6243 0.6174 0.0412  0.0186  0.0369  195 ILE A CA  
1420 C C   . ILE A 193 ? 0.6209 0.6190 0.6153 0.0402  0.0182  0.0371  195 ILE A C   
1421 O O   . ILE A 193 ? 0.6245 0.6032 0.6186 0.0390  0.0139  0.0317  195 ILE A O   
1422 C CB  . ILE A 193 ? 0.6078 0.6000 0.5951 0.0478  0.0255  0.0228  195 ILE A CB  
1423 C CG1 . ILE A 193 ? 0.6076 0.6044 0.5957 0.0490  0.0260  0.0226  195 ILE A CG1 
1424 C CG2 . ILE A 193 ? 0.6052 0.6046 0.5847 0.0537  0.0332  0.0176  195 ILE A CG2 
1425 C CD1 . ILE A 193 ? 0.5965 0.5829 0.5775 0.0542  0.0313  0.0098  195 ILE A CD1 
1426 N N   . SER A 194 ? 0.6107 0.6284 0.6043 0.0416  0.0223  0.0429  196 SER A N   
1427 C CA  . SER A 194 ? 0.6128 0.6300 0.6067 0.0399  0.0213  0.0454  196 SER A CA  
1428 C C   . SER A 194 ? 0.5913 0.6070 0.5753 0.0479  0.0299  0.0341  196 SER A C   
1429 O O   . SER A 194 ? 0.5931 0.6224 0.5719 0.0545  0.0355  0.0315  196 SER A O   
1430 C CB  . SER A 194 ? 0.6153 0.6580 0.6161 0.0353  0.0182  0.0620  196 SER A CB  
1431 O OG  . SER A 194 ? 0.6443 0.6808 0.6477 0.0309  0.0140  0.0656  196 SER A OG  
1432 N N   . ILE A 195 ? 0.5710 0.5701 0.5522 0.0477  0.0297  0.0276  197 ILE A N   
1433 C CA  . ILE A 195 ? 0.5534 0.5462 0.5254 0.0539  0.0361  0.0164  197 ILE A CA  
1434 C C   . ILE A 195 ? 0.5635 0.5592 0.5334 0.0548  0.0373  0.0174  197 ILE A C   
1435 O O   . ILE A 195 ? 0.5531 0.5417 0.5271 0.0498  0.0330  0.0211  197 ILE A O   
1436 C CB  . ILE A 195 ? 0.5387 0.5103 0.5071 0.0542  0.0365  0.0054  197 ILE A CB  
1437 C CG1 . ILE A 195 ? 0.5481 0.5164 0.5186 0.0538  0.0351  0.0038  197 ILE A CG1 
1438 C CG2 . ILE A 195 ? 0.5016 0.4694 0.4609 0.0594  0.0418  -0.0037 197 ILE A CG2 
1439 C CD1 . ILE A 195 ? 0.4882 0.4406 0.4558 0.0546  0.0353  -0.0060 197 ILE A CD1 
1440 N N   . HIS A 196 ? 0.5637 0.5682 0.5262 0.0620  0.0421  0.0129  198 HIS A N   
1441 C CA  . HIS A 196 ? 0.5722 0.5794 0.5304 0.0652  0.0437  0.0114  198 HIS A CA  
1442 C C   . HIS A 196 ? 0.5773 0.5669 0.5264 0.0692  0.0459  -0.0012 198 HIS A C   
1443 O O   . HIS A 196 ? 0.6008 0.5897 0.5439 0.0745  0.0471  -0.0072 198 HIS A O   
1444 C CB  . HIS A 196 ? 0.5834 0.6166 0.5392 0.0724  0.0456  0.0158  198 HIS A CB  
1445 C CG  . HIS A 196 ? 0.6293 0.6698 0.5818 0.0761  0.0465  0.0161  198 HIS A CG  
1446 N ND1 . HIS A 196 ? 0.6653 0.7019 0.6071 0.0855  0.0481  0.0059  198 HIS A ND1 
1447 C CD2 . HIS A 196 ? 0.6330 0.6828 0.5914 0.0715  0.0449  0.0252  198 HIS A CD2 
1448 C CE1 . HIS A 196 ? 0.6503 0.6947 0.5913 0.0874  0.0482  0.0083  198 HIS A CE1 
1449 N NE2 . HIS A 196 ? 0.6363 0.6890 0.5875 0.0786  0.0467  0.0201  198 HIS A NE2 
1450 N N   . ALA A 197 ? 0.5648 0.5402 0.5129 0.0662  0.0454  -0.0046 199 ALA A N   
1451 C CA  . ALA A 197 ? 0.5482 0.5080 0.4888 0.0679  0.0464  -0.0144 199 ALA A CA  
1452 C C   . ALA A 197 ? 0.5441 0.4958 0.4821 0.0668  0.0462  -0.0164 199 ALA A C   
1453 O O   . ALA A 197 ? 0.5401 0.4919 0.4833 0.0628  0.0451  -0.0118 199 ALA A O   
1454 C CB  . ALA A 197 ? 0.5338 0.4823 0.4759 0.0642  0.0461  -0.0180 199 ALA A CB  
1455 N N   . ASP A 198 ? 0.5317 0.4764 0.4615 0.0705  0.0460  -0.0229 200 ASP A N   
1456 C CA  . ASP A 198 ? 0.5373 0.4737 0.4640 0.0694  0.0454  -0.0253 200 ASP A CA  
1457 C C   . ASP A 198 ? 0.5455 0.4671 0.4684 0.0660  0.0444  -0.0309 200 ASP A C   
1458 O O   . ASP A 198 ? 0.5555 0.4733 0.4742 0.0673  0.0428  -0.0342 200 ASP A O   
1459 C CB  . ASP A 198 ? 0.5480 0.4899 0.4680 0.0769  0.0442  -0.0271 200 ASP A CB  
1460 C CG  . ASP A 198 ? 0.5596 0.5234 0.4829 0.0814  0.0455  -0.0204 200 ASP A CG  
1461 O OD1 . ASP A 198 ? 0.5444 0.5170 0.4763 0.0764  0.0464  -0.0122 200 ASP A OD1 
1462 O OD2 . ASP A 198 ? 0.6073 0.5806 0.5240 0.0908  0.0443  -0.0232 200 ASP A OD2 
1463 N N   . PHE A 199 ? 0.5322 0.4469 0.4566 0.0613  0.0447  -0.0312 201 PHE A N   
1464 C CA  . PHE A 199 ? 0.5341 0.4401 0.4556 0.0574  0.0438  -0.0345 201 PHE A CA  
1465 C C   . PHE A 199 ? 0.5364 0.4356 0.4537 0.0562  0.0423  -0.0357 201 PHE A C   
1466 O O   . PHE A 199 ? 0.5502 0.4503 0.4699 0.0558  0.0434  -0.0342 201 PHE A O   
1467 C CB  . PHE A 199 ? 0.5315 0.4388 0.4586 0.0539  0.0454  -0.0339 201 PHE A CB  
1468 C CG  . PHE A 199 ? 0.5122 0.4248 0.4438 0.0549  0.0459  -0.0326 201 PHE A CG  
1469 C CD1 . PHE A 199 ? 0.4804 0.3939 0.4111 0.0544  0.0460  -0.0343 201 PHE A CD1 
1470 C CD2 . PHE A 199 ? 0.5188 0.4354 0.4562 0.0555  0.0453  -0.0287 201 PHE A CD2 
1471 C CE1 . PHE A 199 ? 0.4796 0.3976 0.4145 0.0554  0.0464  -0.0332 201 PHE A CE1 
1472 C CE2 . PHE A 199 ? 0.4844 0.4049 0.4261 0.0558  0.0446  -0.0268 201 PHE A CE2 
1473 C CZ  . PHE A 199 ? 0.5029 0.4241 0.4432 0.0562  0.0456  -0.0296 201 PHE A CZ  
1474 N N   . GLU A 200 ? 0.5470 0.4386 0.4583 0.0550  0.0386  -0.0380 202 GLU A N   
1475 C CA  . GLU A 200 ? 0.5640 0.4485 0.4719 0.0521  0.0364  -0.0384 202 GLU A CA  
1476 C C   . GLU A 200 ? 0.5437 0.4270 0.4522 0.0449  0.0357  -0.0371 202 GLU A C   
1477 O O   . GLU A 200 ? 0.5445 0.4295 0.4534 0.0424  0.0344  -0.0364 202 GLU A O   
1478 C CB  . GLU A 200 ? 0.5964 0.4714 0.4962 0.0550  0.0297  -0.0409 202 GLU A CB  
1479 C CG  . GLU A 200 ? 0.6732 0.5504 0.5688 0.0647  0.0279  -0.0436 202 GLU A CG  
1480 C CD  . GLU A 200 ? 0.7733 0.6401 0.6608 0.0683  0.0212  -0.0469 202 GLU A CD  
1481 O OE1 . GLU A 200 ? 0.7599 0.6159 0.6452 0.0618  0.0170  -0.0463 202 GLU A OE1 
1482 O OE2 . GLU A 200 ? 0.8308 0.7022 0.7142 0.0779  0.0198  -0.0497 202 GLU A OE2 
1483 N N   . ASN A 201 ? 0.5263 0.4086 0.4348 0.0416  0.0361  -0.0363 203 ASN A N   
1484 C CA  . ASN A 201 ? 0.5129 0.3986 0.4216 0.0349  0.0351  -0.0339 203 ASN A CA  
1485 C C   . ASN A 201 ? 0.5338 0.4143 0.4393 0.0314  0.0323  -0.0326 203 ASN A C   
1486 O O   . ASN A 201 ? 0.5399 0.4231 0.4470 0.0321  0.0355  -0.0331 203 ASN A O   
1487 C CB  . ASN A 201 ? 0.4869 0.3841 0.4008 0.0353  0.0402  -0.0341 203 ASN A CB  
1488 C CG  . ASN A 201 ? 0.4758 0.3826 0.3899 0.0300  0.0400  -0.0315 203 ASN A CG  
1489 O OD1 . ASN A 201 ? 0.4606 0.3671 0.3722 0.0237  0.0357  -0.0275 203 ASN A OD1 
1490 N ND2 . ASN A 201 ? 0.4184 0.3349 0.3352 0.0328  0.0435  -0.0334 203 ASN A ND2 
1491 N N   . THR A 202 ? 0.5468 0.4187 0.4476 0.0274  0.0249  -0.0308 204 THR A N   
1492 C CA  . THR A 202 ? 0.5575 0.4227 0.4547 0.0227  0.0199  -0.0285 204 THR A CA  
1493 C C   . THR A 202 ? 0.5665 0.4392 0.4650 0.0128  0.0166  -0.0218 204 THR A C   
1494 O O   . THR A 202 ? 0.5914 0.4597 0.4874 0.0070  0.0112  -0.0182 204 THR A O   
1495 C CB  . THR A 202 ? 0.5700 0.4182 0.4601 0.0254  0.0107  -0.0307 204 THR A CB  
1496 O OG1 . THR A 202 ? 0.6091 0.4519 0.4969 0.0238  0.0038  -0.0299 204 THR A OG1 
1497 C CG2 . THR A 202 ? 0.5809 0.4270 0.4695 0.0361  0.0141  -0.0365 204 THR A CG2 
1498 N N   . SER A 203 ? 0.5574 0.4433 0.4599 0.0107  0.0196  -0.0196 205 SER A N   
1499 C CA  . SER A 203 ? 0.5665 0.4680 0.4717 0.0021  0.0186  -0.0123 205 SER A CA  
1500 C C   . SER A 203 ? 0.5701 0.4872 0.4778 0.0037  0.0257  -0.0127 205 SER A C   
1501 O O   . SER A 203 ? 0.5591 0.4738 0.4674 0.0115  0.0313  -0.0190 205 SER A O   
1502 C CB  . SER A 203 ? 0.5621 0.4753 0.4708 0.0025  0.0212  -0.0115 205 SER A CB  
1503 O OG  . SER A 203 ? 0.5477 0.4754 0.4601 0.0090  0.0304  -0.0156 205 SER A OG  
1504 N N   . SER A 204 ? 0.5918 0.5270 0.5013 -0.0036 0.0247  -0.0054 206 SER A N   
1505 C CA  . SER A 204 ? 0.5833 0.5374 0.4943 -0.0011 0.0305  -0.0058 206 SER A CA  
1506 C C   . SER A 204 ? 0.5875 0.5589 0.5015 0.0071  0.0375  -0.0107 206 SER A C   
1507 O O   . SER A 204 ? 0.5945 0.5823 0.5088 0.0116  0.0414  -0.0126 206 SER A O   
1508 C CB  . SER A 204 ? 0.5852 0.5565 0.4968 -0.0119 0.0262  0.0051  206 SER A CB  
1509 O OG  . SER A 204 ? 0.5862 0.5743 0.5008 -0.0182 0.0239  0.0127  206 SER A OG  
1510 N N   . ARG A 205 ? 0.5964 0.5648 0.5120 0.0099  0.0383  -0.0131 207 ARG A N   
1511 C CA  . ARG A 205 ? 0.6017 0.5861 0.5196 0.0180  0.0435  -0.0179 207 ARG A CA  
1512 C C   . ARG A 205 ? 0.5723 0.5421 0.4903 0.0279  0.0462  -0.0271 207 ARG A C   
1513 O O   . ARG A 205 ? 0.5894 0.5396 0.5067 0.0278  0.0449  -0.0286 207 ARG A O   
1514 C CB  . ARG A 205 ? 0.6047 0.5985 0.5251 0.0155  0.0428  -0.0145 207 ARG A CB  
1515 C CG  . ARG A 205 ? 0.6571 0.6554 0.5780 0.0030  0.0368  -0.0037 207 ARG A CG  
1516 C CD  . ARG A 205 ? 0.7592 0.7888 0.6819 -0.0020 0.0372  0.0045  207 ARG A CD  
1517 N NE  . ARG A 205 ? 0.8294 0.8661 0.7540 -0.0153 0.0300  0.0171  207 ARG A NE  
1518 C CZ  . ARG A 205 ? 0.8530 0.8727 0.7759 -0.0260 0.0210  0.0242  207 ARG A CZ  
1519 N NH1 . ARG A 205 ? 0.7880 0.7841 0.7071 -0.0244 0.0190  0.0196  207 ARG A NH1 
1520 N NH2 . ARG A 205 ? 0.9062 0.9320 0.8313 -0.0384 0.0125  0.0362  207 ARG A NH2 
1521 N N   . ILE A 206 ? 0.5528 0.5331 0.4714 0.0366  0.0488  -0.0328 208 ILE A N   
1522 C CA  . ILE A 206 ? 0.5292 0.4971 0.4490 0.0447  0.0490  -0.0399 208 ILE A CA  
1523 C C   . ILE A 206 ? 0.5365 0.5052 0.4587 0.0450  0.0493  -0.0397 208 ILE A C   
1524 O O   . ILE A 206 ? 0.5514 0.5391 0.4745 0.0453  0.0503  -0.0383 208 ILE A O   
1525 C CB  . ILE A 206 ? 0.5294 0.5069 0.4481 0.0546  0.0489  -0.0465 208 ILE A CB  
1526 C CG1 . ILE A 206 ? 0.4944 0.4672 0.4107 0.0555  0.0481  -0.0478 208 ILE A CG1 
1527 C CG2 . ILE A 206 ? 0.5585 0.5242 0.4791 0.0624  0.0465  -0.0528 208 ILE A CG2 
1528 C CD1 . ILE A 206 ? 0.3906 0.3785 0.3039 0.0655  0.0470  -0.0540 208 ILE A CD1 
1529 N N   . VAL A 207 ? 0.5147 0.4664 0.4383 0.0452  0.0486  -0.0407 209 VAL A N   
1530 C CA  . VAL A 207 ? 0.5041 0.4556 0.4298 0.0449  0.0487  -0.0400 209 VAL A CA  
1531 C C   . VAL A 207 ? 0.5169 0.4604 0.4453 0.0515  0.0480  -0.0444 209 VAL A C   
1532 O O   . VAL A 207 ? 0.5317 0.4653 0.4603 0.0540  0.0465  -0.0462 209 VAL A O   
1533 C CB  . VAL A 207 ? 0.5033 0.4442 0.4278 0.0385  0.0471  -0.0356 209 VAL A CB  
1534 C CG1 . VAL A 207 ? 0.4867 0.4325 0.4088 0.0305  0.0448  -0.0300 209 VAL A CG1 
1535 C CG2 . VAL A 207 ? 0.4598 0.3843 0.3835 0.0403  0.0464  -0.0369 209 VAL A CG2 
1536 N N   . VAL A 208 ? 0.5156 0.4628 0.4460 0.0535  0.0480  -0.0453 210 VAL A N   
1537 C CA  . VAL A 208 ? 0.5129 0.4529 0.4461 0.0590  0.0458  -0.0486 210 VAL A CA  
1538 C C   . VAL A 208 ? 0.5078 0.4429 0.4432 0.0567  0.0462  -0.0459 210 VAL A C   
1539 O O   . VAL A 208 ? 0.5142 0.4562 0.4494 0.0545  0.0477  -0.0446 210 VAL A O   
1540 C CB  . VAL A 208 ? 0.5316 0.4822 0.4648 0.0659  0.0443  -0.0536 210 VAL A CB  
1541 C CG1 . VAL A 208 ? 0.5317 0.4718 0.4675 0.0717  0.0390  -0.0571 210 VAL A CG1 
1542 C CG2 . VAL A 208 ? 0.5555 0.5150 0.4856 0.0692  0.0441  -0.0564 210 VAL A CG2 
1543 N N   . PRO A 209 ? 0.5042 0.4290 0.4418 0.0570  0.0446  -0.0443 211 PRO A N   
1544 C CA  . PRO A 209 ? 0.4896 0.4130 0.4289 0.0557  0.0452  -0.0416 211 PRO A CA  
1545 C C   . PRO A 209 ? 0.4939 0.4183 0.4370 0.0592  0.0427  -0.0431 211 PRO A C   
1546 O O   . PRO A 209 ? 0.5053 0.4260 0.4501 0.0626  0.0384  -0.0453 211 PRO A O   
1547 C CB  . PRO A 209 ? 0.4839 0.4009 0.4240 0.0548  0.0445  -0.0382 211 PRO A CB  
1548 C CG  . PRO A 209 ? 0.4748 0.3872 0.4160 0.0560  0.0417  -0.0390 211 PRO A CG  
1549 C CD  . PRO A 209 ? 0.5039 0.4203 0.4427 0.0580  0.0418  -0.0438 211 PRO A CD  
1550 N N   . LYS A 210 ? 0.4855 0.4134 0.4295 0.0586  0.0439  -0.0421 212 LYS A N   
1551 C CA  . LYS A 210 ? 0.4790 0.4080 0.4264 0.0617  0.0413  -0.0435 212 LYS A CA  
1552 C C   . LYS A 210 ? 0.4865 0.4159 0.4359 0.0600  0.0423  -0.0399 212 LYS A C   
1553 O O   . LYS A 210 ? 0.4765 0.4067 0.4233 0.0576  0.0450  -0.0377 212 LYS A O   
1554 C CB  . LYS A 210 ? 0.4808 0.4191 0.4269 0.0648  0.0418  -0.0481 212 LYS A CB  
1555 C CG  . LYS A 210 ? 0.4666 0.4096 0.4101 0.0684  0.0410  -0.0523 212 LYS A CG  
1556 C CD  . LYS A 210 ? 0.4866 0.4455 0.4287 0.0715  0.0425  -0.0553 212 LYS A CD  
1557 C CE  . LYS A 210 ? 0.5176 0.4878 0.4564 0.0741  0.0434  -0.0578 212 LYS A CE  
1558 N NZ  . LYS A 210 ? 0.5706 0.5611 0.5080 0.0807  0.0436  -0.0618 212 LYS A NZ  
1559 N N   . ALA A 211 ? 0.4785 0.4068 0.4317 0.0619  0.0388  -0.0395 213 ALA A N   
1560 C CA  . ALA A 211 ? 0.4603 0.3914 0.4153 0.0607  0.0399  -0.0361 213 ALA A CA  
1561 C C   . ALA A 211 ? 0.4728 0.4050 0.4305 0.0631  0.0371  -0.0382 213 ALA A C   
1562 O O   . ALA A 211 ? 0.4719 0.4000 0.4312 0.0664  0.0317  -0.0413 213 ALA A O   
1563 C CB  . ALA A 211 ? 0.4497 0.3799 0.4077 0.0590  0.0382  -0.0298 213 ALA A CB  
1564 N N   . ALA A 212 ? 0.4578 0.3946 0.4156 0.0624  0.0395  -0.0373 214 ALA A N   
1565 C CA  . ALA A 212 ? 0.4720 0.4099 0.4328 0.0648  0.0366  -0.0388 214 ALA A CA  
1566 C C   . ALA A 212 ? 0.4674 0.4087 0.4293 0.0631  0.0384  -0.0353 214 ALA A C   
1567 O O   . ALA A 212 ? 0.4595 0.4034 0.4180 0.0615  0.0424  -0.0341 214 ALA A O   
1568 C CB  . ALA A 212 ? 0.4682 0.4122 0.4269 0.0680  0.0376  -0.0448 214 ALA A CB  
1569 N N   . ILE A 213 ? 0.4764 0.4166 0.4424 0.0640  0.0343  -0.0337 215 ILE A N   
1570 C CA  . ILE A 213 ? 0.4842 0.4291 0.4516 0.0631  0.0357  -0.0308 215 ILE A CA  
1571 C C   . ILE A 213 ? 0.4842 0.4319 0.4505 0.0654  0.0368  -0.0361 215 ILE A C   
1572 O O   . ILE A 213 ? 0.4813 0.4274 0.4488 0.0687  0.0330  -0.0402 215 ILE A O   
1573 C CB  . ILE A 213 ? 0.4999 0.4438 0.4733 0.0616  0.0298  -0.0242 215 ILE A CB  
1574 C CG1 . ILE A 213 ? 0.4880 0.4364 0.4628 0.0587  0.0301  -0.0165 215 ILE A CG1 
1575 C CG2 . ILE A 213 ? 0.4810 0.4294 0.4561 0.0618  0.0301  -0.0230 215 ILE A CG2 
1576 C CD1 . ILE A 213 ? 0.4565 0.4051 0.4384 0.0551  0.0222  -0.0075 215 ILE A CD1 
1577 N N   . VAL A 214 ? 0.4827 0.4351 0.4463 0.0642  0.0409  -0.0362 216 VAL A N   
1578 C CA  . VAL A 214 ? 0.5060 0.4635 0.4694 0.0654  0.0418  -0.0397 216 VAL A CA  
1579 C C   . VAL A 214 ? 0.5148 0.4744 0.4797 0.0651  0.0419  -0.0378 216 VAL A C   
1580 O O   . VAL A 214 ? 0.4984 0.4576 0.4628 0.0640  0.0426  -0.0341 216 VAL A O   
1581 C CB  . VAL A 214 ? 0.5172 0.4795 0.4766 0.0634  0.0449  -0.0412 216 VAL A CB  
1582 C CG1 . VAL A 214 ? 0.5361 0.4996 0.4946 0.0650  0.0445  -0.0439 216 VAL A CG1 
1583 C CG2 . VAL A 214 ? 0.4979 0.4566 0.4535 0.0601  0.0463  -0.0385 216 VAL A CG2 
1584 N N   . ALA A 215 ? 0.5419 0.5055 0.5084 0.0671  0.0410  -0.0405 217 ALA A N   
1585 C CA  . ALA A 215 ? 0.5595 0.5249 0.5280 0.0671  0.0406  -0.0389 217 ALA A CA  
1586 C C   . ALA A 215 ? 0.5713 0.5438 0.5377 0.0661  0.0431  -0.0408 217 ALA A C   
1587 O O   . ALA A 215 ? 0.5861 0.5654 0.5526 0.0680  0.0432  -0.0440 217 ALA A O   
1588 C CB  . ALA A 215 ? 0.5580 0.5209 0.5308 0.0702  0.0354  -0.0400 217 ALA A CB  
1589 N N   . ARG A 216 ? 0.5741 0.5464 0.5384 0.0636  0.0444  -0.0385 218 ARG A N   
1590 C CA  . ARG A 216 ? 0.5988 0.5770 0.5621 0.0614  0.0449  -0.0386 218 ARG A CA  
1591 C C   . ARG A 216 ? 0.6096 0.5898 0.5751 0.0627  0.0442  -0.0384 218 ARG A C   
1592 O O   . ARG A 216 ? 0.6075 0.5838 0.5715 0.0624  0.0438  -0.0367 218 ARG A O   
1593 C CB  . ARG A 216 ? 0.5893 0.5635 0.5477 0.0575  0.0443  -0.0366 218 ARG A CB  
1594 C CG  . ARG A 216 ? 0.6252 0.5967 0.5814 0.0563  0.0447  -0.0366 218 ARG A CG  
1595 C CD  . ARG A 216 ? 0.7047 0.6695 0.6555 0.0528  0.0420  -0.0350 218 ARG A CD  
1596 N NE  . ARG A 216 ? 0.7265 0.6891 0.6753 0.0511  0.0420  -0.0347 218 ARG A NE  
1597 C CZ  . ARG A 216 ? 0.7373 0.6928 0.6835 0.0536  0.0422  -0.0356 218 ARG A CZ  
1598 N NH1 . ARG A 216 ? 0.6986 0.6513 0.6441 0.0580  0.0424  -0.0361 218 ARG A NH1 
1599 N NH2 . ARG A 216 ? 0.6905 0.6443 0.6352 0.0516  0.0421  -0.0353 218 ARG A NH2 
1600 N N   . HIS A 217 ? 0.6312 0.6184 0.6000 0.0651  0.0438  -0.0407 219 HIS A N   
1601 C CA  . HIS A 217 ? 0.6502 0.6392 0.6213 0.0663  0.0429  -0.0406 219 HIS A CA  
1602 C C   . HIS A 217 ? 0.6646 0.6596 0.6342 0.0626  0.0436  -0.0389 219 HIS A C   
1603 O O   . HIS A 217 ? 0.6659 0.6710 0.6357 0.0609  0.0442  -0.0387 219 HIS A O   
1604 C CB  . HIS A 217 ? 0.6567 0.6507 0.6312 0.0713  0.0408  -0.0443 219 HIS A CB  
1605 C CG  . HIS A 217 ? 0.6885 0.6767 0.6639 0.0750  0.0378  -0.0467 219 HIS A CG  
1606 N ND1 . HIS A 217 ? 0.7117 0.6906 0.6898 0.0764  0.0332  -0.0456 219 HIS A ND1 
1607 C CD2 . HIS A 217 ? 0.7323 0.7222 0.7061 0.0772  0.0376  -0.0494 219 HIS A CD2 
1608 C CE1 . HIS A 217 ? 0.7375 0.7109 0.7158 0.0790  0.0294  -0.0475 219 HIS A CE1 
1609 N NE2 . HIS A 217 ? 0.7775 0.7573 0.7529 0.0802  0.0325  -0.0506 219 HIS A NE2 
1610 N N   . THR A 218 ? 0.6874 0.6774 0.6557 0.0614  0.0428  -0.0372 220 THR A N   
1611 C CA  . THR A 218 ? 0.7108 0.7041 0.6780 0.0579  0.0415  -0.0353 220 THR A CA  
1612 C C   . THR A 218 ? 0.7293 0.7281 0.7006 0.0609  0.0418  -0.0366 220 THR A C   
1613 O O   . THR A 218 ? 0.7236 0.7177 0.6965 0.0641  0.0414  -0.0373 220 THR A O   
1614 C CB  . THR A 218 ? 0.7086 0.6918 0.6708 0.0568  0.0390  -0.0341 220 THR A CB  
1615 O OG1 . THR A 218 ? 0.7068 0.6833 0.6660 0.0586  0.0394  -0.0347 220 THR A OG1 
1616 C CG2 . THR A 218 ? 0.7055 0.6877 0.6647 0.0512  0.0348  -0.0315 220 THR A CG2 
1617 N N   . TYR A 219 ? 0.7508 0.7615 0.7243 0.0597  0.0419  -0.0363 221 TYR A N   
1618 C CA  . TYR A 219 ? 0.7822 0.7995 0.7595 0.0638  0.0418  -0.0385 221 TYR A CA  
1619 C C   . TYR A 219 ? 0.7984 0.8260 0.7767 0.0603  0.0412  -0.0358 221 TYR A C   
1620 O O   . TYR A 219 ? 0.8018 0.8362 0.7790 0.0543  0.0405  -0.0315 221 TYR A O   
1621 C CB  . TYR A 219 ? 0.7797 0.8039 0.7593 0.0704  0.0416  -0.0433 221 TYR A CB  
1622 C CG  . TYR A 219 ? 0.7917 0.8327 0.7710 0.0707  0.0430  -0.0434 221 TYR A CG  
1623 C CD1 . TYR A 219 ? 0.8358 0.8956 0.8172 0.0742  0.0432  -0.0447 221 TYR A CD1 
1624 C CD2 . TYR A 219 ? 0.8037 0.8445 0.7808 0.0678  0.0441  -0.0418 221 TYR A CD2 
1625 C CE1 . TYR A 219 ? 0.8595 0.9404 0.8409 0.0749  0.0446  -0.0438 221 TYR A CE1 
1626 C CE2 . TYR A 219 ? 0.8401 0.8989 0.8172 0.0676  0.0454  -0.0408 221 TYR A CE2 
1627 C CZ  . TYR A 219 ? 0.8813 0.9615 0.8606 0.0712  0.0457  -0.0415 221 TYR A CZ  
1628 O OH  . TYR A 219 ? 0.9149 1.0178 0.8941 0.0713  0.0472  -0.0393 221 TYR A OH  
1629 N N   . LEU A 220 ? 0.8160 0.8445 0.7967 0.0634  0.0407  -0.0373 222 LEU A N   
1630 C CA  . LEU A 220 ? 0.8490 0.8883 0.8316 0.0611  0.0400  -0.0350 222 LEU A CA  
1631 C C   . LEU A 220 ? 0.8694 0.9293 0.8552 0.0652  0.0411  -0.0369 222 LEU A C   
1632 O O   . LEU A 220 ? 0.8727 0.9339 0.8601 0.0733  0.0405  -0.0425 222 LEU A O   
1633 C CB  . LEU A 220 ? 0.8384 0.8694 0.8218 0.0627  0.0389  -0.0358 222 LEU A CB  
1634 C CG  . LEU A 220 ? 0.8369 0.8536 0.8162 0.0596  0.0373  -0.0337 222 LEU A CG  
1635 C CD1 . LEU A 220 ? 0.8157 0.8280 0.7960 0.0623  0.0366  -0.0344 222 LEU A CD1 
1636 C CD2 . LEU A 220 ? 0.8162 0.8317 0.7920 0.0525  0.0342  -0.0294 222 LEU A CD2 
1637 N N   . ALA A 221 ? 0.8868 0.9635 0.8732 0.0602  0.0415  -0.0319 223 ALA A N   
1638 C CA  . ALA A 221 ? 0.9246 1.0277 0.9138 0.0648  0.0427  -0.0327 223 ALA A CA  
1639 C C   . ALA A 221 ? 0.9535 1.0790 0.9452 0.0566  0.0421  -0.0236 223 ALA A C   
1640 O O   . ALA A 221 ? 0.9576 1.0835 0.9483 0.0473  0.0406  -0.0163 223 ALA A O   
1641 C CB  . ALA A 221 ? 0.9237 1.0346 0.9117 0.0730  0.0440  -0.0384 223 ALA A CB  
1642 N N   . ASN A 222 ? 0.9734 1.1180 0.9682 0.0599  0.0424  -0.0234 224 ASN A N   
1643 C CA  . ASN A 222 ? 0.9958 1.1699 0.9943 0.0534  0.0418  -0.0141 224 ASN A CA  
1644 C C   . ASN A 222 ? 1.0062 1.1712 1.0051 0.0383  0.0372  -0.0030 224 ASN A C   
1645 O O   . ASN A 222 ? 1.0161 1.1970 1.0167 0.0290  0.0349  0.0071  224 ASN A O   
1646 C CB  . ASN A 222 ? 1.0158 1.2192 1.0149 0.0568  0.0442  -0.0126 224 ASN A CB  
1647 C CG  . ASN A 222 ? 1.0335 1.2500 1.0313 0.0741  0.0465  -0.0244 224 ASN A CG  
1648 O OD1 . ASN A 222 ? 1.0258 1.2366 1.0238 0.0822  0.0457  -0.0315 224 ASN A OD1 
1649 N ND2 . ASN A 222 ? 1.0365 1.2702 1.0326 0.0800  0.0481  -0.0266 224 ASN A ND2 
1650 N N   . GLY A 223 ? 1.0011 1.1406 0.9983 0.0365  0.0346  -0.0049 225 GLY A N   
1651 C CA  . GLY A 223 ? 1.0043 1.1275 0.9999 0.0250  0.0280  0.0026  225 GLY A CA  
1652 C C   . GLY A 223 ? 1.0058 1.1031 0.9959 0.0219  0.0250  0.0016  225 GLY A C   
1653 O O   . GLY A 223 ? 1.0091 1.0907 0.9965 0.0137  0.0174  0.0067  225 GLY A O   
1654 N N   . GLN A 224 ? 0.9996 1.0917 0.9877 0.0292  0.0298  -0.0054 226 GLN A N   
1655 C CA  . GLN A 224 ? 0.9991 1.0747 0.9828 0.0268  0.0282  -0.0057 226 GLN A CA  
1656 C C   . GLN A 224 ? 0.9800 1.0348 0.9600 0.0355  0.0314  -0.0150 226 GLN A C   
1657 O O   . GLN A 224 ? 0.9831 1.0401 0.9650 0.0434  0.0352  -0.0209 226 GLN A O   
1658 C CB  . GLN A 224 ? 1.0063 1.1029 0.9920 0.0253  0.0305  -0.0022 226 GLN A CB  
1659 C CG  . GLN A 224 ? 1.0420 1.1580 1.0308 0.0130  0.0253  0.0107  226 GLN A CG  
1660 C CD  . GLN A 224 ? 1.0874 1.2057 1.0786 0.0054  0.0193  0.0179  226 GLN A CD  
1661 O OE1 . GLN A 224 ? 1.1176 1.2599 1.1136 0.0069  0.0218  0.0202  226 GLN A OE1 
1662 N NE2 . GLN A 224 ? 1.0767 1.1698 1.0640 -0.0018 0.0104  0.0211  226 GLN A NE2 
1663 N N   . THR A 225 ? 0.9680 1.0046 0.9431 0.0348  0.0296  -0.0163 227 THR A N   
1664 C CA  . THR A 225 ? 0.9555 0.9868 0.9275 0.0281  0.0253  -0.0118 227 THR A CA  
1665 C C   . THR A 225 ? 0.9280 0.9690 0.9010 0.0294  0.0295  -0.0124 227 THR A C   
1666 O O   . THR A 225 ? 0.9457 0.9911 0.9182 0.0220  0.0260  -0.0062 227 THR A O   
1667 C CB  . THR A 225 ? 0.9723 1.0066 0.9446 0.0167  0.0167  -0.0021 227 THR A CB  
1668 O OG1 . THR A 225 ? 1.0083 1.0280 0.9758 0.0115  0.0102  0.0005  227 THR A OG1 
1669 C CG2 . THR A 225 ? 0.9699 1.0322 0.9482 0.0115  0.0183  0.0051  227 THR A CG2 
1670 N N   . LYS A 226 ? 0.8780 0.9216 0.8521 0.0380  0.0355  -0.0192 228 LYS A N   
1671 C CA  . LYS A 226 ? 0.8444 0.8943 0.8183 0.0394  0.0381  -0.0201 228 LYS A CA  
1672 C C   . LYS A 226 ? 0.8134 0.8469 0.7845 0.0450  0.0401  -0.0260 228 LYS A C   
1673 O O   . LYS A 226 ? 0.8034 0.8252 0.7741 0.0499  0.0408  -0.0301 228 LYS A O   
1674 C CB  . LYS A 226 ? 0.8535 0.9287 0.8313 0.0442  0.0417  -0.0213 228 LYS A CB  
1675 C CG  . LYS A 226 ? 0.8409 0.9423 0.8219 0.0375  0.0404  -0.0128 228 LYS A CG  
1676 C CD  . LYS A 226 ? 0.7862 0.9126 0.7702 0.0472  0.0442  -0.0173 228 LYS A CD  
1677 C CE  . LYS A 226 ? 0.7663 0.9272 0.7538 0.0428  0.0442  -0.0088 228 LYS A CE  
1678 N NZ  . LYS A 226 ? 0.7272 0.9137 0.7149 0.0537  0.0478  -0.0140 228 LYS A NZ  
1679 N N   . VAL A 227 ? 0.7866 0.8213 0.7563 0.0436  0.0407  -0.0253 229 VAL A N   
1680 C CA  . VAL A 227 ? 0.7460 0.7680 0.7135 0.0483  0.0424  -0.0299 229 VAL A CA  
1681 C C   . VAL A 227 ? 0.7318 0.7658 0.7005 0.0519  0.0450  -0.0321 229 VAL A C   
1682 O O   . VAL A 227 ? 0.7428 0.7905 0.7117 0.0477  0.0449  -0.0281 229 VAL A O   
1683 C CB  . VAL A 227 ? 0.7434 0.7487 0.7060 0.0443  0.0396  -0.0281 229 VAL A CB  
1684 C CG1 . VAL A 227 ? 0.7137 0.7218 0.6746 0.0356  0.0351  -0.0218 229 VAL A CG1 
1685 C CG2 . VAL A 227 ? 0.7490 0.7475 0.7104 0.0484  0.0419  -0.0315 229 VAL A CG2 
1686 N N   . LEU A 228 ? 0.7072 0.7371 0.6768 0.0597  0.0461  -0.0381 230 LEU A N   
1687 C CA  . LEU A 228 ? 0.6924 0.7298 0.6620 0.0654  0.0469  -0.0420 230 LEU A CA  
1688 C C   . LEU A 228 ? 0.6787 0.6995 0.6463 0.0660  0.0465  -0.0436 230 LEU A C   
1689 O O   . LEU A 228 ? 0.6728 0.6790 0.6407 0.0667  0.0454  -0.0441 230 LEU A O   
1690 C CB  . LEU A 228 ? 0.6983 0.7412 0.6699 0.0746  0.0455  -0.0482 230 LEU A CB  
1691 C CG  . LEU A 228 ? 0.7232 0.7667 0.6936 0.0832  0.0436  -0.0545 230 LEU A CG  
1692 C CD1 . LEU A 228 ? 0.7605 0.8290 0.7304 0.0900  0.0440  -0.0577 230 LEU A CD1 
1693 C CD2 . LEU A 228 ? 0.7501 0.7779 0.7216 0.0889  0.0388  -0.0591 230 LEU A CD2 
1694 N N   . THR A 229 ? 0.6611 0.6864 0.6270 0.0656  0.0473  -0.0436 231 THR A N   
1695 C CA  . THR A 229 ? 0.6504 0.6621 0.6147 0.0666  0.0469  -0.0451 231 THR A CA  
1696 C C   . THR A 229 ? 0.6498 0.6612 0.6145 0.0750  0.0446  -0.0513 231 THR A C   
1697 O O   . THR A 229 ? 0.6558 0.6812 0.6196 0.0799  0.0446  -0.0545 231 THR A O   
1698 C CB  . THR A 229 ? 0.6501 0.6633 0.6118 0.0607  0.0480  -0.0414 231 THR A CB  
1699 O OG1 . THR A 229 ? 0.6915 0.7056 0.6524 0.0534  0.0473  -0.0360 231 THR A OG1 
1700 C CG2 . THR A 229 ? 0.6466 0.6437 0.6063 0.0600  0.0477  -0.0416 231 THR A CG2 
1701 N N   . GLN A 230 ? 0.6363 0.6323 0.6022 0.0768  0.0416  -0.0523 232 GLN A N   
1702 C CA  . GLN A 230 ? 0.6418 0.6313 0.6081 0.0837  0.0364  -0.0572 232 GLN A CA  
1703 C C   . GLN A 230 ? 0.6271 0.6052 0.5925 0.0807  0.0360  -0.0550 232 GLN A C   
1704 O O   . GLN A 230 ? 0.6246 0.5969 0.5902 0.0747  0.0385  -0.0499 232 GLN A O   
1705 C CB  . GLN A 230 ? 0.6524 0.6326 0.6218 0.0859  0.0314  -0.0575 232 GLN A CB  
1706 C CG  . GLN A 230 ? 0.7209 0.6962 0.6906 0.0947  0.0229  -0.0639 232 GLN A CG  
1707 C CD  . GLN A 230 ? 0.7844 0.7444 0.7579 0.0940  0.0150  -0.0615 232 GLN A CD  
1708 O OE1 . GLN A 230 ? 0.7930 0.7526 0.7693 0.0894  0.0168  -0.0566 232 GLN A OE1 
1709 N NE2 . GLN A 230 ? 0.8125 0.7602 0.7861 0.0987  0.0049  -0.0645 232 GLN A NE2 
1710 N N   . LYS A 231 ? 0.6210 0.5975 0.5849 0.0858  0.0326  -0.0593 233 LYS A N   
1711 C CA  . LYS A 231 ? 0.5911 0.5569 0.5545 0.0840  0.0309  -0.0578 233 LYS A CA  
1712 C C   . LYS A 231 ? 0.5982 0.5496 0.5643 0.0868  0.0218  -0.0583 233 LYS A C   
1713 O O   . LYS A 231 ? 0.6019 0.5513 0.5673 0.0948  0.0146  -0.0646 233 LYS A O   
1714 C CB  . LYS A 231 ? 0.5883 0.5620 0.5481 0.0883  0.0315  -0.0624 233 LYS A CB  
1715 C CG  . LYS A 231 ? 0.5607 0.5250 0.5194 0.0859  0.0308  -0.0608 233 LYS A CG  
1716 C CD  . LYS A 231 ? 0.5306 0.5023 0.4857 0.0933  0.0289  -0.0673 233 LYS A CD  
1717 C CE  . LYS A 231 ? 0.5780 0.5448 0.5314 0.0905  0.0300  -0.0658 233 LYS A CE  
1718 N NZ  . LYS A 231 ? 0.6046 0.5727 0.5544 0.0995  0.0249  -0.0730 233 LYS A NZ  
1719 N N   . LEU A 232 ? 0.5850 0.5275 0.5540 0.0806  0.0210  -0.0513 234 LEU A N   
1720 C CA  . LEU A 232 ? 0.5997 0.5294 0.5725 0.0805  0.0108  -0.0485 234 LEU A CA  
1721 C C   . LEU A 232 ? 0.6106 0.5317 0.5827 0.0800  0.0065  -0.0477 234 LEU A C   
1722 O O   . LEU A 232 ? 0.6242 0.5462 0.5925 0.0854  0.0060  -0.0545 234 LEU A O   
1723 C CB  . LEU A 232 ? 0.5959 0.5252 0.5733 0.0743  0.0108  -0.0398 234 LEU A CB  
1724 C CG  . LEU A 232 ? 0.5745 0.5114 0.5524 0.0746  0.0149  -0.0403 234 LEU A CG  
1725 C CD1 . LEU A 232 ? 0.5287 0.4675 0.5105 0.0690  0.0152  -0.0314 234 LEU A CD1 
1726 C CD2 . LEU A 232 ? 0.5867 0.5204 0.5648 0.0810  0.0080  -0.0465 234 LEU A CD2 
1727 N N   . SER A 233 ? 0.6091 0.5244 0.5850 0.0738  0.0034  -0.0393 235 SER A N   
1728 C CA  . SER A 233 ? 0.6110 0.5178 0.5866 0.0734  -0.0019 -0.0385 235 SER A CA  
1729 C C   . SER A 233 ? 0.5767 0.4898 0.5481 0.0729  0.0074  -0.0406 235 SER A C   
1730 O O   . SER A 233 ? 0.5574 0.4802 0.5270 0.0708  0.0169  -0.0399 235 SER A O   
1731 C CB  . SER A 233 ? 0.6309 0.5306 0.6126 0.0664  -0.0104 -0.0275 235 SER A CB  
1732 O OG  . SER A 233 ? 0.6719 0.5810 0.6578 0.0605  -0.0064 -0.0185 235 SER A OG  
1733 N N   . SER A 234 ? 0.5823 0.4891 0.5517 0.0753  0.0034  -0.0437 236 SER A N   
1734 C CA  . SER A 234 ? 0.5712 0.4834 0.5368 0.0743  0.0114  -0.0450 236 SER A CA  
1735 C C   . SER A 234 ? 0.5897 0.4923 0.5551 0.0746  0.0051  -0.0448 236 SER A C   
1736 O O   . SER A 234 ? 0.6246 0.5160 0.5910 0.0780  -0.0063 -0.0468 236 SER A O   
1737 C CB  . SER A 234 ? 0.5683 0.4909 0.5289 0.0794  0.0174  -0.0528 236 SER A CB  
1738 O OG  . SER A 234 ? 0.5446 0.4655 0.5024 0.0880  0.0110  -0.0610 236 SER A OG  
1739 N N   . VAL A 235 ? 0.5906 0.4962 0.5544 0.0709  0.0113  -0.0421 237 VAL A N   
1740 C CA  . VAL A 235 ? 0.5976 0.4959 0.5606 0.0708  0.0074  -0.0420 237 VAL A CA  
1741 C C   . VAL A 235 ? 0.6105 0.5165 0.5683 0.0718  0.0161  -0.0462 237 VAL A C   
1742 O O   . VAL A 235 ? 0.6160 0.5320 0.5718 0.0702  0.0247  -0.0463 237 VAL A O   
1743 C CB  . VAL A 235 ? 0.5936 0.4909 0.5607 0.0634  0.0071  -0.0318 237 VAL A CB  
1744 C CG1 . VAL A 235 ? 0.6445 0.5340 0.6180 0.0602  -0.0044 -0.0246 237 VAL A CG1 
1745 C CG2 . VAL A 235 ? 0.5325 0.4414 0.4993 0.0599  0.0172  -0.0277 237 VAL A CG2 
1746 N N   . ARG A 236 ? 0.6226 0.5228 0.5785 0.0734  0.0128  -0.0482 238 ARG A N   
1747 C CA  . ARG A 236 ? 0.6150 0.5208 0.5660 0.0750  0.0182  -0.0524 238 ARG A CA  
1748 C C   . ARG A 236 ? 0.6197 0.5176 0.5718 0.0710  0.0161  -0.0478 238 ARG A C   
1749 O O   . ARG A 236 ? 0.6240 0.5107 0.5791 0.0709  0.0067  -0.0455 238 ARG A O   
1750 C CB  . ARG A 236 ? 0.6344 0.5407 0.5818 0.0843  0.0126  -0.0615 238 ARG A CB  
1751 C CG  . ARG A 236 ? 0.6631 0.5802 0.6056 0.0869  0.0180  -0.0656 238 ARG A CG  
1752 C CD  . ARG A 236 ? 0.7120 0.6312 0.6499 0.0984  0.0113  -0.0753 238 ARG A CD  
1753 N NE  . ARG A 236 ? 0.7370 0.6678 0.6710 0.0981  0.0176  -0.0761 238 ARG A NE  
1754 C CZ  . ARG A 236 ? 0.7199 0.6716 0.6504 0.1021  0.0226  -0.0794 238 ARG A CZ  
1755 N NH1 . ARG A 236 ? 0.6929 0.6541 0.6210 0.0994  0.0276  -0.0777 238 ARG A NH1 
1756 N NH2 . ARG A 236 ? 0.7227 0.6875 0.6524 0.1088  0.0222  -0.0836 238 ARG A NH2 
1757 N N   . GLY A 237 ? 0.5984 0.5010 0.5483 0.0673  0.0235  -0.0457 239 GLY A N   
1758 C CA  . GLY A 237 ? 0.5799 0.4764 0.5307 0.0641  0.0218  -0.0417 239 GLY A CA  
1759 C C   . GLY A 237 ? 0.5907 0.4853 0.5373 0.0679  0.0206  -0.0475 239 GLY A C   
1760 O O   . GLY A 237 ? 0.5907 0.4919 0.5336 0.0728  0.0221  -0.0539 239 GLY A O   
1761 N N   . ASN A 238 ? 0.6055 0.4934 0.5524 0.0657  0.0181  -0.0448 240 ASN A N   
1762 C CA  . ASN A 238 ? 0.6276 0.5149 0.5701 0.0688  0.0181  -0.0499 240 ASN A CA  
1763 C C   . ASN A 238 ? 0.6208 0.5191 0.5592 0.0673  0.0273  -0.0511 240 ASN A C   
1764 O O   . ASN A 238 ? 0.6149 0.5163 0.5538 0.0620  0.0329  -0.0464 240 ASN A O   
1765 C CB  . ASN A 238 ? 0.6305 0.5090 0.5747 0.0653  0.0146  -0.0452 240 ASN A CB  
1766 C CG  . ASN A 238 ? 0.6928 0.5599 0.6414 0.0653  0.0033  -0.0423 240 ASN A CG  
1767 O OD1 . ASN A 238 ? 0.7594 0.6194 0.7062 0.0717  -0.0051 -0.0487 240 ASN A OD1 
1768 N ND2 . ASN A 238 ? 0.7096 0.5758 0.6639 0.0585  0.0016  -0.0323 240 ASN A ND2 
1769 N N   . HIS A 239 ? 0.6310 0.5361 0.5651 0.0720  0.0278  -0.0570 241 HIS A N   
1770 C CA  . HIS A 239 ? 0.6337 0.5505 0.5646 0.0687  0.0351  -0.0560 241 HIS A CA  
1771 C C   . HIS A 239 ? 0.6050 0.5151 0.5359 0.0622  0.0376  -0.0509 241 HIS A C   
1772 O O   . HIS A 239 ? 0.6169 0.5171 0.5494 0.0621  0.0341  -0.0495 241 HIS A O   
1773 C CB  . HIS A 239 ? 0.6580 0.5863 0.5847 0.0745  0.0348  -0.0615 241 HIS A CB  
1774 C CG  . HIS A 239 ? 0.7668 0.6870 0.6914 0.0783  0.0301  -0.0647 241 HIS A CG  
1775 N ND1 . HIS A 239 ? 0.8072 0.7224 0.7303 0.0878  0.0219  -0.0717 241 HIS A ND1 
1776 C CD2 . HIS A 239 ? 0.8102 0.7254 0.7338 0.0743  0.0314  -0.0622 241 HIS A CD2 
1777 C CE1 . HIS A 239 ? 0.8379 0.7451 0.7590 0.0892  0.0183  -0.0731 241 HIS A CE1 
1778 N NE2 . HIS A 239 ? 0.8479 0.7557 0.7697 0.0808  0.0245  -0.0672 241 HIS A NE2 
1779 N N   . ILE A 240 ? 0.5824 0.4972 0.5116 0.0570  0.0423  -0.0477 242 ILE A N   
1780 C CA  . ILE A 240 ? 0.5541 0.4622 0.4819 0.0525  0.0435  -0.0441 242 ILE A CA  
1781 C C   . ILE A 240 ? 0.5500 0.4635 0.4740 0.0498  0.0451  -0.0439 242 ILE A C   
1782 O O   . ILE A 240 ? 0.5466 0.4685 0.4691 0.0465  0.0465  -0.0423 242 ILE A O   
1783 C CB  . ILE A 240 ? 0.5493 0.4555 0.4773 0.0495  0.0450  -0.0407 242 ILE A CB  
1784 C CG1 . ILE A 240 ? 0.5405 0.4439 0.4726 0.0516  0.0436  -0.0392 242 ILE A CG1 
1785 C CG2 . ILE A 240 ? 0.5339 0.4346 0.4589 0.0469  0.0453  -0.0385 242 ILE A CG2 
1786 C CD1 . ILE A 240 ? 0.5470 0.4542 0.4798 0.0514  0.0448  -0.0385 242 ILE A CD1 
1787 N N   . ILE A 241 ? 0.5432 0.4528 0.4660 0.0504  0.0441  -0.0448 243 ILE A N   
1788 C CA  . ILE A 241 ? 0.5310 0.4467 0.4503 0.0475  0.0453  -0.0439 243 ILE A CA  
1789 C C   . ILE A 241 ? 0.5454 0.4564 0.4625 0.0409  0.0455  -0.0395 243 ILE A C   
1790 O O   . ILE A 241 ? 0.5389 0.4404 0.4562 0.0405  0.0448  -0.0384 243 ILE A O   
1791 C CB  . ILE A 241 ? 0.5278 0.4399 0.4460 0.0505  0.0437  -0.0464 243 ILE A CB  
1792 C CG1 . ILE A 241 ? 0.5200 0.4183 0.4393 0.0490  0.0424  -0.0444 243 ILE A CG1 
1793 C CG2 . ILE A 241 ? 0.4904 0.4046 0.4094 0.0578  0.0409  -0.0516 243 ILE A CG2 
1794 C CD1 . ILE A 241 ? 0.4988 0.3931 0.4166 0.0505  0.0406  -0.0461 243 ILE A CD1 
1795 N N   . SER A 242 ? 0.5561 0.4747 0.4707 0.0363  0.0453  -0.0368 244 SER A N   
1796 C CA  . SER A 242 ? 0.5773 0.4891 0.4890 0.0297  0.0426  -0.0325 244 SER A CA  
1797 C C   . SER A 242 ? 0.5713 0.4686 0.4814 0.0310  0.0414  -0.0336 244 SER A C   
1798 O O   . SER A 242 ? 0.5773 0.4729 0.4883 0.0343  0.0427  -0.0358 244 SER A O   
1799 C CB  . SER A 242 ? 0.5942 0.5173 0.5043 0.0233  0.0412  -0.0278 244 SER A CB  
1800 O OG  . SER A 242 ? 0.6352 0.5473 0.5421 0.0172  0.0364  -0.0240 244 SER A OG  
1801 N N   . GLY A 243 ? 0.5715 0.4587 0.4787 0.0294  0.0380  -0.0324 245 GLY A N   
1802 C CA  . GLY A 243 ? 0.5639 0.4406 0.4690 0.0321  0.0367  -0.0337 245 GLY A CA  
1803 C C   . GLY A 243 ? 0.5741 0.4510 0.4826 0.0381  0.0397  -0.0356 245 GLY A C   
1804 O O   . GLY A 243 ? 0.5855 0.4589 0.4940 0.0401  0.0398  -0.0358 245 GLY A O   
1805 N N   . THR A 244 ? 0.5747 0.4565 0.4867 0.0403  0.0415  -0.0361 246 THR A N   
1806 C CA  . THR A 244 ? 0.5684 0.4511 0.4841 0.0446  0.0427  -0.0357 246 THR A CA  
1807 C C   . THR A 244 ? 0.5697 0.4555 0.4863 0.0467  0.0428  -0.0354 246 THR A C   
1808 O O   . THR A 244 ? 0.5691 0.4550 0.4837 0.0450  0.0420  -0.0361 246 THR A O   
1809 C CB  . THR A 244 ? 0.5723 0.4575 0.4929 0.0456  0.0433  -0.0358 246 THR A CB  
1810 O OG1 . THR A 244 ? 0.5923 0.4823 0.5137 0.0454  0.0438  -0.0378 246 THR A OG1 
1811 C CG2 . THR A 244 ? 0.5698 0.4516 0.4897 0.0449  0.0426  -0.0361 246 THR A CG2 
1812 N N   . CYS A 245 ? 0.5786 0.4681 0.4986 0.0500  0.0434  -0.0333 247 CYS A N   
1813 C CA  . CYS A 245 ? 0.5866 0.4818 0.5088 0.0524  0.0439  -0.0322 247 CYS A CA  
1814 C C   . CYS A 245 ? 0.5828 0.4825 0.5120 0.0522  0.0438  -0.0286 247 CYS A C   
1815 O O   . CYS A 245 ? 0.5857 0.4844 0.5174 0.0512  0.0425  -0.0262 247 CYS A O   
1816 C CB  . CYS A 245 ? 0.5855 0.4846 0.5044 0.0573  0.0432  -0.0315 247 CYS A CB  
1817 S SG  . CYS A 245 ? 0.6459 0.5362 0.5553 0.0596  0.0395  -0.0359 247 CYS A SG  
1818 N N   . ALA A 246 ? 0.5749 0.4788 0.5072 0.0528  0.0438  -0.0276 248 ALA A N   
1819 C CA  . ALA A 246 ? 0.5682 0.4759 0.5074 0.0521  0.0416  -0.0227 248 ALA A CA  
1820 C C   . ALA A 246 ? 0.5641 0.4807 0.5047 0.0539  0.0424  -0.0199 248 ALA A C   
1821 O O   . ALA A 246 ? 0.5624 0.4800 0.4982 0.0563  0.0444  -0.0232 248 ALA A O   
1822 C CB  . ALA A 246 ? 0.5698 0.4715 0.5115 0.0510  0.0390  -0.0252 248 ALA A CB  
1823 N N   . SER A 247 ? 0.5616 0.4839 0.5091 0.0522  0.0396  -0.0133 249 SER A N   
1824 C CA  . SER A 247 ? 0.5414 0.4769 0.4919 0.0534  0.0398  -0.0075 249 SER A CA  
1825 C C   . SER A 247 ? 0.5365 0.4722 0.4938 0.0503  0.0357  -0.0031 249 SER A C   
1826 O O   . SER A 247 ? 0.5215 0.4487 0.4829 0.0470  0.0303  -0.0016 249 SER A O   
1827 C CB  . SER A 247 ? 0.5358 0.4842 0.4890 0.0533  0.0391  0.0004  249 SER A CB  
1828 O OG  . SER A 247 ? 0.5590 0.5130 0.5053 0.0591  0.0427  -0.0034 249 SER A OG  
1829 N N   . TRP A 248 ? 0.5330 0.4776 0.4910 0.0519  0.0372  -0.0016 250 TRP A N   
1830 C CA  . TRP A 248 ? 0.5453 0.4936 0.5106 0.0485  0.0325  0.0053  250 TRP A CA  
1831 C C   . TRP A 248 ? 0.5510 0.5201 0.5200 0.0482  0.0327  0.0157  250 TRP A C   
1832 O O   . TRP A 248 ? 0.5496 0.5307 0.5138 0.0537  0.0377  0.0140  250 TRP A O   
1833 C CB  . TRP A 248 ? 0.5407 0.4845 0.5049 0.0501  0.0334  -0.0001 250 TRP A CB  
1834 C CG  . TRP A 248 ? 0.5294 0.4585 0.4908 0.0508  0.0328  -0.0088 250 TRP A CG  
1835 C CD1 . TRP A 248 ? 0.5267 0.4457 0.4869 0.0503  0.0305  -0.0121 250 TRP A CD1 
1836 C CD2 . TRP A 248 ? 0.5196 0.4452 0.4786 0.0528  0.0346  -0.0153 250 TRP A CD2 
1837 N NE1 . TRP A 248 ? 0.5339 0.4458 0.4909 0.0526  0.0309  -0.0203 250 TRP A NE1 
1838 C CE2 . TRP A 248 ? 0.5299 0.4460 0.4864 0.0539  0.0334  -0.0220 250 TRP A CE2 
1839 C CE3 . TRP A 248 ? 0.5089 0.4397 0.4676 0.0541  0.0366  -0.0159 250 TRP A CE3 
1840 C CZ2 . TRP A 248 ? 0.4852 0.4000 0.4395 0.0561  0.0346  -0.0285 250 TRP A CZ2 
1841 C CZ3 . TRP A 248 ? 0.4747 0.4009 0.4315 0.0556  0.0374  -0.0225 250 TRP A CZ3 
1842 C CH2 . TRP A 248 ? 0.4498 0.3696 0.4045 0.0566  0.0366  -0.0283 250 TRP A CH2 
1843 N N   . ARG A 249 ? 0.5733 0.5477 0.5508 0.0422  0.0260  0.0268  251 ARG A N   
1844 C CA  . ARG A 249 ? 0.5876 0.5873 0.5702 0.0406  0.0255  0.0397  251 ARG A CA  
1845 C C   . ARG A 249 ? 0.6062 0.6091 0.5974 0.0340  0.0181  0.0498  251 ARG A C   
1846 O O   . ARG A 249 ? 0.6293 0.6267 0.6276 0.0265  0.0089  0.0586  251 ARG A O   
1847 C CB  . ARG A 249 ? 0.5798 0.5855 0.5653 0.0373  0.0230  0.0472  251 ARG A CB  
1848 C CG  . ARG A 249 ? 0.5331 0.5377 0.5102 0.0441  0.0298  0.0381  251 ARG A CG  
1849 C CD  . ARG A 249 ? 0.5327 0.5591 0.5050 0.0520  0.0357  0.0377  251 ARG A CD  
1850 N NE  . ARG A 249 ? 0.5949 0.6193 0.5586 0.0592  0.0400  0.0292  251 ARG A NE  
1851 C CZ  . ARG A 249 ? 0.6026 0.6124 0.5571 0.0651  0.0433  0.0162  251 ARG A CZ  
1852 N NH1 . ARG A 249 ? 0.6681 0.6659 0.6213 0.0645  0.0436  0.0106  251 ARG A NH1 
1853 N NH2 . ARG A 249 ? 0.6094 0.6166 0.5562 0.0710  0.0452  0.0095  251 ARG A NH2 
1854 N N   . GLY A 250 ? 0.6201 0.6283 0.6103 0.0367  0.0208  0.0478  252 GLY A N   
1855 C CA  . GLY A 250 ? 0.6483 0.6588 0.6467 0.0303  0.0131  0.0574  252 GLY A CA  
1856 C C   . GLY A 250 ? 0.6534 0.6370 0.6519 0.0287  0.0069  0.0499  252 GLY A C   
1857 O O   . GLY A 250 ? 0.6827 0.6637 0.6875 0.0236  -0.0015 0.0567  252 GLY A O   
1858 N N   . LYS A 251 ? 0.6297 0.5952 0.6214 0.0333  0.0101  0.0364  253 LYS A N   
1859 C CA  . LYS A 251 ? 0.6390 0.5840 0.6291 0.0347  0.0059  0.0274  253 LYS A CA  
1860 C C   . LYS A 251 ? 0.6414 0.5917 0.6318 0.0364  0.0082  0.0262  253 LYS A C   
1861 O O   . LYS A 251 ? 0.6422 0.6059 0.6291 0.0400  0.0168  0.0247  253 LYS A O   
1862 C CB  . LYS A 251 ? 0.6312 0.5653 0.6131 0.0405  0.0123  0.0138  253 LYS A CB  
1863 C CG  . LYS A 251 ? 0.6411 0.5629 0.6199 0.0443  0.0116  0.0034  253 LYS A CG  
1864 C CD  . LYS A 251 ? 0.6717 0.5770 0.6493 0.0458  0.0044  -0.0023 253 LYS A CD  
1865 C CE  . LYS A 251 ? 0.6507 0.5542 0.6221 0.0487  0.0109  -0.0095 253 LYS A CE  
1866 N NZ  . LYS A 251 ? 0.7073 0.5970 0.6783 0.0502  0.0024  -0.0132 253 LYS A NZ  
1867 N N   . SER A 252 ? 0.6522 0.5909 0.6462 0.0345  -0.0007 0.0264  254 SER A N   
1868 C CA  . SER A 252 ? 0.6472 0.5933 0.6443 0.0335  -0.0015 0.0304  254 SER A CA  
1869 C C   . SER A 252 ? 0.6303 0.5612 0.6249 0.0378  -0.0041 0.0198  254 SER A C   
1870 O O   . SER A 252 ? 0.6231 0.5370 0.6167 0.0395  -0.0117 0.0139  254 SER A O   
1871 C CB  . SER A 252 ? 0.6674 0.6229 0.6743 0.0247  -0.0118 0.0476  254 SER A CB  
1872 O OG  . SER A 252 ? 0.7155 0.6528 0.7271 0.0208  -0.0265 0.0500  254 SER A OG  
1873 N N   . LEU A 253 ? 0.6058 0.5443 0.5987 0.0404  0.0021  0.0170  255 LEU A N   
1874 C CA  . LEU A 253 ? 0.5977 0.5257 0.5890 0.0442  -0.0002 0.0085  255 LEU A CA  
1875 C C   . LEU A 253 ? 0.6154 0.5487 0.6126 0.0406  -0.0055 0.0167  255 LEU A C   
1876 O O   . LEU A 253 ? 0.6038 0.5543 0.6029 0.0383  -0.0005 0.0246  255 LEU A O   
1877 C CB  . LEU A 253 ? 0.5728 0.5056 0.5573 0.0497  0.0113  -0.0012 255 LEU A CB  
1878 C CG  . LEU A 253 ? 0.5278 0.4538 0.5060 0.0540  0.0155  -0.0117 255 LEU A CG  
1879 C CD1 . LEU A 253 ? 0.5131 0.4463 0.4867 0.0565  0.0246  -0.0166 255 LEU A CD1 
1880 C CD2 . LEU A 253 ? 0.5575 0.4718 0.5357 0.0574  0.0080  -0.0181 255 LEU A CD2 
1881 N N   . ARG A 254 ? 0.6375 0.5566 0.6364 0.0415  -0.0157 0.0137  256 ARG A N   
1882 C CA  . ARG A 254 ? 0.6658 0.5855 0.6705 0.0378  -0.0236 0.0210  256 ARG A CA  
1883 C C   . ARG A 254 ? 0.6601 0.5878 0.6617 0.0421  -0.0143 0.0150  256 ARG A C   
1884 O O   . ARG A 254 ? 0.6442 0.5679 0.6396 0.0487  -0.0078 0.0027  256 ARG A O   
1885 C CB  . ARG A 254 ? 0.6941 0.5913 0.7001 0.0392  -0.0400 0.0173  256 ARG A CB  
1886 C CG  . ARG A 254 ? 0.7060 0.5974 0.7166 0.0371  -0.0511 0.0215  256 ARG A CG  
1887 C CD  . ARG A 254 ? 0.8183 0.7231 0.8380 0.0258  -0.0559 0.0406  256 ARG A CD  
1888 N NE  . ARG A 254 ? 0.8846 0.7833 0.9101 0.0176  -0.0694 0.0527  256 ARG A NE  
1889 C CZ  . ARG A 254 ? 0.9513 0.8291 0.9808 0.0139  -0.0901 0.0568  256 ARG A CZ  
1890 N NH1 . ARG A 254 ? 0.9270 0.7875 0.9544 0.0193  -0.0995 0.0483  256 ARG A NH1 
1891 N NH2 . ARG A 254 ? 0.9995 0.8725 1.0346 0.0052  -0.1029 0.0692  256 ARG A NH2 
1892 N N   . VAL A 255 ? 0.6757 0.6151 0.6819 0.0381  -0.0147 0.0242  257 VAL A N   
1893 C CA  . VAL A 255 ? 0.6866 0.6305 0.6901 0.0422  -0.0082 0.0183  257 VAL A CA  
1894 C C   . VAL A 255 ? 0.7313 0.6634 0.7382 0.0421  -0.0191 0.0175  257 VAL A C   
1895 O O   . VAL A 255 ? 0.7587 0.6940 0.7723 0.0358  -0.0275 0.0291  257 VAL A O   
1896 C CB  . VAL A 255 ? 0.6661 0.6314 0.6708 0.0403  -0.0007 0.0263  257 VAL A CB  
1897 C CG1 . VAL A 255 ? 0.6379 0.6061 0.6379 0.0455  0.0072  0.0180  257 VAL A CG1 
1898 C CG2 . VAL A 255 ? 0.6397 0.6167 0.6415 0.0409  0.0068  0.0283  257 VAL A CG2 
1899 N N   . GLN A 256 ? 0.7650 0.6850 0.7672 0.0492  -0.0198 0.0046  258 GLN A N   
1900 C CA  . GLN A 256 ? 0.8083 0.7155 0.8125 0.0513  -0.0318 0.0019  258 GLN A CA  
1901 C C   . GLN A 256 ? 0.8201 0.7357 0.8246 0.0526  -0.0264 0.0007  258 GLN A C   
1902 O O   . GLN A 256 ? 0.7881 0.7153 0.7884 0.0553  -0.0129 -0.0039 258 GLN A O   
1903 C CB  . GLN A 256 ? 0.8132 0.7056 0.8121 0.0601  -0.0371 -0.0116 258 GLN A CB  
1904 C CG  . GLN A 256 ? 0.8356 0.7328 0.8286 0.0639  -0.0264 -0.0189 258 GLN A CG  
1905 C CD  . GLN A 256 ? 0.8598 0.7476 0.8472 0.0737  -0.0309 -0.0320 258 GLN A CD  
1906 O OE1 . GLN A 256 ? 0.9042 0.7774 0.8915 0.0760  -0.0438 -0.0337 258 GLN A OE1 
1907 N NE2 . GLN A 256 ? 0.8388 0.7364 0.8212 0.0799  -0.0210 -0.0411 258 GLN A NE2 
1908 N N   . LYS A 257 ? 0.8637 0.7727 0.8731 0.0500  -0.0382 0.0060  259 LYS A N   
1909 C CA  . LYS A 257 ? 0.8880 0.8010 0.8977 0.0520  -0.0361 0.0037  259 LYS A CA  
1910 C C   . LYS A 257 ? 0.8959 0.8049 0.8990 0.0622  -0.0314 -0.0120 259 LYS A C   
1911 O O   . LYS A 257 ? 0.8980 0.7965 0.8976 0.0681  -0.0366 -0.0204 259 LYS A O   
1912 C CB  . LYS A 257 ? 0.9186 0.8200 0.9342 0.0485  -0.0531 0.0103  259 LYS A CB  
1913 C CG  . LYS A 257 ? 0.9773 0.8780 1.0007 0.0374  -0.0649 0.0272  259 LYS A CG  
1914 C CD  . LYS A 257 ? 1.0485 0.9248 1.0754 0.0359  -0.0885 0.0294  259 LYS A CD  
1915 C CE  . LYS A 257 ? 1.0703 0.9280 1.0927 0.0414  -0.0967 0.0204  259 LYS A CE  
1916 N NZ  . LYS A 257 ? 1.0895 0.9275 1.1172 0.0346  -0.1204 0.0303  259 LYS A NZ  
1917 N N   . ILE A 258 ? 0.9122 0.8309 0.9133 0.0648  -0.0222 -0.0159 260 ILE A N   
1918 C CA  . ILE A 258 ? 0.9340 0.8516 0.9301 0.0740  -0.0200 -0.0291 260 ILE A CA  
1919 C C   . ILE A 258 ? 0.9711 0.8796 0.9693 0.0775  -0.0317 -0.0314 260 ILE A C   
1920 O O   . ILE A 258 ? 0.9872 0.8898 0.9909 0.0714  -0.0410 -0.0219 260 ILE A O   
1921 C CB  . ILE A 258 ? 0.9125 0.8449 0.9052 0.0748  -0.0052 -0.0322 260 ILE A CB  
1922 C CG1 . ILE A 258 ? 0.8915 0.8304 0.8819 0.0709  0.0040  -0.0291 260 ILE A CG1 
1923 C CG2 . ILE A 258 ? 0.9080 0.8436 0.8965 0.0835  -0.0037 -0.0438 260 ILE A CG2 
1924 C CD1 . ILE A 258 ? 0.8692 0.8146 0.8542 0.0744  0.0127  -0.0366 260 ILE A CD1 
1925 N N   . ARG A 259 ? 0.9933 0.9022 0.9872 0.0872  -0.0319 -0.0432 261 ARG A N   
1926 C CA  . ARG A 259 ? 1.0221 0.9241 1.0169 0.0924  -0.0421 -0.0471 261 ARG A CA  
1927 C C   . ARG A 259 ? 1.0045 0.9187 1.0007 0.0905  -0.0331 -0.0454 261 ARG A C   
1928 O O   . ARG A 259 ? 1.0023 0.9142 1.0033 0.0843  -0.0371 -0.0371 261 ARG A O   
1929 C CB  . ARG A 259 ? 1.0424 0.9397 1.0314 0.1060  -0.0492 -0.0612 261 ARG A CB  
1930 C CG  . ARG A 259 ? 1.1196 0.9946 1.1090 0.1108  -0.0707 -0.0637 261 ARG A CG  
1931 C CD  . ARG A 259 ? 1.1788 1.0486 1.1700 0.1138  -0.0795 -0.0651 261 ARG A CD  
1932 N NE  . ARG A 259 ? 1.1697 1.0595 1.1596 0.1168  -0.0649 -0.0693 261 ARG A NE  
1933 C CZ  . ARG A 259 ? 1.1736 1.0733 1.1579 0.1298  -0.0630 -0.0819 261 ARG A CZ  
1934 N NH1 . ARG A 259 ? 1.1947 1.0865 1.1733 0.1430  -0.0748 -0.0934 261 ARG A NH1 
1935 N NH2 . ARG A 259 ? 1.1349 1.0538 1.1191 0.1300  -0.0500 -0.0830 261 ARG A NH2 
1936 N N   . ASN A 266 ? 0.8780 0.8772 0.8702 0.0828  0.0258  -0.0462 268 ASN A N   
1937 C CA  . ASN A 266 ? 0.8709 0.8801 0.8605 0.0798  0.0318  -0.0458 268 ASN A CA  
1938 C C   . ASN A 266 ? 0.8592 0.8665 0.8454 0.0757  0.0352  -0.0435 268 ASN A C   
1939 O O   . ASN A 266 ? 0.8594 0.8735 0.8435 0.0724  0.0381  -0.0423 268 ASN A O   
1940 C CB  . ASN A 266 ? 0.8759 0.8993 0.8660 0.0843  0.0320  -0.0501 268 ASN A CB  
1941 C CG  . ASN A 266 ? 0.8885 0.9205 0.8796 0.0820  0.0337  -0.0483 268 ASN A CG  
1942 O OD1 . ASN A 266 ? 0.8346 0.8595 0.8260 0.0785  0.0337  -0.0450 268 ASN A OD1 
1943 N ND2 . ASN A 266 ? 0.9107 0.9603 0.9024 0.0843  0.0349  -0.0498 268 ASN A ND2 
1944 N N   . ILE A 267 ? 0.8442 0.8426 0.8302 0.0755  0.0340  -0.0421 269 ILE A N   
1945 C CA  . ILE A 267 ? 0.8331 0.8292 0.8157 0.0721  0.0368  -0.0402 269 ILE A CA  
1946 C C   . ILE A 267 ? 0.8068 0.7989 0.7875 0.0696  0.0377  -0.0362 269 ILE A C   
1947 O O   . ILE A 267 ? 0.8143 0.8048 0.7976 0.0705  0.0357  -0.0338 269 ILE A O   
1948 C CB  . ILE A 267 ? 0.8419 0.8324 0.8250 0.0737  0.0349  -0.0409 269 ILE A CB  
1949 C CG1 . ILE A 267 ? 0.8501 0.8337 0.8371 0.0749  0.0296  -0.0387 269 ILE A CG1 
1950 C CG2 . ILE A 267 ? 0.8543 0.8503 0.8371 0.0778  0.0341  -0.0461 269 ILE A CG2 
1951 C CD1 . ILE A 267 ? 0.9070 0.8848 0.8942 0.0730  0.0282  -0.0350 269 ILE A CD1 
1952 N N   . LEU A 268 ? 0.7684 0.7596 0.7444 0.0672  0.0394  -0.0353 270 LEU A N   
1953 C CA  . LEU A 268 ? 0.7280 0.7161 0.7003 0.0675  0.0392  -0.0331 270 LEU A CA  
1954 C C   . LEU A 268 ? 0.7124 0.6989 0.6841 0.0687  0.0396  -0.0312 270 LEU A C   
1955 O O   . LEU A 268 ? 0.7001 0.6895 0.6739 0.0701  0.0390  -0.0278 270 LEU A O   
1956 C CB  . LEU A 268 ? 0.7233 0.7082 0.6896 0.0658  0.0381  -0.0339 270 LEU A CB  
1957 C CG  . LEU A 268 ? 0.6887 0.6772 0.6566 0.0627  0.0371  -0.0340 270 LEU A CG  
1958 C CD1 . LEU A 268 ? 0.6581 0.6462 0.6235 0.0582  0.0354  -0.0331 270 LEU A CD1 
1959 C CD2 . LEU A 268 ? 0.6670 0.6536 0.6327 0.0636  0.0348  -0.0337 270 LEU A CD2 
1960 N N   . ARG A 269 ? 0.7014 0.6851 0.6711 0.0677  0.0404  -0.0323 271 ARG A N   
1961 C CA  . ARG A 269 ? 0.6929 0.6756 0.6620 0.0686  0.0408  -0.0303 271 ARG A CA  
1962 C C   . ARG A 269 ? 0.6974 0.6773 0.6676 0.0673  0.0412  -0.0318 271 ARG A C   
1963 O O   . ARG A 269 ? 0.7068 0.6873 0.6770 0.0661  0.0417  -0.0346 271 ARG A O   
1964 C CB  . ARG A 269 ? 0.6942 0.6756 0.6564 0.0704  0.0409  -0.0307 271 ARG A CB  
1965 C CG  . ARG A 269 ? 0.6847 0.6603 0.6424 0.0683  0.0397  -0.0337 271 ARG A CG  
1966 C CD  . ARG A 269 ? 0.6646 0.6357 0.6144 0.0713  0.0369  -0.0351 271 ARG A CD  
1967 N NE  . ARG A 269 ? 0.7203 0.6872 0.6676 0.0694  0.0334  -0.0364 271 ARG A NE  
1968 C CZ  . ARG A 269 ? 0.7213 0.6806 0.6646 0.0660  0.0289  -0.0371 271 ARG A CZ  
1969 N NH1 . ARG A 269 ? 0.7315 0.6860 0.6720 0.0647  0.0278  -0.0374 271 ARG A NH1 
1970 N NH2 . ARG A 269 ? 0.7588 0.7150 0.7008 0.0632  0.0245  -0.0367 271 ARG A NH2 
1971 N N   . VAL A 270 ? 0.6877 0.6669 0.6590 0.0676  0.0408  -0.0293 272 VAL A N   
1972 C CA  . VAL A 270 ? 0.6864 0.6621 0.6573 0.0668  0.0411  -0.0308 272 VAL A CA  
1973 C C   . VAL A 270 ? 0.6834 0.6584 0.6497 0.0671  0.0425  -0.0295 272 VAL A C   
1974 O O   . VAL A 270 ? 0.7051 0.6839 0.6720 0.0682  0.0422  -0.0255 272 VAL A O   
1975 C CB  . VAL A 270 ? 0.6831 0.6566 0.6592 0.0670  0.0377  -0.0290 272 VAL A CB  
1976 C CG1 . VAL A 270 ? 0.6765 0.6466 0.6519 0.0675  0.0374  -0.0328 272 VAL A CG1 
1977 C CG2 . VAL A 270 ? 0.6882 0.6617 0.6686 0.0679  0.0342  -0.0291 272 VAL A CG2 
1978 N N   . GLU A 271 ? 0.6744 0.6459 0.6360 0.0662  0.0434  -0.0322 273 GLU A N   
1979 C CA  . GLU A 271 ? 0.6664 0.6357 0.6235 0.0673  0.0436  -0.0318 273 GLU A CA  
1980 C C   . GLU A 271 ? 0.6425 0.6098 0.6016 0.0658  0.0442  -0.0316 273 GLU A C   
1981 O O   . GLU A 271 ? 0.6345 0.6005 0.5950 0.0641  0.0444  -0.0337 273 GLU A O   
1982 C CB  . GLU A 271 ? 0.6876 0.6515 0.6380 0.0667  0.0420  -0.0345 273 GLU A CB  
1983 C CG  . GLU A 271 ? 0.7380 0.7013 0.6845 0.0691  0.0395  -0.0354 273 GLU A CG  
1984 C CD  . GLU A 271 ? 0.8197 0.7752 0.7613 0.0661  0.0352  -0.0372 273 GLU A CD  
1985 O OE1 . GLU A 271 ? 0.8714 0.8224 0.8113 0.0626  0.0340  -0.0372 273 GLU A OE1 
1986 O OE2 . GLU A 271 ? 0.7629 0.7167 0.7024 0.0666  0.0321  -0.0378 273 GLU A OE2 
1987 N N   . TYR A 272 ? 0.6256 0.5944 0.5842 0.0672  0.0443  -0.0288 274 TYR A N   
1988 C CA  . TYR A 272 ? 0.5943 0.5612 0.5553 0.0659  0.0441  -0.0276 274 TYR A CA  
1989 C C   . TYR A 272 ? 0.5740 0.5385 0.5298 0.0666  0.0451  -0.0286 274 TYR A C   
1990 O O   . TYR A 272 ? 0.5904 0.5563 0.5408 0.0696  0.0450  -0.0292 274 TYR A O   
1991 C CB  . TYR A 272 ? 0.5948 0.5675 0.5607 0.0658  0.0424  -0.0214 274 TYR A CB  
1992 C CG  . TYR A 272 ? 0.5972 0.5697 0.5690 0.0645  0.0394  -0.0196 274 TYR A CG  
1993 C CD1 . TYR A 272 ? 0.6039 0.5698 0.5797 0.0633  0.0355  -0.0205 274 TYR A CD1 
1994 C CD2 . TYR A 272 ? 0.6295 0.6081 0.6025 0.0653  0.0393  -0.0173 274 TYR A CD2 
1995 C CE1 . TYR A 272 ? 0.6001 0.5637 0.5807 0.0631  0.0305  -0.0196 274 TYR A CE1 
1996 C CE2 . TYR A 272 ? 0.6207 0.5981 0.5993 0.0639  0.0354  -0.0154 274 TYR A CE2 
1997 C CZ  . TYR A 272 ? 0.5979 0.5671 0.5802 0.0630  0.0306  -0.0168 274 TYR A CZ  
1998 O OH  . TYR A 272 ? 0.6636 0.6295 0.6505 0.0626  0.0248  -0.0157 274 TYR A OH  
1999 N N   . SER A 273 ? 0.5443 0.5047 0.5007 0.0648  0.0452  -0.0296 275 SER A N   
2000 C CA  . SER A 273 ? 0.5399 0.4973 0.4914 0.0653  0.0457  -0.0306 275 SER A CA  
2001 C C   . SER A 273 ? 0.5168 0.4728 0.4713 0.0639  0.0456  -0.0290 275 SER A C   
2002 O O   . SER A 273 ? 0.5284 0.4825 0.4871 0.0627  0.0444  -0.0296 275 SER A O   
2003 C CB  . SER A 273 ? 0.5548 0.5065 0.5017 0.0631  0.0453  -0.0342 275 SER A CB  
2004 O OG  . SER A 273 ? 0.5808 0.5297 0.5219 0.0646  0.0430  -0.0356 275 SER A OG  
2005 N N   . LEU A 274 ? 0.4954 0.4519 0.4472 0.0651  0.0460  -0.0277 276 LEU A N   
2006 C CA  . LEU A 274 ? 0.4808 0.4342 0.4341 0.0635  0.0457  -0.0270 276 LEU A CA  
2007 C C   . LEU A 274 ? 0.4901 0.4374 0.4378 0.0627  0.0465  -0.0311 276 LEU A C   
2008 O O   . LEU A 274 ? 0.4885 0.4342 0.4304 0.0646  0.0460  -0.0325 276 LEU A O   
2009 C CB  . LEU A 274 ? 0.4790 0.4392 0.4336 0.0647  0.0453  -0.0216 276 LEU A CB  
2010 C CG  . LEU A 274 ? 0.4561 0.4136 0.4122 0.0629  0.0446  -0.0198 276 LEU A CG  
2011 C CD1 . LEU A 274 ? 0.3979 0.3482 0.3590 0.0599  0.0413  -0.0200 276 LEU A CD1 
2012 C CD2 . LEU A 274 ? 0.3832 0.3524 0.3417 0.0638  0.0440  -0.0127 276 LEU A CD2 
2013 N N   . LEU A 275 ? 0.4923 0.4365 0.4415 0.0605  0.0465  -0.0330 277 LEU A N   
2014 C CA  . LEU A 275 ? 0.4967 0.4376 0.4420 0.0584  0.0468  -0.0353 277 LEU A CA  
2015 C C   . LEU A 275 ? 0.4980 0.4363 0.4437 0.0584  0.0469  -0.0348 277 LEU A C   
2016 O O   . LEU A 275 ? 0.5133 0.4515 0.4630 0.0588  0.0459  -0.0345 277 LEU A O   
2017 C CB  . LEU A 275 ? 0.5024 0.4469 0.4491 0.0567  0.0471  -0.0374 277 LEU A CB  
2018 C CG  . LEU A 275 ? 0.5101 0.4573 0.4547 0.0541  0.0466  -0.0373 277 LEU A CG  
2019 C CD1 . LEU A 275 ? 0.4556 0.4000 0.3983 0.0555  0.0453  -0.0366 277 LEU A CD1 
2020 C CD2 . LEU A 275 ? 0.5376 0.4936 0.4857 0.0545  0.0474  -0.0385 277 LEU A CD2 
2021 N N   . ILE A 276 ? 0.5129 0.4478 0.4540 0.0582  0.0468  -0.0348 278 ILE A N   
2022 C CA  . ILE A 276 ? 0.5069 0.4390 0.4476 0.0576  0.0469  -0.0345 278 ILE A CA  
2023 C C   . ILE A 276 ? 0.5012 0.4299 0.4375 0.0545  0.0464  -0.0364 278 ILE A C   
2024 O O   . ILE A 276 ? 0.5067 0.4317 0.4382 0.0538  0.0442  -0.0367 278 ILE A O   
2025 C CB  . ILE A 276 ? 0.5101 0.4432 0.4493 0.0603  0.0467  -0.0322 278 ILE A CB  
2026 C CG1 . ILE A 276 ? 0.5363 0.4764 0.4811 0.0615  0.0465  -0.0277 278 ILE A CG1 
2027 C CG2 . ILE A 276 ? 0.5289 0.4592 0.4682 0.0593  0.0467  -0.0315 278 ILE A CG2 
2028 C CD1 . ILE A 276 ? 0.5422 0.4907 0.4845 0.0658  0.0467  -0.0253 278 ILE A CD1 
2029 N N   . TYR A 277 ? 0.4860 0.4163 0.4238 0.0529  0.0471  -0.0373 279 TYR A N   
2030 C CA  . TYR A 277 ? 0.4870 0.4187 0.4219 0.0489  0.0465  -0.0372 279 TYR A CA  
2031 C C   . TYR A 277 ? 0.4804 0.4120 0.4151 0.0485  0.0471  -0.0378 279 TYR A C   
2032 O O   . TYR A 277 ? 0.4798 0.4102 0.4169 0.0515  0.0476  -0.0390 279 TYR A O   
2033 C CB  . TYR A 277 ? 0.4878 0.4285 0.4242 0.0468  0.0466  -0.0368 279 TYR A CB  
2034 C CG  . TYR A 277 ? 0.5330 0.4826 0.4737 0.0506  0.0483  -0.0393 279 TYR A CG  
2035 C CD1 . TYR A 277 ? 0.5224 0.4696 0.4663 0.0547  0.0480  -0.0407 279 TYR A CD1 
2036 C CD2 . TYR A 277 ? 0.4928 0.4542 0.4337 0.0509  0.0491  -0.0403 279 TYR A CD2 
2037 C CE1 . TYR A 277 ? 0.5298 0.4823 0.4767 0.0592  0.0472  -0.0440 279 TYR A CE1 
2038 C CE2 . TYR A 277 ? 0.4899 0.4593 0.4331 0.0568  0.0491  -0.0442 279 TYR A CE2 
2039 C CZ  . TYR A 277 ? 0.5200 0.4830 0.4658 0.0612  0.0475  -0.0466 279 TYR A CZ  
2040 O OH  . TYR A 277 ? 0.5348 0.5029 0.4820 0.0680  0.0453  -0.0514 279 TYR A OH  
2041 N N   . VAL A 278 ? 0.4791 0.4107 0.4106 0.0444  0.0460  -0.0364 280 VAL A N   
2042 C CA  . VAL A 278 ? 0.4656 0.3987 0.3968 0.0441  0.0468  -0.0369 280 VAL A CA  
2043 C C   . VAL A 278 ? 0.4649 0.4105 0.3962 0.0407  0.0468  -0.0351 280 VAL A C   
2044 O O   . VAL A 278 ? 0.4778 0.4249 0.4075 0.0348  0.0443  -0.0312 280 VAL A O   
2045 C CB  . VAL A 278 ? 0.4714 0.3955 0.3984 0.0415  0.0447  -0.0355 280 VAL A CB  
2046 C CG1 . VAL A 278 ? 0.4585 0.3856 0.3854 0.0410  0.0458  -0.0359 280 VAL A CG1 
2047 C CG2 . VAL A 278 ? 0.4413 0.3569 0.3673 0.0452  0.0443  -0.0364 280 VAL A CG2 
2048 N N   . SER A 279 ? 0.4674 0.4232 0.4005 0.0444  0.0487  -0.0377 281 SER A N   
2049 C CA  . SER A 279 ? 0.4825 0.4564 0.4159 0.0422  0.0492  -0.0355 281 SER A CA  
2050 C C   . SER A 279 ? 0.4942 0.4730 0.4252 0.0384  0.0488  -0.0327 281 SER A C   
2051 O O   . SER A 279 ? 0.4696 0.4416 0.3994 0.0415  0.0493  -0.0357 281 SER A O   
2052 C CB  . SER A 279 ? 0.4748 0.4600 0.4102 0.0502  0.0505  -0.0405 281 SER A CB  
2053 O OG  . SER A 279 ? 0.4996 0.4996 0.4337 0.0530  0.0512  -0.0417 281 SER A OG  
2054 N N   . VAL A 280 ? 0.5414 0.5318 0.4721 0.0307  0.0472  -0.0259 282 VAL A N   
2055 C CA  . VAL A 280 ? 0.5679 0.5618 0.4967 0.0245  0.0453  -0.0209 282 VAL A CA  
2056 C C   . VAL A 280 ? 0.5914 0.6145 0.5216 0.0220  0.0463  -0.0157 282 VAL A C   
2057 O O   . VAL A 280 ? 0.5995 0.6359 0.5316 0.0154  0.0442  -0.0085 282 VAL A O   
2058 C CB  . VAL A 280 ? 0.5603 0.5389 0.4869 0.0152  0.0392  -0.0150 282 VAL A CB  
2059 C CG1 . VAL A 280 ? 0.5804 0.5615 0.5052 0.0089  0.0364  -0.0098 282 VAL A CG1 
2060 C CG2 . VAL A 280 ? 0.5574 0.5120 0.4816 0.0194  0.0383  -0.0203 282 VAL A CG2 
2061 N N   . PRO A 281 ? 0.6120 0.6470 0.5411 0.0278  0.0490  -0.0190 283 PRO A N   
2062 C CA  . PRO A 281 ? 0.6462 0.7149 0.5763 0.0282  0.0506  -0.0149 283 PRO A CA  
2063 C C   . PRO A 281 ? 0.6730 0.7541 0.6044 0.0141  0.0467  -0.0014 283 PRO A C   
2064 O O   . PRO A 281 ? 0.6847 0.7502 0.6145 0.0072  0.0433  0.0020  283 PRO A O   
2065 C CB  . PRO A 281 ? 0.6333 0.7075 0.5606 0.0376  0.0528  -0.0218 283 PRO A CB  
2066 C CG  . PRO A 281 ? 0.6184 0.6634 0.5444 0.0441  0.0526  -0.0309 283 PRO A CG  
2067 C CD  . PRO A 281 ? 0.6078 0.6292 0.5346 0.0349  0.0503  -0.0265 283 PRO A CD  
2068 N N   . GLY A 282 ? 0.6986 0.8073 0.6331 0.0097  0.0462  0.0066  284 GLY A N   
2069 C CA  . GLY A 282 ? 0.7225 0.8431 0.6596 -0.0060 0.0402  0.0219  284 GLY A CA  
2070 C C   . GLY A 282 ? 0.7445 0.8409 0.6824 -0.0161 0.0329  0.0271  284 GLY A C   
2071 O O   . GLY A 282 ? 0.7675 0.8694 0.7073 -0.0303 0.0249  0.0405  284 GLY A O   
2072 N N   . SER A 283 ? 0.7236 0.7941 0.6600 -0.0094 0.0341  0.0174  285 SER A N   
2073 C CA  . SER A 283 ? 0.7359 0.7816 0.6714 -0.0165 0.0266  0.0203  285 SER A CA  
2074 C C   . SER A 283 ? 0.7242 0.7597 0.6601 -0.0090 0.0294  0.0125  285 SER A C   
2075 O O   . SER A 283 ? 0.7263 0.7698 0.6632 0.0019  0.0368  0.0042  285 SER A O   
2076 C CB  . SER A 283 ? 0.7459 0.7603 0.6767 -0.0183 0.0214  0.0176  285 SER A CB  
2077 O OG  . SER A 283 ? 0.8118 0.8325 0.7422 -0.0274 0.0165  0.0263  285 SER A OG  
2078 N N   . LYS A 284 ? 0.7114 0.7285 0.6463 -0.0145 0.0223  0.0151  286 LYS A N   
2079 C CA  . LYS A 284 ? 0.6874 0.6957 0.6227 -0.0078 0.0247  0.0085  286 LYS A CA  
2080 C C   . LYS A 284 ? 0.6493 0.6360 0.5814 0.0030  0.0290  -0.0031 286 LYS A C   
2081 O O   . LYS A 284 ? 0.6428 0.6140 0.5715 0.0029  0.0267  -0.0047 286 LYS A O   
2082 C CB  . LYS A 284 ? 0.7082 0.7041 0.6427 -0.0162 0.0147  0.0147  286 LYS A CB  
2083 C CG  . LYS A 284 ? 0.7435 0.7633 0.6827 -0.0266 0.0108  0.0268  286 LYS A CG  
2084 C CD  . LYS A 284 ? 0.8151 0.8210 0.7527 -0.0401 -0.0039 0.0375  286 LYS A CD  
2085 C CE  . LYS A 284 ? 0.8613 0.8882 0.8042 -0.0510 -0.0093 0.0502  286 LYS A CE  
2086 N NZ  . LYS A 284 ? 0.9184 0.9355 0.8612 -0.0461 -0.0091 0.0448  286 LYS A NZ  
2087 N N   . LYS A 285 ? 0.6199 0.6069 0.5536 0.0117  0.0345  -0.0101 287 LYS A N   
2088 C CA  . LYS A 285 ? 0.5983 0.5673 0.5301 0.0199  0.0372  -0.0183 287 LYS A CA  
2089 C C   . LYS A 285 ? 0.6039 0.5507 0.5311 0.0182  0.0310  -0.0185 287 LYS A C   
2090 O O   . LYS A 285 ? 0.6286 0.5702 0.5539 0.0114  0.0234  -0.0135 287 LYS A O   
2091 C CB  . LYS A 285 ? 0.5749 0.5471 0.5095 0.0270  0.0413  -0.0233 287 LYS A CB  
2092 C CG  . LYS A 285 ? 0.6024 0.5942 0.5401 0.0319  0.0459  -0.0256 287 LYS A CG  
2093 C CD  . LYS A 285 ? 0.5996 0.5954 0.5401 0.0377  0.0479  -0.0293 287 LYS A CD  
2094 C CE  . LYS A 285 ? 0.6054 0.6184 0.5474 0.0451  0.0506  -0.0336 287 LYS A CE  
2095 N NZ  . LYS A 285 ? 0.6831 0.7230 0.6269 0.0436  0.0513  -0.0296 287 LYS A NZ  
2096 N N   . VAL A 286 ? 0.5718 0.5062 0.4968 0.0246  0.0330  -0.0240 288 VAL A N   
2097 C CA  . VAL A 286 ? 0.5593 0.4762 0.4794 0.0275  0.0283  -0.0266 288 VAL A CA  
2098 C C   . VAL A 286 ? 0.5463 0.4650 0.4688 0.0349  0.0335  -0.0308 288 VAL A C   
2099 O O   . VAL A 286 ? 0.5310 0.4531 0.4563 0.0393  0.0387  -0.0332 288 VAL A O   
2100 C CB  . VAL A 286 ? 0.5586 0.4650 0.4747 0.0297  0.0271  -0.0286 288 VAL A CB  
2101 C CG1 . VAL A 286 ? 0.5204 0.4116 0.4302 0.0346  0.0211  -0.0319 288 VAL A CG1 
2102 C CG2 . VAL A 286 ? 0.5655 0.4736 0.4808 0.0222  0.0238  -0.0240 288 VAL A CG2 
2103 N N   . ILE A 287 ? 0.5456 0.4615 0.4672 0.0357  0.0307  -0.0310 289 ILE A N   
2104 C CA  . ILE A 287 ? 0.5252 0.4461 0.4501 0.0406  0.0347  -0.0332 289 ILE A CA  
2105 C C   . ILE A 287 ? 0.5424 0.4539 0.4626 0.0462  0.0314  -0.0359 289 ILE A C   
2106 O O   . ILE A 287 ? 0.5705 0.4730 0.4854 0.0450  0.0240  -0.0358 289 ILE A O   
2107 C CB  . ILE A 287 ? 0.5200 0.4486 0.4475 0.0363  0.0336  -0.0305 289 ILE A CB  
2108 C CG1 . ILE A 287 ? 0.5010 0.4451 0.4331 0.0329  0.0371  -0.0281 289 ILE A CG1 
2109 C CG2 . ILE A 287 ? 0.5169 0.4477 0.4467 0.0411  0.0361  -0.0327 289 ILE A CG2 
2110 C CD1 . ILE A 287 ? 0.4772 0.4295 0.4103 0.0259  0.0333  -0.0226 289 ILE A CD1 
2111 N N   . LEU A 288 ? 0.5296 0.4440 0.4513 0.0525  0.0355  -0.0378 290 LEU A N   
2112 C CA  . LEU A 288 ? 0.5295 0.4441 0.4490 0.0589  0.0346  -0.0395 290 LEU A CA  
2113 C C   . LEU A 288 ? 0.5250 0.4476 0.4500 0.0592  0.0380  -0.0385 290 LEU A C   
2114 O O   . LEU A 288 ? 0.5061 0.4353 0.4374 0.0581  0.0423  -0.0371 290 LEU A O   
2115 C CB  . LEU A 288 ? 0.5236 0.4419 0.4426 0.0649  0.0369  -0.0399 290 LEU A CB  
2116 C CG  . LEU A 288 ? 0.5429 0.4560 0.4579 0.0660  0.0351  -0.0409 290 LEU A CG  
2117 C CD1 . LEU A 288 ? 0.5082 0.4310 0.4257 0.0710  0.0389  -0.0392 290 LEU A CD1 
2118 C CD2 . LEU A 288 ? 0.5500 0.4513 0.4550 0.0695  0.0267  -0.0447 290 LEU A CD2 
2119 N N   . ASP A 289 ? 0.5392 0.4601 0.4613 0.0612  0.0348  -0.0396 291 ASP A N   
2120 C CA  . ASP A 289 ? 0.5257 0.4535 0.4521 0.0620  0.0373  -0.0388 291 ASP A CA  
2121 C C   . ASP A 289 ? 0.5272 0.4588 0.4509 0.0696  0.0370  -0.0397 291 ASP A C   
2122 O O   . ASP A 289 ? 0.5451 0.4715 0.4619 0.0738  0.0319  -0.0426 291 ASP A O   
2123 C CB  . ASP A 289 ? 0.5242 0.4485 0.4492 0.0581  0.0334  -0.0387 291 ASP A CB  
2124 C CG  . ASP A 289 ? 0.5866 0.5174 0.5157 0.0589  0.0356  -0.0382 291 ASP A CG  
2125 O OD1 . ASP A 289 ? 0.6506 0.5859 0.5804 0.0643  0.0375  -0.0385 291 ASP A OD1 
2126 O OD2 . ASP A 289 ? 0.6051 0.5385 0.5369 0.0538  0.0352  -0.0366 291 ASP A OD2 
2127 N N   . LEU A 290 ? 0.5239 0.4655 0.4530 0.0715  0.0412  -0.0369 292 LEU A N   
2128 C CA  . LEU A 290 ? 0.5258 0.4772 0.4534 0.0784  0.0414  -0.0359 292 LEU A CA  
2129 C C   . LEU A 290 ? 0.5462 0.5053 0.4782 0.0785  0.0428  -0.0335 292 LEU A C   
2130 O O   . LEU A 290 ? 0.5515 0.5156 0.4910 0.0750  0.0451  -0.0293 292 LEU A O   
2131 C CB  . LEU A 290 ? 0.5051 0.4654 0.4369 0.0787  0.0441  -0.0314 292 LEU A CB  
2132 C CG  . LEU A 290 ? 0.4718 0.4337 0.3977 0.0839  0.0430  -0.0328 292 LEU A CG  
2133 C CD1 . LEU A 290 ? 0.4943 0.4418 0.4119 0.0851  0.0384  -0.0391 292 LEU A CD1 
2134 C CD2 . LEU A 290 ? 0.4044 0.3673 0.3353 0.0797  0.0451  -0.0291 292 LEU A CD2 
2135 N N   . PRO A 291 ? 0.5786 0.5378 0.5057 0.0830  0.0403  -0.0363 293 PRO A N   
2136 C CA  . PRO A 291 ? 0.5735 0.5398 0.5052 0.0825  0.0417  -0.0338 293 PRO A CA  
2137 C C   . PRO A 291 ? 0.5667 0.5493 0.5045 0.0838  0.0444  -0.0273 293 PRO A C   
2138 O O   . PRO A 291 ? 0.5715 0.5661 0.5070 0.0893  0.0446  -0.0252 293 PRO A O   
2139 C CB  . PRO A 291 ? 0.5859 0.5494 0.5095 0.0887  0.0375  -0.0385 293 PRO A CB  
2140 C CG  . PRO A 291 ? 0.6133 0.5618 0.5291 0.0890  0.0321  -0.0435 293 PRO A CG  
2141 C CD  . PRO A 291 ? 0.6010 0.5525 0.5177 0.0891  0.0345  -0.0420 293 PRO A CD  
2142 N N   . LEU A 292 ? 0.5550 0.5393 0.5006 0.0788  0.0454  -0.0235 294 LEU A N   
2143 C CA  . LEU A 292 ? 0.5499 0.5488 0.5018 0.0784  0.0458  -0.0157 294 LEU A CA  
2144 C C   . LEU A 292 ? 0.5591 0.5629 0.5124 0.0793  0.0454  -0.0149 294 LEU A C   
2145 O O   . LEU A 292 ? 0.5533 0.5476 0.5042 0.0790  0.0450  -0.0202 294 LEU A O   
2146 C CB  . LEU A 292 ? 0.5317 0.5276 0.4921 0.0716  0.0446  -0.0106 294 LEU A CB  
2147 C CG  . LEU A 292 ? 0.5372 0.5238 0.4967 0.0696  0.0447  -0.0129 294 LEU A CG  
2148 C CD1 . LEU A 292 ? 0.5405 0.5178 0.5060 0.0644  0.0422  -0.0123 294 LEU A CD1 
2149 C CD2 . LEU A 292 ? 0.5584 0.5551 0.5166 0.0718  0.0453  -0.0087 294 LEU A CD2 
2150 N N   . VAL A 293 ? 0.5681 0.5889 0.5257 0.0800  0.0453  -0.0070 295 VAL A N   
2151 C CA  . VAL A 293 ? 0.5709 0.5988 0.5328 0.0787  0.0444  -0.0029 295 VAL A CA  
2152 C C   . VAL A 293 ? 0.5849 0.6168 0.5573 0.0711  0.0414  0.0071  295 VAL A C   
2153 O O   . VAL A 293 ? 0.5711 0.6153 0.5467 0.0695  0.0404  0.0152  295 VAL A O   
2154 C CB  . VAL A 293 ? 0.5770 0.6261 0.5352 0.0859  0.0453  0.0003  295 VAL A CB  
2155 C CG1 . VAL A 293 ? 0.5699 0.6317 0.5354 0.0826  0.0440  0.0088  295 VAL A CG1 
2156 C CG2 . VAL A 293 ? 0.5612 0.6044 0.5086 0.0944  0.0454  -0.0099 295 VAL A CG2 
2157 N N   . ILE A 294 ? 0.6082 0.6302 0.5855 0.0667  0.0386  0.0070  296 ILE A N   
2158 C CA  . ILE A 294 ? 0.6353 0.6551 0.6219 0.0596  0.0325  0.0153  296 ILE A CA  
2159 C C   . ILE A 294 ? 0.6445 0.6682 0.6370 0.0566  0.0283  0.0210  296 ILE A C   
2160 O O   . ILE A 294 ? 0.6561 0.6694 0.6479 0.0575  0.0280  0.0147  296 ILE A O   
2161 C CB  . ILE A 294 ? 0.6410 0.6412 0.6281 0.0575  0.0300  0.0091  296 ILE A CB  
2162 C CG1 . ILE A 294 ? 0.6339 0.6350 0.6188 0.0577  0.0316  0.0097  296 ILE A CG1 
2163 C CG2 . ILE A 294 ? 0.6342 0.6257 0.6292 0.0523  0.0208  0.0141  296 ILE A CG2 
2164 C CD1 . ILE A 294 ? 0.6588 0.6459 0.6389 0.0596  0.0340  -0.0003 296 ILE A CD1 
2165 N N   . GLY A 295 ? 0.6661 0.7068 0.6645 0.0528  0.0249  0.0338  297 GLY A N   
2166 C CA  . GLY A 295 ? 0.6944 0.7406 0.6987 0.0491  0.0201  0.0410  297 GLY A CA  
2167 C C   . GLY A 295 ? 0.7226 0.7628 0.7366 0.0400  0.0088  0.0518  297 GLY A C   
2168 O O   . GLY A 295 ? 0.7319 0.7634 0.7484 0.0364  0.0039  0.0540  297 GLY A O   
2169 N N   . SER A 296 ? 0.7523 0.7967 0.7718 0.0361  0.0031  0.0590  298 SER A N   
2170 C CA  . SER A 296 ? 0.7797 0.8176 0.8088 0.0265  -0.0108 0.0710  298 SER A CA  
2171 C C   . SER A 296 ? 0.8079 0.8713 0.8447 0.0193  -0.0153 0.0896  298 SER A C   
2172 O O   . SER A 296 ? 0.8538 0.9149 0.8996 0.0091  -0.0289 0.1036  298 SER A O   
2173 C CB  . SER A 296 ? 0.7771 0.7910 0.8063 0.0276  -0.0173 0.0623  298 SER A CB  
2174 O OG  . SER A 296 ? 0.7455 0.7633 0.7694 0.0341  -0.0082 0.0533  298 SER A OG  
2175 N N   . MET B 1   ? 0.8938 1.3905 1.1633 0.1351  -0.0079 -0.0174 1   MET B N   
2176 C CA  . MET B 1   ? 0.8977 1.4035 1.1623 0.1326  0.0147  -0.0176 1   MET B CA  
2177 C C   . MET B 1   ? 0.8638 1.3593 1.1185 0.1032  0.0223  -0.0088 1   MET B C   
2178 O O   . MET B 1   ? 0.8648 1.3645 1.1326 0.0822  0.0118  -0.0030 1   MET B O   
2179 C CB  . MET B 1   ? 0.9448 1.5138 1.2468 0.1447  0.0257  -0.0220 1   MET B CB  
2180 C CG  . MET B 1   ? 1.0120 1.5763 1.3075 0.1780  0.0298  -0.0343 1   MET B CG  
2181 S SD  . MET B 1   ? 1.1573 1.7778 1.4681 0.1835  0.0574  -0.0411 1   MET B SD  
2182 C CE  . MET B 1   ? 1.0915 1.6654 1.3569 0.1616  0.0707  -0.0339 1   MET B CE  
2183 N N   . VAL B 2   ? 0.8385 1.3189 1.0703 0.1024  0.0386  -0.0082 2   VAL B N   
2184 C CA  . VAL B 2   ? 0.8023 1.2590 1.0161 0.0780  0.0430  0.0009  2   VAL B CA  
2185 C C   . VAL B 2   ? 0.8140 1.3102 1.0408 0.0638  0.0610  0.0093  2   VAL B C   
2186 O O   . VAL B 2   ? 0.8171 1.3265 1.0338 0.0765  0.0773  0.0047  2   VAL B O   
2187 C CB  . VAL B 2   ? 0.7738 1.1753 0.9437 0.0846  0.0452  -0.0023 2   VAL B CB  
2188 C CG1 . VAL B 2   ? 0.7571 1.1304 0.9109 0.0615  0.0436  0.0063  2   VAL B CG1 
2189 C CG2 . VAL B 2   ? 0.7678 1.1358 0.9214 0.1004  0.0304  -0.0090 2   VAL B CG2 
2190 N N   . LYS B 3   ? 0.8203 1.3341 1.0679 0.0366  0.0568  0.0218  3   LYS B N   
2191 C CA  . LYS B 3   ? 0.8484 1.4033 1.1096 0.0169  0.0721  0.0352  3   LYS B CA  
2192 C C   . LYS B 3   ? 0.8189 1.3340 1.0439 0.0070  0.0790  0.0423  3   LYS B C   
2193 O O   . LYS B 3   ? 0.8054 1.2756 1.0174 -0.0080 0.0657  0.0481  3   LYS B O   
2194 C CB  . LYS B 3   ? 0.8773 1.4602 1.1741 -0.0127 0.0616  0.0493  3   LYS B CB  
2195 C CG  . LYS B 3   ? 0.9240 1.5610 1.2625 -0.0059 0.0565  0.0444  3   LYS B CG  
2196 C CD  . LYS B 3   ? 0.9501 1.5756 1.3101 -0.0252 0.0319  0.0479  3   LYS B CD  
2197 C CE  . LYS B 3   ? 0.9974 1.6846 1.4019 -0.0213 0.0271  0.0451  3   LYS B CE  
2198 N NZ  . LYS B 3   ? 1.0190 1.6821 1.4293 -0.0182 0.0016  0.0362  3   LYS B NZ  
2199 N N   . GLN B 4   ? 0.8092 1.3412 1.0180 0.0178  0.0983  0.0396  4   GLN B N   
2200 C CA  . GLN B 4   ? 0.7919 1.3027 0.9714 0.0045  0.1070  0.0499  4   GLN B CA  
2201 C C   . GLN B 4   ? 0.8338 1.3626 1.0331 -0.0303 0.1031  0.0727  4   GLN B C   
2202 O O   . GLN B 4   ? 0.8578 1.4256 1.0937 -0.0413 0.0984  0.0780  4   GLN B O   
2203 C CB  . GLN B 4   ? 0.7498 1.2929 0.9149 0.0204  0.1290  0.0426  4   GLN B CB  
2204 C CG  . GLN B 4   ? 0.7038 1.2075 0.8420 0.0522  0.1275  0.0210  4   GLN B CG  
2205 C CD  . GLN B 4   ? 0.6694 1.2141 0.8199 0.0814  0.1383  0.0024  4   GLN B CD  
2206 O OE1 . GLN B 4   ? 0.6834 1.2937 0.8536 0.0806  0.1543  0.0034  4   GLN B OE1 
2207 N NE2 . GLN B 4   ? 0.6286 1.1367 0.7682 0.1078  0.1287  -0.0145 4   GLN B NE2 
2208 N N   . ILE B 5   ? 0.8506 1.3477 1.0274 -0.0486 0.1016  0.0868  5   ILE B N   
2209 C CA  . ILE B 5   ? 0.9053 1.4049 1.0999 -0.0835 0.0916  0.1105  5   ILE B CA  
2210 C C   . ILE B 5   ? 0.9503 1.4375 1.1192 -0.1010 0.0983  0.1295  5   ILE B C   
2211 O O   . ILE B 5   ? 0.9322 1.3747 1.0665 -0.0885 0.0979  0.1224  5   ILE B O   
2212 C CB  . ILE B 5   ? 0.8825 1.3308 1.0852 -0.0907 0.0647  0.1074  5   ILE B CB  
2213 C CG1 . ILE B 5   ? 0.8732 1.3555 1.1146 -0.0912 0.0562  0.1016  5   ILE B CG1 
2214 C CG2 . ILE B 5   ? 0.9062 1.3193 1.1058 -0.1207 0.0502  0.1285  5   ILE B CG2 
2215 C CD1 . ILE B 5   ? 0.8812 1.3244 1.1358 -0.1060 0.0287  0.1016  5   ILE B CD1 
2216 N N   . GLU B 6   ? 1.0218 1.5496 1.2078 -0.1310 0.1032  0.1549  6   GLU B N   
2217 C CA  . GLU B 6   ? 1.0739 1.6011 1.2350 -0.1489 0.1113  0.1767  6   GLU B CA  
2218 C C   . GLU B 6   ? 1.1304 1.6433 1.3010 -0.1887 0.0963  0.2098  6   GLU B C   
2219 O O   . GLU B 6   ? 1.1641 1.6740 1.3111 -0.2028 0.1015  0.2294  6   GLU B O   
2220 C CB  . GLU B 6   ? 1.1121 1.7118 1.2673 -0.1427 0.1402  0.1773  6   GLU B CB  
2221 C CG  . GLU B 6   ? 1.1059 1.7021 1.2355 -0.1039 0.1539  0.1473  6   GLU B CG  
2222 C CD  . GLU B 6   ? 1.1380 1.7729 1.2952 -0.0797 0.1597  0.1247  6   GLU B CD  
2223 O OE1 . GLU B 6   ? 1.1844 1.8801 1.3794 -0.0941 0.1638  0.1347  6   GLU B OE1 
2224 O OE2 . GLU B 6   ? 1.1122 1.7176 1.2542 -0.0473 0.1589  0.0984  6   GLU B OE2 
2225 N N   . SER B 7   ? 1.1495 1.6522 1.3530 -0.2079 0.0762  0.2173  7   SER B N   
2226 C CA  . SER B 7   ? 1.2185 1.6962 1.4305 -0.2464 0.0572  0.2491  7   SER B CA  
2227 C C   . SER B 7   ? 1.2174 1.6314 1.4448 -0.2504 0.0251  0.2411  7   SER B C   
2228 O O   . SER B 7   ? 1.1727 1.5834 1.4123 -0.2297 0.0205  0.2153  7   SER B O   
2229 C CB  . SER B 7   ? 1.2930 1.8453 1.5352 -0.2812 0.0670  0.2790  7   SER B CB  
2230 O OG  . SER B 7   ? 1.2910 1.8612 1.5767 -0.2962 0.0530  0.2797  7   SER B OG  
2231 N N   . LYS B 8   ? 1.2751 1.6379 1.5011 -0.2754 0.0015  0.2619  8   LYS B N   
2232 C CA  . LYS B 8   ? 1.2991 1.6093 1.5459 -0.2820 -0.0308 0.2535  8   LYS B CA  
2233 C C   . LYS B 8   ? 1.3461 1.7016 1.6377 -0.3041 -0.0366 0.2600  8   LYS B C   
2234 O O   . LYS B 8   ? 1.3340 1.6681 1.6432 -0.2957 -0.0547 0.2388  8   LYS B O   
2235 C CB  . LYS B 8   ? 1.3590 1.5993 1.5973 -0.3016 -0.0588 0.2718  8   LYS B CB  
2236 C CG  . LYS B 8   ? 1.3898 1.5715 1.6482 -0.3036 -0.0944 0.2565  8   LYS B CG  
2237 C CD  . LYS B 8   ? 1.4895 1.6054 1.7468 -0.3265 -0.1251 0.2776  8   LYS B CD  
2238 C CE  . LYS B 8   ? 1.4775 1.5505 1.6956 -0.3050 -0.1230 0.2738  8   LYS B CE  
2239 N NZ  . LYS B 8   ? 1.5772 1.5913 1.7943 -0.3288 -0.1521 0.3004  8   LYS B NZ  
2240 N N   . THR B 9   ? 1.4054 1.8275 1.7156 -0.3325 -0.0215 0.2888  9   THR B N   
2241 C CA  . THR B 9   ? 1.4463 1.9234 1.8025 -0.3541 -0.0249 0.2956  9   THR B CA  
2242 C C   . THR B 9   ? 1.3860 1.9125 1.7532 -0.3209 -0.0072 0.2645  9   THR B C   
2243 O O   . THR B 9   ? 1.3897 1.9285 1.7895 -0.3239 -0.0210 0.2539  9   THR B O   
2244 C CB  . THR B 9   ? 1.5322 2.0748 1.9118 -0.3995 -0.0161 0.3384  9   THR B CB  
2245 O OG1 . THR B 9   ? 1.5161 2.1146 1.8720 -0.3922 0.0176  0.3480  9   THR B OG1 
2246 C CG2 . THR B 9   ? 1.6056 2.0899 1.9876 -0.4390 -0.0460 0.3706  9   THR B CG2 
2247 N N   . ALA B 10  ? 1.3343 1.8850 1.6740 -0.2892 0.0204  0.2496  10  ALA B N   
2248 C CA  . ALA B 10  ? 1.2754 1.8561 1.6192 -0.2522 0.0334  0.2181  10  ALA B CA  
2249 C C   . ALA B 10  ? 1.2290 1.7436 1.5656 -0.2302 0.0106  0.1905  10  ALA B C   
2250 O O   . ALA B 10  ? 1.2079 1.7422 1.5655 -0.2159 0.0060  0.1720  10  ALA B O   
2251 C CB  . ALA B 10  ? 1.2330 1.8417 1.5461 -0.2231 0.0637  0.2072  10  ALA B CB  
2252 N N   . PHE B 11  ? 1.2214 1.6619 1.5296 -0.2286 -0.0047 0.1887  11  PHE B N   
2253 C CA  . PHE B 11  ? 1.1918 1.5706 1.4915 -0.2113 -0.0277 0.1643  11  PHE B CA  
2254 C C   . PHE B 11  ? 1.2380 1.6067 1.5717 -0.2316 -0.0554 0.1640  11  PHE B C   
2255 O O   . PHE B 11  ? 1.2072 1.5765 1.5499 -0.2148 -0.0641 0.1412  11  PHE B O   
2256 C CB  . PHE B 11  ? 1.1880 1.4970 1.4539 -0.2072 -0.0382 0.1643  11  PHE B CB  
2257 C CG  . PHE B 11  ? 1.1341 1.3933 1.3823 -0.1798 -0.0522 0.1346  11  PHE B CG  
2258 C CD1 . PHE B 11  ? 1.0566 1.3318 1.2913 -0.1482 -0.0383 0.1119  11  PHE B CD1 
2259 C CD2 . PHE B 11  ? 1.1614 1.3583 1.4060 -0.1852 -0.0802 0.1295  11  PHE B CD2 
2260 C CE1 . PHE B 11  ? 1.0163 1.2514 1.2331 -0.1253 -0.0503 0.0872  11  PHE B CE1 
2261 C CE2 . PHE B 11  ? 1.1069 1.2659 1.3342 -0.1589 -0.0916 0.1007  11  PHE B CE2 
2262 C CZ  . PHE B 11  ? 1.0290 1.2099 1.2419 -0.1303 -0.0758 0.0808  11  PHE B CZ  
2263 N N   . GLN B 12  ? 1.3236 1.6813 1.6751 -0.2687 -0.0708 0.1900  12  GLN B N   
2264 C CA  . GLN B 12  ? 1.3920 1.7439 1.7806 -0.2946 -0.0989 0.1933  12  GLN B CA  
2265 C C   . GLN B 12  ? 1.3796 1.7984 1.7997 -0.2892 -0.0910 0.1830  12  GLN B C   
2266 O O   . GLN B 12  ? 1.3731 1.7766 1.8064 -0.2824 -0.1114 0.1625  12  GLN B O   
2267 C CB  . GLN B 12  ? 1.4843 1.8339 1.8932 -0.3410 -0.1118 0.2306  12  GLN B CB  
2268 C CG  . GLN B 12  ? 1.5328 1.8007 1.9194 -0.3513 -0.1339 0.2412  12  GLN B CG  
2269 C CD  . GLN B 12  ? 1.5234 1.7119 1.8981 -0.3305 -0.1640 0.2098  12  GLN B CD  
2270 O OE1 . GLN B 12  ? 1.4826 1.6705 1.8719 -0.3197 -0.1772 0.1844  12  GLN B OE1 
2271 N NE2 . GLN B 12  ? 1.5419 1.6666 1.8894 -0.3242 -0.1752 0.2114  12  GLN B NE2 
2272 N N   . GLU B 13  ? 1.3817 1.8754 1.8120 -0.2897 -0.0620 0.1955  13  GLU B N   
2273 C CA  . GLU B 13  ? 1.3789 1.9427 1.8394 -0.2794 -0.0519 0.1851  13  GLU B CA  
2274 C C   . GLU B 13  ? 1.3267 1.8664 1.7775 -0.2444 -0.0610 0.1513  13  GLU B C   
2275 O O   . GLU B 13  ? 1.3543 1.9007 1.8321 -0.2507 -0.0810 0.1425  13  GLU B O   
2276 C CB  . GLU B 13  ? 1.3645 2.0019 1.8238 -0.2661 -0.0162 0.1906  13  GLU B CB  
2277 C CG  . GLU B 13  ? 1.4298 2.1507 1.9302 -0.2979 -0.0060 0.2164  13  GLU B CG  
2278 C CD  . GLU B 13  ? 1.4819 2.2187 1.9676 -0.3214 0.0105  0.2463  13  GLU B CD  
2279 O OE1 . GLU B 13  ? 1.4618 2.1882 1.9095 -0.2984 0.0306  0.2403  13  GLU B OE1 
2280 O OE2 . GLU B 13  ? 1.5621 2.3231 2.0737 -0.3645 0.0025  0.2771  13  GLU B OE2 
2281 N N   . ALA B 14  ? 1.2611 1.7752 1.6737 -0.2094 -0.0474 0.1336  14  ALA B N   
2282 C CA  . ALA B 14  ? 1.2158 1.7161 1.6188 -0.1770 -0.0541 0.1049  14  ALA B CA  
2283 C C   . ALA B 14  ? 1.2326 1.6820 1.6378 -0.1825 -0.0869 0.0907  14  ALA B C   
2284 O O   . ALA B 14  ? 1.2201 1.6837 1.6389 -0.1717 -0.0987 0.0744  14  ALA B O   
2285 C CB  . ALA B 14  ? 1.1541 1.6290 1.5149 -0.1437 -0.0371 0.0914  14  ALA B CB  
2286 N N   . LEU B 15  ? 1.2648 1.6568 1.6568 -0.1988 -0.1024 0.0966  15  LEU B N   
2287 C CA  . LEU B 15  ? 1.3034 1.6426 1.6971 -0.2056 -0.1354 0.0824  15  LEU B CA  
2288 C C   . LEU B 15  ? 1.3578 1.7289 1.7942 -0.2275 -0.1546 0.0837  15  LEU B C   
2289 O O   . LEU B 15  ? 1.3719 1.7184 1.8118 -0.2236 -0.1798 0.0631  15  LEU B O   
2290 C CB  . LEU B 15  ? 1.3489 1.6297 1.7307 -0.2244 -0.1487 0.0950  15  LEU B CB  
2291 C CG  . LEU B 15  ? 1.3000 1.5504 1.6399 -0.2027 -0.1312 0.0933  15  LEU B CG  
2292 C CD1 . LEU B 15  ? 1.3413 1.5626 1.6755 -0.2261 -0.1334 0.1192  15  LEU B CD1 
2293 C CD2 . LEU B 15  ? 1.2562 1.4594 1.5656 -0.1719 -0.1419 0.0623  15  LEU B CD2 
2294 N N   . ASP B 16  ? 1.3905 1.8218 1.8592 -0.2503 -0.1419 0.1077  16  ASP B N   
2295 C CA  . ASP B 16  ? 1.4352 1.9188 1.9493 -0.2694 -0.1532 0.1115  16  ASP B CA  
2296 C C   . ASP B 16  ? 1.3823 1.9239 1.9038 -0.2401 -0.1374 0.0969  16  ASP B C   
2297 O O   . ASP B 16  ? 1.3851 1.9337 1.9206 -0.2337 -0.1558 0.0799  16  ASP B O   
2298 C CB  . ASP B 16  ? 1.5018 2.0308 2.0494 -0.3096 -0.1464 0.1463  16  ASP B CB  
2299 C CG  . ASP B 16  ? 1.5639 2.0341 2.0986 -0.3367 -0.1584 0.1664  16  ASP B CG  
2300 O OD1 . ASP B 16  ? 1.5336 1.9361 2.0295 -0.3173 -0.1631 0.1532  16  ASP B OD1 
2301 O OD2 . ASP B 16  ? 1.6489 2.1422 2.2133 -0.3778 -0.1643 0.1965  16  ASP B OD2 
2302 N N   . ALA B 17  ? 1.3410 1.9215 1.8522 -0.2218 -0.1055 0.1028  17  ALA B N   
2303 C CA  . ALA B 17  ? 1.3004 1.9368 1.8198 -0.1919 -0.0891 0.0911  17  ALA B CA  
2304 C C   . ALA B 17  ? 1.2703 1.8847 1.7802 -0.1672 -0.1073 0.0653  17  ALA B C   
2305 O O   . ALA B 17  ? 1.2890 1.9470 1.8303 -0.1668 -0.1173 0.0603  17  ALA B O   
2306 C CB  . ALA B 17  ? 1.2536 1.8990 1.7439 -0.1662 -0.0576 0.0915  17  ALA B CB  
2307 N N   . ALA B 18  ? 1.2273 1.7782 1.6939 -0.1475 -0.1116 0.0502  18  ALA B N   
2308 C CA  . ALA B 18  ? 1.2037 1.7271 1.6548 -0.1286 -0.1314 0.0270  18  ALA B CA  
2309 C C   . ALA B 18  ? 1.2530 1.7588 1.7244 -0.1532 -0.1636 0.0214  18  ALA B C   
2310 O O   . ALA B 18  ? 1.2936 1.7631 1.7670 -0.1781 -0.1753 0.0288  18  ALA B O   
2311 C CB  . ALA B 18  ? 1.1562 1.6205 1.5570 -0.1064 -0.1274 0.0144  18  ALA B CB  
2312 N N   . GLY B 19  ? 1.2548 1.7847 1.7415 -0.1462 -0.1799 0.0081  19  GLY B N   
2313 C CA  . GLY B 19  ? 1.2963 1.8091 1.8001 -0.1670 -0.2128 -0.0016 19  GLY B CA  
2314 C C   . GLY B 19  ? 1.2713 1.7178 1.7334 -0.1528 -0.2281 -0.0243 19  GLY B C   
2315 O O   . GLY B 19  ? 1.2404 1.6423 1.6739 -0.1485 -0.2194 -0.0232 19  GLY B O   
2316 N N   . ASP B 20  ? 1.2806 1.7263 1.7398 -0.1446 -0.2510 -0.0455 20  ASP B N   
2317 C CA  . ASP B 20  ? 1.2640 1.6617 1.6822 -0.1257 -0.2638 -0.0707 20  ASP B CA  
2318 C C   . ASP B 20  ? 1.1824 1.5723 1.5592 -0.0944 -0.2390 -0.0723 20  ASP B C   
2319 O O   . ASP B 20  ? 1.1715 1.5253 1.5115 -0.0783 -0.2447 -0.0907 20  ASP B O   
2320 C CB  . ASP B 20  ? 1.3043 1.7169 1.7266 -0.1214 -0.2906 -0.0921 20  ASP B CB  
2321 C CG  . ASP B 20  ? 1.3924 1.7827 1.8386 -0.1488 -0.3238 -0.1025 20  ASP B CG  
2322 O OD1 . ASP B 20  ? 1.4306 1.8583 1.9089 -0.1618 -0.3409 -0.1035 20  ASP B OD1 
2323 O OD2 . ASP B 20  ? 1.4188 1.7534 1.8527 -0.1566 -0.3350 -0.1106 20  ASP B OD2 
2324 N N   . LYS B 21  ? 1.1196 1.5441 1.5029 -0.0860 -0.2128 -0.0542 21  LYS B N   
2325 C CA  . LYS B 21  ? 1.0410 1.4580 1.3879 -0.0581 -0.1914 -0.0544 21  LYS B CA  
2326 C C   . LYS B 21  ? 0.9979 1.3663 1.3115 -0.0542 -0.1784 -0.0536 21  LYS B C   
2327 O O   . LYS B 21  ? 1.0008 1.3567 1.3242 -0.0708 -0.1704 -0.0402 21  LYS B O   
2328 C CB  . LYS B 21  ? 1.0146 1.4801 1.3772 -0.0455 -0.1716 -0.0405 21  LYS B CB  
2329 C CG  . LYS B 21  ? 1.0396 1.5538 1.4505 -0.0649 -0.1665 -0.0244 21  LYS B CG  
2330 C CD  . LYS B 21  ? 1.0309 1.5962 1.4551 -0.0428 -0.1485 -0.0173 21  LYS B CD  
2331 C CE  . LYS B 21  ? 1.0929 1.7236 1.5750 -0.0660 -0.1444 -0.0018 21  LYS B CE  
2332 N NZ  . LYS B 21  ? 1.0633 1.7364 1.5535 -0.0453 -0.1158 0.0068  21  LYS B NZ  
2333 N N   . LEU B 22  ? 0.9527 1.2974 1.2273 -0.0332 -0.1778 -0.0673 22  LEU B N   
2334 C CA  . LEU B 22  ? 0.9003 1.2062 1.1426 -0.0255 -0.1659 -0.0683 22  LEU B CA  
2335 C C   . LEU B 22  ? 0.8599 1.1770 1.1030 -0.0230 -0.1393 -0.0488 22  LEU B C   
2336 O O   . LEU B 22  ? 0.8411 1.1933 1.0952 -0.0148 -0.1277 -0.0402 22  LEU B O   
2337 C CB  . LEU B 22  ? 0.8764 1.1694 1.0794 -0.0035 -0.1681 -0.0844 22  LEU B CB  
2338 C CG  . LEU B 22  ? 0.8008 1.0700 0.9673 0.0111  -0.1510 -0.0835 22  LEU B CG  
2339 C CD1 . LEU B 22  ? 0.7982 1.0418 0.9372 0.0192  -0.1630 -0.1046 22  LEU B CD1 
2340 C CD2 . LEU B 22  ? 0.7370 1.0264 0.8874 0.0278  -0.1366 -0.0751 22  LEU B CD2 
2341 N N   . VAL B 23  ? 0.8502 1.1369 1.0822 -0.0296 -0.1312 -0.0430 23  VAL B N   
2342 C CA  . VAL B 23  ? 0.8165 1.1119 1.0472 -0.0297 -0.1068 -0.0254 23  VAL B CA  
2343 C C   . VAL B 23  ? 0.7665 1.0239 0.9600 -0.0186 -0.0976 -0.0286 23  VAL B C   
2344 O O   . VAL B 23  ? 0.7738 0.9962 0.9561 -0.0225 -0.1095 -0.0368 23  VAL B O   
2345 C CB  . VAL B 23  ? 0.8523 1.1662 1.1178 -0.0563 -0.1048 -0.0074 23  VAL B CB  
2346 C CG1 . VAL B 23  ? 0.9033 1.1813 1.1764 -0.0772 -0.1261 -0.0091 23  VAL B CG1 
2347 C CG2 . VAL B 23  ? 0.8283 1.1524 1.0882 -0.0568 -0.0799 0.0090  23  VAL B CG2 
2348 N N   . VAL B 24  ? 0.7102 0.9759 0.8858 -0.0028 -0.0787 -0.0241 24  VAL B N   
2349 C CA  . VAL B 24  ? 0.6572 0.8945 0.7988 0.0082  -0.0690 -0.0260 24  VAL B CA  
2350 C C   . VAL B 24  ? 0.6436 0.8818 0.7863 0.0010  -0.0506 -0.0105 24  VAL B C   
2351 O O   . VAL B 24  ? 0.6561 0.9259 0.8183 -0.0027 -0.0397 -0.0004 24  VAL B O   
2352 C CB  . VAL B 24  ? 0.6249 0.8692 0.7449 0.0288  -0.0639 -0.0313 24  VAL B CB  
2353 C CG1 . VAL B 24  ? 0.6033 0.8769 0.7369 0.0357  -0.0517 -0.0222 24  VAL B CG1 
2354 C CG2 . VAL B 24  ? 0.5968 0.8137 0.6815 0.0383  -0.0558 -0.0335 24  VAL B CG2 
2355 N N   . VAL B 25  ? 0.6269 0.8342 0.7498 -0.0011 -0.0481 -0.0090 25  VAL B N   
2356 C CA  . VAL B 25  ? 0.6187 0.8268 0.7381 -0.0081 -0.0318 0.0058  25  VAL B CA  
2357 C C   . VAL B 25  ? 0.5844 0.7699 0.6702 0.0052  -0.0222 0.0026  25  VAL B C   
2358 O O   . VAL B 25  ? 0.5876 0.7452 0.6566 0.0094  -0.0315 -0.0060 25  VAL B O   
2359 C CB  . VAL B 25  ? 0.6558 0.8469 0.7874 -0.0300 -0.0407 0.0163  25  VAL B CB  
2360 C CG1 . VAL B 25  ? 0.6316 0.8313 0.7585 -0.0392 -0.0230 0.0347  25  VAL B CG1 
2361 C CG2 . VAL B 25  ? 0.6882 0.8958 0.8541 -0.0466 -0.0558 0.0183  25  VAL B CG2 
2362 N N   . ASP B 26  ? 0.5574 0.7573 0.6347 0.0126  -0.0045 0.0082  26  ASP B N   
2363 C CA  . ASP B 26  ? 0.5308 0.7115 0.5787 0.0213  0.0053  0.0079  26  ASP B CA  
2364 C C   . ASP B 26  ? 0.5479 0.7230 0.5929 0.0076  0.0129  0.0212  26  ASP B C   
2365 O O   . ASP B 26  ? 0.5615 0.7631 0.6169 0.0012  0.0254  0.0312  26  ASP B O   
2366 C CB  . ASP B 26  ? 0.5152 0.7118 0.5562 0.0368  0.0173  0.0054  26  ASP B CB  
2367 C CG  . ASP B 26  ? 0.5110 0.6869 0.5215 0.0456  0.0257  0.0040  26  ASP B CG  
2368 O OD1 . ASP B 26  ? 0.5053 0.6647 0.5024 0.0385  0.0284  0.0085  26  ASP B OD1 
2369 O OD2 . ASP B 26  ? 0.5220 0.6974 0.5227 0.0591  0.0280  -0.0008 26  ASP B OD2 
2370 N N   . PHE B 27  ? 0.5359 0.6802 0.5671 0.0035  0.0049  0.0215  27  PHE B N   
2371 C CA  . PHE B 27  ? 0.5387 0.6736 0.5587 -0.0057 0.0117  0.0343  27  PHE B CA  
2372 C C   . PHE B 27  ? 0.5051 0.6335 0.4974 0.0075  0.0230  0.0299  27  PHE B C   
2373 O O   . PHE B 27  ? 0.4875 0.5943 0.4631 0.0158  0.0169  0.0216  27  PHE B O   
2374 C CB  . PHE B 27  ? 0.5704 0.6730 0.5899 -0.0140 -0.0050 0.0365  27  PHE B CB  
2375 C CG  . PHE B 27  ? 0.6279 0.7288 0.6752 -0.0296 -0.0205 0.0409  27  PHE B CG  
2376 C CD1 . PHE B 27  ? 0.6551 0.7598 0.7157 -0.0514 -0.0213 0.0617  27  PHE B CD1 
2377 C CD2 . PHE B 27  ? 0.6146 0.7118 0.6744 -0.0241 -0.0354 0.0252  27  PHE B CD2 
2378 C CE1 . PHE B 27  ? 0.6837 0.7838 0.7711 -0.0689 -0.0381 0.0676  27  PHE B CE1 
2379 C CE2 . PHE B 27  ? 0.6693 0.7623 0.7551 -0.0396 -0.0522 0.0281  27  PHE B CE2 
2380 C CZ  . PHE B 27  ? 0.7045 0.7974 0.8053 -0.0630 -0.0540 0.0499  27  PHE B CZ  
2381 N N   . SER B 28  ? 0.5101 0.6604 0.4985 0.0092  0.0391  0.0346  28  SER B N   
2382 C CA  . SER B 28  ? 0.4905 0.6378 0.4555 0.0223  0.0497  0.0285  28  SER B CA  
2383 C C   . SER B 28  ? 0.5036 0.6471 0.4493 0.0159  0.0586  0.0376  28  SER B C   
2384 O O   . SER B 28  ? 0.5215 0.6656 0.4722 0.0006  0.0565  0.0513  28  SER B O   
2385 C CB  . SER B 28  ? 0.4979 0.6750 0.4751 0.0311  0.0597  0.0242  28  SER B CB  
2386 O OG  . SER B 28  ? 0.5486 0.7226 0.5058 0.0446  0.0690  0.0170  28  SER B OG  
2387 N N   . ALA B 29  ? 0.4926 0.6320 0.4159 0.0267  0.0671  0.0310  29  ALA B N   
2388 C CA  . ALA B 29  ? 0.5063 0.6502 0.4099 0.0228  0.0776  0.0371  29  ALA B CA  
2389 C C   . ALA B 29  ? 0.5003 0.6458 0.3849 0.0374  0.0871  0.0250  29  ALA B C   
2390 O O   . ALA B 29  ? 0.4877 0.6125 0.3623 0.0472  0.0815  0.0153  29  ALA B O   
2391 C CB  . ALA B 29  ? 0.5053 0.6231 0.3934 0.0146  0.0688  0.0449  29  ALA B CB  
2392 N N   . THR B 30  ? 0.5204 0.6920 0.4006 0.0374  0.1005  0.0260  30  THR B N   
2393 C CA  . THR B 30  ? 0.5345 0.7111 0.3954 0.0505  0.1101  0.0135  30  THR B CA  
2394 C C   . THR B 30  ? 0.5189 0.6613 0.3533 0.0572  0.1040  0.0046  30  THR B C   
2395 O O   . THR B 30  ? 0.5199 0.6527 0.3480 0.0716  0.1037  -0.0098 30  THR B O   
2396 C CB  . THR B 30  ? 0.5929 0.8000 0.4439 0.0409  0.1231  0.0224  30  THR B CB  
2397 O OG1 . THR B 30  ? 0.5874 0.8372 0.4638 0.0385  0.1323  0.0263  30  THR B OG1 
2398 C CG2 . THR B 30  ? 0.5900 0.7965 0.4078 0.0498  0.1311  0.0109  30  THR B CG2 
2399 N N   . TRP B 31  ? 0.4937 0.6189 0.3134 0.0463  0.0983  0.0137  31  TRP B N   
2400 C CA  . TRP B 31  ? 0.4760 0.5762 0.2695 0.0487  0.0935  0.0081  31  TRP B CA  
2401 C C   . TRP B 31  ? 0.4336 0.5084 0.2306 0.0498  0.0805  0.0063  31  TRP B C   
2402 O O   . TRP B 31  ? 0.4113 0.4680 0.1911 0.0503  0.0751  0.0025  31  TRP B O   
2403 C CB  . TRP B 31  ? 0.4876 0.5896 0.2634 0.0371  0.0944  0.0195  31  TRP B CB  
2404 C CG  . TRP B 31  ? 0.4803 0.5828 0.2719 0.0240  0.0878  0.0368  31  TRP B CG  
2405 C CD1 . TRP B 31  ? 0.5020 0.6267 0.3061 0.0131  0.0929  0.0506  31  TRP B CD1 
2406 C CD2 . TRP B 31  ? 0.4249 0.5047 0.2240 0.0213  0.0735  0.0404  31  TRP B CD2 
2407 N NE1 . TRP B 31  ? 0.4885 0.5986 0.3063 0.0029  0.0803  0.0633  31  TRP B NE1 
2408 C CE2 . TRP B 31  ? 0.4967 0.5797 0.3118 0.0098  0.0685  0.0553  31  TRP B CE2 
2409 C CE3 . TRP B 31  ? 0.3403 0.4003 0.1346 0.0271  0.0640  0.0325  31  TRP B CE3 
2410 C CZ2 . TRP B 31  ? 0.4696 0.5316 0.2955 0.0074  0.0527  0.0589  31  TRP B CZ2 
2411 C CZ3 . TRP B 31  ? 0.3867 0.4346 0.1911 0.0249  0.0515  0.0362  31  TRP B CZ3 
2412 C CH2 . TRP B 31  ? 0.4012 0.4480 0.2215 0.0168  0.0452  0.0475  31  TRP B CH2 
2413 N N   . CYS B 32  ? 0.4236 0.5016 0.2432 0.0493  0.0755  0.0090  32  CYS B N   
2414 C CA  . CYS B 32  ? 0.4170 0.4802 0.2407 0.0501  0.0642  0.0075  32  CYS B CA  
2415 C C   . CYS B 32  ? 0.4265 0.4822 0.2498 0.0593  0.0613  -0.0008 32  CYS B C   
2416 O O   . CYS B 32  ? 0.4370 0.5020 0.2760 0.0654  0.0620  -0.0033 32  CYS B O   
2417 C CB  . CYS B 32  ? 0.4130 0.4832 0.2588 0.0454  0.0586  0.0127  32  CYS B CB  
2418 S SG  . CYS B 32  ? 0.4334 0.4939 0.2848 0.0478  0.0447  0.0079  32  CYS B SG  
2419 N N   . GLY B 33  ? 0.4382 0.4773 0.2444 0.0592  0.0562  -0.0032 33  GLY B N   
2420 C CA  . GLY B 33  ? 0.4514 0.4784 0.2547 0.0642  0.0501  -0.0069 33  GLY B CA  
2421 C C   . GLY B 33  ? 0.4465 0.4822 0.2674 0.0666  0.0448  -0.0049 33  GLY B C   
2422 O O   . GLY B 33  ? 0.4745 0.5115 0.3048 0.0747  0.0444  -0.0075 33  GLY B O   
2423 N N   . PRO B 34  ? 0.4162 0.4595 0.2423 0.0612  0.0399  -0.0018 34  PRO B N   
2424 C CA  . PRO B 34  ? 0.4025 0.4561 0.2424 0.0635  0.0337  -0.0017 34  PRO B CA  
2425 C C   . PRO B 34  ? 0.3996 0.4659 0.2606 0.0675  0.0361  -0.0030 34  PRO B C   
2426 O O   . PRO B 34  ? 0.4115 0.4850 0.2823 0.0714  0.0305  -0.0036 34  PRO B O   
2427 C CB  . PRO B 34  ? 0.3844 0.4454 0.2244 0.0590  0.0283  -0.0025 34  PRO B CB  
2428 C CG  . PRO B 34  ? 0.3814 0.4340 0.2059 0.0544  0.0304  -0.0010 34  PRO B CG  
2429 C CD  . PRO B 34  ? 0.3973 0.4408 0.2164 0.0548  0.0383  0.0000  34  PRO B CD  
2430 N N   . ALA B 35  ? 0.3919 0.4646 0.2602 0.0654  0.0436  -0.0020 35  ALA B N   
2431 C CA  . ALA B 35  ? 0.3877 0.4784 0.2791 0.0667  0.0452  -0.0017 35  ALA B CA  
2432 C C   . ALA B 35  ? 0.4089 0.5059 0.3039 0.0768  0.0509  -0.0052 35  ALA B C   
2433 O O   . ALA B 35  ? 0.4216 0.5344 0.3361 0.0820  0.0493  -0.0065 35  ALA B O   
2434 C CB  . ALA B 35  ? 0.3964 0.4956 0.2967 0.0576  0.0494  0.0035  35  ALA B CB  
2435 N N   . LYS B 36  ? 0.4193 0.5043 0.2963 0.0808  0.0563  -0.0083 36  LYS B N   
2436 C CA  . LYS B 36  ? 0.4518 0.5367 0.3294 0.0940  0.0591  -0.0156 36  LYS B CA  
2437 C C   . LYS B 36  ? 0.4609 0.5316 0.3399 0.1014  0.0473  -0.0161 36  LYS B C   
2438 O O   . LYS B 36  ? 0.4772 0.5559 0.3707 0.1133  0.0454  -0.0200 36  LYS B O   
2439 C CB  . LYS B 36  ? 0.4755 0.5457 0.3304 0.0963  0.0645  -0.0213 36  LYS B CB  
2440 C CG  . LYS B 36  ? 0.5133 0.6068 0.3686 0.0945  0.0781  -0.0225 36  LYS B CG  
2441 C CD  . LYS B 36  ? 0.5871 0.6697 0.4182 0.0991  0.0830  -0.0314 36  LYS B CD  
2442 C CE  . LYS B 36  ? 0.5622 0.6252 0.3709 0.0863  0.0793  -0.0254 36  LYS B CE  
2443 N NZ  . LYS B 36  ? 0.6166 0.6782 0.4028 0.0886  0.0856  -0.0333 36  LYS B NZ  
2444 N N   . MET B 37  ? 0.4557 0.5082 0.3198 0.0943  0.0388  -0.0111 37  MET B N   
2445 C CA  . MET B 37  ? 0.4881 0.5303 0.3517 0.0976  0.0267  -0.0072 37  MET B CA  
2446 C C   . MET B 37  ? 0.4871 0.5507 0.3719 0.1003  0.0219  -0.0051 37  MET B C   
2447 O O   . MET B 37  ? 0.5255 0.5858 0.4153 0.1077  0.0128  -0.0028 37  MET B O   
2448 C CB  . MET B 37  ? 0.4801 0.5080 0.3239 0.0864  0.0202  -0.0005 37  MET B CB  
2449 C CG  . MET B 37  ? 0.5262 0.5506 0.3670 0.0845  0.0075  0.0081  37  MET B CG  
2450 S SD  . MET B 37  ? 0.6214 0.6753 0.4727 0.0806  0.0026  0.0112  37  MET B SD  
2451 C CE  . MET B 37  ? 0.4871 0.5487 0.3223 0.0679  0.0043  0.0126  37  MET B CE  
2452 N N   . ILE B 38  ? 0.4648 0.5487 0.3625 0.0942  0.0258  -0.0057 38  ILE B N   
2453 C CA  . ILE B 38  ? 0.4559 0.5574 0.3702 0.0943  0.0181  -0.0046 38  ILE B CA  
2454 C C   . ILE B 38  ? 0.4859 0.6093 0.4266 0.1015  0.0216  -0.0077 38  ILE B C   
2455 O O   . ILE B 38  ? 0.4905 0.6277 0.4465 0.1059  0.0130  -0.0072 38  ILE B O   
2456 C CB  . ILE B 38  ? 0.4295 0.5380 0.3442 0.0838  0.0162  -0.0054 38  ILE B CB  
2457 C CG1 . ILE B 38  ? 0.4244 0.5479 0.3495 0.0841  0.0051  -0.0067 38  ILE B CG1 
2458 C CG2 . ILE B 38  ? 0.4167 0.5338 0.3448 0.0782  0.0240  -0.0065 38  ILE B CG2 
2459 C CD1 . ILE B 38  ? 0.4103 0.5315 0.3173 0.0829  -0.0033 -0.0046 38  ILE B CD1 
2460 N N   . LYS B 39  ? 0.4972 0.6286 0.4431 0.1021  0.0339  -0.0103 39  LYS B N   
2461 C CA  . LYS B 39  ? 0.5199 0.6802 0.4912 0.1098  0.0401  -0.0137 39  LYS B CA  
2462 C C   . LYS B 39  ? 0.5386 0.7030 0.5218 0.1258  0.0315  -0.0167 39  LYS B C   
2463 O O   . LYS B 39  ? 0.5571 0.7466 0.5647 0.1273  0.0269  -0.0161 39  LYS B O   
2464 C CB  . LYS B 39  ? 0.5391 0.7064 0.5056 0.1138  0.0547  -0.0181 39  LYS B CB  
2465 C CG  . LYS B 39  ? 0.5784 0.7662 0.5511 0.0991  0.0653  -0.0127 39  LYS B CG  
2466 C CD  . LYS B 39  ? 0.6656 0.8868 0.6481 0.1051  0.0807  -0.0168 39  LYS B CD  
2467 C CE  . LYS B 39  ? 0.7310 0.9459 0.7045 0.1277  0.0833  -0.0309 39  LYS B CE  
2468 N NZ  . LYS B 39  ? 0.7141 0.8886 0.6547 0.1313  0.0809  -0.0359 39  LYS B NZ  
2469 N N   . PRO B 40  ? 0.5527 0.6909 0.5200 0.1375  0.0271  -0.0194 40  PRO B N   
2470 C CA  . PRO B 40  ? 0.5761 0.7172 0.5580 0.1532  0.0153  -0.0204 40  PRO B CA  
2471 C C   . PRO B 40  ? 0.5583 0.7087 0.5484 0.1470  0.0023  -0.0125 40  PRO B C   
2472 O O   . PRO B 40  ? 0.5629 0.7388 0.5781 0.1549  -0.0026 -0.0137 40  PRO B O   
2473 C CB  . PRO B 40  ? 0.6012 0.7018 0.5608 0.1620  0.0070  -0.0209 40  PRO B CB  
2474 C CG  . PRO B 40  ? 0.5986 0.6836 0.5363 0.1539  0.0182  -0.0246 40  PRO B CG  
2475 C CD  . PRO B 40  ? 0.5451 0.6509 0.4846 0.1373  0.0290  -0.0212 40  PRO B CD  
2476 N N   . PHE B 41  ? 0.5268 0.6614 0.4965 0.1337  -0.0031 -0.0059 41  PHE B N   
2477 C CA  . PHE B 41  ? 0.5218 0.6662 0.4941 0.1295  -0.0162 -0.0004 41  PHE B CA  
2478 C C   . PHE B 41  ? 0.5046 0.6808 0.5015 0.1237  -0.0145 -0.0045 41  PHE B C   
2479 O O   . PHE B 41  ? 0.5245 0.7189 0.5357 0.1259  -0.0256 -0.0036 41  PHE B O   
2480 C CB  . PHE B 41  ? 0.5159 0.6441 0.4606 0.1179  -0.0213 0.0058  41  PHE B CB  
2481 C CG  . PHE B 41  ? 0.5654 0.6627 0.4873 0.1195  -0.0248 0.0127  41  PHE B CG  
2482 C CD1 . PHE B 41  ? 0.5644 0.6433 0.4693 0.1130  -0.0156 0.0110  41  PHE B CD1 
2483 C CD2 . PHE B 41  ? 0.5986 0.6833 0.5171 0.1268  -0.0392 0.0217  41  PHE B CD2 
2484 C CE1 . PHE B 41  ? 0.6135 0.6622 0.4991 0.1126  -0.0209 0.0172  41  PHE B CE1 
2485 C CE2 . PHE B 41  ? 0.6166 0.6679 0.5154 0.1260  -0.0455 0.0297  41  PHE B CE2 
2486 C CZ  . PHE B 41  ? 0.6386 0.6717 0.5214 0.1184  -0.0364 0.0269  41  PHE B CZ  
2487 N N   . PHE B 42  ? 0.4719 0.6542 0.4738 0.1152  -0.0022 -0.0080 42  PHE B N   
2488 C CA  . PHE B 42  ? 0.4632 0.6725 0.4903 0.1071  -0.0012 -0.0100 42  PHE B CA  
2489 C C   . PHE B 42  ? 0.5056 0.7455 0.5630 0.1174  -0.0008 -0.0115 42  PHE B C   
2490 O O   . PHE B 42  ? 0.5078 0.7731 0.5888 0.1132  -0.0085 -0.0118 42  PHE B O   
2491 C CB  . PHE B 42  ? 0.4481 0.6547 0.4729 0.0948  0.0107  -0.0096 42  PHE B CB  
2492 C CG  . PHE B 42  ? 0.4356 0.6620 0.4837 0.0811  0.0079  -0.0088 42  PHE B CG  
2493 C CD1 . PHE B 42  ? 0.4218 0.6435 0.4702 0.0738  -0.0057 -0.0118 42  PHE B CD1 
2494 C CD2 . PHE B 42  ? 0.4643 0.7157 0.5341 0.0751  0.0178  -0.0053 42  PHE B CD2 
2495 C CE1 . PHE B 42  ? 0.4474 0.6815 0.5180 0.0603  -0.0118 -0.0120 42  PHE B CE1 
2496 C CE2 . PHE B 42  ? 0.4972 0.7647 0.5898 0.0586  0.0131  -0.0017 42  PHE B CE2 
2497 C CZ  . PHE B 42  ? 0.4914 0.7466 0.5849 0.0513  -0.0031 -0.0054 42  PHE B CZ  
2498 N N   . HIS B 43  ? 0.5405 0.7795 0.5982 0.1320  0.0068  -0.0142 43  HIS B N   
2499 C CA  . HIS B 43  ? 0.5851 0.8582 0.6737 0.1465  0.0079  -0.0184 43  HIS B CA  
2500 C C   . HIS B 43  ? 0.6020 0.8800 0.7019 0.1579  -0.0101 -0.0168 43  HIS B C   
2501 O O   . HIS B 43  ? 0.6188 0.9332 0.7490 0.1586  -0.0146 -0.0174 43  HIS B O   
2502 C CB  . HIS B 43  ? 0.6184 0.8912 0.7047 0.1631  0.0198  -0.0260 43  HIS B CB  
2503 C CG  . HIS B 43  ? 0.6992 1.0188 0.8205 0.1775  0.0251  -0.0329 43  HIS B CG  
2504 N ND1 . HIS B 43  ? 0.7576 1.0868 0.8974 0.1984  0.0127  -0.0369 43  HIS B ND1 
2505 C CD2 . HIS B 43  ? 0.7243 1.0880 0.8664 0.1740  0.0412  -0.0359 43  HIS B CD2 
2506 C CE1 . HIS B 43  ? 0.7857 1.1653 0.9583 0.2086  0.0214  -0.0440 43  HIS B CE1 
2507 N NE2 . HIS B 43  ? 0.7824 1.1857 0.9565 0.1931  0.0396  -0.0431 43  HIS B NE2 
2508 N N   . SER B 44  ? 0.6036 0.8475 0.6799 0.1654  -0.0214 -0.0130 44  SER B N   
2509 C CA  . SER B 44  ? 0.6332 0.8799 0.7166 0.1752  -0.0402 -0.0083 44  SER B CA  
2510 C C   . SER B 44  ? 0.6277 0.8967 0.7197 0.1612  -0.0495 -0.0055 44  SER B C   
2511 O O   . SER B 44  ? 0.6402 0.9389 0.7584 0.1670  -0.0589 -0.0061 44  SER B O   
2512 C CB  . SER B 44  ? 0.6414 0.8461 0.6941 0.1794  -0.0515 -0.0003 44  SER B CB  
2513 O OG  . SER B 44  ? 0.6358 0.8115 0.6691 0.1801  -0.0412 -0.0032 44  SER B OG  
2514 N N   . LEU B 45  ? 0.6056 0.8617 0.6769 0.1439  -0.0476 -0.0046 45  LEU B N   
2515 C CA  . LEU B 45  ? 0.6029 0.8779 0.6817 0.1318  -0.0571 -0.0064 45  LEU B CA  
2516 C C   . LEU B 45  ? 0.6157 0.9280 0.7330 0.1285  -0.0554 -0.0108 45  LEU B C   
2517 O O   . LEU B 45  ? 0.6414 0.9748 0.7733 0.1248  -0.0688 -0.0122 45  LEU B O   
2518 C CB  . LEU B 45  ? 0.5738 0.8319 0.6298 0.1161  -0.0536 -0.0092 45  LEU B CB  
2519 C CG  . LEU B 45  ? 0.5827 0.8144 0.6014 0.1153  -0.0568 -0.0047 45  LEU B CG  
2520 C CD1 . LEU B 45  ? 0.5471 0.7661 0.5464 0.1032  -0.0511 -0.0098 45  LEU B CD1 
2521 C CD2 . LEU B 45  ? 0.6145 0.8548 0.6237 0.1189  -0.0739 0.0004  45  LEU B CD2 
2522 N N   . SER B 46  ? 0.6104 0.9349 0.7443 0.1287  -0.0398 -0.0125 46  SER B N   
2523 C CA  . SER B 46  ? 0.6229 0.9906 0.7960 0.1234  -0.0376 -0.0140 46  SER B CA  
2524 C C   . SER B 46  ? 0.6630 1.0617 0.8631 0.1413  -0.0464 -0.0148 46  SER B C   
2525 O O   . SER B 46  ? 0.6736 1.1112 0.9065 0.1360  -0.0525 -0.0155 46  SER B O   
2526 C CB  . SER B 46  ? 0.6168 0.9965 0.7990 0.1164  -0.0177 -0.0136 46  SER B CB  
2527 O OG  . SER B 46  ? 0.6213 1.0062 0.8040 0.1357  -0.0064 -0.0167 46  SER B OG  
2528 N N   . GLU B 47  ? 0.6885 1.0688 0.8760 0.1623  -0.0488 -0.0146 47  GLU B N   
2529 C CA  . GLU B 47  ? 0.7459 1.1475 0.9558 0.1829  -0.0617 -0.0150 47  GLU B CA  
2530 C C   . GLU B 47  ? 0.7544 1.1563 0.9599 0.1779  -0.0835 -0.0098 47  GLU B C   
2531 O O   . GLU B 47  ? 0.7832 1.2232 1.0193 0.1787  -0.0934 -0.0109 47  GLU B O   
2532 C CB  . GLU B 47  ? 0.7755 1.1496 0.9727 0.2076  -0.0626 -0.0162 47  GLU B CB  
2533 C CG  . GLU B 47  ? 0.8055 1.1717 0.9972 0.2138  -0.0421 -0.0240 47  GLU B CG  
2534 C CD  . GLU B 47  ? 0.9031 1.3221 1.1335 0.2264  -0.0295 -0.0340 47  GLU B CD  
2535 O OE1 . GLU B 47  ? 0.9828 1.3984 1.2173 0.2520  -0.0278 -0.0433 47  GLU B OE1 
2536 O OE2 . GLU B 47  ? 0.8776 1.3420 1.1343 0.2109  -0.0217 -0.0331 47  GLU B OE2 
2537 N N   . LYS B 48  ? 0.7423 1.1070 0.9102 0.1718  -0.0908 -0.0045 48  LYS B N   
2538 C CA  . LYS B 48  ? 0.7539 1.1240 0.9128 0.1644  -0.1099 -0.0012 48  LYS B CA  
2539 C C   . LYS B 48  ? 0.7559 1.1574 0.9364 0.1474  -0.1136 -0.0082 48  LYS B C   
2540 O O   . LYS B 48  ? 0.7824 1.2141 0.9851 0.1498  -0.1286 -0.0087 48  LYS B O   
2541 C CB  . LYS B 48  ? 0.7329 1.0671 0.8474 0.1567  -0.1128 0.0042  48  LYS B CB  
2542 C CG  . LYS B 48  ? 0.7565 1.0759 0.8505 0.1670  -0.1297 0.0165  48  LYS B CG  
2543 C CD  . LYS B 48  ? 0.7440 1.0570 0.8029 0.1526  -0.1372 0.0196  48  LYS B CD  
2544 C CE  . LYS B 48  ? 0.7494 1.0533 0.7842 0.1578  -0.1551 0.0360  48  LYS B CE  
2545 N NZ  . LYS B 48  ? 0.7841 1.1195 0.8323 0.1619  -0.1752 0.0379  48  LYS B NZ  
2546 N N   . TYR B 49  ? 0.7394 1.1321 0.9148 0.1302  -0.1021 -0.0135 49  TYR B N   
2547 C CA  . TYR B 49  ? 0.7522 1.1610 0.9406 0.1119  -0.1104 -0.0205 49  TYR B CA  
2548 C C   . TYR B 49  ? 0.7619 1.2044 0.9924 0.1019  -0.1044 -0.0218 49  TYR B C   
2549 O O   . TYR B 49  ? 0.7535 1.1899 0.9883 0.0850  -0.0964 -0.0234 49  TYR B O   
2550 C CB  . TYR B 49  ? 0.7291 1.1060 0.8860 0.0991  -0.1081 -0.0259 49  TYR B CB  
2551 C CG  . TYR B 49  ? 0.7533 1.1095 0.8708 0.1060  -0.1154 -0.0243 49  TYR B CG  
2552 C CD1 . TYR B 49  ? 0.7891 1.1582 0.8971 0.1053  -0.1344 -0.0284 49  TYR B CD1 
2553 C CD2 . TYR B 49  ? 0.7744 1.1017 0.8638 0.1116  -0.1039 -0.0179 49  TYR B CD2 
2554 C CE1 . TYR B 49  ? 0.7930 1.1508 0.8638 0.1097  -0.1402 -0.0245 49  TYR B CE1 
2555 C CE2 . TYR B 49  ? 0.7945 1.1080 0.8488 0.1148  -0.1106 -0.0131 49  TYR B CE2 
2556 C CZ  . TYR B 49  ? 0.8263 1.1573 0.8713 0.1135  -0.1281 -0.0156 49  TYR B CZ  
2557 O OH  . TYR B 49  ? 0.8466 1.1708 0.8557 0.1144  -0.1336 -0.0088 49  TYR B OH  
2558 N N   . SER B 50  ? 0.7946 1.2751 1.0576 0.1119  -0.1093 -0.0198 50  SER B N   
2559 C CA  . SER B 50  ? 0.8225 1.3449 1.1283 0.1026  -0.1015 -0.0190 50  SER B CA  
2560 C C   . SER B 50  ? 0.8448 1.3879 1.1734 0.0807  -0.1170 -0.0223 50  SER B C   
2561 O O   . SER B 50  ? 0.8587 1.4398 1.2255 0.0670  -0.1142 -0.0196 50  SER B O   
2562 C CB  . SER B 50  ? 0.8472 1.4075 1.1818 0.1244  -0.0991 -0.0174 50  SER B CB  
2563 O OG  . SER B 50  ? 0.8825 1.4294 1.2015 0.1437  -0.1153 -0.0165 50  SER B OG  
2564 N N   . ASN B 51  ? 0.8506 1.3693 1.1545 0.0764  -0.1339 -0.0284 51  ASN B N   
2565 C CA  . ASN B 51  ? 0.8864 1.4098 1.2026 0.0550  -0.1498 -0.0355 51  ASN B CA  
2566 C C   . ASN B 51  ? 0.8647 1.3538 1.1675 0.0370  -0.1417 -0.0374 51  ASN B C   
2567 O O   . ASN B 51  ? 0.8840 1.3678 1.1975 0.0173  -0.1548 -0.0434 51  ASN B O   
2568 C CB  . ASN B 51  ? 0.9179 1.4335 1.2117 0.0604  -0.1723 -0.0444 51  ASN B CB  
2569 C CG  . ASN B 51  ? 0.9243 1.4005 1.1674 0.0731  -0.1680 -0.0455 51  ASN B CG  
2570 O OD1 . ASN B 51  ? 0.9121 1.3757 1.1402 0.0877  -0.1539 -0.0366 51  ASN B OD1 
2571 N ND2 . ASN B 51  ? 0.9486 1.4082 1.1659 0.0674  -0.1818 -0.0575 51  ASN B ND2 
2572 N N   . VAL B 52  ? 0.8340 1.2983 1.1141 0.0446  -0.1217 -0.0321 52  VAL B N   
2573 C CA  . VAL B 52  ? 0.8100 1.2375 1.0710 0.0325  -0.1122 -0.0322 52  VAL B CA  
2574 C C   . VAL B 52  ? 0.8001 1.2383 1.0740 0.0288  -0.0897 -0.0206 52  VAL B C   
2575 O O   . VAL B 52  ? 0.7852 1.2437 1.0640 0.0450  -0.0768 -0.0160 52  VAL B O   
2576 C CB  . VAL B 52  ? 0.7770 1.1651 0.9921 0.0457  -0.1087 -0.0369 52  VAL B CB  
2577 C CG1 . VAL B 52  ? 0.7541 1.1066 0.9520 0.0341  -0.1043 -0.0397 52  VAL B CG1 
2578 C CG2 . VAL B 52  ? 0.7946 1.1828 0.9922 0.0542  -0.1274 -0.0462 52  VAL B CG2 
2579 N N   . ILE B 53  ? 0.8108 1.2342 1.0885 0.0083  -0.0866 -0.0164 53  ILE B N   
2580 C CA  . ILE B 53  ? 0.8147 1.2498 1.1010 0.0011  -0.0657 -0.0039 53  ILE B CA  
2581 C C   . ILE B 53  ? 0.7859 1.1794 1.0346 0.0069  -0.0535 -0.0035 53  ILE B C   
2582 O O   . ILE B 53  ? 0.7794 1.1344 1.0090 -0.0006 -0.0625 -0.0079 53  ILE B O   
2583 C CB  . ILE B 53  ? 0.8513 1.3001 1.1674 -0.0292 -0.0700 0.0064  53  ILE B CB  
2584 C CG1 . ILE B 53  ? 0.8940 1.3923 1.2534 -0.0386 -0.0818 0.0076  53  ILE B CG1 
2585 C CG2 . ILE B 53  ? 0.8359 1.2959 1.1526 -0.0373 -0.0475 0.0210  53  ILE B CG2 
2586 C CD1 . ILE B 53  ? 0.8889 1.4355 1.2648 -0.0159 -0.0732 0.0060  53  ILE B CD1 
2587 N N   . PHE B 54  ? 0.7737 1.1759 1.0129 0.0215  -0.0344 0.0002  54  PHE B N   
2588 C CA  . PHE B 54  ? 0.7513 1.1186 0.9566 0.0260  -0.0217 0.0016  54  PHE B CA  
2589 C C   . PHE B 54  ? 0.7569 1.1398 0.9709 0.0127  -0.0053 0.0134  54  PHE B C   
2590 O O   . PHE B 54  ? 0.7830 1.2119 1.0241 0.0106  0.0042  0.0190  54  PHE B O   
2591 C CB  . PHE B 54  ? 0.7363 1.0969 0.9206 0.0509  -0.0134 -0.0032 54  PHE B CB  
2592 C CG  . PHE B 54  ? 0.7474 1.0968 0.9209 0.0637  -0.0285 -0.0106 54  PHE B CG  
2593 C CD1 . PHE B 54  ? 0.7898 1.1683 0.9888 0.0656  -0.0419 -0.0130 54  PHE B CD1 
2594 C CD2 . PHE B 54  ? 0.7397 1.0530 0.8770 0.0729  -0.0296 -0.0138 54  PHE B CD2 
2595 C CE1 . PHE B 54  ? 0.8049 1.1754 0.9910 0.0770  -0.0568 -0.0180 54  PHE B CE1 
2596 C CE2 . PHE B 54  ? 0.7507 1.0578 0.8755 0.0828  -0.0434 -0.0177 54  PHE B CE2 
2597 C CZ  . PHE B 54  ? 0.7867 1.1219 0.9348 0.0850  -0.0572 -0.0195 54  PHE B CZ  
2598 N N   . LEU B 55  ? 0.7379 1.0861 0.9281 0.0044  -0.0018 0.0173  55  LEU B N   
2599 C CA  . LEU B 55  ? 0.7452 1.1041 0.9354 -0.0081 0.0136  0.0302  55  LEU B CA  
2600 C C   . LEU B 55  ? 0.7155 1.0363 0.8673 -0.0002 0.0221  0.0290  55  LEU B C   
2601 O O   . LEU B 55  ? 0.6945 0.9773 0.8238 0.0075  0.0125  0.0203  55  LEU B O   
2602 C CB  . LEU B 55  ? 0.7798 1.1380 0.9900 -0.0372 0.0031  0.0428  55  LEU B CB  
2603 C CG  . LEU B 55  ? 0.8028 1.1892 1.0514 -0.0519 -0.0117 0.0446  55  LEU B CG  
2604 C CD1 . LEU B 55  ? 0.8115 1.1694 1.0687 -0.0796 -0.0296 0.0538  55  LEU B CD1 
2605 C CD2 . LEU B 55  ? 0.8114 1.2641 1.0924 -0.0556 0.0025  0.0533  55  LEU B CD2 
2606 N N   . GLU B 56  ? 0.7127 1.0498 0.8578 -0.0021 0.0401  0.0371  56  GLU B N   
2607 C CA  . GLU B 56  ? 0.6894 0.9967 0.8010 0.0006  0.0483  0.0387  56  GLU B CA  
2608 C C   . GLU B 56  ? 0.7116 1.0208 0.8246 -0.0229 0.0514  0.0563  56  GLU B C   
2609 O O   . GLU B 56  ? 0.7520 1.1008 0.8885 -0.0377 0.0574  0.0682  56  GLU B O   
2610 C CB  . GLU B 56  ? 0.6907 1.0145 0.7885 0.0197  0.0659  0.0320  56  GLU B CB  
2611 C CG  . GLU B 56  ? 0.6859 0.9730 0.7456 0.0260  0.0709  0.0296  56  GLU B CG  
2612 C CD  . GLU B 56  ? 0.7153 0.9978 0.7594 0.0502  0.0771  0.0158  56  GLU B CD  
2613 O OE1 . GLU B 56  ? 0.7971 1.1119 0.8607 0.0619  0.0817  0.0099  56  GLU B OE1 
2614 O OE2 . GLU B 56  ? 0.6779 0.9257 0.6932 0.0575  0.0758  0.0108  56  GLU B OE2 
2615 N N   . VAL B 57  ? 0.6936 0.9619 0.7816 -0.0267 0.0465  0.0592  57  VAL B N   
2616 C CA  . VAL B 57  ? 0.7059 0.9696 0.7863 -0.0459 0.0497  0.0774  57  VAL B CA  
2617 C C   . VAL B 57  ? 0.6811 0.9195 0.7252 -0.0353 0.0572  0.0745  57  VAL B C   
2618 O O   . VAL B 57  ? 0.6325 0.8341 0.6592 -0.0241 0.0482  0.0637  57  VAL B O   
2619 C CB  . VAL B 57  ? 0.7317 0.9618 0.8216 -0.0644 0.0281  0.0859  57  VAL B CB  
2620 C CG1 . VAL B 57  ? 0.7644 0.9867 0.8451 -0.0848 0.0295  0.1085  57  VAL B CG1 
2621 C CG2 . VAL B 57  ? 0.7445 0.9931 0.8706 -0.0767 0.0159  0.0871  57  VAL B CG2 
2622 N N   . ASP B 58  ? 0.7058 0.9687 0.7389 -0.0398 0.0736  0.0843  58  ASP B N   
2623 C CA  . ASP B 58  ? 0.6968 0.9388 0.6962 -0.0337 0.0795  0.0838  58  ASP B CA  
2624 C C   . ASP B 58  ? 0.7297 0.9434 0.7215 -0.0528 0.0677  0.1019  58  ASP B C   
2625 O O   . ASP B 58  ? 0.7753 1.0087 0.7747 -0.0737 0.0702  0.1227  58  ASP B O   
2626 C CB  . ASP B 58  ? 0.7060 0.9870 0.6939 -0.0281 0.1008  0.0834  58  ASP B CB  
2627 C CG  . ASP B 58  ? 0.7144 0.9729 0.6664 -0.0184 0.1055  0.0778  58  ASP B CG  
2628 O OD1 . ASP B 58  ? 0.7730 1.0096 0.7093 -0.0307 0.0995  0.0909  58  ASP B OD1 
2629 O OD2 . ASP B 58  ? 0.7095 0.9703 0.6490 0.0015  0.1134  0.0603  58  ASP B OD2 
2630 N N   . VAL B 59  ? 0.7068 0.8762 0.6840 -0.0451 0.0543  0.0943  59  VAL B N   
2631 C CA  . VAL B 59  ? 0.7347 0.8700 0.7054 -0.0574 0.0391  0.1074  59  VAL B CA  
2632 C C   . VAL B 59  ? 0.7845 0.9300 0.7369 -0.0703 0.0476  0.1274  59  VAL B C   
2633 O O   . VAL B 59  ? 0.8208 0.9482 0.7748 -0.0878 0.0351  0.1471  59  VAL B O   
2634 C CB  . VAL B 59  ? 0.6962 0.7921 0.6505 -0.0409 0.0275  0.0917  59  VAL B CB  
2635 C CG1 . VAL B 59  ? 0.6504 0.7370 0.6203 -0.0306 0.0167  0.0741  59  VAL B CG1 
2636 C CG2 . VAL B 59  ? 0.6569 0.7570 0.5832 -0.0260 0.0412  0.0823  59  VAL B CG2 
2637 N N   . ASP B 60  ? 0.7914 0.9636 0.7247 -0.0609 0.0670  0.1219  60  ASP B N   
2638 C CA  . ASP B 60  ? 0.8526 1.0431 0.7656 -0.0723 0.0772  0.1391  60  ASP B CA  
2639 C C   . ASP B 60  ? 0.9098 1.1486 0.8401 -0.0920 0.0881  0.1578  60  ASP B C   
2640 O O   . ASP B 60  ? 0.9641 1.2164 0.8840 -0.1109 0.0906  0.1812  60  ASP B O   
2641 C CB  . ASP B 60  ? 0.8339 1.0326 0.7175 -0.0539 0.0918  0.1231  60  ASP B CB  
2642 C CG  . ASP B 60  ? 0.8140 0.9691 0.6768 -0.0427 0.0801  0.1138  60  ASP B CG  
2643 O OD1 . ASP B 60  ? 0.7863 0.9350 0.6378 -0.0246 0.0845  0.0936  60  ASP B OD1 
2644 O OD2 . ASP B 60  ? 0.8427 0.9706 0.7020 -0.0523 0.0654  0.1274  60  ASP B OD2 
2645 N N   . ASP B 61  ? 0.9093 1.1776 0.8662 -0.0885 0.0942  0.1489  61  ASP B N   
2646 C CA  . ASP B 61  ? 0.9749 1.3000 0.9510 -0.1061 0.1068  0.1649  61  ASP B CA  
2647 C C   . ASP B 61  ? 1.0182 1.3326 1.0202 -0.1337 0.0895  0.1881  61  ASP B C   
2648 O O   . ASP B 61  ? 1.0872 1.4361 1.0971 -0.1590 0.0944  0.2137  61  ASP B O   
2649 C CB  . ASP B 61  ? 0.9604 1.3274 0.9579 -0.0904 0.1196  0.1460  61  ASP B CB  
2650 C CG  . ASP B 61  ? 0.9784 1.3766 0.9547 -0.0690 0.1406  0.1287  61  ASP B CG  
2651 O OD1 . ASP B 61  ? 1.0071 1.4100 0.9538 -0.0725 0.1488  0.1358  61  ASP B OD1 
2652 O OD2 . ASP B 61  ? 0.9704 1.3867 0.9598 -0.0480 0.1470  0.1074  61  ASP B OD2 
2653 N N   . CYS B 62  ? 0.9929 1.2608 1.0081 -0.1295 0.0685  0.1788  62  CYS B N   
2654 C CA  . CYS B 62  ? 1.0359 1.2842 1.0771 -0.1535 0.0474  0.1960  62  CYS B CA  
2655 C C   . CYS B 62  ? 1.0341 1.2170 1.0618 -0.1519 0.0245  0.1967  62  CYS B C   
2656 O O   . CYS B 62  ? 1.0238 1.1700 1.0661 -0.1468 0.0045  0.1842  62  CYS B O   
2657 C CB  . CYS B 62  ? 1.0128 1.2685 1.0855 -0.1478 0.0406  0.1798  62  CYS B CB  
2658 S SG  . CYS B 62  ? 1.0447 1.3780 1.1356 -0.1397 0.0666  0.1713  62  CYS B SG  
2659 N N   . GLN B 63  ? 1.0501 1.2202 1.0495 -0.1546 0.0266  0.2097  63  GLN B N   
2660 C CA  . GLN B 63  ? 1.0558 1.1665 1.0441 -0.1523 0.0035  0.2119  63  GLN B CA  
2661 C C   . GLN B 63  ? 1.0951 1.1748 1.1147 -0.1691 -0.0230 0.2195  63  GLN B C   
2662 O O   . GLN B 63  ? 1.0793 1.1148 1.1048 -0.1552 -0.0429 0.2010  63  GLN B O   
2663 C CB  . GLN B 63  ? 1.0951 1.2025 1.0561 -0.1636 0.0053  0.2360  63  GLN B CB  
2664 C CG  . GLN B 63  ? 1.0864 1.1549 1.0201 -0.1426 -0.0021 0.2232  63  GLN B CG  
2665 C CD  . GLN B 63  ? 1.0896 1.1870 0.9917 -0.1259 0.0219  0.2110  63  GLN B CD  
2666 O OE1 . GLN B 63  ? 1.1278 1.2500 1.0093 -0.1369 0.0329  0.2290  63  GLN B OE1 
2667 N NE2 . GLN B 63  ? 1.0199 1.1126 0.9173 -0.1001 0.0279  0.1806  63  GLN B NE2 
2668 N N   . ASP B 64  ? 1.1434 1.2518 1.1848 -0.1979 -0.0226 0.2438  64  ASP B N   
2669 C CA  . ASP B 64  ? 1.1958 1.2741 1.2681 -0.2191 -0.0501 0.2545  64  ASP B CA  
2670 C C   . ASP B 64  ? 1.1523 1.2141 1.2475 -0.2042 -0.0627 0.2245  64  ASP B C   
2671 O O   . ASP B 64  ? 1.1817 1.1906 1.2871 -0.2039 -0.0914 0.2176  64  ASP B O   
2672 C CB  . ASP B 64  ? 1.2753 1.3903 1.3663 -0.2587 -0.0481 0.2920  64  ASP B CB  
2673 C CG  . ASP B 64  ? 1.2651 1.4541 1.3747 -0.2623 -0.0229 0.2884  64  ASP B CG  
2674 O OD1 . ASP B 64  ? 1.2033 1.4249 1.3001 -0.2358 0.0007  0.2650  64  ASP B OD1 
2675 O OD2 . ASP B 64  ? 1.3539 1.5696 1.4930 -0.2924 -0.0281 0.3097  64  ASP B OD2 
2676 N N   . VAL B 65  ? 1.0871 1.1914 1.1889 -0.1896 -0.0436 0.2050  65  VAL B N   
2677 C CA  . VAL B 65  ? 1.0643 1.1538 1.1851 -0.1766 -0.0573 0.1786  65  VAL B CA  
2678 C C   . VAL B 65  ? 1.0196 1.0679 1.1196 -0.1459 -0.0653 0.1502  65  VAL B C   
2679 O O   . VAL B 65  ? 1.0254 1.0377 1.1355 -0.1389 -0.0882 0.1328  65  VAL B O   
2680 C CB  . VAL B 65  ? 1.0309 1.1777 1.1704 -0.1724 -0.0396 0.1686  65  VAL B CB  
2681 C CG1 . VAL B 65  ? 0.9641 1.1298 1.0817 -0.1414 -0.0181 0.1464  65  VAL B CG1 
2682 C CG2 . VAL B 65  ? 1.0430 1.1768 1.2101 -0.1743 -0.0606 0.1540  65  VAL B CG2 
2683 N N   . ALA B 66  ? 0.9775 1.0340 1.0483 -0.1283 -0.0467 0.1452  66  ALA B N   
2684 C CA  . ALA B 66  ? 0.9416 0.9657 0.9911 -0.1026 -0.0521 0.1235  66  ALA B CA  
2685 C C   . ALA B 66  ? 0.9905 0.9610 1.0445 -0.1060 -0.0815 0.1245  66  ALA B C   
2686 O O   . ALA B 66  ? 0.9787 0.9237 1.0342 -0.0882 -0.0962 0.1001  66  ALA B O   
2687 C CB  . ALA B 66  ? 0.9115 0.9474 0.9298 -0.0920 -0.0321 0.1266  66  ALA B CB  
2688 N N   . SER B 67  ? 1.0583 1.0130 1.1151 -0.1288 -0.0912 0.1526  67  SER B N   
2689 C CA  . SER B 67  ? 1.1270 1.0253 1.1894 -0.1312 -0.1225 0.1545  67  SER B CA  
2690 C C   . SER B 67  ? 1.1725 1.0451 1.2648 -0.1404 -0.1488 0.1464  67  SER B C   
2691 O O   . SER B 67  ? 1.1790 1.0134 1.2740 -0.1221 -0.1704 0.1218  67  SER B O   
2692 C CB  . SER B 67  ? 1.1960 1.0780 1.2487 -0.1510 -0.1285 0.1881  67  SER B CB  
2693 O OG  . SER B 67  ? 1.2541 1.0834 1.2995 -0.1363 -0.1525 0.1801  67  SER B OG  
2694 N N   . GLU B 68  ? 1.2061 1.1030 1.3210 -0.1677 -0.1474 0.1649  68  GLU B N   
2695 C CA  . GLU B 68  ? 1.2509 1.1314 1.3960 -0.1776 -0.1708 0.1548  68  GLU B CA  
2696 C C   . GLU B 68  ? 1.2015 1.0779 1.3451 -0.1469 -0.1745 0.1134  68  GLU B C   
2697 O O   . GLU B 68  ? 1.2457 1.0912 1.4068 -0.1463 -0.2013 0.0964  68  GLU B O   
2698 C CB  . GLU B 68  ? 1.2691 1.1974 1.4387 -0.2066 -0.1603 0.1753  68  GLU B CB  
2699 C CG  . GLU B 68  ? 1.3807 1.2848 1.5761 -0.2456 -0.1860 0.2061  68  GLU B CG  
2700 C CD  . GLU B 68  ? 1.4269 1.3145 1.6553 -0.2558 -0.2124 0.1917  68  GLU B CD  
2701 O OE1 . GLU B 68  ? 1.3470 1.2632 1.5818 -0.2390 -0.2039 0.1646  68  GLU B OE1 
2702 O OE2 . GLU B 68  ? 1.5179 1.3622 1.7654 -0.2819 -0.2438 0.2087  68  GLU B OE2 
2703 N N   . CYS B 69  ? 1.1153 1.0230 1.2371 -0.1227 -0.1489 0.0978  69  CYS B N   
2704 C CA  . CYS B 69  ? 1.0577 0.9723 1.1745 -0.0956 -0.1480 0.0629  69  CYS B CA  
2705 C C   . CYS B 69  ? 1.0171 0.9120 1.1092 -0.0671 -0.1485 0.0424  69  CYS B C   
2706 O O   . CYS B 69  ? 0.9525 0.8675 1.0337 -0.0461 -0.1385 0.0197  69  CYS B O   
2707 C CB  . CYS B 69  ? 0.9991 0.9683 1.1122 -0.0901 -0.1195 0.0608  69  CYS B CB  
2708 S SG  . CYS B 69  ? 1.0207 1.0301 1.1666 -0.1126 -0.1172 0.0711  69  CYS B SG  
2709 N N   . GLU B 70  ? 1.0461 0.9053 1.1299 -0.0672 -0.1602 0.0519  70  GLU B N   
2710 C CA  . GLU B 70  ? 1.0093 0.8558 1.0711 -0.0411 -0.1595 0.0356  70  GLU B CA  
2711 C C   . GLU B 70  ? 0.9077 0.7938 0.9486 -0.0228 -0.1325 0.0227  70  GLU B C   
2712 O O   . GLU B 70  ? 0.8733 0.7627 0.9065 -0.0005 -0.1347 -0.0036 70  GLU B O   
2713 C CB  . GLU B 70  ? 1.0534 0.8642 1.1230 -0.0230 -0.1878 0.0069  70  GLU B CB  
2714 C CG  . GLU B 70  ? 1.1680 0.9259 1.2501 -0.0324 -0.2178 0.0177  70  GLU B CG  
2715 C CD  . GLU B 70  ? 1.2556 0.9836 1.3604 -0.0332 -0.2473 -0.0018 70  GLU B CD  
2716 O OE1 . GLU B 70  ? 1.2575 0.9858 1.3592 -0.0069 -0.2549 -0.0375 70  GLU B OE1 
2717 O OE2 . GLU B 70  ? 1.3108 1.0186 1.4360 -0.0608 -0.2627 0.0183  70  GLU B OE2 
2718 N N   . VAL B 71  ? 0.8529 0.7700 0.8843 -0.0320 -0.1079 0.0406  71  VAL B N   
2719 C CA  . VAL B 71  ? 0.7826 0.7293 0.7950 -0.0153 -0.0866 0.0286  71  VAL B CA  
2720 C C   . VAL B 71  ? 0.7500 0.6887 0.7395 -0.0050 -0.0811 0.0307  71  VAL B C   
2721 O O   . VAL B 71  ? 0.7692 0.6990 0.7523 -0.0161 -0.0795 0.0513  71  VAL B O   
2722 C CB  . VAL B 71  ? 0.7623 0.7473 0.7758 -0.0241 -0.0639 0.0392  71  VAL B CB  
2723 C CG1 . VAL B 71  ? 0.7250 0.7311 0.7156 -0.0081 -0.0440 0.0308  71  VAL B CG1 
2724 C CG2 . VAL B 71  ? 0.7667 0.7657 0.8029 -0.0284 -0.0699 0.0308  71  VAL B CG2 
2725 N N   . LYS B 72  ? 0.7016 0.6473 0.6784 0.0153  -0.0783 0.0104  72  LYS B N   
2726 C CA  . LYS B 72  ? 0.6768 0.6159 0.6356 0.0253  -0.0767 0.0105  72  LYS B CA  
2727 C C   . LYS B 72  ? 0.6102 0.5763 0.5487 0.0286  -0.0539 0.0126  72  LYS B C   
2728 O O   . LYS B 72  ? 0.6090 0.5738 0.5317 0.0284  -0.0480 0.0217  72  LYS B O   
2729 C CB  . LYS B 72  ? 0.6902 0.6184 0.6512 0.0450  -0.0930 -0.0132 72  LYS B CB  
2730 C CG  . LYS B 72  ? 0.8015 0.6917 0.7807 0.0430  -0.1199 -0.0144 72  LYS B CG  
2731 C CD  . LYS B 72  ? 0.8877 0.7519 0.8615 0.0442  -0.1307 -0.0020 72  LYS B CD  
2732 C CE  . LYS B 72  ? 0.9708 0.7967 0.9593 0.0261  -0.1505 0.0188  72  LYS B CE  
2733 N NZ  . LYS B 72  ? 1.0087 0.8105 0.9896 0.0307  -0.1625 0.0299  72  LYS B NZ  
2734 N N   . CYS B 73  ? 0.5608 0.5497 0.4998 0.0310  -0.0427 0.0051  73  CYS B N   
2735 C CA  . CYS B 73  ? 0.5114 0.5204 0.4321 0.0354  -0.0248 0.0051  73  CYS B CA  
2736 C C   . CYS B 73  ? 0.4673 0.4963 0.3935 0.0326  -0.0137 0.0053  73  CYS B C   
2737 O O   . CYS B 73  ? 0.4827 0.5145 0.4271 0.0283  -0.0198 0.0035  73  CYS B O   
2738 C CB  . CYS B 73  ? 0.5035 0.5185 0.4133 0.0503  -0.0275 -0.0109 73  CYS B CB  
2739 S SG  . CYS B 73  ? 0.5560 0.5841 0.4767 0.0603  -0.0361 -0.0316 73  CYS B SG  
2740 N N   . MET B 74  ? 0.4284 0.4703 0.3396 0.0357  0.0007  0.0067  74  MET B N   
2741 C CA  . MET B 74  ? 0.4096 0.4690 0.3256 0.0347  0.0115  0.0086  74  MET B CA  
2742 C C   . MET B 74  ? 0.3761 0.4411 0.2783 0.0448  0.0149  -0.0001 74  MET B C   
2743 O O   . MET B 74  ? 0.3676 0.4264 0.2535 0.0479  0.0151  -0.0018 74  MET B O   
2744 C CB  . MET B 74  ? 0.4112 0.4781 0.3201 0.0284  0.0257  0.0204  74  MET B CB  
2745 C CG  . MET B 74  ? 0.4247 0.4916 0.3429 0.0147  0.0252  0.0346  74  MET B CG  
2746 S SD  . MET B 74  ? 0.5403 0.5799 0.4508 0.0094  0.0118  0.0421  74  MET B SD  
2747 C CE  . MET B 74  ? 0.4257 0.4647 0.3064 0.0107  0.0225  0.0480  74  MET B CE  
2748 N N   . PRO B 75  ? 0.3672 0.4447 0.2764 0.0489  0.0162  -0.0040 75  PRO B N   
2749 C CA  . PRO B 75  ? 0.3768 0.4653 0.3083 0.0462  0.0122  -0.0045 75  PRO B CA  
2750 C C   . PRO B 75  ? 0.3855 0.4690 0.3268 0.0462  -0.0030 -0.0133 75  PRO B C   
2751 O O   . PRO B 75  ? 0.3795 0.4623 0.3095 0.0538  -0.0084 -0.0228 75  PRO B O   
2752 C CB  . PRO B 75  ? 0.3676 0.4684 0.2977 0.0543  0.0145  -0.0081 75  PRO B CB  
2753 C CG  . PRO B 75  ? 0.3727 0.4657 0.2800 0.0592  0.0193  -0.0079 75  PRO B CG  
2754 C CD  . PRO B 75  ? 0.3539 0.4345 0.2482 0.0557  0.0200  -0.0068 75  PRO B CD  
2755 N N   . THR B 76  ? 0.4028 0.4840 0.3646 0.0375  -0.0105 -0.0107 76  THR B N   
2756 C CA  . THR B 76  ? 0.4120 0.4881 0.3870 0.0382  -0.0277 -0.0223 76  THR B CA  
2757 C C   . THR B 76  ? 0.4229 0.5157 0.4194 0.0326  -0.0306 -0.0214 76  THR B C   
2758 O O   . THR B 76  ? 0.4291 0.5315 0.4394 0.0225  -0.0238 -0.0090 76  THR B O   
2759 C CB  . THR B 76  ? 0.4535 0.5053 0.4381 0.0301  -0.0406 -0.0200 76  THR B CB  
2760 O OG1 . THR B 76  ? 0.4082 0.4449 0.3766 0.0379  -0.0430 -0.0244 76  THR B OG1 
2761 C CG2 . THR B 76  ? 0.4850 0.5296 0.4889 0.0288  -0.0611 -0.0330 76  THR B CG2 
2762 N N   . PHE B 77  ? 0.4293 0.5298 0.4297 0.0388  -0.0414 -0.0347 77  PHE B N   
2763 C CA  . PHE B 77  ? 0.4447 0.5632 0.4665 0.0339  -0.0461 -0.0344 77  PHE B CA  
2764 C C   . PHE B 77  ? 0.5054 0.6133 0.5445 0.0276  -0.0666 -0.0449 77  PHE B C   
2765 O O   . PHE B 77  ? 0.5232 0.6191 0.5532 0.0358  -0.0789 -0.0612 77  PHE B O   
2766 C CB  . PHE B 77  ? 0.4082 0.5460 0.4206 0.0452  -0.0441 -0.0403 77  PHE B CB  
2767 C CG  . PHE B 77  ? 0.3513 0.4955 0.3505 0.0509  -0.0282 -0.0308 77  PHE B CG  
2768 C CD1 . PHE B 77  ? 0.3732 0.5333 0.3867 0.0495  -0.0196 -0.0217 77  PHE B CD1 
2769 C CD2 . PHE B 77  ? 0.3223 0.4584 0.2959 0.0584  -0.0231 -0.0321 77  PHE B CD2 
2770 C CE1 . PHE B 77  ? 0.3732 0.5358 0.3747 0.0576  -0.0071 -0.0161 77  PHE B CE1 
2771 C CE2 . PHE B 77  ? 0.3402 0.4772 0.3014 0.0631  -0.0115 -0.0241 77  PHE B CE2 
2772 C CZ  . PHE B 77  ? 0.3621 0.5095 0.3367 0.0637  -0.0040 -0.0171 77  PHE B CZ  
2773 N N   . GLN B 78  ? 0.5532 0.6668 0.6182 0.0130  -0.0716 -0.0366 78  GLN B N   
2774 C CA  . GLN B 78  ? 0.6264 0.7261 0.7090 0.0054  -0.0944 -0.0472 78  GLN B CA  
2775 C C   . GLN B 78  ? 0.6537 0.7793 0.7586 -0.0002 -0.1020 -0.0500 78  GLN B C   
2776 O O   . GLN B 78  ? 0.6426 0.7950 0.7623 -0.0070 -0.0904 -0.0357 78  GLN B O   
2777 C CB  . GLN B 78  ? 0.6668 0.7409 0.7630 -0.0120 -0.1016 -0.0344 78  GLN B CB  
2778 C CG  . GLN B 78  ? 0.6790 0.7257 0.7554 -0.0065 -0.0986 -0.0320 78  GLN B CG  
2779 C CD  . GLN B 78  ? 0.7521 0.7655 0.8420 -0.0228 -0.1141 -0.0214 78  GLN B CD  
2780 O OE1 . GLN B 78  ? 0.7884 0.7734 0.8659 -0.0171 -0.1197 -0.0228 78  GLN B OE1 
2781 N NE2 . GLN B 78  ? 0.8155 0.8328 0.9320 -0.0441 -0.1228 -0.0094 78  GLN B NE2 
2782 N N   . PHE B 79  ? 0.7026 0.8230 0.8102 0.0038  -0.1221 -0.0697 79  PHE B N   
2783 C CA  . PHE B 79  ? 0.7405 0.8860 0.8677 -0.0006 -0.1326 -0.0748 79  PHE B CA  
2784 C C   . PHE B 79  ? 0.8123 0.9401 0.9641 -0.0166 -0.1569 -0.0813 79  PHE B C   
2785 O O   . PHE B 79  ? 0.8443 0.9393 0.9898 -0.0136 -0.1739 -0.0972 79  PHE B O   
2786 C CB  . PHE B 79  ? 0.7282 0.8899 0.8354 0.0175  -0.1365 -0.0925 79  PHE B CB  
2787 C CG  . PHE B 79  ? 0.6896 0.8656 0.7723 0.0314  -0.1160 -0.0847 79  PHE B CG  
2788 C CD1 . PHE B 79  ? 0.6680 0.8264 0.7301 0.0369  -0.1032 -0.0804 79  PHE B CD1 
2789 C CD2 . PHE B 79  ? 0.7087 0.9139 0.7895 0.0384  -0.1120 -0.0812 79  PHE B CD2 
2790 C CE1 . PHE B 79  ? 0.6549 0.8235 0.6956 0.0473  -0.0870 -0.0731 79  PHE B CE1 
2791 C CE2 . PHE B 79  ? 0.6715 0.8838 0.7306 0.0497  -0.0968 -0.0729 79  PHE B CE2 
2792 C CZ  . PHE B 79  ? 0.6712 0.8646 0.7103 0.0531  -0.0842 -0.0689 79  PHE B CZ  
2793 N N   . PHE B 80  ? 0.8559 1.0074 1.0372 -0.0331 -0.1592 -0.0695 80  PHE B N   
2794 C CA  . PHE B 80  ? 0.9424 1.0848 1.1539 -0.0538 -0.1835 -0.0719 80  PHE B CA  
2795 C C   . PHE B 80  ? 0.9726 1.1518 1.2030 -0.0558 -0.1930 -0.0787 80  PHE B C   
2796 O O   . PHE B 80  ? 0.9324 1.1516 1.1658 -0.0490 -0.1771 -0.0699 80  PHE B O   
2797 C CB  . PHE B 80  ? 0.9590 1.1000 1.1950 -0.0797 -0.1784 -0.0447 80  PHE B CB  
2798 C CG  . PHE B 80  ? 0.9551 1.0720 1.1722 -0.0778 -0.1641 -0.0322 80  PHE B CG  
2799 C CD1 . PHE B 80  ? 0.8948 1.0339 1.0941 -0.0658 -0.1359 -0.0217 80  PHE B CD1 
2800 C CD2 . PHE B 80  ? 1.0203 1.0893 1.2361 -0.0864 -0.1811 -0.0323 80  PHE B CD2 
2801 C CE1 . PHE B 80  ? 0.8703 0.9882 1.0505 -0.0640 -0.1237 -0.0110 80  PHE B CE1 
2802 C CE2 . PHE B 80  ? 0.9855 1.0324 1.1827 -0.0839 -0.1693 -0.0198 80  PHE B CE2 
2803 C CZ  . PHE B 80  ? 0.9161 0.9896 1.0953 -0.0734 -0.1400 -0.0091 80  PHE B CZ  
2804 N N   . LYS B 81  ? 1.0556 1.2186 1.2992 -0.0643 -0.2214 -0.0955 81  LYS B N   
2805 C CA  . LYS B 81  ? 1.0988 1.2916 1.3687 -0.0746 -0.2373 -0.1002 81  LYS B CA  
2806 C C   . LYS B 81  ? 1.1795 1.3473 1.4811 -0.1039 -0.2604 -0.0949 81  LYS B C   
2807 O O   . LYS B 81  ? 1.2217 1.3399 1.5162 -0.1063 -0.2775 -0.1055 81  LYS B O   
2808 C CB  . LYS B 81  ? 1.1129 1.3076 1.3624 -0.0556 -0.2538 -0.1305 81  LYS B CB  
2809 C CG  . LYS B 81  ? 1.1023 1.3471 1.3610 -0.0511 -0.2546 -0.1311 81  LYS B CG  
2810 C CD  . LYS B 81  ? 1.0772 1.3333 1.2968 -0.0234 -0.2501 -0.1478 81  LYS B CD  
2811 C CE  . LYS B 81  ? 1.1067 1.3279 1.2969 -0.0107 -0.2655 -0.1780 81  LYS B CE  
2812 N NZ  . LYS B 81  ? 1.0851 1.3324 1.2404 0.0119  -0.2660 -0.1953 81  LYS B NZ  
2813 N N   . LYS B 82  ? 1.2136 1.4165 1.5517 -0.1264 -0.2622 -0.0777 82  LYS B N   
2814 C CA  . LYS B 82  ? 1.2987 1.4842 1.6719 -0.1603 -0.2852 -0.0675 82  LYS B CA  
2815 C C   . LYS B 82  ? 1.3095 1.4725 1.6872 -0.1787 -0.2744 -0.0401 82  LYS B C   
2816 O O   . LYS B 82  ? 1.3742 1.5404 1.7843 -0.2113 -0.2843 -0.0192 82  LYS B O   
2817 C CB  . LYS B 82  ? 1.3696 1.5087 1.7417 -0.1621 -0.3233 -0.0969 82  LYS B CB  
2818 C CG  . LYS B 82  ? 1.3740 1.5401 1.7478 -0.1519 -0.3402 -0.1227 82  LYS B CG  
2819 C CD  . LYS B 82  ? 1.4371 1.6096 1.8522 -0.1826 -0.3704 -0.1224 82  LYS B CD  
2820 C CE  . LYS B 82  ? 1.4388 1.6251 1.8485 -0.1701 -0.3941 -0.1553 82  LYS B CE  
2821 N NZ  . LYS B 82  ? 1.4670 1.6732 1.9188 -0.1995 -0.4205 -0.1531 82  LYS B NZ  
2822 N N   . GLY B 83  ? 1.2587 1.4023 1.6041 -0.1596 -0.2546 -0.0384 83  GLY B N   
2823 C CA  . GLY B 83  ? 1.2707 1.3905 1.6153 -0.1751 -0.2460 -0.0134 83  GLY B CA  
2824 C C   . GLY B 83  ? 1.2653 1.3294 1.5768 -0.1557 -0.2511 -0.0281 83  GLY B C   
2825 O O   . GLY B 83  ? 1.2534 1.2998 1.5528 -0.1583 -0.2387 -0.0105 83  GLY B O   
2826 N N   . GLN B 84  ? 1.2750 1.3158 1.5711 -0.1351 -0.2692 -0.0613 84  GLN B N   
2827 C CA  . GLN B 84  ? 1.2860 1.2765 1.5559 -0.1163 -0.2783 -0.0790 84  GLN B CA  
2828 C C   . GLN B 84  ? 1.2037 1.2122 1.4376 -0.0825 -0.2570 -0.0958 84  GLN B C   
2829 O O   . GLN B 84  ? 1.1844 1.2237 1.4109 -0.0683 -0.2550 -0.1129 84  GLN B O   
2830 C CB  . GLN B 84  ? 1.3783 1.3245 1.6583 -0.1188 -0.3179 -0.1058 84  GLN B CB  
2831 C CG  . GLN B 84  ? 1.4784 1.4026 1.7962 -0.1572 -0.3420 -0.0856 84  GLN B CG  
2832 C CD  . GLN B 84  ? 1.5187 1.4123 1.8414 -0.1774 -0.3384 -0.0519 84  GLN B CD  
2833 O OE1 . GLN B 84  ? 1.5978 1.4366 1.9339 -0.1938 -0.3686 -0.0491 84  GLN B OE1 
2834 N NE2 . GLN B 84  ? 1.4402 1.3681 1.7511 -0.1760 -0.3032 -0.0265 84  GLN B NE2 
2835 N N   . LYS B 85  ? 1.1574 1.1489 1.3695 -0.0715 -0.2418 -0.0885 85  LYS B N   
2836 C CA  . LYS B 85  ? 1.0777 1.0860 1.2568 -0.0429 -0.2220 -0.1012 85  LYS B CA  
2837 C C   . LYS B 85  ? 1.0865 1.0975 1.2529 -0.0227 -0.2376 -0.1363 85  LYS B C   
2838 O O   . LYS B 85  ? 1.1591 1.1391 1.3334 -0.0228 -0.2657 -0.1573 85  LYS B O   
2839 C CB  . LYS B 85  ? 1.0669 1.0446 1.2262 -0.0331 -0.2152 -0.0972 85  LYS B CB  
2840 C CG  . LYS B 85  ? 0.9883 0.9900 1.1163 -0.0100 -0.1897 -0.1011 85  LYS B CG  
2841 C CD  . LYS B 85  ? 0.9739 0.9481 1.0835 0.0013  -0.1863 -0.1013 85  LYS B CD  
2842 C CE  . LYS B 85  ? 0.9858 0.9393 1.1061 -0.0191 -0.1828 -0.0717 85  LYS B CE  
2843 N NZ  . LYS B 85  ? 0.9808 0.8969 1.0895 -0.0099 -0.1910 -0.0745 85  LYS B NZ  
2844 N N   . VAL B 86  ? 1.0199 1.0682 1.1664 -0.0058 -0.2211 -0.1428 86  VAL B N   
2845 C CA  . VAL B 86  ? 1.0293 1.0843 1.1565 0.0152  -0.2330 -0.1753 86  VAL B CA  
2846 C C   . VAL B 86  ? 0.9715 1.0445 1.0664 0.0356  -0.2105 -0.1761 86  VAL B C   
2847 O O   . VAL B 86  ? 0.9859 1.0634 1.0595 0.0549  -0.2159 -0.2009 86  VAL B O   
2848 C CB  . VAL B 86  ? 1.0463 1.1322 1.1822 0.0128  -0.2452 -0.1872 86  VAL B CB  
2849 C CG1 . VAL B 86  ? 1.0650 1.1567 1.2369 -0.0136 -0.2515 -0.1674 86  VAL B CG1 
2850 C CG2 . VAL B 86  ? 0.9791 1.1087 1.0922 0.0274  -0.2271 -0.1859 86  VAL B CG2 
2851 N N   . GLY B 87  ? 0.9062 0.9914 0.9977 0.0309  -0.1857 -0.1493 87  GLY B N   
2852 C CA  . GLY B 87  ? 0.8453 0.9456 0.9078 0.0468  -0.1652 -0.1470 87  GLY B CA  
2853 C C   . GLY B 87  ? 0.8025 0.8868 0.8617 0.0423  -0.1482 -0.1261 87  GLY B C   
2854 O O   . GLY B 87  ? 0.8127 0.8848 0.8914 0.0252  -0.1462 -0.1069 87  GLY B O   
2855 N N   . GLU B 88  ? 0.7504 0.8382 0.7847 0.0564  -0.1363 -0.1293 88  GLU B N   
2856 C CA  . GLU B 88  ? 0.7056 0.7829 0.7329 0.0533  -0.1194 -0.1102 88  GLU B CA  
2857 C C   . GLU B 88  ? 0.6620 0.7466 0.6632 0.0685  -0.1094 -0.1165 88  GLU B C   
2858 O O   . GLU B 88  ? 0.6871 0.7705 0.6800 0.0814  -0.1199 -0.1377 88  GLU B O   
2859 C CB  . GLU B 88  ? 0.7486 0.7905 0.7915 0.0425  -0.1298 -0.1036 88  GLU B CB  
2860 C CG  . GLU B 88  ? 0.7615 0.7942 0.7964 0.0381  -0.1138 -0.0832 88  GLU B CG  
2861 C CD  . GLU B 88  ? 0.8817 0.8804 0.9156 0.0420  -0.1272 -0.0891 88  GLU B CD  
2862 O OE1 . GLU B 88  ? 0.9507 0.9335 0.9920 0.0492  -0.1494 -0.1114 88  GLU B OE1 
2863 O OE2 . GLU B 88  ? 0.8449 0.8331 0.8704 0.0394  -0.1172 -0.0736 88  GLU B OE2 
2864 N N   . PHE B 89  ? 0.5995 0.6939 0.5887 0.0669  -0.0896 -0.0987 89  PHE B N   
2865 C CA  . PHE B 89  ? 0.5566 0.6601 0.5223 0.0770  -0.0787 -0.0998 89  PHE B CA  
2866 C C   . PHE B 89  ? 0.5133 0.6102 0.4735 0.0700  -0.0616 -0.0781 89  PHE B C   
2867 O O   . PHE B 89  ? 0.5021 0.5991 0.4733 0.0603  -0.0548 -0.0637 89  PHE B O   
2868 C CB  . PHE B 89  ? 0.5467 0.6822 0.4957 0.0849  -0.0753 -0.1061 89  PHE B CB  
2869 C CG  . PHE B 89  ? 0.5156 0.6635 0.4609 0.0794  -0.0627 -0.0876 89  PHE B CG  
2870 C CD1 . PHE B 89  ? 0.4871 0.6394 0.4146 0.0801  -0.0489 -0.0755 89  PHE B CD1 
2871 C CD2 . PHE B 89  ? 0.5292 0.6841 0.4903 0.0742  -0.0667 -0.0833 89  PHE B CD2 
2872 C CE1 . PHE B 89  ? 0.4893 0.6469 0.4142 0.0770  -0.0402 -0.0597 89  PHE B CE1 
2873 C CE2 . PHE B 89  ? 0.5012 0.6673 0.4609 0.0728  -0.0570 -0.0679 89  PHE B CE2 
2874 C CZ  . PHE B 89  ? 0.4609 0.6253 0.4022 0.0749  -0.0443 -0.0567 89  PHE B CZ  
2875 N N   . SER B 90  ? 0.4773 0.5730 0.4208 0.0757  -0.0548 -0.0777 90  SER B N   
2876 C CA  . SER B 90  ? 0.4267 0.5166 0.3605 0.0707  -0.0399 -0.0607 90  SER B CA  
2877 C C   . SER B 90  ? 0.3867 0.4948 0.3004 0.0746  -0.0295 -0.0575 90  SER B C   
2878 O O   . SER B 90  ? 0.3751 0.5015 0.2793 0.0816  -0.0331 -0.0678 90  SER B O   
2879 C CB  . SER B 90  ? 0.4366 0.5068 0.3691 0.0714  -0.0434 -0.0604 90  SER B CB  
2880 O OG  . SER B 90  ? 0.4752 0.5243 0.4260 0.0630  -0.0526 -0.0559 90  SER B OG  
2881 N N   . GLY B 91  ? 0.3594 0.4631 0.2664 0.0695  -0.0174 -0.0430 91  GLY B N   
2882 C CA  . GLY B 91  ? 0.3452 0.4580 0.2335 0.0706  -0.0098 -0.0377 91  GLY B CA  
2883 C C   . GLY B 91  ? 0.3376 0.4537 0.2266 0.0691  -0.0055 -0.0292 91  GLY B C   
2884 O O   . GLY B 91  ? 0.3392 0.4625 0.2413 0.0701  -0.0106 -0.0319 91  GLY B O   
2885 N N   . ALA B 92  ? 0.3396 0.4500 0.2153 0.0675  0.0018  -0.0200 92  ALA B N   
2886 C CA  . ALA B 92  ? 0.3533 0.4627 0.2305 0.0691  0.0035  -0.0130 92  ALA B CA  
2887 C C   . ALA B 92  ? 0.3642 0.4865 0.2334 0.0706  -0.0035 -0.0109 92  ALA B C   
2888 O O   . ALA B 92  ? 0.4023 0.5186 0.2585 0.0688  -0.0032 -0.0024 92  ALA B O   
2889 C CB  . ALA B 92  ? 0.3430 0.4355 0.2100 0.0682  0.0115  -0.0060 92  ALA B CB  
2890 N N   . ASN B 93  ? 0.3752 0.5148 0.2514 0.0728  -0.0113 -0.0176 93  ASN B N   
2891 C CA  . ASN B 93  ? 0.3917 0.5478 0.2564 0.0730  -0.0180 -0.0137 93  ASN B CA  
2892 C C   . ASN B 93  ? 0.4093 0.5713 0.2872 0.0771  -0.0249 -0.0119 93  ASN B C   
2893 O O   . ASN B 93  ? 0.4102 0.5844 0.3015 0.0792  -0.0310 -0.0219 93  ASN B O   
2894 C CB  . ASN B 93  ? 0.4000 0.5782 0.2581 0.0739  -0.0223 -0.0256 93  ASN B CB  
2895 C CG  . ASN B 93  ? 0.4561 0.6615 0.2999 0.0731  -0.0288 -0.0228 93  ASN B CG  
2896 O OD1 . ASN B 93  ? 0.5090 0.7159 0.3506 0.0722  -0.0337 -0.0119 93  ASN B OD1 
2897 N ND2 . ASN B 93  ? 0.4831 0.7131 0.3170 0.0743  -0.0297 -0.0329 93  ASN B ND2 
2898 N N   . LYS B 94  ? 0.4272 0.5794 0.3030 0.0788  -0.0259 0.0000  94  LYS B N   
2899 C CA  . LYS B 94  ? 0.4521 0.6117 0.3438 0.0848  -0.0334 0.0017  94  LYS B CA  
2900 C C   . LYS B 94  ? 0.4623 0.6478 0.3532 0.0846  -0.0443 -0.0038 94  LYS B C   
2901 O O   . LYS B 94  ? 0.4571 0.6536 0.3673 0.0869  -0.0489 -0.0130 94  LYS B O   
2902 C CB  . LYS B 94  ? 0.4841 0.6305 0.3703 0.0888  -0.0384 0.0156  94  LYS B CB  
2903 C CG  . LYS B 94  ? 0.5276 0.6464 0.4021 0.0875  -0.0322 0.0221  94  LYS B CG  
2904 C CD  . LYS B 94  ? 0.6015 0.7026 0.4722 0.0927  -0.0421 0.0345  94  LYS B CD  
2905 C CE  . LYS B 94  ? 0.6729 0.7842 0.5267 0.0858  -0.0545 0.0481  94  LYS B CE  
2906 N NZ  . LYS B 94  ? 0.6881 0.7964 0.5182 0.0720  -0.0521 0.0561  94  LYS B NZ  
2907 N N   . GLU B 95  ? 0.4707 0.6679 0.3384 0.0807  -0.0484 0.0020  95  GLU B N   
2908 C CA  . GLU B 95  ? 0.4774 0.7042 0.3358 0.0805  -0.0589 -0.0010 95  GLU B CA  
2909 C C   . GLU B 95  ? 0.4550 0.6963 0.3241 0.0831  -0.0614 -0.0222 95  GLU B C   
2910 O O   . GLU B 95  ? 0.4652 0.7215 0.3438 0.0861  -0.0717 -0.0293 95  GLU B O   
2911 C CB  . GLU B 95  ? 0.5021 0.7454 0.3326 0.0734  -0.0584 0.0071  95  GLU B CB  
2912 C CG  . GLU B 95  ? 0.5574 0.7897 0.3723 0.0667  -0.0617 0.0316  95  GLU B CG  
2913 C CD  . GLU B 95  ? 0.6169 0.8127 0.4341 0.0645  -0.0541 0.0395  95  GLU B CD  
2914 O OE1 . GLU B 95  ? 0.5764 0.7616 0.4012 0.0657  -0.0434 0.0278  95  GLU B OE1 
2915 O OE2 . GLU B 95  ? 0.6555 0.8320 0.4666 0.0620  -0.0608 0.0575  95  GLU B OE2 
2916 N N   . LYS B 96  ? 0.4273 0.6622 0.2952 0.0822  -0.0539 -0.0323 96  LYS B N   
2917 C CA  . LYS B 96  ? 0.4388 0.6773 0.3188 0.0854  -0.0581 -0.0530 96  LYS B CA  
2918 C C   . LYS B 96  ? 0.4342 0.6607 0.3417 0.0851  -0.0623 -0.0558 96  LYS B C   
2919 O O   . LYS B 96  ? 0.4460 0.6822 0.3646 0.0864  -0.0733 -0.0694 96  LYS B O   
2920 C CB  . LYS B 96  ? 0.4174 0.6435 0.2952 0.0854  -0.0504 -0.0599 96  LYS B CB  
2921 C CG  . LYS B 96  ? 0.4708 0.6885 0.3660 0.0886  -0.0576 -0.0791 96  LYS B CG  
2922 C CD  . LYS B 96  ? 0.5690 0.8103 0.4609 0.0951  -0.0709 -0.1000 96  LYS B CD  
2923 C CE  . LYS B 96  ? 0.6345 0.8666 0.5329 0.1018  -0.0776 -0.1224 96  LYS B CE  
2924 N NZ  . LYS B 96  ? 0.6232 0.8419 0.5165 0.1024  -0.0672 -0.1178 96  LYS B NZ  
2925 N N   . LEU B 97  ? 0.4205 0.6289 0.3392 0.0832  -0.0540 -0.0434 97  LEU B N   
2926 C CA  . LEU B 97  ? 0.4463 0.6516 0.3928 0.0816  -0.0559 -0.0439 97  LEU B CA  
2927 C C   . LEU B 97  ? 0.4764 0.7018 0.4348 0.0841  -0.0678 -0.0438 97  LEU B C   
2928 O O   . LEU B 97  ? 0.5037 0.7367 0.4825 0.0810  -0.0766 -0.0533 97  LEU B O   
2929 C CB  . LEU B 97  ? 0.4342 0.6239 0.3885 0.0809  -0.0430 -0.0320 97  LEU B CB  
2930 C CG  . LEU B 97  ? 0.4331 0.6289 0.4166 0.0793  -0.0418 -0.0297 97  LEU B CG  
2931 C CD1 . LEU B 97  ? 0.4282 0.6233 0.4311 0.0701  -0.0457 -0.0373 97  LEU B CD1 
2932 C CD2 . LEU B 97  ? 0.4381 0.6227 0.4201 0.0818  -0.0280 -0.0206 97  LEU B CD2 
2933 N N   . GLU B 98  ? 0.4794 0.7118 0.4264 0.0887  -0.0699 -0.0322 98  GLU B N   
2934 C CA  . GLU B 98  ? 0.4961 0.7491 0.4511 0.0920  -0.0832 -0.0309 98  GLU B CA  
2935 C C   . GLU B 98  ? 0.5245 0.7960 0.4689 0.0905  -0.0946 -0.0455 98  GLU B C   
2936 O O   . GLU B 98  ? 0.5463 0.8293 0.5081 0.0893  -0.1052 -0.0567 98  GLU B O   
2937 C CB  . GLU B 98  ? 0.4976 0.7501 0.4383 0.0970  -0.0860 -0.0138 98  GLU B CB  
2938 C CG  . GLU B 98  ? 0.5143 0.7855 0.4681 0.1022  -0.1002 -0.0098 98  GLU B CG  
2939 C CD  . GLU B 98  ? 0.5484 0.8124 0.4912 0.1084  -0.1060 0.0095  98  GLU B CD  
2940 O OE1 . GLU B 98  ? 0.5151 0.7596 0.4355 0.1061  -0.1003 0.0203  98  GLU B OE1 
2941 O OE2 . GLU B 98  ? 0.5489 0.8262 0.5068 0.1153  -0.1184 0.0141  98  GLU B OE2 
2942 N N   . ALA B 99  ? 0.5432 0.8195 0.4594 0.0904  -0.0925 -0.0470 99  ALA B N   
2943 C CA  . ALA B 99  ? 0.5795 0.8777 0.4837 0.0916  -0.1023 -0.0656 99  ALA B CA  
2944 C C   . ALA B 99  ? 0.5857 0.8763 0.5125 0.0908  -0.1088 -0.0862 99  ALA B C   
2945 O O   . ALA B 99  ? 0.6309 0.9376 0.5625 0.0918  -0.1234 -0.0999 99  ALA B O   
2946 C CB  . ALA B 99  ? 0.5684 0.8759 0.4443 0.0920  -0.0953 -0.0681 99  ALA B CB  
2947 N N   . THR B 100 ? 0.5571 0.8222 0.4975 0.0876  -0.1004 -0.0875 100 THR B N   
2948 C CA  . THR B 100 ? 0.5744 0.8280 0.5350 0.0846  -0.1097 -0.1048 100 THR B CA  
2949 C C   . THR B 100 ? 0.6049 0.8635 0.5940 0.0787  -0.1181 -0.1010 100 THR B C   
2950 O O   . THR B 100 ? 0.6391 0.9009 0.6419 0.0757  -0.1338 -0.1165 100 THR B O   
2951 C CB  . THR B 100 ? 0.5484 0.7724 0.5163 0.0811  -0.1007 -0.1045 100 THR B CB  
2952 O OG1 . THR B 100 ? 0.5204 0.7438 0.4649 0.0875  -0.0947 -0.1104 100 THR B OG1 
2953 C CG2 . THR B 100 ? 0.5535 0.7613 0.5438 0.0757  -0.1139 -0.1184 100 THR B CG2 
2954 N N   . ILE B 101 ? 0.6048 0.8656 0.6038 0.0777  -0.1088 -0.0817 101 ILE B N   
2955 C CA  . ILE B 101 ? 0.6358 0.9077 0.6661 0.0728  -0.1144 -0.0766 101 ILE B CA  
2956 C C   . ILE B 101 ? 0.6908 0.9869 0.7221 0.0749  -0.1325 -0.0856 101 ILE B C   
2957 O O   . ILE B 101 ? 0.7234 1.0245 0.7755 0.0680  -0.1463 -0.0971 101 ILE B O   
2958 C CB  . ILE B 101 ? 0.6168 0.8933 0.6544 0.0770  -0.1028 -0.0579 101 ILE B CB  
2959 C CG1 . ILE B 101 ? 0.6005 0.8599 0.6493 0.0719  -0.0868 -0.0506 101 ILE B CG1 
2960 C CG2 . ILE B 101 ? 0.6303 0.9340 0.6942 0.0781  -0.1138 -0.0546 101 ILE B CG2 
2961 C CD1 . ILE B 101 ? 0.5886 0.8520 0.6436 0.0788  -0.0747 -0.0365 101 ILE B CD1 
2962 N N   . ASN B 102 ? 0.7140 1.0245 0.7222 0.0831  -0.1337 -0.0788 102 ASN B N   
2963 C CA  . ASN B 102 ? 0.7739 1.1102 0.7753 0.0859  -0.1510 -0.0857 102 ASN B CA  
2964 C C   . ASN B 102 ? 0.8151 1.1503 0.8126 0.0831  -0.1623 -0.1111 102 ASN B C   
2965 O O   . ASN B 102 ? 0.8486 1.1880 0.8695 0.0773  -0.1765 -0.1227 102 ASN B O   
2966 C CB  . ASN B 102 ? 0.7839 1.1318 0.7506 0.0926  -0.1496 -0.0751 102 ASN B CB  
2967 C CG  . ASN B 102 ? 0.7617 1.1050 0.7317 0.0967  -0.1434 -0.0510 102 ASN B CG  
2968 O OD1 . ASN B 102 ? 0.7731 1.1248 0.7679 0.0990  -0.1495 -0.0447 102 ASN B OD1 
2969 N ND2 . ASN B 102 ? 0.7620 1.0923 0.7080 0.0981  -0.1328 -0.0382 102 ASN B ND2 
2970 N N   . GLU B 103 ? 0.8225 1.1512 0.7933 0.0874  -0.1565 -0.1204 103 GLU B N   
2971 C CA  . GLU B 103 ? 0.8746 1.2050 0.8369 0.0901  -0.1688 -0.1486 103 GLU B CA  
2972 C C   . GLU B 103 ? 0.8974 1.2030 0.8904 0.0825  -0.1791 -0.1628 103 GLU B C   
2973 O O   . GLU B 103 ? 0.9320 1.2277 0.9207 0.0859  -0.1898 -0.1872 103 GLU B O   
2974 C CB  . GLU B 103 ? 0.8650 1.1951 0.7982 0.0975  -0.1582 -0.1554 103 GLU B CB  
2975 C CG  . GLU B 103 ? 0.9203 1.2649 0.8378 0.1061  -0.1712 -0.1874 103 GLU B CG  
2976 C CD  . GLU B 103 ? 0.9337 1.2525 0.8546 0.1111  -0.1689 -0.2051 103 GLU B CD  
2977 O OE1 . GLU B 103 ? 0.9986 1.3217 0.9148 0.1201  -0.1835 -0.2363 103 GLU B OE1 
2978 O OE2 . GLU B 103 ? 0.8260 1.1204 0.7542 0.1073  -0.1545 -0.1894 103 GLU B OE2 
2979 N N   . LEU B 104 ? 0.8889 1.1856 0.9131 0.0722  -0.1771 -0.1478 104 LEU B N   
2980 C CA  . LEU B 104 ? 0.9199 1.1952 0.9738 0.0606  -0.1879 -0.1563 104 LEU B CA  
2981 C C   . LEU B 104 ? 0.9443 1.2334 1.0330 0.0484  -0.1960 -0.1466 104 LEU B C   
2982 O O   . LEU B 104 ? 0.9804 1.2570 1.0940 0.0360  -0.2106 -0.1552 104 LEU B O   
2983 C CB  . LEU B 104 ? 0.8868 1.1311 0.9463 0.0558  -0.1737 -0.1466 104 LEU B CB  
2984 C CG  . LEU B 104 ? 0.9036 1.1208 0.9495 0.0612  -0.1774 -0.1642 104 LEU B CG  
2985 C CD1 . LEU B 104 ? 0.8947 1.0828 0.9579 0.0502  -0.1677 -0.1482 104 LEU B CD1 
2986 C CD2 . LEU B 104 ? 0.9297 1.1384 0.9798 0.0627  -0.2034 -0.1941 104 LEU B CD2 
2987 N N   . VAL B 105 ? 0.9355 1.2497 1.0276 0.0518  -0.1875 -0.1285 105 VAL B N   
2988 C CA  . VAL B 105 ? 0.9614 1.2981 1.0891 0.0432  -0.1933 -0.1182 105 VAL B CA  
2989 C C   . VAL B 105 ? 1.0280 1.3676 1.1759 0.0317  -0.2183 -0.1363 105 VAL B C   
2990 O O   . VAL B 105 ? 1.0539 1.3962 1.2381 0.0155  -0.2241 -0.1310 105 VAL B O   
2991 C CB  . VAL B 105 ? 0.9559 1.3240 1.0778 0.0543  -0.1934 -0.1072 105 VAL B CB  
2992 C CG1 . VAL B 105 ? 0.9724 1.3670 1.1349 0.0475  -0.1980 -0.0971 105 VAL B CG1 
2993 C CG2 . VAL B 105 ? 0.9189 1.2795 1.0190 0.0655  -0.1733 -0.0909 105 VAL B CG2 
2994 O OXT . VAL B 105 ? 1.0677 1.4084 1.1949 0.0377  -0.2341 -0.1573 105 VAL B OXT 
2995 N N   . LYS C 6   ? 0.9206 1.1023 0.9070 -0.0272 -0.0613 -0.0387 8   LYS C N   
2996 C CA  . LYS C 6   ? 0.9363 1.1207 0.9165 -0.0302 -0.0633 -0.0287 8   LYS C CA  
2997 C C   . LYS C 6   ? 0.9226 1.1007 0.9060 -0.0318 -0.0604 -0.0205 8   LYS C C   
2998 O O   . LYS C 6   ? 0.9345 1.1177 0.9104 -0.0342 -0.0573 -0.0160 8   LYS C O   
2999 C CB  . LYS C 6   ? 0.9480 1.1309 0.9297 -0.0308 -0.0708 -0.0270 8   LYS C CB  
3000 C CG  . LYS C 6   ? 0.9857 1.1712 0.9574 -0.0340 -0.0754 -0.0177 8   LYS C CG  
3001 C CD  . LYS C 6   ? 0.9828 1.1576 0.9598 -0.0342 -0.0786 -0.0098 8   LYS C CD  
3002 C CE  . LYS C 6   ? 1.0266 1.2006 0.9941 -0.0371 -0.0871 -0.0016 8   LYS C CE  
3003 N NZ  . LYS C 6   ? 1.0222 1.1839 0.9943 -0.0353 -0.0934 0.0042  8   LYS C NZ  
3004 N N   . SER C 7   ? 0.8997 1.0684 0.8933 -0.0306 -0.0619 -0.0184 9   SER C N   
3005 C CA  . SER C 7   ? 0.8746 1.0362 0.8723 -0.0305 -0.0587 -0.0135 9   SER C CA  
3006 C C   . SER C 7   ? 0.8535 1.0117 0.8628 -0.0280 -0.0541 -0.0195 9   SER C C   
3007 O O   . SER C 7   ? 0.8633 1.0224 0.8798 -0.0269 -0.0562 -0.0244 9   SER C O   
3008 C CB  . SER C 7   ? 0.8739 1.0275 0.8738 -0.0296 -0.0647 -0.0070 9   SER C CB  
3009 O OG  . SER C 7   ? 0.8988 1.0539 0.8936 -0.0302 -0.0724 -0.0047 9   SER C OG  
3010 N N   . PHE C 8   ? 0.8231 0.9781 0.8342 -0.0279 -0.0486 -0.0184 10  PHE C N   
3011 C CA  . PHE C 8   ? 0.7920 0.9433 0.8128 -0.0264 -0.0442 -0.0227 10  PHE C CA  
3012 C C   . PHE C 8   ? 0.7830 0.9294 0.8039 -0.0263 -0.0399 -0.0182 10  PHE C C   
3013 O O   . PHE C 8   ? 0.7864 0.9348 0.8025 -0.0272 -0.0356 -0.0185 10  PHE C O   
3014 C CB  . PHE C 8   ? 0.7876 0.9416 0.8066 -0.0261 -0.0420 -0.0302 10  PHE C CB  
3015 C CG  . PHE C 8   ? 0.7621 0.9104 0.7899 -0.0256 -0.0388 -0.0340 10  PHE C CG  
3016 C CD1 . PHE C 8   ? 0.7553 0.9012 0.7939 -0.0264 -0.0401 -0.0334 10  PHE C CD1 
3017 C CD2 . PHE C 8   ? 0.7282 0.8751 0.7531 -0.0245 -0.0352 -0.0381 10  PHE C CD2 
3018 C CE1 . PHE C 8   ? 0.7333 0.8749 0.7793 -0.0274 -0.0377 -0.0356 10  PHE C CE1 
3019 C CE2 . PHE C 8   ? 0.6975 0.8376 0.7295 -0.0245 -0.0335 -0.0410 10  PHE C CE2 
3020 C CZ  . PHE C 8   ? 0.7228 0.8598 0.7651 -0.0267 -0.0348 -0.0391 10  PHE C CZ  
3021 N N   . GLU C 9   ? 0.7640 0.9050 0.7906 -0.0247 -0.0415 -0.0147 11  GLU C N   
3022 C CA  . GLU C 9   ? 0.7480 0.8831 0.7717 -0.0249 -0.0402 -0.0092 11  GLU C CA  
3023 C C   . GLU C 9   ? 0.7138 0.8440 0.7473 -0.0215 -0.0379 -0.0101 11  GLU C C   
3024 O O   . GLU C 9   ? 0.7117 0.8438 0.7529 -0.0186 -0.0402 -0.0123 11  GLU C O   
3025 C CB  . GLU C 9   ? 0.7695 0.9014 0.7855 -0.0260 -0.0475 -0.0026 11  GLU C CB  
3026 C CG  . GLU C 9   ? 0.8357 0.9684 0.8405 -0.0311 -0.0476 0.0040  11  GLU C CG  
3027 C CD  . GLU C 9   ? 0.8803 1.0020 0.8832 -0.0318 -0.0504 0.0109  11  GLU C CD  
3028 O OE1 . GLU C 9   ? 0.8382 0.9501 0.8417 -0.0289 -0.0580 0.0134  11  GLU C OE1 
3029 O OE2 . GLU C 9   ? 0.8725 0.9952 0.8732 -0.0347 -0.0458 0.0132  11  GLU C OE2 
3030 N N   . VAL C 10  ? 0.6722 0.7985 0.7055 -0.0221 -0.0331 -0.0089 12  VAL C N   
3031 C CA  . VAL C 10  ? 0.6154 0.7376 0.6562 -0.0190 -0.0308 -0.0093 12  VAL C CA  
3032 C C   . VAL C 10  ? 0.6074 0.7216 0.6444 -0.0167 -0.0361 -0.0042 12  VAL C C   
3033 O O   . VAL C 10  ? 0.6112 0.7203 0.6401 -0.0197 -0.0375 0.0009  12  VAL C O   
3034 C CB  . VAL C 10  ? 0.5976 0.7182 0.6394 -0.0205 -0.0242 -0.0103 12  VAL C CB  
3035 C CG1 . VAL C 10  ? 0.5995 0.7156 0.6470 -0.0175 -0.0225 -0.0096 12  VAL C CG1 
3036 C CG2 . VAL C 10  ? 0.5599 0.6848 0.6055 -0.0218 -0.0211 -0.0158 12  VAL C CG2 
3037 N N   . VAL C 11  ? 0.5830 0.6966 0.6256 -0.0113 -0.0397 -0.0057 13  VAL C N   
3038 C CA  . VAL C 11  ? 0.5649 0.6691 0.6032 -0.0074 -0.0474 -0.0023 13  VAL C CA  
3039 C C   . VAL C 11  ? 0.5412 0.6441 0.5861 -0.0009 -0.0463 -0.0052 13  VAL C C   
3040 O O   . VAL C 11  ? 0.5238 0.6366 0.5775 0.0035  -0.0450 -0.0098 13  VAL C O   
3041 C CB  . VAL C 11  ? 0.5819 0.6881 0.6194 -0.0047 -0.0552 -0.0028 13  VAL C CB  
3042 C CG1 . VAL C 11  ? 0.5801 0.6741 0.6122 0.0003  -0.0657 0.0001  13  VAL C CG1 
3043 C CG2 . VAL C 11  ? 0.6139 0.7231 0.6444 -0.0114 -0.0556 -0.0002 13  VAL C CG2 
3044 N N   . PHE C 12  ? 0.5340 0.6262 0.5742 -0.0006 -0.0473 -0.0021 14  PHE C N   
3045 C CA  . PHE C 12  ? 0.5277 0.6172 0.5721 0.0064  -0.0474 -0.0049 14  PHE C CA  
3046 C C   . PHE C 12  ? 0.5506 0.6334 0.5930 0.0151  -0.0581 -0.0062 14  PHE C C   
3047 O O   . PHE C 12  ? 0.5688 0.6407 0.6029 0.0140  -0.0673 -0.0021 14  PHE C O   
3048 C CB  . PHE C 12  ? 0.5146 0.5938 0.5541 0.0033  -0.0451 -0.0012 14  PHE C CB  
3049 C CG  . PHE C 12  ? 0.4610 0.5464 0.5025 -0.0035 -0.0355 -0.0008 14  PHE C CG  
3050 C CD1 . PHE C 12  ? 0.4138 0.5069 0.4635 -0.0023 -0.0278 -0.0049 14  PHE C CD1 
3051 C CD2 . PHE C 12  ? 0.4331 0.5182 0.4681 -0.0108 -0.0346 0.0033  14  PHE C CD2 
3052 C CE1 . PHE C 12  ? 0.3967 0.4932 0.4479 -0.0076 -0.0204 -0.0052 14  PHE C CE1 
3053 C CE2 . PHE C 12  ? 0.4738 0.5654 0.5106 -0.0152 -0.0263 0.0020  14  PHE C CE2 
3054 C CZ  . PHE C 12  ? 0.4002 0.4958 0.4451 -0.0133 -0.0196 -0.0024 14  PHE C CZ  
3055 N N   . ASN C 13  ? 0.5514 0.6409 0.6007 0.0240  -0.0576 -0.0119 15  ASN C N   
3056 C CA  . ASN C 13  ? 0.5721 0.6557 0.6196 0.0350  -0.0682 -0.0152 15  ASN C CA  
3057 C C   . ASN C 13  ? 0.6061 0.6675 0.6432 0.0369  -0.0775 -0.0119 15  ASN C C   
3058 O O   . ASN C 13  ? 0.6498 0.6996 0.6811 0.0424  -0.0897 -0.0119 15  ASN C O   
3059 C CB  . ASN C 13  ? 0.5596 0.6596 0.6167 0.0440  -0.0644 -0.0225 15  ASN C CB  
3060 C CG  . ASN C 13  ? 0.5669 0.6891 0.6342 0.0421  -0.0586 -0.0251 15  ASN C CG  
3061 O OD1 . ASN C 13  ? 0.5574 0.6982 0.6339 0.0459  -0.0533 -0.0294 15  ASN C OD1 
3062 N ND2 . ASN C 13  ? 0.6377 0.7592 0.7031 0.0356  -0.0600 -0.0221 15  ASN C ND2 
3063 N N   . ASP C 14  ? 0.6135 0.6679 0.6480 0.0322  -0.0727 -0.0089 16  ASP C N   
3064 C CA  . ASP C 14  ? 0.6405 0.6729 0.6646 0.0311  -0.0815 -0.0041 16  ASP C CA  
3065 C C   . ASP C 14  ? 0.6290 0.6574 0.6477 0.0172  -0.0774 0.0047  16  ASP C C   
3066 O O   . ASP C 14  ? 0.6116 0.6436 0.6321 0.0121  -0.0684 0.0061  16  ASP C O   
3067 C CB  . ASP C 14  ? 0.6591 0.6891 0.6851 0.0380  -0.0797 -0.0085 16  ASP C CB  
3068 C CG  . ASP C 14  ? 0.7211 0.7653 0.7551 0.0516  -0.0795 -0.0184 16  ASP C CG  
3069 O OD1 . ASP C 14  ? 0.7639 0.8237 0.8058 0.0535  -0.0692 -0.0224 16  ASP C OD1 
3070 O OD2 . ASP C 14  ? 0.8228 0.8641 0.8551 0.0603  -0.0900 -0.0220 16  ASP C OD2 
3071 N N   . PRO C 15  ? 0.6433 0.6676 0.6556 0.0110  -0.0833 0.0104  17  PRO C N   
3072 C CA  . PRO C 15  ? 0.6347 0.6615 0.6426 -0.0017 -0.0779 0.0180  17  PRO C CA  
3073 C C   . PRO C 15  ? 0.6450 0.6603 0.6471 -0.0070 -0.0795 0.0239  17  PRO C C   
3074 O O   . PRO C 15  ? 0.6279 0.6506 0.6292 -0.0159 -0.0718 0.0281  17  PRO C O   
3075 C CB  . PRO C 15  ? 0.6550 0.6776 0.6549 -0.0068 -0.0868 0.0240  17  PRO C CB  
3076 C CG  . PRO C 15  ? 0.6463 0.6734 0.6518 0.0032  -0.0904 0.0167  17  PRO C CG  
3077 C CD  . PRO C 15  ? 0.6597 0.6806 0.6690 0.0147  -0.0935 0.0102  17  PRO C CD  
3078 N N   . GLU C 16  ? 0.6668 0.6643 0.6645 -0.0013 -0.0900 0.0238  18  GLU C N   
3079 C CA  . GLU C 16  ? 0.6785 0.6639 0.6702 -0.0074 -0.0928 0.0301  18  GLU C CA  
3080 C C   . GLU C 16  ? 0.6667 0.6505 0.6632 -0.0011 -0.0876 0.0245  18  GLU C C   
3081 O O   . GLU C 16  ? 0.6917 0.6630 0.6829 -0.0050 -0.0920 0.0293  18  GLU C O   
3082 C CB  . GLU C 16  ? 0.7136 0.6763 0.6930 -0.0113 -0.1105 0.0384  18  GLU C CB  
3083 C CG  . GLU C 16  ? 0.7304 0.6972 0.7029 -0.0256 -0.1121 0.0496  18  GLU C CG  
3084 C CD  . GLU C 16  ? 0.7755 0.7562 0.7506 -0.0250 -0.1086 0.0473  18  GLU C CD  
3085 O OE1 . GLU C 16  ? 0.8072 0.7781 0.7800 -0.0181 -0.1192 0.0450  18  GLU C OE1 
3086 O OE2 . GLU C 16  ? 0.7667 0.7678 0.7460 -0.0304 -0.0960 0.0471  18  GLU C OE2 
3087 N N   . LYS C 17  ? 0.6373 0.6344 0.6435 0.0075  -0.0787 0.0153  19  LYS C N   
3088 C CA  . LYS C 17  ? 0.6324 0.6280 0.6420 0.0142  -0.0755 0.0101  19  LYS C CA  
3089 C C   . LYS C 17  ? 0.6117 0.6140 0.6239 0.0061  -0.0644 0.0132  19  LYS C C   
3090 O O   . LYS C 17  ? 0.6069 0.6224 0.6224 -0.0012 -0.0553 0.0152  19  LYS C O   
3091 C CB  . LYS C 17  ? 0.6317 0.6416 0.6504 0.0254  -0.0705 0.0002  19  LYS C CB  
3092 C CG  . LYS C 17  ? 0.6493 0.6586 0.6702 0.0339  -0.0689 -0.0056 19  LYS C CG  
3093 C CD  . LYS C 17  ? 0.6487 0.6792 0.6798 0.0420  -0.0610 -0.0139 19  LYS C CD  
3094 C CE  . LYS C 17  ? 0.6844 0.7151 0.7162 0.0498  -0.0597 -0.0189 19  LYS C CE  
3095 N NZ  . LYS C 17  ? 0.6951 0.7499 0.7366 0.0560  -0.0518 -0.0255 19  LYS C NZ  
3096 N N   . VAL C 18  ? 0.5983 0.5909 0.6082 0.0076  -0.0661 0.0133  20  VAL C N   
3097 C CA  . VAL C 18  ? 0.5597 0.5608 0.5740 0.0030  -0.0547 0.0138  20  VAL C CA  
3098 C C   . VAL C 18  ? 0.5511 0.5613 0.5731 0.0125  -0.0479 0.0051  20  VAL C C   
3099 O O   . VAL C 18  ? 0.5741 0.5764 0.5941 0.0212  -0.0536 0.0010  20  VAL C O   
3100 C CB  . VAL C 18  ? 0.5586 0.5460 0.5666 -0.0020 -0.0593 0.0195  20  VAL C CB  
3101 C CG1 . VAL C 18  ? 0.4966 0.4957 0.5098 -0.0075 -0.0468 0.0203  20  VAL C CG1 
3102 C CG2 . VAL C 18  ? 0.5609 0.5371 0.5598 -0.0110 -0.0699 0.0291  20  VAL C CG2 
3103 N N   . TYR C 19  ? 0.5180 0.5451 0.5480 0.0107  -0.0365 0.0025  21  TYR C N   
3104 C CA  . TYR C 19  ? 0.4901 0.5287 0.5272 0.0178  -0.0306 -0.0041 21  TYR C CA  
3105 C C   . TYR C 19  ? 0.4818 0.5182 0.5193 0.0174  -0.0259 -0.0042 21  TYR C C   
3106 O O   . TYR C 19  ? 0.4710 0.5036 0.5069 0.0099  -0.0226 0.0004  21  TYR C O   
3107 C CB  . TYR C 19  ? 0.4701 0.5260 0.5152 0.0150  -0.0225 -0.0060 21  TYR C CB  
3108 C CG  . TYR C 19  ? 0.4704 0.5296 0.5155 0.0160  -0.0273 -0.0065 21  TYR C CG  
3109 C CD1 . TYR C 19  ? 0.4674 0.5359 0.5169 0.0244  -0.0299 -0.0119 21  TYR C CD1 
3110 C CD2 . TYR C 19  ? 0.4735 0.5282 0.5141 0.0088  -0.0295 -0.0016 21  TYR C CD2 
3111 C CE1 . TYR C 19  ? 0.4816 0.5529 0.5311 0.0256  -0.0348 -0.0124 21  TYR C CE1 
3112 C CE2 . TYR C 19  ? 0.5068 0.5639 0.5467 0.0095  -0.0344 -0.0017 21  TYR C CE2 
3113 C CZ  . TYR C 19  ? 0.5441 0.6085 0.5886 0.0178  -0.0372 -0.0071 21  TYR C CZ  
3114 O OH  . TYR C 19  ? 0.6242 0.6909 0.6680 0.0183  -0.0423 -0.0071 21  TYR C OH  
3115 N N   . GLY C 20  ? 0.4829 0.5231 0.5223 0.0262  -0.0260 -0.0097 22  GLY C N   
3116 C CA  . GLY C 20  ? 0.4875 0.5259 0.5266 0.0270  -0.0224 -0.0102 22  GLY C CA  
3117 C C   . GLY C 20  ? 0.4869 0.5432 0.5340 0.0259  -0.0119 -0.0124 22  GLY C C   
3118 O O   . GLY C 20  ? 0.4780 0.5488 0.5311 0.0260  -0.0086 -0.0143 22  GLY C O   
3119 N N   . SER C 21  ? 0.4931 0.5484 0.5403 0.0240  -0.0073 -0.0115 23  SER C N   
3120 C CA  . SER C 21  ? 0.5120 0.5829 0.5658 0.0223  0.0011  -0.0126 23  SER C CA  
3121 C C   . SER C 21  ? 0.5278 0.6157 0.5857 0.0299  0.0009  -0.0176 23  SER C C   
3122 O O   . SER C 21  ? 0.5527 0.6386 0.6071 0.0396  -0.0056 -0.0220 23  SER C O   
3123 C CB  . SER C 21  ? 0.5087 0.5756 0.5607 0.0215  0.0042  -0.0117 23  SER C CB  
3124 O OG  . SER C 21  ? 0.5522 0.6332 0.6101 0.0176  0.0116  -0.0111 23  SER C OG  
3125 N N   . GLY C 22  ? 0.5343 0.6393 0.5995 0.0254  0.0070  -0.0170 24  GLY C N   
3126 C CA  . GLY C 22  ? 0.5503 0.6769 0.6208 0.0310  0.0077  -0.0209 24  GLY C CA  
3127 C C   . GLY C 22  ? 0.5729 0.7061 0.6457 0.0351  0.0033  -0.0236 24  GLY C C   
3128 O O   . GLY C 22  ? 0.5881 0.7420 0.6679 0.0342  0.0062  -0.0244 24  GLY C O   
3129 N N   . GLU C 23  ? 0.5869 0.7034 0.6540 0.0388  -0.0042 -0.0244 25  GLU C N   
3130 C CA  . GLU C 23  ? 0.5925 0.7125 0.6607 0.0434  -0.0098 -0.0269 25  GLU C CA  
3131 C C   . GLU C 23  ? 0.5884 0.7197 0.6633 0.0347  -0.0050 -0.0241 25  GLU C C   
3132 O O   . GLU C 23  ? 0.5746 0.7100 0.6529 0.0260  0.0017  -0.0206 25  GLU C O   
3133 C CB  . GLU C 23  ? 0.5940 0.6908 0.6538 0.0445  -0.0189 -0.0254 25  GLU C CB  
3134 C CG  . GLU C 23  ? 0.6192 0.6968 0.6710 0.0466  -0.0234 -0.0245 25  GLU C CG  
3135 C CD  . GLU C 23  ? 0.7026 0.7621 0.7462 0.0533  -0.0363 -0.0258 25  GLU C CD  
3136 O OE1 . GLU C 23  ? 0.7287 0.7690 0.7655 0.0475  -0.0413 -0.0205 25  GLU C OE1 
3137 O OE2 . GLU C 23  ? 0.7644 0.8292 0.8081 0.0646  -0.0425 -0.0322 25  GLU C OE2 
3138 N N   . LYS C 24  ? 0.6087 0.7438 0.6850 0.0374  -0.0096 -0.0258 26  LYS C N   
3139 C CA  . LYS C 24  ? 0.6147 0.7616 0.6974 0.0303  -0.0064 -0.0240 26  LYS C CA  
3140 C C   . LYS C 24  ? 0.5996 0.7335 0.6781 0.0283  -0.0118 -0.0224 26  LYS C C   
3141 O O   . LYS C 24  ? 0.6153 0.7394 0.6885 0.0352  -0.0195 -0.0241 26  LYS C O   
3142 C CB  . LYS C 24  ? 0.1666 0.3387 0.2569 0.0363  -0.0064 -0.0281 26  LYS C CB  
3143 C CG  . LYS C 24  ? 0.1678 0.3466 0.2616 0.0358  -0.0098 -0.0287 26  LYS C CG  
3144 C CD  . LYS C 24  ? 0.1652 0.3739 0.2685 0.0389  -0.0078 -0.0315 26  LYS C CD  
3145 C CE  . LYS C 24  ? 0.1605 0.3798 0.2704 0.0294  -0.0061 -0.0285 26  LYS C CE  
3146 N NZ  . LYS C 24  ? 0.1535 0.3881 0.2699 0.0189  0.0008  -0.0242 26  LYS C NZ  
3147 N N   . VAL C 25  ? 0.5680 0.7013 0.6481 0.0188  -0.0085 -0.0191 27  VAL C N   
3148 C CA  . VAL C 25  ? 0.5545 0.6758 0.6293 0.0158  -0.0129 -0.0170 27  VAL C CA  
3149 C C   . VAL C 25  ? 0.5568 0.6904 0.6367 0.0146  -0.0141 -0.0183 27  VAL C C   
3150 O O   . VAL C 25  ? 0.5528 0.6986 0.6395 0.0092  -0.0092 -0.0182 27  VAL C O   
3151 C CB  . VAL C 25  ? 0.5323 0.6426 0.6028 0.0071  -0.0095 -0.0132 27  VAL C CB  
3152 C CG1 . VAL C 25  ? 0.5123 0.6185 0.5789 0.0032  -0.0128 -0.0114 27  VAL C CG1 
3153 C CG2 . VAL C 25  ? 0.5278 0.6247 0.5921 0.0082  -0.0104 -0.0112 27  VAL C CG2 
3154 N N   . ALA C 26  ? 0.5615 0.6910 0.6380 0.0191  -0.0215 -0.0192 28  ALA C N   
3155 C CA  . ALA C 26  ? 0.5581 0.7004 0.6398 0.0198  -0.0239 -0.0211 28  ALA C CA  
3156 C C   . ALA C 26  ? 0.5585 0.6907 0.6339 0.0190  -0.0306 -0.0194 28  ALA C C   
3157 O O   . ALA C 26  ? 0.5710 0.6872 0.6378 0.0216  -0.0370 -0.0175 28  ALA C O   
3158 C CB  . ALA C 26  ? 0.5597 0.7188 0.6478 0.0298  -0.0263 -0.0261 28  ALA C CB  
3159 N N   . GLY C 27  ? 0.5411 0.6828 0.6205 0.0148  -0.0301 -0.0197 29  GLY C N   
3160 C CA  . GLY C 27  ? 0.5442 0.6794 0.6181 0.0131  -0.0358 -0.0181 29  GLY C CA  
3161 C C   . GLY C 27  ? 0.5468 0.6957 0.6271 0.0099  -0.0354 -0.0197 29  GLY C C   
3162 O O   . GLY C 27  ? 0.5537 0.7191 0.6433 0.0115  -0.0333 -0.0223 29  GLY C O   
3163 N N   . ARG C 28  ? 0.5508 0.6939 0.6255 0.0051  -0.0378 -0.0179 30  ARG C N   
3164 C CA  . ARG C 28  ? 0.5640 0.7168 0.6425 0.0020  -0.0391 -0.0193 30  ARG C CA  
3165 C C   . ARG C 28  ? 0.5737 0.7193 0.6454 -0.0056 -0.0371 -0.0176 30  ARG C C   
3166 O O   . ARG C 28  ? 0.5834 0.7180 0.6462 -0.0071 -0.0371 -0.0148 30  ARG C O   
3167 C CB  . ARG C 28  ? 0.5874 0.7410 0.6641 0.0080  -0.0477 -0.0199 30  ARG C CB  
3168 C CG  . ARG C 28  ? 0.6057 0.7742 0.6916 0.0166  -0.0507 -0.0239 30  ARG C CG  
3169 C CD  . ARG C 28  ? 0.6458 0.8056 0.7264 0.0268  -0.0602 -0.0248 30  ARG C CD  
3170 N NE  . ARG C 28  ? 0.7035 0.8469 0.7729 0.0238  -0.0668 -0.0208 30  ARG C NE  
3171 C CZ  . ARG C 28  ? 0.7603 0.8859 0.8199 0.0272  -0.0744 -0.0180 30  ARG C CZ  
3172 N NH1 . ARG C 28  ? 0.8079 0.9277 0.8673 0.0351  -0.0770 -0.0200 30  ARG C NH1 
3173 N NH2 . ARG C 28  ? 0.7490 0.8624 0.7983 0.0220  -0.0801 -0.0128 30  ARG C NH2 
3174 N N   . VAL C 29  ? 0.5872 0.7399 0.6628 -0.0105 -0.0358 -0.0196 31  VAL C N   
3175 C CA  . VAL C 29  ? 0.5945 0.7420 0.6626 -0.0153 -0.0362 -0.0197 31  VAL C CA  
3176 C C   . VAL C 29  ? 0.6278 0.7798 0.6945 -0.0146 -0.0425 -0.0203 31  VAL C C   
3177 O O   . VAL C 29  ? 0.6207 0.7826 0.6954 -0.0137 -0.0448 -0.0221 31  VAL C O   
3178 C CB  . VAL C 29  ? 0.5812 0.7295 0.6519 -0.0204 -0.0326 -0.0223 31  VAL C CB  
3179 C CG1 . VAL C 29  ? 0.5842 0.7267 0.6453 -0.0226 -0.0325 -0.0233 31  VAL C CG1 
3180 C CG2 . VAL C 29  ? 0.5491 0.6950 0.6235 -0.0208 -0.0273 -0.0216 31  VAL C CG2 
3181 N N   . ILE C 30  ? 0.6700 0.8161 0.7265 -0.0152 -0.0456 -0.0181 32  ILE C N   
3182 C CA  . ILE C 30  ? 0.7167 0.8657 0.7711 -0.0137 -0.0527 -0.0177 32  ILE C CA  
3183 C C   . ILE C 30  ? 0.7506 0.9006 0.7975 -0.0181 -0.0538 -0.0187 32  ILE C C   
3184 O O   . ILE C 30  ? 0.7576 0.9035 0.7946 -0.0206 -0.0523 -0.0166 32  ILE C O   
3185 C CB  . ILE C 30  ? 0.7243 0.8663 0.7737 -0.0090 -0.0590 -0.0138 32  ILE C CB  
3186 C CG1 . ILE C 30  ? 0.6969 0.8384 0.7533 -0.0029 -0.0582 -0.0146 32  ILE C CG1 
3187 C CG2 . ILE C 30  ? 0.7436 0.8892 0.7919 -0.0070 -0.0671 -0.0140 32  ILE C CG2 
3188 C CD1 . ILE C 30  ? 0.6482 0.7825 0.7013 0.0043  -0.0671 -0.0128 32  ILE C CD1 
3189 N N   . VAL C 31  ? 0.7764 0.9337 0.8283 -0.0188 -0.0568 -0.0220 33  VAL C N   
3190 C CA  . VAL C 31  ? 0.8119 0.9713 0.8592 -0.0224 -0.0579 -0.0252 33  VAL C CA  
3191 C C   . VAL C 31  ? 0.8512 1.0141 0.8951 -0.0217 -0.0650 -0.0245 33  VAL C C   
3192 O O   . VAL C 31  ? 0.8557 1.0241 0.9073 -0.0194 -0.0690 -0.0248 33  VAL C O   
3193 C CB  . VAL C 31  ? 0.8075 0.9706 0.8634 -0.0254 -0.0565 -0.0298 33  VAL C CB  
3194 C CG1 . VAL C 31  ? 0.8339 0.9942 0.8824 -0.0280 -0.0570 -0.0343 33  VAL C CG1 
3195 C CG2 . VAL C 31  ? 0.7859 0.9472 0.8488 -0.0258 -0.0508 -0.0294 33  VAL C CG2 
3196 N N   . GLU C 32  ? 0.9003 1.0617 0.9323 -0.0234 -0.0667 -0.0235 34  GLU C N   
3197 C CA  . GLU C 32  ? 0.9519 1.1164 0.9786 -0.0235 -0.0738 -0.0225 34  GLU C CA  
3198 C C   . GLU C 32  ? 0.9835 1.1517 1.0026 -0.0262 -0.0738 -0.0267 34  GLU C C   
3199 O O   . GLU C 32  ? 0.9793 1.1469 0.9933 -0.0273 -0.0688 -0.0289 34  GLU C O   
3200 C CB  . GLU C 32  ? 0.9575 1.1168 0.9754 -0.0228 -0.0779 -0.0155 34  GLU C CB  
3201 C CG  . GLU C 32  ? 0.9733 1.1279 0.9985 -0.0182 -0.0801 -0.0130 34  GLU C CG  
3202 C CD  . GLU C 32  ? 1.0401 1.1909 1.0610 -0.0154 -0.0900 -0.0091 34  GLU C CD  
3203 O OE1 . GLU C 32  ? 1.0644 1.2161 1.0758 -0.0185 -0.0946 -0.0068 34  GLU C OE1 
3204 O OE2 . GLU C 32  ? 1.0367 1.1841 1.0636 -0.0095 -0.0937 -0.0088 34  GLU C OE2 
3205 N N   . VAL C 33  ? 1.0302 1.2027 1.0487 -0.0265 -0.0800 -0.0286 35  VAL C N   
3206 C CA  . VAL C 33  ? 1.0722 1.2485 1.0843 -0.0281 -0.0819 -0.0344 35  VAL C CA  
3207 C C   . VAL C 33  ? 1.1134 1.2940 1.1167 -0.0285 -0.0889 -0.0328 35  VAL C C   
3208 O O   . VAL C 33  ? 1.1192 1.2999 1.1262 -0.0274 -0.0944 -0.0290 35  VAL C O   
3209 C CB  . VAL C 33  ? 1.0666 1.2427 1.0891 -0.0293 -0.0824 -0.0411 35  VAL C CB  
3210 C CG1 . VAL C 33  ? 1.0772 1.2571 1.0984 -0.0304 -0.0897 -0.0452 35  VAL C CG1 
3211 C CG2 . VAL C 33  ? 1.0562 1.2279 1.0764 -0.0295 -0.0775 -0.0459 35  VAL C CG2 
3212 N N   . CYS C 34  ? 1.1493 1.3341 1.1408 -0.0294 -0.0891 -0.0361 36  CYS C N   
3213 C CA  . CYS C 34  ? 1.1906 1.3809 1.1720 -0.0302 -0.0956 -0.0351 36  CYS C CA  
3214 C C   . CYS C 34  ? 1.2065 1.3996 1.1886 -0.0299 -0.1010 -0.0428 36  CYS C C   
3215 O O   . CYS C 34  ? 1.2178 1.4150 1.1936 -0.0304 -0.1072 -0.0417 36  CYS C O   
3216 C CB  . CYS C 34  ? 1.2053 1.4020 1.1711 -0.0320 -0.0938 -0.0311 36  CYS C CB  
3217 S SG  . CYS C 34  ? 1.2368 1.4286 1.1993 -0.0346 -0.0970 -0.0177 36  CYS C SG  
3218 N N   . GLU C 35  ? 1.2097 1.3994 1.1991 -0.0295 -0.0994 -0.0500 37  GLU C N   
3219 C CA  . GLU C 35  ? 1.2278 1.4168 1.2225 -0.0304 -0.1059 -0.0563 37  GLU C CA  
3220 C C   . GLU C 35  ? 1.2173 1.4004 1.2255 -0.0323 -0.1051 -0.0595 37  GLU C C   
3221 O O   . GLU C 35  ? 1.2089 1.3869 1.2177 -0.0318 -0.1000 -0.0615 37  GLU C O   
3222 C CB  . GLU C 35  ? 1.2559 1.4477 1.2373 -0.0290 -0.1100 -0.0638 37  GLU C CB  
3223 C CG  . GLU C 35  ? 1.2666 1.4516 1.2500 -0.0284 -0.1128 -0.0736 37  GLU C CG  
3224 C CD  . GLU C 35  ? 1.2624 1.4455 1.2388 -0.0248 -0.1070 -0.0784 37  GLU C CD  
3225 O OE1 . GLU C 35  ? 1.2178 1.3940 1.2027 -0.0256 -0.1028 -0.0777 37  GLU C OE1 
3226 O OE2 . GLU C 35  ? 1.2760 1.4666 1.2384 -0.0211 -0.1067 -0.0825 37  GLU C OE2 
3227 N N   . VAL C 36  ? 1.2182 1.4035 1.2371 -0.0350 -0.1107 -0.0590 38  VAL C N   
3228 C CA  . VAL C 36  ? 1.2111 1.3939 1.2428 -0.0393 -0.1126 -0.0609 38  VAL C CA  
3229 C C   . VAL C 36  ? 1.2110 1.3835 1.2414 -0.0402 -0.1103 -0.0658 38  VAL C C   
3230 O O   . VAL C 36  ? 1.2328 1.3993 1.2525 -0.0383 -0.1135 -0.0730 38  VAL C O   
3231 C CB  . VAL C 36  ? 1.2313 1.4177 1.2665 -0.0428 -0.1226 -0.0635 38  VAL C CB  
3232 C CG1 . VAL C 36  ? 1.2657 1.4457 1.2876 -0.0417 -0.1286 -0.0718 38  VAL C CG1 
3233 C CG2 . VAL C 36  ? 1.2184 1.4073 1.2695 -0.0492 -0.1254 -0.0620 38  VAL C CG2 
3234 N N   . THR C 37  ? 1.1864 1.3574 1.2273 -0.0426 -0.1055 -0.0622 39  THR C N   
3235 C CA  . THR C 37  ? 1.1762 1.3365 1.2165 -0.0436 -0.1036 -0.0657 39  THR C CA  
3236 C C   . THR C 37  ? 1.1726 1.3316 1.2268 -0.0503 -0.1044 -0.0624 39  THR C C   
3237 O O   . THR C 37  ? 1.1673 1.3368 1.2326 -0.0523 -0.1013 -0.0560 39  THR C O   
3238 C CB  . THR C 37  ? 1.1567 1.3159 1.1921 -0.0389 -0.0944 -0.0639 39  THR C CB  
3239 O OG1 . THR C 37  ? 1.1523 1.3170 1.1765 -0.0345 -0.0929 -0.0634 39  THR C OG1 
3240 C CG2 . THR C 37  ? 1.1494 1.2975 1.1802 -0.0376 -0.0934 -0.0696 39  THR C CG2 
3241 N N   . ARG C 38  ? 1.1788 1.3256 1.2319 -0.0536 -0.1090 -0.0666 40  ARG C N   
3242 C CA  . ARG C 38  ? 1.1674 1.3122 1.2323 -0.0616 -0.1103 -0.0623 40  ARG C CA  
3243 C C   . ARG C 38  ? 1.1404 1.2778 1.2051 -0.0600 -0.1032 -0.0612 40  ARG C C   
3244 O O   . ARG C 38  ? 1.1540 1.2783 1.2089 -0.0559 -0.1043 -0.0676 40  ARG C O   
3245 C CB  . ARG C 38  ? 1.1944 1.3288 1.2593 -0.0686 -0.1227 -0.0658 40  ARG C CB  
3246 C CG  . ARG C 38  ? 1.2137 1.3566 1.2932 -0.0798 -0.1266 -0.0583 40  ARG C CG  
3247 C CD  . ARG C 38  ? 1.2515 1.3902 1.3317 -0.0874 -0.1402 -0.0602 40  ARG C CD  
3248 N NE  . ARG C 38  ? 1.2519 1.3986 1.3460 -0.1004 -0.1445 -0.0519 40  ARG C NE  
3249 C CZ  . ARG C 38  ? 1.2651 1.3973 1.3601 -0.1097 -0.1525 -0.0503 40  ARG C CZ  
3250 N NH1 . ARG C 38  ? 1.2907 1.3982 1.3735 -0.1057 -0.1577 -0.0579 40  ARG C NH1 
3251 N NH2 . ARG C 38  ? 1.2456 1.3889 1.3534 -0.1229 -0.1561 -0.0410 40  ARG C NH2 
3252 N N   . VAL C 39  ? 1.0927 1.2391 1.1678 -0.0625 -0.0966 -0.0539 41  VAL C N   
3253 C CA  . VAL C 39  ? 1.0473 1.1881 1.1223 -0.0606 -0.0892 -0.0524 41  VAL C CA  
3254 C C   . VAL C 39  ? 1.0371 1.1737 1.1203 -0.0690 -0.0911 -0.0484 41  VAL C C   
3255 O O   . VAL C 39  ? 1.0298 1.1797 1.1245 -0.0749 -0.0898 -0.0416 41  VAL C O   
3256 C CB  . VAL C 39  ? 1.0236 1.1760 1.1016 -0.0555 -0.0796 -0.0476 41  VAL C CB  
3257 C CG1 . VAL C 39  ? 1.0023 1.1505 1.0822 -0.0548 -0.0725 -0.0450 41  VAL C CG1 
3258 C CG2 . VAL C 39  ? 1.0205 1.1733 1.0877 -0.0480 -0.0779 -0.0507 41  VAL C CG2 
3259 N N   . LYS C 40  ? 1.0340 1.1532 1.1109 -0.0690 -0.0944 -0.0525 42  LYS C N   
3260 C CA  . LYS C 40  ? 1.0289 1.1405 1.1117 -0.0777 -0.0978 -0.0483 42  LYS C CA  
3261 C C   . LYS C 40  ? 0.9887 1.1099 1.0792 -0.0786 -0.0877 -0.0411 42  LYS C C   
3262 O O   . LYS C 40  ? 0.9833 1.1102 1.0828 -0.0880 -0.0890 -0.0341 42  LYS C O   
3263 C CB  . LYS C 40  ? 1.0507 1.1385 1.1234 -0.0761 -0.1057 -0.0556 42  LYS C CB  
3264 C CG  . LYS C 40  ? 1.0712 1.1469 1.1476 -0.0839 -0.1093 -0.0512 42  LYS C CG  
3265 C CD  . LYS C 40  ? 1.0939 1.1432 1.1597 -0.0816 -0.1205 -0.0595 42  LYS C CD  
3266 C CE  . LYS C 40  ? 1.1266 1.1629 1.1921 -0.0911 -0.1369 -0.0600 42  LYS C CE  
3267 N NZ  . LYS C 40  ? 1.1636 1.1731 1.2165 -0.0852 -0.1492 -0.0710 42  LYS C NZ  
3268 N N   . ALA C 41  ? 0.9503 1.0742 1.0366 -0.0693 -0.0782 -0.0425 43  ALA C N   
3269 C CA  . ALA C 41  ? 0.9059 1.0363 0.9972 -0.0682 -0.0689 -0.0373 43  ALA C CA  
3270 C C   . ALA C 41  ? 0.8770 1.0106 0.9627 -0.0582 -0.0606 -0.0390 43  ALA C C   
3271 O O   . ALA C 41  ? 0.8857 1.0122 0.9614 -0.0523 -0.0612 -0.0446 43  ALA C O   
3272 C CB  . ALA C 41  ? 0.9082 1.0240 0.9980 -0.0716 -0.0702 -0.0369 43  ALA C CB  
3273 N N   . VAL C 42  ? 0.8443 0.9895 0.9361 -0.0564 -0.0537 -0.0340 44  VAL C N   
3274 C CA  . VAL C 42  ? 0.8064 0.9505 0.8932 -0.0486 -0.0462 -0.0339 44  VAL C CA  
3275 C C   . VAL C 42  ? 0.7852 0.9269 0.8754 -0.0495 -0.0406 -0.0306 44  VAL C C   
3276 O O   . VAL C 42  ? 0.7785 0.9312 0.8775 -0.0524 -0.0386 -0.0260 44  VAL C O   
3277 C CB  . VAL C 42  ? 0.7946 0.9498 0.8819 -0.0433 -0.0445 -0.0323 44  VAL C CB  
3278 C CG1 . VAL C 42  ? 0.7731 0.9283 0.8587 -0.0378 -0.0382 -0.0298 44  VAL C CG1 
3279 C CG2 . VAL C 42  ? 0.7904 0.9425 0.8688 -0.0406 -0.0481 -0.0360 44  VAL C CG2 
3280 N N   . ARG C 43  ? 0.7708 0.9000 0.8539 -0.0469 -0.0385 -0.0332 45  ARG C N   
3281 C CA  . ARG C 43  ? 0.7536 0.8782 0.8388 -0.0478 -0.0340 -0.0306 45  ARG C CA  
3282 C C   . ARG C 43  ? 0.7144 0.8382 0.7950 -0.0411 -0.0273 -0.0302 45  ARG C C   
3283 O O   . ARG C 43  ? 0.7120 0.8354 0.7857 -0.0365 -0.0268 -0.0324 45  ARG C O   
3284 C CB  . ARG C 43  ? 0.7734 0.8828 0.8547 -0.0504 -0.0383 -0.0340 45  ARG C CB  
3285 C CG  . ARG C 43  ? 0.8184 0.9246 0.9057 -0.0599 -0.0444 -0.0309 45  ARG C CG  
3286 C CD  . ARG C 43  ? 0.8878 0.9749 0.9684 -0.0610 -0.0527 -0.0364 45  ARG C CD  
3287 N NE  . ARG C 43  ? 0.9465 1.0300 1.0189 -0.0544 -0.0558 -0.0443 45  ARG C NE  
3288 C CZ  . ARG C 43  ? 0.9491 1.0238 1.0124 -0.0467 -0.0558 -0.0515 45  ARG C CZ  
3289 N NH1 . ARG C 43  ? 0.9222 0.9886 0.9838 -0.0444 -0.0535 -0.0521 45  ARG C NH1 
3290 N NH2 . ARG C 43  ? 0.9608 1.0368 1.0169 -0.0410 -0.0583 -0.0583 45  ARG C NH2 
3291 N N   . ILE C 44  ? 0.6806 0.8046 0.7647 -0.0413 -0.0227 -0.0268 46  ILE C N   
3292 C CA  . ILE C 44  ? 0.6547 0.7745 0.7340 -0.0363 -0.0175 -0.0264 46  ILE C CA  
3293 C C   . ILE C 44  ? 0.6494 0.7615 0.7292 -0.0377 -0.0149 -0.0255 46  ILE C C   
3294 O O   . ILE C 44  ? 0.6627 0.7765 0.7486 -0.0425 -0.0152 -0.0225 46  ILE C O   
3295 C CB  . ILE C 44  ? 0.6417 0.7694 0.7231 -0.0323 -0.0141 -0.0229 46  ILE C CB  
3296 C CG1 . ILE C 44  ? 0.6329 0.7700 0.7232 -0.0344 -0.0126 -0.0196 46  ILE C CG1 
3297 C CG2 . ILE C 44  ? 0.6414 0.7736 0.7197 -0.0293 -0.0168 -0.0233 46  ILE C CG2 
3298 C CD1 . ILE C 44  ? 0.5961 0.7366 0.6867 -0.0287 -0.0091 -0.0177 46  ILE C CD1 
3299 N N   . LEU C 45  ? 0.6320 0.7376 0.7055 -0.0337 -0.0123 -0.0274 47  LEU C N   
3300 C CA  . LEU C 45  ? 0.5972 0.6968 0.6707 -0.0333 -0.0089 -0.0261 47  LEU C CA  
3301 C C   . LEU C 45  ? 0.5731 0.6749 0.6434 -0.0288 -0.0041 -0.0240 47  LEU C C   
3302 O O   . LEU C 45  ? 0.5599 0.6641 0.6249 -0.0262 -0.0043 -0.0248 47  LEU C O   
3303 C CB  . LEU C 45  ? 0.6031 0.6923 0.6721 -0.0328 -0.0119 -0.0311 47  LEU C CB  
3304 C CG  . LEU C 45  ? 0.6173 0.7006 0.6832 -0.0297 -0.0087 -0.0319 47  LEU C CG  
3305 C CD1 . LEU C 45  ? 0.6080 0.6871 0.6787 -0.0330 -0.0071 -0.0277 47  LEU C CD1 
3306 C CD2 . LEU C 45  ? 0.6639 0.7398 0.7244 -0.0267 -0.0133 -0.0391 47  LEU C CD2 
3307 N N   . ALA C 46  ? 0.5586 0.6597 0.6318 -0.0287 -0.0007 -0.0207 48  ALA C N   
3308 C CA  . ALA C 46  ? 0.5515 0.6525 0.6220 -0.0252 0.0026  -0.0182 48  ALA C CA  
3309 C C   . ALA C 46  ? 0.5498 0.6443 0.6194 -0.0249 0.0056  -0.0176 48  ALA C C   
3310 O O   . ALA C 46  ? 0.5581 0.6514 0.6319 -0.0271 0.0065  -0.0163 48  ALA C O   
3311 C CB  . ALA C 46  ? 0.5447 0.6522 0.6193 -0.0236 0.0029  -0.0153 48  ALA C CB  
3312 N N   . CYS C 47  ? 0.5499 0.6417 0.6142 -0.0228 0.0070  -0.0181 49  CYS C N   
3313 C CA  . CYS C 47  ? 0.5567 0.6429 0.6204 -0.0223 0.0095  -0.0180 49  CYS C CA  
3314 C C   . CYS C 47  ? 0.5363 0.6221 0.5975 -0.0206 0.0118  -0.0146 49  CYS C C   
3315 O O   . CYS C 47  ? 0.5511 0.6398 0.6090 -0.0200 0.0108  -0.0123 49  CYS C O   
3316 C CB  . CYS C 47  ? 0.5753 0.6593 0.6354 -0.0210 0.0084  -0.0228 49  CYS C CB  
3317 S SG  . CYS C 47  ? 0.6867 0.7671 0.7485 -0.0229 0.0031  -0.0277 49  CYS C SG  
3318 N N   . GLY C 48  ? 0.5103 0.5914 0.5724 -0.0204 0.0140  -0.0138 50  GLY C N   
3319 C CA  . GLY C 48  ? 0.4972 0.5766 0.5564 -0.0192 0.0158  -0.0108 50  GLY C CA  
3320 C C   . GLY C 48  ? 0.4926 0.5686 0.5517 -0.0188 0.0173  -0.0128 50  GLY C C   
3321 O O   . GLY C 48  ? 0.4904 0.5616 0.5525 -0.0195 0.0173  -0.0140 50  GLY C O   
3322 N N   . VAL C 49  ? 0.4885 0.5681 0.5439 -0.0179 0.0181  -0.0129 51  VAL C N   
3323 C CA  . VAL C 49  ? 0.4740 0.5519 0.5294 -0.0162 0.0192  -0.0156 51  VAL C CA  
3324 C C   . VAL C 49  ? 0.4645 0.5476 0.5172 -0.0161 0.0208  -0.0128 51  VAL C C   
3325 O O   . VAL C 49  ? 0.4670 0.5576 0.5165 -0.0178 0.0205  -0.0100 51  VAL C O   
3326 C CB  . VAL C 49  ? 0.4791 0.5584 0.5339 -0.0138 0.0170  -0.0223 51  VAL C CB  
3327 C CG1 . VAL C 49  ? 0.4732 0.5620 0.5247 -0.0136 0.0162  -0.0237 51  VAL C CG1 
3328 C CG2 . VAL C 49  ? 0.4733 0.5531 0.5271 -0.0102 0.0173  -0.0260 51  VAL C CG2 
3329 N N   . ALA C 50  ? 0.4713 0.5504 0.5252 -0.0151 0.0220  -0.0128 52  ALA C N   
3330 C CA  . ALA C 50  ? 0.4717 0.5570 0.5239 -0.0151 0.0234  -0.0106 52  ALA C CA  
3331 C C   . ALA C 50  ? 0.4810 0.5722 0.5335 -0.0109 0.0237  -0.0165 52  ALA C C   
3332 O O   . ALA C 50  ? 0.4785 0.5620 0.5327 -0.0079 0.0222  -0.0215 52  ALA C O   
3333 C CB  . ALA C 50  ? 0.4487 0.5255 0.5018 -0.0165 0.0240  -0.0060 52  ALA C CB  
3334 N N   . LYS C 51  ? 0.5089 0.6148 0.5593 -0.0108 0.0248  -0.0160 53  LYS C N   
3335 C CA  . LYS C 51  ? 0.5439 0.6590 0.5948 -0.0056 0.0252  -0.0217 53  LYS C CA  
3336 C C   . LYS C 51  ? 0.5497 0.6726 0.6009 -0.0082 0.0270  -0.0162 53  LYS C C   
3337 O O   . LYS C 51  ? 0.5679 0.7031 0.6168 -0.0131 0.0277  -0.0105 53  LYS C O   
3338 C CB  . LYS C 51  ? 0.5549 0.6874 0.6030 -0.0021 0.0250  -0.0272 53  LYS C CB  
3339 C CG  . LYS C 51  ? 0.5855 0.7103 0.6332 0.0022  0.0219  -0.0348 53  LYS C CG  
3340 C CD  . LYS C 51  ? 0.6346 0.7715 0.6786 0.0015  0.0218  -0.0358 53  LYS C CD  
3341 C CE  . LYS C 51  ? 0.6702 0.7969 0.7136 0.0054  0.0176  -0.0435 53  LYS C CE  
3342 N NZ  . LYS C 51  ? 0.6943 0.8247 0.7353 0.0014  0.0174  -0.0408 53  LYS C NZ  
3343 N N   . VAL C 52  ? 0.5522 0.6677 0.6060 -0.0061 0.0270  -0.0170 54  VAL C N   
3344 C CA  . VAL C 52  ? 0.5554 0.6817 0.6098 -0.0075 0.0282  -0.0134 54  VAL C CA  
3345 C C   . VAL C 52  ? 0.5639 0.7063 0.6195 0.0000  0.0284  -0.0216 54  VAL C C   
3346 O O   . VAL C 52  ? 0.5778 0.7120 0.6342 0.0071  0.0262  -0.0298 54  VAL C O   
3347 C CB  . VAL C 52  ? 0.5516 0.6626 0.6077 -0.0095 0.0279  -0.0092 54  VAL C CB  
3348 C CG1 . VAL C 52  ? 0.5509 0.6715 0.6066 -0.0145 0.0282  -0.0022 54  VAL C CG1 
3349 C CG2 . VAL C 52  ? 0.5541 0.6473 0.6094 -0.0128 0.0270  -0.0056 54  VAL C CG2 
3350 N N   . LEU C 53  ? 0.5626 0.7287 0.6178 -0.0014 0.0301  -0.0194 55  LEU C N   
3351 C CA  . LEU C 53  ? 0.5679 0.7559 0.6237 0.0068  0.0305  -0.0281 55  LEU C CA  
3352 C C   . LEU C 53  ? 0.5535 0.7645 0.6113 0.0039  0.0325  -0.0233 55  LEU C C   
3353 O O   . LEU C 53  ? 0.5521 0.7709 0.6087 -0.0063 0.0335  -0.0127 55  LEU C O   
3354 C CB  . LEU C 53  ? 0.5866 0.7889 0.6388 0.0077  0.0309  -0.0312 55  LEU C CB  
3355 C CG  . LEU C 53  ? 0.6380 0.8634 0.6891 0.0182  0.0306  -0.0426 55  LEU C CG  
3356 C CD1 . LEU C 53  ? 0.6721 0.8812 0.7210 0.0270  0.0263  -0.0539 55  LEU C CD1 
3357 C CD2 . LEU C 53  ? 0.6512 0.9090 0.6994 0.0137  0.0336  -0.0385 55  LEU C CD2 
3358 N N   . TRP C 54  ? 0.5325 0.7535 0.5932 0.0124  0.0320  -0.0306 56  TRP C N   
3359 C CA  . TRP C 54  ? 0.5132 0.7587 0.5770 0.0100  0.0338  -0.0263 56  TRP C CA  
3360 C C   . TRP C 54  ? 0.5158 0.7804 0.5824 0.0227  0.0332  -0.0378 56  TRP C C   
3361 O O   . TRP C 54  ? 0.5165 0.7679 0.5826 0.0336  0.0299  -0.0489 56  TRP C O   
3362 C CB  . TRP C 54  ? 0.4880 0.7173 0.5537 0.0019  0.0332  -0.0166 56  TRP C CB  
3363 C CG  . TRP C 54  ? 0.4938 0.7012 0.5619 0.0085  0.0310  -0.0217 56  TRP C CG  
3364 C CD1 . TRP C 54  ? 0.4853 0.7007 0.5572 0.0132  0.0303  -0.0244 56  TRP C CD1 
3365 C CD2 . TRP C 54  ? 0.4895 0.6641 0.5564 0.0102  0.0288  -0.0237 56  TRP C CD2 
3366 N NE1 . TRP C 54  ? 0.5024 0.6906 0.5748 0.0178  0.0275  -0.0279 56  TRP C NE1 
3367 C CE2 . TRP C 54  ? 0.4666 0.6306 0.5359 0.0155  0.0266  -0.0273 56  TRP C CE2 
3368 C CE3 . TRP C 54  ? 0.4925 0.6483 0.5565 0.0076  0.0283  -0.0229 56  TRP C CE3 
3369 C CZ2 . TRP C 54  ? 0.4701 0.6058 0.5386 0.0171  0.0239  -0.0289 56  TRP C CZ2 
3370 C CZ3 . TRP C 54  ? 0.4960 0.6254 0.5600 0.0096  0.0259  -0.0249 56  TRP C CZ3 
3371 C CH2 . TRP C 54  ? 0.4582 0.5780 0.5240 0.0138  0.0237  -0.0275 56  TRP C CH2 
3372 N N   . MET C 55  ? 0.5210 0.8180 0.5902 0.0211  0.0354  -0.0350 57  MET C N   
3373 C CA  . MET C 55  ? 0.5282 0.8458 0.6010 0.0340  0.0345  -0.0459 57  MET C CA  
3374 C C   . MET C 55  ? 0.5171 0.8226 0.5942 0.0337  0.0330  -0.0433 57  MET C C   
3375 O O   . MET C 55  ? 0.5001 0.7993 0.5782 0.0215  0.0340  -0.0310 57  MET C O   
3376 C CB  . MET C 55  ? 0.5474 0.9124 0.6213 0.0328  0.0381  -0.0446 57  MET C CB  
3377 C CG  . MET C 55  ? 0.5026 0.8840 0.5715 0.0329  0.0398  -0.0469 57  MET C CG  
3378 S SD  . MET C 55  ? 0.5228 0.8907 0.5886 0.0521  0.0356  -0.0666 57  MET C SD  
3379 C CE  . MET C 55  ? 0.4957 0.8898 0.5648 0.0720  0.0329  -0.0836 57  MET C CE  
3380 N N   . GLN C 56  ? 0.5242 0.8238 0.6033 0.0474  0.0293  -0.0551 58  GLN C N   
3381 C CA  . GLN C 56  ? 0.5341 0.8261 0.6174 0.0490  0.0273  -0.0541 58  GLN C CA  
3382 C C   . GLN C 56  ? 0.5480 0.8721 0.6343 0.0633  0.0261  -0.0663 58  GLN C C   
3383 O O   . GLN C 56  ? 0.5643 0.8800 0.6490 0.0779  0.0211  -0.0802 58  GLN C O   
3384 C CB  . GLN C 56  ? 0.5459 0.7952 0.6274 0.0527  0.0223  -0.0574 58  GLN C CB  
3385 C CG  . GLN C 56  ? 0.5985 0.8312 0.6829 0.0485  0.0210  -0.0511 58  GLN C CG  
3386 C CD  . GLN C 56  ? 0.6697 0.8873 0.7526 0.0328  0.0239  -0.0366 58  GLN C CD  
3387 O OE1 . GLN C 56  ? 0.6978 0.8887 0.7770 0.0284  0.0235  -0.0336 58  GLN C OE1 
3388 N NE2 . GLN C 56  ? 0.6859 0.9208 0.7716 0.0247  0.0260  -0.0278 58  GLN C NE2 
3389 N N   . GLY C 57  ? 0.5506 0.9132 0.6410 0.0589  0.0300  -0.0612 59  GLY C N   
3390 C CA  . GLY C 57  ? 0.5656 0.9697 0.6590 0.0715  0.0303  -0.0719 59  GLY C CA  
3391 C C   . GLY C 57  ? 0.5912 1.0041 0.6798 0.0815  0.0297  -0.0832 59  GLY C C   
3392 O O   . GLY C 57  ? 0.5844 0.9992 0.6689 0.0725  0.0329  -0.0770 59  GLY C O   
3393 N N   . SER C 58  ? 0.6271 1.0437 0.7155 0.1008  0.0245  -0.1003 60  SER C N   
3394 C CA  . SER C 58  ? 0.6591 1.0923 0.7431 0.1139  0.0229  -0.1141 60  SER C CA  
3395 C C   . SER C 58  ? 0.6579 1.0521 0.7350 0.1132  0.0193  -0.1165 60  SER C C   
3396 O O   . SER C 58  ? 0.6734 1.0775 0.7459 0.1220  0.0178  -0.1266 60  SER C O   
3397 C CB  . SER C 58  ? 0.6825 1.1274 0.7683 0.1363  0.0162  -0.1326 60  SER C CB  
3398 O OG  . SER C 58  ? 0.7629 1.2027 0.8428 0.1523  0.0101  -0.1492 60  SER C OG  
3399 N N   . GLN C 59  ? 0.6540 1.0058 0.7306 0.1025  0.0181  -0.1070 61  GLN C N   
3400 C CA  . GLN C 59  ? 0.6596 0.9685 0.7311 0.1037  0.0124  -0.1104 61  GLN C CA  
3401 C C   . GLN C 59  ? 0.6265 0.9161 0.6964 0.0853  0.0172  -0.0950 61  GLN C C   
3402 O O   . GLN C 59  ? 0.6049 0.8929 0.6779 0.0727  0.0214  -0.0818 61  GLN C O   
3403 C CB  . GLN C 59  ? 0.6730 0.9491 0.7458 0.1096  0.0049  -0.1142 61  GLN C CB  
3404 C CG  . GLN C 59  ? 0.7450 0.9761 0.8131 0.1103  -0.0026 -0.1170 61  GLN C CG  
3405 C CD  . GLN C 59  ? 0.8616 1.0828 0.9260 0.1288  -0.0139 -0.1346 61  GLN C CD  
3406 O OE1 . GLN C 59  ? 0.9050 1.1106 0.9640 0.1327  -0.0193 -0.1413 61  GLN C OE1 
3407 N NE2 . GLN C 59  ? 0.8901 1.1198 0.9573 0.1410  -0.0186 -0.1427 61  GLN C NE2 
3408 N N   . GLN C 60  ? 0.6241 0.8978 0.6891 0.0845  0.0156  -0.0971 62  GLN C N   
3409 C CA  . GLN C 60  ? 0.5964 0.8535 0.6598 0.0689  0.0194  -0.0841 62  GLN C CA  
3410 C C   . GLN C 60  ? 0.5765 0.7912 0.6393 0.0655  0.0152  -0.0814 62  GLN C C   
3411 O O   . GLN C 60  ? 0.5986 0.7938 0.6597 0.0749  0.0080  -0.0911 62  GLN C O   
3412 C CB  . GLN C 60  ? 0.6035 0.8699 0.6622 0.0693  0.0202  -0.0873 62  GLN C CB  
3413 C CG  . GLN C 60  ? 0.6322 0.8881 0.6892 0.0544  0.0241  -0.0745 62  GLN C CG  
3414 C CD  . GLN C 60  ? 0.7143 0.9796 0.7664 0.0560  0.0242  -0.0787 62  GLN C CD  
3415 O OE1 . GLN C 60  ? 0.7722 1.0390 0.8216 0.0686  0.0195  -0.0923 62  GLN C OE1 
3416 N NE2 . GLN C 60  ? 0.6879 0.9596 0.7383 0.0438  0.0284  -0.0677 62  GLN C NE2 
3417 N N   . CYS C 61  ? 0.5459 0.7468 0.6097 0.0520  0.0189  -0.0682 63  CYS C N   
3418 C CA  . CYS C 61  ? 0.5393 0.7046 0.6026 0.0477  0.0158  -0.0645 63  CYS C CA  
3419 C C   . CYS C 61  ? 0.5181 0.6749 0.5793 0.0374  0.0188  -0.0567 63  CYS C C   
3420 O O   . CYS C 61  ? 0.5140 0.6841 0.5753 0.0290  0.0236  -0.0479 63  CYS C O   
3421 C CB  . CYS C 61  ? 0.5268 0.6831 0.5933 0.0432  0.0167  -0.0574 63  CYS C CB  
3422 S SG  . CYS C 61  ? 0.6207 0.7914 0.6903 0.0557  0.0132  -0.0667 63  CYS C SG  
3423 N N   . LYS C 62  ? 0.5102 0.6439 0.5693 0.0378  0.0148  -0.0593 64  LYS C N   
3424 C CA  . LYS C 62  ? 0.4986 0.6246 0.5560 0.0295  0.0168  -0.0532 64  LYS C CA  
3425 C C   . LYS C 62  ? 0.4655 0.5636 0.5234 0.0242  0.0147  -0.0486 64  LYS C C   
3426 O O   . LYS C 62  ? 0.4692 0.5508 0.5266 0.0283  0.0091  -0.0535 64  LYS C O   
3427 C CB  . LYS C 62  ? 0.5300 0.6620 0.5842 0.0353  0.0141  -0.0618 64  LYS C CB  
3428 C CG  . LYS C 62  ? 0.5762 0.7038 0.6286 0.0283  0.0156  -0.0572 64  LYS C CG  
3429 C CD  . LYS C 62  ? 0.6579 0.7906 0.7067 0.0354  0.0117  -0.0673 64  LYS C CD  
3430 C CE  . LYS C 62  ? 0.7042 0.8340 0.7513 0.0287  0.0129  -0.0629 64  LYS C CE  
3431 N NZ  . LYS C 62  ? 0.7636 0.9066 0.8064 0.0356  0.0104  -0.0723 64  LYS C NZ  
3432 N N   . GLN C 63  ? 0.4339 0.5276 0.4923 0.0151  0.0185  -0.0390 65  GLN C N   
3433 C CA  . GLN C 63  ? 0.4183 0.4917 0.4768 0.0100  0.0172  -0.0350 65  GLN C CA  
3434 C C   . GLN C 63  ? 0.4149 0.4901 0.4721 0.0058  0.0184  -0.0329 65  GLN C C   
3435 O O   . GLN C 63  ? 0.3980 0.4859 0.4545 0.0026  0.0218  -0.0287 65  GLN C O   
3436 C CB  . GLN C 63  ? 0.3986 0.4647 0.4584 0.0047  0.0197  -0.0270 65  GLN C CB  
3437 C CG  . GLN C 63  ? 0.3981 0.4473 0.4581 0.0003  0.0184  -0.0235 65  GLN C CG  
3438 C CD  . GLN C 63  ? 0.3817 0.4250 0.4422 -0.0037 0.0207  -0.0167 65  GLN C CD  
3439 O OE1 . GLN C 63  ? 0.4035 0.4534 0.4639 -0.0041 0.0228  -0.0139 65  GLN C OE1 
3440 N NE2 . GLN C 63  ? 0.3176 0.3497 0.3781 -0.0069 0.0197  -0.0139 65  GLN C NE2 
3441 N N   . THR C 64  ? 0.4133 0.4759 0.4704 0.0053  0.0148  -0.0352 66  THR C N   
3442 C CA  . THR C 64  ? 0.4015 0.4647 0.4580 0.0013  0.0153  -0.0333 66  THR C CA  
3443 C C   . THR C 64  ? 0.3979 0.4495 0.4564 -0.0051 0.0158  -0.0269 66  THR C C   
3444 O O   . THR C 64  ? 0.4154 0.4550 0.4748 -0.0063 0.0129  -0.0265 66  THR C O   
3445 C CB  . THR C 64  ? 0.4125 0.4739 0.4671 0.0054  0.0103  -0.0413 66  THR C CB  
3446 O OG1 . THR C 64  ? 0.4509 0.5281 0.5033 0.0119  0.0106  -0.0476 66  THR C OG1 
3447 C CG2 . THR C 64  ? 0.4008 0.4620 0.4554 0.0011  0.0102  -0.0393 66  THR C CG2 
3448 N N   . SER C 65  ? 0.3848 0.4410 0.4435 -0.0089 0.0188  -0.0218 67  SER C N   
3449 C CA  . SER C 65  ? 0.3878 0.4376 0.4485 -0.0132 0.0193  -0.0173 67  SER C CA  
3450 C C   . SER C 65  ? 0.4181 0.4717 0.4794 -0.0155 0.0190  -0.0165 67  SER C C   
3451 O O   . SER C 65  ? 0.4268 0.4878 0.4867 -0.0154 0.0206  -0.0149 67  SER C O   
3452 C CB  . SER C 65  ? 0.3611 0.4121 0.4216 -0.0143 0.0224  -0.0120 67  SER C CB  
3453 O OG  . SER C 65  ? 0.3840 0.4311 0.4444 -0.0128 0.0225  -0.0122 67  SER C OG  
3454 N N   . GLU C 66  ? 0.4432 0.4920 0.5066 -0.0183 0.0164  -0.0167 68  GLU C N   
3455 C CA  . GLU C 66  ? 0.4599 0.5135 0.5249 -0.0208 0.0161  -0.0154 68  GLU C CA  
3456 C C   . GLU C 66  ? 0.4715 0.5280 0.5387 -0.0227 0.0188  -0.0104 68  GLU C C   
3457 O O   . GLU C 66  ? 0.4844 0.5376 0.5531 -0.0247 0.0192  -0.0079 68  GLU C O   
3458 C CB  . GLU C 66  ? 0.4649 0.5137 0.5315 -0.0239 0.0115  -0.0174 68  GLU C CB  
3459 C CG  . GLU C 66  ? 0.4927 0.5413 0.5567 -0.0210 0.0080  -0.0234 68  GLU C CG  
3460 C CD  . GLU C 66  ? 0.5624 0.6041 0.6274 -0.0244 0.0018  -0.0253 68  GLU C CD  
3461 O OE1 . GLU C 66  ? 0.5871 0.6335 0.6545 -0.0282 0.0011  -0.0232 68  GLU C OE1 
3462 O OE2 . GLU C 66  ? 0.6078 0.6386 0.6709 -0.0232 -0.0036 -0.0288 68  GLU C OE2 
3463 N N   . TYR C 67  ? 0.4766 0.5395 0.5433 -0.0214 0.0200  -0.0092 69  TYR C N   
3464 C CA  . TYR C 67  ? 0.4745 0.5414 0.5430 -0.0211 0.0213  -0.0061 69  TYR C CA  
3465 C C   . TYR C 67  ? 0.4971 0.5715 0.5691 -0.0227 0.0202  -0.0061 69  TYR C C   
3466 O O   . TYR C 67  ? 0.5039 0.5847 0.5782 -0.0220 0.0212  -0.0044 69  TYR C O   
3467 C CB  . TYR C 67  ? 0.4632 0.5299 0.5284 -0.0178 0.0216  -0.0047 69  TYR C CB  
3468 C CG  . TYR C 67  ? 0.4544 0.5155 0.5171 -0.0171 0.0227  -0.0037 69  TYR C CG  
3469 C CD1 . TYR C 67  ? 0.4551 0.5154 0.5154 -0.0173 0.0226  -0.0046 69  TYR C CD1 
3470 C CD2 . TYR C 67  ? 0.4758 0.5343 0.5387 -0.0162 0.0239  -0.0020 69  TYR C CD2 
3471 C CE1 . TYR C 67  ? 0.4243 0.4814 0.4830 -0.0168 0.0236  -0.0035 69  TYR C CE1 
3472 C CE2 . TYR C 67  ? 0.4554 0.5083 0.5161 -0.0158 0.0247  -0.0009 69  TYR C CE2 
3473 C CZ  . TYR C 67  ? 0.4153 0.4676 0.4743 -0.0163 0.0244  -0.0016 69  TYR C CZ  
3474 O OH  . TYR C 67  ? 0.4426 0.4917 0.5004 -0.0159 0.0250  -0.0005 69  TYR C OH  
3475 N N   . LEU C 68  ? 0.5150 0.5901 0.5874 -0.0244 0.0179  -0.0084 70  LEU C N   
3476 C CA  . LEU C 68  ? 0.5326 0.6157 0.6082 -0.0257 0.0163  -0.0084 70  LEU C CA  
3477 C C   . LEU C 68  ? 0.5674 0.6485 0.6433 -0.0288 0.0130  -0.0110 70  LEU C C   
3478 O O   . LEU C 68  ? 0.5842 0.6649 0.6571 -0.0268 0.0117  -0.0137 70  LEU C O   
3479 C CB  . LEU C 68  ? 0.5241 0.6111 0.5977 -0.0216 0.0159  -0.0086 70  LEU C CB  
3480 C CG  . LEU C 68  ? 0.5302 0.6255 0.6068 -0.0224 0.0136  -0.0095 70  LEU C CG  
3481 C CD1 . LEU C 68  ? 0.5291 0.6356 0.6116 -0.0228 0.0143  -0.0079 70  LEU C CD1 
3482 C CD2 . LEU C 68  ? 0.4817 0.5776 0.5548 -0.0192 0.0114  -0.0101 70  LEU C CD2 
3483 N N   . ARG C 69  ? 0.6166 0.6971 0.6959 -0.0340 0.0107  -0.0098 71  ARG C N   
3484 C CA  . ARG C 69  ? 0.6661 0.7435 0.7457 -0.0373 0.0057  -0.0122 71  ARG C CA  
3485 C C   . ARG C 69  ? 0.7057 0.7937 0.7907 -0.0421 0.0040  -0.0096 71  ARG C C   
3486 O O   . ARG C 69  ? 0.7282 0.8202 0.8173 -0.0483 0.0031  -0.0053 71  ARG C O   
3487 C CB  . ARG C 69  ? 0.6660 0.7308 0.7440 -0.0403 0.0014  -0.0133 71  ARG C CB  
3488 C CG  . ARG C 69  ? 0.6843 0.7435 0.7601 -0.0404 -0.0045 -0.0182 71  ARG C CG  
3489 C CD  . ARG C 69  ? 0.7108 0.7564 0.7853 -0.0441 -0.0116 -0.0193 71  ARG C CD  
3490 N NE  . ARG C 69  ? 0.6797 0.7168 0.7517 -0.0413 -0.0106 -0.0197 71  ARG C NE  
3491 C CZ  . ARG C 69  ? 0.7123 0.7390 0.7845 -0.0463 -0.0152 -0.0167 71  ARG C CZ  
3492 N NH1 . ARG C 69  ? 0.7453 0.7697 0.8200 -0.0553 -0.0211 -0.0123 71  ARG C NH1 
3493 N NH2 . ARG C 69  ? 0.7271 0.7461 0.7969 -0.0431 -0.0144 -0.0173 71  ARG C NH2 
3494 N N   . TYR C 70  ? 0.7319 0.8259 0.8170 -0.0399 0.0032  -0.0117 72  TYR C N   
3495 C CA  . TYR C 70  ? 0.7536 0.8614 0.8443 -0.0423 0.0026  -0.0096 72  TYR C CA  
3496 C C   . TYR C 70  ? 0.7666 0.8726 0.8564 -0.0437 -0.0023 -0.0127 72  TYR C C   
3497 O O   . TYR C 70  ? 0.7733 0.8759 0.8582 -0.0389 -0.0023 -0.0163 72  TYR C O   
3498 C CB  . TYR C 70  ? 0.7479 0.8650 0.8389 -0.0356 0.0064  -0.0093 72  TYR C CB  
3499 C CG  . TYR C 70  ? 0.7788 0.9118 0.8755 -0.0358 0.0054  -0.0085 72  TYR C CG  
3500 C CD1 . TYR C 70  ? 0.7964 0.9447 0.8989 -0.0365 0.0075  -0.0057 72  TYR C CD1 
3501 C CD2 . TYR C 70  ? 0.7962 0.9313 0.8929 -0.0354 0.0020  -0.0107 72  TYR C CD2 
3502 C CE1 . TYR C 70  ? 0.8330 0.9994 0.9415 -0.0363 0.0063  -0.0055 72  TYR C CE1 
3503 C CE2 . TYR C 70  ? 0.8142 0.9649 0.9167 -0.0355 0.0004  -0.0102 72  TYR C CE2 
3504 C CZ  . TYR C 70  ? 0.8131 0.9799 0.9218 -0.0357 0.0025  -0.0078 72  TYR C CZ  
3505 O OH  . TYR C 70  ? 0.8007 0.9853 0.9154 -0.0351 0.0008  -0.0080 72  TYR C OH  
3506 N N   . GLU C 71  ? 0.7870 0.8949 0.8806 -0.0510 -0.0071 -0.0112 73  GLU C N   
3507 C CA  . GLU C 71  ? 0.7998 0.9058 0.8924 -0.0525 -0.0127 -0.0145 73  GLU C CA  
3508 C C   . GLU C 71  ? 0.7940 0.9164 0.8939 -0.0571 -0.0140 -0.0111 73  GLU C C   
3509 O O   . GLU C 71  ? 0.7928 0.9278 0.8984 -0.0597 -0.0111 -0.0064 73  GLU C O   
3510 C CB  . GLU C 71  ? 0.8271 0.9170 0.9162 -0.0567 -0.0199 -0.0170 73  GLU C CB  
3511 C CG  . GLU C 71  ? 0.8816 0.9671 0.9671 -0.0556 -0.0262 -0.0226 73  GLU C CG  
3512 C CD  . GLU C 71  ? 0.9497 1.0171 1.0276 -0.0527 -0.0323 -0.0294 73  GLU C CD  
3513 O OE1 . GLU C 71  ? 0.9493 1.0050 1.0252 -0.0530 -0.0338 -0.0296 73  GLU C OE1 
3514 O OE2 . GLU C 71  ? 0.9787 1.0441 1.0521 -0.0492 -0.0360 -0.0353 73  GLU C OE2 
3515 N N   . ASP C 72  ? 0.7873 0.9122 0.8874 -0.0575 -0.0182 -0.0136 74  ASP C N   
3516 C CA  . ASP C 72  ? 0.7778 0.9208 0.8857 -0.0616 -0.0196 -0.0104 74  ASP C CA  
3517 C C   . ASP C 72  ? 0.7701 0.9145 0.8772 -0.0609 -0.0244 -0.0138 74  ASP C C   
3518 O O   . ASP C 72  ? 0.7775 0.9129 0.8775 -0.0547 -0.0244 -0.0185 74  ASP C O   
3519 C CB  . ASP C 72  ? 0.7680 0.9276 0.8801 -0.0560 -0.0133 -0.0085 74  ASP C CB  
3520 C CG  . ASP C 72  ? 0.7746 0.9571 0.8960 -0.0601 -0.0142 -0.0051 74  ASP C CG  
3521 O OD1 . ASP C 72  ? 0.7544 0.9390 0.8789 -0.0681 -0.0200 -0.0037 74  ASP C OD1 
3522 O OD2 . ASP C 72  ? 0.7389 0.9375 0.8643 -0.0549 -0.0099 -0.0043 74  ASP C OD2 
3523 N N   . THR C 73  ? 0.7524 0.9094 0.8665 -0.0679 -0.0286 -0.0109 75  THR C N   
3524 C CA  . THR C 73  ? 0.7344 0.8948 0.8486 -0.0677 -0.0336 -0.0138 75  THR C CA  
3525 C C   . THR C 73  ? 0.7118 0.8932 0.8323 -0.0636 -0.0311 -0.0127 75  THR C C   
3526 O O   . THR C 73  ? 0.7075 0.9075 0.8366 -0.0671 -0.0294 -0.0084 75  THR C O   
3527 C CB  . THR C 73  ? 0.7558 0.9162 0.8737 -0.0786 -0.0421 -0.0116 75  THR C CB  
3528 O OG1 . THR C 73  ? 0.7665 0.9112 0.8817 -0.0853 -0.0460 -0.0099 75  THR C OG1 
3529 C CG2 . THR C 73  ? 0.7621 0.9156 0.8752 -0.0765 -0.0481 -0.0171 75  THR C CG2 
3530 N N   . LEU C 74  ? 0.6873 0.8668 0.8034 -0.0562 -0.0315 -0.0168 76  LEU C N   
3531 C CA  . LEU C 74  ? 0.6609 0.8571 0.7815 -0.0504 -0.0307 -0.0168 76  LEU C CA  
3532 C C   . LEU C 74  ? 0.6679 0.8778 0.7948 -0.0546 -0.0362 -0.0165 76  LEU C C   
3533 O O   . LEU C 74  ? 0.6641 0.8654 0.7877 -0.0586 -0.0417 -0.0184 76  LEU C O   
3534 C CB  . LEU C 74  ? 0.6523 0.8386 0.7642 -0.0413 -0.0297 -0.0201 76  LEU C CB  
3535 C CG  . LEU C 74  ? 0.6338 0.8157 0.7424 -0.0346 -0.0244 -0.0196 76  LEU C CG  
3536 C CD1 . LEU C 74  ? 0.6098 0.7877 0.7197 -0.0382 -0.0201 -0.0174 76  LEU C CD1 
3537 C CD2 . LEU C 74  ? 0.5720 0.7397 0.6703 -0.0303 -0.0250 -0.0216 76  LEU C CD2 
3538 N N   . LEU C 75  ? 0.6736 0.9064 0.8097 -0.0528 -0.0349 -0.0145 77  LEU C N   
3539 C CA  . LEU C 75  ? 0.6837 0.9365 0.8284 -0.0562 -0.0394 -0.0136 77  LEU C CA  
3540 C C   . LEU C 75  ? 0.6729 0.9348 0.8180 -0.0453 -0.0404 -0.0171 77  LEU C C   
3541 O O   . LEU C 75  ? 0.6729 0.9388 0.8176 -0.0361 -0.0369 -0.0184 77  LEU C O   
3542 C CB  . LEU C 75  ? 0.6902 0.9684 0.8463 -0.0623 -0.0372 -0.0085 77  LEU C CB  
3543 C CG  . LEU C 75  ? 0.7069 0.9882 0.8678 -0.0779 -0.0418 -0.0029 77  LEU C CG  
3544 C CD1 . LEU C 75  ? 0.7239 1.0413 0.8983 -0.0834 -0.0414 0.0022  77  LEU C CD1 
3545 C CD2 . LEU C 75  ? 0.7240 0.9895 0.8804 -0.0825 -0.0498 -0.0052 77  LEU C CD2 
3546 N N   . LEU C 76  ? 0.6797 0.9445 0.8255 -0.0461 -0.0462 -0.0186 78  LEU C N   
3547 C CA  . LEU C 76  ? 0.6871 0.9630 0.8346 -0.0362 -0.0486 -0.0214 78  LEU C CA  
3548 C C   . LEU C 76  ? 0.7008 1.0084 0.8618 -0.0368 -0.0492 -0.0201 78  LEU C C   
3549 O O   . LEU C 76  ? 0.7153 1.0362 0.8842 -0.0481 -0.0504 -0.0161 78  LEU C O   
3550 C CB  . LEU C 76  ? 0.6976 0.9633 0.8391 -0.0361 -0.0549 -0.0238 78  LEU C CB  
3551 C CG  . LEU C 76  ? 0.7255 0.9818 0.8588 -0.0252 -0.0574 -0.0267 78  LEU C CG  
3552 C CD1 . LEU C 76  ? 0.7203 0.9826 0.8548 -0.0134 -0.0556 -0.0279 78  LEU C CD1 
3553 C CD2 . LEU C 76  ? 0.7090 0.9402 0.8285 -0.0261 -0.0572 -0.0274 78  LEU C CD2 
3554 N N   . GLU C 77  ? 0.7036 1.0240 0.8672 -0.0245 -0.0494 -0.0233 79  GLU C N   
3555 C CA  . GLU C 77  ? 0.7151 1.0699 0.8916 -0.0213 -0.0505 -0.0238 79  GLU C CA  
3556 C C   . GLU C 77  ? 0.7163 1.0870 0.9007 -0.0304 -0.0559 -0.0218 79  GLU C C   
3557 O O   . GLU C 77  ? 0.7183 1.1196 0.9148 -0.0347 -0.0556 -0.0193 79  GLU C O   
3558 C CB  . GLU C 77  ? 0.7170 1.0736 0.8912 -0.0049 -0.0535 -0.0295 79  GLU C CB  
3559 C CG  . GLU C 77  ? 0.7718 1.1350 0.9464 0.0051  -0.0493 -0.0318 79  GLU C CG  
3560 C CD  . GLU C 77  ? 0.8866 1.2763 1.0687 0.0188  -0.0532 -0.0373 79  GLU C CD  
3561 O OE1 . GLU C 77  ? 0.9077 1.2848 1.0838 0.0301  -0.0600 -0.0418 79  GLU C OE1 
3562 O OE2 . GLU C 77  ? 0.8981 1.3223 1.0922 0.0180  -0.0500 -0.0369 79  GLU C OE2 
3563 N N   . ASP C 78  ? 0.7142 1.0651 0.8915 -0.0333 -0.0610 -0.0227 80  ASP C N   
3564 C CA  . ASP C 78  ? 0.7275 1.0895 0.9107 -0.0414 -0.0672 -0.0213 80  ASP C CA  
3565 C C   . ASP C 78  ? 0.7277 1.0844 0.9124 -0.0584 -0.0683 -0.0161 80  ASP C C   
3566 O O   . ASP C 78  ? 0.7272 1.0893 0.9158 -0.0670 -0.0746 -0.0145 80  ASP C O   
3567 C CB  . ASP C 78  ? 0.7312 1.0747 0.9051 -0.0361 -0.0732 -0.0251 80  ASP C CB  
3568 C CG  . ASP C 78  ? 0.7589 1.1215 0.9407 -0.0379 -0.0803 -0.0256 80  ASP C CG  
3569 O OD1 . ASP C 78  ? 0.7512 1.1460 0.9466 -0.0379 -0.0804 -0.0245 80  ASP C OD1 
3570 O OD2 . ASP C 78  ? 0.7884 1.1352 0.9627 -0.0390 -0.0858 -0.0272 80  ASP C OD2 
3571 N N   . GLN C 79  ? 0.7221 1.0667 0.9033 -0.0630 -0.0633 -0.0135 81  GLN C N   
3572 C CA  . GLN C 79  ? 0.7303 1.0659 0.9115 -0.0784 -0.0655 -0.0085 81  GLN C CA  
3573 C C   . GLN C 79  ? 0.7213 1.0837 0.9139 -0.0867 -0.0623 -0.0019 81  GLN C C   
3574 O O   . GLN C 79  ? 0.7149 1.0684 0.9048 -0.0908 -0.0585 0.0011  81  GLN C O   
3575 C CB  . GLN C 79  ? 0.7208 1.0247 0.8897 -0.0775 -0.0623 -0.0099 81  GLN C CB  
3576 C CG  . GLN C 79  ? 0.7508 1.0250 0.9065 -0.0741 -0.0658 -0.0151 81  GLN C CG  
3577 C CD  . GLN C 79  ? 0.7895 1.0380 0.9351 -0.0739 -0.0622 -0.0161 81  GLN C CD  
3578 O OE1 . GLN C 79  ? 0.7347 0.9696 0.8713 -0.0645 -0.0585 -0.0197 81  GLN C OE1 
3579 N NE2 . GLN C 79  ? 0.8227 1.0655 0.9699 -0.0848 -0.0642 -0.0123 81  GLN C NE2 
3580 N N   . PRO C 80  ? 0.7233 1.1202 0.9285 -0.0890 -0.0638 0.0007  82  PRO C N   
3581 C CA  . PRO C 80  ? 0.7319 1.1581 0.9469 -0.0946 -0.0590 0.0066  82  PRO C CA  
3582 C C   . PRO C 80  ? 0.7547 1.1779 0.9716 -0.1145 -0.0624 0.0159  82  PRO C C   
3583 O O   . PRO C 80  ? 0.7539 1.1931 0.9753 -0.1203 -0.0579 0.0216  82  PRO C O   
3584 C CB  . PRO C 80  ? 0.7410 1.2074 0.9690 -0.0913 -0.0604 0.0063  82  PRO C CB  
3585 C CG  . PRO C 80  ? 0.7490 1.2054 0.9759 -0.0946 -0.0687 0.0046  82  PRO C CG  
3586 C CD  . PRO C 80  ? 0.7407 1.1547 0.9522 -0.0874 -0.0696 -0.0012 82  PRO C CD  
3587 N N   . THR C 81  ? 0.7829 1.1835 0.9952 -0.1246 -0.0711 0.0171  83  THR C N   
3588 C CA  . THR C 81  ? 0.8198 1.2097 1.0316 -0.1434 -0.0774 0.0253  83  THR C CA  
3589 C C   . THR C 81  ? 0.8226 1.1760 1.0220 -0.1419 -0.0758 0.0234  83  THR C C   
3590 O O   . THR C 81  ? 0.8354 1.1687 1.0307 -0.1546 -0.0829 0.0278  83  THR C O   
3591 C CB  . THR C 81  ? 0.8360 1.2157 1.0476 -0.1537 -0.0893 0.0262  83  THR C CB  
3592 O OG1 . THR C 81  ? 0.8283 1.1890 1.0318 -0.1402 -0.0901 0.0163  83  THR C OG1 
3593 C CG2 . THR C 81  ? 0.8327 1.2537 1.0594 -0.1633 -0.0925 0.0329  83  THR C CG2 
3594 N N   . GLY C 82  ? 0.8223 1.1668 1.0156 -0.1262 -0.0674 0.0168  84  GLY C N   
3595 C CA  . GLY C 82  ? 0.8518 1.1662 1.0343 -0.1233 -0.0646 0.0148  84  GLY C CA  
3596 C C   . GLY C 82  ? 0.8887 1.1663 1.0592 -0.1223 -0.0709 0.0092  84  GLY C C   
3597 O O   . GLY C 82  ? 0.8916 1.1633 1.0593 -0.1190 -0.0758 0.0044  84  GLY C O   
3598 N N   . GLU C 83  ? 0.9294 1.1833 1.0924 -0.1253 -0.0713 0.0099  85  GLU C N   
3599 C CA  . GLU C 83  ? 0.9651 1.1861 1.1150 -0.1179 -0.0730 0.0022  85  GLU C CA  
3600 C C   . GLU C 83  ? 1.0200 1.2155 1.1635 -0.1269 -0.0851 0.0013  85  GLU C C   
3601 O O   . GLU C 83  ? 1.0244 1.1965 1.1571 -0.1194 -0.0877 -0.0067 85  GLU C O   
3602 C CB  . GLU C 83  ? 0.9471 1.1585 1.0922 -0.1111 -0.0647 0.0014  85  GLU C CB  
3603 C CG  . GLU C 83  ? 0.9670 1.1829 1.1165 -0.1225 -0.0647 0.0099  85  GLU C CG  
3604 C CD  . GLU C 83  ? 0.9378 1.1715 1.0912 -0.1163 -0.0537 0.0120  85  GLU C CD  
3605 O OE1 . GLU C 83  ? 0.9416 1.1589 1.0884 -0.1113 -0.0495 0.0101  85  GLU C OE1 
3606 O OE2 . GLU C 83  ? 0.9119 1.1761 1.0748 -0.1156 -0.0497 0.0148  85  GLU C OE2 
3607 N N   . ASN C 84  ? 1.0844 1.2839 1.2336 -0.1427 -0.0933 0.0093  86  ASN C N   
3608 C CA  . ASN C 84  ? 1.1430 1.3190 1.2863 -0.1509 -0.1079 0.0076  86  ASN C CA  
3609 C C   . ASN C 84  ? 1.1606 1.3462 1.3067 -0.1511 -0.1132 0.0050  86  ASN C C   
3610 O O   . ASN C 84  ? 1.1914 1.3634 1.3349 -0.1598 -0.1263 0.0049  86  ASN C O   
3611 C CB  . ASN C 84  ? 1.1785 1.3460 1.3236 -0.1684 -0.1182 0.0168  86  ASN C CB  
3612 C CG  . ASN C 84  ? 1.2235 1.3532 1.3560 -0.1664 -0.1252 0.0119  86  ASN C CG  
3613 O OD1 . ASN C 84  ? 1.2860 1.4049 1.4180 -0.1779 -0.1320 0.0190  86  ASN C OD1 
3614 N ND2 . ASN C 84  ? 1.2245 1.3353 1.3466 -0.1516 -0.1240 -0.0002 86  ASN C ND2 
3615 N N   . GLU C 85  ? 1.1459 1.3527 1.2962 -0.1404 -0.1036 0.0022  87  GLU C N   
3616 C CA  . GLU C 85  ? 1.1570 1.3744 1.3095 -0.1375 -0.1067 -0.0011 87  GLU C CA  
3617 C C   . GLU C 85  ? 1.1386 1.3435 1.2809 -0.1212 -0.1013 -0.0109 87  GLU C C   
3618 O O   . GLU C 85  ? 1.1158 1.3148 1.2535 -0.1122 -0.0925 -0.0131 87  GLU C O   
3619 C CB  . GLU C 85  ? 1.1492 1.4041 1.3157 -0.1390 -0.1010 0.0047  87  GLU C CB  
3620 C CG  . GLU C 85  ? 1.1789 1.4498 1.3544 -0.1526 -0.1011 0.0151  87  GLU C CG  
3621 C CD  . GLU C 85  ? 1.2519 1.5261 1.4326 -0.1707 -0.1140 0.0222  87  GLU C CD  
3622 O OE1 . GLU C 85  ? 1.2753 1.5808 1.4675 -0.1751 -0.1144 0.0263  87  GLU C OE1 
3623 O OE2 . GLU C 85  ? 1.2744 1.5209 1.4481 -0.1803 -0.1246 0.0235  87  GLU C OE2 
3624 N N   . MET C 86  ? 1.1532 1.3555 1.2922 -0.1184 -0.1071 -0.0158 88  MET C N   
3625 C CA  . MET C 86  ? 1.1494 1.3371 1.2764 -0.1058 -0.1053 -0.0247 88  MET C CA  
3626 C C   . MET C 86  ? 1.1361 1.3408 1.2656 -0.0980 -0.1021 -0.0264 88  MET C C   
3627 O O   . MET C 86  ? 1.1422 1.3668 1.2815 -0.1029 -0.1053 -0.0228 88  MET C O   
3628 C CB  . MET C 86  ? 1.1814 1.3460 1.2986 -0.1085 -0.1169 -0.0306 88  MET C CB  
3629 C CG  . MET C 86  ? 1.2014 1.3410 1.3091 -0.1070 -0.1183 -0.0344 88  MET C CG  
3630 S SD  . MET C 86  ? 1.2654 1.3811 1.3562 -0.0981 -0.1261 -0.0471 88  MET C SD  
3631 C CE  . MET C 86  ? 1.2236 1.3567 1.3128 -0.0884 -0.1198 -0.0499 88  MET C CE  
3632 N N   . VAL C 87  ? 1.1190 1.3155 1.2389 -0.0863 -0.0968 -0.0316 89  VAL C N   
3633 C CA  . VAL C 87  ? 1.1105 1.3199 1.2309 -0.0776 -0.0933 -0.0327 89  VAL C CA  
3634 C C   . VAL C 87  ? 1.1277 1.3269 1.2371 -0.0730 -0.0983 -0.0387 89  VAL C C   
3635 O O   . VAL C 87  ? 1.1438 1.3256 1.2440 -0.0746 -0.1034 -0.0434 89  VAL C O   
3636 C CB  . VAL C 87  ? 1.0837 1.2942 1.2021 -0.0685 -0.0832 -0.0319 89  VAL C CB  
3637 C CG1 . VAL C 87  ? 1.0762 1.2710 1.1896 -0.0696 -0.0793 -0.0322 89  VAL C CG1 
3638 C CG2 . VAL C 87  ? 1.0700 1.2764 1.1789 -0.0585 -0.0819 -0.0354 89  VAL C CG2 
3639 N N   . ILE C 88  ? 1.1276 1.3377 1.2372 -0.0664 -0.0973 -0.0387 90  ILE C N   
3640 C CA  . ILE C 88  ? 1.1446 1.3526 1.2470 -0.0638 -0.1035 -0.0426 90  ILE C CA  
3641 C C   . ILE C 88  ? 1.1342 1.3448 1.2305 -0.0540 -0.0997 -0.0427 90  ILE C C   
3642 O O   . ILE C 88  ? 1.1266 1.3515 1.2300 -0.0507 -0.0998 -0.0401 90  ILE C O   
3643 C CB  . ILE C 88  ? 1.1620 1.3851 1.2751 -0.0707 -0.1115 -0.0407 90  ILE C CB  
3644 C CG1 . ILE C 88  ? 1.1845 1.3962 1.2956 -0.0802 -0.1207 -0.0430 90  ILE C CG1 
3645 C CG2 . ILE C 88  ? 1.1653 1.3969 1.2764 -0.0647 -0.1147 -0.0421 90  ILE C CG2 
3646 C CD1 . ILE C 88  ? 1.1797 1.3872 1.2972 -0.0901 -0.1213 -0.0392 90  ILE C CD1 
3647 N N   . MET C 89  ? 1.1374 1.3344 1.2200 -0.0494 -0.0972 -0.0456 91  MET C N   
3648 C CA  . MET C 89  ? 1.1334 1.3302 1.2090 -0.0418 -0.0933 -0.0439 91  MET C CA  
3649 C C   . MET C 89  ? 1.1506 1.3464 1.2152 -0.0386 -0.0982 -0.0454 91  MET C C   
3650 O O   . MET C 89  ? 1.1566 1.3445 1.2085 -0.0376 -0.0983 -0.0485 91  MET C O   
3651 C CB  . MET C 89  ? 1.1214 1.3085 1.1910 -0.0393 -0.0856 -0.0433 91  MET C CB  
3652 C CG  . MET C 89  ? 1.1098 1.3018 1.1889 -0.0377 -0.0796 -0.0390 91  MET C CG  
3653 S SD  . MET C 89  ? 1.0876 1.2693 1.1599 -0.0338 -0.0711 -0.0372 91  MET C SD  
3654 C CE  . MET C 89  ? 1.0650 1.2366 1.1347 -0.0386 -0.0697 -0.0413 91  MET C CE  
3655 N N   . ARG C 90  ? 1.1586 1.3643 1.2283 -0.0365 -0.1023 -0.0430 92  ARG C N   
3656 C CA  . ARG C 90  ? 1.1767 1.3824 1.2370 -0.0334 -0.1076 -0.0429 92  ARG C CA  
3657 C C   . ARG C 90  ? 1.1638 1.3645 1.2160 -0.0283 -0.1047 -0.0387 92  ARG C C   
3658 O O   . ARG C 90  ? 1.1497 1.3503 1.2076 -0.0256 -0.1004 -0.0359 92  ARG C O   
3659 C CB  . ARG C 90  ? 1.1954 1.4135 1.2649 -0.0332 -0.1147 -0.0424 92  ARG C CB  
3660 C CG  . ARG C 90  ? 1.2050 1.4324 1.2832 -0.0270 -0.1152 -0.0388 92  ARG C CG  
3661 C CD  . ARG C 90  ? 1.2335 1.4796 1.3287 -0.0284 -0.1183 -0.0393 92  ARG C CD  
3662 N NE  . ARG C 90  ? 1.2837 1.5357 1.3803 -0.0329 -0.1258 -0.0413 92  ARG C NE  
3663 C CZ  . ARG C 90  ? 1.2860 1.5407 1.3877 -0.0413 -0.1277 -0.0431 92  ARG C CZ  
3664 N NH1 . ARG C 90  ? 1.2692 1.5210 1.3752 -0.0466 -0.1227 -0.0427 92  ARG C NH1 
3665 N NH2 . ARG C 90  ? 1.2838 1.5430 1.3860 -0.0449 -0.1358 -0.0449 92  ARG C NH2 
3666 N N   . PRO C 91  ? 1.1712 1.3678 1.2095 -0.0274 -0.1077 -0.0378 93  PRO C N   
3667 C CA  . PRO C 91  ? 1.1660 1.3575 1.1952 -0.0244 -0.1076 -0.0321 93  PRO C CA  
3668 C C   . PRO C 91  ? 1.1574 1.3504 1.1938 -0.0194 -0.1117 -0.0283 93  PRO C C   
3669 O O   . PRO C 91  ? 1.1586 1.3604 1.2077 -0.0176 -0.1139 -0.0304 93  PRO C O   
3670 C CB  . PRO C 91  ? 1.1846 1.3760 1.1994 -0.0259 -0.1127 -0.0318 93  PRO C CB  
3671 C CG  . PRO C 91  ? 1.1877 1.3809 1.2007 -0.0288 -0.1113 -0.0388 93  PRO C CG  
3672 C CD  . PRO C 91  ? 1.1865 1.3829 1.2154 -0.0300 -0.1117 -0.0421 93  PRO C CD  
3673 N N   . GLY C 92  ? 1.1518 1.3367 1.1799 -0.0171 -0.1131 -0.0228 94  GLY C N   
3674 C CA  . GLY C 92  ? 1.1445 1.3277 1.1759 -0.0109 -0.1201 -0.0199 94  GLY C CA  
3675 C C   . GLY C 92  ? 1.1258 1.3110 1.1694 -0.0048 -0.1182 -0.0209 94  GLY C C   
3676 O O   . GLY C 92  ? 1.1360 1.3184 1.1805 0.0019  -0.1254 -0.0194 94  GLY C O   
3677 N N   . ASN C 93  ? 1.0935 1.2838 1.1462 -0.0064 -0.1096 -0.0239 95  ASN C N   
3678 C CA  . ASN C 93  ? 1.0741 1.2670 1.1367 -0.0006 -0.1067 -0.0245 95  ASN C CA  
3679 C C   . ASN C 93  ? 1.0422 1.2293 1.1042 -0.0036 -0.0974 -0.0238 95  ASN C C   
3680 O O   . ASN C 93  ? 1.0377 1.2242 1.0976 -0.0101 -0.0918 -0.0250 95  ASN C O   
3681 C CB  . ASN C 93  ? 1.0745 1.2861 1.1535 0.0023  -0.1069 -0.0287 95  ASN C CB  
3682 C CG  . ASN C 93  ? 1.0939 1.3144 1.1755 0.0049  -0.1158 -0.0301 95  ASN C CG  
3683 O OD1 . ASN C 93  ? 1.1115 1.3391 1.1990 0.0136  -0.1216 -0.0315 95  ASN C OD1 
3684 N ND2 . ASN C 93  ? 1.0645 1.2848 1.1414 -0.0017 -0.1176 -0.0304 95  ASN C ND2 
3685 N N   . LYS C 94  ? 1.0178 1.2001 1.0812 0.0018  -0.0965 -0.0226 96  LYS C N   
3686 C CA  . LYS C 94  ? 0.9777 1.1530 1.0391 -0.0009 -0.0883 -0.0213 96  LYS C CA  
3687 C C   . LYS C 94  ? 0.9425 1.1295 1.0170 -0.0019 -0.0811 -0.0247 96  LYS C C   
3688 O O   . LYS C 94  ? 0.9438 1.1420 1.0285 0.0038  -0.0821 -0.0267 96  LYS C O   
3689 C CB  . LYS C 94  ? 0.9812 1.1433 1.0360 0.0041  -0.0913 -0.0177 96  LYS C CB  
3690 C CG  . LYS C 94  ? 1.0120 1.1688 1.0633 0.0114  -0.1031 -0.0164 96  LYS C CG  
3691 C CD  . LYS C 94  ? 1.0261 1.1648 1.0680 0.0148  -0.1084 -0.0119 96  LYS C CD  
3692 C CE  . LYS C 94  ? 1.0309 1.1578 1.0607 0.0057  -0.1045 -0.0055 96  LYS C CE  
3693 N NZ  . LYS C 94  ? 1.0314 1.1543 1.0488 -0.0014 -0.1091 0.0000  96  LYS C NZ  
3694 N N   . TYR C 95  ? 0.9011 1.0864 0.9749 -0.0088 -0.0746 -0.0253 97  TYR C N   
3695 C CA  . TYR C 95  ? 0.8710 1.0650 0.9556 -0.0116 -0.0686 -0.0271 97  TYR C CA  
3696 C C   . TYR C 95  ? 0.8289 1.0164 0.9130 -0.0101 -0.0624 -0.0257 97  TYR C C   
3697 O O   . TYR C 95  ? 0.8148 0.9906 0.8905 -0.0125 -0.0590 -0.0244 97  TYR C O   
3698 C CB  . TYR C 95  ? 0.8821 1.0769 0.9672 -0.0197 -0.0673 -0.0291 97  TYR C CB  
3699 C CG  . TYR C 95  ? 0.9508 1.1506 1.0351 -0.0212 -0.0741 -0.0307 97  TYR C CG  
3700 C CD1 . TYR C 95  ? 0.9881 1.2036 1.0836 -0.0209 -0.0780 -0.0315 97  TYR C CD1 
3701 C CD2 . TYR C 95  ? 0.9945 1.1856 1.0666 -0.0227 -0.0769 -0.0313 97  TYR C CD2 
3702 C CE1 . TYR C 95  ? 1.0182 1.2383 1.1130 -0.0222 -0.0848 -0.0329 97  TYR C CE1 
3703 C CE2 . TYR C 95  ? 1.0144 1.2100 1.0849 -0.0238 -0.0836 -0.0328 97  TYR C CE2 
3704 C CZ  . TYR C 95  ? 1.0414 1.2503 1.1233 -0.0236 -0.0877 -0.0336 97  TYR C CZ  
3705 O OH  . TYR C 95  ? 1.0784 1.2916 1.1588 -0.0248 -0.0946 -0.0351 97  TYR C OH  
3706 N N   . GLU C 96  ? 0.8013 0.9986 0.8946 -0.0054 -0.0611 -0.0264 98  GLU C N   
3707 C CA  . GLU C 96  ? 0.7631 0.9553 0.8560 -0.0022 -0.0566 -0.0254 98  GLU C CA  
3708 C C   . GLU C 96  ? 0.7327 0.9359 0.8354 -0.0060 -0.0503 -0.0259 98  GLU C C   
3709 O O   . GLU C 96  ? 0.7353 0.9564 0.8483 -0.0043 -0.0506 -0.0271 98  GLU C O   
3710 C CB  . GLU C 96  ? 0.7657 0.9592 0.8591 0.0081  -0.0616 -0.0262 98  GLU C CB  
3711 C CG  . GLU C 96  ? 0.7932 0.9732 0.8758 0.0112  -0.0695 -0.0244 98  GLU C CG  
3712 C CD  . GLU C 96  ? 0.8659 1.0438 0.9484 0.0224  -0.0764 -0.0259 98  GLU C CD  
3713 O OE1 . GLU C 96  ? 0.8448 1.0382 0.9375 0.0289  -0.0753 -0.0298 98  GLU C OE1 
3714 O OE2 . GLU C 96  ? 0.9226 1.0839 0.9945 0.0248  -0.0835 -0.0231 98  GLU C OE2 
3715 N N   . TYR C 97  ? 0.6990 0.8924 0.7981 -0.0112 -0.0449 -0.0248 99  TYR C N   
3716 C CA  . TYR C 97  ? 0.6664 0.8662 0.7727 -0.0156 -0.0394 -0.0242 99  TYR C CA  
3717 C C   . TYR C 97  ? 0.6428 0.8399 0.7486 -0.0103 -0.0353 -0.0234 99  TYR C C   
3718 O O   . TYR C 97  ? 0.6424 0.8243 0.7399 -0.0092 -0.0337 -0.0225 99  TYR C O   
3719 C CB  . TYR C 97  ? 0.6592 0.8469 0.7604 -0.0231 -0.0374 -0.0240 99  TYR C CB  
3720 C CG  . TYR C 97  ? 0.6806 0.8713 0.7834 -0.0292 -0.0416 -0.0253 99  TYR C CG  
3721 C CD1 . TYR C 97  ? 0.7023 0.9011 0.8134 -0.0366 -0.0418 -0.0244 99  TYR C CD1 
3722 C CD2 . TYR C 97  ? 0.6798 0.8650 0.7753 -0.0283 -0.0461 -0.0271 99  TYR C CD2 
3723 C CE1 . TYR C 97  ? 0.7152 0.9149 0.8275 -0.0428 -0.0470 -0.0255 99  TYR C CE1 
3724 C CE2 . TYR C 97  ? 0.6797 0.8669 0.7762 -0.0337 -0.0507 -0.0289 99  TYR C CE2 
3725 C CZ  . TYR C 97  ? 0.7121 0.9058 0.8172 -0.0408 -0.0514 -0.0282 99  TYR C CZ  
3726 O OH  . TYR C 97  ? 0.7419 0.9361 0.8483 -0.0471 -0.0573 -0.0297 99  TYR C OH  
3727 N N   . LYS C 98  ? 0.6297 0.8430 0.7443 -0.0071 -0.0336 -0.0239 100 LYS C N   
3728 C CA  . LYS C 98  ? 0.6144 0.8249 0.7276 -0.0010 -0.0304 -0.0241 100 LYS C CA  
3729 C C   . LYS C 98  ? 0.5827 0.7886 0.6961 -0.0073 -0.0240 -0.0218 100 LYS C C   
3730 O O   . LYS C 98  ? 0.5698 0.7837 0.6889 -0.0156 -0.0221 -0.0202 100 LYS C O   
3731 C CB  . LYS C 98  ? 0.6232 0.8545 0.7445 0.0075  -0.0315 -0.0267 100 LYS C CB  
3732 C CG  . LYS C 98  ? 0.6716 0.8999 0.7893 0.0183  -0.0389 -0.0298 100 LYS C CG  
3733 C CD  . LYS C 98  ? 0.7704 1.0260 0.8988 0.0242  -0.0415 -0.0332 100 LYS C CD  
3734 C CE  . LYS C 98  ? 0.8164 1.0848 0.9481 0.0355  -0.0407 -0.0372 100 LYS C CE  
3735 N NZ  . LYS C 98  ? 0.8515 1.1448 0.9915 0.0449  -0.0454 -0.0420 100 LYS C NZ  
3736 N N   . PHE C 99  ? 0.5582 0.7506 0.6652 -0.0039 -0.0217 -0.0214 101 PHE C N   
3737 C CA  . PHE C 99  ? 0.5327 0.7211 0.6400 -0.0089 -0.0159 -0.0194 101 PHE C CA  
3738 C C   . PHE C 99  ? 0.5346 0.7196 0.6395 -0.0020 -0.0140 -0.0199 101 PHE C C   
3739 O O   . PHE C 99  ? 0.5323 0.7087 0.6315 0.0055  -0.0178 -0.0212 101 PHE C O   
3740 C CB  . PHE C 99  ? 0.5131 0.6838 0.6132 -0.0149 -0.0149 -0.0183 101 PHE C CB  
3741 C CG  . PHE C 99  ? 0.4699 0.6253 0.5604 -0.0108 -0.0160 -0.0181 101 PHE C CG  
3742 C CD1 . PHE C 99  ? 0.4242 0.5714 0.5113 -0.0085 -0.0130 -0.0170 101 PHE C CD1 
3743 C CD2 . PHE C 99  ? 0.4653 0.6153 0.5499 -0.0102 -0.0205 -0.0183 101 PHE C CD2 
3744 C CE1 . PHE C 99  ? 0.4218 0.5554 0.4999 -0.0063 -0.0149 -0.0155 101 PHE C CE1 
3745 C CE2 . PHE C 99  ? 0.4509 0.5880 0.5259 -0.0082 -0.0223 -0.0164 101 PHE C CE2 
3746 C CZ  . PHE C 99  ? 0.4182 0.5473 0.4902 -0.0066 -0.0197 -0.0147 101 PHE C CZ  
3747 N N   . GLY C 100 ? 0.5368 0.7271 0.6452 -0.0051 -0.0089 -0.0185 102 GLY C N   
3748 C CA  . GLY C 100 ? 0.5504 0.7379 0.6565 0.0009  -0.0066 -0.0190 102 GLY C CA  
3749 C C   . GLY C 100 ? 0.5556 0.7406 0.6623 -0.0059 -0.0010 -0.0161 102 GLY C C   
3750 O O   . GLY C 100 ? 0.5598 0.7489 0.6705 -0.0150 0.0004  -0.0137 102 GLY C O   
3751 N N   . PHE C 101 ? 0.5608 0.7366 0.6629 -0.0018 0.0009  -0.0162 103 PHE C N   
3752 C CA  . PHE C 101 ? 0.5574 0.7320 0.6601 -0.0066 0.0059  -0.0137 103 PHE C CA  
3753 C C   . PHE C 101 ? 0.5735 0.7398 0.6709 0.0009  0.0064  -0.0150 103 PHE C C   
3754 O O   . PHE C 101 ? 0.5644 0.7203 0.6562 0.0080  0.0023  -0.0171 103 PHE C O   
3755 C CB  . PHE C 101 ? 0.5271 0.6871 0.6269 -0.0150 0.0069  -0.0114 103 PHE C CB  
3756 C CG  . PHE C 101 ? 0.5125 0.6557 0.6047 -0.0130 0.0047  -0.0124 103 PHE C CG  
3757 C CD1 . PHE C 101 ? 0.4594 0.5900 0.5455 -0.0097 0.0057  -0.0120 103 PHE C CD1 
3758 C CD2 . PHE C 101 ? 0.4519 0.5934 0.5429 -0.0144 0.0013  -0.0134 103 PHE C CD2 
3759 C CE1 . PHE C 101 ? 0.4188 0.5373 0.4981 -0.0091 0.0034  -0.0117 103 PHE C CE1 
3760 C CE2 . PHE C 101 ? 0.3828 0.5120 0.4663 -0.0131 -0.0007 -0.0136 103 PHE C CE2 
3761 C CZ  . PHE C 101 ? 0.4081 0.5268 0.4860 -0.0110 0.0004  -0.0124 103 PHE C CZ  
3762 N N   . GLU C 102 ? 0.6003 0.7705 0.6989 -0.0012 0.0106  -0.0134 104 GLU C N   
3763 C CA  . GLU C 102 ? 0.6278 0.7890 0.7211 0.0051  0.0110  -0.0146 104 GLU C CA  
3764 C C   . GLU C 102 ? 0.6202 0.7630 0.7085 -0.0002 0.0130  -0.0118 104 GLU C C   
3765 O O   . GLU C 102 ? 0.6155 0.7550 0.7052 -0.0084 0.0151  -0.0093 104 GLU C O   
3766 C CB  . GLU C 102 ? 0.6436 0.8227 0.7402 0.0093  0.0137  -0.0158 104 GLU C CB  
3767 C CG  . GLU C 102 ? 0.7113 0.9118 0.8128 0.0174  0.0111  -0.0200 104 GLU C CG  
3768 C CD  . GLU C 102 ? 0.7865 1.0121 0.8923 0.0207  0.0148  -0.0211 104 GLU C CD  
3769 O OE1 . GLU C 102 ? 0.8176 1.0384 0.9197 0.0216  0.0174  -0.0205 104 GLU C OE1 
3770 O OE2 . GLU C 102 ? 0.7934 1.0450 0.9064 0.0221  0.0150  -0.0224 104 GLU C OE2 
3771 N N   . LEU C 103 ? 0.6284 0.7586 0.7105 0.0052  0.0112  -0.0127 105 LEU C N   
3772 C CA  . LEU C 103 ? 0.6267 0.7430 0.7047 0.0015  0.0134  -0.0103 105 LEU C CA  
3773 C C   . LEU C 103 ? 0.6452 0.7686 0.7253 0.0009  0.0175  -0.0095 105 LEU C C   
3774 O O   . LEU C 103 ? 0.6435 0.7778 0.7244 0.0074  0.0173  -0.0118 105 LEU C O   
3775 C CB  . LEU C 103 ? 0.6203 0.7212 0.6909 0.0059  0.0091  -0.0105 105 LEU C CB  
3776 C CG  . LEU C 103 ? 0.5945 0.6896 0.6624 0.0045  0.0050  -0.0098 105 LEU C CG  
3777 C CD1 . LEU C 103 ? 0.5545 0.6348 0.6147 0.0067  -0.0003 -0.0082 105 LEU C CD1 
3778 C CD2 . LEU C 103 ? 0.5542 0.6489 0.6235 -0.0034 0.0084  -0.0082 105 LEU C CD2 
3779 N N   . PRO C 104 ? 0.6552 0.7732 0.7357 -0.0064 0.0205  -0.0066 106 PRO C N   
3780 C CA  . PRO C 104 ? 0.6643 0.7853 0.7454 -0.0086 0.0238  -0.0046 106 PRO C CA  
3781 C C   . PRO C 104 ? 0.6684 0.7862 0.7451 -0.0011 0.0235  -0.0064 106 PRO C C   
3782 O O   . PRO C 104 ? 0.6552 0.7634 0.7274 0.0048  0.0198  -0.0085 106 PRO C O   
3783 C CB  . PRO C 104 ? 0.6610 0.7679 0.7403 -0.0151 0.0246  -0.0024 106 PRO C CB  
3784 C CG  . PRO C 104 ? 0.6639 0.7678 0.7442 -0.0182 0.0225  -0.0032 106 PRO C CG  
3785 C CD  . PRO C 104 ? 0.6599 0.7674 0.7393 -0.0122 0.0200  -0.0056 106 PRO C CD  
3786 N N   . GLN C 105 ? 0.6868 0.8118 0.7641 -0.0021 0.0265  -0.0050 107 GLN C N   
3787 C CA  . GLN C 105 ? 0.7110 0.8390 0.7850 0.0056  0.0264  -0.0073 107 GLN C CA  
3788 C C   . GLN C 105 ? 0.7145 0.8230 0.7821 0.0075  0.0247  -0.0073 107 GLN C C   
3789 O O   . GLN C 105 ? 0.7193 0.8231 0.7824 0.0157  0.0212  -0.0106 107 GLN C O   
3790 C CB  . GLN C 105 ? 0.7189 0.8634 0.7954 0.0023  0.0306  -0.0049 107 GLN C CB  
3791 C CG  . GLN C 105 ? 0.7692 0.9390 0.8495 0.0075  0.0312  -0.0077 107 GLN C CG  
3792 C CD  . GLN C 105 ? 0.8267 0.9933 0.9039 0.0201  0.0263  -0.0145 107 GLN C CD  
3793 O OE1 . GLN C 105 ? 0.8503 1.0001 0.9210 0.0262  0.0230  -0.0170 107 GLN C OE1 
3794 N NE2 . GLN C 105 ? 0.8344 1.0154 0.9162 0.0235  0.0246  -0.0172 107 GLN C NE2 
3795 N N   . GLY C 106 ? 0.7100 0.8075 0.7774 0.0003  0.0263  -0.0039 108 GLY C N   
3796 C CA  . GLY C 106 ? 0.7268 0.8122 0.7900 0.0000  0.0266  -0.0026 108 GLY C CA  
3797 C C   . GLY C 106 ? 0.7329 0.8038 0.7913 0.0028  0.0227  -0.0033 108 GLY C C   
3798 O O   . GLY C 106 ? 0.7462 0.8158 0.8025 0.0081  0.0185  -0.0056 108 GLY C O   
3799 N N   . PRO C 107 ? 0.7323 0.7926 0.7890 -0.0010 0.0232  -0.0011 109 PRO C N   
3800 C CA  . PRO C 107 ? 0.7310 0.7806 0.7840 -0.0011 0.0196  -0.0001 109 PRO C CA  
3801 C C   . PRO C 107 ? 0.7314 0.7826 0.7867 -0.0056 0.0202  0.0005  109 PRO C C   
3802 O O   . PRO C 107 ? 0.7353 0.7888 0.7936 -0.0095 0.0233  0.0007  109 PRO C O   
3803 C CB  . PRO C 107 ? 0.7292 0.7713 0.7801 -0.0030 0.0206  0.0018  109 PRO C CB  
3804 C CG  . PRO C 107 ? 0.7250 0.7723 0.7800 -0.0068 0.0252  0.0023  109 PRO C CG  
3805 C CD  . PRO C 107 ? 0.7293 0.7883 0.7874 -0.0058 0.0265  0.0011  109 PRO C CD  
3806 N N   . LEU C 108 ? 0.7331 0.7825 0.7862 -0.0048 0.0165  0.0007  110 LEU C N   
3807 C CA  . LEU C 108 ? 0.7276 0.7797 0.7817 -0.0086 0.0169  0.0012  110 LEU C CA  
3808 C C   . LEU C 108 ? 0.7399 0.7875 0.7905 -0.0118 0.0156  0.0040  110 LEU C C   
3809 O O   . LEU C 108 ? 0.7670 0.8077 0.8136 -0.0114 0.0123  0.0065  110 LEU C O   
3810 C CB  . LEU C 108 ? 0.7270 0.7822 0.7809 -0.0065 0.0135  0.0002  110 LEU C CB  
3811 C CG  . LEU C 108 ? 0.7139 0.7758 0.7708 -0.0017 0.0136  -0.0026 110 LEU C CG  
3812 C CD1 . LEU C 108 ? 0.6839 0.7502 0.7414 0.0003  0.0103  -0.0039 110 LEU C CD1 
3813 C CD2 . LEU C 108 ? 0.7130 0.7835 0.7752 -0.0042 0.0189  -0.0032 110 LEU C CD2 
3814 N N   . GLY C 109 ? 0.7286 0.7811 0.7801 -0.0150 0.0174  0.0037  111 GLY C N   
3815 C CA  . GLY C 109 ? 0.7161 0.7695 0.7652 -0.0178 0.0174  0.0060  111 GLY C CA  
3816 C C   . GLY C 109 ? 0.7167 0.7668 0.7606 -0.0202 0.0124  0.0111  111 GLY C C   
3817 O O   . GLY C 109 ? 0.7367 0.7872 0.7786 -0.0233 0.0117  0.0146  111 GLY C O   
3818 N N   . THR C 110 ? 0.6969 0.7438 0.7386 -0.0192 0.0082  0.0119  112 THR C N   
3819 C CA  . THR C 110 ? 0.6756 0.7164 0.7113 -0.0217 0.0008  0.0170  112 THR C CA  
3820 C C   . THR C 110 ? 0.7208 0.7687 0.7529 -0.0283 -0.0014 0.0221  112 THR C C   
3821 O O   . THR C 110 ? 0.7450 0.7930 0.7738 -0.0337 -0.0040 0.0278  112 THR C O   
3822 C CB  . THR C 110 ? 0.6282 0.6570 0.6603 -0.0210 -0.0041 0.0197  112 THR C CB  
3823 O OG1 . THR C 110 ? 0.5499 0.5740 0.5760 -0.0271 -0.0113 0.0267  112 THR C OG1 
3824 C CG2 . THR C 110 ? 0.5768 0.6072 0.6118 -0.0211 0.0011  0.0187  112 THR C CG2 
3825 N N   . SER C 111 ? 0.7408 0.7954 0.7731 -0.0285 -0.0010 0.0207  113 SER C N   
3826 C CA  . SER C 111 ? 0.7728 0.8366 0.8011 -0.0346 -0.0029 0.0253  113 SER C CA  
3827 C C   . SER C 111 ? 0.8015 0.8700 0.8256 -0.0422 -0.0052 0.0329  113 SER C C   
3828 O O   . SER C 111 ? 0.8207 0.8781 0.8403 -0.0456 -0.0125 0.0391  113 SER C O   
3829 C CB  . SER C 111 ? 0.7903 0.8491 0.8151 -0.0344 -0.0092 0.0268  113 SER C CB  
3830 O OG  . SER C 111 ? 0.7460 0.8100 0.7751 -0.0299 -0.0055 0.0204  113 SER C OG  
3831 N N   . PHE C 112 ? 0.8165 0.9024 0.8422 -0.0445 0.0005  0.0322  114 PHE C N   
3832 C CA  . PHE C 112 ? 0.8423 0.9386 0.8670 -0.0502 0.0012  0.0373  114 PHE C CA  
3833 C C   . PHE C 112 ? 0.8512 0.9705 0.8753 -0.0522 0.0052  0.0364  114 PHE C C   
3834 O O   . PHE C 112 ? 0.8458 0.9693 0.8716 -0.0473 0.0084  0.0297  114 PHE C O   
3835 C CB  . PHE C 112 ? 0.8360 0.9297 0.8662 -0.0450 0.0063  0.0320  114 PHE C CB  
3836 C CG  . PHE C 112 ? 0.8592 0.9590 0.8893 -0.0497 0.0061  0.0370  114 PHE C CG  
3837 C CD1 . PHE C 112 ? 0.8900 1.0122 0.9197 -0.0547 0.0081  0.0403  114 PHE C CD1 
3838 C CD2 . PHE C 112 ? 0.8760 0.9613 0.9072 -0.0482 0.0044  0.0375  114 PHE C CD2 
3839 C CE1 . PHE C 112 ? 0.8992 1.0297 0.9298 -0.0592 0.0079  0.0450  114 PHE C CE1 
3840 C CE2 . PHE C 112 ? 0.8749 0.9656 0.9065 -0.0525 0.0038  0.0420  114 PHE C CE2 
3841 C CZ  . PHE C 112 ? 0.8948 1.0084 0.9265 -0.0583 0.0056  0.0460  114 PHE C CZ  
3842 N N   . LYS C 113 ? 0.8742 1.0098 0.8957 -0.0595 0.0046  0.0432  115 LYS C N   
3843 C CA  . LYS C 113 ? 0.8831 1.0464 0.9046 -0.0602 0.0095  0.0412  115 LYS C CA  
3844 C C   . LYS C 113 ? 0.8898 1.0682 0.9105 -0.0679 0.0087  0.0492  115 LYS C C   
3845 O O   . LYS C 113 ? 0.9169 1.1091 0.9326 -0.0776 0.0053  0.0585  115 LYS C O   
3846 C CB  . LYS C 113 ? 0.8938 1.0660 0.9098 -0.0642 0.0071  0.0443  115 LYS C CB  
3847 C CG  . LYS C 113 ? 0.9038 1.0770 0.9216 -0.0556 0.0108  0.0338  115 LYS C CG  
3848 C CD  . LYS C 113 ? 0.9624 1.1501 0.9743 -0.0601 0.0090  0.0372  115 LYS C CD  
3849 C CE  . LYS C 113 ? 0.9961 1.2093 1.0086 -0.0549 0.0149  0.0291  115 LYS C CE  
3850 N NZ  . LYS C 113 ? 1.0299 1.2712 1.0371 -0.0636 0.0147  0.0374  115 LYS C NZ  
3851 N N   . GLY C 114 ? 0.8804 1.0564 0.9059 -0.0644 0.0115  0.0460  116 GLY C N   
3852 C CA  . GLY C 114 ? 0.8773 1.0627 0.9029 -0.0721 0.0096  0.0543  116 GLY C CA  
3853 C C   . GLY C 114 ? 0.8606 1.0676 0.8917 -0.0667 0.0162  0.0479  116 GLY C C   
3854 O O   . GLY C 114 ? 0.8624 1.0890 0.8948 -0.0605 0.0213  0.0402  116 GLY C O   
3855 N N   . LYS C 115 ? 0.8392 1.0426 0.8732 -0.0682 0.0155  0.0504  117 LYS C N   
3856 C CA  . LYS C 115 ? 0.8153 1.0452 0.8539 -0.0651 0.0205  0.0467  117 LYS C CA  
3857 C C   . LYS C 115 ? 0.7758 1.0051 0.8189 -0.0507 0.0261  0.0319  117 LYS C C   
3858 O O   . LYS C 115 ? 0.7720 1.0247 0.8158 -0.0451 0.0298  0.0250  117 LYS C O   
3859 C CB  . LYS C 115 ? 0.8292 1.0592 0.8699 -0.0713 0.0179  0.0538  117 LYS C CB  
3860 C CG  . LYS C 115 ? 0.8542 1.1233 0.8973 -0.0757 0.0205  0.0573  117 LYS C CG  
3861 C CD  . LYS C 115 ? 0.8840 1.1568 0.9326 -0.0744 0.0212  0.0569  117 LYS C CD  
3862 C CE  . LYS C 115 ? 0.9207 1.1773 0.9669 -0.0869 0.0136  0.0699  117 LYS C CE  
3863 N NZ  . LYS C 115 ? 0.9574 1.2380 1.0079 -0.0925 0.0135  0.0752  117 LYS C NZ  
3864 N N   . TYR C 116 ? 0.7257 0.9284 0.7712 -0.0448 0.0258  0.0271  118 TYR C N   
3865 C CA  . TYR C 116 ? 0.6969 0.8962 0.7459 -0.0327 0.0292  0.0144  118 TYR C CA  
3866 C C   . TYR C 116 ? 0.6823 0.8650 0.7297 -0.0282 0.0290  0.0088  118 TYR C C   
3867 O O   . TYR C 116 ? 0.6608 0.8248 0.7104 -0.0225 0.0290  0.0031  118 TYR C O   
3868 C CB  . TYR C 116 ? 0.6784 0.8646 0.7314 -0.0288 0.0292  0.0121  118 TYR C CB  
3869 C CG  . TYR C 116 ? 0.6495 0.8498 0.7041 -0.0344 0.0286  0.0188  118 TYR C CG  
3870 C CD1 . TYR C 116 ? 0.6537 0.8797 0.7118 -0.0299 0.0311  0.0143  118 TYR C CD1 
3871 C CD2 . TYR C 116 ? 0.6326 0.8202 0.6852 -0.0435 0.0247  0.0290  118 TYR C CD2 
3872 C CE1 . TYR C 116 ? 0.6831 0.9239 0.7436 -0.0355 0.0305  0.0208  118 TYR C CE1 
3873 C CE2 . TYR C 116 ? 0.6246 0.8237 0.6788 -0.0495 0.0231  0.0356  118 TYR C CE2 
3874 C CZ  . TYR C 116 ? 0.6656 0.8922 0.7241 -0.0460 0.0264  0.0319  118 TYR C CZ  
3875 O OH  . TYR C 116 ? 0.7053 0.9456 0.7660 -0.0526 0.0248  0.0389  118 TYR C OH  
3876 N N   . GLY C 117 ? 0.7024 0.8938 0.7460 -0.0317 0.0284  0.0111  119 GLY C N   
3877 C CA  . GLY C 117 ? 0.6988 0.8794 0.7410 -0.0278 0.0281  0.0057  119 GLY C CA  
3878 C C   . GLY C 117 ? 0.6929 0.8545 0.7325 -0.0331 0.0247  0.0118  119 GLY C C   
3879 O O   . GLY C 117 ? 0.6966 0.8524 0.7339 -0.0405 0.0214  0.0211  119 GLY C O   
3880 N N   . CYS C 118 ? 0.6821 0.8329 0.7220 -0.0286 0.0246  0.0061  120 CYS C N   
3881 C CA  . CYS C 118 ? 0.6711 0.8094 0.7085 -0.0320 0.0215  0.0101  120 CYS C CA  
3882 C C   . CYS C 118 ? 0.6382 0.7576 0.6786 -0.0275 0.0212  0.0055  120 CYS C C   
3883 O O   . CYS C 118 ? 0.6354 0.7498 0.6796 -0.0225 0.0232  -0.0006 120 CYS C O   
3884 C CB  . CYS C 118 ? 0.6888 0.8413 0.7226 -0.0329 0.0213  0.0091  120 CYS C CB  
3885 S SG  . CYS C 118 ? 0.7279 0.8938 0.7639 -0.0241 0.0249  -0.0028 120 CYS C SG  
3886 N N   . VAL C 119 ? 0.6142 0.7245 0.6528 -0.0297 0.0181  0.0088  121 VAL C N   
3887 C CA  . VAL C 119 ? 0.5856 0.6828 0.6271 -0.0262 0.0177  0.0052  121 VAL C CA  
3888 C C   . VAL C 119 ? 0.5749 0.6737 0.6140 -0.0275 0.0150  0.0060  121 VAL C C   
3889 O O   . VAL C 119 ? 0.5979 0.6946 0.6329 -0.0314 0.0110  0.0123  121 VAL C O   
3890 C CB  . VAL C 119 ? 0.5859 0.6692 0.6278 -0.0265 0.0155  0.0089  121 VAL C CB  
3891 C CG1 . VAL C 119 ? 0.5766 0.6521 0.6223 -0.0227 0.0161  0.0048  121 VAL C CG1 
3892 C CG2 . VAL C 119 ? 0.5860 0.6672 0.6288 -0.0268 0.0169  0.0104  121 VAL C CG2 
3893 N N   . ASP C 120 ? 0.5425 0.6435 0.5834 -0.0246 0.0160  0.0001  122 ASP C N   
3894 C CA  . ASP C 120 ? 0.5251 0.6273 0.5641 -0.0256 0.0131  0.0007  122 ASP C CA  
3895 C C   . ASP C 120 ? 0.4971 0.5913 0.5406 -0.0228 0.0127  -0.0030 122 ASP C C   
3896 O O   . ASP C 120 ? 0.4863 0.5781 0.5339 -0.0206 0.0148  -0.0077 122 ASP C O   
3897 C CB  . ASP C 120 ? 0.5489 0.6648 0.5848 -0.0257 0.0137  -0.0024 122 ASP C CB  
3898 C CG  . ASP C 120 ? 0.6134 0.7418 0.6474 -0.0259 0.0163  -0.0027 122 ASP C CG  
3899 O OD1 . ASP C 120 ? 0.6684 0.7968 0.7056 -0.0215 0.0188  -0.0088 122 ASP C OD1 
3900 O OD2 . ASP C 120 ? 0.6611 0.7993 0.6906 -0.0308 0.0153  0.0037  122 ASP C OD2 
3901 N N   . TYR C 121 ? 0.4646 0.5553 0.5072 -0.0233 0.0092  -0.0003 123 TYR C N   
3902 C CA  . TYR C 121 ? 0.4315 0.5200 0.4784 -0.0211 0.0083  -0.0033 123 TYR C CA  
3903 C C   . TYR C 121 ? 0.4337 0.5274 0.4774 -0.0223 0.0050  -0.0029 123 TYR C C   
3904 O O   . TYR C 121 ? 0.4196 0.5144 0.4576 -0.0247 0.0019  0.0019  123 TYR C O   
3905 C CB  . TYR C 121 ? 0.4271 0.5086 0.4757 -0.0189 0.0063  -0.0011 123 TYR C CB  
3906 C CG  . TYR C 121 ? 0.4226 0.4990 0.4735 -0.0176 0.0090  -0.0010 123 TYR C CG  
3907 C CD1 . TYR C 121 ? 0.4371 0.5137 0.4935 -0.0155 0.0110  -0.0035 123 TYR C CD1 
3908 C CD2 . TYR C 121 ? 0.4353 0.5079 0.4829 -0.0189 0.0092  0.0022  123 TYR C CD2 
3909 C CE1 . TYR C 121 ? 0.4384 0.5112 0.4963 -0.0144 0.0133  -0.0031 123 TYR C CE1 
3910 C CE2 . TYR C 121 ? 0.4333 0.5008 0.4827 -0.0174 0.0113  0.0022  123 TYR C CE2 
3911 C CZ  . TYR C 121 ? 0.4481 0.5157 0.5026 -0.0150 0.0134  -0.0007 123 TYR C CZ  
3912 O OH  . TYR C 121 ? 0.4615 0.5254 0.5174 -0.0137 0.0155  -0.0006 123 TYR C OH  
3913 N N   . TRP C 122 ? 0.4232 0.5198 0.4702 -0.0213 0.0050  -0.0073 124 TRP C N   
3914 C CA  . TRP C 122 ? 0.4275 0.5292 0.4720 -0.0220 0.0019  -0.0079 124 TRP C CA  
3915 C C   . TRP C 122 ? 0.4174 0.5198 0.4679 -0.0210 0.0012  -0.0120 124 TRP C C   
3916 O O   . TRP C 122 ? 0.4001 0.5001 0.4559 -0.0208 0.0032  -0.0140 124 TRP C O   
3917 C CB  . TRP C 122 ? 0.4333 0.5431 0.4727 -0.0233 0.0029  -0.0100 124 TRP C CB  
3918 C CG  . TRP C 122 ? 0.4980 0.6085 0.5395 -0.0214 0.0062  -0.0155 124 TRP C CG  
3919 C CD1 . TRP C 122 ? 0.5228 0.6353 0.5628 -0.0210 0.0089  -0.0151 124 TRP C CD1 
3920 C CD2 . TRP C 122 ? 0.5401 0.6478 0.5852 -0.0198 0.0056  -0.0219 124 TRP C CD2 
3921 N NE1 . TRP C 122 ? 0.5140 0.6248 0.5562 -0.0182 0.0100  -0.0214 124 TRP C NE1 
3922 C CE2 . TRP C 122 ? 0.5165 0.6231 0.5614 -0.0177 0.0075  -0.0255 124 TRP C CE2 
3923 C CE3 . TRP C 122 ? 0.5723 0.6780 0.6207 -0.0203 0.0027  -0.0246 124 TRP C CE3 
3924 C CZ2 . TRP C 122 ? 0.5440 0.6451 0.5908 -0.0158 0.0056  -0.0318 124 TRP C CZ2 
3925 C CZ3 . TRP C 122 ? 0.5962 0.6970 0.6467 -0.0196 0.0009  -0.0303 124 TRP C CZ3 
3926 C CH2 . TRP C 122 ? 0.5685 0.6660 0.6178 -0.0172 0.0019  -0.0339 124 TRP C CH2 
3927 N N   . VAL C 123 ? 0.4354 0.5416 0.4848 -0.0213 -0.0021 -0.0127 125 VAL C N   
3928 C CA  . VAL C 123 ? 0.4503 0.5590 0.5054 -0.0214 -0.0034 -0.0161 125 VAL C CA  
3929 C C   . VAL C 123 ? 0.4903 0.6031 0.5411 -0.0224 -0.0055 -0.0195 125 VAL C C   
3930 O O   . VAL C 123 ? 0.4903 0.6066 0.5347 -0.0227 -0.0071 -0.0176 125 VAL C O   
3931 C CB  . VAL C 123 ? 0.4440 0.5549 0.5025 -0.0197 -0.0065 -0.0143 125 VAL C CB  
3932 C CG1 . VAL C 123 ? 0.4143 0.5309 0.4775 -0.0209 -0.0086 -0.0171 125 VAL C CG1 
3933 C CG2 . VAL C 123 ? 0.4053 0.5142 0.4682 -0.0173 -0.0047 -0.0126 125 VAL C CG2 
3934 N N   . LYS C 124 ? 0.5327 0.6446 0.5864 -0.0232 -0.0060 -0.0242 126 LYS C N   
3935 C CA  . LYS C 124 ? 0.5888 0.7032 0.6385 -0.0230 -0.0088 -0.0293 126 LYS C CA  
3936 C C   . LYS C 124 ? 0.6154 0.7310 0.6700 -0.0250 -0.0129 -0.0303 126 LYS C C   
3937 O O   . LYS C 124 ? 0.6068 0.7205 0.6687 -0.0273 -0.0131 -0.0293 126 LYS C O   
3938 C CB  . LYS C 124 ? 0.6024 0.7118 0.6513 -0.0219 -0.0086 -0.0347 126 LYS C CB  
3939 C CG  . LYS C 124 ? 0.6478 0.7619 0.6888 -0.0186 -0.0100 -0.0407 126 LYS C CG  
3940 C CD  . LYS C 124 ? 0.6849 0.8055 0.7208 -0.0164 -0.0056 -0.0394 126 LYS C CD  
3941 C CE  . LYS C 124 ? 0.7222 0.8389 0.7581 -0.0128 -0.0046 -0.0444 126 LYS C CE  
3942 N NZ  . LYS C 124 ? 0.7852 0.9087 0.8145 -0.0073 -0.0069 -0.0532 126 LYS C NZ  
3943 N N   . ALA C 125 ? 0.6410 0.7615 0.6915 -0.0247 -0.0162 -0.0317 127 ALA C N   
3944 C CA  . ALA C 125 ? 0.6714 0.7942 0.7258 -0.0267 -0.0208 -0.0331 127 ALA C CA  
3945 C C   . ALA C 125 ? 0.7103 0.8321 0.7598 -0.0264 -0.0249 -0.0396 127 ALA C C   
3946 O O   . ALA C 125 ? 0.7213 0.8474 0.7626 -0.0241 -0.0254 -0.0418 127 ALA C O   
3947 C CB  . ALA C 125 ? 0.6590 0.7876 0.7130 -0.0259 -0.0225 -0.0294 127 ALA C CB  
3948 N N   . PHE C 126 ? 0.7401 0.8562 0.7940 -0.0291 -0.0286 -0.0426 128 PHE C N   
3949 C CA  . PHE C 126 ? 0.7861 0.8985 0.8355 -0.0286 -0.0346 -0.0494 128 PHE C CA  
3950 C C   . PHE C 126 ? 0.8070 0.9235 0.8594 -0.0317 -0.0397 -0.0489 128 PHE C C   
3951 O O   . PHE C 126 ? 0.8136 0.9327 0.8747 -0.0361 -0.0402 -0.0444 128 PHE C O   
3952 C CB  . PHE C 126 ? 0.8074 0.9082 0.8597 -0.0310 -0.0383 -0.0521 128 PHE C CB  
3953 C CG  . PHE C 126 ? 0.8123 0.9082 0.8646 -0.0291 -0.0337 -0.0513 128 PHE C CG  
3954 C CD1 . PHE C 126 ? 0.8276 0.9184 0.8728 -0.0236 -0.0346 -0.0580 128 PHE C CD1 
3955 C CD2 . PHE C 126 ? 0.7929 0.8904 0.8520 -0.0320 -0.0288 -0.0445 128 PHE C CD2 
3956 C CE1 . PHE C 126 ? 0.8414 0.9280 0.8870 -0.0217 -0.0309 -0.0574 128 PHE C CE1 
3957 C CE2 . PHE C 126 ? 0.8071 0.8994 0.8660 -0.0304 -0.0250 -0.0437 128 PHE C CE2 
3958 C CZ  . PHE C 126 ? 0.8150 0.9015 0.8673 -0.0255 -0.0260 -0.0499 128 PHE C CZ  
3959 N N   . LEU C 127 ? 0.8386 0.9576 0.8840 -0.0295 -0.0437 -0.0537 129 LEU C N   
3960 C CA  . LEU C 127 ? 0.8640 0.9853 0.9119 -0.0328 -0.0501 -0.0543 129 LEU C CA  
3961 C C   . LEU C 127 ? 0.9026 1.0144 0.9470 -0.0335 -0.0589 -0.0621 129 LEU C C   
3962 O O   . LEU C 127 ? 0.9075 1.0128 0.9442 -0.0287 -0.0604 -0.0690 129 LEU C O   
3963 C CB  . LEU C 127 ? 0.8534 0.9847 0.8965 -0.0304 -0.0494 -0.0526 129 LEU C CB  
3964 C CG  . LEU C 127 ? 0.8850 1.0185 0.9246 -0.0310 -0.0564 -0.0566 129 LEU C CG  
3965 C CD1 . LEU C 127 ? 0.8947 1.0315 0.9449 -0.0361 -0.0597 -0.0526 129 LEU C CD1 
3966 C CD2 . LEU C 127 ? 0.9120 1.0543 0.9426 -0.0277 -0.0553 -0.0558 129 LEU C CD2 
3967 N N   . ASP C 128 ? 0.9310 1.0420 0.9809 -0.0391 -0.0656 -0.0612 130 ASP C N   
3968 C CA  . ASP C 128 ? 0.9739 1.0735 1.0200 -0.0405 -0.0760 -0.0683 130 ASP C CA  
3969 C C   . ASP C 128 ? 0.9905 1.0950 1.0362 -0.0429 -0.0829 -0.0696 130 ASP C C   
3970 O O   . ASP C 128 ? 1.0004 1.1065 1.0547 -0.0506 -0.0874 -0.0653 130 ASP C O   
3971 C CB  . ASP C 128 ? 0.9762 1.0633 1.0284 -0.0472 -0.0808 -0.0663 130 ASP C CB  
3972 C CG  . ASP C 128 ? 0.9782 1.0628 1.0321 -0.0454 -0.0732 -0.0634 130 ASP C CG  
3973 O OD1 . ASP C 128 ? 0.9869 1.0639 1.0465 -0.0514 -0.0751 -0.0595 130 ASP C OD1 
3974 O OD2 . ASP C 128 ? 0.9532 1.0440 1.0023 -0.0385 -0.0655 -0.0644 130 ASP C OD2 
3975 N N   . ARG C 129 ? 0.9984 1.1075 1.0340 -0.0365 -0.0832 -0.0751 131 ARG C N   
3976 C CA  . ARG C 129 ? 1.0151 1.1278 1.0473 -0.0370 -0.0903 -0.0783 131 ARG C CA  
3977 C C   . ARG C 129 ? 1.0455 1.1441 1.0774 -0.0411 -0.1031 -0.0839 131 ARG C C   
3978 O O   . ARG C 129 ? 1.0556 1.1408 1.0904 -0.0443 -0.1068 -0.0844 131 ARG C O   
3979 C CB  . ARG C 129 ? 1.0273 1.1467 1.0461 -0.0287 -0.0884 -0.0842 131 ARG C CB  
3980 C CG  . ARG C 129 ? 1.0184 1.1528 1.0354 -0.0274 -0.0815 -0.0779 131 ARG C CG  
3981 C CD  . ARG C 129 ? 1.0909 1.2330 1.0941 -0.0219 -0.0837 -0.0840 131 ARG C CD  
3982 N NE  . ARG C 129 ? 1.1254 1.2803 1.1254 -0.0222 -0.0798 -0.0772 131 ARG C NE  
3983 C CZ  . ARG C 129 ? 1.1317 1.2936 1.1258 -0.0221 -0.0843 -0.0778 131 ARG C CZ  
3984 N NH1 . ARG C 129 ? 1.1303 1.2885 1.1208 -0.0214 -0.0926 -0.0855 131 ARG C NH1 
3985 N NH2 . ARG C 129 ? 1.1068 1.2781 1.0977 -0.0230 -0.0815 -0.0704 131 ARG C NH2 
3986 N N   . PRO C 130 ? 1.0483 1.1487 1.0767 -0.0418 -0.1110 -0.0876 132 PRO C N   
3987 C CA  . PRO C 130 ? 1.0803 1.1669 1.1064 -0.0453 -0.1252 -0.0936 132 PRO C CA  
3988 C C   . PRO C 130 ? 1.1069 1.1728 1.1290 -0.0446 -0.1330 -0.0998 132 PRO C C   
3989 O O   . PRO C 130 ? 1.1122 1.1687 1.1428 -0.0536 -0.1372 -0.0942 132 PRO C O   
3990 C CB  . PRO C 130 ? 0.9983 1.0893 1.0119 -0.0378 -0.1286 -0.1021 132 PRO C CB  
3991 C CG  . PRO C 130 ? 0.9725 1.0835 0.9889 -0.0374 -0.1187 -0.0945 132 PRO C CG  
3992 C CD  . PRO C 130 ? 0.9390 1.0547 0.9652 -0.0396 -0.1076 -0.0853 132 PRO C CD  
3993 N N   . SER C 131 ? 1.1253 1.1856 1.1342 -0.0336 -0.1352 -0.1112 133 SER C N   
3994 C CA  . SER C 131 ? 1.1548 1.1951 1.1573 -0.0292 -0.1438 -0.1200 133 SER C CA  
3995 C C   . SER C 131 ? 1.1417 1.1882 1.1357 -0.0168 -0.1354 -0.1267 133 SER C C   
3996 O O   . SER C 131 ? 1.1722 1.2129 1.1543 -0.0063 -0.1418 -0.1395 133 SER C O   
3997 C CB  . SER C 131 ? 1.2043 1.2307 1.1977 -0.0269 -0.1599 -0.1306 133 SER C CB  
3998 O OG  . SER C 131 ? 1.2339 1.2464 1.2350 -0.0397 -0.1716 -0.1250 133 SER C OG  
3999 N N   . GLN C 132 ? 1.1019 1.1607 1.1020 -0.0178 -0.1218 -0.1183 134 GLN C N   
4000 C CA  . GLN C 132 ? 1.0837 1.1562 1.0770 -0.0081 -0.1113 -0.1214 134 GLN C CA  
4001 C C   . GLN C 132 ? 1.0652 1.1336 1.0626 -0.0072 -0.1047 -0.1183 134 GLN C C   
4002 O O   . GLN C 132 ? 1.0576 1.1170 1.0650 -0.0156 -0.1049 -0.1105 134 GLN C O   
4003 C CB  . GLN C 132 ? 1.0574 1.1507 1.0526 -0.0104 -0.1011 -0.1130 134 GLN C CB  
4004 C CG  . GLN C 132 ? 1.0671 1.1655 1.0589 -0.0118 -0.1070 -0.1147 134 GLN C CG  
4005 C CD  . GLN C 132 ? 1.0780 1.1886 1.0558 -0.0021 -0.1065 -0.1235 134 GLN C CD  
4006 O OE1 . GLN C 132 ? 1.0487 1.1561 1.0189 0.0012  -0.1158 -0.1321 134 GLN C OE1 
4007 N NE2 . GLN C 132 ? 1.0815 1.2073 1.0554 0.0022  -0.0959 -0.1212 134 GLN C NE2 
4008 N N   . PRO C 133 ? 1.0599 1.1377 1.0500 0.0026  -0.0984 -0.1238 135 PRO C N   
4009 C CA  . PRO C 133 ? 1.0379 1.1108 1.0333 0.0022  -0.0928 -0.1199 135 PRO C CA  
4010 C C   . PRO C 133 ? 1.0012 1.0877 1.0050 -0.0047 -0.0805 -0.1065 135 PRO C C   
4011 O O   . PRO C 133 ? 0.9905 1.0901 0.9946 -0.0074 -0.0769 -0.1015 135 PRO C O   
4012 C CB  . PRO C 133 ? 1.0488 1.1293 1.0343 0.0149  -0.0908 -0.1304 135 PRO C CB  
4013 C CG  . PRO C 133 ? 1.0633 1.1606 1.0387 0.0210  -0.0909 -0.1367 135 PRO C CG  
4014 C CD  . PRO C 133 ? 1.0697 1.1652 1.0483 0.0126  -0.0950 -0.1314 135 PRO C CD  
4015 N N   . THR C 134 ? 0.9645 1.0467 0.9749 -0.0072 -0.0752 -0.1009 136 THR C N   
4016 C CA  . THR C 134 ? 0.9165 1.0062 0.9359 -0.0143 -0.0665 -0.0887 136 THR C CA  
4017 C C   . THR C 134 ? 0.8850 0.9912 0.9003 -0.0101 -0.0566 -0.0860 136 THR C C   
4018 O O   . THR C 134 ? 0.8786 0.9866 0.8910 -0.0052 -0.0524 -0.0882 136 THR C O   
4019 C CB  . THR C 134 ? 0.9139 0.9920 0.9426 -0.0203 -0.0660 -0.0827 136 THR C CB  
4020 O OG1 . THR C 134 ? 0.9125 0.9894 0.9391 -0.0151 -0.0608 -0.0842 136 THR C OG1 
4021 C CG2 . THR C 134 ? 0.9290 0.9888 0.9601 -0.0257 -0.0785 -0.0853 136 THR C CG2 
4022 N N   . GLN C 135 ? 0.8600 0.9780 0.8746 -0.0123 -0.0538 -0.0810 137 GLN C N   
4023 C CA  . GLN C 135 ? 0.8329 0.9655 0.8437 -0.0110 -0.0458 -0.0758 137 GLN C CA  
4024 C C   . GLN C 135 ? 0.8017 0.9332 0.8192 -0.0139 -0.0385 -0.0672 137 GLN C C   
4025 O O   . GLN C 135 ? 0.7945 0.9165 0.8209 -0.0177 -0.0390 -0.0640 137 GLN C O   
4026 C CB  . GLN C 135 ? 0.8277 0.9692 0.8365 -0.0137 -0.0469 -0.0715 137 GLN C CB  
4027 C CG  . GLN C 135 ? 0.8013 0.9558 0.8054 -0.0142 -0.0409 -0.0645 137 GLN C CG  
4028 C CD  . GLN C 135 ? 0.7985 0.9600 0.7986 -0.0162 -0.0441 -0.0618 137 GLN C CD  
4029 O OE1 . GLN C 135 ? 0.8674 1.0247 0.8692 -0.0168 -0.0501 -0.0656 137 GLN C OE1 
4030 N NE2 . GLN C 135 ? 0.7800 0.9516 0.7747 -0.0179 -0.0412 -0.0548 137 GLN C NE2 
4031 N N   . GLU C 136 ? 0.7792 0.9214 0.7923 -0.0126 -0.0325 -0.0633 138 GLU C N   
4032 C CA  . GLU C 136 ? 0.7530 0.8938 0.7710 -0.0147 -0.0264 -0.0559 138 GLU C CA  
4033 C C   . GLU C 136 ? 0.7287 0.8776 0.7444 -0.0176 -0.0230 -0.0468 138 GLU C C   
4034 O O   . GLU C 136 ? 0.7476 0.9074 0.7555 -0.0177 -0.0236 -0.0457 138 GLU C O   
4035 C CB  . GLU C 136 ? 0.7601 0.9019 0.7755 -0.0104 -0.0232 -0.0600 138 GLU C CB  
4036 C CG  . GLU C 136 ? 0.8033 0.9307 0.8248 -0.0098 -0.0250 -0.0635 138 GLU C CG  
4037 C CD  . GLU C 136 ? 0.8491 0.9776 0.8691 -0.0058 -0.0212 -0.0657 138 GLU C CD  
4038 O OE1 . GLU C 136 ? 0.8958 1.0174 0.9143 -0.0010 -0.0252 -0.0741 138 GLU C OE1 
4039 O OE2 . GLU C 136 ? 0.8462 0.9821 0.8664 -0.0073 -0.0152 -0.0591 138 GLU C OE2 
4040 N N   . THR C 137 ? 0.6890 0.8320 0.7110 -0.0201 -0.0203 -0.0402 139 THR C N   
4041 C CA  . THR C 137 ? 0.6528 0.7992 0.6725 -0.0224 -0.0181 -0.0316 139 THR C CA  
4042 C C   . THR C 137 ? 0.6210 0.7597 0.6468 -0.0226 -0.0144 -0.0286 139 THR C C   
4043 O O   . THR C 137 ? 0.6266 0.7577 0.6602 -0.0224 -0.0144 -0.0304 139 THR C O   
4044 C CB  . THR C 137 ? 0.6569 0.8027 0.6771 -0.0246 -0.0223 -0.0264 139 THR C CB  
4045 O OG1 . THR C 137 ? 0.6629 0.8095 0.6789 -0.0270 -0.0223 -0.0183 139 THR C OG1 
4046 C CG2 . THR C 137 ? 0.6317 0.7698 0.6619 -0.0245 -0.0236 -0.0261 139 THR C CG2 
4047 N N   . LYS C 138 ? 0.5933 0.7350 0.6155 -0.0237 -0.0115 -0.0236 140 LYS C N   
4048 C CA  . LYS C 138 ? 0.5578 0.6928 0.5845 -0.0238 -0.0081 -0.0207 140 LYS C CA  
4049 C C   . LYS C 138 ? 0.5322 0.6653 0.5562 -0.0267 -0.0093 -0.0117 140 LYS C C   
4050 O O   . LYS C 138 ? 0.5542 0.6943 0.5708 -0.0296 -0.0109 -0.0074 140 LYS C O   
4051 C CB  . LYS C 138 ? 0.5503 0.6901 0.5748 -0.0218 -0.0043 -0.0246 140 LYS C CB  
4052 C CG  . LYS C 138 ? 0.5662 0.7052 0.5908 -0.0232 -0.0012 -0.0194 140 LYS C CG  
4053 C CD  . LYS C 138 ? 0.6149 0.7551 0.6409 -0.0198 0.0022  -0.0248 140 LYS C CD  
4054 C CE  . LYS C 138 ? 0.6675 0.8150 0.6906 -0.0217 0.0053  -0.0197 140 LYS C CE  
4055 N NZ  . LYS C 138 ? 0.7500 0.9053 0.7724 -0.0173 0.0080  -0.0263 140 LYS C NZ  
4056 N N   . LYS C 139 ? 0.4875 0.6112 0.5165 -0.0262 -0.0095 -0.0087 141 LYS C N   
4057 C CA  . LYS C 139 ? 0.4580 0.5774 0.4828 -0.0285 -0.0126 -0.0008 141 LYS C CA  
4058 C C   . LYS C 139 ? 0.4315 0.5427 0.4596 -0.0275 -0.0106 0.0013  141 LYS C C   
4059 O O   . LYS C 139 ? 0.4147 0.5212 0.4498 -0.0243 -0.0086 -0.0022 141 LYS C O   
4060 C CB  . LYS C 139 ? 0.4635 0.5784 0.4881 -0.0276 -0.0189 0.0013  141 LYS C CB  
4061 C CG  . LYS C 139 ? 0.4710 0.5805 0.4889 -0.0304 -0.0246 0.0091  141 LYS C CG  
4062 C CD  . LYS C 139 ? 0.4692 0.5717 0.4873 -0.0277 -0.0321 0.0104  141 LYS C CD  
4063 C CE  . LYS C 139 ? 0.5112 0.6205 0.5237 -0.0304 -0.0358 0.0115  141 LYS C CE  
4064 N NZ  . LYS C 139 ? 0.5231 0.6244 0.5323 -0.0293 -0.0455 0.0154  141 LYS C NZ  
4065 N N   . ASN C 140 ? 0.4162 0.5269 0.4391 -0.0309 -0.0110 0.0071  142 ASN C N   
4066 C CA  . ASN C 140 ? 0.4091 0.5122 0.4348 -0.0300 -0.0092 0.0085  142 ASN C CA  
4067 C C   . ASN C 140 ? 0.4055 0.4963 0.4324 -0.0274 -0.0144 0.0108  142 ASN C C   
4068 O O   . ASN C 140 ? 0.4221 0.5093 0.4457 -0.0274 -0.0209 0.0134  142 ASN C O   
4069 C CB  . ASN C 140 ? 0.4023 0.5095 0.4227 -0.0350 -0.0085 0.0142  142 ASN C CB  
4070 C CG  . ASN C 140 ? 0.4564 0.5783 0.4761 -0.0355 -0.0030 0.0105  142 ASN C CG  
4071 O OD1 . ASN C 140 ? 0.4933 0.6160 0.5181 -0.0316 0.0017  0.0038  142 ASN C OD1 
4072 N ND2 . ASN C 140 ? 0.5557 0.6902 0.5685 -0.0403 -0.0042 0.0147  142 ASN C ND2 
4073 N N   . PHE C 141 ? 0.3787 0.4636 0.4103 -0.0243 -0.0119 0.0090  143 PHE C N   
4074 C CA  . PHE C 141 ? 0.3750 0.4486 0.4058 -0.0212 -0.0171 0.0111  143 PHE C CA  
4075 C C   . PHE C 141 ? 0.3882 0.4559 0.4183 -0.0222 -0.0154 0.0134  143 PHE C C   
4076 O O   . PHE C 141 ? 0.3438 0.4172 0.3760 -0.0240 -0.0089 0.0121  143 PHE C O   
4077 C CB  . PHE C 141 ? 0.3737 0.4476 0.4111 -0.0146 -0.0175 0.0058  143 PHE C CB  
4078 C CG  . PHE C 141 ? 0.3285 0.4077 0.3734 -0.0128 -0.0103 0.0010  143 PHE C CG  
4079 C CD1 . PHE C 141 ? 0.3232 0.4110 0.3722 -0.0149 -0.0056 -0.0024 143 PHE C CD1 
4080 C CD2 . PHE C 141 ? 0.2718 0.3468 0.3192 -0.0092 -0.0091 0.0001  143 PHE C CD2 
4081 C CE1 . PHE C 141 ? 0.2414 0.3321 0.2965 -0.0146 -0.0007 -0.0056 143 PHE C CE1 
4082 C CE2 . PHE C 141 ? 0.2342 0.3146 0.2880 -0.0088 -0.0029 -0.0031 143 PHE C CE2 
4083 C CZ  . PHE C 141 ? 0.2478 0.3354 0.3054 -0.0119 0.0009  -0.0054 143 PHE C CZ  
4084 N N   . GLU C 142 ? 0.4283 0.4837 0.4545 -0.0206 -0.0225 0.0167  144 GLU C N   
4085 C CA  . GLU C 142 ? 0.4478 0.4947 0.4716 -0.0218 -0.0237 0.0199  144 GLU C CA  
4086 C C   . GLU C 142 ? 0.4500 0.4917 0.4783 -0.0144 -0.0224 0.0149  144 GLU C C   
4087 O O   . GLU C 142 ? 0.4352 0.4766 0.4663 -0.0078 -0.0244 0.0104  144 GLU C O   
4088 C CB  . GLU C 142 ? 0.4650 0.5001 0.4800 -0.0260 -0.0344 0.0276  144 GLU C CB  
4089 C CG  . GLU C 142 ? 0.5524 0.5963 0.5622 -0.0357 -0.0348 0.0345  144 GLU C CG  
4090 C CD  . GLU C 142 ? 0.5748 0.6321 0.5867 -0.0406 -0.0260 0.0354  144 GLU C CD  
4091 O OE1 . GLU C 142 ? 0.5465 0.5995 0.5578 -0.0428 -0.0261 0.0383  144 GLU C OE1 
4092 O OE2 . GLU C 142 ? 0.5798 0.6520 0.5938 -0.0414 -0.0197 0.0325  144 GLU C OE2 
4093 N N   . VAL C 143 ? 0.4829 0.5226 0.5118 -0.0157 -0.0188 0.0156  145 VAL C N   
4094 C CA  . VAL C 143 ? 0.5163 0.5552 0.5499 -0.0099 -0.0149 0.0108  145 VAL C CA  
4095 C C   . VAL C 143 ? 0.5579 0.5868 0.5874 -0.0115 -0.0177 0.0144  145 VAL C C   
4096 O O   . VAL C 143 ? 0.5692 0.5976 0.5949 -0.0186 -0.0190 0.0201  145 VAL C O   
4097 C CB  . VAL C 143 ? 0.4882 0.5388 0.5287 -0.0111 -0.0051 0.0073  145 VAL C CB  
4098 C CG1 . VAL C 143 ? 0.4842 0.5334 0.5277 -0.0085 -0.0011 0.0052  145 VAL C CG1 
4099 C CG2 . VAL C 143 ? 0.4773 0.5363 0.5225 -0.0087 -0.0036 0.0033  145 VAL C CG2 
4100 N N   . VAL C 144 ? 0.6020 0.6247 0.6320 -0.0053 -0.0188 0.0111  146 VAL C N   
4101 C CA  . VAL C 144 ? 0.6535 0.6646 0.6789 -0.0060 -0.0229 0.0139  146 VAL C CA  
4102 C C   . VAL C 144 ? 0.6893 0.6998 0.7173 0.0003  -0.0197 0.0092  146 VAL C C   
4103 O O   . VAL C 144 ? 0.7011 0.7110 0.7294 0.0088  -0.0223 0.0040  146 VAL C O   
4104 C CB  . VAL C 144 ? 0.6748 0.6695 0.6922 -0.0045 -0.0361 0.0167  146 VAL C CB  
4105 C CG1 . VAL C 144 ? 0.6997 0.6912 0.7172 0.0072  -0.0410 0.0095  146 VAL C CG1 
4106 C CG2 . VAL C 144 ? 0.6820 0.6642 0.6944 -0.0070 -0.0411 0.0205  146 VAL C CG2 
4107 N N   . ASP C 145 ? 0.7332 0.7447 0.7624 -0.0034 -0.0148 0.0109  147 ASP C N   
4108 C CA  . ASP C 145 ? 0.7745 0.7849 0.8050 0.0021  -0.0123 0.0070  147 ASP C CA  
4109 C C   . ASP C 145 ? 0.8105 0.8050 0.8338 0.0058  -0.0219 0.0076  147 ASP C C   
4110 O O   . ASP C 145 ? 0.8299 0.8144 0.8482 -0.0002 -0.0279 0.0134  147 ASP C O   
4111 C CB  . ASP C 145 ? 0.7560 0.7740 0.7912 -0.0019 -0.0033 0.0075  147 ASP C CB  
4112 C CG  . ASP C 145 ? 0.7780 0.8033 0.8174 0.0031  0.0021  0.0028  147 ASP C CG  
4113 O OD1 . ASP C 145 ? 0.7754 0.8108 0.8192 0.0046  0.0052  0.0001  147 ASP C OD1 
4114 O OD2 . ASP C 145 ? 0.8453 0.8671 0.8833 0.0051  0.0027  0.0022  147 ASP C OD2 
4115 N N   . LEU C 146 ? 0.8396 0.8333 0.8622 0.0154  -0.0236 0.0014  148 LEU C N   
4116 C CA  . LEU C 146 ? 0.8807 0.8593 0.8957 0.0235  -0.0354 -0.0015 148 LEU C CA  
4117 C C   . LEU C 146 ? 0.8926 0.8564 0.9017 0.0217  -0.0408 0.0011  148 LEU C C   
4118 O O   . LEU C 146 ? 0.8776 0.8425 0.8883 0.0129  -0.0361 0.0066  148 LEU C O   
4119 C CB  . LEU C 146 ? 0.8950 0.8838 0.9120 0.0360  -0.0343 -0.0105 148 LEU C CB  
4120 C CG  . LEU C 146 ? 0.9351 0.9168 0.9461 0.0493  -0.0430 -0.0181 148 LEU C CG  
4121 C CD1 . LEU C 146 ? 0.9580 0.9157 0.9594 0.0524  -0.0595 -0.0176 148 LEU C CD1 
4122 C CD2 . LEU C 146 ? 0.9130 0.9150 0.9286 0.0604  -0.0390 -0.0265 148 LEU C CD2 
4123 N N   . PRO C 152 ? 0.7589 0.7814 0.7838 -0.0551 -0.0179 0.0532  154 PRO C N   
4124 C CA  . PRO C 152 ? 0.7439 0.7769 0.7734 -0.0561 -0.0135 0.0532  154 PRO C CA  
4125 C C   . PRO C 152 ? 0.7249 0.7829 0.7603 -0.0566 -0.0052 0.0515  154 PRO C C   
4126 O O   . PRO C 152 ? 0.7221 0.7838 0.7596 -0.0510 0.0002  0.0454  154 PRO C O   
4127 C CB  . PRO C 152 ? 0.7253 0.7470 0.7563 -0.0464 -0.0096 0.0452  154 PRO C CB  
4128 C CG  . PRO C 152 ? 0.7367 0.7548 0.7677 -0.0400 -0.0065 0.0394  154 PRO C CG  
4129 C CD  . PRO C 152 ? 0.7493 0.7665 0.7761 -0.0451 -0.0123 0.0443  154 PRO C CD  
4130 N N   . ASP C 153 ? 0.7129 0.7886 0.7508 -0.0629 -0.0049 0.0564  155 ASP C N   
4131 C CA  . ASP C 153 ? 0.6879 0.7907 0.7308 -0.0627 0.0019  0.0544  155 ASP C CA  
4132 C C   . ASP C 153 ? 0.6657 0.7736 0.7144 -0.0532 0.0088  0.0452  155 ASP C C   
4133 O O   . ASP C 153 ? 0.6876 0.7925 0.7383 -0.0522 0.0083  0.0451  155 ASP C O   
4134 C CB  . ASP C 153 ? 0.7022 0.8278 0.7459 -0.0730 -0.0005 0.0632  155 ASP C CB  
4135 C CG  . ASP C 153 ? 0.6970 0.8543 0.7466 -0.0695 0.0074  0.0584  155 ASP C CG  
4136 O OD1 . ASP C 153 ? 0.7258 0.8888 0.7756 -0.0642 0.0116  0.0525  155 ASP C OD1 
4137 O OD2 . ASP C 153 ? 0.6402 0.8169 0.6941 -0.0708 0.0089  0.0595  155 ASP C OD2 
4138 N N   . LEU C 154 ? 0.6261 0.7422 0.6772 -0.0468 0.0143  0.0379  156 LEU C N   
4139 C CA  . LEU C 154 ? 0.5874 0.7085 0.6433 -0.0378 0.0194  0.0289  156 LEU C CA  
4140 C C   . LEU C 154 ? 0.5744 0.7076 0.6344 -0.0368 0.0200  0.0285  156 LEU C C   
4141 O O   . LEU C 154 ? 0.5749 0.7025 0.6376 -0.0294 0.0219  0.0220  156 LEU C O   
4142 C CB  . LEU C 154 ? 0.5877 0.7252 0.6450 -0.0337 0.0231  0.0230  156 LEU C CB  
4143 C CG  . LEU C 154 ? 0.5844 0.7197 0.6448 -0.0233 0.0262  0.0124  156 LEU C CG  
4144 C CD1 . LEU C 154 ? 0.5735 0.6830 0.6330 -0.0202 0.0256  0.0100  156 LEU C CD1 
4145 C CD2 . LEU C 154 ? 0.5955 0.7425 0.6554 -0.0200 0.0281  0.0072  156 LEU C CD2 
4146 N N   . MET C 155 ? 0.5701 0.7208 0.6305 -0.0445 0.0181  0.0358  157 MET C N   
4147 C CA  . MET C 155 ? 0.5653 0.7320 0.6307 -0.0426 0.0191  0.0345  157 MET C CA  
4148 C C   . MET C 155 ? 0.5624 0.7204 0.6270 -0.0495 0.0143  0.0422  157 MET C C   
4149 O O   . MET C 155 ? 0.5546 0.7246 0.6235 -0.0484 0.0146  0.0418  157 MET C O   
4150 C CB  . MET C 155 ? 0.5722 0.7744 0.6408 -0.0437 0.0218  0.0345  157 MET C CB  
4151 C CG  . MET C 155 ? 0.6024 0.8142 0.6718 -0.0346 0.0260  0.0247  157 MET C CG  
4152 S SD  . MET C 155 ? 0.6644 0.8803 0.7388 -0.0190 0.0284  0.0105  157 MET C SD  
4153 C CE  . MET C 155 ? 0.6517 0.8289 0.7232 -0.0132 0.0276  0.0050  157 MET C CE  
4154 N N   . ALA C 156 ? 0.5604 0.6969 0.6195 -0.0557 0.0091  0.0485  158 ALA C N   
4155 C CA  . ALA C 156 ? 0.5652 0.6882 0.6222 -0.0611 0.0030  0.0547  158 ALA C CA  
4156 C C   . ALA C 156 ? 0.5547 0.6598 0.6127 -0.0523 0.0045  0.0479  158 ALA C C   
4157 O O   . ALA C 156 ? 0.5349 0.6316 0.5935 -0.0438 0.0087  0.0402  158 ALA C O   
4158 C CB  . ALA C 156 ? 0.5635 0.6671 0.6131 -0.0686 -0.0045 0.0620  158 ALA C CB  
4159 N N   . PRO C 157 ? 0.5649 0.6641 0.6226 -0.0554 0.0003  0.0517  159 PRO C N   
4160 C CA  . PRO C 157 ? 0.5612 0.6455 0.6193 -0.0478 0.0015  0.0460  159 PRO C CA  
4161 C C   . PRO C 157 ? 0.5786 0.6365 0.6302 -0.0455 -0.0009 0.0448  159 PRO C C   
4162 O O   . PRO C 157 ? 0.6037 0.6522 0.6501 -0.0511 -0.0066 0.0499  159 PRO C O   
4163 C CB  . PRO C 157 ? 0.5676 0.6540 0.6264 -0.0532 -0.0035 0.0516  159 PRO C CB  
4164 C CG  . PRO C 157 ? 0.5810 0.6865 0.6410 -0.0637 -0.0067 0.0600  159 PRO C CG  
4165 C CD  . PRO C 157 ? 0.5936 0.6982 0.6501 -0.0666 -0.0066 0.0618  159 PRO C CD  
4166 N N   . VAL C 158 ? 0.5784 0.6251 0.6299 -0.0373 0.0026  0.0381  160 VAL C N   
4167 C CA  . VAL C 158 ? 0.5854 0.6116 0.6313 -0.0338 0.0013  0.0359  160 VAL C CA  
4168 C C   . VAL C 158 ? 0.5866 0.6011 0.6303 -0.0311 -0.0006 0.0350  160 VAL C C   
4169 O O   . VAL C 158 ? 0.5851 0.6059 0.6326 -0.0294 0.0012  0.0337  160 VAL C O   
4170 C CB  . VAL C 158 ? 0.5822 0.6084 0.6296 -0.0278 0.0072  0.0297  160 VAL C CB  
4171 C CG1 . VAL C 158 ? 0.5870 0.5969 0.6296 -0.0238 0.0068  0.0271  160 VAL C CG1 
4172 C CG2 . VAL C 158 ? 0.5996 0.6371 0.6486 -0.0301 0.0089  0.0301  160 VAL C CG2 
4173 N N   . SER C 159 ? 0.5958 0.5936 0.6330 -0.0298 -0.0048 0.0350  161 SER C N   
4174 C CA  . SER C 159 ? 0.6043 0.5913 0.6381 -0.0279 -0.0079 0.0347  161 SER C CA  
4175 C C   . SER C 159 ? 0.6093 0.5793 0.6350 -0.0241 -0.0123 0.0328  161 SER C C   
4176 O O   . SER C 159 ? 0.6269 0.5913 0.6490 -0.0247 -0.0162 0.0333  161 SER C O   
4177 C CB  . SER C 159 ? 0.6080 0.5980 0.6424 -0.0345 -0.0138 0.0405  161 SER C CB  
4178 O OG  . SER C 159 ? 0.6125 0.5934 0.6415 -0.0392 -0.0215 0.0447  161 SER C OG  
4179 N N   . ALA C 160 ? 0.5932 0.5558 0.6157 -0.0198 -0.0126 0.0302  162 ALA C N   
4180 C CA  . ALA C 160 ? 0.5883 0.5387 0.6030 -0.0141 -0.0157 0.0266  162 ALA C CA  
4181 C C   . ALA C 160 ? 0.5864 0.5303 0.5973 -0.0118 -0.0178 0.0258  162 ALA C C   
4182 O O   . ALA C 160 ? 0.5731 0.5226 0.5884 -0.0142 -0.0155 0.0277  162 ALA C O   
4183 C CB  . ALA C 160 ? 0.5588 0.5145 0.5746 -0.0091 -0.0087 0.0222  162 ALA C CB  
4184 N N   . LYS C 161 ? 0.5927 0.5255 0.5953 -0.0065 -0.0230 0.0225  163 LYS C N   
4185 C CA  . LYS C 161 ? 0.6113 0.5387 0.6089 -0.0028 -0.0245 0.0205  163 LYS C CA  
4186 C C   . LYS C 161 ? 0.6196 0.5440 0.6097 0.0059  -0.0247 0.0144  163 LYS C C   
4187 O O   . LYS C 161 ? 0.6304 0.5516 0.6174 0.0096  -0.0279 0.0115  163 LYS C O   
4188 C CB  . LYS C 161 ? 0.6447 0.5614 0.6388 -0.0064 -0.0340 0.0236  163 LYS C CB  
4189 C CG  . LYS C 161 ? 0.6875 0.5923 0.6772 -0.0095 -0.0449 0.0259  163 LYS C CG  
4190 C CD  . LYS C 161 ? 0.7615 0.6559 0.7425 -0.0007 -0.0497 0.0194  163 LYS C CD  
4191 C CE  . LYS C 161 ? 0.8278 0.7026 0.8003 -0.0013 -0.0649 0.0201  163 LYS C CE  
4192 N NZ  . LYS C 161 ? 0.8512 0.7245 0.8275 -0.0129 -0.0704 0.0286  163 LYS C NZ  
4193 N N   . LYS C 162 ? 0.6092 0.5364 0.5964 0.0095  -0.0215 0.0124  164 LYS C N   
4194 C CA  . LYS C 162 ? 0.6078 0.5370 0.5877 0.0179  -0.0212 0.0066  164 LYS C CA  
4195 C C   . LYS C 162 ? 0.6056 0.5322 0.5790 0.0211  -0.0230 0.0051  164 LYS C C   
4196 O O   . LYS C 162 ? 0.5910 0.5177 0.5672 0.0164  -0.0213 0.0091  164 LYS C O   
4197 C CB  . LYS C 162 ? 0.6051 0.5493 0.5894 0.0187  -0.0119 0.0058  164 LYS C CB  
4198 C CG  . LYS C 162 ? 0.6305 0.5831 0.6083 0.0270  -0.0104 0.0002  164 LYS C CG  
4199 C CD  . LYS C 162 ? 0.6675 0.6292 0.6485 0.0292  -0.0073 -0.0021 164 LYS C CD  
4200 C CE  . LYS C 162 ? 0.6715 0.6477 0.6593 0.0240  0.0021  0.0015  164 LYS C CE  
4201 N NZ  . LYS C 162 ? 0.6956 0.6819 0.6862 0.0264  0.0048  -0.0010 164 LYS C NZ  
4202 N N   . GLU C 163 ? 0.6161 0.5410 0.5803 0.0300  -0.0269 -0.0012 165 GLU C N   
4203 C CA  . GLU C 163 ? 0.6320 0.5540 0.5877 0.0348  -0.0301 -0.0040 165 GLU C CA  
4204 C C   . GLU C 163 ? 0.6367 0.5731 0.5860 0.0443  -0.0263 -0.0105 165 GLU C C   
4205 O O   . GLU C 163 ? 0.6426 0.5826 0.5900 0.0509  -0.0277 -0.0159 165 GLU C O   
4206 C CB  . GLU C 163 ? 0.6489 0.5513 0.5982 0.0365  -0.0429 -0.0058 165 GLU C CB  
4207 C CG  . GLU C 163 ? 0.7461 0.6422 0.6858 0.0417  -0.0485 -0.0092 165 GLU C CG  
4208 C CD  . GLU C 163 ? 0.8278 0.7058 0.7661 0.0362  -0.0588 -0.0056 165 GLU C CD  
4209 O OE1 . GLU C 163 ? 0.8759 0.7417 0.8151 0.0329  -0.0668 -0.0040 165 GLU C OE1 
4210 O OE2 . GLU C 163 ? 0.8581 0.7348 0.7946 0.0343  -0.0592 -0.0037 165 GLU C OE2 
4211 N N   . LYS C 164 ? 0.6413 0.5885 0.5878 0.0444  -0.0211 -0.0096 166 LYS C N   
4212 C CA  . LYS C 164 ? 0.6471 0.6118 0.5867 0.0526  -0.0176 -0.0150 166 LYS C CA  
4213 C C   . LYS C 164 ? 0.6549 0.6189 0.5846 0.0569  -0.0209 -0.0173 166 LYS C C   
4214 O O   . LYS C 164 ? 0.6550 0.6113 0.5854 0.0506  -0.0213 -0.0120 166 LYS C O   
4215 C CB  . LYS C 164 ? 0.6342 0.6201 0.5801 0.0471  -0.0067 -0.0102 166 LYS C CB  
4216 C CG  . LYS C 164 ? 0.7035 0.7118 0.6448 0.0556  -0.0031 -0.0162 166 LYS C CG  
4217 C CD  . LYS C 164 ? 0.7628 0.7938 0.7102 0.0485  0.0069  -0.0103 166 LYS C CD  
4218 C CE  . LYS C 164 ? 0.8016 0.8376 0.7480 0.0394  0.0110  -0.0020 166 LYS C CE  
4219 N NZ  . LYS C 164 ? 0.8266 0.8912 0.7690 0.0392  0.0170  -0.0005 166 LYS C NZ  
4220 N N   . LYS C 165 ? 0.6689 0.6415 0.5891 0.0688  -0.0236 -0.0261 167 LYS C N   
4221 C CA  . LYS C 165 ? 0.6809 0.6556 0.5896 0.0761  -0.0273 -0.0310 167 LYS C CA  
4222 C C   . LYS C 165 ? 0.6556 0.6544 0.5652 0.0708  -0.0166 -0.0254 167 LYS C C   
4223 O O   . LYS C 165 ? 0.6552 0.6750 0.5680 0.0711  -0.0096 -0.0252 167 LYS C O   
4224 C CB  . LYS C 165 ? 0.7057 0.6845 0.6049 0.0920  -0.0338 -0.0435 167 LYS C CB  
4225 C CG  . LYS C 165 ? 0.8214 0.7891 0.7072 0.1020  -0.0440 -0.0514 167 LYS C CG  
4226 C CD  . LYS C 165 ? 0.9024 0.8637 0.7787 0.1190  -0.0552 -0.0652 167 LYS C CD  
4227 C CE  . LYS C 165 ? 0.9629 0.9532 0.8298 0.1334  -0.0519 -0.0754 167 LYS C CE  
4228 N NZ  . LYS C 165 ? 1.0345 1.0203 0.8871 0.1430  -0.0596 -0.0828 167 LYS C NZ  
4229 N N   . VAL C 166 ? 0.6370 0.6324 0.5444 0.0647  -0.0160 -0.0196 168 VAL C N   
4230 C CA  . VAL C 166 ? 0.6165 0.6329 0.5224 0.0591  -0.0080 -0.0136 168 VAL C CA  
4231 C C   . VAL C 166 ? 0.6420 0.6607 0.5353 0.0655  -0.0119 -0.0175 168 VAL C C   
4232 O O   . VAL C 166 ? 0.6463 0.6499 0.5376 0.0614  -0.0158 -0.0139 168 VAL C O   
4233 C CB  . VAL C 166 ? 0.5944 0.6040 0.5094 0.0447  -0.0039 -0.0018 168 VAL C CB  
4234 C CG1 . VAL C 166 ? 0.6107 0.6401 0.5222 0.0386  0.0021  0.0050  168 VAL C CG1 
4235 C CG2 . VAL C 166 ? 0.5401 0.5473 0.4672 0.0387  -0.0004 0.0015  168 VAL C CG2 
4236 N N   . SER C 167 ? 0.6728 0.7111 0.5567 0.0768  -0.0116 -0.0258 169 SER C N   
4237 C CA  . SER C 167 ? 0.6982 0.7334 0.5690 0.0857  -0.0181 -0.0324 169 SER C CA  
4238 C C   . SER C 167 ? 0.7092 0.7676 0.5739 0.0819  -0.0119 -0.0272 169 SER C C   
4239 O O   . SER C 167 ? 0.7057 0.7850 0.5754 0.0732  -0.0030 -0.0192 169 SER C O   
4240 C CB  . SER C 167 ? 0.7239 0.7620 0.5858 0.1032  -0.0248 -0.0469 169 SER C CB  
4241 O OG  . SER C 167 ? 0.7395 0.8105 0.6006 0.1079  -0.0172 -0.0497 169 SER C OG  
4242 N N   . SER C 168 ? 0.7331 0.7871 0.5860 0.0884  -0.0177 -0.0318 170 SER C N   
4243 C CA  . SER C 168 ? 0.7426 0.8071 0.5885 0.0828  -0.0151 -0.0254 170 SER C CA  
4244 C C   . SER C 168 ? 0.7796 0.8527 0.6102 0.0993  -0.0209 -0.0386 170 SER C C   
4245 O O   . SER C 168 ? 0.7984 0.8548 0.6254 0.1115  -0.0300 -0.0501 170 SER C O   
4246 C CB  . SER C 168 ? 0.7330 0.7670 0.5824 0.0742  -0.0207 -0.0189 170 SER C CB  
4247 O OG  . SER C 168 ? 0.7436 0.7821 0.5931 0.0624  -0.0168 -0.0075 170 SER C OG  
4248 N N   . MET C 169 ? 0.8067 0.9058 0.6274 0.1003  -0.0168 -0.0374 171 MET C N   
4249 C CA  . MET C 169 ? 0.8480 0.9522 0.6529 0.1162  -0.0236 -0.0502 171 MET C CA  
4250 C C   . MET C 169 ? 0.8533 0.9211 0.6536 0.1176  -0.0352 -0.0526 171 MET C C   
4251 O O   . MET C 169 ? 0.8694 0.9247 0.6603 0.1323  -0.0456 -0.0658 171 MET C O   
4252 C CB  . MET C 169 ? 0.8710 1.0120 0.6654 0.1160  -0.0169 -0.0475 171 MET C CB  
4253 C CG  . MET C 169 ? 0.9256 1.0705 0.7025 0.1330  -0.0248 -0.0613 171 MET C CG  
4254 S SD  . MET C 169 ? 0.9741 1.1648 0.7368 0.1330  -0.0173 -0.0582 171 MET C SD  
4255 C CE  . MET C 169 ? 1.0634 1.2423 0.8070 0.1556  -0.0308 -0.0777 171 MET C CE  
4256 N N   . PHE C 170 ? 0.8391 0.8899 0.6463 0.1027  -0.0344 -0.0401 172 PHE C N   
4257 C CA  . PHE C 170 ? 0.8474 0.8674 0.6515 0.1024  -0.0447 -0.0409 172 PHE C CA  
4258 C C   . PHE C 170 ? 0.8142 0.8032 0.6304 0.0974  -0.0503 -0.0391 172 PHE C C   
4259 O O   . PHE C 170 ? 0.8081 0.7715 0.6222 0.0990  -0.0606 -0.0418 172 PHE C O   
4260 C CB  . PHE C 170 ? 0.8603 0.8824 0.6614 0.0917  -0.0424 -0.0302 172 PHE C CB  
4261 C CG  . PHE C 170 ? 0.9200 0.9714 0.7062 0.0975  -0.0392 -0.0327 172 PHE C CG  
4262 C CD1 . PHE C 170 ? 0.9890 1.0418 0.7599 0.1136  -0.0471 -0.0465 172 PHE C CD1 
4263 C CD2 . PHE C 170 ? 0.9431 1.0211 0.7297 0.0868  -0.0292 -0.0214 172 PHE C CD2 
4264 C CE1 . PHE C 170 ? 1.0135 1.0967 0.7697 0.1199  -0.0440 -0.0497 172 PHE C CE1 
4265 C CE2 . PHE C 170 ? 0.9985 1.1077 0.7705 0.0912  -0.0261 -0.0228 172 PHE C CE2 
4266 C CZ  . PHE C 170 ? 1.0372 1.1501 0.7941 0.1083  -0.0330 -0.0374 172 PHE C CZ  
4267 N N   . ILE C 171 ? 0.7869 0.7795 0.6158 0.0915  -0.0439 -0.0346 173 ILE C N   
4268 C CA  . ILE C 171 ? 0.7610 0.7282 0.5995 0.0895  -0.0498 -0.0353 173 ILE C CA  
4269 C C   . ILE C 171 ? 0.7597 0.7331 0.5999 0.0984  -0.0496 -0.0435 173 ILE C C   
4270 O O   . ILE C 171 ? 0.7412 0.7202 0.5927 0.0919  -0.0428 -0.0384 173 ILE C O   
4271 C CB  . ILE C 171 ? 0.7243 0.6808 0.5777 0.0733  -0.0454 -0.0221 173 ILE C CB  
4272 C CG1 . ILE C 171 ? 0.7103 0.6623 0.5612 0.0663  -0.0463 -0.0150 173 ILE C CG1 
4273 C CG2 . ILE C 171 ? 0.6891 0.6203 0.5509 0.0708  -0.0528 -0.0224 173 ILE C CG2 
4274 C CD1 . ILE C 171 ? 0.6548 0.6098 0.5172 0.0526  -0.0388 -0.0026 173 ILE C CD1 
4275 N N   . PRO C 172 ? 0.7907 0.7626 0.6191 0.1143  -0.0581 -0.0571 174 PRO C N   
4276 C CA  . PRO C 172 ? 0.7928 0.7722 0.6232 0.1233  -0.0580 -0.0649 174 PRO C CA  
4277 C C   . PRO C 172 ? 0.7724 0.7305 0.6150 0.1162  -0.0608 -0.0608 174 PRO C C   
4278 O O   . PRO C 172 ? 0.7563 0.7251 0.6056 0.1169  -0.0557 -0.0612 174 PRO C O   
4279 C CB  . PRO C 172 ? 0.8166 0.7903 0.6315 0.1421  -0.0703 -0.0807 174 PRO C CB  
4280 C CG  . PRO C 172 ? 0.8433 0.8240 0.6476 0.1432  -0.0705 -0.0807 174 PRO C CG  
4281 C CD  . PRO C 172 ? 0.8175 0.7823 0.6302 0.1261  -0.0685 -0.0669 174 PRO C CD  
4282 N N   . ASP C 173 ? 0.7927 0.7227 0.6385 0.1088  -0.0688 -0.0562 175 ASP C N   
4283 C CA  . ASP C 173 ? 0.7810 0.6919 0.6371 0.1023  -0.0727 -0.0524 175 ASP C CA  
4284 C C   . ASP C 173 ? 0.7322 0.6476 0.6029 0.0862  -0.0622 -0.0391 175 ASP C C   
4285 O O   . ASP C 173 ? 0.7152 0.6156 0.5951 0.0779  -0.0649 -0.0337 175 ASP C O   
4286 C CB  . ASP C 173 ? 0.8192 0.6985 0.6701 0.1031  -0.0890 -0.0549 175 ASP C CB  
4287 C CG  . ASP C 173 ? 0.9176 0.7888 0.7518 0.1206  -0.1020 -0.0695 175 ASP C CG  
4288 O OD1 . ASP C 173 ? 1.0036 0.8572 0.8288 0.1228  -0.1131 -0.0722 175 ASP C OD1 
4289 O OD2 . ASP C 173 ? 0.9951 0.8774 0.8247 0.1332  -0.1021 -0.0792 175 ASP C OD2 
4290 N N   . GLY C 174 ? 0.7126 0.6492 0.5849 0.0818  -0.0512 -0.0338 176 GLY C N   
4291 C CA  . GLY C 174 ? 0.6934 0.6349 0.5783 0.0683  -0.0420 -0.0225 176 GLY C CA  
4292 C C   . GLY C 174 ? 0.6884 0.6302 0.5845 0.0645  -0.0382 -0.0205 176 GLY C C   
4293 O O   . GLY C 174 ? 0.6977 0.6506 0.5928 0.0714  -0.0362 -0.0261 176 GLY C O   
4294 N N   . ARG C 175 ? 0.6790 0.6096 0.5859 0.0540  -0.0377 -0.0129 177 ARG C N   
4295 C CA  . ARG C 175 ? 0.6599 0.5898 0.5775 0.0497  -0.0347 -0.0105 177 ARG C CA  
4296 C C   . ARG C 175 ? 0.6244 0.5563 0.5537 0.0381  -0.0281 -0.0011 177 ARG C C   
4297 O O   . ARG C 175 ? 0.6264 0.5534 0.5567 0.0330  -0.0290 0.0036  177 ARG C O   
4298 C CB  . ARG C 175 ? 0.6743 0.5846 0.5914 0.0517  -0.0452 -0.0137 177 ARG C CB  
4299 C CG  . ARG C 175 ? 0.7802 0.6876 0.6854 0.0650  -0.0529 -0.0245 177 ARG C CG  
4300 C CD  . ARG C 175 ? 0.8980 0.7814 0.7997 0.0672  -0.0669 -0.0277 177 ARG C CD  
4301 N NE  . ARG C 175 ? 1.0013 0.8827 0.8946 0.0802  -0.0735 -0.0382 177 ARG C NE  
4302 C CZ  . ARG C 175 ? 1.0386 0.9257 0.9364 0.0823  -0.0709 -0.0399 177 ARG C CZ  
4303 N NH1 . ARG C 175 ? 0.9882 0.8839 0.8986 0.0722  -0.0614 -0.0320 177 ARG C NH1 
4304 N NH2 . ARG C 175 ? 1.0954 0.9795 0.9848 0.0956  -0.0787 -0.0505 177 ARG C NH2 
4305 N N   . VAL C 176 ? 0.5902 0.5301 0.5276 0.0348  -0.0219 0.0009  178 VAL C N   
4306 C CA  . VAL C 176 ? 0.5412 0.4813 0.4899 0.0254  -0.0172 0.0081  178 VAL C CA  
4307 C C   . VAL C 176 ? 0.5153 0.4504 0.4709 0.0242  -0.0185 0.0074  178 VAL C C   
4308 O O   . VAL C 176 ? 0.4996 0.4381 0.4531 0.0293  -0.0186 0.0029  178 VAL C O   
4309 C CB  . VAL C 176 ? 0.5320 0.4877 0.4831 0.0218  -0.0086 0.0118  178 VAL C CB  
4310 C CG1 . VAL C 176 ? 0.4885 0.4420 0.4502 0.0137  -0.0055 0.0178  178 VAL C CG1 
4311 C CG2 . VAL C 176 ? 0.5488 0.5106 0.4920 0.0221  -0.0079 0.0135  178 VAL C CG2 
4312 N N   . SER C 177 ? 0.4939 0.4221 0.4575 0.0177  -0.0197 0.0118  179 SER C N   
4313 C CA  . SER C 177 ? 0.4809 0.4056 0.4507 0.0153  -0.0213 0.0122  179 SER C CA  
4314 C C   . SER C 177 ? 0.4597 0.3874 0.4400 0.0081  -0.0179 0.0175  179 SER C C   
4315 O O   . SER C 177 ? 0.4536 0.3810 0.4356 0.0055  -0.0176 0.0203  179 SER C O   
4316 C CB  . SER C 177 ? 0.4877 0.3984 0.4537 0.0159  -0.0315 0.0111  179 SER C CB  
4317 O OG  . SER C 177 ? 0.5138 0.4226 0.4872 0.0085  -0.0328 0.0165  179 SER C OG  
4318 N N   . VAL C 178 ? 0.4450 0.3755 0.4318 0.0056  -0.0161 0.0181  180 VAL C N   
4319 C CA  . VAL C 178 ? 0.4326 0.3685 0.4293 0.0002  -0.0128 0.0216  180 VAL C CA  
4320 C C   . VAL C 178 ? 0.4450 0.3810 0.4460 -0.0027 -0.0151 0.0226  180 VAL C C   
4321 O O   . VAL C 178 ? 0.4767 0.4110 0.4750 -0.0006 -0.0161 0.0205  180 VAL C O   
4322 C CB  . VAL C 178 ? 0.4289 0.3734 0.4292 -0.0001 -0.0053 0.0218  180 VAL C CB  
4323 C CG1 . VAL C 178 ? 0.4126 0.3613 0.4088 0.0035  -0.0027 0.0188  180 VAL C CG1 
4324 C CG2 . VAL C 178 ? 0.3958 0.3456 0.4057 -0.0038 -0.0026 0.0235  180 VAL C CG2 
4325 N N   . SER C 179 ? 0.4426 0.3820 0.4503 -0.0076 -0.0161 0.0259  181 SER C N   
4326 C CA  . SER C 179 ? 0.4478 0.3920 0.4603 -0.0112 -0.0162 0.0275  181 SER C CA  
4327 C C   . SER C 179 ? 0.4462 0.4024 0.4679 -0.0141 -0.0121 0.0292  181 SER C C   
4328 O O   . SER C 179 ? 0.4656 0.4243 0.4900 -0.0145 -0.0126 0.0301  181 SER C O   
4329 C CB  . SER C 179 ? 0.4520 0.3886 0.4611 -0.0148 -0.0249 0.0301  181 SER C CB  
4330 O OG  . SER C 179 ? 0.4662 0.4040 0.4776 -0.0185 -0.0285 0.0334  181 SER C OG  
4331 N N   . ALA C 180 ? 0.4421 0.4060 0.4682 -0.0154 -0.0086 0.0289  182 ALA C N   
4332 C CA  . ALA C 180 ? 0.4332 0.4095 0.4674 -0.0161 -0.0044 0.0286  182 ALA C CA  
4333 C C   . ALA C 180 ? 0.4528 0.4382 0.4905 -0.0202 -0.0047 0.0307  182 ALA C C   
4334 O O   . ALA C 180 ? 0.4686 0.4485 0.5023 -0.0217 -0.0070 0.0317  182 ALA C O   
4335 C CB  . ALA C 180 ? 0.4117 0.3882 0.4466 -0.0126 0.0007  0.0254  182 ALA C CB  
4336 N N   . ARG C 181 ? 0.4570 0.4572 0.5020 -0.0212 -0.0027 0.0308  183 ARG C N   
4337 C CA  . ARG C 181 ? 0.4521 0.4669 0.5014 -0.0252 -0.0020 0.0328  183 ARG C CA  
4338 C C   . ARG C 181 ? 0.4372 0.4665 0.4933 -0.0211 0.0030  0.0284  183 ARG C C   
4339 O O   . ARG C 181 ? 0.4382 0.4692 0.4970 -0.0168 0.0034  0.0254  183 ARG C O   
4340 C CB  . ARG C 181 ? 0.4614 0.4837 0.5121 -0.0320 -0.0072 0.0387  183 ARG C CB  
4341 C CG  . ARG C 181 ? 0.5291 0.5688 0.5833 -0.0387 -0.0077 0.0431  183 ARG C CG  
4342 C CD  . ARG C 181 ? 0.6301 0.6871 0.6895 -0.0438 -0.0104 0.0476  183 ARG C CD  
4343 N NE  . ARG C 181 ? 0.7190 0.8016 0.7836 -0.0498 -0.0094 0.0516  183 ARG C NE  
4344 C CZ  . ARG C 181 ? 0.7527 0.8385 0.8147 -0.0591 -0.0132 0.0588  183 ARG C CZ  
4345 N NH1 . ARG C 181 ? 0.7810 0.8435 0.8350 -0.0625 -0.0190 0.0619  183 ARG C NH1 
4346 N NH2 . ARG C 181 ? 0.7362 0.8497 0.8034 -0.0648 -0.0117 0.0627  183 ARG C NH2 
4347 N N   . ILE C 182 ? 0.4251 0.4631 0.4829 -0.0217 0.0058  0.0273  184 ILE C N   
4348 C CA  . ILE C 182 ? 0.4120 0.4660 0.4756 -0.0177 0.0092  0.0228  184 ILE C CA  
4349 C C   . ILE C 182 ? 0.4249 0.4991 0.4913 -0.0229 0.0095  0.0261  184 ILE C C   
4350 O O   . ILE C 182 ? 0.4160 0.4870 0.4790 -0.0298 0.0070  0.0319  184 ILE C O   
4351 C CB  . ILE C 182 ? 0.3865 0.4323 0.4490 -0.0128 0.0122  0.0175  184 ILE C CB  
4352 C CG1 . ILE C 182 ? 0.3830 0.4210 0.4411 -0.0162 0.0128  0.0199  184 ILE C CG1 
4353 C CG2 . ILE C 182 ? 0.3879 0.4182 0.4481 -0.0090 0.0113  0.0155  184 ILE C CG2 
4354 C CD1 . ILE C 182 ? 0.2944 0.3296 0.3524 -0.0132 0.0158  0.0156  184 ILE C CD1 
4355 N N   . ASP C 183 ? 0.4473 0.5426 0.5193 -0.0194 0.0117  0.0223  185 ASP C N   
4356 C CA  . ASP C 183 ? 0.4788 0.5991 0.5538 -0.0252 0.0120  0.0264  185 ASP C CA  
4357 C C   . ASP C 183 ? 0.4766 0.6011 0.5492 -0.0285 0.0138  0.0277  185 ASP C C   
4358 O O   . ASP C 183 ? 0.5067 0.6407 0.5781 -0.0375 0.0118  0.0353  185 ASP C O   
4359 C CB  . ASP C 183 ? 0.4975 0.6448 0.5794 -0.0213 0.0129  0.0233  185 ASP C CB  
4360 C CG  . ASP C 183 ? 0.5874 0.7470 0.6724 -0.0110 0.0161  0.0133  185 ASP C CG  
4361 O OD1 . ASP C 183 ? 0.6693 0.8399 0.7536 -0.0117 0.0186  0.0122  185 ASP C OD1 
4362 O OD2 . ASP C 183 ? 0.6635 0.8226 0.7513 -0.0018 0.0152  0.0061  185 ASP C OD2 
4363 N N   . ARG C 184 ? 0.4492 0.5653 0.5208 -0.0220 0.0166  0.0211  186 ARG C N   
4364 C CA  . ARG C 184 ? 0.4210 0.5388 0.4903 -0.0240 0.0183  0.0214  186 ARG C CA  
4365 C C   . ARG C 184 ? 0.3980 0.4919 0.4638 -0.0201 0.0190  0.0177  186 ARG C C   
4366 O O   . ARG C 184 ? 0.3915 0.4702 0.4567 -0.0165 0.0183  0.0156  186 ARG C O   
4367 C CB  . ARG C 184 ? 0.4228 0.5642 0.4958 -0.0191 0.0213  0.0155  186 ARG C CB  
4368 C CG  . ARG C 184 ? 0.4089 0.5483 0.4848 -0.0084 0.0218  0.0061  186 ARG C CG  
4369 C CD  . ARG C 184 ? 0.4469 0.6133 0.5267 -0.0024 0.0234  -0.0002 186 ARG C CD  
4370 N NE  . ARG C 184 ? 0.5094 0.6729 0.5919 0.0082  0.0216  -0.0088 186 ARG C NE  
4371 C CZ  . ARG C 184 ? 0.5153 0.6746 0.5976 0.0182  0.0204  -0.0188 186 ARG C CZ  
4372 N NH1 . ARG C 184 ? 0.5424 0.7019 0.6223 0.0192  0.0217  -0.0218 186 ARG C NH1 
4373 N NH2 . ARG C 184 ? 0.4754 0.6291 0.5595 0.0274  0.0168  -0.0258 186 ARG C NH2 
4374 N N   . LYS C 185 ? 0.3643 0.4564 0.4280 -0.0209 0.0202  0.0172  187 LYS C N   
4375 C CA  . LYS C 185 ? 0.3586 0.4329 0.4202 -0.0174 0.0211  0.0136  187 LYS C CA  
4376 C C   . LYS C 185 ? 0.3521 0.4307 0.4158 -0.0112 0.0232  0.0060  187 LYS C C   
4377 O O   . LYS C 185 ? 0.3501 0.4151 0.4126 -0.0086 0.0233  0.0030  187 LYS C O   
4378 C CB  . LYS C 185 ? 0.3623 0.4277 0.4196 -0.0222 0.0197  0.0182  187 LYS C CB  
4379 C CG  . LYS C 185 ? 0.4304 0.4867 0.4864 -0.0194 0.0213  0.0146  187 LYS C CG  
4380 C CD  . LYS C 185 ? 0.4627 0.5156 0.5150 -0.0234 0.0194  0.0185  187 LYS C CD  
4381 C CE  . LYS C 185 ? 0.4927 0.5339 0.5435 -0.0206 0.0201  0.0160  187 LYS C CE  
4382 N NZ  . LYS C 185 ? 0.5417 0.5753 0.5881 -0.0233 0.0159  0.0202  187 LYS C NZ  
4383 N N   . GLY C 186 ? 0.3453 0.4435 0.4116 -0.0088 0.0241  0.0028  188 GLY C N   
4384 C CA  . GLY C 186 ? 0.3302 0.4322 0.3973 -0.0027 0.0248  -0.0048 188 GLY C CA  
4385 C C   . GLY C 186 ? 0.3349 0.4420 0.4050 0.0054  0.0232  -0.0120 188 GLY C C   
4386 O O   . GLY C 186 ? 0.3338 0.4588 0.4067 0.0068  0.0234  -0.0122 188 GLY C O   
4387 N N   . PHE C 187 ? 0.3367 0.4283 0.4061 0.0108  0.0208  -0.0177 189 PHE C N   
4388 C CA  . PHE C 187 ? 0.3454 0.4385 0.4166 0.0199  0.0173  -0.0256 189 PHE C CA  
4389 C C   . PHE C 187 ? 0.3659 0.4554 0.4357 0.0262  0.0145  -0.0339 189 PHE C C   
4390 O O   . PHE C 187 ? 0.3767 0.4566 0.4443 0.0225  0.0150  -0.0324 189 PHE C O   
4391 C CB  . PHE C 187 ? 0.3214 0.3954 0.3921 0.0201  0.0143  -0.0240 189 PHE C CB  
4392 C CG  . PHE C 187 ? 0.3057 0.3819 0.3770 0.0143  0.0163  -0.0164 189 PHE C CG  
4393 C CD1 . PHE C 187 ? 0.3016 0.3921 0.3763 0.0170  0.0156  -0.0171 189 PHE C CD1 
4394 C CD2 . PHE C 187 ? 0.2362 0.3013 0.3048 0.0066  0.0182  -0.0090 189 PHE C CD2 
4395 C CE1 . PHE C 187 ? 0.1978 0.2900 0.2730 0.0111  0.0164  -0.0099 189 PHE C CE1 
4396 C CE2 . PHE C 187 ? 0.2292 0.2949 0.2976 0.0020  0.0185  -0.0028 189 PHE C CE2 
4397 C CZ  . PHE C 187 ? 0.2077 0.2868 0.2794 0.0037  0.0175  -0.0029 189 PHE C CZ  
4398 N N   . CYS C 188 ? 0.3998 0.4997 0.4710 0.0362  0.0111  -0.0430 190 CYS C N   
4399 C CA  . CYS C 188 ? 0.4542 0.5472 0.5234 0.0444  0.0058  -0.0528 190 CYS C CA  
4400 C C   . CYS C 188 ? 0.4582 0.5254 0.5259 0.0479  -0.0017 -0.0553 190 CYS C C   
4401 O O   . CYS C 188 ? 0.4401 0.5046 0.5093 0.0494  -0.0033 -0.0541 190 CYS C O   
4402 C CB  . CYS C 188 ? 0.4779 0.5963 0.5488 0.0556  0.0045  -0.0630 190 CYS C CB  
4403 S SG  . CYS C 188 ? 0.5841 0.7408 0.6575 0.0508  0.0130  -0.0583 190 CYS C SG  
4404 N N   . GLU C 189 ? 0.4842 0.5329 0.5486 0.0492  -0.0074 -0.0590 191 GLU C N   
4405 C CA  . GLU C 189 ? 0.5162 0.5390 0.5780 0.0514  -0.0165 -0.0608 191 GLU C CA  
4406 C C   . GLU C 189 ? 0.5301 0.5603 0.5933 0.0638  -0.0219 -0.0699 191 GLU C C   
4407 O O   . GLU C 189 ? 0.5453 0.5948 0.6094 0.0733  -0.0222 -0.0791 191 GLU C O   
4408 C CB  . GLU C 189 ? 0.5274 0.5313 0.5854 0.0510  -0.0235 -0.0640 191 GLU C CB  
4409 C CG  . GLU C 189 ? 0.6353 0.6381 0.6911 0.0643  -0.0329 -0.0774 191 GLU C CG  
4410 C CD  . GLU C 189 ? 0.7204 0.7146 0.7728 0.0639  -0.0372 -0.0813 191 GLU C CD  
4411 O OE1 . GLU C 189 ? 0.7118 0.7245 0.7641 0.0715  -0.0358 -0.0897 191 GLU C OE1 
4412 O OE2 . GLU C 189 ? 0.7390 0.7097 0.7890 0.0555  -0.0421 -0.0754 191 GLU C OE2 
4413 N N   . GLY C 190 ? 0.5299 0.5477 0.5931 0.0638  -0.0255 -0.0671 192 GLY C N   
4414 C CA  . GLY C 190 ? 0.5575 0.5797 0.6220 0.0755  -0.0316 -0.0752 192 GLY C CA  
4415 C C   . GLY C 190 ? 0.5588 0.5997 0.6281 0.0742  -0.0252 -0.0708 192 GLY C C   
4416 O O   . GLY C 190 ? 0.5750 0.6124 0.6452 0.0804  -0.0305 -0.0736 192 GLY C O   
4417 N N   . ASP C 191 ? 0.5566 0.6167 0.6286 0.0660  -0.0149 -0.0636 193 ASP C N   
4418 C CA  . ASP C 191 ? 0.5561 0.6346 0.6324 0.0634  -0.0096 -0.0585 193 ASP C CA  
4419 C C   . ASP C 191 ? 0.5515 0.6072 0.6258 0.0559  -0.0107 -0.0501 193 ASP C C   
4420 O O   . ASP C 191 ? 0.5400 0.5721 0.6102 0.0506  -0.0130 -0.0465 193 ASP C O   
4421 C CB  . ASP C 191 ? 0.5462 0.6460 0.6244 0.0543  -0.0002 -0.0512 193 ASP C CB  
4422 C CG  . ASP C 191 ? 0.5909 0.7203 0.6711 0.0599  0.0024  -0.0578 193 ASP C CG  
4423 O OD1 . ASP C 191 ? 0.6123 0.7553 0.6941 0.0726  -0.0018 -0.0688 193 ASP C OD1 
4424 O OD2 . ASP C 191 ? 0.6312 0.7711 0.7110 0.0515  0.0085  -0.0517 193 ASP C OD2 
4425 N N   . GLU C 192 ? 0.5575 0.6219 0.6348 0.0547  -0.0090 -0.0463 194 GLU C N   
4426 C CA  . GLU C 192 ? 0.5577 0.6031 0.6325 0.0466  -0.0088 -0.0375 194 GLU C CA  
4427 C C   . GLU C 192 ? 0.5233 0.5778 0.5989 0.0363  -0.0013 -0.0282 194 GLU C C   
4428 O O   . GLU C 192 ? 0.5191 0.5969 0.5983 0.0353  0.0028  -0.0275 194 GLU C O   
4429 C CB  . GLU C 192 ? 0.5893 0.6307 0.6653 0.0521  -0.0143 -0.0394 194 GLU C CB  
4430 C CG  . GLU C 192 ? 0.6493 0.7185 0.7313 0.0591  -0.0135 -0.0441 194 GLU C CG  
4431 C CD  . GLU C 192 ? 0.7322 0.7944 0.8151 0.0669  -0.0209 -0.0480 194 GLU C CD  
4432 O OE1 . GLU C 192 ? 0.7401 0.7844 0.8200 0.0751  -0.0297 -0.0550 194 GLU C OE1 
4433 O OE2 . GLU C 192 ? 0.7417 0.8148 0.8279 0.0643  -0.0190 -0.0436 194 GLU C OE2 
4434 N N   . ILE C 193 ? 0.5023 0.5387 0.5740 0.0284  -0.0001 -0.0207 195 ILE C N   
4435 C CA  . ILE C 193 ? 0.4624 0.5040 0.5338 0.0201  0.0048  -0.0126 195 ILE C CA  
4436 C C   . ILE C 193 ? 0.4588 0.4987 0.5310 0.0202  0.0025  -0.0100 195 ILE C C   
4437 O O   . ILE C 193 ? 0.4718 0.4945 0.5411 0.0214  -0.0013 -0.0097 195 ILE C O   
4438 C CB  . ILE C 193 ? 0.4430 0.4701 0.5099 0.0130  0.0072  -0.0071 195 ILE C CB  
4439 C CG1 . ILE C 193 ? 0.4308 0.4603 0.4976 0.0132  0.0088  -0.0100 195 ILE C CG1 
4440 C CG2 . ILE C 193 ? 0.4336 0.4654 0.4996 0.0061  0.0105  -0.0001 195 ILE C CG2 
4441 C CD1 . ILE C 193 ? 0.4333 0.4502 0.4962 0.0074  0.0107  -0.0057 195 ILE C CD1 
4442 N N   . SER C 194 ? 0.4475 0.5059 0.5233 0.0184  0.0044  -0.0078 196 SER C N   
4443 C CA  . SER C 194 ? 0.4437 0.5051 0.5211 0.0176  0.0024  -0.0048 196 SER C CA  
4444 C C   . SER C 194 ? 0.4268 0.4773 0.4999 0.0085  0.0039  0.0036  196 SER C C   
4445 O O   . SER C 194 ? 0.4369 0.4963 0.5101 0.0023  0.0063  0.0081  196 SER C O   
4446 C CB  . SER C 194 ? 0.4412 0.5327 0.5251 0.0185  0.0037  -0.0058 196 SER C CB  
4447 O OG  . SER C 194 ? 0.4744 0.5747 0.5621 0.0218  0.0007  -0.0066 196 SER C OG  
4448 N N   . ILE C 195 ? 0.4248 0.4560 0.4932 0.0078  0.0019  0.0057  197 ILE C N   
4449 C CA  . ILE C 195 ? 0.4151 0.4358 0.4782 0.0009  0.0028  0.0122  197 ILE C CA  
4450 C C   . ILE C 195 ? 0.4321 0.4539 0.4951 -0.0014 -0.0001 0.0159  197 ILE C C   
4451 O O   . ILE C 195 ? 0.4263 0.4436 0.4896 0.0021  -0.0031 0.0147  197 ILE C O   
4452 C CB  . ILE C 195 ? 0.4025 0.4039 0.4593 0.0004  0.0030  0.0130  197 ILE C CB  
4453 C CG1 . ILE C 195 ? 0.4097 0.4086 0.4668 0.0025  0.0044  0.0094  197 ILE C CG1 
4454 C CG2 . ILE C 195 ? 0.3479 0.3428 0.3993 -0.0046 0.0041  0.0175  197 ILE C CG2 
4455 C CD1 . ILE C 195 ? 0.4146 0.3983 0.4661 0.0005  0.0044  0.0113  197 ILE C CD1 
4456 N N   . HIS C 196 ? 0.4363 0.4631 0.4986 -0.0076 -0.0002 0.0207  198 HIS C N   
4457 C CA  . HIS C 196 ? 0.4539 0.4784 0.5145 -0.0116 -0.0041 0.0254  198 HIS C CA  
4458 C C   . HIS C 196 ? 0.4381 0.4436 0.4903 -0.0138 -0.0053 0.0278  198 HIS C C   
4459 O O   . HIS C 196 ? 0.4455 0.4476 0.4947 -0.0164 -0.0044 0.0290  198 HIS C O   
4460 C CB  . HIS C 196 ? 0.4646 0.5067 0.5294 -0.0179 -0.0054 0.0298  198 HIS C CB  
4461 C CG  . HIS C 196 ? 0.5135 0.5795 0.5868 -0.0153 -0.0047 0.0275  198 HIS C CG  
4462 N ND1 . HIS C 196 ? 0.5383 0.6191 0.6161 -0.0110 -0.0011 0.0227  198 HIS C ND1 
4463 C CD2 . HIS C 196 ? 0.5323 0.6114 0.6105 -0.0154 -0.0075 0.0286  198 HIS C CD2 
4464 C CE1 . HIS C 196 ? 0.5470 0.6501 0.6318 -0.0079 -0.0016 0.0205  198 HIS C CE1 
4465 N NE2 . HIS C 196 ? 0.5409 0.6441 0.6267 -0.0106 -0.0053 0.0242  198 HIS C NE2 
4466 N N   . ALA C 197 ? 0.4336 0.4274 0.4817 -0.0119 -0.0075 0.0278  199 ALA C N   
4467 C CA  . ALA C 197 ? 0.4250 0.4027 0.4642 -0.0121 -0.0084 0.0286  199 ALA C CA  
4468 C C   . ALA C 197 ? 0.4335 0.4030 0.4682 -0.0123 -0.0130 0.0304  199 ALA C C   
4469 O O   . ALA C 197 ? 0.4382 0.4098 0.4756 -0.0106 -0.0145 0.0302  199 ALA C O   
4470 C CB  . ALA C 197 ? 0.4004 0.3718 0.4369 -0.0088 -0.0046 0.0260  199 ALA C CB  
4471 N N   . ASP C 198 ? 0.4431 0.4030 0.4707 -0.0137 -0.0161 0.0316  200 ASP C N   
4472 C CA  . ASP C 198 ? 0.4429 0.3935 0.4645 -0.0132 -0.0210 0.0326  200 ASP C CA  
4473 C C   . ASP C 198 ? 0.4366 0.3768 0.4489 -0.0095 -0.0201 0.0303  200 ASP C C   
4474 O O   . ASP C 198 ? 0.4291 0.3669 0.4382 -0.0088 -0.0195 0.0289  200 ASP C O   
4475 C CB  . ASP C 198 ? 0.4492 0.3976 0.4696 -0.0179 -0.0280 0.0358  200 ASP C CB  
4476 C CG  . ASP C 198 ? 0.4796 0.4426 0.5093 -0.0225 -0.0291 0.0390  200 ASP C CG  
4477 O OD1 . ASP C 198 ? 0.5096 0.4827 0.5458 -0.0202 -0.0260 0.0378  200 ASP C OD1 
4478 O OD2 . ASP C 198 ? 0.5548 0.5197 0.5849 -0.0286 -0.0339 0.0429  200 ASP C OD2 
4479 N N   . PHE C 199 ? 0.4476 0.3835 0.4559 -0.0071 -0.0202 0.0299  201 PHE C N   
4480 C CA  . PHE C 199 ? 0.4626 0.3931 0.4620 -0.0037 -0.0188 0.0282  201 PHE C CA  
4481 C C   . PHE C 199 ? 0.4840 0.4064 0.4755 -0.0022 -0.0245 0.0282  201 PHE C C   
4482 O O   . PHE C 199 ? 0.4874 0.4090 0.4812 -0.0036 -0.0272 0.0301  201 PHE C O   
4483 C CB  . PHE C 199 ? 0.4569 0.3901 0.4575 -0.0033 -0.0145 0.0289  201 PHE C CB  
4484 C CG  . PHE C 199 ? 0.4511 0.3907 0.4598 -0.0046 -0.0104 0.0288  201 PHE C CG  
4485 C CD1 . PHE C 199 ? 0.4641 0.4069 0.4723 -0.0045 -0.0060 0.0277  201 PHE C CD1 
4486 C CD2 . PHE C 199 ? 0.4756 0.4189 0.4921 -0.0051 -0.0113 0.0290  201 PHE C CD2 
4487 C CE1 . PHE C 199 ? 0.4471 0.3947 0.4621 -0.0055 -0.0031 0.0272  201 PHE C CE1 
4488 C CE2 . PHE C 199 ? 0.4947 0.4436 0.5177 -0.0050 -0.0083 0.0277  201 PHE C CE2 
4489 C CZ  . PHE C 199 ? 0.4494 0.3993 0.4712 -0.0055 -0.0044 0.0269  201 PHE C CZ  
4490 N N   . GLU C 200 ? 0.4988 0.4159 0.4810 0.0013  -0.0267 0.0253  202 GLU C N   
4491 C CA  . GLU C 200 ? 0.5233 0.4327 0.4961 0.0043  -0.0323 0.0238  202 GLU C CA  
4492 C C   . GLU C 200 ? 0.5203 0.4331 0.4841 0.0092  -0.0287 0.0211  202 GLU C C   
4493 O O   . GLU C 200 ? 0.5164 0.4348 0.4786 0.0120  -0.0249 0.0185  202 GLU C O   
4494 C CB  . GLU C 200 ? 0.5522 0.4521 0.5209 0.0050  -0.0405 0.0218  202 GLU C CB  
4495 C CG  . GLU C 200 ? 0.6255 0.5150 0.5822 0.0099  -0.0480 0.0183  202 GLU C CG  
4496 C CD  . GLU C 200 ? 0.7192 0.5957 0.6730 0.0085  -0.0590 0.0178  202 GLU C CD  
4497 O OE1 . GLU C 200 ? 0.7378 0.6035 0.6804 0.0144  -0.0666 0.0130  202 GLU C OE1 
4498 O OE2 . GLU C 200 ? 0.7535 0.6309 0.7157 0.0015  -0.0608 0.0224  202 GLU C OE2 
4499 N N   . ASN C 201 ? 0.5150 0.4265 0.4727 0.0102  -0.0300 0.0219  203 ASN C N   
4500 C CA  . ASN C 201 ? 0.4991 0.4173 0.4477 0.0140  -0.0268 0.0203  203 ASN C CA  
4501 C C   . ASN C 201 ? 0.5110 0.4235 0.4487 0.0183  -0.0328 0.0176  203 ASN C C   
4502 O O   . ASN C 201 ? 0.5161 0.4249 0.4529 0.0159  -0.0351 0.0209  203 ASN C O   
4503 C CB  . ASN C 201 ? 0.4805 0.4056 0.4321 0.0094  -0.0213 0.0256  203 ASN C CB  
4504 C CG  . ASN C 201 ? 0.4863 0.4206 0.4277 0.0110  -0.0186 0.0261  203 ASN C CG  
4505 O OD1 . ASN C 201 ? 0.4432 0.3826 0.3758 0.0170  -0.0191 0.0212  203 ASN C OD1 
4506 N ND2 . ASN C 201 ? 0.4276 0.3651 0.3700 0.0057  -0.0162 0.0320  203 ASN C ND2 
4507 N N   . THR C 202 ? 0.5094 0.4204 0.4384 0.0255  -0.0363 0.0112  204 THR C N   
4508 C CA  . THR C 202 ? 0.5328 0.4395 0.4494 0.0314  -0.0424 0.0070  204 THR C CA  
4509 C C   . THR C 202 ? 0.5515 0.4739 0.4585 0.0371  -0.0373 0.0040  204 THR C C   
4510 O O   . THR C 202 ? 0.5661 0.4891 0.4614 0.0450  -0.0416 -0.0021 204 THR C O   
4511 C CB  . THR C 202 ? 0.5429 0.4357 0.4539 0.0372  -0.0525 0.0005  204 THR C CB  
4512 O OG1 . THR C 202 ? 0.5734 0.4706 0.4841 0.0422  -0.0509 -0.0043 204 THR C OG1 
4513 C CG2 . THR C 202 ? 0.5058 0.3851 0.4247 0.0303  -0.0588 0.0047  204 THR C CG2 
4514 N N   . SER C 203 ? 0.5501 0.4868 0.4620 0.0331  -0.0285 0.0080  205 SER C N   
4515 C CA  . SER C 203 ? 0.5751 0.5309 0.4793 0.0370  -0.0232 0.0062  205 SER C CA  
4516 C C   . SER C 203 ? 0.6008 0.5615 0.5006 0.0317  -0.0216 0.0127  205 SER C C   
4517 O O   . SER C 203 ? 0.6032 0.5508 0.5062 0.0267  -0.0251 0.0171  205 SER C O   
4518 C CB  . SER C 203 ? 0.5499 0.5181 0.4620 0.0332  -0.0156 0.0088  205 SER C CB  
4519 O OG  . SER C 203 ? 0.5517 0.5238 0.4685 0.0234  -0.0112 0.0180  205 SER C OG  
4520 N N   . SER C 204 ? 0.6285 0.6091 0.5208 0.0324  -0.0167 0.0138  206 SER C N   
4521 C CA  . SER C 204 ? 0.6541 0.6392 0.5405 0.0269  -0.0163 0.0206  206 SER C CA  
4522 C C   . SER C 204 ? 0.6596 0.6488 0.5535 0.0153  -0.0115 0.0311  206 SER C C   
4523 O O   . SER C 204 ? 0.6727 0.6630 0.5627 0.0086  -0.0122 0.0387  206 SER C O   
4524 C CB  . SER C 204 ? 0.6763 0.6828 0.5493 0.0329  -0.0144 0.0171  206 SER C CB  
4525 O OG  . SER C 204 ? 0.7013 0.7301 0.5765 0.0294  -0.0068 0.0204  206 SER C OG  
4526 N N   . ARG C 205 ? 0.6535 0.6438 0.5574 0.0126  -0.0078 0.0317  207 ARG C N   
4527 C CA  . ARG C 205 ? 0.6569 0.6482 0.5676 0.0019  -0.0051 0.0410  207 ARG C CA  
4528 C C   . ARG C 205 ? 0.6383 0.6086 0.5588 -0.0020 -0.0089 0.0436  207 ARG C C   
4529 O O   . ARG C 205 ? 0.6282 0.5861 0.5523 0.0027  -0.0124 0.0385  207 ARG C O   
4530 C CB  . ARG C 205 ? 0.6590 0.6661 0.5742 -0.0007 0.0011  0.0421  207 ARG C CB  
4531 C CG  . ARG C 205 ? 0.6812 0.7002 0.5950 0.0087  0.0038  0.0331  207 ARG C CG  
4532 C CD  . ARG C 205 ? 0.7632 0.8095 0.6670 0.0110  0.0077  0.0327  207 ARG C CD  
4533 N NE  . ARG C 205 ? 0.8468 0.8954 0.7438 0.0248  0.0053  0.0209  207 ARG C NE  
4534 C CZ  . ARG C 205 ? 0.8903 0.9628 0.7797 0.0330  0.0079  0.0149  207 ARG C CZ  
4535 N NH1 . ARG C 205 ? 0.8820 0.9822 0.7699 0.0275  0.0143  0.0205  207 ARG C NH1 
4536 N NH2 . ARG C 205 ? 0.9128 0.9814 0.7958 0.0467  0.0033  0.0030  207 ARG C NH2 
4537 N N   . ILE C 206 ? 0.6267 0.5942 0.5505 -0.0107 -0.0092 0.0518  208 ILE C N   
4538 C CA  . ILE C 206 ? 0.6002 0.5522 0.5341 -0.0138 -0.0121 0.0537  208 ILE C CA  
4539 C C   . ILE C 206 ? 0.5836 0.5402 0.5258 -0.0156 -0.0079 0.0529  208 ILE C C   
4540 O O   . ILE C 206 ? 0.6042 0.5722 0.5449 -0.0207 -0.0046 0.0572  208 ILE C O   
4541 C CB  . ILE C 206 ? 0.6198 0.5657 0.5516 -0.0216 -0.0160 0.0623  208 ILE C CB  
4542 C CG1 . ILE C 206 ? 0.6219 0.5621 0.5454 -0.0201 -0.0209 0.0636  208 ILE C CG1 
4543 C CG2 . ILE C 206 ? 0.5818 0.5144 0.5244 -0.0241 -0.0189 0.0635  208 ILE C CG2 
4544 C CD1 . ILE C 206 ? 0.6614 0.5977 0.5793 -0.0283 -0.0254 0.0733  208 ILE C CD1 
4545 N N   . VAL C 207 ? 0.5505 0.4993 0.5016 -0.0120 -0.0083 0.0479  209 VAL C N   
4546 C CA  . VAL C 207 ? 0.5065 0.4598 0.4651 -0.0123 -0.0043 0.0459  209 VAL C CA  
4547 C C   . VAL C 207 ? 0.5103 0.4528 0.4782 -0.0152 -0.0068 0.0475  209 VAL C C   
4548 O O   . VAL C 207 ? 0.5332 0.4653 0.5030 -0.0147 -0.0116 0.0481  209 VAL C O   
4549 C CB  . VAL C 207 ? 0.4930 0.4482 0.4527 -0.0052 -0.0031 0.0384  209 VAL C CB  
4550 C CG1 . VAL C 207 ? 0.4627 0.4293 0.4121 -0.0003 -0.0016 0.0352  209 VAL C CG1 
4551 C CG2 . VAL C 207 ? 0.4385 0.3812 0.4018 -0.0024 -0.0078 0.0357  209 VAL C CG2 
4552 N N   . VAL C 208 ? 0.5064 0.4523 0.4800 -0.0178 -0.0041 0.0478  210 VAL C N   
4553 C CA  . VAL C 208 ? 0.4993 0.4361 0.4806 -0.0198 -0.0069 0.0486  210 VAL C CA  
4554 C C   . VAL C 208 ? 0.4978 0.4380 0.4872 -0.0172 -0.0035 0.0436  210 VAL C C   
4555 O O   . VAL C 208 ? 0.5060 0.4546 0.4960 -0.0191 0.0005  0.0438  210 VAL C O   
4556 C CB  . VAL C 208 ? 0.5044 0.4400 0.4836 -0.0272 -0.0087 0.0552  210 VAL C CB  
4557 C CG1 . VAL C 208 ? 0.5023 0.4253 0.4885 -0.0276 -0.0139 0.0546  210 VAL C CG1 
4558 C CG2 . VAL C 208 ? 0.4836 0.4188 0.4536 -0.0311 -0.0115 0.0612  210 VAL C CG2 
4559 N N   . PRO C 209 ? 0.4909 0.4264 0.4868 -0.0134 -0.0053 0.0397  211 PRO C N   
4560 C CA  . PRO C 209 ? 0.4810 0.4205 0.4843 -0.0116 -0.0026 0.0358  211 PRO C CA  
4561 C C   . PRO C 209 ? 0.4942 0.4307 0.5027 -0.0138 -0.0038 0.0363  211 PRO C C   
4562 O O   . PRO C 209 ? 0.5135 0.4417 0.5224 -0.0142 -0.0088 0.0377  211 PRO C O   
4563 C CB  . PRO C 209 ? 0.4671 0.4049 0.4746 -0.0082 -0.0050 0.0329  211 PRO C CB  
4564 C CG  . PRO C 209 ? 0.4737 0.4041 0.4795 -0.0080 -0.0100 0.0350  211 PRO C CG  
4565 C CD  . PRO C 209 ? 0.4916 0.4198 0.4885 -0.0111 -0.0102 0.0393  211 PRO C CD  
4566 N N   . LYS C 210 ? 0.4824 0.4246 0.4941 -0.0146 -0.0002 0.0347  212 LYS C N   
4567 C CA  . LYS C 210 ? 0.4637 0.4031 0.4794 -0.0165 -0.0017 0.0347  212 LYS C CA  
4568 C C   . LYS C 210 ? 0.4514 0.3974 0.4732 -0.0140 0.0018  0.0302  212 LYS C C   
4569 O O   . LYS C 210 ? 0.4482 0.4006 0.4694 -0.0125 0.0052  0.0288  212 LYS C O   
4570 C CB  . LYS C 210 ? 0.4617 0.4037 0.4731 -0.0224 -0.0004 0.0394  212 LYS C CB  
4571 C CG  . LYS C 210 ? 0.4848 0.4216 0.4895 -0.0264 -0.0041 0.0451  212 LYS C CG  
4572 C CD  . LYS C 210 ? 0.4588 0.3977 0.4604 -0.0343 -0.0049 0.0512  212 LYS C CD  
4573 C CE  . LYS C 210 ? 0.4893 0.4254 0.4833 -0.0391 -0.0083 0.0578  212 LYS C CE  
4574 N NZ  . LYS C 210 ? 0.5756 0.5263 0.5657 -0.0456 -0.0043 0.0630  212 LYS C NZ  
4575 N N   . ALA C 211 ? 0.4541 0.3980 0.4809 -0.0131 -0.0001 0.0276  213 ALA C N   
4576 C CA  . ALA C 211 ? 0.4382 0.3896 0.4698 -0.0118 0.0034  0.0240  213 ALA C CA  
4577 C C   . ALA C 211 ? 0.4432 0.3908 0.4766 -0.0136 0.0012  0.0234  213 ALA C C   
4578 O O   . ALA C 211 ? 0.4670 0.4048 0.4983 -0.0153 -0.0042 0.0253  213 ALA C O   
4579 C CB  . ALA C 211 ? 0.4259 0.3829 0.4626 -0.0074 0.0037  0.0200  213 ALA C CB  
4580 N N   . ALA C 212 ? 0.4364 0.3905 0.4730 -0.0135 0.0043  0.0210  214 ALA C N   
4581 C CA  . ALA C 212 ? 0.4360 0.3870 0.4735 -0.0164 0.0023  0.0210  214 ALA C CA  
4582 C C   . ALA C 212 ? 0.4164 0.3762 0.4578 -0.0149 0.0062  0.0173  214 ALA C C   
4583 O O   . ALA C 212 ? 0.3971 0.3655 0.4388 -0.0145 0.0112  0.0174  214 ALA C O   
4584 C CB  . ALA C 212 ? 0.4441 0.3950 0.4772 -0.0236 0.0029  0.0273  214 ALA C CB  
4585 N N   . ILE C 213 ? 0.4297 0.3862 0.4737 -0.0136 0.0029  0.0138  215 ILE C N   
4586 C CA  . ILE C 213 ? 0.4233 0.3876 0.4702 -0.0132 0.0060  0.0110  215 ILE C CA  
4587 C C   . ILE C 213 ? 0.4245 0.3883 0.4699 -0.0195 0.0064  0.0150  215 ILE C C   
4588 O O   . ILE C 213 ? 0.4533 0.4077 0.4968 -0.0234 0.0010  0.0174  215 ILE C O   
4589 C CB  . ILE C 213 ? 0.4271 0.3902 0.4771 -0.0080 0.0022  0.0045  215 ILE C CB  
4590 C CG1 . ILE C 213 ? 0.4113 0.3818 0.4638 -0.0019 0.0030  0.0007  215 ILE C CG1 
4591 C CG2 . ILE C 213 ? 0.4118 0.3819 0.4639 -0.0085 0.0048  0.0021  215 ILE C CG2 
4592 C CD1 . ILE C 213 ? 0.4403 0.4144 0.4958 0.0051  -0.0004 -0.0070 215 ILE C CD1 
4593 N N   . VAL C 214 ? 0.4110 0.3848 0.4569 -0.0210 0.0118  0.0160  216 VAL C N   
4594 C CA  . VAL C 214 ? 0.4298 0.4063 0.4754 -0.0268 0.0120  0.0193  216 VAL C CA  
4595 C C   . VAL C 214 ? 0.4260 0.4090 0.4750 -0.0261 0.0139  0.0160  216 VAL C C   
4596 O O   . VAL C 214 ? 0.4177 0.4080 0.4682 -0.0223 0.0178  0.0133  216 VAL C O   
4597 C CB  . VAL C 214 ? 0.4406 0.4249 0.4833 -0.0298 0.0157  0.0240  216 VAL C CB  
4598 C CG1 . VAL C 214 ? 0.4704 0.4638 0.5141 -0.0353 0.0171  0.0269  216 VAL C CG1 
4599 C CG2 . VAL C 214 ? 0.4351 0.4119 0.4737 -0.0327 0.0123  0.0285  216 VAL C CG2 
4600 N N   . ALA C 215 ? 0.4443 0.4235 0.4941 -0.0302 0.0100  0.0167  217 ALA C N   
4601 C CA  . ALA C 215 ? 0.4396 0.4235 0.4923 -0.0294 0.0107  0.0131  217 ALA C CA  
4602 C C   . ALA C 215 ? 0.4385 0.4316 0.4922 -0.0352 0.0129  0.0171  217 ALA C C   
4603 O O   . ALA C 215 ? 0.4581 0.4498 0.5106 -0.0422 0.0101  0.0225  217 ALA C O   
4604 C CB  . ALA C 215 ? 0.4650 0.4376 0.5181 -0.0283 0.0035  0.0091  217 ALA C CB  
4605 N N   . ARG C 216 ? 0.4320 0.4357 0.4878 -0.0328 0.0174  0.0149  218 ARG C N   
4606 C CA  . ARG C 216 ? 0.4446 0.4585 0.5022 -0.0376 0.0188  0.0176  218 ARG C CA  
4607 C C   . ARG C 216 ? 0.4267 0.4394 0.4869 -0.0382 0.0162  0.0144  218 ARG C C   
4608 O O   . ARG C 216 ? 0.4086 0.4238 0.4699 -0.0330 0.0181  0.0098  218 ARG C O   
4609 C CB  . ARG C 216 ? 0.4384 0.4657 0.4960 -0.0345 0.0245  0.0178  218 ARG C CB  
4610 C CG  . ARG C 216 ? 0.5255 0.5537 0.5797 -0.0335 0.0262  0.0203  218 ARG C CG  
4611 C CD  . ARG C 216 ? 0.6248 0.6606 0.6775 -0.0269 0.0299  0.0178  218 ARG C CD  
4612 N NE  . ARG C 216 ? 0.7143 0.7430 0.7666 -0.0216 0.0296  0.0139  218 ARG C NE  
4613 C CZ  . ARG C 216 ? 0.7047 0.7260 0.7546 -0.0188 0.0289  0.0134  218 ARG C CZ  
4614 N NH1 . ARG C 216 ? 0.7134 0.7315 0.7607 -0.0199 0.0285  0.0159  218 ARG C NH1 
4615 N NH2 . ARG C 216 ? 0.6585 0.6768 0.7086 -0.0157 0.0283  0.0111  218 ARG C NH2 
4616 N N   . HIS C 217 ? 0.4312 0.4391 0.4918 -0.0450 0.0109  0.0173  219 HIS C N   
4617 C CA  . HIS C 217 ? 0.4299 0.4353 0.4924 -0.0463 0.0070  0.0144  219 HIS C CA  
4618 C C   . HIS C 217 ? 0.4255 0.4463 0.4912 -0.0502 0.0102  0.0170  219 HIS C C   
4619 O O   . HIS C 217 ? 0.4236 0.4524 0.4899 -0.0571 0.0105  0.0233  219 HIS C O   
4620 C CB  . HIS C 217 ? 0.4362 0.4257 0.4968 -0.0520 -0.0027 0.0161  219 HIS C CB  
4621 C CG  . HIS C 217 ? 0.4117 0.3860 0.4691 -0.0474 -0.0072 0.0131  219 HIS C CG  
4622 N ND1 . HIS C 217 ? 0.4223 0.3929 0.4773 -0.0492 -0.0072 0.0177  219 HIS C ND1 
4623 C CD2 . HIS C 217 ? 0.3768 0.3405 0.4329 -0.0400 -0.0117 0.0054  219 HIS C CD2 
4624 C CE1 . HIS C 217 ? 0.3764 0.3341 0.4293 -0.0433 -0.0117 0.0131  219 HIS C CE1 
4625 N NE2 . HIS C 217 ? 0.4051 0.3594 0.4587 -0.0372 -0.0143 0.0054  219 HIS C NE2 
4626 N N   . THR C 218 ? 0.4191 0.4458 0.4867 -0.0457 0.0126  0.0123  220 THR C N   
4627 C CA  . THR C 218 ? 0.4326 0.4741 0.5036 -0.0481 0.0151  0.0138  220 THR C CA  
4628 C C   . THR C 218 ? 0.4685 0.5052 0.5409 -0.0528 0.0092  0.0131  220 THR C C   
4629 O O   . THR C 218 ? 0.4780 0.5044 0.5490 -0.0490 0.0059  0.0077  220 THR C O   
4630 C CB  . THR C 218 ? 0.4001 0.4497 0.4719 -0.0409 0.0197  0.0097  220 THR C CB  
4631 O OG1 . THR C 218 ? 0.4009 0.4543 0.4709 -0.0366 0.0239  0.0103  220 THR C OG1 
4632 C CG2 . THR C 218 ? 0.3792 0.4428 0.4545 -0.0432 0.0208  0.0109  220 THR C CG2 
4633 N N   . TYR C 219 ? 0.4989 0.5437 0.5740 -0.0614 0.0071  0.0185  221 TYR C N   
4634 C CA  . TYR C 219 ? 0.5467 0.5836 0.6225 -0.0667 -0.0003 0.0182  221 TYR C CA  
4635 C C   . TYR C 219 ? 0.5605 0.6151 0.6410 -0.0737 0.0005  0.0228  221 TYR C C   
4636 O O   . TYR C 219 ? 0.5600 0.6328 0.6428 -0.0743 0.0064  0.0265  221 TYR C O   
4637 C CB  . TYR C 219 ? 0.5630 0.5812 0.6352 -0.0726 -0.0091 0.0211  221 TYR C CB  
4638 C CG  . TYR C 219 ? 0.6088 0.6350 0.6818 -0.0832 -0.0098 0.0310  221 TYR C CG  
4639 C CD1 . TYR C 219 ? 0.5924 0.6259 0.6642 -0.0818 -0.0039 0.0342  221 TYR C CD1 
4640 C CD2 . TYR C 219 ? 0.6561 0.6859 0.7311 -0.0955 -0.0162 0.0378  221 TYR C CD2 
4641 C CE1 . TYR C 219 ? 0.6148 0.6596 0.6868 -0.0919 -0.0041 0.0437  221 TYR C CE1 
4642 C CE2 . TYR C 219 ? 0.6515 0.6929 0.7272 -0.1069 -0.0168 0.0484  221 TYR C CE2 
4643 C CZ  . TYR C 219 ? 0.6475 0.6971 0.7215 -0.1049 -0.0105 0.0512  221 TYR C CZ  
4644 O OH  . TYR C 219 ? 0.6677 0.7315 0.7419 -0.1167 -0.0110 0.0619  221 TYR C OH  
4645 N N   . LEU C 220 ? 0.6021 0.6526 0.6839 -0.0781 -0.0057 0.0220  222 LEU C N   
4646 C CA  . LEU C 220 ? 0.6332 0.7015 0.7204 -0.0855 -0.0061 0.0263  222 LEU C CA  
4647 C C   . LEU C 220 ? 0.6824 0.7484 0.7700 -0.0998 -0.0141 0.0352  222 LEU C C   
4648 O O   . LEU C 220 ? 0.7021 0.7481 0.7868 -0.1046 -0.0242 0.0351  222 LEU C O   
4649 C CB  . LEU C 220 ? 0.6139 0.6808 0.7024 -0.0822 -0.0084 0.0204  222 LEU C CB  
4650 C CG  . LEU C 220 ? 0.6098 0.6799 0.6975 -0.0699 -0.0019 0.0128  222 LEU C CG  
4651 C CD1 . LEU C 220 ? 0.6212 0.6892 0.7091 -0.0675 -0.0050 0.0075  222 LEU C CD1 
4652 C CD2 . LEU C 220 ? 0.6157 0.7055 0.7061 -0.0650 0.0067  0.0138  222 LEU C CD2 
4653 N N   . ALA C 221 ? 0.7228 0.8091 0.8134 -0.1065 -0.0102 0.0431  223 ALA C N   
4654 C CA  . ALA C 221 ? 0.7932 0.8853 0.8854 -0.1225 -0.0172 0.0536  223 ALA C CA  
4655 C C   . ALA C 221 ? 0.8154 0.9378 0.9147 -0.1233 -0.0114 0.0548  223 ALA C C   
4656 O O   . ALA C 221 ? 0.7946 0.9258 0.8958 -0.1110 -0.0040 0.0470  223 ALA C O   
4657 C CB  . ALA C 221 ? 0.7994 0.8955 0.8891 -0.1295 -0.0166 0.0621  223 ALA C CB  
4658 N N   . ASN C 222 ? 0.8659 1.0049 0.9691 -0.1376 -0.0153 0.0646  224 ASN C N   
4659 C CA  . ASN C 222 ? 0.8923 1.0582 1.0029 -0.1387 -0.0122 0.0648  224 ASN C CA  
4660 C C   . ASN C 222 ? 0.9000 1.1056 1.0162 -0.1407 -0.0041 0.0700  224 ASN C C   
4661 O O   . ASN C 222 ? 0.9255 1.1434 1.0409 -0.1506 -0.0042 0.0794  224 ASN C O   
4662 C CB  . ASN C 222 ? 0.9260 1.0827 1.0382 -0.1512 -0.0235 0.0690  224 ASN C CB  
4663 C CG  . ASN C 222 ? 0.9707 1.0879 1.0758 -0.1492 -0.0329 0.0640  224 ASN C CG  
4664 O OD1 . ASN C 222 ? 0.9957 1.0987 1.0980 -0.1350 -0.0298 0.0530  224 ASN C OD1 
4665 N ND2 . ASN C 222 ? 1.0191 1.1184 1.1205 -0.1629 -0.0451 0.0719  224 ASN C ND2 
4666 N N   . GLY C 223 ? 0.8836 1.1095 1.0047 -0.1301 0.0026  0.0633  225 GLY C N   
4667 C CA  . GLY C 223 ? 0.8438 1.0530 0.9642 -0.1184 0.0025  0.0528  225 GLY C CA  
4668 C C   . GLY C 223 ? 0.8070 1.0113 0.9234 -0.1028 0.0100  0.0449  225 GLY C C   
4669 O O   . GLY C 223 ? 0.7994 1.0198 0.9184 -0.0920 0.0155  0.0393  225 GLY C O   
4670 N N   . GLN C 224 ? 0.7876 0.9702 0.8978 -0.1015 0.0094  0.0448  226 GLN C N   
4671 C CA  . GLN C 224 ? 0.7567 0.9369 0.8633 -0.0882 0.0161  0.0386  226 GLN C CA  
4672 C C   . GLN C 224 ? 0.7345 0.8838 0.8345 -0.0827 0.0145  0.0341  226 GLN C C   
4673 O O   . GLN C 224 ? 0.7282 0.8561 0.8255 -0.0884 0.0079  0.0352  226 GLN C O   
4674 C CB  . GLN C 224 ? 0.7706 0.9741 0.8776 -0.0885 0.0215  0.0428  226 GLN C CB  
4675 C CG  . GLN C 224 ? 0.8118 1.0360 0.9221 -0.1048 0.0191  0.0545  226 GLN C CG  
4676 C CD  . GLN C 224 ? 0.8101 1.0548 0.9187 -0.1055 0.0243  0.0590  226 GLN C CD  
4677 O OE1 . GLN C 224 ? 0.8417 1.1046 0.9518 -0.1189 0.0227  0.0692  226 GLN C OE1 
4678 N NE2 . GLN C 224 ? 0.7771 1.0190 0.8819 -0.0916 0.0298  0.0518  226 GLN C NE2 
4679 N N   . THR C 225 ? 0.7094 0.8575 0.8069 -0.0708 0.0198  0.0283  227 THR C N   
4680 C CA  . THR C 225 ? 0.6999 0.8260 0.7915 -0.0651 0.0200  0.0249  227 THR C CA  
4681 C C   . THR C 225 ? 0.6946 0.8252 0.7841 -0.0680 0.0221  0.0298  227 THR C C   
4682 O O   . THR C 225 ? 0.6938 0.8421 0.7837 -0.0630 0.0272  0.0294  227 THR C O   
4683 C CB  . THR C 225 ? 0.6804 0.8066 0.7706 -0.0526 0.0242  0.0179  227 THR C CB  
4684 O OG1 . THR C 225 ? 0.7119 0.8438 0.8051 -0.0502 0.0232  0.0147  227 THR C OG1 
4685 C CG2 . THR C 225 ? 0.6701 0.7744 0.7550 -0.0476 0.0236  0.0143  227 THR C CG2 
4686 N N   . LYS C 226 ? 0.6811 0.7962 0.7676 -0.0755 0.0175  0.0342  228 LYS C N   
4687 C CA  . LYS C 226 ? 0.6668 0.7835 0.7500 -0.0776 0.0193  0.0387  228 LYS C CA  
4688 C C   . LYS C 226 ? 0.6243 0.7198 0.7024 -0.0696 0.0198  0.0340  228 LYS C C   
4689 O O   . LYS C 226 ? 0.6204 0.7025 0.6977 -0.0632 0.0189  0.0278  228 LYS C O   
4690 C CB  . LYS C 226 ? 0.6921 0.8103 0.7752 -0.0924 0.0137  0.0488  228 LYS C CB  
4691 C CG  . LYS C 226 ? 0.7173 0.8515 0.8060 -0.1019 0.0109  0.0533  228 LYS C CG  
4692 C CD  . LYS C 226 ? 0.7743 0.9124 0.8624 -0.1182 0.0049  0.0650  228 LYS C CD  
4693 C CE  . LYS C 226 ? 0.8372 1.0116 0.9289 -0.1229 0.0107  0.0713  228 LYS C CE  
4694 N NZ  . LYS C 226 ? 0.9204 1.0992 1.0091 -0.1378 0.0065  0.0836  228 LYS C NZ  
4695 N N   . VAL C 227 ? 0.5857 0.6807 0.6602 -0.0698 0.0214  0.0370  229 VAL C N   
4696 C CA  . VAL C 227 ? 0.5423 0.6186 0.6125 -0.0634 0.0213  0.0333  229 VAL C CA  
4697 C C   . VAL C 227 ? 0.5416 0.6083 0.6083 -0.0711 0.0170  0.0396  229 VAL C C   
4698 O O   . VAL C 227 ? 0.5599 0.6405 0.6258 -0.0760 0.0189  0.0455  229 VAL C O   
4699 C CB  . VAL C 227 ? 0.5278 0.6115 0.5962 -0.0532 0.0275  0.0292  229 VAL C CB  
4700 C CG1 . VAL C 227 ? 0.5133 0.5833 0.5770 -0.0504 0.0272  0.0290  229 VAL C CG1 
4701 C CG2 . VAL C 227 ? 0.4904 0.5730 0.5601 -0.0447 0.0292  0.0223  229 VAL C CG2 
4702 N N   . LEU C 228 ? 0.5236 0.5678 0.5881 -0.0719 0.0106  0.0383  230 LEU C N   
4703 C CA  . LEU C 228 ? 0.5175 0.5483 0.5778 -0.0775 0.0051  0.0435  230 LEU C CA  
4704 C C   . LEU C 228 ? 0.4892 0.5092 0.5464 -0.0682 0.0073  0.0386  230 LEU C C   
4705 O O   . LEU C 228 ? 0.4946 0.5057 0.5524 -0.0603 0.0073  0.0315  230 LEU C O   
4706 C CB  . LEU C 228 ? 0.5261 0.5372 0.5853 -0.0838 -0.0057 0.0447  230 LEU C CB  
4707 C CG  . LEU C 228 ? 0.5426 0.5340 0.5966 -0.0856 -0.0126 0.0472  230 LEU C CG  
4708 C CD1 . LEU C 228 ? 0.5760 0.5756 0.6277 -0.0970 -0.0138 0.0583  230 LEU C CD1 
4709 C CD2 . LEU C 228 ? 0.5493 0.5162 0.6011 -0.0865 -0.0244 0.0446  230 LEU C CD2 
4710 N N   . THR C 229 ? 0.4719 0.4942 0.5257 -0.0698 0.0087  0.0430  231 THR C N   
4711 C CA  . THR C 229 ? 0.4494 0.4630 0.5002 -0.0624 0.0103  0.0398  231 THR C CA  
4712 C C   . THR C 229 ? 0.4704 0.4655 0.5171 -0.0666 0.0025  0.0434  231 THR C C   
4713 O O   . THR C 229 ? 0.4948 0.4885 0.5393 -0.0768 -0.0025 0.0514  231 THR C O   
4714 C CB  . THR C 229 ? 0.4346 0.4649 0.4838 -0.0596 0.0175  0.0411  231 THR C CB  
4715 O OG1 . THR C 229 ? 0.4139 0.4574 0.4662 -0.0534 0.0231  0.0362  231 THR C OG1 
4716 C CG2 . THR C 229 ? 0.4179 0.4390 0.4639 -0.0533 0.0183  0.0386  231 THR C CG2 
4717 N N   . GLN C 230 ? 0.4726 0.4539 0.5184 -0.0590 0.0007  0.0378  232 GLN C N   
4718 C CA  . GLN C 230 ? 0.5089 0.4707 0.5514 -0.0605 -0.0082 0.0389  232 GLN C CA  
4719 C C   . GLN C 230 ? 0.5006 0.4580 0.5417 -0.0520 -0.0059 0.0348  232 GLN C C   
4720 O O   . GLN C 230 ? 0.4894 0.4507 0.5331 -0.0433 -0.0013 0.0279  232 GLN C O   
4721 C CB  . GLN C 230 ? 0.5173 0.4657 0.5613 -0.0582 -0.0153 0.0332  232 GLN C CB  
4722 C CG  . GLN C 230 ? 0.6131 0.5406 0.6533 -0.0634 -0.0281 0.0360  232 GLN C CG  
4723 C CD  . GLN C 230 ? 0.7166 0.6292 0.7574 -0.0562 -0.0359 0.0268  232 GLN C CD  
4724 O OE1 . GLN C 230 ? 0.7272 0.6481 0.7715 -0.0509 -0.0316 0.0203  232 GLN C OE1 
4725 N NE2 . GLN C 230 ? 0.7621 0.6529 0.7988 -0.0556 -0.0481 0.0258  232 GLN C NE2 
4726 N N   . LYS C 231 ? 0.5183 0.4685 0.5551 -0.0553 -0.0094 0.0399  233 LYS C N   
4727 C CA  . LYS C 231 ? 0.5223 0.4654 0.5578 -0.0480 -0.0097 0.0363  233 LYS C CA  
4728 C C   . LYS C 231 ? 0.5437 0.4685 0.5793 -0.0435 -0.0190 0.0311  233 LYS C C   
4729 O O   . LYS C 231 ? 0.5706 0.4802 0.6031 -0.0488 -0.0291 0.0344  233 LYS C O   
4730 C CB  . LYS C 231 ? 0.5414 0.4843 0.5720 -0.0528 -0.0102 0.0435  233 LYS C CB  
4731 C CG  . LYS C 231 ? 0.5693 0.5030 0.5982 -0.0456 -0.0120 0.0402  233 LYS C CG  
4732 C CD  . LYS C 231 ? 0.5806 0.5178 0.6043 -0.0499 -0.0107 0.0470  233 LYS C CD  
4733 C CE  . LYS C 231 ? 0.5951 0.5142 0.6151 -0.0504 -0.0199 0.0490  233 LYS C CE  
4734 N NZ  . LYS C 231 ? 0.6556 0.5789 0.6693 -0.0581 -0.0197 0.0581  233 LYS C NZ  
4735 N N   . LEU C 232 ? 0.5238 0.4506 0.5624 -0.0335 -0.0165 0.0229  234 LEU C N   
4736 C CA  . LEU C 232 ? 0.5422 0.4585 0.5819 -0.0272 -0.0235 0.0156  234 LEU C CA  
4737 C C   . LEU C 232 ? 0.5796 0.4893 0.6190 -0.0191 -0.0273 0.0109  234 LEU C C   
4738 O O   . LEU C 232 ? 0.6325 0.5397 0.6738 -0.0108 -0.0312 0.0025  234 LEU C O   
4739 C CB  . LEU C 232 ? 0.5007 0.4298 0.5450 -0.0211 -0.0174 0.0086  234 LEU C CB  
4740 C CG  . LEU C 232 ? 0.4875 0.4179 0.5334 -0.0229 -0.0186 0.0063  234 LEU C CG  
4741 C CD1 . LEU C 232 ? 0.3841 0.3267 0.4337 -0.0145 -0.0135 -0.0016 234 LEU C CD1 
4742 C CD2 . LEU C 232 ? 0.4947 0.4052 0.5376 -0.0238 -0.0317 0.0045  234 LEU C CD2 
4743 N N   . SER C 233 ? 0.5699 0.4776 0.6068 -0.0203 -0.0268 0.0153  235 SER C N   
4744 C CA  . SER C 233 ? 0.5565 0.4619 0.5945 -0.0114 -0.0293 0.0098  235 SER C CA  
4745 C C   . SER C 233 ? 0.5602 0.4745 0.5978 -0.0123 -0.0224 0.0137  235 SER C C   
4746 O O   . SER C 233 ? 0.5491 0.4779 0.5889 -0.0128 -0.0134 0.0141  235 SER C O   
4747 C CB  . SER C 233 ? 0.5372 0.4549 0.5805 -0.0025 -0.0254 0.0008  235 SER C CB  
4748 O OG  . SER C 233 ? 0.4736 0.3919 0.5188 0.0070  -0.0289 -0.0056 235 SER C OG  
4749 N N   . SER C 234 ? 0.5692 0.4742 0.6037 -0.0120 -0.0273 0.0163  236 SER C N   
4750 C CA  . SER C 234 ? 0.5674 0.4799 0.6005 -0.0132 -0.0214 0.0202  236 SER C CA  
4751 C C   . SER C 234 ? 0.5850 0.4899 0.6167 -0.0091 -0.0267 0.0197  236 SER C C   
4752 O O   . SER C 234 ? 0.6042 0.4966 0.6355 -0.0049 -0.0359 0.0163  236 SER C O   
4753 C CB  . SER C 234 ? 0.5505 0.4659 0.5791 -0.0225 -0.0178 0.0286  236 SER C CB  
4754 O OG  . SER C 234 ? 0.5888 0.4908 0.6127 -0.0290 -0.0258 0.0342  236 SER C OG  
4755 N N   . VAL C 235 ? 0.5828 0.4953 0.6137 -0.0094 -0.0214 0.0221  237 VAL C N   
4756 C CA  . VAL C 235 ? 0.6060 0.5144 0.6359 -0.0057 -0.0250 0.0219  237 VAL C CA  
4757 C C   . VAL C 235 ? 0.6168 0.5266 0.6413 -0.0108 -0.0218 0.0284  237 VAL C C   
4758 O O   . VAL C 235 ? 0.6026 0.5209 0.6252 -0.0151 -0.0152 0.0315  237 VAL C O   
4759 C CB  . VAL C 235 ? 0.5886 0.5083 0.6250 0.0025  -0.0229 0.0151  237 VAL C CB  
4760 C CG1 . VAL C 235 ? 0.6192 0.5371 0.6598 0.0099  -0.0286 0.0076  237 VAL C CG1 
4761 C CG2 . VAL C 235 ? 0.5576 0.4923 0.5970 0.0015  -0.0143 0.0146  237 VAL C CG2 
4762 N N   . ARG C 236 ? 0.6490 0.5510 0.6709 -0.0093 -0.0271 0.0299  238 ARG C N   
4763 C CA  . ARG C 236 ? 0.6765 0.5779 0.6919 -0.0137 -0.0259 0.0360  238 ARG C CA  
4764 C C   . ARG C 236 ? 0.6643 0.5663 0.6812 -0.0082 -0.0276 0.0336  238 ARG C C   
4765 O O   . ARG C 236 ? 0.6857 0.5799 0.7046 -0.0035 -0.0348 0.0308  238 ARG C O   
4766 C CB  . ARG C 236 ? 0.7147 0.6025 0.7233 -0.0202 -0.0333 0.0428  238 ARG C CB  
4767 C CG  . ARG C 236 ? 0.7765 0.6673 0.7772 -0.0267 -0.0311 0.0504  238 ARG C CG  
4768 C CD  . ARG C 236 ? 0.8844 0.7605 0.8783 -0.0330 -0.0406 0.0576  238 ARG C CD  
4769 N NE  . ARG C 236 ? 0.9641 0.8450 0.9499 -0.0387 -0.0388 0.0649  238 ARG C NE  
4770 C CZ  . ARG C 236 ? 1.0108 0.8908 0.9937 -0.0352 -0.0394 0.0645  238 ARG C CZ  
4771 N NH1 . ARG C 236 ? 0.9820 0.8575 0.9705 -0.0264 -0.0418 0.0577  238 ARG C NH1 
4772 N NH2 . ARG C 236 ? 1.0284 0.9142 1.0029 -0.0405 -0.0378 0.0710  238 ARG C NH2 
4773 N N   . GLY C 237 ? 0.6409 0.5519 0.6570 -0.0081 -0.0221 0.0340  239 GLY C N   
4774 C CA  . GLY C 237 ? 0.6205 0.5325 0.6378 -0.0041 -0.0242 0.0325  239 GLY C CA  
4775 C C   . GLY C 237 ? 0.6327 0.5353 0.6421 -0.0069 -0.0286 0.0378  239 GLY C C   
4776 O O   . GLY C 237 ? 0.6495 0.5465 0.6527 -0.0124 -0.0298 0.0429  239 GLY C O   
4777 N N   . ASN C 238 ? 0.6290 0.5311 0.6386 -0.0038 -0.0314 0.0372  240 ASN C N   
4778 C CA  . ASN C 238 ? 0.6399 0.5359 0.6412 -0.0064 -0.0342 0.0420  240 ASN C CA  
4779 C C   . ASN C 238 ? 0.6172 0.5186 0.6107 -0.0103 -0.0290 0.0454  240 ASN C C   
4780 O O   . ASN C 238 ? 0.5971 0.5069 0.5925 -0.0087 -0.0241 0.0424  240 ASN C O   
4781 C CB  . ASN C 238 ? 0.6503 0.5479 0.6550 -0.0017 -0.0372 0.0394  240 ASN C CB  
4782 C CG  . ASN C 238 ? 0.6985 0.5906 0.7083 0.0031  -0.0443 0.0366  240 ASN C CG  
4783 O OD1 . ASN C 238 ? 0.7784 0.6585 0.7849 0.0021  -0.0501 0.0387  240 ASN C OD1 
4784 N ND2 . ASN C 238 ? 0.6973 0.5982 0.7149 0.0085  -0.0451 0.0320  240 ASN C ND2 
4785 N N   . HIS C 239 ? 0.6208 0.5177 0.6052 -0.0149 -0.0310 0.0513  241 HIS C N   
4786 C CA  . HIS C 239 ? 0.6247 0.5287 0.6002 -0.0172 -0.0271 0.0539  241 HIS C CA  
4787 C C   . HIS C 239 ? 0.5914 0.4982 0.5678 -0.0121 -0.0263 0.0494  241 HIS C C   
4788 O O   . HIS C 239 ? 0.5943 0.4956 0.5733 -0.0095 -0.0311 0.0483  241 HIS C O   
4789 C CB  . HIS C 239 ? 0.6681 0.5666 0.6338 -0.0219 -0.0317 0.0608  241 HIS C CB  
4790 C CG  . HIS C 239 ? 0.7714 0.6664 0.7341 -0.0294 -0.0342 0.0676  241 HIS C CG  
4791 N ND1 . HIS C 239 ? 0.8636 0.7662 0.8169 -0.0365 -0.0325 0.0746  241 HIS C ND1 
4792 C CD2 . HIS C 239 ? 0.8367 0.7215 0.8040 -0.0314 -0.0393 0.0686  241 HIS C CD2 
4793 C CE1 . HIS C 239 ? 0.8750 0.7721 0.8275 -0.0440 -0.0366 0.0809  241 HIS C CE1 
4794 N NE2 . HIS C 239 ? 0.8692 0.7537 0.8298 -0.0407 -0.0412 0.0771  241 HIS C NE2 
4795 N N   . ILE C 240 ? 0.5493 0.4641 0.5236 -0.0105 -0.0215 0.0466  242 ILE C N   
4796 C CA  . ILE C 240 ? 0.5308 0.4455 0.5042 -0.0066 -0.0229 0.0431  242 ILE C CA  
4797 C C   . ILE C 240 ? 0.5344 0.4507 0.4960 -0.0062 -0.0233 0.0442  242 ILE C C   
4798 O O   . ILE C 240 ? 0.5367 0.4611 0.4927 -0.0062 -0.0192 0.0439  242 ILE C O   
4799 C CB  . ILE C 240 ? 0.5248 0.4444 0.5025 -0.0044 -0.0198 0.0386  242 ILE C CB  
4800 C CG1 . ILE C 240 ? 0.5210 0.4420 0.5101 -0.0047 -0.0190 0.0372  242 ILE C CG1 
4801 C CG2 . ILE C 240 ? 0.4959 0.4129 0.4705 -0.0015 -0.0233 0.0359  242 ILE C CG2 
4802 C CD1 . ILE C 240 ? 0.4742 0.4010 0.4666 -0.0041 -0.0150 0.0343  242 ILE C CD1 
4803 N N   . ILE C 241 ? 0.5282 0.4385 0.4858 -0.0053 -0.0283 0.0452  243 ILE C N   
4804 C CA  . ILE C 241 ? 0.5165 0.4291 0.4617 -0.0048 -0.0290 0.0466  243 ILE C CA  
4805 C C   . ILE C 241 ? 0.5264 0.4410 0.4668 0.0004  -0.0293 0.0409  243 ILE C C   
4806 O O   . ILE C 241 ? 0.5122 0.4225 0.4586 0.0025  -0.0314 0.0373  243 ILE C O   
4807 C CB  . ILE C 241 ? 0.5287 0.4336 0.4695 -0.0060 -0.0350 0.0503  243 ILE C CB  
4808 C CG1 . ILE C 241 ? 0.4897 0.3886 0.4320 -0.0022 -0.0401 0.0467  243 ILE C CG1 
4809 C CG2 . ILE C 241 ? 0.4858 0.3847 0.4307 -0.0104 -0.0376 0.0557  243 ILE C CG2 
4810 C CD1 . ILE C 241 ? 0.4751 0.3673 0.4117 -0.0027 -0.0462 0.0498  243 ILE C CD1 
4811 N N   . SER C 242 ? 0.5484 0.4697 0.4773 0.0024  -0.0282 0.0402  244 SER C N   
4812 C CA  . SER C 242 ? 0.5470 0.4694 0.4687 0.0091  -0.0299 0.0336  244 SER C CA  
4813 C C   . SER C 242 ? 0.5412 0.4510 0.4639 0.0112  -0.0372 0.0310  244 SER C C   
4814 O O   . SER C 242 ? 0.5415 0.4452 0.4649 0.0089  -0.0411 0.0342  244 SER C O   
4815 C CB  . SER C 242 ? 0.5664 0.4987 0.4747 0.0114  -0.0289 0.0334  244 SER C CB  
4816 O OG  . SER C 242 ? 0.6209 0.5514 0.5219 0.0195  -0.0327 0.0256  244 SER C OG  
4817 N N   . GLY C 243 ? 0.5516 0.4574 0.4750 0.0151  -0.0399 0.0256  245 GLY C N   
4818 C CA  . GLY C 243 ? 0.5592 0.4531 0.4840 0.0155  -0.0479 0.0241  245 GLY C CA  
4819 C C   . GLY C 243 ? 0.5539 0.4445 0.4921 0.0099  -0.0490 0.0280  245 GLY C C   
4820 O O   . GLY C 243 ? 0.5644 0.4491 0.5041 0.0083  -0.0549 0.0295  245 GLY C O   
4821 N N   . THR C 244 ? 0.5349 0.4310 0.4828 0.0074  -0.0437 0.0292  246 THR C N   
4822 C CA  . THR C 244 ? 0.5404 0.4371 0.5008 0.0033  -0.0445 0.0318  246 THR C CA  
4823 C C   . THR C 244 ? 0.5436 0.4453 0.5120 0.0019  -0.0405 0.0310  246 THR C C   
4824 O O   . THR C 244 ? 0.5468 0.4516 0.5121 0.0038  -0.0362 0.0289  246 THR C O   
4825 C CB  . THR C 244 ? 0.5453 0.4445 0.5112 0.0012  -0.0429 0.0356  246 THR C CB  
4826 O OG1 . THR C 244 ? 0.5554 0.4596 0.5235 0.0005  -0.0366 0.0364  246 THR C OG1 
4827 C CG2 . THR C 244 ? 0.5521 0.4469 0.5097 0.0020  -0.0461 0.0373  246 THR C CG2 
4828 N N   . CYS C 245 ? 0.5448 0.4496 0.5237 -0.0015 -0.0418 0.0329  247 CYS C N   
4829 C CA  . CYS C 245 ? 0.5458 0.4572 0.5331 -0.0034 -0.0381 0.0328  247 CYS C CA  
4830 C C   . CYS C 245 ? 0.5459 0.4648 0.5432 -0.0045 -0.0355 0.0344  247 CYS C C   
4831 O O   . CYS C 245 ? 0.5674 0.4851 0.5653 -0.0039 -0.0381 0.0356  247 CYS C O   
4832 C CB  . CYS C 245 ? 0.5523 0.4626 0.5422 -0.0066 -0.0433 0.0334  247 CYS C CB  
4833 S SG  . CYS C 245 ? 0.6228 0.5193 0.5997 -0.0042 -0.0509 0.0306  247 CYS C SG  
4834 N N   . ALA C 246 ? 0.5394 0.4657 0.5438 -0.0053 -0.0311 0.0338  248 ALA C N   
4835 C CA  . ALA C 246 ? 0.5370 0.4709 0.5508 -0.0047 -0.0292 0.0337  248 ALA C CA  
4836 C C   . ALA C 246 ? 0.5278 0.4714 0.5490 -0.0062 -0.0258 0.0327  248 ALA C C   
4837 O O   . ALA C 246 ? 0.5207 0.4628 0.5388 -0.0076 -0.0244 0.0325  248 ALA C O   
4838 C CB  . ALA C 246 ? 0.5335 0.4625 0.5439 -0.0027 -0.0271 0.0336  248 ALA C CB  
4839 N N   . SER C 247 ? 0.5267 0.4810 0.5572 -0.0052 -0.0251 0.0316  249 SER C N   
4840 C CA  . SER C 247 ? 0.5263 0.4922 0.5633 -0.0068 -0.0220 0.0309  249 SER C CA  
4841 C C   . SER C 247 ? 0.5312 0.5052 0.5750 -0.0030 -0.0195 0.0276  249 SER C C   
4842 O O   . SER C 247 ? 0.5639 0.5416 0.6118 0.0007  -0.0221 0.0259  249 SER C O   
4843 C CB  . SER C 247 ? 0.5304 0.5083 0.5732 -0.0106 -0.0252 0.0333  249 SER C CB  
4844 O OG  . SER C 247 ? 0.5688 0.5378 0.6054 -0.0143 -0.0299 0.0364  249 SER C OG  
4845 N N   . TRP C 248 ? 0.5113 0.4887 0.5566 -0.0031 -0.0153 0.0260  250 TRP C N   
4846 C CA  . TRP C 248 ? 0.4893 0.4767 0.5416 0.0009  -0.0138 0.0220  250 TRP C CA  
4847 C C   . TRP C 248 ? 0.4833 0.4910 0.5434 -0.0005 -0.0131 0.0218  250 TRP C C   
4848 O O   . TRP C 248 ? 0.4656 0.4779 0.5252 -0.0058 -0.0116 0.0248  250 TRP C O   
4849 C CB  . TRP C 248 ? 0.4848 0.4663 0.5347 0.0014  -0.0102 0.0203  250 TRP C CB  
4850 C CG  . TRP C 248 ? 0.4752 0.4411 0.5185 0.0019  -0.0111 0.0210  250 TRP C CG  
4851 C CD1 . TRP C 248 ? 0.4616 0.4182 0.5010 0.0028  -0.0149 0.0226  250 TRP C CD1 
4852 C CD2 . TRP C 248 ? 0.4578 0.4172 0.4975 0.0007  -0.0084 0.0211  250 TRP C CD2 
4853 N NE1 . TRP C 248 ? 0.4659 0.4111 0.4991 0.0016  -0.0149 0.0242  250 TRP C NE1 
4854 C CE2 . TRP C 248 ? 0.4585 0.4058 0.4921 0.0001  -0.0109 0.0234  250 TRP C CE2 
4855 C CE3 . TRP C 248 ? 0.4280 0.3914 0.4690 -0.0005 -0.0044 0.0199  250 TRP C CE3 
4856 C CZ2 . TRP C 248 ? 0.4813 0.4223 0.5105 -0.0026 -0.0094 0.0251  250 TRP C CZ2 
4857 C CZ3 . TRP C 248 ? 0.3958 0.3522 0.4328 -0.0022 -0.0030 0.0209  250 TRP C CZ3 
4858 C CH2 . TRP C 248 ? 0.4433 0.3894 0.4745 -0.0037 -0.0054 0.0237  250 TRP C CH2 
4859 N N   . ARG C 249 ? 0.5035 0.5245 0.5705 0.0042  -0.0150 0.0186  251 ARG C N   
4860 C CA  . ARG C 249 ? 0.5181 0.5643 0.5931 0.0027  -0.0141 0.0188  251 ARG C CA  
4861 C C   . ARG C 249 ? 0.5317 0.5891 0.6112 0.0091  -0.0116 0.0123  251 ARG C C   
4862 O O   . ARG C 249 ? 0.5454 0.6157 0.6307 0.0167  -0.0136 0.0068  251 ARG C O   
4863 C CB  . ARG C 249 ? 0.5102 0.5697 0.5906 0.0036  -0.0180 0.0195  251 ARG C CB  
4864 C CG  . ARG C 249 ? 0.5385 0.5879 0.6145 -0.0033 -0.0215 0.0259  251 ARG C CG  
4865 C CD  . ARG C 249 ? 0.5893 0.6510 0.6707 -0.0023 -0.0261 0.0267  251 ARG C CD  
4866 N NE  . ARG C 249 ? 0.6463 0.6901 0.7213 -0.0054 -0.0306 0.0305  251 ARG C NE  
4867 C CZ  . ARG C 249 ? 0.6652 0.7024 0.7356 -0.0139 -0.0332 0.0366  251 ARG C CZ  
4868 N NH1 . ARG C 249 ? 0.5790 0.6246 0.6504 -0.0214 -0.0325 0.0408  251 ARG C NH1 
4869 N NH2 . ARG C 249 ? 0.6898 0.7104 0.7537 -0.0146 -0.0376 0.0384  251 ARG C NH2 
4870 N N   . GLY C 250 ? 0.5270 0.5788 0.6035 0.0071  -0.0080 0.0122  252 GLY C N   
4871 C CA  . GLY C 250 ? 0.5294 0.5894 0.6090 0.0132  -0.0061 0.0058  252 GLY C CA  
4872 C C   . GLY C 250 ? 0.5297 0.5719 0.6063 0.0203  -0.0091 0.0005  252 GLY C C   
4873 O O   . GLY C 250 ? 0.5436 0.5926 0.6237 0.0286  -0.0114 -0.0067 252 GLY C O   
4874 N N   . LYS C 251 ? 0.5269 0.5467 0.5966 0.0170  -0.0098 0.0040  253 LYS C N   
4875 C CA  . LYS C 251 ? 0.5365 0.5377 0.6020 0.0205  -0.0130 0.0014  253 LYS C CA  
4876 C C   . LYS C 251 ? 0.5407 0.5450 0.6073 0.0222  -0.0108 -0.0026 253 LYS C C   
4877 O O   . LYS C 251 ? 0.5275 0.5369 0.5937 0.0172  -0.0057 -0.0002 253 LYS C O   
4878 C CB  . LYS C 251 ? 0.5300 0.5124 0.5876 0.0145  -0.0128 0.0075  253 LYS C CB  
4879 C CG  . LYS C 251 ? 0.5609 0.5249 0.6129 0.0141  -0.0154 0.0079  253 LYS C CG  
4880 C CD  . LYS C 251 ? 0.6385 0.5888 0.6880 0.0177  -0.0232 0.0075  253 LYS C CD  
4881 C CE  . LYS C 251 ? 0.6500 0.5912 0.6935 0.0134  -0.0243 0.0135  253 LYS C CE  
4882 N NZ  . LYS C 251 ? 0.6752 0.6223 0.7219 0.0172  -0.0275 0.0125  253 LYS C NZ  
4883 N N   . SER C 252 ? 0.5441 0.5451 0.6120 0.0298  -0.0156 -0.0092 254 SER C N   
4884 C CA  . SER C 252 ? 0.5435 0.5509 0.6130 0.0327  -0.0143 -0.0142 254 SER C CA  
4885 C C   . SER C 252 ? 0.5467 0.5330 0.6107 0.0304  -0.0166 -0.0135 254 SER C C   
4886 O O   . SER C 252 ? 0.5468 0.5145 0.6062 0.0289  -0.0216 -0.0108 254 SER C O   
4887 C CB  . SER C 252 ? 0.5639 0.5859 0.6388 0.0437  -0.0184 -0.0234 254 SER C CB  
4888 O OG  . SER C 252 ? 0.6172 0.6235 0.6893 0.0502  -0.0253 -0.0296 254 SER C OG  
4889 N N   . LEU C 253 ? 0.5386 0.5290 0.6029 0.0291  -0.0135 -0.0152 255 LEU C N   
4890 C CA  . LEU C 253 ? 0.5446 0.5182 0.6042 0.0251  -0.0150 -0.0134 255 LEU C CA  
4891 C C   . LEU C 253 ? 0.5604 0.5394 0.6218 0.0291  -0.0155 -0.0198 255 LEU C C   
4892 O O   . LEU C 253 ? 0.5481 0.5418 0.6118 0.0274  -0.0094 -0.0199 255 LEU C O   
4893 C CB  . LEU C 253 ? 0.5181 0.4898 0.5747 0.0156  -0.0087 -0.0054 255 LEU C CB  
4894 C CG  . LEU C 253 ? 0.5187 0.4798 0.5716 0.0100  -0.0082 -0.0023 255 LEU C CG  
4895 C CD1 . LEU C 253 ? 0.5759 0.5188 0.6253 0.0106  -0.0168 -0.0027 255 LEU C CD1 
4896 C CD2 . LEU C 253 ? 0.4871 0.4471 0.5366 0.0026  -0.0032 0.0050  255 LEU C CD2 
4897 N N   . ARG C 254 ? 0.6077 0.5733 0.6671 0.0344  -0.0239 -0.0252 256 ARG C N   
4898 C CA  . ARG C 254 ? 0.6495 0.6191 0.7099 0.0402  -0.0262 -0.0331 256 ARG C CA  
4899 C C   . ARG C 254 ? 0.6551 0.6209 0.7136 0.0326  -0.0225 -0.0293 256 ARG C C   
4900 O O   . ARG C 254 ? 0.6670 0.6205 0.7222 0.0237  -0.0217 -0.0214 256 ARG C O   
4901 C CB  . ARG C 254 ? 0.6914 0.6434 0.7491 0.0484  -0.0388 -0.0401 256 ARG C CB  
4902 C CG  . ARG C 254 ? 0.7423 0.7031 0.8015 0.0588  -0.0422 -0.0517 256 ARG C CG  
4903 C CD  . ARG C 254 ? 0.8492 0.8064 0.9084 0.0728  -0.0531 -0.0624 256 ARG C CD  
4904 N NE  . ARG C 254 ? 0.8656 0.8423 0.9298 0.0790  -0.0502 -0.0645 256 ARG C NE  
4905 C CZ  . ARG C 254 ? 0.8871 0.8945 0.9569 0.0863  -0.0448 -0.0709 256 ARG C CZ  
4906 N NH1 . ARG C 254 ? 0.8984 0.9234 0.9729 0.0907  -0.0432 -0.0719 256 ARG C NH1 
4907 N NH2 . ARG C 254 ? 0.8909 0.9130 0.9615 0.0885  -0.0411 -0.0758 256 ARG C NH2 
4908 N N   . VAL C 255 ? 0.6666 0.6452 0.7271 0.0362  -0.0201 -0.0349 257 VAL C N   
4909 C CA  . VAL C 255 ? 0.6728 0.6492 0.7320 0.0306  -0.0176 -0.0331 257 VAL C CA  
4910 C C   . VAL C 255 ? 0.7167 0.6820 0.7736 0.0367  -0.0266 -0.0412 257 VAL C C   
4911 O O   . VAL C 255 ? 0.7316 0.7085 0.7903 0.0467  -0.0286 -0.0505 257 VAL C O   
4912 C CB  . VAL C 255 ? 0.6536 0.6535 0.7161 0.0307  -0.0092 -0.0342 257 VAL C CB  
4913 C CG1 . VAL C 255 ? 0.6502 0.6480 0.7114 0.0257  -0.0070 -0.0327 257 VAL C CG1 
4914 C CG2 . VAL C 255 ? 0.6205 0.6319 0.6849 0.0255  -0.0019 -0.0272 257 VAL C CG2 
4915 N N   . GLN C 256 ? 0.7582 0.7026 0.8112 0.0312  -0.0329 -0.0380 258 GLN C N   
4916 C CA  . GLN C 256 ? 0.8164 0.7495 0.8668 0.0365  -0.0426 -0.0460 258 GLN C CA  
4917 C C   . GLN C 256 ? 0.8171 0.7487 0.8666 0.0293  -0.0407 -0.0434 258 GLN C C   
4918 O O   . GLN C 256 ? 0.8440 0.7701 0.8916 0.0344  -0.0477 -0.0511 258 GLN C O   
4919 C CB  . GLN C 256 ? 0.8613 0.7685 0.9071 0.0404  -0.0577 -0.0491 258 GLN C CB  
4920 C CG  . GLN C 256 ? 0.9077 0.8000 0.9510 0.0334  -0.0606 -0.0400 258 GLN C CG  
4921 C CD  . GLN C 256 ? 0.9524 0.8485 0.9959 0.0193  -0.0512 -0.0273 258 GLN C CD  
4922 O OE1 . GLN C 256 ? 0.9905 0.8799 1.0322 0.0135  -0.0513 -0.0196 258 GLN C OE1 
4923 N NE2 . GLN C 256 ? 0.9513 0.8592 0.9969 0.0146  -0.0434 -0.0256 258 GLN C NE2 
4924 N N   . LEU C 263 ? 1.0294 0.9315 1.0771 -0.0763 -0.0635 0.0182  265 LEU C N   
4925 C CA  . LEU C 263 ? 1.0472 0.9502 1.0963 -0.0853 -0.0689 0.0213  265 LEU C CA  
4926 C C   . LEU C 263 ? 1.0407 0.9380 1.0893 -0.0756 -0.0725 0.0093  265 LEU C C   
4927 O O   . LEU C 263 ? 1.0599 0.9414 1.1045 -0.0647 -0.0790 -0.0005 265 LEU C O   
4928 C CB  . LEU C 263 ? 1.0349 0.9644 1.0895 -0.0953 -0.0585 0.0309  265 LEU C CB  
4929 C CG  . LEU C 263 ? 0.9899 0.9464 1.0496 -0.0894 -0.0419 0.0297  265 LEU C CG  
4930 C CD1 . LEU C 263 ? 0.9770 0.9527 1.0416 -0.0977 -0.0387 0.0350  265 LEU C CD1 
4931 C CD2 . LEU C 263 ? 0.9554 0.9205 1.0146 -0.0898 -0.0347 0.0350  265 LEU C CD2 
4932 N N   . GLY C 264 ? 1.0160 0.9269 1.0685 -0.0788 -0.0687 0.0094  266 GLY C N   
4933 C CA  . GLY C 264 ? 1.0044 0.9091 1.0555 -0.0711 -0.0738 -0.0011 266 GLY C CA  
4934 C C   . GLY C 264 ? 0.9541 0.8778 1.0082 -0.0607 -0.0619 -0.0089 266 GLY C C   
4935 O O   . GLY C 264 ? 0.9295 0.8678 0.9860 -0.0557 -0.0501 -0.0089 266 GLY C O   
4936 N N   . SER C 265 ? 0.9528 0.8758 1.0064 -0.0582 -0.0658 -0.0151 267 SER C N   
4937 C CA  . SER C 265 ? 0.9077 0.8492 0.9635 -0.0498 -0.0554 -0.0215 267 SER C CA  
4938 C C   . SER C 265 ? 0.8696 0.8334 0.9317 -0.0566 -0.0447 -0.0137 267 SER C C   
4939 O O   . SER C 265 ? 0.8503 0.8282 0.9142 -0.0520 -0.0379 -0.0171 267 SER C O   
4940 C CB  . SER C 265 ? 0.9276 0.8618 0.9800 -0.0441 -0.0635 -0.0313 267 SER C CB  
4941 O OG  . SER C 265 ? 0.9139 0.8487 0.9684 -0.0540 -0.0683 -0.0267 267 SER C OG  
4942 N N   . ASN C 266 ? 0.8496 0.8167 0.9145 -0.0674 -0.0442 -0.0033 268 ASN C N   
4943 C CA  . ASN C 266 ? 0.7965 0.7862 0.8668 -0.0711 -0.0332 0.0033  268 ASN C CA  
4944 C C   . ASN C 266 ? 0.7434 0.7392 0.8134 -0.0641 -0.0237 0.0029  268 ASN C C   
4945 O O   . ASN C 266 ? 0.7229 0.7361 0.7964 -0.0644 -0.0148 0.0066  268 ASN C O   
4946 C CB  . ASN C 266 ? 0.8190 0.8142 0.8924 -0.0856 -0.0367 0.0144  268 ASN C CB  
4947 C CG  . ASN C 266 ? 0.8630 0.8370 0.9321 -0.0933 -0.0484 0.0192  268 ASN C CG  
4948 O OD1 . ASN C 266 ? 0.8549 0.8100 0.9188 -0.0865 -0.0532 0.0138  268 ASN C OD1 
4949 N ND2 . ASN C 266 ? 0.8828 0.8609 0.9538 -0.1079 -0.0536 0.0298  268 ASN C ND2 
4950 N N   . ILE C 267 ? 0.7061 0.6880 0.7719 -0.0573 -0.0264 -0.0021 269 ILE C N   
4951 C CA  . ILE C 267 ? 0.6529 0.6391 0.7180 -0.0497 -0.0186 -0.0038 269 ILE C CA  
4952 C C   . ILE C 267 ? 0.5956 0.5947 0.6614 -0.0406 -0.0101 -0.0095 269 ILE C C   
4953 O O   . ILE C 267 ? 0.5895 0.5856 0.6530 -0.0334 -0.0119 -0.0170 269 ILE C O   
4954 C CB  . ILE C 267 ? 0.6678 0.6359 0.7285 -0.0454 -0.0256 -0.0076 269 ILE C CB  
4955 C CG1 . ILE C 267 ? 0.6466 0.6187 0.7070 -0.0399 -0.0187 -0.0075 269 ILE C CG1 
4956 C CG2 . ILE C 267 ? 0.6921 0.6514 0.7497 -0.0367 -0.0320 -0.0184 269 ILE C CG2 
4957 C CD1 . ILE C 267 ? 0.6914 0.6495 0.7480 -0.0318 -0.0248 -0.0145 269 ILE C CD1 
4958 N N   . LEU C 268 ? 0.5323 0.5460 0.6008 -0.0410 -0.0018 -0.0056 270 LEU C N   
4959 C CA  . LEU C 268 ? 0.4737 0.4983 0.5426 -0.0351 0.0041  -0.0089 270 LEU C CA  
4960 C C   . LEU C 268 ? 0.4362 0.4611 0.5029 -0.0285 0.0078  -0.0115 270 LEU C C   
4961 O O   . LEU C 268 ? 0.4202 0.4485 0.4852 -0.0233 0.0087  -0.0162 270 LEU C O   
4962 C CB  . LEU C 268 ? 0.4648 0.5034 0.5370 -0.0375 0.0094  -0.0045 270 LEU C CB  
4963 C CG  . LEU C 268 ? 0.5007 0.5462 0.5750 -0.0394 0.0079  -0.0055 270 LEU C CG  
4964 C CD1 . LEU C 268 ? 0.4990 0.5379 0.5745 -0.0469 0.0007  -0.0038 270 LEU C CD1 
4965 C CD2 . LEU C 268 ? 0.4904 0.5513 0.5679 -0.0391 0.0128  -0.0026 270 LEU C CD2 
4966 N N   . ARG C 269 ? 0.4110 0.4342 0.4775 -0.0292 0.0102  -0.0077 271 ARG C N   
4967 C CA  . ARG C 269 ? 0.3980 0.4211 0.4628 -0.0241 0.0132  -0.0090 271 ARG C CA  
4968 C C   . ARG C 269 ? 0.3813 0.3982 0.4456 -0.0261 0.0130  -0.0052 271 ARG C C   
4969 O O   . ARG C 269 ? 0.3652 0.3807 0.4303 -0.0318 0.0117  -0.0006 271 ARG C O   
4970 C CB  . ARG C 269 ? 0.3919 0.4253 0.4568 -0.0221 0.0186  -0.0076 271 ARG C CB  
4971 C CG  . ARG C 269 ? 0.4196 0.4587 0.4862 -0.0249 0.0210  -0.0032 271 ARG C CG  
4972 C CD  . ARG C 269 ? 0.5220 0.5671 0.5874 -0.0215 0.0241  -0.0027 271 ARG C CD  
4973 N NE  . ARG C 269 ? 0.5376 0.5876 0.6036 -0.0217 0.0259  0.0003  271 ARG C NE  
4974 C CZ  . ARG C 269 ? 0.5499 0.6077 0.6186 -0.0235 0.0260  0.0012  271 ARG C CZ  
4975 N NH1 . ARG C 269 ? 0.4604 0.5202 0.5313 -0.0263 0.0241  0.0000  271 ARG C NH1 
4976 N NH2 . ARG C 269 ? 0.6110 0.6758 0.6799 -0.0219 0.0277  0.0028  271 ARG C NH2 
4977 N N   . VAL C 270 ? 0.3784 0.3931 0.4412 -0.0218 0.0141  -0.0066 272 VAL C N   
4978 C CA  . VAL C 270 ? 0.3872 0.3956 0.4489 -0.0230 0.0137  -0.0033 272 VAL C CA  
4979 C C   . VAL C 270 ? 0.3808 0.3952 0.4419 -0.0199 0.0187  -0.0022 272 VAL C C   
4980 O O   . VAL C 270 ? 0.3839 0.4032 0.4449 -0.0162 0.0201  -0.0049 272 VAL C O   
4981 C CB  . VAL C 270 ? 0.4013 0.3969 0.4613 -0.0207 0.0073  -0.0066 272 VAL C CB  
4982 C CG1 . VAL C 270 ? 0.3759 0.3639 0.4346 -0.0244 0.0056  -0.0016 272 VAL C CG1 
4983 C CG2 . VAL C 270 ? 0.3938 0.3807 0.4533 -0.0219 -0.0001 -0.0099 272 VAL C CG2 
4984 N N   . GLU C 271 ? 0.3975 0.4127 0.4578 -0.0216 0.0211  0.0021  273 GLU C N   
4985 C CA  . GLU C 271 ? 0.4173 0.4351 0.4762 -0.0184 0.0239  0.0028  273 GLU C CA  
4986 C C   . GLU C 271 ? 0.4157 0.4268 0.4730 -0.0180 0.0229  0.0043  273 GLU C C   
4987 O O   . GLU C 271 ? 0.4422 0.4483 0.4989 -0.0211 0.0210  0.0066  273 GLU C O   
4988 C CB  . GLU C 271 ? 0.4054 0.4294 0.4636 -0.0185 0.0266  0.0050  273 GLU C CB  
4989 C CG  . GLU C 271 ? 0.4825 0.5124 0.5421 -0.0184 0.0269  0.0034  273 GLU C CG  
4990 C CD  . GLU C 271 ? 0.6130 0.6488 0.6721 -0.0174 0.0283  0.0047  273 GLU C CD  
4991 O OE1 . GLU C 271 ? 0.6807 0.7158 0.7377 -0.0162 0.0290  0.0063  273 GLU C OE1 
4992 O OE2 . GLU C 271 ? 0.6721 0.7133 0.7324 -0.0171 0.0282  0.0036  273 GLU C OE2 
4993 N N   . TYR C 272 ? 0.4084 0.4199 0.4650 -0.0150 0.0235  0.0036  274 TYR C N   
4994 C CA  . TYR C 272 ? 0.4050 0.4099 0.4605 -0.0143 0.0218  0.0044  274 TYR C CA  
4995 C C   . TYR C 272 ? 0.4057 0.4117 0.4592 -0.0134 0.0235  0.0068  274 TYR C C   
4996 O O   . TYR C 272 ? 0.4068 0.4176 0.4600 -0.0125 0.0246  0.0070  274 TYR C O   
4997 C CB  . TYR C 272 ? 0.4034 0.4073 0.4603 -0.0106 0.0191  0.0001  274 TYR C CB  
4998 C CG  . TYR C 272 ? 0.3926 0.3929 0.4505 -0.0095 0.0152  -0.0042 274 TYR C CG  
4999 C CD1 . TYR C 272 ? 0.4186 0.4071 0.4755 -0.0094 0.0096  -0.0051 274 TYR C CD1 
5000 C CD2 . TYR C 272 ? 0.3772 0.3847 0.4363 -0.0081 0.0159  -0.0077 274 TYR C CD2 
5001 C CE1 . TYR C 272 ? 0.4136 0.3956 0.4704 -0.0078 0.0037  -0.0097 274 TYR C CE1 
5002 C CE2 . TYR C 272 ? 0.3556 0.3591 0.4150 -0.0061 0.0114  -0.0127 274 TYR C CE2 
5003 C CZ  . TYR C 272 ? 0.4071 0.3972 0.4652 -0.0057 0.0050  -0.0139 274 TYR C CZ  
5004 O OH  . TYR C 272 ? 0.4056 0.3894 0.4630 -0.0032 -0.0012 -0.0193 274 TYR C OH  
5005 N N   . SER C 273 ? 0.4146 0.4152 0.4660 -0.0142 0.0228  0.0093  275 SER C N   
5006 C CA  . SER C 273 ? 0.4053 0.4051 0.4543 -0.0129 0.0231  0.0110  275 SER C CA  
5007 C C   . SER C 273 ? 0.4007 0.3945 0.4494 -0.0122 0.0208  0.0112  275 SER C C   
5008 O O   . SER C 273 ? 0.3927 0.3809 0.4412 -0.0136 0.0187  0.0117  275 SER C O   
5009 C CB  . SER C 273 ? 0.4074 0.4080 0.4530 -0.0136 0.0246  0.0132  275 SER C CB  
5010 O OG  . SER C 273 ? 0.4310 0.4376 0.4776 -0.0139 0.0261  0.0124  275 SER C OG  
5011 N N   . LEU C 274 ? 0.4018 0.3964 0.4504 -0.0105 0.0202  0.0113  276 LEU C N   
5012 C CA  . LEU C 274 ? 0.4080 0.3970 0.4553 -0.0097 0.0180  0.0124  276 LEU C CA  
5013 C C   . LEU C 274 ? 0.4133 0.3990 0.4557 -0.0108 0.0186  0.0155  276 LEU C C   
5014 O O   . LEU C 274 ? 0.4094 0.3971 0.4498 -0.0102 0.0192  0.0160  276 LEU C O   
5015 C CB  . LEU C 274 ? 0.4040 0.3974 0.4538 -0.0076 0.0168  0.0111  276 LEU C CB  
5016 C CG  . LEU C 274 ? 0.4238 0.4120 0.4723 -0.0067 0.0143  0.0124  276 LEU C CG  
5017 C CD1 . LEU C 274 ? 0.4415 0.4209 0.4890 -0.0060 0.0115  0.0120  276 LEU C CD1 
5018 C CD2 . LEU C 274 ? 0.3969 0.3933 0.4491 -0.0049 0.0131  0.0111  276 LEU C CD2 
5019 N N   . LEU C 275 ? 0.4188 0.3994 0.4586 -0.0121 0.0176  0.0175  277 LEU C N   
5020 C CA  . LEU C 275 ? 0.4234 0.4032 0.4580 -0.0125 0.0182  0.0200  277 LEU C CA  
5021 C C   . LEU C 275 ? 0.4288 0.4028 0.4621 -0.0115 0.0154  0.0208  277 LEU C C   
5022 O O   . LEU C 275 ? 0.4269 0.3959 0.4616 -0.0120 0.0128  0.0211  277 LEU C O   
5023 C CB  . LEU C 275 ? 0.4229 0.4041 0.4550 -0.0160 0.0190  0.0229  277 LEU C CB  
5024 C CG  . LEU C 275 ? 0.4206 0.4098 0.4545 -0.0171 0.0217  0.0222  277 LEU C CG  
5025 C CD1 . LEU C 275 ? 0.4440 0.4386 0.4750 -0.0209 0.0227  0.0259  277 LEU C CD1 
5026 C CD2 . LEU C 275 ? 0.4089 0.4031 0.4419 -0.0131 0.0235  0.0195  277 LEU C CD2 
5027 N N   . ILE C 276 ? 0.4295 0.4030 0.4597 -0.0097 0.0149  0.0210  278 ILE C N   
5028 C CA  . ILE C 276 ? 0.4402 0.4086 0.4680 -0.0090 0.0121  0.0223  278 ILE C CA  
5029 C C   . ILE C 276 ? 0.4572 0.4252 0.4780 -0.0082 0.0125  0.0232  278 ILE C C   
5030 O O   . ILE C 276 ? 0.4678 0.4369 0.4861 -0.0059 0.0122  0.0216  278 ILE C O   
5031 C CB  . ILE C 276 ? 0.4411 0.4101 0.4714 -0.0079 0.0101  0.0214  278 ILE C CB  
5032 C CG1 . ILE C 276 ? 0.4572 0.4320 0.4944 -0.0079 0.0106  0.0195  278 ILE C CG1 
5033 C CG2 . ILE C 276 ? 0.4495 0.4138 0.4781 -0.0074 0.0069  0.0227  278 ILE C CG2 
5034 C CD1 . ILE C 276 ? 0.4605 0.4413 0.5003 -0.0086 0.0099  0.0196  278 ILE C CD1 
5035 N N   . TYR C 277 ? 0.4670 0.4336 0.4841 -0.0098 0.0124  0.0258  279 TYR C N   
5036 C CA  . TYR C 277 ? 0.4723 0.4420 0.4820 -0.0087 0.0130  0.0266  279 TYR C CA  
5037 C C   . TYR C 277 ? 0.4930 0.4576 0.4979 -0.0095 0.0103  0.0294  279 TYR C C   
5038 O O   . TYR C 277 ? 0.4840 0.4417 0.4915 -0.0113 0.0076  0.0311  279 TYR C O   
5039 C CB  . TYR C 277 ? 0.4618 0.4411 0.4705 -0.0109 0.0165  0.0279  279 TYR C CB  
5040 C CG  . TYR C 277 ? 0.4736 0.4508 0.4842 -0.0167 0.0158  0.0322  279 TYR C CG  
5041 C CD1 . TYR C 277 ? 0.4658 0.4380 0.4827 -0.0182 0.0146  0.0315  279 TYR C CD1 
5042 C CD2 . TYR C 277 ? 0.4638 0.4435 0.4690 -0.0209 0.0152  0.0372  279 TYR C CD2 
5043 C CE1 . TYR C 277 ? 0.4711 0.4380 0.4888 -0.0233 0.0117  0.0351  279 TYR C CE1 
5044 C CE2 . TYR C 277 ? 0.4509 0.4260 0.4570 -0.0275 0.0125  0.0422  279 TYR C CE2 
5045 C CZ  . TYR C 277 ? 0.4745 0.4418 0.4867 -0.0284 0.0101  0.0408  279 TYR C CZ  
5046 O OH  . TYR C 277 ? 0.5333 0.4925 0.5455 -0.0343 0.0052  0.0451  279 TYR C OH  
5047 N N   . VAL C 278 ? 0.5027 0.4708 0.5001 -0.0071 0.0105  0.0290  280 VAL C N   
5048 C CA  . VAL C 278 ? 0.5142 0.4798 0.5055 -0.0079 0.0084  0.0317  280 VAL C CA  
5049 C C   . VAL C 278 ? 0.5375 0.5143 0.5225 -0.0100 0.0111  0.0346  280 VAL C C   
5050 O O   . VAL C 278 ? 0.5300 0.5179 0.5121 -0.0066 0.0139  0.0317  280 VAL C O   
5051 C CB  . VAL C 278 ? 0.5089 0.4694 0.4957 -0.0030 0.0052  0.0286  280 VAL C CB  
5052 C CG1 . VAL C 278 ? 0.5158 0.4755 0.4950 -0.0033 0.0034  0.0311  280 VAL C CG1 
5053 C CG2 . VAL C 278 ? 0.5102 0.4620 0.5034 -0.0033 0.0020  0.0281  280 VAL C CG2 
5054 N N   . SER C 279 ? 0.5644 0.5393 0.5471 -0.0156 0.0096  0.0404  281 SER C N   
5055 C CA  . SER C 279 ? 0.6038 0.5919 0.5799 -0.0195 0.0118  0.0449  281 SER C CA  
5056 C C   . SER C 279 ? 0.6172 0.6078 0.5842 -0.0161 0.0106  0.0444  281 SER C C   
5057 O O   . SER C 279 ? 0.6278 0.6063 0.5932 -0.0162 0.0064  0.0457  281 SER C O   
5058 C CB  . SER C 279 ? 0.6194 0.6039 0.5961 -0.0290 0.0094  0.0530  281 SER C CB  
5059 O OG  . SER C 279 ? 0.6550 0.6350 0.6397 -0.0317 0.0092  0.0529  281 SER C OG  
5060 N N   . VAL C 280 ? 0.6219 0.6293 0.5830 -0.0124 0.0139  0.0420  282 VAL C N   
5061 C CA  . VAL C 280 ? 0.6369 0.6509 0.5880 -0.0085 0.0131  0.0408  282 VAL C CA  
5062 C C   . VAL C 280 ? 0.6716 0.7051 0.6172 -0.0155 0.0161  0.0480  282 VAL C C   
5063 O O   . VAL C 280 ? 0.6804 0.7329 0.6267 -0.0155 0.0205  0.0474  282 VAL C O   
5064 C CB  . VAL C 280 ? 0.6397 0.6610 0.5874 0.0027  0.0140  0.0311  282 VAL C CB  
5065 C CG1 . VAL C 280 ? 0.6556 0.6830 0.5919 0.0088  0.0122  0.0280  282 VAL C CG1 
5066 C CG2 . VAL C 280 ? 0.5892 0.5932 0.5431 0.0073  0.0108  0.0256  282 VAL C CG2 
5067 N N   . PRO C 281 ? 0.7038 0.7344 0.6439 -0.0221 0.0134  0.0554  283 PRO C N   
5068 C CA  . PRO C 281 ? 0.7395 0.7925 0.6736 -0.0301 0.0161  0.0634  283 PRO C CA  
5069 C C   . PRO C 281 ? 0.7660 0.8465 0.6927 -0.0225 0.0209  0.0579  283 PRO C C   
5070 O O   . PRO C 281 ? 0.7793 0.8580 0.6997 -0.0126 0.0196  0.0506  283 PRO C O   
5071 C CB  . PRO C 281 ? 0.7507 0.7933 0.6786 -0.0370 0.0110  0.0714  283 PRO C CB  
5072 C CG  . PRO C 281 ? 0.7216 0.7354 0.6562 -0.0353 0.0057  0.0693  283 PRO C CG  
5073 C CD  . PRO C 281 ? 0.7004 0.7106 0.6392 -0.0238 0.0076  0.0580  283 PRO C CD  
5074 N N   . GLY C 282 ? 0.7834 0.8895 0.7110 -0.0265 0.0258  0.0609  284 GLY C N   
5075 C CA  . GLY C 282 ? 0.8082 0.9452 0.7294 -0.0184 0.0306  0.0551  284 GLY C CA  
5076 C C   . GLY C 282 ? 0.8039 0.9394 0.7270 -0.0027 0.0312  0.0410  284 GLY C C   
5077 O O   . GLY C 282 ? 0.8345 0.9801 0.7496 0.0091  0.0308  0.0323  284 GLY C O   
5078 N N   . SER C 283 ? 0.7772 0.8997 0.7103 -0.0023 0.0311  0.0384  285 SER C N   
5079 C CA  . SER C 283 ? 0.7512 0.8677 0.6865 0.0110  0.0300  0.0264  285 SER C CA  
5080 C C   . SER C 283 ? 0.7114 0.8148 0.6583 0.0067  0.0303  0.0275  285 SER C C   
5081 O O   . SER C 283 ? 0.6995 0.7928 0.6519 -0.0043 0.0300  0.0358  285 SER C O   
5082 C CB  . SER C 283 ? 0.7404 0.8349 0.6702 0.0195  0.0240  0.0198  285 SER C CB  
5083 O OG  . SER C 283 ? 0.7586 0.8390 0.6921 0.0282  0.0209  0.0112  285 SER C OG  
5084 N N   . LYS C 284 ? 0.6961 0.8001 0.6466 0.0154  0.0303  0.0192  286 LYS C N   
5085 C CA  . LYS C 284 ? 0.6844 0.7774 0.6455 0.0104  0.0308  0.0212  286 LYS C CA  
5086 C C   . LYS C 284 ? 0.6450 0.7074 0.6105 0.0077  0.0264  0.0223  286 LYS C C   
5087 O O   . LYS C 284 ? 0.6431 0.6915 0.6042 0.0131  0.0222  0.0184  286 LYS C O   
5088 C CB  . LYS C 284 ? 0.6823 0.7860 0.6466 0.0188  0.0321  0.0134  286 LYS C CB  
5089 C CG  . LYS C 284 ? 0.7189 0.8550 0.6844 0.0159  0.0378  0.0160  286 LYS C CG  
5090 C CD  . LYS C 284 ? 0.7968 0.9450 0.7664 0.0245  0.0389  0.0083  286 LYS C CD  
5091 C CE  . LYS C 284 ? 0.8141 0.9688 0.7760 0.0415  0.0358  -0.0041 286 LYS C CE  
5092 N NZ  . LYS C 284 ? 0.8494 0.9719 0.8097 0.0481  0.0285  -0.0100 286 LYS C NZ  
5093 N N   . LYS C 285 ? 0.6054 0.6597 0.5792 -0.0006 0.0271  0.0273  287 LYS C N   
5094 C CA  . LYS C 285 ? 0.5704 0.6012 0.5495 -0.0020 0.0236  0.0274  287 LYS C CA  
5095 C C   . LYS C 285 ? 0.5471 0.5677 0.5269 0.0066  0.0206  0.0197  287 LYS C C   
5096 O O   . LYS C 285 ? 0.5490 0.5781 0.5274 0.0134  0.0211  0.0140  287 LYS C O   
5097 C CB  . LYS C 285 ? 0.5567 0.5840 0.5443 -0.0101 0.0247  0.0320  287 LYS C CB  
5098 C CG  . LYS C 285 ? 0.5645 0.5911 0.5519 -0.0201 0.0239  0.0405  287 LYS C CG  
5099 C CD  . LYS C 285 ? 0.6115 0.6381 0.6059 -0.0264 0.0245  0.0434  287 LYS C CD  
5100 C CE  . LYS C 285 ? 0.6655 0.6893 0.6591 -0.0370 0.0217  0.0522  287 LYS C CE  
5101 N NZ  . LYS C 285 ? 0.7253 0.7692 0.7130 -0.0421 0.0240  0.0579  287 LYS C NZ  
5102 N N   . VAL C 286 ? 0.5247 0.5273 0.5063 0.0062  0.0167  0.0197  288 VAL C N   
5103 C CA  . VAL C 286 ? 0.5017 0.4941 0.4855 0.0107  0.0132  0.0149  288 VAL C CA  
5104 C C   . VAL C 286 ? 0.4761 0.4620 0.4690 0.0055  0.0139  0.0174  288 VAL C C   
5105 O O   . VAL C 286 ? 0.4612 0.4399 0.4575 0.0009  0.0131  0.0209  288 VAL C O   
5106 C CB  . VAL C 286 ? 0.5067 0.4875 0.4840 0.0163  0.0069  0.0114  288 VAL C CB  
5107 C CG1 . VAL C 286 ? 0.5007 0.4825 0.4717 0.0158  0.0064  0.0134  288 VAL C CG1 
5108 C CG2 . VAL C 286 ? 0.5271 0.4934 0.5090 0.0139  0.0026  0.0123  288 VAL C CG2 
5109 N N   . ILE C 287 ? 0.4738 0.4636 0.4703 0.0070  0.0151  0.0149  289 ILE C N   
5110 C CA  . ILE C 287 ? 0.4590 0.4476 0.4636 0.0025  0.0168  0.0166  289 ILE C CA  
5111 C C   . ILE C 287 ? 0.4606 0.4418 0.4678 0.0041  0.0136  0.0144  289 ILE C C   
5112 O O   . ILE C 287 ? 0.4697 0.4508 0.4740 0.0089  0.0113  0.0108  289 ILE C O   
5113 C CB  . ILE C 287 ? 0.4578 0.4592 0.4648 0.0011  0.0211  0.0169  289 ILE C CB  
5114 C CG1 . ILE C 287 ? 0.4649 0.4737 0.4700 -0.0037 0.0235  0.0215  289 ILE C CG1 
5115 C CG2 . ILE C 287 ? 0.4491 0.4487 0.4636 -0.0025 0.0222  0.0176  289 ILE C CG2 
5116 C CD1 . ILE C 287 ? 0.4484 0.4748 0.4520 -0.0038 0.0270  0.0218  289 ILE C CD1 
5117 N N   . LEU C 288 ? 0.4537 0.4294 0.4662 0.0002  0.0128  0.0165  290 LEU C N   
5118 C CA  . LEU C 288 ? 0.4357 0.4090 0.4516 -0.0004 0.0108  0.0160  290 LEU C CA  
5119 C C   . LEU C 288 ? 0.4423 0.4224 0.4640 -0.0031 0.0151  0.0164  290 LEU C C   
5120 O O   . LEU C 288 ? 0.4546 0.4363 0.4786 -0.0056 0.0173  0.0179  290 LEU C O   
5121 C CB  . LEU C 288 ? 0.4316 0.3997 0.4499 -0.0032 0.0078  0.0182  290 LEU C CB  
5122 C CG  . LEU C 288 ? 0.4087 0.3693 0.4222 -0.0022 0.0032  0.0188  290 LEU C CG  
5123 C CD1 . LEU C 288 ? 0.3490 0.3088 0.3669 -0.0060 0.0006  0.0214  290 LEU C CD1 
5124 C CD2 . LEU C 288 ? 0.4041 0.3581 0.4103 0.0017  -0.0021 0.0165  290 LEU C CD2 
5125 N N   . ASP C 289 ? 0.4517 0.4345 0.4754 -0.0027 0.0152  0.0150  291 ASP C N   
5126 C CA  . ASP C 289 ? 0.4440 0.4326 0.4733 -0.0052 0.0185  0.0151  291 ASP C CA  
5127 C C   . ASP C 289 ? 0.4332 0.4216 0.4656 -0.0067 0.0168  0.0152  291 ASP C C   
5128 O O   . ASP C 289 ? 0.4404 0.4271 0.4706 -0.0057 0.0140  0.0148  291 ASP C O   
5129 C CB  . ASP C 289 ? 0.4560 0.4516 0.4845 -0.0035 0.0208  0.0135  291 ASP C CB  
5130 C CG  . ASP C 289 ? 0.4969 0.4980 0.5308 -0.0063 0.0234  0.0135  291 ASP C CG  
5131 O OD1 . ASP C 289 ? 0.5329 0.5327 0.5703 -0.0079 0.0228  0.0133  291 ASP C OD1 
5132 O OD2 . ASP C 289 ? 0.5721 0.5803 0.6066 -0.0072 0.0259  0.0136  291 ASP C OD2 
5133 N N   . LEU C 290 ? 0.4376 0.4285 0.4747 -0.0091 0.0178  0.0158  292 LEU C N   
5134 C CA  . LEU C 290 ? 0.4284 0.4234 0.4684 -0.0111 0.0167  0.0165  292 LEU C CA  
5135 C C   . LEU C 290 ? 0.4246 0.4262 0.4688 -0.0116 0.0196  0.0146  292 LEU C C   
5136 O O   . LEU C 290 ? 0.4559 0.4587 0.5030 -0.0112 0.0208  0.0131  292 LEU C O   
5137 C CB  . LEU C 290 ? 0.4238 0.4206 0.4662 -0.0123 0.0154  0.0177  292 LEU C CB  
5138 C CG  . LEU C 290 ? 0.3984 0.3887 0.4376 -0.0121 0.0124  0.0195  292 LEU C CG  
5139 C CD1 . LEU C 290 ? 0.3343 0.3310 0.3771 -0.0143 0.0108  0.0211  292 LEU C CD1 
5140 C CD2 . LEU C 290 ? 0.3982 0.3818 0.4318 -0.0120 0.0086  0.0206  292 LEU C CD2 
5141 N N   . PRO C 291 ? 0.4096 0.4145 0.4538 -0.0123 0.0195  0.0145  293 PRO C N   
5142 C CA  . PRO C 291 ? 0.3953 0.4060 0.4429 -0.0125 0.0220  0.0123  293 PRO C CA  
5143 C C   . PRO C 291 ? 0.3848 0.4028 0.4361 -0.0129 0.0223  0.0110  293 PRO C C   
5144 O O   . PRO C 291 ? 0.3980 0.4193 0.4497 -0.0139 0.0210  0.0127  293 PRO C O   
5145 C CB  . PRO C 291 ? 0.4106 0.4226 0.4565 -0.0128 0.0210  0.0128  293 PRO C CB  
5146 C CG  . PRO C 291 ? 0.4085 0.4126 0.4492 -0.0111 0.0178  0.0140  293 PRO C CG  
5147 C CD  . PRO C 291 ? 0.4098 0.4119 0.4504 -0.0128 0.0161  0.0161  293 PRO C CD  
5148 N N   . LEU C 292 ? 0.3707 0.3921 0.4247 -0.0119 0.0237  0.0078  294 LEU C N   
5149 C CA  . LEU C 292 ? 0.3634 0.3935 0.4204 -0.0103 0.0235  0.0049  294 LEU C CA  
5150 C C   . LEU C 292 ? 0.3604 0.3957 0.4186 -0.0095 0.0243  0.0016  294 LEU C C   
5151 O O   . LEU C 292 ? 0.3550 0.3861 0.4124 -0.0107 0.0249  0.0018  294 LEU C O   
5152 C CB  . LEU C 292 ? 0.3659 0.3921 0.4243 -0.0071 0.0221  0.0021  294 LEU C CB  
5153 C CG  . LEU C 292 ? 0.4009 0.4180 0.4577 -0.0073 0.0209  0.0046  294 LEU C CG  
5154 C CD1 . LEU C 292 ? 0.4413 0.4496 0.4981 -0.0054 0.0187  0.0022  294 LEU C CD1 
5155 C CD2 . LEU C 292 ? 0.3792 0.4020 0.4372 -0.0066 0.0199  0.0055  294 LEU C CD2 
5156 N N   . VAL C 293 ? 0.3453 0.3919 0.4055 -0.0073 0.0243  -0.0016 295 VAL C N   
5157 C CA  . VAL C 293 ? 0.3204 0.3730 0.3813 -0.0056 0.0244  -0.0058 295 VAL C CA  
5158 C C   . VAL C 293 ? 0.3374 0.3899 0.3998 0.0001  0.0222  -0.0120 295 VAL C C   
5159 O O   . VAL C 293 ? 0.3383 0.3965 0.4020 0.0024  0.0216  -0.0127 295 VAL C O   
5160 C CB  . VAL C 293 ? 0.3213 0.3898 0.3819 -0.0075 0.0257  -0.0043 295 VAL C CB  
5161 C CG1 . VAL C 293 ? 0.2757 0.3548 0.3369 -0.0039 0.0258  -0.0102 295 VAL C CG1 
5162 C CG2 . VAL C 293 ? 0.2895 0.3542 0.3475 -0.0130 0.0259  0.0019  295 VAL C CG2 
5163 N N   . ILE C 294 ? 0.3527 0.3980 0.4148 0.0025  0.0197  -0.0166 296 ILE C N   
5164 C CA  . ILE C 294 ? 0.3756 0.4188 0.4384 0.0093  0.0154  -0.0235 296 ILE C CA  
5165 C C   . ILE C 294 ? 0.3755 0.4225 0.4378 0.0137  0.0129  -0.0306 296 ILE C C   
5166 O O   . ILE C 294 ? 0.3765 0.4130 0.4376 0.0118  0.0106  -0.0311 296 ILE C O   
5167 C CB  . ILE C 294 ? 0.3877 0.4125 0.4496 0.0090  0.0114  -0.0224 296 ILE C CB  
5168 C CG1 . ILE C 294 ? 0.3768 0.4032 0.4394 0.0082  0.0130  -0.0184 296 ILE C CG1 
5169 C CG2 . ILE C 294 ? 0.4250 0.4434 0.4865 0.0163  0.0045  -0.0301 296 ILE C CG2 
5170 C CD1 . ILE C 294 ? 0.4004 0.4141 0.4612 0.0031  0.0133  -0.0123 296 ILE C CD1 
5171 N N   . GLY C 295 ? 0.3871 0.4513 0.4502 0.0196  0.0133  -0.0360 297 GLY C N   
5172 C CA  . GLY C 295 ? 0.4209 0.4913 0.4827 0.0254  0.0106  -0.0441 297 GLY C CA  
5173 C C   . GLY C 295 ? 0.4539 0.5182 0.5150 0.0356  0.0033  -0.0541 297 GLY C C   
5174 O O   . GLY C 295 ? 0.4670 0.5269 0.5292 0.0389  0.0008  -0.0550 297 GLY C O   
5175 N N   . SER C 296 ? 0.4790 0.5424 0.5377 0.0410  -0.0011 -0.0622 298 SER C N   
5176 C CA  . SER C 296 ? 0.5204 0.5766 0.5773 0.0523  -0.0102 -0.0734 298 SER C CA  
5177 C C   . SER C 296 ? 0.5479 0.6310 0.6049 0.0637  -0.0096 -0.0835 298 SER C C   
5178 O O   . SER C 296 ? 0.5142 0.6222 0.5723 0.0610  -0.0020 -0.0809 298 SER C O   
5179 C CB  . SER C 296 ? 0.5416 0.5757 0.5949 0.0517  -0.0182 -0.0766 298 SER C CB  
5180 O OG  . SER C 296 ? 0.5198 0.5581 0.5729 0.0440  -0.0132 -0.0717 298 SER C OG  
5181 N N   . ARG C 297 ? 0.5995 0.6777 0.6551 0.0762  -0.0183 -0.0948 299 ARG C N   
5182 C CA  . ARG C 297 ? 0.6396 0.7439 0.6951 0.0901  -0.0195 -0.1069 299 ARG C CA  
5183 C C   . ARG C 297 ? 0.6557 0.7618 0.7067 0.0955  -0.0232 -0.1156 299 ARG C C   
5184 O O   . ARG C 297 ? 0.6661 0.7977 0.7172 0.0938  -0.0161 -0.1148 299 ARG C O   
5185 C CB  . ARG C 297 ? 0.6770 0.7738 0.7323 0.1032  -0.0289 -0.1169 299 ARG C CB  
5186 C CG  . ARG C 297 ? 0.7170 0.8024 0.7755 0.0975  -0.0279 -0.1083 299 ARG C CG  
5187 C CD  . ARG C 297 ? 0.8020 0.8985 0.8627 0.1108  -0.0326 -0.1172 299 ARG C CD  
5188 N NE  . ARG C 297 ? 0.8332 0.9626 0.8996 0.1082  -0.0224 -0.1121 299 ARG C NE  
5189 C CZ  . ARG C 297 ? 0.8074 0.9340 0.8773 0.0994  -0.0181 -0.1015 299 ARG C CZ  
5190 N NH1 . ARG C 297 ? 0.7995 0.8937 0.8677 0.0926  -0.0219 -0.0948 299 ARG C NH1 
5191 N NH2 . ARG C 297 ? 0.7850 0.9423 0.8598 0.0968  -0.0102 -0.0970 299 ARG C NH2 
5192 N N   . MET D 1   ? 0.6162 0.5389 0.6282 -0.1111 -0.1311 0.0426  1   MET D N   
5193 C CA  . MET D 1   ? 0.5903 0.5236 0.6168 -0.1030 -0.1142 0.0530  1   MET D CA  
5194 C C   . MET D 1   ? 0.5336 0.4869 0.5626 -0.0836 -0.1133 0.0560  1   MET D C   
5195 O O   . MET D 1   ? 0.5209 0.4914 0.5567 -0.0785 -0.1256 0.0531  1   MET D O   
5196 C CB  . MET D 1   ? 0.6169 0.5771 0.6763 -0.1160 -0.1106 0.0587  1   MET D CB  
5197 C CG  . MET D 1   ? 0.7168 0.6527 0.7768 -0.1377 -0.1085 0.0566  1   MET D CG  
5198 S SD  . MET D 1   ? 0.8107 0.6988 0.8489 -0.1360 -0.0900 0.0631  1   MET D SD  
5199 C CE  . MET D 1   ? 0.7522 0.6671 0.8022 -0.1225 -0.0743 0.0810  1   MET D CE  
5200 N N   . VAL D 2   ? 0.5051 0.4547 0.5281 -0.0730 -0.1001 0.0619  2   VAL D N   
5201 C CA  . VAL D 2   ? 0.4634 0.4322 0.4895 -0.0564 -0.0979 0.0627  2   VAL D CA  
5202 C C   . VAL D 2   ? 0.4643 0.4642 0.5106 -0.0546 -0.0874 0.0686  2   VAL D C   
5203 O O   . VAL D 2   ? 0.4736 0.4707 0.5192 -0.0609 -0.0763 0.0768  2   VAL D O   
5204 C CB  . VAL D 2   ? 0.4445 0.3927 0.4488 -0.0459 -0.0927 0.0628  2   VAL D CB  
5205 C CG1 . VAL D 2   ? 0.4149 0.3792 0.4207 -0.0313 -0.0928 0.0601  2   VAL D CG1 
5206 C CG2 . VAL D 2   ? 0.4374 0.3572 0.4227 -0.0485 -0.0985 0.0571  2   VAL D CG2 
5207 N N   . LYS D 3   ? 0.4543 0.4825 0.5177 -0.0453 -0.0897 0.0648  3   LYS D N   
5208 C CA  . LYS D 3   ? 0.4576 0.5172 0.5380 -0.0423 -0.0764 0.0681  3   LYS D CA  
5209 C C   . LYS D 3   ? 0.4422 0.4995 0.5029 -0.0282 -0.0680 0.0666  3   LYS D C   
5210 O O   . LYS D 3   ? 0.4298 0.4773 0.4809 -0.0169 -0.0751 0.0588  3   LYS D O   
5211 C CB  . LYS D 3   ? 0.4683 0.5619 0.5810 -0.0371 -0.0811 0.0628  3   LYS D CB  
5212 C CG  . LYS D 3   ? 0.5150 0.6457 0.6535 -0.0404 -0.0651 0.0668  3   LYS D CG  
5213 C CD  . LYS D 3   ? 0.5348 0.6973 0.6954 -0.0231 -0.0608 0.0585  3   LYS D CD  
5214 C CE  . LYS D 3   ? 0.6050 0.8117 0.8018 -0.0293 -0.0454 0.0619  3   LYS D CE  
5215 N NZ  . LYS D 3   ? 0.6354 0.8495 0.8142 -0.0285 -0.0219 0.0660  3   LYS D NZ  
5216 N N   . GLN D 4   ? 0.4521 0.5185 0.5060 -0.0302 -0.0535 0.0745  4   GLN D N   
5217 C CA  . GLN D 4   ? 0.4645 0.5305 0.4950 -0.0194 -0.0468 0.0738  4   GLN D CA  
5218 C C   . GLN D 4   ? 0.4894 0.5853 0.5278 -0.0084 -0.0384 0.0641  4   GLN D C   
5219 O O   . GLN D 4   ? 0.5316 0.6540 0.5831 -0.0119 -0.0249 0.0678  4   GLN D O   
5220 C CB  . GLN D 4   ? 0.4809 0.5382 0.4941 -0.0265 -0.0371 0.0894  4   GLN D CB  
5221 C CG  . GLN D 4   ? 0.5563 0.6125 0.5397 -0.0163 -0.0339 0.0915  4   GLN D CG  
5222 C CD  . GLN D 4   ? 0.5810 0.6122 0.5484 -0.0094 -0.0466 0.0886  4   GLN D CD  
5223 O OE1 . GLN D 4   ? 0.6054 0.6134 0.5705 -0.0136 -0.0501 0.0975  4   GLN D OE1 
5224 N NE2 . GLN D 4   ? 0.5581 0.5949 0.5170 0.0009  -0.0522 0.0754  4   GLN D NE2 
5225 N N   . ILE D 5   ? 0.4835 0.5747 0.5153 0.0046  -0.0446 0.0508  5   ILE D N   
5226 C CA  . ILE D 5   ? 0.5210 0.6367 0.5600 0.0157  -0.0348 0.0393  5   ILE D CA  
5227 C C   . ILE D 5   ? 0.5757 0.6997 0.5856 0.0176  -0.0219 0.0401  5   ILE D C   
5228 O O   . ILE D 5   ? 0.5858 0.6921 0.5677 0.0186  -0.0280 0.0411  5   ILE D O   
5229 C CB  . ILE D 5   ? 0.4987 0.6041 0.5422 0.0285  -0.0443 0.0241  5   ILE D CB  
5230 C CG1 . ILE D 5   ? 0.4830 0.5885 0.5568 0.0284  -0.0557 0.0253  5   ILE D CG1 
5231 C CG2 . ILE D 5   ? 0.5214 0.6448 0.5628 0.0411  -0.0318 0.0092  5   ILE D CG2 
5232 C CD1 . ILE D 5   ? 0.4863 0.6233 0.5920 0.0233  -0.0493 0.0309  5   ILE D CD1 
5233 N N   . GLU D 6   ? 0.6278 0.7809 0.6434 0.0179  -0.0040 0.0405  6   GLU D N   
5234 C CA  . GLU D 6   ? 0.6774 0.8368 0.6574 0.0188  0.0075  0.0429  6   GLU D CA  
5235 C C   . GLU D 6   ? 0.7045 0.8750 0.6722 0.0327  0.0143  0.0211  6   GLU D C   
5236 O O   . GLU D 6   ? 0.7376 0.9114 0.6687 0.0343  0.0206  0.0191  6   GLU D O   
5237 C CB  . GLU D 6   ? 0.7341 0.9129 0.7142 0.0069  0.0256  0.0614  6   GLU D CB  
5238 C CG  . GLU D 6   ? 0.7649 0.9206 0.7343 -0.0067 0.0198  0.0845  6   GLU D CG  
5239 C CD  . GLU D 6   ? 0.8226 0.9519 0.7556 -0.0021 0.0063  0.0884  6   GLU D CD  
5240 O OE1 . GLU D 6   ? 0.8639 0.9996 0.7669 0.0065  0.0071  0.0804  6   GLU D OE1 
5241 O OE2 . GLU D 6   ? 0.8129 0.9163 0.7485 -0.0070 -0.0054 0.0986  6   GLU D OE2 
5242 N N   . SER D 7   ? 0.6969 0.8704 0.6933 0.0433  0.0115  0.0046  7   SER D N   
5243 C CA  . SER D 7   ? 0.7382 0.9192 0.7277 0.0579  0.0203  -0.0191 7   SER D CA  
5244 C C   . SER D 7   ? 0.7222 0.8951 0.7450 0.0711  0.0126  -0.0347 7   SER D C   
5245 O O   . SER D 7   ? 0.6792 0.8473 0.7329 0.0693  0.0009  -0.0262 7   SER D O   
5246 C CB  . SER D 7   ? 0.7984 1.0156 0.7896 0.0600  0.0468  -0.0211 7   SER D CB  
5247 O OG  . SER D 7   ? 0.7936 1.0345 0.8335 0.0584  0.0529  -0.0137 7   SER D OG  
5248 N N   . LYS D 8   ? 0.7638 0.9347 0.7779 0.0847  0.0196  -0.0581 8   LYS D N   
5249 C CA  . LYS D 8   ? 0.7688 0.9297 0.8140 0.1003  0.0152  -0.0738 8   LYS D CA  
5250 C C   . LYS D 8   ? 0.7719 0.9636 0.8677 0.1071  0.0232  -0.0677 8   LYS D C   
5251 O O   . LYS D 8   ? 0.7504 0.9340 0.8802 0.1140  0.0096  -0.0650 8   LYS D O   
5252 C CB  . LYS D 8   ? 0.8297 0.9842 0.8547 0.1131  0.0263  -0.1018 8   LYS D CB  
5253 C CG  . LYS D 8   ? 0.8411 0.9609 0.8805 0.1250  0.0132  -0.1178 8   LYS D CG  
5254 C CD  . LYS D 8   ? 0.8460 0.9357 0.8442 0.1223  0.0071  -0.1378 8   LYS D CD  
5255 C CE  . LYS D 8   ? 0.9281 1.0193 0.9156 0.1363  0.0246  -0.1688 8   LYS D CE  
5256 N NZ  . LYS D 8   ? 0.9676 1.0527 1.0013 0.1563  0.0293  -0.1782 8   LYS D NZ  
5257 N N   . THR D 9   ? 0.8007 1.0303 0.9025 0.1045  0.0450  -0.0644 9   THR D N   
5258 C CA  . THR D 9   ? 0.8003 1.0662 0.9551 0.1068  0.0518  -0.0560 9   THR D CA  
5259 C C   . THR D 9   ? 0.7418 1.0013 0.9159 0.0923  0.0304  -0.0339 9   THR D C   
5260 O O   . THR D 9   ? 0.7273 0.9870 0.9384 0.0995  0.0157  -0.0323 9   THR D O   
5261 C CB  . THR D 9   ? 0.8456 1.1540 1.0009 0.1021  0.0815  -0.0540 9   THR D CB  
5262 O OG1 . THR D 9   ? 0.9115 1.2234 1.0470 0.1177  0.1008  -0.0784 9   THR D OG1 
5263 C CG2 . THR D 9   ? 0.8554 1.2084 1.0724 0.1027  0.0900  -0.0461 9   THR D CG2 
5264 N N   . ALA D 10  ? 0.7217 0.9723 0.8678 0.0726  0.0276  -0.0174 10  ALA D N   
5265 C CA  . ALA D 10  ? 0.6707 0.9143 0.8316 0.0570  0.0105  0.0011  10  ALA D CA  
5266 C C   . ALA D 10  ? 0.6309 0.8452 0.7987 0.0645  -0.0138 -0.0023 10  ALA D C   
5267 O O   . ALA D 10  ? 0.6131 0.8325 0.8094 0.0605  -0.0279 0.0060  10  ALA D O   
5268 C CB  . ALA D 10  ? 0.6510 0.8754 0.7736 0.0386  0.0097  0.0164  10  ALA D CB  
5269 N N   . PHE D 11  ? 0.6257 0.8106 0.7664 0.0744  -0.0180 -0.0147 11  PHE D N   
5270 C CA  . PHE D 11  ? 0.6037 0.7562 0.7450 0.0807  -0.0379 -0.0172 11  PHE D CA  
5271 C C   . PHE D 11  ? 0.6266 0.7902 0.8099 0.0959  -0.0443 -0.0206 11  PHE D C   
5272 O O   . PHE D 11  ? 0.6133 0.7647 0.8083 0.0938  -0.0635 -0.0106 11  PHE D O   
5273 C CB  . PHE D 11  ? 0.6167 0.7413 0.7287 0.0884  -0.0373 -0.0326 11  PHE D CB  
5274 C CG  . PHE D 11  ? 0.6180 0.7040 0.7186 0.0862  -0.0563 -0.0298 11  PHE D CG  
5275 C CD1 . PHE D 11  ? 0.6000 0.6744 0.6928 0.0715  -0.0688 -0.0130 11  PHE D CD1 
5276 C CD2 . PHE D 11  ? 0.6327 0.6918 0.7289 0.0972  -0.0603 -0.0442 11  PHE D CD2 
5277 C CE1 . PHE D 11  ? 0.5860 0.6258 0.6661 0.0683  -0.0835 -0.0098 11  PHE D CE1 
5278 C CE2 . PHE D 11  ? 0.6291 0.6522 0.7149 0.0925  -0.0760 -0.0393 11  PHE D CE2 
5279 C CZ  . PHE D 11  ? 0.5998 0.6152 0.6770 0.0782  -0.0868 -0.0217 11  PHE D CZ  
5280 N N   . GLN D 12  ? 0.6706 0.8562 0.8748 0.1124  -0.0285 -0.0348 12  GLN D N   
5281 C CA  . GLN D 12  ? 0.6945 0.8930 0.9444 0.1317  -0.0331 -0.0389 12  GLN D CA  
5282 C C   . GLN D 12  ? 0.6812 0.9150 0.9721 0.1249  -0.0421 -0.0228 12  GLN D C   
5283 O O   . GLN D 12  ? 0.6777 0.9068 0.9925 0.1311  -0.0628 -0.0149 12  GLN D O   
5284 C CB  . GLN D 12  ? 0.7555 0.9754 1.0216 0.1508  -0.0094 -0.0591 12  GLN D CB  
5285 C CG  . GLN D 12  ? 0.8039 1.0152 1.1067 0.1765  -0.0161 -0.0681 12  GLN D CG  
5286 C CD  . GLN D 12  ? 0.8022 0.9588 1.0835 0.1774  -0.0394 -0.0643 12  GLN D CD  
5287 O OE1 . GLN D 12  ? 0.8432 0.9656 1.1110 0.1893  -0.0370 -0.0802 12  GLN D OE1 
5288 N NE2 . GLN D 12  ? 0.7647 0.9116 1.0400 0.1627  -0.0607 -0.0439 12  GLN D NE2 
5289 N N   . GLU D 13  ? 0.6740 0.9423 0.9712 0.1106  -0.0275 -0.0171 13  GLU D N   
5290 C CA  . GLU D 13  ? 0.6697 0.9736 1.0068 0.1000  -0.0349 -0.0037 13  GLU D CA  
5291 C C   . GLU D 13  ? 0.6322 0.9079 0.9541 0.0861  -0.0625 0.0096  13  GLU D C   
5292 O O   . GLU D 13  ? 0.6495 0.9377 1.0034 0.0889  -0.0822 0.0164  13  GLU D O   
5293 C CB  . GLU D 13  ? 0.6780 1.0156 1.0177 0.0829  -0.0124 0.0011  13  GLU D CB  
5294 C CG  . GLU D 13  ? 0.7444 1.1197 1.1091 0.0989  0.0157  -0.0123 13  GLU D CG  
5295 C CD  . GLU D 13  ? 0.8183 1.2332 1.2514 0.1180  0.0113  -0.0161 13  GLU D CD  
5296 O OE1 . GLU D 13  ? 0.7758 1.2214 1.2493 0.1063  -0.0013 -0.0033 13  GLU D OE1 
5297 O OE2 . GLU D 13  ? 0.8600 1.2756 1.3082 0.1446  0.0196  -0.0321 13  GLU D OE2 
5298 N N   . ALA D 14  ? 0.5917 0.8298 0.8644 0.0726  -0.0647 0.0128  14  ALA D N   
5299 C CA  . ALA D 14  ? 0.5605 0.7682 0.8138 0.0610  -0.0878 0.0228  14  ALA D CA  
5300 C C   . ALA D 14  ? 0.5779 0.7690 0.8418 0.0769  -0.1081 0.0228  14  ALA D C   
5301 O O   . ALA D 14  ? 0.5936 0.7930 0.8749 0.0727  -0.1278 0.0320  14  ALA D O   
5302 C CB  . ALA D 14  ? 0.5175 0.6862 0.7196 0.0498  -0.0851 0.0239  14  ALA D CB  
5303 N N   . LEU D 15  ? 0.5944 0.7619 0.8476 0.0943  -0.1040 0.0130  15  LEU D N   
5304 C CA  . LEU D 15  ? 0.6291 0.7689 0.8846 0.1088  -0.1219 0.0152  15  LEU D CA  
5305 C C   . LEU D 15  ? 0.6864 0.8545 0.9901 0.1228  -0.1369 0.0220  15  LEU D C   
5306 O O   . LEU D 15  ? 0.7015 0.8499 1.0026 0.1267  -0.1591 0.0327  15  LEU D O   
5307 C CB  . LEU D 15  ? 0.6492 0.7630 0.8936 0.1253  -0.1106 0.0003  15  LEU D CB  
5308 C CG  . LEU D 15  ? 0.6479 0.7113 0.8483 0.1191  -0.1145 -0.0016 15  LEU D CG  
5309 C CD1 . LEU D 15  ? 0.6116 0.6680 0.7763 0.0952  -0.1137 0.0051  15  LEU D CD1 
5310 C CD2 . LEU D 15  ? 0.6334 0.6775 0.8251 0.1316  -0.1007 -0.0211 15  LEU D CD2 
5311 N N   . ASP D 16  ? 0.7217 0.9380 1.0698 0.1304  -0.1242 0.0167  16  ASP D N   
5312 C CA  . ASP D 16  ? 0.7754 1.0268 1.1794 0.1479  -0.1353 0.0208  16  ASP D CA  
5313 C C   . ASP D 16  ? 0.7719 1.0633 1.2007 0.1296  -0.1490 0.0327  16  ASP D C   
5314 O O   . ASP D 16  ? 0.8010 1.1100 1.2607 0.1361  -0.1728 0.0427  16  ASP D O   
5315 C CB  . ASP D 16  ? 0.8207 1.1064 1.2642 0.1679  -0.1097 0.0054  16  ASP D CB  
5316 C CG  . ASP D 16  ? 0.8445 1.0908 1.2591 0.1829  -0.0927 -0.0119 16  ASP D CG  
5317 O OD1 . ASP D 16  ? 0.8542 1.0482 1.2338 0.1841  -0.1053 -0.0101 16  ASP D OD1 
5318 O OD2 . ASP D 16  ? 0.8474 1.1161 1.2746 0.1924  -0.0661 -0.0281 16  ASP D OD2 
5319 N N   . ALA D 17  ? 0.7452 1.0514 1.1622 0.1065  -0.1345 0.0317  17  ALA D N   
5320 C CA  . ALA D 17  ? 0.7495 1.0872 1.1865 0.0842  -0.1467 0.0411  17  ALA D CA  
5321 C C   . ALA D 17  ? 0.7380 1.0387 1.1373 0.0714  -0.1746 0.0507  17  ALA D C   
5322 O O   . ALA D 17  ? 0.7545 1.0759 1.1701 0.0576  -0.1946 0.0579  17  ALA D O   
5323 C CB  . ALA D 17  ? 0.7269 1.0788 1.1550 0.0615  -0.1234 0.0393  17  ALA D CB  
5324 N N   . ALA D 18  ? 0.7160 0.9631 1.0643 0.0748  -0.1751 0.0498  18  ALA D N   
5325 C CA  . ALA D 18  ? 0.7194 0.9301 1.0315 0.0679  -0.1992 0.0588  18  ALA D CA  
5326 C C   . ALA D 18  ? 0.7763 1.0059 1.1234 0.0853  -0.2237 0.0673  18  ALA D C   
5327 O O   . ALA D 18  ? 0.8127 1.0779 1.2105 0.1044  -0.2190 0.0645  18  ALA D O   
5328 C CB  . ALA D 18  ? 0.6865 0.8433 0.9500 0.0727  -0.1919 0.0562  18  ALA D CB  
5329 N N   . GLY D 19  ? 0.7993 1.0080 1.1220 0.0808  -0.2499 0.0783  19  GLY D N   
5330 C CA  . GLY D 19  ? 0.8739 1.1081 1.2357 0.0988  -0.2748 0.0886  19  GLY D CA  
5331 C C   . GLY D 19  ? 0.9043 1.0907 1.2355 0.1154  -0.2855 0.0979  19  GLY D C   
5332 O O   . GLY D 19  ? 0.8968 1.0523 1.2175 0.1288  -0.2672 0.0918  19  GLY D O   
5333 N N   . ASP D 20  ? 0.9433 1.1221 1.2574 0.1127  -0.3156 0.1130  20  ASP D N   
5334 C CA  . ASP D 20  ? 0.9585 1.0798 1.2200 0.1161  -0.3224 0.1236  20  ASP D CA  
5335 C C   . ASP D 20  ? 0.8911 0.9738 1.0915 0.0910  -0.3065 0.1165  20  ASP D C   
5336 O O   . ASP D 20  ? 0.8969 0.9320 1.0500 0.0888  -0.3066 0.1235  20  ASP D O   
5337 C CB  . ASP D 20  ? 1.0351 1.1585 1.2908 0.1218  -0.3591 0.1441  20  ASP D CB  
5338 C CG  . ASP D 20  ? 1.1360 1.2566 1.4293 0.1564  -0.3700 0.1568  20  ASP D CG  
5339 O OD1 . ASP D 20  ? 1.1848 1.3339 1.5077 0.1697  -0.4009 0.1727  20  ASP D OD1 
5340 O OD2 . ASP D 20  ? 1.1220 1.2088 1.4136 0.1700  -0.3477 0.1505  20  ASP D OD2 
5341 N N   . LYS D 21  ? 0.8247 0.9274 1.0284 0.0727  -0.2912 0.1035  21  LYS D N   
5342 C CA  . LYS D 21  ? 0.7846 0.8563 0.9355 0.0493  -0.2822 0.0989  21  LYS D CA  
5343 C C   . LYS D 21  ? 0.7397 0.7691 0.8594 0.0517  -0.2591 0.0937  21  LYS D C   
5344 O O   . LYS D 21  ? 0.7206 0.7493 0.8616 0.0671  -0.2441 0.0877  21  LYS D O   
5345 C CB  . LYS D 21  ? 0.7530 0.8537 0.9175 0.0293  -0.2735 0.0884  21  LYS D CB  
5346 C CG  . LYS D 21  ? 0.8030 0.9591 1.0225 0.0297  -0.2864 0.0888  21  LYS D CG  
5347 C CD  . LYS D 21  ? 0.8409 1.0104 1.0522 0.0017  -0.2953 0.0845  21  LYS D CD  
5348 C CE  . LYS D 21  ? 0.8419 1.0190 1.0622 -0.0137 -0.2689 0.0738  21  LYS D CE  
5349 N NZ  . LYS D 21  ? 0.8502 1.0784 1.1330 -0.0070 -0.2566 0.0711  21  LYS D NZ  
5350 N N   . LEU D 22  ? 0.7168 0.7121 0.7870 0.0363  -0.2559 0.0945  22  LEU D N   
5351 C CA  . LEU D 22  ? 0.6716 0.6335 0.7180 0.0365  -0.2354 0.0895  22  LEU D CA  
5352 C C   . LEU D 22  ? 0.6232 0.5992 0.6788 0.0281  -0.2142 0.0760  22  LEU D C   
5353 O O   . LEU D 22  ? 0.6154 0.6051 0.6684 0.0130  -0.2140 0.0727  22  LEU D O   
5354 C CB  . LEU D 22  ? 0.6852 0.6096 0.6801 0.0243  -0.2376 0.0959  22  LEU D CB  
5355 C CG  . LEU D 22  ? 0.6358 0.5299 0.6060 0.0192  -0.2165 0.0904  22  LEU D CG  
5356 C CD1 . LEU D 22  ? 0.5883 0.4538 0.5553 0.0306  -0.2132 0.0963  22  LEU D CD1 
5357 C CD2 . LEU D 22  ? 0.6669 0.5428 0.5946 0.0021  -0.2164 0.0920  22  LEU D CD2 
5358 N N   . VAL D 23  ? 0.5880 0.5593 0.6535 0.0379  -0.1976 0.0687  23  VAL D N   
5359 C CA  . VAL D 23  ? 0.5449 0.5261 0.6130 0.0321  -0.1782 0.0584  23  VAL D CA  
5360 C C   . VAL D 23  ? 0.5131 0.4618 0.5494 0.0269  -0.1671 0.0555  23  VAL D C   
5361 O O   . VAL D 23  ? 0.5231 0.4506 0.5542 0.0352  -0.1661 0.0552  23  VAL D O   
5362 C CB  . VAL D 23  ? 0.5449 0.5468 0.6439 0.0474  -0.1667 0.0497  23  VAL D CB  
5363 C CG1 . VAL D 23  ? 0.5215 0.5410 0.6216 0.0393  -0.1492 0.0427  23  VAL D CG1 
5364 C CG2 . VAL D 23  ? 0.5663 0.5976 0.7042 0.0602  -0.1764 0.0522  23  VAL D CG2 
5365 N N   . VAL D 24  ? 0.4670 0.4124 0.4864 0.0137  -0.1585 0.0533  24  VAL D N   
5366 C CA  . VAL D 24  ? 0.4560 0.3800 0.4558 0.0114  -0.1474 0.0499  24  VAL D CA  
5367 C C   . VAL D 24  ? 0.4294 0.3703 0.4383 0.0118  -0.1335 0.0429  24  VAL D C   
5368 O O   . VAL D 24  ? 0.4366 0.3983 0.4569 0.0078  -0.1307 0.0434  24  VAL D O   
5369 C CB  . VAL D 24  ? 0.4560 0.3560 0.4255 -0.0007 -0.1486 0.0544  24  VAL D CB  
5370 C CG1 . VAL D 24  ? 0.4827 0.3913 0.4481 -0.0115 -0.1523 0.0550  24  VAL D CG1 
5371 C CG2 . VAL D 24  ? 0.4276 0.3149 0.3852 -0.0041 -0.1353 0.0505  24  VAL D CG2 
5372 N N   . VAL D 25  ? 0.4180 0.3511 0.4223 0.0162  -0.1259 0.0369  25  VAL D N   
5373 C CA  . VAL D 25  ? 0.3988 0.3477 0.4061 0.0180  -0.1152 0.0309  25  VAL D CA  
5374 C C   . VAL D 25  ? 0.3825 0.3173 0.3738 0.0130  -0.1111 0.0300  25  VAL D C   
5375 O O   . VAL D 25  ? 0.3979 0.3167 0.3848 0.0139  -0.1128 0.0267  25  VAL D O   
5376 C CB  . VAL D 25  ? 0.4173 0.3725 0.4349 0.0298  -0.1125 0.0205  25  VAL D CB  
5377 C CG1 . VAL D 25  ? 0.4111 0.3865 0.4264 0.0311  -0.1020 0.0148  25  VAL D CG1 
5378 C CG2 . VAL D 25  ? 0.4659 0.4309 0.5051 0.0396  -0.1176 0.0202  25  VAL D CG2 
5379 N N   . ASP D 26  ? 0.3743 0.3156 0.3601 0.0079  -0.1053 0.0335  26  ASP D N   
5380 C CA  . ASP D 26  ? 0.3586 0.2918 0.3351 0.0054  -0.1021 0.0334  26  ASP D CA  
5381 C C   . ASP D 26  ? 0.3511 0.3012 0.3279 0.0106  -0.0990 0.0285  26  ASP D C   
5382 O O   . ASP D 26  ? 0.3533 0.3177 0.3287 0.0108  -0.0943 0.0331  26  ASP D O   
5383 C CB  . ASP D 26  ? 0.3579 0.2843 0.3282 -0.0012 -0.0984 0.0410  26  ASP D CB  
5384 C CG  . ASP D 26  ? 0.3794 0.3077 0.3475 -0.0002 -0.0937 0.0433  26  ASP D CG  
5385 O OD1 . ASP D 26  ? 0.4454 0.3774 0.4152 0.0027  -0.0952 0.0388  26  ASP D OD1 
5386 O OD2 . ASP D 26  ? 0.4369 0.3623 0.4032 -0.0025 -0.0894 0.0500  26  ASP D OD2 
5387 N N   . PHE D 27  ? 0.3459 0.2935 0.3228 0.0136  -0.1016 0.0190  27  PHE D N   
5388 C CA  . PHE D 27  ? 0.3605 0.3234 0.3319 0.0170  -0.1008 0.0121  27  PHE D CA  
5389 C C   . PHE D 27  ? 0.3577 0.3231 0.3254 0.0135  -0.1019 0.0184  27  PHE D C   
5390 O O   . PHE D 27  ? 0.3490 0.3040 0.3219 0.0095  -0.1041 0.0182  27  PHE D O   
5391 C CB  . PHE D 27  ? 0.3788 0.3366 0.3516 0.0198  -0.1043 -0.0032 27  PHE D CB  
5392 C CG  . PHE D 27  ? 0.4100 0.3661 0.3897 0.0273  -0.1023 -0.0104 27  PHE D CG  
5393 C CD1 . PHE D 27  ? 0.4297 0.4040 0.4058 0.0342  -0.0963 -0.0188 27  PHE D CD1 
5394 C CD2 . PHE D 27  ? 0.4323 0.3697 0.4223 0.0286  -0.1057 -0.0082 27  PHE D CD2 
5395 C CE1 . PHE D 27  ? 0.4176 0.3931 0.4052 0.0433  -0.0927 -0.0268 27  PHE D CE1 
5396 C CE2 . PHE D 27  ? 0.4718 0.4089 0.4734 0.0386  -0.1051 -0.0142 27  PHE D CE2 
5397 C CZ  . PHE D 27  ? 0.4738 0.4307 0.4769 0.0465  -0.0980 -0.0243 27  PHE D CZ  
5398 N N   . SER D 28  ? 0.3712 0.3515 0.3309 0.0156  -0.0992 0.0254  28  SER D N   
5399 C CA  . SER D 28  ? 0.3633 0.3460 0.3214 0.0152  -0.0995 0.0368  28  SER D CA  
5400 C C   . SER D 28  ? 0.4011 0.4036 0.3463 0.0193  -0.1029 0.0389  28  SER D C   
5401 O O   . SER D 28  ? 0.4162 0.4311 0.3488 0.0215  -0.1022 0.0303  28  SER D O   
5402 C CB  . SER D 28  ? 0.3515 0.3260 0.3106 0.0128  -0.0928 0.0486  28  SER D CB  
5403 O OG  . SER D 28  ? 0.3897 0.3569 0.3516 0.0132  -0.0921 0.0581  28  SER D OG  
5404 N N   . ALA D 29  ? 0.3948 0.4004 0.3419 0.0214  -0.1063 0.0503  29  ALA D N   
5405 C CA  . ALA D 29  ? 0.4274 0.4507 0.3602 0.0261  -0.1119 0.0580  29  ALA D CA  
5406 C C   . ALA D 29  ? 0.4471 0.4642 0.3853 0.0301  -0.1104 0.0776  29  ALA D C   
5407 O O   . ALA D 29  ? 0.4257 0.4305 0.3825 0.0302  -0.1088 0.0788  29  ALA D O   
5408 C CB  . ALA D 29  ? 0.4431 0.4808 0.3779 0.0264  -0.1242 0.0472  29  ALA D CB  
5409 N N   . THR D 30  ? 0.4810 0.5044 0.4023 0.0339  -0.1098 0.0934  30  THR D N   
5410 C CA  . THR D 30  ? 0.4964 0.5048 0.4247 0.0380  -0.1062 0.1135  30  THR D CA  
5411 C C   . THR D 30  ? 0.5077 0.5233 0.4497 0.0474  -0.1170 0.1213  30  THR D C   
5412 O O   . THR D 30  ? 0.5195 0.5190 0.4733 0.0533  -0.1132 0.1358  30  THR D O   
5413 C CB  . THR D 30  ? 0.5449 0.5502 0.4531 0.0376  -0.0992 0.1327  30  THR D CB  
5414 O OG1 . THR D 30  ? 0.6550 0.6772 0.5454 0.0453  -0.1097 0.1453  30  THR D OG1 
5415 C CG2 . THR D 30  ? 0.5559 0.5674 0.4506 0.0294  -0.0890 0.1257  30  THR D CG2 
5416 N N   . TRP D 31  ? 0.5125 0.5522 0.4557 0.0491  -0.1304 0.1114  31  TRP D N   
5417 C CA  . TRP D 31  ? 0.5373 0.5936 0.4994 0.0579  -0.1438 0.1178  31  TRP D CA  
5418 C C   . TRP D 31  ? 0.5131 0.5710 0.5096 0.0559  -0.1430 0.1043  31  TRP D C   
5419 O O   . TRP D 31  ? 0.5347 0.6066 0.5570 0.0637  -0.1501 0.1100  31  TRP D O   
5420 C CB  . TRP D 31  ? 0.5729 0.6591 0.5161 0.0594  -0.1615 0.1165  31  TRP D CB  
5421 C CG  . TRP D 31  ? 0.5632 0.6574 0.4931 0.0488  -0.1631 0.0919  31  TRP D CG  
5422 C CD1 . TRP D 31  ? 0.5592 0.6512 0.4576 0.0442  -0.1568 0.0850  31  TRP D CD1 
5423 C CD2 . TRP D 31  ? 0.5234 0.6267 0.4734 0.0418  -0.1699 0.0708  31  TRP D CD2 
5424 N NE1 . TRP D 31  ? 0.5418 0.6380 0.4394 0.0368  -0.1594 0.0599  31  TRP D NE1 
5425 C CE2 . TRP D 31  ? 0.5349 0.6362 0.4627 0.0340  -0.1680 0.0513  31  TRP D CE2 
5426 C CE3 . TRP D 31  ? 0.4824 0.5948 0.4689 0.0409  -0.1755 0.0665  31  TRP D CE3 
5427 C CZ2 . TRP D 31  ? 0.5298 0.6325 0.4694 0.0250  -0.1727 0.0283  31  TRP D CZ2 
5428 C CZ3 . TRP D 31  ? 0.5202 0.6384 0.5188 0.0298  -0.1800 0.0446  31  TRP D CZ3 
5429 C CH2 . TRP D 31  ? 0.5147 0.6249 0.4889 0.0217  -0.1790 0.0259  31  TRP D CH2 
5430 N N   . CYS D 32  ? 0.4864 0.5310 0.4835 0.0457  -0.1338 0.0880  32  CYS D N   
5431 C CA  . CYS D 32  ? 0.4710 0.5128 0.4931 0.0401  -0.1296 0.0750  32  CYS D CA  
5432 C C   . CYS D 32  ? 0.4575 0.4789 0.4966 0.0433  -0.1157 0.0804  32  CYS D C   
5433 O O   . CYS D 32  ? 0.4504 0.4463 0.4771 0.0396  -0.1044 0.0804  32  CYS D O   
5434 C CB  . CYS D 32  ? 0.4412 0.4705 0.4515 0.0289  -0.1248 0.0589  32  CYS D CB  
5435 S SG  . CYS D 32  ? 0.4732 0.4976 0.5089 0.0200  -0.1197 0.0461  32  CYS D SG  
5436 N N   . GLY D 33  ? 0.4680 0.5020 0.5363 0.0494  -0.1160 0.0827  33  GLY D N   
5437 C CA  . GLY D 33  ? 0.4647 0.4799 0.5483 0.0540  -0.1007 0.0854  33  GLY D CA  
5438 C C   . GLY D 33  ? 0.4402 0.4308 0.5104 0.0423  -0.0879 0.0740  33  GLY D C   
5439 O O   . GLY D 33  ? 0.4568 0.4203 0.5120 0.0418  -0.0784 0.0764  33  GLY D O   
5440 N N   . PRO D 34  ? 0.4120 0.4104 0.4863 0.0319  -0.0888 0.0622  34  PRO D N   
5441 C CA  . PRO D 34  ? 0.3978 0.3719 0.4575 0.0217  -0.0780 0.0543  34  PRO D CA  
5442 C C   . PRO D 34  ? 0.3877 0.3428 0.4192 0.0184  -0.0794 0.0551  34  PRO D C   
5443 O O   . PRO D 34  ? 0.3972 0.3292 0.4160 0.0152  -0.0706 0.0546  34  PRO D O   
5444 C CB  . PRO D 34  ? 0.4060 0.3914 0.4742 0.0114  -0.0820 0.0447  34  PRO D CB  
5445 C CG  . PRO D 34  ? 0.4038 0.4221 0.4933 0.0147  -0.0957 0.0446  34  PRO D CG  
5446 C CD  . PRO D 34  ? 0.4156 0.4438 0.5084 0.0286  -0.1006 0.0565  34  PRO D CD  
5447 N N   . ALA D 35  ? 0.3905 0.3564 0.4120 0.0185  -0.0900 0.0552  35  ALA D N   
5448 C CA  . ALA D 35  ? 0.3930 0.3459 0.3939 0.0163  -0.0892 0.0572  35  ALA D CA  
5449 C C   . ALA D 35  ? 0.4080 0.3456 0.4049 0.0198  -0.0823 0.0674  35  ALA D C   
5450 O O   . ALA D 35  ? 0.4178 0.3375 0.4046 0.0140  -0.0773 0.0660  35  ALA D O   
5451 C CB  . ALA D 35  ? 0.3802 0.3489 0.3709 0.0173  -0.0978 0.0555  35  ALA D CB  
5452 N N   . LYS D 36  ? 0.4341 0.3776 0.4400 0.0288  -0.0831 0.0777  36  LYS D N   
5453 C CA  . LYS D 36  ? 0.4632 0.3857 0.4682 0.0325  -0.0755 0.0874  36  LYS D CA  
5454 C C   . LYS D 36  ? 0.4675 0.3659 0.4752 0.0294  -0.0638 0.0797  36  LYS D C   
5455 O O   . LYS D 36  ? 0.4928 0.3669 0.4902 0.0245  -0.0576 0.0800  36  LYS D O   
5456 C CB  . LYS D 36  ? 0.4973 0.4280 0.5158 0.0460  -0.0788 0.1012  36  LYS D CB  
5457 C CG  . LYS D 36  ? 0.5081 0.4447 0.5135 0.0494  -0.0854 0.1166  36  LYS D CG  
5458 C CD  . LYS D 36  ? 0.6323 0.5752 0.6526 0.0650  -0.0906 0.1326  36  LYS D CD  
5459 C CE  . LYS D 36  ? 0.6358 0.6153 0.6721 0.0718  -0.1045 0.1300  36  LYS D CE  
5460 N NZ  . LYS D 36  ? 0.6917 0.6826 0.7480 0.0891  -0.1127 0.1471  36  LYS D NZ  
5461 N N   . MET D 37  ? 0.4495 0.3549 0.4703 0.0309  -0.0600 0.0723  37  MET D N   
5462 C CA  . MET D 37  ? 0.4605 0.3442 0.4798 0.0286  -0.0463 0.0645  37  MET D CA  
5463 C C   . MET D 37  ? 0.4449 0.3091 0.4386 0.0154  -0.0452 0.0570  37  MET D C   
5464 O O   . MET D 37  ? 0.4818 0.3212 0.4636 0.0119  -0.0384 0.0537  37  MET D O   
5465 C CB  . MET D 37  ? 0.4553 0.3543 0.4939 0.0310  -0.0400 0.0586  37  MET D CB  
5466 C CG  . MET D 37  ? 0.5355 0.4141 0.5694 0.0289  -0.0223 0.0496  37  MET D CG  
5467 S SD  . MET D 37  ? 0.6122 0.4779 0.6164 0.0118  -0.0187 0.0399  37  MET D SD  
5468 C CE  . MET D 37  ? 0.5984 0.4952 0.6280 0.0098  -0.0200 0.0400  37  MET D CE  
5469 N N   . ILE D 38  ? 0.4098 0.2847 0.3956 0.0085  -0.0534 0.0541  38  ILE D N   
5470 C CA  . ILE D 38  ? 0.3881 0.2482 0.3534 -0.0020 -0.0541 0.0481  38  ILE D CA  
5471 C C   . ILE D 38  ? 0.3880 0.2426 0.3441 -0.0066 -0.0603 0.0510  38  ILE D C   
5472 O O   . ILE D 38  ? 0.3828 0.2268 0.3244 -0.0153 -0.0633 0.0468  38  ILE D O   
5473 C CB  . ILE D 38  ? 0.3685 0.2400 0.3331 -0.0057 -0.0603 0.0454  38  ILE D CB  
5474 C CG1 . ILE D 38  ? 0.3934 0.2477 0.3369 -0.0146 -0.0601 0.0415  38  ILE D CG1 
5475 C CG2 . ILE D 38  ? 0.3012 0.1896 0.2704 -0.0035 -0.0712 0.0478  38  ILE D CG2 
5476 C CD1 . ILE D 38  ? 0.4123 0.2664 0.3543 -0.0183 -0.0578 0.0400  38  ILE D CD1 
5477 N N   . LYS D 39  ? 0.3868 0.2503 0.3517 -0.0016 -0.0626 0.0593  39  LYS D N   
5478 C CA  . LYS D 39  ? 0.3918 0.2538 0.3517 -0.0080 -0.0661 0.0631  39  LYS D CA  
5479 C C   . LYS D 39  ? 0.3973 0.2348 0.3480 -0.0175 -0.0625 0.0588  39  LYS D C   
5480 O O   . LYS D 39  ? 0.3932 0.2320 0.3378 -0.0266 -0.0685 0.0550  39  LYS D O   
5481 C CB  . LYS D 39  ? 0.3952 0.2690 0.3615 -0.0029 -0.0668 0.0747  39  LYS D CB  
5482 C CG  . LYS D 39  ? 0.4323 0.3331 0.3994 0.0004  -0.0735 0.0747  39  LYS D CG  
5483 C CD  . LYS D 39  ? 0.5353 0.4471 0.5006 0.0024  -0.0727 0.0865  39  LYS D CD  
5484 C CE  . LYS D 39  ? 0.5832 0.4753 0.5486 -0.0049 -0.0663 0.0941  39  LYS D CE  
5485 N NZ  . LYS D 39  ? 0.6518 0.5559 0.6155 -0.0105 -0.0634 0.1033  39  LYS D NZ  
5486 N N   . PRO D 40  ? 0.4232 0.2383 0.3739 -0.0149 -0.0535 0.0579  40  PRO D N   
5487 C CA  . PRO D 40  ? 0.4614 0.2498 0.4001 -0.0259 -0.0506 0.0501  40  PRO D CA  
5488 C C   . PRO D 40  ? 0.4749 0.2606 0.3951 -0.0346 -0.0551 0.0387  40  PRO D C   
5489 O O   . PRO D 40  ? 0.5076 0.2842 0.4168 -0.0470 -0.0609 0.0330  40  PRO D O   
5490 C CB  . PRO D 40  ? 0.4896 0.2529 0.4312 -0.0183 -0.0380 0.0479  40  PRO D CB  
5491 C CG  . PRO D 40  ? 0.4696 0.2507 0.4295 -0.0026 -0.0362 0.0580  40  PRO D CG  
5492 C CD  . PRO D 40  ? 0.4279 0.2416 0.3911 -0.0017 -0.0465 0.0629  40  PRO D CD  
5493 N N   . PHE D 41  ? 0.4561 0.2505 0.3727 -0.0292 -0.0536 0.0364  41  PHE D N   
5494 C CA  . PHE D 41  ? 0.4460 0.2337 0.3405 -0.0371 -0.0570 0.0288  41  PHE D CA  
5495 C C   . PHE D 41  ? 0.4212 0.2261 0.3173 -0.0415 -0.0718 0.0328  41  PHE D C   
5496 O O   . PHE D 41  ? 0.4608 0.2597 0.3414 -0.0511 -0.0802 0.0286  41  PHE D O   
5497 C CB  . PHE D 41  ? 0.4493 0.2366 0.3382 -0.0324 -0.0479 0.0263  41  PHE D CB  
5498 C CG  . PHE D 41  ? 0.4998 0.2723 0.3915 -0.0265 -0.0308 0.0207  41  PHE D CG  
5499 C CD1 . PHE D 41  ? 0.5766 0.3207 0.4490 -0.0321 -0.0232 0.0098  41  PHE D CD1 
5500 C CD2 . PHE D 41  ? 0.5246 0.3117 0.4408 -0.0150 -0.0228 0.0251  41  PHE D CD2 
5501 C CE1 . PHE D 41  ? 0.5640 0.2921 0.4414 -0.0244 -0.0057 0.0030  41  PHE D CE1 
5502 C CE2 . PHE D 41  ? 0.5772 0.3533 0.5027 -0.0066 -0.0065 0.0203  41  PHE D CE2 
5503 C CZ  . PHE D 41  ? 0.5870 0.3322 0.4931 -0.0103 0.0033  0.0090  41  PHE D CZ  
5504 N N   . PHE D 42  ? 0.3782 0.2055 0.2932 -0.0345 -0.0757 0.0400  42  PHE D N   
5505 C CA  . PHE D 42  ? 0.3755 0.2201 0.2956 -0.0364 -0.0880 0.0424  42  PHE D CA  
5506 C C   . PHE D 42  ? 0.4088 0.2527 0.3298 -0.0464 -0.0938 0.0414  42  PHE D C   
5507 O O   . PHE D 42  ? 0.4386 0.2884 0.3561 -0.0520 -0.1054 0.0399  42  PHE D O   
5508 C CB  . PHE D 42  ? 0.3466 0.2134 0.2852 -0.0282 -0.0885 0.0476  42  PHE D CB  
5509 C CG  . PHE D 42  ? 0.3289 0.2126 0.2748 -0.0259 -0.0978 0.0477  42  PHE D CG  
5510 C CD1 . PHE D 42  ? 0.3860 0.2651 0.3255 -0.0234 -0.1027 0.0460  42  PHE D CD1 
5511 C CD2 . PHE D 42  ? 0.3494 0.2537 0.3106 -0.0249 -0.0996 0.0503  42  PHE D CD2 
5512 C CE1 . PHE D 42  ? 0.3895 0.2808 0.3386 -0.0183 -0.1112 0.0462  42  PHE D CE1 
5513 C CE2 . PHE D 42  ? 0.3940 0.3156 0.3663 -0.0194 -0.1060 0.0489  42  PHE D CE2 
5514 C CZ  . PHE D 42  ? 0.4003 0.3137 0.3672 -0.0152 -0.1127 0.0465  42  PHE D CZ  
5515 N N   . HIS D 43  ? 0.4209 0.2569 0.3484 -0.0489 -0.0864 0.0431  43  HIS D N   
5516 C CA  . HIS D 43  ? 0.4478 0.2806 0.3803 -0.0614 -0.0896 0.0422  43  HIS D CA  
5517 C C   . HIS D 43  ? 0.4969 0.3080 0.4100 -0.0747 -0.0947 0.0312  43  HIS D C   
5518 O O   . HIS D 43  ? 0.5346 0.3538 0.4527 -0.0869 -0.1054 0.0288  43  HIS D O   
5519 C CB  . HIS D 43  ? 0.4545 0.2767 0.3966 -0.0610 -0.0788 0.0486  43  HIS D CB  
5520 C CG  . HIS D 43  ? 0.5063 0.3222 0.4557 -0.0765 -0.0806 0.0481  43  HIS D CG  
5521 N ND1 . HIS D 43  ? 0.5338 0.3762 0.5030 -0.0825 -0.0842 0.0551  43  HIS D ND1 
5522 C CD2 . HIS D 43  ? 0.5871 0.3741 0.5275 -0.0893 -0.0796 0.0394  43  HIS D CD2 
5523 C CE1 . HIS D 43  ? 0.6150 0.4468 0.5905 -0.0996 -0.0854 0.0525  43  HIS D CE1 
5524 N NE2 . HIS D 43  ? 0.6241 0.4203 0.5812 -0.1043 -0.0835 0.0424  43  HIS D NE2 
5525 N N   . SER D 44  ? 0.5111 0.2961 0.4031 -0.0733 -0.0866 0.0235  44  SER D N   
5526 C CA  . SER D 44  ? 0.5670 0.3306 0.4329 -0.0856 -0.0909 0.0108  44  SER D CA  
5527 C C   . SER D 44  ? 0.5691 0.3493 0.4224 -0.0899 -0.1083 0.0109  44  SER D C   
5528 O O   . SER D 44  ? 0.5961 0.3773 0.4414 -0.1034 -0.1224 0.0051  44  SER D O   
5529 C CB  . SER D 44  ? 0.6015 0.3389 0.4461 -0.0799 -0.0758 0.0026  44  SER D CB  
5530 O OG  . SER D 44  ? 0.6274 0.3476 0.4851 -0.0742 -0.0613 0.0026  44  SER D OG  
5531 N N   . LEU D 45  ? 0.5217 0.3143 0.3751 -0.0782 -0.1083 0.0183  45  LEU D N   
5532 C CA  . LEU D 45  ? 0.5141 0.3216 0.3617 -0.0776 -0.1239 0.0232  45  LEU D CA  
5533 C C   . LEU D 45  ? 0.5084 0.3426 0.3811 -0.0815 -0.1399 0.0271  45  LEU D C   
5534 O O   . LEU D 45  ? 0.5435 0.3840 0.4072 -0.0888 -0.1573 0.0261  45  LEU D O   
5535 C CB  . LEU D 45  ? 0.4812 0.2958 0.3348 -0.0642 -0.1187 0.0312  45  LEU D CB  
5536 C CG  . LEU D 45  ? 0.4918 0.2896 0.3166 -0.0626 -0.1135 0.0319  45  LEU D CG  
5537 C CD1 . LEU D 45  ? 0.4958 0.2681 0.2848 -0.0715 -0.1052 0.0223  45  LEU D CD1 
5538 C CD2 . LEU D 45  ? 0.4169 0.2181 0.2563 -0.0524 -0.1006 0.0360  45  LEU D CD2 
5539 N N   . SER D 46  ? 0.4693 0.3213 0.3734 -0.0770 -0.1341 0.0319  46  SER D N   
5540 C CA  . SER D 46  ? 0.4642 0.3463 0.3975 -0.0804 -0.1451 0.0355  46  SER D CA  
5541 C C   . SER D 46  ? 0.5213 0.4014 0.4529 -0.0991 -0.1558 0.0285  46  SER D C   
5542 O O   . SER D 46  ? 0.5292 0.4334 0.4750 -0.1039 -0.1733 0.0296  46  SER D O   
5543 C CB  . SER D 46  ? 0.4123 0.3129 0.3744 -0.0742 -0.1333 0.0416  46  SER D CB  
5544 O OG  . SER D 46  ? 0.4602 0.3502 0.4270 -0.0852 -0.1245 0.0407  46  SER D OG  
5545 N N   . GLU D 47  ? 0.5568 0.4089 0.4744 -0.1092 -0.1460 0.0210  47  GLU D N   
5546 C CA  . GLU D 47  ? 0.6200 0.4631 0.5312 -0.1292 -0.1561 0.0107  47  GLU D CA  
5547 C C   . GLU D 47  ? 0.6713 0.5077 0.5489 -0.1335 -0.1728 0.0038  47  GLU D C   
5548 O O   . GLU D 47  ? 0.7278 0.5809 0.6105 -0.1460 -0.1929 0.0004  47  GLU D O   
5549 C CB  . GLU D 47  ? 0.6588 0.4658 0.5603 -0.1382 -0.1409 0.0024  47  GLU D CB  
5550 C CG  . GLU D 47  ? 0.6222 0.4332 0.5552 -0.1394 -0.1280 0.0111  47  GLU D CG  
5551 C CD  . GLU D 47  ? 0.6953 0.5371 0.6615 -0.1548 -0.1388 0.0142  47  GLU D CD  
5552 O OE1 . GLU D 47  ? 0.8025 0.6423 0.7650 -0.1733 -0.1534 0.0031  47  GLU D OE1 
5553 O OE2 . GLU D 47  ? 0.6723 0.5428 0.6689 -0.1495 -0.1328 0.0268  47  GLU D OE2 
5554 N N   . LYS D 48  ? 0.6714 0.4872 0.5157 -0.1240 -0.1660 0.0031  48  LYS D N   
5555 C CA  . LYS D 48  ? 0.7364 0.5458 0.5429 -0.1295 -0.1824 -0.0010 48  LYS D CA  
5556 C C   . LYS D 48  ? 0.7394 0.5798 0.5582 -0.1231 -0.2041 0.0112  48  LYS D C   
5557 O O   . LYS D 48  ? 0.8003 0.6521 0.6122 -0.1335 -0.2262 0.0088  48  LYS D O   
5558 C CB  . LYS D 48  ? 0.7543 0.5320 0.5166 -0.1249 -0.1682 -0.0056 48  LYS D CB  
5559 C CG  . LYS D 48  ? 0.7922 0.5636 0.5092 -0.1296