data_4LL7
# 
_entry.id   4LL7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4LL7         
RCSB  RCSB080768   
WWPDB D_1000080768 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4LL6 . unspecified 
PDB 4LL8 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4LL7 
_pdbx_database_status.recvd_initial_deposition_date   2013-07-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shi, H.'       1 
'Singh, N.'     2 
'Esselborn, F.' 3 
'Blobel, G.'    4 
# 
_citation.id                        primary 
_citation.title                     'Structure of a myosinbulletadaptor complex and pairing by cargo.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            111 
_citation.page_first                E1082 
_citation.page_last                 E1090 
_citation.year                      2014 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24522109 
_citation.pdbx_database_id_DOI      10.1073/pnas.1401428111 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shi, H.'       1 ? 
primary 'Singh, N.'     2 ? 
primary 'Esselborn, F.' 3 ? 
primary 'Blobel, G.'    4 ? 
# 
_cell.length_a           28.069 
_cell.length_b           49.576 
_cell.length_c           149.950 
_cell.angle_alpha        89.960 
_cell.angle_beta         84.670 
_cell.angle_gamma        89.980 
_cell.entry_id           4LL7 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.entry_id                         4LL7 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                1 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SWI5-dependent HO expression protein 3' 11297.770 8   ? ? 'UNP residues 42-137' ? 
2 non-polymer syn 'DYSPROSIUM ION'                         162.500   26  ? ? ?                     ? 
3 non-polymer syn 'SULFATE ION'                            96.063    29  ? ? ?                     ? 
4 non-polymer syn 'PLATINUM (II) ION'                      195.078   6   ? ? ?                     ? 
5 non-polymer syn 2,3-DIHYDROXY-1,4-DITHIOBUTANE           154.251   1   ? ? ?                     ? 
6 non-polymer syn 1,2-ETHANEDIOL                           62.068    7   ? ? ?                     ? 
7 non-polymer syn 'ISOPROPYL ALCOHOL'                      60.095    6   ? ? ?                     ? 
8 water       nat water                                    18.015    195 ? ? ?                     ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SSRVIESLHDQIDMLTKTNLQLTTQSQNLLSKLELAQSKESKLLENLNLLKNENENLNSIFERKNKKLKELEKDYSELSN
RYNEQKEKMDQLSKLA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SSRVIESLHDQIDMLTKTNLQLTTQSQNLLSKLELAQSKESKLLENLNLLKNENENLNSIFERKNKKLKELEKDYSELSN
RYNEQKEKMDQLSKLA
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  SER n 
1 3  ARG n 
1 4  VAL n 
1 5  ILE n 
1 6  GLU n 
1 7  SER n 
1 8  LEU n 
1 9  HIS n 
1 10 ASP n 
1 11 GLN n 
1 12 ILE n 
1 13 ASP n 
1 14 MET n 
1 15 LEU n 
1 16 THR n 
1 17 LYS n 
1 18 THR n 
1 19 ASN n 
1 20 LEU n 
1 21 GLN n 
1 22 LEU n 
1 23 THR n 
1 24 THR n 
1 25 GLN n 
1 26 SER n 
1 27 GLN n 
1 28 ASN n 
1 29 LEU n 
1 30 LEU n 
1 31 SER n 
1 32 LYS n 
1 33 LEU n 
1 34 GLU n 
1 35 LEU n 
1 36 ALA n 
1 37 GLN n 
1 38 SER n 
1 39 LYS n 
1 40 GLU n 
1 41 SER n 
1 42 LYS n 
1 43 LEU n 
1 44 LEU n 
1 45 GLU n 
1 46 ASN n 
1 47 LEU n 
1 48 ASN n 
1 49 LEU n 
1 50 LEU n 
1 51 LYS n 
1 52 ASN n 
1 53 GLU n 
1 54 ASN n 
1 55 GLU n 
1 56 ASN n 
1 57 LEU n 
1 58 ASN n 
1 59 SER n 
1 60 ILE n 
1 61 PHE n 
1 62 GLU n 
1 63 ARG n 
1 64 LYS n 
1 65 ASN n 
1 66 LYS n 
1 67 LYS n 
1 68 LEU n 
1 69 LYS n 
1 70 GLU n 
1 71 LEU n 
1 72 GLU n 
1 73 LYS n 
1 74 ASP n 
1 75 TYR n 
1 76 SER n 
1 77 GLU n 
1 78 LEU n 
1 79 SER n 
1 80 ASN n 
1 81 ARG n 
1 82 TYR n 
1 83 ASN n 
1 84 GLU n 
1 85 GLN n 
1 86 LYS n 
1 87 GLU n 
1 88 LYS n 
1 89 MET n 
1 90 ASP n 
1 91 GLN n 
1 92 LEU n 
1 93 SER n 
1 94 LYS n 
1 95 LEU n 
1 96 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;Baker's yeast
;
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SHE3, YBR130C, YBR1005' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 204508 / S288c' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     559292 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SHE3_YEAST 
_struct_ref.pdbx_db_accession          P38272 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SSRVIESLHDQIDMLTKTNLQLTTQSQNLLSKLELAQSKESKLLENLNLLKNENENLNSIFERKNKKLKELEKDYSELSN
RYNEQKEKMDQLSKLA
;
_struct_ref.pdbx_align_begin           42 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4LL7 A 1 ? 96 ? P38272 42 ? 137 ? 42 137 
2 1 4LL7 B 1 ? 96 ? P38272 42 ? 137 ? 42 137 
3 1 4LL7 C 1 ? 96 ? P38272 42 ? 137 ? 42 137 
4 1 4LL7 D 1 ? 96 ? P38272 42 ? 137 ? 42 137 
5 1 4LL7 E 1 ? 96 ? P38272 42 ? 137 ? 42 137 
6 1 4LL7 F 1 ? 96 ? P38272 42 ? 137 ? 42 137 
7 1 4LL7 G 1 ? 96 ? P38272 42 ? 137 ? 42 137 
8 1 4LL7 H 1 ? 96 ? P38272 42 ? 137 ? 42 137 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                        ?                  'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                       ?                  'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                     ?                  'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                ?                  'C4 H7 N O4'     133.103 
DTT non-polymer         . 2,3-DIHYDROXY-1,4-DITHIOBUTANE 1,4-DITHIOTHREITOL 'C4 H10 O2 S2'   154.251 
DY  non-polymer         . 'DYSPROSIUM ION'               ?                  'Dy 3'           162.500 
EDO non-polymer         . 1,2-ETHANEDIOL                 'ETHYLENE GLYCOL'  'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE                      ?                  'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                ?                  'C5 H9 N O4'     147.129 
HIS 'L-peptide linking' y HISTIDINE                      ?                  'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                          ?                  'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                     ?                  'C6 H13 N O2'    131.173 
IPA non-polymer         . 'ISOPROPYL ALCOHOL'            2-PROPANOL         'C3 H8 O'        60.095  
LEU 'L-peptide linking' y LEUCINE                        ?                  'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                         ?                  'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                     ?                  'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                  ?                  'C9 H11 N O2'    165.189 
PT  non-polymer         . 'PLATINUM (II) ION'            ?                  'Pt 2'           195.078 
SER 'L-peptide linking' y SERINE                         ?                  'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'                  ?                  'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE                      ?                  'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                       ?                  'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                         ?                  'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4LL7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.30 
_exptl_crystal.density_percent_sol   46.49 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'0.1M MES, pH 6.5, 0.45M Ammonium sulfate, 10% (v/v) 2-propanol, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2011-06-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1050 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1050 
# 
_reflns.entry_id                     4LL7 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.31 
_reflns.number_obs                   34442 
_reflns.number_all                   35520 
_reflns.percent_possible_obs         97.5 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 4LL7 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            2.31 
_refine.ls_d_res_low                             29.86 
_refine.pdbx_ls_sigma_F                          3805.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    78.7000 
_refine.ls_number_reflns_obs                     28170 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2314 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2644 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 7.8000 
_refine.ls_number_reflns_R_free                  3193 
_refine.ls_number_reflns_R_work                  25362 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               76.8162 
_refine.solvent_model_param_bsol                 63.1719 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            2.8620 
_refine.aniso_B[2][2]                            19.9370 
_refine.aniso_B[3][3]                            -22.7990 
_refine.aniso_B[1][2]                            -4.4250 
_refine.aniso_B[1][3]                            -0.4110 
_refine.aniso_B[2][3]                            -2.8430 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                174.900 
_refine.B_iso_min                                3.850 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5986 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         237 
_refine_hist.number_atoms_solvent             195 
_refine_hist.number_atoms_total               6418 
_refine_hist.d_res_high                       2.31 
_refine_hist.d_res_low                        29.86 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' c_bond_d     ? 0.006  ?     ? ? 
'X-RAY DIFFRACTION' c_angle_d    ? 1.142  ?     ? ? 
'X-RAY DIFFRACTION' c_mcbond_it  ? 5.774  1.500 ? ? 
'X-RAY DIFFRACTION' c_scbond_it  ? 8.494  2.000 ? ? 
'X-RAY DIFFRACTION' c_mcangle_it ? 6.710  2.000 ? ? 
'X-RAY DIFFRACTION' c_scangle_it ? 10.908 2.500 ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
2.31   2.3800  10 49.2000 1576 . 0.2658 0.3082 . 192 . 1768 . 'X-RAY DIFFRACTION' . 
2.3800 2.4800  10 59.6000 1922 . 0.2602 0.3252 . 207 . 2129 . 'X-RAY DIFFRACTION' . 
2.4800 2.5900  10 66.5000 2180 . 0.1922 0.2652 . 245 . 2425 . 'X-RAY DIFFRACTION' . 
2.5900 2.7300  10 75.4000 2368 . 0.2014 0.2462 . 268 . 2636 . 'X-RAY DIFFRACTION' . 
2.7300 2.9000  10 79.2000 2545 . 0.2237 0.2715 . 280 . 2825 . 'X-RAY DIFFRACTION' . 
2.9000 3.1200  10 82.9000 2730 . 0.2261 0.2450 . 288 . 3018 . 'X-RAY DIFFRACTION' . 
3.1200 3.4400  10 89.7000 2837 . 0.2165 0.2458 . 326 . 3163 . 'X-RAY DIFFRACTION' . 
3.4400 3.9300  10 93.7000 3018 . 0.1969 0.2260 . 356 . 3374 . 'X-RAY DIFFRACTION' . 
3.9300 4.9500  10 95.4000 3031 . 0.2190 0.2660 . 344 . 3375 . 'X-RAY DIFFRACTION' . 
4.9500 50.0000 10 96.2000 3155 . 0.2927 0.3074 . 302 . 3457 . 'X-RAY DIFFRACTION' . 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 CNS_TOPPAR:protein_rep.param  ? 
'X-RAY DIFFRACTION' 2 CNS_TOPPAR:dna-rna_rep.param  ? 
'X-RAY DIFFRACTION' 3 CNS_TOPPAR:water_rep.param    ? 
'X-RAY DIFFRACTION' 4 ion.param                     ? 
'X-RAY DIFFRACTION' 5 CNS_TOPPAR:carbohydrate.param ? 
'X-RAY DIFFRACTION' 6 iso.param                     ? 
# 
_struct.entry_id                  4LL7 
_struct.title                     'Structure of She3p amino terminus.' 
_struct.pdbx_descriptor           'SWI5-dependent HO expression protein 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4LL7 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            'She3p, myosin cargo adaptor protein, mRNA translocation, TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 4 ? 
T  N N 5 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 4 ? 
CA N N 6 ? 
DA N N 2 ? 
EA N N 2 ? 
FA N N 2 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 3 ? 
JA N N 3 ? 
KA N N 3 ? 
LA N N 3 ? 
MA N N 3 ? 
NA N N 4 ? 
OA N N 7 ? 
PA N N 2 ? 
QA N N 2 ? 
RA N N 2 ? 
SA N N 3 ? 
TA N N 3 ? 
UA N N 4 ? 
VA N N 6 ? 
WA N N 6 ? 
XA N N 7 ? 
YA N N 2 ? 
ZA N N 2 ? 
AB N N 2 ? 
BB N N 2 ? 
CB N N 2 ? 
DB N N 3 ? 
EB N N 4 ? 
FB N N 6 ? 
GB N N 6 ? 
HB N N 7 ? 
IB N N 2 ? 
JB N N 2 ? 
KB N N 2 ? 
LB N N 3 ? 
MB N N 6 ? 
NB N N 7 ? 
OB N N 7 ? 
PB N N 7 ? 
QB N N 2 ? 
RB N N 2 ? 
SB N N 3 ? 
TB N N 3 ? 
UB N N 3 ? 
VB N N 3 ? 
WB N N 3 ? 
XB N N 3 ? 
YB N N 4 ? 
ZB N N 2 ? 
AC N N 2 ? 
BC N N 2 ? 
CC N N 3 ? 
DC N N 3 ? 
EC N N 6 ? 
FC N N 8 ? 
GC N N 8 ? 
HC N N 8 ? 
IC N N 8 ? 
JC N N 8 ? 
KC N N 8 ? 
LC N N 8 ? 
MC N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 2  ? SER A 31 ? SER A 43 SER A 72  1 ? 30 
HELX_P HELX_P2 2 LYS A 32 ? LYS A 94 ? LYS A 73 LYS A 135 1 ? 63 
HELX_P HELX_P3 3 HIS B 9  ? SER B 93 ? HIS B 50 SER B 134 1 ? 85 
HELX_P HELX_P4 4 GLU C 6  ? LYS C 94 ? GLU C 47 LYS C 135 1 ? 89 
HELX_P HELX_P5 5 GLU D 6  ? LEU D 95 ? GLU D 47 LEU D 136 1 ? 90 
HELX_P HELX_P6 6 SER E 7  ? LEU E 92 ? SER E 48 LEU E 133 1 ? 86 
HELX_P HELX_P7 7 GLU F 6  ? LYS F 94 ? GLU F 47 LYS F 135 1 ? 89 
HELX_P HELX_P8 8 ASP G 10 ? LEU G 92 ? ASP G 51 LEU G 133 1 ? 83 
HELX_P HELX_P9 9 GLU H 6  ? LYS H 94 ? GLU H 47 LYS H 135 1 ? 89 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? C  GLU 72 OE1 ? ? ? 1_555 EA DY  . DY B ? C GLU 113 C DY  202 1_555 ? ? ? ? ? ? ? 2.039 ? 
metalc2   metalc ? ? B  GLU 87 OE1 ? ? ? 1_555 W  DY  . DY ? ? B GLU 128 B DY  203 1_555 ? ? ? ? ? ? ? 2.141 ? 
metalc3   metalc ? ? C  GLU 87 OE1 ? ? ? 1_555 DA DY  . DY A ? C GLU 128 C DY  201 1_555 ? ? ? ? ? ? ? 2.214 ? 
metalc4   metalc ? ? G  ASP 74 OD1 ? ? ? 1_555 QB DY  . DY ? ? G ASP 115 G DY  201 1_555 ? ? ? ? ? ? ? 2.219 ? 
metalc5   metalc ? ? E  GLU 72 OE2 ? ? ? 1_555 ZA DY  . DY ? ? E GLU 113 E DY  202 1_555 ? ? ? ? ? ? ? 2.232 ? 
metalc6   metalc ? ? F  GLU 87 OE1 ? ? ? 1_555 JB DY  . DY ? ? F GLU 128 F DY  202 1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc7   metalc ? ? G  GLU 87 OE1 ? ? ? 1_555 RB DY  . DY ? ? G GLU 128 G DY  202 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc8   metalc ? ? E  GLU 84 OE2 ? ? ? 1_555 J  DY  . DY ? ? E GLU 125 A DY  202 1_555 ? ? ? ? ? ? ? 2.253 ? 
metalc9   metalc ? ? YA DY  .  DY  A ? ? 1_555 JC HOH . O  ? ? E DY  201 E HOH 319 1_555 ? ? ? ? ? ? ? 2.255 ? 
metalc10  metalc ? ? C  GLU 72 OE1 ? ? ? 1_555 EA DY  . DY A ? C GLU 113 C DY  202 1_555 ? ? ? ? ? ? ? 2.263 ? 
metalc11  metalc ? ? E  GLU 87 OE1 ? ? ? 1_555 YA DY  . DY A ? E GLU 128 E DY  201 1_555 ? ? ? ? ? ? ? 2.266 ? 
metalc12  metalc ? ? A  GLU 72 OE1 ? ? ? 1_555 YA DY  . DY A ? A GLU 113 E DY  201 1_555 ? ? ? ? ? ? ? 2.280 ? 
metalc13  metalc ? ? DA DY  .  DY  B ? ? 1_555 HC HOH . O  ? ? C DY  201 C HOH 321 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc14  metalc ? ? A  GLU 87 OE1 ? ? ? 1_555 I  DY  . DY A ? A GLU 128 A DY  201 1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc15  metalc ? ? E  GLU 72 OE2 ? ? ? 1_555 I  DY  . DY B ? E GLU 113 A DY  201 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc16  metalc ? ? A  GLU 72 OE1 ? ? ? 1_555 YA DY  . DY B ? A GLU 113 E DY  201 1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc17  metalc ? ? A  GLU 62 OE2 ? ? ? 1_555 K  DY  . DY ? ? A GLU 103 A DY  203 1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc18  metalc ? ? A  GLU 84 OE1 ? ? ? 1_555 ZA DY  . DY ? ? A GLU 125 E DY  202 1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc19  metalc ? ? EA DY  .  DY  A ? ? 1_555 LC HOH . O  ? ? C DY  202 G HOH 317 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc20  metalc ? ? A  GLU 84 OE1 ? ? ? 1_555 I  DY  . DY B ? A GLU 125 A DY  201 1_555 ? ? ? ? ? ? ? 2.378 ? 
metalc21  metalc ? ? B  ASP 74 OD1 ? ? ? 1_555 U  DY  . DY ? ? B ASP 115 B DY  201 1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc22  metalc ? ? H  ASP 74 OD1 ? ? ? 1_555 ZB DY  . DY ? ? H ASP 115 H DY  201 1_555 ? ? ? ? ? ? ? 2.397 ? 
metalc23  metalc ? ? D  GLU 87 OE1 ? ? ? 1_555 QA DY  . DY ? ? D GLU 128 D DY  202 1_555 ? ? ? ? ? ? ? 2.398 ? 
metalc24  metalc ? ? DA DY  .  DY  A ? ? 1_555 HC HOH . O  ? ? C DY  201 C HOH 321 1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc25  metalc ? ? B  GLU 72 OE1 ? ? ? 1_555 I  DY  . DY A ? B GLU 113 A DY  201 1_555 ? ? ? ? ? ? ? 2.418 ? 
metalc26  metalc ? ? H  GLU 72 OE1 ? ? ? 1_555 AC DY  . DY ? ? H GLU 113 H DY  202 1_555 ? ? ? ? ? ? ? 2.420 ? 
metalc27  metalc ? ? D  GLU 62 OE1 ? ? ? 1_555 RA DY  . DY ? ? D GLU 103 D DY  203 1_555 ? ? ? ? ? ? ? 2.437 ? 
metalc28  metalc ? ? F  GLU 62 OE1 ? ? ? 1_555 KB DY  . DY ? ? F GLU 103 F DY  203 1_555 ? ? ? ? ? ? ? 2.444 ? 
metalc29  metalc ? ? G  GLU 72 OE1 ? ? ? 1_555 EA DY  . DY A ? G GLU 113 C DY  202 1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc30  metalc ? ? B  ASN 54 OD1 ? ? ? 1_555 EB PT  . PT ? ? B ASN 95  E PT  207 1_555 ? ? ? ? ? ? ? 2.457 ? 
metalc31  metalc ? ? E  ASP 74 OD1 ? ? ? 1_555 AB DY  . DY ? ? E ASP 115 E DY  203 1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc32  metalc ? ? C  ASP 74 OD1 ? ? ? 1_555 FA DY  . DY ? ? C ASP 115 C DY  203 1_555 ? ? ? ? ? ? ? 2.462 ? 
metalc33  metalc ? ? YA DY  .  DY  B ? ? 1_555 JC HOH . O  ? ? E DY  201 E HOH 319 1_555 ? ? ? ? ? ? ? 2.475 ? 
metalc34  metalc ? ? A  GLU 84 OE1 ? ? ? 1_555 I  DY  . DY A ? A GLU 125 A DY  201 1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc35  metalc ? ? E  GLU 84 OE2 ? ? ? 1_555 YA DY  . DY A ? E GLU 125 E DY  201 1_555 ? ? ? ? ? ? ? 2.490 ? 
metalc36  metalc ? ? G  ASN 54 OD1 ? ? ? 1_555 NA PT  . PT ? ? G ASN 95  C PT  211 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc37  metalc ? ? E  GLU 62 OE2 ? ? ? 1_555 CB DY  . DY ? ? E GLU 103 E DY  205 1_555 ? ? ? ? ? ? ? 2.510 ? 
metalc38  metalc ? ? F  ASP 74 OD1 ? ? ? 1_555 IB DY  . DY ? ? F ASP 115 F DY  201 1_555 ? ? ? ? ? ? ? 2.516 ? 
metalc39  metalc ? ? V  DY  .  DY  ? ? ? 1_555 GC HOH . O  ? ? B DY  202 B HOH 321 1_555 ? ? ? ? ? ? ? 2.555 ? 
metalc40  metalc ? ? D  ASP 74 OD1 ? ? ? 1_555 PA DY  . DY ? ? D ASP 115 D DY  201 1_555 ? ? ? ? ? ? ? 2.571 ? 
metalc41  metalc ? ? D  GLU 62 OE2 ? ? ? 1_555 RA DY  . DY ? ? D GLU 103 D DY  203 1_555 ? ? ? ? ? ? ? 2.603 ? 
metalc42  metalc ? ? E  GLU 72 OE2 ? ? ? 1_555 I  DY  . DY A ? E GLU 113 A DY  201 1_555 ? ? ? ? ? ? ? 2.617 ? 
metalc43  metalc ? ? IB DY  .  DY  ? ? ? 1_555 KC HOH . O  ? ? F DY  201 F HOH 312 1_555 ? ? ? ? ? ? ? 2.627 ? 
metalc44  metalc ? ? F  GLU 72 OE1 ? ? ? 1_555 YA DY  . DY A ? F GLU 113 E DY  201 1_555 ? ? ? ? ? ? ? 2.632 ? 
metalc45  metalc ? ? B  GLU 62 OE2 ? ? ? 1_555 V  DY  . DY ? ? B GLU 103 B DY  202 1_555 ? ? ? ? ? ? ? 2.635 ? 
metalc46  metalc ? ? E  GLU 87 OE2 ? ? ? 1_555 YA DY  . DY A ? E GLU 128 E DY  201 1_555 ? ? ? ? ? ? ? 2.639 ? 
metalc47  metalc ? ? H  GLU 62 OE1 ? ? ? 1_555 BC DY  . DY ? ? H GLU 103 H DY  203 1_555 ? ? ? ? ? ? ? 2.646 ? 
metalc48  metalc ? ? EA DY  .  DY  B ? ? 1_555 LC HOH . O  ? ? C DY  202 G HOH 317 1_555 ? ? ? ? ? ? ? 2.658 ? 
metalc49  metalc ? ? C  ASN 54 OD1 ? ? ? 1_555 YB PT  . PT ? ? C ASN 95  G PT  209 1_555 ? ? ? ? ? ? ? 2.670 ? 
metalc50  metalc ? ? E  GLU 87 OE2 ? ? ? 1_555 YA DY  . DY B ? E GLU 128 E DY  201 1_555 ? ? ? ? ? ? ? 2.690 ? 
metalc51  metalc ? ? E  ASN 54 ND2 ? ? ? 1_555 BA PT  . PT ? ? E ASN 95  B PT  208 1_555 ? ? ? ? ? ? ? 2.737 ? 
metalc52  metalc ? ? J  DY  .  DY  ? ? ? 1_555 JC HOH . O  ? ? A DY  202 E HOH 304 1_555 ? ? ? ? ? ? ? 2.753 ? 
metalc53  metalc ? ? E  GLU 77 OE1 ? ? ? 1_555 BB DY  . DY ? ? E GLU 118 E DY  204 1_555 ? ? ? ? ? ? ? 2.772 ? 
metalc54  metalc ? ? F  GLU 62 OE2 ? ? ? 1_555 KB DY  . DY ? ? F GLU 103 F DY  203 1_555 ? ? ? ? ? ? ? 2.789 ? 
metalc55  metalc ? ? A  GLU 72 OE2 ? ? ? 1_555 YA DY  . DY B ? A GLU 113 E DY  201 1_555 ? ? ? ? ? ? ? 2.797 ? 
metalc56  metalc ? ? A  ASP 74 OD1 ? ? ? 1_555 L  DY  . DY ? ? A ASP 115 A DY  204 1_555 ? ? ? ? ? ? ? 2.804 ? 
metalc57  metalc ? ? AC DY  .  DY  ? ? ? 1_555 MC HOH . O  ? ? H DY  202 H HOH 313 1_555 ? ? ? ? ? ? ? 2.808 ? 
metalc58  metalc ? ? E  GLU 72 OE1 ? ? ? 1_555 I  DY  . DY A ? E GLU 113 A DY  201 1_555 ? ? ? ? ? ? ? 2.823 ? 
metalc59  metalc ? ? C  GLU 72 OE2 ? ? ? 1_555 EA DY  . DY B ? C GLU 113 C DY  202 1_555 ? ? ? ? ? ? ? 2.828 ? 
metalc60  metalc ? ? A  GLU 72 OE2 ? ? ? 1_555 YA DY  . DY A ? A GLU 113 E DY  201 1_555 ? ? ? ? ? ? ? 2.848 ? 
metalc61  metalc ? ? H  LYS 69 O   ? ? ? 1_555 AC DY  . DY ? ? H LYS 110 H DY  202 1_555 ? ? ? ? ? ? ? 2.849 ? 
metalc62  metalc ? ? C  GLU 72 OE2 ? ? ? 1_555 EA DY  . DY A ? C GLU 113 C DY  202 1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc63  metalc ? ? E  GLU 72 OE1 ? ? ? 1_555 I  DY  . DY B ? E GLU 113 A DY  201 1_555 ? ? ? ? ? ? ? 2.874 ? 
metalc64  metalc ? ? QB DY  .  DY  ? ? ? 1_555 LC HOH . O  ? ? G DY  201 G HOH 309 1_555 ? ? ? ? ? ? ? 2.878 ? 
metalc65  metalc ? ? B  GLU 62 OE1 ? ? ? 1_555 V  DY  . DY ? ? B GLU 103 B DY  202 1_555 ? ? ? ? ? ? ? 2.902 ? 
metalc66  metalc ? ? W  DY  .  DY  ? ? ? 1_555 GC HOH . O  ? ? B DY  203 B HOH 322 1_555 ? ? ? ? ? ? ? 2.905 ? 
metalc67  metalc ? ? I  DY  .  DY  A ? ? 1_555 GC HOH . O  ? ? A DY  201 B HOH 305 1_555 ? ? ? ? ? ? ? 2.915 ? 
metalc68  metalc ? ? A  GLU 87 OE2 ? ? ? 1_555 I  DY  . DY A ? A GLU 128 A DY  201 1_555 ? ? ? ? ? ? ? 2.926 ? 
metalc69  metalc ? ? RA DY  .  DY  ? ? ? 1_555 IC HOH . O  ? ? D DY  203 D HOH 313 1_555 ? ? ? ? ? ? ? 2.956 ? 
metalc70  metalc ? ? PA DY  .  DY  ? ? ? 1_555 IC HOH . O  ? ? D DY  201 D HOH 308 1_555 ? ? ? ? ? ? ? 2.973 ? 
metalc71  metalc ? ? C  GLU 87 OE2 ? ? ? 1_555 DA DY  . DY B ? C GLU 128 C DY  201 1_555 ? ? ? ? ? ? ? 2.974 ? 
metalc72  metalc ? ? C  GLU 87 OE1 ? ? ? 1_555 DA DY  . DY B ? C GLU 128 C DY  201 1_555 ? ? ? ? ? ? ? 2.985 ? 
metalc73  metalc ? ? C  GLU 87 OE2 ? ? ? 1_555 DA DY  . DY A ? C GLU 128 C DY  201 1_555 ? ? ? ? ? ? ? 3.005 ? 
metalc74  metalc ? ? H  GLU 62 OE2 ? ? ? 1_555 BC DY  . DY ? ? H GLU 103 H DY  203 1_555 ? ? ? ? ? ? ? 3.025 ? 
metalc75  metalc ? ? C  GLU 84 OE1 ? ? ? 1_555 DA DY  . DY A ? C GLU 125 C DY  201 1_555 ? ? ? ? ? ? ? 3.030 ? 
metalc76  metalc ? ? RB DY  .  DY  ? ? ? 1_555 LC HOH . O  ? ? G DY  202 G HOH 319 1_555 ? ? ? ? ? ? ? 3.034 ? 
metalc77  metalc ? ? L  DY  .  DY  ? ? ? 1_555 TB SO4 . O1 ? ? A DY  204 G SO4 204 1_555 ? ? ? ? ? ? ? 3.037 ? 
metalc78  metalc ? ? QA DY  .  DY  ? ? ? 1_555 IC HOH . O  ? ? D DY  202 D HOH 303 1_555 ? ? ? ? ? ? ? 3.060 ? 
metalc79  metalc ? ? E  GLU 84 OE2 ? ? ? 1_555 YA DY  . DY B ? E GLU 125 E DY  201 1_555 ? ? ? ? ? ? ? 3.076 ? 
metalc80  metalc ? ? D  GLU 87 OE2 ? ? ? 1_555 QA DY  . DY ? ? D GLU 128 D DY  202 1_555 ? ? ? ? ? ? ? 3.102 ? 
metalc81  metalc ? ? E  GLU 84 OE1 ? ? ? 1_555 YA DY  . DY A ? E GLU 125 E DY  201 1_555 ? ? ? ? ? ? ? 3.102 ? 
metalc82  metalc ? ? L  DY  .  DY  ? ? ? 1_555 FC HOH . O  ? ? A DY  204 A HOH 320 1_555 ? ? ? ? ? ? ? 3.122 ? 
metalc83  metalc ? ? C  GLU 84 OE2 ? ? ? 1_555 DA DY  . DY A ? C GLU 125 C DY  201 1_555 ? ? ? ? ? ? ? 3.132 ? 
metalc84  metalc ? ? E  ASP 74 OD2 ? ? ? 1_555 AB DY  . DY ? ? E ASP 115 E DY  203 1_555 ? ? ? ? ? ? ? 3.145 ? 
metalc85  metalc ? ? A  GLU 87 OE2 ? ? ? 1_555 I  DY  . DY B ? A GLU 128 A DY  201 1_555 ? ? ? ? ? ? ? 3.166 ? 
metalc86  metalc ? ? A  GLU 84 OE2 ? ? ? 1_555 I  DY  . DY A ? A GLU 125 A DY  201 1_555 ? ? ? ? ? ? ? 3.180 ? 
metalc87  metalc ? ? G  ASP 74 OD2 ? ? ? 1_555 QB DY  . DY ? ? G ASP 115 G DY  201 1_555 ? ? ? ? ? ? ? 3.216 ? 
metalc88  metalc ? ? JB DY  .  DY  ? ? ? 1_555 KC HOH . O  ? ? F DY  202 F HOH 307 1_555 ? ? ? ? ? ? ? 3.249 ? 
metalc89  metalc ? ? F  GLU 84 OE1 ? ? ? 1_555 JB DY  . DY ? ? F GLU 125 F DY  202 1_555 ? ? ? ? ? ? ? 3.282 ? 
metalc90  metalc ? ? I  DY  .  DY  B ? ? 1_555 GC HOH . O  ? ? A DY  201 B HOH 305 1_555 ? ? ? ? ? ? ? 3.286 ? 
metalc91  metalc ? ? B  ASP 74 OD2 ? ? ? 1_555 U  DY  . DY ? ? B ASP 115 B DY  201 1_555 ? ? ? ? ? ? ? 3.307 ? 
metalc92  metalc ? ? A  ASP 74 OD2 ? ? ? 1_555 L  DY  . DY ? ? A ASP 115 A DY  204 1_555 ? ? ? ? ? ? ? 3.323 ? 
metalc93  metalc ? ? IB DY  .  DY  ? ? ? 1_555 KC HOH . O  ? ? F DY  201 F HOH 314 1_555 ? ? ? ? ? ? ? 3.325 ? 
metalc94  metalc ? ? G  GLU 87 OE2 ? ? ? 1_555 RB DY  . DY ? ? G GLU 128 G DY  202 1_555 ? ? ? ? ? ? ? 3.333 ? 
metalc95  metalc ? ? YA DY  .  DY  B ? ? 1_555 JC HOH . O  ? ? E DY  201 E HOH 312 1_555 ? ? ? ? ? ? ? 3.347 ? 
metalc96  metalc ? ? D  ASP 74 OD2 ? ? ? 1_555 PA DY  . DY ? ? D ASP 115 D DY  201 1_555 ? ? ? ? ? ? ? 3.386 ? 
metalc97  metalc ? ? E  GLU 87 OE1 ? ? ? 1_555 YA DY  . DY B ? E GLU 128 E DY  201 1_555 ? ? ? ? ? ? ? 3.398 ? 
metalc98  metalc ? ? F  GLU 87 OE2 ? ? ? 1_555 JB DY  . DY ? ? F GLU 128 F DY  202 1_555 ? ? ? ? ? ? ? 3.421 ? 
metalc99  metalc ? ? C  ASP 74 OD2 ? ? ? 1_555 FA DY  . DY ? ? C ASP 115 C DY  203 1_555 ? ? ? ? ? ? ? 3.423 ? 
metalc100 metalc ? ? C  GLU 84 OE2 ? ? ? 1_555 DA DY  . DY B ? C GLU 125 C DY  201 1_555 ? ? ? ? ? ? ? 3.465 ? 
metalc101 metalc ? ? H  ASP 74 OD2 ? ? ? 1_555 ZB DY  . DY ? ? H ASP 115 H DY  201 1_555 ? ? ? ? ? ? ? 3.488 ? 
metalc102 metalc ? ? A  GLU 87 OE1 ? ? ? 1_555 I  DY  . DY B ? A GLU 128 A DY  201 1_555 ? ? ? ? ? ? ? 3.496 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE DY A 201'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE DY A 202'  
AC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE DY A 203'  
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE DY A 204'  
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 205' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 206' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 207' 
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 209' 
AC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 210' 
BC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PT A 211'  
BC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE DTT A 212' 
BC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE DY B 201'  
BC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE DY B 202'  
BC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE DY B 203'  
BC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 B 204' 
BC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 B 205' 
BC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 B 206' 
BC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 B 207' 
CC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PT B 208'  
CC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO B 209' 
CC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE DY C 201'  
CC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE DY C 202'  
CC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE DY C 203'  
CC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 C 204' 
CC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 C 205' 
CC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 C 206' 
CC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 C 207' 
DC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 C 208' 
DC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 C 209' 
DC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 C 210' 
DC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PT C 211'  
DC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE IPA C 212' 
DC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE DY D 201'  
DC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE DY D 202'  
DC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE DY D 203'  
DC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 D 204' 
EC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 D 205' 
EC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PT D 206'  
EC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO D 207' 
EC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO D 208' 
EC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE IPA D 209' 
EC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE DY E 201'  
EC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE DY E 202'  
EC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE DY E 203'  
EC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE DY E 204'  
FC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE DY E 205'  
FC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 E 206' 
FC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PT E 207'  
FC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO E 208' 
FC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO E 209' 
FC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE IPA E 210' 
FC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE DY F 201'  
FC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE DY F 202'  
FC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE DY F 203'  
GC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 F 204' 
GC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE EDO F 205' 
GC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE IPA F 206' 
GC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE IPA F 207' 
GC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE IPA F 208' 
GC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE DY G 201'  
GC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE DY G 202'  
GC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 G 203' 
GC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 G 204' 
HC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 G 205' 
HC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 G 206' 
HC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE SO4 G 208' 
HC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE PT G 209'  
HC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE DY H 201'  
HC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE DY H 202'  
HC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE DY H 203'  
HC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 H 204' 
HC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 H 205' 
IC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO H 206' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  GLU A  84 ? GLU A 125 . ? 1_555 ? 
2   AC1 6  GLU A  87 ? GLU A 128 . ? 1_555 ? 
3   AC1 6  GLU B  72 ? GLU B 113 . ? 1_555 ? 
4   AC1 6  HOH GC .  ? HOH B 305 . ? 1_555 ? 
5   AC1 6  GLU E  72 ? GLU E 113 . ? 1_555 ? 
6   AC1 6  DY  ZA .  ? DY  E 202 . ? 1_555 ? 
7   AC2 4  GLU A  72 ? GLU A 113 . ? 1_555 ? 
8   AC2 4  GLU E  84 ? GLU E 125 . ? 1_555 ? 
9   AC2 4  DY  YA .  ? DY  E 201 . ? 1_555 ? 
10  AC2 4  HOH JC .  ? HOH E 304 . ? 1_555 ? 
11  AC3 1  GLU A  62 ? GLU A 103 . ? 1_555 ? 
12  AC4 2  ASP A  74 ? ASP A 115 . ? 1_555 ? 
13  AC4 2  SO4 TB .  ? SO4 G 204 . ? 1_555 ? 
14  AC5 4  ASN A  80 ? ASN A 121 . ? 1_555 ? 
15  AC5 4  HOH GC .  ? HOH B 304 . ? 1_555 ? 
16  AC5 4  SER E  76 ? SER E 117 . ? 1_555 ? 
17  AC5 4  ASN E  80 ? ASN E 121 . ? 1_555 ? 
18  AC6 5  ARG A  81 ? ARG A 122 . ? 1_555 ? 
19  AC6 5  SER F  59 ? SER F 100 . ? 1_455 ? 
20  AC6 5  EDO MB .  ? EDO F 205 . ? 1_455 ? 
21  AC6 5  ASN G  56 ? ASN G 97  . ? 1_555 ? 
22  AC6 5  ILE G  60 ? ILE G 101 . ? 1_555 ? 
23  AC7 5  GLN A  85 ? GLN A 126 . ? 1_555 ? 
24  AC7 5  LYS A  88 ? LYS A 129 . ? 1_555 ? 
25  AC7 5  LEU G  49 ? LEU G 90  . ? 1_555 ? 
26  AC7 5  LEU G  50 ? LEU G 91  . ? 1_555 ? 
27  AC7 5  GLU G  53 ? GLU G 94  . ? 1_555 ? 
28  AC8 3  LYS A  67 ? LYS A 108 . ? 1_555 ? 
29  AC8 3  GLU A  70 ? GLU A 111 . ? 1_555 ? 
30  AC8 3  LEU A  71 ? LEU A 112 . ? 1_555 ? 
31  AC9 3  GLN A  21 ? GLN A 62  . ? 1_555 ? 
32  AC9 3  HOH JC .  ? HOH E 320 . ? 1_644 ? 
33  AC9 3  LYS F  17 ? LYS F 58  . ? 1_654 ? 
34  BC1 2  MET A  89 ? MET A 130 . ? 1_555 ? 
35  BC1 2  ASN F  54 ? ASN F 95  . ? 1_555 ? 
36  BC2 7  ASN A  80 ? ASN A 121 . ? 1_555 ? 
37  BC2 7  ASN A  83 ? ASN A 124 . ? 1_555 ? 
38  BC2 7  GLU A  84 ? GLU A 125 . ? 1_555 ? 
39  BC2 7  HOH FC .  ? HOH A 316 . ? 1_555 ? 
40  BC2 7  LYS B  69 ? LYS B 110 . ? 1_555 ? 
41  BC2 7  DY  ZA .  ? DY  E 202 . ? 1_555 ? 
42  BC2 7  HOH JC .  ? HOH E 326 . ? 1_555 ? 
43  BC3 1  ASP B  74 ? ASP B 115 . ? 1_555 ? 
44  BC4 2  GLU B  62 ? GLU B 103 . ? 1_555 ? 
45  BC4 2  HOH GC .  ? HOH B 321 . ? 1_555 ? 
46  BC5 2  GLU B  87 ? GLU B 128 . ? 1_555 ? 
47  BC5 2  HOH GC .  ? HOH B 322 . ? 1_555 ? 
48  BC6 5  ARG B  81 ? ARG B 122 . ? 1_555 ? 
49  BC6 5  SER E  59 ? SER E 100 . ? 1_655 ? 
50  BC6 5  EDO GB .  ? EDO E 209 . ? 1_655 ? 
51  BC6 5  ASN H  56 ? ASN H 97  . ? 1_555 ? 
52  BC6 5  EDO EC .  ? EDO H 206 . ? 1_555 ? 
53  BC7 3  ARG B  63 ? ARG B 104 . ? 1_555 ? 
54  BC7 3  LYS B  64 ? LYS B 105 . ? 1_555 ? 
55  BC7 3  ARG D  63 ? ARG D 104 . ? 1_655 ? 
56  BC8 3  ASN B  56 ? ASN B 97  . ? 1_555 ? 
57  BC8 3  SER D  59 ? SER D 100 . ? 1_655 ? 
58  BC8 3  ARG H  81 ? ARG H 122 . ? 1_555 ? 
59  BC9 8  ASP B  74 ? ASP B 115 . ? 1_555 ? 
60  BC9 8  GLU B  77 ? GLU B 118 . ? 1_555 ? 
61  BC9 8  LEU B  78 ? LEU B 119 . ? 1_555 ? 
62  BC9 8  ARG B  81 ? ARG B 122 . ? 1_555 ? 
63  BC9 8  HOH GC .  ? HOH B 319 . ? 1_555 ? 
64  BC9 8  ILE H  60 ? ILE H 101 . ? 1_555 ? 
65  BC9 8  LYS H  64 ? LYS H 105 . ? 1_555 ? 
66  BC9 8  EDO EC .  ? EDO H 206 . ? 1_555 ? 
67  CC1 2  MET B  89 ? MET B 130 . ? 1_555 ? 
68  CC1 2  ASN E  54 ? ASN E 95  . ? 1_555 ? 
69  CC2 5  ASN B  52 ? ASN B 93  . ? 1_555 ? 
70  CC2 5  GLU B  55 ? GLU B 96  . ? 1_555 ? 
71  CC2 5  ASN B  56 ? ASN B 97  . ? 1_555 ? 
72  CC2 5  HOH GC .  ? HOH B 312 . ? 1_555 ? 
73  CC2 5  EDO VA .  ? EDO D 207 . ? 1_655 ? 
74  CC3 5  GLU C  84 ? GLU C 125 . ? 1_555 ? 
75  CC3 5  GLU C  87 ? GLU C 128 . ? 1_555 ? 
76  CC3 5  HOH HC .  ? HOH C 321 . ? 1_555 ? 
77  CC3 5  GLU D  72 ? GLU D 113 . ? 1_545 ? 
78  CC3 5  GLU H  72 ? GLU H 113 . ? 1_545 ? 
79  CC4 5  GLU C  72 ? GLU C 113 . ? 1_555 ? 
80  CC4 5  GLU G  72 ? GLU G 113 . ? 1_555 ? 
81  CC4 5  HOH LC .  ? HOH G 317 . ? 1_555 ? 
82  CC4 5  GLU H  84 ? GLU H 125 . ? 1_545 ? 
83  CC4 5  GLU H  87 ? GLU H 128 . ? 1_545 ? 
84  CC5 1  ASP C  74 ? ASP C 115 . ? 1_555 ? 
85  CC6 6  SER A  59 ? SER A 100 . ? 1_655 ? 
86  CC6 6  ASN C  56 ? ASN C 97  . ? 1_555 ? 
87  CC6 6  ILE C  60 ? ILE C 101 . ? 1_555 ? 
88  CC6 6  HOH HC .  ? HOH C 310 . ? 1_555 ? 
89  CC6 6  HOH HC .  ? HOH C 313 . ? 1_555 ? 
90  CC6 6  ARG F  81 ? ARG F 122 . ? 1_555 ? 
91  CC7 4  ARG C  81 ? ARG C 122 . ? 1_555 ? 
92  CC7 4  ASN F  56 ? ASN F 97  . ? 1_555 ? 
93  CC7 4  SER G  59 ? SER G 100 . ? 1_655 ? 
94  CC7 4  HOH LC .  ? HOH G 316 . ? 1_655 ? 
95  CC8 3  ASN B  46 ? ASN B 87  . ? 1_545 ? 
96  CC8 3  LEU B  50 ? LEU B 91  . ? 1_545 ? 
97  CC8 3  LYS H  88 ? LYS H 129 . ? 1_545 ? 
98  CC9 7  ARG A  63 ? ARG A 104 . ? 1_655 ? 
99  CC9 7  ARG C  63 ? ARG C 104 . ? 1_555 ? 
100 CC9 7  LYS C  64 ? LYS C 105 . ? 1_555 ? 
101 CC9 7  SO4 KA .  ? SO4 C 208 . ? 1_555 ? 
102 CC9 7  HOH HC .  ? HOH C 317 . ? 1_555 ? 
103 CC9 7  ASP F  74 ? ASP F 115 . ? 1_555 ? 
104 CC9 7  IPA PB .  ? IPA F 208 . ? 1_555 ? 
105 DC1 5  ARG A  63 ? ARG A 104 . ? 1_655 ? 
106 DC1 5  LYS A  67 ? LYS A 108 . ? 1_655 ? 
107 DC1 5  ARG C  63 ? ARG C 104 . ? 1_555 ? 
108 DC1 5  LYS C  67 ? LYS C 108 . ? 1_555 ? 
109 DC1 5  SO4 JA .  ? SO4 C 207 . ? 1_555 ? 
110 DC2 4  ARG A  63 ? ARG A 104 . ? 1_655 ? 
111 DC2 4  LYS A  64 ? LYS A 105 . ? 1_655 ? 
112 DC2 4  ARG C  63 ? ARG C 104 . ? 1_555 ? 
113 DC2 4  SO4 VB .  ? SO4 G 206 . ? 1_655 ? 
114 DC3 8  ASP D  74 ? ASP D 115 . ? 1_545 ? 
115 DC3 8  GLU D  77 ? GLU D 118 . ? 1_545 ? 
116 DC3 8  LEU D  78 ? LEU D 119 . ? 1_545 ? 
117 DC3 8  ARG D  81 ? ARG D 122 . ? 1_545 ? 
118 DC3 8  HOH IC .  ? HOH D 308 . ? 1_545 ? 
119 DC3 8  ILE E  60 ? ILE E 101 . ? 1_545 ? 
120 DC3 8  LYS E  64 ? LYS E 105 . ? 1_545 ? 
121 DC3 8  SO4 DC .  ? SO4 H 205 . ? 1_445 ? 
122 DC4 2  MET C  89 ? MET C 130 . ? 1_555 ? 
123 DC4 2  ASN G  54 ? ASN G 95  . ? 1_555 ? 
124 DC5 2  ASN C  80 ? ASN C 121 . ? 1_555 ? 
125 DC5 2  ASN H  80 ? ASN H 121 . ? 1_545 ? 
126 DC6 2  ASP D  74 ? ASP D 115 . ? 1_555 ? 
127 DC6 2  HOH IC .  ? HOH D 308 . ? 1_555 ? 
128 DC7 2  GLU D  87 ? GLU D 128 . ? 1_555 ? 
129 DC7 2  HOH IC .  ? HOH D 303 . ? 1_555 ? 
130 DC8 2  GLU D  62 ? GLU D 103 . ? 1_555 ? 
131 DC8 2  HOH IC .  ? HOH D 313 . ? 1_555 ? 
132 DC9 5  ARG D  81 ? ARG D 122 . ? 1_555 ? 
133 DC9 5  ASN E  56 ? ASN E 97  . ? 1_555 ? 
134 DC9 5  ILE E  60 ? ILE E 101 . ? 1_555 ? 
135 DC9 5  IPA HB .  ? IPA E 210 . ? 1_555 ? 
136 DC9 5  SER H  59 ? SER H 100 . ? 1_455 ? 
137 EC1 5  GLN D  85 ? GLN D 126 . ? 1_555 ? 
138 EC1 5  LYS D  88 ? LYS D 129 . ? 1_555 ? 
139 EC1 5  LEU E  49 ? LEU E 90  . ? 1_555 ? 
140 EC1 5  LEU E  50 ? LEU E 91  . ? 1_555 ? 
141 EC1 5  GLU E  53 ? GLU E 94  . ? 1_555 ? 
142 EC2 2  ASN D  54 ? ASN D 95  . ? 1_555 ? 
143 EC2 2  MET H  89 ? MET H 130 . ? 1_555 ? 
144 EC3 5  ASN B  52 ? ASN B 93  . ? 1_455 ? 
145 EC3 5  ASN B  56 ? ASN B 97  . ? 1_455 ? 
146 EC3 5  EDO CA .  ? EDO B 209 . ? 1_455 ? 
147 EC3 5  ASN D  52 ? ASN D 93  . ? 1_555 ? 
148 EC3 5  ASN D  56 ? ASN D 97  . ? 1_555 ? 
149 EC4 4  ARG B  63 ? ARG B 104 . ? 1_455 ? 
150 EC4 4  ARG D  63 ? ARG D 104 . ? 1_555 ? 
151 EC4 4  LYS D  64 ? LYS D 105 . ? 1_555 ? 
152 EC4 4  SO4 DB .  ? SO4 E 206 . ? 1_555 ? 
153 EC5 3  GLU D  53 ? GLU D 94  . ? 1_555 ? 
154 EC5 3  ASN D  56 ? ASN D 97  . ? 1_555 ? 
155 EC5 3  ARG E  81 ? ARG E 122 . ? 1_555 ? 
156 EC6 6  GLU A  72 ? GLU A 113 . ? 1_555 ? 
157 EC6 6  DY  J  .  ? DY  A 202 . ? 1_555 ? 
158 EC6 6  GLU E  84 ? GLU E 125 . ? 1_555 ? 
159 EC6 6  GLU E  87 ? GLU E 128 . ? 1_555 ? 
160 EC6 6  HOH JC .  ? HOH E 319 . ? 1_555 ? 
161 EC6 6  GLU F  72 ? GLU F 113 . ? 1_555 ? 
162 EC7 4  GLU A  84 ? GLU A 125 . ? 1_555 ? 
163 EC7 4  DY  I  .  ? DY  A 201 . ? 1_555 ? 
164 EC7 4  DTT T  .  ? DTT A 212 . ? 1_555 ? 
165 EC7 4  GLU E  72 ? GLU E 113 . ? 1_555 ? 
166 EC8 1  ASP E  74 ? ASP E 115 . ? 1_555 ? 
167 EC9 1  GLU E  77 ? GLU E 118 . ? 1_555 ? 
168 FC1 1  GLU E  62 ? GLU E 103 . ? 1_555 ? 
169 FC2 4  ASN D  56 ? ASN D 97  . ? 1_555 ? 
170 FC2 4  ILE D  60 ? ILE D 101 . ? 1_555 ? 
171 FC2 4  EDO WA .  ? EDO D 208 . ? 1_555 ? 
172 FC2 4  ARG E  81 ? ARG E 122 . ? 1_555 ? 
173 FC3 2  ASN B  54 ? ASN B 95  . ? 1_555 ? 
174 FC3 2  MET E  89 ? MET E 130 . ? 1_555 ? 
175 FC4 4  ILE D  60 ? ILE D 101 . ? 1_555 ? 
176 FC4 4  ASP E  74 ? ASP E 115 . ? 1_555 ? 
177 FC4 4  GLU E  77 ? GLU E 118 . ? 1_555 ? 
178 FC4 4  ARG E  81 ? ARG E 122 . ? 1_555 ? 
179 FC5 3  SO4 X  .  ? SO4 B 204 . ? 1_455 ? 
180 FC5 3  ASN E  52 ? ASN E 93  . ? 1_555 ? 
181 FC5 3  HOH JC .  ? HOH E 322 . ? 1_555 ? 
182 FC6 5  SO4 SA .  ? SO4 D 204 . ? 1_555 ? 
183 FC6 5  ASN E  56 ? ASN E 97  . ? 1_555 ? 
184 FC6 5  GLU H  55 ? GLU H 96  . ? 1_455 ? 
185 FC6 5  ASN H  56 ? ASN H 97  . ? 1_455 ? 
186 FC6 5  HOH MC .  ? HOH H 326 . ? 1_455 ? 
187 FC7 2  ASP F  74 ? ASP F 115 . ? 1_555 ? 
188 FC7 2  HOH KC .  ? HOH F 312 . ? 1_555 ? 
189 FC8 2  GLU F  84 ? GLU F 125 . ? 1_555 ? 
190 FC8 2  GLU F  87 ? GLU F 128 . ? 1_555 ? 
191 FC9 1  GLU F  62 ? GLU F 103 . ? 1_555 ? 
192 GC1 4  LEU C  49 ? LEU C 90  . ? 1_555 ? 
193 GC1 4  GLU C  53 ? GLU C 94  . ? 1_555 ? 
194 GC1 4  GLN F  85 ? GLN F 126 . ? 1_555 ? 
195 GC1 4  LYS F  88 ? LYS F 129 . ? 1_555 ? 
196 GC2 10 SO4 N  .  ? SO4 A 206 . ? 1_655 ? 
197 GC2 10 ASN F  56 ? ASN F 97  . ? 1_555 ? 
198 GC2 10 SER F  59 ? SER F 100 . ? 1_555 ? 
199 GC2 10 ILE F  60 ? ILE F 101 . ? 1_555 ? 
200 GC2 10 ARG F  63 ? ARG F 104 . ? 1_555 ? 
201 GC2 10 IPA NB .  ? IPA F 206 . ? 1_555 ? 
202 GC2 10 ASN G  56 ? ASN G 97  . ? 1_655 ? 
203 GC2 10 ARG G  63 ? ARG G 104 . ? 1_655 ? 
204 GC2 10 HOH LC .  ? HOH G 302 . ? 1_655 ? 
205 GC2 10 HOH LC .  ? HOH G 316 . ? 1_655 ? 
206 GC3 6  ASN F  52 ? ASN F 93  . ? 1_555 ? 
207 GC3 6  GLU F  55 ? GLU F 96  . ? 1_555 ? 
208 GC3 6  ASN F  56 ? ASN F 97  . ? 1_555 ? 
209 GC3 6  EDO MB .  ? EDO F 205 . ? 1_555 ? 
210 GC3 6  IPA OB .  ? IPA F 207 . ? 1_555 ? 
211 GC3 6  ASN G  56 ? ASN G 97  . ? 1_655 ? 
212 GC4 5  ASN F  52 ? ASN F 93  . ? 1_555 ? 
213 GC4 5  IPA NB .  ? IPA F 206 . ? 1_555 ? 
214 GC4 5  ASN G  52 ? ASN G 93  . ? 1_655 ? 
215 GC4 5  GLU G  55 ? GLU G 96  . ? 1_655 ? 
216 GC4 5  ASN G  56 ? ASN G 97  . ? 1_655 ? 
217 GC5 6  ILE C  60 ? ILE C 101 . ? 1_555 ? 
218 GC5 6  LYS C  64 ? LYS C 105 . ? 1_555 ? 
219 GC5 6  SO4 JA .  ? SO4 C 207 . ? 1_555 ? 
220 GC5 6  HOH HC .  ? HOH C 313 . ? 1_555 ? 
221 GC5 6  ASP F  74 ? ASP F 115 . ? 1_555 ? 
222 GC5 6  LEU F  78 ? LEU F 119 . ? 1_555 ? 
223 GC6 2  ASP G  74 ? ASP G 115 . ? 1_555 ? 
224 GC6 2  HOH LC .  ? HOH G 309 . ? 1_555 ? 
225 GC7 2  GLU G  87 ? GLU G 128 . ? 1_555 ? 
226 GC7 2  HOH LC .  ? HOH G 319 . ? 1_555 ? 
227 GC8 2  ASN A  56 ? ASN A 97  . ? 1_555 ? 
228 GC8 2  ARG G  81 ? ARG G 122 . ? 1_555 ? 
229 GC9 4  DY  L  .  ? DY  A 204 . ? 1_555 ? 
230 GC9 4  ARG F  63 ? ARG F 104 . ? 1_455 ? 
231 GC9 4  ARG G  63 ? ARG G 104 . ? 1_555 ? 
232 GC9 4  LYS G  64 ? LYS G 105 . ? 1_555 ? 
233 HC1 3  LYS C  73 ? LYS C 114 . ? 1_455 ? 
234 HC1 3  SO4 XB .  ? SO4 G 208 . ? 1_555 ? 
235 HC1 3  HOH MC .  ? HOH H 318 . ? 1_445 ? 
236 HC2 5  LYS A  64 ? LYS A 105 . ? 1_555 ? 
237 HC2 5  SO4 LA .  ? SO4 C 209 . ? 1_455 ? 
238 HC2 5  ASP G  74 ? ASP G 115 . ? 1_555 ? 
239 HC2 5  GLU G  77 ? GLU G 118 . ? 1_555 ? 
240 HC2 5  HOH LC .  ? HOH G 309 . ? 1_555 ? 
241 HC3 1  SO4 UB .  ? SO4 G 205 . ? 1_555 ? 
242 HC4 3  ASN C  54 ? ASN C 95  . ? 1_555 ? 
243 HC4 3  GLN G  85 ? GLN G 126 . ? 1_555 ? 
244 HC4 3  MET G  89 ? MET G 130 . ? 1_555 ? 
245 HC5 1  ASP H  74 ? ASP H 115 . ? 1_555 ? 
246 HC6 4  GLU C  84 ? GLU C 125 . ? 1_565 ? 
247 HC6 4  LYS H  69 ? LYS H 110 . ? 1_555 ? 
248 HC6 4  GLU H  72 ? GLU H 113 . ? 1_555 ? 
249 HC6 4  HOH MC .  ? HOH H 313 . ? 1_555 ? 
250 HC7 1  GLU H  62 ? GLU H 103 . ? 1_555 ? 
251 HC8 3  ARG E  63 ? ARG E 104 . ? 1_655 ? 
252 HC8 3  ARG H  63 ? ARG H 104 . ? 1_555 ? 
253 HC8 3  LYS H  67 ? LYS H 108 . ? 1_555 ? 
254 HC9 4  SO4 MA .  ? SO4 C 210 . ? 1_665 ? 
255 HC9 4  ARG E  63 ? ARG E 104 . ? 1_655 ? 
256 HC9 4  LYS E  64 ? LYS E 105 . ? 1_655 ? 
257 HC9 4  ARG H  63 ? ARG H 104 . ? 1_555 ? 
258 IC1 6  SO4 X  .  ? SO4 B 204 . ? 1_555 ? 
259 IC1 6  SO4 AA .  ? SO4 B 207 . ? 1_555 ? 
260 IC1 6  HOH GC .  ? HOH B 319 . ? 1_555 ? 
261 IC1 6  ARG E  63 ? ARG E 104 . ? 1_655 ? 
262 IC1 6  ARG H  63 ? ARG H 104 . ? 1_555 ? 
263 IC1 6  LYS H  64 ? LYS H 105 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4LL7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4LL7 
_atom_sites.fract_transf_matrix[1][1]   0.035626 
_atom_sites.fract_transf_matrix[1][2]   -0.000012 
_atom_sites.fract_transf_matrix[1][3]   -0.003324 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020171 
_atom_sites.fract_transf_matrix[2][3]   -0.000013 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006698 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
DY 
N  
O  
PT 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A  1 2  ? 0.532   -13.955 -99.751  1.00 144.05 ? 43  SER A N   1 
ATOM   2    C  CA  . SER A  1 2  ? 0.321   -15.315 -99.144  1.00 144.05 ? 43  SER A CA  1 
ATOM   3    C  C   . SER A  1 2  ? 1.493   -15.655 -98.192  1.00 144.05 ? 43  SER A C   1 
ATOM   4    O  O   . SER A  1 2  ? 1.276   -16.127 -97.077  1.00 144.05 ? 43  SER A O   1 
ATOM   5    C  CB  . SER A  1 2  ? 0.219   -16.366 -100.255 1.00 143.09 ? 43  SER A CB  1 
ATOM   6    O  OG  . SER A  1 2  ? -0.015  -17.750 -99.795  1.00 143.09 ? 43  SER A OG  1 
ATOM   7    N  N   . ARG A  1 3  ? 2.741   -15.496 -98.638  1.00 141.94 ? 44  ARG A N   1 
ATOM   8    C  CA  . ARG A  1 3  ? 3.867   -15.653 -97.668  1.00 141.95 ? 44  ARG A CA  1 
ATOM   9    C  C   . ARG A  1 3  ? 3.634   -14.527 -96.627  1.00 142.34 ? 44  ARG A C   1 
ATOM   10   O  O   . ARG A  1 3  ? 4.020   -14.627 -95.443  1.00 142.69 ? 44  ARG A O   1 
ATOM   11   C  CB  . ARG A  1 3  ? 5.246   -15.382 -98.283  1.00 136.71 ? 44  ARG A CB  1 
ATOM   12   C  CG  . ARG A  1 3  ? 5.745   -16.566 -98.869  1.00 141.42 ? 44  ARG A CG  1 
ATOM   13   C  CD  . ARG A  1 3  ? 7.151   -16.357 -99.418  1.00 143.93 ? 44  ARG A CD  1 
ATOM   14   N  NE  . ARG A  1 3  ? 8.088   -17.481 -99.377  1.00 141.90 ? 44  ARG A NE  1 
ATOM   15   C  CZ  . ARG A  1 3  ? 9.412   -17.365 -99.547  1.00 136.65 ? 44  ARG A CZ  1 
ATOM   16   N  NH1 . ARG A  1 3  ? 10.032  -16.187 -99.777  1.00 130.44 ? 44  ARG A NH1 1 
ATOM   17   N  NH2 . ARG A  1 3  ? 10.134  -18.462 -99.468  1.00 133.37 ? 44  ARG A NH2 1 
ATOM   18   N  N   . VAL A  1 4  ? 3.048   -13.426 -97.109  1.00 139.89 ? 45  VAL A N   1 
ATOM   19   C  CA  . VAL A  1 4  ? 2.707   -12.253 -96.292  1.00 139.38 ? 45  VAL A CA  1 
ATOM   20   C  C   . VAL A  1 4  ? 1.814   -12.697 -95.205  1.00 139.12 ? 45  VAL A C   1 
ATOM   21   O  O   . VAL A  1 4  ? 2.210   -12.627 -94.071  1.00 138.74 ? 45  VAL A O   1 
ATOM   22   C  CB  . VAL A  1 4  ? 1.936   -11.155 -97.101  1.00 135.61 ? 45  VAL A CB  1 
ATOM   23   C  CG1 . VAL A  1 4  ? 2.934   -10.431 -97.964  1.00 135.35 ? 45  VAL A CG1 1 
ATOM   24   C  CG2 . VAL A  1 4  ? 0.791   -11.784 -97.974  1.00 130.27 ? 45  VAL A CG2 1 
ATOM   25   N  N   . ILE A  1 5  ? 0.701   -13.326 -95.583  1.00 139.75 ? 46  ILE A N   1 
ATOM   26   C  CA  . ILE A  1 5  ? -0.332  -13.749 -94.640  1.00 136.23 ? 46  ILE A CA  1 
ATOM   27   C  C   . ILE A  1 5  ? -0.019  -14.648 -93.449  1.00 134.77 ? 46  ILE A C   1 
ATOM   28   O  O   . ILE A  1 5  ? -0.241  -14.256 -92.294  1.00 130.76 ? 46  ILE A O   1 
ATOM   29   C  CB  . ILE A  1 5  ? -1.549  -14.332 -95.420  1.00 137.47 ? 46  ILE A CB  1 
ATOM   30   C  CG1 . ILE A  1 5  ? -1.946  -13.359 -96.541  1.00 131.98 ? 46  ILE A CG1 1 
ATOM   31   C  CG2 . ILE A  1 5  ? -2.735  -14.541 -94.477  1.00 136.12 ? 46  ILE A CG2 1 
ATOM   32   C  CD1 . ILE A  1 5  ? -3.019  -13.903 -97.465  1.00 125.37 ? 46  ILE A CD1 1 
ATOM   33   N  N   . GLU A  1 6  ? 0.487   -15.838 -93.731  1.00 134.80 ? 47  GLU A N   1 
ATOM   34   C  CA  . GLU A  1 6  ? 0.796   -16.785 -92.686  1.00 136.07 ? 47  GLU A CA  1 
ATOM   35   C  C   . GLU A  1 6  ? 2.020   -16.387 -91.865  1.00 133.16 ? 47  GLU A C   1 
ATOM   36   O  O   . GLU A  1 6  ? 2.181   -16.833 -90.727  1.00 133.59 ? 47  GLU A O   1 
ATOM   37   C  CB  . GLU A  1 6  ? 0.936   -18.171 -93.303  1.00 137.32 ? 47  GLU A CB  1 
ATOM   38   C  CG  . GLU A  1 6  ? -0.320  -18.579 -94.079  1.00 146.55 ? 47  GLU A CG  1 
ATOM   39   C  CD  . GLU A  1 6  ? -0.262  -19.996 -94.608  1.00 151.86 ? 47  GLU A CD  1 
ATOM   40   O  OE1 . GLU A  1 6  ? 0.859   -20.517 -94.777  1.00 154.58 ? 47  GLU A OE1 1 
ATOM   41   O  OE2 . GLU A  1 6  ? -1.334  -20.583 -94.871  1.00 150.46 ? 47  GLU A OE2 1 
ATOM   42   N  N   . SER A  1 7  ? 2.885   -15.557 -92.440  1.00 130.68 ? 48  SER A N   1 
ATOM   43   C  CA  . SER A  1 7  ? 4.039   -15.056 -91.706  1.00 126.03 ? 48  SER A CA  1 
ATOM   44   C  C   . SER A  1 7  ? 3.376   -14.168 -90.663  1.00 126.22 ? 48  SER A C   1 
ATOM   45   O  O   . SER A  1 7  ? 3.728   -14.180 -89.483  1.00 131.54 ? 48  SER A O   1 
ATOM   46   C  CB  . SER A  1 7  ? 4.925   -14.199 -92.609  1.00 127.23 ? 48  SER A CB  1 
ATOM   47   O  OG  . SER A  1 7  ? 5.924   -13.535 -91.856  1.00 122.52 ? 48  SER A OG  1 
ATOM   48   N  N   . LEU A  1 8  ? 2.392   -13.408 -91.139  1.00 124.29 ? 49  LEU A N   1 
ATOM   49   C  CA  . LEU A  1 8  ? 1.604   -12.495 -90.323  1.00 126.17 ? 49  LEU A CA  1 
ATOM   50   C  C   . LEU A  1 8  ? 0.881   -13.262 -89.216  1.00 132.04 ? 49  LEU A C   1 
ATOM   51   O  O   . LEU A  1 8  ? 0.854   -12.826 -88.064  1.00 132.15 ? 49  LEU A O   1 
ATOM   52   C  CB  . LEU A  1 8  ? 0.600   -11.754 -91.225  1.00 123.56 ? 49  LEU A CB  1 
ATOM   53   C  CG  . LEU A  1 8  ? -0.528  -10.886 -90.662  1.00 122.68 ? 49  LEU A CG  1 
ATOM   54   C  CD1 . LEU A  1 8  ? -0.046  -10.105 -89.463  1.00 121.59 ? 49  LEU A CD1 1 
ATOM   55   C  CD2 . LEU A  1 8  ? -1.023  -9.945  -91.753  1.00 124.22 ? 49  LEU A CD2 1 
ATOM   56   N  N   . HIS A  1 9  ? 0.311   -14.414 -89.565  1.00 129.50 ? 50  HIS A N   1 
ATOM   57   C  CA  . HIS A  1 9  ? -0.406  -15.240 -88.598  1.00 128.22 ? 50  HIS A CA  1 
ATOM   58   C  C   . HIS A  1 9  ? 0.503   -15.730 -87.476  1.00 124.51 ? 50  HIS A C   1 
ATOM   59   O  O   . HIS A  1 9  ? 0.124   -15.688 -86.305  1.00 122.96 ? 50  HIS A O   1 
ATOM   60   C  CB  . HIS A  1 9  ? -1.048  -16.443 -89.295  1.00 126.69 ? 50  HIS A CB  1 
ATOM   61   C  CG  . HIS A  1 9  ? -2.197  -16.086 -90.186  1.00 127.71 ? 50  HIS A CG  1 
ATOM   62   N  ND1 . HIS A  1 9  ? -3.349  -15.494 -89.716  1.00 128.22 ? 50  HIS A ND1 1 
ATOM   63   C  CD2 . HIS A  1 9  ? -2.377  -16.253 -91.518  1.00 127.76 ? 50  HIS A CD2 1 
ATOM   64   C  CE1 . HIS A  1 9  ? -4.190  -15.311 -90.719  1.00 125.62 ? 50  HIS A CE1 1 
ATOM   65   N  NE2 . HIS A  1 9  ? -3.624  -15.763 -91.823  1.00 127.54 ? 50  HIS A NE2 1 
ATOM   66   N  N   . ASP A  1 10 ? 1.699   -16.194 -87.833  1.00 121.10 ? 51  ASP A N   1 
ATOM   67   C  CA  . ASP A  1 10 ? 2.649   -16.684 -86.840  1.00 124.06 ? 51  ASP A CA  1 
ATOM   68   C  C   . ASP A  1 10 ? 2.827   -15.691 -85.698  1.00 126.60 ? 51  ASP A C   1 
ATOM   69   O  O   . ASP A  1 10 ? 3.330   -16.043 -84.629  1.00 122.64 ? 51  ASP A O   1 
ATOM   70   C  CB  . ASP A  1 10 ? 4.006   -16.978 -87.482  1.00 123.08 ? 51  ASP A CB  1 
ATOM   71   C  CG  . ASP A  1 10 ? 3.960   -18.170 -88.416  1.00 131.24 ? 51  ASP A CG  1 
ATOM   72   O  OD1 . ASP A  1 10 ? 3.030   -18.992 -88.284  1.00 132.68 ? 51  ASP A OD1 1 
ATOM   73   O  OD2 . ASP A  1 10 ? 4.861   -18.294 -89.273  1.00 137.75 ? 51  ASP A OD2 1 
ATOM   74   N  N   . GLN A  1 11 ? 2.416   -14.449 -85.930  1.00 121.32 ? 52  GLN A N   1 
ATOM   75   C  CA  . GLN A  1 11 ? 2.507   -13.416 -84.910  1.00 124.50 ? 52  GLN A CA  1 
ATOM   76   C  C   . GLN A  1 11 ? 1.238   -13.378 -84.069  1.00 125.79 ? 52  GLN A C   1 
ATOM   77   O  O   . GLN A  1 11 ? 1.295   -13.210 -82.851  1.00 127.46 ? 52  GLN A O   1 
ATOM   78   C  CB  . GLN A  1 11 ? 2.724   -12.049 -85.544  1.00 124.14 ? 52  GLN A CB  1 
ATOM   79   C  CG  . GLN A  1 11 ? 4.138   -11.795 -86.003  1.00 126.88 ? 52  GLN A CG  1 
ATOM   80   C  CD  . GLN A  1 11 ? 4.513   -10.345 -85.833  1.00 124.75 ? 52  GLN A CD  1 
ATOM   81   O  OE1 . GLN A  1 11 ? 3.756   -9.454  -86.216  1.00 123.41 ? 52  GLN A OE1 1 
ATOM   82   N  NE2 . GLN A  1 11 ? 5.684   -10.094 -85.254  1.00 119.25 ? 52  GLN A NE2 1 
ATOM   83   N  N   . ILE A  1 12 ? 0.092   -13.524 -84.727  1.00 120.27 ? 53  ILE A N   1 
ATOM   84   C  CA  . ILE A  1 12 ? -1.188  -13.518 -84.033  1.00 118.50 ? 53  ILE A CA  1 
ATOM   85   C  C   . ILE A  1 12 ? -1.231  -14.657 -83.019  1.00 117.97 ? 53  ILE A C   1 
ATOM   86   O  O   . ILE A  1 12 ? -1.644  -14.461 -81.877  1.00 118.65 ? 53  ILE A O   1 
ATOM   87   C  CB  . ILE A  1 12 ? -2.367  -13.692 -85.022  1.00 116.24 ? 53  ILE A CB  1 
ATOM   88   C  CG1 . ILE A  1 12 ? -2.476  -12.472 -85.945  1.00 115.45 ? 53  ILE A CG1 1 
ATOM   89   C  CG2 . ILE A  1 12 ? -3.663  -13.908 -84.250  1.00 110.96 ? 53  ILE A CG2 1 
ATOM   90   C  CD1 . ILE A  1 12 ? -3.177  -11.265 -85.333  1.00 116.75 ? 53  ILE A CD1 1 
ATOM   91   N  N   . ASP A  1 13 ? -0.800  -15.846 -83.435  1.00 115.24 ? 54  ASP A N   1 
ATOM   92   C  CA  . ASP A  1 13 ? -0.808  -17.000 -82.542  1.00 119.11 ? 54  ASP A CA  1 
ATOM   93   C  C   . ASP A  1 13 ? 0.136   -16.789 -81.366  1.00 119.24 ? 54  ASP A C   1 
ATOM   94   O  O   . ASP A  1 13 ? -0.167  -17.190 -80.244  1.00 120.48 ? 54  ASP A O   1 
ATOM   95   C  CB  . ASP A  1 13 ? -0.421  -18.282 -83.293  1.00 122.79 ? 54  ASP A CB  1 
ATOM   96   C  CG  . ASP A  1 13 ? 1.061   -18.355 -83.617  1.00 126.57 ? 54  ASP A CG  1 
ATOM   97   O  OD1 . ASP A  1 13 ? 1.888   -18.350 -82.679  1.00 121.43 ? 54  ASP A OD1 1 
ATOM   98   O  OD2 . ASP A  1 13 ? 1.398   -18.429 -84.817  1.00 135.08 ? 54  ASP A OD2 1 
ATOM   99   N  N   . MET A  1 14 ? 1.279   -16.159 -81.624  1.00 116.76 ? 55  MET A N   1 
ATOM   100  C  CA  . MET A  1 14 ? 2.249   -15.903 -80.568  1.00 116.39 ? 55  MET A CA  1 
ATOM   101  C  C   . MET A  1 14 ? 1.665   -14.915 -79.568  1.00 114.61 ? 55  MET A C   1 
ATOM   102  O  O   . MET A  1 14 ? 1.891   -15.025 -78.363  1.00 114.63 ? 55  MET A O   1 
ATOM   103  C  CB  . MET A  1 14 ? 3.547   -15.342 -81.150  1.00 117.87 ? 55  MET A CB  1 
ATOM   104  C  CG  . MET A  1 14 ? 4.614   -15.075 -80.099  1.00 121.72 ? 55  MET A CG  1 
ATOM   105  S  SD  . MET A  1 14 ? 6.225   -14.657 -80.794  1.00 132.61 ? 55  MET A SD  1 
ATOM   106  C  CE  . MET A  1 14 ? 6.989   -16.292 -80.893  1.00 124.52 ? 55  MET A CE  1 
ATOM   107  N  N   . LEU A  1 15 ? 0.909   -13.950 -80.079  1.00 113.73 ? 56  LEU A N   1 
ATOM   108  C  CA  . LEU A  1 15 ? 0.281   -12.946 -79.233  1.00 110.51 ? 56  LEU A CA  1 
ATOM   109  C  C   . LEU A  1 15 ? -0.783  -13.608 -78.364  1.00 109.86 ? 56  LEU A C   1 
ATOM   110  O  O   . LEU A  1 15 ? -0.926  -13.279 -77.189  1.00 109.32 ? 56  LEU A O   1 
ATOM   111  C  CB  . LEU A  1 15 ? -0.343  -11.850 -80.099  1.00 108.34 ? 56  LEU A CB  1 
ATOM   112  C  CG  . LEU A  1 15 ? 0.109   -10.416 -79.806  1.00 106.81 ? 56  LEU A CG  1 
ATOM   113  C  CD1 . LEU A  1 15 ? 1.628   -10.346 -79.774  1.00 104.23 ? 56  LEU A CD1 1 
ATOM   114  C  CD2 . LEU A  1 15 ? -0.443  -9.481  -80.868  1.00 105.87 ? 56  LEU A CD2 1 
ATOM   115  N  N   . THR A  1 16 ? -1.524  -14.547 -78.947  1.00 112.16 ? 57  THR A N   1 
ATOM   116  C  CA  . THR A  1 16 ? -2.563  -15.267 -78.219  1.00 113.10 ? 57  THR A CA  1 
ATOM   117  C  C   . THR A  1 16 ? -1.919  -16.084 -77.105  1.00 116.11 ? 57  THR A C   1 
ATOM   118  O  O   . THR A  1 16 ? -2.462  -16.188 -76.005  1.00 116.27 ? 57  THR A O   1 
ATOM   119  C  CB  . THR A  1 16 ? -3.344  -16.225 -79.146  1.00 114.25 ? 57  THR A CB  1 
ATOM   120  O  OG1 . THR A  1 16 ? -4.026  -15.467 -80.153  1.00 114.07 ? 57  THR A OG1 1 
ATOM   121  C  CG2 . THR A  1 16 ? -4.363  -17.029 -78.347  1.00 111.33 ? 57  THR A CG2 1 
ATOM   122  N  N   . LYS A  1 17 ? -0.759  -16.664 -77.399  1.00 118.85 ? 58  LYS A N   1 
ATOM   123  C  CA  . LYS A  1 17 ? -0.035  -17.463 -76.418  1.00 120.29 ? 58  LYS A CA  1 
ATOM   124  C  C   . LYS A  1 17 ? 0.404   -16.568 -75.268  1.00 120.87 ? 58  LYS A C   1 
ATOM   125  O  O   . LYS A  1 17 ? 0.326   -16.952 -74.100  1.00 124.21 ? 58  LYS A O   1 
ATOM   126  C  CB  . LYS A  1 17 ? 1.192   -18.115 -77.058  1.00 122.02 ? 58  LYS A CB  1 
ATOM   127  C  CG  . LYS A  1 17 ? 0.861   -19.059 -78.199  1.00 128.39 ? 58  LYS A CG  1 
ATOM   128  C  CD  . LYS A  1 17 ? 2.110   -19.714 -78.763  1.00 128.86 ? 58  LYS A CD  1 
ATOM   129  C  CE  . LYS A  1 17 ? 1.760   -20.672 -79.891  1.00 127.20 ? 58  LYS A CE  1 
ATOM   130  N  NZ  . LYS A  1 17 ? 2.949   -21.428 -80.370  1.00 124.38 ? 58  LYS A NZ  1 
ATOM   131  N  N   . THR A  1 18 ? 0.865   -15.369 -75.608  1.00 121.04 ? 59  THR A N   1 
ATOM   132  C  CA  . THR A  1 18 ? 1.311   -14.410 -74.608  1.00 119.11 ? 59  THR A CA  1 
ATOM   133  C  C   . THR A  1 18 ? 0.140   -14.020 -73.708  1.00 117.91 ? 59  THR A C   1 
ATOM   134  O  O   . THR A  1 18 ? 0.291   -13.906 -72.492  1.00 121.06 ? 59  THR A O   1 
ATOM   135  C  CB  . THR A  1 18 ? 1.884   -13.146 -75.275  1.00 121.18 ? 59  THR A CB  1 
ATOM   136  O  OG1 . THR A  1 18 ? 2.931   -13.519 -76.178  1.00 117.81 ? 59  THR A OG1 1 
ATOM   137  C  CG2 . THR A  1 18 ? 2.448   -12.199 -74.228  1.00 123.50 ? 59  THR A CG2 1 
ATOM   138  N  N   . ASN A  1 19 ? -1.029  -13.822 -74.311  1.00 116.94 ? 60  ASN A N   1 
ATOM   139  C  CA  . ASN A  1 19 ? -2.221  -13.456 -73.556  1.00 113.43 ? 60  ASN A CA  1 
ATOM   140  C  C   . ASN A  1 19 ? -2.640  -14.566 -72.601  1.00 114.68 ? 60  ASN A C   1 
ATOM   141  O  O   . ASN A  1 19 ? -3.009  -14.298 -71.461  1.00 118.54 ? 60  ASN A O   1 
ATOM   142  C  CB  . ASN A  1 19 ? -3.383  -13.136 -74.501  1.00 114.64 ? 60  ASN A CB  1 
ATOM   143  C  CG  . ASN A  1 19 ? -3.281  -11.749 -75.100  1.00 112.67 ? 60  ASN A CG  1 
ATOM   144  O  OD1 . ASN A  1 19 ? -2.355  -11.448 -75.852  1.00 117.81 ? 60  ASN A OD1 1 
ATOM   145  N  ND2 . ASN A  1 19 ? -4.235  -10.891 -74.763  1.00 108.43 ? 60  ASN A ND2 1 
ATOM   146  N  N   . LEU A  1 20 ? -2.580  -15.810 -73.067  1.00 113.76 ? 61  LEU A N   1 
ATOM   147  C  CA  . LEU A  1 20 ? -2.964  -16.945 -72.238  1.00 113.75 ? 61  LEU A CA  1 
ATOM   148  C  C   . LEU A  1 20 ? -2.109  -17.002 -70.978  1.00 116.43 ? 61  LEU A C   1 
ATOM   149  O  O   . LEU A  1 20 ? -2.628  -17.179 -69.877  1.00 120.59 ? 61  LEU A O   1 
ATOM   150  C  CB  . LEU A  1 20 ? -2.835  -18.251 -73.028  1.00 113.09 ? 61  LEU A CB  1 
ATOM   151  C  CG  . LEU A  1 20 ? -3.337  -19.519 -72.328  1.00 111.40 ? 61  LEU A CG  1 
ATOM   152  C  CD1 . LEU A  1 20 ? -3.831  -20.521 -73.359  1.00 100.78 ? 61  LEU A CD1 1 
ATOM   153  C  CD2 . LEU A  1 20 ? -2.230  -20.111 -71.473  1.00 112.00 ? 61  LEU A CD2 1 
ATOM   154  N  N   . GLN A  1 21 ? -0.798  -16.849 -71.142  1.00 113.72 ? 62  GLN A N   1 
ATOM   155  C  CA  . GLN A  1 21 ? 0.120   -16.867 -70.008  1.00 117.28 ? 62  GLN A CA  1 
ATOM   156  C  C   . GLN A  1 21 ? -0.297  -15.785 -69.013  1.00 117.95 ? 62  GLN A C   1 
ATOM   157  O  O   . GLN A  1 21 ? -0.643  -16.075 -67.867  1.00 121.14 ? 62  GLN A O   1 
ATOM   158  C  CB  . GLN A  1 21 ? 1.550   -16.597 -70.482  1.00 115.95 ? 62  GLN A CB  1 
ATOM   159  C  CG  . GLN A  1 21 ? 2.046   -17.534 -71.576  1.00 123.74 ? 62  GLN A CG  1 
ATOM   160  C  CD  . GLN A  1 21 ? 2.451   -18.899 -71.055  1.00 128.07 ? 62  GLN A CD  1 
ATOM   161  O  OE1 . GLN A  1 21 ? 1.659   -19.600 -70.425  1.00 132.33 ? 62  GLN A OE1 1 
ATOM   162  N  NE2 . GLN A  1 21 ? 3.694   -19.286 -71.323  1.00 126.12 ? 62  GLN A NE2 1 
ATOM   163  N  N   . LEU A  1 22 ? -0.265  -14.535 -69.464  1.00 114.65 ? 63  LEU A N   1 
ATOM   164  C  CA  . LEU A  1 22 ? -0.637  -13.405 -68.622  1.00 111.56 ? 63  LEU A CA  1 
ATOM   165  C  C   . LEU A  1 22 ? -1.991  -13.592 -67.944  1.00 108.56 ? 63  LEU A C   1 
ATOM   166  O  O   . LEU A  1 22 ? -2.157  -13.236 -66.778  1.00 105.95 ? 63  LEU A O   1 
ATOM   167  C  CB  . LEU A  1 22 ? -0.648  -12.113 -69.445  1.00 109.59 ? 63  LEU A CB  1 
ATOM   168  C  CG  . LEU A  1 22 ? 0.700   -11.435 -69.716  1.00 106.82 ? 63  LEU A CG  1 
ATOM   169  C  CD1 . LEU A  1 22 ? 1.677   -12.416 -70.343  1.00 99.76  ? 63  LEU A CD1 1 
ATOM   170  C  CD2 . LEU A  1 22 ? 0.480   -10.238 -70.623  1.00 106.44 ? 63  LEU A CD2 1 
ATOM   171  N  N   . THR A  1 23 ? -2.957  -14.147 -68.671  1.00 109.57 ? 64  THR A N   1 
ATOM   172  C  CA  . THR A  1 23 ? -4.285  -14.360 -68.107  1.00 114.97 ? 64  THR A CA  1 
ATOM   173  C  C   . THR A  1 23 ? -4.253  -15.393 -66.990  1.00 116.82 ? 64  THR A C   1 
ATOM   174  O  O   . THR A  1 23 ? -4.832  -15.169 -65.930  1.00 117.71 ? 64  THR A O   1 
ATOM   175  C  CB  . THR A  1 23 ? -5.310  -14.800 -69.181  1.00 116.77 ? 64  THR A CB  1 
ATOM   176  O  OG1 . THR A  1 23 ? -4.845  -15.983 -69.838  1.00 120.49 ? 64  THR A OG1 1 
ATOM   177  C  CG2 . THR A  1 23 ? -5.513  -13.696 -70.206  1.00 117.93 ? 64  THR A CG2 1 
ATOM   178  N  N   . THR A  1 24 ? -3.583  -16.520 -67.220  1.00 116.80 ? 65  THR A N   1 
ATOM   179  C  CA  . THR A  1 24 ? -3.480  -17.549 -66.189  1.00 115.90 ? 65  THR A CA  1 
ATOM   180  C  C   . THR A  1 24 ? -2.777  -16.924 -64.989  1.00 115.61 ? 65  THR A C   1 
ATOM   181  O  O   . THR A  1 24 ? -3.016  -17.305 -63.843  1.00 115.37 ? 65  THR A O   1 
ATOM   182  C  CB  . THR A  1 24 ? -2.659  -18.780 -66.652  1.00 114.34 ? 65  THR A CB  1 
ATOM   183  O  OG1 . THR A  1 24 ? -1.325  -18.376 -66.989  1.00 113.59 ? 65  THR A OG1 1 
ATOM   184  C  CG2 . THR A  1 24 ? -3.321  -19.445 -67.853  1.00 107.34 ? 65  THR A CG2 1 
ATOM   185  N  N   . GLN A  1 25 ? -1.912  -15.952 -65.262  1.00 114.20 ? 66  GLN A N   1 
ATOM   186  C  CA  . GLN A  1 25 ? -1.182  -15.269 -64.205  1.00 113.20 ? 66  GLN A CA  1 
ATOM   187  C  C   . GLN A  1 25 ? -2.167  -14.487 -63.343  1.00 114.72 ? 66  GLN A C   1 
ATOM   188  O  O   . GLN A  1 25 ? -2.189  -14.633 -62.124  1.00 117.63 ? 66  GLN A O   1 
ATOM   189  C  CB  . GLN A  1 25 ? -0.133  -14.336 -64.815  1.00 113.93 ? 66  GLN A CB  1 
ATOM   190  C  CG  . GLN A  1 25 ? 0.786   -13.682 -63.803  1.00 109.88 ? 66  GLN A CG  1 
ATOM   191  C  CD  . GLN A  1 25 ? 2.200   -13.517 -64.329  1.00 110.51 ? 66  GLN A CD  1 
ATOM   192  O  OE1 . GLN A  1 25 ? 2.471   -13.768 -65.503  1.00 113.00 ? 66  GLN A OE1 1 
ATOM   193  N  NE2 . GLN A  1 25 ? 3.109   -13.092 -63.460  1.00 114.08 ? 66  GLN A NE2 1 
ATOM   194  N  N   . SER A  1 26 ? -2.994  -13.667 -63.980  1.00 112.04 ? 67  SER A N   1 
ATOM   195  C  CA  . SER A  1 26 ? -3.983  -12.896 -63.243  1.00 110.04 ? 67  SER A CA  1 
ATOM   196  C  C   . SER A  1 26 ? -4.984  -13.836 -62.582  1.00 107.34 ? 67  SER A C   1 
ATOM   197  O  O   . SER A  1 26 ? -5.845  -13.403 -61.818  1.00 106.59 ? 67  SER A O   1 
ATOM   198  C  CB  . SER A  1 26 ? -4.705  -11.932 -64.179  1.00 106.06 ? 67  SER A CB  1 
ATOM   199  O  OG  . SER A  1 26 ? -3.799  -10.960 -64.672  1.00 112.01 ? 67  SER A OG  1 
ATOM   200  N  N   . GLN A  1 27 ? -4.871  -15.125 -62.887  1.00 110.42 ? 68  GLN A N   1 
ATOM   201  C  CA  . GLN A  1 27 ? -5.754  -16.128 -62.301  1.00 112.38 ? 68  GLN A CA  1 
ATOM   202  C  C   . GLN A  1 27 ? -5.116  -16.559 -60.996  1.00 114.21 ? 68  GLN A C   1 
ATOM   203  O  O   . GLN A  1 27 ? -5.740  -16.521 -59.937  1.00 114.46 ? 68  GLN A O   1 
ATOM   204  C  CB  . GLN A  1 27 ? -5.868  -17.368 -63.192  1.00 115.26 ? 68  GLN A CB  1 
ATOM   205  C  CG  . GLN A  1 27 ? -6.184  -17.116 -64.650  1.00 116.59 ? 68  GLN A CG  1 
ATOM   206  C  CD  . GLN A  1 27 ? -7.597  -17.498 -65.024  1.00 115.27 ? 68  GLN A CD  1 
ATOM   207  O  OE1 . GLN A  1 27 ? -8.484  -16.649 -65.096  1.00 115.22 ? 68  GLN A OE1 1 
ATOM   208  N  NE2 . GLN A  1 27 ? -7.817  -18.788 -65.260  1.00 113.14 ? 68  GLN A NE2 1 
ATOM   209  N  N   . ASN A  1 28 ? -3.855  -16.966 -61.091  1.00 114.14 ? 69  ASN A N   1 
ATOM   210  C  CA  . ASN A  1 28 ? -3.124  -17.437 -59.931  1.00 111.66 ? 69  ASN A CA  1 
ATOM   211  C  C   . ASN A  1 28 ? -2.967  -16.380 -58.840  1.00 113.17 ? 69  ASN A C   1 
ATOM   212  O  O   . ASN A  1 28 ? -2.875  -16.722 -57.662  1.00 117.32 ? 69  ASN A O   1 
ATOM   213  C  CB  . ASN A  1 28 ? -1.749  -18.005 -60.353  1.00 112.11 ? 69  ASN A CB  1 
ATOM   214  C  CG  . ASN A  1 28 ? -0.610  -16.993 -60.243  1.00 108.04 ? 69  ASN A CG  1 
ATOM   215  O  OD1 . ASN A  1 28 ? 0.540   -17.369 -60.012  1.00 111.09 ? 69  ASN A OD1 1 
ATOM   216  N  ND2 . ASN A  1 28 ? -0.917  -15.720 -60.425  1.00 104.04 ? 69  ASN A ND2 1 
ATOM   217  N  N   . LEU A  1 29 ? -2.970  -15.103 -59.221  1.00 109.70 ? 70  LEU A N   1 
ATOM   218  C  CA  . LEU A  1 29 ? -2.798  -14.028 -58.245  1.00 109.07 ? 70  LEU A CA  1 
ATOM   219  C  C   . LEU A  1 29 ? -4.107  -13.577 -57.607  1.00 109.49 ? 70  LEU A C   1 
ATOM   220  O  O   . LEU A  1 29 ? -4.127  -13.196 -56.438  1.00 109.50 ? 70  LEU A O   1 
ATOM   221  C  CB  . LEU A  1 29 ? -2.103  -12.815 -58.880  1.00 109.32 ? 70  LEU A CB  1 
ATOM   222  C  CG  . LEU A  1 29 ? -0.845  -12.992 -59.741  1.00 103.79 ? 70  LEU A CG  1 
ATOM   223  C  CD1 . LEU A  1 29 ? -1.106  -12.308 -61.068  1.00 104.60 ? 70  LEU A CD1 1 
ATOM   224  C  CD2 . LEU A  1 29 ? 0.399   -12.400 -59.082  1.00 93.80  ? 70  LEU A CD2 1 
ATOM   225  N  N   . LEU A  1 30 ? -5.203  -13.597 -58.359  1.00 110.50 ? 71  LEU A N   1 
ATOM   226  C  CA  . LEU A  1 30 ? -6.459  -13.190 -57.754  1.00 108.28 ? 71  LEU A CA  1 
ATOM   227  C  C   . LEU A  1 30 ? -6.853  -14.299 -56.787  1.00 107.71 ? 71  LEU A C   1 
ATOM   228  O  O   . LEU A  1 30 ? -7.760  -14.137 -55.975  1.00 107.37 ? 71  LEU A O   1 
ATOM   229  C  CB  . LEU A  1 30 ? -7.566  -12.990 -58.787  1.00 108.35 ? 71  LEU A CB  1 
ATOM   230  C  CG  . LEU A  1 30 ? -8.657  -12.143 -58.120  1.00 108.67 ? 71  LEU A CG  1 
ATOM   231  C  CD1 . LEU A  1 30 ? -8.340  -10.665 -58.328  1.00 109.00 ? 71  LEU A CD1 1 
ATOM   232  C  CD2 . LEU A  1 30 ? -10.028 -12.484 -58.675  1.00 109.31 ? 71  LEU A CD2 1 
ATOM   233  N  N   . SER A  1 31 ? -6.149  -15.426 -56.886  1.00 109.39 ? 72  SER A N   1 
ATOM   234  C  CA  . SER A  1 31 ? -6.386  -16.572 -56.017  1.00 105.82 ? 72  SER A CA  1 
ATOM   235  C  C   . SER A  1 31 ? -5.438  -16.554 -54.830  1.00 104.95 ? 72  SER A C   1 
ATOM   236  O  O   . SER A  1 31 ? -5.573  -17.355 -53.911  1.00 104.15 ? 72  SER A O   1 
ATOM   237  C  CB  . SER A  1 31 ? -6.231  -17.887 -56.785  1.00 106.75 ? 72  SER A CB  1 
ATOM   238  O  OG  . SER A  1 31 ? -7.474  -18.300 -57.336  1.00 106.28 ? 72  SER A OG  1 
ATOM   239  N  N   . LYS A  1 32 ? -4.462  -15.655 -54.866  1.00 103.95 ? 73  LYS A N   1 
ATOM   240  C  CA  . LYS A  1 32 ? -3.528  -15.507 -53.757  1.00 102.00 ? 73  LYS A CA  1 
ATOM   241  C  C   . LYS A  1 32 ? -3.987  -14.316 -52.931  1.00 104.19 ? 73  LYS A C   1 
ATOM   242  O  O   . LYS A  1 32 ? -4.327  -14.452 -51.755  1.00 110.64 ? 73  LYS A O   1 
ATOM   243  C  CB  . LYS A  1 32 ? -2.109  -15.256 -54.256  1.00 93.30  ? 73  LYS A CB  1 
ATOM   244  C  CG  . LYS A  1 32 ? -1.378  -16.514 -54.633  1.00 94.74  ? 73  LYS A CG  1 
ATOM   245  C  CD  . LYS A  1 32 ? 0.083   -16.221 -54.868  1.00 98.31  ? 73  LYS A CD  1 
ATOM   246  C  CE  . LYS A  1 32 ? 0.817   -17.491 -55.242  1.00 96.37  ? 73  LYS A CE  1 
ATOM   247  N  NZ  . LYS A  1 32 ? 2.199   -17.221 -55.730  1.00 97.46  ? 73  LYS A NZ  1 
ATOM   248  N  N   . LEU A  1 33 ? -4.002  -13.145 -53.559  1.00 106.99 ? 74  LEU A N   1 
ATOM   249  C  CA  . LEU A  1 33 ? -4.429  -11.932 -52.881  1.00 107.26 ? 74  LEU A CA  1 
ATOM   250  C  C   . LEU A  1 33 ? -5.609  -12.273 -51.972  1.00 108.74 ? 74  LEU A C   1 
ATOM   251  O  O   . LEU A  1 33 ? -5.714  -11.750 -50.863  1.00 113.03 ? 74  LEU A O   1 
ATOM   252  C  CB  . LEU A  1 33 ? -4.828  -10.874 -53.911  1.00 108.87 ? 74  LEU A CB  1 
ATOM   253  C  CG  . LEU A  1 33 ? -4.911  -9.409  -53.471  1.00 111.53 ? 74  LEU A CG  1 
ATOM   254  C  CD1 . LEU A  1 33 ? -5.092  -8.542  -54.708  1.00 112.66 ? 74  LEU A CD1 1 
ATOM   255  C  CD2 . LEU A  1 33 ? -6.058  -9.201  -52.489  1.00 111.47 ? 74  LEU A CD2 1 
ATOM   256  N  N   . GLU A  1 34 ? -6.485  -13.161 -52.441  1.00 110.61 ? 75  GLU A N   1 
ATOM   257  C  CA  . GLU A  1 34 ? -7.639  -13.588 -51.652  1.00 114.93 ? 75  GLU A CA  1 
ATOM   258  C  C   . GLU A  1 34 ? -7.143  -14.365 -50.436  1.00 117.07 ? 75  GLU A C   1 
ATOM   259  O  O   . GLU A  1 34 ? -7.622  -14.164 -49.320  1.00 118.37 ? 75  GLU A O   1 
ATOM   260  C  CB  . GLU A  1 34 ? -8.569  -14.479 -52.480  1.00 119.90 ? 75  GLU A CB  1 
ATOM   261  C  CG  . GLU A  1 34 ? -9.223  -13.783 -53.660  1.00 123.83 ? 75  GLU A CG  1 
ATOM   262  C  CD  . GLU A  1 34 ? -10.206 -14.680 -54.394  1.00 124.95 ? 75  GLU A CD  1 
ATOM   263  O  OE1 . GLU A  1 34 ? -11.378 -14.759 -53.965  1.00 121.51 ? 75  GLU A OE1 1 
ATOM   264  O  OE2 . GLU A  1 34 ? -9.804  -15.318 -55.391  1.00 126.66 ? 75  GLU A OE2 1 
ATOM   265  N  N   . LEU A  1 35 ? -6.186  -15.261 -50.661  1.00 113.85 ? 76  LEU A N   1 
ATOM   266  C  CA  . LEU A  1 35 ? -5.607  -16.047 -49.579  1.00 112.21 ? 76  LEU A CA  1 
ATOM   267  C  C   . LEU A  1 35 ? -4.964  -15.112 -48.559  1.00 111.94 ? 76  LEU A C   1 
ATOM   268  O  O   . LEU A  1 35 ? -5.124  -15.294 -47.353  1.00 110.89 ? 76  LEU A O   1 
ATOM   269  C  CB  . LEU A  1 35 ? -4.550  -17.016 -50.120  1.00 112.04 ? 76  LEU A CB  1 
ATOM   270  C  CG  . LEU A  1 35 ? -5.024  -18.181 -50.994  1.00 114.53 ? 76  LEU A CG  1 
ATOM   271  C  CD1 . LEU A  1 35 ? -3.831  -19.050 -51.372  1.00 117.63 ? 76  LEU A CD1 1 
ATOM   272  C  CD2 . LEU A  1 35 ? -6.059  -19.005 -50.243  1.00 115.55 ? 76  LEU A CD2 1 
ATOM   273  N  N   . ALA A  1 36 ? -4.237  -14.111 -49.050  1.00 111.08 ? 77  ALA A N   1 
ATOM   274  C  CA  . ALA A  1 36 ? -3.575  -13.144 -48.180  1.00 111.60 ? 77  ALA A CA  1 
ATOM   275  C  C   . ALA A  1 36 ? -4.605  -12.375 -47.360  1.00 111.25 ? 77  ALA A C   1 
ATOM   276  O  O   . ALA A  1 36 ? -4.377  -12.061 -46.192  1.00 111.10 ? 77  ALA A O   1 
ATOM   277  C  CB  . ALA A  1 36 ? -2.741  -12.176 -49.010  1.00 112.29 ? 77  ALA A CB  1 
ATOM   278  N  N   . GLN A  1 37 ? -5.738  -12.078 -47.988  1.00 110.51 ? 78  GLN A N   1 
ATOM   279  C  CA  . GLN A  1 37 ? -6.818  -11.347 -47.339  1.00 115.92 ? 78  GLN A CA  1 
ATOM   280  C  C   . GLN A  1 37 ? -7.514  -12.235 -46.312  1.00 114.22 ? 78  GLN A C   1 
ATOM   281  O  O   . GLN A  1 37 ? -7.810  -11.795 -45.201  1.00 114.28 ? 78  GLN A O   1 
ATOM   282  C  CB  . GLN A  1 37 ? -7.820  -10.866 -48.393  1.00 117.75 ? 78  GLN A CB  1 
ATOM   283  C  CG  . GLN A  1 37 ? -8.869  -9.895  -47.881  1.00 127.36 ? 78  GLN A CG  1 
ATOM   284  C  CD  . GLN A  1 37 ? -9.621  -9.217  -49.010  1.00 136.01 ? 78  GLN A CD  1 
ATOM   285  O  OE1 . GLN A  1 37 ? -10.192 -9.880  -49.877  1.00 141.42 ? 78  GLN A OE1 1 
ATOM   286  N  NE2 . GLN A  1 37 ? -9.622  -7.889  -49.006  1.00 140.21 ? 78  GLN A NE2 1 
ATOM   287  N  N   . SER A  1 38 ? -7.769  -13.485 -46.692  1.00 110.32 ? 79  SER A N   1 
ATOM   288  C  CA  . SER A  1 38 ? -8.419  -14.446 -45.805  1.00 113.54 ? 79  SER A CA  1 
ATOM   289  C  C   . SER A  1 38 ? -7.607  -14.585 -44.527  1.00 116.06 ? 79  SER A C   1 
ATOM   290  O  O   . SER A  1 38 ? -8.133  -14.458 -43.420  1.00 118.18 ? 79  SER A O   1 
ATOM   291  C  CB  . SER A  1 38 ? -8.516  -15.814 -46.479  1.00 108.85 ? 79  SER A CB  1 
ATOM   292  O  OG  . SER A  1 38 ? -9.031  -16.781 -45.581  1.00 103.61 ? 79  SER A OG  1 
ATOM   293  N  N   . LYS A  1 39 ? -6.315  -14.848 -44.708  1.00 112.91 ? 80  LYS A N   1 
ATOM   294  C  CA  . LYS A  1 39 ? -5.368  -15.017 -43.614  1.00 109.77 ? 80  LYS A CA  1 
ATOM   295  C  C   . LYS A  1 39 ? -5.213  -13.753 -42.763  1.00 105.76 ? 80  LYS A C   1 
ATOM   296  O  O   . LYS A  1 39 ? -4.628  -13.791 -41.682  1.00 107.09 ? 80  LYS A O   1 
ATOM   297  C  CB  . LYS A  1 39 ? -4.021  -15.480 -44.192  1.00 109.91 ? 80  LYS A CB  1 
ATOM   298  C  CG  . LYS A  1 39 ? -2.777  -14.912 -43.527  1.00 114.43 ? 80  LYS A CG  1 
ATOM   299  C  CD  . LYS A  1 39 ? -1.500  -15.447 -44.176  1.00 120.34 ? 80  LYS A CD  1 
ATOM   300  C  CE  . LYS A  1 39 ? -1.191  -14.784 -45.521  1.00 124.98 ? 80  LYS A CE  1 
ATOM   301  N  NZ  . LYS A  1 39 ? -2.214  -15.019 -46.567  1.00 127.33 ? 80  LYS A NZ  1 
ATOM   302  N  N   . GLU A  1 40 ? -5.724  -12.633 -43.263  1.00 102.61 ? 81  GLU A N   1 
ATOM   303  C  CA  . GLU A  1 40 ? -5.693  -11.383 -42.516  1.00 99.83  ? 81  GLU A CA  1 
ATOM   304  C  C   . GLU A  1 40 ? -6.915  -11.485 -41.618  1.00 94.76  ? 81  GLU A C   1 
ATOM   305  O  O   . GLU A  1 40 ? -6.823  -11.390 -40.397  1.00 89.31  ? 81  GLU A O   1 
ATOM   306  C  CB  . GLU A  1 40 ? -5.848  -10.182 -43.449  1.00 101.55 ? 81  GLU A CB  1 
ATOM   307  C  CG  . GLU A  1 40 ? -4.590  -9.352  -43.600  1.00 104.19 ? 81  GLU A CG  1 
ATOM   308  C  CD  . GLU A  1 40 ? -4.738  -8.234  -44.617  1.00 107.56 ? 81  GLU A CD  1 
ATOM   309  O  OE1 . GLU A  1 40 ? -5.876  -7.977  -45.064  1.00 103.85 ? 81  GLU A OE1 1 
ATOM   310  O  OE2 . GLU A  1 40 ? -3.715  -7.605  -44.963  1.00 112.12 ? 81  GLU A OE2 1 
ATOM   311  N  N   . SER A  1 41 ? -8.059  -11.705 -42.255  1.00 93.05  ? 82  SER A N   1 
ATOM   312  C  CA  . SER A  1 41 ? -9.337  -11.842 -41.570  1.00 94.54  ? 82  SER A CA  1 
ATOM   313  C  C   . SER A  1 41 ? -9.234  -12.739 -40.342  1.00 93.26  ? 82  SER A C   1 
ATOM   314  O  O   . SER A  1 41 ? -9.553  -12.321 -39.232  1.00 94.01  ? 82  SER A O   1 
ATOM   315  C  CB  . SER A  1 41 ? -10.379 -12.418 -42.529  1.00 87.57  ? 82  SER A CB  1 
ATOM   316  O  OG  . SER A  1 41 ? -11.610 -12.653 -41.864  1.00 91.63  ? 82  SER A OG  1 
ATOM   317  N  N   . LYS A  1 42 ? -8.790  -13.973 -40.560  1.00 91.85  ? 83  LYS A N   1 
ATOM   318  C  CA  . LYS A  1 42 ? -8.636  -14.964 -39.499  1.00 91.17  ? 83  LYS A CA  1 
ATOM   319  C  C   . LYS A  1 42 ? -7.690  -14.436 -38.414  1.00 92.18  ? 83  LYS A C   1 
ATOM   320  O  O   . LYS A  1 42 ? -7.939  -14.606 -37.220  1.00 94.27  ? 83  LYS A O   1 
ATOM   321  C  CB  . LYS A  1 42 ? -8.068  -16.259 -40.095  1.00 91.29  ? 83  LYS A CB  1 
ATOM   322  C  CG  . LYS A  1 42 ? -8.513  -17.567 -39.436  1.00 93.25  ? 83  LYS A CG  1 
ATOM   323  C  CD  . LYS A  1 42 ? -9.785  -18.111 -40.082  1.00 95.13  ? 83  LYS A CD  1 
ATOM   324  C  CE  . LYS A  1 42 ? -10.207 -19.430 -39.457  1.00 95.35  ? 83  LYS A CE  1 
ATOM   325  N  NZ  . LYS A  1 42 ? -11.638 -19.724 -39.749  1.00 93.26  ? 83  LYS A NZ  1 
ATOM   326  N  N   . LEU A  1 43 ? -6.606  -13.795 -38.844  1.00 91.53  ? 84  LEU A N   1 
ATOM   327  C  CA  . LEU A  1 43 ? -5.605  -13.240 -37.938  1.00 90.31  ? 84  LEU A CA  1 
ATOM   328  C  C   . LEU A  1 43 ? -6.189  -12.121 -37.069  1.00 92.72  ? 84  LEU A C   1 
ATOM   329  O  O   . LEU A  1 43 ? -6.004  -12.105 -35.850  1.00 94.32  ? 84  LEU A O   1 
ATOM   330  C  CB  . LEU A  1 43 ? -4.423  -12.693 -38.747  1.00 85.16  ? 84  LEU A CB  1 
ATOM   331  C  CG  . LEU A  1 43 ? -3.002  -12.874 -38.204  1.00 90.44  ? 84  LEU A CG  1 
ATOM   332  C  CD1 . LEU A  1 43 ? -2.029  -12.092 -39.075  1.00 89.96  ? 84  LEU A CD1 1 
ATOM   333  C  CD2 . LEU A  1 43 ? -2.915  -12.408 -36.762  1.00 92.13  ? 84  LEU A CD2 1 
ATOM   334  N  N   . LEU A  1 44 ? -6.893  -11.186 -37.704  1.00 94.21  ? 85  LEU A N   1 
ATOM   335  C  CA  . LEU A  1 44 ? -7.489  -10.057 -36.994  1.00 88.32  ? 85  LEU A CA  1 
ATOM   336  C  C   . LEU A  1 44 ? -8.540  -10.567 -36.024  1.00 82.20  ? 85  LEU A C   1 
ATOM   337  O  O   . LEU A  1 44 ? -8.715  -10.014 -34.941  1.00 83.09  ? 85  LEU A O   1 
ATOM   338  C  CB  . LEU A  1 44 ? -8.153  -9.089  -37.979  1.00 89.51  ? 85  LEU A CB  1 
ATOM   339  C  CG  . LEU A  1 44 ? -7.590  -9.039  -39.404  1.00 91.80  ? 85  LEU A CG  1 
ATOM   340  C  CD1 . LEU A  1 44 ? -8.733  -8.807  -40.375  1.00 86.87  ? 85  LEU A CD1 1 
ATOM   341  C  CD2 . LEU A  1 44 ? -6.510  -7.979  -39.541  1.00 91.26  ? 85  LEU A CD2 1 
ATOM   342  N  N   . GLU A  1 45 ? -9.248  -11.615 -36.428  1.00 78.40  ? 86  GLU A N   1 
ATOM   343  C  CA  . GLU A  1 45 ? -10.278 -12.179 -35.579  1.00 79.72  ? 86  GLU A CA  1 
ATOM   344  C  C   . GLU A  1 45 ? -9.602  -12.714 -34.325  1.00 81.62  ? 86  GLU A C   1 
ATOM   345  O  O   . GLU A  1 45 ? -9.969  -12.352 -33.210  1.00 85.79  ? 86  GLU A O   1 
ATOM   346  C  CB  . GLU A  1 45 ? -11.017 -13.306 -36.297  1.00 80.52  ? 86  GLU A CB  1 
ATOM   347  C  CG  . GLU A  1 45 ? -12.287 -13.717 -35.580  1.00 85.58  ? 86  GLU A CG  1 
ATOM   348  C  CD  . GLU A  1 45 ? -12.794 -15.071 -36.013  1.00 85.39  ? 86  GLU A CD  1 
ATOM   349  O  OE1 . GLU A  1 45 ? -13.594 -15.139 -36.970  1.00 85.72  ? 86  GLU A OE1 1 
ATOM   350  O  OE2 . GLU A  1 45 ? -12.378 -16.072 -35.393  1.00 85.13  ? 86  GLU A OE2 1 
ATOM   351  N  N   . ASN A  1 46 ? -8.600  -13.565 -34.516  1.00 80.36  ? 87  ASN A N   1 
ATOM   352  C  CA  . ASN A  1 46 ? -7.863  -14.137 -33.398  1.00 74.94  ? 87  ASN A CA  1 
ATOM   353  C  C   . ASN A  1 46 ? -7.334  -13.059 -32.460  1.00 70.20  ? 87  ASN A C   1 
ATOM   354  O  O   . ASN A  1 46 ? -7.453  -13.174 -31.239  1.00 63.52  ? 87  ASN A O   1 
ATOM   355  C  CB  . ASN A  1 46 ? -6.701  -14.982 -33.913  1.00 73.88  ? 87  ASN A CB  1 
ATOM   356  C  CG  . ASN A  1 46 ? -7.123  -16.390 -34.248  1.00 79.52  ? 87  ASN A CG  1 
ATOM   357  O  OD1 . ASN A  1 46 ? -8.293  -16.646 -34.520  1.00 84.31  ? 87  ASN A OD1 1 
ATOM   358  N  ND2 . ASN A  1 46 ? -6.172  -17.314 -34.240  1.00 81.04  ? 87  ASN A ND2 1 
ATOM   359  N  N   . LEU A  1 47 ? -6.747  -12.013 -33.029  1.00 69.95  ? 88  LEU A N   1 
ATOM   360  C  CA  . LEU A  1 47 ? -6.210  -10.930 -32.222  1.00 72.18  ? 88  LEU A CA  1 
ATOM   361  C  C   . LEU A  1 47 ? -7.297  -10.357 -31.328  1.00 70.05  ? 88  LEU A C   1 
ATOM   362  O  O   . LEU A  1 47 ? -7.027  -9.938  -30.202  1.00 67.49  ? 88  LEU A O   1 
ATOM   363  C  CB  . LEU A  1 47 ? -5.638  -9.826  -33.117  1.00 72.13  ? 88  LEU A CB  1 
ATOM   364  C  CG  . LEU A  1 47 ? -4.401  -10.170 -33.952  1.00 81.74  ? 88  LEU A CG  1 
ATOM   365  C  CD1 . LEU A  1 47 ? -3.930  -8.916  -34.671  1.00 88.99  ? 88  LEU A CD1 1 
ATOM   366  C  CD2 . LEU A  1 47 ? -3.294  -10.716 -33.059  1.00 77.77  ? 88  LEU A CD2 1 
ATOM   367  N  N   . ASN A  1 48 ? -8.529  -10.356 -31.824  1.00 64.59  ? 89  ASN A N   1 
ATOM   368  C  CA  . ASN A  1 48 ? -9.628  -9.821  -31.043  1.00 68.31  ? 89  ASN A CA  1 
ATOM   369  C  C   . ASN A  1 48 ? -10.145 -10.751 -29.973  1.00 59.33  ? 89  ASN A C   1 
ATOM   370  O  O   . ASN A  1 48 ? -10.631 -10.281 -28.948  1.00 61.21  ? 89  ASN A O   1 
ATOM   371  C  CB  . ASN A  1 48 ? -10.770 -9.385  -31.944  1.00 72.37  ? 89  ASN A CB  1 
ATOM   372  C  CG  . ASN A  1 48 ? -10.462 -8.095  -32.651  1.00 84.95  ? 89  ASN A CG  1 
ATOM   373  O  OD1 . ASN A  1 48 ? -9.751  -7.246  -32.112  1.00 84.47  ? 89  ASN A OD1 1 
ATOM   374  N  ND2 . ASN A  1 48 ? -11.000 -7.924  -33.850  1.00 83.92  ? 89  ASN A ND2 1 
ATOM   375  N  N   . LEU A  1 49 ? -10.068 -12.060 -30.191  1.00 53.13  ? 90  LEU A N   1 
ATOM   376  C  CA  . LEU A  1 49 ? -10.526 -12.970 -29.149  1.00 57.27  ? 90  LEU A CA  1 
ATOM   377  C  C   . LEU A  1 49 ? -9.538  -12.839 -28.002  1.00 63.36  ? 90  LEU A C   1 
ATOM   378  O  O   . LEU A  1 49 ? -9.931  -12.762 -26.839  1.00 60.62  ? 90  LEU A O   1 
ATOM   379  C  CB  . LEU A  1 49 ? -10.553 -14.422 -29.621  1.00 55.99  ? 90  LEU A CB  1 
ATOM   380  C  CG  . LEU A  1 49 ? -11.607 -14.815 -30.648  1.00 64.68  ? 90  LEU A CG  1 
ATOM   381  C  CD1 . LEU A  1 49 ? -11.032 -14.554 -32.017  1.00 50.56  ? 90  LEU A CD1 1 
ATOM   382  C  CD2 . LEU A  1 49 ? -11.971 -16.284 -30.513  1.00 56.87  ? 90  LEU A CD2 1 
ATOM   383  N  N   . LEU A  1 50 ? -8.251  -12.814 -28.338  1.00 60.01  ? 91  LEU A N   1 
ATOM   384  C  CA  . LEU A  1 50 ? -7.212  -12.673 -27.329  1.00 60.70  ? 91  LEU A CA  1 
ATOM   385  C  C   . LEU A  1 50 ? -7.355  -11.321 -26.654  1.00 62.72  ? 91  LEU A C   1 
ATOM   386  O  O   . LEU A  1 50 ? -7.222  -11.201 -25.435  1.00 61.33  ? 91  LEU A O   1 
ATOM   387  C  CB  . LEU A  1 50 ? -5.823  -12.794 -27.962  1.00 59.32  ? 91  LEU A CB  1 
ATOM   388  C  CG  . LEU A  1 50 ? -5.538  -14.149 -28.614  1.00 68.00  ? 91  LEU A CG  1 
ATOM   389  C  CD1 . LEU A  1 50 ? -4.045  -14.295 -28.885  1.00 61.58  ? 91  LEU A CD1 1 
ATOM   390  C  CD2 . LEU A  1 50 ? -6.019  -15.270 -27.695  1.00 72.06  ? 91  LEU A CD2 1 
ATOM   391  N  N   . LYS A  1 51 ? -7.623  -10.302 -27.461  1.00 60.07  ? 92  LYS A N   1 
ATOM   392  C  CA  . LYS A  1 51 ? -7.803  -8.956  -26.950  1.00 58.12  ? 92  LYS A CA  1 
ATOM   393  C  C   . LYS A  1 51 ? -8.931  -8.934  -25.918  1.00 54.98  ? 92  LYS A C   1 
ATOM   394  O  O   . LYS A  1 51 ? -8.778  -8.363  -24.843  1.00 56.50  ? 92  LYS A O   1 
ATOM   395  C  CB  . LYS A  1 51 ? -8.119  -8.003  -28.103  1.00 65.46  ? 92  LYS A CB  1 
ATOM   396  C  CG  . LYS A  1 51 ? -8.490  -6.608  -27.662  1.00 69.98  ? 92  LYS A CG  1 
ATOM   397  C  CD  . LYS A  1 51 ? -8.976  -5.761  -28.827  1.00 79.06  ? 92  LYS A CD  1 
ATOM   398  C  CE  . LYS A  1 51 ? -9.929  -4.687  -28.320  1.00 87.15  ? 92  LYS A CE  1 
ATOM   399  N  NZ  . LYS A  1 51 ? -10.056 -3.499  -29.217  1.00 87.53  ? 92  LYS A NZ  1 
ATOM   400  N  N   . ASN A  1 52 ? -10.057 -9.562  -26.246  1.00 47.77  ? 93  ASN A N   1 
ATOM   401  C  CA  . ASN A  1 52 ? -11.205 -9.608  -25.338  1.00 47.42  ? 93  ASN A CA  1 
ATOM   402  C  C   . ASN A  1 52 ? -10.884 -10.480 -24.130  1.00 47.23  ? 93  ASN A C   1 
ATOM   403  O  O   . ASN A  1 52 ? -11.346 -10.221 -23.016  1.00 54.64  ? 93  ASN A O   1 
ATOM   404  C  CB  . ASN A  1 52 ? -12.450 -10.188 -26.036  1.00 59.40  ? 93  ASN A CB  1 
ATOM   405  C  CG  . ASN A  1 52 ? -12.994 -9.286  -27.139  1.00 60.98  ? 93  ASN A CG  1 
ATOM   406  O  OD1 . ASN A  1 52 ? -13.134 -8.075  -26.960  1.00 70.09  ? 93  ASN A OD1 1 
ATOM   407  N  ND2 . ASN A  1 52 ? -13.325 -9.882  -28.278  1.00 73.82  ? 93  ASN A ND2 1 
ATOM   408  N  N   . GLU A  1 53 ? -10.103 -11.527 -24.373  1.00 44.11  ? 94  GLU A N   1 
ATOM   409  C  CA  . GLU A  1 53 ? -9.695  -12.463 -23.339  1.00 49.95  ? 94  GLU A CA  1 
ATOM   410  C  C   . GLU A  1 53 ? -8.828  -11.699 -22.341  1.00 47.93  ? 94  GLU A C   1 
ATOM   411  O  O   . GLU A  1 53 ? -8.983  -11.824 -21.122  1.00 43.90  ? 94  GLU A O   1 
ATOM   412  C  CB  . GLU A  1 53 ? -8.890  -13.602 -23.982  1.00 64.71  ? 94  GLU A CB  1 
ATOM   413  C  CG  . GLU A  1 53 ? -9.334  -15.020 -23.601  1.00 70.63  ? 94  GLU A CG  1 
ATOM   414  C  CD  . GLU A  1 53 ? -9.076  -16.049 -24.717  1.00 77.93  ? 94  GLU A CD  1 
ATOM   415  O  OE1 . GLU A  1 53 ? -8.935  -15.646 -25.894  1.00 85.37  ? 94  GLU A OE1 1 
ATOM   416  O  OE2 . GLU A  1 53 ? -9.038  -17.264 -24.424  1.00 78.75  ? 94  GLU A OE2 1 
ATOM   417  N  N   . ASN A  1 54 ? -7.923  -10.892 -22.882  1.00 43.08  ? 95  ASN A N   1 
ATOM   418  C  CA  . ASN A  1 54 ? -7.002  -10.094 -22.087  1.00 42.91  ? 95  ASN A CA  1 
ATOM   419  C  C   . ASN A  1 54 ? -7.673  -9.005  -21.233  1.00 36.32  ? 95  ASN A C   1 
ATOM   420  O  O   . ASN A  1 54 ? -7.299  -8.813  -20.077  1.00 46.97  ? 95  ASN A O   1 
ATOM   421  C  CB  . ASN A  1 54 ? -5.959  -9.489  -23.026  1.00 47.86  ? 95  ASN A CB  1 
ATOM   422  C  CG  . ASN A  1 54 ? -4.904  -8.686  -22.301  1.00 63.44  ? 95  ASN A CG  1 
ATOM   423  O  OD1 . ASN A  1 54 ? -4.509  -9.009  -21.181  1.00 64.74  ? 95  ASN A OD1 1 
ATOM   424  N  ND2 . ASN A  1 54 ? -4.421  -7.637  -22.954  1.00 71.40  ? 95  ASN A ND2 1 
ATOM   425  N  N   . GLU A  1 55 ? -8.658  -8.302  -21.787  1.00 46.20  ? 96  GLU A N   1 
ATOM   426  C  CA  . GLU A  1 55 ? -9.352  -7.244  -21.044  1.00 44.35  ? 96  GLU A CA  1 
ATOM   427  C  C   . GLU A  1 55 ? -10.086 -7.868  -19.852  1.00 45.53  ? 96  GLU A C   1 
ATOM   428  O  O   . GLU A  1 55 ? -10.152 -7.295  -18.758  1.00 39.04  ? 96  GLU A O   1 
ATOM   429  C  CB  . GLU A  1 55 ? -10.357 -6.530  -21.957  1.00 55.75  ? 96  GLU A CB  1 
ATOM   430  C  CG  . GLU A  1 55 ? -10.574 -5.041  -21.667  1.00 66.07  ? 96  GLU A CG  1 
ATOM   431  C  CD  . GLU A  1 55 ? -9.836  -4.546  -20.433  1.00 78.26  ? 96  GLU A CD  1 
ATOM   432  O  OE1 . GLU A  1 55 ? -8.581  -4.513  -20.433  1.00 90.72  ? 96  GLU A OE1 1 
ATOM   433  O  OE2 . GLU A  1 55 ? -10.526 -4.191  -19.457  1.00 65.90  ? 96  GLU A OE2 1 
ATOM   434  N  N   . ASN A  1 56 ? -10.636 -9.053  -20.084  1.00 38.53  ? 97  ASN A N   1 
ATOM   435  C  CA  . ASN A  1 56 ? -11.360 -9.795  -19.062  1.00 35.96  ? 97  ASN A CA  1 
ATOM   436  C  C   . ASN A  1 56 ? -10.409 -10.169 -17.925  1.00 31.79  ? 97  ASN A C   1 
ATOM   437  O  O   . ASN A  1 56 ? -10.766 -10.055 -16.750  1.00 42.27  ? 97  ASN A O   1 
ATOM   438  C  CB  . ASN A  1 56 ? -11.996 -11.034 -19.709  1.00 40.76  ? 97  ASN A CB  1 
ATOM   439  C  CG  . ASN A  1 56 ? -12.362 -12.103 -18.711  1.00 56.24  ? 97  ASN A CG  1 
ATOM   440  O  OD1 . ASN A  1 56 ? -13.224 -11.909 -17.857  1.00 65.63  ? 97  ASN A OD1 1 
ATOM   441  N  ND2 . ASN A  1 56 ? -11.703 -13.254 -18.817  1.00 58.31  ? 97  ASN A ND2 1 
ATOM   442  N  N   . LEU A  1 57 ? -9.191  -10.591 -18.265  1.00 23.23  ? 98  LEU A N   1 
ATOM   443  C  CA  . LEU A  1 57 ? -8.215  -10.935 -17.243  1.00 21.71  ? 98  LEU A CA  1 
ATOM   444  C  C   . LEU A  1 57 ? -7.688  -9.691  -16.529  1.00 30.78  ? 98  LEU A C   1 
ATOM   445  O  O   . LEU A  1 57 ? -7.270  -9.744  -15.369  1.00 30.50  ? 98  LEU A O   1 
ATOM   446  C  CB  . LEU A  1 57 ? -7.047  -11.692 -17.859  1.00 32.24  ? 98  LEU A CB  1 
ATOM   447  C  CG  . LEU A  1 57 ? -7.356  -13.094 -18.369  1.00 27.76  ? 98  LEU A CG  1 
ATOM   448  C  CD1 . LEU A  1 57 ? -6.055  -13.769 -18.796  1.00 30.41  ? 98  LEU A CD1 1 
ATOM   449  C  CD2 . LEU A  1 57 ? -8.016  -13.888 -17.266  1.00 21.35  ? 98  LEU A CD2 1 
ATOM   450  N  N   . ASN A  1 58 ? -7.694  -8.565  -17.226  1.00 33.58  ? 99  ASN A N   1 
ATOM   451  C  CA  . ASN A  1 58 ? -7.214  -7.329  -16.625  1.00 26.67  ? 99  ASN A CA  1 
ATOM   452  C  C   . ASN A  1 58 ? -8.212  -6.824  -15.609  1.00 17.60  ? 99  ASN A C   1 
ATOM   453  O  O   . ASN A  1 58 ? -7.845  -6.261  -14.580  1.00 39.38  ? 99  ASN A O   1 
ATOM   454  C  CB  . ASN A  1 58 ? -6.977  -6.270  -17.701  1.00 27.26  ? 99  ASN A CB  1 
ATOM   455  C  CG  . ASN A  1 58 ? -5.692  -6.507  -18.464  1.00 34.66  ? 99  ASN A CG  1 
ATOM   456  O  OD1 . ASN A  1 58 ? -4.761  -7.136  -17.954  1.00 37.90  ? 99  ASN A OD1 1 
ATOM   457  N  ND2 . ASN A  1 58 ? -5.626  -5.994  -19.681  1.00 35.55  ? 99  ASN A ND2 1 
ATOM   458  N  N   . SER A  1 59 ? -9.485  -7.051  -15.901  1.00 27.09  ? 100 SER A N   1 
ATOM   459  C  CA  . SER A  1 59 ? -10.575 -6.632  -15.029  1.00 31.42  ? 100 SER A CA  1 
ATOM   460  C  C   . SER A  1 59 ? -10.584 -7.449  -13.743  1.00 28.08  ? 100 SER A C   1 
ATOM   461  O  O   . SER A  1 59 ? -10.889 -6.931  -12.669  1.00 32.44  ? 100 SER A O   1 
ATOM   462  C  CB  . SER A  1 59 ? -11.909 -6.805  -15.761  1.00 26.45  ? 100 SER A CB  1 
ATOM   463  O  OG  . SER A  1 59 ? -12.999 -6.555  -14.893  1.00 54.62  ? 100 SER A OG  1 
ATOM   464  N  N   . ILE A  1 60 ? -10.259 -8.733  -13.857  1.00 29.35  ? 101 ILE A N   1 
ATOM   465  C  CA  . ILE A  1 60 ? -10.224 -9.620  -12.701  1.00 10.30  ? 101 ILE A CA  1 
ATOM   466  C  C   . ILE A  1 60 ? -9.104  -9.186  -11.769  1.00 9.92   ? 101 ILE A C   1 
ATOM   467  O  O   . ILE A  1 60 ? -9.279  -9.121  -10.556  1.00 26.57  ? 101 ILE A O   1 
ATOM   468  C  CB  . ILE A  1 60 ? -9.981  -11.093 -13.146  1.00 22.67  ? 101 ILE A CB  1 
ATOM   469  C  CG1 . ILE A  1 60 ? -11.172 -11.587 -13.967  1.00 14.14  ? 101 ILE A CG1 1 
ATOM   470  C  CG2 . ILE A  1 60 ? -9.766  -11.970 -11.944  1.00 15.13  ? 101 ILE A CG2 1 
ATOM   471  C  CD1 . ILE A  1 60 ? -11.018 -12.989 -14.510  1.00 30.58  ? 101 ILE A CD1 1 
ATOM   472  N  N   . PHE A  1 61 ? -7.950  -8.896  -12.365  1.00 18.91  ? 102 PHE A N   1 
ATOM   473  C  CA  . PHE A  1 61 ? -6.759  -8.444  -11.648  1.00 30.74  ? 102 PHE A CA  1 
ATOM   474  C  C   . PHE A  1 61 ? -7.097  -7.219  -10.794  1.00 35.39  ? 102 PHE A C   1 
ATOM   475  O  O   . PHE A  1 61 ? -6.871  -7.218  -9.584   1.00 40.48  ? 102 PHE A O   1 
ATOM   476  C  CB  . PHE A  1 61 ? -5.669  -8.070  -12.658  1.00 29.96  ? 102 PHE A CB  1 
ATOM   477  C  CG  . PHE A  1 61 ? -4.278  -8.142  -12.109  1.00 32.98  ? 102 PHE A CG  1 
ATOM   478  C  CD1 . PHE A  1 61 ? -4.038  -8.019  -10.744  1.00 33.07  ? 102 PHE A CD1 1 
ATOM   479  C  CD2 . PHE A  1 61 ? -3.204  -8.348  -12.961  1.00 31.47  ? 102 PHE A CD2 1 
ATOM   480  C  CE1 . PHE A  1 61 ? -2.750  -8.110  -10.240  1.00 45.31  ? 102 PHE A CE1 1 
ATOM   481  C  CE2 . PHE A  1 61 ? -1.912  -8.442  -12.469  1.00 33.89  ? 102 PHE A CE2 1 
ATOM   482  C  CZ  . PHE A  1 61 ? -1.682  -8.322  -11.107  1.00 16.62  ? 102 PHE A CZ  1 
ATOM   483  N  N   . GLU A  1 62 ? -7.632  -6.178  -11.428  1.00 32.39  ? 103 GLU A N   1 
ATOM   484  C  CA  . GLU A  1 62 ? -8.010  -4.953  -10.713  1.00 31.25  ? 103 GLU A CA  1 
ATOM   485  C  C   . GLU A  1 62 ? -8.951  -5.213  -9.521   1.00 17.83  ? 103 GLU A C   1 
ATOM   486  O  O   . GLU A  1 62 ? -8.901  -4.491  -8.523   1.00 36.94  ? 103 GLU A O   1 
ATOM   487  C  CB  . GLU A  1 62 ? -8.674  -3.962  -11.677  1.00 25.56  ? 103 GLU A CB  1 
ATOM   488  C  CG  . GLU A  1 62 ? -7.792  -3.521  -12.822  1.00 42.47  ? 103 GLU A CG  1 
ATOM   489  C  CD  . GLU A  1 62 ? -8.446  -2.441  -13.669  1.00 64.71  ? 103 GLU A CD  1 
ATOM   490  O  OE1 . GLU A  1 62 ? -8.713  -1.342  -13.135  1.00 64.08  ? 103 GLU A OE1 1 
ATOM   491  O  OE2 . GLU A  1 62 ? -8.701  -2.688  -14.867  1.00 69.72  ? 103 GLU A OE2 1 
ATOM   492  N  N   . ARG A  1 63 ? -9.813  -6.225  -9.625   1.00 16.96  ? 104 ARG A N   1 
ATOM   493  C  CA  . ARG A  1 63 ? -10.715 -6.554  -8.522   1.00 21.41  ? 104 ARG A CA  1 
ATOM   494  C  C   . ARG A  1 63 ? -9.937  -7.165  -7.365   1.00 21.10  ? 104 ARG A C   1 
ATOM   495  O  O   . ARG A  1 63 ? -10.179 -6.836  -6.203   1.00 35.16  ? 104 ARG A O   1 
ATOM   496  C  CB  . ARG A  1 63 ? -11.819 -7.539  -8.955   1.00 37.30  ? 104 ARG A CB  1 
ATOM   497  C  CG  . ARG A  1 63 ? -12.978 -6.907  -9.721   1.00 43.19  ? 104 ARG A CG  1 
ATOM   498  C  CD  . ARG A  1 63 ? -14.219 -7.811  -9.771   1.00 36.59  ? 104 ARG A CD  1 
ATOM   499  N  NE  . ARG A  1 63 ? -14.070 -8.972  -10.653  1.00 33.55  ? 104 ARG A NE  1 
ATOM   500  C  CZ  . ARG A  1 63 ? -13.947 -10.232 -10.234  1.00 30.69  ? 104 ARG A CZ  1 
ATOM   501  N  NH1 . ARG A  1 63 ? -13.952 -10.510 -8.937   1.00 46.54  ? 104 ARG A NH1 1 
ATOM   502  N  NH2 . ARG A  1 63 ? -13.829 -11.222 -11.112  1.00 17.70  ? 104 ARG A NH2 1 
ATOM   503  N  N   . LYS A  1 64 ? -9.001  -8.055  -7.671   1.00 31.90  ? 105 LYS A N   1 
ATOM   504  C  CA  . LYS A  1 64 ? -8.205  -8.687  -6.619   1.00 30.39  ? 105 LYS A CA  1 
ATOM   505  C  C   . LYS A  1 64 ? -7.351  -7.651  -5.895   1.00 12.87  ? 105 LYS A C   1 
ATOM   506  O  O   . LYS A  1 64 ? -7.217  -7.681  -4.666   1.00 22.28  ? 105 LYS A O   1 
ATOM   507  C  CB  . LYS A  1 64 ? -7.303  -9.772  -7.220   1.00 28.17  ? 105 LYS A CB  1 
ATOM   508  C  CG  . LYS A  1 64 ? -8.059  -10.769 -8.060   1.00 17.22  ? 105 LYS A CG  1 
ATOM   509  C  CD  . LYS A  1 64 ? -9.206  -11.380 -7.268   1.00 29.25  ? 105 LYS A CD  1 
ATOM   510  C  CE  . LYS A  1 64 ? -10.065 -12.279 -8.148   1.00 33.79  ? 105 LYS A CE  1 
ATOM   511  N  NZ  . LYS A  1 64 ? -11.004 -13.100 -7.332   1.00 37.49  ? 105 LYS A NZ  1 
ATOM   512  N  N   . ASN A  1 65 ? -6.774  -6.734  -6.661   1.00 22.56  ? 106 ASN A N   1 
ATOM   513  C  CA  . ASN A  1 65 ? -5.948  -5.685  -6.080   1.00 28.90  ? 106 ASN A CA  1 
ATOM   514  C  C   . ASN A  1 65 ? -6.751  -4.826  -5.124   1.00 16.55  ? 106 ASN A C   1 
ATOM   515  O  O   . ASN A  1 65 ? -6.241  -4.402  -4.083   1.00 37.10  ? 106 ASN A O   1 
ATOM   516  C  CB  . ASN A  1 65 ? -5.318  -4.825  -7.181   1.00 22.21  ? 106 ASN A CB  1 
ATOM   517  C  CG  . ASN A  1 65 ? -4.177  -5.544  -7.875   1.00 36.76  ? 106 ASN A CG  1 
ATOM   518  O  OD1 . ASN A  1 65 ? -3.740  -6.611  -7.419   1.00 23.73  ? 106 ASN A OD1 1 
ATOM   519  N  ND2 . ASN A  1 65 ? -3.683  -4.974  -8.965   1.00 16.63  ? 106 ASN A ND2 1 
ATOM   520  N  N   . LYS A  1 66 ? -8.016  -4.584  -5.457   1.00 24.83  ? 107 LYS A N   1 
ATOM   521  C  CA  . LYS A  1 66 ? -8.857  -3.790  -4.573   1.00 22.46  ? 107 LYS A CA  1 
ATOM   522  C  C   . LYS A  1 66 ? -9.053  -4.523  -3.261   1.00 18.07  ? 107 LYS A C   1 
ATOM   523  O  O   . LYS A  1 66 ? -9.075  -3.903  -2.199   1.00 24.24  ? 107 LYS A O   1 
ATOM   524  C  CB  . LYS A  1 66 ? -10.216 -3.504  -5.201   1.00 32.97  ? 107 LYS A CB  1 
ATOM   525  C  CG  . LYS A  1 66 ? -10.260 -2.236  -6.011   1.00 51.77  ? 107 LYS A CG  1 
ATOM   526  C  CD  . LYS A  1 66 ? -11.684 -1.943  -6.465   1.00 49.57  ? 107 LYS A CD  1 
ATOM   527  C  CE  . LYS A  1 66 ? -11.759 -1.731  -7.985   1.00 58.53  ? 107 LYS A CE  1 
ATOM   528  N  NZ  . LYS A  1 66 ? -11.410 -2.940  -8.815   1.00 57.65  ? 107 LYS A NZ  1 
ATOM   529  N  N   . LYS A  1 67 ? -9.185  -5.845  -3.324   1.00 32.82  ? 108 LYS A N   1 
ATOM   530  C  CA  . LYS A  1 67 ? -9.351  -6.639  -2.105   1.00 19.48  ? 108 LYS A CA  1 
ATOM   531  C  C   . LYS A  1 67 ? -8.051  -6.658  -1.304   1.00 16.82  ? 108 LYS A C   1 
ATOM   532  O  O   . LYS A  1 67 ? -8.063  -6.613  -0.071   1.00 22.12  ? 108 LYS A O   1 
ATOM   533  C  CB  . LYS A  1 67 ? -9.757  -8.074  -2.455   1.00 39.04  ? 108 LYS A CB  1 
ATOM   534  C  CG  . LYS A  1 67 ? -11.090 -8.189  -3.163   1.00 42.07  ? 108 LYS A CG  1 
ATOM   535  C  CD  . LYS A  1 67 ? -11.396 -9.635  -3.507   1.00 51.98  ? 108 LYS A CD  1 
ATOM   536  C  CE  . LYS A  1 67 ? -12.806 -9.778  -4.052   1.00 67.58  ? 108 LYS A CE  1 
ATOM   537  N  NZ  . LYS A  1 67 ? -13.114 -11.182 -4.466   1.00 68.72  ? 108 LYS A NZ  1 
ATOM   538  N  N   . LEU A  1 68 ? -6.925  -6.735  -2.008   1.00 25.70  ? 109 LEU A N   1 
ATOM   539  C  CA  . LEU A  1 68 ? -5.633  -6.756  -1.339   1.00 16.77  ? 109 LEU A CA  1 
ATOM   540  C  C   . LEU A  1 68 ? -5.378  -5.426  -0.633   1.00 27.77  ? 109 LEU A C   1 
ATOM   541  O  O   . LEU A  1 68 ? -4.767  -5.387  0.434    1.00 31.05  ? 109 LEU A O   1 
ATOM   542  C  CB  . LEU A  1 68 ? -4.522  -7.041  -2.349   1.00 25.13  ? 109 LEU A CB  1 
ATOM   543  C  CG  . LEU A  1 68 ? -3.136  -7.098  -1.729   1.00 16.54  ? 109 LEU A CG  1 
ATOM   544  C  CD1 . LEU A  1 68 ? -3.159  -8.032  -0.536   1.00 29.76  ? 109 LEU A CD1 1 
ATOM   545  C  CD2 . LEU A  1 68 ? -2.103  -7.523  -2.782   1.00 19.54  ? 109 LEU A CD2 1 
ATOM   546  N  N   . LYS A  1 69 ? -5.836  -4.332  -1.236   1.00 23.87  ? 110 LYS A N   1 
ATOM   547  C  CA  . LYS A  1 69 ? -5.680  -3.034  -0.600   1.00 20.69  ? 110 LYS A CA  1 
ATOM   548  C  C   . LYS A  1 69 ? -6.498  -3.004  0.697    1.00 25.26  ? 110 LYS A C   1 
ATOM   549  O  O   . LYS A  1 69 ? -6.094  -2.375  1.671    1.00 34.51  ? 110 LYS A O   1 
ATOM   550  C  CB  . LYS A  1 69 ? -6.136  -1.903  -1.535   1.00 26.71  ? 110 LYS A CB  1 
ATOM   551  C  CG  . LYS A  1 69 ? -5.168  -1.594  -2.668   1.00 24.66  ? 110 LYS A CG  1 
ATOM   552  C  CD  . LYS A  1 69 ? -5.621  -0.348  -3.433   1.00 41.65  ? 110 LYS A CD  1 
ATOM   553  C  CE  . LYS A  1 69 ? -4.795  -0.080  -4.697   1.00 44.52  ? 110 LYS A CE  1 
ATOM   554  N  NZ  . LYS A  1 69 ? -3.375  0.312   -4.455   1.00 36.46  ? 110 LYS A NZ  1 
ATOM   555  N  N   . GLU A  1 70 ? -7.653  -3.672  0.716    1.00 24.15  ? 111 GLU A N   1 
ATOM   556  C  CA  . GLU A  1 70 ? -8.452  -3.688  1.936    1.00 18.41  ? 111 GLU A CA  1 
ATOM   557  C  C   . GLU A  1 70 ? -7.677  -4.483  2.967    1.00 20.51  ? 111 GLU A C   1 
ATOM   558  O  O   . GLU A  1 70 ? -7.482  -4.033  4.089    1.00 18.73  ? 111 GLU A O   1 
ATOM   559  C  CB  . GLU A  1 70 ? -9.818  -4.358  1.734    1.00 35.92  ? 111 GLU A CB  1 
ATOM   560  C  CG  . GLU A  1 70 ? -10.734 -3.725  0.704    1.00 32.75  ? 111 GLU A CG  1 
ATOM   561  C  CD  . GLU A  1 70 ? -12.072 -4.460  0.579    1.00 55.11  ? 111 GLU A CD  1 
ATOM   562  O  OE1 . GLU A  1 70 ? -12.684 -4.821  1.620    1.00 57.33  ? 111 GLU A OE1 1 
ATOM   563  O  OE2 . GLU A  1 70 ? -12.520 -4.660  -0.572   1.00 53.15  ? 111 GLU A OE2 1 
ATOM   564  N  N   . LEU A  1 71 ? -7.241  -5.680  2.594    1.00 21.86  ? 112 LEU A N   1 
ATOM   565  C  CA  . LEU A  1 71 ? -6.471  -6.495  3.530    1.00 29.69  ? 112 LEU A CA  1 
ATOM   566  C  C   . LEU A  1 71 ? -5.268  -5.708  4.043    1.00 21.56  ? 112 LEU A C   1 
ATOM   567  O  O   . LEU A  1 71 ? -4.922  -5.776  5.223    1.00 29.14  ? 112 LEU A O   1 
ATOM   568  C  CB  . LEU A  1 71 ? -5.992  -7.776  2.850    1.00 22.02  ? 112 LEU A CB  1 
ATOM   569  C  CG  . LEU A  1 71 ? -6.931  -8.964  3.002    1.00 26.16  ? 112 LEU A CG  1 
ATOM   570  C  CD1 . LEU A  1 71 ? -6.465  -10.129 2.130    1.00 35.95  ? 112 LEU A CD1 1 
ATOM   571  C  CD2 . LEU A  1 71 ? -6.958  -9.363  4.470    1.00 25.83  ? 112 LEU A CD2 1 
ATOM   572  N  N   . GLU A  1 72 ? -4.626  -4.973  3.138    1.00 27.59  ? 113 GLU A N   1 
ATOM   573  C  CA  . GLU A  1 72 ? -3.463  -4.147  3.469    1.00 31.74  ? 113 GLU A CA  1 
ATOM   574  C  C   . GLU A  1 72 ? -3.819  -3.223  4.644    1.00 29.05  ? 113 GLU A C   1 
ATOM   575  O  O   . GLU A  1 72 ? -3.006  -2.988  5.532    1.00 40.13  ? 113 GLU A O   1 
ATOM   576  C  CB  . GLU A  1 72 ? -3.064  -3.322  2.232    1.00 41.49  ? 113 GLU A CB  1 
ATOM   577  C  CG  . GLU A  1 72 ? -1.659  -2.733  2.255    1.00 33.33  ? 113 GLU A CG  1 
ATOM   578  C  CD  . GLU A  1 72 ? -1.255  -2.073  0.933    1.00 42.54  ? 113 GLU A CD  1 
ATOM   579  O  OE1 . GLU A  1 72 ? -2.080  -1.276  0.411    1.00 26.81  ? 113 GLU A OE1 1 
ATOM   580  O  OE2 . GLU A  1 72 ? -0.115  -2.339  0.437    1.00 17.95  ? 113 GLU A OE2 1 
ATOM   581  N  N   . LYS A  1 73 ? -5.053  -2.726  4.652    1.00 28.12  ? 114 LYS A N   1 
ATOM   582  C  CA  . LYS A  1 73 ? -5.532  -1.830  5.701    1.00 31.68  ? 114 LYS A CA  1 
ATOM   583  C  C   . LYS A  1 73 ? -5.969  -2.556  6.963    1.00 30.18  ? 114 LYS A C   1 
ATOM   584  O  O   . LYS A  1 73 ? -5.799  -2.045  8.072    1.00 30.01  ? 114 LYS A O   1 
ATOM   585  C  CB  . LYS A  1 73 ? -6.716  -1.003  5.194    1.00 38.41  ? 114 LYS A CB  1 
ATOM   586  C  CG  . LYS A  1 73 ? -6.386  0.013   4.112    1.00 40.18  ? 114 LYS A CG  1 
ATOM   587  C  CD  . LYS A  1 73 ? -7.658  0.421   3.370    1.00 58.66  ? 114 LYS A CD  1 
ATOM   588  C  CE  . LYS A  1 73 ? -8.768  0.820   4.339    1.00 60.04  ? 114 LYS A CE  1 
ATOM   589  N  NZ  . LYS A  1 73 ? -10.097 0.996   3.673    1.00 37.43  ? 114 LYS A NZ  1 
ATOM   590  N  N   . ASP A  1 74 ? -6.554  -3.735  6.789    1.00 30.78  ? 115 ASP A N   1 
ATOM   591  C  CA  . ASP A  1 74 ? -7.026  -4.519  7.916    1.00 25.24  ? 115 ASP A CA  1 
ATOM   592  C  C   . ASP A  1 74 ? -5.902  -5.035  8.794    1.00 34.19  ? 115 ASP A C   1 
ATOM   593  O  O   . ASP A  1 74 ? -6.009  -4.999  10.022   1.00 38.34  ? 115 ASP A O   1 
ATOM   594  C  CB  . ASP A  1 74 ? -7.894  -5.686  7.429    1.00 39.33  ? 115 ASP A CB  1 
ATOM   595  C  CG  . ASP A  1 74 ? -9.205  -5.221  6.810    1.00 38.54  ? 115 ASP A CG  1 
ATOM   596  O  OD1 . ASP A  1 74 ? -9.626  -4.072  7.087    1.00 35.56  ? 115 ASP A OD1 1 
ATOM   597  O  OD2 . ASP A  1 74 ? -9.823  -6.005  6.059    1.00 39.72  ? 115 ASP A OD2 1 
ATOM   598  N  N   . TYR A  1 75 ? -4.822  -5.503  8.176    1.00 33.18  ? 116 TYR A N   1 
ATOM   599  C  CA  . TYR A  1 75 ? -3.682  -6.020  8.933    1.00 33.85  ? 116 TYR A CA  1 
ATOM   600  C  C   . TYR A  1 75 ? -2.991  -4.883  9.691    1.00 30.54  ? 116 TYR A C   1 
ATOM   601  O  O   . TYR A  1 75 ? -2.538  -5.048  10.831   1.00 24.81  ? 116 TYR A O   1 
ATOM   602  C  CB  . TYR A  1 75 ? -2.702  -6.730  7.987    1.00 29.32  ? 116 TYR A CB  1 
ATOM   603  C  CG  . TYR A  1 75 ? -3.133  -8.146  7.596    1.00 22.43  ? 116 TYR A CG  1 
ATOM   604  C  CD1 . TYR A  1 75 ? -3.128  -9.178  8.539    1.00 27.26  ? 116 TYR A CD1 1 
ATOM   605  C  CD2 . TYR A  1 75 ? -3.534  -8.448  6.288    1.00 16.08  ? 116 TYR A CD2 1 
ATOM   606  C  CE1 . TYR A  1 75 ? -3.505  -10.468 8.196    1.00 24.58  ? 116 TYR A CE1 1 
ATOM   607  C  CE2 . TYR A  1 75 ? -3.910  -9.742  5.938    1.00 41.42  ? 116 TYR A CE2 1 
ATOM   608  C  CZ  . TYR A  1 75 ? -3.889  -10.746 6.902    1.00 21.51  ? 116 TYR A CZ  1 
ATOM   609  O  OH  . TYR A  1 75 ? -4.233  -12.036 6.579    1.00 30.27  ? 116 TYR A OH  1 
ATOM   610  N  N   . SER A  1 76 ? -2.938  -3.713  9.065    1.00 29.78  ? 117 SER A N   1 
ATOM   611  C  CA  . SER A  1 76 ? -2.324  -2.551  9.695    1.00 21.67  ? 117 SER A CA  1 
ATOM   612  C  C   . SER A  1 76 ? -3.148  -2.160  10.907   1.00 24.35  ? 117 SER A C   1 
ATOM   613  O  O   . SER A  1 76 ? -2.609  -1.892  11.980   1.00 33.38  ? 117 SER A O   1 
ATOM   614  C  CB  . SER A  1 76 ? -2.276  -1.376  8.713    1.00 25.94  ? 117 SER A CB  1 
ATOM   615  O  OG  . SER A  1 76 ? -1.579  -1.743  7.537    1.00 58.81  ? 117 SER A OG  1 
ATOM   616  N  N   . GLU A  1 77 ? -4.462  -2.126  10.752   1.00 24.03  ? 118 GLU A N   1 
ATOM   617  C  CA  . GLU A  1 77 ? -5.292  -1.749  11.881   1.00 15.09  ? 118 GLU A CA  1 
ATOM   618  C  C   . GLU A  1 77 ? -5.189  -2.801  12.960   1.00 20.47  ? 118 GLU A C   1 
ATOM   619  O  O   . GLU A  1 77 ? -5.079  -2.482  14.143   1.00 30.75  ? 118 GLU A O   1 
ATOM   620  C  CB  . GLU A  1 77 ? -6.752  -1.579  11.442   1.00 32.54  ? 118 GLU A CB  1 
ATOM   621  C  CG  . GLU A  1 77 ? -6.934  -0.535  10.335   1.00 62.28  ? 118 GLU A CG  1 
ATOM   622  C  CD  . GLU A  1 77 ? -8.390  -0.331  9.923    1.00 73.07  ? 118 GLU A CD  1 
ATOM   623  O  OE1 . GLU A  1 77 ? -9.132  -1.334  9.805    1.00 65.40  ? 118 GLU A OE1 1 
ATOM   624  O  OE2 . GLU A  1 77 ? -8.786  0.836   9.700    1.00 64.21  ? 118 GLU A OE2 1 
ATOM   625  N  N   . LEU A  1 78 ? -5.204  -4.067  12.555   1.00 21.01  ? 119 LEU A N   1 
ATOM   626  C  CA  . LEU A  1 78 ? -5.133  -5.163  13.520   1.00 10.86  ? 119 LEU A CA  1 
ATOM   627  C  C   . LEU A  1 78 ? -3.838  -5.126  14.317   1.00 5.36   ? 119 LEU A C   1 
ATOM   628  O  O   . LEU A  1 78 ? -3.837  -5.312  15.541   1.00 22.41  ? 119 LEU A O   1 
ATOM   629  C  CB  . LEU A  1 78 ? -5.252  -6.505  12.780   1.00 20.45  ? 119 LEU A CB  1 
ATOM   630  C  CG  . LEU A  1 78 ? -5.297  -7.771  13.625   1.00 35.15  ? 119 LEU A CG  1 
ATOM   631  C  CD1 . LEU A  1 78 ? -6.445  -7.683  14.613   1.00 11.46  ? 119 LEU A CD1 1 
ATOM   632  C  CD2 . LEU A  1 78 ? -5.461  -8.976  12.704   1.00 38.15  ? 119 LEU A CD2 1 
ATOM   633  N  N   . SER A  1 79 ? -2.731  -4.898  13.609   1.00 14.70  ? 120 SER A N   1 
ATOM   634  C  CA  . SER A  1 79 ? -1.408  -4.840  14.234   1.00 15.20  ? 120 SER A CA  1 
ATOM   635  C  C   . SER A  1 79 ? -1.381  -3.764  15.314   1.00 25.75  ? 120 SER A C   1 
ATOM   636  O  O   . SER A  1 79 ? -0.902  -3.942  16.432   1.00 17.66  ? 120 SER A O   1 
ATOM   637  C  CB  . SER A  1 79 ? -0.356  -4.540  13.157   1.00 20.24  ? 120 SER A CB  1 
ATOM   638  O  OG  . SER A  1 79 ? 0.956   -4.540  13.700   1.00 38.66  ? 120 SER A OG  1 
ATOM   639  N  N   . ASN A  1 80 ? -1.921  -2.630  14.943   1.00 23.44  ? 121 ASN A N   1 
ATOM   640  C  CA  . ASN A  1 80 ? -2.030  -1.493  15.793   1.00 14.02  ? 121 ASN A CA  1 
ATOM   641  C  C   . ASN A  1 80 ? -2.810  -1.867  17.051   1.00 14.78  ? 121 ASN A C   1 
ATOM   642  O  O   . ASN A  1 80 ? -2.431  -1.549  18.192   1.00 27.73  ? 121 ASN A O   1 
ATOM   643  C  CB  . ASN A  1 80 ? -2.745  -0.487  14.936   1.00 18.81  ? 121 ASN A CB  1 
ATOM   644  C  CG  . ASN A  1 80 ? -1.788  0.348   14.110   1.00 34.47  ? 121 ASN A CG  1 
ATOM   645  O  OD1 . ASN A  1 80 ? -0.585  0.357   14.350   1.00 35.21  ? 121 ASN A OD1 1 
ATOM   646  N  ND2 . ASN A  1 80 ? -2.325  1.076   13.153   1.00 33.48  ? 121 ASN A ND2 1 
ATOM   647  N  N   . ARG A  1 81 ? -3.907  -2.584  16.861   1.00 17.14  ? 122 ARG A N   1 
ATOM   648  C  CA  . ARG A  1 81 ? -4.688  -2.984  18.025   1.00 26.68  ? 122 ARG A CA  1 
ATOM   649  C  C   . ARG A  1 81 ? -3.864  -3.829  19.003   1.00 21.14  ? 122 ARG A C   1 
ATOM   650  O  O   . ARG A  1 81 ? -3.940  -3.625  20.228   1.00 35.22  ? 122 ARG A O   1 
ATOM   651  C  CB  . ARG A  1 81 ? -5.979  -3.694  17.578   1.00 34.56  ? 122 ARG A CB  1 
ATOM   652  C  CG  . ARG A  1 81 ? -6.883  -2.742  16.774   1.00 28.77  ? 122 ARG A CG  1 
ATOM   653  C  CD  . ARG A  1 81 ? -8.246  -3.311  16.377   1.00 30.74  ? 122 ARG A CD  1 
ATOM   654  N  NE  . ARG A  1 81 ? -9.079  -3.577  17.540   1.00 38.31  ? 122 ARG A NE  1 
ATOM   655  C  CZ  . ARG A  1 81 ? -10.356 -3.943  17.487   1.00 37.07  ? 122 ARG A CZ  1 
ATOM   656  N  NH1 . ARG A  1 81 ? -10.966 -4.083  16.318   1.00 24.77  ? 122 ARG A NH1 1 
ATOM   657  N  NH2 . ARG A  1 81 ? -11.017 -4.190  18.612   1.00 35.92  ? 122 ARG A NH2 1 
ATOM   658  N  N   . TYR A  1 82 ? -3.067  -4.761  18.477   1.00 30.81  ? 123 TYR A N   1 
ATOM   659  C  CA  . TYR A  1 82 ? -2.203  -5.591  19.330   1.00 29.25  ? 123 TYR A CA  1 
ATOM   660  C  C   . TYR A  1 82 ? -1.154  -4.733  20.064   1.00 18.39  ? 123 TYR A C   1 
ATOM   661  O  O   . TYR A  1 82 ? -0.807  -5.012  21.210   1.00 27.54  ? 123 TYR A O   1 
ATOM   662  C  CB  . TYR A  1 82 ? -1.501  -6.669  18.495   1.00 39.87  ? 123 TYR A CB  1 
ATOM   663  C  CG  . TYR A  1 82 ? -2.352  -7.890  18.197   1.00 29.67  ? 123 TYR A CG  1 
ATOM   664  C  CD1 . TYR A  1 82 ? -2.659  -8.809  19.199   1.00 33.62  ? 123 TYR A CD1 1 
ATOM   665  C  CD2 . TYR A  1 82 ? -2.823  -8.137  16.913   1.00 11.06  ? 123 TYR A CD2 1 
ATOM   666  C  CE1 . TYR A  1 82 ? -3.411  -9.947  18.927   1.00 31.77  ? 123 TYR A CE1 1 
ATOM   667  C  CE2 . TYR A  1 82 ? -3.579  -9.271  16.623   1.00 27.73  ? 123 TYR A CE2 1 
ATOM   668  C  CZ  . TYR A  1 82 ? -3.870  -10.172 17.633   1.00 21.50  ? 123 TYR A CZ  1 
ATOM   669  O  OH  . TYR A  1 82 ? -4.631  -11.286 17.365   1.00 32.77  ? 123 TYR A OH  1 
ATOM   670  N  N   . ASN A  1 83 ? -0.652  -3.680  19.425   1.00 28.69  ? 124 ASN A N   1 
ATOM   671  C  CA  . ASN A  1 83 ? 0.328   -2.834  20.111   1.00 27.62  ? 124 ASN A CA  1 
ATOM   672  C  C   . ASN A  1 83 ? -0.330  -2.089  21.270   1.00 19.05  ? 124 ASN A C   1 
ATOM   673  O  O   . ASN A  1 83 ? 0.241   -1.960  22.346   1.00 20.74  ? 124 ASN A O   1 
ATOM   674  C  CB  . ASN A  1 83 ? 0.978   -1.849  19.136   1.00 34.88  ? 124 ASN A CB  1 
ATOM   675  C  CG  . ASN A  1 83 ? 1.880   -2.545  18.136   1.00 45.96  ? 124 ASN A CG  1 
ATOM   676  O  OD1 . ASN A  1 83 ? 2.335   -3.665  18.378   1.00 26.84  ? 124 ASN A OD1 1 
ATOM   677  N  ND2 . ASN A  1 83 ? 2.152   -1.885  17.013   1.00 10.57  ? 124 ASN A ND2 1 
ATOM   678  N  N   . GLU A  1 84 ? -1.549  -1.615  21.060   1.00 22.43  ? 125 GLU A N   1 
ATOM   679  C  CA  . GLU A  1 84 ? -2.240  -0.908  22.116   1.00 20.03  ? 125 GLU A CA  1 
ATOM   680  C  C   . GLU A  1 84 ? -2.514  -1.929  23.221   1.00 19.45  ? 125 GLU A C   1 
ATOM   681  O  O   . GLU A  1 84 ? -2.305  -1.652  24.400   1.00 32.65  ? 125 GLU A O   1 
ATOM   682  C  CB  . GLU A  1 84 ? -3.543  -0.309  21.575   1.00 29.99  ? 125 GLU A CB  1 
ATOM   683  C  CG  . GLU A  1 84 ? -4.167  0.799   22.430   1.00 54.58  ? 125 GLU A CG  1 
ATOM   684  C  CD  . GLU A  1 84 ? -3.237  1.995   22.665   1.00 60.08  ? 125 GLU A CD  1 
ATOM   685  O  OE1 . GLU A  1 84 ? -2.630  2.512   21.699   1.00 38.63  ? 125 GLU A OE1 1 
ATOM   686  O  OE2 . GLU A  1 84 ? -3.128  2.432   23.829   1.00 66.71  ? 125 GLU A OE2 1 
ATOM   687  N  N   . GLN A  1 85 ? -2.955  -3.124  22.837   1.00 35.59  ? 126 GLN A N   1 
ATOM   688  C  CA  . GLN A  1 85 ? -3.242  -4.156  23.831   1.00 20.58  ? 126 GLN A CA  1 
ATOM   689  C  C   . GLN A  1 85 ? -2.032  -4.485  24.694   1.00 24.19  ? 126 GLN A C   1 
ATOM   690  O  O   . GLN A  1 85 ? -2.164  -4.741  25.892   1.00 31.51  ? 126 GLN A O   1 
ATOM   691  C  CB  . GLN A  1 85 ? -3.787  -5.417  23.159   1.00 29.70  ? 126 GLN A CB  1 
ATOM   692  C  CG  . GLN A  1 85 ? -5.261  -5.302  22.761   1.00 31.67  ? 126 GLN A CG  1 
ATOM   693  C  CD  . GLN A  1 85 ? -6.114  -4.693  23.852   1.00 31.04  ? 126 GLN A CD  1 
ATOM   694  O  OE1 . GLN A  1 85 ? -6.531  -3.534  23.760   1.00 52.14  ? 126 GLN A OE1 1 
ATOM   695  N  NE2 . GLN A  1 85 ? -6.369  -5.464  24.901   1.00 30.58  ? 126 GLN A NE2 1 
ATOM   696  N  N   . LYS A  1 86 ? -0.846  -4.454  24.099   1.00 28.21  ? 127 LYS A N   1 
ATOM   697  C  CA  . LYS A  1 86 ? 0.361   -4.726  24.862   1.00 10.30  ? 127 LYS A CA  1 
ATOM   698  C  C   . LYS A  1 86 ? 0.706   -3.581  25.821   1.00 29.23  ? 127 LYS A C   1 
ATOM   699  O  O   . LYS A  1 86 ? 1.152   -3.819  26.934   1.00 35.00  ? 127 LYS A O   1 
ATOM   700  C  CB  . LYS A  1 86 ? 1.543   -4.956  23.932   1.00 33.22  ? 127 LYS A CB  1 
ATOM   701  C  CG  . LYS A  1 86 ? 2.700   -5.590  24.664   1.00 49.27  ? 127 LYS A CG  1 
ATOM   702  C  CD  . LYS A  1 86 ? 4.011   -5.167  24.098   1.00 42.64  ? 127 LYS A CD  1 
ATOM   703  C  CE  . LYS A  1 86 ? 5.044   -5.169  25.187   1.00 51.88  ? 127 LYS A CE  1 
ATOM   704  N  NZ  . LYS A  1 86 ? 5.948   -4.018  24.957   1.00 58.14  ? 127 LYS A NZ  1 
ATOM   705  N  N   . GLU A  1 87 ? 0.512   -2.338  25.389   1.00 28.85  ? 128 GLU A N   1 
ATOM   706  C  CA  . GLU A  1 87 ? 0.814   -1.193  26.252   1.00 23.89  ? 128 GLU A CA  1 
ATOM   707  C  C   . GLU A  1 87 ? 0.075   -1.309  27.594   1.00 20.58  ? 128 GLU A C   1 
ATOM   708  O  O   . GLU A  1 87 ? 0.632   -1.022  28.655   1.00 28.51  ? 128 GLU A O   1 
ATOM   709  C  CB  . GLU A  1 87 ? 0.436   0.119   25.543   1.00 29.62  ? 128 GLU A CB  1 
ATOM   710  C  CG  . GLU A  1 87 ? 1.331   0.493   24.356   1.00 25.45  ? 128 GLU A CG  1 
ATOM   711  C  CD  . GLU A  1 87 ? 0.707   1.568   23.477   1.00 32.15  ? 128 GLU A CD  1 
ATOM   712  O  OE1 . GLU A  1 87 ? 0.265   2.601   24.041   1.00 42.40  ? 128 GLU A OE1 1 
ATOM   713  O  OE2 . GLU A  1 87 ? 0.656   1.386   22.227   1.00 19.04  ? 128 GLU A OE2 1 
ATOM   714  N  N   . LYS A  1 88 ? -1.180  -1.742  27.548   1.00 19.95  ? 129 LYS A N   1 
ATOM   715  C  CA  . LYS A  1 88 ? -1.976  -1.910  28.765   1.00 27.73  ? 129 LYS A CA  1 
ATOM   716  C  C   . LYS A  1 88 ? -1.404  -3.005  29.664   1.00 42.77  ? 129 LYS A C   1 
ATOM   717  O  O   . LYS A  1 88 ? -1.295  -2.836  30.887   1.00 49.71  ? 129 LYS A O   1 
ATOM   718  C  CB  . LYS A  1 88 ? -3.410  -2.276  28.398   1.00 37.50  ? 129 LYS A CB  1 
ATOM   719  C  CG  . LYS A  1 88 ? -4.099  -1.220  27.567   1.00 36.63  ? 129 LYS A CG  1 
ATOM   720  C  CD  . LYS A  1 88 ? -5.494  -1.639  27.169   1.00 35.32  ? 129 LYS A CD  1 
ATOM   721  C  CE  . LYS A  1 88 ? -6.129  -0.586  26.287   1.00 39.62  ? 129 LYS A CE  1 
ATOM   722  N  NZ  . LYS A  1 88 ? -7.326  -1.131  25.608   1.00 56.76  ? 129 LYS A NZ  1 
ATOM   723  N  N   . MET A  1 89 ? -1.054  -4.136  29.055   1.00 34.27  ? 130 MET A N   1 
ATOM   724  C  CA  . MET A  1 89 ? -0.492  -5.242  29.810   1.00 47.89  ? 130 MET A CA  1 
ATOM   725  C  C   . MET A  1 89 ? 0.760   -4.736  30.492   1.00 49.46  ? 130 MET A C   1 
ATOM   726  O  O   . MET A  1 89 ? 1.026   -5.058  31.649   1.00 53.09  ? 130 MET A O   1 
ATOM   727  C  CB  . MET A  1 89 ? -0.146  -6.396  28.880   1.00 50.15  ? 130 MET A CB  1 
ATOM   728  C  CG  . MET A  1 89 ? -0.916  -7.670  29.170   1.00 61.66  ? 130 MET A CG  1 
ATOM   729  S  SD  . MET A  1 89 ? -0.382  -8.469  30.689   1.00 74.61  ? 130 MET A SD  1 
ATOM   730  C  CE  . MET A  1 89 ? -1.905  -8.473  31.674   1.00 91.63  ? 130 MET A CE  1 
ATOM   731  N  N   . ASP A  1 90 ? 1.518   -3.934  29.753   1.00 48.44  ? 131 ASP A N   1 
ATOM   732  C  CA  . ASP A  1 90 ? 2.751   -3.339  30.244   1.00 43.24  ? 131 ASP A CA  1 
ATOM   733  C  C   . ASP A  1 90 ? 2.415   -2.534  31.490   1.00 48.25  ? 131 ASP A C   1 
ATOM   734  O  O   . ASP A  1 90 ? 2.919   -2.802  32.573   1.00 43.09  ? 131 ASP A O   1 
ATOM   735  C  CB  . ASP A  1 90 ? 3.321   -2.413  29.173   1.00 60.96  ? 131 ASP A CB  1 
ATOM   736  C  CG  . ASP A  1 90 ? 4.812   -2.537  29.028   1.00 72.88  ? 131 ASP A CG  1 
ATOM   737  O  OD1 . ASP A  1 90 ? 5.533   -2.152  29.972   1.00 67.76  ? 131 ASP A OD1 1 
ATOM   738  O  OD2 . ASP A  1 90 ? 5.258   -3.025  27.966   1.00 72.90  ? 131 ASP A OD2 1 
ATOM   739  N  N   . GLN A  1 91 ? 1.540   -1.551  31.322   1.00 48.37  ? 132 GLN A N   1 
ATOM   740  C  CA  . GLN A  1 91 ? 1.141   -0.699  32.429   1.00 49.02  ? 132 GLN A CA  1 
ATOM   741  C  C   . GLN A  1 91 ? 0.616   -1.468  33.631   1.00 46.53  ? 132 GLN A C   1 
ATOM   742  O  O   . GLN A  1 91 ? 0.745   -1.007  34.768   1.00 48.54  ? 132 GLN A O   1 
ATOM   743  C  CB  . GLN A  1 91 ? 0.107   0.322   31.964   1.00 46.76  ? 132 GLN A CB  1 
ATOM   744  C  CG  . GLN A  1 91 ? 0.736   1.593   31.419   1.00 47.49  ? 132 GLN A CG  1 
ATOM   745  C  CD  . GLN A  1 91 ? 0.588   1.747   29.918   1.00 48.73  ? 132 GLN A CD  1 
ATOM   746  O  OE1 . GLN A  1 91 ? -0.523  1.751   29.395   1.00 50.14  ? 132 GLN A OE1 1 
ATOM   747  N  NE2 . GLN A  1 91 ? 1.713   1.889   29.218   1.00 52.06  ? 132 GLN A NE2 1 
ATOM   748  N  N   . LEU A  1 92 ? 0.041   -2.642  33.389   1.00 53.51  ? 133 LEU A N   1 
ATOM   749  C  CA  . LEU A  1 92 ? -0.476  -3.465  34.477   1.00 57.65  ? 133 LEU A CA  1 
ATOM   750  C  C   . LEU A  1 92 ? 0.631   -3.954  35.399   1.00 59.58  ? 133 LEU A C   1 
ATOM   751  O  O   . LEU A  1 92 ? 0.460   -3.991  36.615   1.00 59.90  ? 133 LEU A O   1 
ATOM   752  C  CB  . LEU A  1 92 ? -1.229  -4.682  33.932   1.00 60.29  ? 133 LEU A CB  1 
ATOM   753  C  CG  . LEU A  1 92 ? -2.747  -4.579  33.787   1.00 60.73  ? 133 LEU A CG  1 
ATOM   754  C  CD1 . LEU A  1 92 ? -3.320  -5.922  33.352   1.00 49.41  ? 133 LEU A CD1 1 
ATOM   755  C  CD2 . LEU A  1 92 ? -3.346  -4.156  35.115   1.00 50.90  ? 133 LEU A CD2 1 
ATOM   756  N  N   . SER A  1 93 ? 1.758   -4.344  34.812   1.00 62.38  ? 134 SER A N   1 
ATOM   757  C  CA  . SER A  1 93 ? 2.897   -4.847  35.574   1.00 69.42  ? 134 SER A CA  1 
ATOM   758  C  C   . SER A  1 93 ? 3.696   -3.711  36.204   1.00 69.80  ? 134 SER A C   1 
ATOM   759  O  O   . SER A  1 93 ? 4.218   -3.835  37.313   1.00 74.64  ? 134 SER A O   1 
ATOM   760  C  CB  . SER A  1 93 ? 3.815   -5.660  34.655   1.00 74.79  ? 134 SER A CB  1 
ATOM   761  O  OG  . SER A  1 93 ? 4.956   -6.136  35.353   1.00 85.03  ? 134 SER A OG  1 
ATOM   762  N  N   . LYS A  1 94 ? 3.772   -2.601  35.480   1.00 68.34  ? 135 LYS A N   1 
ATOM   763  C  CA  . LYS A  1 94 ? 4.517   -1.419  35.901   1.00 78.23  ? 135 LYS A CA  1 
ATOM   764  C  C   . LYS A  1 94 ? 4.111   -0.861  37.264   1.00 89.10  ? 135 LYS A C   1 
ATOM   765  O  O   . LYS A  1 94 ? 3.129   -1.295  37.872   1.00 87.95  ? 135 LYS A O   1 
ATOM   766  C  CB  . LYS A  1 94 ? 4.366   -0.319  34.846   1.00 72.94  ? 135 LYS A CB  1 
ATOM   767  C  CG  . LYS A  1 94 ? 5.490   0.696   34.806   1.00 67.04  ? 135 LYS A CG  1 
ATOM   768  C  CD  . LYS A  1 94 ? 6.068   0.735   33.407   1.00 64.85  ? 135 LYS A CD  1 
ATOM   769  C  CE  . LYS A  1 94 ? 7.166   1.784   33.253   1.00 65.82  ? 135 LYS A CE  1 
ATOM   770  N  NZ  . LYS A  1 94 ? 8.387   1.567   34.085   1.00 52.67  ? 135 LYS A NZ  1 
ATOM   771  N  N   . LEU A  1 95 ? 4.890   0.112   37.728   1.00 93.13  ? 136 LEU A N   1 
ATOM   772  C  CA  . LEU A  1 95 ? 4.642   0.770   39.004   1.00 97.05  ? 136 LEU A CA  1 
ATOM   773  C  C   . LEU A  1 95 ? 3.816   2.034   38.775   1.00 99.59  ? 136 LEU A C   1 
ATOM   774  O  O   . LEU A  1 95 ? 4.331   3.136   39.063   1.00 99.62  ? 136 LEU A O   1 
ATOM   775  C  CB  . LEU A  1 95 ? 5.969   1.138   39.676   1.00 99.79  ? 136 LEU A CB  1 
ATOM   776  C  CG  . LEU A  1 95 ? 6.946   0.003   39.990   1.00 102.02 ? 136 LEU A CG  1 
ATOM   777  C  CD1 . LEU A  1 95 ? 8.250   0.590   40.516   1.00 99.44  ? 136 LEU A CD1 1 
ATOM   778  C  CD2 . LEU A  1 95 ? 6.326   -0.950  41.007   1.00 102.27 ? 136 LEU A CD2 1 
ATOM   779  N  N   . LEU B  1 8  ? -5.824  16.735  -69.956  1.00 154.39 ? 49  LEU B N   1 
ATOM   780  C  CA  . LEU B  1 8  ? -4.759  15.972  -69.243  1.00 154.39 ? 49  LEU B CA  1 
ATOM   781  C  C   . LEU B  1 8  ? -3.895  16.891  -68.386  1.00 154.39 ? 49  LEU B C   1 
ATOM   782  O  O   . LEU B  1 8  ? -3.759  16.685  -67.180  1.00 154.39 ? 49  LEU B O   1 
ATOM   783  C  CB  . LEU B  1 8  ? -3.877  15.232  -70.252  1.00 153.75 ? 49  LEU B CB  1 
ATOM   784  C  CG  . LEU B  1 8  ? -4.527  14.109  -71.064  1.00 153.75 ? 49  LEU B CG  1 
ATOM   785  C  CD1 . LEU B  1 8  ? -3.529  13.572  -72.072  1.00 153.75 ? 49  LEU B CD1 1 
ATOM   786  C  CD2 . LEU B  1 8  ? -4.994  12.999  -70.136  1.00 153.75 ? 49  LEU B CD2 1 
ATOM   787  N  N   . HIS B  1 9  ? -3.311  17.905  -69.018  1.00 153.37 ? 50  HIS B N   1 
ATOM   788  C  CA  . HIS B  1 9  ? -2.461  18.856  -68.313  1.00 154.13 ? 50  HIS B CA  1 
ATOM   789  C  C   . HIS B  1 9  ? -3.269  19.549  -67.221  1.00 153.97 ? 50  HIS B C   1 
ATOM   790  O  O   . HIS B  1 9  ? -2.710  20.081  -66.262  1.00 155.78 ? 50  HIS B O   1 
ATOM   791  C  CB  . HIS B  1 9  ? -1.910  19.898  -69.290  1.00 149.36 ? 50  HIS B CB  1 
ATOM   792  C  CG  . HIS B  1 9  ? -0.773  20.702  -68.741  1.00 149.08 ? 50  HIS B CG  1 
ATOM   793  N  ND1 . HIS B  1 9  ? 0.436   20.138  -68.395  1.00 148.46 ? 50  HIS B ND1 1 
ATOM   794  C  CD2 . HIS B  1 9  ? -0.659  22.026  -68.480  1.00 147.93 ? 50  HIS B CD2 1 
ATOM   795  C  CE1 . HIS B  1 9  ? 1.246   21.080  -67.944  1.00 146.15 ? 50  HIS B CE1 1 
ATOM   796  N  NE2 . HIS B  1 9  ? 0.606   22.235  -67.985  1.00 146.33 ? 50  HIS B NE2 1 
ATOM   797  N  N   . ASP B  1 10 ? -4.589  19.538  -67.375  1.00 154.56 ? 51  ASP B N   1 
ATOM   798  C  CA  . ASP B  1 10 ? -5.477  20.160  -66.403  1.00 151.22 ? 51  ASP B CA  1 
ATOM   799  C  C   . ASP B  1 10 ? -5.689  19.230  -65.212  1.00 149.79 ? 51  ASP B C   1 
ATOM   800  O  O   . ASP B  1 10 ? -5.981  19.680  -64.104  1.00 147.46 ? 51  ASP B O   1 
ATOM   801  C  CB  . ASP B  1 10 ? -6.822  20.486  -67.055  1.00 151.09 ? 51  ASP B CB  1 
ATOM   802  C  CG  . ASP B  1 10 ? -7.742  21.256  -66.132  1.00 153.56 ? 51  ASP B CG  1 
ATOM   803  O  OD1 . ASP B  1 10 ? -7.384  22.387  -65.743  1.00 150.21 ? 51  ASP B OD1 1 
ATOM   804  O  OD2 . ASP B  1 10 ? -8.822  20.729  -65.794  1.00 156.35 ? 51  ASP B OD2 1 
ATOM   805  N  N   . GLN B  1 11 ? -5.540  17.930  -65.450  1.00 150.13 ? 52  GLN B N   1 
ATOM   806  C  CA  . GLN B  1 11 ? -5.702  16.933  -64.399  1.00 150.83 ? 52  GLN B CA  1 
ATOM   807  C  C   . GLN B  1 11 ? -4.463  16.889  -63.515  1.00 153.07 ? 52  GLN B C   1 
ATOM   808  O  O   . GLN B  1 11 ? -4.565  16.835  -62.290  1.00 155.78 ? 52  GLN B O   1 
ATOM   809  C  CB  . GLN B  1 11 ? -5.946  15.552  -65.009  1.00 150.21 ? 52  GLN B CB  1 
ATOM   810  C  CG  . GLN B  1 11 ? -7.278  15.428  -65.720  1.00 153.54 ? 52  GLN B CG  1 
ATOM   811  C  CD  . GLN B  1 11 ? -8.453  15.674  -64.792  1.00 155.10 ? 52  GLN B CD  1 
ATOM   812  O  OE1 . GLN B  1 11 ? -8.676  14.923  -63.842  1.00 154.28 ? 52  GLN B OE1 1 
ATOM   813  N  NE2 . GLN B  1 11 ? -9.207  16.733  -65.061  1.00 157.42 ? 52  GLN B NE2 1 
ATOM   814  N  N   . ILE B  1 12 ? -3.293  16.911  -64.147  1.00 153.62 ? 53  ILE B N   1 
ATOM   815  C  CA  . ILE B  1 12 ? -2.023  16.881  -63.428  1.00 152.27 ? 53  ILE B CA  1 
ATOM   816  C  C   . ILE B  1 12 ? -1.936  18.017  -62.407  1.00 150.94 ? 53  ILE B C   1 
ATOM   817  O  O   . ILE B  1 12 ? -1.554  17.795  -61.258  1.00 150.95 ? 53  ILE B O   1 
ATOM   818  C  CB  . ILE B  1 12 ? -0.828  17.002  -64.407  1.00 151.53 ? 53  ILE B CB  1 
ATOM   819  C  CG1 . ILE B  1 12 ? -0.667  15.708  -65.213  1.00 150.06 ? 53  ILE B CG1 1 
ATOM   820  C  CG2 . ILE B  1 12 ? 0.446   17.329  -63.636  1.00 152.02 ? 53  ILE B CG2 1 
ATOM   821  C  CD1 . ILE B  1 12 ? 0.066   14.600  -64.480  1.00 147.36 ? 53  ILE B CD1 1 
ATOM   822  N  N   . ASP B  1 13 ? -2.286  19.230  -62.831  1.00 151.98 ? 54  ASP B N   1 
ATOM   823  C  CA  . ASP B  1 13 ? -2.239  20.392  -61.945  1.00 148.90 ? 54  ASP B CA  1 
ATOM   824  C  C   . ASP B  1 13 ? -3.222  20.259  -60.789  1.00 148.23 ? 54  ASP B C   1 
ATOM   825  O  O   . ASP B  1 13 ? -2.888  20.552  -59.640  1.00 149.68 ? 54  ASP B O   1 
ATOM   826  C  CB  . ASP B  1 13 ? -2.540  21.681  -62.718  1.00 151.00 ? 54  ASP B CB  1 
ATOM   827  C  CG  . ASP B  1 13 ? -1.456  22.029  -63.719  1.00 150.70 ? 54  ASP B CG  1 
ATOM   828  O  OD1 . ASP B  1 13 ? -0.312  21.557  -63.546  1.00 153.43 ? 54  ASP B OD1 1 
ATOM   829  O  OD2 . ASP B  1 13 ? -1.742  22.789  -64.669  1.00 146.77 ? 54  ASP B OD2 1 
ATOM   830  N  N   . MET B  1 14 ? -4.439  19.827  -61.106  1.00 147.49 ? 55  MET B N   1 
ATOM   831  C  CA  . MET B  1 14 ? -5.485  19.634  -60.108  1.00 145.60 ? 55  MET B CA  1 
ATOM   832  C  C   . MET B  1 14 ? -5.044  18.612  -59.072  1.00 142.59 ? 55  MET B C   1 
ATOM   833  O  O   . MET B  1 14 ? -5.251  18.791  -57.871  1.00 136.08 ? 55  MET B O   1 
ATOM   834  C  CB  . MET B  1 14 ? -6.765  19.141  -60.784  1.00 148.22 ? 55  MET B CB  1 
ATOM   835  C  CG  . MET B  1 14 ? -7.756  20.236  -61.114  1.00 152.65 ? 55  MET B CG  1 
ATOM   836  S  SD  . MET B  1 14 ? -8.610  20.830  -59.641  1.00 156.63 ? 55  MET B SD  1 
ATOM   837  C  CE  . MET B  1 14 ? -10.140 19.906  -59.754  1.00 146.33 ? 55  MET B CE  1 
ATOM   838  N  N   . LEU B  1 15 ? -4.435  17.537  -59.560  1.00 140.35 ? 56  LEU B N   1 
ATOM   839  C  CA  . LEU B  1 15 ? -3.953  16.455  -58.714  1.00 138.14 ? 56  LEU B CA  1 
ATOM   840  C  C   . LEU B  1 15 ? -2.763  16.902  -57.867  1.00 139.46 ? 56  LEU B C   1 
ATOM   841  O  O   . LEU B  1 15 ? -2.544  16.381  -56.773  1.00 140.48 ? 56  LEU B O   1 
ATOM   842  C  CB  . LEU B  1 15 ? -3.553  15.268  -59.583  1.00 135.06 ? 56  LEU B CB  1 
ATOM   843  C  CG  . LEU B  1 15 ? -3.201  13.954  -58.897  1.00 131.75 ? 56  LEU B CG  1 
ATOM   844  C  CD1 . LEU B  1 15 ? -4.368  12.981  -58.945  1.00 127.63 ? 56  LEU B CD1 1 
ATOM   845  C  CD2 . LEU B  1 15 ? -2.062  13.356  -59.635  1.00 128.69 ? 56  LEU B CD2 1 
ATOM   846  N  N   . THR B  1 16 ? -1.981  17.849  -58.381  1.00 139.52 ? 57  THR B N   1 
ATOM   847  C  CA  . THR B  1 16 ? -0.838  18.360  -57.632  1.00 141.51 ? 57  THR B CA  1 
ATOM   848  C  C   . THR B  1 16 ? -1.406  19.213  -56.506  1.00 140.80 ? 57  THR B C   1 
ATOM   849  O  O   . THR B  1 16 ? -0.883  19.226  -55.393  1.00 139.42 ? 57  THR B O   1 
ATOM   850  C  CB  . THR B  1 16 ? 0.094   19.232  -58.510  1.00 139.61 ? 57  THR B CB  1 
ATOM   851  O  OG1 . THR B  1 16 ? 0.768   18.405  -59.469  1.00 140.08 ? 57  THR B OG1 1 
ATOM   852  C  CG2 . THR B  1 16 ? 1.131   19.941  -57.646  1.00 140.72 ? 57  THR B CG2 1 
ATOM   853  N  N   . LYS B  1 17 ? -2.492  19.919  -56.811  1.00 139.46 ? 58  LYS B N   1 
ATOM   854  C  CA  . LYS B  1 17 ? -3.164  20.767  -55.836  1.00 142.46 ? 58  LYS B CA  1 
ATOM   855  C  C   . LYS B  1 17 ? -3.727  19.908  -54.707  1.00 146.15 ? 58  LYS B C   1 
ATOM   856  O  O   . LYS B  1 17 ? -3.643  20.276  -53.535  1.00 148.11 ? 58  LYS B O   1 
ATOM   857  C  CB  . LYS B  1 17 ? -4.302  21.545  -56.503  1.00 141.00 ? 58  LYS B CB  1 
ATOM   858  C  CG  . LYS B  1 17 ? -3.847  22.619  -57.476  1.00 142.72 ? 58  LYS B CG  1 
ATOM   859  C  CD  . LYS B  1 17 ? -3.121  23.743  -56.757  1.00 146.39 ? 58  LYS B CD  1 
ATOM   860  C  CE  . LYS B  1 17 ? -2.732  24.851  -57.723  1.00 149.24 ? 58  LYS B CE  1 
ATOM   861  N  NZ  . LYS B  1 17 ? -1.992  25.955  -57.049  1.00 148.28 ? 58  LYS B NZ  1 
ATOM   862  N  N   . THR B  1 18 ? -4.304  18.764  -55.064  1.00 146.48 ? 59  THR B N   1 
ATOM   863  C  CA  . THR B  1 18 ? -4.871  17.858  -54.072  1.00 143.24 ? 59  THR B CA  1 
ATOM   864  C  C   . THR B  1 18 ? -3.760  17.304  -53.190  1.00 144.06 ? 59  THR B C   1 
ATOM   865  O  O   . THR B  1 18 ? -3.927  17.166  -51.980  1.00 143.52 ? 59  THR B O   1 
ATOM   866  C  CB  . THR B  1 18 ? -5.604  16.671  -54.730  1.00 144.86 ? 59  THR B CB  1 
ATOM   867  O  OG1 . THR B  1 18 ? -4.679  15.915  -55.522  1.00 143.05 ? 59  THR B OG1 1 
ATOM   868  C  CG2 . THR B  1 18 ? -6.742  17.166  -55.611  1.00 146.76 ? 59  THR B CG2 1 
ATOM   869  N  N   . ASN B  1 19 ? -2.626  16.991  -53.806  1.00 141.02 ? 60  ASN B N   1 
ATOM   870  C  CA  . ASN B  1 19 ? -1.486  16.456  -53.076  1.00 140.53 ? 60  ASN B CA  1 
ATOM   871  C  C   . ASN B  1 19 ? -0.947  17.518  -52.121  1.00 142.34 ? 60  ASN B C   1 
ATOM   872  O  O   . ASN B  1 19 ? -0.641  17.228  -50.967  1.00 140.12 ? 60  ASN B O   1 
ATOM   873  C  CB  . ASN B  1 19 ? -0.391  16.030  -54.056  1.00 143.33 ? 60  ASN B CB  1 
ATOM   874  C  CG  . ASN B  1 19 ? 0.717   15.244  -53.387  1.00 144.49 ? 60  ASN B CG  1 
ATOM   875  O  OD1 . ASN B  1 19 ? 0.488   14.152  -52.865  1.00 147.82 ? 60  ASN B OD1 1 
ATOM   876  N  ND2 . ASN B  1 19 ? 1.926   15.796  -53.397  1.00 142.44 ? 60  ASN B ND2 1 
ATOM   877  N  N   . LEU B  1 20 ? -0.842  18.753  -52.603  1.00 139.99 ? 61  LEU B N   1 
ATOM   878  C  CA  . LEU B  1 20 ? -0.341  19.852  -51.784  1.00 142.21 ? 61  LEU B CA  1 
ATOM   879  C  C   . LEU B  1 20 ? -1.211  20.081  -50.552  1.00 143.29 ? 61  LEU B C   1 
ATOM   880  O  O   . LEU B  1 20 ? -0.698  20.321  -49.458  1.00 144.41 ? 61  LEU B O   1 
ATOM   881  C  CB  . LEU B  1 20 ? -0.268  21.138  -52.611  1.00 142.29 ? 61  LEU B CB  1 
ATOM   882  C  CG  . LEU B  1 20 ? 0.736   21.138  -53.767  1.00 143.05 ? 61  LEU B CG  1 
ATOM   883  C  CD1 . LEU B  1 20 ? 0.630   22.444  -54.540  1.00 142.37 ? 61  LEU B CD1 1 
ATOM   884  C  CD2 . LEU B  1 20 ? 2.145   20.946  -53.222  1.00 142.53 ? 61  LEU B CD2 1 
ATOM   885  N  N   . GLN B  1 21 ? -2.526  20.008  -50.735  1.00 140.84 ? 62  GLN B N   1 
ATOM   886  C  CA  . GLN B  1 21 ? -3.470  20.199  -49.637  1.00 143.30 ? 62  GLN B CA  1 
ATOM   887  C  C   . GLN B  1 21 ? -3.249  19.143  -48.555  1.00 144.95 ? 62  GLN B C   1 
ATOM   888  O  O   . GLN B  1 21 ? -3.284  19.446  -47.362  1.00 144.96 ? 62  GLN B O   1 
ATOM   889  C  CB  . GLN B  1 21 ? -4.909  20.103  -50.154  1.00 144.18 ? 62  GLN B CB  1 
ATOM   890  C  CG  . GLN B  1 21 ? -5.295  21.167  -51.175  1.00 143.26 ? 62  GLN B CG  1 
ATOM   891  C  CD  . GLN B  1 21 ? -5.552  22.525  -50.549  1.00 143.35 ? 62  GLN B CD  1 
ATOM   892  O  OE1 . GLN B  1 21 ? -4.663  23.125  -49.946  1.00 138.43 ? 62  GLN B OE1 1 
ATOM   893  N  NE2 . GLN B  1 21 ? -6.779  23.017  -50.691  1.00 142.25 ? 62  GLN B NE2 1 
ATOM   894  N  N   . LEU B  1 22 ? -3.026  17.903  -48.980  1.00 142.17 ? 63  LEU B N   1 
ATOM   895  C  CA  . LEU B  1 22 ? -2.794  16.806  -48.048  1.00 141.76 ? 63  LEU B CA  1 
ATOM   896  C  C   . LEU B  1 22 ? -1.480  16.956  -47.283  1.00 140.92 ? 63  LEU B C   1 
ATOM   897  O  O   . LEU B  1 22 ? -1.423  16.672  -46.086  1.00 139.27 ? 63  LEU B O   1 
ATOM   898  C  CB  . LEU B  1 22 ? -2.805  15.463  -48.785  1.00 137.32 ? 63  LEU B CB  1 
ATOM   899  C  CG  . LEU B  1 22 ? -4.147  14.744  -48.945  1.00 138.05 ? 63  LEU B CG  1 
ATOM   900  C  CD1 . LEU B  1 22 ? -5.052  15.488  -49.908  1.00 140.20 ? 63  LEU B CD1 1 
ATOM   901  C  CD2 . LEU B  1 22 ? -3.889  13.348  -49.452  1.00 133.43 ? 63  LEU B CD2 1 
ATOM   902  N  N   . THR B  1 23 ? -0.427  17.394  -47.971  1.00 141.32 ? 64  THR B N   1 
ATOM   903  C  CA  . THR B  1 23 ? 0.874   17.574  -47.329  1.00 139.00 ? 64  THR B CA  1 
ATOM   904  C  C   . THR B  1 23 ? 0.773   18.612  -46.222  1.00 137.97 ? 64  THR B C   1 
ATOM   905  O  O   . THR B  1 23 ? 1.303   18.421  -45.129  1.00 138.99 ? 64  THR B O   1 
ATOM   906  C  CB  . THR B  1 23 ? 1.955   18.056  -48.323  1.00 138.35 ? 64  THR B CB  1 
ATOM   907  O  OG1 . THR B  1 23 ? 2.137   17.084  -49.356  1.00 137.31 ? 64  THR B OG1 1 
ATOM   908  C  CG2 . THR B  1 23 ? 3.281   18.262  -47.602  1.00 136.16 ? 64  THR B CG2 1 
ATOM   909  N  N   . THR B  1 24 ? 0.096   19.716  -46.517  1.00 138.60 ? 65  THR B N   1 
ATOM   910  C  CA  . THR B  1 24 ? -0.075  20.791  -45.547  1.00 135.62 ? 65  THR B CA  1 
ATOM   911  C  C   . THR B  1 24 ? -0.868  20.300  -44.345  1.00 132.37 ? 65  THR B C   1 
ATOM   912  O  O   . THR B  1 24 ? -0.537  20.604  -43.200  1.00 132.96 ? 65  THR B O   1 
ATOM   913  C  CB  . THR B  1 24 ? -0.821  21.985  -46.166  1.00 136.98 ? 65  THR B CB  1 
ATOM   914  O  OG1 . THR B  1 24 ? -0.097  22.462  -47.307  1.00 137.81 ? 65  THR B OG1 1 
ATOM   915  C  CG2 . THR B  1 24 ? -0.952  23.108  -45.150  1.00 136.16 ? 65  THR B CG2 1 
ATOM   916  N  N   . GLN B  1 25 ? -1.921  19.540  -44.620  1.00 132.87 ? 66  GLN B N   1 
ATOM   917  C  CA  . GLN B  1 25 ? -2.774  18.994  -43.574  1.00 128.97 ? 66  GLN B CA  1 
ATOM   918  C  C   . GLN B  1 25 ? -1.938  18.063  -42.699  1.00 125.65 ? 66  GLN B C   1 
ATOM   919  O  O   . GLN B  1 25 ? -2.039  18.084  -41.473  1.00 123.64 ? 66  GLN B O   1 
ATOM   920  C  CB  . GLN B  1 25 ? -3.924  18.208  -44.201  1.00 129.13 ? 66  GLN B CB  1 
ATOM   921  C  CG  . GLN B  1 25 ? -5.231  18.259  -43.435  1.00 127.71 ? 66  GLN B CG  1 
ATOM   922  C  CD  . GLN B  1 25 ? -6.058  19.493  -43.757  1.00 128.46 ? 66  GLN B CD  1 
ATOM   923  O  OE1 . GLN B  1 25 ? -7.254  19.550  -43.459  1.00 128.96 ? 66  GLN B OE1 1 
ATOM   924  N  NE2 . GLN B  1 25 ? -5.424  20.490  -44.365  1.00 123.80 ? 66  GLN B NE2 1 
ATOM   925  N  N   . SER B  1 26 ? -1.111  17.247  -43.344  1.00 122.36 ? 67  SER B N   1 
ATOM   926  C  CA  . SER B  1 26 ? -0.258  16.304  -42.636  1.00 120.35 ? 67  SER B CA  1 
ATOM   927  C  C   . SER B  1 26 ? 0.737   17.046  -41.753  1.00 118.73 ? 67  SER B C   1 
ATOM   928  O  O   . SER B  1 26 ? 1.007   16.631  -40.627  1.00 117.89 ? 67  SER B O   1 
ATOM   929  C  CB  . SER B  1 26 ? 0.495   15.422  -43.630  1.00 118.84 ? 67  SER B CB  1 
ATOM   930  O  OG  . SER B  1 26 ? 1.522   16.143  -44.286  1.00 117.90 ? 67  SER B OG  1 
ATOM   931  N  N   . GLN B  1 27 ? 1.287   18.142  -42.269  1.00 117.03 ? 68  GLN B N   1 
ATOM   932  C  CA  . GLN B  1 27 ? 2.242   18.939  -41.505  1.00 114.53 ? 68  GLN B CA  1 
ATOM   933  C  C   . GLN B  1 27 ? 1.557   19.555  -40.295  1.00 114.19 ? 68  GLN B C   1 
ATOM   934  O  O   . GLN B  1 27 ? 2.142   19.644  -39.216  1.00 114.50 ? 68  GLN B O   1 
ATOM   935  C  CB  . GLN B  1 27 ? 2.832   20.057  -42.367  1.00 113.30 ? 68  GLN B CB  1 
ATOM   936  C  CG  . GLN B  1 27 ? 3.982   19.629  -43.262  1.00 118.07 ? 68  GLN B CG  1 
ATOM   937  C  CD  . GLN B  1 27 ? 4.517   20.774  -44.103  1.00 115.14 ? 68  GLN B CD  1 
ATOM   938  O  OE1 . GLN B  1 27 ? 4.976   21.786  -43.574  1.00 114.46 ? 68  GLN B OE1 1 
ATOM   939  N  NE2 . GLN B  1 27 ? 4.459   20.618  -45.422  1.00 112.34 ? 68  GLN B NE2 1 
ATOM   940  N  N   . ASN B  1 28 ? 0.313   19.982  -40.482  1.00 112.66 ? 69  ASN B N   1 
ATOM   941  C  CA  . ASN B  1 28 ? -0.443  20.595  -39.402  1.00 112.49 ? 69  ASN B CA  1 
ATOM   942  C  C   . ASN B  1 28 ? -0.703  19.586  -38.287  1.00 113.90 ? 69  ASN B C   1 
ATOM   943  O  O   . ASN B  1 28 ? -0.569  19.906  -37.107  1.00 117.00 ? 69  ASN B O   1 
ATOM   944  C  CB  . ASN B  1 28 ? -1.770  21.136  -39.931  1.00 112.42 ? 69  ASN B CB  1 
ATOM   945  C  CG  . ASN B  1 28 ? -2.441  22.073  -38.955  1.00 110.99 ? 69  ASN B CG  1 
ATOM   946  O  OD1 . ASN B  1 28 ? -1.918  23.145  -38.650  1.00 111.85 ? 69  ASN B OD1 1 
ATOM   947  N  ND2 . ASN B  1 28 ? -3.600  21.673  -38.451  1.00 105.68 ? 69  ASN B ND2 1 
ATOM   948  N  N   . LEU B  1 29 ? -1.069  18.365  -38.664  1.00 110.79 ? 70  LEU B N   1 
ATOM   949  C  CA  . LEU B  1 29 ? -1.339  17.326  -37.680  1.00 104.78 ? 70  LEU B CA  1 
ATOM   950  C  C   . LEU B  1 29 ? -0.061  16.887  -36.962  1.00 103.14 ? 70  LEU B C   1 
ATOM   951  O  O   . LEU B  1 29 ? -0.107  16.510  -35.793  1.00 102.75 ? 70  LEU B O   1 
ATOM   952  C  CB  . LEU B  1 29 ? -2.005  16.121  -38.349  1.00 101.76 ? 70  LEU B CB  1 
ATOM   953  C  CG  . LEU B  1 29 ? -3.352  16.316  -39.051  1.00 93.32  ? 70  LEU B CG  1 
ATOM   954  C  CD1 . LEU B  1 29 ? -3.800  14.989  -39.633  1.00 93.49  ? 70  LEU B CD1 1 
ATOM   955  C  CD2 . LEU B  1 29 ? -4.399  16.848  -38.079  1.00 87.71  ? 70  LEU B CD2 1 
ATOM   956  N  N   . LEU B  1 30 ? 1.073   16.935  -37.660  1.00 104.68 ? 71  LEU B N   1 
ATOM   957  C  CA  . LEU B  1 30 ? 2.351   16.551  -37.060  1.00 103.90 ? 71  LEU B CA  1 
ATOM   958  C  C   . LEU B  1 30 ? 2.725   17.553  -35.977  1.00 106.82 ? 71  LEU B C   1 
ATOM   959  O  O   . LEU B  1 30 ? 3.225   17.179  -34.915  1.00 106.49 ? 71  LEU B O   1 
ATOM   960  C  CB  . LEU B  1 30 ? 3.466   16.518  -38.112  1.00 108.55 ? 71  LEU B CB  1 
ATOM   961  C  CG  . LEU B  1 30 ? 4.891   16.362  -37.559  1.00 105.90 ? 71  LEU B CG  1 
ATOM   962  C  CD1 . LEU B  1 30 ? 5.091   14.946  -37.035  1.00 107.21 ? 71  LEU B CD1 1 
ATOM   963  C  CD2 . LEU B  1 30 ? 5.908   16.673  -38.647  1.00 103.91 ? 71  LEU B CD2 1 
ATOM   964  N  N   . SER B  1 31 ? 2.483   18.829  -36.259  1.00 105.54 ? 72  SER B N   1 
ATOM   965  C  CA  . SER B  1 31 ? 2.787   19.898  -35.315  1.00 104.87 ? 72  SER B CA  1 
ATOM   966  C  C   . SER B  1 31 ? 1.865   19.798  -34.106  1.00 104.09 ? 72  SER B C   1 
ATOM   967  O  O   . SER B  1 31 ? 2.297   19.972  -32.967  1.00 103.81 ? 72  SER B O   1 
ATOM   968  C  CB  . SER B  1 31 ? 2.605   21.263  -35.981  1.00 106.43 ? 72  SER B CB  1 
ATOM   969  O  OG  . SER B  1 31 ? 1.240   21.509  -36.273  1.00 99.22  ? 72  SER B OG  1 
ATOM   970  N  N   . LYS B  1 32 ? 0.590   19.524  -34.363  1.00 102.43 ? 73  LYS B N   1 
ATOM   971  C  CA  . LYS B  1 32 ? -0.392  19.390  -33.295  1.00 100.41 ? 73  LYS B CA  1 
ATOM   972  C  C   . LYS B  1 32 ? 0.036   18.247  -32.376  1.00 102.16 ? 73  LYS B C   1 
ATOM   973  O  O   . LYS B  1 32 ? -0.028  18.356  -31.154  1.00 104.17 ? 73  LYS B O   1 
ATOM   974  C  CB  . LYS B  1 32 ? -1.771  19.095  -33.887  1.00 100.71 ? 73  LYS B CB  1 
ATOM   975  C  CG  . LYS B  1 32 ? -2.875  19.017  -32.856  1.00 107.22 ? 73  LYS B CG  1 
ATOM   976  C  CD  . LYS B  1 32 ? -4.192  18.594  -33.480  1.00 112.85 ? 73  LYS B CD  1 
ATOM   977  C  CE  . LYS B  1 32 ? -5.284  18.493  -32.421  1.00 119.48 ? 73  LYS B CE  1 
ATOM   978  N  NZ  . LYS B  1 32 ? -6.536  17.871  -32.939  1.00 118.57 ? 73  LYS B NZ  1 
ATOM   979  N  N   . LEU B  1 33 ? 0.474   17.151  -32.983  1.00 102.55 ? 74  LEU B N   1 
ATOM   980  C  CA  . LEU B  1 33 ? 0.927   15.981  -32.241  1.00 100.72 ? 74  LEU B CA  1 
ATOM   981  C  C   . LEU B  1 33 ? 2.165   16.307  -31.420  1.00 96.68  ? 74  LEU B C   1 
ATOM   982  O  O   . LEU B  1 33 ? 2.267   15.942  -30.249  1.00 102.66 ? 74  LEU B O   1 
ATOM   983  C  CB  . LEU B  1 33 ? 1.261   14.848  -33.213  1.00 105.32 ? 74  LEU B CB  1 
ATOM   984  C  CG  . LEU B  1 33 ? 0.208   13.769  -33.439  1.00 109.06 ? 74  LEU B CG  1 
ATOM   985  C  CD1 . LEU B  1 33 ? 0.602   12.927  -34.642  1.00 103.24 ? 74  LEU B CD1 1 
ATOM   986  C  CD2 . LEU B  1 33 ? 0.081   12.921  -32.177  1.00 107.08 ? 74  LEU B CD2 1 
ATOM   987  N  N   . GLU B  1 34 ? 3.105   16.993  -32.056  1.00 91.09  ? 75  GLU B N   1 
ATOM   988  C  CA  . GLU B  1 34 ? 4.359   17.374  -31.429  1.00 92.48  ? 75  GLU B CA  1 
ATOM   989  C  C   . GLU B  1 34 ? 4.132   18.318  -30.253  1.00 93.87  ? 75  GLU B C   1 
ATOM   990  O  O   . GLU B  1 34 ? 4.916   18.343  -29.303  1.00 93.15  ? 75  GLU B O   1 
ATOM   991  C  CB  . GLU B  1 34 ? 5.256   18.033  -32.475  1.00 91.40  ? 75  GLU B CB  1 
ATOM   992  C  CG  . GLU B  1 34 ? 6.676   18.304  -32.032  1.00 97.72  ? 75  GLU B CG  1 
ATOM   993  C  CD  . GLU B  1 34 ? 6.989   19.782  -31.989  1.00 98.42  ? 75  GLU B CD  1 
ATOM   994  O  OE1 . GLU B  1 34 ? 6.517   20.462  -31.055  1.00 100.59 ? 75  GLU B OE1 1 
ATOM   995  O  OE2 . GLU B  1 34 ? 7.700   20.268  -32.893  1.00 96.56  ? 75  GLU B OE2 1 
ATOM   996  N  N   . LEU B  1 35 ? 3.056   19.095  -30.323  1.00 93.49  ? 76  LEU B N   1 
ATOM   997  C  CA  . LEU B  1 35 ? 2.722   20.031  -29.257  1.00 87.01  ? 76  LEU B CA  1 
ATOM   998  C  C   . LEU B  1 35 ? 2.150   19.278  -28.055  1.00 86.47  ? 76  LEU B C   1 
ATOM   999  O  O   . LEU B  1 35 ? 2.679   19.382  -26.946  1.00 85.64  ? 76  LEU B O   1 
ATOM   1000 C  CB  . LEU B  1 35 ? 1.715   21.070  -29.765  1.00 84.18  ? 76  LEU B CB  1 
ATOM   1001 C  CG  . LEU B  1 35 ? 0.313   21.173  -29.149  1.00 82.31  ? 76  LEU B CG  1 
ATOM   1002 C  CD1 . LEU B  1 35 ? 0.407   21.696  -27.728  1.00 85.51  ? 76  LEU B CD1 1 
ATOM   1003 C  CD2 . LEU B  1 35 ? -0.545  22.110  -29.985  1.00 87.49  ? 76  LEU B CD2 1 
ATOM   1004 N  N   . ALA B  1 36 ? 1.076   18.519  -28.276  1.00 86.73  ? 77  ALA B N   1 
ATOM   1005 C  CA  . ALA B  1 36 ? 0.445   17.759  -27.198  1.00 86.22  ? 77  ALA B CA  1 
ATOM   1006 C  C   . ALA B  1 36 ? 1.505   16.921  -26.485  1.00 83.07  ? 77  ALA B C   1 
ATOM   1007 O  O   . ALA B  1 36 ? 1.400   16.645  -25.290  1.00 84.68  ? 77  ALA B O   1 
ATOM   1008 C  CB  . ALA B  1 36 ? -0.670  16.879  -27.749  1.00 76.28  ? 77  ALA B CB  1 
ATOM   1009 N  N   . GLN B  1 37 ? 2.525   16.521  -27.236  1.00 85.39  ? 78  GLN B N   1 
ATOM   1010 C  CA  . GLN B  1 37 ? 3.640   15.785  -26.671  1.00 89.75  ? 78  GLN B CA  1 
ATOM   1011 C  C   . GLN B  1 37 ? 4.271   16.691  -25.614  1.00 91.44  ? 78  GLN B C   1 
ATOM   1012 O  O   . GLN B  1 37 ? 4.104   16.452  -24.424  1.00 100.33 ? 78  GLN B O   1 
ATOM   1013 C  CB  . GLN B  1 37 ? 4.685   15.462  -27.743  1.00 97.03  ? 78  GLN B CB  1 
ATOM   1014 C  CG  . GLN B  1 37 ? 5.985   14.967  -27.155  1.00 96.64  ? 78  GLN B CG  1 
ATOM   1015 C  CD  . GLN B  1 37 ? 5.740   13.824  -26.209  1.00 97.45  ? 78  GLN B CD  1 
ATOM   1016 O  OE1 . GLN B  1 37 ? 5.317   12.748  -26.626  1.00 93.09  ? 78  GLN B OE1 1 
ATOM   1017 N  NE2 . GLN B  1 37 ? 5.985   14.051  -24.923  1.00 94.55  ? 78  GLN B NE2 1 
ATOM   1018 N  N   . SER B  1 38 ? 4.978   17.737  -26.042  1.00 87.34  ? 79  SER B N   1 
ATOM   1019 C  CA  . SER B  1 38 ? 5.617   18.648  -25.085  1.00 86.52  ? 79  SER B CA  1 
ATOM   1020 C  C   . SER B  1 38 ? 4.642   19.069  -23.980  1.00 80.88  ? 79  SER B C   1 
ATOM   1021 O  O   . SER B  1 38 ? 5.060   19.471  -22.889  1.00 66.69  ? 79  SER B O   1 
ATOM   1022 C  CB  . SER B  1 38 ? 6.157   19.902  -25.780  1.00 78.42  ? 79  SER B CB  1 
ATOM   1023 O  OG  . SER B  1 38 ? 5.280   21.001  -25.598  1.00 93.59  ? 79  SER B OG  1 
ATOM   1024 N  N   . LYS B  1 39 ? 3.346   18.983  -24.273  1.00 79.84  ? 80  LYS B N   1 
ATOM   1025 C  CA  . LYS B  1 39 ? 2.303   19.316  -23.306  1.00 80.50  ? 80  LYS B CA  1 
ATOM   1026 C  C   . LYS B  1 39 ? 2.321   18.197  -22.261  1.00 83.54  ? 80  LYS B C   1 
ATOM   1027 O  O   . LYS B  1 39 ? 2.513   18.433  -21.067  1.00 89.72  ? 80  LYS B O   1 
ATOM   1028 C  CB  . LYS B  1 39 ? 0.948   19.368  -24.021  1.00 82.42  ? 80  LYS B CB  1 
ATOM   1029 C  CG  . LYS B  1 39 ? -0.272  19.426  -23.117  1.00 92.33  ? 80  LYS B CG  1 
ATOM   1030 C  CD  . LYS B  1 39 ? -0.663  20.854  -22.775  1.00 87.77  ? 80  LYS B CD  1 
ATOM   1031 C  CE  . LYS B  1 39 ? -1.956  21.265  -23.472  1.00 91.36  ? 80  LYS B CE  1 
ATOM   1032 N  NZ  . LYS B  1 39 ? -1.809  21.406  -24.948  1.00 89.73  ? 80  LYS B NZ  1 
ATOM   1033 N  N   . GLU B  1 40 ? 2.114   16.976  -22.745  1.00 85.54  ? 81  GLU B N   1 
ATOM   1034 C  CA  . GLU B  1 40 ? 2.138   15.765  -21.935  1.00 84.92  ? 81  GLU B CA  1 
ATOM   1035 C  C   . GLU B  1 40 ? 3.420   15.711  -21.112  1.00 79.31  ? 81  GLU B C   1 
ATOM   1036 O  O   . GLU B  1 40 ? 3.403   15.335  -19.941  1.00 71.58  ? 81  GLU B O   1 
ATOM   1037 C  CB  . GLU B  1 40 ? 2.046   14.553  -22.867  1.00 90.90  ? 81  GLU B CB  1 
ATOM   1038 C  CG  . GLU B  1 40 ? 2.835   13.329  -22.450  1.00 93.65  ? 81  GLU B CG  1 
ATOM   1039 C  CD  . GLU B  1 40 ? 3.095   12.419  -23.634  1.00 101.22 ? 81  GLU B CD  1 
ATOM   1040 O  OE1 . GLU B  1 40 ? 2.113   11.928  -24.231  1.00 103.03 ? 81  GLU B OE1 1 
ATOM   1041 O  OE2 . GLU B  1 40 ? 4.278   12.210  -23.979  1.00 100.28 ? 81  GLU B OE2 1 
ATOM   1042 N  N   . SER B  1 41 ? 4.534   16.069  -21.738  1.00 77.17  ? 82  SER B N   1 
ATOM   1043 C  CA  . SER B  1 41 ? 5.806   16.084  -21.039  1.00 81.86  ? 82  SER B CA  1 
ATOM   1044 C  C   . SER B  1 41 ? 5.600   16.843  -19.739  1.00 88.20  ? 82  SER B C   1 
ATOM   1045 O  O   . SER B  1 41 ? 5.703   16.277  -18.652  1.00 92.55  ? 82  SER B O   1 
ATOM   1046 C  CB  . SER B  1 41 ? 6.870   16.795  -21.876  1.00 81.91  ? 82  SER B CB  1 
ATOM   1047 O  OG  . SER B  1 41 ? 7.987   17.138  -21.074  1.00 81.46  ? 82  SER B OG  1 
ATOM   1048 N  N   . LYS B  1 42 ? 5.288   18.130  -19.875  1.00 89.74  ? 83  LYS B N   1 
ATOM   1049 C  CA  . LYS B  1 42 ? 5.046   19.017  -18.741  1.00 85.32  ? 83  LYS B CA  1 
ATOM   1050 C  C   . LYS B  1 42 ? 4.090   18.451  -17.697  1.00 79.82  ? 83  LYS B C   1 
ATOM   1051 O  O   . LYS B  1 42 ? 4.322   18.601  -16.497  1.00 79.05  ? 83  LYS B O   1 
ATOM   1052 C  CB  . LYS B  1 42 ? 4.520   20.369  -19.232  1.00 87.96  ? 83  LYS B CB  1 
ATOM   1053 C  CG  . LYS B  1 42 ? 5.610   21.294  -19.738  1.00 88.30  ? 83  LYS B CG  1 
ATOM   1054 C  CD  . LYS B  1 42 ? 6.523   21.743  -18.604  1.00 88.25  ? 83  LYS B CD  1 
ATOM   1055 C  CE  . LYS B  1 42 ? 6.010   23.009  -17.934  1.00 95.49  ? 83  LYS B CE  1 
ATOM   1056 N  NZ  . LYS B  1 42 ? 6.953   23.468  -16.874  1.00 90.40  ? 83  LYS B NZ  1 
ATOM   1057 N  N   . LEU B  1 43 ? 3.015   17.805  -18.131  1.00 71.18  ? 84  LEU B N   1 
ATOM   1058 C  CA  . LEU B  1 43 ? 2.086   17.248  -17.161  1.00 72.13  ? 84  LEU B CA  1 
ATOM   1059 C  C   . LEU B  1 43 ? 2.789   16.177  -16.333  1.00 79.76  ? 84  LEU B C   1 
ATOM   1060 O  O   . LEU B  1 43 ? 2.568   16.072  -15.128  1.00 88.85  ? 84  LEU B O   1 
ATOM   1061 C  CB  . LEU B  1 43 ? 0.860   16.653  -17.857  1.00 59.75  ? 84  LEU B CB  1 
ATOM   1062 C  CG  . LEU B  1 43 ? -0.257  16.191  -16.919  1.00 80.74  ? 84  LEU B CG  1 
ATOM   1063 C  CD1 . LEU B  1 43 ? -0.591  17.293  -15.921  1.00 78.83  ? 84  LEU B CD1 1 
ATOM   1064 C  CD2 . LEU B  1 43 ? -1.477  15.816  -17.741  1.00 83.28  ? 84  LEU B CD2 1 
ATOM   1065 N  N   . LEU B  1 44 ? 3.646   15.395  -16.982  1.00 83.97  ? 85  LEU B N   1 
ATOM   1066 C  CA  . LEU B  1 44 ? 4.366   14.332  -16.296  1.00 81.78  ? 85  LEU B CA  1 
ATOM   1067 C  C   . LEU B  1 44 ? 5.372   14.896  -15.296  1.00 82.03  ? 85  LEU B C   1 
ATOM   1068 O  O   . LEU B  1 44 ? 5.493   14.389  -14.181  1.00 87.01  ? 85  LEU B O   1 
ATOM   1069 C  CB  . LEU B  1 44 ? 5.089   13.428  -17.309  1.00 82.09  ? 85  LEU B CB  1 
ATOM   1070 C  CG  . LEU B  1 44 ? 4.249   12.719  -18.381  1.00 86.88  ? 85  LEU B CG  1 
ATOM   1071 C  CD1 . LEU B  1 44 ? 5.136   11.758  -19.154  1.00 83.79  ? 85  LEU B CD1 1 
ATOM   1072 C  CD2 . LEU B  1 44 ? 3.089   11.962  -17.742  1.00 71.87  ? 85  LEU B CD2 1 
ATOM   1073 N  N   . GLU B  1 45 ? 6.074   15.955  -15.689  1.00 77.46  ? 86  GLU B N   1 
ATOM   1074 C  CA  . GLU B  1 45 ? 7.082   16.570  -14.830  1.00 75.83  ? 86  GLU B CA  1 
ATOM   1075 C  C   . GLU B  1 45 ? 6.533   17.267  -13.588  1.00 70.54  ? 86  GLU B C   1 
ATOM   1076 O  O   . GLU B  1 45 ? 7.081   17.105  -12.498  1.00 63.07  ? 86  GLU B O   1 
ATOM   1077 C  CB  . GLU B  1 45 ? 7.926   17.555  -15.638  1.00 81.73  ? 86  GLU B CB  1 
ATOM   1078 C  CG  . GLU B  1 45 ? 8.713   16.895  -16.753  1.00 105.19 ? 86  GLU B CG  1 
ATOM   1079 C  CD  . GLU B  1 45 ? 9.528   17.887  -17.554  1.00 117.70 ? 86  GLU B CD  1 
ATOM   1080 O  OE1 . GLU B  1 45 ? 8.935   18.850  -18.083  1.00 126.50 ? 86  GLU B OE1 1 
ATOM   1081 O  OE2 . GLU B  1 45 ? 10.760  17.702  -17.656  1.00 125.98 ? 86  GLU B OE2 1 
ATOM   1082 N  N   . ASN B  1 46 ? 5.471   18.053  -13.746  1.00 60.28  ? 87  ASN B N   1 
ATOM   1083 C  CA  . ASN B  1 46 ? 4.878   18.739  -12.604  1.00 50.18  ? 87  ASN B CA  1 
ATOM   1084 C  C   . ASN B  1 46 ? 4.401   17.656  -11.632  1.00 48.13  ? 87  ASN B C   1 
ATOM   1085 O  O   . ASN B  1 46 ? 4.571   17.752  -10.414  1.00 46.68  ? 87  ASN B O   1 
ATOM   1086 C  CB  . ASN B  1 46 ? 3.709   19.614  -13.070  1.00 59.70  ? 87  ASN B CB  1 
ATOM   1087 C  CG  . ASN B  1 46 ? 4.173   20.861  -13.804  1.00 70.75  ? 87  ASN B CG  1 
ATOM   1088 O  OD1 . ASN B  1 46 ? 4.761   21.753  -13.209  1.00 64.68  ? 87  ASN B OD1 1 
ATOM   1089 N  ND2 . ASN B  1 46 ? 3.912   20.923  -15.102  1.00 62.57  ? 87  ASN B ND2 1 
ATOM   1090 N  N   . LEU B  1 47 ? 3.825   16.611  -12.208  1.00 46.44  ? 88  LEU B N   1 
ATOM   1091 C  CA  . LEU B  1 47 ? 3.316   15.463  -11.476  1.00 48.42  ? 88  LEU B CA  1 
ATOM   1092 C  C   . LEU B  1 47 ? 4.433   14.810  -10.661  1.00 46.13  ? 88  LEU B C   1 
ATOM   1093 O  O   . LEU B  1 47 ? 4.239   14.434  -9.505   1.00 44.42  ? 88  LEU B O   1 
ATOM   1094 C  CB  . LEU B  1 47 ? 2.747   14.460  -12.480  1.00 44.72  ? 88  LEU B CB  1 
ATOM   1095 C  CG  . LEU B  1 47 ? 1.320   13.923  -12.381  1.00 55.98  ? 88  LEU B CG  1 
ATOM   1096 C  CD1 . LEU B  1 47 ? 0.438   14.845  -11.561  1.00 64.42  ? 88  LEU B CD1 1 
ATOM   1097 C  CD2 . LEU B  1 47 ? 0.781   13.762  -13.802  1.00 75.55  ? 88  LEU B CD2 1 
ATOM   1098 N  N   . ASN B  1 48 ? 5.607   14.677  -11.267  1.00 47.93  ? 89  ASN B N   1 
ATOM   1099 C  CA  . ASN B  1 48 ? 6.738   14.061  -10.581  1.00 56.10  ? 89  ASN B CA  1 
ATOM   1100 C  C   . ASN B  1 48 ? 7.304   14.933  -9.454   1.00 57.24  ? 89  ASN B C   1 
ATOM   1101 O  O   . ASN B  1 48 ? 7.802   14.411  -8.453   1.00 67.85  ? 89  ASN B O   1 
ATOM   1102 C  CB  . ASN B  1 48 ? 7.822   13.687  -11.598  1.00 55.04  ? 89  ASN B CB  1 
ATOM   1103 C  CG  . ASN B  1 48 ? 7.438   12.462  -12.426  1.00 72.79  ? 89  ASN B CG  1 
ATOM   1104 O  OD1 . ASN B  1 48 ? 7.355   11.352  -11.903  1.00 76.35  ? 89  ASN B OD1 1 
ATOM   1105 N  ND2 . ASN B  1 48 ? 7.186   12.664  -13.714  1.00 75.56  ? 89  ASN B ND2 1 
ATOM   1106 N  N   . LEU B  1 49 ? 7.220   16.253  -9.604   1.00 59.80  ? 90  LEU B N   1 
ATOM   1107 C  CA  . LEU B  1 49 ? 7.701   17.161  -8.561   1.00 48.13  ? 90  LEU B CA  1 
ATOM   1108 C  C   . LEU B  1 49 ? 6.771   16.965  -7.379   1.00 51.30  ? 90  LEU B C   1 
ATOM   1109 O  O   . LEU B  1 49 ? 7.192   16.655  -6.264   1.00 56.41  ? 90  LEU B O   1 
ATOM   1110 C  CB  . LEU B  1 49 ? 7.575   18.618  -8.988   1.00 52.72  ? 90  LEU B CB  1 
ATOM   1111 C  CG  . LEU B  1 49 ? 8.322   19.254  -10.153  1.00 62.58  ? 90  LEU B CG  1 
ATOM   1112 C  CD1 . LEU B  1 49 ? 7.685   20.610  -10.426  1.00 64.27  ? 90  LEU B CD1 1 
ATOM   1113 C  CD2 . LEU B  1 49 ? 9.795   19.417  -9.820   1.00 54.34  ? 90  LEU B CD2 1 
ATOM   1114 N  N   . LEU B  1 50 ? 5.489   17.161  -7.657   1.00 51.88  ? 91  LEU B N   1 
ATOM   1115 C  CA  . LEU B  1 50 ? 4.440   17.031  -6.670   1.00 47.85  ? 91  LEU B CA  1 
ATOM   1116 C  C   . LEU B  1 50 ? 4.572   15.740  -5.896   1.00 41.96  ? 91  LEU B C   1 
ATOM   1117 O  O   . LEU B  1 50 ? 4.426   15.710  -4.668   1.00 52.77  ? 91  LEU B O   1 
ATOM   1118 C  CB  . LEU B  1 50 ? 3.087   17.081  -7.367   1.00 41.77  ? 91  LEU B CB  1 
ATOM   1119 C  CG  . LEU B  1 50 ? 2.155   18.184  -6.875   1.00 48.27  ? 91  LEU B CG  1 
ATOM   1120 C  CD1 . LEU B  1 50 ? 2.910   19.498  -6.643   1.00 48.27  ? 91  LEU B CD1 1 
ATOM   1121 C  CD2 . LEU B  1 50 ? 1.068   18.359  -7.912   1.00 49.08  ? 91  LEU B CD2 1 
ATOM   1122 N  N   . LYS B  1 51 ? 4.846   14.673  -6.634   1.00 49.55  ? 92  LYS B N   1 
ATOM   1123 C  CA  . LYS B  1 51 ? 5.011   13.350  -6.065   1.00 42.56  ? 92  LYS B CA  1 
ATOM   1124 C  C   . LYS B  1 51 ? 6.127   13.346  -5.034   1.00 40.22  ? 92  LYS B C   1 
ATOM   1125 O  O   . LYS B  1 51 ? 5.930   12.896  -3.906   1.00 39.26  ? 92  LYS B O   1 
ATOM   1126 C  CB  . LYS B  1 51 ? 5.313   12.353  -7.181   1.00 55.41  ? 92  LYS B CB  1 
ATOM   1127 C  CG  . LYS B  1 51 ? 5.925   11.040  -6.738   1.00 59.33  ? 92  LYS B CG  1 
ATOM   1128 C  CD  . LYS B  1 51 ? 6.605   10.386  -7.931   1.00 66.99  ? 92  LYS B CD  1 
ATOM   1129 C  CE  . LYS B  1 51 ? 7.639   9.342   -7.520   1.00 78.61  ? 92  LYS B CE  1 
ATOM   1130 N  NZ  . LYS B  1 51 ? 7.070   8.101   -6.922   1.00 83.54  ? 92  LYS B NZ  1 
ATOM   1131 N  N   . ASN B  1 52 ? 7.294   13.863  -5.399   1.00 37.98  ? 93  ASN B N   1 
ATOM   1132 C  CA  . ASN B  1 52 ? 8.400   13.883  -4.445   1.00 42.28  ? 93  ASN B CA  1 
ATOM   1133 C  C   . ASN B  1 52 ? 8.047   14.611  -3.153   1.00 41.09  ? 93  ASN B C   1 
ATOM   1134 O  O   . ASN B  1 52 ? 8.425   14.163  -2.073   1.00 46.79  ? 93  ASN B O   1 
ATOM   1135 C  CB  . ASN B  1 52 ? 9.659   14.510  -5.066   1.00 48.36  ? 93  ASN B CB  1 
ATOM   1136 C  CG  . ASN B  1 52 ? 10.840  14.531  -4.102   1.00 63.34  ? 93  ASN B CG  1 
ATOM   1137 O  OD1 . ASN B  1 52 ? 11.076  15.522  -3.408   1.00 59.65  ? 93  ASN B OD1 1 
ATOM   1138 N  ND2 . ASN B  1 52 ? 11.580  13.424  -4.046   1.00 78.56  ? 93  ASN B ND2 1 
ATOM   1139 N  N   . GLU B  1 53 ? 7.322   15.725  -3.253   1.00 40.79  ? 94  GLU B N   1 
ATOM   1140 C  CA  . GLU B  1 53 ? 6.950   16.473  -2.053   1.00 45.16  ? 94  GLU B CA  1 
ATOM   1141 C  C   . GLU B  1 53 ? 5.844   15.762  -1.268   1.00 35.76  ? 94  GLU B C   1 
ATOM   1142 O  O   . GLU B  1 53 ? 5.718   15.939  -0.061   1.00 31.96  ? 94  GLU B O   1 
ATOM   1143 C  CB  . GLU B  1 53 ? 6.505   17.894  -2.416   1.00 45.51  ? 94  GLU B CB  1 
ATOM   1144 C  CG  . GLU B  1 53 ? 6.176   18.775  -1.212   1.00 51.16  ? 94  GLU B CG  1 
ATOM   1145 C  CD  . GLU B  1 53 ? 7.332   18.927  -0.229   1.00 49.51  ? 94  GLU B CD  1 
ATOM   1146 O  OE1 . GLU B  1 53 ? 8.459   19.247  -0.656   1.00 61.03  ? 94  GLU B OE1 1 
ATOM   1147 O  OE2 . GLU B  1 53 ? 7.113   18.752  0.984    1.00 37.18  ? 94  GLU B OE2 1 
ATOM   1148 N  N   . ASN B  1 54 ? 5.058   14.947  -1.960   1.00 38.36  ? 95  ASN B N   1 
ATOM   1149 C  CA  . ASN B  1 54 ? 3.980   14.194  -1.334   1.00 34.95  ? 95  ASN B CA  1 
ATOM   1150 C  C   . ASN B  1 54 ? 4.620   13.130  -0.448   1.00 36.32  ? 95  ASN B C   1 
ATOM   1151 O  O   . ASN B  1 54 ? 4.149   12.844  0.657    1.00 39.59  ? 95  ASN B O   1 
ATOM   1152 C  CB  . ASN B  1 54 ? 3.132   13.550  -2.426   1.00 46.84  ? 95  ASN B CB  1 
ATOM   1153 C  CG  . ASN B  1 54 ? 1.768   13.128  -1.940   1.00 49.28  ? 95  ASN B CG  1 
ATOM   1154 O  OD1 . ASN B  1 54 ? 0.919   12.735  -2.736   1.00 64.18  ? 95  ASN B OD1 1 
ATOM   1155 N  ND2 . ASN B  1 54 ? 1.548   13.198  -0.631   1.00 58.93  ? 95  ASN B ND2 1 
ATOM   1156 N  N   . GLU B  1 55 ? 5.714   12.553  -0.935   1.00 42.92  ? 96  GLU B N   1 
ATOM   1157 C  CA  . GLU B  1 55 ? 6.436   11.529  -0.184   1.00 42.59  ? 96  GLU B CA  1 
ATOM   1158 C  C   . GLU B  1 55 ? 7.102   12.170  1.035    1.00 43.75  ? 96  GLU B C   1 
ATOM   1159 O  O   . GLU B  1 55 ? 7.113   11.610  2.139    1.00 40.08  ? 96  GLU B O   1 
ATOM   1160 C  CB  . GLU B  1 55 ? 7.502   10.888  -1.071   1.00 53.57  ? 96  GLU B CB  1 
ATOM   1161 C  CG  . GLU B  1 55 ? 8.272   9.764   -0.412   1.00 54.83  ? 96  GLU B CG  1 
ATOM   1162 C  CD  . GLU B  1 55 ? 7.385   8.601   -0.018   1.00 67.35  ? 96  GLU B CD  1 
ATOM   1163 O  OE1 . GLU B  1 55 ? 6.279   8.477   -0.581   1.00 61.89  ? 96  GLU B OE1 1 
ATOM   1164 O  OE2 . GLU B  1 55 ? 7.799   7.799   0.843    1.00 63.29  ? 96  GLU B OE2 1 
ATOM   1165 N  N   . ASN B  1 56 ? 7.661   13.355  0.824    1.00 37.75  ? 97  ASN B N   1 
ATOM   1166 C  CA  . ASN B  1 56 ? 8.328   14.078  1.894    1.00 32.42  ? 97  ASN B CA  1 
ATOM   1167 C  C   . ASN B  1 56 ? 7.321   14.378  2.995    1.00 29.32  ? 97  ASN B C   1 
ATOM   1168 O  O   . ASN B  1 56 ? 7.628   14.245  4.172    1.00 30.15  ? 97  ASN B O   1 
ATOM   1169 C  CB  . ASN B  1 56 ? 8.946   15.350  1.315    1.00 44.35  ? 97  ASN B CB  1 
ATOM   1170 C  CG  . ASN B  1 56 ? 9.641   16.203  2.349    1.00 58.21  ? 97  ASN B CG  1 
ATOM   1171 O  OD1 . ASN B  1 56 ? 10.331  15.712  3.238    1.00 52.39  ? 97  ASN B OD1 1 
ATOM   1172 N  ND2 . ASN B  1 56 ? 9.478   17.507  2.216    1.00 71.29  ? 97  ASN B ND2 1 
ATOM   1173 N  N   . LEU B  1 57 ? 6.107   14.766  2.619    1.00 25.49  ? 98  LEU B N   1 
ATOM   1174 C  CA  . LEU B  1 57 ? 5.079   15.042  3.611    1.00 17.35  ? 98  LEU B CA  1 
ATOM   1175 C  C   . LEU B  1 57 ? 4.650   13.748  4.327    1.00 16.65  ? 98  LEU B C   1 
ATOM   1176 O  O   . LEU B  1 57 ? 4.494   13.714  5.548    1.00 26.77  ? 98  LEU B O   1 
ATOM   1177 C  CB  . LEU B  1 57 ? 3.870   15.695  2.942    1.00 11.88  ? 98  LEU B CB  1 
ATOM   1178 C  CG  . LEU B  1 57 ? 4.039   17.124  2.401    1.00 28.78  ? 98  LEU B CG  1 
ATOM   1179 C  CD1 . LEU B  1 57 ? 2.680   17.747  2.147    1.00 23.50  ? 98  LEU B CD1 1 
ATOM   1180 C  CD2 . LEU B  1 57 ? 4.773   17.973  3.406    1.00 9.72   ? 98  LEU B CD2 1 
ATOM   1181 N  N   . ASN B  1 58 ? 4.449   12.684  3.564    1.00 26.89  ? 99  ASN B N   1 
ATOM   1182 C  CA  . ASN B  1 58 ? 4.049   11.414  4.158    1.00 20.17  ? 99  ASN B CA  1 
ATOM   1183 C  C   . ASN B  1 58 ? 5.075   10.944  5.176    1.00 4.56   ? 99  ASN B C   1 
ATOM   1184 O  O   . ASN B  1 58 ? 4.725   10.363  6.205    1.00 25.22  ? 99  ASN B O   1 
ATOM   1185 C  CB  . ASN B  1 58 ? 3.851   10.360  3.065    1.00 35.54  ? 99  ASN B CB  1 
ATOM   1186 C  CG  . ASN B  1 58 ? 2.611   10.629  2.216    1.00 29.52  ? 99  ASN B CG  1 
ATOM   1187 O  OD1 . ASN B  1 58 ? 1.811   11.513  2.535    1.00 28.22  ? 99  ASN B OD1 1 
ATOM   1188 N  ND2 . ASN B  1 58 ? 2.443   9.864   1.146    1.00 23.47  ? 99  ASN B ND2 1 
ATOM   1189 N  N   . SER B  1 59 ? 6.347   11.221  4.920    1.00 22.59  ? 100 SER B N   1 
ATOM   1190 C  CA  . SER B  1 59 ? 7.414   10.806  5.843    1.00 19.35  ? 100 SER B CA  1 
ATOM   1191 C  C   . SER B  1 59 ? 7.382   11.577  7.155    1.00 30.98  ? 100 SER B C   1 
ATOM   1192 O  O   . SER B  1 59 ? 7.607   11.010  8.231    1.00 38.27  ? 100 SER B O   1 
ATOM   1193 C  CB  . SER B  1 59 ? 8.789   10.983  5.189    1.00 26.98  ? 100 SER B CB  1 
ATOM   1194 O  OG  . SER B  1 59 ? 8.864   10.259  3.972    1.00 58.00  ? 100 SER B OG  1 
ATOM   1195 N  N   . ILE B  1 60 ? 7.119   12.877  7.057    1.00 27.86  ? 101 ILE B N   1 
ATOM   1196 C  CA  . ILE B  1 60 ? 7.033   13.730  8.233    1.00 19.10  ? 101 ILE B CA  1 
ATOM   1197 C  C   . ILE B  1 60 ? 5.861   13.264  9.090    1.00 11.81  ? 101 ILE B C   1 
ATOM   1198 O  O   . ILE B  1 60 ? 5.992   13.098  10.300   1.00 16.71  ? 101 ILE B O   1 
ATOM   1199 C  CB  . ILE B  1 60 ? 6.798   15.215  7.839    1.00 23.00  ? 101 ILE B CB  1 
ATOM   1200 C  CG1 . ILE B  1 60 ? 7.983   15.727  7.019    1.00 30.75  ? 101 ILE B CG1 1 
ATOM   1201 C  CG2 . ILE B  1 60 ? 6.637   16.060  9.098    1.00 7.63   ? 101 ILE B CG2 1 
ATOM   1202 C  CD1 . ILE B  1 60 ? 7.836   17.143  6.536    1.00 33.58  ? 101 ILE B CD1 1 
ATOM   1203 N  N   . PHE B  1 61 ? 4.709   13.052  8.462    1.00 18.63  ? 102 PHE B N   1 
ATOM   1204 C  CA  . PHE B  1 61 ? 3.520   12.605  9.185    1.00 15.02  ? 102 PHE B CA  1 
ATOM   1205 C  C   . PHE B  1 61 ? 3.842   11.369  10.030   1.00 17.94  ? 102 PHE B C   1 
ATOM   1206 O  O   . PHE B  1 61 ? 3.545   11.318  11.226   1.00 33.35  ? 102 PHE B O   1 
ATOM   1207 C  CB  . PHE B  1 61 ? 2.423   12.262  8.186    1.00 15.85  ? 102 PHE B CB  1 
ATOM   1208 C  CG  . PHE B  1 61 ? 1.038   12.343  8.750    1.00 16.85  ? 102 PHE B CG  1 
ATOM   1209 C  CD1 . PHE B  1 61 ? 0.822   12.366  10.129   1.00 19.54  ? 102 PHE B CD1 1 
ATOM   1210 C  CD2 . PHE B  1 61 ? -0.052  12.384  7.897    1.00 24.34  ? 102 PHE B CD2 1 
ATOM   1211 C  CE1 . PHE B  1 61 ? -0.468  12.433  10.649   1.00 28.28  ? 102 PHE B CE1 1 
ATOM   1212 C  CE2 . PHE B  1 61 ? -1.341  12.451  8.397    1.00 26.08  ? 102 PHE B CE2 1 
ATOM   1213 C  CZ  . PHE B  1 61 ? -1.552  12.476  9.781    1.00 8.24   ? 102 PHE B CZ  1 
ATOM   1214 N  N   . GLU B  1 62 ? 4.459   10.377  9.402    1.00 21.51  ? 103 GLU B N   1 
ATOM   1215 C  CA  . GLU B  1 62 ? 4.830   9.143   10.096   1.00 26.98  ? 103 GLU B CA  1 
ATOM   1216 C  C   . GLU B  1 62 ? 5.744   9.425   11.294   1.00 24.76  ? 103 GLU B C   1 
ATOM   1217 O  O   . GLU B  1 62 ? 5.613   8.793   12.346   1.00 39.00  ? 103 GLU B O   1 
ATOM   1218 C  CB  . GLU B  1 62 ? 5.505   8.175   9.115    1.00 20.42  ? 103 GLU B CB  1 
ATOM   1219 C  CG  . GLU B  1 62 ? 4.563   7.710   7.998    1.00 19.33  ? 103 GLU B CG  1 
ATOM   1220 C  CD  . GLU B  1 62 ? 5.280   7.024   6.841    1.00 41.88  ? 103 GLU B CD  1 
ATOM   1221 O  OE1 . GLU B  1 62 ? 5.899   5.963   7.066    1.00 52.91  ? 103 GLU B OE1 1 
ATOM   1222 O  OE2 . GLU B  1 62 ? 5.222   7.546   5.703    1.00 57.94  ? 103 GLU B OE2 1 
ATOM   1223 N  N   . ARG B  1 63 ? 6.667   10.369  11.142   1.00 23.28  ? 104 ARG B N   1 
ATOM   1224 C  CA  . ARG B  1 63 ? 7.560   10.726  12.246   1.00 24.67  ? 104 ARG B CA  1 
ATOM   1225 C  C   . ARG B  1 63 ? 6.750   11.307  13.413   1.00 23.22  ? 104 ARG B C   1 
ATOM   1226 O  O   . ARG B  1 63 ? 6.926   10.903  14.553   1.00 33.63  ? 104 ARG B O   1 
ATOM   1227 C  CB  . ARG B  1 63 ? 8.602   11.757  11.789   1.00 32.31  ? 104 ARG B CB  1 
ATOM   1228 C  CG  . ARG B  1 63 ? 10.048  11.264  11.821   1.00 47.89  ? 104 ARG B CG  1 
ATOM   1229 C  CD  . ARG B  1 63 ? 11.042  12.427  11.775   1.00 46.32  ? 104 ARG B CD  1 
ATOM   1230 N  NE  . ARG B  1 63 ? 10.887  13.260  10.581   1.00 31.43  ? 104 ARG B NE  1 
ATOM   1231 C  CZ  . ARG B  1 63 ? 10.757  14.588  10.604   1.00 45.21  ? 104 ARG B CZ  1 
ATOM   1232 N  NH1 . ARG B  1 63 ? 10.767  15.245  11.761   1.00 30.20  ? 104 ARG B NH1 1 
ATOM   1233 N  NH2 . ARG B  1 63 ? 10.609  15.258  9.471    1.00 34.90  ? 104 ARG B NH2 1 
ATOM   1234 N  N   . LYS B  1 64 ? 5.860   12.254  13.125   1.00 24.53  ? 105 LYS B N   1 
ATOM   1235 C  CA  . LYS B  1 64 ? 5.036   12.869  14.175   1.00 27.13  ? 105 LYS B CA  1 
ATOM   1236 C  C   . LYS B  1 64 ? 4.153   11.852  14.898   1.00 3.85   ? 105 LYS B C   1 
ATOM   1237 O  O   . LYS B  1 64 ? 3.971   11.921  16.114   1.00 16.31  ? 105 LYS B O   1 
ATOM   1238 C  CB  . LYS B  1 64 ? 4.156   13.961  13.565   1.00 19.86  ? 105 LYS B CB  1 
ATOM   1239 C  CG  . LYS B  1 64 ? 4.960   14.959  12.775   1.00 15.86  ? 105 LYS B CG  1 
ATOM   1240 C  CD  . LYS B  1 64 ? 6.004   15.622  13.659   1.00 18.64  ? 105 LYS B CD  1 
ATOM   1241 C  CE  . LYS B  1 64 ? 6.819   16.615  12.846   1.00 30.62  ? 105 LYS B CE  1 
ATOM   1242 N  NZ  . LYS B  1 64 ? 7.946   17.202  13.625   1.00 29.90  ? 105 LYS B NZ  1 
ATOM   1243 N  N   . ASN B  1 65 ? 3.592   10.923  14.138   1.00 19.68  ? 106 ASN B N   1 
ATOM   1244 C  CA  . ASN B  1 65 ? 2.746   9.880   14.709   1.00 24.06  ? 106 ASN B CA  1 
ATOM   1245 C  C   . ASN B  1 65 ? 3.554   9.083   15.721   1.00 20.85  ? 106 ASN B C   1 
ATOM   1246 O  O   . ASN B  1 65 ? 3.037   8.717   16.779   1.00 33.65  ? 106 ASN B O   1 
ATOM   1247 C  CB  . ASN B  1 65 ? 2.203   8.971   13.592   1.00 25.66  ? 106 ASN B CB  1 
ATOM   1248 C  CG  . ASN B  1 65 ? 1.062   9.627   12.820   1.00 23.62  ? 106 ASN B CG  1 
ATOM   1249 O  OD1 . ASN B  1 65 ? 0.699   10.773  13.092   1.00 29.51  ? 106 ASN B OD1 1 
ATOM   1250 N  ND2 . ASN B  1 65 ? 0.497   8.911   11.862   1.00 21.23  ? 106 ASN B ND2 1 
ATOM   1251 N  N   . LYS B  1 66 ? 4.831   8.845   15.425   1.00 26.40  ? 107 LYS B N   1 
ATOM   1252 C  CA  . LYS B  1 66 ? 5.669   8.096   16.356   1.00 23.40  ? 107 LYS B CA  1 
ATOM   1253 C  C   . LYS B  1 66 ? 5.888   8.855   17.650   1.00 15.23  ? 107 LYS B C   1 
ATOM   1254 O  O   . LYS B  1 66 ? 5.885   8.269   18.729   1.00 21.15  ? 107 LYS B O   1 
ATOM   1255 C  CB  . LYS B  1 66 ? 7.018   7.756   15.742   1.00 31.46  ? 107 LYS B CB  1 
ATOM   1256 C  CG  . LYS B  1 66 ? 7.152   6.273   15.532   1.00 50.55  ? 107 LYS B CG  1 
ATOM   1257 C  CD  . LYS B  1 66 ? 8.602   5.852   15.461   1.00 45.95  ? 107 LYS B CD  1 
ATOM   1258 C  CE  . LYS B  1 66 ? 9.279   6.362   14.198   1.00 40.36  ? 107 LYS B CE  1 
ATOM   1259 N  NZ  . LYS B  1 66 ? 8.573   5.919   12.965   1.00 48.25  ? 107 LYS B NZ  1 
ATOM   1260 N  N   . LYS B  1 67 ? 6.065   10.167  17.560   1.00 32.67  ? 108 LYS B N   1 
ATOM   1261 C  CA  . LYS B  1 67 ? 6.259   10.966  18.770   1.00 10.04  ? 108 LYS B CA  1 
ATOM   1262 C  C   . LYS B  1 67 ? 4.981   10.977  19.629   1.00 19.00  ? 108 LYS B C   1 
ATOM   1263 O  O   . LYS B  1 67 ? 5.040   10.853  20.849   1.00 31.51  ? 108 LYS B O   1 
ATOM   1264 C  CB  . LYS B  1 67 ? 6.666   12.386  18.376   1.00 43.01  ? 108 LYS B CB  1 
ATOM   1265 C  CG  . LYS B  1 67 ? 6.956   13.296  19.558   1.00 57.15  ? 108 LYS B CG  1 
ATOM   1266 C  CD  . LYS B  1 67 ? 7.280   14.725  19.119   1.00 62.05  ? 108 LYS B CD  1 
ATOM   1267 C  CE  . LYS B  1 67 ? 7.187   15.699  20.301   1.00 60.07  ? 108 LYS B CE  1 
ATOM   1268 N  NZ  . LYS B  1 67 ? 7.453   17.124  19.937   1.00 48.89  ? 108 LYS B NZ  1 
ATOM   1269 N  N   . LEU B  1 68 ? 3.825   11.102  18.984   1.00 26.51  ? 109 LEU B N   1 
ATOM   1270 C  CA  . LEU B  1 68 ? 2.548   11.120  19.695   1.00 23.11  ? 109 LEU B CA  1 
ATOM   1271 C  C   . LEU B  1 68 ? 2.261   9.800   20.417   1.00 23.97  ? 109 LEU B C   1 
ATOM   1272 O  O   . LEU B  1 68 ? 1.958   9.792   21.606   1.00 23.47  ? 109 LEU B O   1 
ATOM   1273 C  CB  . LEU B  1 68 ? 1.431   11.408  18.701   1.00 27.48  ? 109 LEU B CB  1 
ATOM   1274 C  CG  . LEU B  1 68 ? 0.030   11.389  19.282   1.00 22.98  ? 109 LEU B CG  1 
ATOM   1275 C  CD1 . LEU B  1 68 ? -0.132  12.534  20.255   1.00 36.42  ? 109 LEU B CD1 1 
ATOM   1276 C  CD2 . LEU B  1 68 ? -0.976  11.477  18.149   1.00 40.18  ? 109 LEU B CD2 1 
ATOM   1277 N  N   . LYS B  1 69 ? 2.347   8.683   19.696   1.00 28.23  ? 110 LYS B N   1 
ATOM   1278 C  CA  . LYS B  1 69 ? 2.107   7.375   20.311   1.00 35.43  ? 110 LYS B CA  1 
ATOM   1279 C  C   . LYS B  1 69 ? 3.031   7.259   21.509   1.00 27.15  ? 110 LYS B C   1 
ATOM   1280 O  O   . LYS B  1 69 ? 2.641   6.806   22.582   1.00 33.95  ? 110 LYS B O   1 
ATOM   1281 C  CB  . LYS B  1 69 ? 2.398   6.244   19.319   1.00 37.12  ? 110 LYS B CB  1 
ATOM   1282 C  CG  . LYS B  1 69 ? 1.431   6.201   18.151   1.00 23.83  ? 110 LYS B CG  1 
ATOM   1283 C  CD  . LYS B  1 69 ? 1.883   5.283   17.021   1.00 62.26  ? 110 LYS B CD  1 
ATOM   1284 C  CE  . LYS B  1 69 ? 0.828   5.322   15.901   1.00 44.70  ? 110 LYS B CE  1 
ATOM   1285 N  NZ  . LYS B  1 69 ? -0.617  5.368   16.390   1.00 49.64  ? 110 LYS B NZ  1 
ATOM   1286 N  N   . GLU B  1 70 ? 4.265   7.691   21.320   1.00 28.66  ? 111 GLU B N   1 
ATOM   1287 C  CA  . GLU B  1 70 ? 5.232   7.655   22.393   1.00 23.56  ? 111 GLU B CA  1 
ATOM   1288 C  C   . GLU B  1 70 ? 4.741   8.550   23.523   1.00 26.43  ? 111 GLU B C   1 
ATOM   1289 O  O   . GLU B  1 70 ? 4.609   8.111   24.667   1.00 32.17  ? 111 GLU B O   1 
ATOM   1290 C  CB  . GLU B  1 70 ? 6.587   8.118   21.856   1.00 23.90  ? 111 GLU B CB  1 
ATOM   1291 C  CG  . GLU B  1 70 ? 7.698   8.211   22.860   1.00 53.82  ? 111 GLU B CG  1 
ATOM   1292 C  CD  . GLU B  1 70 ? 9.064   8.213   22.187   1.00 75.70  ? 111 GLU B CD  1 
ATOM   1293 O  OE1 . GLU B  1 70 ? 9.143   8.618   21.006   1.00 74.35  ? 111 GLU B OE1 1 
ATOM   1294 O  OE2 . GLU B  1 70 ? 10.058  7.812   22.838   1.00 68.50  ? 111 GLU B OE2 1 
ATOM   1295 N  N   . LEU B  1 71 ? 4.435   9.798   23.185   1.00 28.84  ? 112 LEU B N   1 
ATOM   1296 C  CA  . LEU B  1 71 ? 3.955   10.773  24.166   1.00 29.35  ? 112 LEU B CA  1 
ATOM   1297 C  C   . LEU B  1 71 ? 2.674   10.306  24.858   1.00 25.30  ? 112 LEU B C   1 
ATOM   1298 O  O   . LEU B  1 71 ? 2.437   10.622  26.023   1.00 27.20  ? 112 LEU B O   1 
ATOM   1299 C  CB  . LEU B  1 71 ? 3.732   12.127  23.470   1.00 27.63  ? 112 LEU B CB  1 
ATOM   1300 C  CG  . LEU B  1 71 ? 3.269   13.337  24.269   1.00 39.71  ? 112 LEU B CG  1 
ATOM   1301 C  CD1 . LEU B  1 71 ? 4.140   13.499  25.494   1.00 36.13  ? 112 LEU B CD1 1 
ATOM   1302 C  CD2 . LEU B  1 71 ? 3.328   14.579  23.379   1.00 36.50  ? 112 LEU B CD2 1 
ATOM   1303 N  N   . GLU B  1 72 ? 1.833   9.558   24.159   1.00 21.71  ? 113 GLU B N   1 
ATOM   1304 C  CA  . GLU B  1 72 ? 0.607   9.074   24.793   1.00 27.22  ? 113 GLU B CA  1 
ATOM   1305 C  C   . GLU B  1 72 ? 0.867   7.973   25.815   1.00 33.37  ? 113 GLU B C   1 
ATOM   1306 O  O   . GLU B  1 72 ? 0.159   7.874   26.816   1.00 44.71  ? 113 GLU B O   1 
ATOM   1307 C  CB  . GLU B  1 72 ? -0.374  8.560   23.746   1.00 28.26  ? 113 GLU B CB  1 
ATOM   1308 C  CG  . GLU B  1 72 ? -1.658  8.000   24.329   1.00 34.80  ? 113 GLU B CG  1 
ATOM   1309 C  CD  . GLU B  1 72 ? -1.531  6.542   24.743   1.00 50.02  ? 113 GLU B CD  1 
ATOM   1310 O  OE1 . GLU B  1 72 ? -0.902  5.772   23.991   1.00 42.59  ? 113 GLU B OE1 1 
ATOM   1311 O  OE2 . GLU B  1 72 ? -2.078  6.151   25.798   1.00 31.26  ? 113 GLU B OE2 1 
ATOM   1312 N  N   . LYS B  1 73 ? 1.863   7.132   25.555   1.00 34.71  ? 114 LYS B N   1 
ATOM   1313 C  CA  . LYS B  1 73 ? 2.176   6.062   26.488   1.00 33.92  ? 114 LYS B CA  1 
ATOM   1314 C  C   . LYS B  1 73 ? 2.699   6.710   27.752   1.00 27.50  ? 114 LYS B C   1 
ATOM   1315 O  O   . LYS B  1 73 ? 2.587   6.160   28.843   1.00 31.95  ? 114 LYS B O   1 
ATOM   1316 C  CB  . LYS B  1 73 ? 3.230   5.109   25.907   1.00 42.36  ? 114 LYS B CB  1 
ATOM   1317 C  CG  . LYS B  1 73 ? 3.561   3.953   26.837   1.00 56.08  ? 114 LYS B CG  1 
ATOM   1318 C  CD  . LYS B  1 73 ? 4.115   2.743   26.100   1.00 58.50  ? 114 LYS B CD  1 
ATOM   1319 C  CE  . LYS B  1 73 ? 4.079   1.501   26.997   1.00 65.55  ? 114 LYS B CE  1 
ATOM   1320 N  NZ  . LYS B  1 73 ? 4.436   0.237   26.279   1.00 50.53  ? 114 LYS B NZ  1 
ATOM   1321 N  N   . ASP B  1 74 ? 3.272   7.899   27.601   1.00 29.12  ? 115 ASP B N   1 
ATOM   1322 C  CA  . ASP B  1 74 ? 3.805   8.628   28.750   1.00 20.74  ? 115 ASP B CA  1 
ATOM   1323 C  C   . ASP B  1 74 ? 2.688   9.176   29.644   1.00 12.82  ? 115 ASP B C   1 
ATOM   1324 O  O   . ASP B  1 74 ? 2.797   9.172   30.875   1.00 34.46  ? 115 ASP B O   1 
ATOM   1325 C  CB  . ASP B  1 74 ? 4.718   9.754   28.277   1.00 21.27  ? 115 ASP B CB  1 
ATOM   1326 C  CG  . ASP B  1 74 ? 6.073   9.241   27.802   1.00 41.17  ? 115 ASP B CG  1 
ATOM   1327 O  OD1 . ASP B  1 74 ? 6.405   8.072   28.101   1.00 52.44  ? 115 ASP B OD1 1 
ATOM   1328 O  OD2 . ASP B  1 74 ? 6.821   9.998   27.146   1.00 46.09  ? 115 ASP B OD2 1 
ATOM   1329 N  N   . TYR B  1 75 ? 1.606   9.627   29.021   1.00 27.78  ? 116 TYR B N   1 
ATOM   1330 C  CA  . TYR B  1 75 ? 0.465   10.164  29.755   1.00 32.93  ? 116 TYR B CA  1 
ATOM   1331 C  C   . TYR B  1 75 ? -0.254  9.050   30.517   1.00 31.33  ? 116 TYR B C   1 
ATOM   1332 O  O   . TYR B  1 75 ? -0.736  9.268   31.631   1.00 33.95  ? 116 TYR B O   1 
ATOM   1333 C  CB  . TYR B  1 75 ? -0.503  10.861  28.788   1.00 21.22  ? 116 TYR B CB  1 
ATOM   1334 C  CG  . TYR B  1 75 ? -0.089  12.275  28.420   1.00 32.85  ? 116 TYR B CG  1 
ATOM   1335 C  CD1 . TYR B  1 75 ? 0.029   13.260  29.398   1.00 23.74  ? 116 TYR B CD1 1 
ATOM   1336 C  CD2 . TYR B  1 75 ? 0.148   12.634  27.094   1.00 38.07  ? 116 TYR B CD2 1 
ATOM   1337 C  CE1 . TYR B  1 75 ? 0.378   14.570  29.068   1.00 30.33  ? 116 TYR B CE1 1 
ATOM   1338 C  CE2 . TYR B  1 75 ? 0.494   13.941  26.754   1.00 39.55  ? 116 TYR B CE2 1 
ATOM   1339 C  CZ  . TYR B  1 75 ? 0.598   14.899  27.753   1.00 30.21  ? 116 TYR B CZ  1 
ATOM   1340 O  OH  . TYR B  1 75 ? 0.905   16.198  27.440   1.00 31.37  ? 116 TYR B OH  1 
ATOM   1341 N  N   . SER B  1 76 ? -0.315  7.858   29.920   1.00 30.19  ? 117 SER B N   1 
ATOM   1342 C  CA  . SER B  1 76 ? -0.968  6.712   30.559   1.00 27.66  ? 117 SER B CA  1 
ATOM   1343 C  C   . SER B  1 76 ? -0.220  6.316   31.797   1.00 19.93  ? 117 SER B C   1 
ATOM   1344 O  O   . SER B  1 76 ? -0.815  6.129   32.845   1.00 32.59  ? 117 SER B O   1 
ATOM   1345 C  CB  . SER B  1 76 ? -1.022  5.511   29.615   1.00 25.23  ? 117 SER B CB  1 
ATOM   1346 O  OG  . SER B  1 76 ? -1.851  5.796   28.493   1.00 34.04  ? 117 SER B OG  1 
ATOM   1347 N  N   . GLU B  1 77 ? 1.095   6.200   31.678   1.00 35.89  ? 118 GLU B N   1 
ATOM   1348 C  CA  . GLU B  1 77 ? 1.913   5.816   32.816   1.00 30.84  ? 118 GLU B CA  1 
ATOM   1349 C  C   . GLU B  1 77 ? 1.901   6.899   33.888   1.00 32.95  ? 118 GLU B C   1 
ATOM   1350 O  O   . GLU B  1 77 ? 1.907   6.599   35.082   1.00 35.21  ? 118 GLU B O   1 
ATOM   1351 C  CB  . GLU B  1 77 ? 3.349   5.543   32.375   1.00 39.34  ? 118 GLU B CB  1 
ATOM   1352 C  CG  . GLU B  1 77 ? 3.550   4.257   31.587   1.00 51.34  ? 118 GLU B CG  1 
ATOM   1353 C  CD  . GLU B  1 77 ? 5.029   3.952   31.399   1.00 69.90  ? 118 GLU B CD  1 
ATOM   1354 O  OE1 . GLU B  1 77 ? 5.770   4.061   32.400   1.00 67.08  ? 118 GLU B OE1 1 
ATOM   1355 O  OE2 . GLU B  1 77 ? 5.449   3.603   30.270   1.00 54.65  ? 118 GLU B OE2 1 
ATOM   1356 N  N   . LEU B  1 78 ? 1.882   8.157   33.458   1.00 25.65  ? 119 LEU B N   1 
ATOM   1357 C  CA  . LEU B  1 78 ? 1.860   9.275   34.388   1.00 20.92  ? 119 LEU B CA  1 
ATOM   1358 C  C   . LEU B  1 78 ? 0.551   9.246   35.174   1.00 13.81  ? 119 LEU B C   1 
ATOM   1359 O  O   . LEU B  1 78 ? 0.510   9.515   36.378   1.00 25.63  ? 119 LEU B O   1 
ATOM   1360 C  CB  . LEU B  1 78 ? 1.990   10.602  33.618   1.00 14.99  ? 119 LEU B CB  1 
ATOM   1361 C  CG  . LEU B  1 78 ? 2.103   11.863  34.476   1.00 30.39  ? 119 LEU B CG  1 
ATOM   1362 C  CD1 . LEU B  1 78 ? 3.182   11.663  35.498   1.00 20.63  ? 119 LEU B CD1 1 
ATOM   1363 C  CD2 . LEU B  1 78 ? 2.391   13.095  33.614   1.00 30.08  ? 119 LEU B CD2 1 
ATOM   1364 N  N   . SER B  1 79 ? -0.524  8.898   34.485   1.00 27.14  ? 120 SER B N   1 
ATOM   1365 C  CA  . SER B  1 79 ? -1.821  8.830   35.126   1.00 32.54  ? 120 SER B CA  1 
ATOM   1366 C  C   . SER B  1 79 ? -1.839  7.745   36.215   1.00 32.35  ? 120 SER B C   1 
ATOM   1367 O  O   . SER B  1 79 ? -2.384  7.960   37.297   1.00 31.80  ? 120 SER B O   1 
ATOM   1368 C  CB  . SER B  1 79 ? -2.895  8.562   34.069   1.00 34.16  ? 120 SER B CB  1 
ATOM   1369 O  OG  . SER B  1 79 ? -4.193  8.849   34.577   1.00 48.51  ? 120 SER B OG  1 
ATOM   1370 N  N   . ASN B  1 80 ? -1.231  6.589   35.939   1.00 34.12  ? 121 ASN B N   1 
ATOM   1371 C  CA  . ASN B  1 80 ? -1.202  5.505   36.919   1.00 28.71  ? 121 ASN B CA  1 
ATOM   1372 C  C   . ASN B  1 80 ? -0.441  5.937   38.141   1.00 32.70  ? 121 ASN B C   1 
ATOM   1373 O  O   . ASN B  1 80 ? -0.831  5.631   39.264   1.00 37.81  ? 121 ASN B O   1 
ATOM   1374 C  CB  . ASN B  1 80 ? -0.528  4.265   36.346   1.00 39.20  ? 121 ASN B CB  1 
ATOM   1375 C  CG  . ASN B  1 80 ? -1.357  3.600   35.283   1.00 35.36  ? 121 ASN B CG  1 
ATOM   1376 O  OD1 . ASN B  1 80 ? -0.834  2.884   34.435   1.00 64.66  ? 121 ASN B OD1 1 
ATOM   1377 N  ND2 . ASN B  1 80 ? -2.665  3.819   35.328   1.00 42.43  ? 121 ASN B ND2 1 
ATOM   1378 N  N   . ARG B  1 81 ? 0.658   6.647   37.926   1.00 33.00  ? 122 ARG B N   1 
ATOM   1379 C  CA  . ARG B  1 81 ? 1.460   7.101   39.048   1.00 34.73  ? 122 ARG B CA  1 
ATOM   1380 C  C   . ARG B  1 81 ? 0.663   8.025   39.955   1.00 30.64  ? 122 ARG B C   1 
ATOM   1381 O  O   . ARG B  1 81 ? 0.883   8.039   41.158   1.00 40.18  ? 122 ARG B O   1 
ATOM   1382 C  CB  . ARG B  1 81 ? 2.747   7.780   38.548   1.00 25.94  ? 122 ARG B CB  1 
ATOM   1383 C  CG  . ARG B  1 81 ? 3.645   6.795   37.789   1.00 35.41  ? 122 ARG B CG  1 
ATOM   1384 C  CD  . ARG B  1 81 ? 4.960   7.386   37.301   1.00 45.44  ? 122 ARG B CD  1 
ATOM   1385 N  NE  . ARG B  1 81 ? 5.911   7.665   38.372   1.00 45.36  ? 122 ARG B NE  1 
ATOM   1386 C  CZ  . ARG B  1 81 ? 7.207   7.910   38.173   1.00 41.90  ? 122 ARG B CZ  1 
ATOM   1387 N  NH1 . ARG B  1 81 ? 7.707   7.903   36.946   1.00 54.89  ? 122 ARG B NH1 1 
ATOM   1388 N  NH2 . ARG B  1 81 ? 8.004   8.190   39.197   1.00 33.76  ? 122 ARG B NH2 1 
ATOM   1389 N  N   . TYR B  1 82 ? -0.261  8.796   39.393   1.00 27.84  ? 123 TYR B N   1 
ATOM   1390 C  CA  . TYR B  1 82 ? -1.075  9.681   40.215   1.00 37.52  ? 123 TYR B CA  1 
ATOM   1391 C  C   . TYR B  1 82 ? -2.111  8.846   40.960   1.00 31.21  ? 123 TYR B C   1 
ATOM   1392 O  O   . TYR B  1 82 ? -2.469  9.152   42.091   1.00 33.31  ? 123 TYR B O   1 
ATOM   1393 C  CB  . TYR B  1 82 ? -1.770  10.739  39.353   1.00 36.95  ? 123 TYR B CB  1 
ATOM   1394 C  CG  . TYR B  1 82 ? -0.915  11.950  39.042   1.00 29.80  ? 123 TYR B CG  1 
ATOM   1395 C  CD1 . TYR B  1 82 ? -0.570  12.860  40.041   1.00 28.16  ? 123 TYR B CD1 1 
ATOM   1396 C  CD2 . TYR B  1 82 ? -0.472  12.201  37.746   1.00 35.02  ? 123 TYR B CD2 1 
ATOM   1397 C  CE1 . TYR B  1 82 ? 0.194   13.999  39.751   1.00 25.55  ? 123 TYR B CE1 1 
ATOM   1398 C  CE2 . TYR B  1 82 ? 0.295   13.330  37.442   1.00 24.31  ? 123 TYR B CE2 1 
ATOM   1399 C  CZ  . TYR B  1 82 ? 0.621   14.224  38.447   1.00 23.35  ? 123 TYR B CZ  1 
ATOM   1400 O  OH  . TYR B  1 82 ? 1.371   15.341  38.152   1.00 38.15  ? 123 TYR B OH  1 
ATOM   1401 N  N   . ASN B  1 83 ? -2.582  7.780   40.322   1.00 40.22  ? 124 ASN B N   1 
ATOM   1402 C  CA  . ASN B  1 83 ? -3.563  6.891   40.941   1.00 39.49  ? 124 ASN B CA  1 
ATOM   1403 C  C   . ASN B  1 83 ? -2.929  6.156   42.110   1.00 32.93  ? 124 ASN B C   1 
ATOM   1404 O  O   . ASN B  1 83 ? -3.595  5.868   43.101   1.00 37.42  ? 124 ASN B O   1 
ATOM   1405 C  CB  . ASN B  1 83 ? -4.090  5.864   39.931   1.00 36.39  ? 124 ASN B CB  1 
ATOM   1406 C  CG  . ASN B  1 83 ? -4.843  6.504   38.771   1.00 49.55  ? 124 ASN B CG  1 
ATOM   1407 O  OD1 . ASN B  1 83 ? -5.329  7.635   38.864   1.00 42.05  ? 124 ASN B OD1 1 
ATOM   1408 N  ND2 . ASN B  1 83 ? -4.959  5.770   37.678   1.00 34.41  ? 124 ASN B ND2 1 
ATOM   1409 N  N   . GLU B  1 84 ? -1.640  5.846   41.995   1.00 39.31  ? 125 GLU B N   1 
ATOM   1410 C  CA  . GLU B  1 84 ? -0.949  5.145   43.075   1.00 40.50  ? 125 GLU B CA  1 
ATOM   1411 C  C   . GLU B  1 84 ? -0.767  6.069   44.269   1.00 41.95  ? 125 GLU B C   1 
ATOM   1412 O  O   . GLU B  1 84 ? -0.953  5.658   45.414   1.00 47.45  ? 125 GLU B O   1 
ATOM   1413 C  CB  . GLU B  1 84 ? 0.413   4.620   42.605   1.00 37.20  ? 125 GLU B CB  1 
ATOM   1414 C  CG  . GLU B  1 84 ? 0.336   3.367   41.747   1.00 67.16  ? 125 GLU B CG  1 
ATOM   1415 C  CD  . GLU B  1 84 ? 1.694   2.712   41.561   1.00 88.63  ? 125 GLU B CD  1 
ATOM   1416 O  OE1 . GLU B  1 84 ? 2.634   3.411   41.125   1.00 102.71 ? 125 GLU B OE1 1 
ATOM   1417 O  OE2 . GLU B  1 84 ? 1.823   1.500   41.848   1.00 93.06  ? 125 GLU B OE2 1 
ATOM   1418 N  N   . GLN B  1 85 ? -0.413  7.322   43.993   1.00 39.95  ? 126 GLN B N   1 
ATOM   1419 C  CA  . GLN B  1 85 ? -0.220  8.307   45.049   1.00 43.77  ? 126 GLN B CA  1 
ATOM   1420 C  C   . GLN B  1 85 ? -1.540  8.579   45.755   1.00 41.13  ? 126 GLN B C   1 
ATOM   1421 O  O   . GLN B  1 85 ? -1.572  8.823   46.960   1.00 50.01  ? 126 GLN B O   1 
ATOM   1422 C  CB  . GLN B  1 85 ? 0.341   9.603   44.470   1.00 39.48  ? 126 GLN B CB  1 
ATOM   1423 C  CG  . GLN B  1 85 ? 1.706   9.427   43.861   1.00 43.79  ? 126 GLN B CG  1 
ATOM   1424 C  CD  . GLN B  1 85 ? 2.696   8.813   44.837   1.00 41.17  ? 126 GLN B CD  1 
ATOM   1425 O  OE1 . GLN B  1 85 ? 3.048   9.425   45.844   1.00 53.75  ? 126 GLN B OE1 1 
ATOM   1426 N  NE2 . GLN B  1 85 ? 3.149   7.594   44.542   1.00 39.07  ? 126 GLN B NE2 1 
ATOM   1427 N  N   . LYS B  1 86 ? -2.634  8.528   45.005   1.00 44.82  ? 127 LYS B N   1 
ATOM   1428 C  CA  . LYS B  1 86 ? -3.944  8.757   45.590   1.00 39.85  ? 127 LYS B CA  1 
ATOM   1429 C  C   . LYS B  1 86 ? -4.274  7.596   46.525   1.00 45.28  ? 127 LYS B C   1 
ATOM   1430 O  O   . LYS B  1 86 ? -4.908  7.788   47.563   1.00 51.90  ? 127 LYS B O   1 
ATOM   1431 C  CB  . LYS B  1 86 ? -5.001  8.868   44.489   1.00 42.26  ? 127 LYS B CB  1 
ATOM   1432 C  CG  . LYS B  1 86 ? -6.297  9.541   44.925   1.00 52.13  ? 127 LYS B CG  1 
ATOM   1433 C  CD  . LYS B  1 86 ? -7.113  8.671   45.859   1.00 63.73  ? 127 LYS B CD  1 
ATOM   1434 C  CE  . LYS B  1 86 ? -8.375  9.385   46.302   1.00 75.84  ? 127 LYS B CE  1 
ATOM   1435 N  NZ  . LYS B  1 86 ? -9.241  8.506   47.138   1.00 88.56  ? 127 LYS B NZ  1 
ATOM   1436 N  N   . GLU B  1 87 ? -3.841  6.392   46.158   1.00 45.37  ? 128 GLU B N   1 
ATOM   1437 C  CA  . GLU B  1 87 ? -4.095  5.216   46.983   1.00 40.68  ? 128 GLU B CA  1 
ATOM   1438 C  C   . GLU B  1 87 ? -3.263  5.310   48.255   1.00 45.77  ? 128 GLU B C   1 
ATOM   1439 O  O   . GLU B  1 87 ? -3.724  4.960   49.341   1.00 50.98  ? 128 GLU B O   1 
ATOM   1440 C  CB  . GLU B  1 87 ? -3.747  3.938   46.217   1.00 46.34  ? 128 GLU B CB  1 
ATOM   1441 C  CG  . GLU B  1 87 ? -4.460  3.822   44.870   1.00 49.63  ? 128 GLU B CG  1 
ATOM   1442 C  CD  . GLU B  1 87 ? -4.460  2.405   44.308   1.00 74.37  ? 128 GLU B CD  1 
ATOM   1443 O  OE1 . GLU B  1 87 ? -3.376  1.783   44.236   1.00 67.91  ? 128 GLU B OE1 1 
ATOM   1444 O  OE2 . GLU B  1 87 ? -5.551  1.920   43.930   1.00 66.50  ? 128 GLU B OE2 1 
ATOM   1445 N  N   . LYS B  1 88 ? -2.035  5.792   48.114   1.00 48.94  ? 129 LYS B N   1 
ATOM   1446 C  CA  . LYS B  1 88 ? -1.154  5.951   49.259   1.00 48.18  ? 129 LYS B CA  1 
ATOM   1447 C  C   . LYS B  1 88 ? -1.750  6.977   50.220   1.00 59.07  ? 129 LYS B C   1 
ATOM   1448 O  O   . LYS B  1 88 ? -1.627  6.851   51.440   1.00 69.44  ? 129 LYS B O   1 
ATOM   1449 C  CB  . LYS B  1 88 ? 0.227   6.416   48.802   1.00 47.55  ? 129 LYS B CB  1 
ATOM   1450 C  CG  . LYS B  1 88 ? 0.983   5.403   47.958   1.00 41.16  ? 129 LYS B CG  1 
ATOM   1451 C  CD  . LYS B  1 88 ? 2.365   5.933   47.613   1.00 47.97  ? 129 LYS B CD  1 
ATOM   1452 C  CE  . LYS B  1 88 ? 3.145   4.958   46.749   1.00 59.45  ? 129 LYS B CE  1 
ATOM   1453 N  NZ  . LYS B  1 88 ? 4.461   5.522   46.323   1.00 72.31  ? 129 LYS B NZ  1 
ATOM   1454 N  N   . MET B  1 89 ? -2.397  7.995   49.661   1.00 64.63  ? 130 MET B N   1 
ATOM   1455 C  CA  . MET B  1 89 ? -3.020  9.038   50.463   1.00 67.85  ? 130 MET B CA  1 
ATOM   1456 C  C   . MET B  1 89 ? -4.159  8.447   51.284   1.00 65.40  ? 130 MET B C   1 
ATOM   1457 O  O   . MET B  1 89 ? -4.380  8.847   52.424   1.00 69.94  ? 130 MET B O   1 
ATOM   1458 C  CB  . MET B  1 89 ? -3.559  10.147  49.558   1.00 76.57  ? 130 MET B CB  1 
ATOM   1459 C  CG  . MET B  1 89 ? -4.264  11.267  50.297   1.00 84.42  ? 130 MET B CG  1 
ATOM   1460 S  SD  . MET B  1 89 ? -3.126  12.243  51.287   1.00 90.59  ? 130 MET B SD  1 
ATOM   1461 C  CE  . MET B  1 89 ? -2.534  13.404  50.042   1.00 92.07  ? 130 MET B CE  1 
ATOM   1462 N  N   . ASP B  1 90 ? -4.880  7.494   50.703   1.00 70.39  ? 131 ASP B N   1 
ATOM   1463 C  CA  . ASP B  1 90 ? -5.994  6.861   51.407   1.00 77.46  ? 131 ASP B CA  1 
ATOM   1464 C  C   . ASP B  1 90 ? -5.482  6.037   52.582   1.00 78.61  ? 131 ASP B C   1 
ATOM   1465 O  O   . ASP B  1 90 ? -6.147  5.930   53.611   1.00 74.72  ? 131 ASP B O   1 
ATOM   1466 C  CB  . ASP B  1 90 ? -6.789  5.938   50.473   1.00 77.58  ? 131 ASP B CB  1 
ATOM   1467 C  CG  . ASP B  1 90 ? -7.107  6.580   49.140   1.00 96.71  ? 131 ASP B CG  1 
ATOM   1468 O  OD1 . ASP B  1 90 ? -7.416  7.789   49.117   1.00 99.65  ? 131 ASP B OD1 1 
ATOM   1469 O  OD2 . ASP B  1 90 ? -7.059  5.868   48.113   1.00 90.23  ? 131 ASP B OD2 1 
ATOM   1470 N  N   . GLN B  1 91 ? -4.298  5.454   52.418   1.00 77.31  ? 132 GLN B N   1 
ATOM   1471 C  CA  . GLN B  1 91 ? -3.699  4.625   53.453   1.00 73.74  ? 132 GLN B CA  1 
ATOM   1472 C  C   . GLN B  1 91 ? -3.367  5.383   54.729   1.00 78.51  ? 132 GLN B C   1 
ATOM   1473 O  O   . GLN B  1 91 ? -3.565  4.868   55.833   1.00 83.77  ? 132 GLN B O   1 
ATOM   1474 C  CB  . GLN B  1 91 ? -2.438  3.946   52.916   1.00 74.10  ? 132 GLN B CB  1 
ATOM   1475 C  CG  . GLN B  1 91 ? -2.723  2.907   51.847   1.00 81.88  ? 132 GLN B CG  1 
ATOM   1476 C  CD  . GLN B  1 91 ? -3.857  1.977   52.240   1.00 92.73  ? 132 GLN B CD  1 
ATOM   1477 O  OE1 . GLN B  1 91 ? -3.799  1.306   53.273   1.00 93.10  ? 132 GLN B OE1 1 
ATOM   1478 N  NE2 . GLN B  1 91 ? -4.899  1.935   51.418   1.00 96.33  ? 132 GLN B NE2 1 
ATOM   1479 N  N   . LEU B  1 92 ? -2.864  6.603   54.584   1.00 83.30  ? 133 LEU B N   1 
ATOM   1480 C  CA  . LEU B  1 92 ? -2.503  7.406   55.744   1.00 87.05  ? 133 LEU B CA  1 
ATOM   1481 C  C   . LEU B  1 92 ? -3.629  7.482   56.763   1.00 92.08  ? 133 LEU B C   1 
ATOM   1482 O  O   . LEU B  1 92 ? -3.395  7.369   57.965   1.00 90.94  ? 133 LEU B O   1 
ATOM   1483 C  CB  . LEU B  1 92 ? -2.078  8.811   55.305   1.00 81.11  ? 133 LEU B CB  1 
ATOM   1484 C  CG  . LEU B  1 92 ? -0.583  8.934   54.984   1.00 68.54  ? 133 LEU B CG  1 
ATOM   1485 C  CD1 . LEU B  1 92 ? -0.177  7.884   53.964   1.00 62.70  ? 133 LEU B CD1 1 
ATOM   1486 C  CD2 . LEU B  1 92 ? -0.283  10.327  54.475   1.00 75.88  ? 133 LEU B CD2 1 
ATOM   1487 N  N   . SER B  1 93 ? -4.851  7.663   56.280   1.00 99.07  ? 134 SER B N   1 
ATOM   1488 C  CA  . SER B  1 93 ? -6.011  7.738   57.159   1.00 108.38 ? 134 SER B CA  1 
ATOM   1489 C  C   . SER B  1 93 ? -6.992  6.625   56.819   1.00 111.64 ? 134 SER B C   1 
ATOM   1490 O  O   . SER B  1 93 ? -8.186  6.867   56.645   1.00 115.79 ? 134 SER B O   1 
ATOM   1491 C  CB  . SER B  1 93 ? -6.701  9.094   57.011   1.00 109.31 ? 134 SER B CB  1 
ATOM   1492 O  OG  . SER B  1 93 ? -7.934  9.106   57.707   1.00 117.15 ? 134 SER B OG  1 
ATOM   1493 N  N   . LYS B  1 94 ? -6.485  5.402   56.724   1.00 114.18 ? 135 LYS B N   1 
ATOM   1494 C  CA  . LYS B  1 94 ? -7.331  4.264   56.394   1.00 121.01 ? 135 LYS B CA  1 
ATOM   1495 C  C   . LYS B  1 94 ? -8.024  3.748   57.652   1.00 130.94 ? 135 LYS B C   1 
ATOM   1496 O  O   . LYS B  1 94 ? -9.244  3.570   57.673   1.00 133.84 ? 135 LYS B O   1 
ATOM   1497 C  CB  . LYS B  1 94 ? -6.487  3.153   55.760   1.00 120.93 ? 135 LYS B CB  1 
ATOM   1498 C  CG  . LYS B  1 94 ? -7.269  2.182   54.887   1.00 114.13 ? 135 LYS B CG  1 
ATOM   1499 C  CD  . LYS B  1 94 ? -8.307  1.410   55.679   1.00 109.66 ? 135 LYS B CD  1 
ATOM   1500 C  CE  . LYS B  1 94 ? -9.105  0.487   54.778   1.00 102.70 ? 135 LYS B CE  1 
ATOM   1501 N  NZ  . LYS B  1 94 ? -10.164 -0.228  55.537   1.00 96.46  ? 135 LYS B NZ  1 
ATOM   1502 N  N   . LEU B  1 95 ? -7.238  3.519   58.701   1.00 133.31 ? 136 LEU B N   1 
ATOM   1503 C  CA  . LEU B  1 95 ? -7.768  3.020   59.965   1.00 135.23 ? 136 LEU B CA  1 
ATOM   1504 C  C   . LEU B  1 95 ? -7.364  3.922   61.128   1.00 137.69 ? 136 LEU B C   1 
ATOM   1505 O  O   . LEU B  1 95 ? -6.628  4.901   60.885   1.00 140.65 ? 136 LEU B O   1 
ATOM   1506 C  CB  . LEU B  1 95 ? -7.266  1.593   60.220   1.00 134.58 ? 136 LEU B CB  1 
ATOM   1507 C  CG  . LEU B  1 95 ? -5.769  1.381   60.479   1.00 132.98 ? 136 LEU B CG  1 
ATOM   1508 C  CD1 . LEU B  1 95 ? -5.507  -0.098  60.711   1.00 132.63 ? 136 LEU B CD1 1 
ATOM   1509 C  CD2 . LEU B  1 95 ? -4.947  1.884   59.304   1.00 132.45 ? 136 LEU B CD2 1 
ATOM   1510 N  N   . ILE C  1 5  ? -4.141  -6.870  -95.547  1.00 133.65 ? 46  ILE C N   1 
ATOM   1511 C  CA  . ILE C  1 5  ? -3.198  -7.029  -94.403  1.00 133.65 ? 46  ILE C CA  1 
ATOM   1512 C  C   . ILE C  1 5  ? -3.456  -5.966  -93.341  1.00 133.65 ? 46  ILE C C   1 
ATOM   1513 O  O   . ILE C  1 5  ? -3.044  -6.114  -92.191  1.00 133.65 ? 46  ILE C O   1 
ATOM   1514 C  CB  . ILE C  1 5  ? -1.729  -6.922  -94.875  1.00 132.63 ? 46  ILE C CB  1 
ATOM   1515 C  CG1 . ILE C  1 5  ? -1.420  -8.053  -95.859  1.00 132.63 ? 46  ILE C CG1 1 
ATOM   1516 C  CG2 . ILE C  1 5  ? -0.785  -6.989  -93.682  1.00 132.63 ? 46  ILE C CG2 1 
ATOM   1517 C  CD1 . ILE C  1 5  ? 0.009   -8.058  -96.359  1.00 132.63 ? 46  ILE C CD1 1 
ATOM   1518 N  N   . GLU C  1 6  ? -4.141  -4.896  -93.732  1.00 135.06 ? 47  GLU C N   1 
ATOM   1519 C  CA  . GLU C  1 6  ? -4.456  -3.808  -92.812  1.00 135.06 ? 47  GLU C CA  1 
ATOM   1520 C  C   . GLU C  1 6  ? -5.345  -4.304  -91.677  1.00 135.06 ? 47  GLU C C   1 
ATOM   1521 O  O   . GLU C  1 6  ? -5.158  -3.931  -90.517  1.00 135.06 ? 47  GLU C O   1 
ATOM   1522 C  CB  . GLU C  1 6  ? -5.163  -2.677  -93.558  1.00 136.75 ? 47  GLU C CB  1 
ATOM   1523 C  CG  . GLU C  1 6  ? -4.369  -2.115  -94.725  1.00 136.75 ? 47  GLU C CG  1 
ATOM   1524 C  CD  . GLU C  1 6  ? -5.085  -0.973  -95.416  1.00 136.75 ? 47  GLU C CD  1 
ATOM   1525 O  OE1 . GLU C  1 6  ? -6.169  -1.206  -95.990  1.00 136.75 ? 47  GLU C OE1 1 
ATOM   1526 O  OE2 . GLU C  1 6  ? -4.562  0.161   -95.379  1.00 136.75 ? 47  GLU C OE2 1 
ATOM   1527 N  N   . SER C  1 7  ? -6.317  -5.142  -92.020  1.00 136.00 ? 48  SER C N   1 
ATOM   1528 C  CA  . SER C  1 7  ? -7.229  -5.692  -91.028  1.00 136.00 ? 48  SER C CA  1 
ATOM   1529 C  C   . SER C  1 7  ? -6.435  -6.530  -90.036  1.00 136.00 ? 48  SER C C   1 
ATOM   1530 O  O   . SER C  1 7  ? -6.661  -6.464  -88.828  1.00 136.00 ? 48  SER C O   1 
ATOM   1531 C  CB  . SER C  1 7  ? -8.291  -6.560  -91.708  1.00 131.92 ? 48  SER C CB  1 
ATOM   1532 O  OG  . SER C  1 7  ? -9.218  -7.073  -90.766  1.00 131.92 ? 48  SER C OG  1 
ATOM   1533 N  N   . LEU C  1 8  ? -5.494  -7.313  -90.553  1.00 138.25 ? 49  LEU C N   1 
ATOM   1534 C  CA  . LEU C  1 8  ? -4.673  -8.161  -89.702  1.00 138.25 ? 49  LEU C CA  1 
ATOM   1535 C  C   . LEU C  1 8  ? -3.746  -7.356  -88.797  1.00 138.25 ? 49  LEU C C   1 
ATOM   1536 O  O   . LEU C  1 8  ? -3.460  -7.770  -87.673  1.00 138.25 ? 49  LEU C O   1 
ATOM   1537 C  CB  . LEU C  1 8  ? -3.867  -9.140  -90.557  1.00 134.80 ? 49  LEU C CB  1 
ATOM   1538 C  CG  . LEU C  1 8  ? -4.721  -10.142 -91.340  1.00 134.80 ? 49  LEU C CG  1 
ATOM   1539 C  CD1 . LEU C  1 8  ? -3.827  -11.169 -92.005  1.00 134.80 ? 49  LEU C CD1 1 
ATOM   1540 C  CD2 . LEU C  1 8  ? -5.697  -10.835 -90.399  1.00 134.80 ? 49  LEU C CD2 1 
ATOM   1541 N  N   . HIS C  1 9  ? -3.277  -6.208  -89.280  1.00 141.87 ? 50  HIS C N   1 
ATOM   1542 C  CA  . HIS C  1 9  ? -2.400  -5.370  -88.472  1.00 142.19 ? 50  HIS C CA  1 
ATOM   1543 C  C   . HIS C  1 9  ? -3.243  -4.758  -87.359  1.00 141.01 ? 50  HIS C C   1 
ATOM   1544 O  O   . HIS C  1 9  ? -2.781  -4.603  -86.229  1.00 140.68 ? 50  HIS C O   1 
ATOM   1545 C  CB  . HIS C  1 9  ? -1.744  -4.270  -89.330  1.00 142.56 ? 50  HIS C CB  1 
ATOM   1546 C  CG  . HIS C  1 9  ? -2.364  -2.913  -89.180  1.00 142.58 ? 50  HIS C CG  1 
ATOM   1547 N  ND1 . HIS C  1 9  ? -2.446  -2.259  -87.968  1.00 142.41 ? 50  HIS C ND1 1 
ATOM   1548 C  CD2 . HIS C  1 9  ? -2.909  -2.074  -90.093  1.00 142.21 ? 50  HIS C CD2 1 
ATOM   1549 C  CE1 . HIS C  1 9  ? -3.014  -1.080  -88.142  1.00 141.45 ? 50  HIS C CE1 1 
ATOM   1550 N  NE2 . HIS C  1 9  ? -3.305  -0.942  -89.423  1.00 141.06 ? 50  HIS C NE2 1 
ATOM   1551 N  N   . ASP C  1 10 ? -4.488  -4.422  -87.686  1.00 142.39 ? 51  ASP C N   1 
ATOM   1552 C  CA  . ASP C  1 10 ? -5.397  -3.833  -86.712  1.00 140.63 ? 51  ASP C CA  1 
ATOM   1553 C  C   . ASP C  1 10 ? -5.662  -4.834  -85.592  1.00 141.93 ? 51  ASP C C   1 
ATOM   1554 O  O   . ASP C  1 10 ? -5.730  -4.466  -84.418  1.00 140.93 ? 51  ASP C O   1 
ATOM   1555 C  CB  . ASP C  1 10 ? -6.715  -3.443  -87.386  1.00 136.37 ? 51  ASP C CB  1 
ATOM   1556 C  CG  . ASP C  1 10 ? -7.657  -2.717  -86.445  1.00 137.85 ? 51  ASP C CG  1 
ATOM   1557 O  OD1 . ASP C  1 10 ? -7.303  -2.548  -85.260  1.00 137.70 ? 51  ASP C OD1 1 
ATOM   1558 O  OD2 . ASP C  1 10 ? -8.753  -2.316  -86.890  1.00 140.05 ? 51  ASP C OD2 1 
ATOM   1559 N  N   . GLN C  1 11 ? -5.808  -6.102  -85.964  1.00 144.28 ? 52  GLN C N   1 
ATOM   1560 C  CA  . GLN C  1 11 ? -6.056  -7.165  -84.997  1.00 146.55 ? 52  GLN C CA  1 
ATOM   1561 C  C   . GLN C  1 11 ? -4.831  -7.364  -84.116  1.00 141.87 ? 52  GLN C C   1 
ATOM   1562 O  O   . GLN C  1 11 ? -4.953  -7.613  -82.917  1.00 141.96 ? 52  GLN C O   1 
ATOM   1563 C  CB  . GLN C  1 11 ? -6.372  -8.465  -85.722  1.00 146.18 ? 52  GLN C CB  1 
ATOM   1564 C  CG  . GLN C  1 11 ? -7.578  -8.387  -86.622  1.00 161.40 ? 52  GLN C CG  1 
ATOM   1565 C  CD  . GLN C  1 11 ? -7.671  -9.592  -87.515  1.00 169.63 ? 52  GLN C CD  1 
ATOM   1566 O  OE1 . GLN C  1 11 ? -7.597  -10.726 -87.043  1.00 174.90 ? 52  GLN C OE1 1 
ATOM   1567 N  NE2 . GLN C  1 11 ? -7.828  -9.361  -88.814  1.00 172.88 ? 52  GLN C NE2 1 
ATOM   1568 N  N   . ILE C  1 12 ? -3.650  -7.270  -84.720  1.00 142.37 ? 53  ILE C N   1 
ATOM   1569 C  CA  . ILE C  1 12 ? -2.408  -7.414  -83.973  1.00 135.74 ? 53  ILE C CA  1 
ATOM   1570 C  C   . ILE C  1 12 ? -2.383  -6.303  -82.928  1.00 131.48 ? 53  ILE C C   1 
ATOM   1571 O  O   . ILE C  1 12 ? -2.002  -6.529  -81.780  1.00 132.25 ? 53  ILE C O   1 
ATOM   1572 C  CB  . ILE C  1 12 ? -1.170  -7.269  -84.889  1.00 133.25 ? 53  ILE C CB  1 
ATOM   1573 C  CG1 . ILE C  1 12 ? -1.062  -8.474  -85.833  1.00 133.01 ? 53  ILE C CG1 1 
ATOM   1574 C  CG2 . ILE C  1 12 ? 0.089   -7.120  -84.043  1.00 134.78 ? 53  ILE C CG2 1 
ATOM   1575 C  CD1 . ILE C  1 12 ? -0.499  -9.739  -85.197  1.00 130.24 ? 53  ILE C CD1 1 
ATOM   1576 N  N   . ASP C  1 13 ? -2.797  -5.104  -83.331  1.00 134.27 ? 54  ASP C N   1 
ATOM   1577 C  CA  . ASP C  1 13 ? -2.827  -3.965  -82.419  1.00 129.08 ? 54  ASP C CA  1 
ATOM   1578 C  C   . ASP C  1 13 ? -3.812  -4.193  -81.281  1.00 129.63 ? 54  ASP C C   1 
ATOM   1579 O  O   . ASP C  1 13 ? -3.548  -3.816  -80.139  1.00 131.88 ? 54  ASP C O   1 
ATOM   1580 C  CB  . ASP C  1 13 ? -3.196  -2.679  -83.165  1.00 134.59 ? 54  ASP C CB  1 
ATOM   1581 C  CG  . ASP C  1 13 ? -2.028  -2.103  -83.941  1.00 131.45 ? 54  ASP C CG  1 
ATOM   1582 O  OD1 . ASP C  1 13 ? -0.947  -1.924  -83.341  1.00 131.74 ? 54  ASP C OD1 1 
ATOM   1583 O  OD2 . ASP C  1 13 ? -2.190  -1.821  -85.147  1.00 130.48 ? 54  ASP C OD2 1 
ATOM   1584 N  N   . MET C  1 14 ? -4.950  -4.804  -81.592  1.00 127.57 ? 55  MET C N   1 
ATOM   1585 C  CA  . MET C  1 14 ? -5.950  -5.082  -80.571  1.00 125.23 ? 55  MET C CA  1 
ATOM   1586 C  C   . MET C  1 14 ? -5.422  -6.122  -79.596  1.00 121.23 ? 55  MET C C   1 
ATOM   1587 O  O   . MET C  1 14 ? -5.664  -6.038  -78.393  1.00 117.42 ? 55  MET C O   1 
ATOM   1588 C  CB  . MET C  1 14 ? -7.249  -5.575  -81.209  1.00 126.60 ? 55  MET C CB  1 
ATOM   1589 C  CG  . MET C  1 14 ? -8.026  -4.477  -81.907  1.00 131.53 ? 55  MET C CG  1 
ATOM   1590 S  SD  . MET C  1 14 ? -8.297  -3.063  -80.814  1.00 134.31 ? 55  MET C SD  1 
ATOM   1591 C  CE  . MET C  1 14 ? -9.953  -3.394  -80.233  1.00 127.57 ? 55  MET C CE  1 
ATOM   1592 N  N   . LEU C  1 15 ? -4.690  -7.098  -80.121  1.00 119.79 ? 56  LEU C N   1 
ATOM   1593 C  CA  . LEU C  1 15 ? -4.127  -8.152  -79.294  1.00 115.93 ? 56  LEU C CA  1 
ATOM   1594 C  C   . LEU C  1 15 ? -3.047  -7.582  -78.374  1.00 116.23 ? 56  LEU C C   1 
ATOM   1595 O  O   . LEU C  1 15 ? -2.978  -7.937  -77.197  1.00 115.02 ? 56  LEU C O   1 
ATOM   1596 C  CB  . LEU C  1 15 ? -3.556  -9.260  -80.183  1.00 111.08 ? 56  LEU C CB  1 
ATOM   1597 C  CG  . LEU C  1 15 ? -3.824  -10.702 -79.743  1.00 108.52 ? 56  LEU C CG  1 
ATOM   1598 C  CD1 . LEU C  1 15 ? -5.276  -10.847 -79.321  1.00 111.94 ? 56  LEU C CD1 1 
ATOM   1599 C  CD2 . LEU C  1 15 ? -3.508  -11.655 -80.884  1.00 109.09 ? 56  LEU C CD2 1 
ATOM   1600 N  N   . THR C  1 16 ? -2.214  -6.690  -78.906  1.00 117.01 ? 57  THR C N   1 
ATOM   1601 C  CA  . THR C  1 16 ? -1.153  -6.076  -78.110  1.00 114.21 ? 57  THR C CA  1 
ATOM   1602 C  C   . THR C  1 16 ? -1.746  -5.224  -76.995  1.00 115.25 ? 57  THR C C   1 
ATOM   1603 O  O   . THR C  1 16 ? -1.171  -5.115  -75.912  1.00 113.04 ? 57  THR C O   1 
ATOM   1604 C  CB  . THR C  1 16 ? -0.230  -5.186  -78.967  1.00 115.45 ? 57  THR C CB  1 
ATOM   1605 O  OG1 . THR C  1 16 ? -1.015  -4.216  -79.671  1.00 118.45 ? 57  THR C OG1 1 
ATOM   1606 C  CG2 . THR C  1 16 ? 0.560   -6.032  -79.955  1.00 108.85 ? 57  THR C CG2 1 
ATOM   1607 N  N   . LYS C  1 17 ? -2.893  -4.611  -77.266  1.00 114.06 ? 58  LYS C N   1 
ATOM   1608 C  CA  . LYS C  1 17 ? -3.553  -3.793  -76.261  1.00 117.76 ? 58  LYS C CA  1 
ATOM   1609 C  C   . LYS C  1 17 ? -4.122  -4.709  -75.188  1.00 120.76 ? 58  LYS C C   1 
ATOM   1610 O  O   . LYS C  1 17 ? -4.100  -4.381  -74.002  1.00 121.45 ? 58  LYS C O   1 
ATOM   1611 C  CB  . LYS C  1 17 ? -4.674  -2.960  -76.887  1.00 115.62 ? 58  LYS C CB  1 
ATOM   1612 C  CG  . LYS C  1 17 ? -4.170  -1.838  -77.768  1.00 119.42 ? 58  LYS C CG  1 
ATOM   1613 C  CD  . LYS C  1 17 ? -5.274  -0.855  -78.103  1.00 123.27 ? 58  LYS C CD  1 
ATOM   1614 C  CE  . LYS C  1 17 ? -4.735  0.293   -78.946  1.00 119.07 ? 58  LYS C CE  1 
ATOM   1615 N  NZ  . LYS C  1 17 ? -5.779  1.306   -79.261  1.00 120.55 ? 58  LYS C NZ  1 
ATOM   1616 N  N   . THR C  1 18 ? -4.623  -5.865  -75.609  1.00 120.52 ? 59  THR C N   1 
ATOM   1617 C  CA  . THR C  1 18 ? -5.184  -6.818  -74.668  1.00 119.45 ? 59  THR C CA  1 
ATOM   1618 C  C   . THR C  1 18 ? -4.081  -7.335  -73.752  1.00 122.73 ? 59  THR C C   1 
ATOM   1619 O  O   . THR C  1 18 ? -4.242  -7.339  -72.534  1.00 126.73 ? 59  THR C O   1 
ATOM   1620 C  CB  . THR C  1 18 ? -5.843  -8.012  -75.389  1.00 120.16 ? 59  THR C CB  1 
ATOM   1621 O  OG1 . THR C  1 18 ? -6.778  -7.527  -76.360  1.00 121.16 ? 59  THR C OG1 1 
ATOM   1622 C  CG2 . THR C  1 18 ? -6.591  -8.886  -74.392  1.00 116.05 ? 59  THR C CG2 1 
ATOM   1623 N  N   . ASN C  1 19 ? -2.953  -7.747  -74.329  1.00 122.56 ? 60  ASN C N   1 
ATOM   1624 C  CA  . ASN C  1 19 ? -1.849  -8.268  -73.527  1.00 124.18 ? 60  ASN C CA  1 
ATOM   1625 C  C   . ASN C  1 19 ? -1.273  -7.242  -72.552  1.00 126.03 ? 60  ASN C C   1 
ATOM   1626 O  O   . ASN C  1 19 ? -0.889  -7.592  -71.436  1.00 129.09 ? 60  ASN C O   1 
ATOM   1627 C  CB  . ASN C  1 19 ? -0.723  -8.816  -74.421  1.00 127.42 ? 60  ASN C CB  1 
ATOM   1628 C  CG  . ASN C  1 19 ? -0.011  -7.733  -75.214  1.00 123.86 ? 60  ASN C CG  1 
ATOM   1629 O  OD1 . ASN C  1 19 ? 0.360   -6.686  -74.678  1.00 130.12 ? 60  ASN C OD1 1 
ATOM   1630 N  ND2 . ASN C  1 19 ? 0.207   -7.994  -76.499  1.00 121.11 ? 60  ASN C ND2 1 
ATOM   1631 N  N   . LEU C  1 20 ? -1.219  -5.979  -72.966  1.00 122.02 ? 61  LEU C N   1 
ATOM   1632 C  CA  . LEU C  1 20 ? -0.680  -4.927  -72.112  1.00 125.36 ? 61  LEU C CA  1 
ATOM   1633 C  C   . LEU C  1 20 ? -1.567  -4.703  -70.893  1.00 127.42 ? 61  LEU C C   1 
ATOM   1634 O  O   . LEU C  1 20 ? -1.074  -4.467  -69.793  1.00 129.85 ? 61  LEU C O   1 
ATOM   1635 C  CB  . LEU C  1 20 ? -0.531  -3.624  -72.903  1.00 123.34 ? 61  LEU C CB  1 
ATOM   1636 C  CG  . LEU C  1 20 ? 0.113   -2.433  -72.184  1.00 122.05 ? 61  LEU C CG  1 
ATOM   1637 C  CD1 . LEU C  1 20 ? 0.650   -1.451  -73.212  1.00 121.16 ? 61  LEU C CD1 1 
ATOM   1638 C  CD2 . LEU C  1 20 ? -0.896  -1.759  -71.266  1.00 117.35 ? 61  LEU C CD2 1 
ATOM   1639 N  N   . GLN C  1 21 ? -2.878  -4.771  -71.088  1.00 127.80 ? 62  GLN C N   1 
ATOM   1640 C  CA  . GLN C  1 21 ? -3.804  -4.583  -69.980  1.00 127.48 ? 62  GLN C CA  1 
ATOM   1641 C  C   . GLN C  1 21 ? -3.598  -5.700  -68.961  1.00 127.08 ? 62  GLN C C   1 
ATOM   1642 O  O   . GLN C  1 21 ? -3.612  -5.463  -67.752  1.00 129.66 ? 62  GLN C O   1 
ATOM   1643 C  CB  . GLN C  1 21 ? -5.248  -4.590  -70.488  1.00 128.42 ? 62  GLN C CB  1 
ATOM   1644 C  CG  . GLN C  1 21 ? -5.583  -3.419  -71.403  1.00 135.33 ? 62  GLN C CG  1 
ATOM   1645 C  CD  . GLN C  1 21 ? -7.013  -3.458  -71.908  1.00 137.28 ? 62  GLN C CD  1 
ATOM   1646 O  OE1 . GLN C  1 21 ? -7.961  -3.462  -71.124  1.00 135.69 ? 62  GLN C OE1 1 
ATOM   1647 N  NE2 . GLN C  1 21 ? -7.174  -3.483  -73.226  1.00 140.34 ? 62  GLN C NE2 1 
ATOM   1648 N  N   . LEU C  1 22 ? -3.392  -6.915  -69.461  1.00 126.32 ? 63  LEU C N   1 
ATOM   1649 C  CA  . LEU C  1 22 ? -3.176  -8.076  -68.606  1.00 120.35 ? 63  LEU C CA  1 
ATOM   1650 C  C   . LEU C  1 22 ? -1.897  -7.894  -67.796  1.00 117.96 ? 63  LEU C C   1 
ATOM   1651 O  O   . LEU C  1 22 ? -1.866  -8.169  -66.596  1.00 114.17 ? 63  LEU C O   1 
ATOM   1652 C  CB  . LEU C  1 22 ? -3.050  -9.342  -69.455  1.00 122.40 ? 63  LEU C CB  1 
ATOM   1653 C  CG  . LEU C  1 22 ? -3.835  -9.377  -70.765  1.00 112.57 ? 63  LEU C CG  1 
ATOM   1654 C  CD1 . LEU C  1 22 ? -3.527  -10.673 -71.496  1.00 105.14 ? 63  LEU C CD1 1 
ATOM   1655 C  CD2 . LEU C  1 22 ? -5.326  -9.236  -70.497  1.00 109.14 ? 63  LEU C CD2 1 
ATOM   1656 N  N   . THR C  1 23 ? -0.841  -7.433  -68.461  1.00 115.76 ? 64  THR C N   1 
ATOM   1657 C  CA  . THR C  1 23 ? 0.436   -7.227  -67.793  1.00 119.77 ? 64  THR C CA  1 
ATOM   1658 C  C   . THR C  1 23 ? 0.284   -6.161  -66.717  1.00 123.56 ? 64  THR C C   1 
ATOM   1659 O  O   . THR C  1 23 ? 0.870   -6.269  -65.641  1.00 125.43 ? 64  THR C O   1 
ATOM   1660 C  CB  . THR C  1 23 ? 1.545   -6.805  -68.796  1.00 121.60 ? 64  THR C CB  1 
ATOM   1661 O  OG1 . THR C  1 23 ? 2.831   -7.002  -68.196  1.00 112.05 ? 64  THR C OG1 1 
ATOM   1662 C  CG2 . THR C  1 23 ? 1.410   -5.341  -69.177  1.00 121.52 ? 64  THR C CG2 1 
ATOM   1663 N  N   . THR C  1 24 ? -0.510  -5.135  -67.006  1.00 122.30 ? 65  THR C N   1 
ATOM   1664 C  CA  . THR C  1 24 ? -0.739  -4.064  -66.045  1.00 126.84 ? 65  THR C CA  1 
ATOM   1665 C  C   . THR C  1 24 ? -1.454  -4.630  -64.827  1.00 125.42 ? 65  THR C C   1 
ATOM   1666 O  O   . THR C  1 24 ? -1.142  -4.268  -63.692  1.00 126.44 ? 65  THR C O   1 
ATOM   1667 C  CB  . THR C  1 24 ? -1.600  -2.934  -66.642  1.00 125.18 ? 65  THR C CB  1 
ATOM   1668 O  OG1 . THR C  1 24 ? -0.874  -2.279  -67.689  1.00 128.56 ? 65  THR C OG1 1 
ATOM   1669 C  CG2 . THR C  1 24 ? -1.957  -1.917  -65.568  1.00 125.50 ? 65  THR C CG2 1 
ATOM   1670 N  N   . GLN C  1 25 ? -2.419  -5.514  -65.067  1.00 126.84 ? 66  GLN C N   1 
ATOM   1671 C  CA  . GLN C  1 25 ? -3.157  -6.135  -63.975  1.00 125.71 ? 66  GLN C CA  1 
ATOM   1672 C  C   . GLN C  1 25 ? -2.204  -6.979  -63.143  1.00 126.24 ? 66  GLN C C   1 
ATOM   1673 O  O   . GLN C  1 25 ? -2.264  -6.969  -61.914  1.00 127.19 ? 66  GLN C O   1 
ATOM   1674 C  CB  . GLN C  1 25 ? -4.288  -7.021  -64.505  1.00 122.47 ? 66  GLN C CB  1 
ATOM   1675 C  CG  . GLN C  1 25 ? -5.487  -6.262  -65.044  1.00 126.09 ? 66  GLN C CG  1 
ATOM   1676 C  CD  . GLN C  1 25 ? -6.750  -7.103  -65.028  1.00 131.31 ? 66  GLN C CD  1 
ATOM   1677 O  OE1 . GLN C  1 25 ? -6.776  -8.215  -65.556  1.00 135.36 ? 66  GLN C OE1 1 
ATOM   1678 N  NE2 . GLN C  1 25 ? -7.808  -6.573  -64.422  1.00 132.41 ? 66  GLN C NE2 1 
ATOM   1679 N  N   . SER C  1 26 ? -1.327  -7.712  -63.821  1.00 126.42 ? 67  SER C N   1 
ATOM   1680 C  CA  . SER C  1 26 ? -0.349  -8.553  -63.144  1.00 127.14 ? 67  SER C CA  1 
ATOM   1681 C  C   . SER C  1 26 ? 0.509   -7.693  -62.222  1.00 127.72 ? 67  SER C C   1 
ATOM   1682 O  O   . SER C  1 26 ? 0.790   -8.068  -61.084  1.00 127.75 ? 67  SER C O   1 
ATOM   1683 C  CB  . SER C  1 26 ? 0.540   -9.256  -64.171  1.00 125.20 ? 67  SER C CB  1 
ATOM   1684 O  OG  . SER C  1 26 ? 1.631   -9.903  -63.541  1.00 125.54 ? 67  SER C OG  1 
ATOM   1685 N  N   . GLN C  1 27 ? 0.919   -6.535  -62.731  1.00 128.86 ? 68  GLN C N   1 
ATOM   1686 C  CA  . GLN C  1 27 ? 1.734   -5.587  -61.980  1.00 131.35 ? 68  GLN C CA  1 
ATOM   1687 C  C   . GLN C  1 27 ? 0.978   -5.118  -60.742  1.00 131.46 ? 68  GLN C C   1 
ATOM   1688 O  O   . GLN C  1 27 ? 1.539   -5.041  -59.648  1.00 131.58 ? 68  GLN C O   1 
ATOM   1689 C  CB  . GLN C  1 27 ? 2.066   -4.383  -62.864  1.00 132.58 ? 68  GLN C CB  1 
ATOM   1690 C  CG  . GLN C  1 27 ? 2.665   -3.191  -62.130  1.00 140.48 ? 68  GLN C CG  1 
ATOM   1691 C  CD  . GLN C  1 27 ? 4.131   -3.375  -61.803  1.00 145.79 ? 68  GLN C CD  1 
ATOM   1692 O  OE1 . GLN C  1 27 ? 4.949   -3.617  -62.691  1.00 147.16 ? 68  GLN C OE1 1 
ATOM   1693 N  NE2 . GLN C  1 27 ? 4.475   -3.251  -60.525  1.00 146.53 ? 68  GLN C NE2 1 
ATOM   1694 N  N   . ASN C  1 28 ? -0.298  -4.798  -60.928  1.00 132.54 ? 69  ASN C N   1 
ATOM   1695 C  CA  . ASN C  1 28 ? -1.138  -4.337  -59.831  1.00 130.32 ? 69  ASN C CA  1 
ATOM   1696 C  C   . ASN C  1 28 ? -1.316  -5.446  -58.802  1.00 131.14 ? 69  ASN C C   1 
ATOM   1697 O  O   . ASN C  1 28 ? -1.258  -5.200  -57.597  1.00 132.91 ? 69  ASN C O   1 
ATOM   1698 C  CB  . ASN C  1 28 ? -2.504  -3.900  -60.359  1.00 130.95 ? 69  ASN C CB  1 
ATOM   1699 C  CG  . ASN C  1 28 ? -3.409  -3.380  -59.264  1.00 127.35 ? 69  ASN C CG  1 
ATOM   1700 O  OD1 . ASN C  1 28 ? -3.108  -2.374  -58.621  1.00 130.38 ? 69  ASN C OD1 1 
ATOM   1701 N  ND2 . ASN C  1 28 ? -4.522  -4.067  -59.040  1.00 119.13 ? 69  ASN C ND2 1 
ATOM   1702 N  N   . LEU C  1 29 ? -1.534  -6.666  -59.284  1.00 129.46 ? 70  LEU C N   1 
ATOM   1703 C  CA  . LEU C  1 29 ? -1.713  -7.814  -58.403  1.00 126.06 ? 70  LEU C CA  1 
ATOM   1704 C  C   . LEU C  1 29 ? -0.426  -8.058  -57.619  1.00 124.52 ? 70  LEU C C   1 
ATOM   1705 O  O   . LEU C  1 29 ? -0.464  -8.381  -56.432  1.00 119.26 ? 70  LEU C O   1 
ATOM   1706 C  CB  . LEU C  1 29 ? -2.084  -9.056  -59.222  1.00 122.52 ? 70  LEU C CB  1 
ATOM   1707 C  CG  . LEU C  1 29 ? -3.333  -8.916  -60.100  1.00 119.95 ? 70  LEU C CG  1 
ATOM   1708 C  CD1 . LEU C  1 29 ? -3.590  -10.211 -60.846  1.00 117.68 ? 70  LEU C CD1 1 
ATOM   1709 C  CD2 . LEU C  1 29 ? -4.531  -8.552  -59.242  1.00 114.71 ? 70  LEU C CD2 1 
ATOM   1710 N  N   . LEU C  1 30 ? 0.712   -7.895  -58.289  1.00 118.86 ? 71  LEU C N   1 
ATOM   1711 C  CA  . LEU C  1 30 ? 2.015   -8.076  -57.657  1.00 122.54 ? 71  LEU C CA  1 
ATOM   1712 C  C   . LEU C  1 30 ? 2.205   -7.055  -56.540  1.00 123.25 ? 71  LEU C C   1 
ATOM   1713 O  O   . LEU C  1 30 ? 2.699   -7.386  -55.462  1.00 119.59 ? 71  LEU C O   1 
ATOM   1714 C  CB  . LEU C  1 30 ? 3.132   -7.908  -58.687  1.00 122.08 ? 71  LEU C CB  1 
ATOM   1715 C  CG  . LEU C  1 30 ? 4.537   -7.697  -58.115  1.00 125.29 ? 71  LEU C CG  1 
ATOM   1716 C  CD1 . LEU C  1 30 ? 5.035   -8.980  -57.467  1.00 126.86 ? 71  LEU C CD1 1 
ATOM   1717 C  CD2 . LEU C  1 30 ? 5.476   -7.259  -59.225  1.00 125.68 ? 71  LEU C CD2 1 
ATOM   1718 N  N   . SER C  1 31 ? 1.822   -5.810  -56.811  1.00 120.10 ? 72  SER C N   1 
ATOM   1719 C  CA  . SER C  1 31 ? 1.941   -4.742  -55.824  1.00 120.96 ? 72  SER C CA  1 
ATOM   1720 C  C   . SER C  1 31 ? 1.067   -5.035  -54.614  1.00 121.33 ? 72  SER C C   1 
ATOM   1721 O  O   . SER C  1 31 ? 1.463   -4.784  -53.476  1.00 123.16 ? 72  SER C O   1 
ATOM   1722 C  CB  . SER C  1 31 ? 1.537   -3.394  -56.429  1.00 121.46 ? 72  SER C CB  1 
ATOM   1723 O  OG  . SER C  1 31 ? 2.635   -2.771  -57.074  1.00 116.53 ? 72  SER C OG  1 
ATOM   1724 N  N   . LYS C  1 32 ? -0.126  -5.564  -54.866  1.00 119.42 ? 73  LYS C N   1 
ATOM   1725 C  CA  . LYS C  1 32 ? -1.047  -5.897  -53.790  1.00 115.25 ? 73  LYS C CA  1 
ATOM   1726 C  C   . LYS C  1 32 ? -0.457  -7.011  -52.931  1.00 114.73 ? 73  LYS C C   1 
ATOM   1727 O  O   . LYS C  1 32 ? -0.587  -6.995  -51.707  1.00 117.13 ? 73  LYS C O   1 
ATOM   1728 C  CB  . LYS C  1 32 ? -2.402  -6.327  -54.363  1.00 111.49 ? 73  LYS C CB  1 
ATOM   1729 C  CG  . LYS C  1 32 ? -3.100  -5.234  -55.164  1.00 109.62 ? 73  LYS C CG  1 
ATOM   1730 C  CD  . LYS C  1 32 ? -3.230  -3.956  -54.349  1.00 105.91 ? 73  LYS C CD  1 
ATOM   1731 C  CE  . LYS C  1 32 ? -3.692  -2.788  -55.204  1.00 105.97 ? 73  LYS C CE  1 
ATOM   1732 N  NZ  . LYS C  1 32 ? -3.749  -1.524  -54.417  1.00 104.16 ? 73  LYS C NZ  1 
ATOM   1733 N  N   . LEU C  1 33 ? 0.198   -7.972  -53.576  1.00 113.15 ? 74  LEU C N   1 
ATOM   1734 C  CA  . LEU C  1 33 ? 0.820   -9.082  -52.863  1.00 112.28 ? 74  LEU C CA  1 
ATOM   1735 C  C   . LEU C  1 33 ? 1.944   -8.545  -51.986  1.00 111.60 ? 74  LEU C C   1 
ATOM   1736 O  O   . LEU C  1 33 ? 2.131   -8.988  -50.852  1.00 112.52 ? 74  LEU C O   1 
ATOM   1737 C  CB  . LEU C  1 33 ? 1.385   -10.104 -53.853  1.00 112.96 ? 74  LEU C CB  1 
ATOM   1738 C  CG  . LEU C  1 33 ? 2.123   -11.304 -53.249  1.00 115.20 ? 74  LEU C CG  1 
ATOM   1739 C  CD1 . LEU C  1 33 ? 1.183   -12.092 -52.347  1.00 111.80 ? 74  LEU C CD1 1 
ATOM   1740 C  CD2 . LEU C  1 33 ? 2.658   -12.187 -54.364  1.00 116.29 ? 74  LEU C CD2 1 
ATOM   1741 N  N   . GLU C  1 34 ? 2.689   -7.586  -52.521  1.00 110.64 ? 75  GLU C N   1 
ATOM   1742 C  CA  . GLU C  1 34 ? 3.792   -6.979  -51.792  1.00 115.09 ? 75  GLU C CA  1 
ATOM   1743 C  C   . GLU C  1 34 ? 3.245   -6.238  -50.575  1.00 113.55 ? 75  GLU C C   1 
ATOM   1744 O  O   . GLU C  1 34 ? 3.818   -6.301  -49.488  1.00 115.43 ? 75  GLU C O   1 
ATOM   1745 C  CB  . GLU C  1 34 ? 4.551   -6.014  -52.708  1.00 116.22 ? 75  GLU C CB  1 
ATOM   1746 C  CG  . GLU C  1 34 ? 5.868   -5.499  -52.147  1.00 124.57 ? 75  GLU C CG  1 
ATOM   1747 C  CD  . GLU C  1 34 ? 5.682   -4.484  -51.035  1.00 128.25 ? 75  GLU C CD  1 
ATOM   1748 O  OE1 . GLU C  1 34 ? 5.078   -3.422  -51.296  1.00 129.13 ? 75  GLU C OE1 1 
ATOM   1749 O  OE2 . GLU C  1 34 ? 6.141   -4.747  -49.903  1.00 124.88 ? 75  GLU C OE2 1 
ATOM   1750 N  N   . LEU C  1 35 ? 2.127   -5.542  -50.763  1.00 115.57 ? 76  LEU C N   1 
ATOM   1751 C  CA  . LEU C  1 35 ? 1.505   -4.796  -49.678  1.00 111.34 ? 76  LEU C CA  1 
ATOM   1752 C  C   . LEU C  1 35 ? 1.036   -5.765  -48.600  1.00 109.54 ? 76  LEU C C   1 
ATOM   1753 O  O   . LEU C  1 35 ? 1.203   -5.509  -47.409  1.00 110.06 ? 76  LEU C O   1 
ATOM   1754 C  CB  . LEU C  1 35 ? 0.325   -3.973  -50.207  1.00 113.90 ? 76  LEU C CB  1 
ATOM   1755 C  CG  . LEU C  1 35 ? -0.337  -2.985  -49.239  1.00 118.20 ? 76  LEU C CG  1 
ATOM   1756 C  CD1 . LEU C  1 35 ? -0.815  -1.763  -50.004  1.00 120.40 ? 76  LEU C CD1 1 
ATOM   1757 C  CD2 . LEU C  1 35 ? -1.491  -3.656  -48.509  1.00 123.08 ? 76  LEU C CD2 1 
ATOM   1758 N  N   . ALA C  1 36 ? 0.458   -6.884  -49.025  1.00 108.21 ? 77  ALA C N   1 
ATOM   1759 C  CA  . ALA C  1 36 ? -0.021  -7.897  -48.094  1.00 108.24 ? 77  ALA C CA  1 
ATOM   1760 C  C   . ALA C  1 36 ? 1.158   -8.466  -47.316  1.00 107.80 ? 77  ALA C C   1 
ATOM   1761 O  O   . ALA C  1 36 ? 1.042   -8.770  -46.129  1.00 109.13 ? 77  ALA C O   1 
ATOM   1762 C  CB  . ALA C  1 36 ? -0.731  -9.012  -48.850  1.00 107.22 ? 77  ALA C CB  1 
ATOM   1763 N  N   . GLN C  1 37 ? 2.295   -8.604  -47.991  1.00 107.53 ? 78  GLN C N   1 
ATOM   1764 C  CA  . GLN C  1 37 ? 3.484   -9.140  -47.349  1.00 111.21 ? 78  GLN C CA  1 
ATOM   1765 C  C   . GLN C  1 37 ? 4.038   -8.144  -46.345  1.00 109.02 ? 78  GLN C C   1 
ATOM   1766 O  O   . GLN C  1 37 ? 4.578   -8.528  -45.308  1.00 109.09 ? 78  GLN C O   1 
ATOM   1767 C  CB  . GLN C  1 37 ? 4.555   -9.474  -48.387  1.00 110.50 ? 78  GLN C CB  1 
ATOM   1768 C  CG  . GLN C  1 37 ? 5.534   -10.515 -47.887  1.00 118.96 ? 78  GLN C CG  1 
ATOM   1769 C  CD  . GLN C  1 37 ? 4.828   -11.793 -47.468  1.00 123.09 ? 78  GLN C CD  1 
ATOM   1770 O  OE1 . GLN C  1 37 ? 5.396   -12.629 -46.767  1.00 122.80 ? 78  GLN C OE1 1 
ATOM   1771 N  NE2 . GLN C  1 37 ? 3.583   -11.953 -47.906  1.00 124.62 ? 78  GLN C NE2 1 
ATOM   1772 N  N   . SER C  1 38 ? 3.899   -6.861  -46.657  1.00 108.50 ? 79  SER C N   1 
ATOM   1773 C  CA  . SER C  1 38 ? 4.383   -5.818  -45.769  1.00 113.80 ? 79  SER C CA  1 
ATOM   1774 C  C   . SER C  1 38 ? 3.510   -5.803  -44.514  1.00 117.14 ? 79  SER C C   1 
ATOM   1775 O  O   . SER C  1 38 ? 4.001   -5.580  -43.408  1.00 118.83 ? 79  SER C O   1 
ATOM   1776 C  CB  . SER C  1 38 ? 4.328   -4.461  -46.471  1.00 113.49 ? 79  SER C CB  1 
ATOM   1777 O  OG  . SER C  1 38 ? 5.150   -3.516  -45.810  1.00 113.59 ? 79  SER C OG  1 
ATOM   1778 N  N   . LYS C  1 39 ? 2.215   -6.049  -44.695  1.00 117.71 ? 80  LYS C N   1 
ATOM   1779 C  CA  . LYS C  1 39 ? 1.271   -6.084  -43.581  1.00 114.60 ? 80  LYS C CA  1 
ATOM   1780 C  C   . LYS C  1 39 ? 1.549   -7.280  -42.686  1.00 115.44 ? 80  LYS C C   1 
ATOM   1781 O  O   . LYS C  1 39 ? 1.413   -7.206  -41.467  1.00 118.31 ? 80  LYS C O   1 
ATOM   1782 C  CB  . LYS C  1 39 ? -0.170  -6.158  -44.103  1.00 115.62 ? 80  LYS C CB  1 
ATOM   1783 C  CG  . LYS C  1 39 ? -0.798  -4.797  -44.326  1.00 115.19 ? 80  LYS C CG  1 
ATOM   1784 C  CD  . LYS C  1 39 ? 0.179   -3.884  -45.046  1.00 114.03 ? 80  LYS C CD  1 
ATOM   1785 C  CE  . LYS C  1 39 ? -0.055  -2.427  -44.701  1.00 120.57 ? 80  LYS C CE  1 
ATOM   1786 N  NZ  . LYS C  1 39 ? -1.284  -1.888  -45.339  1.00 123.12 ? 80  LYS C NZ  1 
ATOM   1787 N  N   . GLU C  1 40 ? 1.948   -8.380  -43.307  1.00 113.46 ? 81  GLU C N   1 
ATOM   1788 C  CA  . GLU C  1 40 ? 2.246   -9.606  -42.588  1.00 109.42 ? 81  GLU C CA  1 
ATOM   1789 C  C   . GLU C  1 40 ? 3.500   -9.436  -41.730  1.00 104.79 ? 81  GLU C C   1 
ATOM   1790 O  O   . GLU C  1 40 ? 3.565   -9.931  -40.604  1.00 102.45 ? 81  GLU C O   1 
ATOM   1791 C  CB  . GLU C  1 40 ? 2.434   -10.734 -43.596  1.00 115.35 ? 81  GLU C CB  1 
ATOM   1792 C  CG  . GLU C  1 40 ? 2.002   -12.096 -43.112  1.00 117.24 ? 81  GLU C CG  1 
ATOM   1793 C  CD  . GLU C  1 40 ? 1.889   -13.077 -44.256  1.00 120.31 ? 81  GLU C CD  1 
ATOM   1794 O  OE1 . GLU C  1 40 ? 2.791   -13.086 -45.119  1.00 119.73 ? 81  GLU C OE1 1 
ATOM   1795 O  OE2 . GLU C  1 40 ? 0.906   -13.839 -44.292  1.00 121.83 ? 81  GLU C OE2 1 
ATOM   1796 N  N   . SER C  1 41 ? 4.489   -8.727  -42.265  1.00 102.22 ? 82  SER C N   1 
ATOM   1797 C  CA  . SER C  1 41 ? 5.737   -8.490  -41.547  1.00 100.66 ? 82  SER C CA  1 
ATOM   1798 C  C   . SER C  1 41 ? 5.522   -7.578  -40.345  1.00 104.41 ? 82  SER C C   1 
ATOM   1799 O  O   . SER C  1 41 ? 6.068   -7.819  -39.270  1.00 110.06 ? 82  SER C O   1 
ATOM   1800 C  CB  . SER C  1 41 ? 6.777   -7.866  -42.480  1.00 102.07 ? 82  SER C CB  1 
ATOM   1801 O  OG  . SER C  1 41 ? 7.899   -8.717  -42.624  1.00 90.66  ? 82  SER C OG  1 
ATOM   1802 N  N   . LYS C  1 42 ? 4.733   -6.525  -40.534  1.00 103.99 ? 83  LYS C N   1 
ATOM   1803 C  CA  . LYS C  1 42 ? 4.445   -5.589  -39.454  1.00 104.58 ? 83  LYS C CA  1 
ATOM   1804 C  C   . LYS C  1 42 ? 3.653   -6.297  -38.362  1.00 102.15 ? 83  LYS C C   1 
ATOM   1805 O  O   . LYS C  1 42 ? 3.894   -6.098  -37.171  1.00 97.50  ? 83  LYS C O   1 
ATOM   1806 C  CB  . LYS C  1 42 ? 3.635   -4.402  -39.980  1.00 105.62 ? 83  LYS C CB  1 
ATOM   1807 C  CG  . LYS C  1 42 ? 4.348   -3.584  -41.040  1.00 107.93 ? 83  LYS C CG  1 
ATOM   1808 C  CD  . LYS C  1 42 ? 5.713   -3.104  -40.561  1.00 110.21 ? 83  LYS C CD  1 
ATOM   1809 C  CE  . LYS C  1 42 ? 5.613   -2.337  -39.251  1.00 114.36 ? 83  LYS C CE  1 
ATOM   1810 N  NZ  . LYS C  1 42 ? 6.842   -1.536  -38.994  1.00 118.54 ? 83  LYS C NZ  1 
ATOM   1811 N  N   . LEU C  1 43 ? 2.709   -7.132  -38.782  1.00 99.76  ? 84  LEU C N   1 
ATOM   1812 C  CA  . LEU C  1 43 ? 1.872   -7.870  -37.853  1.00 96.57  ? 84  LEU C CA  1 
ATOM   1813 C  C   . LEU C  1 43 ? 2.708   -8.868  -37.047  1.00 100.87 ? 84  LEU C C   1 
ATOM   1814 O  O   . LEU C  1 43 ? 2.486   -9.038  -35.850  1.00 103.70 ? 84  LEU C O   1 
ATOM   1815 C  CB  . LEU C  1 43 ? 0.749   -8.580  -38.624  1.00 93.88  ? 84  LEU C CB  1 
ATOM   1816 C  CG  . LEU C  1 43 ? -0.516  -9.005  -37.867  1.00 104.72 ? 84  LEU C CG  1 
ATOM   1817 C  CD1 . LEU C  1 43 ? -0.732  -8.109  -36.659  1.00 99.63  ? 84  LEU C CD1 1 
ATOM   1818 C  CD2 . LEU C  1 43 ? -1.718  -8.936  -38.806  1.00 99.70  ? 84  LEU C CD2 1 
ATOM   1819 N  N   . LEU C  1 44 ? 3.676   -9.513  -37.695  1.00 100.50 ? 85  LEU C N   1 
ATOM   1820 C  CA  . LEU C  1 44 ? 4.536   -10.477 -37.011  1.00 94.06  ? 85  LEU C CA  1 
ATOM   1821 C  C   . LEU C  1 44 ? 5.483   -9.792  -36.034  1.00 89.83  ? 85  LEU C C   1 
ATOM   1822 O  O   . LEU C  1 44 ? 5.705   -10.285 -34.928  1.00 90.66  ? 85  LEU C O   1 
ATOM   1823 C  CB  . LEU C  1 44 ? 5.339   -11.295 -38.026  1.00 98.96  ? 85  LEU C CB  1 
ATOM   1824 C  CG  . LEU C  1 44 ? 4.761   -12.665 -38.404  1.00 100.02 ? 85  LEU C CG  1 
ATOM   1825 C  CD1 . LEU C  1 44 ? 3.271   -12.544 -38.692  1.00 101.17 ? 85  LEU C CD1 1 
ATOM   1826 C  CD2 . LEU C  1 44 ? 5.508   -13.222 -39.607  1.00 95.52  ? 85  LEU C CD2 1 
ATOM   1827 N  N   . GLU C  1 45 ? 6.044   -8.659  -36.443  1.00 85.55  ? 86  GLU C N   1 
ATOM   1828 C  CA  . GLU C  1 45 ? 6.951   -7.917  -35.576  1.00 83.08  ? 86  GLU C CA  1 
ATOM   1829 C  C   . GLU C  1 45 ? 6.210   -7.428  -34.343  1.00 85.22  ? 86  GLU C C   1 
ATOM   1830 O  O   . GLU C  1 45 ? 6.729   -7.488  -33.229  1.00 86.85  ? 86  GLU C O   1 
ATOM   1831 C  CB  . GLU C  1 45 ? 7.534   -6.712  -36.305  1.00 87.13  ? 86  GLU C CB  1 
ATOM   1832 C  CG  . GLU C  1 45 ? 8.825   -6.986  -37.037  1.00 93.14  ? 86  GLU C CG  1 
ATOM   1833 C  CD  . GLU C  1 45 ? 9.858   -5.916  -36.766  1.00 98.01  ? 86  GLU C CD  1 
ATOM   1834 O  OE1 . GLU C  1 45 ? 10.826  -5.809  -37.548  1.00 97.08  ? 86  GLU C OE1 1 
ATOM   1835 O  OE2 . GLU C  1 45 ? 9.703   -5.186  -35.763  1.00 95.58  ? 86  GLU C OE2 1 
ATOM   1836 N  N   . ASN C  1 46 ? 5.000   -6.924  -34.554  1.00 77.45  ? 87  ASN C N   1 
ATOM   1837 C  CA  . ASN C  1 46 ? 4.181   -6.434  -33.456  1.00 72.62  ? 87  ASN C CA  1 
ATOM   1838 C  C   . ASN C  1 46 ? 3.891   -7.572  -32.482  1.00 71.21  ? 87  ASN C C   1 
ATOM   1839 O  O   . ASN C  1 46 ? 4.057   -7.418  -31.270  1.00 69.46  ? 87  ASN C O   1 
ATOM   1840 C  CB  . ASN C  1 46 ? 2.872   -5.855  -33.998  1.00 77.03  ? 87  ASN C CB  1 
ATOM   1841 C  CG  . ASN C  1 46 ? 3.031   -4.436  -34.507  1.00 77.52  ? 87  ASN C CG  1 
ATOM   1842 O  OD1 . ASN C  1 46 ? 4.137   -3.999  -34.832  1.00 81.61  ? 87  ASN C OD1 1 
ATOM   1843 N  ND2 . ASN C  1 46 ? 1.921   -3.708  -34.587  1.00 87.48  ? 87  ASN C ND2 1 
ATOM   1844 N  N   . LEU C  1 47 ? 3.466   -8.713  -33.015  1.00 64.52  ? 88  LEU C N   1 
ATOM   1845 C  CA  . LEU C  1 47 ? 3.164   -9.868  -32.180  1.00 65.49  ? 88  LEU C CA  1 
ATOM   1846 C  C   . LEU C  1 47 ? 4.384   -10.238 -31.347  1.00 63.31  ? 88  LEU C C   1 
ATOM   1847 O  O   . LEU C  1 47 ? 4.259   -10.595 -30.176  1.00 62.96  ? 88  LEU C O   1 
ATOM   1848 C  CB  . LEU C  1 47 ? 2.745   -11.066 -33.040  1.00 72.38  ? 88  LEU C CB  1 
ATOM   1849 C  CG  . LEU C  1 47 ? 1.509   -10.906 -33.933  1.00 81.89  ? 88  LEU C CG  1 
ATOM   1850 C  CD1 . LEU C  1 47 ? 1.249   -12.211 -34.680  1.00 84.36  ? 88  LEU C CD1 1 
ATOM   1851 C  CD2 . LEU C  1 47 ? 0.301   -10.517 -33.090  1.00 74.67  ? 88  LEU C CD2 1 
ATOM   1852 N  N   . ASN C  1 48 ? 5.564   -10.151 -31.954  1.00 60.63  ? 89  ASN C N   1 
ATOM   1853 C  CA  . ASN C  1 48 ? 6.801   -10.470 -31.251  1.00 68.09  ? 89  ASN C CA  1 
ATOM   1854 C  C   . ASN C  1 48 ? 7.055   -9.481  -30.120  1.00 68.52  ? 89  ASN C C   1 
ATOM   1855 O  O   . ASN C  1 48 ? 7.466   -9.876  -29.029  1.00 68.09  ? 89  ASN C O   1 
ATOM   1856 C  CB  . ASN C  1 48 ? 7.984   -10.476 -32.222  1.00 73.89  ? 89  ASN C CB  1 
ATOM   1857 C  CG  . ASN C  1 48 ? 8.081   -11.770 -33.004  1.00 84.08  ? 89  ASN C CG  1 
ATOM   1858 O  OD1 . ASN C  1 48 ? 8.194   -12.850 -32.420  1.00 82.66  ? 89  ASN C OD1 1 
ATOM   1859 N  ND2 . ASN C  1 48 ? 8.037   -11.672 -34.330  1.00 78.20  ? 89  ASN C ND2 1 
ATOM   1860 N  N   . LEU C  1 49 ? 6.819   -8.198  -30.380  1.00 66.51  ? 90  LEU C N   1 
ATOM   1861 C  CA  . LEU C  1 49 ? 7.004   -7.189  -29.348  1.00 68.40  ? 90  LEU C CA  1 
ATOM   1862 C  C   . LEU C  1 49 ? 6.015   -7.468  -28.217  1.00 70.58  ? 90  LEU C C   1 
ATOM   1863 O  O   . LEU C  1 49 ? 6.394   -7.498  -27.048  1.00 67.01  ? 90  LEU C O   1 
ATOM   1864 C  CB  . LEU C  1 49 ? 6.778   -5.784  -29.916  1.00 70.22  ? 90  LEU C CB  1 
ATOM   1865 C  CG  . LEU C  1 49 ? 7.898   -5.201  -30.782  1.00 82.68  ? 90  LEU C CG  1 
ATOM   1866 C  CD1 . LEU C  1 49 ? 7.588   -3.747  -31.117  1.00 82.27  ? 90  LEU C CD1 1 
ATOM   1867 C  CD2 . LEU C  1 49 ? 9.216   -5.288  -30.033  1.00 75.59  ? 90  LEU C CD2 1 
ATOM   1868 N  N   . LEU C  1 50 ? 4.752   -7.680  -28.575  1.00 63.52  ? 91  LEU C N   1 
ATOM   1869 C  CA  . LEU C  1 50 ? 3.715   -7.976  -27.596  1.00 65.97  ? 91  LEU C CA  1 
ATOM   1870 C  C   . LEU C  1 50 ? 4.051   -9.241  -26.809  1.00 69.48  ? 91  LEU C C   1 
ATOM   1871 O  O   . LEU C  1 50 ? 3.914   -9.286  -25.584  1.00 72.14  ? 91  LEU C O   1 
ATOM   1872 C  CB  . LEU C  1 50 ? 2.363   -8.152  -28.299  1.00 66.69  ? 91  LEU C CB  1 
ATOM   1873 C  CG  . LEU C  1 50 ? 1.460   -6.919  -28.403  1.00 69.48  ? 91  LEU C CG  1 
ATOM   1874 C  CD1 . LEU C  1 50 ? 2.297   -5.655  -28.494  1.00 67.41  ? 91  LEU C CD1 1 
ATOM   1875 C  CD2 . LEU C  1 50 ? 0.548   -7.061  -29.611  1.00 74.09  ? 91  LEU C CD2 1 
ATOM   1876 N  N   . LYS C  1 51 ? 4.507   -10.263 -27.519  1.00 62.47  ? 92  LYS C N   1 
ATOM   1877 C  CA  . LYS C  1 51 ? 4.839   -11.528 -26.896  1.00 61.10  ? 92  LYS C CA  1 
ATOM   1878 C  C   . LYS C  1 51 ? 5.959   -11.480 -25.861  1.00 58.22  ? 92  LYS C C   1 
ATOM   1879 O  O   . LYS C  1 51 ? 5.778   -11.939 -24.735  1.00 60.72  ? 92  LYS C O   1 
ATOM   1880 C  CB  . LYS C  1 51 ? 5.180   -12.548 -27.972  1.00 63.14  ? 92  LYS C CB  1 
ATOM   1881 C  CG  . LYS C  1 51 ? 4.315   -13.777 -27.904  1.00 68.65  ? 92  LYS C CG  1 
ATOM   1882 C  CD  . LYS C  1 51 ? 4.760   -14.841 -28.887  1.00 79.53  ? 92  LYS C CD  1 
ATOM   1883 C  CE  . LYS C  1 51 ? 6.276   -15.029 -28.885  1.00 80.01  ? 92  LYS C CE  1 
ATOM   1884 N  NZ  . LYS C  1 51 ? 6.896   -14.851 -27.536  1.00 92.70  ? 92  LYS C NZ  1 
ATOM   1885 N  N   . ASN C  1 52 ? 7.112   -10.931 -26.232  1.00 56.71  ? 93  ASN C N   1 
ATOM   1886 C  CA  . ASN C  1 52 ? 8.240   -10.859 -25.307  1.00 56.94  ? 93  ASN C CA  1 
ATOM   1887 C  C   . ASN C  1 52 ? 7.908   -10.116 -24.017  1.00 57.18  ? 93  ASN C C   1 
ATOM   1888 O  O   . ASN C  1 52 ? 8.339   -10.532 -22.950  1.00 61.18  ? 93  ASN C O   1 
ATOM   1889 C  CB  . ASN C  1 52 ? 9.465   -10.214 -25.991  1.00 63.97  ? 93  ASN C CB  1 
ATOM   1890 C  CG  . ASN C  1 52 ? 10.679  -10.075 -25.052  1.00 78.40  ? 93  ASN C CG  1 
ATOM   1891 O  OD1 . ASN C  1 52 ? 10.760  -9.142  -24.247  1.00 87.15  ? 93  ASN C OD1 1 
ATOM   1892 N  ND2 . ASN C  1 52 ? 11.620  -11.011 -25.158  1.00 86.92  ? 93  ASN C ND2 1 
ATOM   1893 N  N   . GLU C  1 53 ? 7.137   -9.034  -24.092  1.00 52.75  ? 94  GLU C N   1 
ATOM   1894 C  CA  . GLU C  1 53 ? 6.821   -8.297  -22.869  1.00 51.24  ? 94  GLU C CA  1 
ATOM   1895 C  C   . GLU C  1 53 ? 5.776   -9.029  -22.043  1.00 50.67  ? 94  GLU C C   1 
ATOM   1896 O  O   . GLU C  1 53 ? 5.846   -9.062  -20.816  1.00 50.82  ? 94  GLU C O   1 
ATOM   1897 C  CB  . GLU C  1 53 ? 6.345   -6.884  -23.196  1.00 56.25  ? 94  GLU C CB  1 
ATOM   1898 C  CG  . GLU C  1 53 ? 6.184   -5.977  -21.977  1.00 69.99  ? 94  GLU C CG  1 
ATOM   1899 C  CD  . GLU C  1 53 ? 7.405   -5.957  -21.059  1.00 76.65  ? 94  GLU C CD  1 
ATOM   1900 O  OE1 . GLU C  1 53 ? 8.549   -5.952  -21.562  1.00 82.92  ? 94  GLU C OE1 1 
ATOM   1901 O  OE2 . GLU C  1 53 ? 7.218   -5.926  -19.825  1.00 72.55  ? 94  GLU C OE2 1 
ATOM   1902 N  N   . ASN C  1 54 ? 4.815   -9.626  -22.729  1.00 44.33  ? 95  ASN C N   1 
ATOM   1903 C  CA  . ASN C  1 54 ? 3.772   -10.387 -22.073  1.00 38.38  ? 95  ASN C CA  1 
ATOM   1904 C  C   . ASN C  1 54 ? 4.447   -11.443 -21.189  1.00 42.98  ? 95  ASN C C   1 
ATOM   1905 O  O   . ASN C  1 54 ? 4.089   -11.625 -20.028  1.00 52.33  ? 95  ASN C O   1 
ATOM   1906 C  CB  . ASN C  1 54 ? 2.908   -11.035 -23.146  1.00 44.73  ? 95  ASN C CB  1 
ATOM   1907 C  CG  . ASN C  1 54 ? 1.666   -11.664 -22.593  1.00 63.90  ? 95  ASN C CG  1 
ATOM   1908 O  OD1 . ASN C  1 54 ? 0.974   -12.400 -23.296  1.00 65.13  ? 95  ASN C OD1 1 
ATOM   1909 N  ND2 . ASN C  1 54 ? 1.362   -11.380 -21.332  1.00 70.41  ? 95  ASN C ND2 1 
ATOM   1910 N  N   . GLU C  1 55 ? 5.437   -12.134 -21.747  1.00 48.96  ? 96  GLU C N   1 
ATOM   1911 C  CA  . GLU C  1 55 ? 6.176   -13.148 -21.003  1.00 39.22  ? 96  GLU C CA  1 
ATOM   1912 C  C   . GLU C  1 55 ? 6.953   -12.505 -19.866  1.00 44.29  ? 96  GLU C C   1 
ATOM   1913 O  O   . GLU C  1 55 ? 7.130   -13.110 -18.807  1.00 48.45  ? 96  GLU C O   1 
ATOM   1914 C  CB  . GLU C  1 55 ? 7.156   -13.868 -21.914  1.00 52.28  ? 96  GLU C CB  1 
ATOM   1915 C  CG  . GLU C  1 55 ? 6.762   -15.279 -22.256  1.00 69.05  ? 96  GLU C CG  1 
ATOM   1916 C  CD  . GLU C  1 55 ? 7.546   -16.304 -21.476  1.00 76.72  ? 96  GLU C CD  1 
ATOM   1917 O  OE1 . GLU C  1 55 ? 7.088   -16.727 -20.389  1.00 88.30  ? 96  GLU C OE1 1 
ATOM   1918 O  OE2 . GLU C  1 55 ? 8.639   -16.674 -21.953  1.00 79.37  ? 96  GLU C OE2 1 
ATOM   1919 N  N   . ASN C  1 56 ? 7.439   -11.286 -20.079  1.00 35.89  ? 97  ASN C N   1 
ATOM   1920 C  CA  . ASN C  1 56 ? 8.174   -10.623 -19.013  1.00 28.46  ? 97  ASN C CA  1 
ATOM   1921 C  C   . ASN C  1 56 ? 7.179   -10.406 -17.874  1.00 32.12  ? 97  ASN C C   1 
ATOM   1922 O  O   . ASN C  1 56 ? 7.460   -10.742 -16.725  1.00 38.27  ? 97  ASN C O   1 
ATOM   1923 C  CB  . ASN C  1 56 ? 8.766   -9.293  -19.500  1.00 34.15  ? 97  ASN C CB  1 
ATOM   1924 C  CG  . ASN C  1 56 ? 9.731   -8.679  -18.496  1.00 58.69  ? 97  ASN C CG  1 
ATOM   1925 O  OD1 . ASN C  1 56 ? 10.684  -9.321  -18.047  1.00 68.81  ? 97  ASN C OD1 1 
ATOM   1926 N  ND2 . ASN C  1 56 ? 9.487   -7.426  -18.140  1.00 35.39  ? 97  ASN C ND2 1 
ATOM   1927 N  N   . LEU C  1 57 ? 5.999   -9.882  -18.204  1.00 25.76  ? 98  LEU C N   1 
ATOM   1928 C  CA  . LEU C  1 57 ? 4.972   -9.646  -17.202  1.00 19.94  ? 98  LEU C CA  1 
ATOM   1929 C  C   . LEU C  1 57 ? 4.529   -10.942 -16.508  1.00 32.65  ? 98  LEU C C   1 
ATOM   1930 O  O   . LEU C  1 57 ? 4.240   -10.955 -15.310  1.00 37.60  ? 98  LEU C O   1 
ATOM   1931 C  CB  . LEU C  1 57 ? 3.772   -8.955  -17.844  1.00 28.45  ? 98  LEU C CB  1 
ATOM   1932 C  CG  . LEU C  1 57 ? 4.053   -7.557  -18.402  1.00 20.66  ? 98  LEU C CG  1 
ATOM   1933 C  CD1 . LEU C  1 57 ? 2.740   -6.858  -18.703  1.00 19.75  ? 98  LEU C CD1 1 
ATOM   1934 C  CD2 . LEU C  1 57 ? 4.836   -6.750  -17.395  1.00 16.94  ? 98  LEU C CD2 1 
ATOM   1935 N  N   . ASN C  1 58 ? 4.483   -12.036 -17.251  1.00 31.27  ? 99  ASN C N   1 
ATOM   1936 C  CA  . ASN C  1 58 ? 4.059   -13.293 -16.661  1.00 24.67  ? 99  ASN C CA  1 
ATOM   1937 C  C   . ASN C  1 58 ? 5.014   -13.796 -15.618  1.00 20.52  ? 99  ASN C C   1 
ATOM   1938 O  O   . ASN C  1 58 ? 4.595   -14.370 -14.613  1.00 35.68  ? 99  ASN C O   1 
ATOM   1939 C  CB  . ASN C  1 58 ? 3.866   -14.355 -17.733  1.00 25.02  ? 99  ASN C CB  1 
ATOM   1940 C  CG  . ASN C  1 58 ? 2.563   -14.179 -18.477  1.00 37.86  ? 99  ASN C CG  1 
ATOM   1941 O  OD1 . ASN C  1 58 ? 1.704   -13.378 -18.085  1.00 42.91  ? 99  ASN C OD1 1 
ATOM   1942 N  ND2 . ASN C  1 58 ? 2.399   -14.931 -19.549  1.00 25.59  ? 99  ASN C ND2 1 
ATOM   1943 N  N   . SER C  1 59 ? 6.303   -13.558 -15.831  1.00 31.57  ? 100 SER C N   1 
ATOM   1944 C  CA  . SER C  1 59 ? 7.332   -14.002 -14.885  1.00 21.45  ? 100 SER C CA  1 
ATOM   1945 C  C   . SER C  1 59 ? 7.359   -13.170 -13.616  1.00 26.76  ? 100 SER C C   1 
ATOM   1946 O  O   . SER C  1 59 ? 7.688   -13.674 -12.544  1.00 38.06  ? 100 SER C O   1 
ATOM   1947 C  CB  . SER C  1 59 ? 8.703   -13.921 -15.539  1.00 33.50  ? 100 SER C CB  1 
ATOM   1948 O  OG  . SER C  1 59 ? 8.556   -13.987 -16.943  1.00 51.69  ? 100 SER C OG  1 
ATOM   1949 N  N   . ILE C  1 60 ? 7.059   -11.883 -13.754  1.00 30.75  ? 101 ILE C N   1 
ATOM   1950 C  CA  . ILE C  1 60 ? 7.015   -10.994 -12.609  1.00 19.63  ? 101 ILE C CA  1 
ATOM   1951 C  C   . ILE C  1 60 ? 5.827   -11.404 -11.743  1.00 16.00  ? 101 ILE C C   1 
ATOM   1952 O  O   . ILE C  1 60 ? 5.942   -11.467 -10.526  1.00 32.46  ? 101 ILE C O   1 
ATOM   1953 C  CB  . ILE C  1 60 ? 6.835   -9.535  -13.053  1.00 31.01  ? 101 ILE C CB  1 
ATOM   1954 C  CG1 . ILE C  1 60 ? 8.077   -9.082  -13.829  1.00 19.25  ? 101 ILE C CG1 1 
ATOM   1955 C  CG2 . ILE C  1 60 ? 6.630   -8.650  -11.841  1.00 20.10  ? 101 ILE C CG2 1 
ATOM   1956 C  CD1 . ILE C  1 60 ? 8.020   -7.651  -14.322  1.00 35.12  ? 101 ILE C CD1 1 
ATOM   1957 N  N   . PHE C  1 61 ? 4.687   -11.673 -12.382  1.00 22.96  ? 102 PHE C N   1 
ATOM   1958 C  CA  . PHE C  1 61 ? 3.485   -12.091 -11.669  1.00 24.96  ? 102 PHE C CA  1 
ATOM   1959 C  C   . PHE C  1 61 ? 3.768   -13.367 -10.859  1.00 29.03  ? 102 PHE C C   1 
ATOM   1960 O  O   . PHE C  1 61 ? 3.437   -13.453 -9.677   1.00 37.31  ? 102 PHE C O   1 
ATOM   1961 C  CB  . PHE C  1 61 ? 2.345   -12.358 -12.666  1.00 29.51  ? 102 PHE C CB  1 
ATOM   1962 C  CG  . PHE C  1 61 ? 0.980   -12.393 -12.038  1.00 24.12  ? 102 PHE C CG  1 
ATOM   1963 C  CD1 . PHE C  1 61 ? 0.830   -12.583 -10.662  1.00 30.11  ? 102 PHE C CD1 1 
ATOM   1964 C  CD2 . PHE C  1 61 ? -0.157  -12.203 -12.815  1.00 30.78  ? 102 PHE C CD2 1 
ATOM   1965 C  CE1 . PHE C  1 61 ? -0.426  -12.574 -10.073  1.00 28.06  ? 102 PHE C CE1 1 
ATOM   1966 C  CE2 . PHE C  1 61 ? -1.423  -12.191 -12.236  1.00 31.42  ? 102 PHE C CE2 1 
ATOM   1967 C  CZ  . PHE C  1 61 ? -1.558  -12.376 -10.861  1.00 21.13  ? 102 PHE C CZ  1 
ATOM   1968 N  N   . GLU C  1 62 ? 4.385   -14.355 -11.500  1.00 32.22  ? 103 GLU C N   1 
ATOM   1969 C  CA  . GLU C  1 62 ? 4.699   -15.623 -10.833  1.00 34.43  ? 103 GLU C CA  1 
ATOM   1970 C  C   . GLU C  1 62 ? 5.591   -15.419 -9.615   1.00 33.82  ? 103 GLU C C   1 
ATOM   1971 O  O   . GLU C  1 62 ? 5.475   -16.131 -8.616   1.00 40.69  ? 103 GLU C O   1 
ATOM   1972 C  CB  . GLU C  1 62 ? 5.397   -16.591 -11.801  1.00 37.46  ? 103 GLU C CB  1 
ATOM   1973 C  CG  . GLU C  1 62 ? 4.511   -17.053 -12.948  1.00 34.41  ? 103 GLU C CG  1 
ATOM   1974 C  CD  . GLU C  1 62 ? 5.004   -18.328 -13.614  1.00 62.44  ? 103 GLU C CD  1 
ATOM   1975 O  OE1 . GLU C  1 62 ? 6.017   -18.284 -14.347  1.00 71.77  ? 103 GLU C OE1 1 
ATOM   1976 O  OE2 . GLU C  1 62 ? 4.371   -19.383 -13.398  1.00 64.10  ? 103 GLU C OE2 1 
ATOM   1977 N  N   . ARG C  1 63 ? 6.485   -14.446 -9.703   1.00 30.00  ? 104 ARG C N   1 
ATOM   1978 C  CA  . ARG C  1 63 ? 7.397   -14.152 -8.612   1.00 24.27  ? 104 ARG C CA  1 
ATOM   1979 C  C   . ARG C  1 63 ? 6.680   -13.539 -7.421   1.00 23.89  ? 104 ARG C C   1 
ATOM   1980 O  O   . ARG C  1 63 ? 7.014   -13.826 -6.273   1.00 30.59  ? 104 ARG C O   1 
ATOM   1981 C  CB  . ARG C  1 63 ? 8.471   -13.197 -9.102   1.00 37.35  ? 104 ARG C CB  1 
ATOM   1982 C  CG  . ARG C  1 63 ? 9.880   -13.706 -8.929   1.00 42.93  ? 104 ARG C CG  1 
ATOM   1983 C  CD  . ARG C  1 63 ? 10.803  -12.968 -9.864   1.00 42.12  ? 104 ARG C CD  1 
ATOM   1984 N  NE  . ARG C  1 63 ? 10.825  -11.542 -9.566   1.00 39.55  ? 104 ARG C NE  1 
ATOM   1985 C  CZ  . ARG C  1 63 ? 10.786  -10.580 -10.483  1.00 33.45  ? 104 ARG C CZ  1 
ATOM   1986 N  NH1 . ARG C  1 63 ? 10.716  -10.880 -11.768  1.00 49.63  ? 104 ARG C NH1 1 
ATOM   1987 N  NH2 . ARG C  1 63 ? 10.827  -9.313  -10.111  1.00 43.06  ? 104 ARG C NH2 1 
ATOM   1988 N  N   . LYS C  1 64 ? 5.703   -12.681 -7.697   1.00 34.09  ? 105 LYS C N   1 
ATOM   1989 C  CA  . LYS C  1 64 ? 4.943   -12.028 -6.639   1.00 32.02  ? 105 LYS C CA  1 
ATOM   1990 C  C   . LYS C  1 64 ? 4.078   -13.037 -5.921   1.00 19.03  ? 105 LYS C C   1 
ATOM   1991 O  O   . LYS C  1 64 ? 3.915   -12.977 -4.702   1.00 26.77  ? 105 LYS C O   1 
ATOM   1992 C  CB  . LYS C  1 64 ? 4.055   -10.936 -7.230   1.00 34.08  ? 105 LYS C CB  1 
ATOM   1993 C  CG  . LYS C  1 64 ? 4.834   -9.972  -8.063   1.00 19.82  ? 105 LYS C CG  1 
ATOM   1994 C  CD  . LYS C  1 64 ? 5.870   -9.272  -7.222   1.00 32.68  ? 105 LYS C CD  1 
ATOM   1995 C  CE  . LYS C  1 64 ? 6.788   -8.463  -8.112   1.00 31.89  ? 105 LYS C CE  1 
ATOM   1996 N  NZ  . LYS C  1 64 ? 7.710   -7.619  -7.320   1.00 44.95  ? 105 LYS C NZ  1 
ATOM   1997 N  N   . ASN C  1 65 ? 3.513   -13.958 -6.692   1.00 22.53  ? 106 ASN C N   1 
ATOM   1998 C  CA  . ASN C  1 65 ? 2.662   -15.001 -6.137   1.00 22.63  ? 106 ASN C CA  1 
ATOM   1999 C  C   . ASN C  1 65 ? 3.441   -15.847 -5.148   1.00 26.21  ? 106 ASN C C   1 
ATOM   2000 O  O   . ASN C  1 65 ? 2.903   -16.271 -4.122   1.00 40.16  ? 106 ASN C O   1 
ATOM   2001 C  CB  . ASN C  1 65 ? 2.118   -15.892 -7.253   1.00 24.27  ? 106 ASN C CB  1 
ATOM   2002 C  CG  . ASN C  1 65 ? 0.965   -15.244 -7.983   1.00 36.38  ? 106 ASN C CG  1 
ATOM   2003 O  OD1 . ASN C  1 65 ? 0.346   -14.314 -7.462   1.00 32.90  ? 106 ASN C OD1 1 
ATOM   2004 N  ND2 . ASN C  1 65 ? 0.659   -15.727 -9.182   1.00 19.89  ? 106 ASN C ND2 1 
ATOM   2005 N  N   . LYS C  1 66 ? 4.718   -16.060 -5.461   1.00 33.37  ? 107 LYS C N   1 
ATOM   2006 C  CA  . LYS C  1 66 ? 5.627   -16.864 -4.649   1.00 25.60  ? 107 LYS C CA  1 
ATOM   2007 C  C   . LYS C  1 66 ? 5.864   -16.201 -3.299   1.00 20.96  ? 107 LYS C C   1 
ATOM   2008 O  O   . LYS C  1 66 ? 6.046   -16.866 -2.281   1.00 25.91  ? 107 LYS C O   1 
ATOM   2009 C  CB  . LYS C  1 66 ? 6.941   -17.046 -5.415   1.00 31.56  ? 107 LYS C CB  1 
ATOM   2010 C  CG  . LYS C  1 66 ? 7.795   -18.225 -4.997   1.00 44.16  ? 107 LYS C CG  1 
ATOM   2011 C  CD  . LYS C  1 66 ? 8.871   -18.510 -6.056   1.00 43.81  ? 107 LYS C CD  1 
ATOM   2012 C  CE  . LYS C  1 66 ? 8.285   -19.250 -7.274   1.00 50.50  ? 107 LYS C CE  1 
ATOM   2013 N  NZ  . LYS C  1 66 ? 8.650   -18.656 -8.602   1.00 61.29  ? 107 LYS C NZ  1 
ATOM   2014 N  N   . LYS C  1 67 ? 5.843   -14.876 -3.287   1.00 38.42  ? 108 LYS C N   1 
ATOM   2015 C  CA  . LYS C  1 67 ? 6.032   -14.138 -2.050   1.00 20.53  ? 108 LYS C CA  1 
ATOM   2016 C  C   . LYS C  1 67 ? 4.749   -14.079 -1.251   1.00 25.12  ? 108 LYS C C   1 
ATOM   2017 O  O   . LYS C  1 67 ? 4.773   -14.140 -0.025   1.00 26.90  ? 108 LYS C O   1 
ATOM   2018 C  CB  . LYS C  1 67 ? 6.474   -12.733 -2.369   1.00 36.88  ? 108 LYS C CB  1 
ATOM   2019 C  CG  . LYS C  1 67 ? 7.652   -12.703 -3.268   1.00 56.63  ? 108 LYS C CG  1 
ATOM   2020 C  CD  . LYS C  1 67 ? 7.806   -11.316 -3.800   1.00 73.24  ? 108 LYS C CD  1 
ATOM   2021 C  CE  . LYS C  1 67 ? 9.229   -10.860 -3.652   1.00 83.11  ? 108 LYS C CE  1 
ATOM   2022 N  NZ  . LYS C  1 67 ? 9.363   -9.445  -4.071   1.00 74.63  ? 108 LYS C NZ  1 
ATOM   2023 N  N   . LEU C  1 68 ? 3.630   -13.931 -1.950   1.00 23.83  ? 109 LEU C N   1 
ATOM   2024 C  CA  . LEU C  1 68 ? 2.338   -13.881 -1.288   1.00 19.88  ? 109 LEU C CA  1 
ATOM   2025 C  C   . LEU C  1 68 ? 2.131   -15.215 -0.550   1.00 33.20  ? 109 LEU C C   1 
ATOM   2026 O  O   . LEU C  1 68 ? 1.565   -15.246 0.540    1.00 28.87  ? 109 LEU C O   1 
ATOM   2027 C  CB  . LEU C  1 68 ? 1.234   -13.660 -2.332   1.00 23.60  ? 109 LEU C CB  1 
ATOM   2028 C  CG  . LEU C  1 68 ? -0.011  -12.911 -1.857   1.00 36.04  ? 109 LEU C CG  1 
ATOM   2029 C  CD1 . LEU C  1 68 ? -1.217  -13.307 -2.715   1.00 32.63  ? 109 LEU C CD1 1 
ATOM   2030 C  CD2 . LEU C  1 68 ? -0.277  -13.203 -0.387   1.00 35.98  ? 109 LEU C CD2 1 
ATOM   2031 N  N   . LYS C  1 69 ? 2.595   -16.316 -1.148   1.00 29.26  ? 110 LYS C N   1 
ATOM   2032 C  CA  . LYS C  1 69 ? 2.477   -17.627 -0.505   1.00 28.41  ? 110 LYS C CA  1 
ATOM   2033 C  C   . LYS C  1 69 ? 3.311   -17.648 0.763    1.00 24.76  ? 110 LYS C C   1 
ATOM   2034 O  O   . LYS C  1 69 ? 2.855   -18.158 1.778    1.00 35.77  ? 110 LYS C O   1 
ATOM   2035 C  CB  . LYS C  1 69 ? 2.934   -18.754 -1.428   1.00 24.07  ? 110 LYS C CB  1 
ATOM   2036 C  CG  . LYS C  1 69 ? 2.185   -18.796 -2.722   1.00 21.15  ? 110 LYS C CG  1 
ATOM   2037 C  CD  . LYS C  1 69 ? 1.184   -19.918 -2.778   1.00 44.01  ? 110 LYS C CD  1 
ATOM   2038 C  CE  . LYS C  1 69 ? 1.356   -20.673 -4.092   1.00 41.47  ? 110 LYS C CE  1 
ATOM   2039 N  NZ  . LYS C  1 69 ? 0.083   -21.248 -4.596   1.00 55.56  ? 110 LYS C NZ  1 
ATOM   2040 N  N   . GLU C  1 70 ? 4.531   -17.115 0.725    1.00 30.81  ? 111 GLU C N   1 
ATOM   2041 C  CA  . GLU C  1 70 ? 5.326   -17.078 1.954    1.00 26.03  ? 111 GLU C CA  1 
ATOM   2042 C  C   . GLU C  1 70 ? 4.461   -16.344 2.978    1.00 30.29  ? 111 GLU C C   1 
ATOM   2043 O  O   . GLU C  1 70 ? 4.259   -16.813 4.097    1.00 34.28  ? 111 GLU C O   1 
ATOM   2044 C  CB  . GLU C  1 70 ? 6.649   -16.322 1.758    1.00 41.58  ? 111 GLU C CB  1 
ATOM   2045 C  CG  . GLU C  1 70 ? 7.664   -17.034 0.854    1.00 49.22  ? 111 GLU C CG  1 
ATOM   2046 C  CD  . GLU C  1 70 ? 8.963   -16.245 0.664    1.00 60.28  ? 111 GLU C CD  1 
ATOM   2047 O  OE1 . GLU C  1 70 ? 9.526   -15.766 1.677    1.00 71.81  ? 111 GLU C OE1 1 
ATOM   2048 O  OE2 . GLU C  1 70 ? 9.432   -16.119 -0.495   1.00 50.62  ? 111 GLU C OE2 1 
ATOM   2049 N  N   . LEU C  1 71 ? 3.919   -15.200 2.577    1.00 32.73  ? 112 LEU C N   1 
ATOM   2050 C  CA  . LEU C  1 71 ? 3.074   -14.430 3.476    1.00 27.43  ? 112 LEU C CA  1 
ATOM   2051 C  C   . LEU C  1 71 ? 1.861   -15.162 4.047    1.00 26.98  ? 112 LEU C C   1 
ATOM   2052 O  O   . LEU C  1 71 ? 1.529   -14.952 5.210    1.00 31.05  ? 112 LEU C O   1 
ATOM   2053 C  CB  . LEU C  1 71 ? 2.606   -13.157 2.788    1.00 41.22  ? 112 LEU C CB  1 
ATOM   2054 C  CG  . LEU C  1 71 ? 3.621   -12.026 2.778    1.00 26.79  ? 112 LEU C CG  1 
ATOM   2055 C  CD1 . LEU C  1 71 ? 3.033   -10.874 1.998    1.00 37.26  ? 112 LEU C CD1 1 
ATOM   2056 C  CD2 . LEU C  1 71 ? 3.929   -11.605 4.217    1.00 35.71  ? 112 LEU C CD2 1 
ATOM   2057 N  N   . GLU C  1 72 ? 1.182   -15.993 3.250    1.00 27.09  ? 113 GLU C N   1 
ATOM   2058 C  CA  . GLU C  1 72 ? 0.025   -16.739 3.762    1.00 28.22  ? 113 GLU C CA  1 
ATOM   2059 C  C   . GLU C  1 72 ? 0.546   -17.512 4.953    1.00 26.65  ? 113 GLU C C   1 
ATOM   2060 O  O   . GLU C  1 72 ? -0.070  -17.574 6.014    1.00 47.53  ? 113 GLU C O   1 
ATOM   2061 C  CB  . GLU C  1 72 ? -0.495  -17.792 2.765    1.00 17.62  ? 113 GLU C CB  1 
ATOM   2062 C  CG  . GLU C  1 72 ? -1.028  -17.326 1.450    1.00 38.96  ? 113 GLU C CG  1 
ATOM   2063 C  CD  . GLU C  1 72 ? -1.772  -18.441 0.726    1.00 35.39  ? 113 GLU C CD  1 
ATOM   2064 O  OE1 . GLU C  1 72 ? -1.184  -19.538 0.568    1.00 25.64  ? 113 GLU C OE1 1 
ATOM   2065 O  OE2 . GLU C  1 72 ? -2.946  -18.224 0.322    1.00 25.15  ? 113 GLU C OE2 1 
ATOM   2066 N  N   . LYS C  1 73 ? 1.704   -18.113 4.743    1.00 30.44  ? 114 LYS C N   1 
ATOM   2067 C  CA  . LYS C  1 73 ? 2.351   -18.931 5.746    1.00 24.89  ? 114 LYS C CA  1 
ATOM   2068 C  C   . LYS C  1 73 ? 2.811   -18.123 6.944    1.00 27.96  ? 114 LYS C C   1 
ATOM   2069 O  O   . LYS C  1 73 ? 2.627   -18.540 8.086    1.00 37.19  ? 114 LYS C O   1 
ATOM   2070 C  CB  . LYS C  1 73 ? 3.535   -19.654 5.106    1.00 34.29  ? 114 LYS C CB  1 
ATOM   2071 C  CG  . LYS C  1 73 ? 4.105   -20.792 5.927    1.00 45.00  ? 114 LYS C CG  1 
ATOM   2072 C  CD  . LYS C  1 73 ? 5.076   -21.603 5.088    1.00 55.13  ? 114 LYS C CD  1 
ATOM   2073 C  CE  . LYS C  1 73 ? 6.376   -20.831 4.850    1.00 53.72  ? 114 LYS C CE  1 
ATOM   2074 N  NZ  . LYS C  1 73 ? 7.199   -21.379 3.725    1.00 34.63  ? 114 LYS C NZ  1 
ATOM   2075 N  N   . ASP C  1 74 ? 3.409   -16.966 6.687    1.00 35.55  ? 115 ASP C N   1 
ATOM   2076 C  CA  . ASP C  1 74 ? 3.885   -16.117 7.766    1.00 21.50  ? 115 ASP C CA  1 
ATOM   2077 C  C   . ASP C  1 74 ? 2.780   -15.606 8.665    1.00 23.28  ? 115 ASP C C   1 
ATOM   2078 O  O   . ASP C  1 74 ? 2.954   -15.517 9.882    1.00 31.66  ? 115 ASP C O   1 
ATOM   2079 C  CB  . ASP C  1 74 ? 4.680   -14.940 7.206    1.00 28.15  ? 115 ASP C CB  1 
ATOM   2080 C  CG  . ASP C  1 74 ? 6.049   -15.363 6.695    1.00 45.97  ? 115 ASP C CG  1 
ATOM   2081 O  OD1 . ASP C  1 74 ? 6.504   -16.461 7.069    1.00 35.30  ? 115 ASP C OD1 1 
ATOM   2082 O  OD2 . ASP C  1 74 ? 6.673   -14.599 5.931    1.00 49.97  ? 115 ASP C OD2 1 
ATOM   2083 N  N   . TYR C  1 75 ? 1.644   -15.269 8.067    1.00 30.56  ? 116 TYR C N   1 
ATOM   2084 C  CA  . TYR C  1 75 ? 0.511   -14.760 8.835    1.00 33.17  ? 116 TYR C CA  1 
ATOM   2085 C  C   . TYR C  1 75 ? -0.143  -15.862 9.679    1.00 27.57  ? 116 TYR C C   1 
ATOM   2086 O  O   . TYR C  1 75 ? -0.575  -15.619 10.806   1.00 29.76  ? 116 TYR C O   1 
ATOM   2087 C  CB  . TYR C  1 75 ? -0.503  -14.097 7.888    1.00 33.59  ? 116 TYR C CB  1 
ATOM   2088 C  CG  . TYR C  1 75 ? -0.136  -12.657 7.529    1.00 27.74  ? 116 TYR C CG  1 
ATOM   2089 C  CD1 . TYR C  1 75 ? -0.055  -11.676 8.513    1.00 25.19  ? 116 TYR C CD1 1 
ATOM   2090 C  CD2 . TYR C  1 75 ? 0.152   -12.291 6.212    1.00 30.62  ? 116 TYR C CD2 1 
ATOM   2091 C  CE1 . TYR C  1 75 ? 0.305   -10.369 8.198    1.00 24.69  ? 116 TYR C CE1 1 
ATOM   2092 C  CE2 . TYR C  1 75 ? 0.506   -10.992 5.888    1.00 38.45  ? 116 TYR C CE2 1 
ATOM   2093 C  CZ  . TYR C  1 75 ? 0.583   -10.033 6.882    1.00 25.11  ? 116 TYR C CZ  1 
ATOM   2094 O  OH  . TYR C  1 75 ? 0.944   -8.741  6.559    1.00 36.09  ? 116 TYR C OH  1 
ATOM   2095 N  N   . SER C  1 76 ? -0.191  -17.076 9.139    1.00 25.02  ? 117 SER C N   1 
ATOM   2096 C  CA  . SER C  1 76 ? -0.754  -18.216 9.852    1.00 15.96  ? 117 SER C CA  1 
ATOM   2097 C  C   . SER C  1 76 ? 0.058   -18.515 11.091   1.00 18.02  ? 117 SER C C   1 
ATOM   2098 O  O   . SER C  1 76 ? -0.498  -18.735 12.172   1.00 28.01  ? 117 SER C O   1 
ATOM   2099 C  CB  . SER C  1 76 ? -0.769  -19.447 8.953    1.00 20.45  ? 117 SER C CB  1 
ATOM   2100 O  OG  . SER C  1 76 ? -1.571  -19.189 7.815    1.00 38.16  ? 117 SER C OG  1 
ATOM   2101 N  N   . GLU C  1 77 ? 1.378   -18.515 10.947   1.00 26.28  ? 118 GLU C N   1 
ATOM   2102 C  CA  . GLU C  1 77 ? 2.238   -18.795 12.089   1.00 18.14  ? 118 GLU C CA  1 
ATOM   2103 C  C   . GLU C  1 77 ? 2.031   -17.735 13.139   1.00 23.74  ? 118 GLU C C   1 
ATOM   2104 O  O   . GLU C  1 77 ? 1.887   -18.051 14.314   1.00 36.84  ? 118 GLU C O   1 
ATOM   2105 C  CB  . GLU C  1 77 ? 3.715   -18.836 11.673   1.00 47.56  ? 118 GLU C CB  1 
ATOM   2106 C  CG  . GLU C  1 77 ? 4.078   -19.969 10.715   1.00 60.92  ? 118 GLU C CG  1 
ATOM   2107 C  CD  . GLU C  1 77 ? 5.532   -19.908 10.267   1.00 75.61  ? 118 GLU C CD  1 
ATOM   2108 O  OE1 . GLU C  1 77 ? 6.198   -18.888 10.550   1.00 86.22  ? 118 GLU C OE1 1 
ATOM   2109 O  OE2 . GLU C  1 77 ? 6.003   -20.875 9.625    1.00 58.10  ? 118 GLU C OE2 1 
ATOM   2110 N  N   . LEU C  1 78 ? 1.998   -16.474 12.716   1.00 20.38  ? 119 LEU C N   1 
ATOM   2111 C  CA  . LEU C  1 78 ? 1.822   -15.359 13.650   1.00 11.11  ? 119 LEU C CA  1 
ATOM   2112 C  C   . LEU C  1 78 ? 0.500   -15.473 14.400   1.00 5.54   ? 119 LEU C C   1 
ATOM   2113 O  O   . LEU C  1 78 ? 0.434   -15.329 15.625   1.00 18.29  ? 119 LEU C O   1 
ATOM   2114 C  CB  . LEU C  1 78 ? 1.842   -14.017 12.889   1.00 21.81  ? 119 LEU C CB  1 
ATOM   2115 C  CG  . LEU C  1 78 ? 2.844   -12.923 13.267   1.00 37.71  ? 119 LEU C CG  1 
ATOM   2116 C  CD1 . LEU C  1 78 ? 2.395   -11.613 12.636   1.00 27.69  ? 119 LEU C CD1 1 
ATOM   2117 C  CD2 . LEU C  1 78 ? 2.923   -12.762 14.762   1.00 32.86  ? 119 LEU C CD2 1 
ATOM   2118 N  N   . SER C  1 79 ? -0.566  -15.708 13.651   1.00 8.69   ? 120 SER C N   1 
ATOM   2119 C  CA  . SER C  1 79 ? -1.881  -15.840 14.268   1.00 11.98  ? 120 SER C CA  1 
ATOM   2120 C  C   . SER C  1 79 ? -1.843  -16.958 15.325   1.00 24.37  ? 120 SER C C   1 
ATOM   2121 O  O   . SER C  1 79 ? -2.315  -16.776 16.453   1.00 25.05  ? 120 SER C O   1 
ATOM   2122 C  CB  . SER C  1 79 ? -2.922  -16.143 13.172   1.00 28.23  ? 120 SER C CB  1 
ATOM   2123 O  OG  . SER C  1 79 ? -4.249  -16.175 13.685   1.00 35.51  ? 120 SER C OG  1 
ATOM   2124 N  N   . ASN C  1 80 ? -1.249  -18.099 14.968   1.00 20.33  ? 121 ASN C N   1 
ATOM   2125 C  CA  . ASN C  1 80 ? -1.162  -19.207 15.899   1.00 11.59  ? 121 ASN C CA  1 
ATOM   2126 C  C   . ASN C  1 80 ? -0.388  -18.814 17.131   1.00 16.32  ? 121 ASN C C   1 
ATOM   2127 O  O   . ASN C  1 80 ? -0.812  -19.104 18.252   1.00 33.11  ? 121 ASN C O   1 
ATOM   2128 C  CB  . ASN C  1 80 ? -0.515  -20.438 15.252   1.00 20.85  ? 121 ASN C CB  1 
ATOM   2129 C  CG  . ASN C  1 80 ? -1.460  -21.151 14.320   1.00 24.14  ? 121 ASN C CG  1 
ATOM   2130 O  OD1 . ASN C  1 80 ? -2.652  -21.248 14.613   1.00 34.24  ? 121 ASN C OD1 1 
ATOM   2131 N  ND2 . ASN C  1 80 ? -0.946  -21.662 13.193   1.00 42.10  ? 121 ASN C ND2 1 
ATOM   2132 N  N   . ARG C  1 81 ? 0.744   -18.145 16.936   1.00 15.92  ? 122 ARG C N   1 
ATOM   2133 C  CA  . ARG C  1 81 ? 1.545   -17.711 18.080   1.00 21.19  ? 122 ARG C CA  1 
ATOM   2134 C  C   . ARG C  1 81 ? 0.732   -16.792 18.989   1.00 21.35  ? 122 ARG C C   1 
ATOM   2135 O  O   . ARG C  1 81 ? 0.905   -16.810 20.216   1.00 34.42  ? 122 ARG C O   1 
ATOM   2136 C  CB  . ARG C  1 81 ? 2.835   -17.028 17.602   1.00 24.17  ? 122 ARG C CB  1 
ATOM   2137 C  CG  . ARG C  1 81 ? 3.753   -18.001 16.869   1.00 23.04  ? 122 ARG C CG  1 
ATOM   2138 C  CD  . ARG C  1 81 ? 5.046   -17.368 16.372   1.00 25.47  ? 122 ARG C CD  1 
ATOM   2139 N  NE  . ARG C  1 81 ? 5.965   -17.052 17.456   1.00 37.14  ? 122 ARG C NE  1 
ATOM   2140 C  CZ  . ARG C  1 81 ? 7.240   -16.726 17.269   1.00 33.01  ? 122 ARG C CZ  1 
ATOM   2141 N  NH1 . ARG C  1 81 ? 7.732   -16.684 16.037   1.00 25.09  ? 122 ARG C NH1 1 
ATOM   2142 N  NH2 . ARG C  1 81 ? 8.013   -16.431 18.307   1.00 33.46  ? 122 ARG C NH2 1 
ATOM   2143 N  N   . TYR C  1 82 ? -0.151  -15.983 18.399   1.00 20.62  ? 123 TYR C N   1 
ATOM   2144 C  CA  . TYR C  1 82 ? -1.005  -15.113 19.214   1.00 37.00  ? 123 TYR C CA  1 
ATOM   2145 C  C   . TYR C  1 82 ? -2.038  -15.956 19.954   1.00 22.12  ? 123 TYR C C   1 
ATOM   2146 O  O   . TYR C  1 82 ? -2.296  -15.738 21.130   1.00 28.94  ? 123 TYR C O   1 
ATOM   2147 C  CB  . TYR C  1 82 ? -1.714  -14.069 18.353   1.00 36.73  ? 123 TYR C CB  1 
ATOM   2148 C  CG  . TYR C  1 82 ? -0.878  -12.840 18.082   1.00 22.41  ? 123 TYR C CG  1 
ATOM   2149 C  CD1 . TYR C  1 82 ? -0.532  -11.959 19.112   1.00 29.71  ? 123 TYR C CD1 1 
ATOM   2150 C  CD2 . TYR C  1 82 ? -0.439  -12.552 16.799   1.00 16.53  ? 123 TYR C CD2 1 
ATOM   2151 C  CE1 . TYR C  1 82 ? 0.230   -10.819 18.850   1.00 35.78  ? 123 TYR C CE1 1 
ATOM   2152 C  CE2 . TYR C  1 82 ? 0.321   -11.425 16.530   1.00 17.44  ? 123 TYR C CE2 1 
ATOM   2153 C  CZ  . TYR C  1 82 ? 0.650   -10.564 17.547   1.00 31.50  ? 123 TYR C CZ  1 
ATOM   2154 O  OH  . TYR C  1 82 ? 1.399   -9.447  17.254   1.00 25.61  ? 123 TYR C OH  1 
ATOM   2155 N  N   . ASN C  1 83 ? -2.625  -16.934 19.273   1.00 15.54  ? 124 ASN C N   1 
ATOM   2156 C  CA  . ASN C  1 83 ? -3.605  -17.794 19.942   1.00 31.44  ? 124 ASN C CA  1 
ATOM   2157 C  C   . ASN C  1 83 ? -2.942  -18.512 21.116   1.00 27.74  ? 124 ASN C C   1 
ATOM   2158 O  O   . ASN C  1 83 ? -3.565  -18.747 22.153   1.00 33.31  ? 124 ASN C O   1 
ATOM   2159 C  CB  . ASN C  1 83 ? -4.205  -18.807 18.952   1.00 32.48  ? 124 ASN C CB  1 
ATOM   2160 C  CG  . ASN C  1 83 ? -5.119  -18.146 17.928   1.00 32.63  ? 124 ASN C CG  1 
ATOM   2161 O  OD1 . ASN C  1 83 ? -5.489  -16.972 18.070   1.00 36.25  ? 124 ASN C OD1 1 
ATOM   2162 N  ND2 . ASN C  1 83 ? -5.495  -18.891 16.901   1.00 15.80  ? 124 ASN C ND2 1 
ATOM   2163 N  N   . GLU C  1 84 ? -1.664  -18.838 20.957   1.00 22.75  ? 125 GLU C N   1 
ATOM   2164 C  CA  . GLU C  1 84 ? -0.928  -19.518 22.014   1.00 26.18  ? 125 GLU C CA  1 
ATOM   2165 C  C   . GLU C  1 84 ? -0.617  -18.594 23.171   1.00 24.31  ? 125 GLU C C   1 
ATOM   2166 O  O   . GLU C  1 84 ? -0.644  -19.005 24.325   1.00 30.01  ? 125 GLU C O   1 
ATOM   2167 C  CB  . GLU C  1 84 ? 0.362   -20.116 21.465   1.00 17.15  ? 125 GLU C CB  1 
ATOM   2168 C  CG  . GLU C  1 84 ? 0.162   -21.530 20.903   1.00 51.83  ? 125 GLU C CG  1 
ATOM   2169 C  CD  . GLU C  1 84 ? 0.005   -22.569 21.997   1.00 53.17  ? 125 GLU C CD  1 
ATOM   2170 O  OE1 . GLU C  1 84 ? -0.610  -22.248 23.028   1.00 52.57  ? 125 GLU C OE1 1 
ATOM   2171 O  OE2 . GLU C  1 84 ? 0.483   -23.708 21.831   1.00 71.79  ? 125 GLU C OE2 1 
ATOM   2172 N  N   . GLN C  1 85 ? -0.326  -17.336 22.866   1.00 31.99  ? 126 GLN C N   1 
ATOM   2173 C  CA  . GLN C  1 85 ? -0.027  -16.380 23.915   1.00 25.43  ? 126 GLN C CA  1 
ATOM   2174 C  C   . GLN C  1 85 ? -1.258  -16.072 24.754   1.00 24.67  ? 126 GLN C C   1 
ATOM   2175 O  O   . GLN C  1 85 ? -1.140  -15.774 25.951   1.00 33.24  ? 126 GLN C O   1 
ATOM   2176 C  CB  . GLN C  1 85 ? 0.556   -15.109 23.307   1.00 33.30  ? 126 GLN C CB  1 
ATOM   2177 C  CG  . GLN C  1 85 ? 1.950   -15.335 22.743   1.00 32.73  ? 126 GLN C CG  1 
ATOM   2178 C  CD  . GLN C  1 85 ? 2.921   -15.750 23.819   1.00 36.73  ? 126 GLN C CD  1 
ATOM   2179 O  OE1 . GLN C  1 85 ? 3.342   -14.928 24.634   1.00 42.92  ? 126 GLN C OE1 1 
ATOM   2180 N  NE2 . GLN C  1 85 ? 3.276   -17.031 23.842   1.00 39.32  ? 126 GLN C NE2 1 
ATOM   2181 N  N   . LYS C  1 86 ? -2.439  -16.160 24.148   1.00 31.38  ? 127 LYS C N   1 
ATOM   2182 C  CA  . LYS C  1 86 ? -3.654  -15.908 24.906   1.00 24.86  ? 127 LYS C CA  1 
ATOM   2183 C  C   . LYS C  1 86 ? -3.998  -17.101 25.809   1.00 26.87  ? 127 LYS C C   1 
ATOM   2184 O  O   . LYS C  1 86 ? -4.461  -16.915 26.925   1.00 38.83  ? 127 LYS C O   1 
ATOM   2185 C  CB  . LYS C  1 86 ? -4.825  -15.602 23.977   1.00 31.11  ? 127 LYS C CB  1 
ATOM   2186 C  CG  . LYS C  1 86 ? -6.039  -15.084 24.726   1.00 33.70  ? 127 LYS C CG  1 
ATOM   2187 C  CD  . LYS C  1 86 ? -7.310  -15.697 24.195   1.00 46.90  ? 127 LYS C CD  1 
ATOM   2188 C  CE  . LYS C  1 86 ? -8.274  -15.941 25.341   1.00 50.71  ? 127 LYS C CE  1 
ATOM   2189 N  NZ  . LYS C  1 86 ? -9.226  -17.055 25.057   1.00 42.97  ? 127 LYS C NZ  1 
ATOM   2190 N  N   . GLU C  1 87 ? -3.784  -18.325 25.342   1.00 24.53  ? 128 GLU C N   1 
ATOM   2191 C  CA  . GLU C  1 87 ? -4.068  -19.491 26.185   1.00 16.64  ? 128 GLU C CA  1 
ATOM   2192 C  C   . GLU C  1 87 ? -3.277  -19.333 27.478   1.00 21.35  ? 128 GLU C C   1 
ATOM   2193 O  O   . GLU C  1 87 ? -3.779  -19.595 28.573   1.00 37.21  ? 128 GLU C O   1 
ATOM   2194 C  CB  . GLU C  1 87 ? -3.670  -20.783 25.460   1.00 23.93  ? 128 GLU C CB  1 
ATOM   2195 C  CG  . GLU C  1 87 ? -4.552  -21.105 24.230   1.00 18.08  ? 128 GLU C CG  1 
ATOM   2196 C  CD  . GLU C  1 87 ? -3.926  -22.174 23.311   1.00 26.92  ? 128 GLU C CD  1 
ATOM   2197 O  OE1 . GLU C  1 87 ? -3.666  -23.292 23.804   1.00 45.99  ? 128 GLU C OE1 1 
ATOM   2198 O  OE2 . GLU C  1 87 ? -3.679  -21.905 22.105   1.00 17.58  ? 128 GLU C OE2 1 
ATOM   2199 N  N   . LYS C  1 88 ? -2.036  -18.883 27.348   1.00 27.89  ? 129 LYS C N   1 
ATOM   2200 C  CA  . LYS C  1 88 ? -1.180  -18.658 28.508   1.00 20.96  ? 129 LYS C CA  1 
ATOM   2201 C  C   . LYS C  1 88 ? -1.727  -17.549 29.412   1.00 36.39  ? 129 LYS C C   1 
ATOM   2202 O  O   . LYS C  1 88 ? -1.594  -17.614 30.634   1.00 49.94  ? 129 LYS C O   1 
ATOM   2203 C  CB  . LYS C  1 88 ? 0.228   -18.278 28.059   1.00 36.70  ? 129 LYS C CB  1 
ATOM   2204 C  CG  . LYS C  1 88 ? 0.983   -19.384 27.356   1.00 32.70  ? 129 LYS C CG  1 
ATOM   2205 C  CD  . LYS C  1 88 ? 2.317   -18.862 26.830   1.00 42.05  ? 129 LYS C CD  1 
ATOM   2206 C  CE  . LYS C  1 88 ? 3.112   -19.941 26.123   1.00 35.88  ? 129 LYS C CE  1 
ATOM   2207 N  NZ  . LYS C  1 88 ? 4.341   -19.355 25.527   1.00 55.62  ? 129 LYS C NZ  1 
ATOM   2208 N  N   . MET C  1 89 ? -2.336  -16.528 28.815   1.00 35.98  ? 130 MET C N   1 
ATOM   2209 C  CA  . MET C  1 89 ? -2.897  -15.434 29.597   1.00 42.71  ? 130 MET C CA  1 
ATOM   2210 C  C   . MET C  1 89 ? -4.118  -15.933 30.354   1.00 44.99  ? 130 MET C C   1 
ATOM   2211 O  O   . MET C  1 89 ? -4.297  -15.617 31.528   1.00 45.82  ? 130 MET C O   1 
ATOM   2212 C  CB  . MET C  1 89 ? -3.321  -14.279 28.690   1.00 50.60  ? 130 MET C CB  1 
ATOM   2213 C  CG  . MET C  1 89 ? -2.881  -12.901 29.167   1.00 65.17  ? 130 MET C CG  1 
ATOM   2214 S  SD  . MET C  1 89 ? -3.159  -12.543 30.907   1.00 86.97  ? 130 MET C SD  1 
ATOM   2215 C  CE  . MET C  1 89 ? -1.460  -12.375 31.464   1.00 64.34  ? 130 MET C CE  1 
ATOM   2216 N  N   . ASP C  1 90 ? -4.967  -16.701 29.675   1.00 44.50  ? 131 ASP C N   1 
ATOM   2217 C  CA  . ASP C  1 90 ? -6.166  -17.240 30.313   1.00 47.74  ? 131 ASP C CA  1 
ATOM   2218 C  C   . ASP C  1 90 ? -5.756  -18.079 31.509   1.00 42.63  ? 131 ASP C C   1 
ATOM   2219 O  O   . ASP C  1 90 ? -6.346  -17.981 32.581   1.00 41.69  ? 131 ASP C O   1 
ATOM   2220 C  CB  . ASP C  1 90 ? -6.976  -18.114 29.339   1.00 53.72  ? 131 ASP C CB  1 
ATOM   2221 C  CG  . ASP C  1 90 ? -7.734  -17.297 28.308   1.00 68.57  ? 131 ASP C CG  1 
ATOM   2222 O  OD1 . ASP C  1 90 ? -7.670  -16.054 28.375   1.00 62.82  ? 131 ASP C OD1 1 
ATOM   2223 O  OD2 . ASP C  1 90 ? -8.399  -17.894 27.436   1.00 84.06  ? 131 ASP C OD2 1 
ATOM   2224 N  N   . GLN C  1 91 ? -4.732  -18.902 31.313   1.00 46.31  ? 132 GLN C N   1 
ATOM   2225 C  CA  . GLN C  1 91 ? -4.246  -19.772 32.370   1.00 46.56  ? 132 GLN C CA  1 
ATOM   2226 C  C   . GLN C  1 91 ? -3.668  -18.997 33.545   1.00 53.79  ? 132 GLN C C   1 
ATOM   2227 O  O   . GLN C  1 91 ? -3.742  -19.452 34.690   1.00 55.42  ? 132 GLN C O   1 
ATOM   2228 C  CB  . GLN C  1 91 ? -3.227  -20.756 31.800   1.00 43.47  ? 132 GLN C CB  1 
ATOM   2229 C  CG  . GLN C  1 91 ? -3.880  -22.050 31.326   1.00 58.90  ? 132 GLN C CG  1 
ATOM   2230 C  CD  . GLN C  1 91 ? -3.391  -22.513 29.969   1.00 67.84  ? 132 GLN C CD  1 
ATOM   2231 O  OE1 . GLN C  1 91 ? -2.189  -22.585 29.715   1.00 65.99  ? 132 GLN C OE1 1 
ATOM   2232 N  NE2 . GLN C  1 91 ? -4.328  -22.846 29.091   1.00 62.47  ? 132 GLN C NE2 1 
ATOM   2233 N  N   . LEU C  1 92 ? -3.113  -17.820 33.269   1.00 59.03  ? 133 LEU C N   1 
ATOM   2234 C  CA  . LEU C  1 92 ? -2.560  -16.994 34.333   1.00 57.52  ? 133 LEU C CA  1 
ATOM   2235 C  C   . LEU C  1 92 ? -3.706  -16.546 35.234   1.00 51.68  ? 133 LEU C C   1 
ATOM   2236 O  O   . LEU C  1 92 ? -3.525  -16.372 36.437   1.00 62.22  ? 133 LEU C O   1 
ATOM   2237 C  CB  . LEU C  1 92 ? -1.812  -15.787 33.752   1.00 55.35  ? 133 LEU C CB  1 
ATOM   2238 C  CG  . LEU C  1 92 ? -0.279  -15.833 33.828   1.00 46.10  ? 133 LEU C CG  1 
ATOM   2239 C  CD1 . LEU C  1 92 ? 0.230   -17.171 33.331   1.00 52.98  ? 133 LEU C CD1 1 
ATOM   2240 C  CD2 . LEU C  1 92 ? 0.312   -14.709 33.009   1.00 29.62  ? 133 LEU C CD2 1 
ATOM   2241 N  N   . SER C  1 93 ? -4.892  -16.360 34.666   1.00 51.99  ? 134 SER C N   1 
ATOM   2242 C  CA  . SER C  1 93 ? -6.032  -15.983 35.494   1.00 64.36  ? 134 SER C CA  1 
ATOM   2243 C  C   . SER C  1 93 ? -6.839  -17.241 35.847   1.00 66.88  ? 134 SER C C   1 
ATOM   2244 O  O   . SER C  1 93 ? -7.601  -17.225 36.809   1.00 70.10  ? 134 SER C O   1 
ATOM   2245 C  CB  . SER C  1 93 ? -6.921  -14.965 34.784   1.00 67.84  ? 134 SER C CB  1 
ATOM   2246 O  OG  . SER C  1 93 ? -7.695  -15.587 33.776   1.00 87.82  ? 134 SER C OG  1 
ATOM   2247 N  N   . LYS C  1 94 ? -6.667  -18.293 35.030   1.00 68.87  ? 135 LYS C N   1 
ATOM   2248 C  CA  . LYS C  1 94 ? -7.261  -19.642 35.165   1.00 78.41  ? 135 LYS C CA  1 
ATOM   2249 C  C   . LYS C  1 94 ? -8.394  -20.151 34.253   1.00 80.27  ? 135 LYS C C   1 
ATOM   2250 O  O   . LYS C  1 94 ? -9.000  -19.354 33.504   1.00 80.16  ? 135 LYS C O   1 
ATOM   2251 C  CB  . LYS C  1 94 ? -7.630  -19.894 36.626   1.00 79.91  ? 135 LYS C CB  1 
ATOM   2252 C  CG  . LYS C  1 94 ? -6.402  -20.012 37.489   1.00 75.84  ? 135 LYS C CG  1 
ATOM   2253 C  CD  . LYS C  1 94 ? -6.563  -19.267 38.775   1.00 73.17  ? 135 LYS C CD  1 
ATOM   2254 C  CE  . LYS C  1 94 ? -5.200  -18.900 39.318   1.00 81.67  ? 135 LYS C CE  1 
ATOM   2255 N  NZ  . LYS C  1 94 ? -5.297  -18.040 40.524   1.00 91.65  ? 135 LYS C NZ  1 
ATOM   2256 N  N   . ILE D  1 5  ? 1.721   10.589  -75.456  1.00 145.19 ? 46  ILE D N   1 
ATOM   2257 C  CA  . ILE D  1 5  ? 0.867   10.979  -74.297  1.00 142.80 ? 46  ILE D CA  1 
ATOM   2258 C  C   . ILE D  1 5  ? 1.005   9.975   -73.152  1.00 143.12 ? 46  ILE D C   1 
ATOM   2259 O  O   . ILE D  1 5  ? 0.476   10.186  -72.060  1.00 140.98 ? 46  ILE D O   1 
ATOM   2260 C  CB  . ILE D  1 5  ? -0.622  11.076  -74.716  1.00 144.42 ? 46  ILE D CB  1 
ATOM   2261 C  CG1 . ILE D  1 5  ? -0.786  12.151  -75.795  1.00 144.42 ? 46  ILE D CG1 1 
ATOM   2262 C  CG2 . ILE D  1 5  ? -1.491  11.411  -73.513  1.00 144.42 ? 46  ILE D CG2 1 
ATOM   2263 C  CD1 . ILE D  1 5  ? -2.226  12.418  -76.192  1.00 144.42 ? 46  ILE D CD1 1 
ATOM   2264 N  N   . GLU D  1 6  ? 1.726   8.888   -73.403  1.00 141.24 ? 47  GLU D N   1 
ATOM   2265 C  CA  . GLU D  1 6  ? 1.925   7.861   -72.386  1.00 142.76 ? 47  GLU D CA  1 
ATOM   2266 C  C   . GLU D  1 6  ? 2.657   8.428   -71.173  1.00 143.60 ? 47  GLU D C   1 
ATOM   2267 O  O   . GLU D  1 6  ? 2.337   8.095   -70.031  1.00 139.35 ? 47  GLU D O   1 
ATOM   2268 C  CB  . GLU D  1 6  ? 2.717   6.687   -72.966  1.00 143.22 ? 47  GLU D CB  1 
ATOM   2269 C  CG  . GLU D  1 6  ? 2.844   5.506   -72.017  1.00 146.27 ? 47  GLU D CG  1 
ATOM   2270 C  CD  . GLU D  1 6  ? 3.606   4.346   -72.627  1.00 147.55 ? 47  GLU D CD  1 
ATOM   2271 O  OE1 . GLU D  1 6  ? 3.184   3.849   -73.693  1.00 147.06 ? 47  GLU D OE1 1 
ATOM   2272 O  OE2 . GLU D  1 6  ? 4.626   3.929   -72.038  1.00 146.32 ? 47  GLU D OE2 1 
ATOM   2273 N  N   . SER D  1 7  ? 3.642   9.285   -71.425  1.00 140.25 ? 48  SER D N   1 
ATOM   2274 C  CA  . SER D  1 7  ? 4.412   9.898   -70.351  1.00 141.20 ? 48  SER D CA  1 
ATOM   2275 C  C   . SER D  1 7  ? 3.502   10.790  -69.515  1.00 143.56 ? 48  SER D C   1 
ATOM   2276 O  O   . SER D  1 7  ? 3.593   10.808  -68.288  1.00 144.27 ? 48  SER D O   1 
ATOM   2277 C  CB  . SER D  1 7  ? 5.558   10.732  -70.927  1.00 139.40 ? 48  SER D CB  1 
ATOM   2278 O  OG  . SER D  1 7  ? 5.066   11.844  -71.656  1.00 143.14 ? 48  SER D OG  1 
ATOM   2279 N  N   . LEU D  1 8  ? 2.621   11.526  -70.187  1.00 144.75 ? 49  LEU D N   1 
ATOM   2280 C  CA  . LEU D  1 8  ? 1.692   12.419  -69.505  1.00 145.28 ? 49  LEU D CA  1 
ATOM   2281 C  C   . LEU D  1 8  ? 0.756   11.609  -68.612  1.00 145.89 ? 49  LEU D C   1 
ATOM   2282 O  O   . LEU D  1 8  ? 0.422   12.029  -67.504  1.00 146.63 ? 49  LEU D O   1 
ATOM   2283 C  CB  . LEU D  1 8  ? 0.881   13.222  -70.531  1.00 143.91 ? 49  LEU D CB  1 
ATOM   2284 C  CG  . LEU D  1 8  ? 0.074   14.423  -70.020  1.00 141.88 ? 49  LEU D CG  1 
ATOM   2285 C  CD1 . LEU D  1 8  ? -0.430  15.232  -71.202  1.00 138.48 ? 49  LEU D CD1 1 
ATOM   2286 C  CD2 . LEU D  1 8  ? -1.085  13.956  -69.156  1.00 140.98 ? 49  LEU D CD2 1 
ATOM   2287 N  N   . HIS D  1 9  ? 0.335   10.446  -69.099  1.00 147.40 ? 50  HIS D N   1 
ATOM   2288 C  CA  . HIS D  1 9  ? -0.552  9.580   -68.333  1.00 147.72 ? 50  HIS D CA  1 
ATOM   2289 C  C   . HIS D  1 9  ? 0.214   9.050   -67.126  1.00 147.43 ? 50  HIS D C   1 
ATOM   2290 O  O   . HIS D  1 9  ? -0.338  8.922   -66.033  1.00 147.51 ? 50  HIS D O   1 
ATOM   2291 C  CB  . HIS D  1 9  ? -1.030  8.408   -69.197  1.00 150.82 ? 50  HIS D CB  1 
ATOM   2292 C  CG  . HIS D  1 9  ? -2.144  7.618   -68.583  1.00 149.84 ? 50  HIS D CG  1 
ATOM   2293 N  ND1 . HIS D  1 9  ? -3.352  8.185   -68.234  1.00 147.63 ? 50  HIS D ND1 1 
ATOM   2294 C  CD2 . HIS D  1 9  ? -2.240  6.306   -68.263  1.00 148.55 ? 50  HIS D CD2 1 
ATOM   2295 C  CE1 . HIS D  1 9  ? -4.142  7.256   -67.727  1.00 147.38 ? 50  HIS D CE1 1 
ATOM   2296 N  NE2 . HIS D  1 9  ? -3.492  6.106   -67.734  1.00 147.89 ? 50  HIS D NE2 1 
ATOM   2297 N  N   . ASP D  1 10 ? 1.494   8.755   -67.333  1.00 146.40 ? 51  ASP D N   1 
ATOM   2298 C  CA  . ASP D  1 10 ? 2.346   8.236   -66.272  1.00 145.88 ? 51  ASP D CA  1 
ATOM   2299 C  C   . ASP D  1 10 ? 2.520   9.252   -65.145  1.00 144.58 ? 51  ASP D C   1 
ATOM   2300 O  O   . ASP D  1 10 ? 2.514   8.887   -63.969  1.00 143.41 ? 51  ASP D O   1 
ATOM   2301 C  CB  . ASP D  1 10 ? 3.715   7.845   -66.838  1.00 145.36 ? 51  ASP D CB  1 
ATOM   2302 C  CG  . ASP D  1 10 ? 4.583   7.125   -65.823  1.00 149.83 ? 51  ASP D CG  1 
ATOM   2303 O  OD1 . ASP D  1 10 ? 4.934   7.740   -64.793  1.00 150.76 ? 51  ASP D OD1 1 
ATOM   2304 O  OD2 . ASP D  1 10 ? 4.915   5.943   -66.056  1.00 152.81 ? 51  ASP D OD2 1 
ATOM   2305 N  N   . GLN D  1 11 ? 2.677   10.523  -65.504  1.00 143.28 ? 52  GLN D N   1 
ATOM   2306 C  CA  . GLN D  1 11 ? 2.841   11.576  -64.506  1.00 142.41 ? 52  GLN D CA  1 
ATOM   2307 C  C   . GLN D  1 11 ? 1.574   11.696  -63.666  1.00 143.03 ? 52  GLN D C   1 
ATOM   2308 O  O   . GLN D  1 11 ? 1.639   11.909  -62.455  1.00 144.49 ? 52  GLN D O   1 
ATOM   2309 C  CB  . GLN D  1 11 ? 3.145   12.917  -65.181  1.00 144.63 ? 52  GLN D CB  1 
ATOM   2310 C  CG  . GLN D  1 11 ? 4.470   12.953  -65.930  1.00 144.72 ? 52  GLN D CG  1 
ATOM   2311 C  CD  . GLN D  1 11 ? 5.665   12.706  -65.026  1.00 143.32 ? 52  GLN D CD  1 
ATOM   2312 O  OE1 . GLN D  1 11 ? 5.942   13.486  -64.113  1.00 140.26 ? 52  GLN D OE1 1 
ATOM   2313 N  NE2 . GLN D  1 11 ? 6.381   11.615  -65.277  1.00 140.74 ? 52  GLN D NE2 1 
ATOM   2314 N  N   . ILE D  1 12 ? 0.421   11.554  -64.314  1.00 140.69 ? 53  ILE D N   1 
ATOM   2315 C  CA  . ILE D  1 12 ? -0.855  11.638  -63.615  1.00 141.95 ? 53  ILE D CA  1 
ATOM   2316 C  C   . ILE D  1 12 ? -0.961  10.511  -62.591  1.00 139.92 ? 53  ILE D C   1 
ATOM   2317 O  O   . ILE D  1 12 ? -1.388  10.730  -61.458  1.00 138.84 ? 53  ILE D O   1 
ATOM   2318 C  CB  . ILE D  1 12 ? -2.055  11.528  -64.589  1.00 141.39 ? 53  ILE D CB  1 
ATOM   2319 C  CG1 . ILE D  1 12 ? -1.982  12.625  -65.655  1.00 142.38 ? 53  ILE D CG1 1 
ATOM   2320 C  CG2 . ILE D  1 12 ? -3.360  11.647  -63.815  1.00 144.18 ? 53  ILE D CG2 1 
ATOM   2321 C  CD1 . ILE D  1 12 ? -3.177  12.663  -66.588  1.00 143.09 ? 53  ILE D CD1 1 
ATOM   2322 N  N   . ASP D  1 13 ? -0.567  9.307   -62.999  1.00 137.46 ? 54  ASP D N   1 
ATOM   2323 C  CA  . ASP D  1 13 ? -0.614  8.135   -62.127  1.00 133.35 ? 54  ASP D CA  1 
ATOM   2324 C  C   . ASP D  1 13 ? 0.261   8.282   -60.887  1.00 132.62 ? 54  ASP D C   1 
ATOM   2325 O  O   . ASP D  1 13 ? -0.174  7.982   -59.774  1.00 133.83 ? 54  ASP D O   1 
ATOM   2326 C  CB  . ASP D  1 13 ? -0.190  6.880   -62.897  1.00 128.50 ? 54  ASP D CB  1 
ATOM   2327 C  CG  . ASP D  1 13 ? -1.304  6.317   -63.756  1.00 123.25 ? 54  ASP D CG  1 
ATOM   2328 O  OD1 . ASP D  1 13 ? -1.846  7.064   -64.596  1.00 121.34 ? 54  ASP D OD1 1 
ATOM   2329 O  OD2 . ASP D  1 13 ? -1.635  5.124   -63.591  1.00 115.36 ? 54  ASP D OD2 1 
ATOM   2330 N  N   . MET D  1 14 ? 1.495   8.734   -61.083  1.00 134.96 ? 55  MET D N   1 
ATOM   2331 C  CA  . MET D  1 14 ? 2.425   8.915   -59.975  1.00 131.68 ? 55  MET D CA  1 
ATOM   2332 C  C   . MET D  1 14 ? 1.925   9.945   -58.974  1.00 128.78 ? 55  MET D C   1 
ATOM   2333 O  O   . MET D  1 14 ? 1.984   9.722   -57.765  1.00 127.26 ? 55  MET D O   1 
ATOM   2334 C  CB  . MET D  1 14 ? 3.803   9.326   -60.497  1.00 136.05 ? 55  MET D CB  1 
ATOM   2335 C  CG  . MET D  1 14 ? 4.542   8.190   -61.175  1.00 142.35 ? 55  MET D CG  1 
ATOM   2336 S  SD  . MET D  1 14 ? 4.635   6.738   -60.099  1.00 151.41 ? 55  MET D SD  1 
ATOM   2337 C  CE  . MET D  1 14 ? 6.375   6.732   -59.680  1.00 152.99 ? 55  MET D CE  1 
ATOM   2338 N  N   . LEU D  1 15 ? 1.431   11.072  -59.479  1.00 127.75 ? 56  LEU D N   1 
ATOM   2339 C  CA  . LEU D  1 15 ? 0.921   12.124  -58.613  1.00 123.26 ? 56  LEU D CA  1 
ATOM   2340 C  C   . LEU D  1 15 ? -0.335  11.652  -57.870  1.00 123.72 ? 56  LEU D C   1 
ATOM   2341 O  O   . LEU D  1 15 ? -0.615  12.122  -56.768  1.00 126.08 ? 56  LEU D O   1 
ATOM   2342 C  CB  . LEU D  1 15 ? 0.597   13.382  -59.424  1.00 122.80 ? 56  LEU D CB  1 
ATOM   2343 C  CG  . LEU D  1 15 ? 1.587   14.188  -60.263  1.00 123.11 ? 56  LEU D CG  1 
ATOM   2344 C  CD1 . LEU D  1 15 ? 0.803   15.059  -61.234  1.00 120.78 ? 56  LEU D CD1 1 
ATOM   2345 C  CD2 . LEU D  1 15 ? 2.464   15.046  -59.373  1.00 121.82 ? 56  LEU D CD2 1 
ATOM   2346 N  N   . THR D  1 16 ? -1.103  10.742  -58.471  1.00 123.17 ? 57  THR D N   1 
ATOM   2347 C  CA  . THR D  1 16 ? -2.306  10.227  -57.812  1.00 122.80 ? 57  THR D CA  1 
ATOM   2348 C  C   . THR D  1 16 ? -1.868  9.340   -56.657  1.00 123.31 ? 57  THR D C   1 
ATOM   2349 O  O   . THR D  1 16 ? -2.495  9.326   -55.598  1.00 121.56 ? 57  THR D O   1 
ATOM   2350 C  CB  . THR D  1 16 ? -3.192  9.379   -58.760  1.00 122.56 ? 57  THR D CB  1 
ATOM   2351 O  OG1 . THR D  1 16 ? -3.804  10.226  -59.741  1.00 125.36 ? 57  THR D OG1 1 
ATOM   2352 C  CG2 . THR D  1 16 ? -4.284  8.664   -57.966  1.00 115.05 ? 57  THR D CG2 1 
ATOM   2353 N  N   . LYS D  1 17 ? -0.788  8.594   -56.872  1.00 119.63 ? 58  LYS D N   1 
ATOM   2354 C  CA  . LYS D  1 17 ? -0.258  7.715   -55.841  1.00 122.34 ? 58  LYS D CA  1 
ATOM   2355 C  C   . LYS D  1 17 ? 0.273   8.541   -54.677  1.00 125.57 ? 58  LYS D C   1 
ATOM   2356 O  O   . LYS D  1 17 ? 0.096   8.173   -53.517  1.00 128.21 ? 58  LYS D O   1 
ATOM   2357 C  CB  . LYS D  1 17 ? 0.857   6.830   -56.406  1.00 121.76 ? 58  LYS D CB  1 
ATOM   2358 C  CG  . LYS D  1 17 ? 0.353   5.727   -57.324  1.00 122.57 ? 58  LYS D CG  1 
ATOM   2359 C  CD  . LYS D  1 17 ? 1.495   4.904   -57.901  1.00 119.37 ? 58  LYS D CD  1 
ATOM   2360 C  CE  . LYS D  1 17 ? 0.976   3.852   -58.877  1.00 112.75 ? 58  LYS D CE  1 
ATOM   2361 N  NZ  . LYS D  1 17 ? 2.074   3.059   -59.502  1.00 107.37 ? 58  LYS D NZ  1 
ATOM   2362 N  N   . THR D  1 18 ? 0.919   9.662   -54.985  1.00 122.54 ? 59  THR D N   1 
ATOM   2363 C  CA  . THR D  1 18 ? 1.453   10.527  -53.941  1.00 122.61 ? 59  THR D CA  1 
ATOM   2364 C  C   . THR D  1 18 ? 0.312   11.047  -53.073  1.00 124.47 ? 59  THR D C   1 
ATOM   2365 O  O   . THR D  1 18 ? 0.412   11.062  -51.846  1.00 129.53 ? 59  THR D O   1 
ATOM   2366 C  CB  . THR D  1 18 ? 2.211   11.733  -54.532  1.00 118.31 ? 59  THR D CB  1 
ATOM   2367 O  OG1 . THR D  1 18 ? 1.322   12.510  -55.341  1.00 116.27 ? 59  THR D OG1 1 
ATOM   2368 C  CG2 . THR D  1 18 ? 3.382   11.265  -55.377  1.00 124.23 ? 59  THR D CG2 1 
ATOM   2369 N  N   . ASN D  1 19 ? -0.776  11.466  -53.713  1.00 125.83 ? 60  ASN D N   1 
ATOM   2370 C  CA  . ASN D  1 19 ? -1.929  11.986  -52.990  1.00 124.18 ? 60  ASN D CA  1 
ATOM   2371 C  C   . ASN D  1 19 ? -2.442  10.982  -51.962  1.00 124.47 ? 60  ASN D C   1 
ATOM   2372 O  O   . ASN D  1 19 ? -2.686  11.339  -50.815  1.00 124.28 ? 60  ASN D O   1 
ATOM   2373 C  CB  . ASN D  1 19 ? -3.055  12.340  -53.961  1.00 129.68 ? 60  ASN D CB  1 
ATOM   2374 C  CG  . ASN D  1 19 ? -4.245  12.968  -53.264  1.00 128.43 ? 60  ASN D CG  1 
ATOM   2375 O  OD1 . ASN D  1 19 ? -4.153  14.076  -52.733  1.00 126.51 ? 60  ASN D OD1 1 
ATOM   2376 N  ND2 . ASN D  1 19 ? -5.367  12.259  -53.255  1.00 130.02 ? 60  ASN D ND2 1 
ATOM   2377 N  N   . LEU D  1 20 ? -2.605  9.728   -52.371  1.00 121.66 ? 61  LEU D N   1 
ATOM   2378 C  CA  . LEU D  1 20 ? -3.091  8.699   -51.459  1.00 123.11 ? 61  LEU D CA  1 
ATOM   2379 C  C   . LEU D  1 20 ? -2.122  8.465   -50.304  1.00 128.84 ? 61  LEU D C   1 
ATOM   2380 O  O   . LEU D  1 20 ? -2.542  8.180   -49.180  1.00 135.24 ? 61  LEU D O   1 
ATOM   2381 C  CB  . LEU D  1 20 ? -3.329  7.386   -52.210  1.00 121.19 ? 61  LEU D CB  1 
ATOM   2382 C  CG  . LEU D  1 20 ? -4.549  7.348   -53.134  1.00 120.37 ? 61  LEU D CG  1 
ATOM   2383 C  CD1 . LEU D  1 20 ? -4.633  5.990   -53.813  1.00 117.25 ? 61  LEU D CD1 1 
ATOM   2384 C  CD2 . LEU D  1 20 ? -5.814  7.620   -52.328  1.00 116.54 ? 61  LEU D CD2 1 
ATOM   2385 N  N   . GLN D  1 21 ? -0.828  8.588   -50.585  1.00 127.63 ? 62  GLN D N   1 
ATOM   2386 C  CA  . GLN D  1 21 ? 0.203   8.396   -49.569  1.00 129.14 ? 62  GLN D CA  1 
ATOM   2387 C  C   . GLN D  1 21 ? 0.210   9.566   -48.589  1.00 129.05 ? 62  GLN D C   1 
ATOM   2388 O  O   . GLN D  1 21 ? 0.624   9.427   -47.441  1.00 133.06 ? 62  GLN D O   1 
ATOM   2389 C  CB  . GLN D  1 21 ? 1.575   8.262   -50.229  1.00 130.31 ? 62  GLN D CB  1 
ATOM   2390 C  CG  . GLN D  1 21 ? 1.732   7.025   -51.105  1.00 131.38 ? 62  GLN D CG  1 
ATOM   2391 C  CD  . GLN D  1 21 ? 1.927   5.750   -50.305  1.00 130.54 ? 62  GLN D CD  1 
ATOM   2392 O  OE1 . GLN D  1 21 ? 1.047   5.329   -49.552  1.00 132.89 ? 62  GLN D OE1 1 
ATOM   2393 N  NE2 . GLN D  1 21 ? 3.091   5.127   -50.464  1.00 128.26 ? 62  GLN D NE2 1 
ATOM   2394 N  N   . LEU D  1 22 ? -0.233  10.728  -49.051  1.00 130.28 ? 63  LEU D N   1 
ATOM   2395 C  CA  . LEU D  1 22 ? -0.298  11.894  -48.187  1.00 125.39 ? 63  LEU D CA  1 
ATOM   2396 C  C   . LEU D  1 22 ? -1.535  11.753  -47.315  1.00 123.33 ? 63  LEU D C   1 
ATOM   2397 O  O   . LEU D  1 22 ? -1.593  12.287  -46.207  1.00 121.49 ? 63  LEU D O   1 
ATOM   2398 C  CB  . LEU D  1 22 ? -0.372  13.172  -49.018  1.00 125.92 ? 63  LEU D CB  1 
ATOM   2399 C  CG  . LEU D  1 22 ? 0.960   13.901  -49.193  1.00 123.70 ? 63  LEU D CG  1 
ATOM   2400 C  CD1 . LEU D  1 22 ? 2.043   12.944  -49.661  1.00 118.94 ? 63  LEU D CD1 1 
ATOM   2401 C  CD2 . LEU D  1 22 ? 0.770   15.018  -50.181  1.00 126.58 ? 63  LEU D CD2 1 
ATOM   2402 N  N   . THR D  1 23 ? -2.528  11.028  -47.825  1.00 122.43 ? 64  THR D N   1 
ATOM   2403 C  CA  . THR D  1 23 ? -3.745  10.794  -47.067  1.00 121.38 ? 64  THR D CA  1 
ATOM   2404 C  C   . THR D  1 23 ? -3.344  9.859   -45.937  1.00 125.49 ? 64  THR D C   1 
ATOM   2405 O  O   . THR D  1 23 ? -3.958  9.864   -44.872  1.00 128.10 ? 64  THR D O   1 
ATOM   2406 C  CB  . THR D  1 23 ? -4.849  10.123  -47.913  1.00 121.62 ? 64  THR D CB  1 
ATOM   2407 O  OG1 . THR D  1 23 ? -5.170  10.955  -49.034  1.00 120.86 ? 64  THR D OG1 1 
ATOM   2408 C  CG2 . THR D  1 23 ? -6.106  9.926   -47.079  1.00 114.69 ? 64  THR D CG2 1 
ATOM   2409 N  N   . THR D  1 24 ? -2.311  9.050   -46.172  1.00 126.56 ? 65  THR D N   1 
ATOM   2410 C  CA  . THR D  1 24 ? -1.834  8.152   -45.130  1.00 130.18 ? 65  THR D CA  1 
ATOM   2411 C  C   . THR D  1 24 ? -1.356  9.091   -44.032  1.00 130.97 ? 65  THR D C   1 
ATOM   2412 O  O   . THR D  1 24 ? -1.732  8.939   -42.871  1.00 129.91 ? 65  THR D O   1 
ATOM   2413 C  CB  . THR D  1 24 ? -0.644  7.270   -45.587  1.00 130.45 ? 65  THR D CB  1 
ATOM   2414 O  OG1 . THR D  1 24 ? 0.548   8.062   -45.659  1.00 132.52 ? 65  THR D OG1 1 
ATOM   2415 C  CG2 . THR D  1 24 ? -0.930  6.643   -46.946  1.00 127.05 ? 65  THR D CG2 1 
ATOM   2416 N  N   . GLN D  1 25 ? -0.540  10.074  -44.414  1.00 131.52 ? 66  GLN D N   1 
ATOM   2417 C  CA  . GLN D  1 25 ? -0.031  11.059  -43.464  1.00 130.27 ? 66  GLN D CA  1 
ATOM   2418 C  C   . GLN D  1 25 ? -1.190  11.558  -42.616  1.00 128.08 ? 66  GLN D C   1 
ATOM   2419 O  O   . GLN D  1 25 ? -1.194  11.422  -41.394  1.00 127.37 ? 66  GLN D O   1 
ATOM   2420 C  CB  . GLN D  1 25 ? 0.580   12.264  -44.184  1.00 132.11 ? 66  GLN D CB  1 
ATOM   2421 C  CG  . GLN D  1 25 ? 1.898   12.029  -44.883  1.00 134.74 ? 66  GLN D CG  1 
ATOM   2422 C  CD  . GLN D  1 25 ? 2.637   13.331  -45.135  1.00 138.21 ? 66  GLN D CD  1 
ATOM   2423 O  OE1 . GLN D  1 25 ? 2.896   14.095  -44.207  1.00 133.19 ? 66  GLN D OE1 1 
ATOM   2424 N  NE2 . GLN D  1 25 ? 2.979   13.590  -46.392  1.00 143.23 ? 66  GLN D NE2 1 
ATOM   2425 N  N   . SER D  1 26 ? -2.178  12.136  -43.290  1.00 125.77 ? 67  SER D N   1 
ATOM   2426 C  CA  . SER D  1 26 ? -3.357  12.681  -42.635  1.00 123.37 ? 67  SER D CA  1 
ATOM   2427 C  C   . SER D  1 26 ? -4.044  11.696  -41.689  1.00 123.33 ? 67  SER D C   1 
ATOM   2428 O  O   . SER D  1 26 ? -4.152  11.956  -40.491  1.00 126.26 ? 67  SER D O   1 
ATOM   2429 C  CB  . SER D  1 26 ? -4.355  13.166  -43.692  1.00 123.57 ? 67  SER D CB  1 
ATOM   2430 O  OG  . SER D  1 26 ? -3.760  14.120  -44.558  1.00 123.51 ? 67  SER D OG  1 
ATOM   2431 N  N   . GLN D  1 27 ? -4.498  10.565  -42.225  1.00 120.97 ? 68  GLN D N   1 
ATOM   2432 C  CA  . GLN D  1 27 ? -5.197  9.558   -41.428  1.00 118.29 ? 68  GLN D CA  1 
ATOM   2433 C  C   . GLN D  1 27 ? -4.431  9.009   -40.226  1.00 116.66 ? 68  GLN D C   1 
ATOM   2434 O  O   . GLN D  1 27 ? -5.031  8.723   -39.189  1.00 115.74 ? 68  GLN D O   1 
ATOM   2435 C  CB  . GLN D  1 27 ? -5.639  8.395   -42.317  1.00 117.27 ? 68  GLN D CB  1 
ATOM   2436 C  CG  . GLN D  1 27 ? -6.639  8.786   -43.389  1.00 127.52 ? 68  GLN D CG  1 
ATOM   2437 C  CD  . GLN D  1 27 ? -7.199  7.586   -44.124  1.00 130.73 ? 68  GLN D CD  1 
ATOM   2438 O  OE1 . GLN D  1 27 ? -7.877  6.745   -43.533  1.00 133.10 ? 68  GLN D OE1 1 
ATOM   2439 N  NE2 . GLN D  1 27 ? -6.915  7.497   -45.419  1.00 133.90 ? 68  GLN D NE2 1 
ATOM   2440 N  N   . ASN D  1 28 ? -3.118  8.848   -40.356  1.00 115.83 ? 69  ASN D N   1 
ATOM   2441 C  CA  . ASN D  1 28 ? -2.329  8.338   -39.242  1.00 112.92 ? 69  ASN D CA  1 
ATOM   2442 C  C   . ASN D  1 28 ? -2.261  9.390   -38.136  1.00 114.55 ? 69  ASN D C   1 
ATOM   2443 O  O   . ASN D  1 28 ? -2.375  9.069   -36.954  1.00 118.07 ? 69  ASN D O   1 
ATOM   2444 C  CB  . ASN D  1 28 ? -0.912  7.966   -39.700  1.00 113.08 ? 69  ASN D CB  1 
ATOM   2445 C  CG  . ASN D  1 28 ? -0.112  9.164   -40.164  1.00 114.04 ? 69  ASN D CG  1 
ATOM   2446 O  OD1 . ASN D  1 28 ? 0.087   10.120  -39.418  1.00 118.35 ? 69  ASN D OD1 1 
ATOM   2447 N  ND2 . ASN D  1 28 ? 0.358   9.116   -41.402  1.00 112.00 ? 69  ASN D ND2 1 
ATOM   2448 N  N   . LEU D  1 29 ? -2.090  10.648  -38.530  1.00 110.55 ? 70  LEU D N   1 
ATOM   2449 C  CA  . LEU D  1 29 ? -2.002  11.752  -37.583  1.00 106.46 ? 70  LEU D CA  1 
ATOM   2450 C  C   . LEU D  1 29 ? -3.292  11.940  -36.793  1.00 105.30 ? 70  LEU D C   1 
ATOM   2451 O  O   . LEU D  1 29 ? -3.256  12.293  -35.618  1.00 106.07 ? 70  LEU D O   1 
ATOM   2452 C  CB  . LEU D  1 29 ? -1.650  13.044  -38.322  1.00 106.08 ? 70  LEU D CB  1 
ATOM   2453 C  CG  . LEU D  1 29 ? -0.192  13.521  -38.421  1.00 99.31  ? 70  LEU D CG  1 
ATOM   2454 C  CD1 . LEU D  1 29 ? 0.789   12.412  -38.106  1.00 104.75 ? 70  LEU D CD1 1 
ATOM   2455 C  CD2 . LEU D  1 29 ? 0.039   14.069  -39.816  1.00 103.54 ? 70  LEU D CD2 1 
ATOM   2456 N  N   . LEU D  1 30 ? -4.429  11.703  -37.436  1.00 103.81 ? 71  LEU D N   1 
ATOM   2457 C  CA  . LEU D  1 30 ? -5.709  11.856  -36.762  1.00 100.81 ? 71  LEU D CA  1 
ATOM   2458 C  C   . LEU D  1 30 ? -5.816  10.801  -35.662  1.00 100.77 ? 71  LEU D C   1 
ATOM   2459 O  O   . LEU D  1 30 ? -6.377  11.059  -34.592  1.00 101.88 ? 71  LEU D O   1 
ATOM   2460 C  CB  . LEU D  1 30 ? -6.853  11.713  -37.770  1.00 95.42  ? 71  LEU D CB  1 
ATOM   2461 C  CG  . LEU D  1 30 ? -8.013  12.709  -37.650  1.00 97.81  ? 71  LEU D CG  1 
ATOM   2462 C  CD1 . LEU D  1 30 ? -7.474  14.128  -37.495  1.00 89.94  ? 71  LEU D CD1 1 
ATOM   2463 C  CD2 . LEU D  1 30 ? -8.901  12.605  -38.884  1.00 95.04  ? 71  LEU D CD2 1 
ATOM   2464 N  N   . SER D  1 31 ? -5.262  9.619   -35.927  1.00 101.77 ? 72  SER D N   1 
ATOM   2465 C  CA  . SER D  1 31 ? -5.268  8.520   -34.961  1.00 99.05  ? 72  SER D CA  1 
ATOM   2466 C  C   . SER D  1 31 ? -4.390  8.886   -33.769  1.00 94.68  ? 72  SER D C   1 
ATOM   2467 O  O   . SER D  1 31 ? -4.745  8.637   -32.619  1.00 90.91  ? 72  SER D O   1 
ATOM   2468 C  CB  . SER D  1 31 ? -4.738  7.237   -35.606  1.00 101.24 ? 72  SER D CB  1 
ATOM   2469 O  OG  . SER D  1 31 ? -5.611  6.771   -36.620  1.00 101.71 ? 72  SER D OG  1 
ATOM   2470 N  N   . LYS D  1 32 ? -3.237  9.474   -34.065  1.00 99.42  ? 73  LYS D N   1 
ATOM   2471 C  CA  . LYS D  1 32 ? -2.291  9.896   -33.043  1.00 90.44  ? 73  LYS D CA  1 
ATOM   2472 C  C   . LYS D  1 32 ? -2.965  10.925  -32.139  1.00 94.49  ? 73  LYS D C   1 
ATOM   2473 O  O   . LYS D  1 32 ? -2.791  10.909  -30.922  1.00 97.13  ? 73  LYS D O   1 
ATOM   2474 C  CB  . LYS D  1 32 ? -1.070  10.542  -33.693  1.00 97.48  ? 73  LYS D CB  1 
ATOM   2475 C  CG  . LYS D  1 32 ? -0.400  9.743   -34.790  1.00 107.32 ? 73  LYS D CG  1 
ATOM   2476 C  CD  . LYS D  1 32 ? 0.665   8.817   -34.246  1.00 119.32 ? 73  LYS D CD  1 
ATOM   2477 C  CE  . LYS D  1 32 ? 1.363   8.096   -35.384  1.00 125.01 ? 73  LYS D CE  1 
ATOM   2478 N  NZ  . LYS D  1 32 ? 1.682   6.689   -35.022  1.00 129.43 ? 73  LYS D NZ  1 
ATOM   2479 N  N   . LEU D  1 33 ? -3.724  11.832  -32.745  1.00 87.80  ? 74  LEU D N   1 
ATOM   2480 C  CA  . LEU D  1 33 ? -4.417  12.860  -31.983  1.00 91.25  ? 74  LEU D CA  1 
ATOM   2481 C  C   . LEU D  1 33 ? -5.495  12.253  -31.106  1.00 93.86  ? 74  LEU D C   1 
ATOM   2482 O  O   . LEU D  1 33 ? -5.683  12.672  -29.966  1.00 101.98 ? 74  LEU D O   1 
ATOM   2483 C  CB  . LEU D  1 33 ? -5.051  13.902  -32.914  1.00 95.05  ? 74  LEU D CB  1 
ATOM   2484 C  CG  . LEU D  1 33 ? -4.204  15.122  -33.292  1.00 103.31 ? 74  LEU D CG  1 
ATOM   2485 C  CD1 . LEU D  1 33 ? -3.628  15.736  -32.027  1.00 105.45 ? 74  LEU D CD1 1 
ATOM   2486 C  CD2 . LEU D  1 33 ? -3.084  14.724  -34.229  1.00 109.35 ? 74  LEU D CD2 1 
ATOM   2487 N  N   . GLU D  1 34 ? -6.198  11.262  -31.638  1.00 88.55  ? 75  GLU D N   1 
ATOM   2488 C  CA  . GLU D  1 34 ? -7.265  10.616  -30.891  1.00 91.17  ? 75  GLU D CA  1 
ATOM   2489 C  C   . GLU D  1 34 ? -6.724  9.824   -29.706  1.00 96.91  ? 75  GLU D C   1 
ATOM   2490 O  O   . GLU D  1 34 ? -7.345  9.786   -28.642  1.00 100.14 ? 75  GLU D O   1 
ATOM   2491 C  CB  . GLU D  1 34 ? -8.072  9.700   -31.811  1.00 86.60  ? 75  GLU D CB  1 
ATOM   2492 C  CG  . GLU D  1 34 ? -9.401  9.278   -31.223  1.00 91.38  ? 75  GLU D CG  1 
ATOM   2493 C  CD  . GLU D  1 34 ? -10.431 8.971   -32.288  1.00 97.19  ? 75  GLU D CD  1 
ATOM   2494 O  OE1 . GLU D  1 34 ? -10.376 7.876   -32.888  1.00 94.58  ? 75  GLU D OE1 1 
ATOM   2495 O  OE2 . GLU D  1 34 ? -11.295 9.839   -32.535  1.00 96.19  ? 75  GLU D OE2 1 
ATOM   2496 N  N   . LEU D  1 35 ? -5.566  9.197   -29.885  1.00 94.59  ? 76  LEU D N   1 
ATOM   2497 C  CA  . LEU D  1 35 ? -4.968  8.426   -28.804  1.00 93.17  ? 76  LEU D CA  1 
ATOM   2498 C  C   . LEU D  1 35 ? -4.573  9.393   -27.688  1.00 90.87  ? 76  LEU D C   1 
ATOM   2499 O  O   . LEU D  1 35 ? -4.868  9.157   -26.514  1.00 79.63  ? 76  LEU D O   1 
ATOM   2500 C  CB  . LEU D  1 35 ? -3.732  7.670   -29.304  1.00 92.80  ? 76  LEU D CB  1 
ATOM   2501 C  CG  . LEU D  1 35 ? -3.341  6.396   -28.543  1.00 97.45  ? 76  LEU D CG  1 
ATOM   2502 C  CD1 . LEU D  1 35 ? -2.091  5.798   -29.175  1.00 101.62 ? 76  LEU D CD1 1 
ATOM   2503 C  CD2 . LEU D  1 35 ? -3.101  6.700   -27.069  1.00 100.78 ? 76  LEU D CD2 1 
ATOM   2504 N  N   . ALA D  1 36 ? -3.916  10.489  -28.063  1.00 84.40  ? 77  ALA D N   1 
ATOM   2505 C  CA  . ALA D  1 36 ? -3.479  11.494  -27.097  1.00 83.62  ? 77  ALA D CA  1 
ATOM   2506 C  C   . ALA D  1 36 ? -4.662  12.126  -26.370  1.00 80.68  ? 77  ALA D C   1 
ATOM   2507 O  O   . ALA D  1 36 ? -4.565  12.467  -25.194  1.00 82.33  ? 77  ALA D O   1 
ATOM   2508 C  CB  . ALA D  1 36 ? -2.662  12.573  -27.801  1.00 81.96  ? 77  ALA D CB  1 
ATOM   2509 N  N   . GLN D  1 37 ? -5.777  12.279  -27.074  1.00 80.78  ? 78  GLN D N   1 
ATOM   2510 C  CA  . GLN D  1 37 ? -6.971  12.873  -26.489  1.00 85.22  ? 78  GLN D CA  1 
ATOM   2511 C  C   . GLN D  1 37 ? -7.641  11.913  -25.509  1.00 89.81  ? 78  GLN D C   1 
ATOM   2512 O  O   . GLN D  1 37 ? -8.024  12.314  -24.412  1.00 98.19  ? 78  GLN D O   1 
ATOM   2513 C  CB  . GLN D  1 37 ? -7.947  13.274  -27.600  1.00 86.41  ? 78  GLN D CB  1 
ATOM   2514 C  CG  . GLN D  1 37 ? -9.072  14.217  -27.179  1.00 87.02  ? 78  GLN D CG  1 
ATOM   2515 C  CD  . GLN D  1 37 ? -10.222 13.503  -26.494  1.00 89.91  ? 78  GLN D CD  1 
ATOM   2516 O  OE1 . GLN D  1 37 ? -10.257 13.376  -25.269  1.00 94.53  ? 78  GLN D OE1 1 
ATOM   2517 N  NE2 . GLN D  1 37 ? -11.169 13.020  -27.290  1.00 79.18  ? 78  GLN D NE2 1 
ATOM   2518 N  N   . SER D  1 38 ? -7.787  10.650  -25.899  1.00 87.59  ? 79  SER D N   1 
ATOM   2519 C  CA  . SER D  1 38 ? -8.413  9.672   -25.014  1.00 88.20  ? 79  SER D CA  1 
ATOM   2520 C  C   . SER D  1 38 ? -7.554  9.433   -23.784  1.00 88.89  ? 79  SER D C   1 
ATOM   2521 O  O   . SER D  1 38 ? -8.054  9.055   -22.726  1.00 84.88  ? 79  SER D O   1 
ATOM   2522 C  CB  . SER D  1 38 ? -8.658  8.353   -25.747  1.00 89.74  ? 79  SER D CB  1 
ATOM   2523 O  OG  . SER D  1 38 ? -9.940  8.366   -26.356  1.00 92.34  ? 79  SER D OG  1 
ATOM   2524 N  N   . LYS D  1 39 ? -6.256  9.658   -23.933  1.00 85.63  ? 80  LYS D N   1 
ATOM   2525 C  CA  . LYS D  1 39 ? -5.315  9.496   -22.834  1.00 87.05  ? 80  LYS D CA  1 
ATOM   2526 C  C   . LYS D  1 39 ? -5.587  10.651  -21.877  1.00 87.49  ? 80  LYS D C   1 
ATOM   2527 O  O   . LYS D  1 39 ? -5.661  10.483  -20.659  1.00 88.10  ? 80  LYS D O   1 
ATOM   2528 C  CB  . LYS D  1 39 ? -3.896  9.563   -23.389  1.00 90.75  ? 80  LYS D CB  1 
ATOM   2529 C  CG  . LYS D  1 39 ? -2.787  9.348   -22.382  1.00 96.23  ? 80  LYS D CG  1 
ATOM   2530 C  CD  . LYS D  1 39 ? -1.623  8.648   -23.065  1.00 95.77  ? 80  LYS D CD  1 
ATOM   2531 C  CE  . LYS D  1 39 ? -2.094  7.308   -23.629  1.00 93.45  ? 80  LYS D CE  1 
ATOM   2532 N  NZ  . LYS D  1 39 ? -1.127  6.678   -24.564  1.00 99.09  ? 80  LYS D NZ  1 
ATOM   2533 N  N   . GLU D  1 40 ? -5.733  11.826  -22.472  1.00 81.26  ? 81  GLU D N   1 
ATOM   2534 C  CA  . GLU D  1 40 ? -6.050  13.069  -21.793  1.00 84.03  ? 81  GLU D CA  1 
ATOM   2535 C  C   . GLU D  1 40 ? -7.248  12.894  -20.858  1.00 75.13  ? 81  GLU D C   1 
ATOM   2536 O  O   . GLU D  1 40 ? -7.152  13.088  -19.645  1.00 66.63  ? 81  GLU D O   1 
ATOM   2537 C  CB  . GLU D  1 40 ? -6.403  14.098  -22.861  1.00 88.40  ? 81  GLU D CB  1 
ATOM   2538 C  CG  . GLU D  1 40 ? -6.729  15.471  -22.366  1.00 96.09  ? 81  GLU D CG  1 
ATOM   2539 C  CD  . GLU D  1 40 ? -5.490  16.301  -22.232  1.00 103.38 ? 81  GLU D CD  1 
ATOM   2540 O  OE1 . GLU D  1 40 ? -4.666  15.986  -21.347  1.00 107.09 ? 81  GLU D OE1 1 
ATOM   2541 O  OE2 . GLU D  1 40 ? -5.335  17.255  -23.023  1.00 107.39 ? 81  GLU D OE2 1 
ATOM   2542 N  N   . SER D  1 41 ? -8.382  12.532  -21.453  1.00 78.64  ? 82  SER D N   1 
ATOM   2543 C  CA  . SER D  1 41 ? -9.636  12.348  -20.730  1.00 85.91  ? 82  SER D CA  1 
ATOM   2544 C  C   . SER D  1 41 ? -9.509  11.459  -19.499  1.00 84.09  ? 82  SER D C   1 
ATOM   2545 O  O   . SER D  1 41 ? -10.156 11.706  -18.479  1.00 86.98  ? 82  SER D O   1 
ATOM   2546 C  CB  . SER D  1 41 ? -10.705 11.773  -21.665  1.00 87.40  ? 82  SER D CB  1 
ATOM   2547 O  OG  . SER D  1 41 ? -12.007 12.078  -21.190  1.00 87.17  ? 82  SER D OG  1 
ATOM   2548 N  N   . LYS D  1 42 ? -8.684  10.421  -19.600  1.00 83.71  ? 83  LYS D N   1 
ATOM   2549 C  CA  . LYS D  1 42 ? -8.475  9.513   -18.480  1.00 83.51  ? 83  LYS D CA  1 
ATOM   2550 C  C   . LYS D  1 42 ? -7.635  10.164  -17.383  1.00 82.55  ? 83  LYS D C   1 
ATOM   2551 O  O   . LYS D  1 42 ? -7.907  9.968   -16.201  1.00 84.87  ? 83  LYS D O   1 
ATOM   2552 C  CB  . LYS D  1 42 ? -7.824  8.206   -18.955  1.00 88.71  ? 83  LYS D CB  1 
ATOM   2553 C  CG  . LYS D  1 42 ? -8.824  7.052   -19.113  1.00 80.76  ? 83  LYS D CG  1 
ATOM   2554 C  CD  . LYS D  1 42 ? -9.317  6.576   -17.748  1.00 80.25  ? 83  LYS D CD  1 
ATOM   2555 C  CE  . LYS D  1 42 ? -10.608 5.781   -17.861  1.00 87.62  ? 83  LYS D CE  1 
ATOM   2556 N  NZ  . LYS D  1 42 ? -11.043 5.257   -16.537  1.00 88.39  ? 83  LYS D NZ  1 
ATOM   2557 N  N   . LEU D  1 43 ? -6.623  10.942  -17.752  1.00 75.57  ? 84  LEU D N   1 
ATOM   2558 C  CA  . LEU D  1 43 ? -5.827  11.594  -16.724  1.00 69.96  ? 84  LEU D CA  1 
ATOM   2559 C  C   . LEU D  1 43 ? -6.727  12.553  -15.966  1.00 70.76  ? 84  LEU D C   1 
ATOM   2560 O  O   . LEU D  1 43 ? -6.747  12.547  -14.743  1.00 78.72  ? 84  LEU D O   1 
ATOM   2561 C  CB  . LEU D  1 43 ? -4.657  12.358  -17.328  1.00 65.10  ? 84  LEU D CB  1 
ATOM   2562 C  CG  . LEU D  1 43 ? -3.298  11.842  -16.872  1.00 71.06  ? 84  LEU D CG  1 
ATOM   2563 C  CD1 . LEU D  1 43 ? -2.572  11.284  -18.075  1.00 75.44  ? 84  LEU D CD1 1 
ATOM   2564 C  CD2 . LEU D  1 43 ? -2.496  12.952  -16.227  1.00 83.55  ? 84  LEU D CD2 1 
ATOM   2565 N  N   . LEU D  1 44 ? -7.480  13.371  -16.692  1.00 68.02  ? 85  LEU D N   1 
ATOM   2566 C  CA  . LEU D  1 44 ? -8.383  14.318  -16.050  1.00 67.27  ? 85  LEU D CA  1 
ATOM   2567 C  C   . LEU D  1 44 ? -9.284  13.592  -15.062  1.00 62.46  ? 85  LEU D C   1 
ATOM   2568 O  O   . LEU D  1 44 ? -9.417  14.000  -13.910  1.00 69.91  ? 85  LEU D O   1 
ATOM   2569 C  CB  . LEU D  1 44 ? -9.247  15.024  -17.095  1.00 72.97  ? 85  LEU D CB  1 
ATOM   2570 C  CG  . LEU D  1 44 ? -8.675  16.197  -17.894  1.00 82.23  ? 85  LEU D CG  1 
ATOM   2571 C  CD1 . LEU D  1 44 ? -7.154  16.088  -18.058  1.00 69.71  ? 85  LEU D CD1 1 
ATOM   2572 C  CD2 . LEU D  1 44 ? -9.387  16.221  -19.240  1.00 89.29  ? 85  LEU D CD2 1 
ATOM   2573 N  N   . GLU D  1 45 ? -9.902  12.512  -15.527  1.00 58.71  ? 86  GLU D N   1 
ATOM   2574 C  CA  . GLU D  1 45 ? -10.797 11.716  -14.699  1.00 62.97  ? 86  GLU D CA  1 
ATOM   2575 C  C   . GLU D  1 45 ? -10.065 11.190  -13.465  1.00 59.25  ? 86  GLU D C   1 
ATOM   2576 O  O   . GLU D  1 45 ? -10.609 11.192  -12.365  1.00 59.69  ? 86  GLU D O   1 
ATOM   2577 C  CB  . GLU D  1 45 ? -11.343 10.532  -15.503  1.00 64.98  ? 86  GLU D CB  1 
ATOM   2578 C  CG  . GLU D  1 45 ? -12.839 10.275  -15.340  1.00 85.66  ? 86  GLU D CG  1 
ATOM   2579 C  CD  . GLU D  1 45 ? -13.210 8.806   -15.521  1.00 99.40  ? 86  GLU D CD  1 
ATOM   2580 O  OE1 . GLU D  1 45 ? -13.276 8.078   -14.506  1.00 101.34 ? 86  GLU D OE1 1 
ATOM   2581 O  OE2 . GLU D  1 45 ? -13.426 8.374   -16.675  1.00 108.87 ? 86  GLU D OE2 1 
ATOM   2582 N  N   . ASN D  1 46 ? -8.829  10.734  -13.649  1.00 60.87  ? 87  ASN D N   1 
ATOM   2583 C  CA  . ASN D  1 46 ? -8.060  10.206  -12.532  1.00 54.72  ? 87  ASN D CA  1 
ATOM   2584 C  C   . ASN D  1 46 ? -7.621  11.326  -11.607  1.00 52.55  ? 87  ASN D C   1 
ATOM   2585 O  O   . ASN D  1 46 ? -7.765  11.228  -10.388  1.00 50.83  ? 87  ASN D O   1 
ATOM   2586 C  CB  . ASN D  1 46 ? -6.839  9.439   -13.039  1.00 57.60  ? 87  ASN D CB  1 
ATOM   2587 C  CG  . ASN D  1 46 ? -7.219  8.200   -13.816  1.00 67.99  ? 87  ASN D CG  1 
ATOM   2588 O  OD1 . ASN D  1 46 ? -7.908  7.326   -13.301  1.00 70.74  ? 87  ASN D OD1 1 
ATOM   2589 N  ND2 . ASN D  1 46 ? -6.775  8.119   -15.065  1.00 62.82  ? 87  ASN D ND2 1 
ATOM   2590 N  N   . LEU D  1 47 ? -7.095  12.396  -12.191  1.00 52.43  ? 88  LEU D N   1 
ATOM   2591 C  CA  . LEU D  1 47 ? -6.629  13.532  -11.415  1.00 50.35  ? 88  LEU D CA  1 
ATOM   2592 C  C   . LEU D  1 47 ? -7.732  14.177  -10.594  1.00 54.16  ? 88  LEU D C   1 
ATOM   2593 O  O   . LEU D  1 47 ? -7.496  14.632  -9.479   1.00 52.96  ? 88  LEU D O   1 
ATOM   2594 C  CB  . LEU D  1 47 ? -5.994  14.576  -12.332  1.00 48.96  ? 88  LEU D CB  1 
ATOM   2595 C  CG  . LEU D  1 47 ? -4.565  14.329  -12.822  1.00 50.28  ? 88  LEU D CG  1 
ATOM   2596 C  CD1 . LEU D  1 47 ? -4.174  15.446  -13.774  1.00 59.25  ? 88  LEU D CD1 1 
ATOM   2597 C  CD2 . LEU D  1 47 ? -3.602  14.278  -11.649  1.00 46.70  ? 88  LEU D CD2 1 
ATOM   2598 N  N   . ASN D  1 48 ? -8.942  14.220  -11.129  1.00 54.84  ? 89  ASN D N   1 
ATOM   2599 C  CA  . ASN D  1 48 ? -10.022 14.830  -10.370  1.00 60.91  ? 89  ASN D CA  1 
ATOM   2600 C  C   . ASN D  1 48 ? -10.476 13.969  -9.213   1.00 57.19  ? 89  ASN D C   1 
ATOM   2601 O  O   . ASN D  1 48 ? -10.755 14.483  -8.134   1.00 62.66  ? 89  ASN D O   1 
ATOM   2602 C  CB  . ASN D  1 48 ? -11.208 15.148  -11.266  1.00 59.45  ? 89  ASN D CB  1 
ATOM   2603 C  CG  . ASN D  1 48 ? -10.924 16.301  -12.188  1.00 70.74  ? 89  ASN D CG  1 
ATOM   2604 O  OD1 . ASN D  1 48 ? -10.236 17.253  -11.812  1.00 71.24  ? 89  ASN D OD1 1 
ATOM   2605 N  ND2 . ASN D  1 48 ? -11.455 16.237  -13.397  1.00 78.64  ? 89  ASN D ND2 1 
ATOM   2606 N  N   . LEU D  1 49 ? -10.557 12.661  -9.431   1.00 52.99  ? 90  LEU D N   1 
ATOM   2607 C  CA  . LEU D  1 49 ? -10.972 11.755  -8.366   1.00 50.61  ? 90  LEU D CA  1 
ATOM   2608 C  C   . LEU D  1 49 ? -9.987  11.890  -7.224   1.00 53.77  ? 90  LEU D C   1 
ATOM   2609 O  O   . LEU D  1 49 ? -10.366 11.901  -6.058   1.00 51.29  ? 90  LEU D O   1 
ATOM   2610 C  CB  . LEU D  1 49 ? -10.974 10.314  -8.861   1.00 57.46  ? 90  LEU D CB  1 
ATOM   2611 C  CG  . LEU D  1 49 ? -12.014 9.962   -9.919   1.00 55.67  ? 90  LEU D CG  1 
ATOM   2612 C  CD1 . LEU D  1 49 ? -11.758 8.557   -10.412  1.00 60.60  ? 90  LEU D CD1 1 
ATOM   2613 C  CD2 . LEU D  1 49 ? -13.414 10.091  -9.330   1.00 52.35  ? 90  LEU D CD2 1 
ATOM   2614 N  N   . LEU D  1 50 ? -8.713  11.991  -7.581   1.00 52.65  ? 91  LEU D N   1 
ATOM   2615 C  CA  . LEU D  1 50 ? -7.657  12.134  -6.602   1.00 45.93  ? 91  LEU D CA  1 
ATOM   2616 C  C   . LEU D  1 50 ? -7.884  13.422  -5.823   1.00 48.82  ? 91  LEU D C   1 
ATOM   2617 O  O   . LEU D  1 50 ? -7.836  13.427  -4.591   1.00 51.95  ? 91  LEU D O   1 
ATOM   2618 C  CB  . LEU D  1 50 ? -6.299  12.163  -7.310   1.00 42.78  ? 91  LEU D CB  1 
ATOM   2619 C  CG  . LEU D  1 50 ? -5.312  11.077  -6.872   1.00 62.25  ? 91  LEU D CG  1 
ATOM   2620 C  CD1 . LEU D  1 50 ? -6.026  9.734   -6.702   1.00 59.82  ? 91  LEU D CD1 1 
ATOM   2621 C  CD2 . LEU D  1 50 ? -4.203  10.966  -7.898   1.00 59.05  ? 91  LEU D CD2 1 
ATOM   2622 N  N   . LYS D  1 51 ? -8.147  14.508  -6.544   1.00 52.60  ? 92  LYS D N   1 
ATOM   2623 C  CA  . LYS D  1 51 ? -8.387  15.798  -5.911   1.00 52.39  ? 92  LYS D CA  1 
ATOM   2624 C  C   . LYS D  1 51 ? -9.504  15.686  -4.895   1.00 42.09  ? 92  LYS D C   1 
ATOM   2625 O  O   . LYS D  1 51 ? -9.331  16.076  -3.741   1.00 43.82  ? 92  LYS D O   1 
ATOM   2626 C  CB  . LYS D  1 51 ? -8.737  16.858  -6.957   1.00 65.56  ? 92  LYS D CB  1 
ATOM   2627 C  CG  . LYS D  1 51 ? -7.531  17.366  -7.728   1.00 66.59  ? 92  LYS D CG  1 
ATOM   2628 C  CD  . LYS D  1 51 ? -7.933  18.273  -8.887   1.00 71.40  ? 92  LYS D CD  1 
ATOM   2629 C  CE  . LYS D  1 51 ? -8.750  19.469  -8.419   1.00 74.21  ? 92  LYS D CE  1 
ATOM   2630 N  NZ  . LYS D  1 51 ? -8.900  20.484  -9.504   1.00 91.01  ? 92  LYS D NZ  1 
ATOM   2631 N  N   . ASN D  1 52 ? -10.646 15.149  -5.314   1.00 43.52  ? 93  ASN D N   1 
ATOM   2632 C  CA  . ASN D  1 52 ? -11.761 15.003  -4.393   1.00 42.82  ? 93  ASN D CA  1 
ATOM   2633 C  C   . ASN D  1 52 ? -11.304 14.190  -3.179   1.00 38.83  ? 93  ASN D C   1 
ATOM   2634 O  O   . ASN D  1 52 ? -11.641 14.525  -2.044   1.00 46.49  ? 93  ASN D O   1 
ATOM   2635 C  CB  . ASN D  1 52 ? -12.960 14.313  -5.068   1.00 49.01  ? 93  ASN D CB  1 
ATOM   2636 C  CG  . ASN D  1 52 ? -13.549 15.129  -6.222   1.00 67.22  ? 93  ASN D CG  1 
ATOM   2637 O  OD1 . ASN D  1 52 ? -13.576 16.359  -6.184   1.00 73.64  ? 93  ASN D OD1 1 
ATOM   2638 N  ND2 . ASN D  1 52 ? -14.043 14.436  -7.242   1.00 65.34  ? 93  ASN D ND2 1 
ATOM   2639 N  N   . GLU D  1 53 ? -10.526 13.133  -3.423   1.00 44.17  ? 94  GLU D N   1 
ATOM   2640 C  CA  . GLU D  1 53 ? -10.024 12.271  -2.350   1.00 38.57  ? 94  GLU D CA  1 
ATOM   2641 C  C   . GLU D  1 53 ? -9.051  13.034  -1.446   1.00 42.76  ? 94  GLU D C   1 
ATOM   2642 O  O   . GLU D  1 53 ? -9.089  12.900  -0.223   1.00 40.92  ? 94  GLU D O   1 
ATOM   2643 C  CB  . GLU D  1 53 ? -9.306  11.041  -2.933   1.00 61.76  ? 94  GLU D CB  1 
ATOM   2644 C  CG  . GLU D  1 53 ? -10.171 10.126  -3.808   1.00 69.13  ? 94  GLU D CG  1 
ATOM   2645 C  CD  . GLU D  1 53 ? -9.441  8.849   -4.247   1.00 78.81  ? 94  GLU D CD  1 
ATOM   2646 O  OE1 . GLU D  1 53 ? -8.201  8.884   -4.385   1.00 88.88  ? 94  GLU D OE1 1 
ATOM   2647 O  OE2 . GLU D  1 53 ? -10.103 7.812   -4.472   1.00 67.87  ? 94  GLU D OE2 1 
ATOM   2648 N  N   . ASN D  1 54 ? -8.170  13.816  -2.068   1.00 38.25  ? 95  ASN D N   1 
ATOM   2649 C  CA  . ASN D  1 54 ? -7.170  14.614  -1.365   1.00 36.42  ? 95  ASN D CA  1 
ATOM   2650 C  C   . ASN D  1 54 ? -7.889  15.650  -0.504   1.00 32.80  ? 95  ASN D C   1 
ATOM   2651 O  O   . ASN D  1 54 ? -7.473  15.951  0.618    1.00 35.34  ? 95  ASN D O   1 
ATOM   2652 C  CB  . ASN D  1 54 ? -6.270  15.312  -2.391   1.00 51.06  ? 95  ASN D CB  1 
ATOM   2653 C  CG  . ASN D  1 54 ? -4.974  15.837  -1.789   1.00 65.16  ? 95  ASN D CG  1 
ATOM   2654 O  OD1 . ASN D  1 54 ? -4.965  16.828  -1.059   1.00 74.03  ? 95  ASN D OD1 1 
ATOM   2655 N  ND2 . ASN D  1 54 ? -3.868  15.174  -2.105   1.00 76.45  ? 95  ASN D ND2 1 
ATOM   2656 N  N   . GLU D  1 55 ? -8.984  16.187  -1.030   1.00 41.30  ? 96  GLU D N   1 
ATOM   2657 C  CA  . GLU D  1 55 ? -9.758  17.195  -0.312   1.00 42.39  ? 96  GLU D CA  1 
ATOM   2658 C  C   . GLU D  1 55 ? -10.387 16.629  0.956    1.00 39.17  ? 96  GLU D C   1 
ATOM   2659 O  O   . GLU D  1 55 ? -10.381 17.277  2.003    1.00 36.57  ? 96  GLU D O   1 
ATOM   2660 C  CB  . GLU D  1 55 ? -10.859 17.763  -1.215   1.00 37.03  ? 96  GLU D CB  1 
ATOM   2661 C  CG  . GLU D  1 55 ? -11.681 18.835  -0.549   1.00 37.07  ? 96  GLU D CG  1 
ATOM   2662 C  CD  . GLU D  1 55 ? -10.819 19.955  -0.002   1.00 53.96  ? 96  GLU D CD  1 
ATOM   2663 O  OE1 . GLU D  1 55 ? -10.111 20.598  -0.805   1.00 58.65  ? 96  GLU D OE1 1 
ATOM   2664 O  OE2 . GLU D  1 55 ? -10.844 20.191  1.228    1.00 47.54  ? 96  GLU D OE2 1 
ATOM   2665 N  N   . ASN D  1 56 ? -10.931 15.420  0.858    1.00 38.20  ? 97  ASN D N   1 
ATOM   2666 C  CA  . ASN D  1 56 ? -11.563 14.791  2.012    1.00 30.89  ? 97  ASN D CA  1 
ATOM   2667 C  C   . ASN D  1 56 ? -10.542 14.579  3.111    1.00 26.25  ? 97  ASN D C   1 
ATOM   2668 O  O   . ASN D  1 56 ? -10.830 14.809  4.286    1.00 29.83  ? 97  ASN D O   1 
ATOM   2669 C  CB  . ASN D  1 56 ? -12.200 13.456  1.612    1.00 38.62  ? 97  ASN D CB  1 
ATOM   2670 C  CG  . ASN D  1 56 ? -13.050 12.859  2.724    1.00 58.38  ? 97  ASN D CG  1 
ATOM   2671 O  OD1 . ASN D  1 56 ? -13.778 13.574  3.418    1.00 61.33  ? 97  ASN D OD1 1 
ATOM   2672 N  ND2 . ASN D  1 56 ? -12.974 11.545  2.890    1.00 50.16  ? 97  ASN D ND2 1 
ATOM   2673 N  N   . LEU D  1 57 ? -9.336  14.162  2.731    1.00 29.51  ? 98  LEU D N   1 
ATOM   2674 C  CA  . LEU D  1 57 ? -8.278  13.926  3.708    1.00 21.86  ? 98  LEU D CA  1 
ATOM   2675 C  C   . LEU D  1 57 ? -7.796  15.211  4.417    1.00 17.63  ? 98  LEU D C   1 
ATOM   2676 O  O   . LEU D  1 57 ? -7.520  15.221  5.627    1.00 24.47  ? 98  LEU D O   1 
ATOM   2677 C  CB  . LEU D  1 57 ? -7.106  13.210  3.035    1.00 20.57  ? 98  LEU D CB  1 
ATOM   2678 C  CG  . LEU D  1 57 ? -7.377  11.804  2.488    1.00 32.85  ? 98  LEU D CG  1 
ATOM   2679 C  CD1 . LEU D  1 57 ? -6.099  11.244  1.900    1.00 20.42  ? 98  LEU D CD1 1 
ATOM   2680 C  CD2 . LEU D  1 57 ? -7.858  10.888  3.587    1.00 20.89  ? 98  LEU D CD2 1 
ATOM   2681 N  N   . ASN D  1 58 ? -7.694  16.298  3.672    1.00 28.33  ? 99  ASN D N   1 
ATOM   2682 C  CA  . ASN D  1 58 ? -7.269  17.548  4.275    1.00 18.41  ? 99  ASN D CA  1 
ATOM   2683 C  C   . ASN D  1 58 ? -8.311  18.002  5.278    1.00 9.50   ? 99  ASN D C   1 
ATOM   2684 O  O   . ASN D  1 58 ? -7.975  18.546  6.327    1.00 34.67  ? 99  ASN D O   1 
ATOM   2685 C  CB  . ASN D  1 58 ? -7.059  18.608  3.198    1.00 38.13  ? 99  ASN D CB  1 
ATOM   2686 C  CG  . ASN D  1 58 ? -5.806  18.357  2.390    1.00 37.70  ? 99  ASN D CG  1 
ATOM   2687 O  OD1 . ASN D  1 58 ? -4.958  17.562  2.789    1.00 30.39  ? 99  ASN D OD1 1 
ATOM   2688 N  ND2 . ASN D  1 58 ? -5.673  19.042  1.261    1.00 24.09  ? 99  ASN D ND2 1 
ATOM   2689 N  N   . SER D  1 59 ? -9.584  17.765  4.973    1.00 19.17  ? 100 SER D N   1 
ATOM   2690 C  CA  . SER D  1 59 ? -10.659 18.153  5.886    1.00 18.53  ? 100 SER D CA  1 
ATOM   2691 C  C   . SER D  1 59 ? -10.591 17.336  7.161    1.00 26.09  ? 100 SER D C   1 
ATOM   2692 O  O   . SER D  1 59 ? -10.725 17.864  8.272    1.00 27.23  ? 100 SER D O   1 
ATOM   2693 C  CB  . SER D  1 59 ? -12.033 17.941  5.242    1.00 22.32  ? 100 SER D CB  1 
ATOM   2694 O  OG  . SER D  1 59 ? -12.187 18.728  4.079    1.00 48.06  ? 100 SER D OG  1 
ATOM   2695 N  N   . ILE D  1 60 ? -10.402 16.032  7.003    1.00 25.47  ? 101 ILE D N   1 
ATOM   2696 C  CA  . ILE D  1 60 ? -10.303 15.162  8.163    1.00 9.38   ? 101 ILE D CA  1 
ATOM   2697 C  C   . ILE D  1 60 ? -9.131  15.635  9.020    1.00 9.74   ? 101 ILE D C   1 
ATOM   2698 O  O   . ILE D  1 60 ? -9.258  15.790  10.225   1.00 14.81  ? 101 ILE D O   1 
ATOM   2699 C  CB  . ILE D  1 60 ? -10.069 13.693  7.724    1.00 22.01  ? 101 ILE D CB  1 
ATOM   2700 C  CG1 . ILE D  1 60 ? -11.276 13.188  6.912    1.00 11.25  ? 101 ILE D CG1 1 
ATOM   2701 C  CG2 . ILE D  1 60 ? -9.829  12.845  8.943    1.00 14.31  ? 101 ILE D CG2 1 
ATOM   2702 C  CD1 . ILE D  1 60 ? -11.116 11.787  6.353    1.00 32.15  ? 101 ILE D CD1 1 
ATOM   2703 N  N   . PHE D  1 61 ? -7.990  15.884  8.381    1.00 15.78  ? 102 PHE D N   1 
ATOM   2704 C  CA  . PHE D  1 61 ? -6.793  16.351  9.087    1.00 22.81  ? 102 PHE D CA  1 
ATOM   2705 C  C   . PHE D  1 61 ? -7.101  17.625  9.893    1.00 19.22  ? 102 PHE D C   1 
ATOM   2706 O  O   . PHE D  1 61 ? -6.706  17.752  11.047   1.00 28.78  ? 102 PHE D O   1 
ATOM   2707 C  CB  . PHE D  1 61 ? -5.669  16.631  8.081    1.00 21.60  ? 102 PHE D CB  1 
ATOM   2708 C  CG  . PHE D  1 61 ? -4.292  16.581  8.681    1.00 20.17  ? 102 PHE D CG  1 
ATOM   2709 C  CD1 . PHE D  1 61 ? -4.103  16.749  10.061   1.00 8.79   ? 102 PHE D CD1 1 
ATOM   2710 C  CD2 . PHE D  1 61 ? -3.179  16.375  7.871    1.00 30.50  ? 102 PHE D CD2 1 
ATOM   2711 C  CE1 . PHE D  1 61 ? -2.822  16.706  10.615   1.00 27.86  ? 102 PHE D CE1 1 
ATOM   2712 C  CE2 . PHE D  1 61 ? -1.894  16.331  8.416    1.00 19.10  ? 102 PHE D CE2 1 
ATOM   2713 C  CZ  . PHE D  1 61 ? -1.712  16.499  9.787    1.00 7.91   ? 102 PHE D CZ  1 
ATOM   2714 N  N   . GLU D  1 62 ? -7.811  18.564  9.281    1.00 26.25  ? 103 GLU D N   1 
ATOM   2715 C  CA  . GLU D  1 62 ? -8.174  19.806  9.969    1.00 24.70  ? 103 GLU D CA  1 
ATOM   2716 C  C   . GLU D  1 62 ? -9.061  19.554  11.187   1.00 20.95  ? 103 GLU D C   1 
ATOM   2717 O  O   . GLU D  1 62 ? -8.953  20.257  12.191   1.00 39.78  ? 103 GLU D O   1 
ATOM   2718 C  CB  . GLU D  1 62 ? -8.859  20.776  8.995    1.00 19.09  ? 103 GLU D CB  1 
ATOM   2719 C  CG  . GLU D  1 62 ? -7.886  21.411  8.008    1.00 22.36  ? 103 GLU D CG  1 
ATOM   2720 C  CD  . GLU D  1 62 ? -8.586  22.068  6.837    1.00 55.23  ? 103 GLU D CD  1 
ATOM   2721 O  OE1 . GLU D  1 62 ? -9.209  21.341  6.025    1.00 47.21  ? 103 GLU D OE1 1 
ATOM   2722 O  OE2 . GLU D  1 62 ? -8.512  23.313  6.732    1.00 60.00  ? 103 GLU D OE2 1 
ATOM   2723 N  N   . ARG D  1 63 ? -9.931  18.552  11.116   1.00 27.26  ? 104 ARG D N   1 
ATOM   2724 C  CA  . ARG D  1 63 ? -10.783 18.233  12.263   1.00 33.95  ? 104 ARG D CA  1 
ATOM   2725 C  C   . ARG D  1 63 ? -9.974  17.607  13.405   1.00 32.41  ? 104 ARG D C   1 
ATOM   2726 O  O   . ARG D  1 63 ? -10.146 17.984  14.558   1.00 34.08  ? 104 ARG D O   1 
ATOM   2727 C  CB  . ARG D  1 63 ? -11.898 17.249  11.890   1.00 35.20  ? 104 ARG D CB  1 
ATOM   2728 C  CG  . ARG D  1 63 ? -13.178 17.857  11.344   1.00 50.47  ? 104 ARG D CG  1 
ATOM   2729 C  CD  . ARG D  1 63 ? -14.300 16.809  11.294   1.00 50.67  ? 104 ARG D CD  1 
ATOM   2730 N  NE  . ARG D  1 63 ? -14.076 15.755  10.301   1.00 41.70  ? 104 ARG D NE  1 
ATOM   2731 C  CZ  . ARG D  1 63 ? -13.914 14.463  10.589   1.00 34.36  ? 104 ARG D CZ  1 
ATOM   2732 N  NH1 . ARG D  1 63 ? -13.944 14.039  11.843   1.00 42.58  ? 104 ARG D NH1 1 
ATOM   2733 N  NH2 . ARG D  1 63 ? -13.734 13.587  9.615    1.00 27.62  ? 104 ARG D NH2 1 
ATOM   2734 N  N   . LYS D  1 64 ? -9.103  16.647  13.096   1.00 33.17  ? 105 LYS D N   1 
ATOM   2735 C  CA  . LYS D  1 64 ? -8.313  15.989  14.148   1.00 32.66  ? 105 LYS D CA  1 
ATOM   2736 C  C   . LYS D  1 64 ? -7.388  16.959  14.877   1.00 10.68  ? 105 LYS D C   1 
ATOM   2737 O  O   . LYS D  1 64 ? -7.087  16.777  16.060   1.00 28.13  ? 105 LYS D O   1 
ATOM   2738 C  CB  . LYS D  1 64 ? -7.482  14.843  13.560   1.00 22.28  ? 105 LYS D CB  1 
ATOM   2739 C  CG  . LYS D  1 64 ? -8.320  13.809  12.829   1.00 17.62  ? 105 LYS D CG  1 
ATOM   2740 C  CD  . LYS D  1 64 ? -9.422  13.260  13.718   1.00 28.96  ? 105 LYS D CD  1 
ATOM   2741 C  CE  . LYS D  1 64 ? -10.333 12.328  12.926   1.00 26.80  ? 105 LYS D CE  1 
ATOM   2742 N  NZ  . LYS D  1 64 ? -11.423 11.741  13.779   1.00 25.68  ? 105 LYS D NZ  1 
ATOM   2743 N  N   . ASN D  1 65 ? -6.929  17.984  14.163   1.00 22.87  ? 106 ASN D N   1 
ATOM   2744 C  CA  . ASN D  1 65 ? -6.058  18.992  14.761   1.00 23.14  ? 106 ASN D CA  1 
ATOM   2745 C  C   . ASN D  1 65 ? -6.802  19.842  15.794   1.00 19.21  ? 106 ASN D C   1 
ATOM   2746 O  O   . ASN D  1 65 ? -6.253  20.137  16.862   1.00 31.28  ? 106 ASN D O   1 
ATOM   2747 C  CB  . ASN D  1 65 ? -5.412  19.858  13.665   1.00 17.91  ? 106 ASN D CB  1 
ATOM   2748 C  CG  . ASN D  1 65 ? -4.305  19.103  12.910   1.00 33.27  ? 106 ASN D CG  1 
ATOM   2749 O  OD1 . ASN D  1 65 ? -3.807  18.074  13.389   1.00 23.07  ? 106 ASN D OD1 1 
ATOM   2750 N  ND2 . ASN D  1 65 ? -3.914  19.610  11.745   1.00 16.79  ? 106 ASN D ND2 1 
ATOM   2751 N  N   . LYS D  1 66 ? -8.054  20.205  15.508   1.00 24.05  ? 107 LYS D N   1 
ATOM   2752 C  CA  . LYS D  1 66 ? -8.855  20.986  16.459   1.00 19.54  ? 107 LYS D CA  1 
ATOM   2753 C  C   . LYS D  1 66 ? -9.013  20.200  17.752   1.00 11.22  ? 107 LYS D C   1 
ATOM   2754 O  O   . LYS D  1 66 ? -8.951  20.752  18.848   1.00 23.20  ? 107 LYS D O   1 
ATOM   2755 C  CB  . LYS D  1 66 ? -10.259 21.280  15.909   1.00 29.23  ? 107 LYS D CB  1 
ATOM   2756 C  CG  . LYS D  1 66 ? -10.306 22.286  14.783   1.00 34.37  ? 107 LYS D CG  1 
ATOM   2757 C  CD  . LYS D  1 66 ? -11.744 22.652  14.438   1.00 53.84  ? 107 LYS D CD  1 
ATOM   2758 C  CE  . LYS D  1 66 ? -11.804 23.463  13.154   1.00 68.22  ? 107 LYS D CE  1 
ATOM   2759 N  NZ  . LYS D  1 66 ? -13.201 23.800  12.769   1.00 74.62  ? 107 LYS D NZ  1 
ATOM   2760 N  N   . LYS D  1 67 ? -9.222  18.894  17.626   1.00 31.65  ? 108 LYS D N   1 
ATOM   2761 C  CA  . LYS D  1 67 ? -9.374  18.052  18.807   1.00 10.85  ? 108 LYS D CA  1 
ATOM   2762 C  C   . LYS D  1 67 ? -8.095  18.017  19.653   1.00 19.85  ? 108 LYS D C   1 
ATOM   2763 O  O   . LYS D  1 67 ? -8.155  18.118  20.884   1.00 22.10  ? 108 LYS D O   1 
ATOM   2764 C  CB  . LYS D  1 67 ? -9.774  16.639  18.391   1.00 36.18  ? 108 LYS D CB  1 
ATOM   2765 C  CG  . LYS D  1 67 ? -11.114 16.587  17.706   1.00 40.89  ? 108 LYS D CG  1 
ATOM   2766 C  CD  . LYS D  1 67 ? -11.725 15.223  17.876   1.00 59.51  ? 108 LYS D CD  1 
ATOM   2767 C  CE  . LYS D  1 67 ? -13.159 15.197  17.397   1.00 69.34  ? 108 LYS D CE  1 
ATOM   2768 N  NZ  . LYS D  1 67 ? -13.767 13.864  17.682   1.00 74.90  ? 108 LYS D NZ  1 
ATOM   2769 N  N   . LEU D  1 68 ? -6.945  17.874  18.994   1.00 21.87  ? 109 LEU D N   1 
ATOM   2770 C  CA  . LEU D  1 68 ? -5.657  17.853  19.702   1.00 18.39  ? 109 LEU D CA  1 
ATOM   2771 C  C   . LEU D  1 68 ? -5.439  19.192  20.418   1.00 18.30  ? 109 LEU D C   1 
ATOM   2772 O  O   . LEU D  1 68 ? -5.099  19.222  21.597   1.00 21.11  ? 109 LEU D O   1 
ATOM   2773 C  CB  . LEU D  1 68 ? -4.515  17.607  18.705   1.00 19.35  ? 109 LEU D CB  1 
ATOM   2774 C  CG  . LEU D  1 68 ? -3.101  17.518  19.275   1.00 22.77  ? 109 LEU D CG  1 
ATOM   2775 C  CD1 . LEU D  1 68 ? -3.052  16.530  20.409   1.00 37.76  ? 109 LEU D CD1 1 
ATOM   2776 C  CD2 . LEU D  1 68 ? -2.141  17.091  18.163   1.00 31.11  ? 109 LEU D CD2 1 
ATOM   2777 N  N   . LYS D  1 69 ? -5.638  20.299  19.699   1.00 15.81  ? 110 LYS D N   1 
ATOM   2778 C  CA  . LYS D  1 69 ? -5.484  21.618  20.302   1.00 22.39  ? 110 LYS D CA  1 
ATOM   2779 C  C   . LYS D  1 69 ? -6.366  21.640  21.547   1.00 20.24  ? 110 LYS D C   1 
ATOM   2780 O  O   . LYS D  1 69 ? -5.961  22.081  22.624   1.00 32.78  ? 110 LYS D O   1 
ATOM   2781 C  CB  . LYS D  1 69 ? -5.905  22.718  19.312   1.00 31.31  ? 110 LYS D CB  1 
ATOM   2782 C  CG  . LYS D  1 69 ? -4.913  22.908  18.148   1.00 28.60  ? 110 LYS D CG  1 
ATOM   2783 C  CD  . LYS D  1 69 ? -5.239  24.123  17.283   1.00 48.28  ? 110 LYS D CD  1 
ATOM   2784 C  CE  . LYS D  1 69 ? -4.251  24.280  16.121   1.00 50.31  ? 110 LYS D CE  1 
ATOM   2785 N  NZ  . LYS D  1 69 ? -2.847  24.522  16.568   1.00 47.71  ? 110 LYS D NZ  1 
ATOM   2786 N  N   . GLU D  1 70 ? -7.571  21.127  21.387   1.00 24.00  ? 111 GLU D N   1 
ATOM   2787 C  CA  . GLU D  1 70 ? -8.522  21.058  22.474   1.00 20.02  ? 111 GLU D CA  1 
ATOM   2788 C  C   . GLU D  1 70 ? -7.911  20.222  23.592   1.00 20.54  ? 111 GLU D C   1 
ATOM   2789 O  O   . GLU D  1 70 ? -7.762  20.696  24.724   1.00 22.66  ? 111 GLU D O   1 
ATOM   2790 C  CB  . GLU D  1 70 ? -9.816  20.429  21.953   1.00 35.18  ? 111 GLU D CB  1 
ATOM   2791 C  CG  . GLU D  1 70 ? -11.034 20.650  22.815   1.00 48.64  ? 111 GLU D CG  1 
ATOM   2792 C  CD  . GLU D  1 70 ? -12.321 20.314  22.078   1.00 71.26  ? 111 GLU D CD  1 
ATOM   2793 O  OE1 . GLU D  1 70 ? -12.407 20.642  20.875   1.00 59.83  ? 111 GLU D OE1 1 
ATOM   2794 O  OE2 . GLU D  1 70 ? -13.249 19.743  22.696   1.00 68.27  ? 111 GLU D OE2 1 
ATOM   2795 N  N   . LEU D  1 71 ? -7.538  18.983  23.270   1.00 26.84  ? 112 LEU D N   1 
ATOM   2796 C  CA  . LEU D  1 71 ? -6.932  18.068  24.242   1.00 20.70  ? 112 LEU D CA  1 
ATOM   2797 C  C   . LEU D  1 71 ? -5.698  18.663  24.886   1.00 20.26  ? 112 LEU D C   1 
ATOM   2798 O  O   . LEU D  1 71 ? -5.482  18.530  26.095   1.00 27.46  ? 112 LEU D O   1 
ATOM   2799 C  CB  . LEU D  1 71 ? -6.539  16.754  23.565   1.00 29.44  ? 112 LEU D CB  1 
ATOM   2800 C  CG  . LEU D  1 71 ? -7.212  15.498  24.107   1.00 39.13  ? 112 LEU D CG  1 
ATOM   2801 C  CD1 . LEU D  1 71 ? -6.732  14.290  23.326   1.00 27.43  ? 112 LEU D CD1 1 
ATOM   2802 C  CD2 . LEU D  1 71 ? -6.893  15.333  25.574   1.00 37.86  ? 112 LEU D CD2 1 
ATOM   2803 N  N   . GLU D  1 72 ? -4.862  19.300  24.071   1.00 20.86  ? 113 GLU D N   1 
ATOM   2804 C  CA  . GLU D  1 72 ? -3.650  19.920  24.600   1.00 29.34  ? 113 GLU D CA  1 
ATOM   2805 C  C   . GLU D  1 72 ? -3.986  20.989  25.641   1.00 25.49  ? 113 GLU D C   1 
ATOM   2806 O  O   . GLU D  1 72 ? -3.328  21.083  26.675   1.00 37.23  ? 113 GLU D O   1 
ATOM   2807 C  CB  . GLU D  1 72 ? -2.837  20.546  23.469   1.00 36.78  ? 113 GLU D CB  1 
ATOM   2808 C  CG  . GLU D  1 72 ? -1.530  21.190  23.908   1.00 45.99  ? 113 GLU D CG  1 
ATOM   2809 C  CD  . GLU D  1 72 ? -1.730  22.508  24.640   1.00 31.04  ? 113 GLU D CD  1 
ATOM   2810 O  OE1 . GLU D  1 72 ? -2.559  23.317  24.174   1.00 64.30  ? 113 GLU D OE1 1 
ATOM   2811 O  OE2 . GLU D  1 72 ? -1.050  22.744  25.665   1.00 34.22  ? 113 GLU D OE2 1 
ATOM   2812 N  N   . LYS D  1 73 ? -5.007  21.798  25.370   1.00 29.23  ? 114 LYS D N   1 
ATOM   2813 C  CA  . LYS D  1 73 ? -5.405  22.848  26.301   1.00 27.15  ? 114 LYS D CA  1 
ATOM   2814 C  C   . LYS D  1 73 ? -5.934  22.233  27.594   1.00 23.48  ? 114 LYS D C   1 
ATOM   2815 O  O   . LYS D  1 73 ? -5.853  22.833  28.663   1.00 25.38  ? 114 LYS D O   1 
ATOM   2816 C  CB  . LYS D  1 73 ? -6.477  23.739  25.660   1.00 35.29  ? 114 LYS D CB  1 
ATOM   2817 C  CG  . LYS D  1 73 ? -7.009  24.854  26.552   1.00 46.65  ? 114 LYS D CG  1 
ATOM   2818 C  CD  . LYS D  1 73 ? -8.040  25.674  25.797   1.00 73.07  ? 114 LYS D CD  1 
ATOM   2819 C  CE  . LYS D  1 73 ? -8.638  26.772  26.662   1.00 77.98  ? 114 LYS D CE  1 
ATOM   2820 N  NZ  . LYS D  1 73 ? -9.660  27.572  25.914   1.00 79.13  ? 114 LYS D NZ  1 
ATOM   2821 N  N   . ASP D  1 74 ? -6.481  21.029  27.490   1.00 32.29  ? 115 ASP D N   1 
ATOM   2822 C  CA  . ASP D  1 74 ? -7.014  20.328  28.659   1.00 26.69  ? 115 ASP D CA  1 
ATOM   2823 C  C   . ASP D  1 74 ? -5.901  19.803  29.566   1.00 28.97  ? 115 ASP D C   1 
ATOM   2824 O  O   . ASP D  1 74 ? -5.984  19.890  30.795   1.00 34.30  ? 115 ASP D O   1 
ATOM   2825 C  CB  . ASP D  1 74 ? -7.922  19.170  28.227   1.00 29.26  ? 115 ASP D CB  1 
ATOM   2826 C  CG  . ASP D  1 74 ? -9.250  19.652  27.683   1.00 47.14  ? 115 ASP D CG  1 
ATOM   2827 O  OD1 . ASP D  1 74 ? -9.652  20.780  28.041   1.00 43.55  ? 115 ASP D OD1 1 
ATOM   2828 O  OD2 . ASP D  1 74 ? -9.908  18.912  26.921   1.00 41.50  ? 115 ASP D OD2 1 
ATOM   2829 N  N   . TYR D  1 75 ? -4.851  19.254  28.970   1.00 36.54  ? 116 TYR D N   1 
ATOM   2830 C  CA  . TYR D  1 75 ? -3.734  18.740  29.758   1.00 36.17  ? 116 TYR D CA  1 
ATOM   2831 C  C   . TYR D  1 75 ? -3.027  19.870  30.505   1.00 38.34  ? 116 TYR D C   1 
ATOM   2832 O  O   . TYR D  1 75 ? -2.528  19.678  31.617   1.00 35.91  ? 116 TYR D O   1 
ATOM   2833 C  CB  . TYR D  1 75 ? -2.744  18.015  28.849   1.00 28.50  ? 116 TYR D CB  1 
ATOM   2834 C  CG  . TYR D  1 75 ? -3.180  16.620  28.464   1.00 38.72  ? 116 TYR D CG  1 
ATOM   2835 C  CD1 . TYR D  1 75 ? -3.261  15.609  29.420   1.00 30.38  ? 116 TYR D CD1 1 
ATOM   2836 C  CD2 . TYR D  1 75 ? -3.477  16.301  27.139   1.00 42.23  ? 116 TYR D CD2 1 
ATOM   2837 C  CE1 . TYR D  1 75 ? -3.619  14.311  29.068   1.00 33.92  ? 116 TYR D CE1 1 
ATOM   2838 C  CE2 . TYR D  1 75 ? -3.835  15.009  26.773   1.00 33.21  ? 116 TYR D CE2 1 
ATOM   2839 C  CZ  . TYR D  1 75 ? -3.902  14.018  27.744   1.00 21.14  ? 116 TYR D CZ  1 
ATOM   2840 O  OH  . TYR D  1 75 ? -4.230  12.726  27.389   1.00 40.07  ? 116 TYR D OH  1 
ATOM   2841 N  N   . SER D  1 76 ? -2.994  21.053  29.902   1.00 37.64  ? 117 SER D N   1 
ATOM   2842 C  CA  . SER D  1 76 ? -2.341  22.192  30.543   1.00 33.33  ? 117 SER D CA  1 
ATOM   2843 C  C   . SER D  1 76 ? -3.085  22.616  31.785   1.00 23.76  ? 117 SER D C   1 
ATOM   2844 O  O   . SER D  1 76 ? -2.477  22.866  32.817   1.00 31.71  ? 117 SER D O   1 
ATOM   2845 C  CB  . SER D  1 76 ? -2.251  23.371  29.583   1.00 29.19  ? 117 SER D CB  1 
ATOM   2846 O  OG  . SER D  1 76 ? -1.428  23.030  28.475   1.00 40.52  ? 117 SER D OG  1 
ATOM   2847 N  N   . GLU D  1 77 ? -4.406  22.681  31.691   1.00 33.65  ? 118 GLU D N   1 
ATOM   2848 C  CA  . GLU D  1 77 ? -5.209  23.080  32.837   1.00 29.93  ? 118 GLU D CA  1 
ATOM   2849 C  C   . GLU D  1 77 ? -5.127  22.044  33.937   1.00 33.20  ? 118 GLU D C   1 
ATOM   2850 O  O   . GLU D  1 77 ? -5.033  22.381  35.115   1.00 38.09  ? 118 GLU D O   1 
ATOM   2851 C  CB  . GLU D  1 77 ? -6.668  23.290  32.425   1.00 32.17  ? 118 GLU D CB  1 
ATOM   2852 C  CG  . GLU D  1 77 ? -6.903  24.601  31.677   1.00 63.30  ? 118 GLU D CG  1 
ATOM   2853 C  CD  . GLU D  1 77 ? -8.371  25.008  31.650   1.00 65.25  ? 118 GLU D CD  1 
ATOM   2854 O  OE1 . GLU D  1 77 ? -8.962  25.159  32.744   1.00 61.75  ? 118 GLU D OE1 1 
ATOM   2855 O  OE2 . GLU D  1 77 ? -8.932  25.182  30.543   1.00 47.19  ? 118 GLU D OE2 1 
ATOM   2856 N  N   . LEU D  1 78 ? -5.147  20.778  33.537   1.00 26.15  ? 119 LEU D N   1 
ATOM   2857 C  CA  . LEU D  1 78 ? -5.080  19.683  34.481   1.00 21.98  ? 119 LEU D CA  1 
ATOM   2858 C  C   . LEU D  1 78 ? -3.761  19.721  35.253   1.00 16.57  ? 119 LEU D C   1 
ATOM   2859 O  O   . LEU D  1 78 ? -3.737  19.547  36.472   1.00 31.26  ? 119 LEU D O   1 
ATOM   2860 C  CB  . LEU D  1 78 ? -5.239  18.362  33.723   1.00 27.99  ? 119 LEU D CB  1 
ATOM   2861 C  CG  . LEU D  1 78 ? -5.356  17.078  34.525   1.00 36.01  ? 119 LEU D CG  1 
ATOM   2862 C  CD1 . LEU D  1 78 ? -6.473  17.217  35.533   1.00 11.91  ? 119 LEU D CD1 1 
ATOM   2863 C  CD2 . LEU D  1 78 ? -5.620  15.915  33.586   1.00 32.16  ? 119 LEU D CD2 1 
ATOM   2864 N  N   . SER D  1 79 ? -2.658  19.957  34.551   1.00 30.67  ? 120 SER D N   1 
ATOM   2865 C  CA  . SER D  1 79 ? -1.367  20.034  35.225   1.00 29.02  ? 120 SER D CA  1 
ATOM   2866 C  C   . SER D  1 79 ? -1.380  21.198  36.232   1.00 34.22  ? 120 SER D C   1 
ATOM   2867 O  O   . SER D  1 79 ? -0.943  21.039  37.375   1.00 32.45  ? 120 SER D O   1 
ATOM   2868 C  CB  . SER D  1 79 ? -0.245  20.210  34.196   1.00 24.73  ? 120 SER D CB  1 
ATOM   2869 O  OG  . SER D  1 79 ? 1.009   20.391  34.840   1.00 45.49  ? 120 SER D OG  1 
ATOM   2870 N  N   . ASN D  1 80 ? -1.892  22.361  35.825   1.00 33.45  ? 121 ASN D N   1 
ATOM   2871 C  CA  . ASN D  1 80 ? -1.951  23.500  36.742   1.00 34.09  ? 121 ASN D CA  1 
ATOM   2872 C  C   . ASN D  1 80 ? -2.708  23.096  37.988   1.00 34.62  ? 121 ASN D C   1 
ATOM   2873 O  O   . ASN D  1 80 ? -2.325  23.458  39.098   1.00 40.00  ? 121 ASN D O   1 
ATOM   2874 C  CB  . ASN D  1 80 ? -2.660  24.703  36.110   1.00 28.96  ? 121 ASN D CB  1 
ATOM   2875 C  CG  . ASN D  1 80 ? -1.812  25.393  35.087   1.00 37.01  ? 121 ASN D CG  1 
ATOM   2876 O  OD1 . ASN D  1 80 ? -0.639  25.654  35.331   1.00 53.33  ? 121 ASN D OD1 1 
ATOM   2877 N  ND2 . ASN D  1 80 ? -2.394  25.707  33.935   1.00 47.94  ? 121 ASN D ND2 1 
ATOM   2878 N  N   . ARG D  1 81 ? -3.788  22.343  37.796   1.00 28.77  ? 122 ARG D N   1 
ATOM   2879 C  CA  . ARG D  1 81 ? -4.603  21.895  38.914   1.00 30.86  ? 122 ARG D CA  1 
ATOM   2880 C  C   . ARG D  1 81 ? -3.814  20.968  39.846   1.00 32.05  ? 122 ARG D C   1 
ATOM   2881 O  O   . ARG D  1 81 ? -3.914  21.075  41.070   1.00 40.92  ? 122 ARG D O   1 
ATOM   2882 C  CB  . ARG D  1 81 ? -5.891  21.228  38.388   1.00 41.72  ? 122 ARG D CB  1 
ATOM   2883 C  CG  . ARG D  1 81 ? -6.874  22.239  37.766   1.00 37.71  ? 122 ARG D CG  1 
ATOM   2884 C  CD  . ARG D  1 81 ? -8.169  21.609  37.248   1.00 49.52  ? 122 ARG D CD  1 
ATOM   2885 N  NE  . ARG D  1 81 ? -9.169  21.356  38.285   1.00 58.45  ? 122 ARG D NE  1 
ATOM   2886 C  CZ  . ARG D  1 81 ? -10.400 20.903  38.043   1.00 55.92  ? 122 ARG D CZ  1 
ATOM   2887 N  NH1 . ARG D  1 81 ? -10.793 20.651  36.801   1.00 49.24  ? 122 ARG D NH1 1 
ATOM   2888 N  NH2 . ARG D  1 81 ? -11.245 20.696  39.042   1.00 44.40  ? 122 ARG D NH2 1 
ATOM   2889 N  N   . TYR D  1 82 ? -3.008  20.072  39.286   1.00 36.82  ? 123 TYR D N   1 
ATOM   2890 C  CA  . TYR D  1 82 ? -2.216  19.190  40.142   1.00 32.63  ? 123 TYR D CA  1 
ATOM   2891 C  C   . TYR D  1 82 ? -1.191  20.049  40.891   1.00 27.83  ? 123 TYR D C   1 
ATOM   2892 O  O   . TYR D  1 82 ? -0.880  19.792  42.059   1.00 30.76  ? 123 TYR D O   1 
ATOM   2893 C  CB  . TYR D  1 82 ? -1.516  18.113  39.308   1.00 35.36  ? 123 TYR D CB  1 
ATOM   2894 C  CG  . TYR D  1 82 ? -2.375  16.900  39.002   1.00 28.61  ? 123 TYR D CG  1 
ATOM   2895 C  CD1 . TYR D  1 82 ? -2.684  15.976  39.997   1.00 26.42  ? 123 TYR D CD1 1 
ATOM   2896 C  CD2 . TYR D  1 82 ? -2.869  16.671  37.720   1.00 26.07  ? 123 TYR D CD2 1 
ATOM   2897 C  CE1 . TYR D  1 82 ? -3.449  14.846  39.723   1.00 20.25  ? 123 TYR D CE1 1 
ATOM   2898 C  CE2 . TYR D  1 82 ? -3.643  15.544  37.432   1.00 18.15  ? 123 TYR D CE2 1 
ATOM   2899 C  CZ  . TYR D  1 82 ? -3.927  14.634  38.445   1.00 22.99  ? 123 TYR D CZ  1 
ATOM   2900 O  OH  . TYR D  1 82 ? -4.655  13.490  38.184   1.00 33.26  ? 123 TYR D OH  1 
ATOM   2901 N  N   . ASN D  1 83 ? -0.682  21.086  40.224   1.00 39.88  ? 124 ASN D N   1 
ATOM   2902 C  CA  . ASN D  1 83 ? 0.287   21.986  40.850   1.00 38.51  ? 124 ASN D CA  1 
ATOM   2903 C  C   . ASN D  1 83 ? -0.392  22.746  41.988   1.00 34.85  ? 124 ASN D C   1 
ATOM   2904 O  O   . ASN D  1 83 ? 0.249   23.099  42.975   1.00 32.62  ? 124 ASN D O   1 
ATOM   2905 C  CB  . ASN D  1 83 ? 0.871   22.989  39.836   1.00 38.70  ? 124 ASN D CB  1 
ATOM   2906 C  CG  . ASN D  1 83 ? 1.768   22.326  38.789   1.00 49.38  ? 124 ASN D CG  1 
ATOM   2907 O  OD1 . ASN D  1 83 ? 2.305   21.235  38.999   1.00 46.07  ? 124 ASN D OD1 1 
ATOM   2908 N  ND2 . ASN D  1 83 ? 1.948   23.000  37.666   1.00 26.56  ? 124 ASN D ND2 1 
ATOM   2909 N  N   . GLU D  1 84 ? -1.689  23.002  41.862   1.00 41.64  ? 125 GLU D N   1 
ATOM   2910 C  CA  . GLU D  1 84 ? -2.400  23.702  42.927   1.00 43.68  ? 125 GLU D CA  1 
ATOM   2911 C  C   . GLU D  1 84 ? -2.560  22.797  44.137   1.00 38.18  ? 125 GLU D C   1 
ATOM   2912 O  O   . GLU D  1 84 ? -2.395  23.235  45.271   1.00 42.14  ? 125 GLU D O   1 
ATOM   2913 C  CB  . GLU D  1 84 ? -3.775  24.160  42.463   1.00 43.99  ? 125 GLU D CB  1 
ATOM   2914 C  CG  . GLU D  1 84 ? -3.736  25.364  41.567   1.00 67.18  ? 125 GLU D CG  1 
ATOM   2915 C  CD  . GLU D  1 84 ? -5.088  26.035  41.458   1.00 82.33  ? 125 GLU D CD  1 
ATOM   2916 O  OE1 . GLU D  1 84 ? -6.038  25.398  40.948   1.00 83.77  ? 125 GLU D OE1 1 
ATOM   2917 O  OE2 . GLU D  1 84 ? -5.199  27.203  41.890   1.00 92.37  ? 125 GLU D OE2 1 
ATOM   2918 N  N   . GLN D  1 85 ? -2.889  21.534  43.894   1.00 42.80  ? 126 GLN D N   1 
ATOM   2919 C  CA  . GLN D  1 85 ? -3.046  20.592  44.989   1.00 38.32  ? 126 GLN D CA  1 
ATOM   2920 C  C   . GLN D  1 85 ? -1.709  20.428  45.694   1.00 32.16  ? 126 GLN D C   1 
ATOM   2921 O  O   . GLN D  1 85 ? -1.640  20.335  46.918   1.00 44.96  ? 126 GLN D O   1 
ATOM   2922 C  CB  . GLN D  1 85 ? -3.520  19.249  44.457   1.00 41.07  ? 126 GLN D CB  1 
ATOM   2923 C  CG  . GLN D  1 85 ? -4.914  19.296  43.873   1.00 50.60  ? 126 GLN D CG  1 
ATOM   2924 C  CD  . GLN D  1 85 ? -5.948  19.735  44.890   1.00 60.83  ? 126 GLN D CD  1 
ATOM   2925 O  OE1 . GLN D  1 85 ? -6.309  20.914  44.965   1.00 65.81  ? 126 GLN D OE1 1 
ATOM   2926 N  NE2 . GLN D  1 85 ? -6.423  18.787  45.692   1.00 65.63  ? 126 GLN D NE2 1 
ATOM   2927 N  N   . LYS D  1 86 ? -0.647  20.394  44.905   1.00 43.43  ? 127 LYS D N   1 
ATOM   2928 C  CA  . LYS D  1 86 ? 0.700   20.259  45.429   1.00 39.49  ? 127 LYS D CA  1 
ATOM   2929 C  C   . LYS D  1 86 ? 0.962   21.376  46.434   1.00 44.22  ? 127 LYS D C   1 
ATOM   2930 O  O   . LYS D  1 86 ? 1.456   21.134  47.533   1.00 48.64  ? 127 LYS D O   1 
ATOM   2931 C  CB  . LYS D  1 86 ? 1.703   20.334  44.265   1.00 39.90  ? 127 LYS D CB  1 
ATOM   2932 C  CG  . LYS D  1 86 ? 3.127   20.704  44.655   1.00 57.36  ? 127 LYS D CG  1 
ATOM   2933 C  CD  . LYS D  1 86 ? 3.774   19.660  45.549   1.00 67.22  ? 127 LYS D CD  1 
ATOM   2934 C  CE  . LYS D  1 86 ? 5.204   20.059  45.886   1.00 81.92  ? 127 LYS D CE  1 
ATOM   2935 N  NZ  . LYS D  1 86 ? 5.926   19.014  46.670   1.00 95.13  ? 127 LYS D NZ  1 
ATOM   2936 N  N   . GLU D  1 87 ? 0.624   22.602  46.044   1.00 50.24  ? 128 GLU D N   1 
ATOM   2937 C  CA  . GLU D  1 87 ? 0.829   23.764  46.896   1.00 51.36  ? 128 GLU D CA  1 
ATOM   2938 C  C   . GLU D  1 87 ? 0.009   23.720  48.177   1.00 49.61  ? 128 GLU D C   1 
ATOM   2939 O  O   . GLU D  1 87 ? 0.393   24.309  49.183   1.00 52.63  ? 128 GLU D O   1 
ATOM   2940 C  CB  . GLU D  1 87 ? 0.522   25.044  46.115   1.00 49.90  ? 128 GLU D CB  1 
ATOM   2941 C  CG  . GLU D  1 87 ? 1.639   25.452  45.160   1.00 64.92  ? 128 GLU D CG  1 
ATOM   2942 C  CD  . GLU D  1 87 ? 1.259   26.610  44.246   1.00 80.63  ? 128 GLU D CD  1 
ATOM   2943 O  OE1 . GLU D  1 87 ? 0.740   27.635  44.738   1.00 77.69  ? 128 GLU D OE1 1 
ATOM   2944 O  OE2 . GLU D  1 87 ? 1.493   26.498  43.028   1.00 84.23  ? 128 GLU D OE2 1 
ATOM   2945 N  N   . LYS D  1 88 ? -1.118  23.022  48.150   1.00 53.48  ? 129 LYS D N   1 
ATOM   2946 C  CA  . LYS D  1 88 ? -1.945  22.915  49.343   1.00 57.54  ? 129 LYS D CA  1 
ATOM   2947 C  C   . LYS D  1 88 ? -1.317  21.957  50.346   1.00 65.53  ? 129 LYS D C   1 
ATOM   2948 O  O   . LYS D  1 88 ? -1.401  22.167  51.557   1.00 67.80  ? 129 LYS D O   1 
ATOM   2949 C  CB  . LYS D  1 88 ? -3.342  22.447  48.971   1.00 53.34  ? 129 LYS D CB  1 
ATOM   2950 C  CG  . LYS D  1 88 ? -4.092  23.505  48.215   1.00 52.90  ? 129 LYS D CG  1 
ATOM   2951 C  CD  . LYS D  1 88 ? -5.538  23.152  48.016   1.00 49.91  ? 129 LYS D CD  1 
ATOM   2952 C  CE  . LYS D  1 88 ? -6.290  24.407  47.634   1.00 63.46  ? 129 LYS D CE  1 
ATOM   2953 N  NZ  . LYS D  1 88 ? -7.336  24.166  46.613   1.00 73.34  ? 129 LYS D NZ  1 
ATOM   2954 N  N   . MET D  1 89 ? -0.692  20.900  49.838   1.00 67.52  ? 130 MET D N   1 
ATOM   2955 C  CA  . MET D  1 89 ? -0.027  19.938  50.702   1.00 75.13  ? 130 MET D CA  1 
ATOM   2956 C  C   . MET D  1 89 ? 1.088   20.660  51.449   1.00 73.81  ? 130 MET D C   1 
ATOM   2957 O  O   . MET D  1 89 ? 1.269   20.463  52.649   1.00 78.52  ? 130 MET D O   1 
ATOM   2958 C  CB  . MET D  1 89 ? 0.564   18.797  49.875   1.00 76.21  ? 130 MET D CB  1 
ATOM   2959 C  CG  . MET D  1 89 ? -0.369  17.625  49.674   1.00 77.10  ? 130 MET D CG  1 
ATOM   2960 S  SD  . MET D  1 89 ? -0.698  16.802  51.242   1.00 91.92  ? 130 MET D SD  1 
ATOM   2961 C  CE  . MET D  1 89 ? 0.799   15.824  51.414   1.00 78.71  ? 130 MET D CE  1 
ATOM   2962 N  N   . ASP D  1 90 ? 1.829   21.498  50.727   1.00 74.72  ? 131 ASP D N   1 
ATOM   2963 C  CA  . ASP D  1 90 ? 2.929   22.265  51.309   1.00 76.34  ? 131 ASP D CA  1 
ATOM   2964 C  C   . ASP D  1 90 ? 2.371   23.157  52.406   1.00 77.23  ? 131 ASP D C   1 
ATOM   2965 O  O   . ASP D  1 90 ? 2.869   23.173  53.529   1.00 69.26  ? 131 ASP D O   1 
ATOM   2966 C  CB  . ASP D  1 90 ? 3.599   23.147  50.248   1.00 75.36  ? 131 ASP D CB  1 
ATOM   2967 C  CG  . ASP D  1 90 ? 4.205   22.345  49.111   1.00 85.32  ? 131 ASP D CG  1 
ATOM   2968 O  OD1 . ASP D  1 90 ? 4.039   21.109  49.098   1.00 89.75  ? 131 ASP D OD1 1 
ATOM   2969 O  OD2 . ASP D  1 90 ? 4.846   22.956  48.227   1.00 89.98  ? 131 ASP D OD2 1 
ATOM   2970 N  N   . GLN D  1 91 ? 1.330   23.903  52.055   1.00 74.60  ? 132 GLN D N   1 
ATOM   2971 C  CA  . GLN D  1 91 ? 0.674   24.811  52.978   1.00 72.77  ? 132 GLN D CA  1 
ATOM   2972 C  C   . GLN D  1 91 ? 0.228   24.117  54.258   1.00 70.62  ? 132 GLN D C   1 
ATOM   2973 O  O   . GLN D  1 91 ? 0.291   24.702  55.337   1.00 75.31  ? 132 GLN D O   1 
ATOM   2974 C  CB  . GLN D  1 91 ? -0.514  25.469  52.280   1.00 73.38  ? 132 GLN D CB  1 
ATOM   2975 C  CG  . GLN D  1 91 ? -0.140  26.719  51.481   1.00 81.47  ? 132 GLN D CG  1 
ATOM   2976 C  CD  . GLN D  1 91 ? 1.256   26.654  50.868   1.00 90.82  ? 132 GLN D CD  1 
ATOM   2977 O  OE1 . GLN D  1 91 ? 1.415   26.522  49.652   1.00 95.05  ? 132 GLN D OE1 1 
ATOM   2978 N  NE2 . GLN D  1 91 ? 2.277   26.748  51.716   1.00 95.69  ? 132 GLN D NE2 1 
ATOM   2979 N  N   . LEU D  1 92 ? -0.209  22.867  54.143   1.00 73.05  ? 133 LEU D N   1 
ATOM   2980 C  CA  . LEU D  1 92 ? -0.655  22.114  55.311   1.00 83.90  ? 133 LEU D CA  1 
ATOM   2981 C  C   . LEU D  1 92 ? 0.277   22.235  56.509   1.00 89.11  ? 133 LEU D C   1 
ATOM   2982 O  O   . LEU D  1 92 ? -0.168  22.138  57.651   1.00 90.89  ? 133 LEU D O   1 
ATOM   2983 C  CB  . LEU D  1 92 ? -0.803  20.627  54.981   1.00 77.07  ? 133 LEU D CB  1 
ATOM   2984 C  CG  . LEU D  1 92 ? -2.121  20.038  54.469   1.00 74.06  ? 133 LEU D CG  1 
ATOM   2985 C  CD1 . LEU D  1 92 ? -2.328  18.717  55.192   1.00 73.32  ? 133 LEU D CD1 1 
ATOM   2986 C  CD2 . LEU D  1 92 ? -3.303  20.957  54.737   1.00 82.71  ? 133 LEU D CD2 1 
ATOM   2987 N  N   . SER D  1 93 ? 1.564   22.452  56.250   1.00 93.10  ? 134 SER D N   1 
ATOM   2988 C  CA  . SER D  1 93 ? 2.547   22.532  57.326   1.00 95.75  ? 134 SER D CA  1 
ATOM   2989 C  C   . SER D  1 93 ? 3.024   23.899  57.803   1.00 97.43  ? 134 SER D C   1 
ATOM   2990 O  O   . SER D  1 93 ? 3.117   24.123  59.010   1.00 88.82  ? 134 SER D O   1 
ATOM   2991 C  CB  . SER D  1 93 ? 3.753   21.665  56.975   1.00 91.82  ? 134 SER D CB  1 
ATOM   2992 O  OG  . SER D  1 93 ? 3.424   20.293  57.121   1.00 99.52  ? 134 SER D OG  1 
ATOM   2993 N  N   . LYS D  1 94 ? 3.346   24.810  56.888   1.00 98.11  ? 135 LYS D N   1 
ATOM   2994 C  CA  . LYS D  1 94 ? 3.789   26.142  57.304   1.00 106.52 ? 135 LYS D CA  1 
ATOM   2995 C  C   . LYS D  1 94 ? 2.753   26.661  58.309   1.00 110.70 ? 135 LYS D C   1 
ATOM   2996 O  O   . LYS D  1 94 ? 3.038   27.530  59.135   1.00 112.94 ? 135 LYS D O   1 
ATOM   2997 C  CB  . LYS D  1 94 ? 3.836   27.097  56.102   1.00 104.57 ? 135 LYS D CB  1 
ATOM   2998 C  CG  . LYS D  1 94 ? 4.569   26.568  54.872   1.00 104.79 ? 135 LYS D CG  1 
ATOM   2999 C  CD  . LYS D  1 94 ? 6.085   26.693  54.987   1.00 103.08 ? 135 LYS D CD  1 
ATOM   3000 C  CE  . LYS D  1 94 ? 6.566   28.125  54.748   1.00 103.46 ? 135 LYS D CE  1 
ATOM   3001 N  NZ  . LYS D  1 94 ? 6.030   29.095  55.742   1.00 105.97 ? 135 LYS D NZ  1 
ATOM   3002 N  N   . LEU D  1 95 ? 1.554   26.086  58.229   1.00 113.04 ? 136 LEU D N   1 
ATOM   3003 C  CA  . LEU D  1 95 ? 0.411   26.453  59.059   1.00 115.09 ? 136 LEU D CA  1 
ATOM   3004 C  C   . LEU D  1 95 ? 0.330   25.902  60.489   1.00 115.04 ? 136 LEU D C   1 
ATOM   3005 O  O   . LEU D  1 95 ? 0.803   24.773  60.745   1.00 115.68 ? 136 LEU D O   1 
ATOM   3006 C  CB  . LEU D  1 95 ? -0.859  26.080  58.300   1.00 112.13 ? 136 LEU D CB  1 
ATOM   3007 C  CG  . LEU D  1 95 ? -1.425  27.179  57.404   1.00 114.28 ? 136 LEU D CG  1 
ATOM   3008 C  CD1 . LEU D  1 95 ? -1.650  26.723  55.963   1.00 113.74 ? 136 LEU D CD1 1 
ATOM   3009 C  CD2 . LEU D  1 95 ? -2.719  27.613  58.044   1.00 112.10 ? 136 LEU D CD2 1 
ATOM   3010 N  N   . GLU E  1 6  ? 1.304   19.404  115.860  1.00 137.37 ? 47  GLU E N   1 
ATOM   3011 C  CA  . GLU E  1 6  ? 1.258   20.479  114.829  1.00 137.37 ? 47  GLU E CA  1 
ATOM   3012 C  C   . GLU E  1 6  ? 2.094   20.113  113.607  1.00 137.37 ? 47  GLU E C   1 
ATOM   3013 O  O   . GLU E  1 6  ? 1.756   20.483  112.483  1.00 137.37 ? 47  GLU E O   1 
ATOM   3014 C  CB  . GLU E  1 6  ? 1.768   21.797  115.416  1.00 140.12 ? 47  GLU E CB  1 
ATOM   3015 C  CG  . GLU E  1 6  ? 1.775   22.950  114.422  1.00 140.12 ? 47  GLU E CG  1 
ATOM   3016 C  CD  . GLU E  1 6  ? 2.412   24.206  114.984  1.00 140.12 ? 47  GLU E CD  1 
ATOM   3017 O  OE1 . GLU E  1 6  ? 3.599   24.149  115.369  1.00 140.12 ? 47  GLU E OE1 1 
ATOM   3018 O  OE2 . GLU E  1 6  ? 1.726   25.250  115.037  1.00 140.12 ? 47  GLU E OE2 1 
ATOM   3019 N  N   . SER E  1 7  ? 3.189   19.392  113.830  1.00 133.67 ? 48  SER E N   1 
ATOM   3020 C  CA  . SER E  1 7  ? 4.064   18.982  112.737  1.00 141.91 ? 48  SER E CA  1 
ATOM   3021 C  C   . SER E  1 7  ? 3.313   18.059  111.782  1.00 146.22 ? 48  SER E C   1 
ATOM   3022 O  O   . SER E  1 7  ? 3.467   18.150  110.564  1.00 142.93 ? 48  SER E O   1 
ATOM   3023 C  CB  . SER E  1 7  ? 5.301   18.264  113.285  1.00 140.76 ? 48  SER E CB  1 
ATOM   3024 O  OG  . SER E  1 7  ? 4.937   17.084  113.978  1.00 142.26 ? 48  SER E OG  1 
ATOM   3025 N  N   . LEU E  1 8  ? 2.497   17.174  112.349  1.00 142.43 ? 49  LEU E N   1 
ATOM   3026 C  CA  . LEU E  1 8  ? 1.706   16.229  111.567  1.00 145.73 ? 49  LEU E CA  1 
ATOM   3027 C  C   . LEU E  1 8  ? 0.740   16.993  110.665  1.00 149.71 ? 49  LEU E C   1 
ATOM   3028 O  O   . LEU E  1 8  ? 0.571   16.662  109.490  1.00 149.23 ? 49  LEU E O   1 
ATOM   3029 C  CB  . LEU E  1 8  ? 0.914   15.315  112.504  1.00 143.17 ? 49  LEU E CB  1 
ATOM   3030 C  CG  . LEU E  1 8  ? 1.692   14.708  113.675  1.00 144.87 ? 49  LEU E CG  1 
ATOM   3031 C  CD1 . LEU E  1 8  ? 0.717   14.109  114.674  1.00 145.32 ? 49  LEU E CD1 1 
ATOM   3032 C  CD2 . LEU E  1 8  ? 2.671   13.660  113.169  1.00 144.10 ? 49  LEU E CD2 1 
ATOM   3033 N  N   . HIS E  1 9  ? 0.103   18.014  111.230  1.00 147.90 ? 50  HIS E N   1 
ATOM   3034 C  CA  . HIS E  1 9  ? -0.841  18.837  110.484  1.00 149.16 ? 50  HIS E CA  1 
ATOM   3035 C  C   . HIS E  1 9  ? -0.113  19.557  109.357  1.00 147.23 ? 50  HIS E C   1 
ATOM   3036 O  O   . HIS E  1 9  ? -0.638  19.689  108.252  1.00 150.00 ? 50  HIS E O   1 
ATOM   3037 C  CB  . HIS E  1 9  ? -1.505  19.861  111.409  1.00 147.40 ? 50  HIS E CB  1 
ATOM   3038 C  CG  . HIS E  1 9  ? -2.339  19.250  112.490  1.00 155.30 ? 50  HIS E CG  1 
ATOM   3039 N  ND1 . HIS E  1 9  ? -1.794  18.567  113.558  1.00 161.41 ? 50  HIS E ND1 1 
ATOM   3040 C  CD2 . HIS E  1 9  ? -3.681  19.204  112.661  1.00 157.36 ? 50  HIS E CD2 1 
ATOM   3041 C  CE1 . HIS E  1 9  ? -2.765  18.128  114.338  1.00 162.65 ? 50  HIS E CE1 1 
ATOM   3042 N  NE2 . HIS E  1 9  ? -3.921  18.501  113.816  1.00 160.71 ? 50  HIS E NE2 1 
ATOM   3043 N  N   . ASP E  1 10 ? 1.099   20.022  109.645  1.00 147.46 ? 51  ASP E N   1 
ATOM   3044 C  CA  . ASP E  1 10 ? 1.907   20.720  108.654  1.00 143.37 ? 51  ASP E CA  1 
ATOM   3045 C  C   . ASP E  1 10 ? 2.205   19.766  107.501  1.00 145.89 ? 51  ASP E C   1 
ATOM   3046 O  O   . ASP E  1 10 ? 2.146   20.150  106.332  1.00 151.20 ? 51  ASP E O   1 
ATOM   3047 C  CB  . ASP E  1 10 ? 3.218   21.199  109.279  1.00 145.98 ? 51  ASP E CB  1 
ATOM   3048 C  CG  . ASP E  1 10 ? 4.097   21.941  108.292  1.00 141.79 ? 51  ASP E CG  1 
ATOM   3049 O  OD1 . ASP E  1 10 ? 3.734   23.070  107.901  1.00 140.24 ? 51  ASP E OD1 1 
ATOM   3050 O  OD2 . ASP E  1 10 ? 5.148   21.391  107.902  1.00 140.98 ? 51  ASP E OD2 1 
ATOM   3051 N  N   . GLN E  1 11 ? 2.527   18.522  107.843  1.00 143.79 ? 52  GLN E N   1 
ATOM   3052 C  CA  . GLN E  1 11 ? 2.823   17.497  106.846  1.00 140.55 ? 52  GLN E CA  1 
ATOM   3053 C  C   . GLN E  1 11 ? 1.602   17.243  105.970  1.00 137.75 ? 52  GLN E C   1 
ATOM   3054 O  O   . GLN E  1 11 ? 1.722   17.078  104.756  1.00 136.43 ? 52  GLN E O   1 
ATOM   3055 C  CB  . GLN E  1 11 ? 3.241   16.194  107.533  1.00 139.21 ? 52  GLN E CB  1 
ATOM   3056 C  CG  . GLN E  1 11 ? 4.645   16.213  108.109  1.00 136.74 ? 52  GLN E CG  1 
ATOM   3057 C  CD  . GLN E  1 11 ? 5.711   16.117  107.039  1.00 133.42 ? 52  GLN E CD  1 
ATOM   3058 O  OE1 . GLN E  1 11 ? 5.853   15.090  106.374  1.00 128.13 ? 52  GLN E OE1 1 
ATOM   3059 N  NE2 . GLN E  1 11 ? 6.465   17.191  106.864  1.00 131.08 ? 52  GLN E NE2 1 
ATOM   3060 N  N   . ILE E  1 12 ? 0.428   17.206  106.594  1.00 134.64 ? 53  ILE E N   1 
ATOM   3061 C  CA  . ILE E  1 12 ? -0.811  16.981  105.861  1.00 135.70 ? 53  ILE E CA  1 
ATOM   3062 C  C   . ILE E  1 12 ? -1.073  18.144  104.909  1.00 138.11 ? 53  ILE E C   1 
ATOM   3063 O  O   . ILE E  1 12 ? -1.544  17.943  103.789  1.00 140.41 ? 53  ILE E O   1 
ATOM   3064 C  CB  . ILE E  1 12 ? -2.014  16.822  106.819  1.00 136.49 ? 53  ILE E CB  1 
ATOM   3065 C  CG1 . ILE E  1 12 ? -1.854  15.540  107.641  1.00 130.80 ? 53  ILE E CG1 1 
ATOM   3066 C  CG2 . ILE E  1 12 ? -3.314  16.789  106.028  1.00 134.87 ? 53  ILE E CG2 1 
ATOM   3067 C  CD1 . ILE E  1 12 ? -3.072  15.177  108.464  1.00 123.23 ? 53  ILE E CD1 1 
ATOM   3068 N  N   . ASP E  1 13 ? -0.766  19.359  105.357  1.00 135.17 ? 54  ASP E N   1 
ATOM   3069 C  CA  . ASP E  1 13 ? -0.953  20.547  104.529  1.00 135.61 ? 54  ASP E CA  1 
ATOM   3070 C  C   . ASP E  1 13 ? -0.016  20.487  103.331  1.00 133.46 ? 54  ASP E C   1 
ATOM   3071 O  O   . ASP E  1 13 ? -0.386  20.861  102.217  1.00 130.68 ? 54  ASP E O   1 
ATOM   3072 C  CB  . ASP E  1 13 ? -0.667  21.815  105.338  1.00 135.13 ? 54  ASP E CB  1 
ATOM   3073 C  CG  . ASP E  1 13 ? -1.842  22.238  106.195  1.00 139.34 ? 54  ASP E CG  1 
ATOM   3074 O  OD1 . ASP E  1 13 ? -2.320  21.415  107.005  1.00 140.90 ? 54  ASP E OD1 1 
ATOM   3075 O  OD2 . ASP E  1 13 ? -2.289  23.397  106.058  1.00 139.69 ? 54  ASP E OD2 1 
ATOM   3076 N  N   . MET E  1 14 ? 1.201   20.010  103.571  1.00 131.01 ? 55  MET E N   1 
ATOM   3077 C  CA  . MET E  1 14 ? 2.200   19.892  102.519  1.00 130.58 ? 55  MET E CA  1 
ATOM   3078 C  C   . MET E  1 14 ? 1.720   18.906  101.458  1.00 126.70 ? 55  MET E C   1 
ATOM   3079 O  O   . MET E  1 14 ? 1.875   19.143  100.260  1.00 123.75 ? 55  MET E O   1 
ATOM   3080 C  CB  . MET E  1 14 ? 3.526   19.411  103.108  1.00 132.57 ? 55  MET E CB  1 
ATOM   3081 C  CG  . MET E  1 14 ? 4.694   19.519  102.151  1.00 137.01 ? 55  MET E CG  1 
ATOM   3082 S  SD  . MET E  1 14 ? 5.019   21.235  101.707  1.00 142.79 ? 55  MET E SD  1 
ATOM   3083 C  CE  . MET E  1 14 ? 6.037   21.751  103.094  1.00 144.54 ? 55  MET E CE  1 
ATOM   3084 N  N   . LEU E  1 15 ? 1.136   17.799  101.909  1.00 123.66 ? 56  LEU E N   1 
ATOM   3085 C  CA  . LEU E  1 15 ? 0.625   16.776  101.005  1.00 117.77 ? 56  LEU E CA  1 
ATOM   3086 C  C   . LEU E  1 15 ? -0.565  17.309  100.220  1.00 118.11 ? 56  LEU E C   1 
ATOM   3087 O  O   . LEU E  1 15 ? -0.741  16.978  99.048   1.00 117.11 ? 56  LEU E O   1 
ATOM   3088 C  CB  . LEU E  1 15 ? 0.205   15.532  101.791  1.00 115.71 ? 56  LEU E CB  1 
ATOM   3089 C  CG  . LEU E  1 15 ? 1.309   14.788  102.542  1.00 117.31 ? 56  LEU E CG  1 
ATOM   3090 C  CD1 . LEU E  1 15 ? 0.721   13.610  103.293  1.00 120.01 ? 56  LEU E CD1 1 
ATOM   3091 C  CD2 . LEU E  1 15 ? 2.363   14.321  101.556  1.00 107.28 ? 56  LEU E CD2 1 
ATOM   3092 N  N   . THR E  1 16 ? -1.384  18.129  100.871  1.00 118.18 ? 57  THR E N   1 
ATOM   3093 C  CA  . THR E  1 16 ? -2.544  18.709  100.211  1.00 117.79 ? 57  THR E CA  1 
ATOM   3094 C  C   . THR E  1 16 ? -2.024  19.639  99.123   1.00 121.21 ? 57  THR E C   1 
ATOM   3095 O  O   . THR E  1 16 ? -2.582  19.707  98.027   1.00 122.49 ? 57  THR E O   1 
ATOM   3096 C  CB  . THR E  1 16 ? -3.412  19.521  101.192  1.00 117.99 ? 57  THR E CB  1 
ATOM   3097 O  OG1 . THR E  1 16 ? -3.728  18.715  102.332  1.00 119.46 ? 57  THR E OG1 1 
ATOM   3098 C  CG2 . THR E  1 16 ? -4.709  19.951  100.519  1.00 115.24 ? 57  THR E CG2 1 
ATOM   3099 N  N   . LYS E  1 17 ? -0.943  20.351  99.431   1.00 121.12 ? 58  LYS E N   1 
ATOM   3100 C  CA  . LYS E  1 17 ? -0.349  21.260  98.464   1.00 120.00 ? 58  LYS E CA  1 
ATOM   3101 C  C   . LYS E  1 17 ? 0.149   20.430  97.284   1.00 123.17 ? 58  LYS E C   1 
ATOM   3102 O  O   . LYS E  1 17 ? -0.086  20.777  96.130   1.00 123.80 ? 58  LYS E O   1 
ATOM   3103 C  CB  . LYS E  1 17 ? 0.814   22.037  99.089   1.00 118.96 ? 58  LYS E CB  1 
ATOM   3104 C  CG  . LYS E  1 17 ? 1.281   23.203  98.233   1.00 115.99 ? 58  LYS E CG  1 
ATOM   3105 C  CD  . LYS E  1 17 ? 2.539   23.856  98.774   1.00 112.62 ? 58  LYS E CD  1 
ATOM   3106 C  CE  . LYS E  1 17 ? 3.007   24.963  97.841   1.00 113.32 ? 58  LYS E CE  1 
ATOM   3107 N  NZ  . LYS E  1 17 ? 4.341   25.498  98.219   1.00 113.61 ? 58  LYS E NZ  1 
ATOM   3108 N  N   . THR E  1 18 ? 0.822   19.321  97.583   1.00 122.70 ? 59  THR E N   1 
ATOM   3109 C  CA  . THR E  1 18 ? 1.346   18.434  96.547   1.00 123.33 ? 59  THR E CA  1 
ATOM   3110 C  C   . THR E  1 18 ? 0.222   17.916  95.653   1.00 122.19 ? 59  THR E C   1 
ATOM   3111 O  O   . THR E  1 18 ? 0.378   17.828  94.436   1.00 123.92 ? 59  THR E O   1 
ATOM   3112 C  CB  . THR E  1 18 ? 2.076   17.218  97.161   1.00 123.16 ? 59  THR E CB  1 
ATOM   3113 O  OG1 . THR E  1 18 ? 3.149   17.672  97.994   1.00 124.82 ? 59  THR E OG1 1 
ATOM   3114 C  CG2 . THR E  1 18 ? 2.641   16.325  96.063   1.00 126.00 ? 59  THR E CG2 1 
ATOM   3115 N  N   . ASN E  1 19 ? -0.909  17.572  96.262   1.00 117.08 ? 60  ASN E N   1 
ATOM   3116 C  CA  . ASN E  1 19 ? -2.056  17.065  95.518   1.00 117.62 ? 60  ASN E CA  1 
ATOM   3117 C  C   . ASN E  1 19 ? -2.613  18.113  94.565   1.00 120.94 ? 60  ASN E C   1 
ATOM   3118 O  O   . ASN E  1 19 ? -2.720  17.873  93.363   1.00 124.18 ? 60  ASN E O   1 
ATOM   3119 C  CB  . ASN E  1 19 ? -3.150  16.607  96.484   1.00 114.40 ? 60  ASN E CB  1 
ATOM   3120 C  CG  . ASN E  1 19 ? -4.444  16.263  95.777   1.00 110.31 ? 60  ASN E CG  1 
ATOM   3121 O  OD1 . ASN E  1 19 ? -5.272  17.136  95.507   1.00 100.38 ? 60  ASN E OD1 1 
ATOM   3122 N  ND2 . ASN E  1 19 ? -4.619  14.985  95.456   1.00 113.14 ? 60  ASN E ND2 1 
ATOM   3123 N  N   . LEU E  1 20 ? -2.969  19.272  95.108   1.00 119.71 ? 61  LEU E N   1 
ATOM   3124 C  CA  . LEU E  1 20 ? -3.511  20.359  94.302   1.00 123.78 ? 61  LEU E CA  1 
ATOM   3125 C  C   . LEU E  1 20 ? -2.508  20.758  93.220   1.00 124.80 ? 61  LEU E C   1 
ATOM   3126 O  O   . LEU E  1 20 ? -2.894  21.213  92.143   1.00 124.79 ? 61  LEU E O   1 
ATOM   3127 C  CB  . LEU E  1 20 ? -3.841  21.558  95.201   1.00 124.92 ? 61  LEU E CB  1 
ATOM   3128 C  CG  . LEU E  1 20 ? -4.474  22.810  94.582   1.00 126.44 ? 61  LEU E CG  1 
ATOM   3129 C  CD1 . LEU E  1 20 ? -5.128  23.639  95.678   1.00 126.01 ? 61  LEU E CD1 1 
ATOM   3130 C  CD2 . LEU E  1 20 ? -3.422  23.627  93.843   1.00 127.05 ? 61  LEU E CD2 1 
ATOM   3131 N  N   . GLN E  1 21 ? -1.222  20.576  93.510   1.00 122.70 ? 62  GLN E N   1 
ATOM   3132 C  CA  . GLN E  1 21 ? -0.167  20.912  92.558   1.00 120.53 ? 62  GLN E CA  1 
ATOM   3133 C  C   . GLN E  1 21 ? -0.098  19.907  91.413   1.00 118.73 ? 62  GLN E C   1 
ATOM   3134 O  O   . GLN E  1 21 ? 0.301   20.249  90.303   1.00 120.82 ? 62  GLN E O   1 
ATOM   3135 C  CB  . GLN E  1 21 ? 1.195   20.971  93.259   1.00 124.34 ? 62  GLN E CB  1 
ATOM   3136 C  CG  . GLN E  1 21 ? 1.328   22.079  94.292   1.00 126.21 ? 62  GLN E CG  1 
ATOM   3137 C  CD  . GLN E  1 21 ? 1.030   23.451  93.725   1.00 128.59 ? 62  GLN E CD  1 
ATOM   3138 O  OE1 . GLN E  1 21 ? 1.750   23.947  92.858   1.00 129.58 ? 62  GLN E OE1 1 
ATOM   3139 N  NE2 . GLN E  1 21 ? -0.040  24.071  94.209   1.00 125.35 ? 62  GLN E NE2 1 
ATOM   3140 N  N   . LEU E  1 22 ? -0.473  18.662  91.687   1.00 114.89 ? 63  LEU E N   1 
ATOM   3141 C  CA  . LEU E  1 22 ? -0.453  17.629  90.661   1.00 110.56 ? 63  LEU E CA  1 
ATOM   3142 C  C   . LEU E  1 22 ? -1.764  17.639  89.880   1.00 110.11 ? 63  LEU E C   1 
ATOM   3143 O  O   . LEU E  1 22 ? -1.857  17.090  88.783   1.00 108.19 ? 63  LEU E O   1 
ATOM   3144 C  CB  . LEU E  1 22 ? -0.202  16.251  91.291   1.00 104.90 ? 63  LEU E CB  1 
ATOM   3145 C  CG  . LEU E  1 22 ? 1.265   15.813  91.446   1.00 98.65  ? 63  LEU E CG  1 
ATOM   3146 C  CD1 . LEU E  1 22 ? 2.047   16.822  92.275   1.00 101.79 ? 63  LEU E CD1 1 
ATOM   3147 C  CD2 . LEU E  1 22 ? 1.316   14.435  92.088   1.00 97.46  ? 63  LEU E CD2 1 
ATOM   3148 N  N   . THR E  1 23 ? -2.777  18.280  90.447   1.00 110.06 ? 64  THR E N   1 
ATOM   3149 C  CA  . THR E  1 23 ? -4.059  18.369  89.774   1.00 113.44 ? 64  THR E CA  1 
ATOM   3150 C  C   . THR E  1 23 ? -3.968  19.456  88.706   1.00 115.27 ? 64  THR E C   1 
ATOM   3151 O  O   . THR E  1 23 ? -4.921  19.709  87.970   1.00 112.17 ? 64  THR E O   1 
ATOM   3152 C  CB  . THR E  1 23 ? -5.177  18.671  90.775   1.00 111.20 ? 64  THR E CB  1 
ATOM   3153 O  OG1 . THR E  1 23 ? -5.203  17.634  91.763   1.00 118.39 ? 64  THR E OG1 1 
ATOM   3154 C  CG2 . THR E  1 23 ? -6.527  18.716  90.079   1.00 112.60 ? 64  THR E CG2 1 
ATOM   3155 N  N   . THR E  1 24 ? -2.807  20.103  88.631   1.00 119.52 ? 65  THR E N   1 
ATOM   3156 C  CA  . THR E  1 24 ? -2.580  21.119  87.612   1.00 123.26 ? 65  THR E CA  1 
ATOM   3157 C  C   . THR E  1 24 ? -1.845  20.409  86.491   1.00 122.02 ? 65  THR E C   1 
ATOM   3158 O  O   . THR E  1 24 ? -1.878  20.837  85.338   1.00 118.91 ? 65  THR E O   1 
ATOM   3159 C  CB  . THR E  1 24 ? -1.730  22.299  88.118   1.00 121.31 ? 65  THR E CB  1 
ATOM   3160 O  OG1 . THR E  1 24 ? -0.672  21.817  88.949   1.00 126.06 ? 65  THR E OG1 1 
ATOM   3161 C  CG2 . THR E  1 24 ? -2.592  23.275  88.892   1.00 119.45 ? 65  THR E CG2 1 
ATOM   3162 N  N   . GLN E  1 25 ? -1.177  19.315  86.850   1.00 125.63 ? 66  GLN E N   1 
ATOM   3163 C  CA  . GLN E  1 25 ? -0.474  18.497  85.874   1.00 126.96 ? 66  GLN E CA  1 
ATOM   3164 C  C   . GLN E  1 25 ? -1.588  18.015  84.954   1.00 126.36 ? 66  GLN E C   1 
ATOM   3165 O  O   . GLN E  1 25 ? -1.457  18.030  83.733   1.00 126.79 ? 66  GLN E O   1 
ATOM   3166 C  CB  . GLN E  1 25 ? 0.163   17.259  86.525   1.00 133.38 ? 66  GLN E CB  1 
ATOM   3167 C  CG  . GLN E  1 25 ? 1.224   17.503  87.591   1.00 139.32 ? 66  GLN E CG  1 
ATOM   3168 C  CD  . GLN E  1 25 ? 1.745   16.194  88.183   1.00 143.32 ? 66  GLN E CD  1 
ATOM   3169 O  OE1 . GLN E  1 25 ? 0.964   15.320  88.566   1.00 143.32 ? 66  GLN E OE1 1 
ATOM   3170 N  NE2 . GLN E  1 25 ? 3.066   16.062  88.270   1.00 143.45 ? 66  GLN E NE2 1 
ATOM   3171 N  N   . SER E  1 26 ? -2.694  17.601  85.569   1.00 123.77 ? 67  SER E N   1 
ATOM   3172 C  CA  . SER E  1 26 ? -3.850  17.072  84.851   1.00 123.36 ? 67  SER E CA  1 
ATOM   3173 C  C   . SER E  1 26 ? -4.576  18.030  83.906   1.00 121.58 ? 67  SER E C   1 
ATOM   3174 O  O   . SER E  1 26 ? -4.700  17.729  82.720   1.00 120.41 ? 67  SER E O   1 
ATOM   3175 C  CB  . SER E  1 26 ? -4.845  16.471  85.846   1.00 119.27 ? 67  SER E CB  1 
ATOM   3176 O  OG  . SER E  1 26 ? -4.304  15.307  86.447   1.00 125.54 ? 67  SER E OG  1 
ATOM   3177 N  N   . GLN E  1 27 ? -5.075  19.156  84.419   1.00 120.81 ? 68  GLN E N   1 
ATOM   3178 C  CA  . GLN E  1 27 ? -5.770  20.135  83.572   1.00 121.24 ? 68  GLN E CA  1 
ATOM   3179 C  C   . GLN E  1 27 ? -4.921  20.295  82.323   1.00 122.75 ? 68  GLN E C   1 
ATOM   3180 O  O   . GLN E  1 27 ? -5.358  20.053  81.197   1.00 124.30 ? 68  GLN E O   1 
ATOM   3181 C  CB  . GLN E  1 27 ? -5.859  21.493  84.273   1.00 120.72 ? 68  GLN E CB  1 
ATOM   3182 C  CG  . GLN E  1 27 ? -7.245  21.901  84.742   1.00 122.18 ? 68  GLN E CG  1 
ATOM   3183 C  CD  . GLN E  1 27 ? -7.468  23.401  84.621   1.00 121.80 ? 68  GLN E CD  1 
ATOM   3184 O  OE1 . GLN E  1 27 ? -6.517  24.169  84.461   1.00 124.64 ? 68  GLN E OE1 1 
ATOM   3185 N  NE2 . GLN E  1 27 ? -8.724  23.825  84.700   1.00 119.58 ? 68  GLN E NE2 1 
ATOM   3186 N  N   . ASN E  1 28 ? -3.690  20.715  82.571   1.00 121.58 ? 69  ASN E N   1 
ATOM   3187 C  CA  . ASN E  1 28 ? -2.666  20.921  81.565   1.00 123.11 ? 69  ASN E CA  1 
ATOM   3188 C  C   . ASN E  1 28 ? -2.790  19.949  80.392   1.00 126.74 ? 69  ASN E C   1 
ATOM   3189 O  O   . ASN E  1 28 ? -3.110  20.337  79.267   1.00 129.43 ? 69  ASN E O   1 
ATOM   3190 C  CB  . ASN E  1 28 ? -1.303  20.717  82.232   1.00 122.05 ? 69  ASN E CB  1 
ATOM   3191 C  CG  . ASN E  1 28 ? -0.158  21.268  81.420   1.00 118.08 ? 69  ASN E CG  1 
ATOM   3192 O  OD1 . ASN E  1 28 ? -0.138  21.161  80.197   1.00 120.68 ? 69  ASN E OD1 1 
ATOM   3193 N  ND2 . ASN E  1 28 ? 0.819   21.851  82.105   1.00 112.34 ? 69  ASN E ND2 1 
ATOM   3194 N  N   . LEU E  1 29 ? -2.549  18.676  80.687   1.00 124.40 ? 70  LEU E N   1 
ATOM   3195 C  CA  . LEU E  1 29 ? -2.546  17.617  79.686   1.00 125.50 ? 70  LEU E CA  1 
ATOM   3196 C  C   . LEU E  1 29 ? -3.896  17.163  79.133   1.00 124.36 ? 70  LEU E C   1 
ATOM   3197 O  O   . LEU E  1 29 ? -3.957  16.568  78.055   1.00 123.71 ? 70  LEU E O   1 
ATOM   3198 C  CB  . LEU E  1 29 ? -1.755  16.431  80.244   1.00 121.24 ? 70  LEU E CB  1 
ATOM   3199 C  CG  . LEU E  1 29 ? -0.611  16.889  81.168   1.00 120.53 ? 70  LEU E CG  1 
ATOM   3200 C  CD1 . LEU E  1 29 ? 0.263   15.706  81.535   1.00 120.17 ? 70  LEU E CD1 1 
ATOM   3201 C  CD2 . LEU E  1 29 ? 0.221   17.979  80.495   1.00 121.95 ? 70  LEU E CD2 1 
ATOM   3202 N  N   . LEU E  1 30 ? -4.975  17.429  79.862   1.00 126.98 ? 71  LEU E N   1 
ATOM   3203 C  CA  . LEU E  1 30 ? -6.301  17.073  79.372   1.00 126.70 ? 71  LEU E CA  1 
ATOM   3204 C  C   . LEU E  1 30 ? -6.464  17.929  78.123   1.00 127.01 ? 71  LEU E C   1 
ATOM   3205 O  O   . LEU E  1 30 ? -6.921  17.462  77.079   1.00 125.14 ? 71  LEU E O   1 
ATOM   3206 C  CB  . LEU E  1 30 ? -7.379  17.455  80.389   1.00 128.61 ? 71  LEU E CB  1 
ATOM   3207 C  CG  . LEU E  1 30 ? -7.354  16.798  81.771   1.00 129.56 ? 71  LEU E CG  1 
ATOM   3208 C  CD1 . LEU E  1 30 ? -8.366  17.490  82.675   1.00 126.19 ? 71  LEU E CD1 1 
ATOM   3209 C  CD2 . LEU E  1 30 ? -7.663  15.314  81.650   1.00 130.88 ? 71  LEU E CD2 1 
ATOM   3210 N  N   . SER E  1 31 ? -6.066  19.192  78.254   1.00 128.62 ? 72  SER E N   1 
ATOM   3211 C  CA  . SER E  1 31 ? -6.138  20.157  77.164   1.00 127.29 ? 72  SER E CA  1 
ATOM   3212 C  C   . SER E  1 31 ? -5.274  19.730  75.983   1.00 126.15 ? 72  SER E C   1 
ATOM   3213 O  O   . SER E  1 31 ? -5.658  19.908  74.827   1.00 125.54 ? 72  SER E O   1 
ATOM   3214 C  CB  . SER E  1 31 ? -5.689  21.539  77.651   1.00 125.21 ? 72  SER E CB  1 
ATOM   3215 O  OG  . SER E  1 31 ? -6.589  22.064  78.613   1.00 123.67 ? 72  SER E OG  1 
ATOM   3216 N  N   . LYS E  1 32 ? -4.108  19.163  76.278   1.00 126.79 ? 73  LYS E N   1 
ATOM   3217 C  CA  . LYS E  1 32 ? -3.196  18.716  75.234   1.00 123.78 ? 73  LYS E CA  1 
ATOM   3218 C  C   . LYS E  1 32 ? -3.716  17.535  74.424   1.00 125.95 ? 73  LYS E C   1 
ATOM   3219 O  O   . LYS E  1 32 ? -3.415  17.417  73.237   1.00 127.80 ? 73  LYS E O   1 
ATOM   3220 C  CB  . LYS E  1 32 ? -1.831  18.377  75.833   1.00 122.85 ? 73  LYS E CB  1 
ATOM   3221 C  CG  . LYS E  1 32 ? -1.028  19.608  76.214   1.00 118.65 ? 73  LYS E CG  1 
ATOM   3222 C  CD  . LYS E  1 32 ? 0.373   19.243  76.667   1.00 112.35 ? 73  LYS E CD  1 
ATOM   3223 C  CE  . LYS E  1 32 ? 1.225   20.485  76.859   1.00 111.52 ? 73  LYS E CE  1 
ATOM   3224 N  NZ  . LYS E  1 32 ? 0.610   21.430  77.829   1.00 101.42 ? 73  LYS E NZ  1 
ATOM   3225 N  N   . LEU E  1 33 ? -4.493  16.659  75.053   1.00 127.53 ? 74  LEU E N   1 
ATOM   3226 C  CA  . LEU E  1 33 ? -5.035  15.515  74.333   1.00 126.81 ? 74  LEU E CA  1 
ATOM   3227 C  C   . LEU E  1 33 ? -6.150  16.031  73.427   1.00 126.19 ? 74  LEU E C   1 
ATOM   3228 O  O   . LEU E  1 33 ? -6.416  15.471  72.363   1.00 124.84 ? 74  LEU E O   1 
ATOM   3229 C  CB  . LEU E  1 33 ? -5.570  14.465  75.311   1.00 130.46 ? 74  LEU E CB  1 
ATOM   3230 C  CG  . LEU E  1 33 ? -5.611  13.032  74.767   1.00 129.98 ? 74  LEU E CG  1 
ATOM   3231 C  CD1 . LEU E  1 33 ? -4.216  12.613  74.317   1.00 130.29 ? 74  LEU E CD1 1 
ATOM   3232 C  CD2 . LEU E  1 33 ? -6.128  12.085  75.841   1.00 127.32 ? 74  LEU E CD2 1 
ATOM   3233 N  N   . GLU E  1 34 ? -6.798  17.107  73.862   1.00 127.99 ? 75  GLU E N   1 
ATOM   3234 C  CA  . GLU E  1 34 ? -7.857  17.728  73.079   1.00 130.52 ? 75  GLU E CA  1 
ATOM   3235 C  C   . GLU E  1 34 ? -7.164  18.337  71.865   1.00 130.06 ? 75  GLU E C   1 
ATOM   3236 O  O   . GLU E  1 34 ? -7.691  18.315  70.752   1.00 130.07 ? 75  GLU E O   1 
ATOM   3237 C  CB  . GLU E  1 34 ? -8.542  18.828  73.888   1.00 135.05 ? 75  GLU E CB  1 
ATOM   3238 C  CG  . GLU E  1 34 ? -9.133  18.354  75.203   1.00 139.94 ? 75  GLU E CG  1 
ATOM   3239 C  CD  . GLU E  1 34 ? -9.633  19.503  76.059   1.00 141.57 ? 75  GLU E CD  1 
ATOM   3240 O  OE1 . GLU E  1 34 ? -8.839  20.426  76.337   1.00 137.71 ? 75  GLU E OE1 1 
ATOM   3241 O  OE2 . GLU E  1 34 ? -10.817 19.484  76.457   1.00 145.72 ? 75  GLU E OE2 1 
ATOM   3242 N  N   . LEU E  1 35 ? -5.972  18.881  72.099   1.00 129.86 ? 76  LEU E N   1 
ATOM   3243 C  CA  . LEU E  1 35 ? -5.174  19.481  71.037   1.00 128.18 ? 76  LEU E CA  1 
ATOM   3244 C  C   . LEU E  1 35 ? -4.956  18.416  69.972   1.00 129.32 ? 76  LEU E C   1 
ATOM   3245 O  O   . LEU E  1 35 ? -4.968  18.699  68.775   1.00 131.32 ? 76  LEU E O   1 
ATOM   3246 C  CB  . LEU E  1 35 ? -3.817  19.939  71.582   1.00 129.41 ? 76  LEU E CB  1 
ATOM   3247 C  CG  . LEU E  1 35 ? -3.784  21.044  72.642   1.00 130.34 ? 76  LEU E CG  1 
ATOM   3248 C  CD1 . LEU E  1 35 ? -2.368  21.199  73.179   1.00 131.91 ? 76  LEU E CD1 1 
ATOM   3249 C  CD2 . LEU E  1 35 ? -4.273  22.349  72.037   1.00 129.12 ? 76  LEU E CD2 1 
ATOM   3250 N  N   . ALA E  1 36 ? -4.760  17.185  70.430   1.00 129.72 ? 77  ALA E N   1 
ATOM   3251 C  CA  . ALA E  1 36 ? -4.533  16.051  69.548   1.00 127.57 ? 77  ALA E CA  1 
ATOM   3252 C  C   . ALA E  1 36 ? -5.562  15.964  68.433   1.00 126.61 ? 77  ALA E C   1 
ATOM   3253 O  O   . ALA E  1 36 ? -5.218  16.070  67.257   1.00 127.84 ? 77  ALA E O   1 
ATOM   3254 C  CB  . ALA E  1 36 ? -4.538  14.758  70.353   1.00 129.48 ? 77  ALA E CB  1 
ATOM   3255 N  N   . GLN E  1 37 ? -6.826  15.775  68.801   1.00 127.88 ? 78  GLN E N   1 
ATOM   3256 C  CA  . GLN E  1 37 ? -7.878  15.646  67.802   1.00 129.09 ? 78  GLN E CA  1 
ATOM   3257 C  C   . GLN E  1 37 ? -8.062  16.899  66.963   1.00 125.98 ? 78  GLN E C   1 
ATOM   3258 O  O   . GLN E  1 37 ? -8.335  16.808  65.768   1.00 127.77 ? 78  GLN E O   1 
ATOM   3259 C  CB  . GLN E  1 37 ? -9.212  15.266  68.451   1.00 125.70 ? 78  GLN E CB  1 
ATOM   3260 C  CG  . GLN E  1 37 ? -10.269 14.849  67.430   1.00 130.36 ? 78  GLN E CG  1 
ATOM   3261 C  CD  . GLN E  1 37 ? -9.991  13.487  66.799   1.00 130.13 ? 78  GLN E CD  1 
ATOM   3262 O  OE1 . GLN E  1 37 ? -8.837  13.106  66.584   1.00 130.22 ? 78  GLN E OE1 1 
ATOM   3263 N  NE2 . GLN E  1 37 ? -11.056 12.757  66.485   1.00 127.76 ? 78  GLN E NE2 1 
ATOM   3264 N  N   . SER E  1 38 ? -7.918  18.067  67.580   1.00 126.16 ? 79  SER E N   1 
ATOM   3265 C  CA  . SER E  1 38 ? -8.064  19.314  66.845   1.00 123.88 ? 79  SER E CA  1 
ATOM   3266 C  C   . SER E  1 38 ? -7.113  19.225  65.654   1.00 123.56 ? 79  SER E C   1 
ATOM   3267 O  O   . SER E  1 38 ? -7.521  19.338  64.497   1.00 122.25 ? 79  SER E O   1 
ATOM   3268 C  CB  . SER E  1 38 ? -7.687  20.499  67.738   1.00 122.95 ? 79  SER E CB  1 
ATOM   3269 O  OG  . SER E  1 38 ? -8.198  21.712  67.214   1.00 121.57 ? 79  SER E OG  1 
ATOM   3270 N  N   . LYS E  1 39 ? -5.842  18.988  65.959   1.00 122.30 ? 80  LYS E N   1 
ATOM   3271 C  CA  . LYS E  1 39 ? -4.802  18.867  64.947   1.00 118.80 ? 80  LYS E CA  1 
ATOM   3272 C  C   . LYS E  1 39 ? -5.105  17.712  63.999   1.00 115.95 ? 80  LYS E C   1 
ATOM   3273 O  O   . LYS E  1 39 ? -5.284  17.913  62.798   1.00 117.83 ? 80  LYS E O   1 
ATOM   3274 C  CB  . LYS E  1 39 ? -3.450  18.624  65.621   1.00 119.16 ? 80  LYS E CB  1 
ATOM   3275 C  CG  . LYS E  1 39 ? -2.251  18.815  64.709   1.00 122.18 ? 80  LYS E CG  1 
ATOM   3276 C  CD  . LYS E  1 39 ? -2.073  20.280  64.344   1.00 121.68 ? 80  LYS E CD  1 
ATOM   3277 C  CE  . LYS E  1 39 ? -0.812  20.494  63.524   1.00 119.49 ? 80  LYS E CE  1 
ATOM   3278 N  NZ  . LYS E  1 39 ? -0.582  21.935  63.223   1.00 118.08 ? 80  LYS E NZ  1 
ATOM   3279 N  N   . GLU E  1 40 ? -5.166  16.506  64.556   1.00 114.61 ? 81  GLU E N   1 
ATOM   3280 C  CA  . GLU E  1 40 ? -5.423  15.297  63.782   1.00 111.44 ? 81  GLU E CA  1 
ATOM   3281 C  C   . GLU E  1 40 ? -6.694  15.330  62.943   1.00 106.44 ? 81  GLU E C   1 
ATOM   3282 O  O   . GLU E  1 40 ? -6.700  14.860  61.804   1.00 96.98  ? 81  GLU E O   1 
ATOM   3283 C  CB  . GLU E  1 40 ? -5.463  14.082  64.712   1.00 112.99 ? 81  GLU E CB  1 
ATOM   3284 C  CG  . GLU E  1 40 ? -4.124  13.742  65.349   1.00 119.62 ? 81  GLU E CG  1 
ATOM   3285 C  CD  . GLU E  1 40 ? -4.202  12.527  66.253   1.00 122.12 ? 81  GLU E CD  1 
ATOM   3286 O  OE1 . GLU E  1 40 ? -3.149  12.098  66.770   1.00 122.87 ? 81  GLU E OE1 1 
ATOM   3287 O  OE2 . GLU E  1 40 ? -5.320  12.001  66.448   1.00 121.31 ? 81  GLU E OE2 1 
ATOM   3288 N  N   . SER E  1 41 ? -7.771  15.871  63.501   1.00 105.13 ? 82  SER E N   1 
ATOM   3289 C  CA  . SER E  1 41 ? -9.031  15.938  62.771   1.00 107.99 ? 82  SER E CA  1 
ATOM   3290 C  C   . SER E  1 41 ? -8.890  16.913  61.612   1.00 106.64 ? 82  SER E C   1 
ATOM   3291 O  O   . SER E  1 41 ? -9.360  16.644  60.507   1.00 108.06 ? 82  SER E O   1 
ATOM   3292 C  CB  . SER E  1 41 ? -10.170 16.376  63.693   1.00 103.89 ? 82  SER E CB  1 
ATOM   3293 O  OG  . SER E  1 41 ? -11.425 16.216  63.057   1.00 110.02 ? 82  SER E OG  1 
ATOM   3294 N  N   . LYS E  1 42 ? -8.248  18.049  61.869   1.00 109.65 ? 83  LYS E N   1 
ATOM   3295 C  CA  . LYS E  1 42 ? -8.019  19.037  60.823   1.00 108.19 ? 83  LYS E CA  1 
ATOM   3296 C  C   . LYS E  1 42 ? -7.293  18.302  59.704   1.00 106.64 ? 83  LYS E C   1 
ATOM   3297 O  O   . LYS E  1 42 ? -7.705  18.348  58.545   1.00 105.79 ? 83  LYS E O   1 
ATOM   3298 C  CB  . LYS E  1 42 ? -7.130  20.176  61.331   1.00 109.94 ? 83  LYS E CB  1 
ATOM   3299 C  CG  . LYS E  1 42 ? -7.846  21.491  61.613   1.00 120.43 ? 83  LYS E CG  1 
ATOM   3300 C  CD  . LYS E  1 42 ? -8.700  21.428  62.869   1.00 121.25 ? 83  LYS E CD  1 
ATOM   3301 C  CE  . LYS E  1 42 ? -9.192  22.816  63.265   1.00 118.40 ? 83  LYS E CE  1 
ATOM   3302 N  NZ  . LYS E  1 42 ? -8.066  23.747  63.577   1.00 113.19 ? 83  LYS E NZ  1 
ATOM   3303 N  N   . LEU E  1 43 ? -6.210  17.619  60.068   1.00 107.97 ? 84  LEU E N   1 
ATOM   3304 C  CA  . LEU E  1 43 ? -5.425  16.862  59.103   1.00 105.95 ? 84  LEU E CA  1 
ATOM   3305 C  C   . LEU E  1 43 ? -6.323  15.902  58.337   1.00 109.71 ? 84  LEU E C   1 
ATOM   3306 O  O   . LEU E  1 43 ? -6.369  15.928  57.109   1.00 111.14 ? 84  LEU E O   1 
ATOM   3307 C  CB  . LEU E  1 43 ? -4.322  16.067  59.811   1.00 104.60 ? 84  LEU E CB  1 
ATOM   3308 C  CG  . LEU E  1 43 ? -3.166  16.851  60.435   1.00 110.17 ? 84  LEU E CG  1 
ATOM   3309 C  CD1 . LEU E  1 43 ? -2.202  15.898  61.133   1.00 110.45 ? 84  LEU E CD1 1 
ATOM   3310 C  CD2 . LEU E  1 43 ? -2.448  17.634  59.351   1.00 117.61 ? 84  LEU E CD2 1 
ATOM   3311 N  N   . LEU E  1 44 ? -7.043  15.064  59.075   1.00 108.68 ? 85  LEU E N   1 
ATOM   3312 C  CA  . LEU E  1 44 ? -7.938  14.080  58.479   1.00 108.50 ? 85  LEU E CA  1 
ATOM   3313 C  C   . LEU E  1 44 ? -8.845  14.715  57.432   1.00 105.69 ? 85  LEU E C   1 
ATOM   3314 O  O   . LEU E  1 44 ? -8.873  14.289  56.278   1.00 106.39 ? 85  LEU E O   1 
ATOM   3315 C  CB  . LEU E  1 44 ? -8.803  13.432  59.562   1.00 113.29 ? 85  LEU E CB  1 
ATOM   3316 C  CG  . LEU E  1 44 ? -9.308  12.022  59.256   1.00 114.47 ? 85  LEU E CG  1 
ATOM   3317 C  CD1 . LEU E  1 44 ? -8.164  11.056  59.475   1.00 113.85 ? 85  LEU E CD1 1 
ATOM   3318 C  CD2 . LEU E  1 44 ? -10.473 11.657  60.162   1.00 114.32 ? 85  LEU E CD2 1 
ATOM   3319 N  N   . GLU E  1 45 ? -9.585  15.737  57.848   1.00 99.60  ? 86  GLU E N   1 
ATOM   3320 C  CA  . GLU E  1 45 ? -10.507 16.436  56.964   1.00 99.15  ? 86  GLU E CA  1 
ATOM   3321 C  C   . GLU E  1 45 ? -9.812  16.962  55.715   1.00 102.15 ? 86  GLU E C   1 
ATOM   3322 O  O   . GLU E  1 45 ? -10.229 16.669  54.595   1.00 106.19 ? 86  GLU E O   1 
ATOM   3323 C  CB  . GLU E  1 45 ? -11.158 17.603  57.703   1.00 103.68 ? 86  GLU E CB  1 
ATOM   3324 C  CG  . GLU E  1 45 ? -11.855 17.213  58.989   1.00 109.01 ? 86  GLU E CG  1 
ATOM   3325 C  CD  . GLU E  1 45 ? -12.422 18.411  59.722   1.00 117.17 ? 86  GLU E CD  1 
ATOM   3326 O  OE1 . GLU E  1 45 ? -12.156 19.553  59.286   1.00 114.17 ? 86  GLU E OE1 1 
ATOM   3327 O  OE2 . GLU E  1 45 ? -13.127 18.212  60.736   1.00 116.72 ? 86  GLU E OE2 1 
ATOM   3328 N  N   . ASN E  1 46 ? -8.755  17.745  55.913   1.00 93.95  ? 87  ASN E N   1 
ATOM   3329 C  CA  . ASN E  1 46 ? -8.015  18.314  54.794   1.00 87.17  ? 87  ASN E CA  1 
ATOM   3330 C  C   . ASN E  1 46 ? -7.498  17.235  53.860   1.00 82.18  ? 87  ASN E C   1 
ATOM   3331 O  O   . ASN E  1 46 ? -7.609  17.353  52.640   1.00 75.53  ? 87  ASN E O   1 
ATOM   3332 C  CB  . ASN E  1 46 ? -6.838  19.152  55.295   1.00 87.82  ? 87  ASN E CB  1 
ATOM   3333 C  CG  . ASN E  1 46 ? -7.276  20.298  56.178   1.00 89.26  ? 87  ASN E CG  1 
ATOM   3334 O  OD1 . ASN E  1 46 ? -8.382  20.816  56.036   1.00 91.06  ? 87  ASN E OD1 1 
ATOM   3335 N  ND2 . ASN E  1 46 ? -6.401  20.713  57.087   1.00 93.86  ? 87  ASN E ND2 1 
ATOM   3336 N  N   . LEU E  1 47 ? -6.923  16.188  54.442   1.00 77.22  ? 88  LEU E N   1 
ATOM   3337 C  CA  . LEU E  1 47 ? -6.382  15.086  53.665   1.00 75.98  ? 88  LEU E CA  1 
ATOM   3338 C  C   . LEU E  1 47 ? -7.468  14.455  52.803   1.00 75.33  ? 88  LEU E C   1 
ATOM   3339 O  O   . LEU E  1 47 ? -7.235  14.151  51.632   1.00 59.47  ? 88  LEU E O   1 
ATOM   3340 C  CB  . LEU E  1 47 ? -5.759  14.043  54.597   1.00 82.21  ? 88  LEU E CB  1 
ATOM   3341 C  CG  . LEU E  1 47 ? -4.539  14.531  55.386   1.00 86.00  ? 88  LEU E CG  1 
ATOM   3342 C  CD1 . LEU E  1 47 ? -4.099  13.459  56.369   1.00 91.95  ? 88  LEU E CD1 1 
ATOM   3343 C  CD2 . LEU E  1 47 ? -3.408  14.884  54.425   1.00 92.36  ? 88  LEU E CD2 1 
ATOM   3344 N  N   . ASN E  1 48 ? -8.653  14.262  53.378   1.00 68.98  ? 89  ASN E N   1 
ATOM   3345 C  CA  . ASN E  1 48 ? -9.761  13.685  52.627   1.00 71.31  ? 89  ASN E CA  1 
ATOM   3346 C  C   . ASN E  1 48 ? -10.251 14.711  51.615   1.00 64.82  ? 89  ASN E C   1 
ATOM   3347 O  O   . ASN E  1 48 ? -10.779 14.351  50.563   1.00 66.21  ? 89  ASN E O   1 
ATOM   3348 C  CB  . ASN E  1 48 ? -10.903 13.261  53.560   1.00 72.76  ? 89  ASN E CB  1 
ATOM   3349 C  CG  . ASN E  1 48 ? -10.527 12.076  54.440   1.00 84.55  ? 89  ASN E CG  1 
ATOM   3350 O  OD1 . ASN E  1 48 ? -9.692  11.248  54.064   1.00 78.99  ? 89  ASN E OD1 1 
ATOM   3351 N  ND2 . ASN E  1 48 ? -11.156 11.979  55.608   1.00 86.50  ? 89  ASN E ND2 1 
ATOM   3352 N  N   . LEU E  1 49 ? -10.083 15.991  51.942   1.00 59.64  ? 90  LEU E N   1 
ATOM   3353 C  CA  . LEU E  1 49 ? -10.466 17.065  51.030   1.00 59.36  ? 90  LEU E CA  1 
ATOM   3354 C  C   . LEU E  1 49 ? -9.516  16.959  49.846   1.00 57.61  ? 90  LEU E C   1 
ATOM   3355 O  O   . LEU E  1 49 ? -9.930  16.952  48.692   1.00 55.33  ? 90  LEU E O   1 
ATOM   3356 C  CB  . LEU E  1 49 ? -10.290 18.430  51.689   1.00 56.52  ? 90  LEU E CB  1 
ATOM   3357 C  CG  . LEU E  1 49 ? -11.334 18.882  52.704   1.00 72.85  ? 90  LEU E CG  1 
ATOM   3358 C  CD1 . LEU E  1 49 ? -10.922 20.215  53.315   1.00 64.44  ? 90  LEU E CD1 1 
ATOM   3359 C  CD2 . LEU E  1 49 ? -12.679 19.008  52.011   1.00 65.02  ? 90  LEU E CD2 1 
ATOM   3360 N  N   . LEU E  1 50 ? -8.228  16.887  50.158   1.00 55.34  ? 91  LEU E N   1 
ATOM   3361 C  CA  . LEU E  1 50 ? -7.201  16.749  49.147   1.00 58.20  ? 91  LEU E CA  1 
ATOM   3362 C  C   . LEU E  1 50 ? -7.425  15.417  48.451   1.00 61.03  ? 91  LEU E C   1 
ATOM   3363 O  O   . LEU E  1 50 ? -7.527  15.349  47.226   1.00 63.69  ? 91  LEU E O   1 
ATOM   3364 C  CB  . LEU E  1 50 ? -5.818  16.779  49.800   1.00 53.72  ? 91  LEU E CB  1 
ATOM   3365 C  CG  . LEU E  1 50 ? -5.425  18.153  50.337   1.00 56.67  ? 91  LEU E CG  1 
ATOM   3366 C  CD1 . LEU E  1 50 ? -4.065  18.082  51.000   1.00 51.39  ? 91  LEU E CD1 1 
ATOM   3367 C  CD2 . LEU E  1 50 ? -5.404  19.149  49.184   1.00 70.02  ? 91  LEU E CD2 1 
ATOM   3368 N  N   . LYS E  1 51 ? -7.512  14.360  49.250   1.00 61.97  ? 92  LYS E N   1 
ATOM   3369 C  CA  . LYS E  1 51 ? -7.733  13.022  48.726   1.00 61.91  ? 92  LYS E CA  1 
ATOM   3370 C  C   . LYS E  1 51 ? -8.882  13.036  47.725   1.00 54.46  ? 92  LYS E C   1 
ATOM   3371 O  O   . LYS E  1 51 ? -8.840  12.342  46.715   1.00 55.57  ? 92  LYS E O   1 
ATOM   3372 C  CB  . LYS E  1 51 ? -8.061  12.054  49.868   1.00 62.76  ? 92  LYS E CB  1 
ATOM   3373 C  CG  . LYS E  1 51 ? -8.537  10.677  49.423   1.00 68.59  ? 92  LYS E CG  1 
ATOM   3374 C  CD  . LYS E  1 51 ? -9.371  10.026  50.521   1.00 76.98  ? 92  LYS E CD  1 
ATOM   3375 C  CE  . LYS E  1 51 ? -9.806  8.617   50.141   1.00 84.20  ? 92  LYS E CE  1 
ATOM   3376 N  NZ  . LYS E  1 51 ? -10.155 7.779   51.334   1.00 79.47  ? 92  LYS E NZ  1 
ATOM   3377 N  N   . ASN E  1 52 ? -9.901  13.840  48.005   1.00 54.54  ? 93  ASN E N   1 
ATOM   3378 C  CA  . ASN E  1 52 ? -11.062 13.915  47.131   1.00 49.89  ? 93  ASN E CA  1 
ATOM   3379 C  C   . ASN E  1 52 ? -10.858 14.673  45.834   1.00 49.26  ? 93  ASN E C   1 
ATOM   3380 O  O   . ASN E  1 52 ? -11.371 14.248  44.801   1.00 50.26  ? 93  ASN E O   1 
ATOM   3381 C  CB  . ASN E  1 52 ? -12.262 14.496  47.877   1.00 60.04  ? 93  ASN E CB  1 
ATOM   3382 C  CG  . ASN E  1 52 ? -12.899 13.488  48.810   1.00 67.63  ? 93  ASN E CG  1 
ATOM   3383 O  OD1 . ASN E  1 52 ? -12.819 12.282  48.575   1.00 78.58  ? 93  ASN E OD1 1 
ATOM   3384 N  ND2 . ASN E  1 52 ? -13.553 13.971  49.858   1.00 75.51  ? 93  ASN E ND2 1 
ATOM   3385 N  N   . GLU E  1 53 ? -10.134 15.790  45.861   1.00 41.02  ? 94  GLU E N   1 
ATOM   3386 C  CA  . GLU E  1 53 ? -9.914  16.514  44.614   1.00 55.73  ? 94  GLU E CA  1 
ATOM   3387 C  C   . GLU E  1 53 ? -8.863  15.765  43.796   1.00 55.47  ? 94  GLU E C   1 
ATOM   3388 O  O   . GLU E  1 53 ? -8.941  15.726  42.570   1.00 58.27  ? 94  GLU E O   1 
ATOM   3389 C  CB  . GLU E  1 53 ? -9.460  17.951  44.868   1.00 57.91  ? 94  GLU E CB  1 
ATOM   3390 C  CG  . GLU E  1 53 ? -9.337  18.807  43.591   1.00 71.85  ? 94  GLU E CG  1 
ATOM   3391 C  CD  . GLU E  1 53 ? -10.671 19.047  42.891   1.00 70.87  ? 94  GLU E CD  1 
ATOM   3392 O  OE1 . GLU E  1 53 ? -11.707 19.095  43.586   1.00 80.02  ? 94  GLU E OE1 1 
ATOM   3393 O  OE2 . GLU E  1 53 ? -10.683 19.210  41.651   1.00 57.58  ? 94  GLU E OE2 1 
ATOM   3394 N  N   . ASN E  1 54 ? -7.891  15.168  44.483   1.00 49.22  ? 95  ASN E N   1 
ATOM   3395 C  CA  . ASN E  1 54 ? -6.853  14.391  43.823   1.00 39.97  ? 95  ASN E CA  1 
ATOM   3396 C  C   . ASN E  1 54 ? -7.569  13.353  42.955   1.00 40.86  ? 95  ASN E C   1 
ATOM   3397 O  O   . ASN E  1 54 ? -7.208  13.124  41.793   1.00 39.70  ? 95  ASN E O   1 
ATOM   3398 C  CB  . ASN E  1 54 ? -5.968  13.716  44.881   1.00 45.84  ? 95  ASN E CB  1 
ATOM   3399 C  CG  . ASN E  1 54 ? -4.785  12.973  44.284   1.00 65.39  ? 95  ASN E CG  1 
ATOM   3400 O  OD1 . ASN E  1 54 ? -4.155  13.437  43.338   1.00 72.00  ? 95  ASN E OD1 1 
ATOM   3401 N  ND2 . ASN E  1 54 ? -4.462  11.821  44.859   1.00 69.71  ? 95  ASN E ND2 1 
ATOM   3402 N  N   . GLU E  1 55 ? -8.625  12.759  43.501   1.00 47.26  ? 96  GLU E N   1 
ATOM   3403 C  CA  . GLU E  1 55 ? -9.353  11.751  42.751   1.00 39.52  ? 96  GLU E CA  1 
ATOM   3404 C  C   . GLU E  1 55 ? -10.208 12.323  41.622   1.00 45.00  ? 96  GLU E C   1 
ATOM   3405 O  O   . GLU E  1 55 ? -10.424 11.661  40.608   1.00 50.41  ? 96  GLU E O   1 
ATOM   3406 C  CB  . GLU E  1 55 ? -10.205 10.905  43.679   1.00 52.10  ? 96  GLU E CB  1 
ATOM   3407 C  CG  . GLU E  1 55 ? -10.628 9.621   43.023   1.00 66.50  ? 96  GLU E CG  1 
ATOM   3408 C  CD  . GLU E  1 55 ? -11.230 8.643   43.996   1.00 75.17  ? 96  GLU E CD  1 
ATOM   3409 O  OE1 . GLU E  1 55 ? -11.001 8.787   45.215   1.00 78.58  ? 96  GLU E OE1 1 
ATOM   3410 O  OE2 . GLU E  1 55 ? -11.926 7.716   43.537   1.00 83.98  ? 96  GLU E OE2 1 
ATOM   3411 N  N   . ASN E  1 56 ? -10.695 13.547  41.787   1.00 44.64  ? 97  ASN E N   1 
ATOM   3412 C  CA  . ASN E  1 56 ? -11.468 14.157  40.724   1.00 36.81  ? 97  ASN E CA  1 
ATOM   3413 C  C   . ASN E  1 56 ? -10.491 14.411  39.583   1.00 30.96  ? 97  ASN E C   1 
ATOM   3414 O  O   . ASN E  1 56 ? -10.812 14.188  38.420   1.00 38.75  ? 97  ASN E O   1 
ATOM   3415 C  CB  . ASN E  1 56 ? -12.097 15.474  41.179   1.00 40.15  ? 97  ASN E CB  1 
ATOM   3416 C  CG  . ASN E  1 56 ? -12.909 16.130  40.083   1.00 50.04  ? 97  ASN E CG  1 
ATOM   3417 O  OD1 . ASN E  1 56 ? -13.731 15.481  39.433   1.00 44.51  ? 97  ASN E OD1 1 
ATOM   3418 N  ND2 . ASN E  1 56 ? -12.686 17.421  39.869   1.00 53.10  ? 97  ASN E ND2 1 
ATOM   3419 N  N   . LEU E  1 57 ? -9.289  14.868  39.929   1.00 32.19  ? 98  LEU E N   1 
ATOM   3420 C  CA  . LEU E  1 57 ? -8.252  15.132  38.936   1.00 23.61  ? 98  LEU E CA  1 
ATOM   3421 C  C   . LEU E  1 57 ? -7.758  13.841  38.270   1.00 28.03  ? 98  LEU E C   1 
ATOM   3422 O  O   . LEU E  1 57 ? -7.337  13.861  37.124   1.00 36.10  ? 98  LEU E O   1 
ATOM   3423 C  CB  . LEU E  1 57 ? -7.069  15.857  39.581   1.00 25.35  ? 98  LEU E CB  1 
ATOM   3424 C  CG  . LEU E  1 57 ? -7.316  17.250  40.162   1.00 26.44  ? 98  LEU E CG  1 
ATOM   3425 C  CD1 . LEU E  1 57 ? -6.029  17.788  40.756   1.00 29.11  ? 98  LEU E CD1 1 
ATOM   3426 C  CD2 . LEU E  1 57 ? -7.816  18.182  39.073   1.00 25.62  ? 98  LEU E CD2 1 
ATOM   3427 N  N   . ASN E  1 58 ? -7.799  12.715  38.974   1.00 28.16  ? 99  ASN E N   1 
ATOM   3428 C  CA  . ASN E  1 58 ? -7.329  11.472  38.356   1.00 27.06  ? 99  ASN E CA  1 
ATOM   3429 C  C   . ASN E  1 58 ? -8.293  10.987  37.305   1.00 20.24  ? 99  ASN E C   1 
ATOM   3430 O  O   . ASN E  1 58 ? -7.881  10.458  36.272   1.00 36.15  ? 99  ASN E O   1 
ATOM   3431 C  CB  . ASN E  1 58 ? -7.117  10.369  39.389   1.00 31.55  ? 99  ASN E CB  1 
ATOM   3432 C  CG  . ASN E  1 58 ? -5.862  10.582  40.212   1.00 34.31  ? 99  ASN E CG  1 
ATOM   3433 O  OD1 . ASN E  1 58 ? -4.935  11.290  39.793   1.00 42.15  ? 99  ASN E OD1 1 
ATOM   3434 N  ND2 . ASN E  1 58 ? -5.812  9.956   41.377   1.00 38.82  ? 99  ASN E ND2 1 
ATOM   3435 N  N   . SER E  1 59 ? -9.582  11.183  37.558   1.00 28.28  ? 100 SER E N   1 
ATOM   3436 C  CA  . SER E  1 59 ? -10.618 10.784  36.611   1.00 24.01  ? 100 SER E CA  1 
ATOM   3437 C  C   . SER E  1 59 ? -10.612 11.635  35.358   1.00 29.16  ? 100 SER E C   1 
ATOM   3438 O  O   . SER E  1 59 ? -10.917 11.143  34.273   1.00 41.51  ? 100 SER E O   1 
ATOM   3439 C  CB  . SER E  1 59 ? -11.991 10.881  37.256   1.00 44.28  ? 100 SER E CB  1 
ATOM   3440 O  OG  . SER E  1 59 ? -12.252 9.715   38.026   1.00 63.60  ? 100 SER E OG  1 
ATOM   3441 N  N   . ILE E  1 60 ? -10.297 12.922  35.511   1.00 27.20  ? 101 ILE E N   1 
ATOM   3442 C  CA  . ILE E  1 60 ? -10.244 13.816  34.365   1.00 16.28  ? 101 ILE E CA  1 
ATOM   3443 C  C   . ILE E  1 60 ? -9.082  13.347  33.501   1.00 12.49  ? 101 ILE E C   1 
ATOM   3444 O  O   . ILE E  1 60 ? -9.201  13.260  32.289   1.00 28.77  ? 101 ILE E O   1 
ATOM   3445 C  CB  . ILE E  1 60 ? -10.000 15.289  34.796   1.00 22.15  ? 101 ILE E CB  1 
ATOM   3446 C  CG1 . ILE E  1 60 ? -11.192 15.809  35.592   1.00 9.10   ? 101 ILE E CG1 1 
ATOM   3447 C  CG2 . ILE E  1 60 ? -9.847  16.169  33.573   1.00 13.67  ? 101 ILE E CG2 1 
ATOM   3448 C  CD1 . ILE E  1 60 ? -10.957 17.161  36.198   1.00 28.39  ? 101 ILE E CD1 1 
ATOM   3449 N  N   . PHE E  1 61 ? -7.959  13.041  34.145   1.00 25.18  ? 102 PHE E N   1 
ATOM   3450 C  CA  . PHE E  1 61 ? -6.761  12.570  33.442   1.00 22.98  ? 102 PHE E CA  1 
ATOM   3451 C  C   . PHE E  1 61 ? -7.078  11.328  32.609   1.00 25.40  ? 102 PHE E C   1 
ATOM   3452 O  O   . PHE E  1 61 ? -6.767  11.263  31.418   1.00 31.49  ? 102 PHE E O   1 
ATOM   3453 C  CB  . PHE E  1 61 ? -5.677  12.225  34.449   1.00 26.08  ? 102 PHE E CB  1 
ATOM   3454 C  CG  . PHE E  1 61 ? -4.289  12.361  33.920   1.00 20.02  ? 102 PHE E CG  1 
ATOM   3455 C  CD1 . PHE E  1 61 ? -4.038  12.423  32.554   1.00 29.12  ? 102 PHE E CD1 1 
ATOM   3456 C  CD2 . PHE E  1 61 ? -3.223  12.424  34.803   1.00 28.25  ? 102 PHE E CD2 1 
ATOM   3457 C  CE1 . PHE E  1 61 ? -2.742  12.548  32.075   1.00 26.14  ? 102 PHE E CE1 1 
ATOM   3458 C  CE2 . PHE E  1 61 ? -1.923  12.549  34.350   1.00 33.53  ? 102 PHE E CE2 1 
ATOM   3459 C  CZ  . PHE E  1 61 ? -1.673  12.614  32.974   1.00 23.74  ? 102 PHE E CZ  1 
ATOM   3460 N  N   . GLU E  1 62 ? -7.712  10.342  33.232   1.00 30.79  ? 103 GLU E N   1 
ATOM   3461 C  CA  . GLU E  1 62 ? -8.051  9.117   32.511   1.00 34.84  ? 103 GLU E CA  1 
ATOM   3462 C  C   . GLU E  1 62 ? -8.965  9.384   31.317   1.00 24.46  ? 103 GLU E C   1 
ATOM   3463 O  O   . GLU E  1 62 ? -8.897  8.667   30.325   1.00 34.73  ? 103 GLU E O   1 
ATOM   3464 C  CB  . GLU E  1 62 ? -8.690  8.091   33.456   1.00 32.68  ? 103 GLU E CB  1 
ATOM   3465 C  CG  . GLU E  1 62 ? -7.719  7.538   34.489   1.00 39.82  ? 103 GLU E CG  1 
ATOM   3466 C  CD  . GLU E  1 62 ? -8.348  6.479   35.375   1.00 57.86  ? 103 GLU E CD  1 
ATOM   3467 O  OE1 . GLU E  1 62 ? -8.725  5.414   34.848   1.00 63.84  ? 103 GLU E OE1 1 
ATOM   3468 O  OE2 . GLU E  1 62 ? -8.466  6.710   36.597   1.00 64.87  ? 103 GLU E OE2 1 
ATOM   3469 N  N   . ARG E  1 63 ? -9.802  10.418  31.392   1.00 30.49  ? 104 ARG E N   1 
ATOM   3470 C  CA  . ARG E  1 63 ? -10.693 10.732  30.270   1.00 24.65  ? 104 ARG E CA  1 
ATOM   3471 C  C   . ARG E  1 63 ? -9.957  11.334  29.091   1.00 22.85  ? 104 ARG E C   1 
ATOM   3472 O  O   . ARG E  1 63 ? -10.290 11.052  27.946   1.00 33.78  ? 104 ARG E O   1 
ATOM   3473 C  CB  . ARG E  1 63 ? -11.812 11.691  30.688   1.00 36.30  ? 104 ARG E CB  1 
ATOM   3474 C  CG  . ARG E  1 63 ? -12.938 11.009  31.437   1.00 52.63  ? 104 ARG E CG  1 
ATOM   3475 C  CD  . ARG E  1 63 ? -14.231 11.819  31.444   1.00 50.45  ? 104 ARG E CD  1 
ATOM   3476 N  NE  . ARG E  1 63 ? -14.182 12.973  32.337   1.00 48.22  ? 104 ARG E NE  1 
ATOM   3477 C  CZ  . ARG E  1 63 ? -13.948 14.218  31.943   1.00 40.95  ? 104 ARG E CZ  1 
ATOM   3478 N  NH1 . ARG E  1 63 ? -13.743 14.485  30.662   1.00 51.38  ? 104 ARG E NH1 1 
ATOM   3479 N  NH2 . ARG E  1 63 ? -13.909 15.195  32.834   1.00 19.72  ? 104 ARG E NH2 1 
ATOM   3480 N  N   . LYS E  1 64 ? -8.966  12.173  29.361   1.00 30.87  ? 105 LYS E N   1 
ATOM   3481 C  CA  . LYS E  1 64 ? -8.193  12.792  28.289   1.00 29.84  ? 105 LYS E CA  1 
ATOM   3482 C  C   . LYS E  1 64 ? -7.331  11.752  27.581   1.00 21.52  ? 105 LYS E C   1 
ATOM   3483 O  O   . LYS E  1 64 ? -7.223  11.757  26.347   1.00 28.34  ? 105 LYS E O   1 
ATOM   3484 C  CB  . LYS E  1 64 ? -7.296  13.897  28.851   1.00 30.48  ? 105 LYS E CB  1 
ATOM   3485 C  CG  . LYS E  1 64 ? -8.055  14.916  29.667   1.00 26.44  ? 105 LYS E CG  1 
ATOM   3486 C  CD  . LYS E  1 64 ? -9.239  15.469  28.887   1.00 23.39  ? 105 LYS E CD  1 
ATOM   3487 C  CE  . LYS E  1 64 ? -10.140 16.310  29.793   1.00 36.17  ? 105 LYS E CE  1 
ATOM   3488 N  NZ  . LYS E  1 64 ? -11.168 17.062  29.022   1.00 22.67  ? 105 LYS E NZ  1 
ATOM   3489 N  N   . ASN E  1 65 ? -6.713  10.867  28.366   1.00 28.72  ? 106 ASN E N   1 
ATOM   3490 C  CA  . ASN E  1 65 ? -5.861  9.818   27.805   1.00 30.57  ? 106 ASN E CA  1 
ATOM   3491 C  C   . ASN E  1 65 ? -6.693  8.942   26.886   1.00 26.10  ? 106 ASN E C   1 
ATOM   3492 O  O   . ASN E  1 65 ? -6.216  8.492   25.843   1.00 46.65  ? 106 ASN E O   1 
ATOM   3493 C  CB  . ASN E  1 65 ? -5.237  8.958   28.909   1.00 32.60  ? 106 ASN E CB  1 
ATOM   3494 C  CG  . ASN E  1 65 ? -4.213  9.720   29.739   1.00 37.63  ? 106 ASN E CG  1 
ATOM   3495 O  OD1 . ASN E  1 65 ? -3.762  10.809  29.358   1.00 36.69  ? 106 ASN E OD1 1 
ATOM   3496 N  ND2 . ASN E  1 65 ? -3.832  9.147   30.873   1.00 20.04  ? 106 ASN E ND2 1 
ATOM   3497 N  N   . LYS E  1 66 ? -7.947  8.722   27.270   1.00 30.81  ? 107 LYS E N   1 
ATOM   3498 C  CA  . LYS E  1 66 ? -8.866  7.913   26.477   1.00 26.28  ? 107 LYS E CA  1 
ATOM   3499 C  C   . LYS E  1 66 ? -9.081  8.574   25.116   1.00 25.73  ? 107 LYS E C   1 
ATOM   3500 O  O   . LYS E  1 66 ? -9.143  7.901   24.086   1.00 25.94  ? 107 LYS E O   1 
ATOM   3501 C  CB  . LYS E  1 66 ? -10.193 7.773   27.225   1.00 22.46  ? 107 LYS E CB  1 
ATOM   3502 C  CG  . LYS E  1 66 ? -11.077 6.634   26.764   1.00 43.42  ? 107 LYS E CG  1 
ATOM   3503 C  CD  . LYS E  1 66 ? -12.171 6.364   27.800   1.00 60.41  ? 107 LYS E CD  1 
ATOM   3504 C  CE  . LYS E  1 66 ? -11.579 5.808   29.097   1.00 62.17  ? 107 LYS E CE  1 
ATOM   3505 N  NZ  . LYS E  1 66 ? -12.209 6.371   30.330   1.00 76.07  ? 107 LYS E NZ  1 
ATOM   3506 N  N   . LYS E  1 67 ? -9.199  9.899   25.116   1.00 33.70  ? 108 LYS E N   1 
ATOM   3507 C  CA  . LYS E  1 67 ? -9.383  10.652  23.877   1.00 22.57  ? 108 LYS E CA  1 
ATOM   3508 C  C   . LYS E  1 67 ? -8.065  10.711  23.080   1.00 22.49  ? 108 LYS E C   1 
ATOM   3509 O  O   . LYS E  1 67 ? -8.058  10.552  21.859   1.00 32.24  ? 108 LYS E O   1 
ATOM   3510 C  CB  . LYS E  1 67 ? -9.871  12.070  24.198   1.00 30.07  ? 108 LYS E CB  1 
ATOM   3511 C  CG  . LYS E  1 67 ? -11.258 12.131  24.829   1.00 37.47  ? 108 LYS E CG  1 
ATOM   3512 C  CD  . LYS E  1 67 ? -11.551 13.522  25.392   1.00 53.73  ? 108 LYS E CD  1 
ATOM   3513 C  CE  . LYS E  1 67 ? -11.628 14.572  24.287   1.00 62.28  ? 108 LYS E CE  1 
ATOM   3514 N  NZ  . LYS E  1 67 ? -11.576 15.975  24.803   1.00 67.90  ? 108 LYS E NZ  1 
ATOM   3515 N  N   . LEU E  1 68 ? -6.948  10.931  23.773   1.00 25.73  ? 109 LEU E N   1 
ATOM   3516 C  CA  . LEU E  1 68 ? -5.649  10.984  23.106   1.00 27.43  ? 109 LEU E CA  1 
ATOM   3517 C  C   . LEU E  1 68 ? -5.364  9.648   22.412   1.00 32.08  ? 109 LEU E C   1 
ATOM   3518 O  O   . LEU E  1 68 ? -4.713  9.611   21.363   1.00 37.58  ? 109 LEU E O   1 
ATOM   3519 C  CB  . LEU E  1 68 ? -4.528  11.297  24.114   1.00 16.05  ? 109 LEU E CB  1 
ATOM   3520 C  CG  . LEU E  1 68 ? -3.129  11.366  23.489   1.00 15.21  ? 109 LEU E CG  1 
ATOM   3521 C  CD1 . LEU E  1 68 ? -3.129  12.384  22.362   1.00 24.98  ? 109 LEU E CD1 1 
ATOM   3522 C  CD2 . LEU E  1 68 ? -2.080  11.716  24.561   1.00 19.56  ? 109 LEU E CD2 1 
ATOM   3523 N  N   . LYS E  1 69 ? -5.840  8.549   23.004   1.00 25.80  ? 110 LYS E N   1 
ATOM   3524 C  CA  . LYS E  1 69 ? -5.634  7.239   22.398   1.00 34.82  ? 110 LYS E CA  1 
ATOM   3525 C  C   . LYS E  1 69 ? -6.420  7.186   21.085   1.00 40.85  ? 110 LYS E C   1 
ATOM   3526 O  O   . LYS E  1 69 ? -5.994  6.558   20.114   1.00 39.44  ? 110 LYS E O   1 
ATOM   3527 C  CB  . LYS E  1 69 ? -6.099  6.116   23.334   1.00 28.10  ? 110 LYS E CB  1 
ATOM   3528 C  CG  . LYS E  1 69 ? -5.125  5.777   24.451   1.00 28.94  ? 110 LYS E CG  1 
ATOM   3529 C  CD  . LYS E  1 69 ? -5.616  4.572   25.268   1.00 37.95  ? 110 LYS E CD  1 
ATOM   3530 C  CE  . LYS E  1 69 ? -4.646  4.193   26.375   1.00 37.63  ? 110 LYS E CE  1 
ATOM   3531 N  NZ  . LYS E  1 69 ? -3.309  3.789   25.854   1.00 44.63  ? 110 LYS E NZ  1 
ATOM   3532 N  N   . GLU E  1 70 ? -7.571  7.851   21.057   1.00 40.70  ? 111 GLU E N   1 
ATOM   3533 C  CA  . GLU E  1 70 ? -8.379  7.881   19.845   1.00 33.55  ? 111 GLU E CA  1 
ATOM   3534 C  C   . GLU E  1 70 ? -7.611  8.617   18.743   1.00 19.36  ? 111 GLU E C   1 
ATOM   3535 O  O   . GLU E  1 70 ? -7.508  8.126   17.618   1.00 35.46  ? 111 GLU E O   1 
ATOM   3536 C  CB  . GLU E  1 70 ? -9.725  8.563   20.117   1.00 37.48  ? 111 GLU E CB  1 
ATOM   3537 C  CG  . GLU E  1 70 ? -10.727 7.698   20.883   1.00 57.26  ? 111 GLU E CG  1 
ATOM   3538 C  CD  . GLU E  1 70 ? -11.902 8.501   21.441   1.00 73.26  ? 111 GLU E CD  1 
ATOM   3539 O  OE1 . GLU E  1 70 ? -12.360 9.447   20.757   1.00 77.52  ? 111 GLU E OE1 1 
ATOM   3540 O  OE2 . GLU E  1 70 ? -12.374 8.178   22.558   1.00 68.17  ? 111 GLU E OE2 1 
ATOM   3541 N  N   . LEU E  1 71 ? -7.055  9.785   19.060   1.00 32.35  ? 112 LEU E N   1 
ATOM   3542 C  CA  . LEU E  1 71 ? -6.287  10.541  18.064   1.00 34.01  ? 112 LEU E CA  1 
ATOM   3543 C  C   . LEU E  1 71 ? -5.121  9.726   17.474   1.00 26.02  ? 112 LEU E C   1 
ATOM   3544 O  O   . LEU E  1 71 ? -4.854  9.809   16.273   1.00 36.45  ? 112 LEU E O   1 
ATOM   3545 C  CB  . LEU E  1 71 ? -5.763  11.849  18.665   1.00 47.88  ? 112 LEU E CB  1 
ATOM   3546 C  CG  . LEU E  1 71 ? -6.713  13.048  18.598   1.00 37.60  ? 112 LEU E CG  1 
ATOM   3547 C  CD1 . LEU E  1 71 ? -7.955  12.779  19.428   1.00 40.03  ? 112 LEU E CD1 1 
ATOM   3548 C  CD2 . LEU E  1 71 ? -6.002  14.284  19.120   1.00 36.14  ? 112 LEU E CD2 1 
ATOM   3549 N  N   . GLU E  1 72 ? -4.429  8.952   18.315   1.00 39.79  ? 113 GLU E N   1 
ATOM   3550 C  CA  . GLU E  1 72 ? -3.328  8.084   17.863   1.00 36.42  ? 113 GLU E CA  1 
ATOM   3551 C  C   . GLU E  1 72 ? -3.851  7.249   16.699   1.00 22.19  ? 113 GLU E C   1 
ATOM   3552 O  O   . GLU E  1 72 ? -3.204  7.102   15.666   1.00 44.99  ? 113 GLU E O   1 
ATOM   3553 C  CB  . GLU E  1 72 ? -2.905  7.100   18.971   1.00 37.06  ? 113 GLU E CB  1 
ATOM   3554 C  CG  . GLU E  1 72 ? -1.842  7.578   19.940   1.00 42.61  ? 113 GLU E CG  1 
ATOM   3555 C  CD  . GLU E  1 72 ? -1.534  6.550   21.021   1.00 25.91  ? 113 GLU E CD  1 
ATOM   3556 O  OE1 . GLU E  1 72 ? -0.455  6.661   21.640   1.00 27.73  ? 113 GLU E OE1 1 
ATOM   3557 O  OE2 . GLU E  1 72 ? -2.368  5.651   21.263   1.00 28.05  ? 113 GLU E OE2 1 
ATOM   3558 N  N   . LYS E  1 73 ? -5.037  6.692   16.900   1.00 27.70  ? 114 LYS E N   1 
ATOM   3559 C  CA  . LYS E  1 73 ? -5.687  5.846   15.915   1.00 33.12  ? 114 LYS E CA  1 
ATOM   3560 C  C   . LYS E  1 73 ? -6.042  6.636   14.668   1.00 29.33  ? 114 LYS E C   1 
ATOM   3561 O  O   . LYS E  1 73 ? -5.787  6.203   13.550   1.00 37.49  ? 114 LYS E O   1 
ATOM   3562 C  CB  . LYS E  1 73 ? -6.943  5.247   16.542   1.00 31.02  ? 114 LYS E CB  1 
ATOM   3563 C  CG  . LYS E  1 73 ? -7.583  4.115   15.768   1.00 56.62  ? 114 LYS E CG  1 
ATOM   3564 C  CD  . LYS E  1 73 ? -8.544  3.339   16.667   1.00 63.66  ? 114 LYS E CD  1 
ATOM   3565 C  CE  . LYS E  1 73 ? -9.676  4.218   17.202   1.00 69.46  ? 114 LYS E CE  1 
ATOM   3566 N  NZ  . LYS E  1 73 ? -10.587 3.442   18.098   1.00 64.34  ? 114 LYS E NZ  1 
ATOM   3567 N  N   . ASP E  1 74 ? -6.633  7.807   14.870   1.00 35.43  ? 115 ASP E N   1 
ATOM   3568 C  CA  . ASP E  1 74 ? -7.025  8.660   13.762   1.00 17.95  ? 115 ASP E CA  1 
ATOM   3569 C  C   . ASP E  1 74 ? -5.877  9.141   12.899   1.00 20.92  ? 115 ASP E C   1 
ATOM   3570 O  O   . ASP E  1 74 ? -5.933  9.061   11.670   1.00 28.63  ? 115 ASP E O   1 
ATOM   3571 C  CB  . ASP E  1 74 ? -7.829  9.843   14.293   1.00 31.33  ? 115 ASP E CB  1 
ATOM   3572 C  CG  . ASP E  1 74 ? -9.199  9.424   14.763   1.00 46.99  ? 115 ASP E CG  1 
ATOM   3573 O  OD1 . ASP E  1 74 ? -9.476  8.204   14.725   1.00 36.71  ? 115 ASP E OD1 1 
ATOM   3574 O  OD2 . ASP E  1 74 ? -9.994  10.295  15.165   1.00 52.45  ? 115 ASP E OD2 1 
ATOM   3575 N  N   . TYR E  1 75 ? -4.829  9.636   13.533   1.00 22.69  ? 116 TYR E N   1 
ATOM   3576 C  CA  . TYR E  1 75 ? -3.675  10.107  12.780   1.00 32.34  ? 116 TYR E CA  1 
ATOM   3577 C  C   . TYR E  1 75 ? -3.000  8.944   12.041   1.00 28.48  ? 116 TYR E C   1 
ATOM   3578 O  O   . TYR E  1 75 ? -2.630  9.070   10.874   1.00 34.16  ? 116 TYR E O   1 
ATOM   3579 C  CB  . TYR E  1 75 ? -2.693  10.821  13.723   1.00 24.64  ? 116 TYR E CB  1 
ATOM   3580 C  CG  . TYR E  1 75 ? -3.127  12.240  14.081   1.00 16.74  ? 116 TYR E CG  1 
ATOM   3581 C  CD1 . TYR E  1 75 ? -3.322  13.203  13.085   1.00 29.74  ? 116 TYR E CD1 1 
ATOM   3582 C  CD2 . TYR E  1 75 ? -3.320  12.619  15.406   1.00 25.22  ? 116 TYR E CD2 1 
ATOM   3583 C  CE1 . TYR E  1 75 ? -3.694  14.511  13.407   1.00 14.90  ? 116 TYR E CE1 1 
ATOM   3584 C  CE2 . TYR E  1 75 ? -3.690  13.914  15.741   1.00 33.07  ? 116 TYR E CE2 1 
ATOM   3585 C  CZ  . TYR E  1 75 ? -3.875  14.858  14.738   1.00 18.66  ? 116 TYR E CZ  1 
ATOM   3586 O  OH  . TYR E  1 75 ? -4.242  16.142  15.070   1.00 23.19  ? 116 TYR E OH  1 
ATOM   3587 N  N   . SER E  1 76 ? -2.864  7.805   12.711   1.00 30.78  ? 117 SER E N   1 
ATOM   3588 C  CA  . SER E  1 76 ? -2.250  6.642   12.079   1.00 25.76  ? 117 SER E CA  1 
ATOM   3589 C  C   . SER E  1 76 ? -3.037  6.283   10.834   1.00 14.46  ? 117 SER E C   1 
ATOM   3590 O  O   . SER E  1 76 ? -2.472  6.062   9.760    1.00 22.29  ? 117 SER E O   1 
ATOM   3591 C  CB  . SER E  1 76 ? -2.241  5.449   13.040   1.00 26.43  ? 117 SER E CB  1 
ATOM   3592 O  OG  . SER E  1 76 ? -1.396  5.720   14.143   1.00 53.02  ? 117 SER E OG  1 
ATOM   3593 N  N   . GLU E  1 77 ? -4.355  6.259   10.984   1.00 18.18  ? 118 GLU E N   1 
ATOM   3594 C  CA  . GLU E  1 77 ? -5.228  5.913   9.885    1.00 13.70  ? 118 GLU E CA  1 
ATOM   3595 C  C   . GLU E  1 77 ? -5.147  6.910   8.755    1.00 26.99  ? 118 GLU E C   1 
ATOM   3596 O  O   . GLU E  1 77 ? -5.058  6.529   7.575    1.00 29.45  ? 118 GLU E O   1 
ATOM   3597 C  CB  . GLU E  1 77 ? -6.673  5.805   10.382   1.00 41.17  ? 118 GLU E CB  1 
ATOM   3598 C  CG  . GLU E  1 77 ? -7.730  5.888   9.280    1.00 45.69  ? 118 GLU E CG  1 
ATOM   3599 C  CD  . GLU E  1 77 ? -9.127  5.523   9.768    1.00 59.47  ? 118 GLU E CD  1 
ATOM   3600 O  OE1 . GLU E  1 77 ? -9.498  5.922   10.895   1.00 58.11  ? 118 GLU E OE1 1 
ATOM   3601 O  OE2 . GLU E  1 77 ? -9.860  4.847   9.014    1.00 75.91  ? 118 GLU E OE2 1 
ATOM   3602 N  N   . LEU E  1 78 ? -5.184  8.188   9.130    1.00 20.40  ? 119 LEU E N   1 
ATOM   3603 C  CA  . LEU E  1 78 ? -5.125  9.291   8.180    1.00 13.60  ? 119 LEU E CA  1 
ATOM   3604 C  C   . LEU E  1 78 ? -3.784  9.264   7.455    1.00 4.22   ? 119 LEU E C   1 
ATOM   3605 O  O   . LEU E  1 78 ? -3.705  9.493   6.250    1.00 19.74  ? 119 LEU E O   1 
ATOM   3606 C  CB  . LEU E  1 78 ? -5.306  10.611  8.949    1.00 24.22  ? 119 LEU E CB  1 
ATOM   3607 C  CG  . LEU E  1 78 ? -5.213  11.924  8.182    1.00 32.65  ? 119 LEU E CG  1 
ATOM   3608 C  CD1 . LEU E  1 78 ? -6.185  11.916  7.031    1.00 22.73  ? 119 LEU E CD1 1 
ATOM   3609 C  CD2 . LEU E  1 78 ? -5.530  13.063  9.126    1.00 25.56  ? 119 LEU E CD2 1 
ATOM   3610 N  N   . SER E  1 79 ? -2.720  8.977   8.194    1.00 26.67  ? 120 SER E N   1 
ATOM   3611 C  CA  . SER E  1 79 ? -1.404  8.909   7.589    1.00 19.55  ? 120 SER E CA  1 
ATOM   3612 C  C   . SER E  1 79 ? -1.407  7.831   6.513    1.00 26.80  ? 120 SER E C   1 
ATOM   3613 O  O   . SER E  1 79 ? -0.939  8.057   5.395    1.00 23.44  ? 120 SER E O   1 
ATOM   3614 C  CB  . SER E  1 79 ? -0.349  8.587   8.649    1.00 31.88  ? 120 SER E CB  1 
ATOM   3615 O  OG  . SER E  1 79 ? 0.951   8.533   8.075    1.00 40.25  ? 120 SER E OG  1 
ATOM   3616 N  N   . ASN E  1 80 ? -1.947  6.660   6.845    1.00 26.42  ? 121 ASN E N   1 
ATOM   3617 C  CA  . ASN E  1 80 ? -1.996  5.568   5.882    1.00 21.84  ? 121 ASN E CA  1 
ATOM   3618 C  C   . ASN E  1 80 ? -2.771  5.952   4.644    1.00 22.87  ? 121 ASN E C   1 
ATOM   3619 O  O   . ASN E  1 80 ? -2.374  5.618   3.523    1.00 27.76  ? 121 ASN E O   1 
ATOM   3620 C  CB  . ASN E  1 80 ? -2.633  4.318   6.489    1.00 24.36  ? 121 ASN E CB  1 
ATOM   3621 C  CG  . ASN E  1 80 ? -1.702  3.593   7.423    1.00 34.89  ? 121 ASN E CG  1 
ATOM   3622 O  OD1 . ASN E  1 80 ? -0.502  3.494   7.159    1.00 43.03  ? 121 ASN E OD1 1 
ATOM   3623 N  ND2 . ASN E  1 80 ? -2.246  3.063   8.519    1.00 29.72  ? 121 ASN E ND2 1 
ATOM   3624 N  N   . ARG E  1 81 ? -3.886  6.648   4.833    1.00 23.02  ? 122 ARG E N   1 
ATOM   3625 C  CA  . ARG E  1 81 ? -4.678  7.056   3.687    1.00 21.93  ? 122 ARG E CA  1 
ATOM   3626 C  C   . ARG E  1 81 ? -3.855  7.932   2.740    1.00 19.91  ? 122 ARG E C   1 
ATOM   3627 O  O   . ARG E  1 81 ? -3.915  7.754   1.513    1.00 34.01  ? 122 ARG E O   1 
ATOM   3628 C  CB  . ARG E  1 81 ? -5.966  7.756   4.161    1.00 31.06  ? 122 ARG E CB  1 
ATOM   3629 C  CG  . ARG E  1 81 ? -6.866  6.790   4.968    1.00 20.31  ? 122 ARG E CG  1 
ATOM   3630 C  CD  . ARG E  1 81 ? -8.213  7.361   5.442    1.00 20.45  ? 122 ARG E CD  1 
ATOM   3631 N  NE  . ARG E  1 81 ? -9.148  7.584   4.341    1.00 38.11  ? 122 ARG E NE  1 
ATOM   3632 C  CZ  . ARG E  1 81 ? -10.429 7.909   4.502    1.00 23.44  ? 122 ARG E CZ  1 
ATOM   3633 N  NH1 . ARG E  1 81 ? -10.933 8.044   5.721    1.00 20.30  ? 122 ARG E NH1 1 
ATOM   3634 N  NH2 . ARG E  1 81 ? -11.203 8.110   3.442    1.00 30.85  ? 122 ARG E NH2 1 
ATOM   3635 N  N   . TYR E  1 82 ? -3.079  8.866   3.288    1.00 26.99  ? 123 TYR E N   1 
ATOM   3636 C  CA  . TYR E  1 82 ? -2.235  9.732   2.453    1.00 30.94  ? 123 TYR E CA  1 
ATOM   3637 C  C   . TYR E  1 82 ? -1.142  8.911   1.744    1.00 13.15  ? 123 TYR E C   1 
ATOM   3638 O  O   . TYR E  1 82 ? -0.714  9.248   0.636    1.00 21.98  ? 123 TYR E O   1 
ATOM   3639 C  CB  . TYR E  1 82 ? -1.593  10.841  3.301    1.00 32.64  ? 123 TYR E CB  1 
ATOM   3640 C  CG  . TYR E  1 82 ? -2.465  12.073  3.506    1.00 23.41  ? 123 TYR E CG  1 
ATOM   3641 C  CD1 . TYR E  1 82 ? -2.656  13.011  2.488    1.00 32.62  ? 123 TYR E CD1 1 
ATOM   3642 C  CD2 . TYR E  1 82 ? -3.063  12.312  4.728    1.00 14.27  ? 123 TYR E CD2 1 
ATOM   3643 C  CE1 . TYR E  1 82 ? -3.421  14.159  2.709    1.00 28.82  ? 123 TYR E CE1 1 
ATOM   3644 C  CE2 . TYR E  1 82 ? -3.822  13.435  4.959    1.00 24.25  ? 123 TYR E CE2 1 
ATOM   3645 C  CZ  . TYR E  1 82 ? -4.000  14.358  3.959    1.00 27.44  ? 123 TYR E CZ  1 
ATOM   3646 O  OH  . TYR E  1 82 ? -4.766  15.464  4.244    1.00 25.23  ? 123 TYR E OH  1 
ATOM   3647 N  N   . ASN E  1 83 ? -0.691  7.823   2.369    1.00 27.55  ? 124 ASN E N   1 
ATOM   3648 C  CA  . ASN E  1 83 ? 0.318   7.002   1.706    1.00 20.48  ? 124 ASN E CA  1 
ATOM   3649 C  C   . ASN E  1 83 ? -0.332  6.301   0.517    1.00 16.40  ? 124 ASN E C   1 
ATOM   3650 O  O   . ASN E  1 83 ? 0.276   6.147   -0.547   1.00 25.41  ? 124 ASN E O   1 
ATOM   3651 C  CB  . ASN E  1 83 ? 0.940   6.004   2.686    1.00 31.83  ? 124 ASN E CB  1 
ATOM   3652 C  CG  . ASN E  1 83 ? 1.895   6.678   3.653    1.00 31.63  ? 124 ASN E CG  1 
ATOM   3653 O  OD1 . ASN E  1 83 ? 2.621   7.597   3.276    1.00 50.19  ? 124 ASN E OD1 1 
ATOM   3654 N  ND2 . ASN E  1 83 ? 1.903   6.225   4.898    1.00 23.68  ? 124 ASN E ND2 1 
ATOM   3655 N  N   . GLU E  1 84 ? -1.592  5.919   0.670    1.00 24.23  ? 125 GLU E N   1 
ATOM   3656 C  CA  . GLU E  1 84 ? -2.259  5.276   -0.438   1.00 15.00  ? 125 GLU E CA  1 
ATOM   3657 C  C   . GLU E  1 84 ? -2.520  6.244   -1.562   1.00 25.91  ? 125 GLU E C   1 
ATOM   3658 O  O   . GLU E  1 84 ? -2.407  5.890   -2.734   1.00 26.35  ? 125 GLU E O   1 
ATOM   3659 C  CB  . GLU E  1 84 ? -3.568  4.617   0.003    1.00 29.24  ? 125 GLU E CB  1 
ATOM   3660 C  CG  . GLU E  1 84 ? -3.344  3.164   0.417    1.00 42.66  ? 125 GLU E CG  1 
ATOM   3661 C  CD  . GLU E  1 84 ? -2.803  2.299   -0.723   1.00 18.75  ? 125 GLU E CD  1 
ATOM   3662 O  OE1 . GLU E  1 84 ? -2.102  2.829   -1.608   1.00 38.78  ? 125 GLU E OE1 1 
ATOM   3663 O  OE2 . GLU E  1 84 ? -3.072  1.076   -0.734   1.00 38.37  ? 125 GLU E OE2 1 
ATOM   3664 N  N   . GLN E  1 85 ? -2.850  7.483   -1.217   1.00 27.42  ? 126 GLN E N   1 
ATOM   3665 C  CA  . GLN E  1 85 ? -3.141  8.456   -2.260   1.00 24.02  ? 126 GLN E CA  1 
ATOM   3666 C  C   . GLN E  1 85 ? -1.934  8.736   -3.138   1.00 19.43  ? 126 GLN E C   1 
ATOM   3667 O  O   . GLN E  1 85 ? -2.069  8.971   -4.340   1.00 28.68  ? 126 GLN E O   1 
ATOM   3668 C  CB  . GLN E  1 85 ? -3.686  9.742   -1.638   1.00 25.67  ? 126 GLN E CB  1 
ATOM   3669 C  CG  . GLN E  1 85 ? -5.076  9.545   -1.034   1.00 16.25  ? 126 GLN E CG  1 
ATOM   3670 C  CD  . GLN E  1 85 ? -6.037  8.947   -2.040   1.00 28.94  ? 126 GLN E CD  1 
ATOM   3671 O  OE1 . GLN E  1 85 ? -6.364  9.582   -3.035   1.00 36.82  ? 126 GLN E OE1 1 
ATOM   3672 N  NE2 . GLN E  1 85 ? -6.484  7.718   -1.794   1.00 48.27  ? 126 GLN E NE2 1 
ATOM   3673 N  N   . LYS E  1 86 ? -0.749  8.684   -2.543   1.00 32.35  ? 127 LYS E N   1 
ATOM   3674 C  CA  . LYS E  1 86 ? 0.474   8.902   -3.297   1.00 16.76  ? 127 LYS E CA  1 
ATOM   3675 C  C   . LYS E  1 86 ? 0.780   7.677   -4.161   1.00 28.89  ? 127 LYS E C   1 
ATOM   3676 O  O   . LYS E  1 86 ? 1.313   7.811   -5.247   1.00 39.46  ? 127 LYS E O   1 
ATOM   3677 C  CB  . LYS E  1 86 ? 1.639   9.166   -2.351   1.00 35.54  ? 127 LYS E CB  1 
ATOM   3678 C  CG  . LYS E  1 86 ? 2.863   9.674   -3.063   1.00 33.17  ? 127 LYS E CG  1 
ATOM   3679 C  CD  . LYS E  1 86 ? 4.120   9.237   -2.361   1.00 58.98  ? 127 LYS E CD  1 
ATOM   3680 C  CE  . LYS E  1 86 ? 5.191   8.934   -3.391   1.00 70.15  ? 127 LYS E CE  1 
ATOM   3681 N  NZ  . LYS E  1 86 ? 6.043   7.782   -2.995   1.00 79.50  ? 127 LYS E NZ  1 
ATOM   3682 N  N   . GLU E  1 87 ? 0.458   6.480   -3.686   1.00 25.27  ? 128 GLU E N   1 
ATOM   3683 C  CA  . GLU E  1 87 ? 0.696   5.281   -4.497   1.00 25.37  ? 128 GLU E CA  1 
ATOM   3684 C  C   . GLU E  1 87 ? -0.083  5.427   -5.801   1.00 34.71  ? 128 GLU E C   1 
ATOM   3685 O  O   . GLU E  1 87 ? 0.413   5.107   -6.880   1.00 46.78  ? 128 GLU E O   1 
ATOM   3686 C  CB  . GLU E  1 87 ? 0.226   4.014   -3.760   1.00 32.68  ? 128 GLU E CB  1 
ATOM   3687 C  CG  . GLU E  1 87 ? 1.165   3.515   -2.674   1.00 16.90  ? 128 GLU E CG  1 
ATOM   3688 C  CD  . GLU E  1 87 ? 0.567   2.366   -1.854   1.00 39.24  ? 128 GLU E CD  1 
ATOM   3689 O  OE1 . GLU E  1 87 ? 0.256   1.293   -2.434   1.00 22.33  ? 128 GLU E OE1 1 
ATOM   3690 O  OE2 . GLU E  1 87 ? 0.405   2.546   -0.622   1.00 26.20  ? 128 GLU E OE2 1 
ATOM   3691 N  N   . LYS E  1 88 ? -1.313  5.916   -5.696   1.00 32.25  ? 129 LYS E N   1 
ATOM   3692 C  CA  . LYS E  1 88 ? -2.149  6.109   -6.873   1.00 34.92  ? 129 LYS E CA  1 
ATOM   3693 C  C   . LYS E  1 88 ? -1.584  7.209   -7.767   1.00 42.14  ? 129 LYS E C   1 
ATOM   3694 O  O   . LYS E  1 88 ? -1.515  7.053   -8.987   1.00 51.19  ? 129 LYS E O   1 
ATOM   3695 C  CB  . LYS E  1 88 ? -3.575  6.471   -6.459   1.00 34.55  ? 129 LYS E CB  1 
ATOM   3696 C  CG  . LYS E  1 88 ? -4.321  5.350   -5.744   1.00 34.12  ? 129 LYS E CG  1 
ATOM   3697 C  CD  . LYS E  1 88 ? -5.724  5.791   -5.388   1.00 41.29  ? 129 LYS E CD  1 
ATOM   3698 C  CE  . LYS E  1 88 ? -6.333  4.924   -4.315   1.00 38.10  ? 129 LYS E CE  1 
ATOM   3699 N  NZ  . LYS E  1 88 ? -7.621  5.508   -3.849   1.00 55.61  ? 129 LYS E NZ  1 
ATOM   3700 N  N   . MET E  1 89 ? -1.185  8.323   -7.160   1.00 35.87  ? 130 MET E N   1 
ATOM   3701 C  CA  . MET E  1 89 ? -0.625  9.432   -7.917   1.00 44.82  ? 130 MET E CA  1 
ATOM   3702 C  C   . MET E  1 89 ? 0.645   8.965   -8.608   1.00 48.09  ? 130 MET E C   1 
ATOM   3703 O  O   . MET E  1 89 ? 0.838   9.191   -9.802   1.00 49.21  ? 130 MET E O   1 
ATOM   3704 C  CB  . MET E  1 89 ? -0.329  10.607  -6.979   1.00 52.94  ? 130 MET E CB  1 
ATOM   3705 C  CG  . MET E  1 89 ? 0.553   11.702  -7.571   1.00 64.28  ? 130 MET E CG  1 
ATOM   3706 S  SD  . MET E  1 89 ? 0.072   12.224  -9.230   1.00 74.14  ? 130 MET E SD  1 
ATOM   3707 C  CE  . MET E  1 89 ? -1.654  12.581  -8.984   1.00 60.75  ? 130 MET E CE  1 
ATOM   3708 N  N   . ASP E  1 90 ? 1.506   8.307   -7.842   1.00 43.20  ? 131 ASP E N   1 
ATOM   3709 C  CA  . ASP E  1 90 ? 2.764   7.779   -8.355   1.00 45.78  ? 131 ASP E CA  1 
ATOM   3710 C  C   . ASP E  1 90 ? 2.471   6.865   -9.529   1.00 40.97  ? 131 ASP E C   1 
ATOM   3711 O  O   . ASP E  1 90 ? 2.975   7.049   -10.633  1.00 37.85  ? 131 ASP E O   1 
ATOM   3712 C  CB  . ASP E  1 90 ? 3.485   7.013   -7.236   1.00 56.46  ? 131 ASP E CB  1 
ATOM   3713 C  CG  . ASP E  1 90 ? 4.538   6.049   -7.753   1.00 71.04  ? 131 ASP E CG  1 
ATOM   3714 O  OD1 . ASP E  1 90 ? 4.188   5.128   -8.523   1.00 82.38  ? 131 ASP E OD1 1 
ATOM   3715 O  OD2 . ASP E  1 90 ? 5.719   6.200   -7.372   1.00 77.37  ? 131 ASP E OD2 1 
ATOM   3716 N  N   . GLN E  1 91 ? 1.631   5.878   -9.284   1.00 40.28  ? 132 GLN E N   1 
ATOM   3717 C  CA  . GLN E  1 91 ? 1.284   4.943   -10.329  1.00 48.08  ? 132 GLN E CA  1 
ATOM   3718 C  C   . GLN E  1 91 ? 0.572   5.653   -11.464  1.00 51.06  ? 132 GLN E C   1 
ATOM   3719 O  O   . GLN E  1 91 ? 0.589   5.191   -12.597  1.00 62.59  ? 132 GLN E O   1 
ATOM   3720 C  CB  . GLN E  1 91 ? 0.390   3.859   -9.753   1.00 50.68  ? 132 GLN E CB  1 
ATOM   3721 C  CG  . GLN E  1 91 ? 0.108   2.744   -10.706  1.00 70.29  ? 132 GLN E CG  1 
ATOM   3722 C  CD  . GLN E  1 91 ? 1.355   1.994   -11.115  1.00 74.16  ? 132 GLN E CD  1 
ATOM   3723 O  OE1 . GLN E  1 91 ? 2.059   1.439   -10.275  1.00 75.34  ? 132 GLN E OE1 1 
ATOM   3724 N  NE2 . GLN E  1 91 ? 1.630   1.966   -12.415  1.00 75.03  ? 132 GLN E NE2 1 
ATOM   3725 N  N   . LEU E  1 92 ? -0.052  6.782   -11.155  1.00 58.71  ? 133 LEU E N   1 
ATOM   3726 C  CA  . LEU E  1 92 ? -0.783  7.549   -12.155  1.00 53.96  ? 133 LEU E CA  1 
ATOM   3727 C  C   . LEU E  1 92 ? 0.088   8.177   -13.258  1.00 60.78  ? 133 LEU E C   1 
ATOM   3728 O  O   . LEU E  1 92 ? -0.400  8.973   -14.054  1.00 57.38  ? 133 LEU E O   1 
ATOM   3729 C  CB  . LEU E  1 92 ? -1.608  8.632   -11.456  1.00 54.72  ? 133 LEU E CB  1 
ATOM   3730 C  CG  . LEU E  1 92 ? -2.589  9.412   -12.323  1.00 42.78  ? 133 LEU E CG  1 
ATOM   3731 C  CD1 . LEU E  1 92 ? -3.432  8.446   -13.126  1.00 55.00  ? 133 LEU E CD1 1 
ATOM   3732 C  CD2 . LEU E  1 92 ? -3.457  10.292  -11.437  1.00 53.58  ? 133 LEU E CD2 1 
ATOM   3733 N  N   . SER E  1 93 ? 1.369   7.813   -13.301  1.00 67.50  ? 134 SER E N   1 
ATOM   3734 C  CA  . SER E  1 93 ? 2.331   8.302   -14.302  1.00 67.49  ? 134 SER E CA  1 
ATOM   3735 C  C   . SER E  1 93 ? 3.447   7.266   -14.429  1.00 63.86  ? 134 SER E C   1 
ATOM   3736 O  O   . SER E  1 93 ? 4.621   7.593   -14.272  1.00 71.08  ? 134 SER E O   1 
ATOM   3737 C  CB  . SER E  1 93 ? 2.932   9.630   -13.843  1.00 64.36  ? 134 SER E CB  1 
ATOM   3738 O  OG  . SER E  1 93 ? 2.754   9.789   -12.446  1.00 77.61  ? 134 SER E OG  1 
ATOM   3739 N  N   . LYS E  1 94 ? 3.077   6.029   -14.742  1.00 83.59  ? 135 LYS E N   1 
ATOM   3740 C  CA  . LYS E  1 94 ? 4.052   4.963   -14.800  1.00 87.59  ? 135 LYS E CA  1 
ATOM   3741 C  C   . LYS E  1 94 ? 4.308   4.234   -16.114  1.00 95.29  ? 135 LYS E C   1 
ATOM   3742 O  O   . LYS E  1 94 ? 3.527   4.299   -17.086  1.00 91.05  ? 135 LYS E O   1 
ATOM   3743 C  CB  . LYS E  1 94 ? 3.723   3.941   -13.697  1.00 85.35  ? 135 LYS E CB  1 
ATOM   3744 C  CG  . LYS E  1 94 ? 4.906   3.135   -13.196  1.00 96.95  ? 135 LYS E CG  1 
ATOM   3745 C  CD  . LYS E  1 94 ? 5.807   4.012   -12.328  1.00 98.30  ? 135 LYS E CD  1 
ATOM   3746 C  CE  . LYS E  1 94 ? 6.656   3.203   -11.340  1.00 100.94 ? 135 LYS E CE  1 
ATOM   3747 N  NZ  . LYS E  1 94 ? 7.794   2.527   -12.026  1.00 108.12 ? 135 LYS E NZ  1 
ATOM   3748 N  N   . LEU E  1 95 ? 5.482   3.593   -16.066  1.00 112.33 ? 136 LEU E N   1 
ATOM   3749 C  CA  . LEU E  1 95 ? 6.131   2.744   -17.063  1.00 111.40 ? 136 LEU E CA  1 
ATOM   3750 C  C   . LEU E  1 95 ? 5.973   3.093   -18.529  1.00 109.57 ? 136 LEU E C   1 
ATOM   3751 O  O   . LEU E  1 95 ? 5.832   4.298   -18.812  1.00 101.74 ? 136 LEU E O   1 
ATOM   3752 C  CB  . LEU E  1 95 ? 5.779   1.266   -16.777  1.00 114.93 ? 136 LEU E CB  1 
ATOM   3753 C  CG  . LEU E  1 95 ? 6.429   0.749   -15.477  1.00 112.88 ? 136 LEU E CG  1 
ATOM   3754 C  CD1 . LEU E  1 95 ? 6.636   -0.737  -15.586  1.00 101.77 ? 136 LEU E CD1 1 
ATOM   3755 C  CD2 . LEU E  1 95 ? 7.769   1.441   -15.239  1.00 111.74 ? 136 LEU E CD2 1 
ATOM   3756 N  N   . ILE F  1 5  ? -3.905  -13.397 96.706   1.00 152.70 ? 46  ILE F N   1 
ATOM   3757 C  CA  . ILE F  1 5  ? -2.971  -13.190 95.561   1.00 152.70 ? 46  ILE F CA  1 
ATOM   3758 C  C   . ILE F  1 5  ? -3.162  -14.272 94.499   1.00 152.70 ? 46  ILE F C   1 
ATOM   3759 O  O   . ILE F  1 5  ? -2.726  -14.114 93.358   1.00 152.70 ? 46  ILE F O   1 
ATOM   3760 C  CB  . ILE F  1 5  ? -1.497  -13.213 96.034   1.00 152.73 ? 46  ILE F CB  1 
ATOM   3761 C  CG1 . ILE F  1 5  ? -1.294  -12.198 97.163   1.00 152.73 ? 46  ILE F CG1 1 
ATOM   3762 C  CG2 . ILE F  1 5  ? -0.568  -12.880 94.872   1.00 152.73 ? 46  ILE F CG2 1 
ATOM   3763 C  CD1 . ILE F  1 5  ? 0.122   -12.157 97.706   1.00 152.73 ? 46  ILE F CD1 1 
ATOM   3764 N  N   . GLU F  1 6  ? -3.818  -15.368 94.873   1.00 152.71 ? 47  GLU F N   1 
ATOM   3765 C  CA  . GLU F  1 6  ? -4.048  -16.465 93.939   1.00 154.17 ? 47  GLU F CA  1 
ATOM   3766 C  C   . GLU F  1 6  ? -4.927  -16.020 92.775   1.00 155.81 ? 47  GLU F C   1 
ATOM   3767 O  O   . GLU F  1 6  ? -4.697  -16.409 91.630   1.00 157.15 ? 47  GLU F O   1 
ATOM   3768 C  CB  . GLU F  1 6  ? -4.707  -17.657 94.641   1.00 153.13 ? 47  GLU F CB  1 
ATOM   3769 C  CG  . GLU F  1 6  ? -6.187  -17.476 94.934   1.00 151.06 ? 47  GLU F CG  1 
ATOM   3770 C  CD  . GLU F  1 6  ? -6.936  -18.794 94.953   1.00 151.55 ? 47  GLU F CD  1 
ATOM   3771 O  OE1 . GLU F  1 6  ? -6.918  -19.500 93.923   1.00 151.11 ? 47  GLU F OE1 1 
ATOM   3772 O  OE2 . GLU F  1 6  ? -7.542  -19.124 95.993   1.00 154.18 ? 47  GLU F OE2 1 
ATOM   3773 N  N   . SER F  1 7  ? -5.939  -15.211 93.075   1.00 155.87 ? 48  SER F N   1 
ATOM   3774 C  CA  . SER F  1 7  ? -6.844  -14.708 92.048   1.00 156.39 ? 48  SER F CA  1 
ATOM   3775 C  C   . SER F  1 7  ? -6.051  -13.840 91.081   1.00 157.24 ? 48  SER F C   1 
ATOM   3776 O  O   . SER F  1 7  ? -6.266  -13.882 89.869   1.00 158.89 ? 48  SER F O   1 
ATOM   3777 C  CB  . SER F  1 7  ? -7.964  -13.878 92.683   1.00 156.34 ? 48  SER F CB  1 
ATOM   3778 O  OG  . SER F  1 7  ? -8.722  -14.650 93.598   1.00 153.50 ? 48  SER F OG  1 
ATOM   3779 N  N   . LEU F  1 8  ? -5.129  -13.057 91.631   1.00 159.08 ? 49  LEU F N   1 
ATOM   3780 C  CA  . LEU F  1 8  ? -4.288  -12.174 90.833   1.00 156.43 ? 49  LEU F CA  1 
ATOM   3781 C  C   . LEU F  1 8  ? -3.413  -12.997 89.892   1.00 155.74 ? 49  LEU F C   1 
ATOM   3782 O  O   . LEU F  1 8  ? -3.220  -12.637 88.730   1.00 153.38 ? 49  LEU F O   1 
ATOM   3783 C  CB  . LEU F  1 8  ? -3.400  -11.323 91.743   1.00 157.05 ? 49  LEU F CB  1 
ATOM   3784 C  CG  . LEU F  1 8  ? -3.452  -9.816  91.493   1.00 151.95 ? 49  LEU F CG  1 
ATOM   3785 C  CD1 . LEU F  1 8  ? -2.396  -9.121  92.334   1.00 150.20 ? 49  LEU F CD1 1 
ATOM   3786 C  CD2 . LEU F  1 8  ? -3.225  -9.538  90.025   1.00 148.07 ? 49  LEU F CD2 1 
ATOM   3787 N  N   . HIS F  1 9  ? -2.882  -14.100 90.411   1.00 155.69 ? 50  HIS F N   1 
ATOM   3788 C  CA  . HIS F  1 9  ? -2.036  -14.991 89.627   1.00 153.52 ? 50  HIS F CA  1 
ATOM   3789 C  C   . HIS F  1 9  ? -2.856  -15.613 88.506   1.00 152.58 ? 50  HIS F C   1 
ATOM   3790 O  O   . HIS F  1 9  ? -2.368  -15.789 87.389   1.00 153.67 ? 50  HIS F O   1 
ATOM   3791 C  CB  . HIS F  1 9  ? -1.462  -16.091 90.519   1.00 156.47 ? 50  HIS F CB  1 
ATOM   3792 C  CG  . HIS F  1 9  ? -0.470  -15.598 91.525   1.00 154.39 ? 50  HIS F CG  1 
ATOM   3793 N  ND1 . HIS F  1 9  ? 0.060   -16.408 92.504   1.00 153.57 ? 50  HIS F ND1 1 
ATOM   3794 C  CD2 . HIS F  1 9  ? 0.102   -14.380 91.693   1.00 153.60 ? 50  HIS F CD2 1 
ATOM   3795 C  CE1 . HIS F  1 9  ? 0.916   -15.713 93.233   1.00 153.50 ? 50  HIS F CE1 1 
ATOM   3796 N  NE2 . HIS F  1 9  ? 0.959   -14.480 92.760   1.00 151.55 ? 50  HIS F NE2 1 
ATOM   3797 N  N   . ASP F  1 10 ? -4.104  -15.949 88.817   1.00 151.67 ? 51  ASP F N   1 
ATOM   3798 C  CA  . ASP F  1 10 ? -5.009  -16.539 87.841   1.00 146.52 ? 51  ASP F CA  1 
ATOM   3799 C  C   . ASP F  1 10 ? -5.245  -15.541 86.711   1.00 147.34 ? 51  ASP F C   1 
ATOM   3800 O  O   . ASP F  1 10 ? -5.253  -15.906 85.534   1.00 147.38 ? 51  ASP F O   1 
ATOM   3801 C  CB  . ASP F  1 10 ? -6.339  -16.893 88.506   1.00 147.49 ? 51  ASP F CB  1 
ATOM   3802 C  CG  . ASP F  1 10 ? -7.393  -17.318 87.507   1.00 145.75 ? 51  ASP F CG  1 
ATOM   3803 O  OD1 . ASP F  1 10 ? -7.220  -18.377 86.868   1.00 141.56 ? 51  ASP F OD1 1 
ATOM   3804 O  OD2 . ASP F  1 10 ? -8.392  -16.586 87.356   1.00 147.45 ? 51  ASP F OD2 1 
ATOM   3805 N  N   . GLN F  1 11 ? -5.440  -14.280 87.086   1.00 144.98 ? 52  GLN F N   1 
ATOM   3806 C  CA  . GLN F  1 11 ? -5.662  -13.204 86.126   1.00 144.70 ? 52  GLN F CA  1 
ATOM   3807 C  C   . GLN F  1 11 ? -4.436  -13.063 85.233   1.00 145.01 ? 52  GLN F C   1 
ATOM   3808 O  O   . GLN F  1 11 ? -4.554  -12.853 84.025   1.00 144.65 ? 52  GLN F O   1 
ATOM   3809 C  CB  . GLN F  1 11 ? -5.913  -11.887 86.863   1.00 144.07 ? 52  GLN F CB  1 
ATOM   3810 C  CG  . GLN F  1 11 ? -7.369  -11.442 86.907   1.00 145.89 ? 52  GLN F CG  1 
ATOM   3811 C  CD  . GLN F  1 11 ? -7.727  -10.508 85.766   1.00 141.92 ? 52  GLN F CD  1 
ATOM   3812 O  OE1 . GLN F  1 11 ? -7.006  -9.548  85.491   1.00 136.33 ? 52  GLN F OE1 1 
ATOM   3813 N  NE2 . GLN F  1 11 ? -8.849  -10.774 85.107   1.00 138.45 ? 52  GLN F NE2 1 
ATOM   3814 N  N   . ILE F  1 12 ? -3.259  -13.174 85.841   1.00 141.13 ? 53  ILE F N   1 
ATOM   3815 C  CA  . ILE F  1 12 ? -2.006  -13.074 85.105   1.00 140.34 ? 53  ILE F CA  1 
ATOM   3816 C  C   . ILE F  1 12 ? -1.915  -14.208 84.089   1.00 140.82 ? 53  ILE F C   1 
ATOM   3817 O  O   . ILE F  1 12 ? -1.503  -13.996 82.948   1.00 139.25 ? 53  ILE F O   1 
ATOM   3818 C  CB  . ILE F  1 12 ? -0.791  -13.146 86.060   1.00 142.10 ? 53  ILE F CB  1 
ATOM   3819 C  CG1 . ILE F  1 12 ? -0.766  -11.906 86.955   1.00 138.31 ? 53  ILE F CG1 1 
ATOM   3820 C  CG2 . ILE F  1 12 ? 0.501   -13.257 85.264   1.00 141.95 ? 53  ILE F CG2 1 
ATOM   3821 C  CD1 . ILE F  1 12 ? 0.419   -11.838 87.895   1.00 134.37 ? 53  ILE F CD1 1 
ATOM   3822 N  N   . ASP F  1 13 ? -2.302  -15.412 84.505   1.00 136.71 ? 54  ASP F N   1 
ATOM   3823 C  CA  . ASP F  1 13 ? -2.267  -16.563 83.610   1.00 137.79 ? 54  ASP F CA  1 
ATOM   3824 C  C   . ASP F  1 13 ? -3.252  -16.347 82.470   1.00 138.64 ? 54  ASP F C   1 
ATOM   3825 O  O   . ASP F  1 13 ? -2.931  -16.593 81.308   1.00 141.08 ? 54  ASP F O   1 
ATOM   3826 C  CB  . ASP F  1 13 ? -2.624  -17.854 84.355   1.00 136.10 ? 54  ASP F CB  1 
ATOM   3827 C  CG  . ASP F  1 13 ? -1.602  -18.221 85.414   1.00 136.55 ? 54  ASP F CG  1 
ATOM   3828 O  OD1 . ASP F  1 13 ? -0.434  -17.795 85.292   1.00 135.38 ? 54  ASP F OD1 1 
ATOM   3829 O  OD2 . ASP F  1 13 ? -1.964  -18.951 86.361   1.00 139.07 ? 54  ASP F OD2 1 
ATOM   3830 N  N   . MET F  1 14 ? -4.453  -15.887 82.810   1.00 134.21 ? 55  MET F N   1 
ATOM   3831 C  CA  . MET F  1 14 ? -5.477  -15.626 81.807   1.00 134.74 ? 55  MET F CA  1 
ATOM   3832 C  C   . MET F  1 14 ? -4.935  -14.669 80.756   1.00 136.33 ? 55  MET F C   1 
ATOM   3833 O  O   . MET F  1 14 ? -5.054  -14.915 79.555   1.00 136.08 ? 55  MET F O   1 
ATOM   3834 C  CB  . MET F  1 14 ? -6.714  -14.998 82.445   1.00 137.42 ? 55  MET F CB  1 
ATOM   3835 C  CG  . MET F  1 14 ? -7.736  -14.533 81.419   1.00 136.97 ? 55  MET F CG  1 
ATOM   3836 S  SD  . MET F  1 14 ? -8.882  -13.310 82.066   1.00 138.27 ? 55  MET F SD  1 
ATOM   3837 C  CE  . MET F  1 14 ? -7.910  -11.808 81.869   1.00 135.56 ? 55  MET F CE  1 
ATOM   3838 N  N   . LEU F  1 15 ? -4.351  -13.568 81.218   1.00 131.50 ? 56  LEU F N   1 
ATOM   3839 C  CA  . LEU F  1 15 ? -3.791  -12.576 80.317   1.00 129.03 ? 56  LEU F CA  1 
ATOM   3840 C  C   . LEU F  1 15 ? -2.848  -13.275 79.348   1.00 129.41 ? 56  LEU F C   1 
ATOM   3841 O  O   . LEU F  1 15 ? -3.068  -13.251 78.139   1.00 130.39 ? 56  LEU F O   1 
ATOM   3842 C  CB  . LEU F  1 15 ? -3.056  -11.497 81.117   1.00 124.33 ? 56  LEU F CB  1 
ATOM   3843 C  CG  . LEU F  1 15 ? -3.459  -10.060 80.774   1.00 123.44 ? 56  LEU F CG  1 
ATOM   3844 C  CD1 . LEU F  1 15 ? -4.949  -9.982  80.496   1.00 121.91 ? 56  LEU F CD1 1 
ATOM   3845 C  CD2 . LEU F  1 15 ? -3.099  -9.149  81.921   1.00 118.41 ? 56  LEU F CD2 1 
ATOM   3846 N  N   . THR F  1 16 ? -1.816  -13.916 79.892   1.00 128.52 ? 57  THR F N   1 
ATOM   3847 C  CA  . THR F  1 16 ? -0.839  -14.649 79.091   1.00 127.56 ? 57  THR F CA  1 
ATOM   3848 C  C   . THR F  1 16 ? -1.517  -15.503 78.016   1.00 125.56 ? 57  THR F C   1 
ATOM   3849 O  O   . THR F  1 16 ? -1.145  -15.438 76.844   1.00 126.18 ? 57  THR F O   1 
ATOM   3850 C  CB  . THR F  1 16 ? 0.029   -15.590 79.969   1.00 126.59 ? 57  THR F CB  1 
ATOM   3851 O  OG1 . THR F  1 16 ? 0.667   -14.835 81.006   1.00 129.01 ? 57  THR F OG1 1 
ATOM   3852 C  CG2 . THR F  1 16 ? 1.099   -16.276 79.124   1.00 126.70 ? 57  THR F CG2 1 
ATOM   3853 N  N   . LYS F  1 17 ? -2.511  -16.300 78.409   1.00 121.60 ? 58  LYS F N   1 
ATOM   3854 C  CA  . LYS F  1 17 ? -3.202  -17.165 77.451   1.00 120.59 ? 58  LYS F CA  1 
ATOM   3855 C  C   . LYS F  1 17 ? -4.049  -16.396 76.428   1.00 127.71 ? 58  LYS F C   1 
ATOM   3856 O  O   . LYS F  1 17 ? -3.809  -16.511 75.225   1.00 132.21 ? 58  LYS F O   1 
ATOM   3857 C  CB  . LYS F  1 17 ? -4.077  -18.196 78.171   1.00 112.74 ? 58  LYS F CB  1 
ATOM   3858 C  CG  . LYS F  1 17 ? -4.613  -19.266 77.227   1.00 108.73 ? 58  LYS F CG  1 
ATOM   3859 C  CD  . LYS F  1 17 ? -6.073  -19.581 77.496   1.00 107.92 ? 58  LYS F CD  1 
ATOM   3860 C  CE  . LYS F  1 17 ? -6.646  -20.530 76.448   1.00 105.56 ? 58  LYS F CE  1 
ATOM   3861 N  NZ  . LYS F  1 17 ? -6.053  -21.893 76.521   1.00 93.43  ? 58  LYS F NZ  1 
ATOM   3862 N  N   . THR F  1 18 ? -5.041  -15.635 76.893   1.00 129.25 ? 59  THR F N   1 
ATOM   3863 C  CA  . THR F  1 18 ? -5.879  -14.834 75.993   1.00 129.13 ? 59  THR F CA  1 
ATOM   3864 C  C   . THR F  1 18 ? -4.929  -14.156 75.012   1.00 130.28 ? 59  THR F C   1 
ATOM   3865 O  O   . THR F  1 18 ? -5.137  -14.148 73.796   1.00 132.90 ? 59  THR F O   1 
ATOM   3866 C  CB  . THR F  1 18 ? -6.626  -13.690 76.754   1.00 131.02 ? 59  THR F CB  1 
ATOM   3867 O  OG1 . THR F  1 18 ? -7.559  -14.245 77.690   1.00 132.92 ? 59  THR F OG1 1 
ATOM   3868 C  CG2 . THR F  1 18 ? -7.363  -12.773 75.769   1.00 132.56 ? 59  THR F CG2 1 
ATOM   3869 N  N   . ASN F  1 19 ? -3.861  -13.612 75.580   1.00 126.11 ? 60  ASN F N   1 
ATOM   3870 C  CA  . ASN F  1 19 ? -2.853  -12.868 74.842   1.00 124.24 ? 60  ASN F CA  1 
ATOM   3871 C  C   . ASN F  1 19 ? -1.930  -13.665 73.909   1.00 124.12 ? 60  ASN F C   1 
ATOM   3872 O  O   . ASN F  1 19 ? -1.599  -13.189 72.820   1.00 125.25 ? 60  ASN F O   1 
ATOM   3873 C  CB  . ASN F  1 19 ? -2.039  -12.052 75.845   1.00 120.70 ? 60  ASN F CB  1 
ATOM   3874 C  CG  . ASN F  1 19 ? -1.127  -11.059 75.184   1.00 119.38 ? 60  ASN F CG  1 
ATOM   3875 O  OD1 . ASN F  1 19 ? -1.406  -10.576 74.091   1.00 121.78 ? 60  ASN F OD1 1 
ATOM   3876 N  ND2 . ASN F  1 19 ? -0.027  -10.735 75.852   1.00 113.26 ? 60  ASN F ND2 1 
ATOM   3877 N  N   . LEU F  1 20 ? -1.513  -14.860 74.320   1.00 123.02 ? 61  LEU F N   1 
ATOM   3878 C  CA  . LEU F  1 20 ? -0.652  -15.679 73.472   1.00 123.29 ? 61  LEU F CA  1 
ATOM   3879 C  C   . LEU F  1 20 ? -1.393  -15.882 72.156   1.00 125.95 ? 61  LEU F C   1 
ATOM   3880 O  O   . LEU F  1 20 ? -0.788  -15.967 71.086   1.00 129.76 ? 61  LEU F O   1 
ATOM   3881 C  CB  . LEU F  1 20 ? -0.379  -17.037 74.127   1.00 123.25 ? 61  LEU F CB  1 
ATOM   3882 C  CG  . LEU F  1 20 ? 1.095   -17.401 74.325   1.00 120.95 ? 61  LEU F CG  1 
ATOM   3883 C  CD1 . LEU F  1 20 ? 1.647   -16.645 75.525   1.00 119.39 ? 61  LEU F CD1 1 
ATOM   3884 C  CD2 . LEU F  1 20 ? 1.235   -18.900 74.539   1.00 121.50 ? 61  LEU F CD2 1 
ATOM   3885 N  N   . GLN F  1 21 ? -2.718  -15.950 72.256   1.00 126.01 ? 62  GLN F N   1 
ATOM   3886 C  CA  . GLN F  1 21 ? -3.596  -16.128 71.102   1.00 127.97 ? 62  GLN F CA  1 
ATOM   3887 C  C   . GLN F  1 21 ? -3.347  -15.023 70.081   1.00 127.69 ? 62  GLN F C   1 
ATOM   3888 O  O   . GLN F  1 21 ? -3.231  -15.276 68.881   1.00 126.55 ? 62  GLN F O   1 
ATOM   3889 C  CB  . GLN F  1 21 ? -5.056  -16.071 71.549   1.00 129.14 ? 62  GLN F CB  1 
ATOM   3890 C  CG  . GLN F  1 21 ? -5.395  -16.989 72.710   1.00 130.00 ? 62  GLN F CG  1 
ATOM   3891 C  CD  . GLN F  1 21 ? -5.579  -18.430 72.288   1.00 131.36 ? 62  GLN F CD  1 
ATOM   3892 O  OE1 . GLN F  1 21 ? -4.691  -19.033 71.686   1.00 131.20 ? 62  GLN F OE1 1 
ATOM   3893 N  NE2 . GLN F  1 21 ? -6.740  -18.994 72.604   1.00 129.18 ? 62  GLN F NE2 1 
ATOM   3894 N  N   . LEU F  1 22 ? -3.285  -13.790 70.571   1.00 127.61 ? 63  LEU F N   1 
ATOM   3895 C  CA  . LEU F  1 22 ? -3.039  -12.639 69.716   1.00 124.54 ? 63  LEU F CA  1 
ATOM   3896 C  C   . LEU F  1 22 ? -1.759  -12.813 68.905   1.00 122.48 ? 63  LEU F C   1 
ATOM   3897 O  O   . LEU F  1 22 ? -1.735  -12.516 67.712   1.00 123.09 ? 63  LEU F O   1 
ATOM   3898 C  CB  . LEU F  1 22 ? -2.952  -11.367 70.559   1.00 125.85 ? 63  LEU F CB  1 
ATOM   3899 C  CG  . LEU F  1 22 ? -4.229  -10.536 70.699   1.00 124.49 ? 63  LEU F CG  1 
ATOM   3900 C  CD1 . LEU F  1 22 ? -5.364  -11.398 71.221   1.00 119.37 ? 63  LEU F CD1 1 
ATOM   3901 C  CD2 . LEU F  1 22 ? -3.970  -9.377  71.632   1.00 121.86 ? 63  LEU F CD2 1 
ATOM   3902 N  N   . THR F  1 23 ? -0.697  -13.289 69.553   1.00 121.45 ? 64  THR F N   1 
ATOM   3903 C  CA  . THR F  1 23 ? 0.574   -13.503 68.865   1.00 119.56 ? 64  THR F CA  1 
ATOM   3904 C  C   . THR F  1 23 ? 0.356   -14.504 67.736   1.00 121.99 ? 64  THR F C   1 
ATOM   3905 O  O   . THR F  1 23 ? 0.857   -14.325 66.627   1.00 123.41 ? 64  THR F O   1 
ATOM   3906 C  CB  . THR F  1 23 ? 1.672   -14.055 69.817   1.00 118.62 ? 64  THR F CB  1 
ATOM   3907 O  OG1 . THR F  1 23 ? 1.965   -13.086 70.830   1.00 115.35 ? 64  THR F OG1 1 
ATOM   3908 C  CG2 . THR F  1 23 ? 2.952   -14.356 69.040   1.00 116.69 ? 64  THR F CG2 1 
ATOM   3909 N  N   . THR F  1 24 ? -0.401  -15.558 68.025   1.00 119.48 ? 65  THR F N   1 
ATOM   3910 C  CA  . THR F  1 24 ? -0.692  -16.580 67.027   1.00 122.34 ? 65  THR F CA  1 
ATOM   3911 C  C   . THR F  1 24 ? -1.423  -15.969 65.835   1.00 123.83 ? 65  THR F C   1 
ATOM   3912 O  O   . THR F  1 24 ? -1.158  -16.324 64.686   1.00 123.89 ? 65  THR F O   1 
ATOM   3913 C  CB  . THR F  1 24 ? -1.563  -17.708 67.620   1.00 121.63 ? 65  THR F CB  1 
ATOM   3914 O  OG1 . THR F  1 24 ? -0.815  -18.414 68.618   1.00 121.49 ? 65  THR F OG1 1 
ATOM   3915 C  CG2 . THR F  1 24 ? -1.994  -18.681 66.532   1.00 120.03 ? 65  THR F CG2 1 
ATOM   3916 N  N   . GLN F  1 25 ? -2.341  -15.048 66.114   1.00 126.64 ? 66  GLN F N   1 
ATOM   3917 C  CA  . GLN F  1 25 ? -3.107  -14.392 65.060   1.00 125.92 ? 66  GLN F CA  1 
ATOM   3918 C  C   . GLN F  1 25 ? -2.223  -13.542 64.159   1.00 122.68 ? 66  GLN F C   1 
ATOM   3919 O  O   . GLN F  1 25 ? -2.400  -13.522 62.941   1.00 124.16 ? 66  GLN F O   1 
ATOM   3920 C  CB  . GLN F  1 25 ? -4.214  -13.526 65.664   1.00 119.86 ? 66  GLN F CB  1 
ATOM   3921 C  CG  . GLN F  1 25 ? -5.255  -14.337 66.401   1.00 125.75 ? 66  GLN F CG  1 
ATOM   3922 C  CD  . GLN F  1 25 ? -5.798  -15.474 65.557   1.00 129.98 ? 66  GLN F CD  1 
ATOM   3923 O  OE1 . GLN F  1 25 ? -6.529  -15.253 64.591   1.00 130.46 ? 66  GLN F OE1 1 
ATOM   3924 N  NE2 . GLN F  1 25 ? -5.432  -16.701 65.914   1.00 132.82 ? 66  GLN F NE2 1 
ATOM   3925 N  N   . SER F  1 26 ? -1.270  -12.842 64.759   1.00 126.77 ? 67  SER F N   1 
ATOM   3926 C  CA  . SER F  1 26 ? -0.366  -12.000 63.995   1.00 119.73 ? 67  SER F CA  1 
ATOM   3927 C  C   . SER F  1 26 ? 0.550   -12.847 63.119   1.00 113.43 ? 67  SER F C   1 
ATOM   3928 O  O   . SER F  1 26 ? 0.900   -12.453 62.008   1.00 108.63 ? 67  SER F O   1 
ATOM   3929 C  CB  . SER F  1 26 ? 0.473   -11.136 64.940   1.00 120.47 ? 67  SER F CB  1 
ATOM   3930 O  OG  . SER F  1 26 ? 1.116   -11.928 65.923   1.00 125.16 ? 67  SER F OG  1 
ATOM   3931 N  N   . GLN F  1 27 ? 0.922   -14.020 63.619   1.00 113.98 ? 68  GLN F N   1 
ATOM   3932 C  CA  . GLN F  1 27 ? 1.813   -14.912 62.888   1.00 112.57 ? 68  GLN F CA  1 
ATOM   3933 C  C   . GLN F  1 27 ? 1.170   -15.519 61.641   1.00 112.45 ? 68  GLN F C   1 
ATOM   3934 O  O   . GLN F  1 27 ? 1.835   -15.699 60.619   1.00 109.60 ? 68  GLN F O   1 
ATOM   3935 C  CB  . GLN F  1 27 ? 2.301   -16.023 63.819   1.00 115.06 ? 68  GLN F CB  1 
ATOM   3936 C  CG  . GLN F  1 27 ? 3.621   -16.644 63.405   1.00 112.33 ? 68  GLN F CG  1 
ATOM   3937 C  CD  . GLN F  1 27 ? 4.171   -17.586 64.458   1.00 115.58 ? 68  GLN F CD  1 
ATOM   3938 O  OE1 . GLN F  1 27 ? 4.451   -17.180 65.587   1.00 111.77 ? 68  GLN F OE1 1 
ATOM   3939 N  NE2 . GLN F  1 27 ? 4.327   -18.853 64.094   1.00 113.77 ? 68  GLN F NE2 1 
ATOM   3940 N  N   . ASN F  1 28 ? -0.121  -15.832 61.721   1.00 110.62 ? 69  ASN F N   1 
ATOM   3941 C  CA  . ASN F  1 28 ? -0.822  -16.418 60.584   1.00 111.69 ? 69  ASN F CA  1 
ATOM   3942 C  C   . ASN F  1 28 ? -1.013  -15.401 59.462   1.00 116.20 ? 69  ASN F C   1 
ATOM   3943 O  O   . ASN F  1 28 ? -0.830  -15.721 58.287   1.00 121.59 ? 69  ASN F O   1 
ATOM   3944 C  CB  . ASN F  1 28 ? -2.181  -16.990 61.020   1.00 112.99 ? 69  ASN F CB  1 
ATOM   3945 C  CG  . ASN F  1 28 ? -3.145  -15.924 61.502   1.00 107.13 ? 69  ASN F CG  1 
ATOM   3946 O  OD1 . ASN F  1 28 ? -3.560  -15.051 60.742   1.00 102.54 ? 69  ASN F OD1 1 
ATOM   3947 N  ND2 . ASN F  1 28 ? -3.513  -15.997 62.774   1.00 103.59 ? 69  ASN F ND2 1 
ATOM   3948 N  N   . LEU F  1 29 ? -1.370  -14.174 59.827   1.00 112.63 ? 70  LEU F N   1 
ATOM   3949 C  CA  . LEU F  1 29 ? -1.579  -13.120 58.845   1.00 108.36 ? 70  LEU F CA  1 
ATOM   3950 C  C   . LEU F  1 29 ? -0.262  -12.767 58.170   1.00 107.31 ? 70  LEU F C   1 
ATOM   3951 O  O   . LEU F  1 29 ? -0.239  -12.312 57.023   1.00 110.17 ? 70  LEU F O   1 
ATOM   3952 C  CB  . LEU F  1 29 ? -2.171  -11.886 59.526   1.00 100.09 ? 70  LEU F CB  1 
ATOM   3953 C  CG  . LEU F  1 29 ? -3.494  -12.146 60.250   1.00 98.31  ? 70  LEU F CG  1 
ATOM   3954 C  CD1 . LEU F  1 29 ? -4.054  -10.848 60.772   1.00 93.11  ? 70  LEU F CD1 1 
ATOM   3955 C  CD2 . LEU F  1 29 ? -4.489  -12.794 59.300   1.00 97.29  ? 70  LEU F CD2 1 
ATOM   3956 N  N   . LEU F  1 30 ? 0.831   -12.989 58.894   1.00 105.04 ? 71  LEU F N   1 
ATOM   3957 C  CA  . LEU F  1 30 ? 2.165   -12.712 58.388   1.00 98.73  ? 71  LEU F CA  1 
ATOM   3958 C  C   . LEU F  1 30 ? 2.544   -13.806 57.400   1.00 98.00  ? 71  LEU F C   1 
ATOM   3959 O  O   . LEU F  1 30 ? 3.252   -13.563 56.421   1.00 92.99  ? 71  LEU F O   1 
ATOM   3960 C  CB  . LEU F  1 30 ? 3.171   -12.688 59.538   1.00 101.43 ? 71  LEU F CB  1 
ATOM   3961 C  CG  . LEU F  1 30 ? 4.474   -11.968 59.197   1.00 103.62 ? 71  LEU F CG  1 
ATOM   3962 C  CD1 . LEU F  1 30 ? 4.154   -10.498 58.951   1.00 103.12 ? 71  LEU F CD1 1 
ATOM   3963 C  CD2 . LEU F  1 30 ? 5.489   -12.133 60.316   1.00 101.97 ? 71  LEU F CD2 1 
ATOM   3964 N  N   . SER F  1 31 ? 2.062   -15.015 57.672   1.00 97.81  ? 72  SER F N   1 
ATOM   3965 C  CA  . SER F  1 31 ? 2.320   -16.169 56.822   1.00 94.35  ? 72  SER F CA  1 
ATOM   3966 C  C   . SER F  1 31 ? 1.507   -15.980 55.547   1.00 90.50  ? 72  SER F C   1 
ATOM   3967 O  O   . SER F  1 31 ? 1.918   -16.390 54.463   1.00 80.65  ? 72  SER F O   1 
ATOM   3968 C  CB  . SER F  1 31 ? 1.883   -17.451 57.535   1.00 95.92  ? 72  SER F CB  1 
ATOM   3969 O  OG  . SER F  1 31 ? 2.712   -18.546 57.182   1.00 99.61  ? 72  SER F OG  1 
ATOM   3970 N  N   . LYS F  1 32 ? 0.349   -15.347 55.695   1.00 88.72  ? 73  LYS F N   1 
ATOM   3971 C  CA  . LYS F  1 32 ? -0.529  -15.083 54.568   1.00 88.06  ? 73  LYS F CA  1 
ATOM   3972 C  C   . LYS F  1 32 ? 0.112   -14.017 53.673   1.00 96.58  ? 73  LYS F C   1 
ATOM   3973 O  O   . LYS F  1 32 ? 0.037   -14.095 52.447   1.00 100.08 ? 73  LYS F O   1 
ATOM   3974 C  CB  . LYS F  1 32 ? -1.894  -14.604 55.074   1.00 90.77  ? 73  LYS F CB  1 
ATOM   3975 C  CG  . LYS F  1 32 ? -3.067  -15.128 54.260   1.00 96.84  ? 73  LYS F CG  1 
ATOM   3976 C  CD  . LYS F  1 32 ? -4.385  -14.499 54.680   1.00 96.73  ? 73  LYS F CD  1 
ATOM   3977 C  CE  . LYS F  1 32 ? -5.503  -14.894 53.719   1.00 103.69 ? 73  LYS F CE  1 
ATOM   3978 N  NZ  . LYS F  1 32 ? -6.792  -14.200 54.009   1.00 93.65  ? 73  LYS F NZ  1 
ATOM   3979 N  N   . LEU F  1 33 ? 0.752   -13.031 54.294   1.00 93.88  ? 74  LEU F N   1 
ATOM   3980 C  CA  . LEU F  1 33 ? 1.408   -11.956 53.559   1.00 97.39  ? 74  LEU F CA  1 
ATOM   3981 C  C   . LEU F  1 33 ? 2.608   -12.523 52.808   1.00 97.80  ? 74  LEU F C   1 
ATOM   3982 O  O   . LEU F  1 33 ? 2.920   -12.087 51.701   1.00 105.35 ? 74  LEU F O   1 
ATOM   3983 C  CB  . LEU F  1 33 ? 1.854   -10.855 54.530   1.00 101.97 ? 74  LEU F CB  1 
ATOM   3984 C  CG  . LEU F  1 33 ? 1.862   -9.401  54.037   1.00 108.16 ? 74  LEU F CG  1 
ATOM   3985 C  CD1 . LEU F  1 33 ? 1.578   -8.471  55.213   1.00 105.62 ? 74  LEU F CD1 1 
ATOM   3986 C  CD2 . LEU F  1 33 ? 3.193   -9.063  53.370   1.00 106.82 ? 74  LEU F CD2 1 
ATOM   3987 N  N   . GLU F  1 34 ? 3.273   -13.503 53.413   1.00 95.46  ? 75  GLU F N   1 
ATOM   3988 C  CA  . GLU F  1 34 ? 4.433   -14.145 52.800   1.00 101.47 ? 75  GLU F CA  1 
ATOM   3989 C  C   . GLU F  1 34 ? 3.986   -14.911 51.557   1.00 103.05 ? 75  GLU F C   1 
ATOM   3990 O  O   . GLU F  1 34 ? 4.677   -14.919 50.536   1.00 102.25 ? 75  GLU F O   1 
ATOM   3991 C  CB  . GLU F  1 34 ? 5.086   -15.111 53.791   1.00 101.04 ? 75  GLU F CB  1 
ATOM   3992 C  CG  . GLU F  1 34 ? 6.335   -15.812 53.275   1.00 104.12 ? 75  GLU F CG  1 
ATOM   3993 C  CD  . GLU F  1 34 ? 7.536   -14.887 53.182   1.00 110.17 ? 75  GLU F CD  1 
ATOM   3994 O  OE1 . GLU F  1 34 ? 7.881   -14.258 54.204   1.00 114.30 ? 75  GLU F OE1 1 
ATOM   3995 O  OE2 . GLU F  1 34 ? 8.139   -14.795 52.090   1.00 115.90 ? 75  GLU F OE2 1 
ATOM   3996 N  N   . LEU F  1 35 ? 2.828   -15.558 51.654   1.00 102.15 ? 76  LEU F N   1 
ATOM   3997 C  CA  . LEU F  1 35 ? 2.286   -16.318 50.536   1.00 99.55  ? 76  LEU F CA  1 
ATOM   3998 C  C   . LEU F  1 35 ? 1.810   -15.366 49.447   1.00 97.49  ? 76  LEU F C   1 
ATOM   3999 O  O   . LEU F  1 35 ? 2.046   -15.598 48.260   1.00 94.67  ? 76  LEU F O   1 
ATOM   4000 C  CB  . LEU F  1 35 ? 1.121   -17.200 50.999   1.00 104.92 ? 76  LEU F CB  1 
ATOM   4001 C  CG  . LEU F  1 35 ? 1.447   -18.284 52.033   1.00 114.47 ? 76  LEU F CG  1 
ATOM   4002 C  CD1 . LEU F  1 35 ? 0.211   -19.142 52.287   1.00 118.88 ? 76  LEU F CD1 1 
ATOM   4003 C  CD2 . LEU F  1 35 ? 2.600   -19.145 51.531   1.00 111.15 ? 76  LEU F CD2 1 
ATOM   4004 N  N   . ALA F  1 36 ? 1.142   -14.290 49.856   1.00 97.16  ? 77  ALA F N   1 
ATOM   4005 C  CA  . ALA F  1 36 ? 0.638   -13.298 48.912   1.00 91.72  ? 77  ALA F CA  1 
ATOM   4006 C  C   . ALA F  1 36 ? 1.803   -12.652 48.165   1.00 84.02  ? 77  ALA F C   1 
ATOM   4007 O  O   . ALA F  1 36 ? 1.767   -12.515 46.944   1.00 79.41  ? 77  ALA F O   1 
ATOM   4008 C  CB  . ALA F  1 36 ? -0.175  -12.236 49.647   1.00 88.31  ? 77  ALA F CB  1 
ATOM   4009 N  N   . GLN F  1 37 ? 2.836   -12.256 48.900   1.00 85.66  ? 78  GLN F N   1 
ATOM   4010 C  CA  . GLN F  1 37 ? 4.002   -11.646 48.277   1.00 86.94  ? 78  GLN F CA  1 
ATOM   4011 C  C   . GLN F  1 37 ? 4.611   -12.621 47.279   1.00 87.00  ? 78  GLN F C   1 
ATOM   4012 O  O   . GLN F  1 37 ? 4.982   -12.232 46.175   1.00 82.35  ? 78  GLN F O   1 
ATOM   4013 C  CB  . GLN F  1 37 ? 5.041   -11.257 49.336   1.00 85.39  ? 78  GLN F CB  1 
ATOM   4014 C  CG  . GLN F  1 37 ? 6.426   -10.932 48.779   1.00 87.27  ? 78  GLN F CG  1 
ATOM   4015 C  CD  . GLN F  1 37 ? 6.379   -10.105 47.507   1.00 93.32  ? 78  GLN F CD  1 
ATOM   4016 O  OE1 . GLN F  1 37 ? 5.743   -9.051  47.457   1.00 93.12  ? 78  GLN F OE1 1 
ATOM   4017 N  NE2 . GLN F  1 37 ? 7.061   -10.581 46.469   1.00 90.21  ? 78  GLN F NE2 1 
ATOM   4018 N  N   . SER F  1 38 ? 4.706   -13.889 47.667   1.00 81.06  ? 79  SER F N   1 
ATOM   4019 C  CA  . SER F  1 38 ? 5.266   -14.905 46.784   1.00 77.57  ? 79  SER F CA  1 
ATOM   4020 C  C   . SER F  1 38 ? 4.434   -15.036 45.510   1.00 80.01  ? 79  SER F C   1 
ATOM   4021 O  O   . SER F  1 38 ? 4.983   -15.190 44.417   1.00 74.08  ? 79  SER F O   1 
ATOM   4022 C  CB  . SER F  1 38 ? 5.325   -16.255 47.497   1.00 78.85  ? 79  SER F CB  1 
ATOM   4023 O  OG  . SER F  1 38 ? 5.761   -17.269 46.609   1.00 85.22  ? 79  SER F OG  1 
ATOM   4024 N  N   . LYS F  1 39 ? 3.112   -14.976 45.656   1.00 76.16  ? 80  LYS F N   1 
ATOM   4025 C  CA  . LYS F  1 39 ? 2.210   -15.078 44.513   1.00 76.04  ? 80  LYS F CA  1 
ATOM   4026 C  C   . LYS F  1 39 ? 2.383   -13.889 43.574   1.00 77.24  ? 80  LYS F C   1 
ATOM   4027 O  O   . LYS F  1 39 ? 2.388   -14.052 42.354   1.00 84.73  ? 80  LYS F O   1 
ATOM   4028 C  CB  . LYS F  1 39 ? 0.754   -15.162 44.981   1.00 75.34  ? 80  LYS F CB  1 
ATOM   4029 C  CG  . LYS F  1 39 ? 0.365   -16.526 45.538   1.00 91.02  ? 80  LYS F CG  1 
ATOM   4030 C  CD  . LYS F  1 39 ? -1.084  -16.556 46.003   1.00 94.29  ? 80  LYS F CD  1 
ATOM   4031 C  CE  . LYS F  1 39 ? -1.473  -17.937 46.516   1.00 97.30  ? 80  LYS F CE  1 
ATOM   4032 N  NZ  . LYS F  1 39 ? -2.841  -17.951 47.111   1.00 99.16  ? 80  LYS F NZ  1 
ATOM   4033 N  N   . GLU F  1 40 ? 2.522   -12.697 44.149   1.00 77.11  ? 81  GLU F N   1 
ATOM   4034 C  CA  . GLU F  1 40 ? 2.711   -11.473 43.373   1.00 78.33  ? 81  GLU F CA  1 
ATOM   4035 C  C   . GLU F  1 40 ? 3.989   -11.569 42.558   1.00 69.09  ? 81  GLU F C   1 
ATOM   4036 O  O   . GLU F  1 40 ? 4.022   -11.181 41.396   1.00 64.76  ? 81  GLU F O   1 
ATOM   4037 C  CB  . GLU F  1 40 ? 2.788   -10.256 44.301   1.00 91.21  ? 81  GLU F CB  1 
ATOM   4038 C  CG  . GLU F  1 40 ? 1.431   -9.718  44.741   1.00 100.25 ? 81  GLU F CG  1 
ATOM   4039 C  CD  . GLU F  1 40 ? 0.954   -8.552  43.887   1.00 106.93 ? 81  GLU F CD  1 
ATOM   4040 O  OE1 . GLU F  1 40 ? 1.394   -7.409  44.141   1.00 111.28 ? 81  GLU F OE1 1 
ATOM   4041 O  OE2 . GLU F  1 40 ? 0.149   -8.781  42.958   1.00 99.09  ? 81  GLU F OE2 1 
ATOM   4042 N  N   . SER F  1 41 ? 5.043   -12.086 43.180   1.00 69.92  ? 82  SER F N   1 
ATOM   4043 C  CA  . SER F  1 41 ? 6.323   -12.242 42.503   1.00 78.98  ? 82  SER F CA  1 
ATOM   4044 C  C   . SER F  1 41 ? 6.190   -13.237 41.365   1.00 84.79  ? 82  SER F C   1 
ATOM   4045 O  O   . SER F  1 41 ? 6.752   -13.048 40.286   1.00 90.18  ? 82  SER F O   1 
ATOM   4046 C  CB  . SER F  1 41 ? 7.387   -12.743 43.477   1.00 77.49  ? 82  SER F CB  1 
ATOM   4047 O  OG  . SER F  1 41 ? 8.563   -13.112 42.777   1.00 71.90  ? 82  SER F OG  1 
ATOM   4048 N  N   . LYS F  1 42 ? 5.437   -14.300 41.618   1.00 84.77  ? 83  LYS F N   1 
ATOM   4049 C  CA  . LYS F  1 42 ? 5.227   -15.342 40.627   1.00 85.11  ? 83  LYS F CA  1 
ATOM   4050 C  C   . LYS F  1 42 ? 4.410   -14.851 39.430   1.00 80.36  ? 83  LYS F C   1 
ATOM   4051 O  O   . LYS F  1 42 ? 4.761   -15.123 38.280   1.00 73.49  ? 83  LYS F O   1 
ATOM   4052 C  CB  . LYS F  1 42 ? 4.529   -16.544 41.276   1.00 89.87  ? 83  LYS F CB  1 
ATOM   4053 C  CG  . LYS F  1 42 ? 4.451   -17.766 40.376   1.00 94.36  ? 83  LYS F CG  1 
ATOM   4054 C  CD  . LYS F  1 42 ? 5.841   -18.180 39.910   1.00 97.03  ? 83  LYS F CD  1 
ATOM   4055 C  CE  . LYS F  1 42 ? 5.780   -19.251 38.834   1.00 98.77  ? 83  LYS F CE  1 
ATOM   4056 N  NZ  . LYS F  1 42 ? 7.125   -19.511 38.249   1.00 89.13  ? 83  LYS F NZ  1 
ATOM   4057 N  N   . LEU F  1 43 ? 3.332   -14.120 39.701   1.00 67.89  ? 84  LEU F N   1 
ATOM   4058 C  CA  . LEU F  1 43 ? 2.471   -13.620 38.636   1.00 64.58  ? 84  LEU F CA  1 
ATOM   4059 C  C   . LEU F  1 43 ? 3.144   -12.591 37.730   1.00 67.48  ? 84  LEU F C   1 
ATOM   4060 O  O   . LEU F  1 43 ? 3.008   -12.650 36.508   1.00 59.42  ? 84  LEU F O   1 
ATOM   4061 C  CB  . LEU F  1 43 ? 1.183   -13.027 39.222   1.00 40.64  ? 84  LEU F CB  1 
ATOM   4062 C  CG  . LEU F  1 43 ? 0.215   -12.435 38.187   1.00 67.94  ? 84  LEU F CG  1 
ATOM   4063 C  CD1 . LEU F  1 43 ? -0.188  -13.503 37.188   1.00 63.69  ? 84  LEU F CD1 1 
ATOM   4064 C  CD2 . LEU F  1 43 ? -1.012  -11.876 38.879   1.00 71.41  ? 84  LEU F CD2 1 
ATOM   4065 N  N   . LEU F  1 44 ? 3.864   -11.646 38.324   1.00 68.07  ? 85  LEU F N   1 
ATOM   4066 C  CA  . LEU F  1 44 ? 4.539   -10.625 37.536   1.00 71.83  ? 85  LEU F CA  1 
ATOM   4067 C  C   . LEU F  1 44 ? 5.630   -11.272 36.696   1.00 65.10  ? 85  LEU F C   1 
ATOM   4068 O  O   . LEU F  1 44 ? 5.814   -10.924 35.531   1.00 77.30  ? 85  LEU F O   1 
ATOM   4069 C  CB  . LEU F  1 44 ? 5.134   -9.556  38.451   1.00 75.00  ? 85  LEU F CB  1 
ATOM   4070 C  CG  . LEU F  1 44 ? 4.103   -8.912  39.381   1.00 86.03  ? 85  LEU F CG  1 
ATOM   4071 C  CD1 . LEU F  1 44 ? 4.785   -7.878  40.266   1.00 90.66  ? 85  LEU F CD1 1 
ATOM   4072 C  CD2 . LEU F  1 44 ? 2.986   -8.279  38.556   1.00 83.85  ? 85  LEU F CD2 1 
ATOM   4073 N  N   . GLU F  1 45 ? 6.352   -12.216 37.291   1.00 63.97  ? 86  GLU F N   1 
ATOM   4074 C  CA  . GLU F  1 45 ? 7.404   -12.920 36.572   1.00 67.90  ? 86  GLU F CA  1 
ATOM   4075 C  C   . GLU F  1 45 ? 6.814   -13.480 35.284   1.00 66.24  ? 86  GLU F C   1 
ATOM   4076 O  O   . GLU F  1 45 ? 7.453   -13.467 34.236   1.00 62.80  ? 86  GLU F O   1 
ATOM   4077 C  CB  . GLU F  1 45 ? 7.954   -14.075 37.414   1.00 72.08  ? 86  GLU F CB  1 
ATOM   4078 C  CG  . GLU F  1 45 ? 8.953   -14.959 36.666   1.00 89.51  ? 86  GLU F CG  1 
ATOM   4079 C  CD  . GLU F  1 45 ? 9.365   -16.189 37.461   1.00 99.94  ? 86  GLU F CD  1 
ATOM   4080 O  OE1 . GLU F  1 45 ? 9.984   -16.023 38.534   1.00 102.89 ? 86  GLU F OE1 1 
ATOM   4081 O  OE2 . GLU F  1 45 ? 9.068   -17.321 37.014   1.00 98.07  ? 86  GLU F OE2 1 
ATOM   4082 N  N   . ASN F  1 46 ? 5.580   -13.967 35.368   1.00 58.72  ? 87  ASN F N   1 
ATOM   4083 C  CA  . ASN F  1 46 ? 4.921   -14.538 34.209   1.00 61.69  ? 87  ASN F CA  1 
ATOM   4084 C  C   . ASN F  1 46 ? 4.448   -13.467 33.239   1.00 59.44  ? 87  ASN F C   1 
ATOM   4085 O  O   . ASN F  1 46 ? 4.637   -13.604 32.032   1.00 64.98  ? 87  ASN F O   1 
ATOM   4086 C  CB  . ASN F  1 46 ? 3.748   -15.423 34.642   1.00 61.16  ? 87  ASN F CB  1 
ATOM   4087 C  CG  . ASN F  1 46 ? 4.194   -16.608 35.486   1.00 70.10  ? 87  ASN F CG  1 
ATOM   4088 O  OD1 . ASN F  1 46 ? 5.226   -17.219 35.213   1.00 67.60  ? 87  ASN F OD1 1 
ATOM   4089 N  ND2 . ASN F  1 46 ? 3.412   -16.945 36.506   1.00 69.23  ? 87  ASN F ND2 1 
ATOM   4090 N  N   . LEU F  1 47 ? 3.841   -12.402 33.755   1.00 60.11  ? 88  LEU F N   1 
ATOM   4091 C  CA  . LEU F  1 47 ? 3.354   -11.317 32.903   1.00 56.49  ? 88  LEU F CA  1 
ATOM   4092 C  C   . LEU F  1 47 ? 4.500   -10.657 32.155   1.00 60.75  ? 88  LEU F C   1 
ATOM   4093 O  O   . LEU F  1 47 ? 4.345   -10.233 31.010   1.00 53.97  ? 88  LEU F O   1 
ATOM   4094 C  CB  . LEU F  1 47 ? 2.642   -10.250 33.735   1.00 52.97  ? 88  LEU F CB  1 
ATOM   4095 C  CG  . LEU F  1 47 ? 1.440   -10.687 34.569   1.00 63.84  ? 88  LEU F CG  1 
ATOM   4096 C  CD1 . LEU F  1 47 ? 0.979   -9.537  35.445   1.00 53.82  ? 88  LEU F CD1 1 
ATOM   4097 C  CD2 . LEU F  1 47 ? 0.322   -11.155 33.659   1.00 60.69  ? 88  LEU F CD2 1 
ATOM   4098 N  N   . ASN F  1 48 ? 5.651   -10.550 32.806   1.00 57.73  ? 89  ASN F N   1 
ATOM   4099 C  CA  . ASN F  1 48 ? 6.787   -9.924  32.155   1.00 66.55  ? 89  ASN F CA  1 
ATOM   4100 C  C   . ASN F  1 48 ? 7.280   -10.798 31.025   1.00 65.08  ? 89  ASN F C   1 
ATOM   4101 O  O   . ASN F  1 48 ? 7.692   -10.289 29.986   1.00 76.01  ? 89  ASN F O   1 
ATOM   4102 C  CB  . ASN F  1 48 ? 7.927   -9.673  33.138   1.00 67.18  ? 89  ASN F CB  1 
ATOM   4103 C  CG  . ASN F  1 48 ? 7.562   -8.660  34.198   1.00 76.27  ? 89  ASN F CG  1 
ATOM   4104 O  OD1 . ASN F  1 48 ? 6.797   -7.730  33.947   1.00 78.65  ? 89  ASN F OD1 1 
ATOM   4105 N  ND2 . ASN F  1 48 ? 8.120   -8.823  35.386   1.00 84.66  ? 89  ASN F ND2 1 
ATOM   4106 N  N   . LEU F  1 49 ? 7.244   -12.112 31.222   1.00 63.30  ? 90  LEU F N   1 
ATOM   4107 C  CA  . LEU F  1 49 ? 7.699   -13.034 30.187   1.00 57.95  ? 90  LEU F CA  1 
ATOM   4108 C  C   . LEU F  1 49 ? 6.853   -12.900 28.937   1.00 54.81  ? 90  LEU F C   1 
ATOM   4109 O  O   . LEU F  1 49 ? 7.373   -12.803 27.830   1.00 53.88  ? 90  LEU F O   1 
ATOM   4110 C  CB  . LEU F  1 49 ? 7.635   -14.482 30.678   1.00 53.01  ? 90  LEU F CB  1 
ATOM   4111 C  CG  . LEU F  1 49 ? 8.879   -15.104 31.308   1.00 59.70  ? 90  LEU F CG  1 
ATOM   4112 C  CD1 . LEU F  1 49 ? 9.380   -14.259 32.466   1.00 50.92  ? 90  LEU F CD1 1 
ATOM   4113 C  CD2 . LEU F  1 49 ? 8.523   -16.508 31.769   1.00 55.90  ? 90  LEU F CD2 1 
ATOM   4114 N  N   . LEU F  1 50 ? 5.543   -12.896 29.119   1.00 50.87  ? 91  LEU F N   1 
ATOM   4115 C  CA  . LEU F  1 50 ? 4.644   -12.791 27.992   1.00 49.40  ? 91  LEU F CA  1 
ATOM   4116 C  C   . LEU F  1 50 ? 4.758   -11.440 27.333   1.00 51.68  ? 91  LEU F C   1 
ATOM   4117 O  O   . LEU F  1 50 ? 4.724   -11.341 26.104   1.00 58.04  ? 91  LEU F O   1 
ATOM   4118 C  CB  . LEU F  1 50 ? 3.219   -12.985 28.450   1.00 52.47  ? 91  LEU F CB  1 
ATOM   4119 C  CG  . LEU F  1 50 ? 2.967   -14.299 29.161   1.00 65.85  ? 91  LEU F CG  1 
ATOM   4120 C  CD1 . LEU F  1 50 ? 1.645   -14.150 29.857   1.00 58.78  ? 91  LEU F CD1 1 
ATOM   4121 C  CD2 . LEU F  1 50 ? 2.981   -15.490 28.193   1.00 59.18  ? 91  LEU F CD2 1 
ATOM   4122 N  N   . LYS F  1 51 ? 4.870   -10.402 28.159   1.00 51.77  ? 92  LYS F N   1 
ATOM   4123 C  CA  . LYS F  1 51 ? 4.986   -9.039  27.669   1.00 47.01  ? 92  LYS F CA  1 
ATOM   4124 C  C   . LYS F  1 51 ? 6.080   -9.045  26.643   1.00 41.46  ? 92  LYS F C   1 
ATOM   4125 O  O   . LYS F  1 51 ? 5.910   -8.562  25.521   1.00 51.46  ? 92  LYS F O   1 
ATOM   4126 C  CB  . LYS F  1 51 ? 5.365   -8.074  28.796   1.00 57.46  ? 92  LYS F CB  1 
ATOM   4127 C  CG  . LYS F  1 51 ? 5.506   -6.624  28.343   1.00 52.89  ? 92  LYS F CG  1 
ATOM   4128 C  CD  . LYS F  1 51 ? 5.886   -5.709  29.507   1.00 53.03  ? 92  LYS F CD  1 
ATOM   4129 C  CE  . LYS F  1 51 ? 7.284   -5.123  29.346   1.00 71.19  ? 92  LYS F CE  1 
ATOM   4130 N  NZ  . LYS F  1 51 ? 7.668   -4.270  30.512   1.00 75.29  ? 92  LYS F NZ  1 
ATOM   4131 N  N   . ASN F  1 52 ? 7.210   -9.615  27.027   1.00 38.20  ? 93  ASN F N   1 
ATOM   4132 C  CA  . ASN F  1 52 ? 8.325   -9.665  26.113   1.00 37.68  ? 93  ASN F CA  1 
ATOM   4133 C  C   . ASN F  1 52 ? 8.007   -10.498 24.879   1.00 41.93  ? 93  ASN F C   1 
ATOM   4134 O  O   . ASN F  1 52 ? 8.467   -10.161 23.790   1.00 47.18  ? 93  ASN F O   1 
ATOM   4135 C  CB  . ASN F  1 52 ? 9.566   -10.215 26.806   1.00 40.12  ? 93  ASN F CB  1 
ATOM   4136 C  CG  . ASN F  1 52 ? 10.794  -10.158 25.922   1.00 56.51  ? 93  ASN F CG  1 
ATOM   4137 O  OD1 . ASN F  1 52 ? 11.243  -9.081  25.515   1.00 67.26  ? 93  ASN F OD1 1 
ATOM   4138 N  ND2 . ASN F  1 52 ? 11.342  -11.320 25.613   1.00 35.83  ? 93  ASN F ND2 1 
ATOM   4139 N  N   . GLU F  1 53 ? 7.229   -11.573 25.034   1.00 47.40  ? 94  GLU F N   1 
ATOM   4140 C  CA  . GLU F  1 53 ? 6.879   -12.414 23.887   1.00 44.41  ? 94  GLU F CA  1 
ATOM   4141 C  C   . GLU F  1 53 ? 5.868   -11.702 22.997   1.00 32.26  ? 94  GLU F C   1 
ATOM   4142 O  O   . GLU F  1 53 ? 5.895   -11.832 21.778   1.00 34.33  ? 94  GLU F O   1 
ATOM   4143 C  CB  . GLU F  1 53 ? 6.298   -13.754 24.346   1.00 51.16  ? 94  GLU F CB  1 
ATOM   4144 C  CG  . GLU F  1 53 ? 6.070   -14.747 23.209   1.00 57.23  ? 94  GLU F CG  1 
ATOM   4145 C  CD  . GLU F  1 53 ? 7.292   -14.899 22.318   1.00 55.27  ? 94  GLU F CD  1 
ATOM   4146 O  OE1 . GLU F  1 53 ? 8.404   -15.074 22.857   1.00 73.84  ? 94  GLU F OE1 1 
ATOM   4147 O  OE2 . GLU F  1 53 ? 7.144   -14.849 21.078   1.00 50.42  ? 94  GLU F OE2 1 
ATOM   4148 N  N   . ASN F  1 54 ? 4.978   -10.946 23.628   1.00 41.83  ? 95  ASN F N   1 
ATOM   4149 C  CA  . ASN F  1 54 ? 3.938   -10.188 22.936   1.00 34.10  ? 95  ASN F CA  1 
ATOM   4150 C  C   . ASN F  1 54 ? 4.582   -9.063  22.136   1.00 24.56  ? 95  ASN F C   1 
ATOM   4151 O  O   . ASN F  1 54 ? 4.094   -8.671  21.078   1.00 43.14  ? 95  ASN F O   1 
ATOM   4152 C  CB  . ASN F  1 54 ? 2.965   -9.622  23.973   1.00 48.91  ? 95  ASN F CB  1 
ATOM   4153 C  CG  . ASN F  1 54 ? 1.791   -8.898  23.352   1.00 52.97  ? 95  ASN F CG  1 
ATOM   4154 O  OD1 . ASN F  1 54 ? 1.407   -9.162  22.214   1.00 50.30  ? 95  ASN F OD1 1 
ATOM   4155 N  ND2 . ASN F  1 54 ? 1.196   -7.987  24.114   1.00 62.16  ? 95  ASN F ND2 1 
ATOM   4156 N  N   . GLU F  1 55 ? 5.697   -8.549  22.643   1.00 36.39  ? 96  GLU F N   1 
ATOM   4157 C  CA  . GLU F  1 55 ? 6.412   -7.489  21.952   1.00 34.39  ? 96  GLU F CA  1 
ATOM   4158 C  C   . GLU F  1 55 ? 7.107   -8.103  20.745   1.00 35.02  ? 96  GLU F C   1 
ATOM   4159 O  O   . GLU F  1 55 ? 7.218   -7.481  19.689   1.00 33.73  ? 96  GLU F O   1 
ATOM   4160 C  CB  . GLU F  1 55 ? 7.439   -6.854  22.888   1.00 42.62  ? 96  GLU F CB  1 
ATOM   4161 C  CG  . GLU F  1 55 ? 8.304   -5.792  22.241   1.00 38.46  ? 96  GLU F CG  1 
ATOM   4162 C  CD  . GLU F  1 55 ? 7.493   -4.700  21.576   1.00 52.20  ? 96  GLU F CD  1 
ATOM   4163 O  OE1 . GLU F  1 55 ? 6.641   -4.093  22.260   1.00 53.31  ? 96  GLU F OE1 1 
ATOM   4164 O  OE2 . GLU F  1 55 ? 7.709   -4.450  20.372   1.00 54.36  ? 96  GLU F OE2 1 
ATOM   4165 N  N   . ASN F  1 56 ? 7.565   -9.338  20.908   1.00 43.54  ? 97  ASN F N   1 
ATOM   4166 C  CA  . ASN F  1 56 ? 8.243   -10.049 19.837   1.00 29.13  ? 97  ASN F CA  1 
ATOM   4167 C  C   . ASN F  1 56 ? 7.277   -10.287 18.696   1.00 18.66  ? 97  ASN F C   1 
ATOM   4168 O  O   . ASN F  1 56 ? 7.630   -10.092 17.537   1.00 20.70  ? 97  ASN F O   1 
ATOM   4169 C  CB  . ASN F  1 56 ? 8.794   -11.372 20.379   1.00 51.32  ? 97  ASN F CB  1 
ATOM   4170 C  CG  . ASN F  1 56 ? 9.350   -12.265 19.294   1.00 48.50  ? 97  ASN F CG  1 
ATOM   4171 O  OD1 . ASN F  1 56 ? 10.330  -11.936 18.628   1.00 63.51  ? 97  ASN F OD1 1 
ATOM   4172 N  ND2 . ASN F  1 56 ? 8.717   -13.414 19.112   1.00 63.68  ? 97  ASN F ND2 1 
ATOM   4173 N  N   . LEU F  1 57 ? 6.053   -10.702 19.029   1.00 17.75  ? 98  LEU F N   1 
ATOM   4174 C  CA  . LEU F  1 57 ? 5.026   -10.941 18.024   1.00 16.18  ? 98  LEU F CA  1 
ATOM   4175 C  C   . LEU F  1 57 ? 4.593   -9.629  17.326   1.00 17.48  ? 98  LEU F C   1 
ATOM   4176 O  O   . LEU F  1 57 ? 4.419   -9.583  16.104   1.00 28.15  ? 98  LEU F O   1 
ATOM   4177 C  CB  . LEU F  1 57 ? 3.807   -11.625 18.667   1.00 22.61  ? 98  LEU F CB  1 
ATOM   4178 C  CG  . LEU F  1 57 ? 4.033   -13.011 19.298   1.00 36.26  ? 98  LEU F CG  1 
ATOM   4179 C  CD1 . LEU F  1 57 ? 2.703   -13.631 19.757   1.00 17.96  ? 98  LEU F CD1 1 
ATOM   4180 C  CD2 . LEU F  1 57 ? 4.700   -13.918 18.281   1.00 25.70  ? 98  LEU F CD2 1 
ATOM   4181 N  N   . ASN F  1 58 ? 4.399   -8.567  18.093   1.00 28.57  ? 99  ASN F N   1 
ATOM   4182 C  CA  . ASN F  1 58 ? 3.999   -7.302  17.484   1.00 22.96  ? 99  ASN F CA  1 
ATOM   4183 C  C   . ASN F  1 58 ? 5.037   -6.849  16.467   1.00 14.38  ? 99  ASN F C   1 
ATOM   4184 O  O   . ASN F  1 58 ? 4.701   -6.361  15.394   1.00 30.70  ? 99  ASN F O   1 
ATOM   4185 C  CB  . ASN F  1 58 ? 3.798   -6.244  18.562   1.00 29.77  ? 99  ASN F CB  1 
ATOM   4186 C  CG  . ASN F  1 58 ? 2.514   -6.461  19.341   1.00 34.95  ? 99  ASN F CG  1 
ATOM   4187 O  OD1 . ASN F  1 58 ? 1.754   -7.386  19.053   1.00 30.30  ? 99  ASN F OD1 1 
ATOM   4188 N  ND2 . ASN F  1 58 ? 2.266   -5.616  20.324   1.00 18.92  ? 99  ASN F ND2 1 
ATOM   4189 N  N   . SER F  1 59 ? 6.308   -7.040  16.799   1.00 26.81  ? 100 SER F N   1 
ATOM   4190 C  CA  . SER F  1 59 ? 7.393   -6.660  15.907   1.00 23.85  ? 100 SER F CA  1 
ATOM   4191 C  C   . SER F  1 59 ? 7.371   -7.466  14.617   1.00 25.82  ? 100 SER F C   1 
ATOM   4192 O  O   . SER F  1 59 ? 7.690   -6.939  13.546   1.00 34.65  ? 100 SER F O   1 
ATOM   4193 C  CB  . SER F  1 59 ? 8.735   -6.844  16.601   1.00 24.43  ? 100 SER F CB  1 
ATOM   4194 O  OG  . SER F  1 59 ? 9.773   -6.348  15.777   1.00 41.56  ? 100 SER F OG  1 
ATOM   4195 N  N   . ILE F  1 60 ? 6.993   -8.742  14.712   1.00 30.11  ? 101 ILE F N   1 
ATOM   4196 C  CA  . ILE F  1 60 ? 6.914   -9.591  13.524   1.00 17.59  ? 101 ILE F CA  1 
ATOM   4197 C  C   . ILE F  1 60 ? 5.753   -9.133  12.628   1.00 10.80  ? 101 ILE F C   1 
ATOM   4198 O  O   . ILE F  1 60 ? 5.888   -9.053  11.402   1.00 15.30  ? 101 ILE F O   1 
ATOM   4199 C  CB  . ILE F  1 60 ? 6.679   -11.085 13.890   1.00 28.70  ? 101 ILE F CB  1 
ATOM   4200 C  CG1 . ILE F  1 60 ? 7.794   -11.589 14.804   1.00 31.80  ? 101 ILE F CG1 1 
ATOM   4201 C  CG2 . ILE F  1 60 ? 6.634   -11.925 12.611   1.00 14.57  ? 101 ILE F CG2 1 
ATOM   4202 C  CD1 . ILE F  1 60 ? 7.705   -13.070 15.143   1.00 28.51  ? 101 ILE F CD1 1 
ATOM   4203 N  N   . PHE F  1 61 ? 4.615   -8.835  13.249   1.00 15.40  ? 102 PHE F N   1 
ATOM   4204 C  CA  . PHE F  1 61 ? 3.437   -8.385  12.511   1.00 17.00  ? 102 PHE F CA  1 
ATOM   4205 C  C   . PHE F  1 61 ? 3.777   -7.137  11.697   1.00 8.00   ? 102 PHE F C   1 
ATOM   4206 O  O   . PHE F  1 61 ? 3.450   -7.052  10.514   1.00 35.52  ? 102 PHE F O   1 
ATOM   4207 C  CB  . PHE F  1 61 ? 2.301   -8.074  13.485   1.00 17.23  ? 102 PHE F CB  1 
ATOM   4208 C  CG  . PHE F  1 61 ? 0.934   -8.164  12.872   1.00 15.63  ? 102 PHE F CG  1 
ATOM   4209 C  CD1 . PHE F  1 61 ? 0.779   -8.206  11.493   1.00 20.85  ? 102 PHE F CD1 1 
ATOM   4210 C  CD2 . PHE F  1 61 ? -0.204  -8.194  13.681   1.00 27.50  ? 102 PHE F CD2 1 
ATOM   4211 C  CE1 . PHE F  1 61 ? -0.481  -8.268  10.926   1.00 20.47  ? 102 PHE F CE1 1 
ATOM   4212 C  CE2 . PHE F  1 61 ? -1.468  -8.253  13.121   1.00 23.91  ? 102 PHE F CE2 1 
ATOM   4213 C  CZ  . PHE F  1 61 ? -1.610  -8.294  11.746   1.00 9.55   ? 102 PHE F CZ  1 
ATOM   4214 N  N   . GLU F  1 62 ? 4.444   -6.174  12.331   1.00 19.29  ? 103 GLU F N   1 
ATOM   4215 C  CA  . GLU F  1 62 ? 4.836   -4.932  11.646   1.00 31.02  ? 103 GLU F CA  1 
ATOM   4216 C  C   . GLU F  1 62 ? 5.777   -5.194  10.466   1.00 29.73  ? 103 GLU F C   1 
ATOM   4217 O  O   . GLU F  1 62 ? 5.752   -4.477  9.468    1.00 37.36  ? 103 GLU F O   1 
ATOM   4218 C  CB  . GLU F  1 62 ? 5.521   -3.962  12.621   1.00 30.63  ? 103 GLU F CB  1 
ATOM   4219 C  CG  . GLU F  1 62 ? 4.580   -3.305  13.620   1.00 23.13  ? 103 GLU F CG  1 
ATOM   4220 C  CD  . GLU F  1 62 ? 5.314   -2.547  14.719   1.00 51.85  ? 103 GLU F CD  1 
ATOM   4221 O  OE1 . GLU F  1 62 ? 5.999   -3.190  15.544   1.00 59.24  ? 103 GLU F OE1 1 
ATOM   4222 O  OE2 . GLU F  1 62 ? 5.205   -1.306  14.759   1.00 68.06  ? 103 GLU F OE2 1 
ATOM   4223 N  N   . ARG F  1 63 ? 6.611   -6.220  10.584   1.00 29.23  ? 104 ARG F N   1 
ATOM   4224 C  CA  . ARG F  1 63 ? 7.545   -6.555  9.516    1.00 26.28  ? 104 ARG F CA  1 
ATOM   4225 C  C   . ARG F  1 63 ? 6.797   -7.160  8.332    1.00 23.42  ? 104 ARG F C   1 
ATOM   4226 O  O   . ARG F  1 63 ? 7.084   -6.838  7.184    1.00 38.01  ? 104 ARG F O   1 
ATOM   4227 C  CB  . ARG F  1 63 ? 8.592   -7.553  10.020   1.00 34.10  ? 104 ARG F CB  1 
ATOM   4228 C  CG  . ARG F  1 63 ? 9.963   -6.963  10.301   1.00 51.40  ? 104 ARG F CG  1 
ATOM   4229 C  CD  . ARG F  1 63 ? 10.897  -8.023  10.900   1.00 56.04  ? 104 ARG F CD  1 
ATOM   4230 N  NE  . ARG F  1 63 ? 10.916  -9.248  10.103   1.00 54.13  ? 104 ARG F NE  1 
ATOM   4231 C  CZ  . ARG F  1 63 ? 10.812  -10.474 10.610   1.00 36.13  ? 104 ARG F CZ  1 
ATOM   4232 N  NH1 . ARG F  1 63 ? 10.683  -10.641 11.913   1.00 26.43  ? 104 ARG F NH1 1 
ATOM   4233 N  NH2 . ARG F  1 63 ? 10.827  -11.534 9.813    1.00 42.90  ? 104 ARG F NH2 1 
ATOM   4234 N  N   . LYS F  1 64 ? 5.841   -8.043  8.618    1.00 34.50  ? 105 LYS F N   1 
ATOM   4235 C  CA  . LYS F  1 64 ? 5.060   -8.698  7.569    1.00 34.27  ? 105 LYS F CA  1 
ATOM   4236 C  C   . LYS F  1 64 ? 4.200   -7.684  6.832    1.00 21.28  ? 105 LYS F C   1 
ATOM   4237 O  O   . LYS F  1 64 ? 4.066   -7.737  5.607    1.00 33.03  ? 105 LYS F O   1 
ATOM   4238 C  CB  . LYS F  1 64 ? 4.158   -9.785  8.170    1.00 34.78  ? 105 LYS F CB  1 
ATOM   4239 C  CG  . LYS F  1 64 ? 4.905   -10.858 8.949    1.00 20.89  ? 105 LYS F CG  1 
ATOM   4240 C  CD  . LYS F  1 64 ? 6.002   -11.485 8.105    1.00 26.45  ? 105 LYS F CD  1 
ATOM   4241 C  CE  . LYS F  1 64 ? 6.838   -12.471 8.909    1.00 26.21  ? 105 LYS F CE  1 
ATOM   4242 N  NZ  . LYS F  1 64 ? 7.870   -13.132 8.039    1.00 36.23  ? 105 LYS F NZ  1 
ATOM   4243 N  N   . ASN F  1 65 ? 3.613   -6.760  7.584    1.00 34.46  ? 106 ASN F N   1 
ATOM   4244 C  CA  . ASN F  1 65 ? 2.766   -5.739  6.972    1.00 33.42  ? 106 ASN F CA  1 
ATOM   4245 C  C   . ASN F  1 65 ? 3.587   -4.959  5.949    1.00 16.80  ? 106 ASN F C   1 
ATOM   4246 O  O   . ASN F  1 65 ? 3.105   -4.663  4.855    1.00 42.66  ? 106 ASN F O   1 
ATOM   4247 C  CB  . ASN F  1 65 ? 2.171   -4.824  8.047    1.00 24.70  ? 106 ASN F CB  1 
ATOM   4248 C  CG  . ASN F  1 65 ? 1.042   -5.512  8.837    1.00 23.45  ? 106 ASN F CG  1 
ATOM   4249 O  OD1 . ASN F  1 65 ? 0.710   -6.678  8.584    1.00 25.09  ? 106 ASN F OD1 1 
ATOM   4250 N  ND2 . ASN F  1 65 ? 0.454   -4.798  9.779    1.00 19.10  ? 106 ASN F ND2 1 
ATOM   4251 N  N   . LYS F  1 66 ? 4.843   -4.668  6.278    1.00 30.07  ? 107 LYS F N   1 
ATOM   4252 C  CA  . LYS F  1 66 ? 5.718   -3.948  5.357    1.00 22.56  ? 107 LYS F CA  1 
ATOM   4253 C  C   . LYS F  1 66 ? 5.976   -4.715  4.057    1.00 22.80  ? 107 LYS F C   1 
ATOM   4254 O  O   . LYS F  1 66 ? 6.039   -4.123  2.979    1.00 23.81  ? 107 LYS F O   1 
ATOM   4255 C  CB  . LYS F  1 66 ? 7.043   -3.628  6.041    1.00 31.14  ? 107 LYS F CB  1 
ATOM   4256 C  CG  . LYS F  1 66 ? 7.086   -2.235  6.632    1.00 62.59  ? 107 LYS F CG  1 
ATOM   4257 C  CD  . LYS F  1 66 ? 8.316   -2.029  7.495    1.00 57.24  ? 107 LYS F CD  1 
ATOM   4258 C  CE  . LYS F  1 66 ? 8.197   -0.726  8.268    1.00 58.70  ? 107 LYS F CE  1 
ATOM   4259 N  NZ  . LYS F  1 66 ? 9.256   -0.563  9.304    1.00 71.39  ? 107 LYS F NZ  1 
ATOM   4260 N  N   . LYS F  1 67 ? 6.141   -6.030  4.150    1.00 31.02  ? 108 LYS F N   1 
ATOM   4261 C  CA  . LYS F  1 67 ? 6.361   -6.844  2.953    1.00 15.41  ? 108 LYS F CA  1 
ATOM   4262 C  C   . LYS F  1 67 ? 5.070   -6.887  2.117    1.00 21.28  ? 108 LYS F C   1 
ATOM   4263 O  O   . LYS F  1 67 ? 5.100   -6.804  0.880    1.00 28.14  ? 108 LYS F O   1 
ATOM   4264 C  CB  . LYS F  1 67 ? 6.763   -8.270  3.348    1.00 38.01  ? 108 LYS F CB  1 
ATOM   4265 C  CG  . LYS F  1 67 ? 8.047   -8.375  4.168    1.00 40.05  ? 108 LYS F CG  1 
ATOM   4266 C  CD  . LYS F  1 67 ? 9.266   -7.884  3.395    1.00 54.60  ? 108 LYS F CD  1 
ATOM   4267 C  CE  . LYS F  1 67 ? 10.549  -8.155  4.182    1.00 60.42  ? 108 LYS F CE  1 
ATOM   4268 N  NZ  . LYS F  1 67 ? 11.768  -7.612  3.512    1.00 48.01  ? 108 LYS F NZ  1 
ATOM   4269 N  N   . LEU F  1 68 ? 3.936   -7.020  2.802    1.00 23.83  ? 109 LEU F N   1 
ATOM   4270 C  CA  . LEU F  1 68 ? 2.636   -7.046  2.138    1.00 17.90  ? 109 LEU F CA  1 
ATOM   4271 C  C   . LEU F  1 68 ? 2.386   -5.726  1.411    1.00 24.04  ? 109 LEU F C   1 
ATOM   4272 O  O   . LEU F  1 68 ? 1.916   -5.712  0.280    1.00 31.70  ? 109 LEU F O   1 
ATOM   4273 C  CB  . LEU F  1 68 ? 1.517   -7.284  3.168    1.00 21.22  ? 109 LEU F CB  1 
ATOM   4274 C  CG  . LEU F  1 68 ? 0.090   -7.267  2.611    1.00 20.99  ? 109 LEU F CG  1 
ATOM   4275 C  CD1 . LEU F  1 68 ? -0.004  -8.157  1.387    1.00 28.42  ? 109 LEU F CD1 1 
ATOM   4276 C  CD2 . LEU F  1 68 ? -0.882  -7.728  3.673    1.00 36.11  ? 109 LEU F CD2 1 
ATOM   4277 N  N   . LYS F  1 69 ? 2.703   -4.612  2.061    1.00 25.34  ? 110 LYS F N   1 
ATOM   4278 C  CA  . LYS F  1 69 ? 2.485   -3.322  1.432    1.00 33.12  ? 110 LYS F CA  1 
ATOM   4279 C  C   . LYS F  1 69 ? 3.320   -3.177  0.175    1.00 26.94  ? 110 LYS F C   1 
ATOM   4280 O  O   . LYS F  1 69 ? 2.865   -2.599  -0.813   1.00 35.36  ? 110 LYS F O   1 
ATOM   4281 C  CB  . LYS F  1 69 ? 2.761   -2.181  2.423    1.00 40.16  ? 110 LYS F CB  1 
ATOM   4282 C  CG  . LYS F  1 69 ? 1.781   -2.188  3.607    1.00 54.66  ? 110 LYS F CG  1 
ATOM   4283 C  CD  . LYS F  1 69 ? 1.648   -0.833  4.289    1.00 68.69  ? 110 LYS F CD  1 
ATOM   4284 C  CE  . LYS F  1 69 ? 0.449   -0.821  5.232    1.00 64.57  ? 110 LYS F CE  1 
ATOM   4285 N  NZ  . LYS F  1 69 ? 0.170   0.533   5.793    1.00 61.55  ? 110 LYS F NZ  1 
ATOM   4286 N  N   . GLU F  1 70 ? 4.535   -3.709  0.186    1.00 32.65  ? 111 GLU F N   1 
ATOM   4287 C  CA  . GLU F  1 70 ? 5.351   -3.607  -1.009   1.00 18.88  ? 111 GLU F CA  1 
ATOM   4288 C  C   . GLU F  1 70 ? 4.716   -4.458  -2.094   1.00 24.56  ? 111 GLU F C   1 
ATOM   4289 O  O   . GLU F  1 70 ? 4.581   -4.020  -3.235   1.00 26.09  ? 111 GLU F O   1 
ATOM   4290 C  CB  . GLU F  1 70 ? 6.756   -4.126  -0.775   1.00 33.22  ? 111 GLU F CB  1 
ATOM   4291 C  CG  . GLU F  1 70 ? 7.391   -3.638  0.480    1.00 46.03  ? 111 GLU F CG  1 
ATOM   4292 C  CD  . GLU F  1 70 ? 8.808   -4.127  0.598    1.00 57.98  ? 111 GLU F CD  1 
ATOM   4293 O  OE1 . GLU F  1 70 ? 9.091   -5.252  0.124    1.00 63.16  ? 111 GLU F OE1 1 
ATOM   4294 O  OE2 . GLU F  1 70 ? 9.636   -3.399  1.174    1.00 73.32  ? 111 GLU F OE2 1 
ATOM   4295 N  N   . LEU F  1 71 ? 4.322   -5.676  -1.725   1.00 22.10  ? 112 LEU F N   1 
ATOM   4296 C  CA  . LEU F  1 71 ? 3.711   -6.619  -2.668   1.00 27.31  ? 112 LEU F CA  1 
ATOM   4297 C  C   . LEU F  1 71 ? 2.439   -6.097  -3.302   1.00 23.04  ? 112 LEU F C   1 
ATOM   4298 O  O   . LEU F  1 71 ? 2.181   -6.349  -4.471   1.00 26.02  ? 112 LEU F O   1 
ATOM   4299 C  CB  . LEU F  1 71 ? 3.417   -7.966  -1.973   1.00 24.86  ? 112 LEU F CB  1 
ATOM   4300 C  CG  . LEU F  1 71 ? 3.349   -9.206  -2.872   1.00 29.49  ? 112 LEU F CG  1 
ATOM   4301 C  CD1 . LEU F  1 71 ? 4.640   -9.302  -3.667   1.00 35.63  ? 112 LEU F CD1 1 
ATOM   4302 C  CD2 . LEU F  1 71 ? 3.155   -10.470 -2.030   1.00 27.53  ? 112 LEU F CD2 1 
ATOM   4303 N  N   . GLU F  1 72 ? 1.630   -5.372  -2.545   1.00 25.93  ? 113 GLU F N   1 
ATOM   4304 C  CA  . GLU F  1 72 ? 0.390   -4.853  -3.130   1.00 35.91  ? 113 GLU F CA  1 
ATOM   4305 C  C   . GLU F  1 72 ? 0.727   -3.776  -4.137   1.00 20.59  ? 113 GLU F C   1 
ATOM   4306 O  O   . GLU F  1 72 ? 0.068   -3.618  -5.153   1.00 43.48  ? 113 GLU F O   1 
ATOM   4307 C  CB  . GLU F  1 72 ? -0.516  -4.280  -2.052   1.00 39.54  ? 113 GLU F CB  1 
ATOM   4308 C  CG  . GLU F  1 72 ? -1.847  -3.802  -2.581   1.00 52.24  ? 113 GLU F CG  1 
ATOM   4309 C  CD  . GLU F  1 72 ? -1.745  -2.464  -3.264   1.00 45.36  ? 113 GLU F CD  1 
ATOM   4310 O  OE1 . GLU F  1 72 ? -1.109  -1.560  -2.683   1.00 42.10  ? 113 GLU F OE1 1 
ATOM   4311 O  OE2 . GLU F  1 72 ? -2.319  -2.304  -4.359   1.00 34.59  ? 113 GLU F OE2 1 
ATOM   4312 N  N   . LYS F  1 73 ? 1.775   -3.033  -3.817   1.00 31.28  ? 114 LYS F N   1 
ATOM   4313 C  CA  . LYS F  1 73 ? 2.272   -1.964  -4.652   1.00 30.77  ? 114 LYS F CA  1 
ATOM   4314 C  C   . LYS F  1 73 ? 2.758   -2.569  -5.959   1.00 27.75  ? 114 LYS F C   1 
ATOM   4315 O  O   . LYS F  1 73 ? 2.614   -1.968  -7.025   1.00 28.44  ? 114 LYS F O   1 
ATOM   4316 C  CB  . LYS F  1 73 ? 3.412   -1.255  -3.910   1.00 39.66  ? 114 LYS F CB  1 
ATOM   4317 C  CG  . LYS F  1 73 ? 4.349   -0.449  -4.778   1.00 48.54  ? 114 LYS F CG  1 
ATOM   4318 C  CD  . LYS F  1 73 ? 3.691   0.815   -5.276   1.00 76.20  ? 114 LYS F CD  1 
ATOM   4319 C  CE  . LYS F  1 73 ? 4.127   1.120   -6.701   1.00 75.34  ? 114 LYS F CE  1 
ATOM   4320 N  NZ  . LYS F  1 73 ? 3.563   2.400   -7.223   1.00 75.31  ? 114 LYS F NZ  1 
ATOM   4321 N  N   . ASP F  1 74 ? 3.336   -3.767  -5.874   1.00 39.00  ? 115 ASP F N   1 
ATOM   4322 C  CA  . ASP F  1 74 ? 3.844   -4.460  -7.059   1.00 20.95  ? 115 ASP F CA  1 
ATOM   4323 C  C   . ASP F  1 74 ? 2.708   -4.964  -7.934   1.00 15.87  ? 115 ASP F C   1 
ATOM   4324 O  O   . ASP F  1 74 ? 2.755   -4.869  -9.170   1.00 31.96  ? 115 ASP F O   1 
ATOM   4325 C  CB  . ASP F  1 74 ? 4.750   -5.629  -6.647   1.00 36.98  ? 115 ASP F CB  1 
ATOM   4326 C  CG  . ASP F  1 74 ? 6.094   -5.161  -6.101   1.00 41.32  ? 115 ASP F CG  1 
ATOM   4327 O  OD1 . ASP F  1 74 ? 6.743   -4.328  -6.763   1.00 58.33  ? 115 ASP F OD1 1 
ATOM   4328 O  OD2 . ASP F  1 74 ? 6.507   -5.630  -5.021   1.00 70.27  ? 115 ASP F OD2 1 
ATOM   4329 N  N   . TYR F  1 75 ? 1.676   -5.498  -7.297   1.00 31.91  ? 116 TYR F N   1 
ATOM   4330 C  CA  . TYR F  1 75 ? 0.519   -5.989  -8.039   1.00 32.33  ? 116 TYR F CA  1 
ATOM   4331 C  C   . TYR F  1 75 ? -0.221  -4.852  -8.765   1.00 30.00  ? 116 TYR F C   1 
ATOM   4332 O  O   . TYR F  1 75 ? -0.640  -5.021  -9.911   1.00 29.57  ? 116 TYR F O   1 
ATOM   4333 C  CB  . TYR F  1 75 ? -0.440  -6.733  -7.101   1.00 29.84  ? 116 TYR F CB  1 
ATOM   4334 C  CG  . TYR F  1 75 ? -0.033  -8.166  -6.804   1.00 34.63  ? 116 TYR F CG  1 
ATOM   4335 C  CD1 . TYR F  1 75 ? 0.105   -9.104  -7.833   1.00 33.31  ? 116 TYR F CD1 1 
ATOM   4336 C  CD2 . TYR F  1 75 ? 0.163   -8.601  -5.493   1.00 33.56  ? 116 TYR F CD2 1 
ATOM   4337 C  CE1 . TYR F  1 75 ? 0.424   -10.444 -7.555   1.00 24.00  ? 116 TYR F CE1 1 
ATOM   4338 C  CE2 . TYR F  1 75 ? 0.478   -9.929  -5.209   1.00 28.22  ? 116 TYR F CE2 1 
ATOM   4339 C  CZ  . TYR F  1 75 ? 0.606   -10.843 -6.239   1.00 22.79  ? 116 TYR F CZ  1 
ATOM   4340 O  OH  . TYR F  1 75 ? 0.925   -12.152 -5.944   1.00 34.37  ? 116 TYR F OH  1 
ATOM   4341 N  N   . SER F  1 76 ? -0.376  -3.698  -8.113   1.00 26.15  ? 117 SER F N   1 
ATOM   4342 C  CA  . SER F  1 76 ? -1.063  -2.563  -8.746   1.00 32.05  ? 117 SER F CA  1 
ATOM   4343 C  C   . SER F  1 76 ? -0.280  -2.139  -9.970   1.00 19.87  ? 117 SER F C   1 
ATOM   4344 O  O   . SER F  1 76 ? -0.836  -1.943  -11.047  1.00 27.63  ? 117 SER F O   1 
ATOM   4345 C  CB  . SER F  1 76 ? -1.161  -1.375  -7.791   1.00 20.56  ? 117 SER F CB  1 
ATOM   4346 O  OG  . SER F  1 76 ? -1.987  -1.684  -6.687   1.00 28.95  ? 117 SER F OG  1 
ATOM   4347 N  N   . GLU F  1 77 ? 1.028   -2.013  -9.803   1.00 22.42  ? 118 GLU F N   1 
ATOM   4348 C  CA  . GLU F  1 77 ? 1.880   -1.621  -10.915  1.00 28.90  ? 118 GLU F CA  1 
ATOM   4349 C  C   . GLU F  1 77 ? 1.867   -2.701  -11.999  1.00 35.79  ? 118 GLU F C   1 
ATOM   4350 O  O   . GLU F  1 77 ? 1.889   -2.387  -13.193  1.00 37.81  ? 118 GLU F O   1 
ATOM   4351 C  CB  . GLU F  1 77 ? 3.307   -1.388  -10.419  1.00 34.53  ? 118 GLU F CB  1 
ATOM   4352 C  CG  . GLU F  1 77 ? 4.055   -0.338  -11.216  1.00 66.91  ? 118 GLU F CG  1 
ATOM   4353 C  CD  . GLU F  1 77 ? 5.470   -0.123  -10.725  1.00 72.07  ? 118 GLU F CD  1 
ATOM   4354 O  OE1 . GLU F  1 77 ? 5.652   0.099   -9.506   1.00 74.70  ? 118 GLU F OE1 1 
ATOM   4355 O  OE2 . GLU F  1 77 ? 6.396   -0.169  -11.565  1.00 70.08  ? 118 GLU F OE2 1 
ATOM   4356 N  N   . LEU F  1 78 ? 1.816   -3.971  -11.585  1.00 29.49  ? 119 LEU F N   1 
ATOM   4357 C  CA  . LEU F  1 78 ? 1.801   -5.082  -12.539  1.00 28.08  ? 119 LEU F CA  1 
ATOM   4358 C  C   . LEU F  1 78 ? 0.508   -5.102  -13.341  1.00 16.29  ? 119 LEU F C   1 
ATOM   4359 O  O   . LEU F  1 78 ? 0.514   -5.366  -14.544  1.00 26.62  ? 119 LEU F O   1 
ATOM   4360 C  CB  . LEU F  1 78 ? 1.981   -6.428  -11.819  1.00 32.49  ? 119 LEU F CB  1 
ATOM   4361 C  CG  . LEU F  1 78 ? 2.077   -7.671  -12.715  1.00 38.49  ? 119 LEU F CG  1 
ATOM   4362 C  CD1 . LEU F  1 78 ? 3.140   -7.482  -13.793  1.00 18.62  ? 119 LEU F CD1 1 
ATOM   4363 C  CD2 . LEU F  1 78 ? 2.417   -8.874  -11.863  1.00 28.52  ? 119 LEU F CD2 1 
ATOM   4364 N  N   . SER F  1 79 ? -0.610  -4.831  -12.679  1.00 29.20  ? 120 SER F N   1 
ATOM   4365 C  CA  . SER F  1 79 ? -1.883  -4.811  -13.385  1.00 24.49  ? 120 SER F CA  1 
ATOM   4366 C  C   . SER F  1 79 ? -1.891  -3.679  -14.404  1.00 25.95  ? 120 SER F C   1 
ATOM   4367 O  O   . SER F  1 79 ? -2.500  -3.797  -15.459  1.00 31.86  ? 120 SER F O   1 
ATOM   4368 C  CB  . SER F  1 79 ? -3.042  -4.620  -12.412  1.00 25.60  ? 120 SER F CB  1 
ATOM   4369 O  OG  . SER F  1 79 ? -4.262  -4.502  -13.131  1.00 35.31  ? 120 SER F OG  1 
ATOM   4370 N  N   . ASN F  1 80 ? -1.206  -2.584  -14.087  1.00 31.10  ? 121 ASN F N   1 
ATOM   4371 C  CA  . ASN F  1 80 ? -1.145  -1.437  -14.984  1.00 32.70  ? 121 ASN F CA  1 
ATOM   4372 C  C   . ASN F  1 80 ? -0.369  -1.757  -16.247  1.00 36.18  ? 121 ASN F C   1 
ATOM   4373 O  O   . ASN F  1 80 ? -0.696  -1.261  -17.323  1.00 33.78  ? 121 ASN F O   1 
ATOM   4374 C  CB  . ASN F  1 80 ? -0.498  -0.247  -14.279  1.00 37.23  ? 121 ASN F CB  1 
ATOM   4375 C  CG  . ASN F  1 80 ? -1.468  0.497   -13.400  1.00 48.32  ? 121 ASN F CG  1 
ATOM   4376 O  OD1 . ASN F  1 80 ? -1.081  1.113   -12.414  1.00 64.05  ? 121 ASN F OD1 1 
ATOM   4377 N  ND2 . ASN F  1 80 ? -2.743  0.456   -13.762  1.00 43.13  ? 121 ASN F ND2 1 
ATOM   4378 N  N   . ARG F  1 81 ? 0.667   -2.580  -16.119  1.00 26.49  ? 122 ARG F N   1 
ATOM   4379 C  CA  . ARG F  1 81 ? 1.456   -2.935  -17.281  1.00 28.72  ? 122 ARG F CA  1 
ATOM   4380 C  C   . ARG F  1 81 ? 0.632   -3.813  -18.223  1.00 31.04  ? 122 ARG F C   1 
ATOM   4381 O  O   . ARG F  1 81 ? 0.700   -3.665  -19.445  1.00 38.41  ? 122 ARG F O   1 
ATOM   4382 C  CB  . ARG F  1 81 ? 2.751   -3.625  -16.845  1.00 33.28  ? 122 ARG F CB  1 
ATOM   4383 C  CG  . ARG F  1 81 ? 3.650   -2.676  -16.074  1.00 24.19  ? 122 ARG F CG  1 
ATOM   4384 C  CD  . ARG F  1 81 ? 4.980   -3.284  -15.639  1.00 33.63  ? 122 ARG F CD  1 
ATOM   4385 N  NE  . ARG F  1 81 ? 5.945   -3.396  -16.731  1.00 55.45  ? 122 ARG F NE  1 
ATOM   4386 C  CZ  . ARG F  1 81 ? 7.241   -3.651  -16.554  1.00 56.45  ? 122 ARG F CZ  1 
ATOM   4387 N  NH1 . ARG F  1 81 ? 7.722   -3.812  -15.326  1.00 45.80  ? 122 ARG F NH1 1 
ATOM   4388 N  NH2 . ARG F  1 81 ? 8.052   -3.768  -17.602  1.00 43.79  ? 122 ARG F NH2 1 
ATOM   4389 N  N   . TYR F  1 82 ? -0.169  -4.707  -17.656  1.00 32.58  ? 123 TYR F N   1 
ATOM   4390 C  CA  . TYR F  1 82 ? -1.001  -5.572  -18.483  1.00 32.46  ? 123 TYR F CA  1 
ATOM   4391 C  C   . TYR F  1 82 ? -2.048  -4.733  -19.221  1.00 34.05  ? 123 TYR F C   1 
ATOM   4392 O  O   . TYR F  1 82 ? -2.434  -5.062  -20.343  1.00 32.28  ? 123 TYR F O   1 
ATOM   4393 C  CB  . TYR F  1 82 ? -1.685  -6.643  -17.628  1.00 41.89  ? 123 TYR F CB  1 
ATOM   4394 C  CG  . TYR F  1 82 ? -0.828  -7.857  -17.304  1.00 27.98  ? 123 TYR F CG  1 
ATOM   4395 C  CD1 . TYR F  1 82 ? -0.502  -8.797  -18.290  1.00 31.73  ? 123 TYR F CD1 1 
ATOM   4396 C  CD2 . TYR F  1 82 ? -0.395  -8.102  -15.996  1.00 26.05  ? 123 TYR F CD2 1 
ATOM   4397 C  CE1 . TYR F  1 82 ? 0.224   -9.954  -17.973  1.00 22.57  ? 123 TYR F CE1 1 
ATOM   4398 C  CE2 . TYR F  1 82 ? 0.333   -9.247  -15.672  1.00 19.97  ? 123 TYR F CE2 1 
ATOM   4399 C  CZ  . TYR F  1 82 ? 0.636   -10.169 -16.659  1.00 21.14  ? 123 TYR F CZ  1 
ATOM   4400 O  OH  . TYR F  1 82 ? 1.345   -11.298 -16.317  1.00 30.41  ? 123 TYR F OH  1 
ATOM   4401 N  N   . ASN F  1 83 ? -2.504  -3.648  -18.595  1.00 34.32  ? 124 ASN F N   1 
ATOM   4402 C  CA  . ASN F  1 83 ? -3.494  -2.774  -19.227  1.00 37.13  ? 124 ASN F CA  1 
ATOM   4403 C  C   . ASN F  1 83 ? -2.868  -2.026  -20.387  1.00 33.86  ? 124 ASN F C   1 
ATOM   4404 O  O   . ASN F  1 83 ? -3.537  -1.721  -21.369  1.00 41.55  ? 124 ASN F O   1 
ATOM   4405 C  CB  . ASN F  1 83 ? -4.067  -1.752  -18.241  1.00 47.82  ? 124 ASN F CB  1 
ATOM   4406 C  CG  . ASN F  1 83 ? -4.968  -2.380  -17.195  1.00 44.01  ? 124 ASN F CG  1 
ATOM   4407 O  OD1 . ASN F  1 83 ? -5.615  -3.406  -17.432  1.00 45.44  ? 124 ASN F OD1 1 
ATOM   4408 N  ND2 . ASN F  1 83 ? -5.030  -1.748  -16.034  1.00 24.71  ? 124 ASN F ND2 1 
ATOM   4409 N  N   . GLU F  1 84 ? -1.581  -1.721  -20.270  1.00 44.17  ? 125 GLU F N   1 
ATOM   4410 C  CA  . GLU F  1 84 ? -0.882  -1.022  -21.339  1.00 36.43  ? 125 GLU F CA  1 
ATOM   4411 C  C   . GLU F  1 84 ? -0.759  -1.948  -22.550  1.00 40.65  ? 125 GLU F C   1 
ATOM   4412 O  O   . GLU F  1 84 ? -1.028  -1.549  -23.681  1.00 43.56  ? 125 GLU F O   1 
ATOM   4413 C  CB  . GLU F  1 84 ? 0.503   -0.611  -20.871  1.00 36.55  ? 125 GLU F CB  1 
ATOM   4414 C  CG  . GLU F  1 84 ? 0.494   0.147   -19.573  1.00 67.45  ? 125 GLU F CG  1 
ATOM   4415 C  CD  . GLU F  1 84 ? -0.236  1.466   -19.685  1.00 75.00  ? 125 GLU F CD  1 
ATOM   4416 O  OE1 . GLU F  1 84 ? 0.229   2.326   -20.463  1.00 84.44  ? 125 GLU F OE1 1 
ATOM   4417 O  OE2 . GLU F  1 84 ? -1.268  1.645   -19.000  1.00 64.87  ? 125 GLU F OE2 1 
ATOM   4418 N  N   . GLN F  1 85 ? -0.348  -3.186  -22.297  1.00 35.45  ? 126 GLN F N   1 
ATOM   4419 C  CA  . GLN F  1 85 ? -0.196  -4.179  -23.347  1.00 31.19  ? 126 GLN F CA  1 
ATOM   4420 C  C   . GLN F  1 85 ? -1.515  -4.379  -24.076  1.00 32.03  ? 126 GLN F C   1 
ATOM   4421 O  O   . GLN F  1 85 ? -1.556  -4.491  -25.293  1.00 44.22  ? 126 GLN F O   1 
ATOM   4422 C  CB  . GLN F  1 85 ? 0.244   -5.507  -22.742  1.00 40.71  ? 126 GLN F CB  1 
ATOM   4423 C  CG  . GLN F  1 85 ? 1.601   -5.451  -22.086  1.00 46.17  ? 126 GLN F CG  1 
ATOM   4424 C  CD  . GLN F  1 85 ? 2.698   -5.060  -23.060  1.00 52.38  ? 126 GLN F CD  1 
ATOM   4425 O  OE1 . GLN F  1 85 ? 2.916   -3.873  -23.338  1.00 50.58  ? 126 GLN F OE1 1 
ATOM   4426 N  NE2 . GLN F  1 85 ? 3.388   -6.063  -23.598  1.00 56.32  ? 126 GLN F NE2 1 
ATOM   4427 N  N   . LYS F  1 86 ? -2.598  -4.438  -23.321  1.00 37.22  ? 127 LYS F N   1 
ATOM   4428 C  CA  . LYS F  1 86 ? -3.907  -4.621  -23.916  1.00 37.49  ? 127 LYS F CA  1 
ATOM   4429 C  C   . LYS F  1 86 ? -4.199  -3.454  -24.851  1.00 39.73  ? 127 LYS F C   1 
ATOM   4430 O  O   . LYS F  1 86 ? -4.776  -3.643  -25.919  1.00 46.53  ? 127 LYS F O   1 
ATOM   4431 C  CB  . LYS F  1 86 ? -4.971  -4.713  -22.817  1.00 41.72  ? 127 LYS F CB  1 
ATOM   4432 C  CG  . LYS F  1 86 ? -6.335  -5.202  -23.291  1.00 54.14  ? 127 LYS F CG  1 
ATOM   4433 C  CD  . LYS F  1 86 ? -7.168  -4.075  -23.881  1.00 64.90  ? 127 LYS F CD  1 
ATOM   4434 C  CE  . LYS F  1 86 ? -8.533  -4.566  -24.329  1.00 73.95  ? 127 LYS F CE  1 
ATOM   4435 N  NZ  . LYS F  1 86 ? -9.413  -3.425  -24.711  1.00 73.08  ? 127 LYS F NZ  1 
ATOM   4436 N  N   . GLU F  1 87 ? -3.789  -2.250  -24.458  1.00 41.22  ? 128 GLU F N   1 
ATOM   4437 C  CA  . GLU F  1 87 ? -4.018  -1.066  -25.285  1.00 40.20  ? 128 GLU F CA  1 
ATOM   4438 C  C   . GLU F  1 87 ? -3.223  -1.144  -26.587  1.00 45.99  ? 128 GLU F C   1 
ATOM   4439 O  O   . GLU F  1 87 ? -3.684  -0.687  -27.633  1.00 41.38  ? 128 GLU F O   1 
ATOM   4440 C  CB  . GLU F  1 87 ? -3.641  0.201   -24.518  1.00 45.00  ? 128 GLU F CB  1 
ATOM   4441 C  CG  . GLU F  1 87 ? -4.365  0.331   -23.188  1.00 51.41  ? 128 GLU F CG  1 
ATOM   4442 C  CD  . GLU F  1 87 ? -4.212  1.702   -22.570  1.00 70.31  ? 128 GLU F CD  1 
ATOM   4443 O  OE1 . GLU F  1 87 ? -3.064  2.186   -22.471  1.00 68.50  ? 128 GLU F OE1 1 
ATOM   4444 O  OE2 . GLU F  1 87 ? -5.243  2.291   -22.181  1.00 74.40  ? 128 GLU F OE2 1 
ATOM   4445 N  N   . LYS F  1 88 ? -2.030  -1.728  -26.516  1.00 44.84  ? 129 LYS F N   1 
ATOM   4446 C  CA  . LYS F  1 88 ? -1.182  -1.887  -27.692  1.00 43.13  ? 129 LYS F CA  1 
ATOM   4447 C  C   . LYS F  1 88 ? -1.811  -2.862  -28.682  1.00 55.23  ? 129 LYS F C   1 
ATOM   4448 O  O   . LYS F  1 88 ? -1.694  -2.691  -29.896  1.00 59.48  ? 129 LYS F O   1 
ATOM   4449 C  CB  . LYS F  1 88 ? 0.200   -2.396  -27.282  1.00 47.06  ? 129 LYS F CB  1 
ATOM   4450 C  CG  . LYS F  1 88 ? 0.980   -1.419  -26.420  1.00 54.47  ? 129 LYS F CG  1 
ATOM   4451 C  CD  . LYS F  1 88 ? 2.341   -1.981  -26.055  1.00 62.14  ? 129 LYS F CD  1 
ATOM   4452 C  CE  . LYS F  1 88 ? 3.143   -0.984  -25.245  1.00 80.67  ? 129 LYS F CE  1 
ATOM   4453 N  NZ  . LYS F  1 88 ? 4.469   -1.533  -24.855  1.00 86.43  ? 129 LYS F NZ  1 
ATOM   4454 N  N   . MET F  1 89 ? -2.472  -3.889  -28.157  1.00 58.91  ? 130 MET F N   1 
ATOM   4455 C  CA  . MET F  1 89 ? -3.127  -4.873  -29.006  1.00 62.07  ? 130 MET F CA  1 
ATOM   4456 C  C   . MET F  1 89 ? -4.266  -4.174  -29.732  1.00 64.84  ? 130 MET F C   1 
ATOM   4457 O  O   . MET F  1 89 ? -4.509  -4.427  -30.908  1.00 66.33  ? 130 MET F O   1 
ATOM   4458 C  CB  . MET F  1 89 ? -3.681  -6.025  -28.167  1.00 74.08  ? 130 MET F CB  1 
ATOM   4459 C  CG  . MET F  1 89 ? -4.247  -7.166  -28.990  1.00 76.76  ? 130 MET F CG  1 
ATOM   4460 S  SD  . MET F  1 89 ? -2.969  -7.913  -30.009  1.00 90.13  ? 130 MET F SD  1 
ATOM   4461 C  CE  . MET F  1 89 ? -2.060  -8.804  -28.773  1.00 72.28  ? 130 MET F CE  1 
ATOM   4462 N  N   . ASP F  1 90 ? -4.963  -3.292  -29.021  1.00 67.00  ? 131 ASP F N   1 
ATOM   4463 C  CA  . ASP F  1 90 ? -6.070  -2.546  -29.613  1.00 74.59  ? 131 ASP F CA  1 
ATOM   4464 C  C   . ASP F  1 90 ? -5.540  -1.704  -30.765  1.00 71.31  ? 131 ASP F C   1 
ATOM   4465 O  O   . ASP F  1 90 ? -6.136  -1.664  -31.837  1.00 59.38  ? 131 ASP F O   1 
ATOM   4466 C  CB  . ASP F  1 90 ? -6.714  -1.610  -28.588  1.00 78.43  ? 131 ASP F CB  1 
ATOM   4467 C  CG  . ASP F  1 90 ? -7.107  -2.317  -27.313  1.00 91.23  ? 131 ASP F CG  1 
ATOM   4468 O  OD1 . ASP F  1 90 ? -7.969  -3.215  -27.364  1.00 96.54  ? 131 ASP F OD1 1 
ATOM   4469 O  OD2 . ASP F  1 90 ? -6.552  -1.966  -26.253  1.00 97.82  ? 131 ASP F OD2 1 
ATOM   4470 N  N   . GLN F  1 91 ? -4.418  -1.029  -30.525  1.00 73.53  ? 132 GLN F N   1 
ATOM   4471 C  CA  . GLN F  1 91 ? -3.796  -0.172  -31.527  1.00 74.21  ? 132 GLN F CA  1 
ATOM   4472 C  C   . GLN F  1 91 ? -3.338  -0.969  -32.731  1.00 75.29  ? 132 GLN F C   1 
ATOM   4473 O  O   . GLN F  1 91 ? -3.477  -0.526  -33.869  1.00 79.52  ? 132 GLN F O   1 
ATOM   4474 C  CB  . GLN F  1 91 ? -2.605  0.571   -30.920  1.00 70.31  ? 132 GLN F CB  1 
ATOM   4475 C  CG  . GLN F  1 91 ? -2.976  1.419   -29.717  1.00 85.51  ? 132 GLN F CG  1 
ATOM   4476 C  CD  . GLN F  1 91 ? -4.283  2.160   -29.923  1.00 90.91  ? 132 GLN F CD  1 
ATOM   4477 O  OE1 . GLN F  1 91 ? -4.467  2.847   -30.929  1.00 95.94  ? 132 GLN F OE1 1 
ATOM   4478 N  NE2 . GLN F  1 91 ? -5.202  2.021   -28.970  1.00 91.88  ? 132 GLN F NE2 1 
ATOM   4479 N  N   . LEU F  1 92 ? -2.791  -2.150  -32.475  1.00 79.54  ? 133 LEU F N   1 
ATOM   4480 C  CA  . LEU F  1 92 ? -2.308  -3.011  -33.540  1.00 85.36  ? 133 LEU F CA  1 
ATOM   4481 C  C   . LEU F  1 92 ? -3.388  -3.213  -34.597  1.00 94.10  ? 133 LEU F C   1 
ATOM   4482 O  O   . LEU F  1 92 ? -3.206  -2.843  -35.758  1.00 99.34  ? 133 LEU F O   1 
ATOM   4483 C  CB  . LEU F  1 92 ? -1.868  -4.356  -32.959  1.00 91.51  ? 133 LEU F CB  1 
ATOM   4484 C  CG  . LEU F  1 92 ? -1.251  -5.367  -33.924  1.00 84.90  ? 133 LEU F CG  1 
ATOM   4485 C  CD1 . LEU F  1 92 ? -0.418  -6.374  -33.150  1.00 78.06  ? 133 LEU F CD1 1 
ATOM   4486 C  CD2 . LEU F  1 92 ? -2.353  -6.054  -34.715  1.00 75.26  ? 133 LEU F CD2 1 
ATOM   4487 N  N   . SER F  1 93 ? -4.512  -3.794  -34.193  1.00 96.28  ? 134 SER F N   1 
ATOM   4488 C  CA  . SER F  1 93 ? -5.613  -4.035  -35.118  1.00 100.63 ? 134 SER F CA  1 
ATOM   4489 C  C   . SER F  1 93 ? -6.142  -2.707  -35.642  1.00 106.83 ? 134 SER F C   1 
ATOM   4490 O  O   . SER F  1 93 ? -6.444  -2.567  -36.829  1.00 109.53 ? 134 SER F O   1 
ATOM   4491 C  CB  . SER F  1 93 ? -6.750  -4.779  -34.416  1.00 100.89 ? 134 SER F CB  1 
ATOM   4492 O  OG  . SER F  1 93 ? -7.464  -3.914  -33.547  1.00 100.77 ? 134 SER F OG  1 
ATOM   4493 N  N   . LYS F  1 94 ? -6.246  -1.732  -34.744  1.00 109.72 ? 135 LYS F N   1 
ATOM   4494 C  CA  . LYS F  1 94 ? -6.753  -0.420  -35.104  1.00 116.61 ? 135 LYS F CA  1 
ATOM   4495 C  C   . LYS F  1 94 ? -6.048  0.268   -36.249  1.00 121.95 ? 135 LYS F C   1 
ATOM   4496 O  O   . LYS F  1 94 ? -4.842  0.537   -36.213  1.00 122.96 ? 135 LYS F O   1 
ATOM   4497 C  CB  . LYS F  1 94 ? -6.771  0.516   -33.893  1.00 115.48 ? 135 LYS F CB  1 
ATOM   4498 C  CG  . LYS F  1 94 ? -8.001  0.352   -33.025  1.00 116.93 ? 135 LYS F CG  1 
ATOM   4499 C  CD  . LYS F  1 94 ? -8.048  1.391   -31.925  1.00 120.20 ? 135 LYS F CD  1 
ATOM   4500 C  CE  . LYS F  1 94 ? -8.849  0.876   -30.741  1.00 123.04 ? 135 LYS F CE  1 
ATOM   4501 N  NZ  . LYS F  1 94 ? -10.229 0.473   -31.128  1.00 117.00 ? 135 LYS F NZ  1 
ATOM   4502 N  N   . LEU F  1 95 ? -6.847  0.534   -37.272  1.00 123.76 ? 136 LEU F N   1 
ATOM   4503 C  CA  . LEU F  1 95 ? -6.429  1.228   -38.471  1.00 125.09 ? 136 LEU F CA  1 
ATOM   4504 C  C   . LEU F  1 95 ? -6.272  2.675   -38.006  1.00 126.44 ? 136 LEU F C   1 
ATOM   4505 O  O   . LEU F  1 95 ? -5.180  3.244   -38.204  1.00 126.11 ? 136 LEU F O   1 
ATOM   4506 C  CB  . LEU F  1 95 ? -7.534  1.043   -39.535  1.00 123.41 ? 136 LEU F CB  1 
ATOM   4507 C  CG  . LEU F  1 95 ? -8.359  2.059   -40.351  1.00 127.32 ? 136 LEU F CG  1 
ATOM   4508 C  CD1 . LEU F  1 95 ? -8.827  3.188   -39.465  1.00 127.48 ? 136 LEU F CD1 1 
ATOM   4509 C  CD2 . LEU F  1 95 ? -7.563  2.583   -41.534  1.00 127.20 ? 136 LEU F CD2 1 
ATOM   4510 N  N   . HIS G  1 9  ? -0.493  -6.759  90.701   1.00 151.01 ? 50  HIS G N   1 
ATOM   4511 C  CA  . HIS G  1 9  ? -1.393  -6.078  89.728   1.00 150.59 ? 50  HIS G CA  1 
ATOM   4512 C  C   . HIS G  1 9  ? -0.605  -5.439  88.587   1.00 149.30 ? 50  HIS G C   1 
ATOM   4513 O  O   . HIS G  1 9  ? -1.101  -5.338  87.466   1.00 148.46 ? 50  HIS G O   1 
ATOM   4514 C  CB  . HIS G  1 9  ? -2.231  -5.012  90.441   1.00 155.77 ? 50  HIS G CB  1 
ATOM   4515 C  CG  . HIS G  1 9  ? -3.169  -5.566  91.469   1.00 158.17 ? 50  HIS G CG  1 
ATOM   4516 N  ND1 . HIS G  1 9  ? -4.175  -6.459  91.157   1.00 159.04 ? 50  HIS G ND1 1 
ATOM   4517 C  CD2 . HIS G  1 9  ? -3.259  -5.352  92.803   1.00 157.69 ? 50  HIS G CD2 1 
ATOM   4518 C  CE1 . HIS G  1 9  ? -4.842  -6.768  92.254   1.00 157.24 ? 50  HIS G CE1 1 
ATOM   4519 N  NE2 . HIS G  1 9  ? -4.306  -6.111  93.268   1.00 157.81 ? 50  HIS G NE2 1 
ATOM   4520 N  N   . ASP G  1 10 ? 0.623   -5.010  88.870   1.00 146.81 ? 51  ASP G N   1 
ATOM   4521 C  CA  . ASP G  1 10 ? 1.454   -4.386  87.846   1.00 145.17 ? 51  ASP G CA  1 
ATOM   4522 C  C   . ASP G  1 10 ? 1.793   -5.367  86.732   1.00 144.14 ? 51  ASP G C   1 
ATOM   4523 O  O   . ASP G  1 10 ? 1.817   -4.999  85.558   1.00 144.98 ? 51  ASP G O   1 
ATOM   4524 C  CB  . ASP G  1 10 ? 2.748   -3.833  88.451   1.00 142.97 ? 51  ASP G CB  1 
ATOM   4525 C  CG  . ASP G  1 10 ? 2.510   -2.615  89.321   1.00 142.59 ? 51  ASP G CG  1 
ATOM   4526 O  OD1 . ASP G  1 10 ? 1.464   -1.953  89.148   1.00 140.17 ? 51  ASP G OD1 1 
ATOM   4527 O  OD2 . ASP G  1 10 ? 3.377   -2.308  90.167   1.00 135.34 ? 51  ASP G OD2 1 
ATOM   4528 N  N   . GLN G  1 11 ? 2.057   -6.616  87.105   1.00 143.42 ? 52  GLN G N   1 
ATOM   4529 C  CA  . GLN G  1 11 ? 2.388   -7.653  86.132   1.00 141.90 ? 52  GLN G CA  1 
ATOM   4530 C  C   . GLN G  1 11 ? 1.202   -7.861  85.193   1.00 143.97 ? 52  GLN G C   1 
ATOM   4531 O  O   . GLN G  1 11 ? 1.369   -8.037  83.987   1.00 145.84 ? 52  GLN G O   1 
ATOM   4532 C  CB  . GLN G  1 11 ? 2.708   -8.966  86.852   1.00 143.67 ? 52  GLN G CB  1 
ATOM   4533 C  CG  . GLN G  1 11 ? 3.147   -10.106 85.939   1.00 138.41 ? 52  GLN G CG  1 
ATOM   4534 C  CD  . GLN G  1 11 ? 4.628   -10.058 85.594   1.00 135.53 ? 52  GLN G CD  1 
ATOM   4535 O  OE1 . GLN G  1 11 ? 5.121   -9.072  85.044   1.00 130.07 ? 52  GLN G OE1 1 
ATOM   4536 N  NE2 . GLN G  1 11 ? 5.344   -11.131 85.916   1.00 126.08 ? 52  GLN G NE2 1 
ATOM   4537 N  N   . ILE G  1 12 ? 0.003   -7.837  85.766   1.00 139.78 ? 53  ILE G N   1 
ATOM   4538 C  CA  . ILE G  1 12 ? -1.229  -8.019  85.011   1.00 140.61 ? 53  ILE G CA  1 
ATOM   4539 C  C   . ILE G  1 12 ? -1.399  -6.841  84.062   1.00 141.24 ? 53  ILE G C   1 
ATOM   4540 O  O   . ILE G  1 12 ? -1.787  -7.010  82.910   1.00 140.03 ? 53  ILE G O   1 
ATOM   4541 C  CB  . ILE G  1 12 ? -2.459  -8.086  85.947   1.00 140.62 ? 53  ILE G CB  1 
ATOM   4542 C  CG1 . ILE G  1 12 ? -2.226  -9.116  87.052   1.00 135.02 ? 53  ILE G CG1 1 
ATOM   4543 C  CG2 . ILE G  1 12 ? -3.699  -8.477  85.155   1.00 139.47 ? 53  ILE G CG2 1 
ATOM   4544 C  CD1 . ILE G  1 12 ? -1.073  -8.787  87.990   1.00 129.14 ? 53  ILE G CD1 1 
ATOM   4545 N  N   . ASP G  1 13 ? -1.108  -5.642  84.553   1.00 140.39 ? 54  ASP G N   1 
ATOM   4546 C  CA  . ASP G  1 13 ? -1.224  -4.450  83.726   1.00 140.19 ? 54  ASP G CA  1 
ATOM   4547 C  C   . ASP G  1 13 ? -0.270  -4.556  82.544   1.00 139.57 ? 54  ASP G C   1 
ATOM   4548 O  O   . ASP G  1 13 ? -0.617  -4.180  81.425   1.00 140.78 ? 54  ASP G O   1 
ATOM   4549 C  CB  . ASP G  1 13 ? -0.903  -3.195  84.538   1.00 140.42 ? 54  ASP G CB  1 
ATOM   4550 C  CG  . ASP G  1 13 ? -0.891  -1.942  83.685   1.00 142.42 ? 54  ASP G CG  1 
ATOM   4551 O  OD1 . ASP G  1 13 ? -1.911  -1.663  83.020   1.00 141.31 ? 54  ASP G OD1 1 
ATOM   4552 O  OD2 . ASP G  1 13 ? 0.140   -1.237  83.678   1.00 142.80 ? 54  ASP G OD2 1 
ATOM   4553 N  N   . MET G  1 14 ? 0.931   -5.073  82.794   1.00 139.49 ? 55  MET G N   1 
ATOM   4554 C  CA  . MET G  1 14 ? 1.917   -5.227  81.730   1.00 138.77 ? 55  MET G CA  1 
ATOM   4555 C  C   . MET G  1 14 ? 1.436   -6.232  80.689   1.00 136.26 ? 55  MET G C   1 
ATOM   4556 O  O   . MET G  1 14 ? 1.601   -6.017  79.488   1.00 133.64 ? 55  MET G O   1 
ATOM   4557 C  CB  . MET G  1 14 ? 3.262   -5.698  82.287   1.00 138.03 ? 55  MET G CB  1 
ATOM   4558 C  CG  . MET G  1 14 ? 4.295   -5.935  81.191   1.00 144.16 ? 55  MET G CG  1 
ATOM   4559 S  SD  . MET G  1 14 ? 5.751   -6.851  81.705   1.00 150.97 ? 55  MET G SD  1 
ATOM   4560 C  CE  . MET G  1 14 ? 5.121   -8.530  81.664   1.00 150.45 ? 55  MET G CE  1 
ATOM   4561 N  N   . LEU G  1 15 ? 0.850   -7.333  81.151   1.00 136.26 ? 56  LEU G N   1 
ATOM   4562 C  CA  . LEU G  1 15 ? 0.345   -8.358  80.244   1.00 134.48 ? 56  LEU G CA  1 
ATOM   4563 C  C   . LEU G  1 15 ? -0.790  -7.786  79.401   1.00 135.41 ? 56  LEU G C   1 
ATOM   4564 O  O   . LEU G  1 15 ? -0.947  -8.144  78.235   1.00 136.46 ? 56  LEU G O   1 
ATOM   4565 C  CB  . LEU G  1 15 ? -0.166  -9.570  81.027   1.00 135.47 ? 56  LEU G CB  1 
ATOM   4566 C  CG  . LEU G  1 15 ? 0.800   -10.358 81.911   1.00 131.43 ? 56  LEU G CG  1 
ATOM   4567 C  CD1 . LEU G  1 15 ? 0.006   -11.341 82.750   1.00 126.82 ? 56  LEU G CD1 1 
ATOM   4568 C  CD2 . LEU G  1 15 ? 1.826   -11.084 81.058   1.00 130.25 ? 56  LEU G CD2 1 
ATOM   4569 N  N   . THR G  1 16 ? -1.581  -6.898  79.997   1.00 136.32 ? 57  THR G N   1 
ATOM   4570 C  CA  . THR G  1 16 ? -2.695  -6.279  79.287   1.00 138.78 ? 57  THR G CA  1 
ATOM   4571 C  C   . THR G  1 16 ? -2.168  -5.354  78.193   1.00 139.42 ? 57  THR G C   1 
ATOM   4572 O  O   . THR G  1 16 ? -2.742  -5.280  77.106   1.00 140.03 ? 57  THR G O   1 
ATOM   4573 C  CB  . THR G  1 16 ? -3.597  -5.466  80.240   1.00 136.54 ? 57  THR G CB  1 
ATOM   4574 O  OG1 . THR G  1 16 ? -4.144  -6.336  81.239   1.00 138.18 ? 57  THR G OG1 1 
ATOM   4575 C  CG2 . THR G  1 16 ? -4.739  -4.817  79.468   1.00 138.26 ? 57  THR G CG2 1 
ATOM   4576 N  N   . LYS G  1 17 ? -1.077  -4.650  78.482   1.00 140.00 ? 58  LYS G N   1 
ATOM   4577 C  CA  . LYS G  1 17 ? -0.482  -3.751  77.499   1.00 137.70 ? 58  LYS G CA  1 
ATOM   4578 C  C   . LYS G  1 17 ? 0.106   -4.566  76.351   1.00 138.78 ? 58  LYS G C   1 
ATOM   4579 O  O   . LYS G  1 17 ? 0.001   -4.178  75.188   1.00 138.98 ? 58  LYS G O   1 
ATOM   4580 C  CB  . LYS G  1 17 ? 0.617   -2.896  78.135   1.00 136.90 ? 58  LYS G CB  1 
ATOM   4581 C  CG  . LYS G  1 17 ? 0.124   -1.888  79.158   1.00 137.93 ? 58  LYS G CG  1 
ATOM   4582 C  CD  . LYS G  1 17 ? 1.260   -0.980  79.604   1.00 139.54 ? 58  LYS G CD  1 
ATOM   4583 C  CE  . LYS G  1 17 ? 0.852   -0.093  80.772   1.00 139.27 ? 58  LYS G CE  1 
ATOM   4584 N  NZ  . LYS G  1 17 ? 1.990   0.745   81.247   1.00 134.16 ? 58  LYS G NZ  1 
ATOM   4585 N  N   . THR G  1 18 ? 0.725   -5.695  76.685   1.00 138.13 ? 59  THR G N   1 
ATOM   4586 C  CA  . THR G  1 18 ? 1.319   -6.570  75.679   1.00 137.92 ? 59  THR G CA  1 
ATOM   4587 C  C   . THR G  1 18 ? 0.216   -7.122  74.787   1.00 139.92 ? 59  THR G C   1 
ATOM   4588 O  O   . THR G  1 18 ? 0.384   -7.259  73.575   1.00 143.44 ? 59  THR G O   1 
ATOM   4589 C  CB  . THR G  1 18 ? 2.053   -7.754  76.332   1.00 135.83 ? 59  THR G CB  1 
ATOM   4590 O  OG1 . THR G  1 18 ? 3.119   -7.261  77.151   1.00 137.26 ? 59  THR G OG1 1 
ATOM   4591 C  CG2 . THR G  1 18 ? 2.623   -8.681  75.271   1.00 131.61 ? 59  THR G CG2 1 
ATOM   4592 N  N   . ASN G  1 19 ? -0.915  -7.436  75.406   1.00 140.86 ? 60  ASN G N   1 
ATOM   4593 C  CA  . ASN G  1 19 ? -2.057  -7.973  74.688   1.00 140.28 ? 60  ASN G CA  1 
ATOM   4594 C  C   . ASN G  1 19 ? -2.595  -6.927  73.721   1.00 140.54 ? 60  ASN G C   1 
ATOM   4595 O  O   . ASN G  1 19 ? -2.745  -7.193  72.533   1.00 142.64 ? 60  ASN G O   1 
ATOM   4596 C  CB  . ASN G  1 19 ? -3.141  -8.394  75.685   1.00 142.99 ? 60  ASN G CB  1 
ATOM   4597 C  CG  . ASN G  1 19 ? -4.199  -9.279  75.061   1.00 145.30 ? 60  ASN G CG  1 
ATOM   4598 O  OD1 . ASN G  1 19 ? -3.886  -10.234 74.354   1.00 150.06 ? 60  ASN G OD1 1 
ATOM   4599 N  ND2 . ASN G  1 19 ? -5.462  -8.975  75.334   1.00 143.75 ? 60  ASN G ND2 1 
ATOM   4600 N  N   . LEU G  1 20 ? -2.863  -5.729  74.227   1.00 139.41 ? 61  LEU G N   1 
ATOM   4601 C  CA  . LEU G  1 20 ? -3.384  -4.656  73.391   1.00 141.59 ? 61  LEU G CA  1 
ATOM   4602 C  C   . LEU G  1 20 ? -2.527  -4.447  72.145   1.00 141.70 ? 61  LEU G C   1 
ATOM   4603 O  O   . LEU G  1 20 ? -3.057  -4.256  71.051   1.00 142.47 ? 61  LEU G O   1 
ATOM   4604 C  CB  . LEU G  1 20 ? -3.467  -3.351  74.191   1.00 141.89 ? 61  LEU G CB  1 
ATOM   4605 C  CG  . LEU G  1 20 ? -4.169  -2.155  73.533   1.00 142.80 ? 61  LEU G CG  1 
ATOM   4606 C  CD1 . LEU G  1 20 ? -3.287  -1.535  72.457   1.00 139.44 ? 61  LEU G CD1 1 
ATOM   4607 C  CD2 . LEU G  1 20 ? -5.502  -2.611  72.956   1.00 143.45 ? 61  LEU G CD2 1 
ATOM   4608 N  N   . GLN G  1 21 ? -1.208  -4.484  72.311   1.00 140.99 ? 62  GLN G N   1 
ATOM   4609 C  CA  . GLN G  1 21 ? -0.287  -4.296  71.191   1.00 141.91 ? 62  GLN G CA  1 
ATOM   4610 C  C   . GLN G  1 21 ? -0.500  -5.379  70.136   1.00 141.90 ? 62  GLN G C   1 
ATOM   4611 O  O   . GLN G  1 21 ? -0.533  -5.098  68.937   1.00 141.69 ? 62  GLN G O   1 
ATOM   4612 C  CB  . GLN G  1 21 ? 1.161   -4.342  71.683   1.00 140.18 ? 62  GLN G CB  1 
ATOM   4613 C  CG  . GLN G  1 21 ? 1.461   -3.382  72.824   1.00 139.90 ? 62  GLN G CG  1 
ATOM   4614 C  CD  . GLN G  1 21 ? 2.442   -2.293  72.441   1.00 140.02 ? 62  GLN G CD  1 
ATOM   4615 O  OE1 . GLN G  1 21 ? 3.562   -2.573  72.014   1.00 139.72 ? 62  GLN G OE1 1 
ATOM   4616 N  NE2 . GLN G  1 21 ? 2.029   -1.041  72.598   1.00 140.01 ? 62  GLN G NE2 1 
ATOM   4617 N  N   . LEU G  1 22 ? -0.638  -6.619  70.594   1.00 143.19 ? 63  LEU G N   1 
ATOM   4618 C  CA  . LEU G  1 22 ? -0.858  -7.751  69.704   1.00 144.33 ? 63  LEU G CA  1 
ATOM   4619 C  C   . LEU G  1 22 ? -2.179  -7.605  68.954   1.00 145.98 ? 63  LEU G C   1 
ATOM   4620 O  O   . LEU G  1 22 ? -2.280  -7.976  67.785   1.00 146.60 ? 63  LEU G O   1 
ATOM   4621 C  CB  . LEU G  1 22 ? -0.859  -9.056  70.504   1.00 144.50 ? 63  LEU G CB  1 
ATOM   4622 C  CG  . LEU G  1 22 ? 0.440   -9.854  70.653   1.00 140.45 ? 63  LEU G CG  1 
ATOM   4623 C  CD1 . LEU G  1 22 ? 1.575   -8.955  71.111   1.00 138.63 ? 63  LEU G CD1 1 
ATOM   4624 C  CD2 . LEU G  1 22 ? 0.211   -10.983 71.645   1.00 141.05 ? 63  LEU G CD2 1 
ATOM   4625 N  N   . THR G  1 23 ? -3.190  -7.067  69.631   1.00 148.11 ? 64  THR G N   1 
ATOM   4626 C  CA  . THR G  1 23 ? -4.495  -6.874  69.008   1.00 147.87 ? 64  THR G CA  1 
ATOM   4627 C  C   . THR G  1 23 ? -4.339  -5.844  67.897   1.00 145.45 ? 64  THR G C   1 
ATOM   4628 O  O   . THR G  1 23 ? -4.924  -5.982  66.823   1.00 144.95 ? 64  THR G O   1 
ATOM   4629 C  CB  . THR G  1 23 ? -5.547  -6.351  70.012   1.00 148.49 ? 64  THR G CB  1 
ATOM   4630 O  OG1 . THR G  1 23 ? -5.385  -7.009  71.274   1.00 152.01 ? 64  THR G OG1 1 
ATOM   4631 C  CG2 . THR G  1 23 ? -6.954  -6.629  69.494   1.00 148.17 ? 64  THR G CG2 1 
ATOM   4632 N  N   . THR G  1 24 ? -3.540  -4.813  68.164   1.00 146.54 ? 65  THR G N   1 
ATOM   4633 C  CA  . THR G  1 24 ? -3.295  -3.754  67.190   1.00 144.37 ? 65  THR G CA  1 
ATOM   4634 C  C   . THR G  1 24 ? -2.574  -4.351  65.986   1.00 143.25 ? 65  THR G C   1 
ATOM   4635 O  O   . THR G  1 24 ? -2.850  -3.992  64.841   1.00 143.57 ? 65  THR G O   1 
ATOM   4636 C  CB  . THR G  1 24 ? -2.412  -2.632  67.778   1.00 145.06 ? 65  THR G CB  1 
ATOM   4637 O  OG1 . THR G  1 24 ? -2.459  -2.680  69.209   1.00 145.38 ? 65  THR G OG1 1 
ATOM   4638 C  CG2 . THR G  1 24 ? -2.915  -1.270  67.319   1.00 142.54 ? 65  THR G CG2 1 
ATOM   4639 N  N   . GLN G  1 25 ? -1.646  -5.264  66.259   1.00 142.02 ? 66  GLN G N   1 
ATOM   4640 C  CA  . GLN G  1 25 ? -0.883  -5.931  65.208   1.00 136.99 ? 66  GLN G CA  1 
ATOM   4641 C  C   . GLN G  1 25 ? -1.840  -6.736  64.328   1.00 134.41 ? 66  GLN G C   1 
ATOM   4642 O  O   . GLN G  1 25 ? -1.734  -6.719  63.102   1.00 133.24 ? 66  GLN G O   1 
ATOM   4643 C  CB  . GLN G  1 25 ? 0.154   -6.875  65.825   1.00 138.80 ? 66  GLN G CB  1 
ATOM   4644 C  CG  . GLN G  1 25 ? 1.161   -6.217  66.766   1.00 140.79 ? 66  GLN G CG  1 
ATOM   4645 C  CD  . GLN G  1 25 ? 2.427   -5.760  66.062   1.00 145.16 ? 66  GLN G CD  1 
ATOM   4646 O  OE1 . GLN G  1 25 ? 2.998   -6.493  65.253   1.00 149.82 ? 66  GLN G OE1 1 
ATOM   4647 N  NE2 . GLN G  1 25 ? 2.883   -4.554  66.384   1.00 146.77 ? 66  GLN G NE2 1 
ATOM   4648 N  N   . SER G  1 26 ? -2.770  -7.442  64.966   1.00 128.99 ? 67  SER G N   1 
ATOM   4649 C  CA  . SER G  1 26 ? -3.750  -8.249  64.246   1.00 130.63 ? 67  SER G CA  1 
ATOM   4650 C  C   . SER G  1 26 ? -4.628  -7.367  63.368   1.00 129.89 ? 67  SER G C   1 
ATOM   4651 O  O   . SER G  1 26 ? -4.981  -7.744  62.251   1.00 130.40 ? 67  SER G O   1 
ATOM   4652 C  CB  . SER G  1 26 ? -4.627  -9.029  65.230   1.00 127.03 ? 67  SER G CB  1 
ATOM   4653 O  OG  . SER G  1 26 ? -3.889  -10.053 65.873   1.00 129.15 ? 67  SER G OG  1 
ATOM   4654 N  N   . GLN G  1 27 ? -4.979  -6.193  63.883   1.00 127.09 ? 68  GLN G N   1 
ATOM   4655 C  CA  . GLN G  1 27 ? -5.811  -5.245  63.150   1.00 125.81 ? 68  GLN G CA  1 
ATOM   4656 C  C   . GLN G  1 27 ? -5.067  -4.741  61.918   1.00 123.33 ? 68  GLN G C   1 
ATOM   4657 O  O   . GLN G  1 27 ? -5.644  -4.606  60.838   1.00 121.69 ? 68  GLN G O   1 
ATOM   4658 C  CB  . GLN G  1 27 ? -6.167  -4.055  64.042   1.00 127.46 ? 68  GLN G CB  1 
ATOM   4659 C  CG  . GLN G  1 27 ? -6.945  -4.418  65.295   1.00 132.88 ? 68  GLN G CG  1 
ATOM   4660 C  CD  . GLN G  1 27 ? -7.183  -3.221  66.192   1.00 131.37 ? 68  GLN G CD  1 
ATOM   4661 O  OE1 . GLN G  1 27 ? -7.700  -2.196  65.750   1.00 129.34 ? 68  GLN G OE1 1 
ATOM   4662 N  NE2 . GLN G  1 27 ? -6.810  -3.346  67.460   1.00 130.27 ? 68  GLN G NE2 1 
ATOM   4663 N  N   . ASN G  1 28 ? -3.782  -4.458  62.097   1.00 117.92 ? 69  ASN G N   1 
ATOM   4664 C  CA  . ASN G  1 28 ? -2.946  -3.969  61.012   1.00 118.58 ? 69  ASN G CA  1 
ATOM   4665 C  C   . ASN G  1 28 ? -2.851  -5.026  59.919   1.00 123.74 ? 69  ASN G C   1 
ATOM   4666 O  O   . ASN G  1 28 ? -2.960  -4.717  58.733   1.00 128.98 ? 69  ASN G O   1 
ATOM   4667 C  CB  . ASN G  1 28 ? -1.550  -3.634  61.543   1.00 115.16 ? 69  ASN G CB  1 
ATOM   4668 C  CG  . ASN G  1 28 ? -0.642  -3.063  60.475   1.00 116.13 ? 69  ASN G CG  1 
ATOM   4669 O  OD1 . ASN G  1 28 ? -0.323  -3.731  59.491   1.00 116.94 ? 69  ASN G OD1 1 
ATOM   4670 N  ND2 . ASN G  1 28 ? -0.220  -1.818  60.662   1.00 116.34 ? 69  ASN G ND2 1 
ATOM   4671 N  N   . LEU G  1 29 ? -2.657  -6.276  60.324   1.00 122.65 ? 70  LEU G N   1 
ATOM   4672 C  CA  . LEU G  1 29 ? -2.549  -7.371  59.371   1.00 118.83 ? 70  LEU G CA  1 
ATOM   4673 C  C   . LEU G  1 29 ? -3.853  -7.611  58.617   1.00 116.43 ? 70  LEU G C   1 
ATOM   4674 O  O   . LEU G  1 29 ? -3.837  -8.066  57.475   1.00 118.30 ? 70  LEU G O   1 
ATOM   4675 C  CB  . LEU G  1 29 ? -2.112  -8.645  60.087   1.00 120.03 ? 70  LEU G CB  1 
ATOM   4676 C  CG  . LEU G  1 29 ? -0.718  -8.606  60.713   1.00 117.27 ? 70  LEU G CG  1 
ATOM   4677 C  CD1 . LEU G  1 29 ? -0.473  -9.900  61.457   1.00 122.80 ? 70  LEU G CD1 1 
ATOM   4678 C  CD2 . LEU G  1 29 ? 0.337   -8.395  59.636   1.00 109.35 ? 70  LEU G CD2 1 
ATOM   4679 N  N   . LEU G  1 30 ? -4.981  -7.310  59.254   1.00 115.42 ? 71  LEU G N   1 
ATOM   4680 C  CA  . LEU G  1 30 ? -6.276  -7.480  58.607   1.00 114.97 ? 71  LEU G CA  1 
ATOM   4681 C  C   . LEU G  1 30 ? -6.423  -6.423  57.522   1.00 115.08 ? 71  LEU G C   1 
ATOM   4682 O  O   . LEU G  1 30 ? -6.908  -6.706  56.427   1.00 115.61 ? 71  LEU G O   1 
ATOM   4683 C  CB  . LEU G  1 30 ? -7.415  -7.321  59.612   1.00 119.71 ? 71  LEU G CB  1 
ATOM   4684 C  CG  . LEU G  1 30 ? -7.668  -8.419  60.642   1.00 121.57 ? 71  LEU G CG  1 
ATOM   4685 C  CD1 . LEU G  1 30 ? -8.828  -7.983  61.514   1.00 121.25 ? 71  LEU G CD1 1 
ATOM   4686 C  CD2 . LEU G  1 30 ? -7.975  -9.744  59.951   1.00 116.27 ? 71  LEU G CD2 1 
ATOM   4687 N  N   . SER G  1 31 ? -6.008  -5.200  57.843   1.00 114.57 ? 72  SER G N   1 
ATOM   4688 C  CA  . SER G  1 31 ? -6.076  -4.092  56.899   1.00 111.74 ? 72  SER G CA  1 
ATOM   4689 C  C   . SER G  1 31 ? -5.165  -4.401  55.718   1.00 109.70 ? 72  SER G C   1 
ATOM   4690 O  O   . SER G  1 31 ? -5.521  -4.157  54.567   1.00 106.15 ? 72  SER G O   1 
ATOM   4691 C  CB  . SER G  1 31 ? -5.635  -2.789  57.571   1.00 112.28 ? 72  SER G CB  1 
ATOM   4692 O  OG  . SER G  1 31 ? -6.505  -2.447  58.637   1.00 115.32 ? 72  SER G OG  1 
ATOM   4693 N  N   . LYS G  1 32 ? -3.986  -4.939  56.014   1.00 107.98 ? 73  LYS G N   1 
ATOM   4694 C  CA  . LYS G  1 32 ? -3.030  -5.311  54.978   1.00 105.44 ? 73  LYS G CA  1 
ATOM   4695 C  C   . LYS G  1 32 ? -3.687  -6.328  54.053   1.00 108.16 ? 73  LYS G C   1 
ATOM   4696 O  O   . LYS G  1 32 ? -3.603  -6.219  52.830   1.00 112.15 ? 73  LYS G O   1 
ATOM   4697 C  CB  . LYS G  1 32 ? -1.780  -5.928  55.610   1.00 110.28 ? 73  LYS G CB  1 
ATOM   4698 C  CG  . LYS G  1 32 ? -0.971  -4.955  56.444   1.00 113.05 ? 73  LYS G CG  1 
ATOM   4699 C  CD  . LYS G  1 32 ? -0.321  -3.915  55.555   1.00 118.37 ? 73  LYS G CD  1 
ATOM   4700 C  CE  . LYS G  1 32 ? -0.267  -2.559  56.239   1.00 121.10 ? 73  LYS G CE  1 
ATOM   4701 N  NZ  . LYS G  1 32 ? 0.261   -1.505  55.325   1.00 117.49 ? 73  LYS G NZ  1 
ATOM   4702 N  N   . LEU G  1 33 ? -4.345  -7.316  54.651   1.00 105.25 ? 74  LEU G N   1 
ATOM   4703 C  CA  . LEU G  1 33 ? -5.022  -8.360  53.894   1.00 105.55 ? 74  LEU G CA  1 
ATOM   4704 C  C   . LEU G  1 33 ? -6.112  -7.789  53.005   1.00 105.39 ? 74  LEU G C   1 
ATOM   4705 O  O   . LEU G  1 33 ? -6.212  -8.143  51.833   1.00 111.04 ? 74  LEU G O   1 
ATOM   4706 C  CB  . LEU G  1 33 ? -5.635  -9.397  54.839   1.00 111.40 ? 74  LEU G CB  1 
ATOM   4707 C  CG  . LEU G  1 33 ? -4.670  -10.226 55.691   1.00 115.17 ? 74  LEU G CG  1 
ATOM   4708 C  CD1 . LEU G  1 33 ? -5.465  -11.215 56.529   1.00 119.00 ? 74  LEU G CD1 1 
ATOM   4709 C  CD2 . LEU G  1 33 ? -3.677  -10.958 54.795   1.00 112.04 ? 74  LEU G CD2 1 
ATOM   4710 N  N   . GLU G  1 34 ? -6.935  -6.908  53.562   1.00 101.40 ? 75  GLU G N   1 
ATOM   4711 C  CA  . GLU G  1 34 ? -8.010  -6.315  52.786   1.00 100.56 ? 75  GLU G CA  1 
ATOM   4712 C  C   . GLU G  1 34 ? -7.440  -5.542  51.595   1.00 101.72 ? 75  GLU G C   1 
ATOM   4713 O  O   . GLU G  1 34 ? -8.008  -5.566  50.504   1.00 107.02 ? 75  GLU G O   1 
ATOM   4714 C  CB  . GLU G  1 34 ? -8.856  -5.382  53.652   1.00 110.69 ? 75  GLU G CB  1 
ATOM   4715 C  CG  . GLU G  1 34 ? -10.236 -5.151  53.065   1.00 104.23 ? 75  GLU G CG  1 
ATOM   4716 C  CD  . GLU G  1 34 ? -10.811 -3.802  53.428   1.00 109.20 ? 75  GLU G CD  1 
ATOM   4717 O  OE1 . GLU G  1 34 ? -10.046 -2.813  53.404   1.00 109.43 ? 75  GLU G OE1 1 
ATOM   4718 O  OE2 . GLU G  1 34 ? -12.025 -3.724  53.714   1.00 108.33 ? 75  GLU G OE2 1 
ATOM   4719 N  N   . LEU G  1 35 ? -6.315  -4.864  51.807   1.00 95.52  ? 76  LEU G N   1 
ATOM   4720 C  CA  . LEU G  1 35 ? -5.669  -4.101  50.744   1.00 99.98  ? 76  LEU G CA  1 
ATOM   4721 C  C   . LEU G  1 35 ? -5.198  -5.031  49.629   1.00 99.01  ? 76  LEU G C   1 
ATOM   4722 O  O   . LEU G  1 35 ? -5.424  -4.762  48.447   1.00 96.31  ? 76  LEU G O   1 
ATOM   4723 C  CB  . LEU G  1 35 ? -4.484  -3.307  51.307   1.00 95.26  ? 76  LEU G CB  1 
ATOM   4724 C  CG  . LEU G  1 35 ? -3.509  -2.661  50.315   1.00 101.88 ? 76  LEU G CG  1 
ATOM   4725 C  CD1 . LEU G  1 35 ? -2.876  -1.426  50.936   1.00 98.80  ? 76  LEU G CD1 1 
ATOM   4726 C  CD2 . LEU G  1 35 ? -2.443  -3.670  49.912   1.00 105.26 ? 76  LEU G CD2 1 
ATOM   4727 N  N   . ALA G  1 36 ? -4.543  -6.125  50.011   1.00 100.80 ? 77  ALA G N   1 
ATOM   4728 C  CA  . ALA G  1 36 ? -4.048  -7.103  49.045   1.00 93.64  ? 77  ALA G CA  1 
ATOM   4729 C  C   . ALA G  1 36 ? -5.214  -7.677  48.239   1.00 85.01  ? 77  ALA G C   1 
ATOM   4730 O  O   . ALA G  1 36 ? -5.093  -7.926  47.043   1.00 81.29  ? 77  ALA G O   1 
ATOM   4731 C  CB  . ALA G  1 36 ? -3.304  -8.224  49.767   1.00 93.18  ? 77  ALA G CB  1 
ATOM   4732 N  N   . GLN G  1 37 ? -6.343  -7.884  48.906   1.00 90.22  ? 78  GLN G N   1 
ATOM   4733 C  CA  . GLN G  1 37 ? -7.535  -8.414  48.254   1.00 91.33  ? 78  GLN G CA  1 
ATOM   4734 C  C   . GLN G  1 37 ? -8.032  -7.451  47.184   1.00 90.65  ? 78  GLN G C   1 
ATOM   4735 O  O   . GLN G  1 37 ? -8.411  -7.871  46.091   1.00 91.50  ? 78  GLN G O   1 
ATOM   4736 C  CB  . GLN G  1 37 ? -8.644  -8.643  49.282   1.00 91.26  ? 78  GLN G CB  1 
ATOM   4737 C  CG  . GLN G  1 37 ? -10.004 -8.982  48.685   1.00 97.92  ? 78  GLN G CG  1 
ATOM   4738 C  CD  . GLN G  1 37 ? -10.053 -10.366 48.065   1.00 101.15 ? 78  GLN G CD  1 
ATOM   4739 O  OE1 . GLN G  1 37 ? -9.694  -11.360 48.701   1.00 103.45 ? 78  GLN G OE1 1 
ATOM   4740 N  NE2 . GLN G  1 37 ? -10.513 -10.441 46.821   1.00 101.78 ? 78  GLN G NE2 1 
ATOM   4741 N  N   . SER G  1 38 ? -8.038  -6.160  47.502   1.00 85.34  ? 79  SER G N   1 
ATOM   4742 C  CA  . SER G  1 38 ? -8.493  -5.153  46.551   1.00 80.75  ? 79  SER G CA  1 
ATOM   4743 C  C   . SER G  1 38 ? -7.571  -5.099  45.340   1.00 80.32  ? 79  SER G C   1 
ATOM   4744 O  O   . SER G  1 38 ? -8.034  -5.016  44.203   1.00 75.37  ? 79  SER G O   1 
ATOM   4745 C  CB  . SER G  1 38 ? -8.560  -3.776  47.218   1.00 85.08  ? 79  SER G CB  1 
ATOM   4746 O  OG  . SER G  1 38 ? -9.636  -3.710  48.140   1.00 85.68  ? 79  SER G OG  1 
ATOM   4747 N  N   . LYS G  1 39 ? -6.265  -5.156  45.589   1.00 77.89  ? 80  LYS G N   1 
ATOM   4748 C  CA  . LYS G  1 39 ? -5.276  -5.113  44.517   1.00 80.61  ? 80  LYS G CA  1 
ATOM   4749 C  C   . LYS G  1 39 ? -5.361  -6.358  43.638   1.00 83.71  ? 80  LYS G C   1 
ATOM   4750 O  O   . LYS G  1 39 ? -5.174  -6.285  42.423   1.00 92.43  ? 80  LYS G O   1 
ATOM   4751 C  CB  . LYS G  1 39 ? -3.865  -4.985  45.100   1.00 84.52  ? 80  LYS G CB  1 
ATOM   4752 C  CG  . LYS G  1 39 ? -2.772  -4.922  44.045   1.00 98.14  ? 80  LYS G CG  1 
ATOM   4753 C  CD  . LYS G  1 39 ? -1.390  -4.747  44.657   1.00 92.40  ? 80  LYS G CD  1 
ATOM   4754 C  CE  . LYS G  1 39 ? -0.314  -4.754  43.575   1.00 95.41  ? 80  LYS G CE  1 
ATOM   4755 N  NZ  . LYS G  1 39 ? 1.066   -4.635  44.128   1.00 102.33 ? 80  LYS G NZ  1 
ATOM   4756 N  N   . GLU G  1 40 ? -5.644  -7.498  44.260   1.00 78.66  ? 81  GLU G N   1 
ATOM   4757 C  CA  . GLU G  1 40 ? -5.763  -8.768  43.548   1.00 73.96  ? 81  GLU G CA  1 
ATOM   4758 C  C   . GLU G  1 40 ? -7.031  -8.803  42.707   1.00 66.92  ? 81  GLU G C   1 
ATOM   4759 O  O   . GLU G  1 40 ? -7.044  -9.345  41.606   1.00 61.86  ? 81  GLU G O   1 
ATOM   4760 C  CB  . GLU G  1 40 ? -5.793  -9.928  44.541   1.00 83.09  ? 81  GLU G CB  1 
ATOM   4761 C  CG  . GLU G  1 40 ? -6.127  -11.271 43.911   1.00 96.39  ? 81  GLU G CG  1 
ATOM   4762 C  CD  . GLU G  1 40 ? -6.609  -12.289 44.932   1.00 104.72 ? 81  GLU G CD  1 
ATOM   4763 O  OE1 . GLU G  1 40 ? -5.812  -12.690 45.806   1.00 108.81 ? 81  GLU G OE1 1 
ATOM   4764 O  OE2 . GLU G  1 40 ? -7.794  -12.685 44.864   1.00 101.73 ? 81  GLU G OE2 1 
ATOM   4765 N  N   . SER G  1 41 ? -8.102  -8.235  43.248   1.00 70.10  ? 82  SER G N   1 
ATOM   4766 C  CA  . SER G  1 41 ? -9.376  -8.185  42.548   1.00 79.55  ? 82  SER G CA  1 
ATOM   4767 C  C   . SER G  1 41 ? -9.237  -7.254  41.350   1.00 86.66  ? 82  SER G C   1 
ATOM   4768 O  O   . SER G  1 41 ? -9.761  -7.530  40.272   1.00 88.42  ? 82  SER G O   1 
ATOM   4769 C  CB  . SER G  1 41 ? -10.477 -7.665  43.478   1.00 74.99  ? 82  SER G CB  1 
ATOM   4770 O  OG  . SER G  1 41 ? -11.741 -7.671  42.832   1.00 78.98  ? 82  SER G OG  1 
ATOM   4771 N  N   . LYS G  1 42 ? -8.518  -6.154  41.544   1.00 83.94  ? 83  LYS G N   1 
ATOM   4772 C  CA  . LYS G  1 42 ? -8.320  -5.185  40.479   1.00 80.51  ? 83  LYS G CA  1 
ATOM   4773 C  C   . LYS G  1 42 ? -7.498  -5.799  39.354   1.00 77.24  ? 83  LYS G C   1 
ATOM   4774 O  O   . LYS G  1 42 ? -7.745  -5.538  38.174   1.00 75.19  ? 83  LYS G O   1 
ATOM   4775 C  CB  . LYS G  1 42 ? -7.621  -3.933  41.022   1.00 83.91  ? 83  LYS G CB  1 
ATOM   4776 C  CG  . LYS G  1 42 ? -7.882  -2.687  40.189   1.00 86.02  ? 83  LYS G CG  1 
ATOM   4777 C  CD  . LYS G  1 42 ? -9.383  -2.443  40.054   1.00 82.01  ? 83  LYS G CD  1 
ATOM   4778 C  CE  . LYS G  1 42 ? -9.697  -1.425  38.970   1.00 89.02  ? 83  LYS G CE  1 
ATOM   4779 N  NZ  . LYS G  1 42 ? -11.164 -1.305  38.733   1.00 85.61  ? 83  LYS G NZ  1 
ATOM   4780 N  N   . LEU G  1 43 ? -6.522  -6.621  39.723   1.00 69.62  ? 84  LEU G N   1 
ATOM   4781 C  CA  . LEU G  1 43 ? -5.677  -7.269  38.733   1.00 69.00  ? 84  LEU G CA  1 
ATOM   4782 C  C   . LEU G  1 43 ? -6.510  -8.296  37.972   1.00 70.80  ? 84  LEU G C   1 
ATOM   4783 O  O   . LEU G  1 43 ? -6.387  -8.424  36.761   1.00 71.78  ? 84  LEU G O   1 
ATOM   4784 C  CB  . LEU G  1 43 ? -4.489  -7.941  39.421   1.00 61.07  ? 84  LEU G CB  1 
ATOM   4785 C  CG  . LEU G  1 43 ? -3.302  -8.371  38.560   1.00 69.22  ? 84  LEU G CG  1 
ATOM   4786 C  CD1 . LEU G  1 43 ? -2.751  -7.190  37.769   1.00 60.31  ? 84  LEU G CD1 1 
ATOM   4787 C  CD2 . LEU G  1 43 ? -2.231  -8.942  39.466   1.00 77.49  ? 84  LEU G CD2 1 
ATOM   4788 N  N   . LEU G  1 44 ? -7.375  -9.010  38.684   1.00 75.68  ? 85  LEU G N   1 
ATOM   4789 C  CA  . LEU G  1 44 ? -8.227  -10.018 38.059   1.00 77.67  ? 85  LEU G CA  1 
ATOM   4790 C  C   . LEU G  1 44 ? -9.200  -9.348  37.087   1.00 74.55  ? 85  LEU G C   1 
ATOM   4791 O  O   . LEU G  1 44 ? -9.425  -9.841  35.982   1.00 76.14  ? 85  LEU G O   1 
ATOM   4792 C  CB  . LEU G  1 44 ? -8.996  -10.798 39.137   1.00 84.54  ? 85  LEU G CB  1 
ATOM   4793 C  CG  . LEU G  1 44 ? -9.753  -12.065 38.719   1.00 96.06  ? 85  LEU G CG  1 
ATOM   4794 C  CD1 . LEU G  1 44 ? -8.838  -12.951 37.889   1.00 101.49 ? 85  LEU G CD1 1 
ATOM   4795 C  CD2 . LEU G  1 44 ? -10.246 -12.815 39.959   1.00 98.53  ? 85  LEU G CD2 1 
ATOM   4796 N  N   . GLU G  1 45 ? -9.764  -8.218  37.503   1.00 72.43  ? 86  GLU G N   1 
ATOM   4797 C  CA  . GLU G  1 45 ? -10.705 -7.476  36.672   1.00 69.39  ? 86  GLU G CA  1 
ATOM   4798 C  C   . GLU G  1 45 ? -10.072 -7.108  35.325   1.00 71.23  ? 86  GLU G C   1 
ATOM   4799 O  O   . GLU G  1 45 ? -10.589 -7.472  34.269   1.00 62.21  ? 86  GLU G O   1 
ATOM   4800 C  CB  . GLU G  1 45 ? -11.155 -6.202  37.400   1.00 74.67  ? 86  GLU G CB  1 
ATOM   4801 C  CG  . GLU G  1 45 ? -12.029 -5.265  36.568   1.00 91.81  ? 86  GLU G CG  1 
ATOM   4802 C  CD  . GLU G  1 45 ? -12.298 -3.937  37.262   1.00 99.82  ? 86  GLU G CD  1 
ATOM   4803 O  OE1 . GLU G  1 45 ? -12.965 -3.069  36.658   1.00 102.14 ? 86  GLU G OE1 1 
ATOM   4804 O  OE2 . GLU G  1 45 ? -11.841 -3.759  38.411   1.00 103.52 ? 86  GLU G OE2 1 
ATOM   4805 N  N   . ASN G  1 46 ? -8.950  -6.393  35.372   1.00 65.09  ? 87  ASN G N   1 
ATOM   4806 C  CA  . ASN G  1 46 ? -8.254  -5.973  34.162   1.00 63.53  ? 87  ASN G CA  1 
ATOM   4807 C  C   . ASN G  1 46 ? -7.741  -7.152  33.334   1.00 55.37  ? 87  ASN G C   1 
ATOM   4808 O  O   . ASN G  1 46 ? -7.906  -7.179  32.111   1.00 58.16  ? 87  ASN G O   1 
ATOM   4809 C  CB  . ASN G  1 46 ? -7.085  -5.050  34.528   1.00 62.00  ? 87  ASN G CB  1 
ATOM   4810 C  CG  . ASN G  1 46 ? -7.545  -3.707  35.061   1.00 78.77  ? 87  ASN G CG  1 
ATOM   4811 O  OD1 . ASN G  1 46 ? -8.174  -2.926  34.346   1.00 86.10  ? 87  ASN G OD1 1 
ATOM   4812 N  ND2 . ASN G  1 46 ? -7.238  -3.433  36.325   1.00 81.02  ? 87  ASN G ND2 1 
ATOM   4813 N  N   . LEU G  1 47 ? -7.116  -8.117  34.004   1.00 60.56  ? 88  LEU G N   1 
ATOM   4814 C  CA  . LEU G  1 47 ? -6.557  -9.297  33.349   1.00 61.66  ? 88  LEU G CA  1 
ATOM   4815 C  C   . LEU G  1 47 ? -7.577  -10.078 32.516   1.00 65.39  ? 88  LEU G C   1 
ATOM   4816 O  O   . LEU G  1 47 ? -7.339  -10.369 31.339   1.00 65.54  ? 88  LEU G O   1 
ATOM   4817 C  CB  . LEU G  1 47 ? -5.922  -10.231 34.394   1.00 71.44  ? 88  LEU G CB  1 
ATOM   4818 C  CG  . LEU G  1 47 ? -4.462  -10.025 34.826   1.00 82.40  ? 88  LEU G CG  1 
ATOM   4819 C  CD1 . LEU G  1 47 ? -4.211  -8.586  35.250   1.00 78.18  ? 88  LEU G CD1 1 
ATOM   4820 C  CD2 . LEU G  1 47 ? -4.148  -10.984 35.967   1.00 85.80  ? 88  LEU G CD2 1 
ATOM   4821 N  N   . ASN G  1 48 ? -8.705  -10.433 33.121   1.00 64.98  ? 89  ASN G N   1 
ATOM   4822 C  CA  . ASN G  1 48 ? -9.716  -11.181 32.388   1.00 71.83  ? 89  ASN G CA  1 
ATOM   4823 C  C   . ASN G  1 48 ? -10.297 -10.309 31.282   1.00 69.03  ? 89  ASN G C   1 
ATOM   4824 O  O   . ASN G  1 48 ? -10.827 -10.804 30.289   1.00 73.35  ? 89  ASN G O   1 
ATOM   4825 C  CB  . ASN G  1 48 ? -10.836 -11.649 33.317   1.00 71.38  ? 89  ASN G CB  1 
ATOM   4826 C  CG  . ASN G  1 48 ? -10.381 -12.730 34.298   1.00 84.54  ? 89  ASN G CG  1 
ATOM   4827 O  OD1 . ASN G  1 48 ? -9.915  -12.440 35.401   1.00 91.57  ? 89  ASN G OD1 1 
ATOM   4828 N  ND2 . ASN G  1 48 ? -10.521 -13.987 33.892   1.00 89.09  ? 89  ASN G ND2 1 
ATOM   4829 N  N   . LEU G  1 49 ? -10.142 -9.003  31.435   1.00 62.87  ? 90  LEU G N   1 
ATOM   4830 C  CA  . LEU G  1 49 ? -10.659 -8.043  30.473   1.00 60.35  ? 90  LEU G CA  1 
ATOM   4831 C  C   . LEU G  1 49 ? -9.794  -7.895  29.227   1.00 60.98  ? 90  LEU G C   1 
ATOM   4832 O  O   . LEU G  1 49 ? -10.305 -7.688  28.130   1.00 58.11  ? 90  LEU G O   1 
ATOM   4833 C  CB  . LEU G  1 49 ? -10.807 -6.707  31.161   1.00 58.93  ? 90  LEU G CB  1 
ATOM   4834 C  CG  . LEU G  1 49 ? -11.678 -5.652  30.518   1.00 66.27  ? 90  LEU G CG  1 
ATOM   4835 C  CD1 . LEU G  1 49 ? -12.767 -5.235  31.483   1.00 78.46  ? 90  LEU G CD1 1 
ATOM   4836 C  CD2 . LEU G  1 49 ? -10.807 -4.479  30.122   1.00 51.50  ? 90  LEU G CD2 1 
ATOM   4837 N  N   . LEU G  1 50 ? -8.484  -7.991  29.380   1.00 58.37  ? 91  LEU G N   1 
ATOM   4838 C  CA  . LEU G  1 50 ? -7.630  -7.909  28.215   1.00 54.97  ? 91  LEU G CA  1 
ATOM   4839 C  C   . LEU G  1 50 ? -7.892  -9.193  27.466   1.00 56.46  ? 91  LEU G C   1 
ATOM   4840 O  O   . LEU G  1 50 ? -8.073  -9.198  26.245   1.00 60.41  ? 91  LEU G O   1 
ATOM   4841 C  CB  . LEU G  1 50 ? -6.169  -7.900  28.615   1.00 53.71  ? 91  LEU G CB  1 
ATOM   4842 C  CG  . LEU G  1 50 ? -5.641  -6.718  29.387   1.00 68.42  ? 91  LEU G CG  1 
ATOM   4843 C  CD1 . LEU G  1 50 ? -4.396  -7.225  30.049   1.00 68.02  ? 91  LEU G CD1 1 
ATOM   4844 C  CD2 . LEU G  1 50 ? -5.359  -5.510  28.480   1.00 50.33  ? 91  LEU G CD2 1 
ATOM   4845 N  N   . LYS G  1 51 ? -7.863  -10.283 28.232   1.00 57.68  ? 92  LYS G N   1 
ATOM   4846 C  CA  . LYS G  1 51 ? -8.088  -11.638 27.741   1.00 46.84  ? 92  LYS G CA  1 
ATOM   4847 C  C   . LYS G  1 51 ? -9.192  -11.634 26.728   1.00 39.16  ? 92  LYS G C   1 
ATOM   4848 O  O   . LYS G  1 51 ? -9.086  -12.176 25.631   1.00 43.59  ? 92  LYS G O   1 
ATOM   4849 C  CB  . LYS G  1 51 ? -8.495  -12.528 28.912   1.00 64.84  ? 92  LYS G CB  1 
ATOM   4850 C  CG  . LYS G  1 51 ? -9.258  -13.804 28.586   1.00 49.53  ? 92  LYS G CG  1 
ATOM   4851 C  CD  . LYS G  1 51 ? -10.030 -14.211 29.829   1.00 56.72  ? 92  LYS G CD  1 
ATOM   4852 C  CE  . LYS G  1 51 ? -9.900  -15.685 30.133   1.00 66.58  ? 92  LYS G CE  1 
ATOM   4853 N  NZ  . LYS G  1 51 ? -10.001 -15.906 31.603   1.00 70.81  ? 92  LYS G NZ  1 
ATOM   4854 N  N   . ASN G  1 52 ? -10.258 -10.972 27.111   1.00 41.22  ? 93  ASN G N   1 
ATOM   4855 C  CA  . ASN G  1 52 ? -11.411 -10.894 26.275   1.00 39.46  ? 93  ASN G CA  1 
ATOM   4856 C  C   . ASN G  1 52 ? -11.170 -10.141 24.983   1.00 39.75  ? 93  ASN G C   1 
ATOM   4857 O  O   . ASN G  1 52 ? -11.599 -10.593 23.930   1.00 43.83  ? 93  ASN G O   1 
ATOM   4858 C  CB  . ASN G  1 52 ? -12.510 -10.249 27.063   1.00 54.40  ? 93  ASN G CB  1 
ATOM   4859 C  CG  . ASN G  1 52 ? -13.842 -10.783 26.699   1.00 67.58  ? 93  ASN G CG  1 
ATOM   4860 O  OD1 . ASN G  1 52 ? -14.371 -10.489 25.627   1.00 73.03  ? 93  ASN G OD1 1 
ATOM   4861 N  ND2 . ASN G  1 52 ? -14.404 -11.599 27.582   1.00 73.37  ? 93  ASN G ND2 1 
ATOM   4862 N  N   . GLU G  1 53 ? -10.496 -8.994  25.052   1.00 41.46  ? 94  GLU G N   1 
ATOM   4863 C  CA  . GLU G  1 53 ? -10.207 -8.227  23.838   1.00 47.55  ? 94  GLU G CA  1 
ATOM   4864 C  C   . GLU G  1 53 ? -9.139  -8.960  23.018   1.00 43.17  ? 94  GLU G C   1 
ATOM   4865 O  O   . GLU G  1 53 ? -9.118  -8.884  21.792   1.00 43.29  ? 94  GLU G O   1 
ATOM   4866 C  CB  . GLU G  1 53 ? -9.713  -6.818  24.183   1.00 52.65  ? 94  GLU G CB  1 
ATOM   4867 C  CG  . GLU G  1 53 ? -9.486  -5.919  22.958   1.00 62.72  ? 94  GLU G CG  1 
ATOM   4868 C  CD  . GLU G  1 53 ? -10.731 -5.769  22.098   1.00 64.14  ? 94  GLU G CD  1 
ATOM   4869 O  OE1 . GLU G  1 53 ? -11.846 -5.887  22.648   1.00 78.57  ? 94  GLU G OE1 1 
ATOM   4870 O  OE2 . GLU G  1 53 ? -10.599 -5.518  20.880   1.00 54.20  ? 94  GLU G OE2 1 
ATOM   4871 N  N   . ASN G  1 54 ? -8.254  -9.658  23.723   1.00 43.71  ? 95  ASN G N   1 
ATOM   4872 C  CA  . ASN G  1 54 ? -7.176  -10.445 23.129   1.00 42.25  ? 95  ASN G CA  1 
ATOM   4873 C  C   . ASN G  1 54 ? -7.841  -11.507 22.243   1.00 34.44  ? 95  ASN G C   1 
ATOM   4874 O  O   . ASN G  1 54 ? -7.406  -11.789 21.124   1.00 42.13  ? 95  ASN G O   1 
ATOM   4875 C  CB  . ASN G  1 54 ? -6.380  -11.088 24.277   1.00 56.45  ? 95  ASN G CB  1 
ATOM   4876 C  CG  . ASN G  1 54 ? -5.021  -11.633 23.850   1.00 68.19  ? 95  ASN G CG  1 
ATOM   4877 O  OD1 . ASN G  1 54 ? -4.201  -12.004 24.698   1.00 66.49  ? 95  ASN G OD1 1 
ATOM   4878 N  ND2 . ASN G  1 54 ? -4.782  -11.698 22.547   1.00 74.41  ? 95  ASN G ND2 1 
ATOM   4879 N  N   . GLU G  1 55 ? -8.929  -12.068 22.751   1.00 37.64  ? 96  GLU G N   1 
ATOM   4880 C  CA  . GLU G  1 55 ? -9.683  -13.091 22.038   1.00 38.68  ? 96  GLU G CA  1 
ATOM   4881 C  C   . GLU G  1 55 ? -10.388 -12.515 20.814   1.00 35.34  ? 96  GLU G C   1 
ATOM   4882 O  O   . GLU G  1 55 ? -10.498 -13.178 19.779   1.00 36.85  ? 96  GLU G O   1 
ATOM   4883 C  CB  . GLU G  1 55 ? -10.697 -13.712 22.998   1.00 46.39  ? 96  GLU G CB  1 
ATOM   4884 C  CG  . GLU G  1 55 ? -11.668 -14.680 22.388   1.00 46.02  ? 96  GLU G CG  1 
ATOM   4885 C  CD  . GLU G  1 55 ? -10.987 -15.822 21.695   1.00 63.47  ? 96  GLU G CD  1 
ATOM   4886 O  OE1 . GLU G  1 55 ? -10.125 -16.466 22.329   1.00 61.83  ? 96  GLU G OE1 1 
ATOM   4887 O  OE2 . GLU G  1 55 ? -11.318 -16.080 20.518   1.00 55.92  ? 96  GLU G OE2 1 
ATOM   4888 N  N   . ASN G  1 56 ? -10.862 -11.277 20.930   1.00 35.80  ? 97  ASN G N   1 
ATOM   4889 C  CA  . ASN G  1 56 ? -11.545 -10.634 19.813   1.00 27.03  ? 97  ASN G CA  1 
ATOM   4890 C  C   . ASN G  1 56 ? -10.557 -10.381 18.686   1.00 22.32  ? 97  ASN G C   1 
ATOM   4891 O  O   . ASN G  1 56 ? -10.876 -10.571 17.513   1.00 32.30  ? 97  ASN G O   1 
ATOM   4892 C  CB  . ASN G  1 56 ? -12.179 -9.311  20.249   1.00 43.99  ? 97  ASN G CB  1 
ATOM   4893 C  CG  . ASN G  1 56 ? -13.098 -8.734  19.191   1.00 61.14  ? 97  ASN G CG  1 
ATOM   4894 O  OD1 . ASN G  1 56 ? -13.992 -9.419  18.695   1.00 79.17  ? 97  ASN G OD1 1 
ATOM   4895 N  ND2 . ASN G  1 56 ? -12.886 -7.472  18.838   1.00 48.66  ? 97  ASN G ND2 1 
ATOM   4896 N  N   . LEU G  1 57 ? -9.350  -9.956  19.042   1.00 24.79  ? 98  LEU G N   1 
ATOM   4897 C  CA  . LEU G  1 57 ? -8.330  -9.694  18.041   1.00 22.41  ? 98  LEU G CA  1 
ATOM   4898 C  C   . LEU G  1 57 ? -7.852  -10.987 17.374   1.00 19.28  ? 98  LEU G C   1 
ATOM   4899 O  O   . LEU G  1 57 ? -7.712  -11.043 16.154   1.00 30.89  ? 98  LEU G O   1 
ATOM   4900 C  CB  . LEU G  1 57 ? -7.149  -8.948  18.669   1.00 17.17  ? 98  LEU G CB  1 
ATOM   4901 C  CG  . LEU G  1 57 ? -7.417  -7.558  19.272   1.00 28.26  ? 98  LEU G CG  1 
ATOM   4902 C  CD1 . LEU G  1 57 ? -6.084  -6.902  19.634   1.00 19.43  ? 98  LEU G CD1 1 
ATOM   4903 C  CD2 . LEU G  1 57 ? -8.177  -6.676  18.281   1.00 12.50  ? 98  LEU G CD2 1 
ATOM   4904 N  N   . ASN G  1 58 ? -7.585  -12.023 18.163   1.00 26.46  ? 99  ASN G N   1 
ATOM   4905 C  CA  . ASN G  1 58 ? -7.141  -13.302 17.586   1.00 26.24  ? 99  ASN G CA  1 
ATOM   4906 C  C   . ASN G  1 58 ? -8.163  -13.757 16.561   1.00 12.04  ? 99  ASN G C   1 
ATOM   4907 O  O   . ASN G  1 58 ? -7.827  -14.237 15.479   1.00 31.30  ? 99  ASN G O   1 
ATOM   4908 C  CB  . ASN G  1 58 ? -7.011  -14.363 18.678   1.00 37.43  ? 99  ASN G CB  1 
ATOM   4909 C  CG  . ASN G  1 58 ? -5.788  -14.161 19.537   1.00 35.34  ? 99  ASN G CG  1 
ATOM   4910 O  OD1 . ASN G  1 58 ? -5.098  -13.142 19.435   1.00 41.38  ? 99  ASN G OD1 1 
ATOM   4911 N  ND2 . ASN G  1 58 ? -5.515  -15.124 20.395   1.00 30.19  ? 99  ASN G ND2 1 
ATOM   4912 N  N   . SER G  1 59 ? -9.426  -13.571 16.915   1.00 25.81  ? 100 SER G N   1 
ATOM   4913 C  CA  . SER G  1 59 ? -10.538 -13.937 16.060   1.00 14.68  ? 100 SER G CA  1 
ATOM   4914 C  C   . SER G  1 59 ? -10.538 -13.153 14.765   1.00 34.29  ? 100 SER G C   1 
ATOM   4915 O  O   . SER G  1 59 ? -10.845 -13.707 13.705   1.00 34.65  ? 100 SER G O   1 
ATOM   4916 C  CB  . SER G  1 59 ? -11.861 -13.704 16.802   1.00 22.46  ? 100 SER G CB  1 
ATOM   4917 O  OG  . SER G  1 59 ? -12.968 -14.081 16.001   1.00 43.03  ? 100 SER G OG  1 
ATOM   4918 N  N   . ILE G  1 60 ? -10.210 -11.863 14.839   1.00 30.08  ? 101 ILE G N   1 
ATOM   4919 C  CA  . ILE G  1 60 ? -10.179 -11.046 13.629   1.00 22.25  ? 101 ILE G CA  1 
ATOM   4920 C  C   . ILE G  1 60 ? -9.038  -11.509 12.729   1.00 10.48  ? 101 ILE G C   1 
ATOM   4921 O  O   . ILE G  1 60 ? -9.196  -11.626 11.512   1.00 15.23  ? 101 ILE G O   1 
ATOM   4922 C  CB  . ILE G  1 60 ? -9.985  -9.545  13.946   1.00 24.99  ? 101 ILE G CB  1 
ATOM   4923 C  CG1 . ILE G  1 60 ? -11.176 -9.023  14.747   1.00 25.83  ? 101 ILE G CG1 1 
ATOM   4924 C  CG2 . ILE G  1 60 ? -9.863  -8.772  12.637   1.00 12.96  ? 101 ILE G CG2 1 
ATOM   4925 C  CD1 . ILE G  1 60 ? -11.031 -7.607  15.187   1.00 35.27  ? 101 ILE G CD1 1 
ATOM   4926 N  N   . PHE G  1 61 ? -7.886  -11.773 13.337   1.00 24.04  ? 102 PHE G N   1 
ATOM   4927 C  CA  . PHE G  1 61 ? -6.713  -12.242 12.598   1.00 20.11  ? 102 PHE G CA  1 
ATOM   4928 C  C   . PHE G  1 61 ? -7.060  -13.463 11.735   1.00 18.29  ? 102 PHE G C   1 
ATOM   4929 O  O   . PHE G  1 61 ? -6.702  -13.540 10.559   1.00 26.20  ? 102 PHE G O   1 
ATOM   4930 C  CB  . PHE G  1 61 ? -5.615  -12.622 13.581   1.00 27.16  ? 102 PHE G CB  1 
ATOM   4931 C  CG  . PHE G  1 61 ? -4.238  -12.508 13.021   1.00 11.89  ? 102 PHE G CG  1 
ATOM   4932 C  CD1 . PHE G  1 61 ? -4.037  -12.377 11.647   1.00 18.11  ? 102 PHE G CD1 1 
ATOM   4933 C  CD2 . PHE G  1 61 ? -3.136  -12.522 13.868   1.00 21.66  ? 102 PHE G CD2 1 
ATOM   4934 C  CE1 . PHE G  1 61 ? -2.746  -12.257 11.117   1.00 28.66  ? 102 PHE G CE1 1 
ATOM   4935 C  CE2 . PHE G  1 61 ? -1.842  -12.405 13.356   1.00 17.35  ? 102 PHE G CE2 1 
ATOM   4936 C  CZ  . PHE G  1 61 ? -1.644  -12.271 11.974   1.00 7.81   ? 102 PHE G CZ  1 
ATOM   4937 N  N   . GLU G  1 62 ? -7.764  -14.420 12.325   1.00 21.76  ? 103 GLU G N   1 
ATOM   4938 C  CA  . GLU G  1 62 ? -8.154  -15.617 11.581   1.00 34.81  ? 103 GLU G CA  1 
ATOM   4939 C  C   . GLU G  1 62 ? -9.124  -15.347 10.443   1.00 24.44  ? 103 GLU G C   1 
ATOM   4940 O  O   . GLU G  1 62 ? -9.120  -16.077 9.460    1.00 36.11  ? 103 GLU G O   1 
ATOM   4941 C  CB  . GLU G  1 62 ? -8.767  -16.659 12.504   1.00 27.15  ? 103 GLU G CB  1 
ATOM   4942 C  CG  . GLU G  1 62 ? -7.786  -17.186 13.502   1.00 36.52  ? 103 GLU G CG  1 
ATOM   4943 C  CD  . GLU G  1 62 ? -8.328  -18.354 14.281   1.00 61.37  ? 103 GLU G CD  1 
ATOM   4944 O  OE1 . GLU G  1 62 ? -9.542  -18.365 14.566   1.00 70.39  ? 103 GLU G OE1 1 
ATOM   4945 O  OE2 . GLU G  1 62 ? -7.537  -19.256 14.627   1.00 66.36  ? 103 GLU G OE2 1 
ATOM   4946 N  N   . ARG G  1 63 ? -9.966  -14.324 10.563   1.00 29.47  ? 104 ARG G N   1 
ATOM   4947 C  CA  . ARG G  1 63 ? -10.886 -14.034 9.470    1.00 24.63  ? 104 ARG G CA  1 
ATOM   4948 C  C   . ARG G  1 63 ? -10.086 -13.462 8.305    1.00 14.83  ? 104 ARG G C   1 
ATOM   4949 O  O   . ARG G  1 63 ? -10.326 -13.812 7.154    1.00 26.77  ? 104 ARG G O   1 
ATOM   4950 C  CB  . ARG G  1 63 ? -11.971 -13.018 9.877    1.00 33.14  ? 104 ARG G CB  1 
ATOM   4951 C  CG  . ARG G  1 63 ? -13.107 -13.562 10.730   1.00 49.28  ? 104 ARG G CG  1 
ATOM   4952 C  CD  . ARG G  1 63 ? -14.313 -12.595 10.781   1.00 57.72  ? 104 ARG G CD  1 
ATOM   4953 N  NE  . ARG G  1 63 ? -14.111 -11.399 11.607   1.00 38.53  ? 104 ARG G NE  1 
ATOM   4954 C  CZ  . ARG G  1 63 ? -13.994 -10.157 11.135   1.00 34.42  ? 104 ARG G CZ  1 
ATOM   4955 N  NH1 . ARG G  1 63 ? -14.049 -9.924  9.827    1.00 28.86  ? 104 ARG G NH1 1 
ATOM   4956 N  NH2 . ARG G  1 63 ? -13.848 -9.141  11.976   1.00 29.41  ? 104 ARG G NH2 1 
ATOM   4957 N  N   . LYS G  1 64 ? -9.132  -12.587 8.605    1.00 27.16  ? 105 LYS G N   1 
ATOM   4958 C  CA  . LYS G  1 64 ? -8.315  -11.952 7.562    1.00 24.36  ? 105 LYS G CA  1 
ATOM   4959 C  C   . LYS G  1 64 ? -7.413  -12.942 6.829    1.00 14.80  ? 105 LYS G C   1 
ATOM   4960 O  O   . LYS G  1 64 ? -7.275  -12.882 5.603    1.00 28.16  ? 105 LYS G O   1 
ATOM   4961 C  CB  . LYS G  1 64 ? -7.469  -10.831 8.176    1.00 21.15  ? 105 LYS G CB  1 
ATOM   4962 C  CG  . LYS G  1 64 ? -8.298  -9.819  8.956    1.00 15.31  ? 105 LYS G CG  1 
ATOM   4963 C  CD  . LYS G  1 64 ? -9.442  -9.278  8.098    1.00 18.15  ? 105 LYS G CD  1 
ATOM   4964 C  CE  . LYS G  1 64 ? -10.319 -8.288  8.879    1.00 40.52  ? 105 LYS G CE  1 
ATOM   4965 N  NZ  . LYS G  1 64 ? -11.256 -7.549  7.974    1.00 26.86  ? 105 LYS G NZ  1 
ATOM   4966 N  N   . ASN G  1 65 ? -6.797  -13.849 7.579    1.00 24.11  ? 106 ASN G N   1 
ATOM   4967 C  CA  . ASN G  1 65 ? -5.930  -14.858 6.969    1.00 30.66  ? 106 ASN G CA  1 
ATOM   4968 C  C   . ASN G  1 65 ? -6.731  -15.678 5.946    1.00 21.75  ? 106 ASN G C   1 
ATOM   4969 O  O   . ASN G  1 65 ? -6.224  -15.994 4.865    1.00 43.78  ? 106 ASN G O   1 
ATOM   4970 C  CB  . ASN G  1 65 ? -5.304  -15.743 8.062    1.00 20.35  ? 106 ASN G CB  1 
ATOM   4971 C  CG  . ASN G  1 65 ? -4.279  -14.980 8.910    1.00 29.83  ? 106 ASN G CG  1 
ATOM   4972 O  OD1 . ASN G  1 65 ? -3.933  -13.830 8.605    1.00 31.98  ? 106 ASN G OD1 1 
ATOM   4973 N  ND2 . ASN G  1 65 ? -3.787  -15.612 9.961    1.00 21.74  ? 106 ASN G ND2 1 
ATOM   4974 N  N   . LYS G  1 66 ? -7.989  -15.991 6.267    1.00 32.00  ? 107 LYS G N   1 
ATOM   4975 C  CA  . LYS G  1 66 ? -8.863  -16.728 5.341    1.00 26.00  ? 107 LYS G CA  1 
ATOM   4976 C  C   . LYS G  1 66 ? -9.083  -15.977 4.016    1.00 21.71  ? 107 LYS G C   1 
ATOM   4977 O  O   . LYS G  1 66 ? -9.147  -16.584 2.956    1.00 29.83  ? 107 LYS G O   1 
ATOM   4978 C  CB  . LYS G  1 66 ? -10.231 -16.994 5.969    1.00 29.24  ? 107 LYS G CB  1 
ATOM   4979 C  CG  . LYS G  1 66 ? -10.389 -18.365 6.584    1.00 38.52  ? 107 LYS G CG  1 
ATOM   4980 C  CD  . LYS G  1 66 ? -11.859 -18.752 6.637    1.00 45.00  ? 107 LYS G CD  1 
ATOM   4981 C  CE  . LYS G  1 66 ? -12.192 -19.495 7.917    1.00 57.64  ? 107 LYS G CE  1 
ATOM   4982 N  NZ  . LYS G  1 66 ? -13.525 -20.170 7.842    1.00 66.05  ? 107 LYS G NZ  1 
ATOM   4983 N  N   . LYS G  1 67 ? -9.220  -14.655 4.077    1.00 33.86  ? 108 LYS G N   1 
ATOM   4984 C  CA  . LYS G  1 67 ? -9.405  -13.859 2.860    1.00 19.81  ? 108 LYS G CA  1 
ATOM   4985 C  C   . LYS G  1 67 ? -8.129  -13.841 2.010    1.00 19.30  ? 108 LYS G C   1 
ATOM   4986 O  O   . LYS G  1 67 ? -8.176  -13.970 0.782    1.00 31.68  ? 108 LYS G O   1 
ATOM   4987 C  CB  . LYS G  1 67 ? -9.810  -12.426 3.234    1.00 40.46  ? 108 LYS G CB  1 
ATOM   4988 C  CG  . LYS G  1 67 ? -11.137 -12.329 3.980    1.00 47.55  ? 108 LYS G CG  1 
ATOM   4989 C  CD  . LYS G  1 67 ? -12.280 -12.878 3.138    1.00 59.50  ? 108 LYS G CD  1 
ATOM   4990 C  CE  . LYS G  1 67 ? -13.621 -12.747 3.851    1.00 70.45  ? 108 LYS G CE  1 
ATOM   4991 N  NZ  . LYS G  1 67 ? -14.751 -13.257 3.014    1.00 67.67  ? 108 LYS G NZ  1 
ATOM   4992 N  N   . LEU G  1 68 ? -6.990  -13.664 2.674    1.00 26.87  ? 109 LEU G N   1 
ATOM   4993 C  CA  . LEU G  1 68 ? -5.696  -13.665 2.001    1.00 18.92  ? 109 LEU G CA  1 
ATOM   4994 C  C   . LEU G  1 68 ? -5.534  -15.026 1.312    1.00 19.81  ? 109 LEU G C   1 
ATOM   4995 O  O   . LEU G  1 68 ? -5.149  -15.104 0.143    1.00 25.38  ? 109 LEU G O   1 
ATOM   4996 C  CB  . LEU G  1 68 ? -4.584  -13.460 3.038    1.00 13.26  ? 109 LEU G CB  1 
ATOM   4997 C  CG  . LEU G  1 68 ? -3.132  -13.431 2.561    1.00 26.74  ? 109 LEU G CG  1 
ATOM   4998 C  CD1 . LEU G  1 68 ? -2.935  -12.329 1.542    1.00 27.11  ? 109 LEU G CD1 1 
ATOM   4999 C  CD2 . LEU G  1 68 ? -2.220  -13.229 3.770    1.00 29.43  ? 109 LEU G CD2 1 
ATOM   5000 N  N   . LYS G  1 69 ? -5.847  -16.106 2.031    1.00 19.87  ? 110 LYS G N   1 
ATOM   5001 C  CA  . LYS G  1 69 ? -5.724  -17.435 1.434    1.00 33.44  ? 110 LYS G CA  1 
ATOM   5002 C  C   . LYS G  1 69 ? -6.569  -17.497 0.174    1.00 27.45  ? 110 LYS G C   1 
ATOM   5003 O  O   . LYS G  1 69 ? -6.158  -18.054 -0.841   1.00 35.63  ? 110 LYS G O   1 
ATOM   5004 C  CB  . LYS G  1 69 ? -6.141  -18.524 2.426    1.00 28.72  ? 110 LYS G CB  1 
ATOM   5005 C  CG  . LYS G  1 69 ? -5.093  -18.754 3.510    1.00 43.33  ? 110 LYS G CG  1 
ATOM   5006 C  CD  . LYS G  1 69 ? -5.381  -19.985 4.359    1.00 67.39  ? 110 LYS G CD  1 
ATOM   5007 C  CE  . LYS G  1 69 ? -4.223  -20.276 5.317    1.00 59.19  ? 110 LYS G CE  1 
ATOM   5008 N  NZ  . LYS G  1 69 ? -2.949  -20.588 4.600    1.00 52.79  ? 110 LYS G NZ  1 
ATOM   5009 N  N   . GLU G  1 70 ? -7.751  -16.904 0.237    1.00 32.12  ? 111 GLU G N   1 
ATOM   5010 C  CA  . GLU G  1 70 ? -8.626  -16.881 -0.917   1.00 25.57  ? 111 GLU G CA  1 
ATOM   5011 C  C   . GLU G  1 70 ? -7.989  -16.019 -2.003   1.00 20.57  ? 111 GLU G C   1 
ATOM   5012 O  O   . GLU G  1 70 ? -7.874  -16.446 -3.149   1.00 34.12  ? 111 GLU G O   1 
ATOM   5013 C  CB  . GLU G  1 70 ? -9.991  -16.316 -0.525   1.00 35.09  ? 111 GLU G CB  1 
ATOM   5014 C  CG  . GLU G  1 70 ? -11.032 -17.377 -0.233   1.00 52.41  ? 111 GLU G CG  1 
ATOM   5015 C  CD  . GLU G  1 70 ? -12.105 -16.905 0.732    1.00 64.99  ? 111 GLU G CD  1 
ATOM   5016 O  OE1 . GLU G  1 70 ? -12.708 -15.832 0.498    1.00 79.43  ? 111 GLU G OE1 1 
ATOM   5017 O  OE2 . GLU G  1 70 ? -12.352 -17.622 1.727    1.00 71.57  ? 111 GLU G OE2 1 
ATOM   5018 N  N   . LEU G  1 71 ? -7.563  -14.810 -1.635   1.00 25.41  ? 112 LEU G N   1 
ATOM   5019 C  CA  . LEU G  1 71 ? -6.947  -13.876 -2.585   1.00 21.60  ? 112 LEU G CA  1 
ATOM   5020 C  C   . LEU G  1 71 ? -5.702  -14.454 -3.259   1.00 18.73  ? 112 LEU G C   1 
ATOM   5021 O  O   . LEU G  1 71 ? -5.468  -14.243 -4.460   1.00 28.63  ? 112 LEU G O   1 
ATOM   5022 C  CB  . LEU G  1 71 ? -6.627  -12.551 -1.865   1.00 17.34  ? 112 LEU G CB  1 
ATOM   5023 C  CG  . LEU G  1 71 ? -6.330  -11.327 -2.730   1.00 38.91  ? 112 LEU G CG  1 
ATOM   5024 C  CD1 . LEU G  1 71 ? -7.289  -11.266 -3.909   1.00 30.15  ? 112 LEU G CD1 1 
ATOM   5025 C  CD2 . LEU G  1 71 ? -6.453  -10.076 -1.876   1.00 34.05  ? 112 LEU G CD2 1 
ATOM   5026 N  N   . GLU G  1 72 ? -4.894  -15.184 -2.492   1.00 28.96  ? 113 GLU G N   1 
ATOM   5027 C  CA  . GLU G  1 72 ? -3.692  -15.818 -3.074   1.00 26.67  ? 113 GLU G CA  1 
ATOM   5028 C  C   . GLU G  1 72 ? -4.049  -16.885 -4.100   1.00 23.29  ? 113 GLU G C   1 
ATOM   5029 O  O   . GLU G  1 72 ? -3.364  -17.048 -5.112   1.00 41.28  ? 113 GLU G O   1 
ATOM   5030 C  CB  . GLU G  1 72 ? -2.807  -16.421 -1.984   1.00 42.52  ? 113 GLU G CB  1 
ATOM   5031 C  CG  . GLU G  1 72 ? -1.472  -16.994 -2.485   1.00 44.76  ? 113 GLU G CG  1 
ATOM   5032 C  CD  . GLU G  1 72 ? -1.631  -18.322 -3.205   1.00 44.77  ? 113 GLU G CD  1 
ATOM   5033 O  OE1 . GLU G  1 72 ? -2.231  -19.246 -2.627   1.00 57.77  ? 113 GLU G OE1 1 
ATOM   5034 O  OE2 . GLU G  1 72 ? -1.145  -18.459 -4.346   1.00 40.74  ? 113 GLU G OE2 1 
ATOM   5035 N  N   . LYS G  1 73 ? -5.155  -17.585 -3.853   1.00 27.78  ? 114 LYS G N   1 
ATOM   5036 C  CA  . LYS G  1 73 ? -5.591  -18.639 -4.764   1.00 34.01  ? 114 LYS G CA  1 
ATOM   5037 C  C   . LYS G  1 73 ? -6.074  -18.086 -6.053   1.00 25.64  ? 114 LYS G C   1 
ATOM   5038 O  O   . LYS G  1 73 ? -6.024  -18.712 -7.076   1.00 39.29  ? 114 LYS G O   1 
ATOM   5039 C  CB  . LYS G  1 73 ? -6.663  -19.538 -4.116   1.00 35.35  ? 114 LYS G CB  1 
ATOM   5040 C  CG  . LYS G  1 73 ? -7.471  -20.361 -5.122   1.00 41.78  ? 114 LYS G CG  1 
ATOM   5041 C  CD  . LYS G  1 73 ? -7.354  -21.850 -4.766   1.00 53.65  ? 114 LYS G CD  1 
ATOM   5042 C  CE  . LYS G  1 73 ? -7.096  -22.587 -6.062   1.00 73.68  ? 114 LYS G CE  1 
ATOM   5043 N  NZ  . LYS G  1 73 ? -6.871  -24.051 -5.911   1.00 81.31  ? 114 LYS G NZ  1 
ATOM   5044 N  N   . ASP G  1 74 ? -6.600  -16.887 -5.957   1.00 34.35  ? 115 ASP G N   1 
ATOM   5045 C  CA  . ASP G  1 74 ? -7.092  -16.150 -7.117   1.00 15.00  ? 115 ASP G CA  1 
ATOM   5046 C  C   . ASP G  1 74 ? -5.918  -15.602 -7.968   1.00 12.64  ? 115 ASP G C   1 
ATOM   5047 O  O   . ASP G  1 74 ? -5.875  -15.710 -9.205   1.00 29.36  ? 115 ASP G O   1 
ATOM   5048 C  CB  . ASP G  1 74 ? -8.024  -15.006 -6.653   1.00 26.57  ? 115 ASP G CB  1 
ATOM   5049 C  CG  . ASP G  1 74 ? -9.340  -15.514 -6.114   1.00 33.41  ? 115 ASP G CG  1 
ATOM   5050 O  OD1 . ASP G  1 74 ? -9.876  -16.486 -6.671   1.00 52.35  ? 115 ASP G OD1 1 
ATOM   5051 O  OD2 . ASP G  1 74 ? -9.857  -14.942 -5.140   1.00 50.78  ? 115 ASP G OD2 1 
ATOM   5052 N  N   . TYR G  1 75 ? -4.934  -15.038 -7.289   1.00 24.10  ? 116 TYR G N   1 
ATOM   5053 C  CA  . TYR G  1 75 ? -3.757  -14.540 -7.998   1.00 31.32  ? 116 TYR G CA  1 
ATOM   5054 C  C   . TYR G  1 75 ? -3.035  -15.662 -8.743   1.00 34.93  ? 116 TYR G C   1 
ATOM   5055 O  O   . TYR G  1 75 ? -2.595  -15.469 -9.884   1.00 32.85  ? 116 TYR G O   1 
ATOM   5056 C  CB  . TYR G  1 75 ? -2.789  -13.843 -7.030   1.00 26.07  ? 116 TYR G CB  1 
ATOM   5057 C  CG  . TYR G  1 75 ? -3.187  -12.409 -6.713   1.00 38.16  ? 116 TYR G CG  1 
ATOM   5058 C  CD1 . TYR G  1 75 ? -3.351  -11.462 -7.732   1.00 30.39  ? 116 TYR G CD1 1 
ATOM   5059 C  CD2 . TYR G  1 75 ? -3.349  -11.989 -5.394   1.00 31.07  ? 116 TYR G CD2 1 
ATOM   5060 C  CE1 . TYR G  1 75 ? -3.656  -10.130 -7.432   1.00 29.84  ? 116 TYR G CE1 1 
ATOM   5061 C  CE2 . TYR G  1 75 ? -3.652  -10.675 -5.087   1.00 34.66  ? 116 TYR G CE2 1 
ATOM   5062 C  CZ  . TYR G  1 75 ? -3.799  -9.747  -6.102   1.00 26.44  ? 116 TYR G CZ  1 
ATOM   5063 O  OH  . TYR G  1 75 ? -4.063  -8.436  -5.780   1.00 42.97  ? 116 TYR G OH  1 
ATOM   5064 N  N   . SER G  1 76 ? -2.935  -16.831 -8.109   1.00 26.16  ? 117 SER G N   1 
ATOM   5065 C  CA  . SER G  1 76 ? -2.279  -17.985 -8.734   1.00 29.73  ? 117 SER G CA  1 
ATOM   5066 C  C   . SER G  1 76 ? -3.062  -18.450 -9.938   1.00 23.01  ? 117 SER G C   1 
ATOM   5067 O  O   . SER G  1 76 ? -2.476  -18.750 -10.977  1.00 28.07  ? 117 SER G O   1 
ATOM   5068 C  CB  . SER G  1 76 ? -2.146  -19.154 -7.760   1.00 18.10  ? 117 SER G CB  1 
ATOM   5069 O  OG  . SER G  1 76 ? -1.198  -18.837 -6.761   1.00 34.02  ? 117 SER G OG  1 
ATOM   5070 N  N   . GLU G  1 77 ? -4.384  -18.502 -9.802   1.00 27.11  ? 118 GLU G N   1 
ATOM   5071 C  CA  . GLU G  1 77 ? -5.220  -18.917 -10.919  1.00 25.03  ? 118 GLU G CA  1 
ATOM   5072 C  C   . GLU G  1 77 ? -5.150  -17.888 -12.039  1.00 34.03  ? 118 GLU G C   1 
ATOM   5073 O  O   . GLU G  1 77 ? -5.111  -18.251 -13.213  1.00 41.75  ? 118 GLU G O   1 
ATOM   5074 C  CB  . GLU G  1 77 ? -6.683  -19.080 -10.494  1.00 34.48  ? 118 GLU G CB  1 
ATOM   5075 C  CG  . GLU G  1 77 ? -6.981  -20.334 -9.683   1.00 55.01  ? 118 GLU G CG  1 
ATOM   5076 C  CD  . GLU G  1 77 ? -8.473  -20.627 -9.592   1.00 67.25  ? 118 GLU G CD  1 
ATOM   5077 O  OE1 . GLU G  1 77 ? -9.124  -20.692 -10.657  1.00 73.92  ? 118 GLU G OE1 1 
ATOM   5078 O  OE2 . GLU G  1 77 ? -8.994  -20.801 -8.466   1.00 58.55  ? 118 GLU G OE2 1 
ATOM   5079 N  N   . LEU G  1 78 ? -5.142  -16.607 -11.677  1.00 28.92  ? 119 LEU G N   1 
ATOM   5080 C  CA  . LEU G  1 78 ? -5.086  -15.548 -12.668  1.00 24.29  ? 119 LEU G CA  1 
ATOM   5081 C  C   . LEU G  1 78 ? -3.775  -15.595 -13.434  1.00 19.40  ? 119 LEU G C   1 
ATOM   5082 O  O   . LEU G  1 78 ? -3.756  -15.475 -14.660  1.00 25.34  ? 119 LEU G O   1 
ATOM   5083 C  CB  . LEU G  1 78 ? -5.259  -14.185 -11.987  1.00 35.91  ? 119 LEU G CB  1 
ATOM   5084 C  CG  . LEU G  1 78 ? -5.236  -12.910 -12.834  1.00 46.47  ? 119 LEU G CG  1 
ATOM   5085 C  CD1 . LEU G  1 78 ? -6.057  -13.085 -14.085  1.00 35.17  ? 119 LEU G CD1 1 
ATOM   5086 C  CD2 . LEU G  1 78 ? -5.765  -11.748 -12.009  1.00 25.01  ? 119 LEU G CD2 1 
ATOM   5087 N  N   . SER G  1 79 ? -2.677  -15.785 -12.715  1.00 32.36  ? 120 SER G N   1 
ATOM   5088 C  CA  . SER G  1 79 ? -1.383  -15.850 -13.365  1.00 23.46  ? 120 SER G CA  1 
ATOM   5089 C  C   . SER G  1 79 ? -1.371  -16.965 -14.403  1.00 30.89  ? 120 SER G C   1 
ATOM   5090 O  O   . SER G  1 79 ? -0.904  -16.764 -15.526  1.00 35.54  ? 120 SER G O   1 
ATOM   5091 C  CB  . SER G  1 79 ? -0.279  -16.074 -12.337  1.00 24.14  ? 120 SER G CB  1 
ATOM   5092 O  OG  . SER G  1 79 ? 0.985   -16.121 -12.984  1.00 43.09  ? 120 SER G OG  1 
ATOM   5093 N  N   . ASN G  1 80 ? -1.889  -18.139 -14.049  1.00 34.28  ? 121 ASN G N   1 
ATOM   5094 C  CA  . ASN G  1 80 ? -1.913  -19.232 -15.018  1.00 33.05  ? 121 ASN G CA  1 
ATOM   5095 C  C   . ASN G  1 80 ? -2.754  -18.867 -16.214  1.00 34.70  ? 121 ASN G C   1 
ATOM   5096 O  O   . ASN G  1 80 ? -2.447  -19.260 -17.337  1.00 40.26  ? 121 ASN G O   1 
ATOM   5097 C  CB  . ASN G  1 80 ? -2.459  -20.518 -14.406  1.00 29.56  ? 121 ASN G CB  1 
ATOM   5098 C  CG  . ASN G  1 80 ? -1.419  -21.244 -13.607  1.00 42.35  ? 121 ASN G CG  1 
ATOM   5099 O  OD1 . ASN G  1 80 ? -0.233  -21.182 -13.927  1.00 63.78  ? 121 ASN G OD1 1 
ATOM   5100 N  ND2 . ASN G  1 80 ? -1.846  -21.947 -12.571  1.00 48.22  ? 121 ASN G ND2 1 
ATOM   5101 N  N   . ARG G  1 81 ? -3.828  -18.122 -15.970  1.00 31.76  ? 122 ARG G N   1 
ATOM   5102 C  CA  . ARG G  1 81 ? -4.699  -17.696 -17.052  1.00 37.52  ? 122 ARG G CA  1 
ATOM   5103 C  C   . ARG G  1 81 ? -3.890  -16.851 -18.037  1.00 29.34  ? 122 ARG G C   1 
ATOM   5104 O  O   . ARG G  1 81 ? -4.028  -16.991 -19.251  1.00 40.40  ? 122 ARG G O   1 
ATOM   5105 C  CB  . ARG G  1 81 ? -5.868  -16.867 -16.510  1.00 27.66  ? 122 ARG G CB  1 
ATOM   5106 C  CG  . ARG G  1 81 ? -7.065  -17.661 -15.993  1.00 27.41  ? 122 ARG G CG  1 
ATOM   5107 C  CD  . ARG G  1 81 ? -8.320  -17.338 -16.828  1.00 48.25  ? 122 ARG G CD  1 
ATOM   5108 N  NE  . ARG G  1 81 ? -9.475  -17.011 -15.995  1.00 64.49  ? 122 ARG G NE  1 
ATOM   5109 C  CZ  . ARG G  1 81 ? -10.675 -16.645 -16.450  1.00 69.86  ? 122 ARG G CZ  1 
ATOM   5110 N  NH1 . ARG G  1 81 ? -10.923 -16.550 -17.752  1.00 41.23  ? 122 ARG G NH1 1 
ATOM   5111 N  NH2 . ARG G  1 81 ? -11.637 -16.360 -15.587  1.00 78.25  ? 122 ARG G NH2 1 
ATOM   5112 N  N   . TYR G  1 82 ? -3.047  -15.970 -17.515  1.00 33.06  ? 123 TYR G N   1 
ATOM   5113 C  CA  . TYR G  1 82 ? -2.246  -15.124 -18.387  1.00 36.67  ? 123 TYR G CA  1 
ATOM   5114 C  C   . TYR G  1 82 ? -1.204  -15.967 -19.119  1.00 31.96  ? 123 TYR G C   1 
ATOM   5115 O  O   . TYR G  1 82 ? -0.855  -15.677 -20.263  1.00 32.03  ? 123 TYR G O   1 
ATOM   5116 C  CB  . TYR G  1 82 ? -1.556  -14.019 -17.580  1.00 36.65  ? 123 TYR G CB  1 
ATOM   5117 C  CG  . TYR G  1 82 ? -2.396  -12.780 -17.314  1.00 31.02  ? 123 TYR G CG  1 
ATOM   5118 C  CD1 . TYR G  1 82 ? -2.699  -11.881 -18.336  1.00 30.77  ? 123 TYR G CD1 1 
ATOM   5119 C  CD2 . TYR G  1 82 ? -2.811  -12.465 -16.025  1.00 27.50  ? 123 TYR G CD2 1 
ATOM   5120 C  CE1 . TYR G  1 82 ? -3.386  -10.689 -18.069  1.00 25.60  ? 123 TYR G CE1 1 
ATOM   5121 C  CE2 . TYR G  1 82 ? -3.496  -11.284 -15.748  1.00 29.59  ? 123 TYR G CE2 1 
ATOM   5122 C  CZ  . TYR G  1 82 ? -3.777  -10.399 -16.769  1.00 25.48  ? 123 TYR G CZ  1 
ATOM   5123 O  OH  . TYR G  1 82 ? -4.430  -9.219  -16.481  1.00 42.13  ? 123 TYR G OH  1 
ATOM   5124 N  N   . ASN G  1 83 ? -0.713  -17.016 -18.465  1.00 39.94  ? 124 ASN G N   1 
ATOM   5125 C  CA  . ASN G  1 83 ? 0.279   -17.889 -19.090  1.00 32.32  ? 124 ASN G CA  1 
ATOM   5126 C  C   . ASN G  1 83 ? -0.353  -18.610 -20.270  1.00 31.57  ? 124 ASN G C   1 
ATOM   5127 O  O   . ASN G  1 83 ? 0.300   -18.847 -21.282  1.00 39.46  ? 124 ASN G O   1 
ATOM   5128 C  CB  . ASN G  1 83 ? 0.820   -18.915 -18.091  1.00 40.65  ? 124 ASN G CB  1 
ATOM   5129 C  CG  . ASN G  1 83 ? 1.784   -18.298 -17.094  1.00 49.51  ? 124 ASN G CG  1 
ATOM   5130 O  OD1 . ASN G  1 83 ? 2.523   -17.369 -17.425  1.00 59.08  ? 124 ASN G OD1 1 
ATOM   5131 N  ND2 . ASN G  1 83 ? 1.800   -18.825 -15.879  1.00 35.32  ? 124 ASN G ND2 1 
ATOM   5132 N  N   . GLU G  1 84 ? -1.627  -18.960 -20.145  1.00 40.33  ? 125 GLU G N   1 
ATOM   5133 C  CA  . GLU G  1 84 ? -2.319  -19.639 -21.232  1.00 41.92  ? 125 GLU G CA  1 
ATOM   5134 C  C   . GLU G  1 84 ? -2.410  -18.720 -22.440  1.00 38.96  ? 125 GLU G C   1 
ATOM   5135 O  O   . GLU G  1 84 ? -2.180  -19.132 -23.578  1.00 46.57  ? 125 GLU G O   1 
ATOM   5136 C  CB  . GLU G  1 84 ? -3.739  -20.003 -20.829  1.00 41.05  ? 125 GLU G CB  1 
ATOM   5137 C  CG  . GLU G  1 84 ? -3.930  -21.311 -20.105  1.00 61.60  ? 125 GLU G CG  1 
ATOM   5138 C  CD  . GLU G  1 84 ? -5.371  -21.769 -20.228  1.00 84.10  ? 125 GLU G CD  1 
ATOM   5139 O  OE1 . GLU G  1 84 ? -6.255  -20.888 -20.328  1.00 84.16  ? 125 GLU G OE1 1 
ATOM   5140 O  OE2 . GLU G  1 84 ? -5.630  -22.991 -20.220  1.00 92.19  ? 125 GLU G OE2 1 
ATOM   5141 N  N   . GLN G  1 85 ? -2.777  -17.471 -22.178  1.00 42.86  ? 126 GLN G N   1 
ATOM   5142 C  CA  . GLN G  1 85 ? -2.931  -16.476 -23.230  1.00 40.28  ? 126 GLN G CA  1 
ATOM   5143 C  C   . GLN G  1 85 ? -1.633  -16.226 -23.981  1.00 33.79  ? 126 GLN G C   1 
ATOM   5144 O  O   . GLN G  1 85 ? -1.639  -15.967 -25.181  1.00 42.65  ? 126 GLN G O   1 
ATOM   5145 C  CB  . GLN G  1 85 ? -3.429  -15.169 -22.627  1.00 47.48  ? 126 GLN G CB  1 
ATOM   5146 C  CG  . GLN G  1 85 ? -4.865  -15.236 -22.127  1.00 56.30  ? 126 GLN G CG  1 
ATOM   5147 C  CD  . GLN G  1 85 ? -5.859  -15.432 -23.258  1.00 47.19  ? 126 GLN G CD  1 
ATOM   5148 O  OE1 . GLN G  1 85 ? -6.425  -16.514 -23.427  1.00 47.71  ? 126 GLN G OE1 1 
ATOM   5149 N  NE2 . GLN G  1 85 ? -6.068  -14.379 -24.048  1.00 49.43  ? 126 GLN G NE2 1 
ATOM   5150 N  N   . LYS G  1 86 ? -0.517  -16.298 -23.268  1.00 43.86  ? 127 LYS G N   1 
ATOM   5151 C  CA  . LYS G  1 86 ? 0.780   -16.076 -23.876  1.00 33.75  ? 127 LYS G CA  1 
ATOM   5152 C  C   . LYS G  1 86 ? 1.136   -17.226 -24.807  1.00 48.70  ? 127 LYS G C   1 
ATOM   5153 O  O   . LYS G  1 86 ? 1.770   -17.016 -25.838  1.00 56.62  ? 127 LYS G O   1 
ATOM   5154 C  CB  . LYS G  1 86 ? 1.838   -15.903 -22.783  1.00 42.54  ? 127 LYS G CB  1 
ATOM   5155 C  CG  . LYS G  1 86 ? 3.171   -15.370 -23.285  1.00 53.13  ? 127 LYS G CG  1 
ATOM   5156 C  CD  . LYS G  1 86 ? 4.091   -16.501 -23.707  1.00 66.98  ? 127 LYS G CD  1 
ATOM   5157 C  CE  . LYS G  1 86 ? 5.201   -16.004 -24.616  1.00 71.86  ? 127 LYS G CE  1 
ATOM   5158 N  NZ  . LYS G  1 86 ? 4.650   -15.400 -25.842  1.00 85.33  ? 127 LYS G NZ  1 
ATOM   5159 N  N   . GLU G  1 87 ? 0.726   -18.441 -24.456  1.00 47.97  ? 128 GLU G N   1 
ATOM   5160 C  CA  . GLU G  1 87 ? 1.019   -19.596 -25.300  1.00 43.51  ? 128 GLU G CA  1 
ATOM   5161 C  C   . GLU G  1 87 ? 0.245   -19.496 -26.602  1.00 50.88  ? 128 GLU G C   1 
ATOM   5162 O  O   . GLU G  1 87 ? 0.761   -19.784 -27.677  1.00 50.34  ? 128 GLU G O   1 
ATOM   5163 C  CB  . GLU G  1 87 ? 0.626   -20.887 -24.604  1.00 43.94  ? 128 GLU G CB  1 
ATOM   5164 C  CG  . GLU G  1 87 ? 1.198   -21.036 -23.225  1.00 56.99  ? 128 GLU G CG  1 
ATOM   5165 C  CD  . GLU G  1 87 ? 1.053   -22.450 -22.694  1.00 74.55  ? 128 GLU G CD  1 
ATOM   5166 O  OE1 . GLU G  1 87 ? -0.064  -23.013 -22.760  1.00 71.10  ? 128 GLU G OE1 1 
ATOM   5167 O  OE2 . GLU G  1 87 ? 2.062   -22.998 -22.203  1.00 85.76  ? 128 GLU G OE2 1 
ATOM   5168 N  N   . LYS G  1 88 ? -1.011  -19.098 -26.494  1.00 54.15  ? 129 LYS G N   1 
ATOM   5169 C  CA  . LYS G  1 88 ? -1.848  -18.946 -27.666  1.00 54.49  ? 129 LYS G CA  1 
ATOM   5170 C  C   . LYS G  1 88 ? -1.251  -17.921 -28.620  1.00 62.32  ? 129 LYS G C   1 
ATOM   5171 O  O   . LYS G  1 88 ? -1.317  -18.085 -29.839  1.00 73.59  ? 129 LYS G O   1 
ATOM   5172 C  CB  . LYS G  1 88 ? -3.243  -18.504 -27.244  1.00 49.26  ? 129 LYS G CB  1 
ATOM   5173 C  CG  . LYS G  1 88 ? -4.055  -19.589 -26.570  1.00 48.56  ? 129 LYS G CG  1 
ATOM   5174 C  CD  . LYS G  1 88 ? -5.265  -18.984 -25.888  1.00 55.92  ? 129 LYS G CD  1 
ATOM   5175 C  CE  . LYS G  1 88 ? -6.429  -19.954 -25.855  1.00 79.21  ? 129 LYS G CE  1 
ATOM   5176 N  NZ  . LYS G  1 88 ? -7.587  -19.394 -25.102  1.00 78.34  ? 129 LYS G NZ  1 
ATOM   5177 N  N   . MET G  1 89 ? -0.675  -16.861 -28.062  1.00 68.60  ? 130 MET G N   1 
ATOM   5178 C  CA  . MET G  1 89 ? -0.065  -15.813 -28.871  1.00 72.05  ? 130 MET G CA  1 
ATOM   5179 C  C   . MET G  1 89 ? 1.169   -16.356 -29.569  1.00 72.43  ? 130 MET G C   1 
ATOM   5180 O  O   . MET G  1 89 ? 1.420   -16.035 -30.729  1.00 66.92  ? 130 MET G O   1 
ATOM   5181 C  CB  . MET G  1 89 ? 0.329   -14.623 -27.995  1.00 83.26  ? 130 MET G CB  1 
ATOM   5182 C  CG  . MET G  1 89 ? 0.980   -13.472 -28.751  1.00 93.53  ? 130 MET G CG  1 
ATOM   5183 S  SD  . MET G  1 89 ? -0.140  -12.690 -29.923  1.00 96.45  ? 130 MET G SD  1 
ATOM   5184 C  CE  . MET G  1 89 ? -1.234  -11.852 -28.796  1.00 92.43  ? 130 MET G CE  1 
ATOM   5185 N  N   . ASP G  1 90 ? 1.938   -17.178 -28.858  1.00 68.14  ? 131 ASP G N   1 
ATOM   5186 C  CA  . ASP G  1 90 ? 3.147   -17.768 -29.420  1.00 72.47  ? 131 ASP G CA  1 
ATOM   5187 C  C   . ASP G  1 90 ? 2.761   -18.707 -30.558  1.00 77.59  ? 131 ASP G C   1 
ATOM   5188 O  O   . ASP G  1 90 ? 3.413   -18.735 -31.603  1.00 80.63  ? 131 ASP G O   1 
ATOM   5189 C  CB  . ASP G  1 90 ? 3.911   -18.546 -28.345  1.00 71.32  ? 131 ASP G CB  1 
ATOM   5190 C  CG  . ASP G  1 90 ? 5.298   -18.966 -28.801  1.00 87.29  ? 131 ASP G CG  1 
ATOM   5191 O  OD1 . ASP G  1 90 ? 6.157   -18.078 -29.004  1.00 95.76  ? 131 ASP G OD1 1 
ATOM   5192 O  OD2 . ASP G  1 90 ? 5.528   -20.185 -28.961  1.00 95.87  ? 131 ASP G OD2 1 
ATOM   5193 N  N   . GLN G  1 91 ? 1.688   -19.467 -30.350  1.00 79.87  ? 132 GLN G N   1 
ATOM   5194 C  CA  . GLN G  1 91 ? 1.204   -20.415 -31.348  1.00 73.56  ? 132 GLN G CA  1 
ATOM   5195 C  C   . GLN G  1 91 ? 0.642   -19.715 -32.569  1.00 77.08  ? 132 GLN G C   1 
ATOM   5196 O  O   . GLN G  1 91 ? 0.765   -20.206 -33.690  1.00 74.61  ? 132 GLN G O   1 
ATOM   5197 C  CB  . GLN G  1 91 ? 0.111   -21.306 -30.759  1.00 69.05  ? 132 GLN G CB  1 
ATOM   5198 C  CG  . GLN G  1 91 ? 0.556   -22.132 -29.568  1.00 74.08  ? 132 GLN G CG  1 
ATOM   5199 C  CD  . GLN G  1 91 ? 1.847   -22.875 -29.839  1.00 85.38  ? 132 GLN G CD  1 
ATOM   5200 O  OE1 . GLN G  1 91 ? 1.937   -23.660 -30.782  1.00 88.40  ? 132 GLN G OE1 1 
ATOM   5201 N  NE2 . GLN G  1 91 ? 2.858   -22.628 -29.012  1.00 83.19  ? 132 GLN G NE2 1 
ATOM   5202 N  N   . LEU G  1 92 ? 0.017   -18.566 -32.343  1.00 83.32  ? 133 LEU G N   1 
ATOM   5203 C  CA  . LEU G  1 92 ? -0.588  -17.795 -33.418  1.00 88.26  ? 133 LEU G CA  1 
ATOM   5204 C  C   . LEU G  1 92 ? 0.293   -17.752 -34.659  1.00 89.86  ? 133 LEU G C   1 
ATOM   5205 O  O   . LEU G  1 92 ? -0.203  -17.592 -35.774  1.00 89.68  ? 133 LEU G O   1 
ATOM   5206 C  CB  . LEU G  1 92 ? -0.886  -16.375 -32.934  1.00 84.85  ? 133 LEU G CB  1 
ATOM   5207 C  CG  . LEU G  1 92 ? -1.776  -15.511 -33.827  1.00 87.07  ? 133 LEU G CG  1 
ATOM   5208 C  CD1 . LEU G  1 92 ? -2.956  -16.328 -34.328  1.00 95.22  ? 133 LEU G CD1 1 
ATOM   5209 C  CD2 . LEU G  1 92 ? -2.256  -14.302 -33.041  1.00 90.26  ? 133 LEU G CD2 1 
ATOM   5210 N  N   . SER G  1 93 ? 1.597   -17.906 -34.461  1.00 92.36  ? 134 SER G N   1 
ATOM   5211 C  CA  . SER G  1 93 ? 2.553   -17.891 -35.560  1.00 101.46 ? 134 SER G CA  1 
ATOM   5212 C  C   . SER G  1 93 ? 2.860   -19.318 -36.010  1.00 109.05 ? 134 SER G C   1 
ATOM   5213 O  O   . SER G  1 93 ? 2.182   -19.862 -36.884  1.00 117.35 ? 134 SER G O   1 
ATOM   5214 C  CB  . SER G  1 93 ? 3.842   -17.207 -35.110  1.00 98.62  ? 134 SER G CB  1 
ATOM   5215 O  OG  . SER G  1 93 ? 3.549   -16.074 -34.311  1.00 96.35  ? 134 SER G OG  1 
ATOM   5216 N  N   . LYS G  1 94 ? 3.884   -19.908 -35.397  1.00 114.81 ? 135 LYS G N   1 
ATOM   5217 C  CA  . LYS G  1 94 ? 4.335   -21.270 -35.686  1.00 121.79 ? 135 LYS G CA  1 
ATOM   5218 C  C   . LYS G  1 94 ? 3.849   -21.858 -37.008  1.00 131.41 ? 135 LYS G C   1 
ATOM   5219 O  O   . LYS G  1 94 ? 2.703   -22.292 -37.128  1.00 135.64 ? 135 LYS G O   1 
ATOM   5220 C  CB  . LYS G  1 94 ? 3.950   -22.198 -34.529  1.00 123.11 ? 135 LYS G CB  1 
ATOM   5221 C  CG  . LYS G  1 94 ? 4.616   -21.813 -33.220  1.00 119.26 ? 135 LYS G CG  1 
ATOM   5222 C  CD  . LYS G  1 94 ? 6.123   -21.708 -33.408  1.00 112.92 ? 135 LYS G CD  1 
ATOM   5223 C  CE  . LYS G  1 94 ? 6.756   -20.818 -32.356  1.00 106.11 ? 135 LYS G CE  1 
ATOM   5224 N  NZ  . LYS G  1 94 ? 7.669   -19.816 -32.979  1.00 102.59 ? 135 LYS G NZ  1 
ATOM   5225 N  N   . LEU G  1 95 ? 4.739   -21.880 -37.997  1.00 136.56 ? 136 LEU G N   1 
ATOM   5226 C  CA  . LEU G  1 95 ? 4.406   -22.407 -39.314  1.00 137.76 ? 136 LEU G CA  1 
ATOM   5227 C  C   . LEU G  1 95 ? 5.681   -22.571 -40.140  1.00 139.38 ? 136 LEU G C   1 
ATOM   5228 O  O   . LEU G  1 95 ? 6.776   -22.436 -39.552  1.00 140.20 ? 136 LEU G O   1 
ATOM   5229 C  CB  . LEU G  1 95 ? 3.420   -21.458 -40.010  1.00 143.38 ? 136 LEU G CB  1 
ATOM   5230 C  CG  . LEU G  1 95 ? 2.598   -21.916 -41.225  1.00 143.77 ? 136 LEU G CG  1 
ATOM   5231 C  CD1 . LEU G  1 95 ? 3.380   -21.716 -42.512  1.00 146.83 ? 136 LEU G CD1 1 
ATOM   5232 C  CD2 . LEU G  1 95 ? 2.181   -23.369 -41.042  1.00 141.28 ? 136 LEU G CD2 1 
ATOM   5233 N  N   . ILE H  1 5  ? -5.237  10.837  117.426  1.00 122.50 ? 46  ILE H N   1 
ATOM   5234 C  CA  . ILE H  1 5  ? -4.578  11.403  116.212  1.00 124.33 ? 46  ILE H CA  1 
ATOM   5235 C  C   . ILE H  1 5  ? -4.516  10.385  115.078  1.00 128.21 ? 46  ILE H C   1 
ATOM   5236 O  O   . ILE H  1 5  ? -4.046  10.692  113.983  1.00 125.57 ? 46  ILE H O   1 
ATOM   5237 C  CB  . ILE H  1 5  ? -3.136  11.858  116.512  1.00 125.80 ? 46  ILE H CB  1 
ATOM   5238 C  CG1 . ILE H  1 5  ? -2.292  10.656  116.941  1.00 118.90 ? 46  ILE H CG1 1 
ATOM   5239 C  CG2 . ILE H  1 5  ? -3.142  12.918  117.599  1.00 125.08 ? 46  ILE H CG2 1 
ATOM   5240 C  CD1 . ILE H  1 5  ? -0.798  10.877  116.811  1.00 99.94  ? 46  ILE H CD1 1 
ATOM   5241 N  N   . GLU H  1 6  ? -4.983  9.170   115.344  1.00 125.91 ? 47  GLU H N   1 
ATOM   5242 C  CA  . GLU H  1 6  ? -4.971  8.114   114.338  1.00 131.87 ? 47  GLU H CA  1 
ATOM   5243 C  C   . GLU H  1 6  ? -5.861  8.476   113.152  1.00 133.37 ? 47  GLU H C   1 
ATOM   5244 O  O   . GLU H  1 6  ? -5.497  8.242   112.001  1.00 135.85 ? 47  GLU H O   1 
ATOM   5245 C  CB  . GLU H  1 6  ? -5.445  6.799   114.958  1.00 131.92 ? 47  GLU H CB  1 
ATOM   5246 C  CG  . GLU H  1 6  ? -6.772  6.301   114.419  1.00 130.95 ? 47  GLU H CG  1 
ATOM   5247 C  CD  . GLU H  1 6  ? -7.616  5.639   115.482  1.00 131.34 ? 47  GLU H CD  1 
ATOM   5248 O  OE1 . GLU H  1 6  ? -8.799  5.361   115.204  1.00 127.55 ? 47  GLU H OE1 1 
ATOM   5249 O  OE2 . GLU H  1 6  ? -7.102  5.401   116.595  1.00 125.92 ? 47  GLU H OE2 1 
ATOM   5250 N  N   . SER H  1 7  ? -7.036  9.029   113.439  1.00 133.46 ? 48  SER H N   1 
ATOM   5251 C  CA  . SER H  1 7  ? -7.957  9.427   112.382  1.00 133.77 ? 48  SER H CA  1 
ATOM   5252 C  C   . SER H  1 7  ? -7.224  10.417  111.485  1.00 136.40 ? 48  SER H C   1 
ATOM   5253 O  O   . SER H  1 7  ? -7.347  10.373  110.261  1.00 139.33 ? 48  SER H O   1 
ATOM   5254 C  CB  . SER H  1 7  ? -9.206  10.080  112.980  1.00 133.40 ? 48  SER H CB  1 
ATOM   5255 O  OG  . SER H  1 7  ? -8.869  11.214  113.760  1.00 126.49 ? 48  SER H OG  1 
ATOM   5256 N  N   . LEU H  1 8  ? -6.457  11.304  112.112  1.00 136.62 ? 49  LEU H N   1 
ATOM   5257 C  CA  . LEU H  1 8  ? -5.672  12.306  111.397  1.00 135.30 ? 49  LEU H CA  1 
ATOM   5258 C  C   . LEU H  1 8  ? -4.655  11.591  110.513  1.00 138.09 ? 49  LEU H C   1 
ATOM   5259 O  O   . LEU H  1 8  ? -4.460  11.945  109.348  1.00 138.55 ? 49  LEU H O   1 
ATOM   5260 C  CB  . LEU H  1 8  ? -4.932  13.200  112.393  1.00 134.95 ? 49  LEU H CB  1 
ATOM   5261 C  CG  . LEU H  1 8  ? -3.921  14.184  111.802  1.00 129.54 ? 49  LEU H CG  1 
ATOM   5262 C  CD1 . LEU H  1 8  ? -4.644  15.423  111.305  1.00 126.36 ? 49  LEU H CD1 1 
ATOM   5263 C  CD2 . LEU H  1 8  ? -2.901  14.562  112.859  1.00 125.23 ? 49  LEU H CD2 1 
ATOM   5264 N  N   . HIS H  1 9  ? -4.003  10.585  111.088  1.00 138.86 ? 50  HIS H N   1 
ATOM   5265 C  CA  . HIS H  1 9  ? -3.008  9.803   110.369  1.00 139.01 ? 50  HIS H CA  1 
ATOM   5266 C  C   . HIS H  1 9  ? -3.643  9.068   109.198  1.00 139.05 ? 50  HIS H C   1 
ATOM   5267 O  O   . HIS H  1 9  ? -3.045  8.945   108.133  1.00 140.05 ? 50  HIS H O   1 
ATOM   5268 C  CB  . HIS H  1 9  ? -2.341  8.793   111.306  1.00 136.38 ? 50  HIS H CB  1 
ATOM   5269 C  CG  . HIS H  1 9  ? -0.965  9.188   111.741  1.00 136.33 ? 50  HIS H CG  1 
ATOM   5270 N  ND1 . HIS H  1 9  ? -0.118  8.326   112.400  1.00 136.50 ? 50  HIS H ND1 1 
ATOM   5271 C  CD2 . HIS H  1 9  ? -0.282  10.350  111.597  1.00 136.76 ? 50  HIS H CD2 1 
ATOM   5272 C  CE1 . HIS H  1 9  ? 1.029   8.936   112.642  1.00 138.05 ? 50  HIS H CE1 1 
ATOM   5273 N  NE2 . HIS H  1 9  ? 0.954   10.166  112.164  1.00 139.79 ? 50  HIS H NE2 1 
ATOM   5274 N  N   . ASP H  1 10 ? -4.856  8.567   109.400  1.00 139.22 ? 51  ASP H N   1 
ATOM   5275 C  CA  . ASP H  1 10 ? -5.552  7.860   108.336  1.00 138.94 ? 51  ASP H CA  1 
ATOM   5276 C  C   . ASP H  1 10 ? -5.842  8.852   107.214  1.00 140.14 ? 51  ASP H C   1 
ATOM   5277 O  O   . ASP H  1 10 ? -5.729  8.528   106.031  1.00 138.65 ? 51  ASP H O   1 
ATOM   5278 C  CB  . ASP H  1 10 ? -6.856  7.258   108.861  1.00 140.56 ? 51  ASP H CB  1 
ATOM   5279 C  CG  . ASP H  1 10 ? -7.620  6.504   107.791  1.00 140.57 ? 51  ASP H CG  1 
ATOM   5280 O  OD1 . ASP H  1 10 ? -8.180  7.157   106.885  1.00 139.08 ? 51  ASP H OD1 1 
ATOM   5281 O  OD2 . ASP H  1 10 ? -7.651  5.257   107.852  1.00 138.49 ? 51  ASP H OD2 1 
ATOM   5282 N  N   . GLN H  1 11 ? -6.210  10.066  107.609  1.00 137.92 ? 52  GLN H N   1 
ATOM   5283 C  CA  . GLN H  1 11 ? -6.513  11.139  106.672  1.00 138.86 ? 52  GLN H CA  1 
ATOM   5284 C  C   . GLN H  1 11 ? -5.289  11.496  105.840  1.00 137.82 ? 52  GLN H C   1 
ATOM   5285 O  O   . GLN H  1 11 ? -5.382  11.675  104.624  1.00 137.51 ? 52  GLN H O   1 
ATOM   5286 C  CB  . GLN H  1 11 ? -6.981  12.378  107.436  1.00 136.54 ? 52  GLN H CB  1 
ATOM   5287 C  CG  . GLN H  1 11 ? -8.425  12.332  107.893  1.00 141.55 ? 52  GLN H CG  1 
ATOM   5288 C  CD  . GLN H  1 11 ? -9.385  12.683  106.779  1.00 144.38 ? 52  GLN H CD  1 
ATOM   5289 O  OE1 . GLN H  1 11 ? -9.218  13.700  106.107  1.00 144.02 ? 52  GLN H OE1 1 
ATOM   5290 N  NE2 . GLN H  1 11 ? -10.402 11.851  106.583  1.00 144.93 ? 52  GLN H NE2 1 
ATOM   5291 N  N   . ILE H  1 12 ? -4.143  11.606  106.503  1.00 135.56 ? 53  ILE H N   1 
ATOM   5292 C  CA  . ILE H  1 12 ? -2.908  11.947  105.814  1.00 133.00 ? 53  ILE H CA  1 
ATOM   5293 C  C   . ILE H  1 12 ? -2.514  10.825  104.856  1.00 132.99 ? 53  ILE H C   1 
ATOM   5294 O  O   . ILE H  1 12 ? -1.983  11.085  103.777  1.00 135.70 ? 53  ILE H O   1 
ATOM   5295 C  CB  . ILE H  1 12 ? -1.759  12.226  106.820  1.00 136.03 ? 53  ILE H CB  1 
ATOM   5296 C  CG1 . ILE H  1 12 ? -0.536  12.762  106.079  1.00 133.08 ? 53  ILE H CG1 1 
ATOM   5297 C  CG2 . ILE H  1 12 ? -1.390  10.964  107.570  1.00 129.74 ? 53  ILE H CG2 1 
ATOM   5298 C  CD1 . ILE H  1 12 ? 0.602   13.181  106.988  1.00 123.79 ? 53  ILE H CD1 1 
ATOM   5299 N  N   . ASP H  1 13 ? -2.785  9.582   105.248  1.00 132.04 ? 54  ASP H N   1 
ATOM   5300 C  CA  . ASP H  1 13 ? -2.470  8.431   104.405  1.00 134.03 ? 54  ASP H CA  1 
ATOM   5301 C  C   . ASP H  1 13 ? -3.418  8.380   103.208  1.00 134.98 ? 54  ASP H C   1 
ATOM   5302 O  O   . ASP H  1 13 ? -2.999  8.101   102.085  1.00 136.74 ? 54  ASP H O   1 
ATOM   5303 C  CB  . ASP H  1 13 ? -2.573  7.128   105.206  1.00 131.69 ? 54  ASP H CB  1 
ATOM   5304 C  CG  . ASP H  1 13 ? -1.388  6.916   106.133  1.00 135.48 ? 54  ASP H CG  1 
ATOM   5305 O  OD1 . ASP H  1 13 ? -0.247  6.812   105.632  1.00 134.73 ? 54  ASP H OD1 1 
ATOM   5306 O  OD2 . ASP H  1 13 ? -1.596  6.852   107.363  1.00 137.87 ? 54  ASP H OD2 1 
ATOM   5307 N  N   . MET H  1 14 ? -4.697  8.648   103.456  1.00 133.80 ? 55  MET H N   1 
ATOM   5308 C  CA  . MET H  1 14 ? -5.704  8.652   102.398  1.00 132.58 ? 55  MET H CA  1 
ATOM   5309 C  C   . MET H  1 14 ? -5.334  9.708   101.359  1.00 127.49 ? 55  MET H C   1 
ATOM   5310 O  O   . MET H  1 14 ? -5.420  9.474   100.153  1.00 125.37 ? 55  MET H O   1 
ATOM   5311 C  CB  . MET H  1 14 ? -7.082  8.971   102.985  1.00 135.55 ? 55  MET H CB  1 
ATOM   5312 C  CG  . MET H  1 14 ? -8.153  9.270   101.945  1.00 140.91 ? 55  MET H CG  1 
ATOM   5313 S  SD  . MET H  1 14 ? -8.650  7.834   100.978  1.00 151.93 ? 55  MET H SD  1 
ATOM   5314 C  CE  . MET H  1 14 ? -10.235 7.451   101.745  1.00 148.15 ? 55  MET H CE  1 
ATOM   5315 N  N   . LEU H  1 15 ? -4.925  10.873  101.851  1.00 121.16 ? 56  LEU H N   1 
ATOM   5316 C  CA  . LEU H  1 15 ? -4.522  11.984  101.002  1.00 116.47 ? 56  LEU H CA  1 
ATOM   5317 C  C   . LEU H  1 15 ? -3.325  11.592  100.137  1.00 114.14 ? 56  LEU H C   1 
ATOM   5318 O  O   . LEU H  1 15 ? -3.284  11.902  98.947   1.00 110.84 ? 56  LEU H O   1 
ATOM   5319 C  CB  . LEU H  1 15 ? -4.160  13.191  101.872  1.00 112.08 ? 56  LEU H CB  1 
ATOM   5320 C  CG  . LEU H  1 15 ? -3.502  14.408  101.215  1.00 109.94 ? 56  LEU H CG  1 
ATOM   5321 C  CD1 . LEU H  1 15 ? -4.520  15.198  100.412  1.00 112.60 ? 56  LEU H CD1 1 
ATOM   5322 C  CD2 . LEU H  1 15 ? -2.905  15.284  102.298  1.00 110.16 ? 56  LEU H CD2 1 
ATOM   5323 N  N   . THR H  1 16 ? -2.352  10.911  100.739  1.00 110.17 ? 57  THR H N   1 
ATOM   5324 C  CA  . THR H  1 16 ? -1.157  10.484  100.013  1.00 107.23 ? 57  THR H CA  1 
ATOM   5325 C  C   . THR H  1 16 ? -1.495  9.412   98.989   1.00 113.71 ? 57  THR H C   1 
ATOM   5326 O  O   . THR H  1 16 ? -1.002  9.442   97.861   1.00 119.87 ? 57  THR H O   1 
ATOM   5327 C  CB  . THR H  1 16 ? -0.086  9.893   100.951  1.00 106.19 ? 57  THR H CB  1 
ATOM   5328 O  OG1 . THR H  1 16 ? -0.578  8.681   101.534  1.00 98.29  ? 57  THR H OG1 1 
ATOM   5329 C  CG2 . THR H  1 16 ? 0.272   10.874  102.043  1.00 97.19  ? 57  THR H CG2 1 
ATOM   5330 N  N   . LYS H  1 17 ? -2.329  8.459   99.392   1.00 110.82 ? 58  LYS H N   1 
ATOM   5331 C  CA  . LYS H  1 17 ? -2.722  7.377   98.503   1.00 110.67 ? 58  LYS H CA  1 
ATOM   5332 C  C   . LYS H  1 17 ? -3.286  7.939   97.209   1.00 112.00 ? 58  LYS H C   1 
ATOM   5333 O  O   . LYS H  1 17 ? -2.937  7.477   96.122   1.00 114.67 ? 58  LYS H O   1 
ATOM   5334 C  CB  . LYS H  1 17 ? -3.753  6.479   99.183   1.00 109.84 ? 58  LYS H CB  1 
ATOM   5335 C  CG  . LYS H  1 17 ? -3.205  5.761   100.403  1.00 114.07 ? 58  LYS H CG  1 
ATOM   5336 C  CD  . LYS H  1 17 ? -4.209  4.778   100.969  1.00 117.29 ? 58  LYS H CD  1 
ATOM   5337 C  CE  . LYS H  1 17 ? -4.529  3.683   99.967   1.00 115.07 ? 58  LYS H CE  1 
ATOM   5338 N  NZ  . LYS H  1 17 ? -5.501  2.704   100.522  1.00 113.72 ? 58  LYS H NZ  1 
ATOM   5339 N  N   . THR H  1 18 ? -4.152  8.941   97.324   1.00 110.45 ? 59  THR H N   1 
ATOM   5340 C  CA  . THR H  1 18 ? -4.735  9.561   96.143   1.00 108.87 ? 59  THR H CA  1 
ATOM   5341 C  C   . THR H  1 18 ? -3.594  10.114  95.292   1.00 111.27 ? 59  THR H C   1 
ATOM   5342 O  O   . THR H  1 18 ? -3.413  9.710   94.144   1.00 115.34 ? 59  THR H O   1 
ATOM   5343 C  CB  . THR H  1 18 ? -5.704  10.708  96.522   1.00 108.68 ? 59  THR H CB  1 
ATOM   5344 O  OG1 . THR H  1 18 ? -4.994  11.729  97.232   1.00 111.80 ? 59  THR H OG1 1 
ATOM   5345 C  CG2 . THR H  1 18 ? -6.833  10.183  97.397   1.00 104.04 ? 59  THR H CG2 1 
ATOM   5346 N  N   . ASN H  1 19 ? -2.815  11.023  95.875   1.00 109.94 ? 60  ASN H N   1 
ATOM   5347 C  CA  . ASN H  1 19 ? -1.679  11.635  95.189   1.00 111.21 ? 60  ASN H CA  1 
ATOM   5348 C  C   . ASN H  1 19 ? -0.843  10.629  94.401   1.00 111.09 ? 60  ASN H C   1 
ATOM   5349 O  O   . ASN H  1 19 ? -0.557  10.842  93.224   1.00 112.99 ? 60  ASN H O   1 
ATOM   5350 C  CB  . ASN H  1 19 ? -0.776  12.355  96.197   1.00 104.78 ? 60  ASN H CB  1 
ATOM   5351 C  CG  . ASN H  1 19 ? -1.322  13.708  96.614   1.00 104.25 ? 60  ASN H CG  1 
ATOM   5352 O  OD1 . ASN H  1 19 ? -2.452  13.819  97.083   1.00 109.31 ? 60  ASN H OD1 1 
ATOM   5353 N  ND2 . ASN H  1 19 ? -0.511  14.745  96.448   1.00 104.67 ? 60  ASN H ND2 1 
ATOM   5354 N  N   . LEU H  1 20 ? -0.451  9.537   95.048   1.00 114.50 ? 61  LEU H N   1 
ATOM   5355 C  CA  . LEU H  1 20 ? 0.357   8.514   94.392   1.00 115.44 ? 61  LEU H CA  1 
ATOM   5356 C  C   . LEU H  1 20 ? -0.327  7.994   93.130   1.00 114.24 ? 61  LEU H C   1 
ATOM   5357 O  O   . LEU H  1 20 ? 0.300   7.878   92.076   1.00 112.11 ? 61  LEU H O   1 
ATOM   5358 C  CB  . LEU H  1 20 ? 0.621   7.349   95.353   1.00 117.04 ? 61  LEU H CB  1 
ATOM   5359 C  CG  . LEU H  1 20 ? 1.275   7.697   96.695   1.00 118.85 ? 61  LEU H CG  1 
ATOM   5360 C  CD1 . LEU H  1 20 ? 1.430   6.431   97.523   1.00 118.07 ? 61  LEU H CD1 1 
ATOM   5361 C  CD2 . LEU H  1 20 ? 2.627   8.359   96.468   1.00 118.14 ? 61  LEU H CD2 1 
ATOM   5362 N  N   . GLN H  1 21 ? -1.616  7.686   93.242   1.00 114.76 ? 62  GLN H N   1 
ATOM   5363 C  CA  . GLN H  1 21 ? -2.381  7.180   92.107   1.00 115.42 ? 62  GLN H CA  1 
ATOM   5364 C  C   . GLN H  1 21 ? -2.505  8.236   91.013   1.00 114.01 ? 62  GLN H C   1 
ATOM   5365 O  O   . GLN H  1 21 ? -2.471  7.918   89.822   1.00 115.56 ? 62  GLN H O   1 
ATOM   5366 C  CB  . GLN H  1 21 ? -3.772  6.732   92.564   1.00 116.64 ? 62  GLN H CB  1 
ATOM   5367 C  CG  . GLN H  1 21 ? -3.749  5.627   93.613   1.00 125.10 ? 62  GLN H CG  1 
ATOM   5368 C  CD  . GLN H  1 21 ? -5.134  5.100   93.947   1.00 129.63 ? 62  GLN H CD  1 
ATOM   5369 O  OE1 . GLN H  1 21 ? -5.830  4.558   93.086   1.00 130.84 ? 62  GLN H OE1 1 
ATOM   5370 N  NE2 . GLN H  1 21 ? -5.540  5.255   95.203   1.00 128.91 ? 62  GLN H NE2 1 
ATOM   5371 N  N   . LEU H  1 22 ? -2.655  9.491   91.423   1.00 109.76 ? 63  LEU H N   1 
ATOM   5372 C  CA  . LEU H  1 22 ? -2.766  10.596  90.479   1.00 109.20 ? 63  LEU H CA  1 
ATOM   5373 C  C   . LEU H  1 22 ? -1.456  10.753  89.712   1.00 107.62 ? 63  LEU H C   1 
ATOM   5374 O  O   . LEU H  1 22 ? -1.439  11.230  88.579   1.00 106.07 ? 63  LEU H O   1 
ATOM   5375 C  CB  . LEU H  1 22 ? -3.084  11.900  91.220   1.00 108.98 ? 63  LEU H CB  1 
ATOM   5376 C  CG  . LEU H  1 22 ? -4.517  12.194  91.680   1.00 105.90 ? 63  LEU H CG  1 
ATOM   5377 C  CD1 . LEU H  1 22 ? -5.098  11.012  92.439   1.00 101.95 ? 63  LEU H CD1 1 
ATOM   5378 C  CD2 . LEU H  1 22 ? -4.503  13.445  92.551   1.00 108.32 ? 63  LEU H CD2 1 
ATOM   5379 N  N   . THR H  1 23 ? -0.358  10.349  90.342   1.00 107.20 ? 64  THR H N   1 
ATOM   5380 C  CA  . THR H  1 23 ? 0.957   10.442  89.722   1.00 110.37 ? 64  THR H CA  1 
ATOM   5381 C  C   . THR H  1 23 ? 1.144   9.368   88.658   1.00 116.21 ? 64  THR H C   1 
ATOM   5382 O  O   . THR H  1 23 ? 1.736   9.623   87.608   1.00 118.32 ? 64  THR H O   1 
ATOM   5383 C  CB  . THR H  1 23 ? 2.069   10.329  90.772   1.00 107.00 ? 64  THR H CB  1 
ATOM   5384 O  OG1 . THR H  1 23 ? 2.004   11.465  91.639   1.00 106.20 ? 64  THR H OG1 1 
ATOM   5385 C  CG2 . THR H  1 23 ? 3.435   10.284  90.108   1.00 110.12 ? 64  THR H CG2 1 
ATOM   5386 N  N   . THR H  1 24 ? 0.654   8.162   88.933   1.00 119.55 ? 65  THR H N   1 
ATOM   5387 C  CA  . THR H  1 24 ? 0.751   7.091   87.951   1.00 117.33 ? 65  THR H CA  1 
ATOM   5388 C  C   . THR H  1 24 ? -0.116  7.604   86.811   1.00 115.74 ? 65  THR H C   1 
ATOM   5389 O  O   . THR H  1 24 ? 0.115   7.301   85.642   1.00 115.07 ? 65  THR H O   1 
ATOM   5390 C  CB  . THR H  1 24 ? 0.150   5.762   88.462   1.00 116.48 ? 65  THR H CB  1 
ATOM   5391 O  OG1 . THR H  1 24 ? 0.685   5.451   89.754   1.00 117.11 ? 65  THR H OG1 1 
ATOM   5392 C  CG2 . THR H  1 24 ? 0.492   4.631   87.505   1.00 114.89 ? 65  THR H CG2 1 
ATOM   5393 N  N   . GLN H  1 25 ? -1.113  8.403   87.178   1.00 112.71 ? 66  GLN H N   1 
ATOM   5394 C  CA  . GLN H  1 25 ? -2.037  8.984   86.220   1.00 112.65 ? 66  GLN H CA  1 
ATOM   5395 C  C   . GLN H  1 25 ? -1.375  9.967   85.254   1.00 111.71 ? 66  GLN H C   1 
ATOM   5396 O  O   . GLN H  1 25 ? -1.639  9.927   84.051   1.00 115.91 ? 66  GLN H O   1 
ATOM   5397 C  CB  . GLN H  1 25 ? -3.182  9.668   86.955   1.00 108.89 ? 66  GLN H CB  1 
ATOM   5398 C  CG  . GLN H  1 25 ? -4.015  10.533  86.050   1.00 114.94 ? 66  GLN H CG  1 
ATOM   5399 C  CD  . GLN H  1 25 ? -5.489  10.361  86.287   1.00 120.37 ? 66  GLN H CD  1 
ATOM   5400 O  OE1 . GLN H  1 25 ? -5.959  9.255   86.549   1.00 122.95 ? 66  GLN H OE1 1 
ATOM   5401 N  NE2 . GLN H  1 25 ? -6.237  11.451  86.177   1.00 122.16 ? 66  GLN H NE2 1 
ATOM   5402 N  N   . SER H  1 26 ? -0.540  10.864  85.772   1.00 111.05 ? 67  SER H N   1 
ATOM   5403 C  CA  . SER H  1 26 ? 0.157   11.802  84.902   1.00 107.07 ? 67  SER H CA  1 
ATOM   5404 C  C   . SER H  1 26 ? 0.956   10.932  83.950   1.00 104.36 ? 67  SER H C   1 
ATOM   5405 O  O   . SER H  1 26 ? 0.953   11.145  82.739   1.00 104.81 ? 67  SER H O   1 
ATOM   5406 C  CB  . SER H  1 26 ? 1.095   12.698  85.709   1.00 105.02 ? 67  SER H CB  1 
ATOM   5407 O  OG  . SER H  1 26 ? 0.356   13.686  86.407   1.00 108.52 ? 67  SER H OG  1 
ATOM   5408 N  N   . GLN H  1 27 ? 1.624   9.934   84.518   1.00 102.39 ? 68  GLN H N   1 
ATOM   5409 C  CA  . GLN H  1 27 ? 2.415   8.990   83.743   1.00 110.48 ? 68  GLN H CA  1 
ATOM   5410 C  C   . GLN H  1 27 ? 1.542   8.476   82.603   1.00 113.37 ? 68  GLN H C   1 
ATOM   5411 O  O   . GLN H  1 27 ? 1.950   8.493   81.441   1.00 113.59 ? 68  GLN H O   1 
ATOM   5412 C  CB  . GLN H  1 27 ? 2.843   7.820   84.627   1.00 109.72 ? 68  GLN H CB  1 
ATOM   5413 C  CG  . GLN H  1 27 ? 4.283   7.401   84.447   1.00 112.68 ? 68  GLN H CG  1 
ATOM   5414 C  CD  . GLN H  1 27 ? 4.417   5.959   84.021   1.00 116.26 ? 68  GLN H CD  1 
ATOM   5415 O  OE1 . GLN H  1 27 ? 3.914   5.054   84.686   1.00 117.98 ? 68  GLN H OE1 1 
ATOM   5416 N  NE2 . GLN H  1 27 ? 5.101   5.734   82.906   1.00 118.18 ? 68  GLN H NE2 1 
ATOM   5417 N  N   . ASN H  1 28 ? 0.338   8.023   82.948   1.00 111.79 ? 69  ASN H N   1 
ATOM   5418 C  CA  . ASN H  1 28 ? -0.607  7.513   81.959   1.00 112.28 ? 69  ASN H CA  1 
ATOM   5419 C  C   . ASN H  1 28 ? -0.708  8.521   80.829   1.00 115.25 ? 69  ASN H C   1 
ATOM   5420 O  O   . ASN H  1 28 ? -0.344  8.227   79.689   1.00 119.10 ? 69  ASN H O   1 
ATOM   5421 C  CB  . ASN H  1 28 ? -1.986  7.282   82.607   1.00 106.85 ? 69  ASN H CB  1 
ATOM   5422 C  CG  . ASN H  1 28 ? -3.118  7.207   81.590   1.00 102.05 ? 69  ASN H CG  1 
ATOM   5423 O  OD1 . ASN H  1 28 ? -3.606  8.230   81.114   1.00 97.28  ? 69  ASN H OD1 1 
ATOM   5424 N  ND2 . ASN H  1 28 ? -3.538  5.993   81.255   1.00 99.08  ? 69  ASN H ND2 1 
ATOM   5425 N  N   . LEU H  1 29 ? -1.173  9.720   81.164   1.00 115.67 ? 70  LEU H N   1 
ATOM   5426 C  CA  . LEU H  1 29 ? -1.331  10.792  80.191   1.00 114.36 ? 70  LEU H CA  1 
ATOM   5427 C  C   . LEU H  1 29 ? -0.074  11.152  79.395   1.00 114.85 ? 70  LEU H C   1 
ATOM   5428 O  O   . LEU H  1 29 ? -0.153  11.363  78.187   1.00 116.27 ? 70  LEU H O   1 
ATOM   5429 C  CB  . LEU H  1 29 ? -1.877  12.045  80.883   1.00 112.23 ? 70  LEU H CB  1 
ATOM   5430 C  CG  . LEU H  1 29 ? -3.387  12.277  80.760   1.00 107.57 ? 70  LEU H CG  1 
ATOM   5431 C  CD1 . LEU H  1 29 ? -4.142  11.016  81.138   1.00 97.17  ? 70  LEU H CD1 1 
ATOM   5432 C  CD2 . LEU H  1 29 ? -3.803  13.443  81.643   1.00 105.28 ? 70  LEU H CD2 1 
ATOM   5433 N  N   . LEU H  1 30 ? 1.081   11.226  80.050   1.00 114.19 ? 71  LEU H N   1 
ATOM   5434 C  CA  . LEU H  1 30 ? 2.301   11.581  79.333   1.00 113.65 ? 71  LEU H CA  1 
ATOM   5435 C  C   . LEU H  1 30 ? 2.837   10.476  78.431   1.00 114.79 ? 71  LEU H C   1 
ATOM   5436 O  O   . LEU H  1 30 ? 3.730   10.710  77.612   1.00 115.45 ? 71  LEU H O   1 
ATOM   5437 C  CB  . LEU H  1 30 ? 3.379   12.047  80.308   1.00 114.90 ? 71  LEU H CB  1 
ATOM   5438 C  CG  . LEU H  1 30 ? 3.089   13.429  80.900   1.00 116.63 ? 71  LEU H CG  1 
ATOM   5439 C  CD1 . LEU H  1 30 ? 4.310   13.907  81.661   1.00 115.77 ? 71  LEU H CD1 1 
ATOM   5440 C  CD2 . LEU H  1 30 ? 2.742   14.417  79.786   1.00 114.88 ? 71  LEU H CD2 1 
ATOM   5441 N  N   . SER H  1 31 ? 2.297   9.273   78.587   1.00 114.51 ? 72  SER H N   1 
ATOM   5442 C  CA  . SER H  1 31 ? 2.688   8.156   77.741   1.00 109.37 ? 72  SER H CA  1 
ATOM   5443 C  C   . SER H  1 31 ? 1.860   8.310   76.474   1.00 106.95 ? 72  SER H C   1 
ATOM   5444 O  O   . SER H  1 31 ? 2.318   8.005   75.375   1.00 108.75 ? 72  SER H O   1 
ATOM   5445 C  CB  . SER H  1 31 ? 2.373   6.822   78.414   1.00 104.20 ? 72  SER H CB  1 
ATOM   5446 O  OG  . SER H  1 31 ? 3.557   6.229   78.921   1.00 104.46 ? 72  SER H OG  1 
ATOM   5447 N  N   . LYS H  1 32 ? 0.631   8.792   76.645   1.00 109.70 ? 73  LYS H N   1 
ATOM   5448 C  CA  . LYS H  1 32 ? -0.268  9.024   75.522   1.00 111.26 ? 73  LYS H CA  1 
ATOM   5449 C  C   . LYS H  1 32 ? 0.252   10.202  74.711   1.00 115.65 ? 73  LYS H C   1 
ATOM   5450 O  O   . LYS H  1 32 ? 0.526   10.068  73.519   1.00 122.60 ? 73  LYS H O   1 
ATOM   5451 C  CB  . LYS H  1 32 ? -1.686  9.333   76.012   1.00 107.64 ? 73  LYS H CB  1 
ATOM   5452 C  CG  . LYS H  1 32 ? -2.498  8.108   76.382   1.00 103.00 ? 73  LYS H CG  1 
ATOM   5453 C  CD  . LYS H  1 32 ? -3.887  8.493   76.853   1.00 102.93 ? 73  LYS H CD  1 
ATOM   5454 C  CE  . LYS H  1 32 ? -4.724  7.252   77.112   1.00 104.84 ? 73  LYS H CE  1 
ATOM   5455 N  NZ  . LYS H  1 32 ? -6.043  7.557   77.737   1.00 107.74 ? 73  LYS H NZ  1 
ATOM   5456 N  N   . LEU H  1 33 ? 0.381   11.354  75.364   1.00 118.74 ? 74  LEU H N   1 
ATOM   5457 C  CA  . LEU H  1 33 ? 0.884   12.558  74.709   1.00 121.16 ? 74  LEU H CA  1 
ATOM   5458 C  C   . LEU H  1 33 ? 2.026   12.184  73.774   1.00 121.47 ? 74  LEU H C   1 
ATOM   5459 O  O   . LEU H  1 33 ? 2.087   12.651  72.637   1.00 119.64 ? 74  LEU H O   1 
ATOM   5460 C  CB  . LEU H  1 33 ? 1.391   13.560  75.747   1.00 124.21 ? 74  LEU H CB  1 
ATOM   5461 C  CG  . LEU H  1 33 ? 2.146   14.775  75.197   1.00 125.82 ? 74  LEU H CG  1 
ATOM   5462 C  CD1 . LEU H  1 33 ? 1.168   15.754  74.563   1.00 129.74 ? 74  LEU H CD1 1 
ATOM   5463 C  CD2 . LEU H  1 33 ? 2.912   15.449  76.324   1.00 125.72 ? 74  LEU H CD2 1 
ATOM   5464 N  N   . GLU H  1 34 ? 2.933   11.340  74.264   1.00 124.86 ? 75  GLU H N   1 
ATOM   5465 C  CA  . GLU H  1 34 ? 4.064   10.890  73.462   1.00 125.03 ? 75  GLU H CA  1 
ATOM   5466 C  C   . GLU H  1 34 ? 3.568   10.135  72.237   1.00 124.07 ? 75  GLU H C   1 
ATOM   5467 O  O   . GLU H  1 34 ? 4.041   10.370  71.124   1.00 121.46 ? 75  GLU H O   1 
ATOM   5468 C  CB  . GLU H  1 34 ? 4.994   9.989   74.280   1.00 127.82 ? 75  GLU H CB  1 
ATOM   5469 C  CG  . GLU H  1 34 ? 6.081   10.735  75.044   1.00 130.74 ? 75  GLU H CG  1 
ATOM   5470 C  CD  . GLU H  1 34 ? 7.096   9.790   75.662   1.00 134.71 ? 75  GLU H CD  1 
ATOM   5471 O  OE1 . GLU H  1 34 ? 6.669   8.812   76.309   1.00 135.79 ? 75  GLU H OE1 1 
ATOM   5472 O  OE2 . GLU H  1 34 ? 8.315   10.024  75.509   1.00 133.07 ? 75  GLU H OE2 1 
ATOM   5473 N  N   . LEU H  1 35 ? 2.625   9.220   72.438   1.00 123.10 ? 76  LEU H N   1 
ATOM   5474 C  CA  . LEU H  1 35 ? 2.074   8.477   71.314   1.00 125.48 ? 76  LEU H CA  1 
ATOM   5475 C  C   . LEU H  1 35 ? 1.436   9.480   70.364   1.00 127.27 ? 76  LEU H C   1 
ATOM   5476 O  O   . LEU H  1 35 ? 1.612   9.395   69.148   1.00 131.58 ? 76  LEU H O   1 
ATOM   5477 C  CB  . LEU H  1 35 ? 1.019   7.467   71.779   1.00 127.33 ? 76  LEU H CB  1 
ATOM   5478 C  CG  . LEU H  1 35 ? 1.522   6.119   72.302   1.00 130.53 ? 76  LEU H CG  1 
ATOM   5479 C  CD1 . LEU H  1 35 ? 0.337   5.195   72.553   1.00 130.00 ? 76  LEU H CD1 1 
ATOM   5480 C  CD2 . LEU H  1 35 ? 2.464   5.491   71.282   1.00 128.83 ? 76  LEU H CD2 1 
ATOM   5481 N  N   . ALA H  1 36 ? 0.710   10.439  70.936   1.00 126.50 ? 77  ALA H N   1 
ATOM   5482 C  CA  . ALA H  1 36 ? 0.031   11.474  70.164   1.00 125.14 ? 77  ALA H CA  1 
ATOM   5483 C  C   . ALA H  1 36 ? 0.981   12.147  69.176   1.00 122.90 ? 77  ALA H C   1 
ATOM   5484 O  O   . ALA H  1 36 ? 0.603   12.388  68.027   1.00 119.69 ? 77  ALA H O   1 
ATOM   5485 C  CB  . ALA H  1 36 ? -0.595  12.504  71.102   1.00 126.54 ? 77  ALA H CB  1 
ATOM   5486 N  N   . GLN H  1 37 ? 2.205   12.462  69.603   1.00 120.39 ? 78  GLN H N   1 
ATOM   5487 C  CA  . GLN H  1 37 ? 3.133   13.054  68.650   1.00 120.57 ? 78  GLN H CA  1 
ATOM   5488 C  C   . GLN H  1 37 ? 3.586   11.995  67.660   1.00 118.51 ? 78  GLN H C   1 
ATOM   5489 O  O   . GLN H  1 37 ? 3.383   12.154  66.465   1.00 118.30 ? 78  GLN H O   1 
ATOM   5490 C  CB  . GLN H  1 37 ? 4.412   13.634  69.256   1.00 119.04 ? 78  GLN H CB  1 
ATOM   5491 C  CG  . GLN H  1 37 ? 5.257   14.162  68.078   1.00 130.42 ? 78  GLN H CG  1 
ATOM   5492 C  CD  . GLN H  1 37 ? 6.765   14.131  68.253   1.00 136.70 ? 78  GLN H CD  1 
ATOM   5493 O  OE1 . GLN H  1 37 ? 7.320   13.287  68.958   1.00 138.89 ? 78  GLN H OE1 1 
ATOM   5494 N  NE2 . GLN H  1 37 ? 7.441   15.047  67.566   1.00 139.00 ? 78  GLN H NE2 1 
ATOM   5495 N  N   . SER H  1 38 ? 4.217   10.929  68.157   1.00 115.71 ? 79  SER H N   1 
ATOM   5496 C  CA  . SER H  1 38 ? 4.714   9.847   67.299   1.00 116.33 ? 79  SER H CA  1 
ATOM   5497 C  C   . SER H  1 38 ? 3.818   9.678   66.066   1.00 118.61 ? 79  SER H C   1 
ATOM   5498 O  O   . SER H  1 38 ? 4.299   9.407   64.963   1.00 119.34 ? 79  SER H O   1 
ATOM   5499 C  CB  . SER H  1 38 ? 4.793   8.532   68.090   1.00 113.69 ? 79  SER H CB  1 
ATOM   5500 O  OG  . SER H  1 38 ? 5.748   7.648   67.526   1.00 101.32 ? 79  SER H OG  1 
ATOM   5501 N  N   . LYS H  1 39 ? 2.514   9.861   66.266   1.00 118.76 ? 80  LYS H N   1 
ATOM   5502 C  CA  . LYS H  1 39 ? 1.527   9.770   65.191   1.00 116.56 ? 80  LYS H CA  1 
ATOM   5503 C  C   . LYS H  1 39 ? 1.610   11.024  64.320   1.00 117.49 ? 80  LYS H C   1 
ATOM   5504 O  O   . LYS H  1 39 ? 1.646   10.943  63.093   1.00 121.15 ? 80  LYS H O   1 
ATOM   5505 C  CB  . LYS H  1 39 ? 0.122   9.618   65.785   1.00 122.67 ? 80  LYS H CB  1 
ATOM   5506 C  CG  . LYS H  1 39 ? -0.128  8.215   66.328   1.00 121.15 ? 80  LYS H CG  1 
ATOM   5507 C  CD  . LYS H  1 39 ? -1.317  8.132   67.272   1.00 115.54 ? 80  LYS H CD  1 
ATOM   5508 C  CE  . LYS H  1 39 ? -1.437  6.723   67.847   1.00 116.01 ? 80  LYS H CE  1 
ATOM   5509 N  NZ  . LYS H  1 39 ? -2.512  6.632   68.872   1.00 116.68 ? 80  LYS H NZ  1 
ATOM   5510 N  N   . GLU H  1 40 ? 1.644   12.178  64.975   1.00 112.07 ? 81  GLU H N   1 
ATOM   5511 C  CA  . GLU H  1 40 ? 1.760   13.468  64.309   1.00 111.66 ? 81  GLU H CA  1 
ATOM   5512 C  C   . GLU H  1 40 ? 3.081   13.516  63.527   1.00 108.03 ? 81  GLU H C   1 
ATOM   5513 O  O   . GLU H  1 40 ? 3.139   14.065  62.429   1.00 104.35 ? 81  GLU H O   1 
ATOM   5514 C  CB  . GLU H  1 40 ? 1.730   14.576  65.367   1.00 113.70 ? 81  GLU H CB  1 
ATOM   5515 C  CG  . GLU H  1 40 ? 1.173   15.906  64.896   1.00 124.07 ? 81  GLU H CG  1 
ATOM   5516 C  CD  . GLU H  1 40 ? 0.732   16.780  66.058   1.00 130.73 ? 81  GLU H CD  1 
ATOM   5517 O  OE1 . GLU H  1 40 ? -0.154  16.341  66.822   1.00 130.97 ? 81  GLU H OE1 1 
ATOM   5518 O  OE2 . GLU H  1 40 ? 1.267   17.898  66.210   1.00 134.19 ? 81  GLU H OE2 1 
ATOM   5519 N  N   . SER H  1 41 ? 4.135   12.936  64.096   1.00 104.34 ? 82  SER H N   1 
ATOM   5520 C  CA  . SER H  1 41 ? 5.446   12.914  63.448   1.00 103.93 ? 82  SER H CA  1 
ATOM   5521 C  C   . SER H  1 41 ? 5.448   12.011  62.218   1.00 101.07 ? 82  SER H C   1 
ATOM   5522 O  O   . SER H  1 41 ? 5.967   12.379  61.163   1.00 102.90 ? 82  SER H O   1 
ATOM   5523 C  CB  . SER H  1 41 ? 6.521   12.432  64.429   1.00 105.23 ? 82  SER H CB  1 
ATOM   5524 O  OG  . SER H  1 41 ? 7.792   12.349  63.799   1.00 97.95  ? 82  SER H OG  1 
ATOM   5525 N  N   . LYS H  1 42 ? 4.863   10.828  62.360   1.00 99.35  ? 83  LYS H N   1 
ATOM   5526 C  CA  . LYS H  1 42 ? 4.803   9.870   61.267   1.00 94.78  ? 83  LYS H CA  1 
ATOM   5527 C  C   . LYS H  1 42 ? 4.034   10.435  60.078   1.00 96.67  ? 83  LYS H C   1 
ATOM   5528 O  O   . LYS H  1 42 ? 4.476   10.323  58.934   1.00 98.07  ? 83  LYS H O   1 
ATOM   5529 C  CB  . LYS H  1 42 ? 4.144   8.569   61.734   1.00 96.23  ? 83  LYS H CB  1 
ATOM   5530 C  CG  . LYS H  1 42 ? 4.814   7.335   61.164   1.00 96.42  ? 83  LYS H CG  1 
ATOM   5531 C  CD  . LYS H  1 42 ? 6.271   7.307   61.603   1.00 95.70  ? 83  LYS H CD  1 
ATOM   5532 C  CE  . LYS H  1 42 ? 7.126   6.432   60.708   1.00 95.64  ? 83  LYS H CE  1 
ATOM   5533 N  NZ  . LYS H  1 42 ? 8.563   6.571   61.067   1.00 97.06  ? 83  LYS H NZ  1 
ATOM   5534 N  N   . LEU H  1 43 ? 2.885   11.044  60.352   1.00 95.08  ? 84  LEU H N   1 
ATOM   5535 C  CA  . LEU H  1 43 ? 2.069   11.613  59.292   1.00 90.37  ? 84  LEU H CA  1 
ATOM   5536 C  C   . LEU H  1 43 ? 2.881   12.644  58.511   1.00 93.97  ? 84  LEU H C   1 
ATOM   5537 O  O   . LEU H  1 43 ? 2.887   12.631  57.281   1.00 92.13  ? 84  LEU H O   1 
ATOM   5538 C  CB  . LEU H  1 43 ? 0.807   12.256  59.879   1.00 90.72  ? 84  LEU H CB  1 
ATOM   5539 C  CG  . LEU H  1 43 ? -0.380  12.420  58.922   1.00 98.06  ? 84  LEU H CG  1 
ATOM   5540 C  CD1 . LEU H  1 43 ? -0.778  11.059  58.363   1.00 97.97  ? 84  LEU H CD1 1 
ATOM   5541 C  CD2 . LEU H  1 43 ? -1.554  13.048  59.652   1.00 98.31  ? 84  LEU H CD2 1 
ATOM   5542 N  N   . LEU H  1 44 ? 3.579   13.522  59.227   1.00 92.19  ? 85  LEU H N   1 
ATOM   5543 C  CA  . LEU H  1 44 ? 4.391   14.554  58.589   1.00 92.48  ? 85  LEU H CA  1 
ATOM   5544 C  C   . LEU H  1 44 ? 5.455   13.952  57.678   1.00 91.80  ? 85  LEU H C   1 
ATOM   5545 O  O   . LEU H  1 44 ? 5.753   14.501  56.618   1.00 91.97  ? 85  LEU H O   1 
ATOM   5546 C  CB  . LEU H  1 44 ? 5.063   15.439  59.645   1.00 99.43  ? 85  LEU H CB  1 
ATOM   5547 C  CG  . LEU H  1 44 ? 4.147   16.115  60.670   1.00 105.53 ? 85  LEU H CG  1 
ATOM   5548 C  CD1 . LEU H  1 44 ? 4.926   17.186  61.427   1.00 104.55 ? 85  LEU H CD1 1 
ATOM   5549 C  CD2 . LEU H  1 44 ? 2.950   16.731  59.963   1.00 105.95 ? 85  LEU H CD2 1 
ATOM   5550 N  N   . GLU H  1 45 ? 6.028   12.825  58.091   1.00 84.75  ? 86  GLU H N   1 
ATOM   5551 C  CA  . GLU H  1 45 ? 7.051   12.169  57.287   1.00 84.59  ? 86  GLU H CA  1 
ATOM   5552 C  C   . GLU H  1 45 ? 6.441   11.604  56.009   1.00 86.05  ? 86  GLU H C   1 
ATOM   5553 O  O   . GLU H  1 45 ? 7.044   11.676  54.940   1.00 84.95  ? 86  GLU H O   1 
ATOM   5554 C  CB  . GLU H  1 45 ? 7.722   11.044  58.077   1.00 90.76  ? 86  GLU H CB  1 
ATOM   5555 C  CG  . GLU H  1 45 ? 8.823   10.341  57.301   1.00 101.92 ? 86  GLU H CG  1 
ATOM   5556 C  CD  . GLU H  1 45 ? 9.908   9.799   58.203   1.00 108.98 ? 86  GLU H CD  1 
ATOM   5557 O  OE1 . GLU H  1 45 ? 9.905   8.583   58.489   1.00 114.78 ? 86  GLU H OE1 1 
ATOM   5558 O  OE2 . GLU H  1 45 ? 10.762  10.601  58.636   1.00 112.35 ? 86  GLU H OE2 1 
ATOM   5559 N  N   . ASN H  1 46 ? 5.245   11.036  56.125   1.00 79.88  ? 87  ASN H N   1 
ATOM   5560 C  CA  . ASN H  1 46 ? 4.565   10.475  54.967   1.00 78.37  ? 87  ASN H CA  1 
ATOM   5561 C  C   . ASN H  1 46 ? 4.101   11.596  54.047   1.00 74.96  ? 87  ASN H C   1 
ATOM   5562 O  O   . ASN H  1 46 ? 4.283   11.535  52.829   1.00 77.48  ? 87  ASN H O   1 
ATOM   5563 C  CB  . ASN H  1 46 ? 3.357   9.643   55.400   1.00 78.11  ? 87  ASN H CB  1 
ATOM   5564 C  CG  . ASN H  1 46 ? 3.752   8.337   56.060   1.00 78.43  ? 87  ASN H CG  1 
ATOM   5565 O  OD1 . ASN H  1 46 ? 3.271   7.271   55.684   1.00 81.64  ? 87  ASN H OD1 1 
ATOM   5566 N  ND2 . ASN H  1 46 ? 4.626   8.415   57.056   1.00 69.58  ? 87  ASN H ND2 1 
ATOM   5567 N  N   . LEU H  1 47 ? 3.503   12.619  54.645   1.00 69.82  ? 88  LEU H N   1 
ATOM   5568 C  CA  . LEU H  1 47 ? 2.988   13.760  53.905   1.00 73.28  ? 88  LEU H CA  1 
ATOM   5569 C  C   . LEU H  1 47 ? 4.071   14.443  53.077   1.00 68.73  ? 88  LEU H C   1 
ATOM   5570 O  O   . LEU H  1 47 ? 3.822   14.868  51.950   1.00 71.14  ? 88  LEU H O   1 
ATOM   5571 C  CB  . LEU H  1 47 ? 2.339   14.747  54.883   1.00 74.81  ? 88  LEU H CB  1 
ATOM   5572 C  CG  . LEU H  1 47 ? 1.204   14.123  55.709   1.00 81.79  ? 88  LEU H CG  1 
ATOM   5573 C  CD1 . LEU H  1 47 ? 0.720   15.090  56.774   1.00 83.52  ? 88  LEU H CD1 1 
ATOM   5574 C  CD2 . LEU H  1 47 ? 0.064   13.718  54.785   1.00 85.49  ? 88  LEU H CD2 1 
ATOM   5575 N  N   . ASN H  1 48 ? 5.274   14.542  53.635   1.00 67.43  ? 89  ASN H N   1 
ATOM   5576 C  CA  . ASN H  1 48 ? 6.384   15.167  52.929   1.00 68.97  ? 89  ASN H CA  1 
ATOM   5577 C  C   . ASN H  1 48 ? 6.935   14.232  51.872   1.00 64.14  ? 89  ASN H C   1 
ATOM   5578 O  O   . ASN H  1 48 ? 7.511   14.672  50.882   1.00 65.24  ? 89  ASN H O   1 
ATOM   5579 C  CB  . ASN H  1 48 ? 7.497   15.531  53.905   1.00 75.92  ? 89  ASN H CB  1 
ATOM   5580 C  CG  . ASN H  1 48 ? 7.212   16.812  54.647   1.00 86.91  ? 89  ASN H CG  1 
ATOM   5581 O  OD1 . ASN H  1 48 ? 7.212   17.895  54.057   1.00 82.05  ? 89  ASN H OD1 1 
ATOM   5582 N  ND2 . ASN H  1 48 ? 6.956   16.700  55.948   1.00 88.58  ? 89  ASN H ND2 1 
ATOM   5583 N  N   . LEU H  1 49 ? 6.754   12.937  52.094   1.00 62.46  ? 90  LEU H N   1 
ATOM   5584 C  CA  . LEU H  1 49 ? 7.234   11.928  51.168   1.00 63.92  ? 90  LEU H CA  1 
ATOM   5585 C  C   . LEU H  1 49 ? 6.293   11.890  49.966   1.00 59.58  ? 90  LEU H C   1 
ATOM   5586 O  O   . LEU H  1 49 ? 6.707   11.605  48.848   1.00 59.20  ? 90  LEU H O   1 
ATOM   5587 C  CB  . LEU H  1 49 ? 7.296   10.573  51.879   1.00 68.09  ? 90  LEU H CB  1 
ATOM   5588 C  CG  . LEU H  1 49 ? 8.366   9.572   51.438   1.00 75.65  ? 90  LEU H CG  1 
ATOM   5589 C  CD1 . LEU H  1 49 ? 8.868   8.796   52.641   1.00 73.19  ? 90  LEU H CD1 1 
ATOM   5590 C  CD2 . LEU H  1 49 ? 7.795   8.635   50.389   1.00 57.13  ? 90  LEU H CD2 1 
ATOM   5591 N  N   . LEU H  1 50 ? 5.021   12.188  50.208   1.00 62.80  ? 91  LEU H N   1 
ATOM   5592 C  CA  . LEU H  1 50 ? 4.027   12.225  49.144   1.00 62.39  ? 91  LEU H CA  1 
ATOM   5593 C  C   . LEU H  1 50 ? 4.116   13.584  48.473   1.00 69.69  ? 91  LEU H C   1 
ATOM   5594 O  O   . LEU H  1 50 ? 3.823   13.726  47.285   1.00 70.48  ? 91  LEU H O   1 
ATOM   5595 C  CB  . LEU H  1 50 ? 2.622   12.030  49.715   1.00 62.73  ? 91  LEU H CB  1 
ATOM   5596 C  CG  . LEU H  1 50 ? 2.400   10.686  50.400   1.00 76.26  ? 91  LEU H CG  1 
ATOM   5597 C  CD1 . LEU H  1 50 ? 0.948   10.569  50.840   1.00 76.22  ? 91  LEU H CD1 1 
ATOM   5598 C  CD2 . LEU H  1 50 ? 2.765   9.563   49.439   1.00 68.18  ? 91  LEU H CD2 1 
ATOM   5599 N  N   . LYS H  1 51 ? 4.519   14.579  49.255   1.00 66.45  ? 92  LYS H N   1 
ATOM   5600 C  CA  . LYS H  1 51 ? 4.667   15.941  48.768   1.00 64.32  ? 92  LYS H CA  1 
ATOM   5601 C  C   . LYS H  1 51 ? 5.734   15.908  47.688   1.00 56.83  ? 92  LYS H C   1 
ATOM   5602 O  O   . LYS H  1 51 ? 5.553   16.440  46.598   1.00 65.79  ? 92  LYS H O   1 
ATOM   5603 C  CB  . LYS H  1 51 ? 5.129   16.855  49.905   1.00 67.64  ? 92  LYS H CB  1 
ATOM   5604 C  CG  . LYS H  1 51 ? 4.630   18.286  49.826   1.00 70.10  ? 92  LYS H CG  1 
ATOM   5605 C  CD  . LYS H  1 51 ? 5.382   19.167  50.818   1.00 61.40  ? 92  LYS H CD  1 
ATOM   5606 C  CE  . LYS H  1 51 ? 6.758   19.580  50.295   1.00 71.10  ? 92  LYS H CE  1 
ATOM   5607 N  NZ  . LYS H  1 51 ? 6.686   20.791  49.420   1.00 68.02  ? 92  LYS H NZ  1 
ATOM   5608 N  N   . ASN H  1 52 ? 6.842   15.251  48.004   1.00 56.31  ? 93  ASN H N   1 
ATOM   5609 C  CA  . ASN H  1 52 ? 7.964   15.157  47.090   1.00 50.11  ? 93  ASN H CA  1 
ATOM   5610 C  C   . ASN H  1 52 ? 7.733   14.349  45.825   1.00 55.55  ? 93  ASN H C   1 
ATOM   5611 O  O   . ASN H  1 52 ? 8.296   14.674  44.784   1.00 61.69  ? 93  ASN H O   1 
ATOM   5612 C  CB  . ASN H  1 52 ? 9.194   14.620  47.827   1.00 63.73  ? 93  ASN H CB  1 
ATOM   5613 C  CG  . ASN H  1 52 ? 9.798   15.649  48.765   1.00 73.01  ? 93  ASN H CG  1 
ATOM   5614 O  OD1 . ASN H  1 52 ? 10.029  16.795  48.374   1.00 81.38  ? 93  ASN H OD1 1 
ATOM   5615 N  ND2 . ASN H  1 52 ? 10.064  15.247  50.004   1.00 67.95  ? 93  ASN H ND2 1 
ATOM   5616 N  N   . GLU H  1 53 ? 6.920   13.301  45.900   1.00 49.32  ? 94  GLU H N   1 
ATOM   5617 C  CA  . GLU H  1 53 ? 6.669   12.497  44.714   1.00 45.30  ? 94  GLU H CA  1 
ATOM   5618 C  C   . GLU H  1 53 ? 5.624   13.197  43.854   1.00 48.09  ? 94  GLU H C   1 
ATOM   5619 O  O   . GLU H  1 53 ? 5.659   13.134  42.624   1.00 51.02  ? 94  GLU H O   1 
ATOM   5620 C  CB  . GLU H  1 53 ? 6.199   11.104  45.114   1.00 53.21  ? 94  GLU H CB  1 
ATOM   5621 C  CG  . GLU H  1 53 ? 5.988   10.167  43.942   1.00 65.43  ? 94  GLU H CG  1 
ATOM   5622 C  CD  . GLU H  1 53 ? 7.183   10.115  43.006   1.00 72.41  ? 94  GLU H CD  1 
ATOM   5623 O  OE1 . GLU H  1 53 ? 8.328   10.007  43.492   1.00 83.63  ? 94  GLU H OE1 1 
ATOM   5624 O  OE2 . GLU H  1 53 ? 6.980   10.164  41.778   1.00 60.44  ? 94  GLU H OE2 1 
ATOM   5625 N  N   . ASN H  1 54 ? 4.706   13.877  44.526   1.00 48.50  ? 95  ASN H N   1 
ATOM   5626 C  CA  . ASN H  1 54 ? 3.654   14.633  43.871   1.00 38.84  ? 95  ASN H CA  1 
ATOM   5627 C  C   . ASN H  1 54 ? 4.382   15.645  42.988   1.00 36.03  ? 95  ASN H C   1 
ATOM   5628 O  O   . ASN H  1 54 ? 4.061   15.833  41.820   1.00 52.96  ? 95  ASN H O   1 
ATOM   5629 C  CB  . ASN H  1 54 ? 2.839   15.361  44.940   1.00 45.36  ? 95  ASN H CB  1 
ATOM   5630 C  CG  . ASN H  1 54 ? 1.464   15.777  44.462   1.00 66.04  ? 95  ASN H CG  1 
ATOM   5631 O  OD1 . ASN H  1 54 ? 1.232   15.984  43.266   1.00 62.34  ? 95  ASN H OD1 1 
ATOM   5632 N  ND2 . ASN H  1 54 ? 0.539   15.929  45.410   1.00 69.27  ? 95  ASN H ND2 1 
ATOM   5633 N  N   . GLU H  1 55 ? 5.392   16.280  43.563   1.00 42.09  ? 96  GLU H N   1 
ATOM   5634 C  CA  . GLU H  1 55 ? 6.163   17.291  42.861   1.00 41.38  ? 96  GLU H CA  1 
ATOM   5635 C  C   . GLU H  1 55 ? 7.002   16.719  41.709   1.00 43.90  ? 96  GLU H C   1 
ATOM   5636 O  O   . GLU H  1 55 ? 7.307   17.423  40.740   1.00 46.67  ? 96  GLU H O   1 
ATOM   5637 C  CB  . GLU H  1 55 ? 7.033   18.018  43.878   1.00 42.94  ? 96  GLU H CB  1 
ATOM   5638 C  CG  . GLU H  1 55 ? 8.046   18.955  43.306   1.00 63.41  ? 96  GLU H CG  1 
ATOM   5639 C  CD  . GLU H  1 55 ? 7.429   20.201  42.721   1.00 75.80  ? 96  GLU H CD  1 
ATOM   5640 O  OE1 . GLU H  1 55 ? 6.696   20.905  43.454   1.00 70.70  ? 96  GLU H OE1 1 
ATOM   5641 O  OE2 . GLU H  1 55 ? 7.691   20.479  41.529   1.00 75.60  ? 96  GLU H OE2 1 
ATOM   5642 N  N   . ASN H  1 56 ? 7.369   15.446  41.807   1.00 34.69  ? 97  ASN H N   1 
ATOM   5643 C  CA  . ASN H  1 56 ? 8.131   14.800  40.749   1.00 26.30  ? 97  ASN H CA  1 
ATOM   5644 C  C   . ASN H  1 56 ? 7.204   14.553  39.574   1.00 29.79  ? 97  ASN H C   1 
ATOM   5645 O  O   . ASN H  1 56 ? 7.558   14.819  38.427   1.00 35.17  ? 97  ASN H O   1 
ATOM   5646 C  CB  . ASN H  1 56 ? 8.717   13.478  41.252   1.00 31.61  ? 97  ASN H CB  1 
ATOM   5647 C  CG  . ASN H  1 56 ? 9.400   12.694  40.160   1.00 45.78  ? 97  ASN H CG  1 
ATOM   5648 O  OD1 . ASN H  1 56 ? 10.331  13.176  39.522   1.00 45.87  ? 97  ASN H OD1 1 
ATOM   5649 N  ND2 . ASN H  1 56 ? 8.938   11.474  39.935   1.00 59.12  ? 97  ASN H ND2 1 
ATOM   5650 N  N   . LEU H  1 57 ? 6.010   14.044  39.866   1.00 22.65  ? 98  LEU H N   1 
ATOM   5651 C  CA  . LEU H  1 57 ? 5.034   13.785  38.825   1.00 25.16  ? 98  LEU H CA  1 
ATOM   5652 C  C   . LEU H  1 57 ? 4.580   15.080  38.144   1.00 35.34  ? 98  LEU H C   1 
ATOM   5653 O  O   . LEU H  1 57 ? 4.358   15.112  36.933   1.00 34.16  ? 98  LEU H O   1 
ATOM   5654 C  CB  . LEU H  1 57 ? 3.830   13.062  39.418   1.00 31.53  ? 98  LEU H CB  1 
ATOM   5655 C  CG  . LEU H  1 57 ? 4.122   11.703  40.052   1.00 36.87  ? 98  LEU H CG  1 
ATOM   5656 C  CD1 . LEU H  1 57 ? 2.842   11.113  40.607   1.00 23.57  ? 98  LEU H CD1 1 
ATOM   5657 C  CD2 . LEU H  1 57 ? 4.732   10.782  39.015   1.00 26.35  ? 98  LEU H CD2 1 
ATOM   5658 N  N   . ASN H  1 58 ? 4.437   16.149  38.918   1.00 29.11  ? 99  ASN H N   1 
ATOM   5659 C  CA  . ASN H  1 58 ? 4.005   17.415  38.333   1.00 30.29  ? 99  ASN H CA  1 
ATOM   5660 C  C   . ASN H  1 58 ? 5.021   17.915  37.331   1.00 20.62  ? 99  ASN H C   1 
ATOM   5661 O  O   . ASN H  1 58 ? 4.663   18.513  36.323   1.00 38.22  ? 99  ASN H O   1 
ATOM   5662 C  CB  . ASN H  1 58 ? 3.795   18.482  39.403   1.00 30.48  ? 99  ASN H CB  1 
ATOM   5663 C  CG  . ASN H  1 58 ? 2.504   18.281  40.183   1.00 29.97  ? 99  ASN H CG  1 
ATOM   5664 O  OD1 . ASN H  1 58 ? 1.563   17.641  39.707   1.00 30.13  ? 99  ASN H OD1 1 
ATOM   5665 N  ND2 . ASN H  1 58 ? 2.449   18.849  41.373   1.00 30.07  ? 99  ASN H ND2 1 
ATOM   5666 N  N   . SER H  1 59 ? 6.297   17.669  37.601   1.00 31.87  ? 100 SER H N   1 
ATOM   5667 C  CA  . SER H  1 59 ? 7.354   18.095  36.692   1.00 30.72  ? 100 SER H CA  1 
ATOM   5668 C  C   . SER H  1 59 ? 7.364   17.310  35.407   1.00 28.91  ? 100 SER H C   1 
ATOM   5669 O  O   . SER H  1 59 ? 7.722   17.835  34.350   1.00 40.82  ? 100 SER H O   1 
ATOM   5670 C  CB  . SER H  1 59 ? 8.711   17.954  37.356   1.00 32.25  ? 100 SER H CB  1 
ATOM   5671 O  OG  . SER H  1 59 ? 9.078   19.199  37.932   1.00 70.19  ? 100 SER H OG  1 
ATOM   5672 N  N   . ILE H  1 60 ? 6.999   16.036  35.504   1.00 35.25  ? 101 ILE H N   1 
ATOM   5673 C  CA  . ILE H  1 60 ? 6.960   15.184  34.336   1.00 21.56  ? 101 ILE H CA  1 
ATOM   5674 C  C   . ILE H  1 60 ? 5.792   15.620  33.461   1.00 17.87  ? 101 ILE H C   1 
ATOM   5675 O  O   . ILE H  1 60 ? 5.892   15.615  32.241   1.00 29.33  ? 101 ILE H O   1 
ATOM   5676 C  CB  . ILE H  1 60 ? 6.762   13.710  34.737   1.00 23.87  ? 101 ILE H CB  1 
ATOM   5677 C  CG1 . ILE H  1 60 ? 7.970   13.207  35.524   1.00 21.70  ? 101 ILE H CG1 1 
ATOM   5678 C  CG2 . ILE H  1 60 ? 6.623   12.859  33.505   1.00 18.98  ? 101 ILE H CG2 1 
ATOM   5679 C  CD1 . ILE H  1 60 ? 7.791   11.799  36.010   1.00 33.29  ? 101 ILE H CD1 1 
ATOM   5680 N  N   . PHE H  1 61 ? 4.684   15.983  34.104   1.00 21.59  ? 102 PHE H N   1 
ATOM   5681 C  CA  . PHE H  1 61 ? 3.472   16.420  33.410   1.00 25.98  ? 102 PHE H CA  1 
ATOM   5682 C  C   . PHE H  1 61 ? 3.749   17.645  32.528   1.00 21.00  ? 102 PHE H C   1 
ATOM   5683 O  O   . PHE H  1 61 ? 3.478   17.629  31.327   1.00 39.24  ? 102 PHE H O   1 
ATOM   5684 C  CB  . PHE H  1 61 ? 2.379   16.763  34.440   1.00 21.19  ? 102 PHE H CB  1 
ATOM   5685 C  CG  . PHE H  1 61 ? 0.979   16.665  33.906   1.00 22.59  ? 102 PHE H CG  1 
ATOM   5686 C  CD1 . PHE H  1 61 ? 0.738   16.538  32.538   1.00 21.09  ? 102 PHE H CD1 1 
ATOM   5687 C  CD2 . PHE H  1 61 ? -0.104  16.687  34.775   1.00 27.93  ? 102 PHE H CD2 1 
ATOM   5688 C  CE1 . PHE H  1 61 ? -0.560  16.431  32.041   1.00 31.48  ? 102 PHE H CE1 1 
ATOM   5689 C  CE2 . PHE H  1 61 ? -1.405  16.580  34.294   1.00 32.78  ? 102 PHE H CE2 1 
ATOM   5690 C  CZ  . PHE H  1 61 ? -1.635  16.451  32.917   1.00 15.06  ? 102 PHE H CZ  1 
ATOM   5691 N  N   . GLU H  1 62 ? 4.286   18.702  33.130   1.00 25.82  ? 103 GLU H N   1 
ATOM   5692 C  CA  . GLU H  1 62 ? 4.598   19.937  32.403   1.00 29.45  ? 103 GLU H CA  1 
ATOM   5693 C  C   . GLU H  1 62 ? 5.558   19.662  31.234   1.00 30.68  ? 103 GLU H C   1 
ATOM   5694 O  O   . GLU H  1 62 ? 5.456   20.270  30.169   1.00 37.52  ? 103 GLU H O   1 
ATOM   5695 C  CB  . GLU H  1 62 ? 5.250   20.954  33.352   1.00 23.92  ? 103 GLU H CB  1 
ATOM   5696 C  CG  . GLU H  1 62 ? 4.565   21.074  34.702   1.00 36.38  ? 103 GLU H CG  1 
ATOM   5697 C  CD  . GLU H  1 62 ? 5.364   21.879  35.717   1.00 57.54  ? 103 GLU H CD  1 
ATOM   5698 O  OE1 . GLU H  1 62 ? 5.054   21.780  36.925   1.00 73.80  ? 103 GLU H OE1 1 
ATOM   5699 O  OE2 . GLU H  1 62 ? 6.290   22.613  35.313   1.00 72.43  ? 103 GLU H OE2 1 
ATOM   5700 N  N   . ARG H  1 63 ? 6.482   18.731  31.430   1.00 29.58  ? 104 ARG H N   1 
ATOM   5701 C  CA  . ARG H  1 63 ? 7.456   18.409  30.399   1.00 30.76  ? 104 ARG H CA  1 
ATOM   5702 C  C   . ARG H  1 63 ? 6.800   17.748  29.192   1.00 24.13  ? 104 ARG H C   1 
ATOM   5703 O  O   . ARG H  1 63 ? 7.188   18.007  28.054   1.00 42.03  ? 104 ARG H O   1 
ATOM   5704 C  CB  . ARG H  1 63 ? 8.553   17.521  31.000   1.00 43.25  ? 104 ARG H CB  1 
ATOM   5705 C  CG  . ARG H  1 63 ? 9.683   17.136  30.062   1.00 57.81  ? 104 ARG H CG  1 
ATOM   5706 C  CD  . ARG H  1 63 ? 11.020  17.069  30.817   1.00 46.21  ? 104 ARG H CD  1 
ATOM   5707 N  NE  . ARG H  1 63 ? 10.972  16.221  32.011   1.00 41.92  ? 104 ARG H NE  1 
ATOM   5708 C  CZ  . ARG H  1 63 ? 10.877  14.892  31.994   1.00 32.89  ? 104 ARG H CZ  1 
ATOM   5709 N  NH1 . ARG H  1 63 ? 10.821  14.244  30.842   1.00 49.34  ? 104 ARG H NH1 1 
ATOM   5710 N  NH2 . ARG H  1 63 ? 10.835  14.203  33.126   1.00 34.78  ? 104 ARG H NH2 1 
ATOM   5711 N  N   . LYS H  1 64 ? 5.804   16.901  29.438   1.00 36.71  ? 105 LYS H N   1 
ATOM   5712 C  CA  . LYS H  1 64 ? 5.085   16.221  28.359   1.00 39.06  ? 105 LYS H CA  1 
ATOM   5713 C  C   . LYS H  1 64 ? 4.205   17.232  27.618   1.00 31.23  ? 105 LYS H C   1 
ATOM   5714 O  O   . LYS H  1 64 ? 4.086   17.196  26.385   1.00 27.58  ? 105 LYS H O   1 
ATOM   5715 C  CB  . LYS H  1 64 ? 4.213   15.097  28.931   1.00 33.94  ? 105 LYS H CB  1 
ATOM   5716 C  CG  . LYS H  1 64 ? 4.992   14.067  29.736   1.00 30.61  ? 105 LYS H CG  1 
ATOM   5717 C  CD  . LYS H  1 64 ? 6.065   13.391  28.894   1.00 30.13  ? 105 LYS H CD  1 
ATOM   5718 C  CE  . LYS H  1 64 ? 6.908   12.434  29.743   1.00 37.80  ? 105 LYS H CE  1 
ATOM   5719 N  NZ  . LYS H  1 64 ? 7.887   11.632  28.933   1.00 31.53  ? 105 LYS H NZ  1 
ATOM   5720 N  N   . ASN H  1 65 ? 3.591   18.138  28.376   1.00 31.87  ? 106 ASN H N   1 
ATOM   5721 C  CA  . ASN H  1 65 ? 2.739   19.167  27.784   1.00 36.74  ? 106 ASN H CA  1 
ATOM   5722 C  C   . ASN H  1 65 ? 3.527   20.097  26.858   1.00 27.32  ? 106 ASN H C   1 
ATOM   5723 O  O   . ASN H  1 65 ? 2.954   20.701  25.956   1.00 44.41  ? 106 ASN H O   1 
ATOM   5724 C  CB  . ASN H  1 65 ? 2.023   19.964  28.878   1.00 32.96  ? 106 ASN H CB  1 
ATOM   5725 C  CG  . ASN H  1 65 ? 0.908   19.164  29.535   1.00 37.11  ? 106 ASN H CG  1 
ATOM   5726 O  OD1 . ASN H  1 65 ? 0.471   18.141  29.000   1.00 25.70  ? 106 ASN H OD1 1 
ATOM   5727 N  ND2 . ASN H  1 65 ? 0.432   19.630  30.679   1.00 18.65  ? 106 ASN H ND2 1 
ATOM   5728 N  N   . LYS H  1 66 ? 4.841   20.201  27.069   1.00 32.39  ? 107 LYS H N   1 
ATOM   5729 C  CA  . LYS H  1 66 ? 5.679   21.027  26.200   1.00 27.43  ? 107 LYS H CA  1 
ATOM   5730 C  C   . LYS H  1 66 ? 5.856   20.313  24.874   1.00 28.90  ? 107 LYS H C   1 
ATOM   5731 O  O   . LYS H  1 66 ? 5.892   20.942  23.811   1.00 21.51  ? 107 LYS H O   1 
ATOM   5732 C  CB  . LYS H  1 66 ? 7.061   21.265  26.801   1.00 33.97  ? 107 LYS H CB  1 
ATOM   5733 C  CG  . LYS H  1 66 ? 7.078   22.249  27.938   1.00 48.33  ? 107 LYS H CG  1 
ATOM   5734 C  CD  . LYS H  1 66 ? 8.502   22.694  28.226   1.00 48.15  ? 107 LYS H CD  1 
ATOM   5735 C  CE  . LYS H  1 66 ? 8.687   23.079  29.697   1.00 61.78  ? 107 LYS H CE  1 
ATOM   5736 N  NZ  . LYS H  1 66 ? 8.523   21.908  30.626   1.00 64.34  ? 107 LYS H NZ  1 
ATOM   5737 N  N   . LYS H  1 67 ? 5.996   18.992  24.941   1.00 26.43  ? 108 LYS H N   1 
ATOM   5738 C  CA  . LYS H  1 67 ? 6.134   18.193  23.732   1.00 18.52  ? 108 LYS H CA  1 
ATOM   5739 C  C   . LYS H  1 67 ? 4.802   18.194  22.984   1.00 17.79  ? 108 LYS H C   1 
ATOM   5740 O  O   . LYS H  1 67 ? 4.765   18.326  21.759   1.00 21.35  ? 108 LYS H O   1 
ATOM   5741 C  CB  . LYS H  1 67 ? 6.484   16.746  24.079   1.00 38.29  ? 108 LYS H CB  1 
ATOM   5742 C  CG  . LYS H  1 67 ? 7.842   16.516  24.674   1.00 40.60  ? 108 LYS H CG  1 
ATOM   5743 C  CD  . LYS H  1 67 ? 7.967   15.030  24.989   1.00 58.66  ? 108 LYS H CD  1 
ATOM   5744 C  CE  . LYS H  1 67 ? 9.227   14.704  25.758   1.00 71.20  ? 108 LYS H CE  1 
ATOM   5745 N  NZ  . LYS H  1 67 ? 9.256   13.268  26.157   1.00 66.63  ? 108 LYS H NZ  1 
ATOM   5746 N  N   . LEU H  1 68 ? 3.708   18.012  23.727   1.00 22.75  ? 109 LEU H N   1 
ATOM   5747 C  CA  . LEU H  1 68 ? 2.380   18.003  23.114   1.00 23.13  ? 109 LEU H CA  1 
ATOM   5748 C  C   . LEU H  1 68 ? 2.143   19.337  22.405   1.00 26.41  ? 109 LEU H C   1 
ATOM   5749 O  O   . LEU H  1 68 ? 1.558   19.372  21.321   1.00 28.98  ? 109 LEU H O   1 
ATOM   5750 C  CB  . LEU H  1 68 ? 1.281   17.749  24.166   1.00 9.28   ? 109 LEU H CB  1 
ATOM   5751 C  CG  . LEU H  1 68 ? -0.126  17.777  23.549   1.00 18.20  ? 109 LEU H CG  1 
ATOM   5752 C  CD1 . LEU H  1 68 ? -0.124  16.954  22.273   1.00 26.34  ? 109 LEU H CD1 1 
ATOM   5753 C  CD2 . LEU H  1 68 ? -1.173  17.274  24.528   1.00 12.88  ? 109 LEU H CD2 1 
ATOM   5754 N  N   . LYS H  1 69 ? 2.609   20.430  23.015   1.00 23.12  ? 110 LYS H N   1 
ATOM   5755 C  CA  . LYS H  1 69 ? 2.473   21.752  22.403   1.00 31.46  ? 110 LYS H CA  1 
ATOM   5756 C  C   . LYS H  1 69 ? 3.260   21.825  21.101   1.00 32.74  ? 110 LYS H C   1 
ATOM   5757 O  O   . LYS H  1 69 ? 2.864   22.532  20.174   1.00 38.51  ? 110 LYS H O   1 
ATOM   5758 C  CB  . LYS H  1 69 ? 2.969   22.859  23.344   1.00 21.59  ? 110 LYS H CB  1 
ATOM   5759 C  CG  . LYS H  1 69 ? 2.013   23.223  24.465   1.00 32.35  ? 110 LYS H CG  1 
ATOM   5760 C  CD  . LYS H  1 69 ? 2.555   24.407  25.266   1.00 40.57  ? 110 LYS H CD  1 
ATOM   5761 C  CE  . LYS H  1 69 ? 1.632   24.777  26.412   1.00 47.04  ? 110 LYS H CE  1 
ATOM   5762 N  NZ  . LYS H  1 69 ? 0.286   25.222  25.944   1.00 70.74  ? 110 LYS H NZ  1 
ATOM   5763 N  N   . GLU H  1 70 ? 4.383   21.113  21.029   1.00 28.68  ? 111 GLU H N   1 
ATOM   5764 C  CA  . GLU H  1 70 ? 5.178   21.133  19.804   1.00 17.70  ? 111 GLU H CA  1 
ATOM   5765 C  C   . GLU H  1 70 ? 4.437   20.366  18.715   1.00 23.98  ? 111 GLU H C   1 
ATOM   5766 O  O   . GLU H  1 70 ? 4.361   20.796  17.558   1.00 27.14  ? 111 GLU H O   1 
ATOM   5767 C  CB  . GLU H  1 70 ? 6.543   20.480  20.017   1.00 33.28  ? 111 GLU H CB  1 
ATOM   5768 C  CG  . GLU H  1 70 ? 7.408   21.154  21.056   1.00 42.69  ? 111 GLU H CG  1 
ATOM   5769 C  CD  . GLU H  1 70 ? 8.818   20.578  21.107   1.00 53.01  ? 111 GLU H CD  1 
ATOM   5770 O  OE1 . GLU H  1 70 ? 9.353   20.183  20.041   1.00 59.34  ? 111 GLU H OE1 1 
ATOM   5771 O  OE2 . GLU H  1 70 ? 9.399   20.544  22.214   1.00 48.29  ? 111 GLU H OE2 1 
ATOM   5772 N  N   . LEU H  1 71 ? 3.886   19.219  19.090   1.00 30.93  ? 112 LEU H N   1 
ATOM   5773 C  CA  . LEU H  1 71 ? 3.159   18.395  18.134   1.00 33.47  ? 112 LEU H CA  1 
ATOM   5774 C  C   . LEU H  1 71 ? 1.972   19.127  17.522   1.00 25.15  ? 112 LEU H C   1 
ATOM   5775 O  O   . LEU H  1 71 ? 1.762   19.087  16.316   1.00 37.95  ? 112 LEU H O   1 
ATOM   5776 C  CB  . LEU H  1 71 ? 2.678   17.114  18.821   1.00 32.89  ? 112 LEU H CB  1 
ATOM   5777 C  CG  . LEU H  1 71 ? 3.025   15.793  18.139   1.00 46.14  ? 112 LEU H CG  1 
ATOM   5778 C  CD1 . LEU H  1 71 ? 4.512   15.760  17.824   1.00 36.77  ? 112 LEU H CD1 1 
ATOM   5779 C  CD2 . LEU H  1 71 ? 2.641   14.638  19.053   1.00 47.46  ? 112 LEU H CD2 1 
ATOM   5780 N  N   . GLU H  1 72 ? 1.191   19.802  18.359   1.00 42.19  ? 113 GLU H N   1 
ATOM   5781 C  CA  . GLU H  1 72 ? 0.016   20.510  17.864   1.00 36.98  ? 113 GLU H CA  1 
ATOM   5782 C  C   . GLU H  1 72 ? 0.462   21.535  16.832   1.00 27.22  ? 113 GLU H C   1 
ATOM   5783 O  O   . GLU H  1 72 ? -0.308  21.934  15.966   1.00 38.96  ? 113 GLU H O   1 
ATOM   5784 C  CB  . GLU H  1 72 ? -0.733  21.191  19.024   1.00 43.26  ? 113 GLU H CB  1 
ATOM   5785 C  CG  . GLU H  1 72 ? -0.200  22.552  19.436   1.00 37.76  ? 113 GLU H CG  1 
ATOM   5786 C  CD  . GLU H  1 72 ? -0.983  23.178  20.579   1.00 43.23  ? 113 GLU H CD  1 
ATOM   5787 O  OE1 . GLU H  1 72 ? -0.901  24.421  20.753   1.00 36.93  ? 113 GLU H OE1 1 
ATOM   5788 O  OE2 . GLU H  1 72 ? -1.677  22.427  21.307   1.00 22.34  ? 113 GLU H OE2 1 
ATOM   5789 N  N   . LYS H  1 73 ? 1.723   21.939  16.933   1.00 33.07  ? 114 LYS H N   1 
ATOM   5790 C  CA  . LYS H  1 73 ? 2.313   22.909  16.023   1.00 26.56  ? 114 LYS H CA  1 
ATOM   5791 C  C   . LYS H  1 73 ? 2.807   22.221  14.759   1.00 32.38  ? 114 LYS H C   1 
ATOM   5792 O  O   . LYS H  1 73 ? 2.706   22.779  13.669   1.00 25.48  ? 114 LYS H O   1 
ATOM   5793 C  CB  . LYS H  1 73 ? 3.481   23.635  16.708   1.00 38.87  ? 114 LYS H CB  1 
ATOM   5794 C  CG  . LYS H  1 73 ? 4.169   24.685  15.837   1.00 51.63  ? 114 LYS H CG  1 
ATOM   5795 C  CD  . LYS H  1 73 ? 5.093   25.587  16.651   1.00 63.74  ? 114 LYS H CD  1 
ATOM   5796 C  CE  . LYS H  1 73 ? 6.241   24.817  17.303   1.00 61.66  ? 114 LYS H CE  1 
ATOM   5797 N  NZ  . LYS H  1 73 ? 7.103   25.715  18.140   1.00 43.61  ? 114 LYS H NZ  1 
ATOM   5798 N  N   . ASP H  1 74 ? 3.342   21.010  14.913   1.00 30.73  ? 115 ASP H N   1 
ATOM   5799 C  CA  . ASP H  1 74 ? 3.851   20.253  13.777   1.00 18.48  ? 115 ASP H CA  1 
ATOM   5800 C  C   . ASP H  1 74 ? 2.738   19.770  12.865   1.00 15.47  ? 115 ASP H C   1 
ATOM   5801 O  O   . ASP H  1 74 ? 2.888   19.767  11.642   1.00 25.63  ? 115 ASP H O   1 
ATOM   5802 C  CB  . ASP H  1 74 ? 4.700   19.063  14.246   1.00 27.59  ? 115 ASP H CB  1 
ATOM   5803 C  CG  . ASP H  1 74 ? 6.038   19.493  14.850   1.00 25.17  ? 115 ASP H CG  1 
ATOM   5804 O  OD1 . ASP H  1 74 ? 6.519   20.607  14.555   1.00 39.64  ? 115 ASP H OD1 1 
ATOM   5805 O  OD2 . ASP H  1 74 ? 6.620   18.701  15.621   1.00 52.67  ? 115 ASP H OD2 1 
ATOM   5806 N  N   . TYR H  1 75 ? 1.614   19.378  13.451   1.00 20.99  ? 116 TYR H N   1 
ATOM   5807 C  CA  . TYR H  1 75 ? 0.479   18.908  12.662   1.00 22.57  ? 116 TYR H CA  1 
ATOM   5808 C  C   . TYR H  1 75 ? -0.223  20.051  11.909   1.00 29.16  ? 116 TYR H C   1 
ATOM   5809 O  O   . TYR H  1 75 ? -0.740  19.849  10.807   1.00 25.40  ? 116 TYR H O   1 
ATOM   5810 C  CB  . TYR H  1 75 ? -0.525  18.165  13.556   1.00 25.11  ? 116 TYR H CB  1 
ATOM   5811 C  CG  . TYR H  1 75 ? -0.107  16.750  13.952   1.00 23.76  ? 116 TYR H CG  1 
ATOM   5812 C  CD1 . TYR H  1 75 ? 0.051   15.750  12.994   1.00 23.94  ? 116 TYR H CD1 1 
ATOM   5813 C  CD2 . TYR H  1 75 ? 0.097   16.411  15.286   1.00 20.27  ? 116 TYR H CD2 1 
ATOM   5814 C  CE1 . TYR H  1 75 ? 0.398   14.449  13.361   1.00 23.24  ? 116 TYR H CE1 1 
ATOM   5815 C  CE2 . TYR H  1 75 ? 0.438   15.127  15.655   1.00 28.87  ? 116 TYR H CE2 1 
ATOM   5816 C  CZ  . TYR H  1 75 ? 0.589   14.151  14.694   1.00 27.98  ? 116 TYR H CZ  1 
ATOM   5817 O  OH  . TYR H  1 75 ? 0.950   12.884  15.081   1.00 22.80  ? 116 TYR H OH  1 
ATOM   5818 N  N   . SER H  1 76 ? -0.244  21.248  12.490   1.00 21.51  ? 117 SER H N   1 
ATOM   5819 C  CA  . SER H  1 76 ? -0.873  22.391  11.816   1.00 20.90  ? 117 SER H CA  1 
ATOM   5820 C  C   . SER H  1 76 ? -0.041  22.712  10.586   1.00 17.12  ? 117 SER H C   1 
ATOM   5821 O  O   . SER H  1 76 ? -0.568  22.876  9.480    1.00 31.88  ? 117 SER H O   1 
ATOM   5822 C  CB  . SER H  1 76 ? -0.911  23.612  12.732   1.00 27.34  ? 117 SER H CB  1 
ATOM   5823 O  OG  . SER H  1 76 ? -1.571  23.307  13.945   1.00 26.43  ? 117 SER H OG  1 
ATOM   5824 N  N   . GLU H  1 77 ? 1.271   22.785  10.783   1.00 28.88  ? 118 GLU H N   1 
ATOM   5825 C  CA  . GLU H  1 77 ? 2.184   23.073  9.685    1.00 15.83  ? 118 GLU H CA  1 
ATOM   5826 C  C   . GLU H  1 77 ? 2.061   22.002  8.618    1.00 27.41  ? 118 GLU H C   1 
ATOM   5827 O  O   . GLU H  1 77 ? 1.983   22.309  7.427    1.00 32.01  ? 118 GLU H O   1 
ATOM   5828 C  CB  . GLU H  1 77 ? 3.625   23.136  10.199   1.00 38.31  ? 118 GLU H CB  1 
ATOM   5829 C  CG  . GLU H  1 77 ? 4.671   22.901  9.110    1.00 63.90  ? 118 GLU H CG  1 
ATOM   5830 C  CD  . GLU H  1 77 ? 6.088   23.170  9.577    1.00 66.75  ? 118 GLU H CD  1 
ATOM   5831 O  OE1 . GLU H  1 77 ? 6.462   22.701  10.676   1.00 83.58  ? 118 GLU H OE1 1 
ATOM   5832 O  OE2 . GLU H  1 77 ? 6.832   23.846  8.834    1.00 84.62  ? 118 GLU H OE2 1 
ATOM   5833 N  N   . LEU H  1 78 ? 2.027   20.741  9.051    1.00 21.90  ? 119 LEU H N   1 
ATOM   5834 C  CA  . LEU H  1 78 ? 1.911   19.610  8.126    1.00 21.36  ? 119 LEU H CA  1 
ATOM   5835 C  C   . LEU H  1 78 ? 0.588   19.658  7.346    1.00 15.87  ? 119 LEU H C   1 
ATOM   5836 O  O   . LEU H  1 78 ? 0.558   19.445  6.132    1.00 28.82  ? 119 LEU H O   1 
ATOM   5837 C  CB  . LEU H  1 78 ? 2.034   18.281  8.902    1.00 23.16  ? 119 LEU H CB  1 
ATOM   5838 C  CG  . LEU H  1 78 ? 1.988   17.011  8.046    1.00 38.76  ? 119 LEU H CG  1 
ATOM   5839 C  CD1 . LEU H  1 78 ? 3.089   17.073  7.000    1.00 18.36  ? 119 LEU H CD1 1 
ATOM   5840 C  CD2 . LEU H  1 78 ? 2.163   15.769  8.924    1.00 26.33  ? 119 LEU H CD2 1 
ATOM   5841 N  N   . SER H  1 79 ? -0.506  19.951  8.044    1.00 24.80  ? 120 SER H N   1 
ATOM   5842 C  CA  . SER H  1 79 ? -1.809  20.034  7.391    1.00 15.86  ? 120 SER H CA  1 
ATOM   5843 C  C   . SER H  1 79 ? -1.820  21.186  6.390    1.00 19.88  ? 120 SER H C   1 
ATOM   5844 O  O   . SER H  1 79 ? -2.378  21.060  5.303    1.00 19.28  ? 120 SER H O   1 
ATOM   5845 C  CB  . SER H  1 79 ? -2.919  20.236  8.426    1.00 23.22  ? 120 SER H CB  1 
ATOM   5846 O  OG  . SER H  1 79 ? -4.189  20.339  7.787    1.00 34.11  ? 120 SER H OG  1 
ATOM   5847 N  N   . ASN H  1 80 ? -1.202  22.309  6.750    1.00 20.38  ? 121 ASN H N   1 
ATOM   5848 C  CA  . ASN H  1 80 ? -1.152  23.437  5.834    1.00 20.14  ? 121 ASN H CA  1 
ATOM   5849 C  C   . ASN H  1 80 ? -0.385  23.043  4.583    1.00 16.14  ? 121 ASN H C   1 
ATOM   5850 O  O   . ASN H  1 80 ? -0.794  23.386  3.470    1.00 31.70  ? 121 ASN H O   1 
ATOM   5851 C  CB  . ASN H  1 80 ? -0.494  24.669  6.485    1.00 22.78  ? 121 ASN H CB  1 
ATOM   5852 C  CG  . ASN H  1 80 ? -1.400  25.351  7.489    1.00 26.30  ? 121 ASN H CG  1 
ATOM   5853 O  OD1 . ASN H  1 80 ? -2.612  25.441  7.276    1.00 30.14  ? 121 ASN H OD1 1 
ATOM   5854 N  ND2 . ASN H  1 80 ? -0.819  25.847  8.590    1.00 29.09  ? 121 ASN H ND2 1 
ATOM   5855 N  N   . ARG H  1 81 ? 0.719   22.314  4.753    1.00 28.55  ? 122 ARG H N   1 
ATOM   5856 C  CA  . ARG H  1 81 ? 1.509   21.879  3.599    1.00 25.23  ? 122 ARG H CA  1 
ATOM   5857 C  C   . ARG H  1 81 ? 0.683   20.970  2.677    1.00 26.30  ? 122 ARG H C   1 
ATOM   5858 O  O   . ARG H  1 81 ? 0.765   21.071  1.436    1.00 28.45  ? 122 ARG H O   1 
ATOM   5859 C  CB  . ARG H  1 81 ? 2.800   21.185  4.067    1.00 26.76  ? 122 ARG H CB  1 
ATOM   5860 C  CG  . ARG H  1 81 ? 3.666   22.116  4.934    1.00 29.99  ? 122 ARG H CG  1 
ATOM   5861 C  CD  . ARG H  1 81 ? 4.973   21.497  5.417    1.00 24.46  ? 122 ARG H CD  1 
ATOM   5862 N  NE  . ARG H  1 81 ? 5.943   21.377  4.339    1.00 41.95  ? 122 ARG H NE  1 
ATOM   5863 C  CZ  . ARG H  1 81 ? 7.214   21.035  4.512    1.00 34.87  ? 122 ARG H CZ  1 
ATOM   5864 N  NH1 . ARG H  1 81 ? 7.688   20.773  5.723    1.00 23.75  ? 122 ARG H NH1 1 
ATOM   5865 N  NH2 . ARG H  1 81 ? 8.016   20.962  3.465    1.00 26.36  ? 122 ARG H NH2 1 
ATOM   5866 N  N   . TYR H  1 82 ? -0.118  20.085  3.267    1.00 28.23  ? 123 TYR H N   1 
ATOM   5867 C  CA  . TYR H  1 82 ? -0.973  19.209  2.457    1.00 30.91  ? 123 TYR H CA  1 
ATOM   5868 C  C   . TYR H  1 82 ? -2.035  20.051  1.743    1.00 23.62  ? 123 TYR H C   1 
ATOM   5869 O  O   . TYR H  1 82 ? -2.434  19.744  0.620    1.00 24.80  ? 123 TYR H O   1 
ATOM   5870 C  CB  . TYR H  1 82 ? -1.653  18.142  3.323    1.00 34.01  ? 123 TYR H CB  1 
ATOM   5871 C  CG  . TYR H  1 82 ? -0.809  16.901  3.575    1.00 30.02  ? 123 TYR H CG  1 
ATOM   5872 C  CD1 . TYR H  1 82 ? -0.447  16.046  2.531    1.00 37.47  ? 123 TYR H CD1 1 
ATOM   5873 C  CD2 . TYR H  1 82 ? -0.397  16.572  4.858    1.00 30.51  ? 123 TYR H CD2 1 
ATOM   5874 C  CE1 . TYR H  1 82 ? 0.302   14.892  2.777    1.00 40.07  ? 123 TYR H CE1 1 
ATOM   5875 C  CE2 . TYR H  1 82 ? 0.349   15.431  5.109    1.00 15.85  ? 123 TYR H CE2 1 
ATOM   5876 C  CZ  . TYR H  1 82 ? 0.693   14.596  4.078    1.00 25.48  ? 123 TYR H CZ  1 
ATOM   5877 O  OH  . TYR H  1 82 ? 1.409   13.459  4.370    1.00 25.21  ? 123 TYR H OH  1 
ATOM   5878 N  N   . ASN H  1 83 ? -2.498  21.123  2.380    1.00 25.15  ? 124 ASN H N   1 
ATOM   5879 C  CA  . ASN H  1 83 ? -3.489  21.963  1.714    1.00 27.23  ? 124 ASN H CA  1 
ATOM   5880 C  C   . ASN H  1 83 ? -2.829  22.635  0.502    1.00 21.15  ? 124 ASN H C   1 
ATOM   5881 O  O   . ASN H  1 83 ? -3.405  22.688  -0.597   1.00 25.92  ? 124 ASN H O   1 
ATOM   5882 C  CB  . ASN H  1 83 ? -4.062  23.008  2.687    1.00 38.66  ? 124 ASN H CB  1 
ATOM   5883 C  CG  . ASN H  1 83 ? -4.955  22.381  3.763    1.00 45.44  ? 124 ASN H CG  1 
ATOM   5884 O  OD1 . ASN H  1 83 ? -5.616  21.364  3.528    1.00 32.09  ? 124 ASN H OD1 1 
ATOM   5885 N  ND2 . ASN H  1 83 ? -4.988  23.000  4.941    1.00 29.65  ? 124 ASN H ND2 1 
ATOM   5886 N  N   . GLU H  1 84 ? -1.605  23.116  0.696    1.00 18.86  ? 125 GLU H N   1 
ATOM   5887 C  CA  . GLU H  1 84 ? -0.885  23.765  -0.386   1.00 17.43  ? 125 GLU H CA  1 
ATOM   5888 C  C   . GLU H  1 84 ? -0.678  22.807  -1.542   1.00 31.06  ? 125 GLU H C   1 
ATOM   5889 O  O   . GLU H  1 84 ? -0.980  23.124  -2.692   1.00 40.11  ? 125 GLU H O   1 
ATOM   5890 C  CB  . GLU H  1 84 ? 0.470   24.279  0.109    1.00 21.07  ? 125 GLU H CB  1 
ATOM   5891 C  CG  . GLU H  1 84 ? 0.392   25.470  1.068    1.00 41.61  ? 125 GLU H CG  1 
ATOM   5892 C  CD  . GLU H  1 84 ? -0.021  26.789  0.402    1.00 42.17  ? 125 GLU H CD  1 
ATOM   5893 O  OE1 . GLU H  1 84 ? -0.097  26.845  -0.849   1.00 23.49  ? 125 GLU H OE1 1 
ATOM   5894 O  OE2 . GLU H  1 84 ? -0.254  27.783  1.142    1.00 41.05  ? 125 GLU H OE2 1 
ATOM   5895 N  N   . GLN H  1 85 ? -0.162  21.625  -1.239   1.00 39.47  ? 126 GLN H N   1 
ATOM   5896 C  CA  . GLN H  1 85 ? 0.087   20.641  -2.285   1.00 31.08  ? 126 GLN H CA  1 
ATOM   5897 C  C   . GLN H  1 85 ? -1.163  20.321  -3.096   1.00 26.24  ? 126 GLN H C   1 
ATOM   5898 O  O   . GLN H  1 85 ? -1.082  20.027  -4.285   1.00 33.65  ? 126 GLN H O   1 
ATOM   5899 C  CB  . GLN H  1 85 ? 0.630   19.354  -1.682   1.00 36.34  ? 126 GLN H CB  1 
ATOM   5900 C  CG  . GLN H  1 85 ? 2.058   19.452  -1.196   1.00 35.40  ? 126 GLN H CG  1 
ATOM   5901 C  CD  . GLN H  1 85 ? 2.990   19.979  -2.259   1.00 38.58  ? 126 GLN H CD  1 
ATOM   5902 O  OE1 . GLN H  1 85 ? 3.150   21.187  -2.411   1.00 37.45  ? 126 GLN H OE1 1 
ATOM   5903 N  NE2 . GLN H  1 85 ? 3.604   19.073  -3.013   1.00 51.76  ? 126 GLN H NE2 1 
ATOM   5904 N  N   . LYS H  1 86 ? -2.318  20.382  -2.446   1.00 33.87  ? 127 LYS H N   1 
ATOM   5905 C  CA  . LYS H  1 86 ? -3.577  20.090  -3.101   1.00 21.44  ? 127 LYS H CA  1 
ATOM   5906 C  C   . LYS H  1 86 ? -3.992  21.214  -4.048   1.00 25.13  ? 127 LYS H C   1 
ATOM   5907 O  O   . LYS H  1 86 ? -4.687  20.972  -5.029   1.00 33.17  ? 127 LYS H O   1 
ATOM   5908 C  CB  . LYS H  1 86 ? -4.651  19.852  -2.038   1.00 34.66  ? 127 LYS H CB  1 
ATOM   5909 C  CG  . LYS H  1 86 ? -5.932  19.219  -2.569   1.00 38.69  ? 127 LYS H CG  1 
ATOM   5910 C  CD  . LYS H  1 86 ? -6.874  20.261  -3.131   1.00 49.66  ? 127 LYS H CD  1 
ATOM   5911 C  CE  . LYS H  1 86 ? -8.148  19.621  -3.617   1.00 40.41  ? 127 LYS H CE  1 
ATOM   5912 N  NZ  . LYS H  1 86 ? -9.162  20.657  -3.986   1.00 60.06  ? 127 LYS H NZ  1 
ATOM   5913 N  N   . GLU H  1 87 ? -3.568  22.441  -3.752   1.00 24.85  ? 128 GLU H N   1 
ATOM   5914 C  CA  . GLU H  1 87 ? -3.883  23.599  -4.592   1.00 21.72  ? 128 GLU H CA  1 
ATOM   5915 C  C   . GLU H  1 87 ? -3.097  23.508  -5.888   1.00 28.13  ? 128 GLU H C   1 
ATOM   5916 O  O   . GLU H  1 87 ? -3.604  23.827  -6.960   1.00 40.09  ? 128 GLU H O   1 
ATOM   5917 C  CB  . GLU H  1 87 ? -3.509  24.896  -3.865   1.00 24.89  ? 128 GLU H CB  1 
ATOM   5918 C  CG  . GLU H  1 87 ? -4.456  25.280  -2.733   1.00 35.18  ? 128 GLU H CG  1 
ATOM   5919 C  CD  . GLU H  1 87 ? -3.837  26.298  -1.787   1.00 44.27  ? 128 GLU H CD  1 
ATOM   5920 O  OE1 . GLU H  1 87 ? -3.361  27.353  -2.266   1.00 41.22  ? 128 GLU H OE1 1 
ATOM   5921 O  OE2 . GLU H  1 87 ? -3.822  26.037  -0.563   1.00 44.38  ? 128 GLU H OE2 1 
ATOM   5922 N  N   . LYS H  1 88 ? -1.846  23.076  -5.780   1.00 28.45  ? 129 LYS H N   1 
ATOM   5923 C  CA  . LYS H  1 88 ? -0.994  22.927  -6.952   1.00 33.13  ? 129 LYS H CA  1 
ATOM   5924 C  C   . LYS H  1 88 ? -1.553  21.818  -7.840   1.00 42.08  ? 129 LYS H C   1 
ATOM   5925 O  O   . LYS H  1 88 ? -1.358  21.831  -9.059   1.00 49.79  ? 129 LYS H O   1 
ATOM   5926 C  CB  . LYS H  1 88 ? 0.435   22.575  -6.539   1.00 40.15  ? 129 LYS H CB  1 
ATOM   5927 C  CG  . LYS H  1 88 ? 1.075   23.568  -5.595   1.00 39.17  ? 129 LYS H CG  1 
ATOM   5928 C  CD  . LYS H  1 88 ? 2.580   23.519  -5.720   1.00 45.49  ? 129 LYS H CD  1 
ATOM   5929 C  CE  . LYS H  1 88 ? 3.239   24.293  -4.607   1.00 35.78  ? 129 LYS H CE  1 
ATOM   5930 N  NZ  . LYS H  1 88 ? 3.200   23.522  -3.346   1.00 46.90  ? 129 LYS H NZ  1 
ATOM   5931 N  N   . MET H  1 89 ? -2.247  20.866  -7.215   1.00 37.18  ? 130 MET H N   1 
ATOM   5932 C  CA  . MET H  1 89 ? -2.857  19.740  -7.921   1.00 41.41  ? 130 MET H CA  1 
ATOM   5933 C  C   . MET H  1 89 ? -4.164  20.178  -8.586   1.00 46.91  ? 130 MET H C   1 
ATOM   5934 O  O   . MET H  1 89 ? -4.451  19.751  -9.715   1.00 43.21  ? 130 MET H O   1 
ATOM   5935 C  CB  . MET H  1 89 ? -3.084  18.576  -6.945   1.00 52.76  ? 130 MET H CB  1 
ATOM   5936 C  CG  . MET H  1 89 ? -3.831  17.373  -7.506   1.00 57.44  ? 130 MET H CG  1 
ATOM   5937 S  SD  . MET H  1 89 ? -3.155  16.641  -9.018   1.00 71.11  ? 130 MET H SD  1 
ATOM   5938 C  CE  . MET H  1 89 ? -1.454  16.378  -8.588   1.00 83.11  ? 130 MET H CE  1 
ATOM   5939 N  N   . ASP H  1 90 ? -4.949  21.023  -7.903   1.00 42.24  ? 131 ASP H N   1 
ATOM   5940 C  CA  . ASP H  1 90 ? -6.196  21.533  -8.508   1.00 46.71  ? 131 ASP H CA  1 
ATOM   5941 C  C   . ASP H  1 90 ? -5.766  22.259  -9.763   1.00 41.11  ? 131 ASP H C   1 
ATOM   5942 O  O   . ASP H  1 90 ? -6.251  22.004  -10.865  1.00 41.28  ? 131 ASP H O   1 
ATOM   5943 C  CB  . ASP H  1 90 ? -6.944  22.593  -7.652   1.00 39.93  ? 131 ASP H CB  1 
ATOM   5944 C  CG  . ASP H  1 90 ? -7.418  22.080  -6.293   1.00 64.09  ? 131 ASP H CG  1 
ATOM   5945 O  OD1 . ASP H  1 90 ? -7.983  20.966  -6.200   1.00 63.14  ? 131 ASP H OD1 1 
ATOM   5946 O  OD2 . ASP H  1 90 ? -7.252  22.839  -5.308   1.00 67.47  ? 131 ASP H OD2 1 
ATOM   5947 N  N   . GLN H  1 91 ? -4.868  23.212  -9.546   1.00 44.04  ? 132 GLN H N   1 
ATOM   5948 C  CA  . GLN H  1 91 ? -4.339  24.045  -10.622  1.00 49.96  ? 132 GLN H CA  1 
ATOM   5949 C  C   . GLN H  1 91 ? -3.682  23.260  -11.733  1.00 49.72  ? 132 GLN H C   1 
ATOM   5950 O  O   . GLN H  1 91 ? -3.782  23.615  -12.899  1.00 55.57  ? 132 GLN H O   1 
ATOM   5951 C  CB  . GLN H  1 91 ? -3.354  25.101  -10.062  1.00 45.02  ? 132 GLN H CB  1 
ATOM   5952 C  CG  . GLN H  1 91 ? -4.010  26.385  -9.515   1.00 56.01  ? 132 GLN H CG  1 
ATOM   5953 C  CD  . GLN H  1 91 ? -3.566  26.728  -8.082   1.00 56.90  ? 132 GLN H CD  1 
ATOM   5954 O  OE1 . GLN H  1 91 ? -4.436  26.877  -7.189   1.00 47.41  ? 132 GLN H OE1 1 
ATOM   5955 N  NE2 . GLN H  1 91 ? -2.226  26.823  -7.840   1.00 60.17  ? 132 GLN H NE2 1 
ATOM   5956 N  N   . LEU H  1 92 ? -3.033  22.165  -11.367  1.00 61.79  ? 133 LEU H N   1 
ATOM   5957 C  CA  . LEU H  1 92 ? -2.329  21.332  -12.346  1.00 65.46  ? 133 LEU H CA  1 
ATOM   5958 C  C   . LEU H  1 92 ? -3.210  20.756  -13.457  1.00 66.70  ? 133 LEU H C   1 
ATOM   5959 O  O   . LEU H  1 92 ? -2.712  20.345  -14.517  1.00 79.23  ? 133 LEU H O   1 
ATOM   5960 C  CB  . LEU H  1 92 ? -1.589  20.173  -11.649  1.00 68.10  ? 133 LEU H CB  1 
ATOM   5961 C  CG  . LEU H  1 92 ? -0.491  19.449  -12.451  1.00 60.15  ? 133 LEU H CG  1 
ATOM   5962 C  CD1 . LEU H  1 92 ? 0.505   20.477  -12.970  1.00 54.96  ? 133 LEU H CD1 1 
ATOM   5963 C  CD2 . LEU H  1 92 ? 0.220   18.424  -11.552  1.00 51.58  ? 133 LEU H CD2 1 
ATOM   5964 N  N   . SER H  1 93 ? -4.517  20.729  -13.222  1.00 70.68  ? 134 SER H N   1 
ATOM   5965 C  CA  . SER H  1 93 ? -5.450  20.206  -14.215  1.00 80.38  ? 134 SER H CA  1 
ATOM   5966 C  C   . SER H  1 93 ? -6.498  21.245  -14.603  1.00 80.48  ? 134 SER H C   1 
ATOM   5967 O  O   . SER H  1 93 ? -7.300  21.012  -15.499  1.00 78.02  ? 134 SER H O   1 
ATOM   5968 C  CB  . SER H  1 93 ? -6.164  18.974  -13.666  1.00 74.39  ? 134 SER H CB  1 
ATOM   5969 O  OG  . SER H  1 93 ? -7.149  19.347  -12.712  1.00 81.43  ? 134 SER H OG  1 
ATOM   5970 N  N   . LYS H  1 94 ? -6.467  22.389  -13.930  1.00 84.30  ? 135 LYS H N   1 
ATOM   5971 C  CA  . LYS H  1 94 ? -7.423  23.476  -14.136  1.00 95.36  ? 135 LYS H CA  1 
ATOM   5972 C  C   . LYS H  1 94 ? -7.654  24.062  -15.526  1.00 105.28 ? 135 LYS H C   1 
ATOM   5973 O  O   . LYS H  1 94 ? -6.829  23.936  -16.434  1.00 105.11 ? 135 LYS H O   1 
ATOM   5974 C  CB  . LYS H  1 94 ? -7.074  24.641  -13.211  1.00 91.35  ? 135 LYS H CB  1 
ATOM   5975 C  CG  . LYS H  1 94 ? -8.165  25.032  -12.239  1.00 81.14  ? 135 LYS H CG  1 
ATOM   5976 C  CD  . LYS H  1 94 ? -7.922  26.419  -11.663  1.00 86.24  ? 135 LYS H CD  1 
ATOM   5977 C  CE  . LYS H  1 94 ? -6.474  26.633  -11.233  1.00 91.03  ? 135 LYS H CE  1 
ATOM   5978 N  NZ  . LYS H  1 94 ? -5.560  26.989  -12.364  1.00 94.86  ? 135 LYS H NZ  1 
ATOM   5979 N  N   . LEU H  1 95 ? -8.803  24.734  -15.628  1.00 112.33 ? 136 LEU H N   1 
ATOM   5980 C  CA  . LEU H  1 95 ? -9.299  25.459  -16.802  1.00 117.13 ? 136 LEU H CA  1 
ATOM   5981 C  C   . LEU H  1 95 ? -9.070  24.887  -18.190  1.00 122.61 ? 136 LEU H C   1 
ATOM   5982 O  O   . LEU H  1 95 ? -8.082  24.157  -18.405  1.00 127.28 ? 136 LEU H O   1 
ATOM   5983 C  CB  . LEU H  1 95 ? -8.753  26.891  -16.787  1.00 114.66 ? 136 LEU H CB  1 
ATOM   5984 C  CG  . LEU H  1 95 ? -7.269  27.068  -17.135  1.00 114.66 ? 136 LEU H CG  1 
ATOM   5985 C  CD1 . LEU H  1 95 ? -7.078  28.407  -17.810  1.00 114.66 ? 136 LEU H CD1 1 
ATOM   5986 C  CD2 . LEU H  1 95 ? -6.398  26.970  -15.890  1.00 114.66 ? 136 LEU H CD2 1 
HETATM 5987 DY DY  A DY  I  2 .  ? -0.730  3.957   22.402   0.80 33.02  ? 201 DY  A DY  1 
HETATM 5988 DY DY  B DY  I  2 .  ? -0.829  3.889   20.981   0.20 18.41  ? 201 DY  A DY  1 
HETATM 5989 DY DY  . DY  J  2 .  ? -3.219  0.076   1.280    0.23 56.25  ? 202 DY  A DY  1 
HETATM 5990 DY DY  . DY  K  2 .  ? -10.029 -1.763  -16.605  0.16 71.36  ? 203 DY  A DY  1 
HETATM 5991 DY DY  . DY  L  2 .  ? -12.367 -3.916  6.516    0.26 71.52  ? 204 DY  A DY  1 
HETATM 5992 S  S   . SO4 M  3 .  ? 0.162   2.333   11.144   1.00 76.37  ? 205 SO4 A S   1 
HETATM 5993 O  O1  . SO4 M  3 .  ? 0.641   1.950   9.803    1.00 72.57  ? 205 SO4 A O1  1 
HETATM 5994 O  O2  . SO4 M  3 .  ? -1.270  2.683   11.080   1.00 74.14  ? 205 SO4 A O2  1 
HETATM 5995 O  O3  . SO4 M  3 .  ? 0.936   3.494   11.640   1.00 61.82  ? 205 SO4 A O3  1 
HETATM 5996 O  O4  . SO4 M  3 .  ? 0.342   1.190   12.058   1.00 74.29  ? 205 SO4 A O4  1 
HETATM 5997 S  S   . SO4 N  3 .  ? -14.369 -5.177  16.154   1.00 91.34  ? 206 SO4 A S   1 
HETATM 5998 O  O1  . SO4 N  3 .  ? -14.060 -6.286  15.230   1.00 93.77  ? 206 SO4 A O1  1 
HETATM 5999 O  O2  . SO4 N  3 .  ? -13.753 -3.939  15.634   1.00 94.90  ? 206 SO4 A O2  1 
HETATM 6000 O  O3  . SO4 N  3 .  ? -15.830 -4.998  16.248   1.00 90.50  ? 206 SO4 A O3  1 
HETATM 6001 O  O4  . SO4 N  3 .  ? -13.833 -5.474  17.494   1.00 83.98  ? 206 SO4 A O4  1 
HETATM 6002 S  S   . SO4 O  3 .  ? -9.372  -3.518  26.676   1.00 144.22 ? 207 SO4 A S   1 
HETATM 6003 O  O1  . SO4 O  3 .  ? -9.862  -4.905  26.784   1.00 145.86 ? 207 SO4 A O1  1 
HETATM 6004 O  O2  . SO4 O  3 .  ? -9.737  -2.966  25.357   1.00 144.52 ? 207 SO4 A O2  1 
HETATM 6005 O  O3  . SO4 O  3 .  ? -7.905  -3.513  26.826   1.00 146.61 ? 207 SO4 A O3  1 
HETATM 6006 O  O4  . SO4 O  3 .  ? -9.977  -2.693  27.741   1.00 144.47 ? 207 SO4 A O4  1 
HETATM 6007 S  S   . SO4 P  3 .  ? 10.313  1.000   28.675   1.00 134.82 ? 208 SO4 A S   1 
HETATM 6008 O  O1  . SO4 P  3 .  ? 11.577  0.544   28.066   1.00 131.42 ? 208 SO4 A O1  1 
HETATM 6009 O  O2  . SO4 P  3 .  ? 9.619   1.916   27.749   1.00 131.25 ? 208 SO4 A O2  1 
HETATM 6010 O  O3  . SO4 P  3 .  ? 9.452   -0.166  28.953   1.00 134.54 ? 208 SO4 A O3  1 
HETATM 6011 O  O4  . SO4 P  3 .  ? 10.600  1.707   29.937   1.00 133.86 ? 208 SO4 A O4  1 
HETATM 6012 S  S   . SO4 Q  3 .  ? -10.968 -8.205  2.127    1.00 117.77 ? 209 SO4 A S   1 
HETATM 6013 O  O1  . SO4 Q  3 .  ? -10.715 -7.120  1.163    1.00 110.26 ? 209 SO4 A O1  1 
HETATM 6014 O  O2  . SO4 Q  3 .  ? -11.123 -9.475  1.390    1.00 110.28 ? 209 SO4 A O2  1 
HETATM 6015 O  O3  . SO4 Q  3 .  ? -12.199 -7.908  2.889    1.00 115.58 ? 209 SO4 A O3  1 
HETATM 6016 O  O4  . SO4 Q  3 .  ? -9.833  -8.310  3.064    1.00 117.46 ? 209 SO4 A O4  1 
HETATM 6017 S  S   . SO4 R  3 .  ? 4.188   -22.601 -70.750  1.00 161.13 ? 210 SO4 A S   1 
HETATM 6018 O  O1  . SO4 R  3 .  ? 5.138   -23.577 -71.318  1.00 160.56 ? 210 SO4 A O1  1 
HETATM 6019 O  O2  . SO4 R  3 .  ? 3.334   -22.064 -71.826  1.00 160.28 ? 210 SO4 A O2  1 
HETATM 6020 O  O3  . SO4 R  3 .  ? 3.346   -23.266 -69.737  1.00 159.67 ? 210 SO4 A O3  1 
HETATM 6021 O  O4  . SO4 R  3 .  ? 4.937   -21.498 -70.119  1.00 160.51 ? 210 SO4 A O4  1 
HETATM 6022 PT PT  . PT  S  4 .  ? 0.608   -8.819  27.128   0.26 105.53 ? 211 PT  A PT  1 
HETATM 6023 S  S1  . DTT T  5 .  ? -5.384  1.580   17.923   1.00 90.25  ? 212 DTT A S1  1 
HETATM 6024 C  C1  . DTT T  5 .  ? -3.677  1.414   18.572   1.00 88.66  ? 212 DTT A C1  1 
HETATM 6025 C  C2  . DTT T  5 .  ? -2.603  1.848   17.484   1.00 89.82  ? 212 DTT A C2  1 
HETATM 6026 O  O2  . DTT T  5 .  ? -2.785  1.150   16.323   1.00 87.71  ? 212 DTT A O2  1 
HETATM 6027 C  C3  . DTT T  5 .  ? -1.124  1.571   17.928   1.00 87.71  ? 212 DTT A C3  1 
HETATM 6028 O  O3  . DTT T  5 .  ? -1.098  0.115   17.741   1.00 97.83  ? 212 DTT A O3  1 
HETATM 6029 C  C4  . DTT T  5 .  ? -0.141  2.081   16.857   1.00 86.78  ? 212 DTT A C4  1 
HETATM 6030 S  S4  . DTT T  5 .  ? 1.508   1.764   17.450   1.00 84.10  ? 212 DTT A S4  1 
HETATM 6031 DY DY  . DY  U  2 .  ? 8.505   7.164   27.403   0.33 63.43  ? 201 DY  B DY  1 
HETATM 6032 DY DY  . DY  V  2 .  ? 6.999   6.115   4.385    0.20 72.96  ? 202 DY  B DY  1 
HETATM 6033 DY DY  . DY  W  2 .  ? -2.306  0.176   43.311   0.25 67.01  ? 203 DY  B DY  1 
HETATM 6034 S  S   . SO4 X  3 .  ? 11.331  8.880   37.612   1.00 126.21 ? 204 SO4 B S   1 
HETATM 6035 O  O1  . SO4 X  3 .  ? 10.450  7.709   37.785   1.00 123.83 ? 204 SO4 B O1  1 
HETATM 6036 O  O2  . SO4 X  3 .  ? 11.175  9.416   36.247   1.00 122.48 ? 204 SO4 B O2  1 
HETATM 6037 O  O3  . SO4 X  3 .  ? 12.734  8.472   37.820   1.00 127.47 ? 204 SO4 B O3  1 
HETATM 6038 O  O4  . SO4 X  3 .  ? 10.970  9.924   38.591   1.00 124.74 ? 204 SO4 B O4  1 
HETATM 6039 S  S   . SO4 Y  3 .  ? 10.657  18.846  11.496   1.00 87.97  ? 205 SO4 B S   1 
HETATM 6040 O  O1  . SO4 Y  3 .  ? 11.147  17.959  10.420   1.00 84.57  ? 205 SO4 B O1  1 
HETATM 6041 O  O2  . SO4 Y  3 .  ? 9.201   19.044  11.336   1.00 87.50  ? 205 SO4 B O2  1 
HETATM 6042 O  O3  . SO4 Y  3 .  ? 10.933  18.238  12.814   1.00 83.72  ? 205 SO4 B O3  1 
HETATM 6043 O  O4  . SO4 Y  3 .  ? 11.341  20.151  11.409   1.00 84.75  ? 205 SO4 B O4  1 
HETATM 6044 S  S   . SO4 Z  3 .  ? 11.248  19.533  5.185    1.00 83.94  ? 206 SO4 B S   1 
HETATM 6045 O  O1  . SO4 Z  3 .  ? 11.624  20.798  4.516    1.00 87.29  ? 206 SO4 B O1  1 
HETATM 6046 O  O2  . SO4 Z  3 .  ? 10.328  18.784  4.308    1.00 81.46  ? 206 SO4 B O2  1 
HETATM 6047 O  O3  . SO4 Z  3 .  ? 10.585  19.822  6.474    1.00 75.18  ? 206 SO4 B O3  1 
HETATM 6048 O  O4  . SO4 Z  3 .  ? 12.457  18.726  5.434    1.00 78.72  ? 206 SO4 B O4  1 
HETATM 6049 S  S   . SO4 AA 3 .  ? 6.355   8.699   32.537   1.00 121.93 ? 207 SO4 B S   1 
HETATM 6050 O  O1  . SO4 AA 3 .  ? 7.538   7.894   32.176   1.00 123.62 ? 207 SO4 B O1  1 
HETATM 6051 O  O2  . SO4 AA 3 .  ? 6.376   9.977   31.797   1.00 121.89 ? 207 SO4 B O2  1 
HETATM 6052 O  O3  . SO4 AA 3 .  ? 6.365   8.967   33.988   1.00 124.05 ? 207 SO4 B O3  1 
HETATM 6053 O  O4  . SO4 AA 3 .  ? 5.135   7.954   32.187   1.00 124.49 ? 207 SO4 B O4  1 
HETATM 6054 PT PT  . PT  BA 4 .  ? -3.352  12.391  47.295   0.22 106.96 ? 208 PT  B PT  1 
HETATM 6055 C  C1  . EDO CA 6 .  ? 11.313  11.530  -0.617   1.00 63.72  ? 209 EDO B C1  1 
HETATM 6056 O  O1  . EDO CA 6 .  ? 11.599  12.868  -1.030   1.00 68.45  ? 209 EDO B O1  1 
HETATM 6057 C  C2  . EDO CA 6 .  ? 11.678  11.351  0.859    1.00 73.44  ? 209 EDO B C2  1 
HETATM 6058 O  O2  . EDO CA 6 .  ? 10.956  12.294  1.659    1.00 64.23  ? 209 EDO B O2  1 
HETATM 6059 DY DY  A DY  DA 2 .  ? -2.437  -24.610 22.517   0.80 35.39  ? 201 DY  C DY  1 
HETATM 6060 DY DY  B DY  DA 2 .  ? -2.812  -24.625 21.273   0.20 18.22  ? 201 DY  C DY  1 
HETATM 6061 DY DY  A DY  EA 2 .  ? -2.490  -20.822 -0.761   0.80 32.01  ? 202 DY  C DY  1 
HETATM 6062 DY DY  B DY  EA 2 .  ? -2.590  -21.013 0.626    0.20 17.44  ? 202 DY  C DY  1 
HETATM 6063 DY DY  . DY  FA 2 .  ? 8.676   -17.347 6.321    0.30 70.24  ? 203 DY  C DY  1 
HETATM 6064 S  S   . SO4 GA 3 .  ? 11.400  -5.089  -15.482  1.00 110.83 ? 204 SO4 C S   1 
HETATM 6065 O  O1  . SO4 GA 3 .  ? 12.130  -3.815  -15.639  1.00 112.67 ? 204 SO4 C O1  1 
HETATM 6066 O  O2  . SO4 GA 3 .  ? 11.099  -5.649  -16.813  1.00 108.59 ? 204 SO4 C O2  1 
HETATM 6067 O  O3  . SO4 GA 3 .  ? 10.140  -4.852  -14.753  1.00 112.85 ? 204 SO4 C O3  1 
HETATM 6068 O  O4  . SO4 GA 3 .  ? 12.228  -6.041  -14.718  1.00 110.71 ? 204 SO4 C O4  1 
HETATM 6069 S  S   . SO4 HA 3 .  ? 11.394  -15.605 16.723   1.00 122.22 ? 205 SO4 C S   1 
HETATM 6070 O  O1  . SO4 HA 3 .  ? 12.821  -15.900 16.488   1.00 122.37 ? 205 SO4 C O1  1 
HETATM 6071 O  O2  . SO4 HA 3 .  ? 10.718  -15.374 15.431   1.00 119.15 ? 205 SO4 C O2  1 
HETATM 6072 O  O3  . SO4 HA 3 .  ? 10.767  -16.751 17.409   1.00 122.83 ? 205 SO4 C O3  1 
HETATM 6073 O  O4  . SO4 HA 3 .  ? 11.274  -14.399 17.565   1.00 123.40 ? 205 SO4 C O4  1 
HETATM 6074 S  S   . SO4 IA 3 .  ? 3.408   -27.607 -9.761   1.00 118.53 ? 206 SO4 C S   1 
HETATM 6075 O  O1  . SO4 IA 3 .  ? 4.101   -26.738 -10.733  1.00 115.27 ? 206 SO4 C O1  1 
HETATM 6076 O  O2  . SO4 IA 3 .  ? 3.757   -29.017 -10.013  1.00 117.66 ? 206 SO4 C O2  1 
HETATM 6077 O  O3  . SO4 IA 3 .  ? 1.949   -27.429 -9.895   1.00 117.24 ? 206 SO4 C O3  1 
HETATM 6078 O  O4  . SO4 IA 3 .  ? 3.831   -27.243 -8.396   1.00 121.32 ? 206 SO4 C O4  1 
HETATM 6079 S  S   . SO4 JA 3 .  ? 10.580  -5.667  -9.017   1.00 85.88  ? 207 SO4 C S   1 
HETATM 6080 O  O1  . SO4 JA 3 .  ? 11.275  -4.373  -9.174   1.00 87.76  ? 207 SO4 C O1  1 
HETATM 6081 O  O2  . SO4 JA 3 .  ? 10.828  -6.513  -10.199  1.00 79.89  ? 207 SO4 C O2  1 
HETATM 6082 O  O3  . SO4 JA 3 .  ? 9.133   -5.426  -8.891   1.00 88.92  ? 207 SO4 C O3  1 
HETATM 6083 O  O4  . SO4 JA 3 .  ? 11.072  -6.347  -7.800   1.00 82.27  ? 207 SO4 C O4  1 
HETATM 6084 S  S   . SO4 KA 3 .  ? 12.064  -9.635  -6.176   1.00 111.62 ? 208 SO4 C S   1 
HETATM 6085 O  O1  . SO4 KA 3 .  ? 13.503  -9.788  -6.411   1.00 104.52 ? 208 SO4 C O1  1 
HETATM 6086 O  O2  . SO4 KA 3 .  ? 11.355  -9.603  -7.459   1.00 106.28 ? 208 SO4 C O2  1 
HETATM 6087 O  O3  . SO4 KA 3 .  ? 11.585  -10.779 -5.397   1.00 107.58 ? 208 SO4 C O3  1 
HETATM 6088 O  O4  . SO4 KA 3 .  ? 11.813  -8.381  -5.451   1.00 105.40 ? 208 SO4 C O4  1 
HETATM 6089 S  S   . SO4 LA 3 .  ? 14.257  -14.790 -9.130   1.00 95.58  ? 209 SO4 C S   1 
HETATM 6090 O  O1  . SO4 LA 3 .  ? 15.047  -14.131 -10.178  1.00 92.91  ? 209 SO4 C O1  1 
HETATM 6091 O  O2  . SO4 LA 3 .  ? 12.860  -14.838 -9.563   1.00 93.76  ? 209 SO4 C O2  1 
HETATM 6092 O  O3  . SO4 LA 3 .  ? 14.745  -16.162 -8.915   1.00 88.27  ? 209 SO4 C O3  1 
HETATM 6093 O  O4  . SO4 LA 3 .  ? 14.349  -14.022 -7.879   1.00 89.14  ? 209 SO4 C O4  1 
HETATM 6094 S  S   . SO4 MA 3 .  ? -9.444  -29.366 32.588   1.00 84.78  ? 210 SO4 C S   1 
HETATM 6095 O  O1  . SO4 MA 3 .  ? -8.046  -29.537 32.189   1.00 80.88  ? 210 SO4 C O1  1 
HETATM 6096 O  O2  . SO4 MA 3 .  ? -10.048 -28.296 31.781   1.00 78.68  ? 210 SO4 C O2  1 
HETATM 6097 O  O3  . SO4 MA 3 .  ? -10.151 -30.636 32.366   1.00 81.76  ? 210 SO4 C O3  1 
HETATM 6098 O  O4  . SO4 MA 3 .  ? -9.508  -29.006 34.014   1.00 74.13  ? 210 SO4 C O4  1 
HETATM 6099 PT PT  . PT  NA 4 .  ? -3.411  -11.703 27.041   0.35 112.96 ? 211 PT  C PT  1 
HETATM 6100 C  C1  . IPA OA 7 .  ? -4.122  -23.929 11.516   1.00 54.08  ? 212 IPA C C1  1 
HETATM 6101 C  C2  . IPA OA 7 .  ? -3.546  -22.899 10.527   1.00 62.42  ? 212 IPA C C2  1 
HETATM 6102 C  C3  . IPA OA 7 .  ? -4.358  -21.598 10.580   1.00 44.40  ? 212 IPA C C3  1 
HETATM 6103 O  O2  . IPA OA 7 .  ? -2.192  -22.616 10.882   1.00 68.07  ? 212 IPA C O2  1 
HETATM 6104 DY DY  . DY  PA 2 .  ? -12.011 21.531  27.349   0.37 83.92  ? 201 DY  D DY  1 
HETATM 6105 DY DY  . DY  QA 2 .  ? -0.732  28.656  43.144   0.22 56.87  ? 202 DY  D DY  1 
HETATM 6106 DY DY  . DY  RA 2 .  ? -10.309 23.174  4.854    0.10 33.83  ? 203 DY  D DY  1 
HETATM 6107 S  S   . SO4 SA 3 .  ? -14.515 19.771  37.309   1.00 107.72 ? 204 SO4 D S   1 
HETATM 6108 O  O1  . SO4 SA 3 .  ? -13.950 19.010  36.178   1.00 108.94 ? 204 SO4 D O1  1 
HETATM 6109 O  O2  . SO4 SA 3 .  ? -15.949 20.023  37.063   1.00 108.79 ? 204 SO4 D O2  1 
HETATM 6110 O  O3  . SO4 SA 3 .  ? -14.352 18.989  38.546   1.00 104.80 ? 204 SO4 D O3  1 
HETATM 6111 O  O4  . SO4 SA 3 .  ? -13.808 21.060  37.448   1.00 106.75 ? 204 SO4 D O4  1 
HETATM 6112 S  S   . SO4 TA 3 .  ? -9.420  21.017  47.485   1.00 112.75 ? 205 SO4 D S   1 
HETATM 6113 O  O1  . SO4 TA 3 .  ? -8.524  21.788  46.604   1.00 116.17 ? 205 SO4 D O1  1 
HETATM 6114 O  O2  . SO4 TA 3 .  ? -10.752 20.923  46.857   1.00 115.41 ? 205 SO4 D O2  1 
HETATM 6115 O  O3  . SO4 TA 3 .  ? -8.867  19.663  47.681   1.00 113.46 ? 205 SO4 D O3  1 
HETATM 6116 O  O4  . SO4 TA 3 .  ? -9.533  21.698  48.790   1.00 112.12 ? 205 SO4 D O4  1 
HETATM 6117 PT PT  . PT  UA 4 .  ? -3.255  16.378  -4.683   0.25 105.63 ? 206 PT  D PT  1 
HETATM 6118 C  C1  . EDO VA 6 .  ? -14.616 15.542  0.189    1.00 76.81  ? 207 EDO D C1  1 
HETATM 6119 O  O1  . EDO VA 6 .  ? -14.537 16.025  -1.151   1.00 77.13  ? 207 EDO D O1  1 
HETATM 6120 C  C2  . EDO VA 6 .  ? -14.488 16.712  1.162    1.00 76.50  ? 207 EDO D C2  1 
HETATM 6121 O  O2  . EDO VA 6 .  ? -14.630 16.234  2.503    1.00 72.33  ? 207 EDO D O2  1 
HETATM 6122 C  C1  . EDO WA 6 .  ? -14.515 9.990   10.915   1.00 52.39  ? 208 EDO D C1  1 
HETATM 6123 O  O1  . EDO WA 6 .  ? -13.583 10.523  9.970    1.00 63.36  ? 208 EDO D O1  1 
HETATM 6124 C  C2  . EDO WA 6 .  ? -13.834 9.837   12.271   1.00 48.67  ? 208 EDO D C2  1 
HETATM 6125 O  O2  . EDO WA 6 .  ? -14.326 10.837  13.167   1.00 53.49  ? 208 EDO D O2  1 
HETATM 6126 C  C1  . IPA XA 7 .  ? -12.228 10.106  -0.518   1.00 67.16  ? 209 IPA D C1  1 
HETATM 6127 C  C2  . IPA XA 7 .  ? -11.230 9.408   0.409    1.00 65.06  ? 209 IPA D C2  1 
HETATM 6128 C  C3  . IPA XA 7 .  ? -9.817  9.532   -0.147   1.00 62.92  ? 209 IPA D C3  1 
HETATM 6129 O  O2  . IPA XA 7 .  ? -11.273 10.028  1.686    1.00 65.36  ? 209 IPA D O2  1 
HETATM 6130 DY DY  A DY  YA 2 .  ? -0.750  0.176   -0.738   0.80 29.05  ? 201 DY  E DY  1 
HETATM 6131 DY DY  B DY  YA 2 .  ? -0.470  0.416   0.768    0.20 13.21  ? 201 DY  E DY  1 
HETATM 6132 DY DY  . DY  ZA 2 .  ? -3.160  4.029   19.950   0.30 85.71  ? 202 DY  E DY  1 
HETATM 6133 DY DY  . DY  AB 2 .  ? -11.884 7.787   15.002   0.28 79.64  ? 203 DY  E DY  1 
HETATM 6134 DY DY  . DY  BB 2 .  ? -8.843  3.603   12.265   0.18 61.44  ? 204 DY  E DY  1 
HETATM 6135 DY DY  . DY  CB 2 .  ? -10.367 5.796   37.957   0.21 71.06  ? 205 DY  E DY  1 
HETATM 6136 S  S   . SO4 DB 3 .  ? -14.291 9.162   5.773    1.00 100.34 ? 206 SO4 E S   1 
HETATM 6137 O  O1  . SO4 DB 3 .  ? -14.034 10.239  4.801    1.00 96.15  ? 206 SO4 E O1  1 
HETATM 6138 O  O2  . SO4 DB 3 .  ? -13.680 7.906   5.295    1.00 102.57 ? 206 SO4 E O2  1 
HETATM 6139 O  O3  . SO4 DB 3 .  ? -15.747 8.974   5.912    1.00 106.63 ? 206 SO4 E O3  1 
HETATM 6140 O  O4  . SO4 DB 3 .  ? -13.713 9.516   7.086    1.00 97.80  ? 206 SO4 E O4  1 
HETATM 6141 PT PT  . PT  EB 4 .  ? 0.009   12.519  -5.008   0.28 88.06  ? 207 PT  E PT  1 
HETATM 6142 C  C1  . EDO FB 6 .  ? -9.985  9.286   9.132    1.00 55.60  ? 208 EDO E C1  1 
HETATM 6143 O  O1  . EDO FB 6 .  ? -9.634  8.049   8.516    1.00 50.00  ? 208 EDO E O1  1 
HETATM 6144 C  C2  . EDO FB 6 .  ? -8.962  9.626   10.212   1.00 35.40  ? 208 EDO E C2  1 
HETATM 6145 O  O2  . EDO FB 6 .  ? -9.152  8.768   11.325   1.00 42.98  ? 208 EDO E O2  1 
HETATM 6146 C  C1  . EDO GB 6 .  ? -14.792 11.197  42.434   1.00 74.95  ? 209 EDO E C1  1 
HETATM 6147 O  O1  . EDO GB 6 .  ? -15.027 10.958  41.042   1.00 82.29  ? 209 EDO E O1  1 
HETATM 6148 C  C2  . EDO GB 6 .  ? -14.327 12.641  42.635   1.00 74.15  ? 209 EDO E C2  1 
HETATM 6149 O  O2  . EDO GB 6 .  ? -14.426 12.989  44.019   1.00 53.74  ? 209 EDO E O2  1 
HETATM 6150 C  C1  . IPA HB 7 .  ? -16.421 18.411  40.692   1.00 66.25  ? 210 IPA E C1  1 
HETATM 6151 C  C2  . IPA HB 7 .  ? -16.269 16.895  40.887   1.00 74.61  ? 210 IPA E C2  1 
HETATM 6152 C  C3  . IPA HB 7 .  ? -17.418 16.375  41.740   1.00 70.62  ? 210 IPA E C3  1 
HETATM 6153 O  O2  . IPA HB 7 .  ? -16.301 16.232  39.613   1.00 64.10  ? 210 IPA E O2  1 
HETATM 6154 DY DY  . DY  IB 2 .  ? 8.601   -2.774  -6.083   0.48 94.34  ? 201 DY  F DY  1 
HETATM 6155 DY DY  . DY  JB 2 .  ? -2.405  4.039   -21.412  0.26 64.73  ? 202 DY  F DY  1 
HETATM 6156 DY DY  . DY  KB 2 .  ? 6.789   -1.435  17.051   0.10 58.70  ? 203 DY  F DY  1 
HETATM 6157 S  S   . SO4 LB 3 .  ? 6.375   -3.808  -25.273  1.00 118.44 ? 204 SO4 F S   1 
HETATM 6158 O  O1  . SO4 LB 3 .  ? 6.498   -2.992  -26.496  1.00 119.63 ? 204 SO4 F O1  1 
HETATM 6159 O  O2  . SO4 LB 3 .  ? 7.284   -4.965  -25.361  1.00 125.15 ? 204 SO4 F O2  1 
HETATM 6160 O  O3  . SO4 LB 3 .  ? 4.984   -4.283  -25.141  1.00 118.05 ? 204 SO4 F O3  1 
HETATM 6161 O  O4  . SO4 LB 3 .  ? 6.737   -2.994  -24.097  1.00 119.05 ? 204 SO4 F O4  1 
HETATM 6162 C  C1  . EDO MB 6 .  ? 10.655  -9.810  15.509   1.00 49.23  ? 205 EDO F C1  1 
HETATM 6163 O  O1  . EDO MB 6 .  ? 10.933  -9.540  16.873   1.00 34.98  ? 205 EDO F O1  1 
HETATM 6164 C  C2  . EDO MB 6 .  ? 11.278  -8.740  14.607   1.00 54.70  ? 205 EDO F C2  1 
HETATM 6165 O  O2  . EDO MB 6 .  ? 12.685  -8.635  14.860   1.00 61.64  ? 205 EDO F O2  1 
HETATM 6166 C  C1  . IPA NB 7 .  ? 11.290  -9.325  20.423   1.00 51.87  ? 206 IPA F C1  1 
HETATM 6167 C  C2  . IPA NB 7 .  ? 11.676  -8.020  21.105   1.00 66.51  ? 206 IPA F C2  1 
HETATM 6168 C  C3  . IPA NB 7 .  ? 10.959  -6.857  20.409   1.00 50.09  ? 206 IPA F C3  1 
HETATM 6169 O  O2  . IPA NB 7 .  ? 11.292  -8.088  22.473   1.00 58.01  ? 206 IPA F O2  1 
HETATM 6170 C  C1  . IPA OB 7 .  ? 13.737  -13.425 20.642   1.00 66.63  ? 207 IPA F C1  1 
HETATM 6171 C  C2  . IPA OB 7 .  ? 13.258  -12.275 21.532   1.00 70.50  ? 207 IPA F C2  1 
HETATM 6172 C  C3  . IPA OB 7 .  ? 13.640  -12.546 22.986   1.00 53.34  ? 207 IPA F C3  1 
HETATM 6173 O  O2  . IPA OB 7 .  ? 13.879  -11.066 21.105   1.00 73.24  ? 207 IPA F O2  1 
HETATM 6174 C  C1  . IPA PB 7 .  ? 7.015   -3.903  -11.203  1.00 78.85  ? 208 IPA F C1  1 
HETATM 6175 C  C2  . IPA PB 7 .  ? 5.940   -4.754  -10.531  1.00 74.25  ? 208 IPA F C2  1 
HETATM 6176 C  C3  . IPA PB 7 .  ? 5.215   -5.564  -11.592  1.00 80.06  ? 208 IPA F C3  1 
HETATM 6177 O  O2  . IPA PB 7 .  ? 6.550   -5.650  -9.609   1.00 80.73  ? 208 IPA F O2  1 
HETATM 6178 DY DY  . DY  QB 2 .  ? -11.572 -17.591 -5.762   0.34 84.76  ? 201 DY  G DY  1 
HETATM 6179 DY DY  . DY  RB 2 .  ? -0.681  -24.740 -21.460  0.20 55.81  ? 202 DY  G DY  1 
HETATM 6180 S  S   . SO4 SB 3 .  ? -14.647 -15.208 -15.384  1.00 108.02 ? 203 SO4 G S   1 
HETATM 6181 O  O1  . SO4 SB 3 .  ? -13.872 -15.367 -16.629  1.00 111.28 ? 203 SO4 G O1  1 
HETATM 6182 O  O2  . SO4 SB 3 .  ? -15.998 -15.769 -15.575  1.00 112.22 ? 203 SO4 G O2  1 
HETATM 6183 O  O3  . SO4 SB 3 .  ? -13.973 -15.922 -14.283  1.00 108.76 ? 203 SO4 G O3  1 
HETATM 6184 O  O4  . SO4 SB 3 .  ? -14.749 -13.772 -15.052  1.00 112.20 ? 203 SO4 G O4  1 
HETATM 6185 S  S   . SO4 TB 3 .  ? -14.293 -5.832  9.664    1.00 104.96 ? 204 SO4 G S   1 
HETATM 6186 O  O1  . SO4 TB 3 .  ? -13.246 -4.875  9.260    1.00 101.63 ? 204 SO4 G O1  1 
HETATM 6187 O  O2  . SO4 TB 3 .  ? -14.439 -6.867  8.620    1.00 99.35  ? 204 SO4 G O2  1 
HETATM 6188 O  O3  . SO4 TB 3 .  ? -15.572 -5.114  9.834    1.00 102.93 ? 204 SO4 G O3  1 
HETATM 6189 O  O4  . SO4 TB 3 .  ? -13.914 -6.466  10.943   1.00 99.57  ? 204 SO4 G O4  1 
HETATM 6190 S  S   . SO4 UB 3 .  ? -17.621 -22.995 3.628    1.00 155.94 ? 205 SO4 G S   1 
HETATM 6191 O  O1  . SO4 UB 3 .  ? -17.686 -23.210 2.170    1.00 155.60 ? 205 SO4 G O1  1 
HETATM 6192 O  O2  . SO4 UB 3 .  ? -17.193 -21.609 3.901    1.00 153.67 ? 205 SO4 G O2  1 
HETATM 6193 O  O3  . SO4 UB 3 .  ? -16.651 -23.934 4.220    1.00 155.89 ? 205 SO4 G O3  1 
HETATM 6194 O  O4  . SO4 UB 3 .  ? -18.951 -23.232 4.219    1.00 154.47 ? 205 SO4 G O4  1 
HETATM 6195 S  S   . SO4 VB 3 .  ? -9.502  -16.032 -10.734  1.00 131.44 ? 206 SO4 G S   1 
HETATM 6196 O  O1  . SO4 VB 3 .  ? -10.954 -15.836 -10.587  1.00 133.35 ? 206 SO4 G O1  1 
HETATM 6197 O  O2  . SO4 VB 3 .  ? -9.128  -15.868 -12.151  1.00 132.71 ? 206 SO4 G O2  1 
HETATM 6198 O  O3  . SO4 VB 3 .  ? -9.150  -17.391 -10.286  1.00 132.19 ? 206 SO4 G O3  1 
HETATM 6199 O  O4  . SO4 VB 3 .  ? -8.784  -15.037 -9.914   1.00 131.21 ? 206 SO4 G O4  1 
HETATM 6200 S  S   . SO4 WB 3 .  ? -16.530 0.094   18.778   1.00 151.58 ? 207 SO4 G S   1 
HETATM 6201 O  O1  . SO4 WB 3 .  ? -17.612 0.715   17.989   1.00 149.92 ? 207 SO4 G O1  1 
HETATM 6202 O  O2  . SO4 WB 3 .  ? -15.227 0.616   18.321   1.00 150.11 ? 207 SO4 G O2  1 
HETATM 6203 O  O3  . SO4 WB 3 .  ? -16.566 -1.370  18.594   1.00 151.80 ? 207 SO4 G O3  1 
HETATM 6204 O  O4  . SO4 WB 3 .  ? -16.713 0.415   20.206   1.00 149.76 ? 207 SO4 G O4  1 
HETATM 6205 S  S   . SO4 XB 3 .  ? -16.514 -23.881 -2.077   1.00 121.61 ? 208 SO4 G S   1 
HETATM 6206 O  O1  . SO4 XB 3 .  ? -15.290 -23.204 -2.521   1.00 118.30 ? 208 SO4 G O1  1 
HETATM 6207 O  O2  . SO4 XB 3 .  ? -16.711 -25.106 -2.859   1.00 116.52 ? 208 SO4 G O2  1 
HETATM 6208 O  O3  . SO4 XB 3 .  ? -17.661 -22.988 -2.280   1.00 117.32 ? 208 SO4 G O3  1 
HETATM 6209 O  O4  . SO4 XB 3 .  ? -16.399 -24.220 -0.652   1.00 116.95 ? 208 SO4 G O4  1 
HETATM 6210 PT PT  . PT  YB 4 .  ? 0.120   -12.818 -25.791  0.21 86.47  ? 209 PT  G PT  1 
HETATM 6211 DY DY  . DY  ZB 2 .  ? 8.645   21.509  15.198   0.21 80.45  ? 201 DY  H DY  1 
HETATM 6212 DY DY  . DY  AC 2 .  ? 1.379   24.963  20.151   0.33 65.60  ? 202 DY  H DY  1 
HETATM 6213 DY DY  . DY  BC 2 .  ? 7.118   22.817  38.215   0.20 70.62  ? 203 DY  H DY  1 
HETATM 6214 S  S   . SO4 CC 3 .  ? 12.511  14.412  27.617   1.00 103.31 ? 204 SO4 H S   1 
HETATM 6215 O  O1  . SO4 CC 3 .  ? 12.910  12.996  27.725   1.00 95.66  ? 204 SO4 H O1  1 
HETATM 6216 O  O2  . SO4 CC 3 .  ? 12.264  14.742  26.201   1.00 106.48 ? 204 SO4 H O2  1 
HETATM 6217 O  O3  . SO4 CC 3 .  ? 11.273  14.638  28.387   1.00 93.49  ? 204 SO4 H O3  1 
HETATM 6218 O  O4  . SO4 CC 3 .  ? 13.592  15.275  28.133   1.00 91.12  ? 204 SO4 H O4  1 
HETATM 6219 S  S   . SO4 DC 3 .  ? 14.350  19.382  31.038   1.00 100.52 ? 205 SO4 H S   1 
HETATM 6220 O  O1  . SO4 DC 3 .  ? 14.069  18.587  29.838   1.00 83.95  ? 205 SO4 H O1  1 
HETATM 6221 O  O2  . SO4 DC 3 .  ? 15.751  19.790  31.019   1.00 94.85  ? 205 SO4 H O2  1 
HETATM 6222 O  O3  . SO4 DC 3 .  ? 14.104  18.572  32.237   1.00 91.20  ? 205 SO4 H O3  1 
HETATM 6223 O  O4  . SO4 DC 3 .  ? 13.508  20.586  31.058   1.00 93.80  ? 205 SO4 H O4  1 
HETATM 6224 C  C1  . EDO EC 6 .  ? 9.837   10.169  32.426   1.00 56.40  ? 206 EDO H C1  1 
HETATM 6225 O  O1  . EDO EC 6 .  ? 10.434  10.259  33.726   1.00 51.21  ? 206 EDO H O1  1 
HETATM 6226 C  C2  . EDO EC 6 .  ? 10.741  10.843  31.395   1.00 49.38  ? 206 EDO H C2  1 
HETATM 6227 O  O2  . EDO EC 6 .  ? 10.606  10.194  30.128   1.00 44.10  ? 206 EDO H O2  1 
HETATM 6228 O  O   . HOH FC 8 .  ? 1.977   -5.049  15.944   1.00 33.21  ? 301 HOH A O   1 
HETATM 6229 O  O   . HOH FC 8 .  ? -6.530  -2.343  21.291   1.00 39.66  ? 302 HOH A O   1 
HETATM 6230 O  O   . HOH FC 8 .  ? -5.341  -8.326  24.225   1.00 48.66  ? 303 HOH A O   1 
HETATM 6231 O  O   . HOH FC 8 .  ? -4.890  -2.184  -9.305   1.00 31.82  ? 304 HOH A O   1 
HETATM 6232 O  O   . HOH FC 8 .  ? -3.175  -8.451  -25.792  1.00 77.31  ? 305 HOH A O   1 
HETATM 6233 O  O   . HOH FC 8 .  ? -7.746  -2.027  -8.823   1.00 37.19  ? 306 HOH A O   1 
HETATM 6234 O  O   . HOH FC 8 .  ? -8.788  -4.707  10.912   1.00 34.09  ? 307 HOH A O   1 
HETATM 6235 O  O   . HOH FC 8 .  ? -9.668  -1.294  -1.761   1.00 38.43  ? 308 HOH A O   1 
HETATM 6236 O  O   . HOH FC 8 .  ? -14.300 -8.955  -21.051  1.00 56.63  ? 309 HOH A O   1 
HETATM 6237 O  O   . HOH FC 8 .  ? -13.917 -9.339  -14.482  1.00 40.81  ? 310 HOH A O   1 
HETATM 6238 O  O   . HOH FC 8 .  ? -14.569 -7.368  -19.035  1.00 70.05  ? 311 HOH A O   1 
HETATM 6239 O  O   . HOH FC 8 .  ? -15.885 -1.801  1.563    1.00 51.98  ? 312 HOH A O   1 
HETATM 6240 O  O   . HOH FC 8 .  ? -17.163 -4.812  4.275    1.00 56.58  ? 313 HOH A O   1 
HETATM 6241 O  O   . HOH FC 8 .  ? -10.559 -14.737 -20.823  1.00 58.76  ? 314 HOH A O   1 
HETATM 6242 O  O   . HOH FC 8 .  ? 1.539   -1.753  13.028   1.00 41.75  ? 315 HOH A O   1 
HETATM 6243 O  O   . HOH FC 8 .  ? -6.165  0.383   15.188   1.00 30.20  ? 316 HOH A O   1 
HETATM 6244 O  O   . HOH FC 8 .  ? -15.692 -4.524  1.655    1.00 50.80  ? 317 HOH A O   1 
HETATM 6245 O  O   . HOH FC 8 .  ? -15.042 -0.133  4.421    1.00 59.92  ? 318 HOH A O   1 
HETATM 6246 O  O   . HOH FC 8 .  ? -7.013  -3.093  -19.687  1.00 44.88  ? 319 HOH A O   1 
HETATM 6247 O  O   . HOH FC 8 .  ? -15.253 -2.989  5.769    1.00 65.73  ? 320 HOH A O   1 
HETATM 6248 O  O   . HOH GC 8 .  ? 4.480   6.039   12.188   1.00 28.69  ? 301 HOH B O   1 
HETATM 6249 O  O   . HOH GC 8 .  ? 5.845   21.177  0.925    1.00 27.97  ? 302 HOH B O   1 
HETATM 6250 O  O   . HOH GC 8 .  ? 11.642  16.273  7.198    1.00 34.34  ? 303 HOH B O   1 
HETATM 6251 O  O   . HOH GC 8 .  ? 1.486   6.304   11.281   1.00 27.26  ? 304 HOH B O   1 
HETATM 6252 O  O   . HOH GC 8 .  ? 2.173   4.190   22.282   1.00 40.24  ? 305 HOH B O   1 
HETATM 6253 O  O   . HOH GC 8 .  ? 1.726   20.820  -19.339  1.00 57.91  ? 306 HOH B O   1 
HETATM 6254 O  O   . HOH GC 8 .  ? 6.199   7.907   47.128   1.00 52.20  ? 307 HOH B O   1 
HETATM 6255 O  O   . HOH GC 8 .  ? 4.270   7.755   1.050    1.00 36.28  ? 308 HOH B O   1 
HETATM 6256 O  O   . HOH GC 8 .  ? -4.926  6.418   34.242   1.00 43.90  ? 309 HOH B O   1 
HETATM 6257 O  O   . HOH GC 8 .  ? 6.161   4.222   35.201   1.00 45.62  ? 310 HOH B O   1 
HETATM 6258 O  O   . HOH GC 8 .  ? 7.062   13.731  -19.869  1.00 64.28  ? 311 HOH B O   1 
HETATM 6259 O  O   . HOH GC 8 .  ? 11.139  13.548  4.195    1.00 42.20  ? 312 HOH B O   1 
HETATM 6260 O  O   . HOH GC 8 .  ? 4.030   5.590   14.937   1.00 52.00  ? 313 HOH B O   1 
HETATM 6261 O  O   . HOH GC 8 .  ? 3.357   3.864   35.593   1.00 33.98  ? 314 HOH B O   1 
HETATM 6262 O  O   . HOH GC 8 .  ? 0.012   12.512  44.111   1.00 47.56  ? 315 HOH B O   1 
HETATM 6263 O  O   . HOH GC 8 .  ? 1.688   2.108   34.150   1.00 55.55  ? 316 HOH B O   1 
HETATM 6264 O  O   . HOH GC 8 .  ? -3.826  4.159   61.298   1.00 63.96  ? 317 HOH B O   1 
HETATM 6265 O  O   . HOH GC 8 .  ? -6.786  4.590   42.079   1.00 58.81  ? 318 HOH B O   1 
HETATM 6266 O  O   . HOH GC 8 .  ? 10.404  7.194   32.128   1.00 45.65  ? 319 HOH B O   1 
HETATM 6267 O  O   . HOH GC 8 .  ? -5.074  9.141   36.881   1.00 43.49  ? 320 HOH B O   1 
HETATM 6268 O  O   . HOH GC 8 .  ? 8.845   4.352   4.277    1.00 63.68  ? 321 HOH B O   1 
HETATM 6269 O  O   . HOH GC 8 .  ? -0.581  1.166   45.428   1.00 68.70  ? 322 HOH B O   1 
HETATM 6270 O  O   . HOH GC 8 .  ? 13.770  13.886  14.875   1.00 50.87  ? 323 HOH B O   1 
HETATM 6271 O  O   . HOH GC 8 .  ? 11.094  15.205  14.934   1.00 56.04  ? 324 HOH B O   1 
HETATM 6272 O  O   . HOH GC 8 .  ? 2.448   12.102  45.240   1.00 63.20  ? 325 HOH B O   1 
HETATM 6273 O  O   . HOH GC 8 .  ? -7.196  2.382   49.958   1.00 67.75  ? 326 HOH B O   1 
HETATM 6274 O  O   . HOH GC 8 .  ? -2.846  2.279   57.280   1.00 59.22  ? 327 HOH B O   1 
HETATM 6275 O  O   . HOH GC 8 .  ? 9.166   20.377  -20.504  1.00 50.33  ? 328 HOH B O   1 
HETATM 6276 O  O   . HOH GC 8 .  ? 6.728   23.180  -28.334  1.00 63.00  ? 329 HOH B O   1 
HETATM 6277 O  O   . HOH GC 8 .  ? 8.289   21.284  -27.115  1.00 65.49  ? 330 HOH B O   1 
HETATM 6278 O  O   . HOH GC 8 .  ? -0.859  12.093  -0.179   1.00 46.91  ? 331 HOH B O   1 
HETATM 6279 O  O   . HOH GC 8 .  ? 6.534   5.586   18.687   1.00 39.84  ? 332 HOH B O   1 
HETATM 6280 O  O   . HOH GC 8 .  ? 4.767   4.200   21.844   1.00 44.41  ? 333 HOH B O   1 
HETATM 6281 O  O   . HOH GC 8 .  ? 11.129  12.924  7.907    1.00 51.55  ? 334 HOH B O   1 
HETATM 6282 O  O   . HOH HC 8 .  ? -5.087  -15.578 15.753   1.00 24.87  ? 301 HOH C O   1 
HETATM 6283 O  O   . HOH HC 8 .  ? 3.251   -18.007 21.160   1.00 37.03  ? 302 HOH C O   1 
HETATM 6284 O  O   . HOH HC 8 .  ? 4.588   -18.579 -8.857   1.00 28.96  ? 303 HOH C O   1 
HETATM 6285 O  O   . HOH HC 8 .  ? -2.574  -22.206 18.171   1.00 43.02  ? 304 HOH C O   1 
HETATM 6286 O  O   . HOH HC 8 .  ? 5.589   -15.694 11.407   1.00 35.37  ? 305 HOH C O   1 
HETATM 6287 O  O   . HOH HC 8 .  ? -0.114  -8.625  -22.104  1.00 48.98  ? 306 HOH C O   1 
HETATM 6288 O  O   . HOH HC 8 .  ? 1.402   -18.447 -9.294   1.00 41.24  ? 307 HOH C O   1 
HETATM 6289 O  O   . HOH HC 8 .  ? 4.222   -17.024 -19.750  1.00 38.43  ? 308 HOH C O   1 
HETATM 6290 O  O   . HOH HC 8 .  ? -2.523  -21.561 -4.887   1.00 44.18  ? 309 HOH C O   1 
HETATM 6291 O  O   . HOH HC 8 .  ? 11.599  -8.605  -14.109  1.00 44.23  ? 310 HOH C O   1 
HETATM 6292 O  O   . HOH HC 8 .  ? -7.614  -20.100 26.380   1.00 46.95  ? 311 HOH C O   1 
HETATM 6293 O  O   . HOH HC 8 .  ? 5.393   -23.474 21.962   1.00 48.21  ? 312 HOH C O   1 
HETATM 6294 O  O   . HOH HC 8 .  ? 9.835   -4.121  -12.154  1.00 58.60  ? 313 HOH C O   1 
HETATM 6295 O  O   . HOH HC 8 .  ? 3.746   -21.052 19.949   1.00 58.58  ? 314 HOH C O   1 
HETATM 6296 O  O   . HOH HC 8 .  ? 2.838   -20.884 15.057   1.00 20.08  ? 315 HOH C O   1 
HETATM 6297 O  O   . HOH HC 8 .  ? 7.305   -12.827 1.389    1.00 41.73  ? 316 HOH C O   1 
HETATM 6298 O  O   . HOH HC 8 .  ? 13.870  -4.116  -9.434   1.00 72.56  ? 317 HOH C O   1 
HETATM 6299 O  O   . HOH HC 8 .  ? 2.599   -20.818 17.583   1.00 44.58  ? 318 HOH C O   1 
HETATM 6300 O  O   . HOH HC 8 .  ? -5.485  -23.091 33.582   1.00 71.29  ? 319 HOH C O   1 
HETATM 6301 O  O   . HOH HC 8 .  ? 6.623   -19.400 -2.176   1.00 36.32  ? 320 HOH C O   1 
HETATM 6302 O  O   . HOH HC 8 .  ? -4.837  -24.834 22.371   1.00 17.23  ? 321 HOH C O   1 
HETATM 6303 O  O   . HOH HC 8 .  ? 10.920  -11.019 -14.197  1.00 39.00  ? 322 HOH C O   1 
HETATM 6304 O  O   . HOH HC 8 .  ? 6.256   -20.776 -0.144   1.00 58.29  ? 323 HOH C O   1 
HETATM 6305 O  O   . HOH HC 8 .  ? 3.790   -19.260 -6.434   1.00 45.68  ? 324 HOH C O   1 
HETATM 6306 O  O   . HOH HC 8 .  ? 14.141  -21.134 -22.983  1.00 62.64  ? 325 HOH C O   1 
HETATM 6307 O  O   . HOH HC 8 .  ? -6.679  -22.025 28.627   1.00 57.97  ? 326 HOH C O   1 
HETATM 6308 O  O   . HOH HC 8 .  ? 2.241   -12.400 24.647   1.00 42.60  ? 327 HOH C O   1 
HETATM 6309 O  O   . HOH HC 8 .  ? -0.342  -22.236 31.885   1.00 42.73  ? 328 HOH C O   1 
HETATM 6310 O  O   . HOH HC 8 .  ? 0.136   -19.599 31.952   1.00 47.90  ? 329 HOH C O   1 
HETATM 6311 O  O   . HOH HC 8 .  ? 7.014   -19.021 -16.578  1.00 70.44  ? 330 HOH C O   1 
HETATM 6312 O  O   . HOH IC 8 .  ? -4.933  22.476  11.374   1.00 24.96  ? 301 HOH D O   1 
HETATM 6313 O  O   . HOH IC 8 .  ? -9.501  23.420  18.830   1.00 28.65  ? 302 HOH D O   1 
HETATM 6314 O  O   . HOH IC 8 .  ? -2.208  28.303  45.801   1.00 58.62  ? 303 HOH D O   1 
HETATM 6315 O  O   . HOH IC 8 .  ? -9.341  24.850  35.565   1.00 60.69  ? 304 HOH D O   1 
HETATM 6316 O  O   . HOH IC 8 .  ? -14.088 15.714  7.532    1.00 42.31  ? 305 HOH D O   1 
HETATM 6317 O  O   . HOH IC 8 .  ? -13.068 10.672  -5.314   1.00 51.30  ? 306 HOH D O   1 
HETATM 6318 O  O   . HOH IC 8 .  ? -6.406  24.857  35.510   1.00 49.12  ? 307 HOH D O   1 
HETATM 6319 O  O   . HOH IC 8 .  ? -10.484 22.788  29.569   1.00 49.99  ? 308 HOH D O   1 
HETATM 6320 O  O   . HOH IC 8 .  ? -10.543 17.133  22.277   1.00 28.13  ? 309 HOH D O   1 
HETATM 6321 O  O   . HOH IC 8 .  ? -7.697  22.811  11.932   1.00 32.54  ? 310 HOH D O   1 
HETATM 6322 O  O   . HOH IC 8 .  ? -7.448  26.688  38.775   1.00 54.05  ? 311 HOH D O   1 
HETATM 6323 O  O   . HOH IC 8 .  ? 0.902   25.498  38.114   1.00 48.92  ? 312 HOH D O   1 
HETATM 6324 O  O   . HOH IC 8 .  ? -8.393  21.283  3.633    1.00 58.19  ? 313 HOH D O   1 
HETATM 6325 O  O   . HOH IC 8 .  ? 2.112   0.396   -60.272  1.00 72.90  ? 314 HOH D O   1 
HETATM 6326 O  O   . HOH IC 8 .  ? -7.321  21.368  1.100    1.00 27.56  ? 315 HOH D O   1 
HETATM 6327 O  O   . HOH IC 8 .  ? -5.223  12.548  -2.160   1.00 29.78  ? 316 HOH D O   1 
HETATM 6328 O  O   . HOH IC 8 .  ? -16.068 19.965  21.118   1.00 58.45  ? 317 HOH D O   1 
HETATM 6329 O  O   . HOH JC 8 .  ? 1.861   9.258   5.884    1.00 27.93  ? 301 HOH E O   1 
HETATM 6330 O  O   . HOH JC 8 .  ? -4.059  16.103  44.091   1.00 40.94  ? 302 HOH E O   1 
HETATM 6331 O  O   . HOH JC 8 .  ? -6.504  6.722   0.452    1.00 31.13  ? 303 HOH E O   1 
HETATM 6332 O  O   . HOH JC 8 .  ? -3.458  1.247   3.760    1.00 65.81  ? 304 HOH E O   1 
HETATM 6333 O  O   . HOH JC 8 .  ? -7.427  7.596   41.733   1.00 38.45  ? 305 HOH E O   1 
HETATM 6334 O  O   . HOH JC 8 .  ? -7.797  6.054   30.576   1.00 37.32  ? 306 HOH E O   1 
HETATM 6335 O  O   . HOH JC 8 .  ? 1.271   3.125   4.910    1.00 33.59  ? 307 HOH E O   1 
HETATM 6336 O  O   . HOH JC 8 .  ? -4.728  6.283   31.067   1.00 39.04  ? 308 HOH E O   1 
HETATM 6337 O  O   . HOH JC 8 .  ? -9.691  5.264   23.760   1.00 43.17  ? 309 HOH E O   1 
HETATM 6338 O  O   . HOH JC 8 .  ? -7.227  5.565   27.943   1.00 47.62  ? 310 HOH E O   1 
HETATM 6339 O  O   . HOH JC 8 .  ? 3.283   0.250   -14.060  1.00 42.01  ? 311 HOH E O   1 
HETATM 6340 O  O   . HOH JC 8 .  ? -0.918  2.713   3.161    1.00 40.09  ? 312 HOH E O   1 
HETATM 6341 O  O   . HOH JC 8 .  ? -6.924  1.824   0.356    1.00 62.66  ? 313 HOH E O   1 
HETATM 6342 O  O   . HOH JC 8 .  ? -7.053  3.892   1.830    1.00 41.74  ? 314 HOH E O   1 
HETATM 6343 O  O   . HOH JC 8 .  ? -5.591  3.786   3.771    1.00 41.00  ? 315 HOH E O   1 
HETATM 6344 O  O   . HOH JC 8 .  ? -9.283  0.626   18.379   1.00 64.73  ? 316 HOH E O   1 
HETATM 6345 O  O   . HOH JC 8 .  ? -10.710 12.112  20.055   1.00 40.54  ? 317 HOH E O   1 
HETATM 6346 O  O   . HOH JC 8 .  ? -6.469  3.685   6.369    1.00 40.63  ? 318 HOH E O   1 
HETATM 6347 O  O   . HOH JC 8 .  ? 1.484   -0.119  -0.653   1.00 15.31  ? 319 HOH E O   1 
HETATM 6348 O  O   . HOH JC 8 .  ? -6.617  24.897  79.486   1.00 79.09  ? 320 HOH E O   1 
HETATM 6349 O  O   . HOH JC 8 .  ? 0.525   1.797   -7.773   1.00 49.59  ? 321 HOH E O   1 
HETATM 6350 O  O   . HOH JC 8 .  ? -15.729 14.365  46.213   1.00 51.18  ? 322 HOH E O   1 
HETATM 6351 O  O   . HOH JC 8 .  ? -0.578  0.798   -5.114   1.00 62.74  ? 323 HOH E O   1 
HETATM 6352 O  O   . HOH JC 8 .  ? -4.842  2.035   7.988    1.00 47.53  ? 324 HOH E O   1 
HETATM 6353 O  O   . HOH JC 8 .  ? 1.066   5.666   8.711    1.00 38.46  ? 325 HOH E O   1 
HETATM 6354 O  O   . HOH JC 8 .  ? -7.185  0.447   19.693   1.00 52.79  ? 326 HOH E O   1 
HETATM 6355 O  O   . HOH KC 8 .  ? 10.618  -4.300  -2.038   1.00 65.19  ? 301 HOH F O   1 
HETATM 6356 O  O   . HOH KC 8 .  ? 6.507   -1.373  3.016    1.00 32.15  ? 302 HOH F O   1 
HETATM 6357 O  O   . HOH KC 8 .  ? 1.376   -2.173  10.308   1.00 32.04  ? 303 HOH F O   1 
HETATM 6358 O  O   . HOH KC 8 .  ? 0.507   -12.176 22.767   1.00 47.96  ? 304 HOH F O   1 
HETATM 6359 O  O   . HOH KC 8 .  ? -6.894  -0.934  -21.210  1.00 60.23  ? 305 HOH F O   1 
HETATM 6360 O  O   . HOH KC 8 .  ? -4.012  0.963   -16.116  1.00 42.41  ? 306 HOH F O   1 
HETATM 6361 O  O   . HOH KC 8 .  ? -0.384  3.421   -23.880  1.00 53.15  ? 307 HOH F O   1 
HETATM 6362 O  O   . HOH KC 8 .  ? 3.701   -1.879  6.268    1.00 28.79  ? 308 HOH F O   1 
HETATM 6363 O  O   . HOH KC 8 .  ? 4.352   -3.465  20.780   1.00 39.33  ? 309 HOH F O   1 
HETATM 6364 O  O   . HOH KC 8 .  ? 8.840   -1.123  -11.729  1.00 39.24  ? 310 HOH F O   1 
HETATM 6365 O  O   . HOH KC 8 .  ? 8.979   2.014   -6.008   1.00 51.93  ? 311 HOH F O   1 
HETATM 6366 O  O   . HOH KC 8 .  ? 9.815   -4.761  -4.867   1.00 39.01  ? 312 HOH F O   1 
HETATM 6367 O  O   . HOH KC 8 .  ? 10.959  -14.506 9.745    1.00 39.16  ? 313 HOH F O   1 
HETATM 6368 O  O   . HOH KC 8 .  ? 6.823   0.008   -6.480   1.00 45.88  ? 314 HOH F O   1 
HETATM 6369 O  O   . HOH KC 8 .  ? 4.615   -2.000  9.431    1.00 24.64  ? 315 HOH F O   1 
HETATM 6370 O  O   . HOH KC 8 .  ? 4.264   4.266   -4.967   1.00 40.76  ? 316 HOH F O   1 
HETATM 6371 O  O   . HOH KC 8 .  ? -2.362  1.818   -36.140  1.00 66.07  ? 317 HOH F O   1 
HETATM 6372 O  O   . HOH KC 8 .  ? 11.429  4.187   4.004    1.00 46.75  ? 318 HOH F O   1 
HETATM 6373 O  O   . HOH KC 8 .  ? 9.031   1.862   6.954    1.00 61.77  ? 319 HOH F O   1 
HETATM 6374 O  O   . HOH KC 8 .  ? 11.106  -10.549 7.048    1.00 43.31  ? 320 HOH F O   1 
HETATM 6375 O  O   . HOH LC 8 .  ? -7.753  -18.676 9.590    1.00 30.98  ? 301 HOH G O   1 
HETATM 6376 O  O   . HOH LC 8 .  ? -14.080 -11.080 16.005   1.00 21.40  ? 302 HOH G O   1 
HETATM 6377 O  O   . HOH LC 8 .  ? -10.817 -19.404 16.647   1.00 43.89  ? 303 HOH G O   1 
HETATM 6378 O  O   . HOH LC 8 .  ? -9.817  -29.374 -30.182  1.00 49.54  ? 304 HOH G O   1 
HETATM 6379 O  O   . HOH LC 8 .  ? -4.874  -3.840  41.046   1.00 48.70  ? 305 HOH G O   1 
HETATM 6380 O  O   . HOH LC 8 .  ? -9.736  -19.178 3.068    1.00 33.10  ? 306 HOH G O   1 
HETATM 6381 O  O   . HOH LC 8 .  ? -6.469  -17.663 -20.813  1.00 46.05  ? 307 HOH G O   1 
HETATM 6382 O  O   . HOH LC 8 .  ? -0.559  -21.274 5.701    1.00 47.75  ? 308 HOH G O   1 
HETATM 6383 O  O   . HOH LC 8 .  ? -10.716 -18.584 -8.324   1.00 43.96  ? 309 HOH G O   1 
HETATM 6384 O  O   . HOH LC 8 .  ? -7.313  -19.230 6.657    1.00 35.05  ? 310 HOH G O   1 
HETATM 6385 O  O   . HOH LC 8 .  ? -14.289 0.980   23.434   1.00 52.64  ? 311 HOH G O   1 
HETATM 6386 O  O   . HOH LC 8 .  ? -15.467 -18.502 1.955    1.00 54.51  ? 312 HOH G O   1 
HETATM 6387 O  O   . HOH LC 8 .  ? -8.214  2.091   65.323   1.00 60.31  ? 313 HOH G O   1 
HETATM 6388 O  O   . HOH LC 8 .  ? -1.850  -12.397 22.387   1.00 54.17  ? 314 HOH G O   1 
HETATM 6389 O  O   . HOH LC 8 .  ? -4.720  -18.507 10.258   1.00 31.96  ? 315 HOH G O   1 
HETATM 6390 O  O   . HOH LC 8 .  ? -16.402 -12.561 15.411   1.00 52.68  ? 316 HOH G O   1 
HETATM 6391 O  O   . HOH LC 8 .  ? -4.826  -20.390 -0.669   1.00 23.47  ? 317 HOH G O   1 
HETATM 6392 O  O   . HOH LC 8 .  ? -14.540 -9.913  7.127    1.00 45.46  ? 318 HOH G O   1 
HETATM 6393 O  O   . HOH LC 8 .  ? -2.707  -24.050 -23.611  1.00 65.41  ? 319 HOH G O   1 
HETATM 6394 O  O   . HOH LC 8 .  ? -7.471  -17.255 21.057   1.00 28.92  ? 320 HOH G O   1 
HETATM 6395 O  O   . HOH LC 8 .  ? -4.828  -12.340 -23.017  1.00 55.42  ? 321 HOH G O   1 
HETATM 6396 O  O   . HOH MC 8 .  ? -5.235  19.676  5.670    1.00 42.44  ? 301 HOH H O   1 
HETATM 6397 O  O   . HOH MC 8 .  ? 3.320   22.468  0.489    1.00 33.32  ? 302 HOH H O   1 
HETATM 6398 O  O   . HOH MC 8 .  ? 5.924   20.911  -4.174   1.00 57.94  ? 303 HOH H O   1 
HETATM 6399 O  O   . HOH MC 8 .  ? 1.467   22.553  31.008   1.00 35.84  ? 304 HOH H O   1 
HETATM 6400 O  O   . HOH MC 8 .  ? 4.688   22.601  30.566   1.00 34.79  ? 305 HOH H O   1 
HETATM 6401 O  O   . HOH MC 8 .  ? -4.173  26.035  4.598    1.00 42.28  ? 306 HOH H O   1 
HETATM 6402 O  O   . HOH MC 8 .  ? 5.511   19.652  10.599   1.00 38.55  ? 307 HOH H O   1 
HETATM 6403 O  O   . HOH MC 8 .  ? -6.363  22.959  -0.869   1.00 57.94  ? 308 HOH H O   1 
HETATM 6404 O  O   . HOH MC 8 .  ? 4.243   21.180  41.729   1.00 38.40  ? 309 HOH H O   1 
HETATM 6405 O  O   . HOH MC 8 .  ? 6.434   23.715  23.576   1.00 30.07  ? 310 HOH H O   1 
HETATM 6406 O  O   . HOH MC 8 .  ? -0.629  26.800  -9.715   1.00 54.10  ? 311 HOH H O   1 
HETATM 6407 O  O   . HOH MC 8 .  ? -2.071  26.157  3.022    1.00 31.00  ? 312 HOH H O   1 
HETATM 6408 O  O   . HOH MC 8 .  ? 0.044   26.273  18.056   1.00 52.94  ? 313 HOH H O   1 
HETATM 6409 O  O   . HOH MC 8 .  ? 3.733   25.355  1.564    1.00 42.83  ? 314 HOH H O   1 
HETATM 6410 O  O   . HOH MC 8 .  ? 11.030  20.006  24.575   1.00 63.65  ? 315 HOH H O   1 
HETATM 6411 O  O   . HOH MC 8 .  ? 2.298   28.525  1.588    1.00 35.40  ? 316 HOH H O   1 
HETATM 6412 O  O   . HOH MC 8 .  ? 5.554   24.914  12.033   1.00 43.85  ? 317 HOH H O   1 
HETATM 6413 O  O   . HOH MC 8 .  ? 6.526   25.414  3.466    1.00 64.82  ? 318 HOH H O   1 
HETATM 6414 O  O   . HOH MC 8 .  ? 2.563   25.359  3.943    1.00 47.27  ? 319 HOH H O   1 
HETATM 6415 O  O   . HOH MC 8 .  ? 11.974  22.539  26.012   1.00 49.04  ? 320 HOH H O   1 
HETATM 6416 O  O   . HOH MC 8 .  ? 3.790   3.686   79.346   1.00 68.57  ? 321 HOH H O   1 
HETATM 6417 O  O   . HOH MC 8 .  ? 10.651  15.817  35.067   1.00 51.15  ? 322 HOH H O   1 
HETATM 6418 O  O   . HOH MC 8 .  ? 9.621   22.650  2.083    1.00 62.64  ? 323 HOH H O   1 
HETATM 6419 O  O   . HOH MC 8 .  ? 1.651   27.039  8.611    1.00 46.46  ? 324 HOH H O   1 
HETATM 6420 O  O   . HOH MC 8 .  ? -3.077  21.815  15.950   1.00 56.95  ? 325 HOH H O   1 
HETATM 6421 O  O   . HOH MC 8 .  ? 11.306  16.146  44.520   1.00 47.20  ? 326 HOH H O   1 
HETATM 6422 O  O   . HOH MC 8 .  ? 2.936   25.284  6.323    1.00 28.86  ? 327 HOH H O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'R-FREE REPORTED BUT NO TEST FLAGS IN STRUCTURE FACTOR FILE' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  42  ?   ?   ?   A . n 
A 1 2  SER 2  43  43  SER SER A . n 
A 1 3  ARG 3  44  44  ARG ARG A . n 
A 1 4  VAL 4  45  45  VAL VAL A . n 
A 1 5  ILE 5  46  46  ILE ILE A . n 
A 1 6  GLU 6  47  47  GLU GLU A . n 
A 1 7  SER 7  48  48  SER SER A . n 
A 1 8  LEU 8  49  49  LEU LEU A . n 
A 1 9  HIS 9  50  50  HIS HIS A . n 
A 1 10 ASP 10 51  51  ASP ASP A . n 
A 1 11 GLN 11 52  52  GLN GLN A . n 
A 1 12 ILE 12 53  53  ILE ILE A . n 
A 1 13 ASP 13 54  54  ASP ASP A . n 
A 1 14 MET 14 55  55  MET MET A . n 
A 1 15 LEU 15 56  56  LEU LEU A . n 
A 1 16 THR 16 57  57  THR THR A . n 
A 1 17 LYS 17 58  58  LYS LYS A . n 
A 1 18 THR 18 59  59  THR THR A . n 
A 1 19 ASN 19 60  60  ASN ASN A . n 
A 1 20 LEU 20 61  61  LEU LEU A . n 
A 1 21 GLN 21 62  62  GLN GLN A . n 
A 1 22 LEU 22 63  63  LEU LEU A . n 
A 1 23 THR 23 64  64  THR THR A . n 
A 1 24 THR 24 65  65  THR THR A . n 
A 1 25 GLN 25 66  66  GLN GLN A . n 
A 1 26 SER 26 67  67  SER SER A . n 
A 1 27 GLN 27 68  68  GLN GLN A . n 
A 1 28 ASN 28 69  69  ASN ASN A . n 
A 1 29 LEU 29 70  70  LEU LEU A . n 
A 1 30 LEU 30 71  71  LEU LEU A . n 
A 1 31 SER 31 72  72  SER SER A . n 
A 1 32 LYS 32 73  73  LYS LYS A . n 
A 1 33 LEU 33 74  74  LEU LEU A . n 
A 1 34 GLU 34 75  75  GLU GLU A . n 
A 1 35 LEU 35 76  76  LEU LEU A . n 
A 1 36 ALA 36 77  77  ALA ALA A . n 
A 1 37 GLN 37 78  78  GLN GLN A . n 
A 1 38 SER 38 79  79  SER SER A . n 
A 1 39 LYS 39 80  80  LYS LYS A . n 
A 1 40 GLU 40 81  81  GLU GLU A . n 
A 1 41 SER 41 82  82  SER SER A . n 
A 1 42 LYS 42 83  83  LYS LYS A . n 
A 1 43 LEU 43 84  84  LEU LEU A . n 
A 1 44 LEU 44 85  85  LEU LEU A . n 
A 1 45 GLU 45 86  86  GLU GLU A . n 
A 1 46 ASN 46 87  87  ASN ASN A . n 
A 1 47 LEU 47 88  88  LEU LEU A . n 
A 1 48 ASN 48 89  89  ASN ASN A . n 
A 1 49 LEU 49 90  90  LEU LEU A . n 
A 1 50 LEU 50 91  91  LEU LEU A . n 
A 1 51 LYS 51 92  92  LYS LYS A . n 
A 1 52 ASN 52 93  93  ASN ASN A . n 
A 1 53 GLU 53 94  94  GLU GLU A . n 
A 1 54 ASN 54 95  95  ASN ASN A . n 
A 1 55 GLU 55 96  96  GLU GLU A . n 
A 1 56 ASN 56 97  97  ASN ASN A . n 
A 1 57 LEU 57 98  98  LEU LEU A . n 
A 1 58 ASN 58 99  99  ASN ASN A . n 
A 1 59 SER 59 100 100 SER SER A . n 
A 1 60 ILE 60 101 101 ILE ILE A . n 
A 1 61 PHE 61 102 102 PHE PHE A . n 
A 1 62 GLU 62 103 103 GLU GLU A . n 
A 1 63 ARG 63 104 104 ARG ARG A . n 
A 1 64 LYS 64 105 105 LYS LYS A . n 
A 1 65 ASN 65 106 106 ASN ASN A . n 
A 1 66 LYS 66 107 107 LYS LYS A . n 
A 1 67 LYS 67 108 108 LYS LYS A . n 
A 1 68 LEU 68 109 109 LEU LEU A . n 
A 1 69 LYS 69 110 110 LYS LYS A . n 
A 1 70 GLU 70 111 111 GLU GLU A . n 
A 1 71 LEU 71 112 112 LEU LEU A . n 
A 1 72 GLU 72 113 113 GLU GLU A . n 
A 1 73 LYS 73 114 114 LYS LYS A . n 
A 1 74 ASP 74 115 115 ASP ASP A . n 
A 1 75 TYR 75 116 116 TYR TYR A . n 
A 1 76 SER 76 117 117 SER SER A . n 
A 1 77 GLU 77 118 118 GLU GLU A . n 
A 1 78 LEU 78 119 119 LEU LEU A . n 
A 1 79 SER 79 120 120 SER SER A . n 
A 1 80 ASN 80 121 121 ASN ASN A . n 
A 1 81 ARG 81 122 122 ARG ARG A . n 
A 1 82 TYR 82 123 123 TYR TYR A . n 
A 1 83 ASN 83 124 124 ASN ASN A . n 
A 1 84 GLU 84 125 125 GLU GLU A . n 
A 1 85 GLN 85 126 126 GLN GLN A . n 
A 1 86 LYS 86 127 127 LYS LYS A . n 
A 1 87 GLU 87 128 128 GLU GLU A . n 
A 1 88 LYS 88 129 129 LYS LYS A . n 
A 1 89 MET 89 130 130 MET MET A . n 
A 1 90 ASP 90 131 131 ASP ASP A . n 
A 1 91 GLN 91 132 132 GLN GLN A . n 
A 1 92 LEU 92 133 133 LEU LEU A . n 
A 1 93 SER 93 134 134 SER SER A . n 
A 1 94 LYS 94 135 135 LYS LYS A . n 
A 1 95 LEU 95 136 136 LEU LEU A . n 
A 1 96 ALA 96 137 ?   ?   ?   A . n 
B 1 1  SER 1  42  ?   ?   ?   B . n 
B 1 2  SER 2  43  ?   ?   ?   B . n 
B 1 3  ARG 3  44  ?   ?   ?   B . n 
B 1 4  VAL 4  45  ?   ?   ?   B . n 
B 1 5  ILE 5  46  ?   ?   ?   B . n 
B 1 6  GLU 6  47  ?   ?   ?   B . n 
B 1 7  SER 7  48  ?   ?   ?   B . n 
B 1 8  LEU 8  49  49  LEU LEU B . n 
B 1 9  HIS 9  50  50  HIS HIS B . n 
B 1 10 ASP 10 51  51  ASP ASP B . n 
B 1 11 GLN 11 52  52  GLN GLN B . n 
B 1 12 ILE 12 53  53  ILE ILE B . n 
B 1 13 ASP 13 54  54  ASP ASP B . n 
B 1 14 MET 14 55  55  MET MET B . n 
B 1 15 LEU 15 56  56  LEU LEU B . n 
B 1 16 THR 16 57  57  THR THR B . n 
B 1 17 LYS 17 58  58  LYS LYS B . n 
B 1 18 THR 18 59  59  THR THR B . n 
B 1 19 ASN 19 60  60  ASN ASN B . n 
B 1 20 LEU 20 61  61  LEU LEU B . n 
B 1 21 GLN 21 62  62  GLN GLN B . n 
B 1 22 LEU 22 63  63  LEU LEU B . n 
B 1 23 THR 23 64  64  THR THR B . n 
B 1 24 THR 24 65  65  THR THR B . n 
B 1 25 GLN 25 66  66  GLN GLN B . n 
B 1 26 SER 26 67  67  SER SER B . n 
B 1 27 GLN 27 68  68  GLN GLN B . n 
B 1 28 ASN 28 69  69  ASN ASN B . n 
B 1 29 LEU 29 70  70  LEU LEU B . n 
B 1 30 LEU 30 71  71  LEU LEU B . n 
B 1 31 SER 31 72  72  SER SER B . n 
B 1 32 LYS 32 73  73  LYS LYS B . n 
B 1 33 LEU 33 74  74  LEU LEU B . n 
B 1 34 GLU 34 75  75  GLU GLU B . n 
B 1 35 LEU 35 76  76  LEU LEU B . n 
B 1 36 ALA 36 77  77  ALA ALA B . n 
B 1 37 GLN 37 78  78  GLN GLN B . n 
B 1 38 SER 38 79  79  SER SER B . n 
B 1 39 LYS 39 80  80  LYS LYS B . n 
B 1 40 GLU 40 81  81  GLU GLU B . n 
B 1 41 SER 41 82  82  SER SER B . n 
B 1 42 LYS 42 83  83  LYS LYS B . n 
B 1 43 LEU 43 84  84  LEU LEU B . n 
B 1 44 LEU 44 85  85  LEU LEU B . n 
B 1 45 GLU 45 86  86  GLU GLU B . n 
B 1 46 ASN 46 87  87  ASN ASN B . n 
B 1 47 LEU 47 88  88  LEU LEU B . n 
B 1 48 ASN 48 89  89  ASN ASN B . n 
B 1 49 LEU 49 90  90  LEU LEU B . n 
B 1 50 LEU 50 91  91  LEU LEU B . n 
B 1 51 LYS 51 92  92  LYS LYS B . n 
B 1 52 ASN 52 93  93  ASN ASN B . n 
B 1 53 GLU 53 94  94  GLU GLU B . n 
B 1 54 ASN 54 95  95  ASN ASN B . n 
B 1 55 GLU 55 96  96  GLU GLU B . n 
B 1 56 ASN 56 97  97  ASN ASN B . n 
B 1 57 LEU 57 98  98  LEU LEU B . n 
B 1 58 ASN 58 99  99  ASN ASN B . n 
B 1 59 SER 59 100 100 SER SER B . n 
B 1 60 ILE 60 101 101 ILE ILE B . n 
B 1 61 PHE 61 102 102 PHE PHE B . n 
B 1 62 GLU 62 103 103 GLU GLU B . n 
B 1 63 ARG 63 104 104 ARG ARG B . n 
B 1 64 LYS 64 105 105 LYS LYS B . n 
B 1 65 ASN 65 106 106 ASN ASN B . n 
B 1 66 LYS 66 107 107 LYS LYS B . n 
B 1 67 LYS 67 108 108 LYS LYS B . n 
B 1 68 LEU 68 109 109 LEU LEU B . n 
B 1 69 LYS 69 110 110 LYS LYS B . n 
B 1 70 GLU 70 111 111 GLU GLU B . n 
B 1 71 LEU 71 112 112 LEU LEU B . n 
B 1 72 GLU 72 113 113 GLU GLU B . n 
B 1 73 LYS 73 114 114 LYS LYS B . n 
B 1 74 ASP 74 115 115 ASP ASP B . n 
B 1 75 TYR 75 116 116 TYR TYR B . n 
B 1 76 SER 76 117 117 SER SER B . n 
B 1 77 GLU 77 118 118 GLU GLU B . n 
B 1 78 LEU 78 119 119 LEU LEU B . n 
B 1 79 SER 79 120 120 SER SER B . n 
B 1 80 ASN 80 121 121 ASN ASN B . n 
B 1 81 ARG 81 122 122 ARG ARG B . n 
B 1 82 TYR 82 123 123 TYR TYR B . n 
B 1 83 ASN 83 124 124 ASN ASN B . n 
B 1 84 GLU 84 125 125 GLU GLU B . n 
B 1 85 GLN 85 126 126 GLN GLN B . n 
B 1 86 LYS 86 127 127 LYS LYS B . n 
B 1 87 GLU 87 128 128 GLU GLU B . n 
B 1 88 LYS 88 129 129 LYS LYS B . n 
B 1 89 MET 89 130 130 MET MET B . n 
B 1 90 ASP 90 131 131 ASP ASP B . n 
B 1 91 GLN 91 132 132 GLN GLN B . n 
B 1 92 LEU 92 133 133 LEU LEU B . n 
B 1 93 SER 93 134 134 SER SER B . n 
B 1 94 LYS 94 135 135 LYS LYS B . n 
B 1 95 LEU 95 136 136 LEU LEU B . n 
B 1 96 ALA 96 137 ?   ?   ?   B . n 
C 1 1  SER 1  42  ?   ?   ?   C . n 
C 1 2  SER 2  43  ?   ?   ?   C . n 
C 1 3  ARG 3  44  ?   ?   ?   C . n 
C 1 4  VAL 4  45  ?   ?   ?   C . n 
C 1 5  ILE 5  46  46  ILE ILE C . n 
C 1 6  GLU 6  47  47  GLU GLU C . n 
C 1 7  SER 7  48  48  SER SER C . n 
C 1 8  LEU 8  49  49  LEU LEU C . n 
C 1 9  HIS 9  50  50  HIS HIS C . n 
C 1 10 ASP 10 51  51  ASP ASP C . n 
C 1 11 GLN 11 52  52  GLN GLN C . n 
C 1 12 ILE 12 53  53  ILE ILE C . n 
C 1 13 ASP 13 54  54  ASP ASP C . n 
C 1 14 MET 14 55  55  MET MET C . n 
C 1 15 LEU 15 56  56  LEU LEU C . n 
C 1 16 THR 16 57  57  THR THR C . n 
C 1 17 LYS 17 58  58  LYS LYS C . n 
C 1 18 THR 18 59  59  THR THR C . n 
C 1 19 ASN 19 60  60  ASN ASN C . n 
C 1 20 LEU 20 61  61  LEU LEU C . n 
C 1 21 GLN 21 62  62  GLN GLN C . n 
C 1 22 LEU 22 63  63  LEU LEU C . n 
C 1 23 THR 23 64  64  THR THR C . n 
C 1 24 THR 24 65  65  THR THR C . n 
C 1 25 GLN 25 66  66  GLN GLN C . n 
C 1 26 SER 26 67  67  SER SER C . n 
C 1 27 GLN 27 68  68  GLN GLN C . n 
C 1 28 ASN 28 69  69  ASN ASN C . n 
C 1 29 LEU 29 70  70  LEU LEU C . n 
C 1 30 LEU 30 71  71  LEU LEU C . n 
C 1 31 SER 31 72  72  SER SER C . n 
C 1 32 LYS 32 73  73  LYS LYS C . n 
C 1 33 LEU 33 74  74  LEU LEU C . n 
C 1 34 GLU 34 75  75  GLU GLU C . n 
C 1 35 LEU 35 76  76  LEU LEU C . n 
C 1 36 ALA 36 77  77  ALA ALA C . n 
C 1 37 GLN 37 78  78  GLN GLN C . n 
C 1 38 SER 38 79  79  SER SER C . n 
C 1 39 LYS 39 80  80  LYS LYS C . n 
C 1 40 GLU 40 81  81  GLU GLU C . n 
C 1 41 SER 41 82  82  SER SER C . n 
C 1 42 LYS 42 83  83  LYS LYS C . n 
C 1 43 LEU 43 84  84  LEU LEU C . n 
C 1 44 LEU 44 85  85  LEU LEU C . n 
C 1 45 GLU 45 86  86  GLU GLU C . n 
C 1 46 ASN 46 87  87  ASN ASN C . n 
C 1 47 LEU 47 88  88  LEU LEU C . n 
C 1 48 ASN 48 89  89  ASN ASN C . n 
C 1 49 LEU 49 90  90  LEU LEU C . n 
C 1 50 LEU 50 91  91  LEU LEU C . n 
C 1 51 LYS 51 92  92  LYS LYS C . n 
C 1 52 ASN 52 93  93  ASN ASN C . n 
C 1 53 GLU 53 94  94  GLU GLU C . n 
C 1 54 ASN 54 95  95  ASN ASN C . n 
C 1 55 GLU 55 96  96  GLU GLU C . n 
C 1 56 ASN 56 97  97  ASN ASN C . n 
C 1 57 LEU 57 98  98  LEU LEU C . n 
C 1 58 ASN 58 99  99  ASN ASN C . n 
C 1 59 SER 59 100 100 SER SER C . n 
C 1 60 ILE 60 101 101 ILE ILE C . n 
C 1 61 PHE 61 102 102 PHE PHE C . n 
C 1 62 GLU 62 103 103 GLU GLU C . n 
C 1 63 ARG 63 104 104 ARG ARG C . n 
C 1 64 LYS 64 105 105 LYS LYS C . n 
C 1 65 ASN 65 106 106 ASN ASN C . n 
C 1 66 LYS 66 107 107 LYS LYS C . n 
C 1 67 LYS 67 108 108 LYS LYS C . n 
C 1 68 LEU 68 109 109 LEU LEU C . n 
C 1 69 LYS 69 110 110 LYS LYS C . n 
C 1 70 GLU 70 111 111 GLU GLU C . n 
C 1 71 LEU 71 112 112 LEU LEU C . n 
C 1 72 GLU 72 113 113 GLU GLU C . n 
C 1 73 LYS 73 114 114 LYS LYS C . n 
C 1 74 ASP 74 115 115 ASP ASP C . n 
C 1 75 TYR 75 116 116 TYR TYR C . n 
C 1 76 SER 76 117 117 SER SER C . n 
C 1 77 GLU 77 118 118 GLU GLU C . n 
C 1 78 LEU 78 119 119 LEU LEU C . n 
C 1 79 SER 79 120 120 SER SER C . n 
C 1 80 ASN 80 121 121 ASN ASN C . n 
C 1 81 ARG 81 122 122 ARG ARG C . n 
C 1 82 TYR 82 123 123 TYR TYR C . n 
C 1 83 ASN 83 124 124 ASN ASN C . n 
C 1 84 GLU 84 125 125 GLU GLU C . n 
C 1 85 GLN 85 126 126 GLN GLN C . n 
C 1 86 LYS 86 127 127 LYS LYS C . n 
C 1 87 GLU 87 128 128 GLU GLU C . n 
C 1 88 LYS 88 129 129 LYS LYS C . n 
C 1 89 MET 89 130 130 MET MET C . n 
C 1 90 ASP 90 131 131 ASP ASP C . n 
C 1 91 GLN 91 132 132 GLN GLN C . n 
C 1 92 LEU 92 133 133 LEU LEU C . n 
C 1 93 SER 93 134 134 SER SER C . n 
C 1 94 LYS 94 135 135 LYS LYS C . n 
C 1 95 LEU 95 136 ?   ?   ?   C . n 
C 1 96 ALA 96 137 ?   ?   ?   C . n 
D 1 1  SER 1  42  ?   ?   ?   D . n 
D 1 2  SER 2  43  ?   ?   ?   D . n 
D 1 3  ARG 3  44  ?   ?   ?   D . n 
D 1 4  VAL 4  45  ?   ?   ?   D . n 
D 1 5  ILE 5  46  46  ILE ILE D . n 
D 1 6  GLU 6  47  47  GLU GLU D . n 
D 1 7  SER 7  48  48  SER SER D . n 
D 1 8  LEU 8  49  49  LEU LEU D . n 
D 1 9  HIS 9  50  50  HIS HIS D . n 
D 1 10 ASP 10 51  51  ASP ASP D . n 
D 1 11 GLN 11 52  52  GLN GLN D . n 
D 1 12 ILE 12 53  53  ILE ILE D . n 
D 1 13 ASP 13 54  54  ASP ASP D . n 
D 1 14 MET 14 55  55  MET MET D . n 
D 1 15 LEU 15 56  56  LEU LEU D . n 
D 1 16 THR 16 57  57  THR THR D . n 
D 1 17 LYS 17 58  58  LYS LYS D . n 
D 1 18 THR 18 59  59  THR THR D . n 
D 1 19 ASN 19 60  60  ASN ASN D . n 
D 1 20 LEU 20 61  61  LEU LEU D . n 
D 1 21 GLN 21 62  62  GLN GLN D . n 
D 1 22 LEU 22 63  63  LEU LEU D . n 
D 1 23 THR 23 64  64  THR THR D . n 
D 1 24 THR 24 65  65  THR THR D . n 
D 1 25 GLN 25 66  66  GLN GLN D . n 
D 1 26 SER 26 67  67  SER SER D . n 
D 1 27 GLN 27 68  68  GLN GLN D . n 
D 1 28 ASN 28 69  69  ASN ASN D . n 
D 1 29 LEU 29 70  70  LEU LEU D . n 
D 1 30 LEU 30 71  71  LEU LEU D . n 
D 1 31 SER 31 72  72  SER SER D . n 
D 1 32 LYS 32 73  73  LYS LYS D . n 
D 1 33 LEU 33 74  74  LEU LEU D . n 
D 1 34 GLU 34 75  75  GLU GLU D . n 
D 1 35 LEU 35 76  76  LEU LEU D . n 
D 1 36 ALA 36 77  77  ALA ALA D . n 
D 1 37 GLN 37 78  78  GLN GLN D . n 
D 1 38 SER 38 79  79  SER SER D . n 
D 1 39 LYS 39 80  80  LYS LYS D . n 
D 1 40 GLU 40 81  81  GLU GLU D . n 
D 1 41 SER 41 82  82  SER SER D . n 
D 1 42 LYS 42 83  83  LYS LYS D . n 
D 1 43 LEU 43 84  84  LEU LEU D . n 
D 1 44 LEU 44 85  85  LEU LEU D . n 
D 1 45 GLU 45 86  86  GLU GLU D . n 
D 1 46 ASN 46 87  87  ASN ASN D . n 
D 1 47 LEU 47 88  88  LEU LEU D . n 
D 1 48 ASN 48 89  89  ASN ASN D . n 
D 1 49 LEU 49 90  90  LEU LEU D . n 
D 1 50 LEU 50 91  91  LEU LEU D . n 
D 1 51 LYS 51 92  92  LYS LYS D . n 
D 1 52 ASN 52 93  93  ASN ASN D . n 
D 1 53 GLU 53 94  94  GLU GLU D . n 
D 1 54 ASN 54 95  95  ASN ASN D . n 
D 1 55 GLU 55 96  96  GLU GLU D . n 
D 1 56 ASN 56 97  97  ASN ASN D . n 
D 1 57 LEU 57 98  98  LEU LEU D . n 
D 1 58 ASN 58 99  99  ASN ASN D . n 
D 1 59 SER 59 100 100 SER SER D . n 
D 1 60 ILE 60 101 101 ILE ILE D . n 
D 1 61 PHE 61 102 102 PHE PHE D . n 
D 1 62 GLU 62 103 103 GLU GLU D . n 
D 1 63 ARG 63 104 104 ARG ARG D . n 
D 1 64 LYS 64 105 105 LYS LYS D . n 
D 1 65 ASN 65 106 106 ASN ASN D . n 
D 1 66 LYS 66 107 107 LYS LYS D . n 
D 1 67 LYS 67 108 108 LYS LYS D . n 
D 1 68 LEU 68 109 109 LEU LEU D . n 
D 1 69 LYS 69 110 110 LYS LYS D . n 
D 1 70 GLU 70 111 111 GLU GLU D . n 
D 1 71 LEU 71 112 112 LEU LEU D . n 
D 1 72 GLU 72 113 113 GLU GLU D . n 
D 1 73 LYS 73 114 114 LYS LYS D . n 
D 1 74 ASP 74 115 115 ASP ASP D . n 
D 1 75 TYR 75 116 116 TYR TYR D . n 
D 1 76 SER 76 117 117 SER SER D . n 
D 1 77 GLU 77 118 118 GLU GLU D . n 
D 1 78 LEU 78 119 119 LEU LEU D . n 
D 1 79 SER 79 120 120 SER SER D . n 
D 1 80 ASN 80 121 121 ASN ASN D . n 
D 1 81 ARG 81 122 122 ARG ARG D . n 
D 1 82 TYR 82 123 123 TYR TYR D . n 
D 1 83 ASN 83 124 124 ASN ASN D . n 
D 1 84 GLU 84 125 125 GLU GLU D . n 
D 1 85 GLN 85 126 126 GLN GLN D . n 
D 1 86 LYS 86 127 127 LYS LYS D . n 
D 1 87 GLU 87 128 128 GLU GLU D . n 
D 1 88 LYS 88 129 129 LYS LYS D . n 
D 1 89 MET 89 130 130 MET MET D . n 
D 1 90 ASP 90 131 131 ASP ASP D . n 
D 1 91 GLN 91 132 132 GLN GLN D . n 
D 1 92 LEU 92 133 133 LEU LEU D . n 
D 1 93 SER 93 134 134 SER SER D . n 
D 1 94 LYS 94 135 135 LYS LYS D . n 
D 1 95 LEU 95 136 136 LEU LEU D . n 
D 1 96 ALA 96 137 ?   ?   ?   D . n 
E 1 1  SER 1  42  ?   ?   ?   E . n 
E 1 2  SER 2  43  ?   ?   ?   E . n 
E 1 3  ARG 3  44  ?   ?   ?   E . n 
E 1 4  VAL 4  45  ?   ?   ?   E . n 
E 1 5  ILE 5  46  ?   ?   ?   E . n 
E 1 6  GLU 6  47  47  GLU GLU E . n 
E 1 7  SER 7  48  48  SER SER E . n 
E 1 8  LEU 8  49  49  LEU LEU E . n 
E 1 9  HIS 9  50  50  HIS HIS E . n 
E 1 10 ASP 10 51  51  ASP ASP E . n 
E 1 11 GLN 11 52  52  GLN GLN E . n 
E 1 12 ILE 12 53  53  ILE ILE E . n 
E 1 13 ASP 13 54  54  ASP ASP E . n 
E 1 14 MET 14 55  55  MET MET E . n 
E 1 15 LEU 15 56  56  LEU LEU E . n 
E 1 16 THR 16 57  57  THR THR E . n 
E 1 17 LYS 17 58  58  LYS LYS E . n 
E 1 18 THR 18 59  59  THR THR E . n 
E 1 19 ASN 19 60  60  ASN ASN E . n 
E 1 20 LEU 20 61  61  LEU LEU E . n 
E 1 21 GLN 21 62  62  GLN GLN E . n 
E 1 22 LEU 22 63  63  LEU LEU E . n 
E 1 23 THR 23 64  64  THR THR E . n 
E 1 24 THR 24 65  65  THR THR E . n 
E 1 25 GLN 25 66  66  GLN GLN E . n 
E 1 26 SER 26 67  67  SER SER E . n 
E 1 27 GLN 27 68  68  GLN GLN E . n 
E 1 28 ASN 28 69  69  ASN ASN E . n 
E 1 29 LEU 29 70  70  LEU LEU E . n 
E 1 30 LEU 30 71  71  LEU LEU E . n 
E 1 31 SER 31 72  72  SER SER E . n 
E 1 32 LYS 32 73  73  LYS LYS E . n 
E 1 33 LEU 33 74  74  LEU LEU E . n 
E 1 34 GLU 34 75  75  GLU GLU E . n 
E 1 35 LEU 35 76  76  LEU LEU E . n 
E 1 36 ALA 36 77  77  ALA ALA E . n 
E 1 37 GLN 37 78  78  GLN GLN E . n 
E 1 38 SER 38 79  79  SER SER E . n 
E 1 39 LYS 39 80  80  LYS LYS E . n 
E 1 40 GLU 40 81  81  GLU GLU E . n 
E 1 41 SER 41 82  82  SER SER E . n 
E 1 42 LYS 42 83  83  LYS LYS E . n 
E 1 43 LEU 43 84  84  LEU LEU E . n 
E 1 44 LEU 44 85  85  LEU LEU E . n 
E 1 45 GLU 45 86  86  GLU GLU E . n 
E 1 46 ASN 46 87  87  ASN ASN E . n 
E 1 47 LEU 47 88  88  LEU LEU E . n 
E 1 48 ASN 48 89  89  ASN ASN E . n 
E 1 49 LEU 49 90  90  LEU LEU E . n 
E 1 50 LEU 50 91  91  LEU LEU E . n 
E 1 51 LYS 51 92  92  LYS LYS E . n 
E 1 52 ASN 52 93  93  ASN ASN E . n 
E 1 53 GLU 53 94  94  GLU GLU E . n 
E 1 54 ASN 54 95  95  ASN ASN E . n 
E 1 55 GLU 55 96  96  GLU GLU E . n 
E 1 56 ASN 56 97  97  ASN ASN E . n 
E 1 57 LEU 57 98  98  LEU LEU E . n 
E 1 58 ASN 58 99  99  ASN ASN E . n 
E 1 59 SER 59 100 100 SER SER E . n 
E 1 60 ILE 60 101 101 ILE ILE E . n 
E 1 61 PHE 61 102 102 PHE PHE E . n 
E 1 62 GLU 62 103 103 GLU GLU E . n 
E 1 63 ARG 63 104 104 ARG ARG E . n 
E 1 64 LYS 64 105 105 LYS LYS E . n 
E 1 65 ASN 65 106 106 ASN ASN E . n 
E 1 66 LYS 66 107 107 LYS LYS E . n 
E 1 67 LYS 67 108 108 LYS LYS E . n 
E 1 68 LEU 68 109 109 LEU LEU E . n 
E 1 69 LYS 69 110 110 LYS LYS E . n 
E 1 70 GLU 70 111 111 GLU GLU E . n 
E 1 71 LEU 71 112 112 LEU LEU E . n 
E 1 72 GLU 72 113 113 GLU GLU E . n 
E 1 73 LYS 73 114 114 LYS LYS E . n 
E 1 74 ASP 74 115 115 ASP ASP E . n 
E 1 75 TYR 75 116 116 TYR TYR E . n 
E 1 76 SER 76 117 117 SER SER E . n 
E 1 77 GLU 77 118 118 GLU GLU E . n 
E 1 78 LEU 78 119 119 LEU LEU E . n 
E 1 79 SER 79 120 120 SER SER E . n 
E 1 80 ASN 80 121 121 ASN ASN E . n 
E 1 81 ARG 81 122 122 ARG ARG E . n 
E 1 82 TYR 82 123 123 TYR TYR E . n 
E 1 83 ASN 83 124 124 ASN ASN E . n 
E 1 84 GLU 84 125 125 GLU GLU E . n 
E 1 85 GLN 85 126 126 GLN GLN E . n 
E 1 86 LYS 86 127 127 LYS LYS E . n 
E 1 87 GLU 87 128 128 GLU GLU E . n 
E 1 88 LYS 88 129 129 LYS LYS E . n 
E 1 89 MET 89 130 130 MET MET E . n 
E 1 90 ASP 90 131 131 ASP ASP E . n 
E 1 91 GLN 91 132 132 GLN GLN E . n 
E 1 92 LEU 92 133 133 LEU LEU E . n 
E 1 93 SER 93 134 134 SER SER E . n 
E 1 94 LYS 94 135 135 LYS LYS E . n 
E 1 95 LEU 95 136 136 LEU LEU E . n 
E 1 96 ALA 96 137 ?   ?   ?   E . n 
F 1 1  SER 1  42  ?   ?   ?   F . n 
F 1 2  SER 2  43  ?   ?   ?   F . n 
F 1 3  ARG 3  44  ?   ?   ?   F . n 
F 1 4  VAL 4  45  ?   ?   ?   F . n 
F 1 5  ILE 5  46  46  ILE ILE F . n 
F 1 6  GLU 6  47  47  GLU GLU F . n 
F 1 7  SER 7  48  48  SER SER F . n 
F 1 8  LEU 8  49  49  LEU LEU F . n 
F 1 9  HIS 9  50  50  HIS HIS F . n 
F 1 10 ASP 10 51  51  ASP ASP F . n 
F 1 11 GLN 11 52  52  GLN GLN F . n 
F 1 12 ILE 12 53  53  ILE ILE F . n 
F 1 13 ASP 13 54  54  ASP ASP F . n 
F 1 14 MET 14 55  55  MET MET F . n 
F 1 15 LEU 15 56  56  LEU LEU F . n 
F 1 16 THR 16 57  57  THR THR F . n 
F 1 17 LYS 17 58  58  LYS LYS F . n 
F 1 18 THR 18 59  59  THR THR F . n 
F 1 19 ASN 19 60  60  ASN ASN F . n 
F 1 20 LEU 20 61  61  LEU LEU F . n 
F 1 21 GLN 21 62  62  GLN GLN F . n 
F 1 22 LEU 22 63  63  LEU LEU F . n 
F 1 23 THR 23 64  64  THR THR F . n 
F 1 24 THR 24 65  65  THR THR F . n 
F 1 25 GLN 25 66  66  GLN GLN F . n 
F 1 26 SER 26 67  67  SER SER F . n 
F 1 27 GLN 27 68  68  GLN GLN F . n 
F 1 28 ASN 28 69  69  ASN ASN F . n 
F 1 29 LEU 29 70  70  LEU LEU F . n 
F 1 30 LEU 30 71  71  LEU LEU F . n 
F 1 31 SER 31 72  72  SER SER F . n 
F 1 32 LYS 32 73  73  LYS LYS F . n 
F 1 33 LEU 33 74  74  LEU LEU F . n 
F 1 34 GLU 34 75  75  GLU GLU F . n 
F 1 35 LEU 35 76  76  LEU LEU F . n 
F 1 36 ALA 36 77  77  ALA ALA F . n 
F 1 37 GLN 37 78  78  GLN GLN F . n 
F 1 38 SER 38 79  79  SER SER F . n 
F 1 39 LYS 39 80  80  LYS LYS F . n 
F 1 40 GLU 40 81  81  GLU GLU F . n 
F 1 41 SER 41 82  82  SER SER F . n 
F 1 42 LYS 42 83  83  LYS LYS F . n 
F 1 43 LEU 43 84  84  LEU LEU F . n 
F 1 44 LEU 44 85  85  LEU LEU F . n 
F 1 45 GLU 45 86  86  GLU GLU F . n 
F 1 46 ASN 46 87  87  ASN ASN F . n 
F 1 47 LEU 47 88  88  LEU LEU F . n 
F 1 48 ASN 48 89  89  ASN ASN F . n 
F 1 49 LEU 49 90  90  LEU LEU F . n 
F 1 50 LEU 50 91  91  LEU LEU F . n 
F 1 51 LYS 51 92  92  LYS LYS F . n 
F 1 52 ASN 52 93  93  ASN ASN F . n 
F 1 53 GLU 53 94  94  GLU GLU F . n 
F 1 54 ASN 54 95  95  ASN ASN F . n 
F 1 55 GLU 55 96  96  GLU GLU F . n 
F 1 56 ASN 56 97  97  ASN ASN F . n 
F 1 57 LEU 57 98  98  LEU LEU F . n 
F 1 58 ASN 58 99  99  ASN ASN F . n 
F 1 59 SER 59 100 100 SER SER F . n 
F 1 60 ILE 60 101 101 ILE ILE F . n 
F 1 61 PHE 61 102 102 PHE PHE F . n 
F 1 62 GLU 62 103 103 GLU GLU F . n 
F 1 63 ARG 63 104 104 ARG ARG F . n 
F 1 64 LYS 64 105 105 LYS LYS F . n 
F 1 65 ASN 65 106 106 ASN ASN F . n 
F 1 66 LYS 66 107 107 LYS LYS F . n 
F 1 67 LYS 67 108 108 LYS LYS F . n 
F 1 68 LEU 68 109 109 LEU LEU F . n 
F 1 69 LYS 69 110 110 LYS LYS F . n 
F 1 70 GLU 70 111 111 GLU GLU F . n 
F 1 71 LEU 71 112 112 LEU LEU F . n 
F 1 72 GLU 72 113 113 GLU GLU F . n 
F 1 73 LYS 73 114 114 LYS LYS F . n 
F 1 74 ASP 74 115 115 ASP ASP F . n 
F 1 75 TYR 75 116 116 TYR TYR F . n 
F 1 76 SER 76 117 117 SER SER F . n 
F 1 77 GLU 77 118 118 GLU GLU F . n 
F 1 78 LEU 78 119 119 LEU LEU F . n 
F 1 79 SER 79 120 120 SER SER F . n 
F 1 80 ASN 80 121 121 ASN ASN F . n 
F 1 81 ARG 81 122 122 ARG ARG F . n 
F 1 82 TYR 82 123 123 TYR TYR F . n 
F 1 83 ASN 83 124 124 ASN ASN F . n 
F 1 84 GLU 84 125 125 GLU GLU F . n 
F 1 85 GLN 85 126 126 GLN GLN F . n 
F 1 86 LYS 86 127 127 LYS LYS F . n 
F 1 87 GLU 87 128 128 GLU GLU F . n 
F 1 88 LYS 88 129 129 LYS LYS F . n 
F 1 89 MET 89 130 130 MET MET F . n 
F 1 90 ASP 90 131 131 ASP ASP F . n 
F 1 91 GLN 91 132 132 GLN GLN F . n 
F 1 92 LEU 92 133 133 LEU LEU F . n 
F 1 93 SER 93 134 134 SER SER F . n 
F 1 94 LYS 94 135 135 LYS LYS F . n 
F 1 95 LEU 95 136 136 LEU LEU F . n 
F 1 96 ALA 96 137 ?   ?   ?   F . n 
G 1 1  SER 1  42  ?   ?   ?   G . n 
G 1 2  SER 2  43  ?   ?   ?   G . n 
G 1 3  ARG 3  44  ?   ?   ?   G . n 
G 1 4  VAL 4  45  ?   ?   ?   G . n 
G 1 5  ILE 5  46  ?   ?   ?   G . n 
G 1 6  GLU 6  47  ?   ?   ?   G . n 
G 1 7  SER 7  48  ?   ?   ?   G . n 
G 1 8  LEU 8  49  ?   ?   ?   G . n 
G 1 9  HIS 9  50  50  HIS HIS G . n 
G 1 10 ASP 10 51  51  ASP ASP G . n 
G 1 11 GLN 11 52  52  GLN GLN G . n 
G 1 12 ILE 12 53  53  ILE ILE G . n 
G 1 13 ASP 13 54  54  ASP ASP G . n 
G 1 14 MET 14 55  55  MET MET G . n 
G 1 15 LEU 15 56  56  LEU LEU G . n 
G 1 16 THR 16 57  57  THR THR G . n 
G 1 17 LYS 17 58  58  LYS LYS G . n 
G 1 18 THR 18 59  59  THR THR G . n 
G 1 19 ASN 19 60  60  ASN ASN G . n 
G 1 20 LEU 20 61  61  LEU LEU G . n 
G 1 21 GLN 21 62  62  GLN GLN G . n 
G 1 22 LEU 22 63  63  LEU LEU G . n 
G 1 23 THR 23 64  64  THR THR G . n 
G 1 24 THR 24 65  65  THR THR G . n 
G 1 25 GLN 25 66  66  GLN GLN G . n 
G 1 26 SER 26 67  67  SER SER G . n 
G 1 27 GLN 27 68  68  GLN GLN G . n 
G 1 28 ASN 28 69  69  ASN ASN G . n 
G 1 29 LEU 29 70  70  LEU LEU G . n 
G 1 30 LEU 30 71  71  LEU LEU G . n 
G 1 31 SER 31 72  72  SER SER G . n 
G 1 32 LYS 32 73  73  LYS LYS G . n 
G 1 33 LEU 33 74  74  LEU LEU G . n 
G 1 34 GLU 34 75  75  GLU GLU G . n 
G 1 35 LEU 35 76  76  LEU LEU G . n 
G 1 36 ALA 36 77  77  ALA ALA G . n 
G 1 37 GLN 37 78  78  GLN GLN G . n 
G 1 38 SER 38 79  79  SER SER G . n 
G 1 39 LYS 39 80  80  LYS LYS G . n 
G 1 40 GLU 40 81  81  GLU GLU G . n 
G 1 41 SER 41 82  82  SER SER G . n 
G 1 42 LYS 42 83  83  LYS LYS G . n 
G 1 43 LEU 43 84  84  LEU LEU G . n 
G 1 44 LEU 44 85  85  LEU LEU G . n 
G 1 45 GLU 45 86  86  GLU GLU G . n 
G 1 46 ASN 46 87  87  ASN ASN G . n 
G 1 47 LEU 47 88  88  LEU LEU G . n 
G 1 48 ASN 48 89  89  ASN ASN G . n 
G 1 49 LEU 49 90  90  LEU LEU G . n 
G 1 50 LEU 50 91  91  LEU LEU G . n 
G 1 51 LYS 51 92  92  LYS LYS G . n 
G 1 52 ASN 52 93  93  ASN ASN G . n 
G 1 53 GLU 53 94  94  GLU GLU G . n 
G 1 54 ASN 54 95  95  ASN ASN G . n 
G 1 55 GLU 55 96  96  GLU GLU G . n 
G 1 56 ASN 56 97  97  ASN ASN G . n 
G 1 57 LEU 57 98  98  LEU LEU G . n 
G 1 58 ASN 58 99  99  ASN ASN G . n 
G 1 59 SER 59 100 100 SER SER G . n 
G 1 60 ILE 60 101 101 ILE ILE G . n 
G 1 61 PHE 61 102 102 PHE PHE G . n 
G 1 62 GLU 62 103 103 GLU GLU G . n 
G 1 63 ARG 63 104 104 ARG ARG G . n 
G 1 64 LYS 64 105 105 LYS LYS G . n 
G 1 65 ASN 65 106 106 ASN ASN G . n 
G 1 66 LYS 66 107 107 LYS LYS G . n 
G 1 67 LYS 67 108 108 LYS LYS G . n 
G 1 68 LEU 68 109 109 LEU LEU G . n 
G 1 69 LYS 69 110 110 LYS LYS G . n 
G 1 70 GLU 70 111 111 GLU GLU G . n 
G 1 71 LEU 71 112 112 LEU LEU G . n 
G 1 72 GLU 72 113 113 GLU GLU G . n 
G 1 73 LYS 73 114 114 LYS LYS G . n 
G 1 74 ASP 74 115 115 ASP ASP G . n 
G 1 75 TYR 75 116 116 TYR TYR G . n 
G 1 76 SER 76 117 117 SER SER G . n 
G 1 77 GLU 77 118 118 GLU GLU G . n 
G 1 78 LEU 78 119 119 LEU LEU G . n 
G 1 79 SER 79 120 120 SER SER G . n 
G 1 80 ASN 80 121 121 ASN ASN G . n 
G 1 81 ARG 81 122 122 ARG ARG G . n 
G 1 82 TYR 82 123 123 TYR TYR G . n 
G 1 83 ASN 83 124 124 ASN ASN G . n 
G 1 84 GLU 84 125 125 GLU GLU G . n 
G 1 85 GLN 85 126 126 GLN GLN G . n 
G 1 86 LYS 86 127 127 LYS LYS G . n 
G 1 87 GLU 87 128 128 GLU GLU G . n 
G 1 88 LYS 88 129 129 LYS LYS G . n 
G 1 89 MET 89 130 130 MET MET G . n 
G 1 90 ASP 90 131 131 ASP ASP G . n 
G 1 91 GLN 91 132 132 GLN GLN G . n 
G 1 92 LEU 92 133 133 LEU LEU G . n 
G 1 93 SER 93 134 134 SER SER G . n 
G 1 94 LYS 94 135 135 LYS LYS G . n 
G 1 95 LEU 95 136 136 LEU LEU G . n 
G 1 96 ALA 96 137 ?   ?   ?   G . n 
H 1 1  SER 1  42  ?   ?   ?   H . n 
H 1 2  SER 2  43  ?   ?   ?   H . n 
H 1 3  ARG 3  44  ?   ?   ?   H . n 
H 1 4  VAL 4  45  ?   ?   ?   H . n 
H 1 5  ILE 5  46  46  ILE ILE H . n 
H 1 6  GLU 6  47  47  GLU GLU H . n 
H 1 7  SER 7  48  48  SER SER H . n 
H 1 8  LEU 8  49  49  LEU LEU H . n 
H 1 9  HIS 9  50  50  HIS HIS H . n 
H 1 10 ASP 10 51  51  ASP ASP H . n 
H 1 11 GLN 11 52  52  GLN GLN H . n 
H 1 12 ILE 12 53  53  ILE ILE H . n 
H 1 13 ASP 13 54  54  ASP ASP H . n 
H 1 14 MET 14 55  55  MET MET H . n 
H 1 15 LEU 15 56  56  LEU LEU H . n 
H 1 16 THR 16 57  57  THR THR H . n 
H 1 17 LYS 17 58  58  LYS LYS H . n 
H 1 18 THR 18 59  59  THR THR H . n 
H 1 19 ASN 19 60  60  ASN ASN H . n 
H 1 20 LEU 20 61  61  LEU LEU H . n 
H 1 21 GLN 21 62  62  GLN GLN H . n 
H 1 22 LEU 22 63  63  LEU LEU H . n 
H 1 23 THR 23 64  64  THR THR H . n 
H 1 24 THR 24 65  65  THR THR H . n 
H 1 25 GLN 25 66  66  GLN GLN H . n 
H 1 26 SER 26 67  67  SER SER H . n 
H 1 27 GLN 27 68  68  GLN GLN H . n 
H 1 28 ASN 28 69  69  ASN ASN H . n 
H 1 29 LEU 29 70  70  LEU LEU H . n 
H 1 30 LEU 30 71  71  LEU LEU H . n 
H 1 31 SER 31 72  72  SER SER H . n 
H 1 32 LYS 32 73  73  LYS LYS H . n 
H 1 33 LEU 33 74  74  LEU LEU H . n 
H 1 34 GLU 34 75  75  GLU GLU H . n 
H 1 35 LEU 35 76  76  LEU LEU H . n 
H 1 36 ALA 36 77  77  ALA ALA H . n 
H 1 37 GLN 37 78  78  GLN GLN H . n 
H 1 38 SER 38 79  79  SER SER H . n 
H 1 39 LYS 39 80  80  LYS LYS H . n 
H 1 40 GLU 40 81  81  GLU GLU H . n 
H 1 41 SER 41 82  82  SER SER H . n 
H 1 42 LYS 42 83  83  LYS LYS H . n 
H 1 43 LEU 43 84  84  LEU LEU H . n 
H 1 44 LEU 44 85  85  LEU LEU H . n 
H 1 45 GLU 45 86  86  GLU GLU H . n 
H 1 46 ASN 46 87  87  ASN ASN H . n 
H 1 47 LEU 47 88  88  LEU LEU H . n 
H 1 48 ASN 48 89  89  ASN ASN H . n 
H 1 49 LEU 49 90  90  LEU LEU H . n 
H 1 50 LEU 50 91  91  LEU LEU H . n 
H 1 51 LYS 51 92  92  LYS LYS H . n 
H 1 52 ASN 52 93  93  ASN ASN H . n 
H 1 53 GLU 53 94  94  GLU GLU H . n 
H 1 54 ASN 54 95  95  ASN ASN H . n 
H 1 55 GLU 55 96  96  GLU GLU H . n 
H 1 56 ASN 56 97  97  ASN ASN H . n 
H 1 57 LEU 57 98  98  LEU LEU H . n 
H 1 58 ASN 58 99  99  ASN ASN H . n 
H 1 59 SER 59 100 100 SER SER H . n 
H 1 60 ILE 60 101 101 ILE ILE H . n 
H 1 61 PHE 61 102 102 PHE PHE H . n 
H 1 62 GLU 62 103 103 GLU GLU H . n 
H 1 63 ARG 63 104 104 ARG ARG H . n 
H 1 64 LYS 64 105 105 LYS LYS H . n 
H 1 65 ASN 65 106 106 ASN ASN H . n 
H 1 66 LYS 66 107 107 LYS LYS H . n 
H 1 67 LYS 67 108 108 LYS LYS H . n 
H 1 68 LEU 68 109 109 LEU LEU H . n 
H 1 69 LYS 69 110 110 LYS LYS H . n 
H 1 70 GLU 70 111 111 GLU GLU H . n 
H 1 71 LEU 71 112 112 LEU LEU H . n 
H 1 72 GLU 72 113 113 GLU GLU H . n 
H 1 73 LYS 73 114 114 LYS LYS H . n 
H 1 74 ASP 74 115 115 ASP ASP H . n 
H 1 75 TYR 75 116 116 TYR TYR H . n 
H 1 76 SER 76 117 117 SER SER H . n 
H 1 77 GLU 77 118 118 GLU GLU H . n 
H 1 78 LEU 78 119 119 LEU LEU H . n 
H 1 79 SER 79 120 120 SER SER H . n 
H 1 80 ASN 80 121 121 ASN ASN H . n 
H 1 81 ARG 81 122 122 ARG ARG H . n 
H 1 82 TYR 82 123 123 TYR TYR H . n 
H 1 83 ASN 83 124 124 ASN ASN H . n 
H 1 84 GLU 84 125 125 GLU GLU H . n 
H 1 85 GLN 85 126 126 GLN GLN H . n 
H 1 86 LYS 86 127 127 LYS LYS H . n 
H 1 87 GLU 87 128 128 GLU GLU H . n 
H 1 88 LYS 88 129 129 LYS LYS H . n 
H 1 89 MET 89 130 130 MET MET H . n 
H 1 90 ASP 90 131 131 ASP ASP H . n 
H 1 91 GLN 91 132 132 GLN GLN H . n 
H 1 92 LEU 92 133 133 LEU LEU H . n 
H 1 93 SER 93 134 134 SER SER H . n 
H 1 94 LYS 94 135 135 LYS LYS H . n 
H 1 95 LEU 95 136 136 LEU LEU H . n 
H 1 96 ALA 96 137 ?   ?   ?   H . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I  2 DY  1  201 3   DY  DY  A . 
J  2 DY  1  202 11  DY  DY  A . 
K  2 DY  1  203 19  DY  DY  A . 
L  2 DY  1  204 21  DY  DY  A . 
M  3 SO4 1  205 6   SO4 SO4 A . 
N  3 SO4 1  206 10  SO4 SO4 A . 
O  3 SO4 1  207 14  SO4 SO4 A . 
P  3 SO4 1  208 15  SO4 SO4 A . 
Q  3 SO4 1  209 21  SO4 SO4 A . 
R  3 SO4 1  210 22  SO4 SO4 A . 
S  4 PT  1  211 2   PT  PT  A . 
T  5 DTT 1  212 1   DTT DTT A . 
U  2 DY  1  201 5   DY  DY  B . 
V  2 DY  1  202 9   DY  DY  B . 
W  2 DY  1  203 22  DY  DY  B . 
X  3 SO4 1  204 3   SO4 SO4 B . 
Y  3 SO4 1  205 8   SO4 SO4 B . 
Z  3 SO4 1  206 9   SO4 SO4 B . 
AA 3 SO4 1  207 19  SO4 SO4 B . 
BA 4 PT  1  208 5   PT  PT  B . 
CA 6 EDO 1  209 1   EDO EDO B . 
DA 2 DY  1  201 1   DY  DY  C . 
EA 2 DY  1  202 4   DY  DY  C . 
FA 2 DY  1  203 26  DY  DY  C . 
GA 3 SO4 1  204 7   SO4 SO4 C . 
HA 3 SO4 1  205 13  SO4 SO4 C . 
IA 3 SO4 1  206 16  SO4 SO4 C . 
JA 3 SO4 1  207 24  SO4 SO4 C . 
KA 3 SO4 1  208 25  SO4 SO4 C . 
LA 3 SO4 1  209 27  SO4 SO4 C . 
MA 3 SO4 1  210 28  SO4 SO4 C . 
NA 4 PT  1  211 3   PT  PT  C . 
OA 7 IPA 1  212 4   IPA IPA C . 
PA 2 DY  1  201 6   DY  DY  D . 
QA 2 DY  1  202 17  DY  DY  D . 
RA 2 DY  1  203 18  DY  DY  D . 
SA 3 SO4 1  204 11  SO4 SO4 D . 
TA 3 SO4 1  205 12  SO4 SO4 D . 
UA 4 PT  1  206 1   PT  PT  D . 
VA 6 EDO 1  207 3   EDO EDO D . 
WA 6 EDO 1  208 4   EDO EDO D . 
XA 7 IPA 1  209 1   IPA IPA D . 
YA 2 DY  1  201 2   DY  DY  E . 
ZA 2 DY  1  202 13  DY  DY  E . 
AB 2 DY  1  203 20  DY  DY  E . 
BB 2 DY  1  204 24  DY  DY  E . 
CB 2 DY  1  205 25  DY  DY  E . 
DB 3 SO4 1  206 5   SO4 SO4 E . 
EB 4 PT  1  207 4   PT  PT  E . 
FB 6 EDO 1  208 2   EDO EDO E . 
GB 6 EDO 1  209 5   EDO EDO E . 
HB 7 IPA 1  210 6   IPA IPA E . 
IB 2 DY  1  201 8   DY  DY  F . 
JB 2 DY  1  202 15  DY  DY  F . 
KB 2 DY  1  203 23  DY  DY  F . 
LB 3 SO4 1  204 18  SO4 SO4 F . 
MB 6 EDO 1  205 7   EDO EDO F . 
NB 7 IPA 1  206 2   IPA IPA F . 
OB 7 IPA 1  207 3   IPA IPA F . 
PB 7 IPA 1  208 5   IPA IPA F . 
QB 2 DY  1  201 7   DY  DY  G . 
RB 2 DY  1  202 16  DY  DY  G . 
SB 3 SO4 1  203 1   SO4 SO4 G . 
TB 3 SO4 1  204 2   SO4 SO4 G . 
UB 3 SO4 1  205 17  SO4 SO4 G . 
VB 3 SO4 1  206 20  SO4 SO4 G . 
WB 3 SO4 1  207 23  SO4 SO4 G . 
XB 3 SO4 1  208 29  SO4 SO4 G . 
YB 4 PT  1  209 6   PT  PT  G . 
ZB 2 DY  1  201 10  DY  DY  H . 
AC 2 DY  1  202 12  DY  DY  H . 
BC 2 DY  1  203 14  DY  DY  H . 
CC 3 SO4 1  204 4   SO4 SO4 H . 
DC 3 SO4 1  205 26  SO4 SO4 H . 
EC 6 EDO 1  206 6   EDO EDO H . 
FC 8 HOH 1  301 3   HOH HOH A . 
FC 8 HOH 2  302 6   HOH HOH A . 
FC 8 HOH 3  303 17  HOH HOH A . 
FC 8 HOH 4  304 28  HOH HOH A . 
FC 8 HOH 5  305 63  HOH HOH A . 
FC 8 HOH 6  306 74  HOH HOH A . 
FC 8 HOH 7  307 77  HOH HOH A . 
FC 8 HOH 8  308 84  HOH HOH A . 
FC 8 HOH 9  309 86  HOH HOH A . 
FC 8 HOH 10 310 87  HOH HOH A . 
FC 8 HOH 11 311 92  HOH HOH A . 
FC 8 HOH 12 312 114 HOH HOH A . 
FC 8 HOH 13 313 117 HOH HOH A . 
FC 8 HOH 14 314 121 HOH HOH A . 
FC 8 HOH 15 315 125 HOH HOH A . 
FC 8 HOH 16 316 136 HOH HOH A . 
FC 8 HOH 17 317 179 HOH HOH A . 
FC 8 HOH 18 318 187 HOH HOH A . 
FC 8 HOH 19 319 190 HOH HOH A . 
FC 8 HOH 20 320 131 HOH HOH A . 
GC 8 HOH 1  301 10  HOH HOH B . 
GC 8 HOH 2  302 23  HOH HOH B . 
GC 8 HOH 3  303 30  HOH HOH B . 
GC 8 HOH 4  304 31  HOH HOH B . 
GC 8 HOH 5  305 41  HOH HOH B . 
GC 8 HOH 6  306 48  HOH HOH B . 
GC 8 HOH 7  307 57  HOH HOH B . 
GC 8 HOH 8  308 58  HOH HOH B . 
GC 8 HOH 9  309 65  HOH HOH B . 
GC 8 HOH 10 310 70  HOH HOH B . 
GC 8 HOH 11 311 71  HOH HOH B . 
GC 8 HOH 12 312 80  HOH HOH B . 
GC 8 HOH 13 313 82  HOH HOH B . 
GC 8 HOH 14 314 90  HOH HOH B . 
GC 8 HOH 15 315 97  HOH HOH B . 
GC 8 HOH 16 316 115 HOH HOH B . 
GC 8 HOH 17 317 119 HOH HOH B . 
GC 8 HOH 18 318 123 HOH HOH B . 
GC 8 HOH 19 319 124 HOH HOH B . 
GC 8 HOH 20 320 129 HOH HOH B . 
GC 8 HOH 21 321 132 HOH HOH B . 
GC 8 HOH 22 322 133 HOH HOH B . 
GC 8 HOH 23 323 152 HOH HOH B . 
GC 8 HOH 24 324 153 HOH HOH B . 
GC 8 HOH 25 325 155 HOH HOH B . 
GC 8 HOH 26 326 161 HOH HOH B . 
GC 8 HOH 27 327 164 HOH HOH B . 
GC 8 HOH 28 328 165 HOH HOH B . 
GC 8 HOH 29 329 168 HOH HOH B . 
GC 8 HOH 30 330 178 HOH HOH B . 
GC 8 HOH 31 331 183 HOH HOH B . 
GC 8 HOH 32 332 184 HOH HOH B . 
GC 8 HOH 33 333 191 HOH HOH B . 
GC 8 HOH 34 334 181 HOH HOH B . 
HC 8 HOH 1  301 2   HOH HOH C . 
HC 8 HOH 2  302 9   HOH HOH C . 
HC 8 HOH 3  303 25  HOH HOH C . 
HC 8 HOH 4  304 34  HOH HOH C . 
HC 8 HOH 5  305 35  HOH HOH C . 
HC 8 HOH 6  306 40  HOH HOH C . 
HC 8 HOH 7  307 44  HOH HOH C . 
HC 8 HOH 8  308 51  HOH HOH C . 
HC 8 HOH 9  309 56  HOH HOH C . 
HC 8 HOH 10 310 88  HOH HOH C . 
HC 8 HOH 11 311 89  HOH HOH C . 
HC 8 HOH 12 312 91  HOH HOH C . 
HC 8 HOH 13 313 94  HOH HOH C . 
HC 8 HOH 14 314 96  HOH HOH C . 
HC 8 HOH 15 315 99  HOH HOH C . 
HC 8 HOH 16 316 100 HOH HOH C . 
HC 8 HOH 17 317 106 HOH HOH C . 
HC 8 HOH 18 318 110 HOH HOH C . 
HC 8 HOH 19 319 134 HOH HOH C . 
HC 8 HOH 20 320 140 HOH HOH C . 
HC 8 HOH 21 321 142 HOH HOH C . 
HC 8 HOH 22 322 145 HOH HOH C . 
HC 8 HOH 23 323 146 HOH HOH C . 
HC 8 HOH 24 324 148 HOH HOH C . 
HC 8 HOH 25 325 163 HOH HOH C . 
HC 8 HOH 26 326 175 HOH HOH C . 
HC 8 HOH 27 327 180 HOH HOH C . 
HC 8 HOH 28 328 185 HOH HOH C . 
HC 8 HOH 29 329 186 HOH HOH C . 
HC 8 HOH 30 330 193 HOH HOH C . 
IC 8 HOH 1  301 42  HOH HOH D . 
IC 8 HOH 2  302 50  HOH HOH D . 
IC 8 HOH 3  303 52  HOH HOH D . 
IC 8 HOH 4  304 53  HOH HOH D . 
IC 8 HOH 5  305 62  HOH HOH D . 
IC 8 HOH 6  306 69  HOH HOH D . 
IC 8 HOH 7  307 73  HOH HOH D . 
IC 8 HOH 8  308 79  HOH HOH D . 
IC 8 HOH 9  309 93  HOH HOH D . 
IC 8 HOH 10 310 138 HOH HOH D . 
IC 8 HOH 11 311 143 HOH HOH D . 
IC 8 HOH 12 312 151 HOH HOH D . 
IC 8 HOH 13 313 159 HOH HOH D . 
IC 8 HOH 14 314 167 HOH HOH D . 
IC 8 HOH 15 315 176 HOH HOH D . 
IC 8 HOH 16 316 182 HOH HOH D . 
IC 8 HOH 17 317 194 HOH HOH D . 
JC 8 HOH 1  301 5   HOH HOH E . 
JC 8 HOH 2  302 11  HOH HOH E . 
JC 8 HOH 3  303 12  HOH HOH E . 
JC 8 HOH 4  304 16  HOH HOH E . 
JC 8 HOH 5  305 27  HOH HOH E . 
JC 8 HOH 6  306 29  HOH HOH E . 
JC 8 HOH 7  307 33  HOH HOH E . 
JC 8 HOH 8  308 36  HOH HOH E . 
JC 8 HOH 9  309 38  HOH HOH E . 
JC 8 HOH 10 310 60  HOH HOH E . 
JC 8 HOH 11 311 64  HOH HOH E . 
JC 8 HOH 12 312 76  HOH HOH E . 
JC 8 HOH 13 313 98  HOH HOH E . 
JC 8 HOH 14 314 101 HOH HOH E . 
JC 8 HOH 15 315 108 HOH HOH E . 
JC 8 HOH 16 316 109 HOH HOH E . 
JC 8 HOH 17 317 112 HOH HOH E . 
JC 8 HOH 18 318 113 HOH HOH E . 
JC 8 HOH 19 319 130 HOH HOH E . 
JC 8 HOH 20 320 135 HOH HOH E . 
JC 8 HOH 21 321 141 HOH HOH E . 
JC 8 HOH 22 322 147 HOH HOH E . 
JC 8 HOH 23 323 158 HOH HOH E . 
JC 8 HOH 24 324 166 HOH HOH E . 
JC 8 HOH 25 325 173 HOH HOH E . 
JC 8 HOH 26 326 192 HOH HOH E . 
KC 8 HOH 1  301 188 HOH HOH F . 
KC 8 HOH 2  302 1   HOH HOH F . 
KC 8 HOH 3  303 8   HOH HOH F . 
KC 8 HOH 4  304 15  HOH HOH F . 
KC 8 HOH 5  305 18  HOH HOH F . 
KC 8 HOH 6  306 26  HOH HOH F . 
KC 8 HOH 7  307 32  HOH HOH F . 
KC 8 HOH 8  308 47  HOH HOH F . 
KC 8 HOH 9  309 59  HOH HOH F . 
KC 8 HOH 10 310 61  HOH HOH F . 
KC 8 HOH 11 311 72  HOH HOH F . 
KC 8 HOH 12 312 83  HOH HOH F . 
KC 8 HOH 13 313 104 HOH HOH F . 
KC 8 HOH 14 314 116 HOH HOH F . 
KC 8 HOH 15 315 137 HOH HOH F . 
KC 8 HOH 16 316 144 HOH HOH F . 
KC 8 HOH 17 317 150 HOH HOH F . 
KC 8 HOH 18 318 154 HOH HOH F . 
KC 8 HOH 19 319 170 HOH HOH F . 
KC 8 HOH 20 320 177 HOH HOH F . 
LC 8 HOH 1  301 4   HOH HOH G . 
LC 8 HOH 2  302 20  HOH HOH G . 
LC 8 HOH 3  303 24  HOH HOH G . 
LC 8 HOH 4  304 37  HOH HOH G . 
LC 8 HOH 5  305 54  HOH HOH G . 
LC 8 HOH 6  306 55  HOH HOH G . 
LC 8 HOH 7  307 66  HOH HOH G . 
LC 8 HOH 8  308 67  HOH HOH G . 
LC 8 HOH 9  309 68  HOH HOH G . 
LC 8 HOH 10 310 85  HOH HOH G . 
LC 8 HOH 11 311 111 HOH HOH G . 
LC 8 HOH 12 312 118 HOH HOH G . 
LC 8 HOH 13 313 120 HOH HOH G . 
LC 8 HOH 14 314 126 HOH HOH G . 
LC 8 HOH 15 315 139 HOH HOH G . 
LC 8 HOH 16 316 149 HOH HOH G . 
LC 8 HOH 17 317 156 HOH HOH G . 
LC 8 HOH 18 318 162 HOH HOH G . 
LC 8 HOH 19 319 171 HOH HOH G . 
LC 8 HOH 20 320 174 HOH HOH G . 
LC 8 HOH 21 321 189 HOH HOH G . 
MC 8 HOH 1  301 7   HOH HOH H . 
MC 8 HOH 2  302 13  HOH HOH H . 
MC 8 HOH 3  303 14  HOH HOH H . 
MC 8 HOH 4  304 19  HOH HOH H . 
MC 8 HOH 5  305 21  HOH HOH H . 
MC 8 HOH 6  306 22  HOH HOH H . 
MC 8 HOH 7  307 39  HOH HOH H . 
MC 8 HOH 8  308 43  HOH HOH H . 
MC 8 HOH 9  309 45  HOH HOH H . 
MC 8 HOH 10 310 46  HOH HOH H . 
MC 8 HOH 11 311 49  HOH HOH H . 
MC 8 HOH 12 312 75  HOH HOH H . 
MC 8 HOH 13 313 78  HOH HOH H . 
MC 8 HOH 14 314 81  HOH HOH H . 
MC 8 HOH 15 315 95  HOH HOH H . 
MC 8 HOH 16 316 102 HOH HOH H . 
MC 8 HOH 17 317 103 HOH HOH H . 
MC 8 HOH 18 318 105 HOH HOH H . 
MC 8 HOH 19 319 107 HOH HOH H . 
MC 8 HOH 20 320 122 HOH HOH H . 
MC 8 HOH 21 321 127 HOH HOH H . 
MC 8 HOH 22 322 128 HOH HOH H . 
MC 8 HOH 23 323 157 HOH HOH H . 
MC 8 HOH 24 324 160 HOH HOH H . 
MC 8 HOH 25 325 169 HOH HOH H . 
MC 8 HOH 26 326 172 HOH HOH H . 
MC 8 HOH 27 327 195 HOH HOH H . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
3 author_and_software_defined_assembly PISA dimeric 2 
4 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,I,J,K,L,M,N,O,P,Q,R,S,T,DA,EA,FA,GA,HA,IA,JA,KA,LA,MA,NA,OA,FC,HC 
2 1 B,D,U,V,W,X,Y,Z,AA,BA,CA,PA,QA,RA,SA,TA,UA,VA,WA,XA,GC,IC             
3 1 E,H,YA,ZA,AB,BB,CB,DB,EB,FB,GB,HB,ZB,AC,BC,CC,DC,EC,JC,MC             
4 1 F,G,IB,JB,KB,LB,MB,NB,OB,PB,QB,RB,SB,TB,UB,VB,WB,XB,YB,KC,LC          
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3840  ? 
1 MORE         -119  ? 
1 'SSA (A^2)'  17440 ? 
2 'ABSA (A^2)' 4150  ? 
2 MORE         -121  ? 
2 'SSA (A^2)'  17210 ? 
3 'ABSA (A^2)' 3160  ? 
3 MORE         -76   ? 
3 'SSA (A^2)'  16860 ? 
4 'ABSA (A^2)' 3300  ? 
4 MORE         -97   ? 
4 'SSA (A^2)'  17040 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   OE1 ? C  GLU 72 ? C GLU 113 ? 1_555 DY B EA DY . ? C DY 202 ? 1_555 O   ? LC HOH .  ? G HOH 317 ? 1_555 113.4 ? 
2   OE1 ? C  GLU 72 ? C GLU 113 ? 1_555 DY B EA DY . ? C DY 202 ? 1_555 OE2 ? C  GLU 72 ? C GLU 113 ? 1_555 51.0  ? 
3   O   ? LC HOH .  ? G HOH 317 ? 1_555 DY B EA DY . ? C DY 202 ? 1_555 OE2 ? C  GLU 72 ? C GLU 113 ? 1_555 67.1  ? 
4   OE1 ? B  GLU 87 ? B GLU 128 ? 1_555 DY ? W  DY . ? B DY 203 ? 1_555 O   ? GC HOH .  ? B HOH 322 ? 1_555 74.1  ? 
5   OE1 ? C  GLU 87 ? C GLU 128 ? 1_555 DY A DA DY . ? C DY 201 ? 1_555 O   ? HC HOH .  ? C HOH 321 ? 1_555 62.5  ? 
6   OE1 ? C  GLU 87 ? C GLU 128 ? 1_555 DY A DA DY . ? C DY 201 ? 1_555 OE2 ? C  GLU 87 ? C GLU 128 ? 1_555 46.7  ? 
7   O   ? HC HOH .  ? C HOH 321 ? 1_555 DY A DA DY . ? C DY 201 ? 1_555 OE2 ? C  GLU 87 ? C GLU 128 ? 1_555 70.4  ? 
8   OE1 ? C  GLU 87 ? C GLU 128 ? 1_555 DY A DA DY . ? C DY 201 ? 1_555 OE1 ? C  GLU 84 ? C GLU 125 ? 1_555 76.9  ? 
9   O   ? HC HOH .  ? C HOH 321 ? 1_555 DY A DA DY . ? C DY 201 ? 1_555 OE1 ? C  GLU 84 ? C GLU 125 ? 1_555 133.0 ? 
10  OE2 ? C  GLU 87 ? C GLU 128 ? 1_555 DY A DA DY . ? C DY 201 ? 1_555 OE1 ? C  GLU 84 ? C GLU 125 ? 1_555 64.6  ? 
11  OE1 ? C  GLU 87 ? C GLU 128 ? 1_555 DY A DA DY . ? C DY 201 ? 1_555 OE2 ? C  GLU 84 ? C GLU 125 ? 1_555 118.2 ? 
12  O   ? HC HOH .  ? C HOH 321 ? 1_555 DY A DA DY . ? C DY 201 ? 1_555 OE2 ? C  GLU 84 ? C GLU 125 ? 1_555 160.1 ? 
13  OE2 ? C  GLU 87 ? C GLU 128 ? 1_555 DY A DA DY . ? C DY 201 ? 1_555 OE2 ? C  GLU 84 ? C GLU 125 ? 1_555 95.5  ? 
14  OE1 ? C  GLU 84 ? C GLU 125 ? 1_555 DY A DA DY . ? C DY 201 ? 1_555 OE2 ? C  GLU 84 ? C GLU 125 ? 1_555 41.4  ? 
15  OD1 ? G  ASP 74 ? G ASP 115 ? 1_555 DY ? QB DY . ? G DY 201 ? 1_555 O   ? LC HOH .  ? G HOH 309 ? 1_555 65.2  ? 
16  OD1 ? G  ASP 74 ? G ASP 115 ? 1_555 DY ? QB DY . ? G DY 201 ? 1_555 OD2 ? G  ASP 74 ? G ASP 115 ? 1_555 42.4  ? 
17  O   ? LC HOH .  ? G HOH 309 ? 1_555 DY ? QB DY . ? G DY 201 ? 1_555 OD2 ? G  ASP 74 ? G ASP 115 ? 1_555 107.3 ? 
18  OE2 ? E  GLU 72 ? E GLU 113 ? 1_555 DY ? ZA DY . ? E DY 202 ? 1_555 OE1 ? A  GLU 84 ? A GLU 125 ? 1_555 87.2  ? 
19  OE1 ? F  GLU 87 ? F GLU 128 ? 1_555 DY ? JB DY . ? F DY 202 ? 1_555 O   ? KC HOH .  ? F HOH 307 ? 1_555 70.5  ? 
20  OE1 ? F  GLU 87 ? F GLU 128 ? 1_555 DY ? JB DY . ? F DY 202 ? 1_555 OE1 ? F  GLU 84 ? F GLU 125 ? 1_555 86.6  ? 
21  O   ? KC HOH .  ? F HOH 307 ? 1_555 DY ? JB DY . ? F DY 202 ? 1_555 OE1 ? F  GLU 84 ? F GLU 125 ? 1_555 67.7  ? 
22  OE1 ? F  GLU 87 ? F GLU 128 ? 1_555 DY ? JB DY . ? F DY 202 ? 1_555 OE2 ? F  GLU 87 ? F GLU 128 ? 1_555 39.2  ? 
23  O   ? KC HOH .  ? F HOH 307 ? 1_555 DY ? JB DY . ? F DY 202 ? 1_555 OE2 ? F  GLU 87 ? F GLU 128 ? 1_555 104.4 ? 
24  OE1 ? F  GLU 84 ? F GLU 125 ? 1_555 DY ? JB DY . ? F DY 202 ? 1_555 OE2 ? F  GLU 87 ? F GLU 128 ? 1_555 117.7 ? 
25  OE1 ? G  GLU 87 ? G GLU 128 ? 1_555 DY ? RB DY . ? G DY 202 ? 1_555 O   ? LC HOH .  ? G HOH 319 ? 1_555 66.3  ? 
26  OE1 ? G  GLU 87 ? G GLU 128 ? 1_555 DY ? RB DY . ? G DY 202 ? 1_555 OE2 ? G  GLU 87 ? G GLU 128 ? 1_555 40.9  ? 
27  O   ? LC HOH .  ? G HOH 319 ? 1_555 DY ? RB DY . ? G DY 202 ? 1_555 OE2 ? G  GLU 87 ? G GLU 128 ? 1_555 105.8 ? 
28  OE2 ? E  GLU 84 ? E GLU 125 ? 1_555 DY ? J  DY . ? A DY 202 ? 1_555 O   ? JC HOH .  ? E HOH 304 ? 1_555 128.5 ? 
29  O   ? JC HOH .  ? E HOH 319 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE1 ? E  GLU 87 ? E GLU 128 ? 1_555 69.7  ? 
30  O   ? JC HOH .  ? E HOH 319 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE1 ? A  GLU 72 ? A GLU 113 ? 1_555 118.4 ? 
31  OE1 ? E  GLU 87 ? E GLU 128 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE1 ? A  GLU 72 ? A GLU 113 ? 1_555 161.8 ? 
32  O   ? JC HOH .  ? E HOH 319 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE2 ? E  GLU 84 ? E GLU 125 ? 1_555 166.2 ? 
33  OE1 ? E  GLU 87 ? E GLU 128 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE2 ? E  GLU 84 ? E GLU 125 ? 1_555 103.7 ? 
34  OE1 ? A  GLU 72 ? A GLU 113 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE2 ? E  GLU 84 ? E GLU 125 ? 1_555 71.7  ? 
35  O   ? JC HOH .  ? E HOH 319 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE1 ? F  GLU 72 ? F GLU 113 ? 1_555 94.4  ? 
36  OE1 ? E  GLU 87 ? E GLU 128 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE1 ? F  GLU 72 ? F GLU 113 ? 1_555 80.4  ? 
37  OE1 ? A  GLU 72 ? A GLU 113 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE1 ? F  GLU 72 ? F GLU 113 ? 1_555 82.7  ? 
38  OE2 ? E  GLU 84 ? E GLU 125 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE1 ? F  GLU 72 ? F GLU 113 ? 1_555 96.5  ? 
39  O   ? JC HOH .  ? E HOH 319 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE2 ? E  GLU 87 ? E GLU 128 ? 1_555 71.5  ? 
40  OE1 ? E  GLU 87 ? E GLU 128 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE2 ? E  GLU 87 ? E GLU 128 ? 1_555 52.8  ? 
41  OE1 ? A  GLU 72 ? A GLU 113 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE2 ? E  GLU 87 ? E GLU 128 ? 1_555 143.6 ? 
42  OE2 ? E  GLU 84 ? E GLU 125 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE2 ? E  GLU 87 ? E GLU 128 ? 1_555 94.8  ? 
43  OE1 ? F  GLU 72 ? F GLU 113 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE2 ? E  GLU 87 ? E GLU 128 ? 1_555 133.2 ? 
44  O   ? JC HOH .  ? E HOH 319 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE2 ? A  GLU 72 ? A GLU 113 ? 1_555 69.4  ? 
45  OE1 ? E  GLU 87 ? E GLU 128 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE2 ? A  GLU 72 ? A GLU 113 ? 1_555 130.2 ? 
46  OE1 ? A  GLU 72 ? A GLU 113 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE2 ? A  GLU 72 ? A GLU 113 ? 1_555 50.2  ? 
47  OE2 ? E  GLU 84 ? E GLU 125 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE2 ? A  GLU 72 ? A GLU 113 ? 1_555 121.8 ? 
48  OE1 ? F  GLU 72 ? F GLU 113 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE2 ? A  GLU 72 ? A GLU 113 ? 1_555 75.7  ? 
49  OE2 ? E  GLU 87 ? E GLU 128 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE2 ? A  GLU 72 ? A GLU 113 ? 1_555 132.6 ? 
50  O   ? JC HOH .  ? E HOH 319 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE1 ? E  GLU 84 ? E GLU 125 ? 1_555 123.7 ? 
51  OE1 ? E  GLU 87 ? E GLU 128 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE1 ? E  GLU 84 ? E GLU 125 ? 1_555 64.0  ? 
52  OE1 ? A  GLU 72 ? A GLU 113 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE1 ? E  GLU 84 ? E GLU 125 ? 1_555 115.6 ? 
53  OE2 ? E  GLU 84 ? E GLU 125 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE1 ? E  GLU 84 ? E GLU 125 ? 1_555 44.4  ? 
54  OE1 ? F  GLU 72 ? F GLU 113 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE1 ? E  GLU 84 ? E GLU 125 ? 1_555 107.3 ? 
55  OE2 ? E  GLU 87 ? E GLU 128 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE1 ? E  GLU 84 ? E GLU 125 ? 1_555 55.6  ? 
56  OE2 ? A  GLU 72 ? A GLU 113 ? 1_555 DY A YA DY . ? E DY 201 ? 1_555 OE1 ? E  GLU 84 ? E GLU 125 ? 1_555 165.5 ? 
57  OE1 ? C  GLU 72 ? C GLU 113 ? 1_555 DY A EA DY . ? C DY 202 ? 1_555 O   ? LC HOH .  ? G HOH 317 ? 1_555 116.2 ? 
58  OE1 ? C  GLU 72 ? C GLU 113 ? 1_555 DY A EA DY . ? C DY 202 ? 1_555 OE1 ? G  GLU 72 ? G GLU 113 ? 1_555 91.2  ? 
59  O   ? LC HOH .  ? G HOH 317 ? 1_555 DY A EA DY . ? C DY 202 ? 1_555 OE1 ? G  GLU 72 ? G GLU 113 ? 1_555 90.9  ? 
60  OE1 ? C  GLU 72 ? C GLU 113 ? 1_555 DY A EA DY . ? C DY 202 ? 1_555 OE2 ? C  GLU 72 ? C GLU 113 ? 1_555 49.6  ? 
61  O   ? LC HOH .  ? G HOH 317 ? 1_555 DY A EA DY . ? C DY 202 ? 1_555 OE2 ? C  GLU 72 ? C GLU 113 ? 1_555 70.3  ? 
62  OE1 ? G  GLU 72 ? G GLU 113 ? 1_555 DY A EA DY . ? C DY 202 ? 1_555 OE2 ? C  GLU 72 ? C GLU 113 ? 1_555 73.8  ? 
63  O   ? HC HOH .  ? C HOH 321 ? 1_555 DY B DA DY . ? C DY 201 ? 1_555 OE2 ? C  GLU 87 ? C GLU 128 ? 1_555 72.2  ? 
64  O   ? HC HOH .  ? C HOH 321 ? 1_555 DY B DA DY . ? C DY 201 ? 1_555 OE1 ? C  GLU 87 ? C GLU 128 ? 1_555 52.2  ? 
65  OE2 ? C  GLU 87 ? C GLU 128 ? 1_555 DY B DA DY . ? C DY 201 ? 1_555 OE1 ? C  GLU 87 ? C GLU 128 ? 1_555 43.2  ? 
66  O   ? HC HOH .  ? C HOH 321 ? 1_555 DY B DA DY . ? C DY 201 ? 1_555 OE2 ? C  GLU 84 ? C GLU 125 ? 1_555 141.3 ? 
67  OE2 ? C  GLU 87 ? C GLU 128 ? 1_555 DY B DA DY . ? C DY 201 ? 1_555 OE2 ? C  GLU 84 ? C GLU 125 ? 1_555 89.4  ? 
68  OE1 ? C  GLU 87 ? C GLU 128 ? 1_555 DY B DA DY . ? C DY 201 ? 1_555 OE2 ? C  GLU 84 ? C GLU 125 ? 1_555 91.0  ? 
69  OE1 ? A  GLU 87 ? A GLU 128 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE1 ? B  GLU 72 ? B GLU 113 ? 1_555 90.3  ? 
70  OE1 ? A  GLU 87 ? A GLU 128 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE1 ? A  GLU 84 ? A GLU 125 ? 1_555 100.7 ? 
71  OE1 ? B  GLU 72 ? B GLU 113 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE1 ? A  GLU 84 ? A GLU 125 ? 1_555 124.5 ? 
72  OE1 ? A  GLU 87 ? A GLU 128 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? E  GLU 72 ? E GLU 113 ? 1_555 160.5 ? 
73  OE1 ? B  GLU 72 ? B GLU 113 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? E  GLU 72 ? E GLU 113 ? 1_555 75.9  ? 
74  OE1 ? A  GLU 84 ? A GLU 125 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? E  GLU 72 ? E GLU 113 ? 1_555 77.0  ? 
75  OE1 ? A  GLU 87 ? A GLU 128 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE1 ? E  GLU 72 ? E GLU 113 ? 1_555 134.4 ? 
76  OE1 ? B  GLU 72 ? B GLU 113 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE1 ? E  GLU 72 ? E GLU 113 ? 1_555 57.7  ? 
77  OE1 ? A  GLU 84 ? A GLU 125 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE1 ? E  GLU 72 ? E GLU 113 ? 1_555 123.7 ? 
78  OE2 ? E  GLU 72 ? E GLU 113 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE1 ? E  GLU 72 ? E GLU 113 ? 1_555 47.4  ? 
79  OE1 ? A  GLU 87 ? A GLU 128 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 O   ? GC HOH .  ? B HOH 305 ? 1_555 69.7  ? 
80  OE1 ? B  GLU 72 ? B GLU 113 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 O   ? GC HOH .  ? B HOH 305 ? 1_555 92.2  ? 
81  OE1 ? A  GLU 84 ? A GLU 125 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 O   ? GC HOH .  ? B HOH 305 ? 1_555 142.7 ? 
82  OE2 ? E  GLU 72 ? E GLU 113 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 O   ? GC HOH .  ? B HOH 305 ? 1_555 123.6 ? 
83  OE1 ? E  GLU 72 ? E GLU 113 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 O   ? GC HOH .  ? B HOH 305 ? 1_555 79.4  ? 
84  OE1 ? A  GLU 87 ? A GLU 128 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 87 ? A GLU 128 ? 1_555 48.2  ? 
85  OE1 ? B  GLU 72 ? B GLU 113 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 87 ? A GLU 128 ? 1_555 137.1 ? 
86  OE1 ? A  GLU 84 ? A GLU 125 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 87 ? A GLU 128 ? 1_555 80.5  ? 
87  OE2 ? E  GLU 72 ? E GLU 113 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 87 ? A GLU 128 ? 1_555 147.0 ? 
88  OE1 ? E  GLU 72 ? E GLU 113 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 87 ? A GLU 128 ? 1_555 141.2 ? 
89  O   ? GC HOH .  ? B HOH 305 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 87 ? A GLU 128 ? 1_555 66.2  ? 
90  OE1 ? A  GLU 87 ? A GLU 128 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 84 ? A GLU 125 ? 1_555 74.3  ? 
91  OE1 ? B  GLU 72 ? B GLU 113 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 84 ? A GLU 125 ? 1_555 90.7  ? 
92  OE1 ? A  GLU 84 ? A GLU 125 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 84 ? A GLU 125 ? 1_555 43.3  ? 
93  OE2 ? E  GLU 72 ? E GLU 113 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 84 ? A GLU 125 ? 1_555 91.9  ? 
94  OE1 ? E  GLU 72 ? E GLU 113 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 84 ? A GLU 125 ? 1_555 130.8 ? 
95  O   ? GC HOH .  ? B HOH 305 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 84 ? A GLU 125 ? 1_555 143.9 ? 
96  OE2 ? A  GLU 87 ? A GLU 128 ? 1_555 DY A I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 84 ? A GLU 125 ? 1_555 87.9  ? 
97  OE2 ? E  GLU 72 ? E GLU 113 ? 1_555 DY B I  DY . ? A DY 201 ? 1_555 OE1 ? A  GLU 84 ? A GLU 125 ? 1_555 84.4  ? 
98  OE2 ? E  GLU 72 ? E GLU 113 ? 1_555 DY B I  DY . ? A DY 201 ? 1_555 OE1 ? E  GLU 72 ? E GLU 113 ? 1_555 48.4  ? 
99  OE1 ? A  GLU 84 ? A GLU 125 ? 1_555 DY B I  DY . ? A DY 201 ? 1_555 OE1 ? E  GLU 72 ? E GLU 113 ? 1_555 126.0 ? 
100 OE2 ? E  GLU 72 ? E GLU 113 ? 1_555 DY B I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 87 ? A GLU 128 ? 1_555 148.3 ? 
101 OE1 ? A  GLU 84 ? A GLU 125 ? 1_555 DY B I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 87 ? A GLU 128 ? 1_555 77.2  ? 
102 OE1 ? E  GLU 72 ? E GLU 113 ? 1_555 DY B I  DY . ? A DY 201 ? 1_555 OE2 ? A  GLU 87 ? A GLU 128 ? 1_555 127.7 ? 
103 OE2 ? E  GLU 72 ? E GLU 113 ? 1_555 DY B I  DY . ? A DY 201 ? 1_555 O   ? GC HOH .  ? B HOH 305 ? 1_555 118.7 ? 
104 OE1 ? A  GLU 84 ? A GLU 125 ? 1_555 DY B I  DY . ? A DY 201 ? 1_555 O   ? GC HOH .  ? B HOH 305 ? 1_555 128.7 ? 
105 OE1 ? E  GLU 72 ? E GLU 113 ? 1_555 DY B I  DY . ? A DY 201 ? 1_555 O   ? GC HOH .  ? B HOH 305 ? 1_555 72.7  ? 
106 OE2 ? A  GLU 87 ? A GLU 128 ? 1_555 DY B I  DY . ? A DY 201 ? 1_555 O   ? GC HOH .  ? B HOH 305 ? 1_555 59.2  ? 
107 OE2 ? E  GLU 72 ? E GLU 113 ? 1_555 DY B I  DY . ? A DY 201 ? 1_555 OE1 ? A  GLU 87 ? A GLU 128 ? 1_555 112.0 ? 
108 OE1 ? A  GLU 84 ? A GLU 125 ? 1_555 DY B I  DY . ? A DY 201 ? 1_555 OE1 ? A  GLU 87 ? A GLU 128 ? 1_555 76.1  ? 
109 OE1 ? E  GLU 72 ? E GLU 113 ? 1_555 DY B I  DY . ? A DY 201 ? 1_555 OE1 ? A  GLU 87 ? A GLU 128 ? 1_555 96.5  ? 
110 OE2 ? A  GLU 87 ? A GLU 128 ? 1_555 DY B I  DY . ? A DY 201 ? 1_555 OE1 ? A  GLU 87 ? A GLU 128 ? 1_555 38.5  ? 
111 O   ? GC HOH .  ? B HOH 305 ? 1_555 DY B I  DY . ? A DY 201 ? 1_555 OE1 ? A  GLU 87 ? A GLU 128 ? 1_555 53.2  ? 
112 OE1 ? A  GLU 72 ? A GLU 113 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 O   ? JC HOH .  ? E HOH 319 ? 1_555 107.2 ? 
113 OE1 ? A  GLU 72 ? A GLU 113 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 OE2 ? E  GLU 87 ? E GLU 128 ? 1_555 135.3 ? 
114 O   ? JC HOH .  ? E HOH 319 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 OE2 ? E  GLU 87 ? E GLU 128 ? 1_555 67.5  ? 
115 OE1 ? A  GLU 72 ? A GLU 113 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 OE2 ? A  GLU 72 ? A GLU 113 ? 1_555 50.5  ? 
116 O   ? JC HOH .  ? E HOH 319 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 OE2 ? A  GLU 72 ? A GLU 113 ? 1_555 67.6  ? 
117 OE2 ? E  GLU 87 ? E GLU 128 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 OE2 ? A  GLU 72 ? A GLU 113 ? 1_555 132.6 ? 
118 OE1 ? A  GLU 72 ? A GLU 113 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 OE2 ? E  GLU 84 ? E GLU 125 ? 1_555 60.2  ? 
119 O   ? JC HOH .  ? E HOH 319 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 OE2 ? E  GLU 84 ? E GLU 125 ? 1_555 115.7 ? 
120 OE2 ? E  GLU 87 ? E GLU 128 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 OE2 ? E  GLU 84 ? E GLU 125 ? 1_555 81.5  ? 
121 OE2 ? A  GLU 72 ? A GLU 113 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 OE2 ? E  GLU 84 ? E GLU 125 ? 1_555 105.1 ? 
122 OE1 ? A  GLU 72 ? A GLU 113 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 O   ? JC HOH .  ? E HOH 312 ? 1_555 120.5 ? 
123 O   ? JC HOH .  ? E HOH 319 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 O   ? JC HOH .  ? E HOH 312 ? 1_555 131.7 ? 
124 OE2 ? E  GLU 87 ? E GLU 128 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 O   ? JC HOH .  ? E HOH 312 ? 1_555 82.5  ? 
125 OE2 ? A  GLU 72 ? A GLU 113 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 O   ? JC HOH .  ? E HOH 312 ? 1_555 141.0 ? 
126 OE2 ? E  GLU 84 ? E GLU 125 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 O   ? JC HOH .  ? E HOH 312 ? 1_555 95.1  ? 
127 OE1 ? A  GLU 72 ? A GLU 113 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 OE1 ? E  GLU 87 ? E GLU 128 ? 1_555 100.8 ? 
128 O   ? JC HOH .  ? E HOH 319 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 OE1 ? E  GLU 87 ? E GLU 128 ? 1_555 49.2  ? 
129 OE2 ? E  GLU 87 ? E GLU 128 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 OE1 ? E  GLU 87 ? E GLU 128 ? 1_555 40.5  ? 
130 OE2 ? A  GLU 72 ? A GLU 113 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 OE1 ? E  GLU 87 ? E GLU 128 ? 1_555 96.6  ? 
131 OE2 ? E  GLU 84 ? E GLU 125 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 OE1 ? E  GLU 87 ? E GLU 128 ? 1_555 70.4  ? 
132 O   ? JC HOH .  ? E HOH 312 ? 1_555 DY B YA DY . ? E DY 201 ? 1_555 OE1 ? E  GLU 87 ? E GLU 128 ? 1_555 121.7 ? 
133 OD1 ? B  ASP 74 ? B ASP 115 ? 1_555 DY ? U  DY . ? B DY 201 ? 1_555 OD2 ? B  ASP 74 ? B ASP 115 ? 1_555 41.4  ? 
134 OD1 ? H  ASP 74 ? H ASP 115 ? 1_555 DY ? ZB DY . ? H DY 201 ? 1_555 OD2 ? H  ASP 74 ? H ASP 115 ? 1_555 38.3  ? 
135 OE1 ? D  GLU 87 ? D GLU 128 ? 1_555 DY ? QA DY . ? D DY 202 ? 1_555 O   ? IC HOH .  ? D HOH 303 ? 1_555 70.7  ? 
136 OE1 ? D  GLU 87 ? D GLU 128 ? 1_555 DY ? QA DY . ? D DY 202 ? 1_555 OE2 ? D  GLU 87 ? D GLU 128 ? 1_555 44.6  ? 
137 O   ? IC HOH .  ? D HOH 303 ? 1_555 DY ? QA DY . ? D DY 202 ? 1_555 OE2 ? D  GLU 87 ? D GLU 128 ? 1_555 107.4 ? 
138 OE1 ? H  GLU 72 ? H GLU 113 ? 1_555 DY ? AC DY . ? H DY 202 ? 1_555 O   ? MC HOH .  ? H HOH 313 ? 1_555 80.9  ? 
139 OE1 ? H  GLU 72 ? H GLU 113 ? 1_555 DY ? AC DY . ? H DY 202 ? 1_555 O   ? H  LYS 69 ? H LYS 110 ? 1_555 107.3 ? 
140 O   ? MC HOH .  ? H HOH 313 ? 1_555 DY ? AC DY . ? H DY 202 ? 1_555 O   ? H  LYS 69 ? H LYS 110 ? 1_555 130.7 ? 
141 OE1 ? D  GLU 62 ? D GLU 103 ? 1_555 DY ? RA DY . ? D DY 203 ? 1_555 OE2 ? D  GLU 62 ? D GLU 103 ? 1_555 51.8  ? 
142 OE1 ? D  GLU 62 ? D GLU 103 ? 1_555 DY ? RA DY . ? D DY 203 ? 1_555 O   ? IC HOH .  ? D HOH 313 ? 1_555 54.9  ? 
143 OE2 ? D  GLU 62 ? D GLU 103 ? 1_555 DY ? RA DY . ? D DY 203 ? 1_555 O   ? IC HOH .  ? D HOH 313 ? 1_555 83.4  ? 
144 OE1 ? F  GLU 62 ? F GLU 103 ? 1_555 DY ? KB DY . ? F DY 203 ? 1_555 OE2 ? F  GLU 62 ? F GLU 103 ? 1_555 48.9  ? 
145 OD1 ? E  ASP 74 ? E ASP 115 ? 1_555 DY ? AB DY . ? E DY 203 ? 1_555 OD2 ? E  ASP 74 ? E ASP 115 ? 1_555 44.1  ? 
146 OD1 ? C  ASP 74 ? C ASP 115 ? 1_555 DY ? FA DY . ? C DY 203 ? 1_555 OD2 ? C  ASP 74 ? C ASP 115 ? 1_555 39.6  ? 
147 OD1 ? F  ASP 74 ? F ASP 115 ? 1_555 DY ? IB DY . ? F DY 201 ? 1_555 O   ? KC HOH .  ? F HOH 312 ? 1_555 90.0  ? 
148 OD1 ? F  ASP 74 ? F ASP 115 ? 1_555 DY ? IB DY . ? F DY 201 ? 1_555 O   ? KC HOH .  ? F HOH 314 ? 1_555 95.1  ? 
149 O   ? KC HOH .  ? F HOH 312 ? 1_555 DY ? IB DY . ? F DY 201 ? 1_555 O   ? KC HOH .  ? F HOH 314 ? 1_555 159.3 ? 
150 O   ? GC HOH .  ? B HOH 321 ? 1_555 DY ? V  DY . ? B DY 202 ? 1_555 OE2 ? B  GLU 62 ? B GLU 103 ? 1_555 152.0 ? 
151 O   ? GC HOH .  ? B HOH 321 ? 1_555 DY ? V  DY . ? B DY 202 ? 1_555 OE1 ? B  GLU 62 ? B GLU 103 ? 1_555 106.1 ? 
152 OE2 ? B  GLU 62 ? B GLU 103 ? 1_555 DY ? V  DY . ? B DY 202 ? 1_555 OE1 ? B  GLU 62 ? B GLU 103 ? 1_555 46.4  ? 
153 OD1 ? D  ASP 74 ? D ASP 115 ? 1_555 DY ? PA DY . ? D DY 201 ? 1_555 O   ? IC HOH .  ? D HOH 308 ? 1_555 56.7  ? 
154 OD1 ? D  ASP 74 ? D ASP 115 ? 1_555 DY ? PA DY . ? D DY 201 ? 1_555 OD2 ? D  ASP 74 ? D ASP 115 ? 1_555 40.4  ? 
155 O   ? IC HOH .  ? D HOH 308 ? 1_555 DY ? PA DY . ? D DY 201 ? 1_555 OD2 ? D  ASP 74 ? D ASP 115 ? 1_555 95.9  ? 
156 OE1 ? H  GLU 62 ? H GLU 103 ? 1_555 DY ? BC DY . ? H DY 203 ? 1_555 OE2 ? H  GLU 62 ? H GLU 103 ? 1_555 44.9  ? 
157 OD1 ? A  ASP 74 ? A ASP 115 ? 1_555 DY ? L  DY . ? A DY 204 ? 1_555 O1  ? TB SO4 .  ? G SO4 204 ? 1_555 94.7  ? 
158 OD1 ? A  ASP 74 ? A ASP 115 ? 1_555 DY ? L  DY . ? A DY 204 ? 1_555 O   ? FC HOH .  ? A HOH 320 ? 1_555 165.7 ? 
159 O1  ? TB SO4 .  ? G SO4 204 ? 1_555 DY ? L  DY . ? A DY 204 ? 1_555 O   ? FC HOH .  ? A HOH 320 ? 1_555 92.4  ? 
160 OD1 ? A  ASP 74 ? A ASP 115 ? 1_555 DY ? L  DY . ? A DY 204 ? 1_555 OD2 ? A  ASP 74 ? A ASP 115 ? 1_555 41.0  ? 
161 O1  ? TB SO4 .  ? G SO4 204 ? 1_555 DY ? L  DY . ? A DY 204 ? 1_555 OD2 ? A  ASP 74 ? A ASP 115 ? 1_555 98.5  ? 
162 O   ? FC HOH .  ? A HOH 320 ? 1_555 DY ? L  DY . ? A DY 204 ? 1_555 OD2 ? A  ASP 74 ? A ASP 115 ? 1_555 149.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-02-12 
2 'Structure model' 1 1 2014-05-21 
3 'Structure model' 2 0 2019-07-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'     
2 3 'Structure model' Advisory                  
3 3 'Structure model' 'Atomic model'            
4 3 'Structure model' 'Data collection'         
5 3 'Structure model' 'Derived calculations'    
6 3 'Structure model' 'Non-polymer description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' atom_site                  
2 3 'Structure model' chem_comp                  
3 3 'Structure model' pdbx_distant_solvent_atoms 
4 3 'Structure model' pdbx_struct_conn_angle     
5 3 'Structure model' struct_conn                
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_atom_site.B_iso_or_equiv'                   
2 3 'Structure model' '_atom_site.Cartn_x'                          
3 3 'Structure model' '_atom_site.Cartn_y'                          
4 3 'Structure model' '_atom_site.Cartn_z'                          
5 3 'Structure model' '_chem_comp.formula'                          
6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
8 3 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CBASS     'data collection' . ? 1 
SHELXS    phasing           . ? 2 
CNS       refinement        . ? 3 
HKL-2000  'data reduction'  . ? 4 
SCALEPACK 'data scaling'    . ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 A GLU 113 ? ? DY A DY  202 ? ? 1.97 
2 1 CB  A ASN 121 ? ? O2 A DTT 212 ? ? 2.15 
3 1 O   A ASN 121 ? ? O3 A DTT 212 ? ? 2.18 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 OE1 H GLU 113 ? ? 1_555 DY C DY 201 ? B 1_565 2.03 
2 1 OE2 C GLU 125 ? ? 1_555 DY H DY 202 ? ? 1_545 2.10 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 44  ? ? CZ A ARG 44  ? ? NH1 A ARG 44  ? ? 123.41 120.30 3.11  0.50 N 
2 1 CA F LEU 136 ? ? CB F LEU 136 ? ? CG  F LEU 136 ? ? 131.91 115.30 16.61 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 51  ? ? -49.72  -17.27 
2  1 LYS A 73  ? ? -99.77  -61.60 
3  1 LEU A 74  ? ? -38.58  -37.90 
4  1 LYS A 135 ? ? -55.90  172.15 
5  1 GLN B 78  ? ? -60.52  -73.06 
6  1 LEU E 133 ? ? -66.52  9.06   
7  1 SER E 134 ? ? -155.51 56.52  
8  1 SER G 134 ? ? -95.69  -90.25 
9  1 LYS G 135 ? ? 17.43   102.79 
10 1 SER H 79  ? ? -31.56  -36.71 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? C HOH 325 ? 7.16  . 
2 1 O ? F HOH 318 ? 6.02  . 
3 1 O ? G HOH 304 ? 11.42 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 42  ? A SER 1  
2  1 Y 1 A ALA 137 ? A ALA 96 
3  1 Y 1 B SER 42  ? B SER 1  
4  1 Y 1 B SER 43  ? B SER 2  
5  1 Y 1 B ARG 44  ? B ARG 3  
6  1 Y 1 B VAL 45  ? B VAL 4  
7  1 Y 1 B ILE 46  ? B ILE 5  
8  1 Y 1 B GLU 47  ? B GLU 6  
9  1 Y 1 B SER 48  ? B SER 7  
10 1 Y 1 B ALA 137 ? B ALA 96 
11 1 Y 1 C SER 42  ? C SER 1  
12 1 Y 1 C SER 43  ? C SER 2  
13 1 Y 1 C ARG 44  ? C ARG 3  
14 1 Y 1 C VAL 45  ? C VAL 4  
15 1 Y 1 C LEU 136 ? C LEU 95 
16 1 Y 1 C ALA 137 ? C ALA 96 
17 1 Y 1 D SER 42  ? D SER 1  
18 1 Y 1 D SER 43  ? D SER 2  
19 1 Y 1 D ARG 44  ? D ARG 3  
20 1 Y 1 D VAL 45  ? D VAL 4  
21 1 Y 1 D ALA 137 ? D ALA 96 
22 1 Y 1 E SER 42  ? E SER 1  
23 1 Y 1 E SER 43  ? E SER 2  
24 1 Y 1 E ARG 44  ? E ARG 3  
25 1 Y 1 E VAL 45  ? E VAL 4  
26 1 Y 1 E ILE 46  ? E ILE 5  
27 1 Y 1 E ALA 137 ? E ALA 96 
28 1 Y 1 F SER 42  ? F SER 1  
29 1 Y 1 F SER 43  ? F SER 2  
30 1 Y 1 F ARG 44  ? F ARG 3  
31 1 Y 1 F VAL 45  ? F VAL 4  
32 1 Y 1 F ALA 137 ? F ALA 96 
33 1 Y 1 G SER 42  ? G SER 1  
34 1 Y 1 G SER 43  ? G SER 2  
35 1 Y 1 G ARG 44  ? G ARG 3  
36 1 Y 1 G VAL 45  ? G VAL 4  
37 1 Y 1 G ILE 46  ? G ILE 5  
38 1 Y 1 G GLU 47  ? G GLU 6  
39 1 Y 1 G SER 48  ? G SER 7  
40 1 Y 1 G LEU 49  ? G LEU 8  
41 1 Y 1 G ALA 137 ? G ALA 96 
42 1 Y 1 H SER 42  ? H SER 1  
43 1 Y 1 H SER 43  ? H SER 2  
44 1 Y 1 H ARG 44  ? H ARG 3  
45 1 Y 1 H VAL 45  ? H VAL 4  
46 1 Y 1 H ALA 137 ? H ALA 96 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'DYSPROSIUM ION'               DY  
3 'SULFATE ION'                  SO4 
4 'PLATINUM (II) ION'            PT  
5 2,3-DIHYDROXY-1,4-DITHIOBUTANE DTT 
6 1,2-ETHANEDIOL                 EDO 
7 'ISOPROPYL ALCOHOL'            IPA 
8 water                          HOH 
#