data_4LLL
# 
_entry.id   4LLL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4LLL         
NDB   NA2598       
RCSB  RCSB080782   
WWPDB D_1000080782 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4LLN 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        4LLL 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-07-09 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Birukou, I.'   1 
'Brennan, R.G.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Structural mechanism of transcription regulation of the Staphylococcus aureus multidrug efflux operon mepRA by the MarR family repressor MepR.
;
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            42 
_citation.page_first                2774 
_citation.page_last                 2788 
_citation.year                      2014 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24293644 
_citation.pdbx_database_id_DOI      10.1093/nar/gkt1215 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Birukou, I.'     1 
primary 'Seo, S.M.'       2 
primary 'Schindler, B.D.' 3 
primary 'Kaatz, G.W.'     4 
primary 'Brennan, R.G.'   5 
# 
_cell.entry_id           4LLL 
_cell.length_a           130.177 
_cell.length_b           130.177 
_cell.length_c           124.707 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4LLL 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man MepR                                   16262.288 8 ? ? ? ? 
2 polymer syn 'Palindromized mepR operator sequence' 7365.814  6 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;SNEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYR
YVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
;
;SNEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYR
YVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
;
A,B,C,D,I,J,M,O ? 
2 polydeoxyribonucleotide no no 
;(DA)(DT)(DT)(DT)(DA)(DG)(DT)(DT)(DA)(DG)(DA)(DT)(DA)(DT)(DC)(DT)(DA)(DA)(DC)(DT)
(DA)(DA)(DA)(DT)
;
ATTTAGTTAGATATCTAACTAAAT E,F,G,H,K,L     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   GLU n 
1 4   PHE n 
1 5   THR n 
1 6   TYR n 
1 7   SER n 
1 8   TYR n 
1 9   LEU n 
1 10  PHE n 
1 11  ARG n 
1 12  MET n 
1 13  ILE n 
1 14  SER n 
1 15  HIS n 
1 16  GLU n 
1 17  MET n 
1 18  LYS n 
1 19  GLN n 
1 20  LYS n 
1 21  ALA n 
1 22  ASP n 
1 23  GLN n 
1 24  LYS n 
1 25  LEU n 
1 26  GLU n 
1 27  GLN n 
1 28  PHE n 
1 29  ASP n 
1 30  ILE n 
1 31  THR n 
1 32  ASN n 
1 33  GLU n 
1 34  GLN n 
1 35  GLY n 
1 36  HIS n 
1 37  THR n 
1 38  LEU n 
1 39  GLY n 
1 40  TYR n 
1 41  LEU n 
1 42  TYR n 
1 43  ALA n 
1 44  HIS n 
1 45  GLN n 
1 46  GLN n 
1 47  ASP n 
1 48  GLY n 
1 49  LEU n 
1 50  THR n 
1 51  GLN n 
1 52  ASN n 
1 53  ASP n 
1 54  ILE n 
1 55  ALA n 
1 56  LYS n 
1 57  ALA n 
1 58  LEU n 
1 59  GLN n 
1 60  ARG n 
1 61  THR n 
1 62  GLY n 
1 63  PRO n 
1 64  THR n 
1 65  VAL n 
1 66  SER n 
1 67  ASN n 
1 68  LEU n 
1 69  LEU n 
1 70  ARG n 
1 71  ASN n 
1 72  LEU n 
1 73  GLU n 
1 74  ARG n 
1 75  LYS n 
1 76  LYS n 
1 77  LEU n 
1 78  ILE n 
1 79  TYR n 
1 80  ARG n 
1 81  TYR n 
1 82  VAL n 
1 83  ASP n 
1 84  ALA n 
1 85  GLN n 
1 86  ASP n 
1 87  THR n 
1 88  ARG n 
1 89  ARG n 
1 90  LYS n 
1 91  ASN n 
1 92  ILE n 
1 93  GLY n 
1 94  LEU n 
1 95  THR n 
1 96  THR n 
1 97  SER n 
1 98  GLY n 
1 99  ILE n 
1 100 LYS n 
1 101 LEU n 
1 102 VAL n 
1 103 GLU n 
1 104 ALA n 
1 105 PHE n 
1 106 THR n 
1 107 SER n 
1 108 ILE n 
1 109 PHE n 
1 110 ASP n 
1 111 GLU n 
1 112 MET n 
1 113 GLU n 
1 114 GLN n 
1 115 THR n 
1 116 LEU n 
1 117 VAL n 
1 118 SER n 
1 119 GLN n 
1 120 LEU n 
1 121 SER n 
1 122 GLU n 
1 123 GLU n 
1 124 GLU n 
1 125 ASN n 
1 126 GLU n 
1 127 GLN n 
1 128 MET n 
1 129 LYS n 
1 130 ALA n 
1 131 ASN n 
1 132 LEU n 
1 133 THR n 
1 134 LYS n 
1 135 MET n 
1 136 LEU n 
1 137 SER n 
1 138 SER n 
1 139 LEU n 
1 140 GLN n 
2 1   DA  n 
2 2   DT  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DG  n 
2 7   DT  n 
2 8   DT  n 
2 9   DA  n 
2 10  DG  n 
2 11  DA  n 
2 12  DT  n 
2 13  DA  n 
2 14  DT  n 
2 15  DC  n 
2 16  DT  n 
2 17  DA  n 
2 18  DA  n 
2 19  DC  n 
2 20  DT  n 
2 21  DA  n 
2 22  DA  n 
2 23  DA  n 
2 24  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 mepR 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Staphylococcus aureus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1280 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q5Y812_STAAU Q5Y812 1 
;EFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYV
DAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
;
2 ? 
2 PDB 4LLL         4LLL   2 ATTTAGTTAGATATCTAACTAAAT ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4LLL A 3 ? 140 ? Q5Y812 2 ? 139 ? 2 139 
2  1 4LLL B 3 ? 140 ? Q5Y812 2 ? 139 ? 2 139 
3  1 4LLL C 3 ? 140 ? Q5Y812 2 ? 139 ? 2 139 
4  1 4LLL D 3 ? 140 ? Q5Y812 2 ? 139 ? 2 139 
5  1 4LLL I 3 ? 140 ? Q5Y812 2 ? 139 ? 2 139 
6  1 4LLL J 3 ? 140 ? Q5Y812 2 ? 139 ? 2 139 
7  1 4LLL M 3 ? 140 ? Q5Y812 2 ? 139 ? 2 139 
8  1 4LLL O 3 ? 140 ? Q5Y812 2 ? 139 ? 2 139 
9  2 4LLL E 1 ? 24  ? 4LLL   1 ? 24  ? 1 24  
10 2 4LLL F 1 ? 24  ? 4LLL   1 ? 24  ? 1 24  
11 2 4LLL G 1 ? 24  ? 4LLL   1 ? 24  ? 1 24  
12 2 4LLL H 1 ? 24  ? 4LLL   1 ? 24  ? 1 24  
13 2 4LLL K 1 ? 24  ? 4LLL   1 ? 24  ? 1 24  
14 2 4LLL L 1 ? 24  ? 4LLL   1 ? 24  ? 1 24  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4LLL SER A 1 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 0 1  
1 4LLL ASN A 2 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 1 2  
2 4LLL SER B 1 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 0 3  
2 4LLL ASN B 2 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 1 4  
3 4LLL SER C 1 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 0 5  
3 4LLL ASN C 2 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 1 6  
4 4LLL SER D 1 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 0 7  
4 4LLL ASN D 2 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 1 8  
5 4LLL SER I 1 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 0 9  
5 4LLL ASN I 2 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 1 10 
6 4LLL SER J 1 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 0 11 
6 4LLL ASN J 2 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 1 12 
7 4LLL SER M 1 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 0 13 
7 4LLL ASN M 2 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 1 14 
8 4LLL SER O 1 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 0 15 
8 4LLL ASN O 2 ? UNP Q5Y812 ? ? 'EXPRESSION TAG' 1 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4LLL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.50 
_exptl_crystal.density_percent_sol   64.86 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'0.04M Mg Acetate, 0.05M Na Cacodylate, 30% (+/-)-2-methyl-2,4-pentanediol., pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 315r' 2012-07-18 ? 
2 CCD 'ADSC QUANTUM 315r' 2012-07-18 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'Double-crystal, Si(111) liquid N2 cooled' 'SINGLE WAVELENGTH' x-ray 
2 1 M 'Double-crystal, Si(111) liquid N2 cooled' 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1     1.0 
2 0.979 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'ALS BEAMLINE 5.0.2' ALS 5.0.2 ? 1     
2 SYNCHROTRON 'ALS BEAMLINE 5.0.2' ALS 5.0.2 ? 0.979 
# 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4LLL 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            3.00 
_reflns.number_obs                   47910 
_reflns.number_all                   47910 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.081 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        42.9 
_reflns.B_iso_Wilson_estimate        79.470 
_reflns.pdbx_redundancy              11.5 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4LLL 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     45454 
_refine.ls_number_reflns_all                     45646 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.97 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             42.610 
_refine.ls_d_res_high                            3.036 
_refine.ls_percent_reflns_obs                    99.58 
_refine.ls_R_factor_obs                          0.1952 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1936 
_refine.ls_R_factor_R_free                       0.2340 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.24 
_refine.ls_number_reflns_R_free                  1929 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.220 
_refine.occupancy_max                            1.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               75.2658 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'Molecular Replacement/SAD' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.41 
_refine.pdbx_overall_phase_error                 25.12 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8103 
_refine_hist.pdbx_number_atoms_nucleic_acid   2934 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               11037 
_refine_hist.d_res_high                       3.036 
_refine_hist.d_res_low                        42.610 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.009  ? ? 11494 'X-RAY DIFFRACTION' ? 
f_angle_d          1.533  ? ? 16182 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 22.762 ? ? 4291  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.079  ? ? 1887  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 1592  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.0358 3.1117  3029 0.3133 97.00  0.3780 . . 134 . . . . 
'X-RAY DIFFRACTION' . 3.1117 3.1958  3078 0.2490 100.00 0.2597 . . 144 . . . . 
'X-RAY DIFFRACTION' . 3.1958 3.2898  3039 0.2061 99.00  0.2614 . . 134 . . . . 
'X-RAY DIFFRACTION' . 3.2898 3.3960  3180 0.2116 100.00 0.2815 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.3960 3.5173  3152 0.2129 100.00 0.2467 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.5173 3.6580  3075 0.2062 100.00 0.2614 . . 134 . . . . 
'X-RAY DIFFRACTION' . 3.6580 3.8244  3140 0.2068 100.00 0.2377 . . 144 . . . . 
'X-RAY DIFFRACTION' . 3.8244 4.0259  3126 0.1905 100.00 0.2927 . . 136 . . . . 
'X-RAY DIFFRACTION' . 4.0259 4.2779  3085 0.1830 100.00 0.2279 . . 141 . . . . 
'X-RAY DIFFRACTION' . 4.2779 4.6079  3158 0.1773 100.00 0.2283 . . 138 . . . . 
'X-RAY DIFFRACTION' . 4.6079 5.0709  3083 0.1916 100.00 0.2279 . . 142 . . . . 
'X-RAY DIFFRACTION' . 5.0709 5.8031  3137 0.2126 100.00 0.2573 . . 125 . . . . 
'X-RAY DIFFRACTION' . 5.8031 7.3053  3129 0.2139 100.00 0.2666 . . 142 . . . . 
'X-RAY DIFFRACTION' . 7.3053 42.6146 3114 0.1582 99.00  0.1671 . . 135 . . . . 
# 
_struct.entry_id                  4LLL 
_struct.title                     'Crystal structure of S. aureus MepR-DNA complex' 
_struct.pdbx_descriptor           MepR 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4LLL 
_struct_keywords.text            
'multidrug resistance, winged helix-turn-helix, transcription repression, mepR operator, TRANSCRIPTION-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 5   ? LEU A 25  ? THR A 4   LEU A 24  1 ? 21 
HELX_P HELX_P2  2  THR A 31  ? GLN A 45  ? THR A 30  GLN A 44  1 ? 15 
HELX_P HELX_P3  3  GLN A 46  ? GLY A 48  ? GLN A 45  GLY A 47  5 ? 3  
HELX_P HELX_P4  4  THR A 50  ? GLN A 59  ? THR A 49  GLN A 58  1 ? 10 
HELX_P HELX_P5  5  THR A 61  ? LYS A 75  ? THR A 60  LYS A 74  1 ? 15 
HELX_P HELX_P6  6  THR A 95  ? SER A 118 ? THR A 94  SER A 117 1 ? 24 
HELX_P HELX_P7  7  SER A 121 ? LEU A 139 ? SER A 120 LEU A 138 1 ? 19 
HELX_P HELX_P8  8  THR B 5   ? LEU B 25  ? THR B 4   LEU B 24  1 ? 21 
HELX_P HELX_P9  9  GLU B 26  ? ASP B 29  ? GLU B 25  ASP B 28  5 ? 4  
HELX_P HELX_P10 10 THR B 31  ? GLN B 45  ? THR B 30  GLN B 44  1 ? 15 
HELX_P HELX_P11 11 GLN B 46  ? GLY B 48  ? GLN B 45  GLY B 47  5 ? 3  
HELX_P HELX_P12 12 THR B 50  ? GLN B 59  ? THR B 49  GLN B 58  1 ? 10 
HELX_P HELX_P13 13 THR B 61  ? LYS B 75  ? THR B 60  LYS B 74  1 ? 15 
HELX_P HELX_P14 14 THR B 95  ? GLN B 119 ? THR B 94  GLN B 118 1 ? 25 
HELX_P HELX_P15 15 SER B 121 ? GLN B 140 ? SER B 120 GLN B 139 1 ? 20 
HELX_P HELX_P16 16 THR C 5   ? GLU C 26  ? THR C 4   GLU C 25  1 ? 22 
HELX_P HELX_P17 17 GLN C 27  ? ASP C 29  ? GLN C 26  ASP C 28  5 ? 3  
HELX_P HELX_P18 18 THR C 31  ? GLN C 45  ? THR C 30  GLN C 44  1 ? 15 
HELX_P HELX_P19 19 GLN C 46  ? GLY C 48  ? GLN C 45  GLY C 47  5 ? 3  
HELX_P HELX_P20 20 THR C 50  ? GLN C 59  ? THR C 49  GLN C 58  1 ? 10 
HELX_P HELX_P21 21 THR C 61  ? LYS C 75  ? THR C 60  LYS C 74  1 ? 15 
HELX_P HELX_P22 22 THR C 95  ? VAL C 117 ? THR C 94  VAL C 116 1 ? 23 
HELX_P HELX_P23 23 SER C 121 ? SER C 138 ? SER C 120 SER C 137 1 ? 18 
HELX_P HELX_P24 24 THR D 5   ? GLU D 26  ? THR D 4   GLU D 25  1 ? 22 
HELX_P HELX_P25 25 GLN D 27  ? ASP D 29  ? GLN D 26  ASP D 28  5 ? 3  
HELX_P HELX_P26 26 THR D 31  ? GLN D 45  ? THR D 30  GLN D 44  1 ? 15 
HELX_P HELX_P27 27 THR D 50  ? GLN D 59  ? THR D 49  GLN D 58  1 ? 10 
HELX_P HELX_P28 28 THR D 61  ? LYS D 75  ? THR D 60  LYS D 74  1 ? 15 
HELX_P HELX_P29 29 THR D 95  ? LEU D 120 ? THR D 94  LEU D 119 1 ? 26 
HELX_P HELX_P30 30 SER D 121 ? GLN D 140 ? SER D 120 GLN D 139 1 ? 20 
HELX_P HELX_P31 31 THR E 5   ? LYS E 24  ? THR I 4   LYS I 23  1 ? 20 
HELX_P HELX_P32 32 THR E 31  ? GLN E 45  ? THR I 30  GLN I 44  1 ? 15 
HELX_P HELX_P33 33 GLN E 46  ? GLY E 48  ? GLN I 45  GLY I 47  5 ? 3  
HELX_P HELX_P34 34 THR E 50  ? LEU E 58  ? THR I 49  LEU I 57  1 ? 9  
HELX_P HELX_P35 35 THR E 61  ? LYS E 75  ? THR I 60  LYS I 74  1 ? 15 
HELX_P HELX_P36 36 THR E 95  ? LEU E 120 ? THR I 94  LEU I 119 1 ? 26 
HELX_P HELX_P37 37 GLU E 123 ? SER E 138 ? GLU I 122 SER I 137 1 ? 16 
HELX_P HELX_P38 38 THR F 5   ? GLN F 27  ? THR J 4   GLN J 26  1 ? 23 
HELX_P HELX_P39 39 THR F 31  ? HIS F 44  ? THR J 30  HIS J 43  1 ? 14 
HELX_P HELX_P40 40 GLN F 45  ? GLY F 48  ? GLN J 44  GLY J 47  5 ? 4  
HELX_P HELX_P41 41 THR F 50  ? LEU F 58  ? THR J 49  LEU J 57  1 ? 9  
HELX_P HELX_P42 42 THR F 61  ? LYS F 75  ? THR J 60  LYS J 74  1 ? 15 
HELX_P HELX_P43 43 THR F 95  ? SER F 118 ? THR J 94  SER J 117 1 ? 24 
HELX_P HELX_P44 44 GLU F 123 ? GLN F 140 ? GLU J 122 GLN J 139 1 ? 18 
HELX_P HELX_P45 45 TYR G 8   ? PHE G 28  ? TYR M 7   PHE M 27  1 ? 21 
HELX_P HELX_P46 46 THR G 31  ? ALA G 43  ? THR M 30  ALA M 42  1 ? 13 
HELX_P HELX_P47 47 THR G 50  ? GLN G 59  ? THR M 49  GLN M 58  1 ? 10 
HELX_P HELX_P48 48 THR G 61  ? LYS G 75  ? THR M 60  LYS M 74  1 ? 15 
HELX_P HELX_P49 49 THR G 95  ? THR G 115 ? THR M 94  THR M 114 1 ? 21 
HELX_P HELX_P50 50 GLN G 127 ? GLN G 140 ? GLN M 126 GLN M 139 1 ? 14 
HELX_P HELX_P51 51 SER H 7   ? ASP H 29  ? SER O 6   ASP O 28  1 ? 23 
HELX_P HELX_P52 52 THR H 31  ? LEU H 49  ? THR O 30  LEU O 48  1 ? 19 
HELX_P HELX_P53 53 THR H 50  ? LEU H 58  ? THR O 49  LEU O 57  1 ? 9  
HELX_P HELX_P54 54 THR H 61  ? LYS H 75  ? THR O 60  LYS O 74  1 ? 15 
HELX_P HELX_P55 55 THR H 95  ? LEU H 120 ? THR O 94  LEU O 119 1 ? 26 
HELX_P HELX_P56 56 SER H 121 ? LEU H 139 ? SER O 120 LEU O 138 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? I DA 1  N1 ? ? ? 1_555 J DT 24 N3 ? ? E DA 1  F DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2   hydrog ? ? I DA 1  N6 ? ? ? 1_555 J DT 24 O4 ? ? E DA 1  F DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3   hydrog ? ? I DT 2  N3 ? ? ? 1_555 J DA 23 N1 ? ? E DT 2  F DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4   hydrog ? ? I DT 2  O4 ? ? ? 1_555 J DA 23 N6 ? ? E DT 2  F DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5   hydrog ? ? I DT 3  N3 ? ? ? 1_555 J DA 22 N1 ? ? E DT 3  F DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6   hydrog ? ? I DT 3  O4 ? ? ? 1_555 J DA 22 N6 ? ? E DT 3  F DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7   hydrog ? ? I DT 4  N3 ? ? ? 1_555 J DA 21 N1 ? ? E DT 4  F DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8   hydrog ? ? I DT 4  O4 ? ? ? 1_555 J DA 21 N6 ? ? E DT 4  F DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9   hydrog ? ? I DA 5  N1 ? ? ? 1_555 J DT 20 N3 ? ? E DA 5  F DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10  hydrog ? ? I DA 5  N6 ? ? ? 1_555 J DT 20 O4 ? ? E DA 5  F DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11  hydrog ? ? I DG 6  N1 ? ? ? 1_555 J DC 19 N3 ? ? E DG 6  F DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12  hydrog ? ? I DG 6  N2 ? ? ? 1_555 J DC 19 O2 ? ? E DG 6  F DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13  hydrog ? ? I DG 6  O6 ? ? ? 1_555 J DC 19 N4 ? ? E DG 6  F DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14  hydrog ? ? I DT 7  N3 ? ? ? 1_555 J DA 18 N1 ? ? E DT 7  F DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15  hydrog ? ? I DT 7  O4 ? ? ? 1_555 J DA 18 N6 ? ? E DT 7  F DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16  hydrog ? ? I DT 8  N3 ? ? ? 1_555 J DA 17 N1 ? ? E DT 8  F DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17  hydrog ? ? I DT 8  O4 ? ? ? 1_555 J DA 17 N6 ? ? E DT 8  F DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18  hydrog ? ? I DA 9  N1 ? ? ? 1_555 J DT 16 N3 ? ? E DA 9  F DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19  hydrog ? ? I DA 9  N6 ? ? ? 1_555 J DT 16 O4 ? ? E DA 9  F DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20  hydrog ? ? I DG 10 N1 ? ? ? 1_555 J DC 15 N3 ? ? E DG 10 F DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21  hydrog ? ? I DG 10 N2 ? ? ? 1_555 J DC 15 O2 ? ? E DG 10 F DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22  hydrog ? ? I DG 10 O6 ? ? ? 1_555 J DC 15 N4 ? ? E DG 10 F DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23  hydrog ? ? I DA 11 N1 ? ? ? 1_555 J DT 14 N3 ? ? E DA 11 F DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24  hydrog ? ? I DA 11 N6 ? ? ? 1_555 J DT 14 O4 ? ? E DA 11 F DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25  hydrog ? ? I DT 12 N3 ? ? ? 1_555 J DA 13 N1 ? ? E DT 12 F DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26  hydrog ? ? I DT 12 O4 ? ? ? 1_555 J DA 13 N6 ? ? E DT 12 F DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27  hydrog ? ? I DA 13 N1 ? ? ? 1_555 J DT 12 N3 ? ? E DA 13 F DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28  hydrog ? ? I DA 13 N6 ? ? ? 1_555 J DT 12 O4 ? ? E DA 13 F DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29  hydrog ? ? I DT 14 N3 ? ? ? 1_555 J DA 11 N1 ? ? E DT 14 F DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30  hydrog ? ? I DT 14 O4 ? ? ? 1_555 J DA 11 N6 ? ? E DT 14 F DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31  hydrog ? ? I DC 15 N3 ? ? ? 1_555 J DG 10 N1 ? ? E DC 15 F DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32  hydrog ? ? I DC 15 N4 ? ? ? 1_555 J DG 10 O6 ? ? E DC 15 F DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33  hydrog ? ? I DC 15 O2 ? ? ? 1_555 J DG 10 N2 ? ? E DC 15 F DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34  hydrog ? ? I DT 16 N3 ? ? ? 1_555 J DA 9  N1 ? ? E DT 16 F DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35  hydrog ? ? I DT 16 O4 ? ? ? 1_555 J DA 9  N6 ? ? E DT 16 F DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36  hydrog ? ? I DA 17 N1 ? ? ? 1_555 J DT 8  N3 ? ? E DA 17 F DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37  hydrog ? ? I DA 17 N6 ? ? ? 1_555 J DT 8  O4 ? ? E DA 17 F DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38  hydrog ? ? I DA 18 N1 ? ? ? 1_555 J DT 7  N3 ? ? E DA 18 F DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39  hydrog ? ? I DA 18 N6 ? ? ? 1_555 J DT 7  O4 ? ? E DA 18 F DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40  hydrog ? ? I DC 19 N3 ? ? ? 1_555 J DG 6  N1 ? ? E DC 19 F DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41  hydrog ? ? I DC 19 N4 ? ? ? 1_555 J DG 6  O6 ? ? E DC 19 F DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42  hydrog ? ? I DC 19 O2 ? ? ? 1_555 J DG 6  N2 ? ? E DC 19 F DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43  hydrog ? ? I DT 20 N3 ? ? ? 1_555 J DA 5  N1 ? ? E DT 20 F DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44  hydrog ? ? I DT 20 O4 ? ? ? 1_555 J DA 5  N6 ? ? E DT 20 F DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45  hydrog ? ? I DA 21 N1 ? ? ? 1_555 J DT 4  N3 ? ? E DA 21 F DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46  hydrog ? ? I DA 21 N6 ? ? ? 1_555 J DT 4  O4 ? ? E DA 21 F DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47  hydrog ? ? I DA 22 N1 ? ? ? 1_555 J DT 3  N3 ? ? E DA 22 F DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48  hydrog ? ? I DA 22 N6 ? ? ? 1_555 J DT 3  O4 ? ? E DA 22 F DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49  hydrog ? ? I DA 23 N1 ? ? ? 1_555 J DT 2  N3 ? ? E DA 23 F DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50  hydrog ? ? I DA 23 N6 ? ? ? 1_555 J DT 2  O4 ? ? E DA 23 F DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51  hydrog ? ? K DA 1  N1 ? ? ? 1_555 L DT 24 N3 ? ? G DA 1  H DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52  hydrog ? ? K DA 1  N6 ? ? ? 1_555 L DT 24 O4 ? ? G DA 1  H DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53  hydrog ? ? K DT 2  N3 ? ? ? 1_555 L DA 23 N1 ? ? G DT 2  H DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54  hydrog ? ? K DT 2  O4 ? ? ? 1_555 L DA 23 N6 ? ? G DT 2  H DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55  hydrog ? ? K DT 3  N3 ? ? ? 1_555 L DA 22 N1 ? ? G DT 3  H DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56  hydrog ? ? K DT 3  O4 ? ? ? 1_555 L DA 22 N6 ? ? G DT 3  H DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57  hydrog ? ? K DT 4  N3 ? ? ? 1_555 L DA 21 N1 ? ? G DT 4  H DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58  hydrog ? ? K DT 4  O4 ? ? ? 1_555 L DA 21 N6 ? ? G DT 4  H DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59  hydrog ? ? K DA 5  N1 ? ? ? 1_555 L DT 20 N3 ? ? G DA 5  H DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60  hydrog ? ? K DA 5  N6 ? ? ? 1_555 L DT 20 O4 ? ? G DA 5  H DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61  hydrog ? ? K DG 6  N1 ? ? ? 1_555 L DC 19 N3 ? ? G DG 6  H DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62  hydrog ? ? K DG 6  N2 ? ? ? 1_555 L DC 19 O2 ? ? G DG 6  H DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63  hydrog ? ? K DG 6  O6 ? ? ? 1_555 L DC 19 N4 ? ? G DG 6  H DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64  hydrog ? ? K DT 7  N3 ? ? ? 1_555 L DA 18 N1 ? ? G DT 7  H DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65  hydrog ? ? K DT 7  O4 ? ? ? 1_555 L DA 18 N6 ? ? G DT 7  H DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66  hydrog ? ? K DT 8  N3 ? ? ? 1_555 L DA 17 N1 ? ? G DT 8  H DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67  hydrog ? ? K DT 8  O4 ? ? ? 1_555 L DA 17 N6 ? ? G DT 8  H DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68  hydrog ? ? K DA 9  N1 ? ? ? 1_555 L DT 16 N3 ? ? G DA 9  H DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69  hydrog ? ? K DA 9  N6 ? ? ? 1_555 L DT 16 O4 ? ? G DA 9  H DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70  hydrog ? ? K DG 10 N1 ? ? ? 1_555 L DC 15 N3 ? ? G DG 10 H DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71  hydrog ? ? K DG 10 N2 ? ? ? 1_555 L DC 15 O2 ? ? G DG 10 H DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72  hydrog ? ? K DG 10 O6 ? ? ? 1_555 L DC 15 N4 ? ? G DG 10 H DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73  hydrog ? ? K DA 11 N1 ? ? ? 1_555 L DT 14 N3 ? ? G DA 11 H DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74  hydrog ? ? K DA 11 N6 ? ? ? 1_555 L DT 14 O4 ? ? G DA 11 H DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75  hydrog ? ? K DT 12 N3 ? ? ? 1_555 L DA 13 N1 ? ? G DT 12 H DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76  hydrog ? ? K DT 12 O4 ? ? ? 1_555 L DA 13 N6 ? ? G DT 12 H DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77  hydrog ? ? K DA 13 N1 ? ? ? 1_555 L DT 12 N3 ? ? G DA 13 H DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78  hydrog ? ? K DA 13 N6 ? ? ? 1_555 L DT 12 O4 ? ? G DA 13 H DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79  hydrog ? ? K DT 14 N3 ? ? ? 1_555 L DA 11 N1 ? ? G DT 14 H DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80  hydrog ? ? K DT 14 O4 ? ? ? 1_555 L DA 11 N6 ? ? G DT 14 H DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81  hydrog ? ? K DC 15 N3 ? ? ? 1_555 L DG 10 N1 ? ? G DC 15 H DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog82  hydrog ? ? K DC 15 N4 ? ? ? 1_555 L DG 10 O6 ? ? G DC 15 H DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog83  hydrog ? ? K DC 15 O2 ? ? ? 1_555 L DG 10 N2 ? ? G DC 15 H DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog84  hydrog ? ? K DT 16 N3 ? ? ? 1_555 L DA 9  N1 ? ? G DT 16 H DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog85  hydrog ? ? K DT 16 O4 ? ? ? 1_555 L DA 9  N6 ? ? G DT 16 H DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog86  hydrog ? ? K DA 17 N1 ? ? ? 1_555 L DT 8  N3 ? ? G DA 17 H DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog87  hydrog ? ? K DA 17 N6 ? ? ? 1_555 L DT 8  O4 ? ? G DA 17 H DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog88  hydrog ? ? K DA 18 N1 ? ? ? 1_555 L DT 7  N3 ? ? G DA 18 H DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog89  hydrog ? ? K DA 18 N6 ? ? ? 1_555 L DT 7  O4 ? ? G DA 18 H DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog90  hydrog ? ? K DC 19 N3 ? ? ? 1_555 L DG 6  N1 ? ? G DC 19 H DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91  hydrog ? ? K DC 19 N4 ? ? ? 1_555 L DG 6  O6 ? ? G DC 19 H DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92  hydrog ? ? K DC 19 O2 ? ? ? 1_555 L DG 6  N2 ? ? G DC 19 H DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93  hydrog ? ? K DT 20 N3 ? ? ? 1_555 L DA 5  N1 ? ? G DT 20 H DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94  hydrog ? ? K DT 20 O4 ? ? ? 1_555 L DA 5  N6 ? ? G DT 20 H DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95  hydrog ? ? K DA 21 N1 ? ? ? 1_555 L DT 4  N3 ? ? G DA 21 H DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96  hydrog ? ? K DA 21 N6 ? ? ? 1_555 L DT 4  O4 ? ? G DA 21 H DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog97  hydrog ? ? K DA 22 N1 ? ? ? 1_555 L DT 3  N3 ? ? G DA 22 H DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98  hydrog ? ? K DA 22 N6 ? ? ? 1_555 L DT 3  O4 ? ? G DA 22 H DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99  hydrog ? ? K DA 23 N1 ? ? ? 1_555 L DT 2  N3 ? ? G DA 23 H DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100 hydrog ? ? K DA 23 N6 ? ? ? 1_555 L DT 2  O4 ? ? G DA 23 H DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101 hydrog ? ? K DT 24 N3 ? ? ? 1_555 L DA 1  N1 ? ? G DT 24 H DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102 hydrog ? ? K DT 24 O4 ? ? ? 1_555 L DA 1  N6 ? ? G DT 24 H DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103 hydrog ? ? M DA 1  N1 ? ? ? 1_555 N DT 24 N3 ? ? K DA 1  L DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104 hydrog ? ? M DA 1  N6 ? ? ? 1_555 N DT 24 O4 ? ? K DA 1  L DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog105 hydrog ? ? M DT 2  N3 ? ? ? 1_555 N DA 23 N1 ? ? K DT 2  L DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog106 hydrog ? ? M DT 2  O4 ? ? ? 1_555 N DA 23 N6 ? ? K DT 2  L DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog107 hydrog ? ? M DT 3  N3 ? ? ? 1_555 N DA 22 N1 ? ? K DT 3  L DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog108 hydrog ? ? M DT 3  O4 ? ? ? 1_555 N DA 22 N6 ? ? K DT 3  L DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog109 hydrog ? ? M DT 4  N3 ? ? ? 1_555 N DA 21 N1 ? ? K DT 4  L DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog110 hydrog ? ? M DT 4  O4 ? ? ? 1_555 N DA 21 N6 ? ? K DT 4  L DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog111 hydrog ? ? M DA 5  N1 ? ? ? 1_555 N DT 20 N3 ? ? K DA 5  L DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112 hydrog ? ? M DA 5  N6 ? ? ? 1_555 N DT 20 O4 ? ? K DA 5  L DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113 hydrog ? ? M DG 6  N1 ? ? ? 1_555 N DC 19 N3 ? ? K DG 6  L DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114 hydrog ? ? M DG 6  N2 ? ? ? 1_555 N DC 19 O2 ? ? K DG 6  L DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115 hydrog ? ? M DG 6  O6 ? ? ? 1_555 N DC 19 N4 ? ? K DG 6  L DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116 hydrog ? ? M DT 7  N3 ? ? ? 1_555 N DA 18 N1 ? ? K DT 7  L DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog117 hydrog ? ? M DT 7  O4 ? ? ? 1_555 N DA 18 N6 ? ? K DT 7  L DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog118 hydrog ? ? M DT 8  N3 ? ? ? 1_555 N DA 17 N1 ? ? K DT 8  L DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog119 hydrog ? ? M DT 8  O4 ? ? ? 1_555 N DA 17 N6 ? ? K DT 8  L DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog120 hydrog ? ? M DA 9  N1 ? ? ? 1_555 N DT 16 N3 ? ? K DA 9  L DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog121 hydrog ? ? M DA 9  N6 ? ? ? 1_555 N DT 16 O4 ? ? K DA 9  L DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122 hydrog ? ? M DG 10 N1 ? ? ? 1_555 N DC 15 N3 ? ? K DG 10 L DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123 hydrog ? ? M DG 10 N2 ? ? ? 1_555 N DC 15 O2 ? ? K DG 10 L DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124 hydrog ? ? M DG 10 O6 ? ? ? 1_555 N DC 15 N4 ? ? K DG 10 L DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125 hydrog ? ? M DA 11 N1 ? ? ? 1_555 N DT 14 N3 ? ? K DA 11 L DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126 hydrog ? ? M DA 11 N6 ? ? ? 1_555 N DT 14 O4 ? ? K DA 11 L DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog127 hydrog ? ? M DT 12 N3 ? ? ? 1_555 N DA 13 N1 ? ? K DT 12 L DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog128 hydrog ? ? M DT 12 O4 ? ? ? 1_555 N DA 13 N6 ? ? K DT 12 L DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog129 hydrog ? ? M DA 13 N1 ? ? ? 1_555 N DT 12 N3 ? ? K DA 13 L DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog130 hydrog ? ? M DA 13 N6 ? ? ? 1_555 N DT 12 O4 ? ? K DA 13 L DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog131 hydrog ? ? M DT 14 N3 ? ? ? 1_555 N DA 11 N1 ? ? K DT 14 L DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog132 hydrog ? ? M DT 14 O4 ? ? ? 1_555 N DA 11 N6 ? ? K DT 14 L DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog133 hydrog ? ? M DC 15 N3 ? ? ? 1_555 N DG 10 N1 ? ? K DC 15 L DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134 hydrog ? ? M DC 15 N4 ? ? ? 1_555 N DG 10 O6 ? ? K DC 15 L DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135 hydrog ? ? M DC 15 O2 ? ? ? 1_555 N DG 10 N2 ? ? K DC 15 L DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136 hydrog ? ? M DT 16 N3 ? ? ? 1_555 N DA 9  N1 ? ? K DT 16 L DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137 hydrog ? ? M DT 16 O4 ? ? ? 1_555 N DA 9  N6 ? ? K DT 16 L DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138 hydrog ? ? M DA 17 N1 ? ? ? 1_555 N DT 8  N3 ? ? K DA 17 L DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139 hydrog ? ? M DA 17 N6 ? ? ? 1_555 N DT 8  O4 ? ? K DA 17 L DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140 hydrog ? ? M DA 18 N1 ? ? ? 1_555 N DT 7  N3 ? ? K DA 18 L DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141 hydrog ? ? M DA 18 N6 ? ? ? 1_555 N DT 7  O4 ? ? K DA 18 L DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142 hydrog ? ? M DC 19 N3 ? ? ? 1_555 N DG 6  N1 ? ? K DC 19 L DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143 hydrog ? ? M DC 19 N4 ? ? ? 1_555 N DG 6  O6 ? ? K DC 19 L DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144 hydrog ? ? M DC 19 O2 ? ? ? 1_555 N DG 6  N2 ? ? K DC 19 L DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145 hydrog ? ? M DT 20 N3 ? ? ? 1_555 N DA 5  N1 ? ? K DT 20 L DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146 hydrog ? ? M DT 20 O4 ? ? ? 1_555 N DA 5  N6 ? ? K DT 20 L DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147 hydrog ? ? M DA 21 N1 ? ? ? 1_555 N DT 4  N3 ? ? K DA 21 L DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog148 hydrog ? ? M DA 21 N6 ? ? ? 1_555 N DT 4  O4 ? ? K DA 21 L DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog149 hydrog ? ? M DA 22 N1 ? ? ? 1_555 N DT 3  N3 ? ? K DA 22 L DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog150 hydrog ? ? M DA 22 N6 ? ? ? 1_555 N DT 3  O4 ? ? K DA 22 L DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog151 hydrog ? ? M DA 23 N1 ? ? ? 1_555 N DT 2  N3 ? ? K DA 23 L DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog152 hydrog ? ? M DA 23 N6 ? ? ? 1_555 N DT 2  O4 ? ? K DA 23 L DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog153 hydrog ? ? M DT 24 N3 ? ? ? 1_555 N DA 1  N1 ? ? K DT 24 L DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog154 hydrog ? ? M DT 24 O4 ? ? ? 1_555 N DA 1  N6 ? ? K DT 24 L DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 47 A . ? ASP 46 A GLY 48 A ? GLY 47 A 1 -6.34  
2 ASP 47 C . ? ASP 46 C GLY 48 C ? GLY 47 C 1 -3.32  
3 ASP 47 E . ? ASP 46 I GLY 48 E ? GLY 47 I 1 -23.72 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 78 ? VAL A 82 ? ILE A 77 VAL A 81 
A 2 LYS A 90 ? LEU A 94 ? LYS A 89 LEU A 93 
B 1 ILE B 78 ? VAL B 82 ? ILE B 77 VAL B 81 
B 2 LYS B 90 ? LEU B 94 ? LYS B 89 LEU B 93 
C 1 ILE C 78 ? VAL C 82 ? ILE C 77 VAL C 81 
C 2 LYS C 90 ? LEU C 94 ? LYS C 89 LEU C 93 
D 1 ILE D 78 ? VAL D 82 ? ILE D 77 VAL D 81 
D 2 LYS D 90 ? LEU D 94 ? LYS D 89 LEU D 93 
E 1 ILE E 78 ? VAL E 82 ? ILE I 77 VAL I 81 
E 2 LYS E 90 ? LEU E 94 ? LYS I 89 LEU I 93 
F 1 ILE F 78 ? VAL F 82 ? ILE J 77 VAL J 81 
F 2 LYS F 90 ? LEU F 94 ? LYS J 89 LEU J 93 
G 1 ILE G 78 ? VAL G 82 ? ILE M 77 VAL M 81 
G 2 LYS G 90 ? LEU G 94 ? LYS M 89 LEU M 93 
H 1 ILE H 78 ? VAL H 82 ? ILE O 77 VAL O 81 
H 2 LYS H 90 ? LEU H 94 ? LYS O 89 LEU O 93 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 81 ? N TYR A 80 O ASN A 91 ? O ASN A 90 
B 1 2 N TYR B 81 ? N TYR B 80 O ASN B 91 ? O ASN B 90 
C 1 2 N TYR C 79 ? N TYR C 78 O GLY C 93 ? O GLY C 92 
D 1 2 N TYR D 81 ? N TYR D 80 O ASN D 91 ? O ASN D 90 
E 1 2 N TYR E 81 ? N TYR I 80 O ASN E 91 ? O ASN I 90 
F 1 2 N TYR F 81 ? N TYR J 80 O ASN F 91 ? O ASN J 90 
G 1 2 N TYR G 79 ? N TYR M 78 O GLY G 93 ? O GLY M 92 
H 1 2 N TYR H 79 ? N TYR O 78 O GLY H 93 ? O GLY O 92 
# 
_atom_sites.entry_id                    4LLL 
_atom_sites.fract_transf_matrix[1][1]   0.007682 
_atom_sites.fract_transf_matrix[1][2]   0.004435 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008870 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008019 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N     . GLU A 1 3   ? 97.316  96.757  34.324  1.00 106.88 ? 2   GLU A N     1 
ATOM 2     C CA    . GLU A 1 3   ? 97.154  95.616  33.427  1.00 106.13 ? 2   GLU A CA    1 
ATOM 3     C C     . GLU A 1 3   ? 98.515  95.081  33.014  1.00 104.50 ? 2   GLU A C     1 
ATOM 4     O O     . GLU A 1 3   ? 99.039  95.435  31.954  1.00 107.45 ? 2   GLU A O     1 
ATOM 5     C CB    . GLU A 1 3   ? 96.345  96.004  32.186  1.00 110.65 ? 2   GLU A CB    1 
ATOM 6     N N     . PHE A 1 4   ? 99.069  94.190  33.822  1.00 100.20 ? 3   PHE A N     1 
ATOM 7     C CA    . PHE A 1 4   ? 100.442 93.755  33.635  1.00 99.31  ? 3   PHE A CA    1 
ATOM 8     C C     . PHE A 1 4   ? 100.625 92.346  33.116  1.00 97.78  ? 3   PHE A C     1 
ATOM 9     O O     . PHE A 1 4   ? 99.847  91.451  33.412  1.00 95.90  ? 3   PHE A O     1 
ATOM 10    C CB    . PHE A 1 4   ? 101.215 93.897  34.935  1.00 96.82  ? 3   PHE A CB    1 
ATOM 11    C CG    . PHE A 1 4   ? 101.691 95.287  35.194  1.00 99.45  ? 3   PHE A CG    1 
ATOM 12    C CD1   . PHE A 1 4   ? 102.610 95.877  34.355  1.00 102.87 ? 3   PHE A CD1   1 
ATOM 13    C CD2   . PHE A 1 4   ? 101.213 96.004  36.269  1.00 98.77  ? 3   PHE A CD2   1 
ATOM 14    C CE1   . PHE A 1 4   ? 103.053 97.161  34.586  1.00 105.52 ? 3   PHE A CE1   1 
ATOM 15    C CE2   . PHE A 1 4   ? 101.651 97.287  36.509  1.00 101.10 ? 3   PHE A CE2   1 
ATOM 16    C CZ    . PHE A 1 4   ? 102.573 97.867  35.666  1.00 104.25 ? 3   PHE A CZ    1 
ATOM 17    N N     . THR A 1 5   ? 101.681 92.168  32.337  1.00 75.49  ? 4   THR A N     1 
ATOM 18    C CA    . THR A 1 5   ? 102.015 90.876  31.784  1.00 74.32  ? 4   THR A CA    1 
ATOM 19    C C     . THR A 1 5   ? 102.270 89.951  32.941  1.00 71.21  ? 4   THR A C     1 
ATOM 20    O O     . THR A 1 5   ? 102.820 90.358  33.950  1.00 69.70  ? 4   THR A O     1 
ATOM 21    C CB    . THR A 1 5   ? 103.295 90.960  30.942  1.00 76.27  ? 4   THR A CB    1 
ATOM 22    O OG1   . THR A 1 5   ? 103.492 89.736  30.229  1.00 76.54  ? 4   THR A OG1   1 
ATOM 23    C CG2   . THR A 1 5   ? 104.486 91.201  31.830  1.00 75.18  ? 4   THR A CG2   1 
ATOM 24    N N     . TYR A 1 6   ? 101.934 88.687  32.775  1.00 95.03  ? 5   TYR A N     1 
ATOM 25    C CA    . TYR A 1 6   ? 102.032 87.747  33.871  1.00 91.71  ? 5   TYR A CA    1 
ATOM 26    C C     . TYR A 1 6   ? 103.478 87.644  34.321  1.00 90.82  ? 5   TYR A C     1 
ATOM 27    O O     . TYR A 1 6   ? 103.755 87.540  35.509  1.00 87.46  ? 5   TYR A O     1 
ATOM 28    C CB    . TYR A 1 6   ? 101.453 86.383  33.511  1.00 91.58  ? 5   TYR A CB    1 
ATOM 29    C CG    . TYR A 1 6   ? 99.978  86.305  33.793  1.00 91.57  ? 5   TYR A CG    1 
ATOM 30    C CD1   . TYR A 1 6   ? 99.429  85.209  34.423  1.00 89.98  ? 5   TYR A CD1   1 
ATOM 31    C CD2   . TYR A 1 6   ? 99.140  87.345  33.450  1.00 93.44  ? 5   TYR A CD2   1 
ATOM 32    C CE1   . TYR A 1 6   ? 98.081  85.145  34.691  1.00 90.52  ? 5   TYR A CE1   1 
ATOM 33    C CE2   . TYR A 1 6   ? 97.792  87.291  33.714  1.00 94.11  ? 5   TYR A CE2   1 
ATOM 34    C CZ    . TYR A 1 6   ? 97.272  86.188  34.336  1.00 93.03  ? 5   TYR A CZ    1 
ATOM 35    O OH    . TYR A 1 6   ? 95.931  86.130  34.603  1.00 95.36  ? 5   TYR A OH    1 
ATOM 36    N N     . SER A 1 7   ? 104.405 87.745  33.382  1.00 87.78  ? 6   SER A N     1 
ATOM 37    C CA    . SER A 1 7   ? 105.807 87.583  33.715  1.00 87.05  ? 6   SER A CA    1 
ATOM 38    C C     . SER A 1 7   ? 106.220 88.640  34.709  1.00 86.26  ? 6   SER A C     1 
ATOM 39    O O     . SER A 1 7   ? 106.938 88.368  35.663  1.00 84.38  ? 6   SER A O     1 
ATOM 40    C CB    . SER A 1 7   ? 106.666 87.712  32.460  1.00 89.41  ? 6   SER A CB    1 
ATOM 41    O OG    . SER A 1 7   ? 106.913 89.068  32.134  1.00 91.63  ? 6   SER A OG    1 
ATOM 42    N N     . TYR A 1 8   ? 105.783 89.860  34.463  1.00 64.65  ? 7   TYR A N     1 
ATOM 43    C CA    . TYR A 1 8   ? 106.212 90.947  35.292  1.00 65.05  ? 7   TYR A CA    1 
ATOM 44    C C     . TYR A 1 8   ? 105.728 90.634  36.670  1.00 62.22  ? 7   TYR A C     1 
ATOM 45    O O     . TYR A 1 8   ? 106.449 90.787  37.642  1.00 61.56  ? 7   TYR A O     1 
ATOM 46    C CB    . TYR A 1 8   ? 105.559 92.228  34.811  1.00 67.93  ? 7   TYR A CB    1 
ATOM 47    C CG    . TYR A 1 8   ? 105.920 93.438  35.617  1.00 69.49  ? 7   TYR A CG    1 
ATOM 48    C CD1   . TYR A 1 8   ? 107.094 94.121  35.382  1.00 72.10  ? 7   TYR A CD1   1 
ATOM 49    C CD2   . TYR A 1 8   ? 105.080 93.905  36.604  1.00 68.33  ? 7   TYR A CD2   1 
ATOM 50    C CE1   . TYR A 1 8   ? 107.424 95.237  36.114  1.00 74.21  ? 7   TYR A CE1   1 
ATOM 51    C CE2   . TYR A 1 8   ? 105.401 95.019  37.343  1.00 70.00  ? 7   TYR A CE2   1 
ATOM 52    C CZ    . TYR A 1 8   ? 106.573 95.678  37.092  1.00 73.49  ? 7   TYR A CZ    1 
ATOM 53    O OH    . TYR A 1 8   ? 106.893 96.786  37.828  1.00 75.10  ? 7   TYR A OH    1 
ATOM 54    N N     . LEU A 1 9   ? 104.491 90.183  36.755  1.00 59.94  ? 8   LEU A N     1 
ATOM 55    C CA    . LEU A 1 9   ? 103.904 89.968  38.053  1.00 56.30  ? 8   LEU A CA    1 
ATOM 56    C C     . LEU A 1 9   ? 104.576 88.882  38.861  1.00 51.88  ? 8   LEU A C     1 
ATOM 57    O O     . LEU A 1 9   ? 104.904 89.096  40.015  1.00 49.44  ? 8   LEU A O     1 
ATOM 58    C CB    . LEU A 1 9   ? 102.425 89.656  37.890  1.00 55.24  ? 8   LEU A CB    1 
ATOM 59    C CG    . LEU A 1 9   ? 101.699 90.660  37.002  1.00 59.14  ? 8   LEU A CG    1 
ATOM 60    C CD1   . LEU A 1 9   ? 100.293 90.189  36.691  1.00 58.91  ? 8   LEU A CD1   1 
ATOM 61    C CD2   . LEU A 1 9   ? 101.678 92.024  37.663  1.00 60.16  ? 8   LEU A CD2   1 
ATOM 62    N N     . PHE A 1 10  ? 104.746 87.711  38.285  1.00 58.64  ? 9   PHE A N     1 
ATOM 63    C CA    . PHE A 1 10  ? 105.394 86.665  39.031  1.00 54.42  ? 9   PHE A CA    1 
ATOM 64    C C     . PHE A 1 10  ? 106.797 87.124  39.333  1.00 55.23  ? 9   PHE A C     1 
ATOM 65    O O     . PHE A 1 10  ? 107.300 86.936  40.427  1.00 52.18  ? 9   PHE A O     1 
ATOM 66    C CB    . PHE A 1 10  ? 105.421 85.386  38.218  1.00 54.48  ? 9   PHE A CB    1 
ATOM 67    C CG    . PHE A 1 10  ? 104.066 84.828  37.947  1.00 55.74  ? 9   PHE A CG    1 
ATOM 68    C CD1   . PHE A 1 10  ? 103.102 84.843  38.926  1.00 55.09  ? 9   PHE A CD1   1 
ATOM 69    C CD2   . PHE A 1 10  ? 103.757 84.296  36.718  1.00 58.30  ? 9   PHE A CD2   1 
ATOM 70    C CE1   . PHE A 1 10  ? 101.848 84.335  38.688  1.00 56.86  ? 9   PHE A CE1   1 
ATOM 71    C CE2   . PHE A 1 10  ? 102.504 83.781  36.469  1.00 59.97  ? 9   PHE A CE2   1 
ATOM 72    C CZ    . PHE A 1 10  ? 101.547 83.802  37.456  1.00 59.38  ? 9   PHE A CZ    1 
ATOM 73    N N     . ARG A 1 11  ? 107.429 87.740  38.351  1.00 66.45  ? 10  ARG A N     1 
ATOM 74    C CA    . ARG A 1 11  ? 108.813 88.097  38.512  1.00 68.88  ? 10  ARG A CA    1 
ATOM 75    C C     . ARG A 1 11  ? 109.048 89.053  39.661  1.00 69.74  ? 10  ARG A C     1 
ATOM 76    O O     . ARG A 1 11  ? 109.893 88.804  40.502  1.00 68.74  ? 10  ARG A O     1 
ATOM 77    C CB    . ARG A 1 11  ? 109.308 88.706  37.203  1.00 73.45  ? 10  ARG A CB    1 
ATOM 78    C CG    . ARG A 1 11  ? 110.570 89.536  37.306  1.00 75.81  ? 10  ARG A CG    1 
ATOM 79    C CD    . ARG A 1 11  ? 111.290 89.564  35.975  1.00 78.80  ? 10  ARG A CD    1 
ATOM 80    N NE    . ARG A 1 11  ? 110.404 89.937  34.882  1.00 80.11  ? 10  ARG A NE    1 
ATOM 81    C CZ    . ARG A 1 11  ? 110.230 91.183  34.467  1.00 82.55  ? 10  ARG A CZ    1 
ATOM 82    N NH1   . ARG A 1 11  ? 110.882 92.169  35.060  1.00 84.00  ? 10  ARG A NH1   1 
ATOM 83    N NH2   . ARG A 1 11  ? 109.412 91.443  33.461  1.00 83.89  ? 10  ARG A NH2   1 
ATOM 84    N N     . MET A 1 12  ? 108.301 90.143  39.676  0.79 65.80  ? 11  MET A N     1 
ATOM 85    C CA    . MET A 1 12  ? 108.373 91.079  40.773  1.00 66.67  ? 11  MET A CA    1 
ATOM 86    C C     . MET A 1 12  ? 107.914 90.476  42.093  0.78 62.13  ? 11  MET A C     1 
ATOM 87    O O     . MET A 1 12  ? 108.553 90.668  43.115  1.00 62.27  ? 11  MET A O     1 
ATOM 88    C CB    . MET A 1 12  ? 107.540 92.310  40.449  1.00 69.35  ? 11  MET A CB    1 
ATOM 89    C CG    . MET A 1 12  ? 108.190 93.234  39.443  1.00 73.96  ? 11  MET A CG    1 
ATOM 90    S SD    . MET A 1 12  ? 109.961 93.302  39.690  1.00 76.22  ? 11  MET A SD    1 
ATOM 91    C CE    . MET A 1 12  ? 110.490 94.204  38.250  1.00 79.69  ? 11  MET A CE    1 
ATOM 92    N N     . ILE A 1 13  ? 106.816 89.735  42.078  1.00 58.09  ? 12  ILE A N     1 
ATOM 93    C CA    . ILE A 1 13  ? 106.264 89.245  43.325  1.00 52.78  ? 12  ILE A CA    1 
ATOM 94    C C     . ILE A 1 13  ? 107.231 88.313  44.008  1.00 50.45  ? 12  ILE A C     1 
ATOM 95    O O     . ILE A 1 13  ? 107.493 88.445  45.190  1.00 50.14  ? 12  ILE A O     1 
ATOM 96    C CB    . ILE A 1 13  ? 104.957 88.477  43.081  1.00 51.52  ? 12  ILE A CB    1 
ATOM 97    C CG1   . ILE A 1 13  ? 103.903 89.408  42.498  1.00 53.99  ? 12  ILE A CG1   1 
ATOM 98    C CG2   . ILE A 1 13  ? 104.445 87.833  44.360  1.00 50.88  ? 12  ILE A CG2   1 
ATOM 99    C CD1   . ILE A 1 13  ? 102.506 88.836  42.523  1.00 55.31  ? 12  ILE A CD1   1 
ATOM 100   N N     . SER A 1 14  ? 107.789 87.385  43.252  1.00 44.53  ? 13  SER A N     1 
ATOM 101   C CA    . SER A 1 14  ? 108.651 86.399  43.854  1.00 42.68  ? 13  SER A CA    1 
ATOM 102   C C     . SER A 1 14  ? 109.827 87.136  44.399  1.00 45.09  ? 13  SER A C     1 
ATOM 103   O O     . SER A 1 14  ? 110.310 86.850  45.480  1.00 44.09  ? 13  SER A O     1 
ATOM 104   C CB    . SER A 1 14  ? 109.102 85.371  42.832  1.00 43.14  ? 13  SER A CB    1 
ATOM 105   O OG    . SER A 1 14  ? 110.127 85.895  42.018  1.00 45.00  ? 13  SER A OG    1 
ATOM 106   N N     . HIS A 1 15  ? 110.336 88.100  43.657  1.00 32.45  ? 14  HIS A N     1 
ATOM 107   C CA    . HIS A 1 15  ? 111.528 88.790  44.117  1.00 34.93  ? 14  HIS A CA    1 
ATOM 108   C C     . HIS A 1 15  ? 111.409 89.512  45.438  1.00 35.70  ? 14  HIS A C     1 
ATOM 109   O O     . HIS A 1 15  ? 112.277 89.405  46.286  1.00 36.72  ? 14  HIS A O     1 
ATOM 110   C CB    . HIS A 1 15  ? 112.014 89.765  43.063  1.00 40.51  ? 14  HIS A CB    1 
ATOM 111   C CG    . HIS A 1 15  ? 113.314 90.418  43.399  1.00 43.86  ? 14  HIS A CG    1 
ATOM 112   N ND1   . HIS A 1 15  ? 113.417 91.757  43.692  1.00 47.12  ? 14  HIS A ND1   1 
ATOM 113   C CD2   . HIS A 1 15  ? 114.569 89.922  43.468  1.00 44.39  ? 14  HIS A CD2   1 
ATOM 114   C CE1   . HIS A 1 15  ? 114.677 92.057  43.938  1.00 49.69  ? 14  HIS A CE1   1 
ATOM 115   N NE2   . HIS A 1 15  ? 115.397 90.961  43.806  1.00 48.05  ? 14  HIS A NE2   1 
ATOM 116   N N     . GLU A 1 16  ? 110.349 90.279  45.607  1.00 61.54  ? 15  GLU A N     1 
ATOM 117   C CA    . GLU A 1 16  ? 110.171 91.017  46.845  1.00 62.03  ? 15  GLU A CA    1 
ATOM 118   C C     . GLU A 1 16  ? 109.881 90.106  48.035  1.00 56.73  ? 15  GLU A C     1 
ATOM 119   O O     . GLU A 1 16  ? 110.195 90.408  49.175  1.00 57.45  ? 15  GLU A O     1 
ATOM 120   C CB    . GLU A 1 16  ? 109.042 92.023  46.728  1.00 62.58  ? 15  GLU A CB    1 
ATOM 121   C CG    . GLU A 1 16  ? 109.327 93.133  45.731  1.00 67.98  ? 15  GLU A CG    1 
ATOM 122   C CD    . GLU A 1 16  ? 110.584 93.914  46.054  1.00 73.25  ? 15  GLU A CD    1 
ATOM 123   O OE1   . GLU A 1 16  ? 110.837 94.193  47.239  1.00 73.86  ? 15  GLU A OE1   1 
ATOM 124   O OE2   . GLU A 1 16  ? 111.322 94.260  45.119  1.00 76.02  ? 15  GLU A OE2   1 
ATOM 125   N N     . MET A 1 17  ? 109.289 88.965  47.734  1.00 50.89  ? 16  MET A N     1 
ATOM 126   C CA    . MET A 1 17  ? 108.984 87.989  48.756  0.31 48.05  ? 16  MET A CA    1 
ATOM 127   C C     . MET A 1 17  ? 110.326 87.542  49.284  1.00 49.17  ? 16  MET A C     1 
ATOM 128   O O     . MET A 1 17  ? 110.509 87.365  50.479  0.22 49.37  ? 16  MET A O     1 
ATOM 129   C CB    . MET A 1 17  ? 108.214 86.788  48.244  1.00 46.27  ? 16  MET A CB    1 
ATOM 130   C CG    . MET A 1 17  ? 106.720 86.990  48.199  1.00 47.47  ? 16  MET A CG    1 
ATOM 131   S SD    . MET A 1 17  ? 105.887 85.407  48.229  1.00 47.57  ? 16  MET A SD    1 
ATOM 132   C CE    . MET A 1 17  ? 105.629 85.208  49.979  1.00 49.05  ? 16  MET A CE    1 
ATOM 133   N N     . LYS A 1 18  ? 111.265 87.345  48.380  1.00 31.00  ? 17  LYS A N     1 
ATOM 134   C CA    . LYS A 1 18  ? 112.575 86.937  48.795  1.00 32.86  ? 17  LYS A CA    1 
ATOM 135   C C     . LYS A 1 18  ? 113.139 88.033  49.660  1.00 37.43  ? 17  LYS A C     1 
ATOM 136   O O     . LYS A 1 18  ? 113.692 87.781  50.716  1.00 38.41  ? 17  LYS A O     1 
ATOM 137   C CB    . LYS A 1 18  ? 113.446 86.741  47.557  1.00 39.65  ? 17  LYS A CB    1 
ATOM 138   N N     . GLN A 1 19  ? 112.988 89.266  49.211  1.00 36.37  ? 18  GLN A N     1 
ATOM 139   C CA    . GLN A 1 19  ? 113.540 90.380  49.949  1.00 39.84  ? 18  GLN A CA    1 
ATOM 140   C C     . GLN A 1 19  ? 112.895 90.588  51.298  1.00 38.84  ? 18  GLN A C     1 
ATOM 141   O O     . GLN A 1 19  ? 113.579 90.806  52.282  1.00 40.65  ? 18  GLN A O     1 
ATOM 142   C CB    . GLN A 1 19  ? 113.429 91.638  49.117  1.00 46.61  ? 18  GLN A CB    1 
ATOM 143   C CG    . GLN A 1 19  ? 113.958 91.442  47.718  1.00 48.35  ? 18  GLN A CG    1 
ATOM 144   C CD    . GLN A 1 19  ? 115.394 90.996  47.720  1.00 49.37  ? 18  GLN A CD    1 
ATOM 145   O OE1   . GLN A 1 19  ? 116.176 91.423  48.551  1.00 50.94  ? 18  GLN A OE1   1 
ATOM 146   N NE2   . GLN A 1 19  ? 115.749 90.135  46.791  1.00 48.51  ? 18  GLN A NE2   1 
ATOM 147   N N     . LYS A 1 20  ? 111.575 90.521  51.350  1.00 46.20  ? 19  LYS A N     1 
ATOM 148   C CA    . LYS A 1 20  ? 110.898 90.713  52.616  1.00 45.23  ? 19  LYS A CA    1 
ATOM 149   C C     . LYS A 1 20  ? 111.273 89.595  53.543  1.00 44.44  ? 19  LYS A C     1 
ATOM 150   O O     . LYS A 1 20  ? 111.615 89.812  54.687  1.00 46.33  ? 19  LYS A O     1 
ATOM 151   C CB    . LYS A 1 20  ? 109.388 90.743  52.419  1.00 42.91  ? 19  LYS A CB    1 
ATOM 152   N N     . ALA A 1 21  ? 111.254 88.387  53.013  1.00 37.54  ? 20  ALA A N     1 
ATOM 153   C CA    . ALA A 1 21  ? 111.636 87.220  53.766  1.00 37.62  ? 20  ALA A CA    1 
ATOM 154   C C     . ALA A 1 21  ? 113.080 87.316  54.174  1.00 40.66  ? 20  ALA A C     1 
ATOM 155   O O     . ALA A 1 21  ? 113.435 87.002  55.293  1.00 42.35  ? 20  ALA A O     1 
ATOM 156   C CB    . ALA A 1 21  ? 111.418 85.982  52.931  1.00 35.29  ? 20  ALA A CB    1 
ATOM 157   N N     . ASP A 1 22  ? 113.922 87.750  53.255  1.00 40.27  ? 21  ASP A N     1 
ATOM 158   C CA    . ASP A 1 22  ? 115.343 87.796  53.520  1.00 44.79  ? 21  ASP A CA    1 
ATOM 159   C C     . ASP A 1 22  ? 115.662 88.777  54.632  1.00 46.51  ? 21  ASP A C     1 
ATOM 160   O O     . ASP A 1 22  ? 116.468 88.483  55.499  1.00 47.75  ? 21  ASP A O     1 
ATOM 161   C CB    . ASP A 1 22  ? 116.091 88.192  52.256  1.00 50.69  ? 21  ASP A CB    1 
ATOM 162   C CG    . ASP A 1 22  ? 116.658 87.007  51.522  1.00 49.64  ? 21  ASP A CG    1 
ATOM 163   O OD1   . ASP A 1 22  ? 116.290 85.865  51.844  1.00 47.39  ? 21  ASP A OD1   1 
ATOM 164   O OD2   . ASP A 1 22  ? 117.477 87.216  50.616  1.00 51.39  ? 21  ASP A OD2   1 
ATOM 165   N N     . GLN A 1 23  ? 115.015 89.935  54.622  1.00 64.92  ? 22  GLN A N     1 
ATOM 166   C CA    . GLN A 1 23  ? 115.235 90.944  55.654  1.00 66.69  ? 22  GLN A CA    1 
ATOM 167   C C     . GLN A 1 23  ? 114.792 90.442  57.008  1.00 65.37  ? 22  GLN A C     1 
ATOM 168   O O     . GLN A 1 23  ? 115.515 90.512  57.985  1.00 67.40  ? 22  GLN A O     1 
ATOM 169   C CB    . GLN A 1 23  ? 114.499 92.237  55.310  1.00 68.77  ? 22  GLN A CB    1 
ATOM 170   C CG    . GLN A 1 23  ? 115.017 92.963  54.081  1.00 70.56  ? 22  GLN A CG    1 
ATOM 171   C CD    . GLN A 1 23  ? 114.206 94.192  53.752  1.00 72.85  ? 22  GLN A CD    1 
ATOM 172   O OE1   . GLN A 1 23  ? 113.033 94.288  54.107  1.00 72.32  ? 22  GLN A OE1   1 
ATOM 173   N NE2   . GLN A 1 23  ? 114.827 95.144  53.073  1.00 74.74  ? 22  GLN A NE2   1 
ATOM 174   N N     . LYS A 1 24  ? 113.604 89.865  57.059  1.00 43.00  ? 23  LYS A N     1 
ATOM 175   C CA    . LYS A 1 24  ? 113.081 89.338  58.305  1.00 44.48  ? 23  LYS A CA    1 
ATOM 176   C C     . LYS A 1 24  ? 113.961 88.248  58.881  1.00 44.99  ? 23  LYS A C     1 
ATOM 177   O O     . LYS A 1 24  ? 114.110 88.130  60.084  1.00 47.28  ? 23  LYS A O     1 
ATOM 178   C CB    . LYS A 1 24  ? 111.682 88.792  58.059  1.00 43.65  ? 23  LYS A CB    1 
ATOM 179   C CG    . LYS A 1 24  ? 110.646 89.854  57.751  1.00 45.04  ? 23  LYS A CG    1 
ATOM 180   C CD    . LYS A 1 24  ? 109.320 89.222  57.379  1.00 44.29  ? 23  LYS A CD    1 
ATOM 181   C CE    . LYS A 1 24  ? 108.153 89.941  58.027  1.00 48.24  ? 23  LYS A CE    1 
ATOM 182   N NZ    . LYS A 1 24  ? 108.039 89.619  59.473  1.00 51.98  ? 23  LYS A NZ    1 
ATOM 183   N N     . LEU A 1 25  ? 114.599 87.482  58.017  1.00 40.94  ? 24  LEU A N     1 
ATOM 184   C CA    . LEU A 1 25  ? 115.415 86.360  58.454  1.00 40.98  ? 24  LEU A CA    1 
ATOM 185   C C     . LEU A 1 25  ? 116.792 86.796  58.880  1.00 42.74  ? 24  LEU A C     1 
ATOM 186   O O     . LEU A 1 25  ? 117.574 86.007  59.374  1.00 43.59  ? 24  LEU A O     1 
ATOM 187   C CB    . LEU A 1 25  ? 115.541 85.332  57.342  1.00 38.04  ? 24  LEU A CB    1 
ATOM 188   C CG    . LEU A 1 25  ? 114.303 84.490  57.083  1.00 37.00  ? 24  LEU A CG    1 
ATOM 189   C CD1   . LEU A 1 25  ? 114.551 83.569  55.914  1.00 34.78  ? 24  LEU A CD1   1 
ATOM 190   C CD2   . LEU A 1 25  ? 113.949 83.681  58.311  1.00 39.40  ? 24  LEU A CD2   1 
ATOM 191   N N     . GLU A 1 26  ? 117.059 88.084  58.791  1.00 44.05  ? 25  GLU A N     1 
ATOM 192   C CA    . GLU A 1 26  ? 118.411 88.569  58.941  1.00 45.90  ? 25  GLU A CA    1 
ATOM 193   C C     . GLU A 1 26  ? 118.649 88.181  60.385  1.00 48.90  ? 25  GLU A C     1 
ATOM 194   O O     . GLU A 1 26  ? 119.770 87.886  60.773  1.00 50.43  ? 25  GLU A O     1 
ATOM 195   C CB    . GLU A 1 26  ? 118.457 90.085  58.776  1.00 47.91  ? 25  GLU A CB    1 
ATOM 196   N N     . GLN A 1 27  ? 117.591 88.147  61.180  1.00 85.33  ? 26  GLN A N     1 
ATOM 197   C CA    . GLN A 1 27  ? 117.768 87.711  62.565  1.00 86.42  ? 26  GLN A CA    1 
ATOM 198   C C     . GLN A 1 27  ? 118.728 86.423  62.799  1.00 85.35  ? 26  GLN A C     1 
ATOM 199   O O     . GLN A 1 27  ? 119.866 86.399  63.239  1.00 86.29  ? 26  GLN A O     1 
ATOM 200   C CB    . GLN A 1 27  ? 116.428 87.628  63.287  1.00 85.88  ? 26  GLN A CB    1 
ATOM 201   C CG    . GLN A 1 27  ? 116.498 87.324  64.766  1.00 87.62  ? 26  GLN A CG    1 
ATOM 202   C CD    . GLN A 1 27  ? 115.140 87.432  65.416  1.00 88.18  ? 26  GLN A CD    1 
ATOM 203   O OE1   . GLN A 1 27  ? 114.172 87.822  64.775  1.00 87.44  ? 26  GLN A OE1   1 
ATOM 204   N NE2   . GLN A 1 27  ? 115.058 87.084  66.688  1.00 89.92  ? 26  GLN A NE2   1 
ATOM 205   N N     . PHE A 1 28  ? 118.191 85.419  62.130  1.00 48.98  ? 27  PHE A N     1 
ATOM 206   C CA    . PHE A 1 28  ? 118.890 84.169  61.922  1.00 47.48  ? 27  PHE A CA    1 
ATOM 207   C C     . PHE A 1 28  ? 120.032 83.782  60.995  1.00 46.29  ? 27  PHE A C     1 
ATOM 208   O O     . PHE A 1 28  ? 120.326 82.614  60.838  1.00 44.91  ? 27  PHE A O     1 
ATOM 209   C CB    . PHE A 1 28  ? 117.720 83.345  61.443  1.00 45.20  ? 27  PHE A CB    1 
ATOM 210   C CG    . PHE A 1 28  ? 116.522 83.466  62.322  1.00 46.12  ? 27  PHE A CG    1 
ATOM 211   C CD1   . PHE A 1 28  ? 116.589 83.090  63.638  1.00 47.72  ? 27  PHE A CD1   1 
ATOM 212   C CD2   . PHE A 1 28  ? 115.341 83.966  61.838  1.00 45.54  ? 27  PHE A CD2   1 
ATOM 213   C CE1   . PHE A 1 28  ? 115.494 83.197  64.457  1.00 48.73  ? 27  PHE A CE1   1 
ATOM 214   C CE2   . PHE A 1 28  ? 114.239 84.078  62.649  1.00 46.55  ? 27  PHE A CE2   1 
ATOM 215   C CZ    . PHE A 1 28  ? 114.316 83.695  63.962  1.00 48.16  ? 27  PHE A CZ    1 
ATOM 216   N N     . ASP A 1 29  ? 120.673 84.759  60.379  1.00 68.26  ? 28  ASP A N     1 
ATOM 217   C CA    . ASP A 1 29  ? 121.897 84.512  59.635  1.00 67.86  ? 28  ASP A CA    1 
ATOM 218   C C     . ASP A 1 29  ? 121.691 83.537  58.496  1.00 64.94  ? 28  ASP A C     1 
ATOM 219   O O     . ASP A 1 29  ? 122.618 82.858  58.073  1.00 64.27  ? 28  ASP A O     1 
ATOM 220   C CB    . ASP A 1 29  ? 122.977 83.970  60.561  1.00 71.52  ? 28  ASP A CB    1 
ATOM 221   C CG    . ASP A 1 29  ? 124.331 83.889  59.890  1.00 71.50  ? 28  ASP A CG    1 
ATOM 222   O OD1   . ASP A 1 29  ? 124.605 84.723  59.009  1.00 71.42  ? 28  ASP A OD1   1 
ATOM 223   O OD2   . ASP A 1 29  ? 125.120 82.990  60.241  1.00 71.66  ? 28  ASP A OD2   1 
ATOM 224   N N     . ILE A 1 30  ? 120.470 83.452  58.000  1.00 39.88  ? 29  ILE A N     1 
ATOM 225   C CA    . ILE A 1 30  ? 120.197 82.578  56.885  1.00 37.34  ? 29  ILE A CA    1 
ATOM 226   C C     . ILE A 1 30  ? 119.441 83.316  55.807  1.00 36.39  ? 29  ILE A C     1 
ATOM 227   O O     . ILE A 1 30  ? 118.776 84.301  56.070  1.00 37.44  ? 29  ILE A O     1 
ATOM 228   C CB    . ILE A 1 30  ? 119.392 81.353  57.310  1.00 36.07  ? 29  ILE A CB    1 
ATOM 229   C CG1   . ILE A 1 30  ? 118.018 81.779  57.791  1.00 36.35  ? 29  ILE A CG1   1 
ATOM 230   C CG2   . ILE A 1 30  ? 120.120 80.599  58.398  1.00 37.10  ? 29  ILE A CG2   1 
ATOM 231   C CD1   . ILE A 1 30  ? 117.198 80.643  58.346  1.00 35.40  ? 29  ILE A CD1   1 
ATOM 232   N N     . THR A 1 31  ? 119.583 82.833  54.581  1.00 38.32  ? 30  THR A N     1 
ATOM 233   C CA    . THR A 1 31  ? 118.881 83.374  53.433  1.00 37.25  ? 30  THR A CA    1 
ATOM 234   C C     . THR A 1 31  ? 117.523 82.758  53.262  1.00 36.06  ? 30  THR A C     1 
ATOM 235   O O     . THR A 1 31  ? 117.221 81.740  53.846  1.00 35.48  ? 30  THR A O     1 
ATOM 236   C CB    . THR A 1 31  ? 119.659 83.160  52.145  1.00 36.24  ? 30  THR A CB    1 
ATOM 237   O OG1   . THR A 1 31  ? 119.554 81.791  51.761  1.00 34.56  ? 30  THR A OG1   1 
ATOM 238   C CG2   . THR A 1 31  ? 121.096 83.505  52.366  1.00 37.61  ? 30  THR A CG2   1 
ATOM 239   N N     . ASN A 1 32  ? 116.697 83.387  52.451  1.00 37.79  ? 31  ASN A N     1 
ATOM 240   C CA    . ASN A 1 32  ? 115.347 82.911  52.255  1.00 37.68  ? 31  ASN A CA    1 
ATOM 241   C C     . ASN A 1 32  ? 115.292 81.446  51.785  1.00 35.96  ? 31  ASN A C     1 
ATOM 242   O O     . ASN A 1 32  ? 114.451 80.656  52.234  1.00 35.67  ? 31  ASN A O     1 
ATOM 243   C CB    . ASN A 1 32  ? 114.649 83.840  51.267  1.00 38.85  ? 31  ASN A CB    1 
ATOM 244   C CG    . ASN A 1 32  ? 113.476 83.190  50.601  1.00 38.71  ? 31  ASN A CG    1 
ATOM 245   O OD1   . ASN A 1 32  ? 112.463 82.885  51.260  1.00 39.22  ? 31  ASN A OD1   1 
ATOM 246   N ND2   . ASN A 1 32  ? 113.594 82.957  49.281  1.00 38.49  ? 31  ASN A ND2   1 
ATOM 247   N N     . GLU A 1 33  ? 116.222 81.098  50.901  1.00 47.66  ? 32  GLU A N     1 
ATOM 248   C CA    . GLU A 1 33  ? 116.325 79.762  50.330  1.00 46.44  ? 32  GLU A CA    1 
ATOM 249   C C     . GLU A 1 33  ? 116.799 78.765  51.374  1.00 45.35  ? 32  GLU A C     1 
ATOM 250   O O     . GLU A 1 33  ? 116.298 77.638  51.467  1.00 44.92  ? 32  GLU A O     1 
ATOM 251   C CB    . GLU A 1 33  ? 117.288 79.774  49.147  1.00 46.16  ? 32  GLU A CB    1 
ATOM 252   C CG    . GLU A 1 33  ? 116.824 80.608  47.948  1.00 47.55  ? 32  GLU A CG    1 
ATOM 253   C CD    . GLU A 1 33  ? 116.757 82.115  48.229  1.00 49.19  ? 32  GLU A CD    1 
ATOM 254   O OE1   . GLU A 1 33  ? 117.140 82.550  49.336  1.00 49.27  ? 32  GLU A OE1   1 
ATOM 255   O OE2   . GLU A 1 33  ? 116.300 82.875  47.352  1.00 50.62  ? 32  GLU A OE2   1 
ATOM 256   N N     . GLN A 1 34  ? 117.774 79.182  52.166  1.00 32.85  ? 33  GLN A N     1 
ATOM 257   C CA    . GLN A 1 34  ? 118.208 78.363  53.286  1.00 32.37  ? 33  GLN A CA    1 
ATOM 258   C C     . GLN A 1 34  ? 117.033 78.071  54.216  1.00 32.82  ? 33  GLN A C     1 
ATOM 259   O O     . GLN A 1 34  ? 116.858 76.936  54.669  1.00 32.29  ? 33  GLN A O     1 
ATOM 260   C CB    . GLN A 1 34  ? 119.373 79.027  54.008  1.00 32.80  ? 33  GLN A CB    1 
ATOM 261   C CG    . GLN A 1 34  ? 120.589 79.019  53.134  1.00 32.34  ? 33  GLN A CG    1 
ATOM 262   C CD    . GLN A 1 34  ? 121.638 79.947  53.590  1.00 33.13  ? 33  GLN A CD    1 
ATOM 263   O OE1   . GLN A 1 34  ? 121.427 80.711  54.517  1.00 34.13  ? 33  GLN A OE1   1 
ATOM 264   N NE2   . GLN A 1 34  ? 122.791 79.893  52.955  1.00 32.89  ? 33  GLN A NE2   1 
ATOM 265   N N     . GLY A 1 35  ? 116.210 79.083  54.467  1.00 36.96  ? 34  GLY A N     1 
ATOM 266   C CA    . GLY A 1 35  ? 115.026 78.883  55.262  1.00 37.84  ? 34  GLY A CA    1 
ATOM 267   C C     . GLY A 1 35  ? 114.175 77.781  54.670  1.00 37.70  ? 34  GLY A C     1 
ATOM 268   O O     . GLY A 1 35  ? 113.710 76.876  55.380  1.00 37.93  ? 34  GLY A O     1 
ATOM 269   N N     . HIS A 1 36  ? 113.898 77.880  53.387  1.00 40.48  ? 35  HIS A N     1 
ATOM 270   C CA    . HIS A 1 36  ? 113.026 76.918  52.751  1.00 41.30  ? 35  HIS A CA    1 
ATOM 271   C C     . HIS A 1 36  ? 113.599 75.519  52.725  1.00 40.44  ? 35  HIS A C     1 
ATOM 272   O O     . HIS A 1 36  ? 112.885 74.543  52.886  1.00 41.72  ? 35  HIS A O     1 
ATOM 273   C CB    . HIS A 1 36  ? 112.623 77.403  51.371  1.00 42.06  ? 35  HIS A CB    1 
ATOM 274   C CG    . HIS A 1 36  ? 111.645 78.531  51.407  1.00 43.84  ? 35  HIS A CG    1 
ATOM 275   N ND1   . HIS A 1 36  ? 110.299 78.339  51.615  1.00 45.64  ? 35  HIS A ND1   1 
ATOM 276   C CD2   . HIS A 1 36  ? 111.819 79.866  51.292  1.00 44.21  ? 35  HIS A CD2   1 
ATOM 277   C CE1   . HIS A 1 36  ? 109.683 79.505  51.607  1.00 46.48  ? 35  HIS A CE1   1 
ATOM 278   N NE2   . HIS A 1 36  ? 110.583 80.448  51.416  1.00 45.93  ? 35  HIS A NE2   1 
ATOM 279   N N     . THR A 1 37  ? 114.888 75.416  52.469  1.00 32.61  ? 36  THR A N     1 
ATOM 280   C CA    . THR A 1 37  ? 115.532 74.126  52.469  1.00 31.65  ? 36  THR A CA    1 
ATOM 281   C C     . THR A 1 37  ? 115.529 73.465  53.828  1.00 31.75  ? 36  THR A C     1 
ATOM 282   O O     . THR A 1 37  ? 115.197 72.303  53.950  1.00 32.39  ? 36  THR A O     1 
ATOM 283   C CB    . THR A 1 37  ? 116.975 74.284  52.030  1.00 30.63  ? 36  THR A CB    1 
ATOM 284   O OG1   . THR A 1 37  ? 117.021 75.234  50.970  1.00 30.92  ? 36  THR A OG1   1 
ATOM 285   C CG2   . THR A 1 37  ? 117.517 72.985  51.546  1.00 29.94  ? 36  THR A CG2   1 
ATOM 286   N N     . LEU A 1 38  ? 115.870 74.220  54.862  1.00 32.60  ? 37  LEU A N     1 
ATOM 287   C CA    . LEU A 1 38  ? 115.891 73.676  56.206  1.00 32.83  ? 37  LEU A CA    1 
ATOM 288   C C     . LEU A 1 38  ? 114.490 73.302  56.557  1.00 35.02  ? 37  LEU A C     1 
ATOM 289   O O     . LEU A 1 38  ? 114.236 72.288  57.175  1.00 36.24  ? 37  LEU A O     1 
ATOM 290   C CB    . LEU A 1 38  ? 116.399 74.697  57.203  1.00 33.14  ? 37  LEU A CB    1 
ATOM 291   C CG    . LEU A 1 38  ? 117.871 75.061  57.149  1.00 32.53  ? 37  LEU A CG    1 
ATOM 292   C CD1   . LEU A 1 38  ? 118.019 76.538  57.413  1.00 33.37  ? 37  LEU A CD1   1 
ATOM 293   C CD2   . LEU A 1 38  ? 118.655 74.266  58.168  1.00 32.43  ? 37  LEU A CD2   1 
ATOM 294   N N     . GLY A 1 39  ? 113.545 74.108  56.120  1.00 33.90  ? 38  GLY A N     1 
ATOM 295   C CA    . GLY A 1 39  ? 112.176 73.835  56.461  1.00 36.12  ? 38  GLY A CA    1 
ATOM 296   C C     . GLY A 1 39  ? 111.800 72.498  55.897  1.00 36.92  ? 38  GLY A C     1 
ATOM 297   O O     . GLY A 1 39  ? 111.168 71.706  56.565  1.00 38.57  ? 38  GLY A O     1 
ATOM 298   N N     . TYR A 1 40  ? 112.208 72.229  54.669  1.00 35.44  ? 39  TYR A N     1 
ATOM 299   C CA    . TYR A 1 40  ? 111.913 70.943  54.070  1.00 36.19  ? 39  TYR A CA    1 
ATOM 300   C C     . TYR A 1 40  ? 112.606 69.857  54.853  1.00 35.85  ? 39  TYR A C     1 
ATOM 301   O O     . TYR A 1 40  ? 112.026 68.827  55.132  1.00 37.48  ? 39  TYR A O     1 
ATOM 302   C CB    . TYR A 1 40  ? 112.370 70.910  52.615  1.00 35.07  ? 39  TYR A CB    1 
ATOM 303   C CG    . TYR A 1 40  ? 111.860 69.727  51.820  1.00 36.11  ? 39  TYR A CG    1 
ATOM 304   C CD1   . TYR A 1 40  ? 110.590 69.724  51.284  1.00 37.96  ? 39  TYR A CD1   1 
ATOM 305   C CD2   . TYR A 1 40  ? 112.658 68.621  51.599  1.00 35.17  ? 39  TYR A CD2   1 
ATOM 306   C CE1   . TYR A 1 40  ? 110.128 68.649  50.559  1.00 39.01  ? 39  TYR A CE1   1 
ATOM 307   C CE2   . TYR A 1 40  ? 112.200 67.544  50.878  1.00 36.16  ? 39  TYR A CE2   1 
ATOM 308   C CZ    . TYR A 1 40  ? 110.935 67.566  50.362  1.00 38.18  ? 39  TYR A CZ    1 
ATOM 309   O OH    . TYR A 1 40  ? 110.476 66.496  49.641  1.00 39.49  ? 39  TYR A OH    1 
ATOM 310   N N     . LEU A 1 41  ? 113.842 70.100  55.245  1.00 39.56  ? 40  LEU A N     1 
ATOM 311   C CA    . LEU A 1 41  ? 114.593 69.082  55.942  1.00 39.18  ? 40  LEU A CA    1 
ATOM 312   C C     . LEU A 1 41  ? 113.900 68.735  57.230  1.00 41.65  ? 40  LEU A C     1 
ATOM 313   O O     . LEU A 1 41  ? 113.815 67.578  57.601  1.00 43.23  ? 40  LEU A O     1 
ATOM 314   C CB    . LEU A 1 41  ? 115.989 69.579  56.242  1.00 36.35  ? 40  LEU A CB    1 
ATOM 315   C CG    . LEU A 1 41  ? 116.966 69.432  55.094  1.00 34.14  ? 40  LEU A CG    1 
ATOM 316   C CD1   . LEU A 1 41  ? 118.239 70.180  55.414  1.00 33.02  ? 40  LEU A CD1   1 
ATOM 317   C CD2   . LEU A 1 41  ? 117.270 67.969  54.901  1.00 34.29  ? 40  LEU A CD2   1 
ATOM 318   N N     . TYR A 1 42  ? 113.382 69.746  57.902  1.00 34.19  ? 41  TYR A N     1 
ATOM 319   C CA    . TYR A 1 42  ? 112.709 69.552  59.166  1.00 36.44  ? 41  TYR A CA    1 
ATOM 320   C C     . TYR A 1 42  ? 111.510 68.660  58.953  1.00 39.32  ? 41  TYR A C     1 
ATOM 321   O O     . TYR A 1 42  ? 111.228 67.787  59.752  1.00 41.28  ? 41  TYR A O     1 
ATOM 322   C CB    . TYR A 1 42  ? 112.246 70.909  59.685  1.00 36.37  ? 41  TYR A CB    1 
ATOM 323   C CG    . TYR A 1 42  ? 111.560 70.882  61.026  1.00 38.47  ? 41  TYR A CG    1 
ATOM 324   C CD1   . TYR A 1 42  ? 112.289 70.886  62.196  1.00 38.32  ? 41  TYR A CD1   1 
ATOM 325   C CD2   . TYR A 1 42  ? 110.183 70.869  61.119  1.00 40.79  ? 41  TYR A CD2   1 
ATOM 326   C CE1   . TYR A 1 42  ? 111.666 70.866  63.422  1.00 40.26  ? 41  TYR A CE1   1 
ATOM 327   C CE2   . TYR A 1 42  ? 109.553 70.851  62.341  1.00 42.54  ? 41  TYR A CE2   1 
ATOM 328   C CZ    . TYR A 1 42  ? 110.302 70.849  63.487  1.00 42.25  ? 41  TYR A CZ    1 
ATOM 329   O OH    . TYR A 1 42  ? 109.682 70.831  64.707  1.00 44.00  ? 41  TYR A OH    1 
ATOM 330   N N     . ALA A 1 43  ? 110.744 68.931  57.911  1.00 35.66  ? 42  ALA A N     1 
ATOM 331   C CA    . ALA A 1 43  ? 109.562 68.137  57.606  1.00 37.29  ? 42  ALA A CA    1 
ATOM 332   C C     . ALA A 1 43  ? 109.789 66.687  57.169  1.00 38.08  ? 42  ALA A C     1 
ATOM 333   O O     . ALA A 1 43  ? 109.062 65.791  57.575  1.00 40.25  ? 42  ALA A O     1 
ATOM 334   C CB    . ALA A 1 43  ? 108.723 68.857  56.576  1.00 36.98  ? 42  ALA A CB    1 
ATOM 335   N N     . HIS A 1 44  ? 110.741 66.468  56.273  1.00 50.38  ? 43  HIS A N     1 
ATOM 336   C CA    . HIS A 1 44  ? 110.929 65.155  55.663  1.00 51.15  ? 43  HIS A CA    1 
ATOM 337   C C     . HIS A 1 44  ? 112.198 64.431  56.048  1.00 49.23  ? 43  HIS A C     1 
ATOM 338   O O     . HIS A 1 44  ? 112.578 63.453  55.425  1.00 48.78  ? 43  HIS A O     1 
ATOM 339   C CB    . HIS A 1 44  ? 110.849 65.269  54.154  1.00 50.34  ? 43  HIS A CB    1 
ATOM 340   C CG    . HIS A 1 44  ? 109.532 65.763  53.670  1.00 52.54  ? 43  HIS A CG    1 
ATOM 341   N ND1   . HIS A 1 44  ? 109.258 67.100  53.513  1.00 51.63  ? 43  HIS A ND1   1 
ATOM 342   C CD2   . HIS A 1 44  ? 108.403 65.104  53.337  1.00 55.47  ? 43  HIS A CD2   1 
ATOM 343   C CE1   . HIS A 1 44  ? 108.018 67.246  53.090  1.00 53.65  ? 43  HIS A CE1   1 
ATOM 344   N NE2   . HIS A 1 44  ? 107.477 66.049  52.974  1.00 56.09  ? 43  HIS A NE2   1 
ATOM 345   N N     . GLN A 1 45  ? 112.827 64.879  57.110  1.00 59.32  ? 44  GLN A N     1 
ATOM 346   C CA    . GLN A 1 45  ? 114.182 64.493  57.420  1.00 56.95  ? 44  GLN A CA    1 
ATOM 347   C C     . GLN A 1 45  ? 114.317 62.990  57.564  1.00 58.04  ? 44  GLN A C     1 
ATOM 348   O O     . GLN A 1 45  ? 115.314 62.405  57.176  1.00 55.88  ? 44  GLN A O     1 
ATOM 349   C CB    . GLN A 1 45  ? 114.590 65.185  58.707  1.00 56.59  ? 44  GLN A CB    1 
ATOM 350   C CG    . GLN A 1 45  ? 116.070 65.401  58.902  1.00 52.94  ? 44  GLN A CG    1 
ATOM 351   C CD    . GLN A 1 45  ? 116.390 65.557  60.362  1.00 54.00  ? 44  GLN A CD    1 
ATOM 352   O OE1   . GLN A 1 45  ? 115.605 66.129  61.109  1.00 55.73  ? 44  GLN A OE1   1 
ATOM 353   N NE2   . GLN A 1 45  ? 117.526 65.029  60.785  1.00 52.98  ? 44  GLN A NE2   1 
ATOM 354   N N     . GLN A 1 46  ? 113.290 62.375  58.121  1.00 53.08  ? 45  GLN A N     1 
ATOM 355   C CA    . GLN A 1 46  ? 113.285 60.976  58.519  1.00 54.64  ? 45  GLN A CA    1 
ATOM 356   C C     . GLN A 1 46  ? 113.385 59.964  57.393  1.00 53.75  ? 45  GLN A C     1 
ATOM 357   O O     . GLN A 1 46  ? 113.586 58.781  57.618  1.00 54.20  ? 45  GLN A O     1 
ATOM 358   C CB    . GLN A 1 46  ? 112.011 60.647  59.296  1.00 58.80  ? 45  GLN A CB    1 
ATOM 359   C CG    . GLN A 1 46  ? 110.739 60.648  58.471  1.00 61.21  ? 45  GLN A CG    1 
ATOM 360   C CD    . GLN A 1 46  ? 110.065 61.995  58.462  1.00 61.33  ? 45  GLN A CD    1 
ATOM 361   O OE1   . GLN A 1 46  ? 110.557 62.937  59.082  1.00 59.87  ? 45  GLN A OE1   1 
ATOM 362   N NE2   . GLN A 1 46  ? 108.949 62.102  57.766  1.00 62.76  ? 45  GLN A NE2   1 
ATOM 363   N N     . ASP A 1 47  ? 113.204 60.435  56.177  1.00 58.03  ? 46  ASP A N     1 
ATOM 364   C CA    . ASP A 1 47  ? 112.962 59.558  55.056  1.00 57.76  ? 46  ASP A CA    1 
ATOM 365   C C     . ASP A 1 47  ? 114.065 58.608  54.551  1.00 55.65  ? 46  ASP A C     1 
ATOM 366   O O     . ASP A 1 47  ? 113.724 57.512  54.132  1.00 56.90  ? 46  ASP A O     1 
ATOM 367   C CB    . ASP A 1 47  ? 112.333 60.290  53.881  1.00 58.06  ? 46  ASP A CB    1 
ATOM 368   C CG    . ASP A 1 47  ? 110.894 60.669  54.157  1.00 61.89  ? 46  ASP A CG    1 
ATOM 369   O OD1   . ASP A 1 47  ? 110.317 60.126  55.113  1.00 64.42  ? 46  ASP A OD1   1 
ATOM 370   O OD2   . ASP A 1 47  ? 110.331 61.499  53.425  1.00 62.56  ? 46  ASP A OD2   1 
ATOM 371   N N     . GLY A 1 48  ? 115.353 58.939  54.573  1.00 55.12  ? 47  GLY A N     1 
ATOM 372   C CA    . GLY A 1 48  ? 115.942 60.197  54.918  1.00 53.53  ? 47  GLY A CA    1 
ATOM 373   C C     . GLY A 1 48  ? 116.565 60.546  53.591  1.00 51.36  ? 47  GLY A C     1 
ATOM 374   O O     . GLY A 1 48  ? 116.956 59.661  52.820  1.00 50.46  ? 47  GLY A O     1 
ATOM 375   N N     . LEU A 1 49  ? 116.674 61.845  53.352  1.00 35.36  ? 48  LEU A N     1 
ATOM 376   C CA    . LEU A 1 49  ? 116.871 62.397  52.034  1.00 34.23  ? 48  LEU A CA    1 
ATOM 377   C C     . LEU A 1 49  ? 118.312 62.377  51.594  1.00 32.75  ? 48  LEU A C     1 
ATOM 378   O O     . LEU A 1 49  ? 119.215 62.610  52.385  1.00 32.50  ? 48  LEU A O     1 
ATOM 379   C CB    . LEU A 1 49  ? 116.385 63.839  52.065  1.00 34.11  ? 48  LEU A CB    1 
ATOM 380   C CG    . LEU A 1 49  ? 115.037 63.913  52.776  1.00 36.58  ? 48  LEU A CG    1 
ATOM 381   C CD1   . LEU A 1 49  ? 114.706 65.317  53.174  1.00 36.74  ? 48  LEU A CD1   1 
ATOM 382   C CD2   . LEU A 1 49  ? 114.000 63.379  51.845  1.00 38.11  ? 48  LEU A CD2   1 
ATOM 383   N N     . THR A 1 50  ? 118.512 62.084  50.316  1.00 35.58  ? 49  THR A N     1 
ATOM 384   C CA    . THR A 1 50  ? 119.753 62.392  49.627  1.00 35.02  ? 49  THR A CA    1 
ATOM 385   C C     . THR A 1 50  ? 119.640 63.803  49.087  1.00 34.06  ? 49  THR A C     1 
ATOM 386   O O     . THR A 1 50  ? 118.547 64.354  49.015  1.00 33.96  ? 49  THR A O     1 
ATOM 387   C CB    . THR A 1 50  ? 119.851 61.570  48.392  1.00 35.60  ? 49  THR A CB    1 
ATOM 388   O OG1   . THR A 1 50  ? 118.710 61.875  47.581  1.00 35.56  ? 49  THR A OG1   1 
ATOM 389   C CG2   . THR A 1 50  ? 119.839 60.118  48.739  1.00 36.89  ? 49  THR A CG2   1 
ATOM 390   N N     . GLN A 1 51  ? 120.759 64.376  48.655  1.00 44.57  ? 50  GLN A N     1 
ATOM 391   C CA    . GLN A 1 51  ? 120.732 65.707  48.047  1.00 42.63  ? 50  GLN A CA    1 
ATOM 392   C C     . GLN A 1 51  ? 119.843 65.737  46.821  1.00 42.95  ? 50  GLN A C     1 
ATOM 393   O O     . GLN A 1 51  ? 119.160 66.727  46.573  1.00 42.50  ? 50  GLN A O     1 
ATOM 394   C CB    . GLN A 1 51  ? 122.133 66.171  47.674  1.00 42.75  ? 50  GLN A CB    1 
ATOM 395   C CG    . GLN A 1 51  ? 123.123 65.958  48.758  1.00 42.25  ? 50  GLN A CG    1 
ATOM 396   C CD    . GLN A 1 51  ? 124.406 66.693  48.518  1.00 41.25  ? 50  GLN A CD    1 
ATOM 397   O OE1   . GLN A 1 51  ? 125.315 66.651  49.345  1.00 42.13  ? 50  GLN A OE1   1 
ATOM 398   N NE2   . GLN A 1 51  ? 124.495 67.385  47.390  1.00 40.07  ? 50  GLN A NE2   1 
ATOM 399   N N     . ASN A 1 52  ? 119.848 64.652  46.054  1.00 43.40  ? 51  ASN A N     1 
ATOM 400   C CA    . ASN A 1 52  ? 119.009 64.601  44.874  1.00 43.86  ? 51  ASN A CA    1 
ATOM 401   C C     . ASN A 1 52  ? 117.534 64.628  45.236  1.00 45.43  ? 51  ASN A C     1 
ATOM 402   O O     . ASN A 1 52  ? 116.721 65.176  44.492  1.00 46.22  ? 51  ASN A O     1 
ATOM 403   C CB    . ASN A 1 52  ? 119.338 63.388  44.021  1.00 44.94  ? 51  ASN A CB    1 
ATOM 404   C CG    . ASN A 1 52  ? 119.906 63.767  42.665  1.00 44.46  ? 51  ASN A CG    1 
ATOM 405   O OD1   . ASN A 1 52  ? 120.383 64.891  42.460  1.00 42.88  ? 51  ASN A OD1   1 
ATOM 406   N ND2   . ASN A 1 52  ? 119.877 62.822  41.730  1.00 46.15  ? 51  ASN A ND2   1 
ATOM 407   N N     . ASP A 1 53  ? 117.194 64.045  46.384  1.00 41.02  ? 52  ASP A N     1 
ATOM 408   C CA    . ASP A 1 53  ? 115.833 64.120  46.882  1.00 42.31  ? 52  ASP A CA    1 
ATOM 409   C C     . ASP A 1 53  ? 115.462 65.573  47.076  1.00 41.88  ? 52  ASP A C     1 
ATOM 410   O O     . ASP A 1 53  ? 114.380 66.001  46.693  1.00 43.31  ? 52  ASP A O     1 
ATOM 411   C CB    . ASP A 1 53  ? 115.700 63.393  48.206  1.00 43.25  ? 52  ASP A CB    1 
ATOM 412   C CG    . ASP A 1 53  ? 115.702 61.906  48.046  1.00 45.24  ? 52  ASP A CG    1 
ATOM 413   O OD1   . ASP A 1 53  ? 115.294 61.439  46.962  1.00 46.07  ? 52  ASP A OD1   1 
ATOM 414   O OD2   . ASP A 1 53  ? 116.102 61.199  49.003  1.00 46.20  ? 52  ASP A OD2   1 
ATOM 415   N N     . ILE A 1 54  ? 116.372 66.328  47.681  1.00 41.73  ? 53  ILE A N     1 
ATOM 416   C CA    . ILE A 1 54  ? 116.171 67.753  47.903  1.00 41.21  ? 53  ILE A CA    1 
ATOM 417   C C     . ILE A 1 54  ? 116.022 68.504  46.575  1.00 41.31  ? 53  ILE A C     1 
ATOM 418   O O     . ILE A 1 54  ? 115.141 69.357  46.436  1.00 42.27  ? 53  ILE A O     1 
ATOM 419   C CB    . ILE A 1 54  ? 117.327 68.361  48.728  1.00 39.15  ? 53  ILE A CB    1 
ATOM 420   C CG1   . ILE A 1 54  ? 117.486 67.606  50.045  1.00 39.76  ? 53  ILE A CG1   1 
ATOM 421   C CG2   . ILE A 1 54  ? 117.067 69.802  49.030  1.00 38.56  ? 53  ILE A CG2   1 
ATOM 422   C CD1   . ILE A 1 54  ? 118.354 68.315  51.068  1.00 38.80  ? 53  ILE A CD1   1 
ATOM 423   N N     . ALA A 1 55  ? 116.821 68.168  45.582  1.00 34.57  ? 54  ALA A N     1 
ATOM 424   C CA    . ALA A 1 55  ? 116.747 68.909  44.343  1.00 34.35  ? 54  ALA A CA    1 
ATOM 425   C C     . ALA A 1 55  ? 115.383 68.776  43.714  1.00 35.77  ? 54  ALA A C     1 
ATOM 426   O O     . ALA A 1 55  ? 114.811 69.745  43.249  1.00 35.77  ? 54  ALA A O     1 
ATOM 427   C CB    . ALA A 1 55  ? 117.804 68.414  43.385  1.00 34.38  ? 54  ALA A CB    1 
ATOM 428   N N     . LYS A 1 56  ? 114.852 67.568  43.703  1.00 37.24  ? 55  LYS A N     1 
ATOM 429   C CA    . LYS A 1 56  ? 113.562 67.348  43.091  1.00 38.91  ? 55  LYS A CA    1 
ATOM 430   C C     . LYS A 1 56  ? 112.469 68.085  43.817  1.00 39.04  ? 55  LYS A C     1 
ATOM 431   O O     . LYS A 1 56  ? 111.593 68.670  43.208  1.00 39.92  ? 55  LYS A O     1 
ATOM 432   C CB    . LYS A 1 56  ? 113.255 65.862  43.042  1.00 40.59  ? 55  LYS A CB    1 
ATOM 433   C CG    . LYS A 1 56  ? 114.408 65.037  42.519  1.00 40.68  ? 55  LYS A CG    1 
ATOM 434   C CD    . LYS A 1 56  ? 113.996 63.598  42.313  1.00 42.76  ? 55  LYS A CD    1 
ATOM 435   C CE    . LYS A 1 56  ? 115.202 62.680  42.315  1.00 42.91  ? 55  LYS A CE    1 
ATOM 436   N NZ    . LYS A 1 56  ? 115.552 62.240  40.939  1.00 44.07  ? 55  LYS A NZ    1 
ATOM 437   N N     . ALA A 1 57  ? 112.499 68.018  45.133  1.00 38.74  ? 56  ALA A N     1 
ATOM 438   C CA    . ALA A 1 57  ? 111.469 68.656  45.915  1.00 39.43  ? 56  ALA A CA    1 
ATOM 439   C C     . ALA A 1 57  ? 111.519 70.145  45.687  1.00 39.74  ? 56  ALA A C     1 
ATOM 440   O O     . ALA A 1 57  ? 110.499 70.791  45.529  1.00 41.86  ? 56  ALA A O     1 
ATOM 441   C CB    . ALA A 1 57  ? 111.665 68.345  47.381  1.00 38.61  ? 56  ALA A CB    1 
ATOM 442   N N     . LEU A 1 58  ? 112.724 70.689  45.655  1.00 39.65  ? 57  LEU A N     1 
ATOM 443   C CA    . LEU A 1 58  ? 112.895 72.120  45.519  1.00 39.43  ? 57  LEU A CA    1 
ATOM 444   C C     . LEU A 1 58  ? 112.998 72.534  44.068  1.00 40.39  ? 57  LEU A C     1 
ATOM 445   O O     . LEU A 1 58  ? 113.107 73.709  43.769  1.00 40.67  ? 57  LEU A O     1 
ATOM 446   C CB    . LEU A 1 58  ? 114.105 72.594  46.308  1.00 36.38  ? 57  LEU A CB    1 
ATOM 447   C CG    . LEU A 1 58  ? 113.982 72.442  47.821  1.00 35.66  ? 57  LEU A CG    1 
ATOM 448   C CD1   . LEU A 1 58  ? 115.343 72.473  48.474  1.00 33.58  ? 57  LEU A CD1   1 
ATOM 449   C CD2   . LEU A 1 58  ? 113.099 73.518  48.410  1.00 36.62  ? 57  LEU A CD2   1 
ATOM 450   N N     . GLN A 1 59  ? 112.934 71.565  43.165  1.00 51.10  ? 58  GLN A N     1 
ATOM 451   C CA    . GLN A 1 59  ? 112.983 71.860  41.743  1.00 52.38  ? 58  GLN A CA    1 
ATOM 452   C C     . GLN A 1 59  ? 114.228 72.626  41.330  1.00 50.32  ? 58  GLN A C     1 
ATOM 453   O O     . GLN A 1 59  ? 114.147 73.652  40.675  1.00 51.54  ? 58  GLN A O     1 
ATOM 454   C CB    . GLN A 1 59  ? 111.735 72.633  41.342  1.00 56.05  ? 58  GLN A CB    1 
ATOM 455   C CG    . GLN A 1 59  ? 110.565 71.750  40.956  1.00 58.98  ? 58  GLN A CG    1 
ATOM 456   C CD    . GLN A 1 59  ? 110.922 70.769  39.864  1.00 58.99  ? 58  GLN A CD    1 
ATOM 457   O OE1   . GLN A 1 59  ? 110.741 71.048  38.681  1.00 60.68  ? 58  GLN A OE1   1 
ATOM 458   N NE2   . GLN A 1 59  ? 111.432 69.612  40.255  1.00 57.19  ? 58  GLN A NE2   1 
ATOM 459   N N     . ARG A 1 60  ? 115.381 72.127  41.746  1.00 38.49  ? 59  ARG A N     1 
ATOM 460   C CA    . ARG A 1 60  ? 116.666 72.776  41.483  1.00 36.42  ? 59  ARG A CA    1 
ATOM 461   C C     . ARG A 1 60  ? 117.690 71.777  40.949  1.00 35.38  ? 59  ARG A C     1 
ATOM 462   O O     . ARG A 1 60  ? 117.560 70.565  41.155  1.00 35.73  ? 59  ARG A O     1 
ATOM 463   C CB    . ARG A 1 60  ? 117.205 73.416  42.752  1.00 34.45  ? 59  ARG A CB    1 
ATOM 464   C CG    . ARG A 1 60  ? 116.334 74.535  43.297  1.00 35.53  ? 59  ARG A CG    1 
ATOM 465   C CD    . ARG A 1 60  ? 116.518 75.815  42.506  1.00 35.99  ? 59  ARG A CD    1 
ATOM 466   N NE    . ARG A 1 60  ? 115.665 76.906  42.984  1.00 37.23  ? 59  ARG A NE    1 
ATOM 467   C CZ    . ARG A 1 60  ? 114.395 77.063  42.620  1.00 40.54  ? 59  ARG A CZ    1 
ATOM 468   N NH1   . ARG A 1 60  ? 113.837 76.188  41.791  1.00 42.80  ? 59  ARG A NH1   1 
ATOM 469   N NH2   . ARG A 1 60  ? 113.685 78.081  43.072  1.00 41.47  ? 59  ARG A NH2   1 
ATOM 470   N N     . THR A 1 61  ? 118.716 72.277  40.270  1.00 32.35  ? 60  THR A N     1 
ATOM 471   C CA    . THR A 1 61  ? 119.747 71.409  39.728  1.00 32.48  ? 60  THR A CA    1 
ATOM 472   C C     . THR A 1 61  ? 120.632 70.834  40.829  1.00 31.71  ? 60  THR A C     1 
ATOM 473   O O     . THR A 1 61  ? 120.683 71.328  41.950  1.00 30.80  ? 60  THR A O     1 
ATOM 474   C CB    . THR A 1 61  ? 120.645 72.184  38.810  1.00 31.90  ? 60  THR A CB    1 
ATOM 475   O OG1   . THR A 1 61  ? 121.395 73.107  39.592  1.00 30.32  ? 60  THR A OG1   1 
ATOM 476   C CG2   . THR A 1 61  ? 119.828 72.965  37.844  1.00 32.71  ? 60  THR A CG2   1 
ATOM 477   N N     . GLY A 1 62  ? 121.381 69.803  40.492  1.00 29.77  ? 61  GLY A N     1 
ATOM 478   C CA    . GLY A 1 62  ? 122.225 69.163  41.472  1.00 30.08  ? 61  GLY A CA    1 
ATOM 479   C C     . GLY A 1 62  ? 123.294 70.068  42.021  1.00 29.36  ? 61  GLY A C     1 
ATOM 480   O O     . GLY A 1 62  ? 123.569 70.033  43.212  1.00 29.42  ? 61  GLY A O     1 
ATOM 481   N N     . PRO A 1 63  ? 123.935 70.895  41.087  1.00 29.63  ? 62  PRO A N     1 
ATOM 482   C CA    . PRO A 1 63  ? 124.954 71.772  41.686  1.00 29.98  ? 62  PRO A CA    1 
ATOM 483   C C     . PRO A 1 63  ? 124.370 72.766  42.666  1.00 29.44  ? 62  PRO A C     1 
ATOM 484   O O     . PRO A 1 63  ? 124.962 73.045  43.690  1.00 29.62  ? 62  PRO A O     1 
ATOM 485   C CB    . PRO A 1 63  ? 125.537 72.522  40.494  1.00 30.43  ? 62  PRO A CB    1 
ATOM 486   C CG    . PRO A 1 63  ? 125.373 71.613  39.362  1.00 30.61  ? 62  PRO A CG    1 
ATOM 487   C CD    . PRO A 1 63  ? 123.974 71.176  39.570  1.00 29.96  ? 62  PRO A CD    1 
ATOM 488   N N     . THR A 1 64  ? 123.212 73.312  42.345  1.00 26.46  ? 63  THR A N     1 
ATOM 489   C CA    . THR A 1 64  ? 122.656 74.363  43.155  1.00 26.05  ? 63  THR A CA    1 
ATOM 490   C C     . THR A 1 64  ? 122.401 73.866  44.555  1.00 26.47  ? 63  THR A C     1 
ATOM 491   O O     . THR A 1 64  ? 122.771 74.504  45.516  1.00 26.29  ? 63  THR A O     1 
ATOM 492   C CB    . THR A 1 64  ? 121.320 74.817  42.574  1.00 25.90  ? 63  THR A CB    1 
ATOM 493   O OG1   . THR A 1 64  ? 121.524 75.323  41.256  1.00 25.58  ? 63  THR A OG1   1 
ATOM 494   C CG2   . THR A 1 64  ? 120.724 75.888  43.420  1.00 25.55  ? 63  THR A CG2   1 
ATOM 495   N N     . VAL A 1 65  ? 121.819 72.692  44.675  1.00 27.14  ? 64  VAL A N     1 
ATOM 496   C CA    . VAL A 1 65  ? 121.598 72.103  45.997  1.00 27.70  ? 64  VAL A CA    1 
ATOM 497   C C     . VAL A 1 65  ? 122.909 71.843  46.710  1.00 27.83  ? 64  VAL A C     1 
ATOM 498   O O     . VAL A 1 65  ? 123.055 72.153  47.889  1.00 27.91  ? 64  VAL A O     1 
ATOM 499   C CB    . VAL A 1 65  ? 120.808 70.794  45.904  1.00 28.57  ? 64  VAL A CB    1 
ATOM 500   C CG1   . VAL A 1 65  ? 120.576 70.199  47.256  1.00 29.25  ? 64  VAL A CG1   1 
ATOM 501   C CG2   . VAL A 1 65  ? 119.497 71.055  45.255  1.00 28.53  ? 64  VAL A CG2   1 
ATOM 502   N N     . SER A 1 66  ? 123.877 71.299  45.978  1.00 30.67  ? 65  SER A N     1 
ATOM 503   C CA    . SER A 1 66  ? 125.192 71.025  46.538  1.00 31.29  ? 65  SER A CA    1 
ATOM 504   C C     . SER A 1 66  ? 125.782 72.259  47.137  1.00 31.57  ? 65  SER A C     1 
ATOM 505   O O     . SER A 1 66  ? 126.455 72.194  48.136  1.00 32.06  ? 65  SER A O     1 
ATOM 506   C CB    . SER A 1 66  ? 126.166 70.518  45.489  1.00 31.82  ? 65  SER A CB    1 
ATOM 507   O OG    . SER A 1 66  ? 127.462 70.455  46.073  1.00 32.58  ? 65  SER A OG    1 
ATOM 508   N N     . ASN A 1 67  ? 125.604 73.382  46.458  1.00 26.84  ? 66  ASN A N     1 
ATOM 509   C CA    . ASN A 1 67  ? 126.066 74.665  46.963  1.00 26.40  ? 66  ASN A CA    1 
ATOM 510   C C     . ASN A 1 67  ? 125.387 75.186  48.213  1.00 26.49  ? 66  ASN A C     1 
ATOM 511   O O     . ASN A 1 67  ? 126.038 75.691  49.096  1.00 26.56  ? 66  ASN A O     1 
ATOM 512   C CB    . ASN A 1 67  ? 125.977 75.716  45.870  1.00 25.78  ? 66  ASN A CB    1 
ATOM 513   C CG    . ASN A 1 67  ? 126.920 76.865  46.097  1.00 25.48  ? 66  ASN A CG    1 
ATOM 514   O OD1   . ASN A 1 67  ? 128.107 76.758  45.850  1.00 25.55  ? 66  ASN A OD1   1 
ATOM 515   N ND2   . ASN A 1 67  ? 126.392 77.974  46.562  1.00 25.24  ? 66  ASN A ND2   1 
ATOM 516   N N     . LEU A 1 68  ? 124.069 75.098  48.266  1.00 26.75  ? 67  LEU A N     1 
ATOM 517   C CA    . LEU A 1 68  ? 123.335 75.549  49.433  1.00 26.93  ? 67  LEU A CA    1 
ATOM 518   C C     . LEU A 1 68  ? 123.606 74.676  50.617  1.00 27.65  ? 67  LEU A C     1 
ATOM 519   O O     . LEU A 1 68  ? 123.750 75.140  51.729  1.00 27.86  ? 67  LEU A O     1 
ATOM 520   C CB    . LEU A 1 68  ? 121.839 75.537  49.171  1.00 26.95  ? 67  LEU A CB    1 
ATOM 521   C CG    . LEU A 1 68  ? 120.978 76.163  50.261  1.00 27.11  ? 67  LEU A CG    1 
ATOM 522   C CD1   . LEU A 1 68  ? 119.766 76.818  49.649  1.00 26.77  ? 67  LEU A CD1   1 
ATOM 523   C CD2   . LEU A 1 68  ? 120.534 75.121  51.256  1.00 27.95  ? 67  LEU A CD2   1 
ATOM 524   N N     . LEU A 1 69  ? 123.645 73.381  50.384  1.00 27.96  ? 68  LEU A N     1 
ATOM 525   C CA    . LEU A 1 69  ? 123.803 72.453  51.473  1.00 28.77  ? 68  LEU A CA    1 
ATOM 526   C C     . LEU A 1 69  ? 125.119 72.726  52.140  1.00 28.80  ? 68  LEU A C     1 
ATOM 527   O O     . LEU A 1 69  ? 125.240 72.666  53.347  1.00 29.31  ? 68  LEU A O     1 
ATOM 528   C CB    . LEU A 1 69  ? 123.760 71.028  50.947  1.00 29.34  ? 68  LEU A CB    1 
ATOM 529   C CG    . LEU A 1 69  ? 122.368 70.537  50.582  1.00 29.67  ? 68  LEU A CG    1 
ATOM 530   C CD1   . LEU A 1 69  ? 122.369 69.035  50.445  1.00 30.55  ? 68  LEU A CD1   1 
ATOM 531   C CD2   . LEU A 1 69  ? 121.376 70.962  51.644  1.00 29.93  ? 68  LEU A CD2   1 
ATOM 532   N N     . ARG A 1 70  ? 126.115 73.026  51.336  1.00 37.28  ? 69  ARG A N     1 
ATOM 533   C CA    . ARG A 1 70  ? 127.431 73.332  51.845  1.00 38.46  ? 69  ARG A CA    1 
ATOM 534   C C     . ARG A 1 70  ? 127.371 74.569  52.701  1.00 38.27  ? 69  ARG A C     1 
ATOM 535   O O     . ARG A 1 70  ? 127.995 74.639  53.740  1.00 39.22  ? 69  ARG A O     1 
ATOM 536   C CB    . ARG A 1 70  ? 128.380 73.550  50.683  1.00 48.35  ? 69  ARG A CB    1 
ATOM 537   C CG    . ARG A 1 70  ? 129.724 74.122  51.062  1.00 49.31  ? 69  ARG A CG    1 
ATOM 538   C CD    . ARG A 1 70  ? 130.396 74.716  49.842  1.00 48.77  ? 69  ARG A CD    1 
ATOM 539   N NE    . ARG A 1 70  ? 129.686 75.900  49.398  1.00 48.05  ? 69  ARG A NE    1 
ATOM 540   C CZ    . ARG A 1 70  ? 130.185 76.789  48.556  1.00 47.11  ? 69  ARG A CZ    1 
ATOM 541   N NH1   . ARG A 1 70  ? 131.400 76.621  48.065  1.00 46.25  ? 69  ARG A NH1   1 
ATOM 542   N NH2   . ARG A 1 70  ? 129.469 77.844  48.210  1.00 46.53  ? 69  ARG A NH2   1 
ATOM 543   N N     . ASN A 1 71  ? 126.606 75.552  52.266  1.00 36.73  ? 70  ASN A N     1 
ATOM 544   C CA    . ASN A 1 71  ? 126.450 76.756  53.043  1.00 36.34  ? 70  ASN A CA    1 
ATOM 545   C C     . ASN A 1 71  ? 125.800 76.432  54.366  1.00 36.15  ? 70  ASN A C     1 
ATOM 546   O O     . ASN A 1 71  ? 126.224 76.911  55.395  1.00 36.62  ? 70  ASN A O     1 
ATOM 547   C CB    . ASN A 1 71  ? 125.601 77.765  52.278  1.00 35.05  ? 70  ASN A CB    1 
ATOM 548   C CG    . ASN A 1 71  ? 126.386 78.507  51.221  1.00 35.47  ? 70  ASN A CG    1 
ATOM 549   O OD1   . ASN A 1 71  ? 127.581 78.317  51.072  1.00 36.83  ? 70  ASN A OD1   1 
ATOM 550   N ND2   . ASN A 1 71  ? 125.709 79.358  50.483  1.00 34.56  ? 70  ASN A ND2   1 
ATOM 551   N N     . LEU A 1 72  ? 124.785 75.587  54.335  1.00 28.58  ? 71  LEU A N     1 
ATOM 552   C CA    . LEU A 1 72  ? 124.126 75.129  55.545  1.00 29.36  ? 71  LEU A CA    1 
ATOM 553   C C     . LEU A 1 72  ? 125.055 74.300  56.393  1.00 30.08  ? 71  LEU A C     1 
ATOM 554   O O     . LEU A 1 72  ? 125.049 74.395  57.602  1.00 30.71  ? 71  LEU A O     1 
ATOM 555   C CB    . LEU A 1 72  ? 122.891 74.316  55.212  1.00 29.59  ? 71  LEU A CB    1 
ATOM 556   C CG    . LEU A 1 72  ? 121.774 75.134  54.593  1.00 29.05  ? 71  LEU A CG    1 
ATOM 557   C CD1   . LEU A 1 72  ? 120.519 74.307  54.475  1.00 29.49  ? 71  LEU A CD1   1 
ATOM 558   C CD2   . LEU A 1 72  ? 121.529 76.351  55.452  1.00 29.02  ? 71  LEU A CD2   1 
ATOM 559   N N     . GLU A 1 73  ? 125.866 73.469  55.769  1.00 35.05  ? 72  GLU A N     1 
ATOM 560   C CA    . GLU A 1 73  ? 126.814 72.673  56.530  1.00 36.55  ? 72  GLU A CA    1 
ATOM 561   C C     . GLU A 1 73  ? 127.839 73.542  57.243  1.00 37.70  ? 72  GLU A C     1 
ATOM 562   O O     . GLU A 1 73  ? 128.234 73.266  58.362  1.00 39.03  ? 72  GLU A O     1 
ATOM 563   C CB    . GLU A 1 73  ? 127.493 71.621  55.662  1.00 37.19  ? 72  GLU A CB    1 
ATOM 564   C CG    . GLU A 1 73  ? 128.291 70.625  56.476  1.00 38.85  ? 72  GLU A CG    1 
ATOM 565   C CD    . GLU A 1 73  ? 128.545 69.335  55.750  1.00 39.04  ? 72  GLU A CD    1 
ATOM 566   O OE1   . GLU A 1 73  ? 128.777 69.380  54.534  1.00 38.52  ? 72  GLU A OE1   1 
ATOM 567   O OE2   . GLU A 1 73  ? 128.515 68.277  56.402  1.00 39.72  ? 72  GLU A OE2   1 
ATOM 568   N N     . ARG A 1 74  ? 128.270 74.601  56.582  1.00 43.16  ? 73  ARG A N     1 
ATOM 569   C CA    . ARG A 1 74  ? 129.263 75.486  57.149  1.00 44.35  ? 73  ARG A CA    1 
ATOM 570   C C     . ARG A 1 74  ? 128.712 76.076  58.416  1.00 43.77  ? 73  ARG A C     1 
ATOM 571   O O     . ARG A 1 74  ? 129.422 76.267  59.385  1.00 45.09  ? 73  ARG A O     1 
ATOM 572   C CB    . ARG A 1 74  ? 129.548 76.619  56.187  1.00 43.69  ? 73  ARG A CB    1 
ATOM 573   C CG    . ARG A 1 74  ? 130.821 76.467  55.391  1.00 45.18  ? 73  ARG A CG    1 
ATOM 574   C CD    . ARG A 1 74  ? 130.569 76.876  53.959  1.00 44.23  ? 73  ARG A CD    1 
ATOM 575   N NE    . ARG A 1 74  ? 131.758 76.790  53.133  1.00 43.71  ? 73  ARG A NE    1 
ATOM 576   C CZ    . ARG A 1 74  ? 132.022 77.637  52.153  1.00 42.32  ? 73  ARG A CZ    1 
ATOM 577   N NH1   . ARG A 1 74  ? 131.177 78.617  51.895  1.00 42.22  ? 73  ARG A NH1   1 
ATOM 578   N NH2   . ARG A 1 74  ? 133.124 77.507  51.437  1.00 40.85  ? 73  ARG A NH2   1 
ATOM 579   N N     . LYS A 1 75  ? 127.434 76.394  58.388  1.00 35.14  ? 74  LYS A N     1 
ATOM 580   C CA    . LYS A 1 75  ? 126.769 76.968  59.531  1.00 34.67  ? 74  LYS A CA    1 
ATOM 581   C C     . LYS A 1 75  ? 126.552 75.929  60.604  1.00 35.55  ? 74  LYS A C     1 
ATOM 582   O O     . LYS A 1 75  ? 126.149 76.246  61.706  1.00 35.58  ? 74  LYS A O     1 
ATOM 583   C CB    . LYS A 1 75  ? 125.460 77.605  59.113  1.00 32.90  ? 74  LYS A CB    1 
ATOM 584   C CG    . LYS A 1 75  ? 125.669 78.898  58.357  1.00 32.10  ? 74  LYS A CG    1 
ATOM 585   C CD    . LYS A 1 75  ? 124.394 79.400  57.720  1.00 31.48  ? 74  LYS A CD    1 
ATOM 586   C CE    . LYS A 1 75  ? 124.687 80.597  56.847  1.00 30.78  ? 74  LYS A CE    1 
ATOM 587   N NZ    . LYS A 1 75  ? 124.181 81.851  57.454  1.00 30.94  ? 74  LYS A NZ    1 
ATOM 588   N N     . LYS A 1 76  ? 126.779 74.673  60.262  1.00 38.15  ? 75  LYS A N     1 
ATOM 589   C CA    . LYS A 1 76  ? 126.533 73.571  61.195  1.00 39.23  ? 75  LYS A CA    1 
ATOM 590   C C     . LYS A 1 76  ? 125.048 73.345  61.503  1.00 38.19  ? 75  LYS A C     1 
ATOM 591   O O     . LYS A 1 76  ? 124.683 72.995  62.624  1.00 39.09  ? 75  LYS A O     1 
ATOM 592   C CB    . LYS A 1 76  ? 127.312 73.781  62.499  1.00 40.77  ? 75  LYS A CB    1 
ATOM 593   C CG    . LYS A 1 76  ? 128.801 73.807  62.304  1.00 42.44  ? 75  LYS A CG    1 
ATOM 594   C CD    . LYS A 1 76  ? 129.531 73.963  63.623  1.00 44.20  ? 75  LYS A CD    1 
ATOM 595   C CE    . LYS A 1 76  ? 130.070 72.629  64.152  1.00 46.65  ? 75  LYS A CE    1 
ATOM 596   N NZ    . LYS A 1 76  ? 130.585 72.755  65.568  1.00 48.43  ? 75  LYS A NZ    1 
ATOM 597   N N     . LEU A 1 77  ? 124.200 73.543  60.504  1.00 32.89  ? 76  LEU A N     1 
ATOM 598   C CA    . LEU A 1 77  ? 122.766 73.428  60.702  1.00 33.19  ? 76  LEU A CA    1 
ATOM 599   C C     . LEU A 1 77  ? 122.278 72.129  60.112  1.00 33.47  ? 76  LEU A C     1 
ATOM 600   O O     . LEU A 1 77  ? 121.198 71.648  60.424  1.00 34.08  ? 76  LEU A O     1 
ATOM 601   C CB    . LEU A 1 77  ? 122.056 74.598  60.036  1.00 32.32  ? 76  LEU A CB    1 
ATOM 602   C CG    . LEU A 1 77  ? 122.448 75.981  60.562  1.00 32.12  ? 76  LEU A CG    1 
ATOM 603   C CD1   . LEU A 1 77  ? 121.902 77.037  59.622  1.00 31.18  ? 76  LEU A CD1   1 
ATOM 604   C CD2   . LEU A 1 77  ? 121.915 76.156  61.969  1.00 33.09  ? 76  LEU A CD2   1 
ATOM 605   N N     . ILE A 1 78  ? 123.078 71.563  59.226  1.00 37.13  ? 77  ILE A N     1 
ATOM 606   C CA    . ILE A 1 78  ? 122.796 70.241  58.709  1.00 37.60  ? 77  ILE A CA    1 
ATOM 607   C C     . ILE A 1 78  ? 124.075 69.465  58.851  1.00 38.08  ? 77  ILE A C     1 
ATOM 608   O O     . ILE A 1 78  ? 125.139 70.049  59.076  1.00 38.44  ? 77  ILE A O     1 
ATOM 609   C CB    . ILE A 1 78  ? 122.439 70.275  57.247  1.00 36.77  ? 77  ILE A CB    1 
ATOM 610   C CG1   . ILE A 1 78  ? 123.606 70.850  56.460  1.00 35.87  ? 77  ILE A CG1   1 
ATOM 611   C CG2   . ILE A 1 78  ? 121.181 71.101  57.024  1.00 36.38  ? 77  ILE A CG2   1 
ATOM 612   C CD1   . ILE A 1 78  ? 123.580 70.479  54.978  1.00 35.35  ? 77  ILE A CD1   1 
ATOM 613   N N     . TYR A 1 79  ? 123.975 68.148  58.765  1.00 34.66  ? 78  TYR A N     1 
ATOM 614   C CA    . TYR A 1 79  ? 125.162 67.324  58.685  1.00 34.97  ? 78  TYR A CA    1 
ATOM 615   C C     . TYR A 1 79  ? 124.828 66.367  57.612  1.00 35.06  ? 78  TYR A C     1 
ATOM 616   O O     . TYR A 1 79  ? 123.659 66.117  57.374  1.00 35.30  ? 78  TYR A O     1 
ATOM 617   C CB    . TYR A 1 79  ? 125.407 66.550  59.971  1.00 36.23  ? 78  TYR A CB    1 
ATOM 618   C CG    . TYR A 1 79  ? 124.356 65.513  60.278  1.00 37.31  ? 78  TYR A CG    1 
ATOM 619   C CD1   . TYR A 1 79  ? 124.600 64.172  60.073  1.00 38.15  ? 78  TYR A CD1   1 
ATOM 620   C CD2   . TYR A 1 79  ? 123.116 65.891  60.789  1.00 37.60  ? 78  TYR A CD2   1 
ATOM 621   C CE1   . TYR A 1 79  ? 123.640 63.238  60.355  1.00 39.27  ? 78  TYR A CE1   1 
ATOM 622   C CE2   . TYR A 1 79  ? 122.151 64.970  61.075  1.00 38.70  ? 78  TYR A CE2   1 
ATOM 623   C CZ    . TYR A 1 79  ? 122.413 63.639  60.858  1.00 39.55  ? 78  TYR A CZ    1 
ATOM 624   O OH    . TYR A 1 79  ? 121.437 62.714  61.155  1.00 40.79  ? 78  TYR A OH    1 
ATOM 625   N N     . ARG A 1 80  ? 125.841 65.835  56.946  1.00 38.83  ? 79  ARG A N     1 
ATOM 626   C CA    . ARG A 1 80  ? 125.594 64.799  55.958  1.00 38.96  ? 79  ARG A CA    1 
ATOM 627   C C     . ARG A 1 80  ? 126.652 63.730  55.988  1.00 39.78  ? 79  ARG A C     1 
ATOM 628   O O     . ARG A 1 80  ? 127.788 63.979  56.359  1.00 40.53  ? 79  ARG A O     1 
ATOM 629   C CB    . ARG A 1 80  ? 125.468 65.396  54.573  1.00 37.75  ? 79  ARG A CB    1 
ATOM 630   C CG    . ARG A 1 80  ? 126.404 66.525  54.304  1.00 37.31  ? 79  ARG A CG    1 
ATOM 631   C CD    . ARG A 1 80  ? 125.843 67.302  53.184  1.00 36.28  ? 79  ARG A CD    1 
ATOM 632   N NE    . ARG A 1 80  ? 126.626 68.483  52.898  1.00 36.47  ? 79  ARG A NE    1 
ATOM 633   C CZ    . ARG A 1 80  ? 127.387 68.605  51.822  1.00 36.28  ? 79  ARG A CZ    1 
ATOM 634   N NH1   . ARG A 1 80  ? 127.468 67.598  50.960  1.00 36.13  ? 79  ARG A NH1   1 
ATOM 635   N NH2   . ARG A 1 80  ? 128.062 69.728  51.606  1.00 36.78  ? 79  ARG A NH2   1 
ATOM 636   N N     . TYR A 1 81  ? 126.269 62.518  55.641  1.00 39.20  ? 80  TYR A N     1 
ATOM 637   C CA    . TYR A 1 81  ? 127.218 61.429  55.686  1.00 40.11  ? 80  TYR A CA    1 
ATOM 638   C C     . TYR A 1 81  ? 126.922 60.590  54.492  1.00 40.06  ? 80  TYR A C     1 
ATOM 639   O O     . TYR A 1 81  ? 125.867 60.760  53.865  1.00 39.86  ? 80  TYR A O     1 
ATOM 640   C CB    . TYR A 1 81  ? 127.049 60.599  56.950  1.00 41.67  ? 80  TYR A CB    1 
ATOM 641   C CG    . TYR A 1 81  ? 125.703 59.937  57.055  1.00 42.40  ? 80  TYR A CG    1 
ATOM 642   C CD1   . TYR A 1 81  ? 125.478 58.686  56.513  1.00 43.21  ? 80  TYR A CD1   1 
ATOM 643   C CD2   . TYR A 1 81  ? 124.660 60.559  57.705  1.00 42.39  ? 80  TYR A CD2   1 
ATOM 644   C CE1   . TYR A 1 81  ? 124.257 58.087  56.605  1.00 44.05  ? 80  TYR A CE1   1 
ATOM 645   C CE2   . TYR A 1 81  ? 123.440 59.966  57.795  1.00 43.19  ? 80  TYR A CE2   1 
ATOM 646   C CZ    . TYR A 1 81  ? 123.244 58.726  57.242  1.00 44.04  ? 80  TYR A CZ    1 
ATOM 647   O OH    . TYR A 1 81  ? 122.018 58.125  57.337  1.00 45.06  ? 80  TYR A OH    1 
ATOM 648   N N     . VAL A 1 82  ? 127.843 59.680  54.182  1.00 39.42  ? 81  VAL A N     1 
ATOM 649   C CA    . VAL A 1 82  ? 127.718 58.848  52.991  1.00 39.77  ? 81  VAL A CA    1 
ATOM 650   C C     . VAL A 1 82  ? 126.774 57.687  53.275  1.00 41.22  ? 81  VAL A C     1 
ATOM 651   O O     . VAL A 1 82  ? 126.912 56.990  54.280  1.00 42.29  ? 81  VAL A O     1 
ATOM 652   C CB    . VAL A 1 82  ? 129.075 58.324  52.528  1.00 39.86  ? 81  VAL A CB    1 
ATOM 653   C CG1   . VAL A 1 82  ? 128.925 57.719  51.186  1.00 40.05  ? 81  VAL A CG1   1 
ATOM 654   C CG2   . VAL A 1 82  ? 130.092 59.447  52.477  1.00 38.64  ? 81  VAL A CG2   1 
ATOM 655   N N     . ASP A 1 83  ? 125.791 57.506  52.409  1.00 40.75  ? 82  ASP A N     1 
ATOM 656   C CA    . ASP A 1 83  ? 124.836 56.427  52.586  1.00 42.22  ? 82  ASP A CA    1 
ATOM 657   C C     . ASP A 1 83  ? 125.554 55.094  52.472  1.00 43.46  ? 82  ASP A C     1 
ATOM 658   O O     . ASP A 1 83  ? 126.301 54.871  51.537  1.00 43.20  ? 82  ASP A O     1 
ATOM 659   C CB    . ASP A 1 83  ? 123.730 56.529  51.542  1.00 42.09  ? 82  ASP A CB    1 
ATOM 660   C CG    . ASP A 1 83  ? 122.719 55.428  51.667  1.00 43.72  ? 82  ASP A CG    1 
ATOM 661   O OD1   . ASP A 1 83  ? 121.586 55.722  52.131  1.00 43.93  ? 82  ASP A OD1   1 
ATOM 662   O OD2   . ASP A 1 83  ? 123.069 54.277  51.308  1.00 44.85  ? 82  ASP A OD2   1 
ATOM 663   N N     . ALA A 1 84  ? 125.322 54.216  53.440  1.00 44.36  ? 83  ALA A N     1 
ATOM 664   C CA    . ALA A 1 84  ? 126.086 52.968  53.576  1.00 45.65  ? 83  ALA A CA    1 
ATOM 665   C C     . ALA A 1 84  ? 125.853 51.909  52.500  1.00 46.65  ? 83  ALA A C     1 
ATOM 666   O O     . ALA A 1 84  ? 126.739 51.111  52.232  1.00 47.29  ? 83  ALA A O     1 
ATOM 667   C CB    . ALA A 1 84  ? 125.850 52.360  54.951  1.00 47.00  ? 83  ALA A CB    1 
ATOM 668   N N     . GLN A 1 85  ? 124.666 51.899  51.905  1.00 62.02  ? 84  GLN A N     1 
ATOM 669   C CA    . GLN A 1 85  ? 124.316 50.885  50.922  1.00 63.38  ? 84  GLN A CA    1 
ATOM 670   C C     . GLN A 1 85  ? 124.620 51.311  49.496  1.00 62.44  ? 84  GLN A C     1 
ATOM 671   O O     . GLN A 1 85  ? 125.086 50.520  48.670  1.00 63.12  ? 84  GLN A O     1 
ATOM 672   C CB    . GLN A 1 85  ? 122.840 50.559  51.035  1.00 63.84  ? 84  GLN A CB    1 
ATOM 673   C CG    . GLN A 1 85  ? 122.587 49.223  51.681  1.00 66.02  ? 84  GLN A CG    1 
ATOM 674   C CD    . GLN A 1 85  ? 121.131 49.020  51.988  1.00 67.08  ? 84  GLN A CD    1 
ATOM 675   O OE1   . GLN A 1 85  ? 120.283 49.079  51.087  1.00 67.12  ? 84  GLN A OE1   1 
ATOM 676   N NE2   . GLN A 1 85  ? 120.819 48.804  53.272  1.00 68.00  ? 84  GLN A NE2   1 
ATOM 677   N N     . ASP A 1 86  ? 124.310 52.564  49.205  1.00 54.09  ? 85  ASP A N     1 
ATOM 678   C CA    . ASP A 1 86  ? 124.658 53.171  47.944  1.00 52.96  ? 85  ASP A CA    1 
ATOM 679   C C     . ASP A 1 86  ? 125.707 54.219  48.249  1.00 51.42  ? 85  ASP A C     1 
ATOM 680   O O     . ASP A 1 86  ? 125.391 55.279  48.730  1.00 50.38  ? 85  ASP A O     1 
ATOM 681   C CB    . ASP A 1 86  ? 123.419 53.857  47.394  1.00 52.45  ? 85  ASP A CB    1 
ATOM 682   C CG    . ASP A 1 86  ? 123.623 54.404  46.025  1.00 51.51  ? 85  ASP A CG    1 
ATOM 683   O OD1   . ASP A 1 86  ? 124.784 54.589  45.644  1.00 50.87  ? 85  ASP A OD1   1 
ATOM 684   O OD2   . ASP A 1 86  ? 122.627 54.657  45.329  1.00 51.47  ? 85  ASP A OD2   1 
ATOM 685   N N     . THR A 1 87  ? 126.953 53.949  47.910  1.00 52.55  ? 86  THR A N     1 
ATOM 686   C CA    . THR A 1 87  ? 128.052 54.813  48.308  1.00 51.35  ? 86  THR A CA    1 
ATOM 687   C C     . THR A 1 87  ? 128.063 56.100  47.480  1.00 49.78  ? 86  THR A C     1 
ATOM 688   O O     . THR A 1 87  ? 128.856 57.000  47.708  1.00 48.72  ? 86  THR A O     1 
ATOM 689   C CB    . THR A 1 87  ? 129.400 54.044  48.346  1.00 51.92  ? 86  THR A CB    1 
ATOM 690   O OG1   . THR A 1 87  ? 129.307 52.992  49.305  1.00 53.35  ? 86  THR A OG1   1 
ATOM 691   C CG2   . THR A 1 87  ? 130.601 54.914  48.702  1.00 50.78  ? 86  THR A CG2   1 
ATOM 692   N N     . ARG A 1 88  ? 127.204 56.140  46.482  1.00 54.87  ? 87  ARG A N     1 
ATOM 693   C CA    . ARG A 1 88  ? 127.036 57.318  45.661  1.00 53.28  ? 87  ARG A CA    1 
ATOM 694   C C     . ARG A 1 88  ? 126.500 58.456  46.509  1.00 52.52  ? 87  ARG A C     1 
ATOM 695   O O     . ARG A 1 88  ? 126.818 59.611  46.268  1.00 51.53  ? 87  ARG A O     1 
ATOM 696   C CB    . ARG A 1 88  ? 126.083 57.049  44.501  1.00 53.74  ? 87  ARG A CB    1 
ATOM 697   C CG    . ARG A 1 88  ? 126.584 56.021  43.510  1.00 54.60  ? 87  ARG A CG    1 
ATOM 698   C CD    . ARG A 1 88  ? 125.677 55.925  42.297  1.00 55.22  ? 87  ARG A CD    1 
ATOM 699   N NE    . ARG A 1 88  ? 124.407 55.276  42.594  1.00 56.54  ? 87  ARG A NE    1 
ATOM 700   C CZ    . ARG A 1 88  ? 123.397 55.193  41.738  1.00 57.07  ? 87  ARG A CZ    1 
ATOM 701   N NH1   . ARG A 1 88  ? 123.508 55.720  40.532  1.00 56.41  ? 87  ARG A NH1   1 
ATOM 702   N NH2   . ARG A 1 88  ? 122.276 54.590  42.085  1.00 58.18  ? 87  ARG A NH2   1 
ATOM 703   N N     . ARG A 1 89  ? 125.641 58.125  47.468  1.00 52.30  ? 88  ARG A N     1 
ATOM 704   C CA    . ARG A 1 89  ? 124.749 59.106  48.072  1.00 51.48  ? 88  ARG A CA    1 
ATOM 705   C C     . ARG A 1 89  ? 125.291 59.756  49.316  1.00 50.80  ? 88  ARG A C     1 
ATOM 706   O O     . ARG A 1 89  ? 126.174 59.229  49.986  1.00 51.52  ? 88  ARG A O     1 
ATOM 707   C CB    . ARG A 1 89  ? 123.412 58.475  48.435  1.00 52.58  ? 88  ARG A CB    1 
ATOM 708   C CG    . ARG A 1 89  ? 122.939 57.432  47.472  1.00 53.75  ? 88  ARG A CG    1 
ATOM 709   C CD    . ARG A 1 89  ? 121.444 57.443  47.415  1.00 54.42  ? 88  ARG A CD    1 
ATOM 710   N NE    . ARG A 1 89  ? 120.902 56.179  46.955  1.00 56.15  ? 88  ARG A NE    1 
ATOM 711   C CZ    . ARG A 1 89  ? 119.613 55.870  47.003  1.00 57.14  ? 88  ARG A CZ    1 
ATOM 712   N NH1   . ARG A 1 89  ? 118.727 56.743  47.490  1.00 56.55  ? 88  ARG A NH1   1 
ATOM 713   N NH2   . ARG A 1 89  ? 119.214 54.679  46.569  1.00 58.63  ? 88  ARG A NH2   1 
ATOM 714   N N     . LYS A 1 90  ? 124.729 60.916  49.616  1.00 36.28  ? 89  LYS A N     1 
ATOM 715   C CA    . LYS A 1 90  ? 124.992 61.602  50.861  1.00 35.95  ? 89  LYS A CA    1 
ATOM 716   C C     . LYS A 1 90  ? 123.644 61.866  51.526  1.00 36.22  ? 89  LYS A C     1 
ATOM 717   O O     . LYS A 1 90  ? 122.779 62.551  50.959  1.00 35.63  ? 89  LYS A O     1 
ATOM 718   C CB    . LYS A 1 90  ? 125.732 62.913  50.607  1.00 34.59  ? 89  LYS A CB    1 
ATOM 719   C CG    . LYS A 1 90  ? 127.151 62.765  50.115  1.00 34.35  ? 89  LYS A CG    1 
ATOM 720   C CD    . LYS A 1 90  ? 127.934 64.009  50.470  1.00 33.36  ? 89  LYS A CD    1 
ATOM 721   C CE    . LYS A 1 90  ? 129.373 63.972  49.979  1.00 33.11  ? 89  LYS A CE    1 
ATOM 722   N NZ    . LYS A 1 90  ? 129.547 64.695  48.679  1.00 32.23  ? 89  LYS A NZ    1 
ATOM 723   N N     . ASN A 1 91  ? 123.452 61.297  52.710  1.00 43.54  ? 90  ASN A N     1 
ATOM 724   C CA    . ASN A 1 91  ? 122.238 61.540  53.471  1.00 43.98  ? 90  ASN A CA    1 
ATOM 725   C C     . ASN A 1 91  ? 122.321 62.872  54.206  1.00 43.11  ? 90  ASN A C     1 
ATOM 726   O O     . ASN A 1 91  ? 123.316 63.152  54.850  1.00 42.83  ? 90  ASN A O     1 
ATOM 727   C CB    . ASN A 1 91  ? 122.002 60.396  54.454  1.00 45.55  ? 90  ASN A CB    1 
ATOM 728   C CG    . ASN A 1 91  ? 121.673 59.098  53.752  1.00 46.85  ? 90  ASN A CG    1 
ATOM 729   O OD1   . ASN A 1 91  ? 121.203 59.102  52.606  1.00 46.92  ? 90  ASN A OD1   1 
ATOM 730   N ND2   . ASN A 1 91  ? 121.912 57.979  54.428  1.00 48.24  ? 90  ASN A ND2   1 
ATOM 731   N N     . ILE A 1 92  ? 121.282 63.689  54.099  1.00 37.22  ? 91  ILE A N     1 
ATOM 732   C CA    . ILE A 1 92  ? 121.268 65.009  54.714  1.00 36.39  ? 91  ILE A CA    1 
ATOM 733   C C     . ILE A 1 92  ? 120.328 65.001  55.884  1.00 37.19  ? 91  ILE A C     1 
ATOM 734   O O     . ILE A 1 92  ? 119.212 64.508  55.761  1.00 37.86  ? 91  ILE A O     1 
ATOM 735   C CB    . ILE A 1 92  ? 120.637 66.022  53.795  1.00 35.34  ? 91  ILE A CB    1 
ATOM 736   C CG1   . ILE A 1 92  ? 121.175 65.876  52.369  1.00 34.76  ? 91  ILE A CG1   1 
ATOM 737   C CG2   . ILE A 1 92  ? 120.783 67.402  54.370  1.00 34.52  ? 91  ILE A CG2   1 
ATOM 738   C CD1   . ILE A 1 92  ? 122.684 65.865  52.287  1.00 34.41  ? 91  ILE A CD1   1 
ATOM 739   N N     . GLY A 1 93  ? 120.752 65.566  57.008  1.00 36.16  ? 92  GLY A N     1 
ATOM 740   C CA    . GLY A 1 93  ? 119.909 65.663  58.181  1.00 36.95  ? 92  GLY A CA    1 
ATOM 741   C C     . GLY A 1 93  ? 120.162 66.975  58.866  1.00 36.28  ? 92  GLY A C     1 
ATOM 742   O O     . GLY A 1 93  ? 121.196 67.597  58.640  1.00 35.46  ? 92  GLY A O     1 
ATOM 743   N N     . LEU A 1 94  ? 119.208 67.401  59.688  1.00 37.22  ? 93  LEU A N     1 
ATOM 744   C CA    . LEU A 1 94  ? 119.351 68.601  60.526  1.00 36.87  ? 93  LEU A CA    1 
ATOM 745   C C     . LEU A 1 94  ? 120.095 68.288  61.806  1.00 37.77  ? 93  LEU A C     1 
ATOM 746   O O     . LEU A 1 94  ? 119.807 67.295  62.481  1.00 39.01  ? 93  LEU A O     1 
ATOM 747   C CB    . LEU A 1 94  ? 117.986 69.145  60.920  1.00 37.12  ? 93  LEU A CB    1 
ATOM 748   C CG    . LEU A 1 94  ? 117.155 69.821  59.850  1.00 36.19  ? 93  LEU A CG    1 
ATOM 749   C CD1   . LEU A 1 94  ? 115.917 70.392  60.481  1.00 36.58  ? 93  LEU A CD1   1 
ATOM 750   C CD2   . LEU A 1 94  ? 117.975 70.903  59.163  1.00 34.85  ? 93  LEU A CD2   1 
ATOM 751   N N     . THR A 1 95  ? 121.048 69.141  62.139  1.00 36.74  ? 94  THR A N     1 
ATOM 752   C CA    . THR A 1 95  ? 121.697 69.075  63.441  1.00 37.61  ? 94  THR A CA    1 
ATOM 753   C C     . THR A 1 95  ? 120.753 69.623  64.498  1.00 38.28  ? 94  THR A C     1 
ATOM 754   O O     . THR A 1 95  ? 119.835 70.362  64.166  1.00 37.77  ? 94  THR A O     1 
ATOM 755   C CB    . THR A 1 95  ? 122.958 69.940  63.480  1.00 36.91  ? 94  THR A CB    1 
ATOM 756   O OG1   . THR A 1 95  ? 122.596 71.326  63.349  1.00 36.11  ? 94  THR A OG1   1 
ATOM 757   C CG2   . THR A 1 95  ? 123.906 69.529  62.373  1.00 36.19  ? 94  THR A CG2   1 
ATOM 758   N N     . THR A 1 96  ? 121.069 69.400  65.765  1.00 47.52  ? 95  THR A N     1 
ATOM 759   C CA    . THR A 1 96  ? 120.218 69.877  66.842  1.00 47.73  ? 95  THR A CA    1 
ATOM 760   C C     . THR A 1 96  ? 120.108 71.382  66.740  1.00 46.38  ? 95  THR A C     1 
ATOM 761   O O     . THR A 1 96  ? 119.050 71.951  66.974  1.00 45.63  ? 95  THR A O     1 
ATOM 762   C CB    . THR A 1 96  ? 120.807 69.543  68.219  1.00 51.13  ? 95  THR A CB    1 
ATOM 763   O OG1   . THR A 1 96  ? 120.849 68.124  68.393  1.00 53.48  ? 95  THR A OG1   1 
ATOM 764   C CG2   . THR A 1 96  ? 119.961 70.150  69.312  1.00 51.89  ? 95  THR A CG2   1 
ATOM 765   N N     . SER A 1 97  ? 121.209 72.028  66.390  1.00 45.92  ? 96  SER A N     1 
ATOM 766   C CA    . SER A 1 97  ? 121.203 73.464  66.221  1.00 44.80  ? 96  SER A CA    1 
ATOM 767   C C     . SER A 1 97  ? 120.235 73.822  65.104  1.00 42.96  ? 96  SER A C     1 
ATOM 768   O O     . SER A 1 97  ? 119.457 74.758  65.226  1.00 41.97  ? 96  SER A O     1 
ATOM 769   C CB    . SER A 1 97  ? 122.614 73.938  65.877  1.00 46.43  ? 96  SER A CB    1 
ATOM 770   O OG    . SER A 1 97  ? 122.610 75.108  65.084  1.00 46.50  ? 96  SER A OG    1 
ATOM 771   N N     . GLY A 1 98  ? 120.274 73.052  64.025  1.00 52.93  ? 97  GLY A N     1 
ATOM 772   C CA    . GLY A 1 98  ? 119.435 73.304  62.869  1.00 51.84  ? 97  GLY A CA    1 
ATOM 773   C C     . GLY A 1 98  ? 117.960 73.177  63.165  1.00 50.55  ? 97  GLY A C     1 
ATOM 774   O O     . GLY A 1 98  ? 117.150 73.951  62.675  1.00 49.65  ? 97  GLY A O     1 
ATOM 775   N N     . ILE A 1 99  ? 117.612 72.178  63.961  1.00 49.69  ? 98  ILE A N     1 
ATOM 776   C CA    . ILE A 1 99  ? 116.224 71.954  64.373  1.00 49.64  ? 98  ILE A CA    1 
ATOM 777   C C     . ILE A 1 99  ? 115.661 73.122  65.176  1.00 50.00  ? 98  ILE A C     1 
ATOM 778   O O     . ILE A 1 99  ? 114.568 73.616  64.883  1.00 50.08  ? 98  ILE A O     1 
ATOM 779   C CB    . ILE A 1 99  ? 116.078 70.715  65.234  1.00 50.59  ? 98  ILE A CB    1 
ATOM 780   C CG1   . ILE A 1 99  ? 116.947 69.597  64.690  1.00 50.83  ? 98  ILE A CG1   1 
ATOM 781   C CG2   . ILE A 1 99  ? 114.641 70.292  65.251  1.00 51.43  ? 98  ILE A CG2   1 
ATOM 782   C CD1   . ILE A 1 99  ? 116.902 68.359  65.509  1.00 52.34  ? 98  ILE A CD1   1 
ATOM 783   N N     . LYS A 1 100 ? 116.408 73.553  66.190  1.00 51.11  ? 99  LYS A N     1 
ATOM 784   C CA    . LYS A 1 100 ? 116.042 74.737  66.953  1.00 51.83  ? 99  LYS A CA    1 
ATOM 785   C C     . LYS A 1 100 ? 115.847 75.931  66.015  1.00 50.95  ? 99  LYS A C     1 
ATOM 786   O O     . LYS A 1 100 ? 114.790 76.574  66.038  1.00 51.14  ? 99  LYS A O     1 
ATOM 787   C CB    . LYS A 1 100 ? 117.077 75.023  68.042  1.00 53.12  ? 99  LYS A CB    1 
ATOM 788   C CG    . LYS A 1 100 ? 116.734 74.353  69.375  1.00 54.53  ? 99  LYS A CG    1 
ATOM 789   C CD    . LYS A 1 100 ? 117.963 74.010  70.216  1.00 55.14  ? 99  LYS A CD    1 
ATOM 790   C CE    . LYS A 1 100 ? 117.567 73.591  71.653  1.00 56.90  ? 99  LYS A CE    1 
ATOM 791   N NZ    . LYS A 1 100 ? 118.594 72.759  72.408  1.00 58.03  ? 99  LYS A NZ    1 
ATOM 792   N N     . LEU A 1 101 ? 116.833 76.187  65.154  1.00 39.05  ? 100 LEU A N     1 
ATOM 793   C CA    . LEU A 1 101 ? 116.750 77.295  64.203  1.00 37.66  ? 100 LEU A CA    1 
ATOM 794   C C     . LEU A 1 101 ? 115.462 77.288  63.406  1.00 35.92  ? 100 LEU A C     1 
ATOM 795   O O     . LEU A 1 101 ? 114.832 78.327  63.257  1.00 35.93  ? 100 LEU A O     1 
ATOM 796   C CB    . LEU A 1 101 ? 117.940 77.300  63.238  1.00 36.99  ? 100 LEU A CB    1 
ATOM 797   C CG    . LEU A 1 101 ? 117.944 78.410  62.175  1.00 37.13  ? 100 LEU A CG    1 
ATOM 798   C CD1   . LEU A 1 101 ? 117.729 79.749  62.818  1.00 37.77  ? 100 LEU A CD1   1 
ATOM 799   C CD2   . LEU A 1 101 ? 119.242 78.431  61.394  1.00 39.59  ? 100 LEU A CD2   1 
ATOM 800   N N     . VAL A 1 102 ? 115.079 76.122  62.887  1.00 44.52  ? 101 VAL A N     1 
ATOM 801   C CA    . VAL A 1 102 ? 113.822 76.028  62.140  1.00 43.99  ? 101 VAL A CA    1 
ATOM 802   C C     . VAL A 1 102 ? 112.665 76.444  63.031  1.00 45.73  ? 101 VAL A C     1 
ATOM 803   O O     . VAL A 1 102 ? 111.969 77.409  62.721  1.00 45.84  ? 101 VAL A O     1 
ATOM 804   C CB    . VAL A 1 102 ? 113.568 74.643  61.539  1.00 43.70  ? 101 VAL A CB    1 
ATOM 805   C CG1   . VAL A 1 102 ? 112.105 74.498  61.155  1.00 44.42  ? 101 VAL A CG1   1 
ATOM 806   C CG2   . VAL A 1 102 ? 114.437 74.447  60.314  1.00 42.32  ? 101 VAL A CG2   1 
ATOM 807   N N     . GLU A 1 103 ? 112.520 75.747  64.161  1.00 39.94  ? 102 GLU A N     1 
ATOM 808   C CA    . GLU A 1 103 ? 111.538 76.071  65.200  1.00 42.13  ? 102 GLU A CA    1 
ATOM 809   C C     . GLU A 1 103 ? 111.473 77.550  65.568  1.00 42.18  ? 102 GLU A C     1 
ATOM 810   O O     . GLU A 1 103 ? 110.412 78.057  65.896  1.00 43.70  ? 102 GLU A O     1 
ATOM 811   C CB    . GLU A 1 103 ? 111.775 75.205  66.431  1.00 43.60  ? 102 GLU A CB    1 
ATOM 812   C CG    . GLU A 1 103 ? 110.978 73.931  66.363  1.00 45.15  ? 102 GLU A CG    1 
ATOM 813   C CD    . GLU A 1 103 ? 111.573 72.815  67.177  1.00 45.63  ? 102 GLU A CD    1 
ATOM 814   O OE1   . GLU A 1 103 ? 112.267 73.105  68.191  1.00 46.64  ? 102 GLU A OE1   1 
ATOM 815   O OE2   . GLU A 1 103 ? 111.349 71.639  66.792  1.00 45.86  ? 102 GLU A OE2   1 
ATOM 816   N N     . ALA A 1 104 ? 112.604 78.238  65.490  1.00 42.12  ? 103 ALA A N     1 
ATOM 817   C CA    . ALA A 1 104 ? 112.615 79.682  65.637  1.00 42.27  ? 103 ALA A CA    1 
ATOM 818   C C     . ALA A 1 104 ? 111.955 80.387  64.449  1.00 41.52  ? 103 ALA A C     1 
ATOM 819   O O     . ALA A 1 104 ? 110.930 81.027  64.620  1.00 42.45  ? 103 ALA A O     1 
ATOM 820   C CB    . ALA A 1 104 ? 114.018 80.178  65.819  1.00 42.00  ? 103 ALA A CB    1 
ATOM 821   N N     . PHE A 1 105 ? 112.509 80.258  63.241  1.00 42.18  ? 104 PHE A N     1 
ATOM 822   C CA    . PHE A 1 105 ? 112.108 81.138  62.139  1.00 41.54  ? 104 PHE A CA    1 
ATOM 823   C C     . PHE A 1 105 ? 110.737 80.780  61.553  1.00 41.49  ? 104 PHE A C     1 
ATOM 824   O O     . PHE A 1 105 ? 110.209 81.554  60.764  1.00 41.15  ? 104 PHE A O     1 
ATOM 825   C CB    . PHE A 1 105 ? 113.224 81.269  61.084  1.00 40.77  ? 104 PHE A CB    1 
ATOM 826   C CG    . PHE A 1 105 ? 113.470 80.005  60.252  1.00 39.59  ? 104 PHE A CG    1 
ATOM 827   C CD1   . PHE A 1 105 ? 112.574 79.596  59.267  1.00 38.60  ? 104 PHE A CD1   1 
ATOM 828   C CD2   . PHE A 1 105 ? 114.637 79.259  60.421  1.00 39.83  ? 104 PHE A CD2   1 
ATOM 829   C CE1   . PHE A 1 105 ? 112.810 78.464  58.514  1.00 37.70  ? 104 PHE A CE1   1 
ATOM 830   C CE2   . PHE A 1 105 ? 114.872 78.137  59.658  1.00 38.90  ? 104 PHE A CE2   1 
ATOM 831   C CZ    . PHE A 1 105 ? 113.951 77.739  58.712  1.00 37.72  ? 104 PHE A CZ    1 
ATOM 832   N N     . THR A 1 106 ? 110.150 79.636  61.885  1.00 40.41  ? 105 THR A N     1 
ATOM 833   C CA    . THR A 1 106 ? 108.969 79.233  61.093  1.00 40.66  ? 105 THR A CA    1 
ATOM 834   C C     . THR A 1 106 ? 107.765 80.256  61.003  1.00 41.65  ? 105 THR A C     1 
ATOM 835   O O     . THR A 1 106 ? 107.110 80.456  59.964  1.00 41.33  ? 105 THR A O     1 
ATOM 836   C CB    . THR A 1 106 ? 108.549 77.722  61.293  1.00 41.98  ? 105 THR A CB    1 
ATOM 837   O OG1   . THR A 1 106 ? 109.609 76.837  60.923  1.00 41.09  ? 105 THR A OG1   1 
ATOM 838   C CG2   . THR A 1 106 ? 107.349 77.386  60.498  1.00 42.30  ? 105 THR A CG2   1 
ATOM 839   N N     . SER A 1 107 ? 107.572 80.956  62.117  1.00 66.39  ? 106 SER A N     1 
ATOM 840   C CA    . SER A 1 107 ? 106.627 82.065  62.135  1.00 67.09  ? 106 SER A CA    1 
ATOM 841   C C     . SER A 1 107 ? 106.656 83.060  60.994  1.00 65.42  ? 106 SER A C     1 
ATOM 842   O O     . SER A 1 107 ? 105.605 83.482  60.516  1.00 65.78  ? 106 SER A O     1 
ATOM 843   C CB    . SER A 1 107 ? 106.777 82.797  63.456  1.00 68.76  ? 106 SER A CB    1 
ATOM 844   O OG    . SER A 1 107 ? 108.143 82.908  63.793  1.00 68.28  ? 106 SER A OG    1 
ATOM 845   N N     . ILE A 1 108 ? 107.857 83.410  60.540  1.00 46.12  ? 107 ILE A N     1 
ATOM 846   C CA    . ILE A 1 108 ? 108.007 84.362  59.447  1.00 45.28  ? 107 ILE A CA    1 
ATOM 847   C C     . ILE A 1 108 ? 107.346 83.869  58.169  1.00 44.29  ? 107 ILE A C     1 
ATOM 848   O O     . ILE A 1 108 ? 106.564 84.587  57.525  1.00 44.67  ? 107 ILE A O     1 
ATOM 849   C CB    . ILE A 1 108 ? 109.460 84.624  59.114  1.00 44.70  ? 107 ILE A CB    1 
ATOM 850   C CG1   . ILE A 1 108 ? 110.200 85.174  60.315  1.00 46.12  ? 107 ILE A CG1   1 
ATOM 851   C CG2   . ILE A 1 108 ? 109.557 85.661  58.031  1.00 44.99  ? 107 ILE A CG2   1 
ATOM 852   C CD1   . ILE A 1 108 ? 111.557 85.768  59.922  1.00 47.06  ? 107 ILE A CD1   1 
ATOM 853   N N     . PHE A 1 109 ? 107.674 82.644  57.794  1.00 43.32  ? 108 PHE A N     1 
ATOM 854   C CA    . PHE A 1 109 ? 107.089 82.059  56.603  1.00 42.45  ? 108 PHE A CA    1 
ATOM 855   C C     . PHE A 1 109 ? 105.571 82.018  56.737  1.00 43.85  ? 108 PHE A C     1 
ATOM 856   O O     . PHE A 1 109 ? 104.843 82.280  55.766  1.00 43.80  ? 108 PHE A O     1 
ATOM 857   C CB    . PHE A 1 109 ? 107.681 80.670  56.331  1.00 41.89  ? 108 PHE A CB    1 
ATOM 858   C CG    . PHE A 1 109 ? 109.092 80.713  55.821  1.00 40.55  ? 108 PHE A CG    1 
ATOM 859   C CD1   . PHE A 1 109 ? 109.439 81.561  54.784  1.00 40.03  ? 108 PHE A CD1   1 
ATOM 860   C CD2   . PHE A 1 109 ? 110.071 79.933  56.384  1.00 40.72  ? 108 PHE A CD2   1 
ATOM 861   C CE1   . PHE A 1 109 ? 110.730 81.623  54.313  1.00 39.60  ? 108 PHE A CE1   1 
ATOM 862   C CE2   . PHE A 1 109 ? 111.361 79.991  55.915  1.00 40.03  ? 108 PHE A CE2   1 
ATOM 863   C CZ    . PHE A 1 109 ? 111.687 80.844  54.881  1.00 39.70  ? 108 PHE A CZ    1 
ATOM 864   N N     . ASP A 1 110 ? 105.097 81.728  57.945  1.00 56.23  ? 109 ASP A N     1 
ATOM 865   C CA    . ASP A 1 110 ? 103.666 81.681  58.172  1.00 57.86  ? 109 ASP A CA    1 
ATOM 866   C C     . ASP A 1 110 ? 103.160 83.108  58.132  1.00 57.95  ? 109 ASP A C     1 
ATOM 867   O O     . ASP A 1 110 ? 102.062 83.371  57.623  1.00 58.73  ? 109 ASP A O     1 
ATOM 868   C CB    . ASP A 1 110 ? 103.360 81.085  59.530  1.00 60.34  ? 109 ASP A CB    1 
ATOM 869   C CG    . ASP A 1 110 ? 103.828 79.670  59.648  1.00 61.42  ? 109 ASP A CG    1 
ATOM 870   O OD1   . ASP A 1 110 ? 104.348 79.308  60.718  1.00 62.66  ? 109 ASP A OD1   1 
ATOM 871   O OD2   . ASP A 1 110 ? 103.678 78.914  58.668  1.00 61.39  ? 109 ASP A OD2   1 
ATOM 872   N N     . GLU A 1 111 ? 103.953 84.026  58.678  1.00 71.93  ? 110 GLU A N     1 
ATOM 873   C CA    . GLU A 1 111 ? 103.509 85.399  58.766  1.00 72.83  ? 110 GLU A CA    1 
ATOM 874   C C     . GLU A 1 111 ? 103.185 85.896  57.353  1.00 72.26  ? 110 GLU A C     1 
ATOM 875   O O     . GLU A 1 111 ? 102.101 86.433  57.089  1.00 73.30  ? 110 GLU A O     1 
ATOM 876   C CB    . GLU A 1 111 ? 104.515 86.254  59.555  1.00 73.58  ? 110 GLU A CB    1 
ATOM 877   C CG    . GLU A 1 111 ? 104.109 87.708  59.814  1.00 76.62  ? 110 GLU A CG    1 
ATOM 878   C CD    . GLU A 1 111 ? 104.350 88.618  58.604  1.00 76.13  ? 110 GLU A CD    1 
ATOM 879   O OE1   . GLU A 1 111 ? 105.233 88.269  57.778  1.00 73.22  ? 110 GLU A OE1   1 
ATOM 880   O OE2   . GLU A 1 111 ? 103.668 89.676  58.484  1.00 78.91  ? 110 GLU A OE2   1 
ATOM 881   N N     . MET A 1 112 ? 104.109 85.630  56.429  1.00 52.38  ? 111 MET A N     1 
ATOM 882   C CA    . MET A 1 112 ? 103.959 86.115  55.055  1.00 52.00  ? 111 MET A CA    1 
ATOM 883   C C     . MET A 1 112 ? 102.862 85.437  54.253  1.00 51.86  ? 111 MET A C     1 
ATOM 884   O O     . MET A 1 112 ? 102.204 86.051  53.421  0.73 52.88  ? 111 MET A O     1 
ATOM 885   C CB    . MET A 1 112 ? 105.321 85.941  54.369  1.00 50.95  ? 111 MET A CB    1 
ATOM 886   C CG    . MET A 1 112 ? 106.477 86.740  54.999  1.00 51.85  ? 111 MET A CG    1 
ATOM 887   S SD    . MET A 1 112 ? 108.023 86.722  54.015  1.00 52.11  ? 111 MET A SD    1 
ATOM 888   C CE    . MET A 1 112 ? 107.472 87.346  52.424  1.00 52.45  ? 111 MET A CE    1 
ATOM 889   N N     . GLU A 1 113 ? 102.676 84.156  54.523  1.00 56.00  ? 112 GLU A N     1 
ATOM 890   C CA    . GLU A 1 113 ? 101.655 83.389  53.849  1.00 56.43  ? 112 GLU A CA    1 
ATOM 891   C C     . GLU A 1 113 ? 100.285 83.907  54.232  1.00 58.25  ? 112 GLU A C     1 
ATOM 892   O O     . GLU A 1 113 ? 99.420  84.076  53.377  1.00 58.72  ? 112 GLU A O     1 
ATOM 893   C CB    . GLU A 1 113 ? 101.774 81.921  54.225  1.00 56.24  ? 112 GLU A CB    1 
ATOM 894   C CG    . GLU A 1 113 ? 100.525 81.124  53.946  1.00 57.87  ? 112 GLU A CG    1 
ATOM 895   C CD    . GLU A 1 113 ? 100.273 80.944  52.474  1.00 57.82  ? 112 GLU A CD    1 
ATOM 896   O OE1   . GLU A 1 113 ? 101.214 81.172  51.672  1.00 56.10  ? 112 GLU A OE1   1 
ATOM 897   O OE2   . GLU A 1 113 ? 99.131  80.567  52.120  1.00 59.44  ? 112 GLU A OE2   1 
ATOM 898   N N     . GLN A 1 114 ? 100.095 84.166  55.523  1.00 86.63  ? 113 GLN A N     1 
ATOM 899   C CA    . GLN A 1 114 ? 98.855  84.750  56.016  1.00 88.79  ? 113 GLN A CA    1 
ATOM 900   C C     . GLN A 1 114 ? 98.610  86.115  55.403  1.00 89.49  ? 113 GLN A C     1 
ATOM 901   O O     . GLN A 1 114 ? 97.579  86.358  54.776  1.00 90.61  ? 113 GLN A O     1 
ATOM 902   C CB    . GLN A 1 114 ? 98.899  84.895  57.534  1.00 88.44  ? 113 GLN A CB    1 
ATOM 903   C CG    . GLN A 1 114 ? 98.321  83.713  58.281  1.00 89.72  ? 113 GLN A CG    1 
ATOM 904   C CD    . GLN A 1 114 ? 96.972  83.292  57.732  1.00 90.92  ? 113 GLN A CD    1 
ATOM 905   O OE1   . GLN A 1 114 ? 96.078  84.122  57.519  1.00 92.43  ? 113 GLN A OE1   1 
ATOM 906   N NE2   . GLN A 1 114 ? 96.822  81.996  57.481  1.00 91.24  ? 113 GLN A NE2   1 
ATOM 907   N N     . THR A 1 115 ? 99.577  87.001  55.599  1.00 66.30  ? 114 THR A N     1 
ATOM 908   C CA    . THR A 1 115 ? 99.497  88.369  55.108  1.00 67.53  ? 114 THR A CA    1 
ATOM 909   C C     . THR A 1 115 ? 99.140  88.423  53.623  1.00 67.69  ? 114 THR A C     1 
ATOM 910   O O     . THR A 1 115 ? 98.489  89.361  53.161  1.00 70.05  ? 114 THR A O     1 
ATOM 911   C CB    . THR A 1 115 ? 100.807 89.118  55.380  1.00 67.18  ? 114 THR A CB    1 
ATOM 912   O OG1   . THR A 1 115 ? 101.010 89.192  56.797  1.00 67.92  ? 114 THR A OG1   1 
ATOM 913   C CG2   . THR A 1 115 ? 100.769 90.524  54.792  1.00 69.30  ? 114 THR A CG2   1 
ATOM 914   N N     . LEU A 1 116 ? 99.552  87.410  52.874  1.00 69.31  ? 115 LEU A N     1 
ATOM 915   C CA    . LEU A 1 116 ? 99.038  87.253  51.526  1.00 69.32  ? 115 LEU A CA    1 
ATOM 916   C C     . LEU A 1 116 ? 97.592  86.804  51.600  1.00 70.65  ? 115 LEU A C     1 
ATOM 917   O O     . LEU A 1 116 ? 96.710  87.498  51.110  1.00 72.95  ? 115 LEU A O     1 
ATOM 918   C CB    . LEU A 1 116 ? 99.850  86.239  50.732  1.00 67.42  ? 115 LEU A CB    1 
ATOM 919   C CG    . LEU A 1 116 ? 101.223 86.719  50.289  1.00 66.87  ? 115 LEU A CG    1 
ATOM 920   C CD1   . LEU A 1 116 ? 101.821 85.707  49.346  1.00 64.64  ? 115 LEU A CD1   1 
ATOM 921   C CD2   . LEU A 1 116 ? 101.122 88.089  49.633  1.00 68.52  ? 115 LEU A CD2   1 
ATOM 922   N N     . VAL A 1 117 ? 97.346  85.654  52.227  1.00 63.31  ? 116 VAL A N     1 
ATOM 923   C CA    . VAL A 1 117 ? 95.998  85.085  52.249  1.00 64.71  ? 116 VAL A CA    1 
ATOM 924   C C     . VAL A 1 117 ? 94.980  86.109  52.730  1.00 67.15  ? 116 VAL A C     1 
ATOM 925   O O     . VAL A 1 117 ? 93.870  86.188  52.200  1.00 69.41  ? 116 VAL A O     1 
ATOM 926   C CB    . VAL A 1 117 ? 95.910  83.798  53.105  1.00 64.43  ? 116 VAL A CB    1 
ATOM 927   C CG1   . VAL A 1 117 ? 94.482  83.275  53.137  1.00 66.28  ? 116 VAL A CG1   1 
ATOM 928   C CG2   . VAL A 1 117 ? 96.821  82.731  52.548  1.00 63.06  ? 116 VAL A CG2   1 
ATOM 929   N N     . SER A 1 118 ? 95.390  86.933  53.691  1.00 76.10  ? 117 SER A N     1 
ATOM 930   C CA    . SER A 1 118 ? 94.502  87.927  54.282  1.00 80.86  ? 117 SER A CA    1 
ATOM 931   C C     . SER A 1 118 ? 94.108  89.007  53.288  1.00 82.81  ? 117 SER A C     1 
ATOM 932   O O     . SER A 1 118 ? 93.359  89.919  53.624  1.00 87.91  ? 117 SER A O     1 
ATOM 933   C CB    . SER A 1 118 ? 95.153  88.573  55.509  1.00 82.02  ? 117 SER A CB    1 
ATOM 934   O OG    . SER A 1 118 ? 96.085  89.578  55.137  1.00 81.60  ? 117 SER A OG    1 
ATOM 935   N N     . GLN A 1 119 ? 94.619  88.901  52.068  1.00 77.51  ? 118 GLN A N     1 
ATOM 936   C CA    . GLN A 1 119 ? 94.339  89.886  51.038  1.00 79.43  ? 118 GLN A CA    1 
ATOM 937   C C     . GLN A 1 119 ? 93.154  89.528  50.149  1.00 81.51  ? 118 GLN A C     1 
ATOM 938   O O     . GLN A 1 119 ? 92.687  90.374  49.389  1.00 84.32  ? 118 GLN A O     1 
ATOM 939   C CB    . GLN A 1 119 ? 95.567  90.098  50.163  1.00 77.22  ? 118 GLN A CB    1 
ATOM 940   C CG    . GLN A 1 119 ? 96.757  90.617  50.909  1.00 76.42  ? 118 GLN A CG    1 
ATOM 941   C CD    . GLN A 1 119 ? 96.708  92.105  51.070  1.00 80.13  ? 118 GLN A CD    1 
ATOM 942   O OE1   . GLN A 1 119 ? 95.728  92.750  50.691  1.00 83.87  ? 118 GLN A OE1   1 
ATOM 943   N NE2   . GLN A 1 119 ? 97.765  92.671  51.630  1.00 79.79  ? 118 GLN A NE2   1 
ATOM 944   N N     . LEU A 1 120 ? 92.667  88.291  50.224  1.00 64.65  ? 119 LEU A N     1 
ATOM 945   C CA    . LEU A 1 120 ? 91.530  87.901  49.384  1.00 68.68  ? 119 LEU A CA    1 
ATOM 946   C C     . LEU A 1 120 ? 90.432  87.100  50.117  1.00 72.19  ? 119 LEU A C     1 
ATOM 947   O O     . LEU A 1 120 ? 90.626  86.641  51.243  1.00 71.30  ? 119 LEU A O     1 
ATOM 948   C CB    . LEU A 1 120 ? 92.007  87.172  48.114  1.00 70.71  ? 119 LEU A CB    1 
ATOM 949   N N     . SER A 1 121 ? 89.275  86.962  49.472  1.00 70.34  ? 120 SER A N     1 
ATOM 950   C CA    . SER A 1 121 ? 88.202  86.130  49.994  1.00 75.98  ? 120 SER A CA    1 
ATOM 951   C C     . SER A 1 121 ? 88.668  84.681  50.050  1.00 75.38  ? 120 SER A C     1 
ATOM 952   O O     . SER A 1 121 ? 89.600  84.299  49.343  1.00 71.68  ? 120 SER A O     1 
ATOM 953   C CB    . SER A 1 121 ? 86.960  86.235  49.106  1.00 81.69  ? 120 SER A CB    1 
ATOM 954   N N     . GLU A 1 122 ? 88.023  83.878  50.893  1.00 104.45 ? 121 GLU A N     1 
ATOM 955   C CA    . GLU A 1 122 ? 88.313  82.448  50.966  1.00 105.06 ? 121 GLU A CA    1 
ATOM 956   C C     . GLU A 1 122 ? 88.053  81.788  49.613  1.00 107.20 ? 121 GLU A C     1 
ATOM 957   O O     . GLU A 1 122 ? 88.730  80.829  49.235  1.00 106.07 ? 121 GLU A O     1 
ATOM 958   C CB    . GLU A 1 122 ? 87.470  81.776  52.054  1.00 110.06 ? 121 GLU A CB    1 
ATOM 959   N N     . GLU A 1 123 ? 87.070  82.309  48.886  1.00 133.81 ? 122 GLU A N     1 
ATOM 960   C CA    . GLU A 1 123 ? 86.784  81.820  47.548  1.00 136.08 ? 122 GLU A CA    1 
ATOM 961   C C     . GLU A 1 123 ? 87.784  82.423  46.582  1.00 132.03 ? 122 GLU A C     1 
ATOM 962   O O     . GLU A 1 123 ? 88.313  81.732  45.717  1.00 132.06 ? 122 GLU A O     1 
ATOM 963   C CB    . GLU A 1 123 ? 85.359  82.177  47.124  1.00 141.91 ? 122 GLU A CB    1 
ATOM 964   N N     . GLU A 1 124 ? 88.045  83.715  46.733  1.00 121.98 ? 123 GLU A N     1 
ATOM 965   C CA    . GLU A 1 124 ? 89.040  84.373  45.903  1.00 119.85 ? 123 GLU A CA    1 
ATOM 966   C C     . GLU A 1 124 ? 90.390  83.671  46.030  1.00 117.88 ? 123 GLU A C     1 
ATOM 967   O O     . GLU A 1 124 ? 91.061  83.419  45.030  1.00 118.11 ? 123 GLU A O     1 
ATOM 968   C CB    . GLU A 1 124 ? 89.160  85.848  46.271  1.00 115.63 ? 123 GLU A CB    1 
ATOM 969   C CG    . GLU A 1 124 ? 88.036  86.709  45.727  1.00 117.52 ? 123 GLU A CG    1 
ATOM 970   C CD    . GLU A 1 124 ? 88.192  88.172  46.103  1.00 114.99 ? 123 GLU A CD    1 
ATOM 971   O OE1   . GLU A 1 124 ? 88.797  88.454  47.163  1.00 111.62 ? 123 GLU A OE1   1 
ATOM 972   O OE2   . GLU A 1 124 ? 87.712  89.039  45.337  1.00 116.42 ? 123 GLU A OE2   1 
ATOM 973   N N     . ASN A 1 125 ? 90.774  83.348  47.262  1.00 115.10 ? 124 ASN A N     1 
ATOM 974   C CA    . ASN A 1 125 ? 91.976  82.556  47.507  1.00 112.70 ? 124 ASN A CA    1 
ATOM 975   C C     . ASN A 1 125 ? 91.862  81.178  46.872  1.00 114.48 ? 124 ASN A C     1 
ATOM 976   O O     . ASN A 1 125 ? 92.817  80.675  46.283  1.00 113.27 ? 124 ASN A O     1 
ATOM 977   C CB    . ASN A 1 125 ? 92.233  82.388  49.008  1.00 109.93 ? 124 ASN A CB    1 
ATOM 978   C CG    . ASN A 1 125 ? 92.741  83.655  49.666  1.00 106.99 ? 124 ASN A CG    1 
ATOM 979   O OD1   . ASN A 1 125 ? 93.930  83.966  49.612  1.00 104.40 ? 124 ASN A OD1   1 
ATOM 980   N ND2   . ASN A 1 125 ? 91.840  84.386  50.310  1.00 107.30 ? 124 ASN A ND2   1 
ATOM 981   N N     . GLU A 1 126 ? 90.689  80.567  47.006  1.00 102.70 ? 125 GLU A N     1 
ATOM 982   C CA    . GLU A 1 126 ? 90.457  79.248  46.438  1.00 104.57 ? 125 GLU A CA    1 
ATOM 983   C C     . GLU A 1 126 ? 90.711  79.271  44.933  1.00 105.67 ? 125 GLU A C     1 
ATOM 984   O O     . GLU A 1 126 ? 91.345  78.368  44.396  1.00 105.15 ? 125 GLU A O     1 
ATOM 985   C CB    . GLU A 1 126 ? 89.038  78.760  46.746  1.00 109.08 ? 125 GLU A CB    1 
ATOM 986   N N     . GLN A 1 127 ? 90.235  80.317  44.263  1.00 102.74 ? 126 GLN A N     1 
ATOM 987   C CA    . GLN A 1 127 ? 90.448  80.462  42.826  1.00 104.11 ? 126 GLN A CA    1 
ATOM 988   C C     . GLN A 1 127 ? 91.922  80.697  42.546  1.00 101.63 ? 126 GLN A C     1 
ATOM 989   O O     . GLN A 1 127 ? 92.534  80.017  41.719  1.00 101.43 ? 126 GLN A O     1 
ATOM 990   C CB    . GLN A 1 127 ? 89.639  81.640  42.266  1.00 105.59 ? 126 GLN A CB    1 
ATOM 991   C CG    . GLN A 1 127 ? 88.153  81.625  42.588  1.00 108.54 ? 126 GLN A CG    1 
ATOM 992   C CD    . GLN A 1 127 ? 87.401  80.529  41.866  1.00 112.72 ? 126 GLN A CD    1 
ATOM 993   O OE1   . GLN A 1 127 ? 87.984  79.744  41.116  1.00 112.35 ? 126 GLN A OE1   1 
ATOM 994   N NE2   . GLN A 1 127 ? 86.091  80.471  42.086  1.00 117.53 ? 126 GLN A NE2   1 
ATOM 995   N N     . MET A 1 128 ? 92.468  81.681  43.248  0.89 84.53  ? 127 MET A N     1 
ATOM 996   C CA    . MET A 1 128 ? 93.858  82.081  43.120  1.00 81.85  ? 127 MET A CA    1 
ATOM 997   C C     . MET A 1 128 ? 94.811  80.895  43.110  1.00 80.45  ? 127 MET A C     1 
ATOM 998   O O     . MET A 1 128 ? 95.452  80.614  42.096  1.00 80.70  ? 127 MET A O     1 
ATOM 999   C CB    . MET A 1 128 ? 94.231  82.996  44.282  1.00 79.29  ? 127 MET A CB    1 
ATOM 1000  C CG    . MET A 1 128 ? 95.588  83.631  44.136  1.00 77.10  ? 127 MET A CG    1 
ATOM 1001  S SD    . MET A 1 128 ? 95.636  84.582  42.620  1.00 77.60  ? 127 MET A SD    1 
ATOM 1002  C CE    . MET A 1 128 ? 96.652  85.962  43.123  1.00 72.69  ? 127 MET A CE    1 
ATOM 1003  N N     . LYS A 1 129 ? 94.893  80.208  44.246  1.00 76.37  ? 128 LYS A N     1 
ATOM 1004  C CA    . LYS A 1 129 ? 95.793  79.074  44.406  1.00 73.90  ? 128 LYS A CA    1 
ATOM 1005  C C     . LYS A 1 129 ? 95.511  77.983  43.375  1.00 76.13  ? 128 LYS A C     1 
ATOM 1006  O O     . LYS A 1 129 ? 96.430  77.296  42.930  1.00 74.69  ? 128 LYS A O     1 
ATOM 1007  C CB    . LYS A 1 129 ? 95.700  78.509  45.832  1.00 71.30  ? 128 LYS A CB    1 
ATOM 1008  N N     . ALA A 1 130 ? 94.243  77.846  42.989  1.00 98.64  ? 129 ALA A N     1 
ATOM 1009  C CA    . ALA A 1 130 ? 93.828  76.851  41.996  1.00 100.76 ? 129 ALA A CA    1 
ATOM 1010  C C     . ALA A 1 130 ? 94.356  77.158  40.602  1.00 101.40 ? 129 ALA A C     1 
ATOM 1011  O O     . ALA A 1 130 ? 94.949  76.293  39.954  1.00 101.01 ? 129 ALA A O     1 
ATOM 1012  C CB    . ALA A 1 130 ? 92.322  76.736  41.959  1.00 104.12 ? 129 ALA A CB    1 
ATOM 1013  N N     . ASN A 1 131 ? 94.124  78.385  40.140  1.00 100.15 ? 130 ASN A N     1 
ATOM 1014  C CA    . ASN A 1 131 ? 94.655  78.829  38.850  1.00 100.16 ? 130 ASN A CA    1 
ATOM 1015  C C     . ASN A 1 131 ? 96.178  78.749  38.791  1.00 97.40  ? 130 ASN A C     1 
ATOM 1016  O O     . ASN A 1 131 ? 96.748  78.319  37.785  1.00 97.26  ? 130 ASN A O     1 
ATOM 1017  C CB    . ASN A 1 131 ? 94.216  80.261  38.528  1.00 100.81 ? 130 ASN A CB    1 
ATOM 1018  C CG    . ASN A 1 131 ? 92.718  80.392  38.351  1.00 103.52 ? 130 ASN A CG    1 
ATOM 1019  O OD1   . ASN A 1 131 ? 92.186  81.502  38.324  1.00 103.65 ? 130 ASN A OD1   1 
ATOM 1020  N ND2   . ASN A 1 131 ? 92.029  79.262  38.229  1.00 105.21 ? 130 ASN A ND2   1 
ATOM 1021  N N     . LEU A 1 132 ? 96.827  79.175  39.873  1.00 81.16  ? 131 LEU A N     1 
ATOM 1022  C CA    . LEU A 1 132 ? 98.282  79.156  39.959  1.00 78.22  ? 131 LEU A CA    1 
ATOM 1023  C C     . LEU A 1 132 ? 98.847  77.759  39.746  1.00 76.98  ? 131 LEU A C     1 
ATOM 1024  O O     . LEU A 1 132 ? 99.844  77.598  39.046  1.00 75.89  ? 131 LEU A O     1 
ATOM 1025  C CB    . LEU A 1 132 ? 98.769  79.713  41.298  1.00 75.59  ? 131 LEU A CB    1 
ATOM 1026  C CG    . LEU A 1 132 ? 98.732  81.227  41.511  1.00 76.47  ? 131 LEU A CG    1 
ATOM 1027  C CD1   . LEU A 1 132 ? 99.301  81.562  42.878  1.00 73.21  ? 131 LEU A CD1   1 
ATOM 1028  C CD2   . LEU A 1 132 ? 99.493  81.964  40.430  1.00 76.60  ? 131 LEU A CD2   1 
ATOM 1029  N N     . THR A 1 133 ? 98.217  76.751  40.344  1.00 79.21  ? 132 THR A N     1 
ATOM 1030  C CA    . THR A 1 133 ? 98.684  75.375  40.181  1.00 77.96  ? 132 THR A CA    1 
ATOM 1031  C C     . THR A 1 133 ? 98.684  74.989  38.707  1.00 79.89  ? 132 THR A C     1 
ATOM 1032  O O     . THR A 1 133 ? 99.635  74.376  38.211  1.00 78.51  ? 132 THR A O     1 
ATOM 1033  C CB    . THR A 1 133 ? 97.815  74.372  40.962  1.00 78.32  ? 132 THR A CB    1 
ATOM 1034  O OG1   . THR A 1 133 ? 97.707  74.791  42.325  1.00 76.64  ? 132 THR A OG1   1 
ATOM 1035  C CG2   . THR A 1 133 ? 98.435  72.983  40.918  1.00 77.60  ? 132 THR A CG2   1 
ATOM 1036  N N     . LYS A 1 134 ? 97.613  75.370  38.016  1.00 83.07  ? 133 LYS A N     1 
ATOM 1037  C CA    . LYS A 1 134 ? 97.459  75.069  36.603  1.00 84.78  ? 133 LYS A CA    1 
ATOM 1038  C C     . LYS A 1 134 ? 98.538  75.772  35.794  1.00 83.59  ? 133 LYS A C     1 
ATOM 1039  O O     . LYS A 1 134 ? 99.195  75.155  34.964  1.00 83.15  ? 133 LYS A O     1 
ATOM 1040  C CB    . LYS A 1 134 ? 96.066  75.471  36.114  1.00 87.75  ? 133 LYS A CB    1 
ATOM 1041  N N     . MET A 1 135 ? 98.727  77.062  36.047  1.00 72.04  ? 134 MET A N     1 
ATOM 1042  C CA    . MET A 1 135 ? 99.750  77.831  35.342  0.77 70.40  ? 134 MET A CA    1 
ATOM 1043  C C     . MET A 1 135 ? 101.142 77.265  35.603  1.00 67.77  ? 134 MET A C     1 
ATOM 1044  O O     . MET A 1 135 ? 101.978 77.204  34.701  0.32 68.34  ? 134 MET A O     1 
ATOM 1045  C CB    . MET A 1 135 ? 99.689  79.304  35.740  1.00 69.57  ? 134 MET A CB    1 
ATOM 1046  C CG    . MET A 1 135 ? 98.367  79.965  35.403  1.00 71.63  ? 134 MET A CG    1 
ATOM 1047  S SD    . MET A 1 135 ? 98.384  81.747  35.681  1.00 70.00  ? 134 MET A SD    1 
ATOM 1048  C CE    . MET A 1 135 ? 98.753  82.341  34.041  1.00 68.58  ? 134 MET A CE    1 
ATOM 1049  N N     . LEU A 1 136 ? 101.377 76.855  36.847  1.00 72.35  ? 135 LEU A N     1 
ATOM 1050  C CA    . LEU A 1 136 ? 102.602 76.158  37.217  1.00 69.20  ? 135 LEU A CA    1 
ATOM 1051  C C     . LEU A 1 136 ? 102.716 74.897  36.356  1.00 70.23  ? 135 LEU A C     1 
ATOM 1052  O O     . LEU A 1 136 ? 103.689 74.736  35.613  1.00 69.64  ? 135 LEU A O     1 
ATOM 1053  C CB    . LEU A 1 136 ? 102.614 75.835  38.724  1.00 66.82  ? 135 LEU A CB    1 
ATOM 1054  C CG    . LEU A 1 136 ? 103.900 75.407  39.455  1.00 63.18  ? 135 LEU A CG    1 
ATOM 1055  C CD1   . LEU A 1 136 ? 104.129 73.913  39.390  1.00 63.00  ? 135 LEU A CD1   1 
ATOM 1056  C CD2   . LEU A 1 136 ? 105.127 76.117  38.921  1.00 61.24  ? 135 LEU A CD2   1 
ATOM 1057  N N     . SER A 1 137 ? 101.704 74.033  36.433  1.00 79.12  ? 136 SER A N     1 
ATOM 1058  C CA    . SER A 1 137 ? 101.670 72.795  35.656  1.00 81.75  ? 136 SER A CA    1 
ATOM 1059  C C     . SER A 1 137 ? 102.025 73.030  34.188  1.00 83.34  ? 136 SER A C     1 
ATOM 1060  O O     . SER A 1 137 ? 102.899 72.361  33.640  1.00 83.78  ? 136 SER A O     1 
ATOM 1061  C CB    . SER A 1 137 ? 100.293 72.131  35.755  1.00 84.64  ? 136 SER A CB    1 
ATOM 1062  N N     . SER A 1 138 ? 101.365 74.009  33.575  1.00 87.25  ? 137 SER A N     1 
ATOM 1063  C CA    . SER A 1 138 ? 101.540 74.310  32.156  1.00 89.18  ? 137 SER A CA    1 
ATOM 1064  C C     . SER A 1 138 ? 102.984 74.649  31.775  1.00 87.20  ? 137 SER A C     1 
ATOM 1065  O O     . SER A 1 138 ? 103.349 74.601  30.597  1.00 88.97  ? 137 SER A O     1 
ATOM 1066  C CB    . SER A 1 138 ? 100.602 75.443  31.732  1.00 90.18  ? 137 SER A CB    1 
ATOM 1067  O OG    . SER A 1 138 ? 100.887 76.646  32.423  1.00 87.32  ? 137 SER A OG    1 
ATOM 1068  N N     . LEU A 1 139 ? 103.800 74.990  32.772  1.00 82.08  ? 138 LEU A N     1 
ATOM 1069  C CA    . LEU A 1 139 ? 105.216 75.271  32.542  1.00 80.09  ? 138 LEU A CA    1 
ATOM 1070  C C     . LEU A 1 139 ? 106.073 74.060  32.906  1.00 79.68  ? 138 LEU A C     1 
ATOM 1071  O O     . LEU A 1 139 ? 107.266 74.198  33.207  1.00 77.64  ? 138 LEU A O     1 
ATOM 1072  C CB    . LEU A 1 139 ? 105.664 76.483  33.355  1.00 76.74  ? 138 LEU A CB    1 
ATOM 1073  C CG    . LEU A 1 139 ? 104.823 77.747  33.217  1.00 76.89  ? 138 LEU A CG    1 
ATOM 1074  C CD1   . LEU A 1 139 ? 105.517 78.896  33.881  1.00 74.52  ? 138 LEU A CD1   1 
ATOM 1075  C CD2   . LEU A 1 139 ? 104.565 78.060  31.774  1.00 79.15  ? 138 LEU A CD2   1 
ATOM 1076  N N     . GLN A 1 140 ? 105.448 72.881  32.869  1.00 73.03  ? 139 GLN A N     1 
ATOM 1077  C CA    . GLN A 1 140 ? 106.086 71.616  33.236  1.00 73.89  ? 139 GLN A CA    1 
ATOM 1078  C C     . GLN A 1 140 ? 106.573 71.633  34.690  1.00 70.28  ? 139 GLN A C     1 
ATOM 1079  O O     . GLN A 1 140 ? 105.968 72.269  35.563  1.00 67.84  ? 139 GLN A O     1 
ATOM 1080  C CB    . GLN A 1 140 ? 107.224 71.261  32.265  1.00 75.84  ? 139 GLN A CB    1 
ATOM 1081  N N     . GLU B 1 3   ? 96.960  72.702  45.939  1.00 112.25 ? 2   GLU B N     1 
ATOM 1082  C CA    . GLU B 1 3   ? 96.687  73.287  47.248  1.00 112.61 ? 2   GLU B CA    1 
ATOM 1083  C C     . GLU B 1 3   ? 97.973  73.501  48.039  1.00 111.74 ? 2   GLU B C     1 
ATOM 1084  O O     . GLU B 1 3   ? 98.253  72.776  48.993  1.00 113.54 ? 2   GLU B O     1 
ATOM 1085  C CB    . GLU B 1 3   ? 95.717  72.406  48.045  1.00 115.58 ? 2   GLU B CB    1 
ATOM 1086  N N     . PHE B 1 4   ? 98.749  74.505  47.643  1.00 88.37  ? 3   PHE B N     1 
ATOM 1087  C CA    . PHE B 1 4   ? 100.027 74.781  48.288  1.00 86.94  ? 3   PHE B CA    1 
ATOM 1088  C C     . PHE B 1 4   ? 100.239 76.166  48.868  1.00 84.57  ? 3   PHE B C     1 
ATOM 1089  O O     . PHE B 1 4   ? 99.363  77.024  48.804  1.00 84.11  ? 3   PHE B O     1 
ATOM 1090  C CB    . PHE B 1 4   ? 101.183 74.563  47.311  1.00 85.63  ? 3   PHE B CB    1 
ATOM 1091  C CG    . PHE B 1 4   ? 101.631 73.143  47.221  1.00 88.31  ? 3   PHE B CG    1 
ATOM 1092  C CD1   . PHE B 1 4   ? 102.270 72.541  48.294  1.00 90.10  ? 3   PHE B CD1   1 
ATOM 1093  C CD2   . PHE B 1 4   ? 101.419 72.407  46.073  1.00 89.23  ? 3   PHE B CD2   1 
ATOM 1094  C CE1   . PHE B 1 4   ? 102.686 71.223  48.223  1.00 93.05  ? 3   PHE B CE1   1 
ATOM 1095  C CE2   . PHE B 1 4   ? 101.835 71.092  45.994  1.00 92.13  ? 3   PHE B CE2   1 
ATOM 1096  C CZ    . PHE B 1 4   ? 102.468 70.498  47.072  1.00 94.16  ? 3   PHE B CZ    1 
ATOM 1097  N N     . THR B 1 5   ? 101.417 76.370  49.438  1.00 82.66  ? 4   THR B N     1 
ATOM 1098  C CA    . THR B 1 5   ? 101.806 77.691  49.919  1.00 79.86  ? 4   THR B CA    1 
ATOM 1099  C C     . THR B 1 5   ? 102.074 78.698  48.814  1.00 77.36  ? 4   THR B C     1 
ATOM 1100  O O     . THR B 1 5   ? 102.512 78.320  47.732  1.00 77.06  ? 4   THR B O     1 
ATOM 1101  C CB    . THR B 1 5   ? 103.094 77.580  50.717  1.00 79.69  ? 4   THR B CB    1 
ATOM 1102  O OG1   . THR B 1 5   ? 102.886 76.680  51.808  1.00 82.06  ? 4   THR B OG1   1 
ATOM 1103  C CG2   . THR B 1 5   ? 103.485 78.945  51.271  1.00 79.84  ? 4   THR B CG2   1 
ATOM 1104  N N     . TYR B 1 6   ? 101.811 79.974  49.065  1.00 73.73  ? 5   TYR B N     1 
ATOM 1105  C CA    . TYR B 1 6   ? 102.031 80.998  48.040  1.00 71.07  ? 5   TYR B CA    1 
ATOM 1106  C C     . TYR B 1 6   ? 103.539 81.125  47.813  1.00 68.60  ? 5   TYR B C     1 
ATOM 1107  O O     . TYR B 1 6   ? 103.969 81.419  46.698  1.00 66.43  ? 5   TYR B O     1 
ATOM 1108  C CB    . TYR B 1 6   ? 101.444 82.372  48.350  1.00 69.95  ? 5   TYR B CB    1 
ATOM 1109  C CG    . TYR B 1 6   ? 99.977  82.496  48.035  1.00 72.18  ? 5   TYR B CG    1 
ATOM 1110  C CD1   . TYR B 1 6   ? 99.450  81.966  46.868  1.00 72.61  ? 5   TYR B CD1   1 
ATOM 1111  C CD2   . TYR B 1 6   ? 99.115  83.137  48.909  1.00 73.55  ? 5   TYR B CD2   1 
ATOM 1112  C CE1   . TYR B 1 6   ? 98.105  82.073  46.579  1.00 74.24  ? 5   TYR B CE1   1 
ATOM 1113  C CE2   . TYR B 1 6   ? 97.770  83.246  48.629  1.00 75.34  ? 5   TYR B CE2   1 
ATOM 1114  C CZ    . TYR B 1 6   ? 97.274  82.714  47.461  1.00 75.61  ? 5   TYR B CZ    1 
ATOM 1115  O OH    . TYR B 1 6   ? 95.933  82.826  47.185  1.00 77.44  ? 5   TYR B OH    1 
ATOM 1116  N N     . SER B 1 7   ? 104.327 80.929  48.873  1.00 66.20  ? 6   SER B N     1 
ATOM 1117  C CA    . SER B 1 7   ? 105.781 80.953  48.772  1.00 64.25  ? 6   SER B CA    1 
ATOM 1118  C C     . SER B 1 7   ? 106.190 79.985  47.683  1.00 65.01  ? 6   SER B C     1 
ATOM 1119  O O     . SER B 1 7   ? 106.891 80.346  46.741  1.00 62.69  ? 6   SER B O     1 
ATOM 1120  C CB    . SER B 1 7   ? 106.426 80.524  50.086  1.00 65.34  ? 6   SER B CB    1 
ATOM 1121  N N     . TYR B 1 8   ? 105.718 78.753  47.815  1.00 55.60  ? 7   TYR B N     1 
ATOM 1122  C CA    . TYR B 1 8   ? 106.014 77.699  46.860  1.00 56.09  ? 7   TYR B CA    1 
ATOM 1123  C C     . TYR B 1 8   ? 105.600 78.099  45.462  1.00 54.49  ? 7   TYR B C     1 
ATOM 1124  O O     . TYR B 1 8   ? 106.417 78.129  44.546  1.00 52.92  ? 7   TYR B O     1 
ATOM 1125  C CB    . TYR B 1 8   ? 105.243 76.451  47.250  1.00 59.83  ? 7   TYR B CB    1 
ATOM 1126  C CG    . TYR B 1 8   ? 105.527 75.269  46.381  1.00 61.48  ? 7   TYR B CG    1 
ATOM 1127  C CD1   . TYR B 1 8   ? 104.571 74.787  45.499  1.00 62.20  ? 7   TYR B CD1   1 
ATOM 1128  C CD2   . TYR B 1 8   ? 106.758 74.630  46.438  1.00 62.59  ? 7   TYR B CD2   1 
ATOM 1129  C CE1   . TYR B 1 8   ? 104.835 73.692  44.700  1.00 63.50  ? 7   TYR B CE1   1 
ATOM 1130  C CE2   . TYR B 1 8   ? 107.030 73.545  45.646  1.00 64.36  ? 7   TYR B CE2   1 
ATOM 1131  C CZ    . TYR B 1 8   ? 106.068 73.075  44.780  1.00 64.58  ? 7   TYR B CZ    1 
ATOM 1132  O OH    . TYR B 1 8   ? 106.346 71.981  43.996  1.00 66.08  ? 7   TYR B OH    1 
ATOM 1133  N N     . LEU B 1 9   ? 104.318 78.413  45.317  1.00 57.85  ? 8   LEU B N     1 
ATOM 1134  C CA    . LEU B 1 9   ? 103.716 78.705  44.019  1.00 56.25  ? 8   LEU B CA    1 
ATOM 1135  C C     . LEU B 1 9   ? 104.441 79.799  43.233  1.00 52.57  ? 8   LEU B C     1 
ATOM 1136  O O     . LEU B 1 9   ? 104.993 79.523  42.163  1.00 51.15  ? 8   LEU B O     1 
ATOM 1137  C CB    . LEU B 1 9   ? 102.233 79.051  44.188  1.00 57.35  ? 8   LEU B CB    1 
ATOM 1138  C CG    . LEU B 1 9   ? 101.362 77.851  44.566  1.00 60.78  ? 8   LEU B CG    1 
ATOM 1139  C CD1   . LEU B 1 9   ? 99.903  78.245  44.671  1.00 62.43  ? 8   LEU B CD1   1 
ATOM 1140  C CD2   . LEU B 1 9   ? 101.544 76.745  43.547  1.00 61.33  ? 8   LEU B CD2   1 
ATOM 1141  N N     . PHE B 1 10  ? 104.432 81.025  43.765  1.00 55.66  ? 9   PHE B N     1 
ATOM 1142  C CA    . PHE B 1 10  ? 105.117 82.158  43.134  1.00 52.43  ? 9   PHE B CA    1 
ATOM 1143  C C     . PHE B 1 10  ? 106.597 81.871  42.892  1.00 50.72  ? 9   PHE B C     1 
ATOM 1144  O O     . PHE B 1 10  ? 107.140 82.266  41.865  1.00 48.73  ? 9   PHE B O     1 
ATOM 1145  C CB    . PHE B 1 10  ? 105.001 83.425  43.981  1.00 51.64  ? 9   PHE B CB    1 
ATOM 1146  C CG    . PHE B 1 10  ? 103.602 83.957  44.116  1.00 53.54  ? 9   PHE B CG    1 
ATOM 1147  C CD1   . PHE B 1 10  ? 102.710 83.901  43.058  1.00 54.24  ? 9   PHE B CD1   1 
ATOM 1148  C CD2   . PHE B 1 10  ? 103.183 84.530  45.308  1.00 55.01  ? 9   PHE B CD2   1 
ATOM 1149  C CE1   . PHE B 1 10  ? 101.420 84.400  43.196  1.00 56.40  ? 9   PHE B CE1   1 
ATOM 1150  C CE2   . PHE B 1 10  ? 101.901 85.025  45.442  1.00 57.11  ? 9   PHE B CE2   1 
ATOM 1151  C CZ    . PHE B 1 10  ? 101.021 84.960  44.394  1.00 57.80  ? 9   PHE B CZ    1 
ATOM 1152  N N     . ARG B 1 11  ? 107.250 81.196  43.838  1.00 59.87  ? 10  ARG B N     1 
ATOM 1153  C CA    . ARG B 1 11  ? 108.644 80.808  43.651  1.00 59.37  ? 10  ARG B CA    1 
ATOM 1154  C C     . ARG B 1 11  ? 108.812 79.874  42.453  1.00 60.13  ? 10  ARG B C     1 
ATOM 1155  O O     . ARG B 1 11  ? 109.563 80.184  41.535  1.00 58.37  ? 10  ARG B O     1 
ATOM 1156  C CB    . ARG B 1 11  ? 109.250 80.192  44.923  1.00 61.47  ? 10  ARG B CB    1 
ATOM 1157  C CG    . ARG B 1 11  ? 110.684 79.710  44.746  1.00 61.91  ? 10  ARG B CG    1 
ATOM 1158  C CD    . ARG B 1 11  ? 111.391 79.347  46.050  1.00 63.99  ? 10  ARG B CD    1 
ATOM 1159  N NE    . ARG B 1 11  ? 110.777 78.268  46.830  1.00 68.25  ? 10  ARG B NE    1 
ATOM 1160  C CZ    . ARG B 1 11  ? 109.970 78.473  47.876  1.00 69.11  ? 10  ARG B CZ    1 
ATOM 1161  N NH1   . ARG B 1 11  ? 109.662 79.717  48.228  1.00 66.63  ? 10  ARG B NH1   1 
ATOM 1162  N NH2   . ARG B 1 11  ? 109.458 77.452  48.570  1.00 72.65  ? 10  ARG B NH2   1 
ATOM 1163  N N     . MET B 1 12  ? 108.107 78.749  42.453  1.00 49.30  ? 11  MET B N     1 
ATOM 1164  C CA    . MET B 1 12  ? 108.202 77.791  41.354  1.00 50.11  ? 11  MET B CA    1 
ATOM 1165  C C     . MET B 1 12  ? 107.903 78.392  39.974  0.91 47.22  ? 11  MET B C     1 
ATOM 1166  O O     . MET B 1 12  ? 108.721 78.316  39.057  0.43 45.99  ? 11  MET B O     1 
ATOM 1167  C CB    . MET B 1 12  ? 107.276 76.601  41.611  1.00 53.41  ? 11  MET B CB    1 
ATOM 1168  C CG    . MET B 1 12  ? 107.656 75.767  42.816  1.00 56.62  ? 11  MET B CG    1 
ATOM 1169  S SD    . MET B 1 12  ? 109.341 75.148  42.695  1.00 57.42  ? 11  MET B SD    1 
ATOM 1170  C CE    . MET B 1 12  ? 110.273 76.278  43.741  1.00 56.14  ? 11  MET B CE    1 
ATOM 1171  N N     . ILE B 1 13  ? 106.718 78.977  39.845  1.00 51.45  ? 12  ILE B N     1 
ATOM 1172  C CA    . ILE B 1 13  ? 106.254 79.554  38.590  1.00 49.58  ? 12  ILE B CA    1 
ATOM 1173  C C     . ILE B 1 13  ? 107.255 80.547  38.045  1.00 46.94  ? 12  ILE B C     1 
ATOM 1174  O O     . ILE B 1 13  ? 107.619 80.486  36.871  1.00 45.77  ? 12  ILE B O     1 
ATOM 1175  C CB    . ILE B 1 13  ? 104.890 80.260  38.757  1.00 50.38  ? 12  ILE B CB    1 
ATOM 1176  C CG1   . ILE B 1 13  ? 103.753 79.244  38.716  1.00 53.21  ? 12  ILE B CG1   1 
ATOM 1177  C CG2   . ILE B 1 13  ? 104.670 81.294  37.665  1.00 48.92  ? 12  ILE B CG2   1 
ATOM 1178  C CD1   . ILE B 1 13  ? 102.397 79.870  38.686  1.00 54.87  ? 12  ILE B CD1   1 
ATOM 1179  N N     . SER B 1 14  ? 107.699 81.460  38.898  1.00 50.68  ? 13  SER B N     1 
ATOM 1180  C CA    . SER B 1 14  ? 108.680 82.458  38.495  1.00 48.36  ? 13  SER B CA    1 
ATOM 1181  C C     . SER B 1 14  ? 109.953 81.802  37.944  1.00 48.04  ? 13  SER B C     1 
ATOM 1182  O O     . SER B 1 14  ? 110.449 82.163  36.872  1.00 46.65  ? 13  SER B O     1 
ATOM 1183  C CB    . SER B 1 14  ? 109.016 83.356  39.684  1.00 47.82  ? 13  SER B CB    1 
ATOM 1184  O OG    . SER B 1 14  ? 110.001 84.310  39.347  1.00 45.82  ? 13  SER B OG    1 
ATOM 1185  N N     . HIS B 1 15  ? 110.462 80.824  38.685  1.00 47.73  ? 14  HIS B N     1 
ATOM 1186  C CA    . HIS B 1 15  ? 111.689 80.138  38.319  1.00 48.75  ? 14  HIS B CA    1 
ATOM 1187  C C     . HIS B 1 15  ? 111.529 79.399  36.990  1.00 49.30  ? 14  HIS B C     1 
ATOM 1188  O O     . HIS B 1 15  ? 112.403 79.450  36.118  1.00 49.01  ? 14  HIS B O     1 
ATOM 1189  C CB    . HIS B 1 15  ? 112.101 79.176  39.436  1.00 51.88  ? 14  HIS B CB    1 
ATOM 1190  C CG    . HIS B 1 15  ? 113.407 78.482  39.197  1.00 53.88  ? 14  HIS B CG    1 
ATOM 1191  N ND1   . HIS B 1 15  ? 114.619 79.136  39.251  1.00 52.10  ? 14  HIS B ND1   1 
ATOM 1192  C CD2   . HIS B 1 15  ? 113.690 77.185  38.926  1.00 57.69  ? 14  HIS B CD2   1 
ATOM 1193  C CE1   . HIS B 1 15  ? 115.591 78.272  39.015  1.00 54.72  ? 14  HIS B CE1   1 
ATOM 1194  N NE2   . HIS B 1 15  ? 115.054 77.082  38.819  1.00 58.59  ? 14  HIS B NE2   1 
ATOM 1195  N N     . GLU B 1 16  ? 110.406 78.722  36.815  1.00 53.32  ? 15  GLU B N     1 
ATOM 1196  C CA    . GLU B 1 16  ? 110.224 78.025  35.565  1.00 53.26  ? 15  GLU B CA    1 
ATOM 1197  C C     . GLU B 1 16  ? 110.033 78.972  34.374  1.00 50.89  ? 15  GLU B C     1 
ATOM 1198  O O     . GLU B 1 16  ? 110.326 78.605  33.238  1.00 50.81  ? 15  GLU B O     1 
ATOM 1199  C CB    . GLU B 1 16  ? 109.126 76.976  35.675  1.00 54.59  ? 15  GLU B CB    1 
ATOM 1200  C CG    . GLU B 1 16  ? 109.468 75.892  36.689  1.00 57.76  ? 15  GLU B CG    1 
ATOM 1201  C CD    . GLU B 1 16  ? 110.881 75.320  36.518  1.00 59.63  ? 15  GLU B CD    1 
ATOM 1202  O OE1   . GLU B 1 16  ? 111.313 75.088  35.365  1.00 58.79  ? 15  GLU B OE1   1 
ATOM 1203  O OE2   . GLU B 1 16  ? 111.563 75.087  37.543  1.00 62.15  ? 15  GLU B OE2   1 
ATOM 1204  N N     . MET B 1 17  ? 109.586 80.198  34.619  1.00 43.70  ? 16  MET B N     1 
ATOM 1205  C CA    . MET B 1 17  ? 109.514 81.168  33.528  1.00 43.44  ? 16  MET B CA    1 
ATOM 1206  C C     . MET B 1 17  ? 110.887 81.695  33.165  1.00 43.06  ? 16  MET B C     1 
ATOM 1207  O O     . MET B 1 17  ? 111.174 81.913  31.987  0.60 43.54  ? 16  MET B O     1 
ATOM 1208  C CB    . MET B 1 17  ? 108.588 82.327  33.854  1.00 43.42  ? 16  MET B CB    1 
ATOM 1209  C CG    . MET B 1 17  ? 107.141 81.923  33.985  1.00 44.35  ? 16  MET B CG    1 
ATOM 1210  S SD    . MET B 1 17  ? 105.986 83.293  33.765  1.00 45.13  ? 16  MET B SD    1 
ATOM 1211  C CE    . MET B 1 17  ? 105.949 83.436  31.973  1.00 45.92  ? 16  MET B CE    1 
ATOM 1212  N N     . LYS B 1 18  ? 111.739 81.904  34.172  1.00 44.34  ? 17  LYS B N     1 
ATOM 1213  C CA    . LYS B 1 18  ? 113.118 82.260  33.885  1.00 44.00  ? 17  LYS B CA    1 
ATOM 1214  C C     . LYS B 1 18  ? 113.758 81.115  33.119  1.00 46.07  ? 17  LYS B C     1 
ATOM 1215  O O     . LYS B 1 18  ? 114.526 81.321  32.185  1.00 46.34  ? 17  LYS B O     1 
ATOM 1216  C CB    . LYS B 1 18  ? 113.911 82.543  35.148  1.00 43.97  ? 17  LYS B CB    1 
ATOM 1217  C CG    . LYS B 1 18  ? 115.413 82.392  34.922  1.00 44.84  ? 17  LYS B CG    1 
ATOM 1218  C CD    . LYS B 1 18  ? 116.266 83.271  35.827  1.00 44.25  ? 17  LYS B CD    1 
ATOM 1219  C CE    . LYS B 1 18  ? 117.758 83.188  35.462  1.00 45.37  ? 17  LYS B CE    1 
ATOM 1220  N NZ    . LYS B 1 18  ? 118.134 83.861  34.165  1.00 45.65  ? 17  LYS B NZ    1 
ATOM 1221  N N     . GLN B 1 19  ? 113.403 79.897  33.500  1.00 44.53  ? 18  GLN B N     1 
ATOM 1222  C CA    . GLN B 1 19  ? 114.012 78.721  32.911  1.00 47.72  ? 18  GLN B CA    1 
ATOM 1223  C C     . GLN B 1 19  ? 113.587 78.470  31.474  1.00 47.70  ? 18  GLN B C     1 
ATOM 1224  O O     . GLN B 1 19  ? 114.446 78.367  30.590  1.00 49.05  ? 18  GLN B O     1 
ATOM 1225  C CB    . GLN B 1 19  ? 113.761 77.503  33.797  1.00 50.05  ? 18  GLN B CB    1 
ATOM 1226  C CG    . GLN B 1 19  ? 114.668 77.515  35.021  1.00 51.45  ? 18  GLN B CG    1 
ATOM 1227  C CD    . GLN B 1 19  ? 116.123 77.608  34.611  1.00 51.39  ? 18  GLN B CD    1 
ATOM 1228  O OE1   . GLN B 1 19  ? 116.707 76.620  34.137  1.00 53.35  ? 18  GLN B OE1   1 
ATOM 1229  N NE2   . GLN B 1 19  ? 116.711 78.804  34.750  1.00 48.87  ? 18  GLN B NE2   1 
ATOM 1230  N N     . LYS B 1 20  ? 112.271 78.373  31.245  1.00 58.96  ? 19  LYS B N     1 
ATOM 1231  C CA    . LYS B 1 20  ? 111.733 78.151  29.902  1.00 58.14  ? 19  LYS B CA    1 
ATOM 1232  C C     . LYS B 1 20  ? 112.224 79.249  28.990  1.00 57.59  ? 19  LYS B C     1 
ATOM 1233  O O     . LYS B 1 20  ? 112.692 78.986  27.899  1.00 58.50  ? 19  LYS B O     1 
ATOM 1234  C CB    . LYS B 1 20  ? 110.200 78.110  29.897  1.00 57.46  ? 19  LYS B CB    1 
ATOM 1235  C CG    . LYS B 1 20  ? 109.584 76.833  30.480  1.00 58.53  ? 19  LYS B CG    1 
ATOM 1236  C CD    . LYS B 1 20  ? 108.580 76.193  29.524  1.00 58.35  ? 19  LYS B CD    1 
ATOM 1237  C CE    . LYS B 1 20  ? 109.286 75.663  28.267  1.00 58.57  ? 19  LYS B CE    1 
ATOM 1238  N NZ    . LYS B 1 20  ? 108.354 75.073  27.236  1.00 58.48  ? 19  LYS B NZ    1 
ATOM 1239  N N     . ALA B 1 21  ? 112.148 80.486  29.459  1.00 45.88  ? 20  ALA B N     1 
ATOM 1240  C CA    . ALA B 1 21  ? 112.567 81.624  28.649  1.00 46.24  ? 20  ALA B CA    1 
ATOM 1241  C C     . ALA B 1 21  ? 114.071 81.692  28.411  1.00 46.77  ? 20  ALA B C     1 
ATOM 1242  O O     . ALA B 1 21  ? 114.497 82.219  27.382  1.00 47.89  ? 20  ALA B O     1 
ATOM 1243  C CB    . ALA B 1 21  ? 112.078 82.917  29.254  1.00 45.29  ? 20  ALA B CB    1 
ATOM 1244  N N     . ASP B 1 22  ? 114.872 81.193  29.358  1.00 46.32  ? 21  ASP B N     1 
ATOM 1245  C CA    . ASP B 1 22  ? 116.318 81.145  29.171  1.00 47.82  ? 21  ASP B CA    1 
ATOM 1246  C C     . ASP B 1 22  ? 116.662 80.234  27.997  1.00 50.82  ? 21  ASP B C     1 
ATOM 1247  O O     . ASP B 1 22  ? 117.504 80.578  27.173  1.00 52.16  ? 21  ASP B O     1 
ATOM 1248  C CB    . ASP B 1 22  ? 117.050 80.684  30.437  1.00 48.20  ? 21  ASP B CB    1 
ATOM 1249  C CG    . ASP B 1 22  ? 117.272 81.819  31.454  1.00 45.95  ? 21  ASP B CG    1 
ATOM 1250  O OD1   . ASP B 1 22  ? 117.072 82.997  31.081  1.00 45.71  ? 21  ASP B OD1   1 
ATOM 1251  O OD2   . ASP B 1 22  ? 117.645 81.522  32.621  1.00 46.06  ? 21  ASP B OD2   1 
ATOM 1252  N N     . GLN B 1 23  ? 115.987 79.089  27.905  1.00 74.69  ? 22  GLN B N     1 
ATOM 1253  C CA    . GLN B 1 23  ? 116.224 78.138  26.815  1.00 75.50  ? 22  GLN B CA    1 
ATOM 1254  C C     . GLN B 1 23  ? 115.861 78.687  25.441  1.00 75.21  ? 22  GLN B C     1 
ATOM 1255  O O     . GLN B 1 23  ? 116.625 78.541  24.496  1.00 76.80  ? 22  GLN B O     1 
ATOM 1256  C CB    . GLN B 1 23  ? 115.487 76.820  27.067  1.00 75.33  ? 22  GLN B CB    1 
ATOM 1257  C CG    . GLN B 1 23  ? 115.976 76.081  28.310  1.00 76.58  ? 22  GLN B CG    1 
ATOM 1258  C CD    . GLN B 1 23  ? 114.947 75.108  28.875  1.00 76.10  ? 22  GLN B CD    1 
ATOM 1259  O OE1   . GLN B 1 23  ? 114.051 74.635  28.156  1.00 75.07  ? 22  GLN B OE1   1 
ATOM 1260  N NE2   . GLN B 1 23  ? 115.067 74.809  30.173  1.00 77.14  ? 22  GLN B NE2   1 
ATOM 1261  N N     . LYS B 1 24  ? 114.695 79.307  25.330  1.00 52.02  ? 23  LYS B N     1 
ATOM 1262  C CA    . LYS B 1 24  ? 114.263 79.890  24.061  1.00 53.45  ? 23  LYS B CA    1 
ATOM 1263  C C     . LYS B 1 24  ? 115.132 81.071  23.650  1.00 53.88  ? 23  LYS B C     1 
ATOM 1264  O O     . LYS B 1 24  ? 115.303 81.360  22.463  1.00 55.91  ? 23  LYS B O     1 
ATOM 1265  C CB    . LYS B 1 24  ? 112.800 80.326  24.121  1.00 52.74  ? 23  LYS B CB    1 
ATOM 1266  C CG    . LYS B 1 24  ? 111.847 79.249  23.723  1.00 53.94  ? 23  LYS B CG    1 
ATOM 1267  C CD    . LYS B 1 24  ? 110.678 79.152  24.682  1.00 52.55  ? 23  LYS B CD    1 
ATOM 1268  C CE    . LYS B 1 24  ? 109.692 78.074  24.228  1.00 54.25  ? 23  LYS B CE    1 
ATOM 1269  N NZ    . LYS B 1 24  ? 108.558 77.934  25.182  1.00 53.32  ? 23  LYS B NZ    1 
ATOM 1270  N N     . LEU B 1 25  ? 115.679 81.756  24.639  1.00 41.59  ? 24  LEU B N     1 
ATOM 1271  C CA    . LEU B 1 25  ? 116.485 82.934  24.376  1.00 40.71  ? 24  LEU B CA    1 
ATOM 1272  C C     . LEU B 1 25  ? 117.947 82.599  24.057  1.00 40.69  ? 24  LEU B C     1 
ATOM 1273  O O     . LEU B 1 25  ? 118.747 83.486  23.756  1.00 40.26  ? 24  LEU B O     1 
ATOM 1274  C CB    . LEU B 1 25  ? 116.417 83.851  25.580  1.00 39.36  ? 24  LEU B CB    1 
ATOM 1275  C CG    . LEU B 1 25  ? 115.192 84.728  25.591  1.00 39.54  ? 24  LEU B CG    1 
ATOM 1276  C CD1   . LEU B 1 25  ? 115.148 85.475  26.889  1.00 38.47  ? 24  LEU B CD1   1 
ATOM 1277  C CD2   . LEU B 1 25  ? 115.286 85.691  24.425  1.00 40.03  ? 24  LEU B CD2   1 
ATOM 1278  N N     . GLU B 1 26  ? 118.278 81.316  24.147  1.00 48.79  ? 25  GLU B N     1 
ATOM 1279  C CA    . GLU B 1 26  ? 119.630 80.814  23.958  1.00 50.09  ? 25  GLU B CA    1 
ATOM 1280  C C     . GLU B 1 26  ? 120.188 81.193  22.602  1.00 51.08  ? 25  GLU B C     1 
ATOM 1281  O O     . GLU B 1 26  ? 121.320 81.636  22.471  1.00 51.84  ? 25  GLU B O     1 
ATOM 1282  C CB    . GLU B 1 26  ? 119.567 79.307  24.053  1.00 51.40  ? 25  GLU B CB    1 
ATOM 1283  C CG    . GLU B 1 26  ? 120.852 78.634  24.313  1.00 52.74  ? 25  GLU B CG    1 
ATOM 1284  C CD    . GLU B 1 26  ? 120.615 77.261  24.883  1.00 53.85  ? 25  GLU B CD    1 
ATOM 1285  O OE1   . GLU B 1 26  ? 120.222 77.205  26.087  1.00 53.25  ? 25  GLU B OE1   1 
ATOM 1286  O OE2   . GLU B 1 26  ? 120.801 76.262  24.128  1.00 55.64  ? 25  GLU B OE2   1 
ATOM 1287  N N     . GLN B 1 27  ? 119.363 81.015  21.589  1.00 49.22  ? 26  GLN B N     1 
ATOM 1288  C CA    . GLN B 1 27  ? 119.731 81.303  20.224  1.00 50.48  ? 26  GLN B CA    1 
ATOM 1289  C C     . GLN B 1 27  ? 120.081 82.770  20.015  1.00 49.99  ? 26  GLN B C     1 
ATOM 1290  O O     . GLN B 1 27  ? 120.622 83.121  18.970  1.00 51.36  ? 26  GLN B O     1 
ATOM 1291  C CB    . GLN B 1 27  ? 118.576 80.938  19.306  1.00 50.89  ? 26  GLN B CB    1 
ATOM 1292  C CG    . GLN B 1 27  ? 117.420 81.886  19.450  1.00 49.45  ? 26  GLN B CG    1 
ATOM 1293  C CD    . GLN B 1 27  ? 116.338 81.653  18.433  1.00 50.31  ? 26  GLN B CD    1 
ATOM 1294  O OE1   . GLN B 1 27  ? 116.604 81.549  17.227  1.00 51.78  ? 26  GLN B OE1   1 
ATOM 1295  N NE2   . GLN B 1 27  ? 115.096 81.568  18.908  1.00 49.71  ? 26  GLN B NE2   1 
ATOM 1296  N N     . PHE B 1 28  ? 119.763 83.630  20.980  1.00 42.72  ? 27  PHE B N     1 
ATOM 1297  C CA    . PHE B 1 28  ? 120.109 85.043  20.876  1.00 42.16  ? 27  PHE B CA    1 
ATOM 1298  C C     . PHE B 1 28  ? 121.206 85.424  21.844  1.00 41.01  ? 27  PHE B C     1 
ATOM 1299  O O     . PHE B 1 28  ? 121.526 86.595  21.992  1.00 40.54  ? 27  PHE B O     1 
ATOM 1300  C CB    . PHE B 1 28  ? 118.895 85.930  21.125  1.00 41.74  ? 27  PHE B CB    1 
ATOM 1301  C CG    . PHE B 1 28  ? 117.749 85.656  20.214  1.00 43.11  ? 27  PHE B CG    1 
ATOM 1302  C CD1   . PHE B 1 28  ? 117.847 85.911  18.855  1.00 44.63  ? 27  PHE B CD1   1 
ATOM 1303  C CD2   . PHE B 1 28  ? 116.567 85.147  20.708  1.00 43.15  ? 27  PHE B CD2   1 
ATOM 1304  C CE1   . PHE B 1 28  ? 116.792 85.655  18.008  1.00 46.18  ? 27  PHE B CE1   1 
ATOM 1305  C CE2   . PHE B 1 28  ? 115.503 84.894  19.861  1.00 44.72  ? 27  PHE B CE2   1 
ATOM 1306  C CZ    . PHE B 1 28  ? 115.621 85.147  18.512  1.00 46.23  ? 27  PHE B CZ    1 
ATOM 1307  N N     . ASP B 1 29  ? 121.766 84.426  22.509  1.00 40.80  ? 28  ASP B N     1 
ATOM 1308  C CA    . ASP B 1 29  ? 122.841 84.615  23.469  1.00 40.02  ? 28  ASP B CA    1 
ATOM 1309  C C     . ASP B 1 29  ? 122.516 85.650  24.541  1.00 38.73  ? 28  ASP B C     1 
ATOM 1310  O O     . ASP B 1 29  ? 123.392 86.417  24.952  1.00 38.42  ? 28  ASP B O     1 
ATOM 1311  C CB    . ASP B 1 29  ? 124.147 84.996  22.782  1.00 40.82  ? 28  ASP B CB    1 
ATOM 1312  C CG    . ASP B 1 29  ? 125.351 84.547  23.570  1.00 40.79  ? 28  ASP B CG    1 
ATOM 1313  O OD1   . ASP B 1 29  ? 125.454 83.325  23.805  1.00 41.23  ? 28  ASP B OD1   1 
ATOM 1314  O OD2   . ASP B 1 29  ? 126.172 85.405  23.993  1.00 40.52  ? 28  ASP B OD2   1 
ATOM 1315  N N     . ILE B 1 30  ? 121.270 85.683  25.007  1.00 38.23  ? 29  ILE B N     1 
ATOM 1316  C CA    . ILE B 1 30  ? 120.941 86.545  26.142  1.00 37.24  ? 29  ILE B CA    1 
ATOM 1317  C C     . ILE B 1 30  ? 120.164 85.780  27.218  1.00 36.80  ? 29  ILE B C     1 
ATOM 1318  O O     . ILE B 1 30  ? 119.682 84.685  26.961  1.00 37.33  ? 29  ILE B O     1 
ATOM 1319  C CB    . ILE B 1 30  ? 120.172 87.801  25.691  1.00 37.34  ? 29  ILE B CB    1 
ATOM 1320  C CG1   . ILE B 1 30  ? 118.962 87.419  24.855  1.00 38.08  ? 29  ILE B CG1   1 
ATOM 1321  C CG2   . ILE B 1 30  ? 121.067 88.715  24.872  1.00 37.85  ? 29  ILE B CG2   1 
ATOM 1322  C CD1   . ILE B 1 30  ? 118.171 88.607  24.389  1.00 38.50  ? 29  ILE B CD1   1 
ATOM 1323  N N     . THR B 1 31  ? 120.061 86.354  28.412  1.00 36.10  ? 30  THR B N     1 
ATOM 1324  C CA    . THR B 1 31  ? 119.278 85.804  29.516  1.00 35.86  ? 30  THR B CA    1 
ATOM 1325  C C     . THR B 1 31  ? 117.895 86.469  29.573  1.00 35.94  ? 30  THR B C     1 
ATOM 1326  O O     . THR B 1 31  ? 117.716 87.509  28.952  1.00 36.06  ? 30  THR B O     1 
ATOM 1327  C CB    . THR B 1 31  ? 119.949 86.167  30.805  1.00 35.36  ? 30  THR B CB    1 
ATOM 1328  O OG1   . THR B 1 31  ? 119.678 87.545  31.089  1.00 35.12  ? 30  THR B OG1   1 
ATOM 1329  C CG2   . THR B 1 31  ? 121.410 85.993  30.665  1.00 35.48  ? 30  THR B CG2   1 
ATOM 1330  N N     . ASN B 1 32  ? 116.933 85.926  30.325  1.00 41.95  ? 31  ASN B N     1 
ATOM 1331  C CA    . ASN B 1 32  ? 115.620 86.568  30.345  1.00 41.56  ? 31  ASN B CA    1 
ATOM 1332  C C     . ASN B 1 32  ? 115.686 87.989  30.906  1.00 40.62  ? 31  ASN B C     1 
ATOM 1333  O O     . ASN B 1 32  ? 115.047 88.897  30.378  1.00 40.49  ? 31  ASN B O     1 
ATOM 1334  C CB    . ASN B 1 32  ? 114.521 85.724  31.008  1.00 42.38  ? 31  ASN B CB    1 
ATOM 1335  C CG    . ASN B 1 32  ? 114.631 85.689  32.521  1.00 42.36  ? 31  ASN B CG    1 
ATOM 1336  O OD1   . ASN B 1 32  ? 115.188 84.747  33.095  1.00 42.97  ? 31  ASN B OD1   1 
ATOM 1337  N ND2   . ASN B 1 32  ? 114.092 86.717  33.188  1.00 41.96  ? 31  ASN B ND2   1 
ATOM 1338  N N     . GLU B 1 33  ? 116.498 88.182  31.943  1.00 35.66  ? 32  GLU B N     1 
ATOM 1339  C CA    . GLU B 1 33  ? 116.719 89.492  32.546  1.00 35.59  ? 32  GLU B CA    1 
ATOM 1340  C C     . GLU B 1 33  ? 117.209 90.487  31.498  1.00 35.71  ? 32  GLU B C     1 
ATOM 1341  O O     . GLU B 1 33  ? 116.794 91.652  31.465  1.00 36.17  ? 32  GLU B O     1 
ATOM 1342  C CB    . GLU B 1 33  ? 117.789 89.376  33.629  1.00 35.25  ? 32  GLU B CB    1 
ATOM 1343  C CG    . GLU B 1 33  ? 117.370 88.636  34.881  1.00 35.39  ? 32  GLU B CG    1 
ATOM 1344  C CD    . GLU B 1 33  ? 117.094 87.163  34.629  1.00 35.47  ? 32  GLU B CD    1 
ATOM 1345  O OE1   . GLU B 1 33  ? 117.665 86.598  33.659  1.00 35.32  ? 32  GLU B OE1   1 
ATOM 1346  O OE2   . GLU B 1 33  ? 116.287 86.572  35.386  1.00 35.91  ? 32  GLU B OE2   1 
ATOM 1347  N N     . GLN B 1 34  ? 118.116 90.003  30.654  1.00 40.20  ? 33  GLN B N     1 
ATOM 1348  C CA    . GLN B 1 34  ? 118.706 90.810  29.610  1.00 40.63  ? 33  GLN B CA    1 
ATOM 1349  C C     . GLN B 1 34  ? 117.670 91.095  28.555  1.00 40.82  ? 33  GLN B C     1 
ATOM 1350  O O     . GLN B 1 34  ? 117.567 92.227  28.069  1.00 41.10  ? 33  GLN B O     1 
ATOM 1351  C CB    . GLN B 1 34  ? 119.896 90.094  28.998  1.00 41.73  ? 33  GLN B CB    1 
ATOM 1352  C CG    . GLN B 1 34  ? 121.185 90.376  29.733  1.00 42.07  ? 33  GLN B CG    1 
ATOM 1353  C CD    . GLN B 1 34  ? 122.313 89.453  29.327  1.00 43.67  ? 33  GLN B CD    1 
ATOM 1354  O OE1   . GLN B 1 34  ? 122.162 88.627  28.429  1.00 44.64  ? 33  GLN B OE1   1 
ATOM 1355  N NE2   . GLN B 1 34  ? 123.454 89.592  29.986  1.00 44.25  ? 33  GLN B NE2   1 
ATOM 1356  N N     . GLY B 1 35  ? 116.893 90.069  28.213  1.00 41.19  ? 34  GLY B N     1 
ATOM 1357  C CA    . GLY B 1 35  ? 115.797 90.217  27.269  1.00 41.59  ? 34  GLY B CA    1 
ATOM 1358  C C     . GLY B 1 35  ? 114.778 91.240  27.742  1.00 41.38  ? 34  GLY B C     1 
ATOM 1359  O O     . GLY B 1 35  ? 114.255 92.040  26.965  1.00 42.30  ? 34  GLY B O     1 
ATOM 1360  N N     . HIS B 1 36  ? 114.507 91.233  29.038  1.00 39.18  ? 35  HIS B N     1 
ATOM 1361  C CA    . HIS B 1 36  ? 113.525 92.141  29.579  1.00 39.88  ? 35  HIS B CA    1 
ATOM 1362  C C     . HIS B 1 36  ? 114.029 93.570  29.585  1.00 40.20  ? 35  HIS B C     1 
ATOM 1363  O O     . HIS B 1 36  ? 113.313 94.494  29.180  1.00 41.44  ? 35  HIS B O     1 
ATOM 1364  C CB    . HIS B 1 36  ? 113.066 91.669  30.950  1.00 39.66  ? 35  HIS B CB    1 
ATOM 1365  C CG    . HIS B 1 36  ? 112.077 90.548  30.873  1.00 40.83  ? 35  HIS B CG    1 
ATOM 1366  N ND1   . HIS B 1 36  ? 112.057 89.500  31.770  1.00 41.20  ? 35  HIS B ND1   1 
ATOM 1367  C CD2   . HIS B 1 36  ? 111.081 90.304  29.993  1.00 41.87  ? 35  HIS B CD2   1 
ATOM 1368  C CE1   . HIS B 1 36  ? 111.088 88.663  31.444  1.00 42.26  ? 35  HIS B CE1   1 
ATOM 1369  N NE2   . HIS B 1 36  ? 110.478 89.131  30.371  1.00 42.77  ? 35  HIS B NE2   1 
ATOM 1370  N N     . THR B 1 37  ? 115.270 93.754  30.011  1.00 38.22  ? 36  THR B N     1 
ATOM 1371  C CA    . THR B 1 37  ? 115.872 95.081  30.004  1.00 38.72  ? 36  THR B CA    1 
ATOM 1372  C C     . THR B 1 37  ? 115.918 95.634  28.586  1.00 39.51  ? 36  THR B C     1 
ATOM 1373  O O     . THR B 1 37  ? 115.513 96.771  28.323  1.00 40.65  ? 36  THR B O     1 
ATOM 1374  C CB    . THR B 1 37  ? 117.284 95.008  30.523  1.00 38.03  ? 36  THR B CB    1 
ATOM 1375  O OG1   . THR B 1 37  ? 117.282 94.273  31.756  1.00 37.39  ? 36  THR B OG1   1 
ATOM 1376  C CG2   . THR B 1 37  ? 117.842 96.401  30.733  1.00 38.83  ? 36  THR B CG2   1 
ATOM 1377  N N     . LEU B 1 38  ? 116.429 94.816  27.675  1.00 38.91  ? 37  LEU B N     1 
ATOM 1378  C CA    . LEU B 1 38  ? 116.468 95.191  26.285  1.00 39.83  ? 37  LEU B CA    1 
ATOM 1379  C C     . LEU B 1 38  ? 115.050 95.559  25.893  1.00 40.97  ? 37  LEU B C     1 
ATOM 1380  O O     . LEU B 1 38  ? 114.813 96.613  25.301  1.00 42.23  ? 37  LEU B O     1 
ATOM 1381  C CB    . LEU B 1 38  ? 116.957 94.024  25.436  1.00 39.48  ? 37  LEU B CB    1 
ATOM 1382  C CG    . LEU B 1 38  ? 118.449 93.763  25.461  1.00 38.91  ? 37  LEU B CG    1 
ATOM 1383  C CD1   . LEU B 1 38  ? 118.784 92.662  24.486  1.00 39.03  ? 37  LEU B CD1   1 
ATOM 1384  C CD2   . LEU B 1 38  ? 119.175 95.020  25.102  1.00 39.70  ? 37  LEU B CD2   1 
ATOM 1385  N N     . GLY B 1 39  ? 114.107 94.695  26.257  1.00 40.76  ? 38  GLY B N     1 
ATOM 1386  C CA    . GLY B 1 39  ? 112.730 94.874  25.853  1.00 42.07  ? 38  GLY B CA    1 
ATOM 1387  C C     . GLY B 1 39  ? 112.224 96.179  26.412  1.00 43.02  ? 38  GLY B C     1 
ATOM 1388  O O     . GLY B 1 39  ? 111.531 96.923  25.725  1.00 44.59  ? 38  GLY B O     1 
ATOM 1389  N N     . TYR B 1 40  ? 112.586 96.461  27.659  1.00 47.63  ? 39  TYR B N     1 
ATOM 1390  C CA    . TYR B 1 40  ? 112.146 97.688  28.299  1.00 48.76  ? 39  TYR B CA    1 
ATOM 1391  C C     . TYR B 1 40  ? 112.681 98.890  27.552  1.00 49.86  ? 39  TYR B C     1 
ATOM 1392  O O     . TYR B 1 40  ? 111.945 99.812  27.248  1.00 51.69  ? 39  TYR B O     1 
ATOM 1393  C CB    . TYR B 1 40  ? 112.595 97.750  29.756  1.00 47.97  ? 39  TYR B CB    1 
ATOM 1394  C CG    . TYR B 1 40  ? 112.222 99.051  30.437  1.00 49.40  ? 39  TYR B CG    1 
ATOM 1395  C CD1   . TYR B 1 40  ? 110.957 99.239  30.971  1.00 50.60  ? 39  TYR B CD1   1 
ATOM 1396  C CD2   . TYR B 1 40  ? 113.136 100.087 30.553  1.00 49.84  ? 39  TYR B CD2   1 
ATOM 1397  C CE1   . TYR B 1 40  ? 110.616 100.415 31.607  1.00 52.19  ? 39  TYR B CE1   1 
ATOM 1398  C CE2   . TYR B 1 40  ? 112.803 101.272 31.188  1.00 51.48  ? 39  TYR B CE2   1 
ATOM 1399  C CZ    . TYR B 1 40  ? 111.536 101.434 31.701  1.00 52.65  ? 39  TYR B CZ    1 
ATOM 1400  O OH    . TYR B 1 40  ? 111.189 102.618 32.330  1.00 54.91  ? 39  TYR B OH    1 
ATOM 1401  N N     . LEU B 1 41  ? 113.970 98.877  27.259  1.00 45.31  ? 40  LEU B N     1 
ATOM 1402  C CA    . LEU B 1 41  ? 114.589 99.965  26.515  1.00 46.45  ? 40  LEU B CA    1 
ATOM 1403  C C     . LEU B 1 41  ? 113.931 100.198 25.147  1.00 47.91  ? 40  LEU B C     1 
ATOM 1404  O O     . LEU B 1 41  ? 113.894 101.321 24.646  1.00 49.58  ? 40  LEU B O     1 
ATOM 1405  C CB    . LEU B 1 41  ? 116.085 99.699  26.357  1.00 45.47  ? 40  LEU B CB    1 
ATOM 1406  C CG    . LEU B 1 41  ? 116.859 99.781  27.666  1.00 44.63  ? 40  LEU B CG    1 
ATOM 1407  C CD1   . LEU B 1 41  ? 118.240 99.208  27.495  1.00 43.68  ? 40  LEU B CD1   1 
ATOM 1408  C CD2   . LEU B 1 41  ? 116.958 101.207 28.074  1.00 46.10  ? 40  LEU B CD2   1 
ATOM 1409  N N     . TYR B 1 42  ? 113.402 99.148  24.544  1.00 57.88  ? 41  TYR B N     1 
ATOM 1410  C CA    . TYR B 1 42  ? 112.741 99.317  23.263  1.00 59.59  ? 41  TYR B CA    1 
ATOM 1411  C C     . TYR B 1 42  ? 111.567 100.269 23.426  1.00 61.62  ? 41  TYR B C     1 
ATOM 1412  O O     . TYR B 1 42  ? 111.326 101.122 22.577  1.00 63.63  ? 41  TYR B O     1 
ATOM 1413  C CB    . TYR B 1 42  ? 112.258 97.971  22.724  1.00 58.94  ? 41  TYR B CB    1 
ATOM 1414  C CG    . TYR B 1 42  ? 111.941 97.971  21.247  1.00 60.55  ? 41  TYR B CG    1 
ATOM 1415  C CD1   . TYR B 1 42  ? 112.869 98.415  20.323  1.00 61.08  ? 41  TYR B CD1   1 
ATOM 1416  C CD2   . TYR B 1 42  ? 110.716 97.502  20.775  1.00 61.99  ? 41  TYR B CD2   1 
ATOM 1417  C CE1   . TYR B 1 42  ? 112.586 98.412  18.973  1.00 62.91  ? 41  TYR B CE1   1 
ATOM 1418  C CE2   . TYR B 1 42  ? 110.422 97.489  19.415  1.00 63.83  ? 41  TYR B CE2   1 
ATOM 1419  C CZ    . TYR B 1 42  ? 111.363 97.950  18.519  1.00 64.32  ? 41  TYR B CZ    1 
ATOM 1420  O OH    . TYR B 1 42  ? 111.093 97.948  17.170  1.00 66.52  ? 41  TYR B OH    1 
ATOM 1421  N N     . ALA B 1 43  ? 110.865 100.145 24.543  1.00 54.73  ? 42  ALA B N     1 
ATOM 1422  C CA    . ALA B 1 43  ? 109.609 100.849 24.728  1.00 56.73  ? 42  ALA B CA    1 
ATOM 1423  C C     . ALA B 1 43  ? 109.750 102.266 25.270  1.00 57.91  ? 42  ALA B C     1 
ATOM 1424  O O     . ALA B 1 43  ? 108.893 103.121 25.016  1.00 60.43  ? 42  ALA B O     1 
ATOM 1425  C CB    . ALA B 1 43  ? 108.697 100.048 25.627  1.00 56.11  ? 42  ALA B CB    1 
ATOM 1426  N N     . HIS B 1 44  ? 110.803 102.528 26.031  1.00 75.55  ? 43  HIS B N     1 
ATOM 1427  C CA    . HIS B 1 44  ? 110.821 103.763 26.798  1.00 77.14  ? 43  HIS B CA    1 
ATOM 1428  C C     . HIS B 1 44  ? 112.105 104.548 26.676  1.00 77.53  ? 43  HIS B C     1 
ATOM 1429  O O     . HIS B 1 44  ? 112.376 105.412 27.511  1.00 78.38  ? 43  HIS B O     1 
ATOM 1430  C CB    . HIS B 1 44  ? 110.538 103.477 28.270  1.00 76.50  ? 43  HIS B CB    1 
ATOM 1431  C CG    . HIS B 1 44  ? 109.289 102.689 28.496  1.00 76.71  ? 43  HIS B CG    1 
ATOM 1432  N ND1   . HIS B 1 44  ? 109.252 101.570 29.298  1.00 74.81  ? 43  HIS B ND1   1 
ATOM 1433  C CD2   . HIS B 1 44  ? 108.031 102.850 28.019  1.00 78.78  ? 43  HIS B CD2   1 
ATOM 1434  C CE1   . HIS B 1 44  ? 108.027 101.076 29.312  1.00 75.85  ? 43  HIS B CE1   1 
ATOM 1435  N NE2   . HIS B 1 44  ? 107.265 101.834 28.543  1.00 78.32  ? 43  HIS B NE2   1 
ATOM 1436  N N     . GLN B 1 45  ? 112.898 104.267 25.650  1.00 98.36  ? 44  GLN B N     1 
ATOM 1437  C CA    . GLN B 1 45  ? 114.164 104.975 25.508  1.00 98.55  ? 44  GLN B CA    1 
ATOM 1438  C C     . GLN B 1 45  ? 113.930 106.417 25.071  1.00 101.74 ? 44  GLN B C     1 
ATOM 1439  O O     . GLN B 1 45  ? 114.796 107.279 25.240  1.00 102.83 ? 44  GLN B O     1 
ATOM 1440  C CB    . GLN B 1 45  ? 115.089 104.260 24.531  1.00 97.39  ? 44  GLN B CB    1 
ATOM 1441  C CG    . GLN B 1 45  ? 114.547 104.177 23.127  1.00 98.26  ? 44  GLN B CG    1 
ATOM 1442  C CD    . GLN B 1 45  ? 115.600 103.725 22.149  1.00 98.03  ? 44  GLN B CD    1 
ATOM 1443  O OE1   . GLN B 1 45  ? 116.718 103.387 22.541  1.00 97.18  ? 44  GLN B OE1   1 
ATOM 1444  N NE2   . GLN B 1 45  ? 115.257 103.726 20.863  1.00 99.19  ? 44  GLN B NE2   1 
ATOM 1445  N N     . GLN B 1 46  ? 112.699 106.711 24.681  1.00 120.82 ? 45  GLN B N     1 
ATOM 1446  C CA    . GLN B 1 46  ? 112.333 108.029 24.180  1.00 123.78 ? 45  GLN B CA    1 
ATOM 1447  C C     . GLN B 1 46  ? 112.537 109.057 25.283  1.00 125.02 ? 45  GLN B C     1 
ATOM 1448  O O     . GLN B 1 46  ? 112.556 110.261 25.037  1.00 127.69 ? 45  GLN B O     1 
ATOM 1449  C CB    . GLN B 1 46  ? 110.876 108.042 23.722  1.00 125.11 ? 45  GLN B CB    1 
ATOM 1450  C CG    . GLN B 1 46  ? 110.566 107.060 22.607  1.00 125.07 ? 45  GLN B CG    1 
ATOM 1451  C CD    . GLN B 1 46  ? 110.504 105.629 23.096  1.00 122.29 ? 45  GLN B CD    1 
ATOM 1452  O OE1   . GLN B 1 46  ? 109.800 105.320 24.057  1.00 121.72 ? 45  GLN B OE1   1 
ATOM 1453  N NE2   . GLN B 1 46  ? 111.241 104.745 22.436  1.00 120.71 ? 45  GLN B NE2   1 
ATOM 1454  N N     . ASP B 1 47  ? 112.670 108.566 26.506  1.00 99.73  ? 46  ASP B N     1 
ATOM 1455  C CA    . ASP B 1 47  ? 112.739 109.400 27.693  1.00 100.96 ? 46  ASP B CA    1 
ATOM 1456  C C     . ASP B 1 47  ? 114.168 109.768 28.100  1.00 100.60 ? 46  ASP B C     1 
ATOM 1457  O O     . ASP B 1 47  ? 114.400 110.202 29.225  1.00 101.04 ? 46  ASP B O     1 
ATOM 1458  C CB    . ASP B 1 47  ? 111.983 108.734 28.838  1.00 99.84  ? 46  ASP B CB    1 
ATOM 1459  C CG    . ASP B 1 47  ? 110.628 108.212 28.403  1.00 100.60 ? 46  ASP B CG    1 
ATOM 1460  O OD1   . ASP B 1 47  ? 110.251 108.443 27.238  1.00 102.06 ? 46  ASP B OD1   1 
ATOM 1461  O OD2   . ASP B 1 47  ? 109.937 107.571 29.219  1.00 99.99  ? 46  ASP B OD2   1 
ATOM 1462  N N     . GLY B 1 48  ? 115.123 109.571 27.194  1.00 88.02  ? 47  GLY B N     1 
ATOM 1463  C CA    . GLY B 1 48  ? 116.510 109.941 27.450  1.00 88.06  ? 47  GLY B CA    1 
ATOM 1464  C C     . GLY B 1 48  ? 117.055 109.201 28.647  1.00 85.89  ? 47  GLY B C     1 
ATOM 1465  O O     . GLY B 1 48  ? 117.788 109.734 29.477  1.00 86.58  ? 47  GLY B O     1 
ATOM 1466  N N     . LEU B 1 49  ? 116.668 107.938 28.705  1.00 85.31  ? 48  LEU B N     1 
ATOM 1467  C CA    . LEU B 1 49  ? 116.856 107.054 29.861  1.00 83.22  ? 48  LEU B CA    1 
ATOM 1468  C C     . LEU B 1 49  ? 118.244 107.026 30.459  1.00 82.84  ? 48  LEU B C     1 
ATOM 1469  O O     . LEU B 1 49  ? 119.249 107.040 29.745  1.00 82.70  ? 48  LEU B O     1 
ATOM 1470  C CB    . LEU B 1 49  ? 116.392 105.630 29.555  1.00 80.77  ? 48  LEU B CB    1 
ATOM 1471  C CG    . LEU B 1 49  ? 114.919 105.459 29.914  1.00 81.29  ? 48  LEU B CG    1 
ATOM 1472  C CD1   . LEU B 1 49  ? 114.531 103.998 29.928  1.00 79.01  ? 48  LEU B CD1   1 
ATOM 1473  C CD2   . LEU B 1 49  ? 114.649 106.108 31.263  1.00 82.31  ? 48  LEU B CD2   1 
ATOM 1474  N N     . THR B 1 50  ? 118.258 106.908 31.786  1.00 80.58  ? 49  THR B N     1 
ATOM 1475  C CA    . THR B 1 50  ? 119.455 106.853 32.613  1.00 80.43  ? 49  THR B CA    1 
ATOM 1476  C C     . THR B 1 50  ? 119.268 105.683 33.546  1.00 78.49  ? 49  THR B C     1 
ATOM 1477  O O     . THR B 1 50  ? 118.146 105.267 33.804  1.00 77.75  ? 49  THR B O     1 
ATOM 1478  C CB    . THR B 1 50  ? 119.578 108.086 33.496  1.00 83.02  ? 49  THR B CB    1 
ATOM 1479  O OG1   . THR B 1 50  ? 118.377 108.224 34.261  1.00 83.61  ? 49  THR B OG1   1 
ATOM 1480  C CG2   . THR B 1 50  ? 119.799 109.321 32.650  1.00 85.75  ? 49  THR B CG2   1 
ATOM 1481  N N     . GLN B 1 51  ? 120.366 105.180 34.090  1.00 78.30  ? 50  GLN B N     1 
ATOM 1482  C CA    . GLN B 1 51  ? 120.353 103.907 34.777  1.00 76.22  ? 50  GLN B CA    1 
ATOM 1483  C C     . GLN B 1 51  ? 119.435 103.901 35.970  1.00 76.57  ? 50  GLN B C     1 
ATOM 1484  O O     . GLN B 1 51  ? 118.769 102.912 36.236  1.00 75.24  ? 50  GLN B O     1 
ATOM 1485  C CB    . GLN B 1 51  ? 121.746 103.567 35.285  1.00 75.78  ? 50  GLN B CB    1 
ATOM 1486  C CG    . GLN B 1 51  ? 122.749 103.291 34.188  1.00 75.79  ? 50  GLN B CG    1 
ATOM 1487  C CD    . GLN B 1 51  ? 124.133 103.029 34.723  1.00 76.65  ? 50  GLN B CD    1 
ATOM 1488  O OE1   . GLN B 1 51  ? 124.939 102.368 34.083  1.00 75.77  ? 50  GLN B OE1   1 
ATOM 1489  N NE2   . GLN B 1 51  ? 124.413 103.543 35.908  1.00 77.51  ? 50  GLN B NE2   1 
ATOM 1490  N N     . ASN B 1 52  ? 119.387 104.988 36.714  1.00 75.10  ? 51  ASN B N     1 
ATOM 1491  C CA    . ASN B 1 52  ? 118.560 104.978 37.904  1.00 75.60  ? 51  ASN B CA    1 
ATOM 1492  C C     . ASN B 1 52  ? 117.146 104.721 37.462  1.00 75.48  ? 51  ASN B C     1 
ATOM 1493  O O     . ASN B 1 52  ? 116.376 104.060 38.140  1.00 75.33  ? 51  ASN B O     1 
ATOM 1494  C CB    . ASN B 1 52  ? 118.652 106.299 38.658  1.00 78.57  ? 51  ASN B CB    1 
ATOM 1495  C CG    . ASN B 1 52  ? 117.530 106.479 39.662  1.00 79.83  ? 51  ASN B CG    1 
ATOM 1496  O OD1   . ASN B 1 52  ? 117.183 107.598 40.032  1.00 82.37  ? 51  ASN B OD1   1 
ATOM 1497  N ND2   . ASN B 1 52  ? 116.942 105.370 40.089  1.00 78.44  ? 51  ASN B ND2   1 
ATOM 1498  N N     . ASP B 1 53  ? 116.801 105.293 36.329  1.00 66.23  ? 52  ASP B N     1 
ATOM 1499  C CA    . ASP B 1 53  ? 115.450 105.199 35.827  1.00 66.39  ? 52  ASP B CA    1 
ATOM 1500  C C     . ASP B 1 53  ? 115.172 103.737 35.572  1.00 64.15  ? 52  ASP B C     1 
ATOM 1501  O O     . ASP B 1 53  ? 114.113 103.228 35.909  1.00 64.22  ? 52  ASP B O     1 
ATOM 1502  C CB    . ASP B 1 53  ? 115.274 105.981 34.508  1.00 75.12  ? 52  ASP B CB    1 
ATOM 1503  C CG    . ASP B 1 53  ? 115.310 107.503 34.684  1.00 77.91  ? 52  ASP B CG    1 
ATOM 1504  O OD1   . ASP B 1 53  ? 115.185 107.960 35.831  1.00 79.16  ? 52  ASP B OD1   1 
ATOM 1505  O OD2   . ASP B 1 53  ? 115.488 108.229 33.681  1.00 79.03  ? 52  ASP B OD2   1 
ATOM 1506  N N     . ILE B 1 54  ? 116.140 103.056 34.978  1.00 48.36  ? 53  ILE B N     1 
ATOM 1507  C CA    . ILE B 1 54  ? 116.002 101.638 34.721  1.00 46.39  ? 53  ILE B CA    1 
ATOM 1508  C C     . ILE B 1 54  ? 115.956 100.854 36.007  1.00 45.72  ? 53  ILE B C     1 
ATOM 1509  O O     . ILE B 1 54  ? 115.087 100.019 36.211  1.00 45.17  ? 53  ILE B O     1 
ATOM 1510  C CB    . ILE B 1 54  ? 117.183 101.118 33.916  1.00 45.16  ? 53  ILE B CB    1 
ATOM 1511  C CG1   . ILE B 1 54  ? 117.505 102.097 32.796  1.00 46.25  ? 53  ILE B CG1   1 
ATOM 1512  C CG2   . ILE B 1 54  ? 116.870 99.747  33.370  1.00 43.56  ? 53  ILE B CG2   1 
ATOM 1513  C CD1   . ILE B 1 54  ? 118.369 101.520 31.707  1.00 45.28  ? 53  ILE B CD1   1 
ATOM 1514  N N     . ALA B 1 55  ? 116.878 101.172 36.899  1.00 44.49  ? 54  ALA B N     1 
ATOM 1515  C CA    . ALA B 1 55  ? 116.907 100.548 38.211  1.00 44.27  ? 54  ALA B CA    1 
ATOM 1516  C C     . ALA B 1 55  ? 115.512 100.607 38.801  1.00 45.18  ? 54  ALA B C     1 
ATOM 1517  O O     . ALA B 1 55  ? 114.977 99.582  39.241  1.00 44.44  ? 54  ALA B O     1 
ATOM 1518  C CB    . ALA B 1 55  ? 117.900 101.230 39.105  1.00 45.36  ? 54  ALA B CB    1 
ATOM 1519  N N     . LYS B 1 56  ? 114.908 101.799 38.734  1.00 46.99  ? 55  LYS B N     1 
ATOM 1520  C CA    . LYS B 1 56  ? 113.559 102.020 39.255  1.00 48.35  ? 55  LYS B CA    1 
ATOM 1521  C C     . LYS B 1 56  ? 112.515 101.182 38.522  1.00 47.54  ? 55  LYS B C     1 
ATOM 1522  O O     . LYS B 1 56  ? 111.686 100.519 39.149  1.00 47.67  ? 55  LYS B O     1 
ATOM 1523  C CB    . LYS B 1 56  ? 113.187 103.506 39.219  1.00 50.74  ? 55  LYS B CB    1 
ATOM 1524  N N     . ALA B 1 57  ? 112.570 101.188 37.199  1.00 49.49  ? 56  ALA B N     1 
ATOM 1525  C CA    . ALA B 1 57  ? 111.581 100.451 36.427  1.00 49.07  ? 56  ALA B CA    1 
ATOM 1526  C C     . ALA B 1 57  ? 111.639 98.931  36.639  1.00 47.34  ? 56  ALA B C     1 
ATOM 1527  O O     . ALA B 1 57  ? 110.601 98.255  36.601  1.00 47.54  ? 56  ALA B O     1 
ATOM 1528  C CB    . ALA B 1 57  ? 111.709 100.778 34.970  1.00 48.99  ? 56  ALA B CB    1 
ATOM 1529  N N     . LEU B 1 58  ? 112.840 98.393  36.864  1.00 53.79  ? 57  LEU B N     1 
ATOM 1530  C CA    . LEU B 1 58  ? 112.994 96.941  36.981  1.00 52.42  ? 57  LEU B CA    1 
ATOM 1531  C C     . LEU B 1 58  ? 112.908 96.483  38.416  1.00 52.88  ? 57  LEU B C     1 
ATOM 1532  O O     . LEU B 1 58  ? 112.969 95.280  38.683  1.00 52.01  ? 57  LEU B O     1 
ATOM 1533  C CB    . LEU B 1 58  ? 114.316 96.462  36.387  1.00 50.85  ? 57  LEU B CB    1 
ATOM 1534  C CG    . LEU B 1 58  ? 114.574 96.945  34.966  1.00 50.84  ? 57  LEU B CG    1 
ATOM 1535  C CD1   . LEU B 1 58  ? 115.750 96.221  34.360  1.00 49.71  ? 57  LEU B CD1   1 
ATOM 1536  C CD2   . LEU B 1 58  ? 113.316 96.784  34.112  1.00 51.53  ? 57  LEU B CD2   1 
ATOM 1537  N N     . GLN B 1 59  ? 112.769 97.448  39.325  1.00 50.15  ? 58  GLN B N     1 
ATOM 1538  C CA    . GLN B 1 59  ? 112.652 97.171  40.745  1.00 50.95  ? 58  GLN B CA    1 
ATOM 1539  C C     . GLN B 1 59  ? 113.860 96.383  41.204  1.00 49.64  ? 58  GLN B C     1 
ATOM 1540  O O     . GLN B 1 59  ? 113.729 95.378  41.895  1.00 49.33  ? 58  GLN B O     1 
ATOM 1541  C CB    . GLN B 1 59  ? 111.350 96.423  41.050  1.00 51.47  ? 58  GLN B CB    1 
ATOM 1542  C CG    . GLN B 1 59  ? 110.149 97.324  41.310  1.00 54.19  ? 58  GLN B CG    1 
ATOM 1543  C CD    . GLN B 1 59  ? 110.335 98.162  42.582  1.00 55.83  ? 58  GLN B CD    1 
ATOM 1544  O OE1   . GLN B 1 59  ? 110.760 97.646  43.637  1.00 55.94  ? 58  GLN B OE1   1 
ATOM 1545  N NE2   . GLN B 1 59  ? 110.037 99.464  42.487  1.00 57.73  ? 58  GLN B NE2   1 
ATOM 1546  N N     . ARG B 1 60  ? 115.038 96.849  40.796  1.00 44.24  ? 59  ARG B N     1 
ATOM 1547  C CA    . ARG B 1 60  ? 116.309 96.207  41.117  1.00 43.38  ? 59  ARG B CA    1 
ATOM 1548  C C     . ARG B 1 60  ? 117.275 97.261  41.575  1.00 44.35  ? 59  ARG B C     1 
ATOM 1549  O O     . ARG B 1 60  ? 117.079 98.442  41.279  1.00 45.36  ? 59  ARG B O     1 
ATOM 1550  C CB    . ARG B 1 60  ? 116.899 95.554  39.880  1.00 41.85  ? 59  ARG B CB    1 
ATOM 1551  C CG    . ARG B 1 60  ? 116.128 94.363  39.381  1.00 40.99  ? 59  ARG B CG    1 
ATOM 1552  C CD    . ARG B 1 60  ? 116.159 93.283  40.386  1.00 40.93  ? 59  ARG B CD    1 
ATOM 1553  N NE    . ARG B 1 60  ? 115.330 92.183  39.955  1.00 40.47  ? 59  ARG B NE    1 
ATOM 1554  C CZ    . ARG B 1 60  ? 114.064 92.058  40.308  1.00 41.27  ? 59  ARG B CZ    1 
ATOM 1555  N NH1   . ARG B 1 60  ? 113.514 92.984  41.082  1.00 42.54  ? 59  ARG B NH1   1 
ATOM 1556  N NH2   . ARG B 1 60  ? 113.351 91.020  39.901  1.00 41.08  ? 59  ARG B NH2   1 
ATOM 1557  N N     . THR B 1 61  ? 118.337 96.851  42.261  1.00 42.64  ? 60  THR B N     1 
ATOM 1558  C CA    . THR B 1 61  ? 119.250 97.823  42.852  1.00 43.97  ? 60  THR B CA    1 
ATOM 1559  C C     . THR B 1 61  ? 120.168 98.503  41.847  1.00 43.80  ? 60  THR B C     1 
ATOM 1560  O O     . THR B 1 61  ? 120.269 98.105  40.694  1.00 42.52  ? 60  THR B O     1 
ATOM 1561  C CB    . THR B 1 61  ? 120.116 97.211  43.942  1.00 44.37  ? 60  THR B CB    1 
ATOM 1562  O OG1   . THR B 1 61  ? 121.115 96.383  43.343  1.00 43.12  ? 60  THR B OG1   1 
ATOM 1563  C CG2   . THR B 1 61  ? 119.274 96.402  44.897  1.00 44.61  ? 60  THR B CG2   1 
ATOM 1564  N N     . GLY B 1 62  ? 120.845 99.540  42.305  1.00 45.37  ? 61  GLY B N     1 
ATOM 1565  C CA    . GLY B 1 62  ? 121.788 100.254 41.474  1.00 45.66  ? 61  GLY B CA    1 
ATOM 1566  C C     . GLY B 1 62  ? 122.967 99.444  40.985  1.00 44.59  ? 61  GLY B C     1 
ATOM 1567  O O     . GLY B 1 62  ? 123.296 99.517  39.805  1.00 43.94  ? 61  GLY B O     1 
ATOM 1568  N N     . PRO B 1 63  ? 123.632 98.701  41.887  1.00 44.68  ? 62  PRO B N     1 
ATOM 1569  C CA    . PRO B 1 63  ? 124.664 97.774  41.431  1.00 43.77  ? 62  PRO B CA    1 
ATOM 1570  C C     . PRO B 1 63  ? 124.104 96.729  40.469  1.00 41.86  ? 62  PRO B C     1 
ATOM 1571  O O     . PRO B 1 63  ? 124.665 96.564  39.381  1.00 41.24  ? 62  PRO B O     1 
ATOM 1572  C CB    . PRO B 1 63  ? 125.109 97.105  42.722  1.00 44.43  ? 62  PRO B CB    1 
ATOM 1573  C CG    . PRO B 1 63  ? 124.881 98.110  43.742  1.00 46.26  ? 62  PRO B CG    1 
ATOM 1574  C CD    . PRO B 1 63  ? 123.603 98.768  43.354  1.00 46.05  ? 62  PRO B CD    1 
ATOM 1575  N N     . THR B 1 64  ? 123.009 96.064  40.842  1.00 41.19  ? 63  THR B N     1 
ATOM 1576  C CA    . THR B 1 64  ? 122.443 95.011  39.997  1.00 39.67  ? 63  THR B CA    1 
ATOM 1577  C C     . THR B 1 64  ? 122.262 95.495  38.576  1.00 39.16  ? 63  THR B C     1 
ATOM 1578  O O     . THR B 1 64  ? 122.660 94.819  37.631  1.00 38.33  ? 63  THR B O     1 
ATOM 1579  C CB    . THR B 1 64  ? 121.101 94.466  40.525  1.00 39.41  ? 63  THR B CB    1 
ATOM 1580  O OG1   . THR B 1 64  ? 121.316 93.791  41.774  1.00 39.92  ? 63  THR B OG1   1 
ATOM 1581  C CG2   . THR B 1 64  ? 120.505 93.490  39.523  1.00 38.15  ? 63  THR B CG2   1 
ATOM 1582  N N     . VAL B 1 65  ? 121.698 96.686  38.436  1.00 39.95  ? 64  VAL B N     1 
ATOM 1583  C CA    . VAL B 1 65  ? 121.446 97.259  37.123  1.00 39.82  ? 64  VAL B CA    1 
ATOM 1584  C C     . VAL B 1 65  ? 122.736 97.674  36.417  1.00 40.18  ? 64  VAL B C     1 
ATOM 1585  O O     . VAL B 1 65  ? 122.901 97.423  35.223  1.00 39.64  ? 64  VAL B O     1 
ATOM 1586  C CB    . VAL B 1 65  ? 120.465 98.438  37.219  1.00 40.93  ? 64  VAL B CB    1 
ATOM 1587  C CG1   . VAL B 1 65  ? 120.473 99.251  35.938  1.00 41.33  ? 64  VAL B CG1   1 
ATOM 1588  C CG2   . VAL B 1 65  ? 119.075 97.912  37.534  1.00 40.59  ? 64  VAL B CG2   1 
ATOM 1589  N N     . SER B 1 66  ? 123.645 98.302  37.169  1.00 41.34  ? 65  SER B N     1 
ATOM 1590  C CA    . SER B 1 66  ? 124.969 98.664  36.658  1.00 42.03  ? 65  SER B CA    1 
ATOM 1591  C C     . SER B 1 66  ? 125.565 97.447  36.032  1.00 40.91  ? 65  SER B C     1 
ATOM 1592  O O     . SER B 1 66  ? 126.032 97.468  34.899  1.00 40.86  ? 65  SER B O     1 
ATOM 1593  C CB    . SER B 1 66  ? 125.904 99.104  37.779  1.00 43.45  ? 65  SER B CB    1 
ATOM 1594  O OG    . SER B 1 66  ? 127.240 98.781  37.433  1.00 43.77  ? 65  SER B OG    1 
ATOM 1595  N N     . ASN B 1 67  ? 125.505 96.363  36.776  1.00 40.20  ? 66  ASN B N     1 
ATOM 1596  C CA    . ASN B 1 67  ? 126.063 95.124  36.305  1.00 39.40  ? 66  ASN B CA    1 
ATOM 1597  C C     . ASN B 1 67  ? 125.433 94.514  35.050  1.00 38.32  ? 66  ASN B C     1 
ATOM 1598  O O     . ASN B 1 67  ? 126.130 93.920  34.225  1.00 38.18  ? 66  ASN B O     1 
ATOM 1599  C CB    . ASN B 1 67  ? 125.987 94.097  37.384  1.00 39.10  ? 66  ASN B CB    1 
ATOM 1600  C CG    . ASN B 1 67  ? 126.873 92.979  37.101  1.00 38.92  ? 66  ASN B CG    1 
ATOM 1601  O OD1   . ASN B 1 67  ? 128.059 93.060  37.393  1.00 39.91  ? 66  ASN B OD1   1 
ATOM 1602  N ND2   . ASN B 1 67  ? 126.342 91.931  36.475  1.00 37.91  ? 66  ASN B ND2   1 
ATOM 1603  N N     . LEU B 1 68  ? 124.115 94.613  34.934  1.00 37.78  ? 67  LEU B N     1 
ATOM 1604  C CA    . LEU B 1 68  ? 123.446 94.026  33.802  1.00 37.03  ? 67  LEU B CA    1 
ATOM 1605  C C     . LEU B 1 68  ? 123.741 94.853  32.566  1.00 37.56  ? 67  LEU B C     1 
ATOM 1606  O O     . LEU B 1 68  ? 124.088 94.318  31.523  1.00 37.40  ? 67  LEU B O     1 
ATOM 1607  C CB    . LEU B 1 68  ? 121.942 93.933  34.046  1.00 36.66  ? 67  LEU B CB    1 
ATOM 1608  C CG    . LEU B 1 68  ? 121.235 93.136  32.940  1.00 36.09  ? 67  LEU B CG    1 
ATOM 1609  C CD1   . LEU B 1 68  ? 120.248 92.101  33.487  1.00 35.62  ? 67  LEU B CD1   1 
ATOM 1610  C CD2   . LEU B 1 68  ? 120.547 94.093  32.004  1.00 36.58  ? 67  LEU B CD2   1 
ATOM 1611  N N     . LEU B 1 69  ? 123.592 96.164  32.694  1.00 38.44  ? 68  LEU B N     1 
ATOM 1612  C CA    . LEU B 1 69  ? 123.917 97.077  31.619  1.00 39.31  ? 68  LEU B CA    1 
ATOM 1613  C C     . LEU B 1 69  ? 125.342 96.866  31.121  1.00 39.75  ? 68  LEU B C     1 
ATOM 1614  O O     . LEU B 1 69  ? 125.594 96.903  29.916  1.00 41.15  ? 68  LEU B O     1 
ATOM 1615  C CB    . LEU B 1 69  ? 123.742 98.514  32.082  1.00 40.56  ? 68  LEU B CB    1 
ATOM 1616  C CG    . LEU B 1 69  ? 122.308 98.901  32.395  1.00 40.59  ? 68  LEU B CG    1 
ATOM 1617  C CD1   . LEU B 1 69  ? 122.253 100.324 32.938  1.00 42.17  ? 68  LEU B CD1   1 
ATOM 1618  C CD2   . LEU B 1 69  ? 121.462 98.764  31.156  1.00 40.39  ? 68  LEU B CD2   1 
ATOM 1619  N N     . ARG B 1 70  ? 126.277 96.631  32.028  1.00 45.52  ? 69  ARG B N     1 
ATOM 1620  C CA    . ARG B 1 70  ? 127.637 96.462  31.580  1.00 47.37  ? 69  ARG B CA    1 
ATOM 1621  C C     . ARG B 1 70  ? 127.757 95.280  30.618  1.00 48.05  ? 69  ARG B C     1 
ATOM 1622  O O     . ARG B 1 70  ? 128.413 95.371  29.583  1.00 50.59  ? 69  ARG B O     1 
ATOM 1623  C CB    . ARG B 1 70  ? 128.551 96.265  32.749  1.00 47.57  ? 69  ARG B CB    1 
ATOM 1624  C CG    . ARG B 1 70  ? 129.973 96.142  32.317  1.00 50.12  ? 69  ARG B CG    1 
ATOM 1625  C CD    . ARG B 1 70  ? 130.703 95.299  33.312  1.00 49.75  ? 69  ARG B CD    1 
ATOM 1626  N NE    . ARG B 1 70  ? 129.933 94.082  33.543  1.00 47.70  ? 69  ARG B NE    1 
ATOM 1627  C CZ    . ARG B 1 70  ? 130.139 93.235  34.548  1.00 46.82  ? 69  ARG B CZ    1 
ATOM 1628  N NH1   . ARG B 1 70  ? 131.106 93.472  35.444  1.00 47.60  ? 69  ARG B NH1   1 
ATOM 1629  N NH2   . ARG B 1 70  ? 129.375 92.147  34.650  1.00 45.44  ? 69  ARG B NH2   1 
ATOM 1630  N N     . ASN B 1 71  ? 127.101 94.178  30.958  1.00 41.83  ? 70  ASN B N     1 
ATOM 1631  C CA    . ASN B 1 71  ? 127.072 93.016  30.101  1.00 42.47  ? 70  ASN B CA    1 
ATOM 1632  C C     . ASN B 1 71  ? 126.540 93.389  28.730  1.00 43.35  ? 70  ASN B C     1 
ATOM 1633  O O     . ASN B 1 71  ? 127.253 93.273  27.732  1.00 45.80  ? 70  ASN B O     1 
ATOM 1634  C CB    . ASN B 1 71  ? 126.193 91.935  30.715  1.00 40.58  ? 70  ASN B CB    1 
ATOM 1635  C CG    . ASN B 1 71  ? 126.823 91.279  31.947  1.00 40.23  ? 70  ASN B CG    1 
ATOM 1636  O OD1   . ASN B 1 71  ? 128.008 91.459  32.234  1.00 41.45  ? 70  ASN B OD1   1 
ATOM 1637  N ND2   . ASN B 1 71  ? 126.032 90.488  32.661  1.00 38.85  ? 70  ASN B ND2   1 
ATOM 1638  N N     . LEU B 1 72  ? 125.289 93.852  28.689  1.00 38.22  ? 71  LEU B N     1 
ATOM 1639  C CA    . LEU B 1 72  ? 124.667 94.338  27.462  1.00 38.69  ? 71  LEU B CA    1 
ATOM 1640  C C     . LEU B 1 72  ? 125.499 95.266  26.596  1.00 40.01  ? 71  LEU B C     1 
ATOM 1641  O O     . LEU B 1 72  ? 125.459 95.188  25.379  1.00 40.61  ? 71  LEU B O     1 
ATOM 1642  C CB    . LEU B 1 72  ? 123.352 95.027  27.772  1.00 38.53  ? 71  LEU B CB    1 
ATOM 1643  C CG    . LEU B 1 72  ? 122.264 94.088  28.259  1.00 37.56  ? 71  LEU B CG    1 
ATOM 1644  C CD1   . LEU B 1 72  ? 120.954 94.827  28.499  1.00 37.76  ? 71  LEU B CD1   1 
ATOM 1645  C CD2   . LEU B 1 72  ? 122.074 93.011  27.239  1.00 37.45  ? 71  LEU B CD2   1 
ATOM 1646  N N     . GLU B 1 73  ? 126.263 96.151  27.215  1.00 54.50  ? 72  GLU B N     1 
ATOM 1647  C CA    . GLU B 1 73  ? 127.185 96.971  26.445  1.00 57.52  ? 72  GLU B CA    1 
ATOM 1648  C C     . GLU B 1 73  ? 128.471 96.242  25.947  1.00 60.66  ? 72  GLU B C     1 
ATOM 1649  O O     . GLU B 1 73  ? 129.127 96.648  24.985  1.00 63.75  ? 72  GLU B O     1 
ATOM 1650  C CB    . GLU B 1 73  ? 127.658 98.121  27.301  1.00 57.94  ? 72  GLU B CB    1 
ATOM 1651  C CG    . GLU B 1 73  ? 128.569 99.056  26.584  1.00 61.71  ? 72  GLU B CG    1 
ATOM 1652  C CD    . GLU B 1 73  ? 128.969 100.197 27.457  1.00 62.88  ? 72  GLU B CD    1 
ATOM 1653  O OE1   . GLU B 1 73  ? 128.539 100.197 28.629  1.00 60.83  ? 72  GLU B OE1   1 
ATOM 1654  O OE2   . GLU B 1 73  ? 129.720 101.081 26.981  1.00 65.88  ? 72  GLU B OE2   1 
ATOM 1655  N N     . ARG B 1 74  ? 128.792 95.129  26.597  1.00 44.60  ? 73  ARG B N     1 
ATOM 1656  C CA    . ARG B 1 74  ? 129.921 94.321  26.150  1.00 47.41  ? 73  ARG B CA    1 
ATOM 1657  C C     . ARG B 1 74  ? 129.472 93.649  24.874  1.00 48.71  ? 73  ARG B C     1 
ATOM 1658  O O     . ARG B 1 74  ? 130.273 93.416  23.979  1.00 52.27  ? 73  ARG B O     1 
ATOM 1659  C CB    . ARG B 1 74  ? 130.426 93.261  27.115  1.00 46.46  ? 73  ARG B CB    1 
ATOM 1660  C CG    . ARG B 1 74  ? 131.036 93.825  28.358  1.00 45.65  ? 73  ARG B CG    1 
ATOM 1661  C CD    . ARG B 1 74  ? 131.837 92.771  29.084  1.00 45.62  ? 73  ARG B CD    1 
ATOM 1662  N NE    . ARG B 1 74  ? 132.863 92.175  28.229  1.00 48.84  ? 73  ARG B NE    1 
ATOM 1663  C CZ    . ARG B 1 74  ? 134.079 92.691  28.048  1.00 51.67  ? 73  ARG B CZ    1 
ATOM 1664  N NH1   . ARG B 1 74  ? 134.415 93.826  28.655  1.00 51.76  ? 73  ARG B NH1   1 
ATOM 1665  N NH2   . ARG B 1 74  ? 134.957 92.080  27.261  1.00 54.60  ? 73  ARG B NH2   1 
ATOM 1666  N N     . LYS B 1 75  ? 128.188 93.319  24.805  1.00 43.84  ? 74  LYS B N     1 
ATOM 1667  C CA    . LYS B 1 75  ? 127.626 92.721  23.606  1.00 41.63  ? 74  LYS B CA    1 
ATOM 1668  C C     . LYS B 1 75  ? 127.429 93.817  22.577  1.00 43.19  ? 74  LYS B C     1 
ATOM 1669  O O     . LYS B 1 75  ? 127.058 93.535  21.439  1.00 41.82  ? 74  LYS B O     1 
ATOM 1670  C CB    . LYS B 1 75  ? 126.272 92.061  23.880  1.00 40.92  ? 74  LYS B CB    1 
ATOM 1671  C CG    . LYS B 1 75  ? 126.249 90.985  24.943  1.00 40.05  ? 74  LYS B CG    1 
ATOM 1672  C CD    . LYS B 1 75  ? 126.703 89.638  24.410  1.00 39.21  ? 74  LYS B CD    1 
ATOM 1673  C CE    . LYS B 1 75  ? 125.562 88.622  24.430  1.00 38.04  ? 74  LYS B CE    1 
ATOM 1674  N NZ    . LYS B 1 75  ? 125.064 88.347  25.824  1.00 38.15  ? 74  LYS B NZ    1 
ATOM 1675  N N     . LYS B 1 76  ? 127.661 95.065  22.985  1.00 37.36  ? 75  LYS B N     1 
ATOM 1676  C CA    . LYS B 1 76  ? 127.429 96.223  22.119  1.00 39.00  ? 75  LYS B CA    1 
ATOM 1677  C C     . LYS B 1 76  ? 125.953 96.313  21.727  1.00 37.84  ? 75  LYS B C     1 
ATOM 1678  O O     . LYS B 1 76  ? 125.581 96.916  20.713  1.00 38.77  ? 75  LYS B O     1 
ATOM 1679  C CB    . LYS B 1 76  ? 128.348 96.196  20.886  1.00 39.93  ? 75  LYS B CB    1 
ATOM 1680  C CG    . LYS B 1 76  ? 129.487 97.178  20.979  1.00 43.24  ? 75  LYS B CG    1 
ATOM 1681  C CD    . LYS B 1 76  ? 130.478 96.981  19.863  1.00 44.32  ? 75  LYS B CD    1 
ATOM 1682  C CE    . LYS B 1 76  ? 131.248 98.272  19.573  1.00 48.37  ? 75  LYS B CE    1 
ATOM 1683  N NZ    . LYS B 1 76  ? 132.160 98.199  18.397  1.00 50.02  ? 75  LYS B NZ    1 
ATOM 1684  N N     . LEU B 1 77  ? 125.125 95.687  22.552  1.00 40.04  ? 76  LEU B N     1 
ATOM 1685  C CA    . LEU B 1 77  ? 123.688 95.688  22.378  1.00 39.53  ? 76  LEU B CA    1 
ATOM 1686  C C     . LEU B 1 77  ? 123.088 97.018  22.827  1.00 43.17  ? 76  LEU B C     1 
ATOM 1687  O O     . LEU B 1 77  ? 121.998 97.381  22.400  1.00 43.97  ? 76  LEU B O     1 
ATOM 1688  C CB    . LEU B 1 77  ? 123.069 94.544  23.182  1.00 37.94  ? 76  LEU B CB    1 
ATOM 1689  C CG    . LEU B 1 77  ? 123.267 93.135  22.620  1.00 35.40  ? 76  LEU B CG    1 
ATOM 1690  C CD1   . LEU B 1 77  ? 122.629 92.142  23.550  1.00 34.35  ? 76  LEU B CD1   1 
ATOM 1691  C CD2   . LEU B 1 77  ? 122.674 93.007  21.235  1.00 34.96  ? 76  LEU B CD2   1 
ATOM 1692  N N     . ILE B 1 78  ? 123.789 97.741  23.695  1.00 42.60  ? 77  ILE B N     1 
ATOM 1693  C CA    . ILE B 1 78  ? 123.349 99.076  24.087  1.00 45.58  ? 77  ILE B CA    1 
ATOM 1694  C C     . ILE B 1 78  ? 124.506 100.075 24.085  1.00 48.73  ? 77  ILE B C     1 
ATOM 1695  O O     . ILE B 1 78  ? 125.653 99.712  23.795  1.00 48.48  ? 77  ILE B O     1 
ATOM 1696  C CB    . ILE B 1 78  ? 122.717 99.087  25.478  1.00 45.84  ? 77  ILE B CB    1 
ATOM 1697  C CG1   . ILE B 1 78  ? 123.750 98.626  26.518  1.00 45.67  ? 77  ILE B CG1   1 
ATOM 1698  C CG2   . ILE B 1 78  ? 121.435 98.252  25.490  1.00 43.57  ? 77  ILE B CG2   1 
ATOM 1699  C CD1   . ILE B 1 78  ? 123.270 98.706  27.948  1.00 46.55  ? 77  ILE B CD1   1 
ATOM 1700  N N     . TYR B 1 79  ? 124.201 101.330 24.413  1.00 56.99  ? 78  TYR B N     1 
ATOM 1701  C CA    . TYR B 1 79  ? 125.207 102.379 24.404  1.00 59.53  ? 78  TYR B CA    1 
ATOM 1702  C C     . TYR B 1 79  ? 124.943 103.451 25.465  1.00 62.96  ? 78  TYR B C     1 
ATOM 1703  O O     . TYR B 1 79  ? 123.806 103.903 25.679  1.00 64.47  ? 78  TYR B O     1 
ATOM 1704  C CB    . TYR B 1 79  ? 125.301 103.028 23.029  1.00 61.15  ? 78  TYR B CB    1 
ATOM 1705  C CG    . TYR B 1 79  ? 124.175 103.985 22.758  1.00 63.72  ? 78  TYR B CG    1 
ATOM 1706  C CD1   . TYR B 1 79  ? 124.329 105.347 22.963  1.00 68.87  ? 78  TYR B CD1   1 
ATOM 1707  C CD2   . TYR B 1 79  ? 122.948 103.531 22.304  1.00 61.61  ? 78  TYR B CD2   1 
ATOM 1708  C CE1   . TYR B 1 79  ? 123.297 106.218 22.715  1.00 71.79  ? 78  TYR B CE1   1 
ATOM 1709  C CE2   . TYR B 1 79  ? 121.909 104.408 22.050  1.00 64.37  ? 78  TYR B CE2   1 
ATOM 1710  C CZ    . TYR B 1 79  ? 122.091 105.748 22.268  1.00 69.50  ? 78  TYR B CZ    1 
ATOM 1711  O OH    . TYR B 1 79  ? 121.063 106.625 22.028  1.00 72.88  ? 78  TYR B OH    1 
ATOM 1712  N N     . ARG B 1 80  ? 126.014 103.866 26.125  1.00 90.54  ? 79  ARG B N     1 
ATOM 1713  C CA    . ARG B 1 80  ? 125.902 104.857 27.164  1.00 93.87  ? 79  ARG B CA    1 
ATOM 1714  C C     . ARG B 1 80  ? 126.760 106.054 26.813  1.00 97.24  ? 79  ARG B C     1 
ATOM 1715  O O     . ARG B 1 80  ? 127.954 106.078 27.110  1.00 97.73  ? 79  ARG B O     1 
ATOM 1716  C CB    . ARG B 1 80  ? 126.332 104.250 28.495  1.00 93.07  ? 79  ARG B CB    1 
ATOM 1717  C CG    . ARG B 1 80  ? 125.776 102.847 28.705  1.00 89.72  ? 79  ARG B CG    1 
ATOM 1718  C CD    . ARG B 1 80  ? 125.927 102.372 30.134  1.00 89.78  ? 79  ARG B CD    1 
ATOM 1719  N NE    . ARG B 1 80  ? 127.148 101.610 30.343  1.00 88.08  ? 79  ARG B NE    1 
ATOM 1720  C CZ    . ARG B 1 80  ? 127.451 101.023 31.493  1.00 87.28  ? 79  ARG B CZ    1 
ATOM 1721  N NH1   . ARG B 1 80  ? 126.613 101.120 32.517  1.00 88.30  ? 79  ARG B NH1   1 
ATOM 1722  N NH2   . ARG B 1 80  ? 128.584 100.342 31.620  1.00 86.31  ? 79  ARG B NH2   1 
ATOM 1723  N N     . TYR B 1 81  ? 126.167 107.040 26.150  1.00 103.53 ? 80  TYR B N     1 
ATOM 1724  C CA    . TYR B 1 81  ? 126.860 108.303 26.015  1.00 109.02 ? 80  TYR B CA    1 
ATOM 1725  C C     . TYR B 1 81  ? 126.862 108.909 27.398  1.00 112.54 ? 80  TYR B C     1 
ATOM 1726  O O     . TYR B 1 81  ? 125.828 108.931 28.067  1.00 112.39 ? 80  TYR B O     1 
ATOM 1727  C CB    . TYR B 1 81  ? 126.208 109.248 24.990  1.00 112.19 ? 80  TYR B CB    1 
ATOM 1728  C CG    . TYR B 1 81  ? 124.713 109.485 25.118  1.00 112.22 ? 80  TYR B CG    1 
ATOM 1729  C CD1   . TYR B 1 81  ? 124.194 110.458 25.965  1.00 116.92 ? 80  TYR B CD1   1 
ATOM 1730  C CD2   . TYR B 1 81  ? 123.827 108.771 24.339  1.00 108.21 ? 80  TYR B CD2   1 
ATOM 1731  C CE1   . TYR B 1 81  ? 122.818 110.674 26.043  1.00 117.38 ? 80  TYR B CE1   1 
ATOM 1732  C CE2   . TYR B 1 81  ? 122.460 108.972 24.408  1.00 109.08 ? 80  TYR B CE2   1 
ATOM 1733  C CZ    . TYR B 1 81  ? 121.954 109.917 25.256  1.00 113.11 ? 80  TYR B CZ    1 
ATOM 1734  O OH    . TYR B 1 81  ? 120.584 110.087 25.297  1.00 113.94 ? 80  TYR B OH    1 
ATOM 1735  N N     . VAL B 1 82  ? 128.030 109.354 27.846  1.00 111.13 ? 81  VAL B N     1 
ATOM 1736  C CA    . VAL B 1 82  ? 128.121 110.077 29.106  1.00 115.61 ? 81  VAL B CA    1 
ATOM 1737  C C     . VAL B 1 82  ? 127.478 111.441 28.868  1.00 121.52 ? 81  VAL B C     1 
ATOM 1738  O O     . VAL B 1 82  ? 128.046 112.270 28.162  1.00 126.06 ? 81  VAL B O     1 
ATOM 1739  C CB    . VAL B 1 82  ? 129.587 110.245 29.548  1.00 118.59 ? 81  VAL B CB    1 
ATOM 1740  C CG1   . VAL B 1 82  ? 130.347 111.078 28.538  1.00 123.07 ? 81  VAL B CG1   1 
ATOM 1741  C CG2   . VAL B 1 82  ? 129.657 110.892 30.928  1.00 123.10 ? 81  VAL B CG2   1 
ATOM 1742  N N     . ASP B 1 83  ? 126.288 111.656 29.430  1.00 167.86 ? 82  ASP B N     1 
ATOM 1743  C CA    . ASP B 1 83  ? 125.488 112.855 29.146  1.00 172.25 ? 82  ASP B CA    1 
ATOM 1744  C C     . ASP B 1 83  ? 126.255 114.158 29.399  1.00 176.20 ? 82  ASP B C     1 
ATOM 1745  O O     . ASP B 1 83  ? 127.234 114.173 30.140  1.00 175.58 ? 82  ASP B O     1 
ATOM 1746  C CB    . ASP B 1 83  ? 124.178 112.816 29.947  1.00 171.39 ? 82  ASP B CB    1 
ATOM 1747  C CG    . ASP B 1 83  ? 123.177 113.868 29.490  1.00 176.13 ? 82  ASP B CG    1 
ATOM 1748  O OD1   . ASP B 1 83  ? 122.659 113.753 28.357  1.00 177.86 ? 82  ASP B OD1   1 
ATOM 1749  O OD2   . ASP B 1 83  ? 122.901 114.805 30.268  1.00 178.70 ? 82  ASP B OD2   1 
ATOM 1750  N N     . ALA B 1 84  ? 125.815 115.245 28.770  1.00 169.09 ? 83  ALA B N     1 
ATOM 1751  C CA    . ALA B 1 84  ? 126.576 116.499 28.763  1.00 173.45 ? 83  ALA B CA    1 
ATOM 1752  C C     . ALA B 1 84  ? 126.465 117.337 30.041  1.00 175.04 ? 83  ALA B C     1 
ATOM 1753  O O     . ALA B 1 84  ? 127.474 117.803 30.574  1.00 176.21 ? 83  ALA B O     1 
ATOM 1754  C CB    . ALA B 1 84  ? 126.196 117.337 27.551  1.00 178.14 ? 83  ALA B CB    1 
ATOM 1755  N N     . GLN B 1 85  ? 125.240 117.538 30.518  1.00 161.25 ? 84  GLN B N     1 
ATOM 1756  C CA    . GLN B 1 85  ? 124.999 118.317 31.729  1.00 163.26 ? 84  GLN B CA    1 
ATOM 1757  C C     . GLN B 1 85  ? 125.639 117.762 33.002  1.00 160.13 ? 84  GLN B C     1 
ATOM 1758  O O     . GLN B 1 85  ? 125.792 118.478 33.995  1.00 162.16 ? 84  GLN B O     1 
ATOM 1759  C CB    . GLN B 1 85  ? 123.495 118.487 31.953  1.00 163.56 ? 84  GLN B CB    1 
ATOM 1760  C CG    . GLN B 1 85  ? 122.737 119.056 30.770  1.00 167.25 ? 84  GLN B CG    1 
ATOM 1761  C CD    . GLN B 1 85  ? 121.239 118.856 30.898  1.00 167.17 ? 84  GLN B CD    1 
ATOM 1762  O OE1   . GLN B 1 85  ? 120.779 118.026 31.686  1.00 163.44 ? 84  GLN B OE1   1 
ATOM 1763  N NE2   . GLN B 1 85  ? 120.469 119.615 30.123  1.00 171.56 ? 84  GLN B NE2   1 
ATOM 1764  N N     . ASP B 1 86  ? 125.908 116.462 32.966  1.00 152.86 ? 85  ASP B N     1 
ATOM 1765  C CA    . ASP B 1 86  ? 126.525 115.743 34.059  1.00 149.53 ? 85  ASP B CA    1 
ATOM 1766  C C     . ASP B 1 86  ? 127.525 114.789 33.451  1.00 146.65 ? 85  ASP B C     1 
ATOM 1767  O O     . ASP B 1 86  ? 127.265 114.209 32.406  1.00 145.26 ? 85  ASP B O     1 
ATOM 1768  C CB    . ASP B 1 86  ? 125.475 114.956 34.833  1.00 154.88 ? 85  ASP B CB    1 
ATOM 1769  C CG    . ASP B 1 86  ? 124.562 115.838 35.639  1.00 157.71 ? 85  ASP B CG    1 
ATOM 1770  O OD1   . ASP B 1 86  ? 124.902 117.021 35.832  1.00 161.92 ? 85  ASP B OD1   1 
ATOM 1771  O OD2   . ASP B 1 86  ? 123.511 115.342 36.090  1.00 155.94 ? 85  ASP B OD2   1 
ATOM 1772  N N     . THR B 1 87  ? 128.661 114.605 34.099  1.00 113.83 ? 86  THR B N     1 
ATOM 1773  C CA    . THR B 1 87  ? 129.578 113.546 33.681  1.00 110.74 ? 86  THR B CA    1 
ATOM 1774  C C     . THR B 1 87  ? 129.333 112.244 34.440  1.00 105.99 ? 86  THR B C     1 
ATOM 1775  O O     . THR B 1 87  ? 129.814 111.173 34.059  1.00 102.98 ? 86  THR B O     1 
ATOM 1776  C CB    . THR B 1 87  ? 130.992 114.031 33.974  1.00 112.78 ? 86  THR B CB    1 
ATOM 1777  O OG1   . THR B 1 87  ? 131.058 115.440 33.772  1.00 117.73 ? 86  THR B OG1   1 
ATOM 1778  C CG2   . THR B 1 87  ? 131.984 113.360 33.051  1.00 111.57 ? 86  THR B CG2   1 
ATOM 1779  N N     . ARG B 1 88  ? 128.583 112.344 35.529  1.00 112.62 ? 87  ARG B N     1 
ATOM 1780  C CA    . ARG B 1 88  ? 128.127 111.158 36.234  1.00 108.46 ? 87  ARG B CA    1 
ATOM 1781  C C     . ARG B 1 88  ? 127.153 110.390 35.338  1.00 106.21 ? 87  ARG B C     1 
ATOM 1782  O O     . ARG B 1 88  ? 127.368 109.219 35.049  1.00 102.85 ? 87  ARG B O     1 
ATOM 1783  C CB    . ARG B 1 88  ? 127.456 111.543 37.555  1.00 109.18 ? 87  ARG B CB    1 
ATOM 1784  C CG    . ARG B 1 88  ? 128.288 112.466 38.444  1.00 112.33 ? 87  ARG B CG    1 
ATOM 1785  C CD    . ARG B 1 88  ? 127.423 113.154 39.497  1.00 114.39 ? 87  ARG B CD    1 
ATOM 1786  N NE    . ARG B 1 88  ? 126.544 114.161 38.910  1.00 117.62 ? 87  ARG B NE    1 
ATOM 1787  C CZ    . ARG B 1 88  ? 125.590 114.806 39.573  1.00 119.79 ? 87  ARG B CZ    1 
ATOM 1788  N NH1   . ARG B 1 88  ? 125.376 114.553 40.853  1.00 119.06 ? 87  ARG B NH1   1 
ATOM 1789  N NH2   . ARG B 1 88  ? 124.849 115.709 38.949  1.00 122.99 ? 87  ARG B NH2   1 
ATOM 1790  N N     . ARG B 1 89  ? 126.102 111.068 34.880  1.00 120.16 ? 88  ARG B N     1 
ATOM 1791  C CA    . ARG B 1 89  ? 125.033 110.436 34.106  1.00 118.68 ? 88  ARG B CA    1 
ATOM 1792  C C     . ARG B 1 89  ? 125.496 109.771 32.815  1.00 117.57 ? 88  ARG B C     1 
ATOM 1793  O O     . ARG B 1 89  ? 126.087 110.408 31.943  1.00 120.23 ? 88  ARG B O     1 
ATOM 1794  C CB    . ARG B 1 89  ? 123.923 111.443 33.784  1.00 122.22 ? 88  ARG B CB    1 
ATOM 1795  C CG    . ARG B 1 89  ? 123.059 111.822 34.966  1.00 122.87 ? 88  ARG B CG    1 
ATOM 1796  C CD    . ARG B 1 89  ? 122.086 112.929 34.609  1.00 127.05 ? 88  ARG B CD    1 
ATOM 1797  N NE    . ARG B 1 89  ? 121.361 113.394 35.786  1.00 128.25 ? 88  ARG B NE    1 
ATOM 1798  C CZ    . ARG B 1 89  ? 120.190 112.905 36.178  1.00 127.31 ? 88  ARG B CZ    1 
ATOM 1799  N NH1   . ARG B 1 89  ? 119.607 111.942 35.476  1.00 125.55 ? 88  ARG B NH1   1 
ATOM 1800  N NH2   . ARG B 1 89  ? 119.597 113.378 37.269  1.00 128.50 ? 88  ARG B NH2   1 
ATOM 1801  N N     . LYS B 1 90  ? 125.225 108.477 32.712  1.00 115.82 ? 89  LYS B N     1 
ATOM 1802  C CA    . LYS B 1 90  ? 125.337 107.768 31.455  1.00 112.21 ? 89  LYS B CA    1 
ATOM 1803  C C     . LYS B 1 90  ? 123.908 107.536 30.998  1.00 111.62 ? 89  LYS B C     1 
ATOM 1804  O O     . LYS B 1 90  ? 123.086 107.030 31.768  1.00 111.48 ? 89  LYS B O     1 
ATOM 1805  C CB    . LYS B 1 90  ? 126.055 106.425 31.644  1.00 108.81 ? 89  LYS B CB    1 
ATOM 1806  C CG    . LYS B 1 90  ? 127.498 106.540 32.117  1.00 110.07 ? 89  LYS B CG    1 
ATOM 1807  C CD    . LYS B 1 90  ? 128.137 105.176 32.331  1.00 106.58 ? 89  LYS B CD    1 
ATOM 1808  C CE    . LYS B 1 90  ? 129.557 105.327 32.863  1.00 109.31 ? 89  LYS B CE    1 
ATOM 1809  N NZ    . LYS B 1 90  ? 130.210 104.024 33.173  1.00 106.43 ? 89  LYS B NZ    1 
ATOM 1810  N N     . ASN B 1 91  ? 123.595 107.920 29.764  1.00 92.18  ? 90  ASN B N     1 
ATOM 1811  C CA    . ASN B 1 91  ? 122.259 107.670 29.236  1.00 92.02  ? 90  ASN B CA    1 
ATOM 1812  C C     . ASN B 1 91  ? 122.184 106.473 28.316  1.00 90.35  ? 90  ASN B C     1 
ATOM 1813  O O     . ASN B 1 91  ? 123.089 106.228 27.518  1.00 89.23  ? 90  ASN B O     1 
ATOM 1814  C CB    . ASN B 1 91  ? 121.674 108.910 28.587  1.00 94.82  ? 90  ASN B CB    1 
ATOM 1815  C CG    . ASN B 1 91  ? 121.155 109.875 29.601  1.00 98.51  ? 90  ASN B CG    1 
ATOM 1816  O OD1   . ASN B 1 91  ? 121.665 109.934 30.716  1.00 99.63  ? 90  ASN B OD1   1 
ATOM 1817  N ND2   . ASN B 1 91  ? 120.115 110.619 29.243  1.00 100.84 ? 90  ASN B ND2   1 
ATOM 1818  N N     . ILE B 1 92  ? 121.093 105.727 28.443  1.00 63.31  ? 91  ILE B N     1 
ATOM 1819  C CA    . ILE B 1 92  ? 121.013 104.390 27.863  1.00 58.89  ? 91  ILE B CA    1 
ATOM 1820  C C     . ILE B 1 92  ? 120.100 104.336 26.656  1.00 58.49  ? 91  ILE B C     1 
ATOM 1821  O O     . ILE B 1 92  ? 118.983 104.837 26.700  1.00 60.37  ? 91  ILE B O     1 
ATOM 1822  C CB    . ILE B 1 92  ? 120.457 103.376 28.882  1.00 56.47  ? 91  ILE B CB    1 
ATOM 1823  C CG1   . ILE B 1 92  ? 121.051 103.607 30.270  1.00 57.88  ? 91  ILE B CG1   1 
ATOM 1824  C CG2   . ILE B 1 92  ? 120.714 101.963 28.410  1.00 52.43  ? 91  ILE B CG2   1 
ATOM 1825  C CD1   . ILE B 1 92  ? 122.527 103.347 30.359  1.00 57.36  ? 91  ILE B CD1   1 
ATOM 1826  N N     . GLY B 1 93  ? 120.572 103.713 25.586  1.00 68.49  ? 92  GLY B N     1 
ATOM 1827  C CA    . GLY B 1 93  ? 119.725 103.419 24.445  1.00 67.99  ? 92  GLY B CA    1 
ATOM 1828  C C     . GLY B 1 93  ? 120.165 102.153 23.722  1.00 65.69  ? 92  GLY B C     1 
ATOM 1829  O O     . GLY B 1 93  ? 121.264 101.655 23.952  1.00 64.66  ? 92  GLY B O     1 
ATOM 1830  N N     . LEU B 1 94  ? 119.310 101.632 22.848  1.00 51.62  ? 93  LEU B N     1 
ATOM 1831  C CA    . LEU B 1 94  ? 119.653 100.464 22.052  1.00 49.02  ? 93  LEU B CA    1 
ATOM 1832  C C     . LEU B 1 94  ? 120.601 100.805 20.912  1.00 49.84  ? 93  LEU B C     1 
ATOM 1833  O O     . LEU B 1 94  ? 120.783 101.954 20.566  1.00 52.63  ? 93  LEU B O     1 
ATOM 1834  C CB    . LEU B 1 94  ? 118.392 99.810  21.491  1.00 48.64  ? 93  LEU B CB    1 
ATOM 1835  C CG    . LEU B 1 94  ? 117.403 99.389  22.570  1.00 48.10  ? 93  LEU B CG    1 
ATOM 1836  C CD1   . LEU B 1 94  ? 116.205 98.724  21.939  1.00 48.24  ? 93  LEU B CD1   1 
ATOM 1837  C CD2   . LEU B 1 94  ? 118.081 98.465  23.563  1.00 45.50  ? 93  LEU B CD2   1 
ATOM 1838  N N     . THR B 1 95  ? 121.216 99.787  20.341  1.00 56.58  ? 94  THR B N     1 
ATOM 1839  C CA    . THR B 1 95  ? 121.991 99.950  19.129  1.00 55.44  ? 94  THR B CA    1 
ATOM 1840  C C     . THR B 1 95  ? 121.193 99.192  18.082  1.00 52.39  ? 94  THR B C     1 
ATOM 1841  O O     . THR B 1 95  ? 120.341 98.389  18.463  1.00 51.28  ? 94  THR B O     1 
ATOM 1842  C CB    . THR B 1 95  ? 123.396 99.360  19.316  1.00 54.85  ? 94  THR B CB    1 
ATOM 1843  O OG1   . THR B 1 95  ? 123.324 97.927  19.365  1.00 51.18  ? 94  THR B OG1   1 
ATOM 1844  C CG2   . THR B 1 95  ? 123.982 99.878  20.618  1.00 56.34  ? 94  THR B CG2   1 
ATOM 1845  N N     . THR B 1 96  ? 121.423 99.453  16.789  1.00 49.59  ? 95  THR B N     1 
ATOM 1846  C CA    . THR B 1 96  ? 120.686 98.742  15.734  1.00 49.66  ? 95  THR B CA    1 
ATOM 1847  C C     . THR B 1 96  ? 120.751 97.251  16.015  1.00 46.84  ? 95  THR B C     1 
ATOM 1848  O O     . THR B 1 96  ? 119.760 96.525  15.860  1.00 46.57  ? 95  THR B O     1 
ATOM 1849  C CB    . THR B 1 96  ? 121.252 98.955  14.317  1.00 51.40  ? 95  THR B CB    1 
ATOM 1850  O OG1   . THR B 1 96  ? 121.732 100.292 14.168  1.00 53.98  ? 95  THR B OG1   1 
ATOM 1851  N N     . SER B 1 97  ? 121.923 96.802  16.457  1.00 46.00  ? 96  SER B N     1 
ATOM 1852  C CA    . SER B 1 97  ? 122.105 95.397  16.708  1.00 43.80  ? 96  SER B CA    1 
ATOM 1853  C C     . SER B 1 97  ? 121.158 94.987  17.823  1.00 42.92  ? 96  SER B C     1 
ATOM 1854  O O     . SER B 1 97  ? 120.561 93.906  17.771  1.00 41.85  ? 96  SER B O     1 
ATOM 1855  C CB    . SER B 1 97  ? 123.547 95.103  17.066  1.00 42.80  ? 96  SER B CB    1 
ATOM 1856  O OG    . SER B 1 97  ? 123.847 95.628  18.341  1.00 44.93  ? 96  SER B OG    1 
ATOM 1857  N N     . GLY B 1 98  ? 121.001 95.863  18.813  1.00 42.18  ? 97  GLY B N     1 
ATOM 1858  C CA    . GLY B 1 98  ? 120.104 95.601  19.926  1.00 41.48  ? 97  GLY B CA    1 
ATOM 1859  C C     . GLY B 1 98  ? 118.638 95.758  19.550  1.00 42.91  ? 97  GLY B C     1 
ATOM 1860  O O     . GLY B 1 98  ? 117.778 95.022  20.028  1.00 42.39  ? 97  GLY B O     1 
ATOM 1861  N N     . ILE B 1 99  ? 118.346 96.735  18.700  1.00 45.15  ? 98  ILE B N     1 
ATOM 1862  C CA    . ILE B 1 99  ? 117.005 96.871  18.155  1.00 47.09  ? 98  ILE B CA    1 
ATOM 1863  C C     . ILE B 1 99  ? 116.738 95.638  17.306  1.00 46.60  ? 98  ILE B C     1 
ATOM 1864  O O     . ILE B 1 99  ? 115.668 95.029  17.391  1.00 47.11  ? 98  ILE B O     1 
ATOM 1865  C CB    . ILE B 1 99  ? 116.873 98.079  17.229  1.00 50.02  ? 98  ILE B CB    1 
ATOM 1866  C CG1   . ILE B 1 99  ? 117.033 99.381  17.992  1.00 51.41  ? 98  ILE B CG1   1 
ATOM 1867  C CG2   . ILE B 1 99  ? 115.529 98.056  16.563  1.00 52.31  ? 98  ILE B CG2   1 
ATOM 1868  C CD1   . ILE B 1 99  ? 116.991 100.548 17.091  1.00 54.65  ? 98  ILE B CD1   1 
ATOM 1869  N N     . LYS B 1 100 ? 117.699 95.241  16.501  1.00 47.63  ? 99  LYS B N     1 
ATOM 1870  C CA    . LYS B 1 100 ? 117.449 94.083  15.693  1.00 47.67  ? 99  LYS B CA    1 
ATOM 1871  C C     . LYS B 1 100 ? 117.194 92.926  16.629  1.00 45.89  ? 99  LYS B C     1 
ATOM 1872  O O     . LYS B 1 100 ? 116.280 92.152  16.410  1.00 46.75  ? 99  LYS B O     1 
ATOM 1873  C CB    . LYS B 1 100 ? 118.639 93.792  14.803  1.00 47.70  ? 99  LYS B CB    1 
ATOM 1874  C CG    . LYS B 1 100 ? 118.442 94.230  13.372  1.00 50.29  ? 99  LYS B CG    1 
ATOM 1875  C CD    . LYS B 1 100 ? 119.166 95.532  13.105  1.00 51.36  ? 99  LYS B CD    1 
ATOM 1876  C CE    . LYS B 1 100 ? 119.302 95.774  11.615  1.00 53.84  ? 99  LYS B CE    1 
ATOM 1877  N NZ    . LYS B 1 100 ? 120.687 95.530  11.131  1.00 53.26  ? 99  LYS B NZ    1 
ATOM 1878  N N     . LEU B 1 101 ? 117.970 92.814  17.697  1.00 43.28  ? 100 LEU B N     1 
ATOM 1879  C CA    . LEU B 1 101 ? 117.744 91.698  18.595  1.00 41.93  ? 100 LEU B CA    1 
ATOM 1880  C C     . LEU B 1 101 ? 116.366 91.709  19.237  1.00 42.84  ? 100 LEU B C     1 
ATOM 1881  O O     . LEU B 1 101 ? 115.671 90.693  19.252  1.00 43.26  ? 100 LEU B O     1 
ATOM 1882  C CB    . LEU B 1 101 ? 118.837 91.700  19.658  1.00 40.04  ? 100 LEU B CB    1 
ATOM 1883  C CG    . LEU B 1 101 ? 119.010 90.370  20.396  1.00 38.78  ? 100 LEU B CG    1 
ATOM 1884  C CD1   . LEU B 1 101 ? 119.442 89.276  19.457  1.00 38.94  ? 100 LEU B CD1   1 
ATOM 1885  C CD2   . LEU B 1 101 ? 120.030 90.508  21.498  1.00 37.45  ? 100 LEU B CD2   1 
ATOM 1886  N N     . VAL B 1 102 ? 115.968 92.867  19.747  1.00 52.65  ? 101 VAL B N     1 
ATOM 1887  C CA    . VAL B 1 102 ? 114.684 92.980  20.422  1.00 55.34  ? 101 VAL B CA    1 
ATOM 1888  C C     . VAL B 1 102 ? 113.524 92.590  19.503  1.00 54.56  ? 101 VAL B C     1 
ATOM 1889  O O     . VAL B 1 102 ? 112.660 91.789  19.891  1.00 55.36  ? 101 VAL B O     1 
ATOM 1890  C CB    . VAL B 1 102 ? 114.460 94.383  20.999  1.00 58.69  ? 101 VAL B CB    1 
ATOM 1891  C CG1   . VAL B 1 102 ? 112.995 94.569  21.388  1.00 61.15  ? 101 VAL B CG1   1 
ATOM 1892  C CG2   . VAL B 1 102 ? 115.392 94.620  22.185  1.00 60.61  ? 101 VAL B CG2   1 
ATOM 1893  N N     . GLU B 1 103 ? 113.520 93.122  18.279  1.00 47.58  ? 102 GLU B N     1 
ATOM 1894  C CA    . GLU B 1 103 ? 112.467 92.818  17.326  1.00 50.28  ? 102 GLU B CA    1 
ATOM 1895  C C     . GLU B 1 103 ? 112.411 91.314  17.078  1.00 49.93  ? 102 GLU B C     1 
ATOM 1896  O O     . GLU B 1 103 ? 111.372 90.765  16.734  1.00 52.23  ? 102 GLU B O     1 
ATOM 1897  C CB    . GLU B 1 103 ? 112.711 93.586  16.036  1.00 52.03  ? 102 GLU B CB    1 
ATOM 1898  C CG    . GLU B 1 103 ? 112.659 95.109  16.227  1.00 53.25  ? 102 GLU B CG    1 
ATOM 1899  C CD    . GLU B 1 103 ? 112.863 95.907  14.926  1.00 55.56  ? 102 GLU B CD    1 
ATOM 1900  O OE1   . GLU B 1 103 ? 113.488 95.361  13.975  1.00 55.27  ? 102 GLU B OE1   1 
ATOM 1901  O OE2   . GLU B 1 103 ? 112.400 97.082  14.863  1.00 58.00  ? 102 GLU B OE2   1 
ATOM 1902  N N     . ALA B 1 104 ? 113.536 90.647  17.314  1.00 47.43  ? 103 ALA B N     1 
ATOM 1903  C CA    . ALA B 1 104 ? 113.685 89.229  17.018  1.00 47.36  ? 103 ALA B CA    1 
ATOM 1904  C C     . ALA B 1 104 ? 113.288 88.270  18.149  1.00 46.74  ? 103 ALA B C     1 
ATOM 1905  O O     . ALA B 1 104 ? 112.779 87.182  17.870  1.00 48.26  ? 103 ALA B O     1 
ATOM 1906  C CB    . ALA B 1 104 ? 115.095 88.951  16.572  1.00 45.70  ? 103 ALA B CB    1 
ATOM 1907  N N     . PHE B 1 105 ? 113.522 88.646  19.412  1.00 44.98  ? 104 PHE B N     1 
ATOM 1908  C CA    . PHE B 1 105 ? 113.159 87.760  20.530  1.00 44.66  ? 104 PHE B CA    1 
ATOM 1909  C C     . PHE B 1 105 ? 111.811 88.073  21.179  1.00 46.42  ? 104 PHE B C     1 
ATOM 1910  O O     . PHE B 1 105 ? 111.224 87.219  21.846  1.00 47.20  ? 104 PHE B O     1 
ATOM 1911  C CB    . PHE B 1 105 ? 114.252 87.700  21.605  1.00 42.05  ? 104 PHE B CB    1 
ATOM 1912  C CG    . PHE B 1 105 ? 114.465 88.991  22.351  1.00 41.13  ? 104 PHE B CG    1 
ATOM 1913  C CD1   . PHE B 1 105 ? 113.516 89.473  23.235  1.00 42.05  ? 104 PHE B CD1   1 
ATOM 1914  C CD2   . PHE B 1 105 ? 115.642 89.693  22.198  1.00 39.74  ? 104 PHE B CD2   1 
ATOM 1915  C CE1   . PHE B 1 105 ? 113.707 90.643  23.910  1.00 42.95  ? 104 PHE B CE1   1 
ATOM 1916  C CE2   . PHE B 1 105 ? 115.854 90.862  22.882  1.00 39.45  ? 104 PHE B CE2   1 
ATOM 1917  C CZ    . PHE B 1 105 ? 114.878 91.345  23.737  1.00 41.87  ? 104 PHE B CZ    1 
ATOM 1918  N N     . THR B 1 106 ? 111.336 89.301  20.997  1.00 47.36  ? 105 THR B N     1 
ATOM 1919  C CA    . THR B 1 106 ? 110.073 89.740  21.580  1.00 49.44  ? 105 THR B CA    1 
ATOM 1920  C C     . THR B 1 106 ? 108.945 88.720  21.432  1.00 52.04  ? 105 THR B C     1 
ATOM 1921  O O     . THR B 1 106 ? 108.057 88.605  22.277  1.00 53.41  ? 105 THR B O     1 
ATOM 1922  C CB    . THR B 1 106 ? 109.643 91.086  20.978  1.00 51.20  ? 105 THR B CB    1 
ATOM 1923  O OG1   . THR B 1 106 ? 110.537 92.114  21.436  1.00 49.40  ? 105 THR B OG1   1 
ATOM 1924  C CG2   . THR B 1 106 ? 108.217 91.440  21.386  1.00 54.21  ? 105 THR B CG2   1 
ATOM 1925  N N     . SER B 1 107 ? 109.041 87.910  20.399  1.00 54.04  ? 106 SER B N     1 
ATOM 1926  C CA    . SER B 1 107 ? 108.024 86.917  20.160  1.00 57.09  ? 106 SER B CA    1 
ATOM 1927  C C     . SER B 1 107 ? 107.961 85.947  21.323  1.00 56.54  ? 106 SER B C     1 
ATOM 1928  O O     . SER B 1 107 ? 106.895 85.527  21.735  1.00 59.14  ? 106 SER B O     1 
ATOM 1929  C CB    . SER B 1 107 ? 108.298 86.191  18.841  1.00 65.93  ? 106 SER B CB    1 
ATOM 1930  O OG    . SER B 1 107 ? 109.504 85.455  18.858  1.00 63.48  ? 106 SER B OG    1 
ATOM 1931  N N     . ILE B 1 108 ? 109.120 85.589  21.846  1.00 52.41  ? 107 ILE B N     1 
ATOM 1932  C CA    . ILE B 1 108 ? 109.226 84.543  22.874  1.00 52.08  ? 107 ILE B CA    1 
ATOM 1933  C C     . ILE B 1 108 ? 108.416 84.919  24.112  1.00 52.76  ? 107 ILE B C     1 
ATOM 1934  O O     . ILE B 1 108 ? 107.618 84.133  24.632  1.00 54.99  ? 107 ILE B O     1 
ATOM 1935  C CB    . ILE B 1 108 ? 110.695 84.288  23.286  1.00 48.83  ? 107 ILE B CB    1 
ATOM 1936  C CG1   . ILE B 1 108 ? 111.429 83.609  22.138  1.00 48.85  ? 107 ILE B CG1   1 
ATOM 1937  C CG2   . ILE B 1 108 ? 110.806 83.459  24.567  1.00 48.56  ? 107 ILE B CG2   1 
ATOM 1938  C CD1   . ILE B 1 108 ? 112.901 83.554  22.364  1.00 46.02  ? 107 ILE B CD1   1 
ATOM 1939  N N     . PHE B 1 109 ? 108.644 86.135  24.575  1.00 51.19  ? 108 PHE B N     1 
ATOM 1940  C CA    . PHE B 1 109 ? 107.914 86.682  25.693  1.00 52.05  ? 108 PHE B CA    1 
ATOM 1941  C C     . PHE B 1 109 ? 106.420 86.654  25.438  1.00 55.89  ? 108 PHE B C     1 
ATOM 1942  O O     . PHE B 1 109 ? 105.665 86.140  26.261  1.00 57.72  ? 108 PHE B O     1 
ATOM 1943  C CB    . PHE B 1 109 ? 108.422 88.085  25.983  1.00 50.36  ? 108 PHE B CB    1 
ATOM 1944  C CG    . PHE B 1 109 ? 109.800 88.101  26.585  1.00 47.21  ? 108 PHE B CG    1 
ATOM 1945  C CD1   . PHE B 1 109 ? 110.136 87.219  27.582  1.00 46.48  ? 108 PHE B CD1   1 
ATOM 1946  C CD2   . PHE B 1 109 ? 110.758 88.975  26.142  1.00 45.43  ? 108 PHE B CD2   1 
ATOM 1947  C CE1   . PHE B 1 109 ? 111.374 87.230  28.131  1.00 44.11  ? 108 PHE B CE1   1 
ATOM 1948  C CE2   . PHE B 1 109 ? 112.007 88.984  26.701  1.00 43.08  ? 108 PHE B CE2   1 
ATOM 1949  C CZ    . PHE B 1 109 ? 112.308 88.111  27.692  1.00 42.44  ? 108 PHE B CZ    1 
ATOM 1950  N N     . ASP B 1 110 ? 106.005 87.159  24.280  1.00 73.59  ? 109 ASP B N     1 
ATOM 1951  C CA    . ASP B 1 110 ? 104.592 87.157  23.892  1.00 75.73  ? 109 ASP B CA    1 
ATOM 1952  C C     . ASP B 1 110 ? 103.932 85.769  23.933  1.00 76.98  ? 109 ASP B C     1 
ATOM 1953  O O     . ASP B 1 110 ? 102.796 85.656  24.396  1.00 79.89  ? 109 ASP B O     1 
ATOM 1954  C CB    . ASP B 1 110 ? 104.400 87.793  22.512  1.00 75.13  ? 109 ASP B CB    1 
ATOM 1955  C CG    . ASP B 1 110 ? 104.932 89.219  22.439  1.00 74.68  ? 109 ASP B CG    1 
ATOM 1956  O OD1   . ASP B 1 110 ? 104.978 89.908  23.483  1.00 76.23  ? 109 ASP B OD1   1 
ATOM 1957  O OD2   . ASP B 1 110 ? 105.303 89.656  21.330  1.00 73.08  ? 109 ASP B OD2   1 
ATOM 1958  N N     . GLU B 1 111 ? 104.634 84.730  23.461  1.00 91.14  ? 110 GLU B N     1 
ATOM 1959  C CA    . GLU B 1 111 ? 104.119 83.351  23.489  1.00 93.63  ? 110 GLU B CA    1 
ATOM 1960  C C     . GLU B 1 111 ? 103.749 82.938  24.901  1.00 95.27  ? 110 GLU B C     1 
ATOM 1961  O O     . GLU B 1 111 ? 102.634 82.487  25.158  1.00 98.86  ? 110 GLU B O     1 
ATOM 1962  C CB    . GLU B 1 111 ? 105.158 82.328  23.006  1.00 92.58  ? 110 GLU B CB    1 
ATOM 1963  C CG    . GLU B 1 111 ? 105.965 82.677  21.771  1.00 90.89  ? 110 GLU B CG    1 
ATOM 1964  C CD    . GLU B 1 111 ? 105.193 82.486  20.485  1.00 95.06  ? 110 GLU B CD    1 
ATOM 1965  O OE1   . GLU B 1 111 ? 105.063 81.324  20.030  1.00 97.78  ? 110 GLU B OE1   1 
ATOM 1966  O OE2   . GLU B 1 111 ? 104.721 83.502  19.928  1.00 96.11  ? 110 GLU B OE2   1 
ATOM 1967  N N     . MET B 1 112 ? 104.713 83.070  25.808  0.38 63.11  ? 111 MET B N     1 
ATOM 1968  C CA    . MET B 1 112 ? 104.550 82.577  27.164  0.90 63.45  ? 111 MET B CA    1 
ATOM 1969  C C     . MET B 1 112 ? 103.364 83.254  27.816  1.00 65.93  ? 111 MET B C     1 
ATOM 1970  O O     . MET B 1 112 ? 102.619 82.639  28.577  0.24 68.64  ? 111 MET B O     1 
ATOM 1971  C CB    . MET B 1 112 ? 105.810 82.821  27.980  1.00 59.37  ? 111 MET B CB    1 
ATOM 1972  N N     . GLU B 1 113 ? 103.195 84.530  27.501  1.00 65.37  ? 112 GLU B N     1 
ATOM 1973  C CA    . GLU B 1 113 ? 102.097 85.297  28.035  1.00 68.01  ? 112 GLU B CA    1 
ATOM 1974  C C     . GLU B 1 113 ? 100.827 84.687  27.507  1.00 72.91  ? 112 GLU B C     1 
ATOM 1975  O O     . GLU B 1 113 ? 99.941  84.326  28.273  1.00 75.96  ? 112 GLU B O     1 
ATOM 1976  C CB    . GLU B 1 113 ? 102.204 86.751  27.588  1.00 67.02  ? 112 GLU B CB    1 
ATOM 1977  C CG    . GLU B 1 113 ? 100.985 87.597  27.913  1.00 70.56  ? 112 GLU B CG    1 
ATOM 1978  C CD    . GLU B 1 113 ? 100.816 87.843  29.393  1.00 70.61  ? 112 GLU B CD    1 
ATOM 1979  O OE1   . GLU B 1 113 ? 99.770  88.401  29.790  1.00 73.98  ? 112 GLU B OE1   1 
ATOM 1980  O OE2   . GLU B 1 113 ? 101.731 87.487  30.160  1.00 68.52  ? 112 GLU B OE2   1 
ATOM 1981  N N     . GLN B 1 114 ? 100.749 84.564  26.187  1.00 85.75  ? 113 GLN B N     1 
ATOM 1982  C CA    . GLN B 1 114 ? 99.552  84.043  25.548  1.00 90.31  ? 113 GLN B CA    1 
ATOM 1983  C C     . GLN B 1 114 ? 99.245  82.644  26.064  1.00 92.86  ? 113 GLN B C     1 
ATOM 1984  O O     . GLN B 1 114 ? 98.132  82.376  26.499  1.00 97.24  ? 113 GLN B O     1 
ATOM 1985  C CB    . GLN B 1 114 ? 99.698  84.038  24.025  1.00 90.90  ? 113 GLN B CB    1 
ATOM 1986  N N     . THR B 1 115 ? 100.245 81.768  26.034  1.00 85.87  ? 114 THR B N     1 
ATOM 1987  C CA    . THR B 1 115 ? 100.082 80.401  26.506  1.00 88.30  ? 114 THR B CA    1 
ATOM 1988  C C     . THR B 1 115 ? 99.539  80.394  27.920  1.00 89.98  ? 114 THR B C     1 
ATOM 1989  O O     . THR B 1 115 ? 98.638  79.626  28.238  1.00 94.51  ? 114 THR B O     1 
ATOM 1990  C CB    . THR B 1 115 ? 101.408 79.644  26.502  1.00 85.76  ? 114 THR B CB    1 
ATOM 1991  O OG1   . THR B 1 115 ? 101.952 79.640  25.176  1.00 84.15  ? 114 THR B OG1   1 
ATOM 1992  C CG2   . THR B 1 115 ? 101.196 78.214  26.975  1.00 89.26  ? 114 THR B CG2   1 
ATOM 1993  N N     . LEU B 1 116 ? 100.092 81.255  28.766  1.00 78.82  ? 115 LEU B N     1 
ATOM 1994  C CA    . LEU B 1 116 ? 99.571  81.430  30.117  1.00 79.98  ? 115 LEU B CA    1 
ATOM 1995  C C     . LEU B 1 116 ? 98.128  81.906  30.059  1.00 84.66  ? 115 LEU B C     1 
ATOM 1996  O O     . LEU B 1 116 ? 97.219  81.201  30.480  1.00 89.04  ? 115 LEU B O     1 
ATOM 1997  C CB    . LEU B 1 116 ? 100.421 82.424  30.913  1.00 75.56  ? 115 LEU B CB    1 
ATOM 1998  C CG    . LEU B 1 116 ? 101.655 81.816  31.576  1.00 72.18  ? 115 LEU B CG    1 
ATOM 1999  C CD1   . LEU B 1 116 ? 102.301 82.808  32.509  1.00 69.02  ? 115 LEU B CD1   1 
ATOM 2000  C CD2   . LEU B 1 116 ? 101.298 80.530  32.311  1.00 75.14  ? 115 LEU B CD2   1 
ATOM 2001  N N     . VAL B 1 117 ? 97.913  83.091  29.497  1.00 84.21  ? 116 VAL B N     1 
ATOM 2002  C CA    . VAL B 1 117 ? 96.573  83.656  29.428  1.00 88.89  ? 116 VAL B CA    1 
ATOM 2003  C C     . VAL B 1 117 ? 95.650  82.845  28.522  1.00 94.02  ? 116 VAL B C     1 
ATOM 2004  O O     . VAL B 1 117 ? 94.521  83.242  28.282  1.00 98.54  ? 116 VAL B O     1 
ATOM 2005  C CB    . VAL B 1 117 ? 96.594  85.138  28.988  1.00 87.63  ? 116 VAL B CB    1 
ATOM 2006  C CG1   . VAL B 1 117 ? 97.635  85.905  29.782  1.00 82.73  ? 116 VAL B CG1   1 
ATOM 2007  C CG2   . VAL B 1 117 ? 96.882  85.257  27.511  1.00 87.12  ? 116 VAL B CG2   1 
ATOM 2008  N N     . SER B 1 118 ? 96.146  81.720  28.011  1.00 98.33  ? 117 SER B N     1 
ATOM 2009  C CA    . SER B 1 118 ? 95.311  80.745  27.318  1.00 103.80 ? 117 SER B CA    1 
ATOM 2010  C C     . SER B 1 118 ? 94.739  79.780  28.339  1.00 107.25 ? 117 SER B C     1 
ATOM 2011  O O     . SER B 1 118 ? 93.632  79.266  28.174  1.00 113.26 ? 117 SER B O     1 
ATOM 2012  C CB    . SER B 1 118 ? 96.111  79.961  26.275  1.00 102.49 ? 117 SER B CB    1 
ATOM 2013  O OG    . SER B 1 118 ? 96.177  80.658  25.044  1.00 102.11 ? 117 SER B OG    1 
ATOM 2014  N N     . GLN B 1 119 ? 95.495  79.551  29.408  1.00 113.10 ? 118 GLN B N     1 
ATOM 2015  C CA    . GLN B 1 119 ? 95.096  78.604  30.438  1.00 110.91 ? 118 GLN B CA    1 
ATOM 2016  C C     . GLN B 1 119 ? 93.797  79.006  31.126  1.00 111.82 ? 118 GLN B C     1 
ATOM 2017  O O     . GLN B 1 119 ? 93.171  78.183  31.789  1.00 111.34 ? 118 GLN B O     1 
ATOM 2018  C CB    . GLN B 1 119 ? 96.203  78.445  31.482  1.00 106.96 ? 118 GLN B CB    1 
ATOM 2019  C CG    . GLN B 1 119 ? 97.552  78.005  30.925  1.00 105.28 ? 118 GLN B CG    1 
ATOM 2020  C CD    . GLN B 1 119 ? 97.511  76.601  30.361  1.00 104.74 ? 118 GLN B CD    1 
ATOM 2021  O OE1   . GLN B 1 119 ? 96.611  75.819  30.681  1.00 104.93 ? 118 GLN B OE1   1 
ATOM 2022  N NE2   . GLN B 1 119 ? 98.480  76.273  29.505  1.00 103.86 ? 118 GLN B NE2   1 
ATOM 2023  N N     . LEU B 1 120 ? 93.396  80.267  30.981  1.00 118.62 ? 119 LEU B N     1 
ATOM 2024  C CA    . LEU B 1 120 ? 92.194  80.763  31.653  1.00 119.70 ? 119 LEU B CA    1 
ATOM 2025  C C     . LEU B 1 120 ? 91.253  81.564  30.747  1.00 126.91 ? 119 LEU B C     1 
ATOM 2026  O O     . LEU B 1 120 ? 91.563  81.840  29.589  1.00 130.07 ? 119 LEU B O     1 
ATOM 2027  C CB    . LEU B 1 120 ? 92.569  81.605  32.876  1.00 115.27 ? 119 LEU B CB    1 
ATOM 2028  C CG    . LEU B 1 120 ? 93.024  80.916  34.167  1.00 110.09 ? 119 LEU B CG    1 
ATOM 2029  C CD1   . LEU B 1 120 ? 94.413  80.307  34.056  1.00 107.83 ? 119 LEU B CD1   1 
ATOM 2030  C CD2   . LEU B 1 120 ? 93.002  81.910  35.303  1.00 107.09 ? 119 LEU B CD2   1 
ATOM 2031  N N     . SER B 1 121 ? 90.101  81.936  31.296  1.00 112.54 ? 120 SER B N     1 
ATOM 2032  C CA    . SER B 1 121 ? 89.111  82.722  30.570  1.00 119.83 ? 120 SER B CA    1 
ATOM 2033  C C     . SER B 1 121 ? 89.188  84.186  30.982  1.00 118.74 ? 120 SER B C     1 
ATOM 2034  O O     . SER B 1 121 ? 89.589  84.491  32.100  1.00 113.24 ? 120 SER B O     1 
ATOM 2035  C CB    . SER B 1 121 ? 87.710  82.179  30.834  1.00 125.09 ? 120 SER B CB    1 
ATOM 2036  O OG    . SER B 1 121 ? 87.448  82.131  32.222  1.00 121.41 ? 120 SER B OG    1 
ATOM 2037  N N     . GLU B 1 122 ? 88.787  85.081  30.080  1.00 162.94 ? 121 GLU B N     1 
ATOM 2038  C CA    . GLU B 1 122 ? 88.957  86.526  30.265  1.00 162.36 ? 121 GLU B CA    1 
ATOM 2039  C C     . GLU B 1 122 ? 88.476  87.020  31.626  1.00 160.11 ? 121 GLU B C     1 
ATOM 2040  O O     . GLU B 1 122 ? 89.103  87.889  32.231  1.00 155.83 ? 121 GLU B O     1 
ATOM 2041  C CB    . GLU B 1 122 ? 88.259  87.304  29.143  1.00 169.42 ? 121 GLU B CB    1 
ATOM 2042  C CG    . GLU B 1 122 ? 88.902  88.655  28.813  1.00 168.84 ? 121 GLU B CG    1 
ATOM 2043  C CD    . GLU B 1 122 ? 88.653  89.722  29.870  1.00 166.85 ? 121 GLU B CD    1 
ATOM 2044  O OE1   . GLU B 1 122 ? 87.545  89.752  30.448  1.00 170.09 ? 121 GLU B OE1   1 
ATOM 2045  O OE2   . GLU B 1 122 ? 89.569  90.533  30.123  1.00 162.36 ? 121 GLU B OE2   1 
ATOM 2046  N N     . GLU B 1 123 ? 87.368  86.461  32.102  1.00 133.48 ? 122 GLU B N     1 
ATOM 2047  C CA    . GLU B 1 123 ? 86.854  86.802  33.422  1.00 131.98 ? 122 GLU B CA    1 
ATOM 2048  C C     . GLU B 1 123 ? 87.889  86.452  34.493  1.00 123.35 ? 122 GLU B C     1 
ATOM 2049  O O     . GLU B 1 123 ? 88.118  87.225  35.423  1.00 120.25 ? 122 GLU B O     1 
ATOM 2050  C CB    . GLU B 1 123 ? 85.529  86.083  33.694  1.00 137.21 ? 122 GLU B CB    1 
ATOM 2051  N N     . GLU B 1 124 ? 88.523  85.293  34.347  1.00 116.06 ? 123 GLU B N     1 
ATOM 2052  C CA    . GLU B 1 124 ? 89.523  84.846  35.310  1.00 108.60 ? 123 GLU B CA    1 
ATOM 2053  C C     . GLU B 1 124 ? 90.782  85.713  35.236  1.00 104.00 ? 123 GLU B C     1 
ATOM 2054  O O     . GLU B 1 124 ? 91.207  86.285  36.245  1.00 99.98  ? 123 GLU B O     1 
ATOM 2055  C CB    . GLU B 1 124 ? 89.880  83.376  35.078  1.00 106.93 ? 123 GLU B CB    1 
ATOM 2056  C CG    . GLU B 1 124 ? 88.716  82.396  35.186  1.00 111.24 ? 123 GLU B CG    1 
ATOM 2057  C CD    . GLU B 1 124 ? 89.100  80.975  34.775  1.00 110.19 ? 123 GLU B CD    1 
ATOM 2058  O OE1   . GLU B 1 124 ? 89.094  80.678  33.557  1.00 113.74 ? 123 GLU B OE1   1 
ATOM 2059  O OE2   . GLU B 1 124 ? 89.408  80.157  35.671  1.00 106.18 ? 123 GLU B OE2   1 
ATOM 2060  N N     . ASN B 1 125 ? 91.302  85.897  34.033  1.00 107.12 ? 124 ASN B N     1 
ATOM 2061  C CA    . ASN B 1 125 ? 92.582  86.552  33.890  1.00 103.44 ? 124 ASN B CA    1 
ATOM 2062  C C     . ASN B 1 125 ? 92.515  87.936  34.493  1.00 102.39 ? 124 ASN B C     1 
ATOM 2063  O O     . ASN B 1 125 ? 93.450  88.362  35.162  1.00 98.02  ? 124 ASN B O     1 
ATOM 2064  C CB    . ASN B 1 125 ? 92.972  86.643  32.419  1.00 107.28 ? 124 ASN B CB    1 
ATOM 2065  C CG    . ASN B 1 125 ? 93.167  85.283  31.788  1.00 108.20 ? 124 ASN B CG    1 
ATOM 2066  O OD1   . ASN B 1 125 ? 92.442  84.338  32.088  1.00 108.54 ? 124 ASN B OD1   1 
ATOM 2067  N ND2   . ASN B 1 125 ? 94.152  85.177  30.909  1.00 109.78 ? 124 ASN B ND2   1 
ATOM 2068  N N     . GLU B 1 126 ? 91.415  88.644  34.277  1.00 106.14 ? 125 GLU B N     1 
ATOM 2069  C CA    . GLU B 1 126 ? 91.284  89.956  34.885  1.00 106.11 ? 125 GLU B CA    1 
ATOM 2070  C C     . GLU B 1 126 ? 91.261  89.882  36.412  1.00 102.08 ? 125 GLU B C     1 
ATOM 2071  O O     . GLU B 1 126 ? 91.960  90.639  37.080  1.00 98.35  ? 125 GLU B O     1 
ATOM 2072  C CB    . GLU B 1 126 ? 90.018  90.649  34.380  1.00 113.64 ? 125 GLU B CB    1 
ATOM 2073  N N     . GLN B 1 127 ? 90.472  88.964  36.965  1.00 158.41 ? 126 GLN B N     1 
ATOM 2074  C CA    . GLN B 1 127 ? 90.416  88.806  38.417  1.00 155.55 ? 126 GLN B CA    1 
ATOM 2075  C C     . GLN B 1 127 ? 91.731  88.287  38.971  1.00 148.80 ? 126 GLN B C     1 
ATOM 2076  O O     . GLN B 1 127 ? 92.265  88.791  39.955  1.00 145.43 ? 126 GLN B O     1 
ATOM 2077  C CB    . GLN B 1 127 ? 89.278  87.863  38.808  1.00 158.97 ? 126 GLN B CB    1 
ATOM 2078  N N     . MET B 1 128 ? 92.257  87.285  38.285  0.97 104.87 ? 127 MET B N     1 
ATOM 2079  C CA    . MET B 1 128 ? 93.563  86.696  38.587  0.64 99.20  ? 127 MET B CA    1 
ATOM 2080  C C     . MET B 1 128 ? 94.711  87.708  38.516  1.00 96.16  ? 127 MET B C     1 
ATOM 2081  O O     . MET B 1 128 ? 95.442  87.900  39.488  1.00 92.20  ? 127 MET B O     1 
ATOM 2082  C CB    . MET B 1 128 ? 93.828  85.514  37.648  1.00 99.45  ? 127 MET B CB    1 
ATOM 2083  C CG    . MET B 1 128 ? 95.280  85.249  37.362  1.00 96.92  ? 127 MET B CG    1 
ATOM 2084  S SD    . MET B 1 128 ? 96.154  84.774  38.848  1.00 90.53  ? 127 MET B SD    1 
ATOM 2085  C CE    . MET B 1 128 ? 96.574  83.075  38.446  1.00 90.00  ? 127 MET B CE    1 
ATOM 2086  N N     . LYS B 1 129 ? 94.854  88.357  37.366  1.00 83.44  ? 128 LYS B N     1 
ATOM 2087  C CA    . LYS B 1 129 ? 95.877  89.374  37.183  1.00 81.20  ? 128 LYS B CA    1 
ATOM 2088  C C     . LYS B 1 129 ? 95.631  90.566  38.106  1.00 81.05  ? 128 LYS B C     1 
ATOM 2089  O O     . LYS B 1 129 ? 96.572  91.191  38.587  1.00 77.61  ? 128 LYS B O     1 
ATOM 2090  C CB    . LYS B 1 129 ? 95.920  89.827  35.726  1.00 84.87  ? 128 LYS B CB    1 
ATOM 2091  C CG    . LYS B 1 129 ? 96.951  90.884  35.433  1.00 83.17  ? 128 LYS B CG    1 
ATOM 2092  C CD    . LYS B 1 129 ? 96.757  91.466  34.047  1.00 88.03  ? 128 LYS B CD    1 
ATOM 2093  C CE    . LYS B 1 129 ? 96.862  90.406  32.957  1.00 89.87  ? 128 LYS B CE    1 
ATOM 2094  N NZ    . LYS B 1 129 ? 98.255  89.932  32.737  1.00 86.89  ? 128 LYS B NZ    1 
ATOM 2095  N N     . ALA B 1 130 ? 94.367  90.874  38.367  1.00 95.62  ? 129 ALA B N     1 
ATOM 2096  C CA    . ALA B 1 130 ? 94.042  91.993  39.243  1.00 96.10  ? 129 ALA B CA    1 
ATOM 2097  C C     . ALA B 1 130 ? 94.246  91.614  40.701  1.00 92.78  ? 129 ALA B C     1 
ATOM 2098  O O     . ALA B 1 130 ? 94.509  92.471  41.539  1.00 91.42  ? 129 ALA B O     1 
ATOM 2099  C CB    . ALA B 1 130 ? 92.624  92.469  39.005  1.00 102.32 ? 129 ALA B CB    1 
ATOM 2100  N N     . ASN B 1 131 ? 94.115  90.326  41.001  1.00 81.55  ? 130 ASN B N     1 
ATOM 2101  C CA    . ASN B 1 131 ? 94.451  89.817  42.328  1.00 78.08  ? 130 ASN B CA    1 
ATOM 2102  C C     . ASN B 1 131 ? 95.970  89.875  42.540  1.00 72.95  ? 130 ASN B C     1 
ATOM 2103  O O     . ASN B 1 131 ? 96.446  90.273  43.611  1.00 70.66  ? 130 ASN B O     1 
ATOM 2104  C CB    . ASN B 1 131 ? 93.947  88.376  42.508  1.00 78.43  ? 130 ASN B CB    1 
ATOM 2105  C CG    . ASN B 1 131 ? 92.542  88.298  43.097  1.00 82.61  ? 130 ASN B CG    1 
ATOM 2106  O OD1   . ASN B 1 131 ? 91.898  89.314  43.368  1.00 85.48  ? 130 ASN B OD1   1 
ATOM 2107  N ND2   . ASN B 1 131 ? 92.059  87.074  43.290  1.00 83.29  ? 130 ASN B ND2   1 
ATOM 2108  N N     . LEU B 1 132 ? 96.718  89.475  41.508  1.00 72.18  ? 131 LEU B N     1 
ATOM 2109  C CA    . LEU B 1 132 ? 98.180  89.484  41.544  1.00 67.93  ? 131 LEU B CA    1 
ATOM 2110  C C     . LEU B 1 132 ? 98.720  90.870  41.867  1.00 67.15  ? 131 LEU B C     1 
ATOM 2111  O O     . LEU B 1 132 ? 99.548  91.033  42.769  1.00 64.10  ? 131 LEU B O     1 
ATOM 2112  C CB    . LEU B 1 132 ? 98.757  89.013  40.206  1.00 67.94  ? 131 LEU B CB    1 
ATOM 2113  C CG    . LEU B 1 132 ? 98.807  87.503  39.949  1.00 67.23  ? 131 LEU B CG    1 
ATOM 2114  C CD1   . LEU B 1 132 ? 99.409  87.210  38.584  1.00 68.66  ? 131 LEU B CD1   1 
ATOM 2115  C CD2   . LEU B 1 132 ? 99.603  86.792  41.037  1.00 63.19  ? 131 LEU B CD2   1 
ATOM 2116  N N     . THR B 1 133 ? 98.240  91.861  41.120  1.00 82.70  ? 132 THR B N     1 
ATOM 2117  C CA    . THR B 1 133 ? 98.612  93.256  41.328  1.00 82.45  ? 132 THR B CA    1 
ATOM 2118  C C     . THR B 1 133 ? 98.436  93.641  42.787  1.00 81.50  ? 132 THR B C     1 
ATOM 2119  O O     . THR B 1 133 ? 99.354  94.182  43.406  1.00 79.03  ? 132 THR B O     1 
ATOM 2120  C CB    . THR B 1 133 ? 97.770  94.211  40.453  1.00 86.74  ? 132 THR B CB    1 
ATOM 2121  O OG1   . THR B 1 133 ? 97.845  93.799  39.085  1.00 88.37  ? 132 THR B OG1   1 
ATOM 2122  C CG2   . THR B 1 133 ? 98.284  95.631  40.567  1.00 86.61  ? 132 THR B CG2   1 
ATOM 2123  N N     . LYS B 1 134 ? 97.261  93.338  43.330  1.00 89.31  ? 133 LYS B N     1 
ATOM 2124  C CA    . LYS B 1 134 ? 96.956  93.645  44.722  1.00 89.17  ? 133 LYS B CA    1 
ATOM 2125  C C     . LYS B 1 134 ? 97.999  93.044  45.666  1.00 85.11  ? 133 LYS B C     1 
ATOM 2126  O O     . LYS B 1 134 ? 98.491  93.713  46.579  1.00 84.10  ? 133 LYS B O     1 
ATOM 2127  C CB    . LYS B 1 134 ? 95.547  93.161  45.089  1.00 92.22  ? 133 LYS B CB    1 
ATOM 2128  N N     . MET B 1 135 ? 98.345  91.786  45.432  0.71 69.10  ? 134 MET B N     1 
ATOM 2129  C CA    . MET B 1 135 ? 99.317  91.115  46.276  0.97 65.65  ? 134 MET B CA    1 
ATOM 2130  C C     . MET B 1 135 ? 100.695 91.738  46.153  0.34 62.99  ? 134 MET B C     1 
ATOM 2131  O O     . MET B 1 135 ? 101.345 91.997  47.163  1.00 61.54  ? 134 MET B O     1 
ATOM 2132  C CB    . MET B 1 135 ? 99.385  89.637  45.936  1.00 64.61  ? 134 MET B CB    1 
ATOM 2133  C CG    . MET B 1 135 ? 98.146  88.866  46.315  1.00 67.08  ? 134 MET B CG    1 
ATOM 2134  S SD    . MET B 1 135 ? 98.342  87.115  45.938  1.00 65.91  ? 134 MET B SD    1 
ATOM 2135  C CE    . MET B 1 135 ? 97.493  86.395  47.333  1.00 67.27  ? 134 MET B CE    1 
ATOM 2136  N N     . LEU B 1 136 ? 101.137 91.972  44.920  1.00 59.42  ? 135 LEU B N     1 
ATOM 2137  C CA    . LEU B 1 136 ? 102.441 92.587  44.691  1.00 57.36  ? 135 LEU B CA    1 
ATOM 2138  C C     . LEU B 1 136 ? 102.594 93.869  45.499  1.00 57.83  ? 135 LEU B C     1 
ATOM 2139  O O     . LEU B 1 136 ? 103.606 94.062  46.163  1.00 55.88  ? 135 LEU B O     1 
ATOM 2140  C CB    . LEU B 1 136 ? 102.672 92.868  43.205  1.00 58.24  ? 135 LEU B CB    1 
ATOM 2141  C CG    . LEU B 1 136 ? 103.989 93.548  42.789  1.00 56.73  ? 135 LEU B CG    1 
ATOM 2142  C CD1   . LEU B 1 136 ? 105.208 92.939  43.450  1.00 53.57  ? 135 LEU B CD1   1 
ATOM 2143  C CD2   . LEU B 1 136 ? 104.153 93.480  41.280  1.00 57.96  ? 135 LEU B CD2   1 
ATOM 2144  N N     . SER B 1 137 ? 101.578 94.727  45.453  1.00 65.88  ? 136 SER B N     1 
ATOM 2145  C CA    . SER B 1 137 ? 101.617 95.996  46.162  1.00 66.87  ? 136 SER B CA    1 
ATOM 2146  C C     . SER B 1 137 ? 101.935 95.784  47.641  1.00 65.47  ? 136 SER B C     1 
ATOM 2147  O O     . SER B 1 137 ? 102.834 96.429  48.192  1.00 64.52  ? 136 SER B O     1 
ATOM 2148  C CB    . SER B 1 137 ? 100.290 96.745  45.998  1.00 70.69  ? 136 SER B CB    1 
ATOM 2149  N N     . SER B 1 138 ? 101.217 94.853  48.262  1.00 74.12  ? 137 SER B N     1 
ATOM 2150  C CA    . SER B 1 138 ? 101.316 94.621  49.699  1.00 74.19  ? 137 SER B CA    1 
ATOM 2151  C C     . SER B 1 138 ? 102.740 94.304  50.140  1.00 71.54  ? 137 SER B C     1 
ATOM 2152  O O     . SER B 1 138 ? 103.193 94.744  51.197  1.00 71.96  ? 137 SER B O     1 
ATOM 2153  C CB    . SER B 1 138 ? 100.382 93.493  50.119  1.00 75.12  ? 137 SER B CB    1 
ATOM 2154  O OG    . SER B 1 138 ? 100.953 92.238  49.832  1.00 72.61  ? 137 SER B OG    1 
ATOM 2155  N N     . LEU B 1 139 ? 103.447 93.536  49.328  1.00 61.37  ? 138 LEU B N     1 
ATOM 2156  C CA    . LEU B 1 139 ? 104.858 93.311  49.567  1.00 59.05  ? 138 LEU B CA    1 
ATOM 2157  C C     . LEU B 1 139 ? 105.618 94.624  49.360  1.00 59.09  ? 138 LEU B C     1 
ATOM 2158  O O     . LEU B 1 139 ? 106.296 95.105  50.266  1.00 59.13  ? 138 LEU B O     1 
ATOM 2159  C CB    . LEU B 1 139 ? 105.380 92.230  48.624  1.00 57.11  ? 138 LEU B CB    1 
ATOM 2160  C CG    . LEU B 1 139 ? 104.572 90.937  48.662  1.00 57.47  ? 138 LEU B CG    1 
ATOM 2161  C CD1   . LEU B 1 139 ? 105.016 90.025  47.557  1.00 56.22  ? 138 LEU B CD1   1 
ATOM 2162  C CD2   . LEU B 1 139 ? 104.710 90.252  50.002  1.00 57.26  ? 138 LEU B CD2   1 
ATOM 2163  N N     . GLN B 1 140 ? 105.480 95.200  48.167  1.00 93.42  ? 139 GLN B N     1 
ATOM 2164  C CA    . GLN B 1 140 ? 106.135 96.454  47.810  1.00 93.68  ? 139 GLN B CA    1 
ATOM 2165  C C     . GLN B 1 140 ? 105.733 97.575  48.760  1.00 95.76  ? 139 GLN B C     1 
ATOM 2166  O O     . GLN B 1 140 ? 106.357 97.769  49.800  1.00 95.53  ? 139 GLN B O     1 
ATOM 2167  C CB    . GLN B 1 140 ? 105.783 96.843  46.371  1.00 92.56  ? 139 GLN B CB    1 
ATOM 2168  C CG    . GLN B 1 140 ? 106.792 97.764  45.720  1.00 92.38  ? 139 GLN B CG    1 
ATOM 2169  C CD    . GLN B 1 140 ? 108.169 97.130  45.638  1.00 90.04  ? 139 GLN B CD    1 
ATOM 2170  O OE1   . GLN B 1 140 ? 108.317 95.997  45.167  1.00 88.90  ? 139 GLN B OE1   1 
ATOM 2171  N NE2   . GLN B 1 140 ? 109.187 97.852  46.112  1.00 89.66  ? 139 GLN B NE2   1 
ATOM 2172  N N     . GLU C 1 3   ? 66.866  73.842  64.340  1.00 127.78 ? 2   GLU C N     1 
ATOM 2173  C CA    . GLU C 1 3   ? 65.497  74.303  64.139  1.00 126.60 ? 2   GLU C CA    1 
ATOM 2174  C C     . GLU C 1 3   ? 65.431  75.809  63.853  1.00 121.85 ? 2   GLU C C     1 
ATOM 2175  O O     . GLU C 1 3   ? 65.139  76.229  62.728  1.00 121.88 ? 2   GLU C O     1 
ATOM 2176  C CB    . GLU C 1 3   ? 64.633  73.952  65.355  1.00 124.28 ? 2   GLU C CB    1 
ATOM 2177  N N     . PHE C 1 4   ? 65.718  76.615  64.872  1.00 115.12 ? 3   PHE C N     1 
ATOM 2178  C CA    . PHE C 1 4   ? 65.544  78.061  64.782  1.00 111.46 ? 3   PHE C CA    1 
ATOM 2179  C C     . PHE C 1 4   ? 66.817  78.802  64.385  1.00 109.11 ? 3   PHE C C     1 
ATOM 2180  O O     . PHE C 1 4   ? 67.919  78.404  64.778  1.00 109.78 ? 3   PHE C O     1 
ATOM 2181  C CB    . PHE C 1 4   ? 65.036  78.599  66.115  1.00 109.99 ? 3   PHE C CB    1 
ATOM 2182  C CG    . PHE C 1 4   ? 63.701  78.055  66.514  1.00 110.13 ? 3   PHE C CG    1 
ATOM 2183  C CD1   . PHE C 1 4   ? 62.556  78.439  65.842  1.00 109.40 ? 3   PHE C CD1   1 
ATOM 2184  C CD2   . PHE C 1 4   ? 63.587  77.165  67.566  1.00 111.27 ? 3   PHE C CD2   1 
ATOM 2185  C CE1   . PHE C 1 4   ? 61.322  77.943  66.207  1.00 111.40 ? 3   PHE C CE1   1 
ATOM 2186  C CE2   . PHE C 1 4   ? 62.355  76.665  67.937  1.00 113.34 ? 3   PHE C CE2   1 
ATOM 2187  C CZ    . PHE C 1 4   ? 61.220  77.057  67.254  1.00 113.41 ? 3   PHE C CZ    1 
ATOM 2188  N N     . THR C 1 5   ? 66.660  79.886  63.619  1.00 86.45  ? 4   THR C N     1 
ATOM 2189  C CA    . THR C 1 5   ? 67.807  80.714  63.249  1.00 83.76  ? 4   THR C CA    1 
ATOM 2190  C C     . THR C 1 5   ? 68.386  81.411  64.472  1.00 81.70  ? 4   THR C C     1 
ATOM 2191  O O     . THR C 1 5   ? 67.762  81.457  65.529  1.00 81.28  ? 4   THR C O     1 
ATOM 2192  C CB    . THR C 1 5   ? 67.464  81.808  62.212  1.00 82.20  ? 4   THR C CB    1 
ATOM 2193  O OG1   . THR C 1 5   ? 66.588  82.773  62.803  1.00 79.66  ? 4   THR C OG1   1 
ATOM 2194  C CG2   . THR C 1 5   ? 66.820  81.218  60.962  1.00 85.17  ? 4   THR C CG2   1 
ATOM 2195  N N     . TYR C 1 6   ? 69.582  81.966  64.312  1.00 108.54 ? 5   TYR C N     1 
ATOM 2196  C CA    . TYR C 1 6   ? 70.248  82.682  65.392  1.00 106.07 ? 5   TYR C CA    1 
ATOM 2197  C C     . TYR C 1 6   ? 69.501  83.942  65.821  1.00 102.94 ? 5   TYR C C     1 
ATOM 2198  O O     . TYR C 1 6   ? 69.336  84.176  67.020  1.00 101.56 ? 5   TYR C O     1 
ATOM 2199  C CB    . TYR C 1 6   ? 71.683  83.026  65.000  1.00 105.56 ? 5   TYR C CB    1 
ATOM 2200  C CG    . TYR C 1 6   ? 72.627  81.871  65.175  1.00 108.59 ? 5   TYR C CG    1 
ATOM 2201  C CD1   . TYR C 1 6   ? 72.432  80.949  66.193  1.00 110.17 ? 5   TYR C CD1   1 
ATOM 2202  C CD2   . TYR C 1 6   ? 73.708  81.692  64.323  1.00 110.65 ? 5   TYR C CD2   1 
ATOM 2203  C CE1   . TYR C 1 6   ? 73.286  79.886  66.363  1.00 113.12 ? 5   TYR C CE1   1 
ATOM 2204  C CE2   . TYR C 1 6   ? 74.571  80.628  64.486  1.00 114.10 ? 5   TYR C CE2   1 
ATOM 2205  C CZ    . TYR C 1 6   ? 74.353  79.729  65.510  1.00 115.23 ? 5   TYR C CZ    1 
ATOM 2206  O OH    . TYR C 1 6   ? 75.201  78.665  65.685  1.00 118.88 ? 5   TYR C OH    1 
ATOM 2207  N N     . SER C 1 7   ? 69.063  84.744  64.843  1.00 79.60  ? 6   SER C N     1 
ATOM 2208  C CA    . SER C 1 7   ? 68.327  85.983  65.112  1.00 76.65  ? 6   SER C CA    1 
ATOM 2209  C C     . SER C 1 7   ? 67.202  85.726  66.100  1.00 77.03  ? 6   SER C C     1 
ATOM 2210  O O     . SER C 1 7   ? 67.036  86.460  67.071  1.00 74.93  ? 6   SER C O     1 
ATOM 2211  C CB    . SER C 1 7   ? 67.748  86.576  63.824  1.00 76.64  ? 6   SER C CB    1 
ATOM 2212  O OG    . SER C 1 7   ? 66.391  86.193  63.631  1.00 78.07  ? 6   SER C OG    1 
ATOM 2213  N N     . TYR C 1 8   ? 66.451  84.657  65.845  1.00 70.07  ? 7   TYR C N     1 
ATOM 2214  C CA    . TYR C 1 8   ? 65.337  84.257  66.690  1.00 71.45  ? 7   TYR C CA    1 
ATOM 2215  C C     . TYR C 1 8   ? 65.827  83.804  68.054  1.00 71.52  ? 7   TYR C C     1 
ATOM 2216  O O     . TYR C 1 8   ? 65.395  84.325  69.091  1.00 70.11  ? 7   TYR C O     1 
ATOM 2217  C CB    . TYR C 1 8   ? 64.580  83.125  66.024  1.00 75.05  ? 7   TYR C CB    1 
ATOM 2218  C CG    . TYR C 1 8   ? 63.495  82.531  66.871  1.00 77.37  ? 7   TYR C CG    1 
ATOM 2219  C CD1   . TYR C 1 8   ? 62.243  83.117  66.932  1.00 77.08  ? 7   TYR C CD1   1 
ATOM 2220  C CD2   . TYR C 1 8   ? 63.714  81.372  67.594  1.00 79.40  ? 7   TYR C CD2   1 
ATOM 2221  C CE1   . TYR C 1 8   ? 61.232  82.565  67.690  1.00 77.13  ? 7   TYR C CE1   1 
ATOM 2222  C CE2   . TYR C 1 8   ? 62.713  80.810  68.360  1.00 79.70  ? 7   TYR C CE2   1 
ATOM 2223  C CZ    . TYR C 1 8   ? 61.470  81.410  68.406  1.00 78.50  ? 7   TYR C CZ    1 
ATOM 2224  O OH    . TYR C 1 8   ? 60.469  80.857  69.175  1.00 78.78  ? 7   TYR C OH    1 
ATOM 2225  N N     . LEU C 1 9   ? 66.720  82.820  68.047  1.00 71.55  ? 8   LEU C N     1 
ATOM 2226  C CA    . LEU C 1 9   ? 67.308  82.330  69.284  1.00 71.70  ? 8   LEU C CA    1 
ATOM 2227  C C     . LEU C 1 9   ? 67.827  83.511  70.124  1.00 68.17  ? 8   LEU C C     1 
ATOM 2228  O O     . LEU C 1 9   ? 67.541  83.607  71.318  1.00 67.42  ? 8   LEU C O     1 
ATOM 2229  C CB    . LEU C 1 9   ? 68.406  81.290  69.002  1.00 73.99  ? 8   LEU C CB    1 
ATOM 2230  N N     . PHE C 1 10  ? 68.535  84.436  69.483  1.00 71.63  ? 9   PHE C N     1 
ATOM 2231  C CA    . PHE C 1 10  ? 69.106  85.584  70.190  1.00 68.45  ? 9   PHE C CA    1 
ATOM 2232  C C     . PHE C 1 10  ? 68.084  86.628  70.661  1.00 66.65  ? 9   PHE C C     1 
ATOM 2233  O O     . PHE C 1 10  ? 68.274  87.255  71.706  1.00 64.69  ? 9   PHE C O     1 
ATOM 2234  C CB    . PHE C 1 10  ? 70.176  86.261  69.337  1.00 67.16  ? 9   PHE C CB    1 
ATOM 2235  C CG    . PHE C 1 10  ? 71.500  85.576  69.380  1.00 68.54  ? 9   PHE C CG    1 
ATOM 2236  C CD1   . PHE C 1 10  ? 71.898  84.886  70.507  1.00 69.48  ? 9   PHE C CD1   1 
ATOM 2237  C CD2   . PHE C 1 10  ? 72.350  85.619  68.294  1.00 69.14  ? 9   PHE C CD2   1 
ATOM 2238  C CE1   . PHE C 1 10  ? 73.126  84.256  70.550  1.00 71.07  ? 9   PHE C CE1   1 
ATOM 2239  C CE2   . PHE C 1 10  ? 73.578  84.986  68.329  1.00 70.82  ? 9   PHE C CE2   1 
ATOM 2240  C CZ    . PHE C 1 10  ? 73.966  84.307  69.458  1.00 71.82  ? 9   PHE C CZ    1 
ATOM 2241  N N     . ARG C 1 11  ? 67.019  86.827  69.886  1.00 74.89  ? 10  ARG C N     1 
ATOM 2242  C CA    . ARG C 1 11  ? 65.987  87.790  70.254  1.00 73.51  ? 10  ARG C CA    1 
ATOM 2243  C C     . ARG C 1 11  ? 65.201  87.304  71.454  1.00 74.56  ? 10  ARG C C     1 
ATOM 2244  O O     . ARG C 1 11  ? 65.161  87.973  72.482  1.00 73.08  ? 10  ARG C O     1 
ATOM 2245  C CB    . ARG C 1 11  ? 65.023  88.040  69.095  1.00 74.28  ? 10  ARG C CB    1 
ATOM 2246  C CG    . ARG C 1 11  ? 65.311  89.299  68.297  1.00 71.93  ? 10  ARG C CG    1 
ATOM 2247  C CD    . ARG C 1 11  ? 64.242  89.551  67.248  1.00 72.76  ? 10  ARG C CD    1 
ATOM 2248  N NE    . ARG C 1 11  ? 64.209  88.516  66.219  1.00 75.36  ? 10  ARG C NE    1 
ATOM 2249  C CZ    . ARG C 1 11  ? 63.143  87.769  65.949  1.00 77.99  ? 10  ARG C CZ    1 
ATOM 2250  N NH1   . ARG C 1 11  ? 62.023  87.955  66.641  1.00 78.68  ? 10  ARG C NH1   1 
ATOM 2251  N NH2   . ARG C 1 11  ? 63.191  86.844  64.984  1.00 79.91  ? 10  ARG C NH2   1 
ATOM 2252  N N     . MET C 1 12  ? 64.576  86.137  71.322  0.79 79.80  ? 11  MET C N     1 
ATOM 2253  C CA    . MET C 1 12  ? 63.688  85.631  72.363  1.00 80.90  ? 11  MET C CA    1 
ATOM 2254  C C     . MET C 1 12  ? 64.384  85.579  73.712  0.78 79.77  ? 11  MET C C     1 
ATOM 2255  O O     . MET C 1 12  ? 63.788  85.894  74.738  1.00 79.31  ? 11  MET C O     1 
ATOM 2256  C CB    . MET C 1 12  ? 63.144  84.252  72.000  1.00 84.03  ? 11  MET C CB    1 
ATOM 2257  C CG    . MET C 1 12  ? 62.254  84.243  70.780  1.00 85.65  ? 11  MET C CG    1 
ATOM 2258  S SD    . MET C 1 12  ? 60.901  85.434  70.867  1.00 84.92  ? 11  MET C SD    1 
ATOM 2259  C CE    . MET C 1 12  ? 61.133  86.263  69.285  1.00 83.98  ? 11  MET C CE    1 
ATOM 2260  N N     . ILE C 1 13  ? 65.657  85.201  73.695  1.00 68.82  ? 12  ILE C N     1 
ATOM 2261  C CA    . ILE C 1 13  ? 66.430  85.076  74.919  1.00 68.09  ? 12  ILE C CA    1 
ATOM 2262  C C     . ILE C 1 13  ? 66.571  86.420  75.626  1.00 65.38  ? 12  ILE C C     1 
ATOM 2263  O O     . ILE C 1 13  ? 66.192  86.550  76.798  1.00 65.33  ? 12  ILE C O     1 
ATOM 2264  C CB    . ILE C 1 13  ? 67.824  84.485  74.656  1.00 68.79  ? 12  ILE C CB    1 
ATOM 2265  C CG1   . ILE C 1 13  ? 67.731  82.988  74.394  1.00 72.25  ? 12  ILE C CG1   1 
ATOM 2266  C CG2   . ILE C 1 13  ? 68.730  84.701  75.852  1.00 67.49  ? 12  ILE C CG2   1 
ATOM 2267  C CD1   . ILE C 1 13  ? 69.081  82.332  74.302  1.00 73.63  ? 12  ILE C CD1   1 
ATOM 2268  N N     . SER C 1 14  ? 67.112  87.411  74.911  1.00 52.75  ? 13  SER C N     1 
ATOM 2269  C CA    . SER C 1 14  ? 67.254  88.772  75.437  1.00 50.01  ? 13  SER C CA    1 
ATOM 2270  C C     . SER C 1 14  ? 65.950  89.340  75.972  1.00 49.40  ? 13  SER C C     1 
ATOM 2271  O O     . SER C 1 14  ? 65.900  89.854  77.091  1.00 48.46  ? 13  SER C O     1 
ATOM 2272  C CB    . SER C 1 14  ? 67.790  89.705  74.365  1.00 48.38  ? 13  SER C CB    1 
ATOM 2273  O OG    . SER C 1 14  ? 69.192  89.602  74.281  1.00 48.39  ? 13  SER C OG    1 
ATOM 2274  N N     . HIS C 1 15  ? 64.903  89.250  75.162  1.00 52.31  ? 14  HIS C N     1 
ATOM 2275  C CA    . HIS C 1 15  ? 63.606  89.738  75.568  1.00 52.58  ? 14  HIS C CA    1 
ATOM 2276  C C     . HIS C 1 15  ? 63.256  89.152  76.922  1.00 53.40  ? 14  HIS C C     1 
ATOM 2277  O O     . HIS C 1 15  ? 62.865  89.881  77.838  1.00 52.53  ? 14  HIS C O     1 
ATOM 2278  C CB    . HIS C 1 15  ? 62.538  89.376  74.543  1.00 54.42  ? 14  HIS C CB    1 
ATOM 2279  C CG    . HIS C 1 15  ? 61.259  90.128  74.730  1.00 54.45  ? 14  HIS C CG    1 
ATOM 2280  N ND1   . HIS C 1 15  ? 61.217  91.501  74.841  1.00 52.69  ? 14  HIS C ND1   1 
ATOM 2281  C CD2   . HIS C 1 15  ? 59.978  89.703  74.838  1.00 55.91  ? 14  HIS C CD2   1 
ATOM 2282  C CE1   . HIS C 1 15  ? 59.967  91.890  75.006  1.00 53.17  ? 14  HIS C CE1   1 
ATOM 2283  N NE2   . HIS C 1 15  ? 59.195  90.819  75.008  1.00 54.93  ? 14  HIS C NE2   1 
ATOM 2284  N N     . GLU C 1 16  ? 63.434  87.838  77.052  1.00 74.75  ? 15  GLU C N     1 
ATOM 2285  C CA    . GLU C 1 16  ? 63.128  87.134  78.291  1.00 75.80  ? 15  GLU C CA    1 
ATOM 2286  C C     . GLU C 1 16  ? 63.971  87.587  79.472  1.00 74.35  ? 15  GLU C C     1 
ATOM 2287  O O     . GLU C 1 16  ? 63.428  87.918  80.524  1.00 74.23  ? 15  GLU C O     1 
ATOM 2288  C CB    . GLU C 1 16  ? 63.251  85.628  78.099  1.00 78.12  ? 15  GLU C CB    1 
ATOM 2289  C CG    . GLU C 1 16  ? 62.088  85.054  77.345  1.00 80.16  ? 15  GLU C CG    1 
ATOM 2290  C CD    . GLU C 1 16  ? 60.774  85.667  77.782  1.00 80.26  ? 15  GLU C CD    1 
ATOM 2291  O OE1   . GLU C 1 16  ? 60.377  85.427  78.946  1.00 80.57  ? 15  GLU C OE1   1 
ATOM 2292  O OE2   . GLU C 1 16  ? 60.153  86.394  76.969  1.00 80.06  ? 15  GLU C OE2   1 
ATOM 2293  N N     . MET C 1 17  ? 65.288  87.601  79.301  1.00 55.99  ? 16  MET C N     1 
ATOM 2294  C CA    . MET C 1 17  ? 66.180  88.026  80.364  0.31 54.73  ? 16  MET C CA    1 
ATOM 2295  C C     . MET C 1 17  ? 65.740  89.379  80.864  1.00 53.00  ? 16  MET C C     1 
ATOM 2296  O O     . MET C 1 17  ? 65.722  89.637  82.067  0.22 52.76  ? 16  MET C O     1 
ATOM 2297  C CB    . MET C 1 17  ? 67.608  88.130  79.857  1.00 53.81  ? 16  MET C CB    1 
ATOM 2298  C CG    . MET C 1 17  ? 68.179  86.838  79.357  1.00 55.71  ? 16  MET C CG    1 
ATOM 2299  S SD    . MET C 1 17  ? 69.975  86.851  79.475  1.00 55.11  ? 16  MET C SD    1 
ATOM 2300  C CE    . MET C 1 17  ? 70.193  87.237  81.227  1.00 54.60  ? 16  MET C CE    1 
ATOM 2301  N N     . LYS C 1 18  ? 65.373  90.241  79.921  1.00 56.17  ? 17  LYS C N     1 
ATOM 2302  C CA    . LYS C 1 18  ? 64.881  91.563  80.255  1.00 54.78  ? 17  LYS C CA    1 
ATOM 2303  C C     . LYS C 1 18  ? 63.585  91.415  81.052  1.00 56.08  ? 17  LYS C C     1 
ATOM 2304  O O     . LYS C 1 18  ? 63.476  91.932  82.165  1.00 55.67  ? 17  LYS C O     1 
ATOM 2305  C CB    . LYS C 1 18  ? 64.665  92.394  78.991  1.00 53.87  ? 17  LYS C CB    1 
ATOM 2306  N N     . GLN C 1 19  ? 62.618  90.685  80.508  1.00 65.50  ? 18  GLN C N     1 
ATOM 2307  C CA    . GLN C 1 19  ? 61.366  90.481  81.219  1.00 66.85  ? 18  GLN C CA    1 
ATOM 2308  C C     . GLN C 1 19  ? 61.593  89.838  82.593  1.00 67.62  ? 18  GLN C C     1 
ATOM 2309  O O     . GLN C 1 19  ? 60.931  90.196  83.570  1.00 67.93  ? 18  GLN C O     1 
ATOM 2310  C CB    . GLN C 1 19  ? 60.369  89.697  80.363  1.00 68.62  ? 18  GLN C CB    1 
ATOM 2311  C CG    . GLN C 1 19  ? 59.924  90.437  79.104  1.00 68.09  ? 18  GLN C CG    1 
ATOM 2312  C CD    . GLN C 1 19  ? 59.140  91.693  79.433  1.00 67.24  ? 18  GLN C CD    1 
ATOM 2313  O OE1   . GLN C 1 19  ? 59.681  92.810  79.402  1.00 65.57  ? 18  GLN C OE1   1 
ATOM 2314  N NE2   . GLN C 1 19  ? 57.847  91.525  79.734  1.00 68.51  ? 18  GLN C NE2   1 
ATOM 2315  N N     . LYS C 1 20  ? 62.543  88.911  82.679  1.00 53.85  ? 19  LYS C N     1 
ATOM 2316  C CA    . LYS C 1 20  ? 62.876  88.297  83.962  1.00 55.38  ? 19  LYS C CA    1 
ATOM 2317  C C     . LYS C 1 20  ? 63.439  89.326  84.923  1.00 53.51  ? 19  LYS C C     1 
ATOM 2318  O O     . LYS C 1 20  ? 62.993  89.432  86.072  1.00 54.50  ? 19  LYS C O     1 
ATOM 2319  C CB    . LYS C 1 20  ? 63.889  87.169  83.760  1.00 56.64  ? 19  LYS C CB    1 
ATOM 2320  N N     . ALA C 1 21  ? 64.410  90.096  84.438  1.00 51.05  ? 20  ALA C N     1 
ATOM 2321  C CA    . ALA C 1 21  ? 65.069  91.089  85.274  1.00 49.38  ? 20  ALA C CA    1 
ATOM 2322  C C     . ALA C 1 21  ? 64.113  92.199  85.705  1.00 48.58  ? 20  ALA C C     1 
ATOM 2323  O O     . ALA C 1 21  ? 64.126  92.607  86.870  1.00 48.77  ? 20  ALA C O     1 
ATOM 2324  C CB    . ALA C 1 21  ? 66.268  91.657  84.574  1.00 47.29  ? 20  ALA C CB    1 
ATOM 2325  N N     . ASP C 1 22  ? 63.298  92.677  84.760  1.00 52.85  ? 21  ASP C N     1 
ATOM 2326  C CA    . ASP C 1 22  ? 62.287  93.692  85.034  1.00 52.76  ? 21  ASP C CA    1 
ATOM 2327  C C     . ASP C 1 22  ? 61.434  93.251  86.199  1.00 54.44  ? 21  ASP C C     1 
ATOM 2328  O O     . ASP C 1 22  ? 61.310  93.960  87.195  1.00 54.29  ? 21  ASP C O     1 
ATOM 2329  C CB    . ASP C 1 22  ? 61.360  93.862  83.842  1.00 53.09  ? 21  ASP C CB    1 
ATOM 2330  C CG    . ASP C 1 22  ? 61.849  94.904  82.847  1.00 51.40  ? 21  ASP C CG    1 
ATOM 2331  O OD1   . ASP C 1 22  ? 62.830  95.614  83.178  1.00 49.89  ? 21  ASP C OD1   1 
ATOM 2332  O OD2   . ASP C 1 22  ? 61.230  95.012  81.740  1.00 51.70  ? 21  ASP C OD2   1 
ATOM 2333  N N     . GLN C 1 23  ? 60.848  92.066  86.057  1.00 62.96  ? 22  GLN C N     1 
ATOM 2334  C CA    . GLN C 1 23  ? 59.926  91.518  87.040  1.00 64.89  ? 22  GLN C CA    1 
ATOM 2335  C C     . GLN C 1 23  ? 60.568  91.456  88.414  1.00 65.04  ? 22  GLN C C     1 
ATOM 2336  O O     . GLN C 1 23  ? 59.961  91.856  89.400  1.00 65.79  ? 22  GLN C O     1 
ATOM 2337  C CB    . GLN C 1 23  ? 59.446  90.128  86.611  1.00 66.75  ? 22  GLN C CB    1 
ATOM 2338  N N     . LYS C 1 24  ? 61.800  90.970  88.482  1.00 54.99  ? 23  LYS C N     1 
ATOM 2339  C CA    . LYS C 1 24  ? 62.484  90.894  89.767  1.00 55.61  ? 23  LYS C CA    1 
ATOM 2340  C C     . LYS C 1 24  ? 62.751  92.287  90.300  1.00 53.60  ? 23  LYS C C     1 
ATOM 2341  O O     . LYS C 1 24  ? 62.424  92.587  91.449  1.00 54.71  ? 23  LYS C O     1 
ATOM 2342  C CB    . LYS C 1 24  ? 63.775  90.076  89.670  1.00 55.68  ? 23  LYS C CB    1 
ATOM 2343  C CG    . LYS C 1 24  ? 63.510  88.573  89.612  1.00 58.66  ? 23  LYS C CG    1 
ATOM 2344  C CD    . LYS C 1 24  ? 64.710  87.779  89.136  1.00 58.76  ? 23  LYS C CD    1 
ATOM 2345  C CE    . LYS C 1 24  ? 64.400  86.292  89.118  1.00 62.09  ? 23  LYS C CE    1 
ATOM 2346  N NZ    . LYS C 1 24  ? 65.638  85.487  88.925  1.00 62.79  ? 23  LYS C NZ    1 
ATOM 2347  N N     . LEU C 1 25  ? 63.302  93.144  89.444  1.00 50.89  ? 24  LEU C N     1 
ATOM 2348  C CA    . LEU C 1 25  ? 63.652  94.509  89.823  1.00 49.17  ? 24  LEU C CA    1 
ATOM 2349  C C     . LEU C 1 25  ? 62.456  95.410  90.142  1.00 49.64  ? 24  LEU C C     1 
ATOM 2350  O O     . LEU C 1 25  ? 62.659  96.540  90.572  1.00 48.78  ? 24  LEU C O     1 
ATOM 2351  C CB    . LEU C 1 25  ? 64.496  95.172  88.733  1.00 47.15  ? 24  LEU C CB    1 
ATOM 2352  C CG    . LEU C 1 25  ? 65.889  94.606  88.529  1.00 46.49  ? 24  LEU C CG    1 
ATOM 2353  C CD1   . LEU C 1 25  ? 66.546  95.209  87.323  1.00 44.77  ? 24  LEU C CD1   1 
ATOM 2354  C CD2   . LEU C 1 25  ? 66.690  94.907  89.741  1.00 46.36  ? 24  LEU C CD2   1 
ATOM 2355  N N     . GLU C 1 26  ? 61.229  94.931  89.940  1.00 51.15  ? 25  GLU C N     1 
ATOM 2356  C CA    . GLU C 1 26  ? 60.043  95.767  90.165  1.00 51.87  ? 25  GLU C CA    1 
ATOM 2357  C C     . GLU C 1 26  ? 60.025  96.352  91.571  1.00 52.73  ? 25  GLU C C     1 
ATOM 2358  O O     . GLU C 1 26  ? 59.631  97.500  91.768  1.00 52.25  ? 25  GLU C O     1 
ATOM 2359  C CB    . GLU C 1 26  ? 58.738  94.998  89.899  1.00 54.41  ? 25  GLU C CB    1 
ATOM 2360  N N     . GLN C 1 27  ? 60.477  95.567  92.541  1.00 65.74  ? 26  GLN C N     1 
ATOM 2361  C CA    . GLN C 1 27  ? 60.505  96.014  93.926  1.00 66.54  ? 26  GLN C CA    1 
ATOM 2362  C C     . GLN C 1 27  ? 61.492  97.160  94.162  1.00 64.80  ? 26  GLN C C     1 
ATOM 2363  O O     . GLN C 1 27  ? 61.393  97.860  95.165  1.00 65.37  ? 26  GLN C O     1 
ATOM 2364  C CB    . GLN C 1 27  ? 60.844  94.848  94.847  1.00 68.37  ? 26  GLN C CB    1 
ATOM 2365  C CG    . GLN C 1 27  ? 62.323  94.611  94.981  1.00 67.04  ? 26  GLN C CG    1 
ATOM 2366  C CD    . GLN C 1 27  ? 62.655  93.252  95.562  1.00 69.42  ? 26  GLN C CD    1 
ATOM 2367  O OE1   . GLN C 1 27  ? 62.658  93.060  96.793  1.00 71.52  ? 26  GLN C OE1   1 
ATOM 2368  N NE2   . GLN C 1 27  ? 62.943  92.290  94.674  1.00 69.36  ? 26  GLN C NE2   1 
ATOM 2369  N N     . PHE C 1 28  ? 62.442  97.354  93.249  1.00 53.89  ? 27  PHE C N     1 
ATOM 2370  C CA    . PHE C 1 28  ? 63.442  98.400  93.408  1.00 52.29  ? 27  PHE C CA    1 
ATOM 2371  C C     . PHE C 1 28  ? 63.108  99.655  92.615  1.00 51.22  ? 27  PHE C C     1 
ATOM 2372  O O     . PHE C 1 28  ? 63.851  100.632 92.678  1.00 50.02  ? 27  PHE C O     1 
ATOM 2373  C CB    . PHE C 1 28  ? 64.816  97.902  92.975  1.00 51.00  ? 27  PHE C CB    1 
ATOM 2374  C CG    . PHE C 1 28  ? 65.355  96.787  93.819  1.00 52.14  ? 27  PHE C CG    1 
ATOM 2375  C CD1   . PHE C 1 28  ? 66.025  97.053  94.997  1.00 52.47  ? 27  PHE C CD1   1 
ATOM 2376  C CD2   . PHE C 1 28  ? 65.206  95.467  93.428  1.00 53.10  ? 27  PHE C CD2   1 
ATOM 2377  C CE1   . PHE C 1 28  ? 66.523  96.019  95.777  1.00 53.77  ? 27  PHE C CE1   1 
ATOM 2378  C CE2   . PHE C 1 28  ? 65.707  94.431  94.207  1.00 54.40  ? 27  PHE C CE2   1 
ATOM 2379  C CZ    . PHE C 1 28  ? 66.368  94.710  95.375  1.00 54.74  ? 27  PHE C CZ    1 
ATOM 2380  N N     . ASP C 1 29  ? 62.007  99.619  91.866  1.00 58.03  ? 28  ASP C N     1 
ATOM 2381  C CA    . ASP C 1 29  ? 61.578  100.726 91.009  1.00 57.50  ? 28  ASP C CA    1 
ATOM 2382  C C     . ASP C 1 29  ? 62.661  101.134 90.003  1.00 55.30  ? 28  ASP C C     1 
ATOM 2383  O O     . ASP C 1 29  ? 62.936  102.309 89.798  1.00 54.45  ? 28  ASP C O     1 
ATOM 2384  C CB    . ASP C 1 29  ? 61.090  101.916 91.850  1.00 57.63  ? 28  ASP C CB    1 
ATOM 2385  C CG    . ASP C 1 29  ? 60.269  102.937 91.037  1.00 57.79  ? 28  ASP C CG    1 
ATOM 2386  O OD1   . ASP C 1 29  ? 59.838  102.630 89.888  1.00 57.53  ? 28  ASP C OD1   1 
ATOM 2387  O OD2   . ASP C 1 29  ? 60.053  104.059 91.560  1.00 58.37  ? 28  ASP C OD2   1 
ATOM 2388  N N     . ILE C 1 30  ? 63.289  100.142 89.391  1.00 42.94  ? 29  ILE C N     1 
ATOM 2389  C CA    . ILE C 1 30  ? 64.187  100.374 88.265  1.00 40.95  ? 29  ILE C CA    1 
ATOM 2390  C C     . ILE C 1 30  ? 63.953  99.350  87.166  1.00 41.13  ? 29  ILE C C     1 
ATOM 2391  O O     . ILE C 1 30  ? 63.484  98.243  87.404  1.00 42.74  ? 29  ILE C O     1 
ATOM 2392  C CB    . ILE C 1 30  ? 65.663  100.293 88.654  1.00 40.17  ? 29  ILE C CB    1 
ATOM 2393  C CG1   . ILE C 1 30  ? 65.987  98.904  89.204  1.00 41.59  ? 29  ILE C CG1   1 
ATOM 2394  C CG2   . ILE C 1 30  ? 66.025  101.406 89.607  1.00 39.93  ? 29  ILE C CG2   1 
ATOM 2395  C CD1   . ILE C 1 30  ? 67.438  98.660  89.416  1.00 41.15  ? 29  ILE C CD1   1 
ATOM 2396  N N     . THR C 1 31  ? 64.281  99.719  85.946  1.00 40.45  ? 30  THR C N     1 
ATOM 2397  C CA    . THR C 1 31  ? 64.156  98.766  84.878  1.00 40.74  ? 30  THR C CA    1 
ATOM 2398  C C     . THR C 1 31  ? 65.467  98.030  84.766  1.00 39.95  ? 30  THR C C     1 
ATOM 2399  O O     . THR C 1 31  ? 66.461  98.421  85.367  1.00 39.03  ? 30  THR C O     1 
ATOM 2400  C CB    . THR C 1 31  ? 63.872  99.447  83.565  1.00 40.20  ? 30  THR C CB    1 
ATOM 2401  O OG1   . THR C 1 31  ? 65.101  99.919  83.034  1.00 38.49  ? 30  THR C OG1   1 
ATOM 2402  C CG2   . THR C 1 31  ? 62.932  100.610 83.777  1.00 40.66  ? 30  THR C CG2   1 
ATOM 2403  N N     . ASN C 1 32  ? 65.461  96.952  84.002  1.00 49.97  ? 31  ASN C N     1 
ATOM 2404  C CA    . ASN C 1 32  ? 66.659  96.184  83.753  1.00 49.61  ? 31  ASN C CA    1 
ATOM 2405  C C     . ASN C 1 32  ? 67.799  97.066  83.223  1.00 47.80  ? 31  ASN C C     1 
ATOM 2406  O O     . ASN C 1 32  ? 68.949  96.962  83.653  1.00 47.37  ? 31  ASN C O     1 
ATOM 2407  C CB    . ASN C 1 32  ? 66.317  95.098  82.741  1.00 50.67  ? 31  ASN C CB    1 
ATOM 2408  C CG    . ASN C 1 32  ? 67.529  94.589  82.015  1.00 50.22  ? 31  ASN C CG    1 
ATOM 2409  O OD1   . ASN C 1 32  ? 68.364  93.881  82.603  1.00 50.72  ? 31  ASN C OD1   1 
ATOM 2410  N ND2   . ASN C 1 32  ? 67.650  94.949  80.727  1.00 49.49  ? 31  ASN C ND2   1 
ATOM 2411  N N     . GLU C 1 33  ? 67.455  97.941  82.288  1.00 42.87  ? 32  GLU C N     1 
ATOM 2412  C CA    . GLU C 1 33  ? 68.414  98.805  81.628  1.00 41.28  ? 32  GLU C CA    1 
ATOM 2413  C C     . GLU C 1 33  ? 69.011  99.776  82.624  1.00 40.40  ? 32  GLU C C     1 
ATOM 2414  O O     . GLU C 1 33  ? 70.177  100.133 82.528  1.00 39.45  ? 32  GLU C O     1 
ATOM 2415  C CB    . GLU C 1 33  ? 67.729  99.578  80.496  1.00 40.90  ? 32  GLU C CB    1 
ATOM 2416  C CG    . GLU C 1 33  ? 67.404  98.774  79.229  1.00 41.53  ? 32  GLU C CG    1 
ATOM 2417  C CD    . GLU C 1 33  ? 66.319  97.716  79.445  1.00 43.38  ? 32  GLU C CD    1 
ATOM 2418  O OE1   . GLU C 1 33  ? 65.444  97.931  80.313  1.00 44.17  ? 32  GLU C OE1   1 
ATOM 2419  O OE2   . GLU C 1 33  ? 66.345  96.657  78.763  1.00 44.26  ? 32  GLU C OE2   1 
ATOM 2420  N N     . GLN C 1 34  ? 68.214  100.218 83.584  1.00 35.77  ? 33  GLN C N     1 
ATOM 2421  C CA    . GLN C 1 34  ? 68.732  101.109 84.607  1.00 35.41  ? 33  GLN C CA    1 
ATOM 2422  C C     . GLN C 1 34  ? 69.587  100.337 85.592  1.00 36.25  ? 33  GLN C C     1 
ATOM 2423  O O     . GLN C 1 34  ? 70.592  100.836 86.071  1.00 35.99  ? 33  GLN C O     1 
ATOM 2424  C CB    . GLN C 1 34  ? 67.601  101.816 85.314  1.00 35.73  ? 33  GLN C CB    1 
ATOM 2425  C CG    . GLN C 1 34  ? 66.603  102.324 84.365  1.00 35.44  ? 33  GLN C CG    1 
ATOM 2426  C CD    . GLN C 1 34  ? 65.530  103.123 85.029  1.00 36.03  ? 33  GLN C CD    1 
ATOM 2427  O OE1   . GLN C 1 34  ? 64.741  102.599 85.816  1.00 37.32  ? 33  GLN C OE1   1 
ATOM 2428  N NE2   . GLN C 1 34  ? 65.484  104.410 84.722  1.00 35.37  ? 33  GLN C NE2   1 
ATOM 2429  N N     . GLY C 1 35  ? 69.194  99.108  85.880  1.00 44.87  ? 34  GLY C N     1 
ATOM 2430  C CA    . GLY C 1 35  ? 70.013  98.247  86.704  1.00 45.60  ? 34  GLY C CA    1 
ATOM 2431  C C     . GLY C 1 35  ? 71.430  98.092  86.180  1.00 44.98  ? 34  GLY C C     1 
ATOM 2432  O O     . GLY C 1 35  ? 72.386  98.099  86.954  1.00 45.11  ? 34  GLY C O     1 
ATOM 2433  N N     . HIS C 1 36  ? 71.565  97.967  84.867  1.00 42.23  ? 35  HIS C N     1 
ATOM 2434  C CA    . HIS C 1 36  ? 72.857  97.756  84.252  1.00 42.04  ? 35  HIS C CA    1 
ATOM 2435  C C     . HIS C 1 36  ? 73.717  98.989  84.210  1.00 40.54  ? 35  HIS C C     1 
ATOM 2436  O O     . HIS C 1 36  ? 74.931  98.883  84.235  1.00 40.58  ? 35  HIS C O     1 
ATOM 2437  C CB    . HIS C 1 36  ? 72.688  97.211  82.843  1.00 42.32  ? 35  HIS C CB    1 
ATOM 2438  C CG    . HIS C 1 36  ? 72.324  95.762  82.817  1.00 44.07  ? 35  HIS C CG    1 
ATOM 2439  N ND1   . HIS C 1 36  ? 72.600  94.912  83.867  1.00 45.34  ? 35  HIS C ND1   1 
ATOM 2440  C CD2   . HIS C 1 36  ? 71.688  95.015  81.884  1.00 44.73  ? 35  HIS C CD2   1 
ATOM 2441  C CE1   . HIS C 1 36  ? 72.164  93.698  83.578  1.00 46.62  ? 35  HIS C CE1   1 
ATOM 2442  N NE2   . HIS C 1 36  ? 71.607  93.733  82.384  1.00 46.34  ? 35  HIS C NE2   1 
ATOM 2443  N N     . THR C 1 37  ? 73.095  100.128 83.986  1.00 36.26  ? 36  THR C N     1 
ATOM 2444  C CA    . THR C 1 37  ? 73.806  101.379 83.987  1.00 35.12  ? 36  THR C CA    1 
ATOM 2445  C C     . THR C 1 37  ? 74.349  101.732 85.343  1.00 35.46  ? 36  THR C C     1 
ATOM 2446  O O     . THR C 1 37  ? 75.479  102.167 85.479  1.00 35.70  ? 36  THR C O     1 
ATOM 2447  C CB    . THR C 1 37  ? 72.906  102.498 83.490  1.00 34.41  ? 36  THR C CB    1 
ATOM 2448  O OG1   . THR C 1 37  ? 72.075  101.986 82.450  1.00 34.66  ? 36  THR C OG1   1 
ATOM 2449  C CG2   . THR C 1 37  ? 73.730  103.606 82.944  1.00 33.49  ? 36  THR C CG2   1 
ATOM 2450  N N     . LEU C 1 38  ? 73.525  101.541 86.360  1.00 35.85  ? 37  LEU C N     1 
ATOM 2451  C CA    . LEU C 1 38  ? 73.951  101.805 87.711  1.00 36.57  ? 37  LEU C CA    1 
ATOM 2452  C C     . LEU C 1 38  ? 75.020  100.805 88.043  1.00 37.84  ? 37  LEU C C     1 
ATOM 2453  O O     . LEU C 1 38  ? 76.003  101.107 88.694  1.00 38.48  ? 37  LEU C O     1 
ATOM 2454  C CB    . LEU C 1 38  ? 72.794  101.612 88.671  1.00 37.13  ? 37  LEU C CB    1 
ATOM 2455  C CG    . LEU C 1 38  ? 71.636  102.583 88.521  1.00 36.36  ? 37  LEU C CG    1 
ATOM 2456  C CD1   . LEU C 1 38  ? 70.507  102.175 89.438  1.00 37.40  ? 37  LEU C CD1   1 
ATOM 2457  C CD2   . LEU C 1 38  ? 72.077  103.997 88.830  1.00 35.87  ? 37  LEU C CD2   1 
ATOM 2458  N N     . GLY C 1 39  ? 74.831  99.597  87.549  1.00 38.44  ? 38  GLY C N     1 
ATOM 2459  C CA    . GLY C 1 39  ? 75.792  98.561  87.807  1.00 39.98  ? 38  GLY C CA    1 
ATOM 2460  C C     . GLY C 1 39  ? 77.076  99.014  87.180  1.00 39.90  ? 38  GLY C C     1 
ATOM 2461  O O     . GLY C 1 39  ? 78.130  98.894  87.775  1.00 41.10  ? 38  GLY C O     1 
ATOM 2462  N N     . TYR C 1 40  ? 77.003  99.561  85.979  1.00 40.44  ? 39  TYR C N     1 
ATOM 2463  C CA    . TYR C 1 40  ? 78.230  99.974  85.343  1.00 40.70  ? 39  TYR C CA    1 
ATOM 2464  C C     . TYR C 1 40  ? 78.839  101.155 86.049  1.00 40.58  ? 39  TYR C C     1 
ATOM 2465  O O     . TYR C 1 40  ? 80.051  101.240 86.177  1.00 41.70  ? 39  TYR C O     1 
ATOM 2466  C CB    . TYR C 1 40  ? 77.982  100.328 83.888  1.00 39.71  ? 39  TYR C CB    1 
ATOM 2467  C CG    . TYR C 1 40  ? 79.240  100.719 83.183  1.00 40.31  ? 39  TYR C CG    1 
ATOM 2468  C CD1   . TYR C 1 40  ? 80.104  99.756  82.691  1.00 41.85  ? 39  TYR C CD1   1 
ATOM 2469  C CD2   . TYR C 1 40  ? 79.584  102.043 83.039  1.00 39.69  ? 39  TYR C CD2   1 
ATOM 2470  C CE1   . TYR C 1 40  ? 81.254  100.098 82.074  1.00 42.77  ? 39  TYR C CE1   1 
ATOM 2471  C CE2   . TYR C 1 40  ? 80.738  102.395 82.422  1.00 40.58  ? 39  TYR C CE2   1 
ATOM 2472  C CZ    . TYR C 1 40  ? 81.570  101.418 81.939  1.00 42.14  ? 39  TYR C CZ    1 
ATOM 2473  O OH    . TYR C 1 40  ? 82.721  101.782 81.279  1.00 43.34  ? 39  TYR C OH    1 
ATOM 2474  N N     . LEU C 1 41  ? 77.999  102.076 86.503  1.00 37.77  ? 40  LEU C N     1 
ATOM 2475  C CA    . LEU C 1 41  ? 78.486  103.264 87.205  1.00 37.80  ? 40  LEU C CA    1 
ATOM 2476  C C     . LEU C 1 41  ? 79.189  102.851 88.486  1.00 39.34  ? 40  LEU C C     1 
ATOM 2477  O O     . LEU C 1 41  ? 80.302  103.272 88.739  1.00 40.29  ? 40  LEU C O     1 
ATOM 2478  C CB    . LEU C 1 41  ? 77.348  104.252 87.490  1.00 36.67  ? 40  LEU C CB    1 
ATOM 2479  C CG    . LEU C 1 41  ? 76.945  105.174 86.341  1.00 35.48  ? 40  LEU C CG    1 
ATOM 2480  C CD1   . LEU C 1 41  ? 75.552  105.688 86.538  1.00 34.68  ? 40  LEU C CD1   1 
ATOM 2481  C CD2   . LEU C 1 41  ? 77.892  106.345 86.249  1.00 35.75  ? 40  LEU C CD2   1 
ATOM 2482  N N     . TYR C 1 42  ? 78.551  101.981 89.261  1.00 39.87  ? 41  TYR C N     1 
ATOM 2483  C CA    . TYR C 1 42  ? 79.098  101.508 90.531  1.00 41.56  ? 41  TYR C CA    1 
ATOM 2484  C C     . TYR C 1 42  ? 80.487  100.909 90.369  1.00 43.15  ? 41  TYR C C     1 
ATOM 2485  O O     . TYR C 1 42  ? 81.275  100.881 91.319  1.00 44.73  ? 41  TYR C O     1 
ATOM 2486  C CB    . TYR C 1 42  ? 78.144  100.475 91.141  1.00 42.12  ? 41  TYR C CB    1 
ATOM 2487  C CG    . TYR C 1 42  ? 78.576  99.848  92.454  1.00 44.15  ? 41  TYR C CG    1 
ATOM 2488  C CD1   . TYR C 1 42  ? 78.030  100.266 93.660  1.00 44.59  ? 41  TYR C CD1   1 
ATOM 2489  C CD2   . TYR C 1 42  ? 79.489  98.803  92.482  1.00 45.90  ? 41  TYR C CD2   1 
ATOM 2490  C CE1   . TYR C 1 42  ? 78.405  99.677  94.858  1.00 46.67  ? 41  TYR C CE1   1 
ATOM 2491  C CE2   . TYR C 1 42  ? 79.872  98.212  93.668  1.00 48.00  ? 41  TYR C CE2   1 
ATOM 2492  C CZ    . TYR C 1 42  ? 79.325  98.649  94.850  1.00 48.35  ? 41  TYR C CZ    1 
ATOM 2493  O OH    . TYR C 1 42  ? 79.710  98.056  96.025  1.00 50.66  ? 41  TYR C OH    1 
ATOM 2494  N N     . ALA C 1 43  ? 80.783  100.439 89.166  1.00 43.21  ? 42  ALA C N     1 
ATOM 2495  C CA    . ALA C 1 43  ? 81.984  99.673  88.943  1.00 45.07  ? 42  ALA C CA    1 
ATOM 2496  C C     . ALA C 1 43  ? 83.111  100.492 88.337  1.00 45.41  ? 42  ALA C C     1 
ATOM 2497  O O     . ALA C 1 43  ? 84.282  100.168 88.534  1.00 47.43  ? 42  ALA C O     1 
ATOM 2498  C CB    . ALA C 1 43  ? 81.674  98.480  88.089  1.00 45.34  ? 42  ALA C CB    1 
ATOM 2499  N N     . HIS C 1 44  ? 82.773  101.546 87.604  1.00 64.63  ? 43  HIS C N     1 
ATOM 2500  C CA    . HIS C 1 44  ? 83.804  102.352 86.947  1.00 65.34  ? 43  HIS C CA    1 
ATOM 2501  C C     . HIS C 1 44  ? 83.692  103.826 87.326  1.00 64.51  ? 43  HIS C C     1 
ATOM 2502  O O     . HIS C 1 44  ? 84.283  104.688 86.669  1.00 64.75  ? 43  HIS C O     1 
ATOM 2503  C CB    . HIS C 1 44  ? 83.722  102.232 85.419  1.00 64.83  ? 43  HIS C CB    1 
ATOM 2504  C CG    . HIS C 1 44  ? 83.832  100.832 84.904  1.00 65.95  ? 43  HIS C CG    1 
ATOM 2505  N ND1   . HIS C 1 44  ? 83.137  99.773  85.450  1.00 66.05  ? 43  HIS C ND1   1 
ATOM 2506  C CD2   . HIS C 1 44  ? 84.542  100.321 83.873  1.00 67.37  ? 43  HIS C CD2   1 
ATOM 2507  C CE1   . HIS C 1 44  ? 83.418  98.670  84.782  1.00 67.44  ? 43  HIS C CE1   1 
ATOM 2508  N NE2   . HIS C 1 44  ? 84.267  98.976  83.819  1.00 68.32  ? 43  HIS C NE2   1 
ATOM 2509  N N     . GLN C 1 45  ? 82.997  104.089 88.418  1.00 49.13  ? 44  GLN C N     1 
ATOM 2510  C CA    . GLN C 1 45  ? 82.525  105.411 88.772  1.00 48.19  ? 44  GLN C CA    1 
ATOM 2511  C C     . GLN C 1 45  ? 83.605  106.472 88.888  1.00 49.34  ? 44  GLN C C     1 
ATOM 2512  O O     . GLN C 1 45  ? 83.432  107.602 88.447  1.00 48.67  ? 44  GLN C O     1 
ATOM 2513  C CB    . GLN C 1 45  ? 81.773  105.312 90.095  1.00 48.18  ? 44  GLN C CB    1 
ATOM 2514  C CG    . GLN C 1 45  ? 80.796  106.431 90.387  1.00 47.02  ? 44  GLN C CG    1 
ATOM 2515  C CD    . GLN C 1 45  ? 80.306  106.388 91.818  1.00 47.67  ? 44  GLN C CD    1 
ATOM 2516  O OE1   . GLN C 1 45  ? 79.902  107.402 92.378  1.00 47.59  ? 44  GLN C OE1   1 
ATOM 2517  N NE2   . GLN C 1 45  ? 80.345  105.207 92.419  1.00 48.58  ? 44  GLN C NE2   1 
ATOM 2518  N N     . GLN C 1 46  ? 84.731  106.086 89.463  1.00 53.57  ? 45  GLN C N     1 
ATOM 2519  C CA    . GLN C 1 46  ? 85.789  107.002 89.868  1.00 55.22  ? 45  GLN C CA    1 
ATOM 2520  C C     . GLN C 1 46  ? 86.592  107.692 88.768  1.00 55.80  ? 45  GLN C C     1 
ATOM 2521  O O     . GLN C 1 46  ? 87.409  108.582 88.996  1.00 57.26  ? 45  GLN C O     1 
ATOM 2522  C CB    . GLN C 1 46  ? 86.874  106.254 90.644  1.00 57.67  ? 45  GLN C CB    1 
ATOM 2523  C CG    . GLN C 1 46  ? 87.714  105.295 89.820  1.00 58.96  ? 45  GLN C CG    1 
ATOM 2524  C CD    . GLN C 1 46  ? 86.966  104.032 89.481  1.00 57.98  ? 45  GLN C CD    1 
ATOM 2525  O OE1   . GLN C 1 46  ? 85.816  103.869 89.862  1.00 56.37  ? 45  GLN C OE1   1 
ATOM 2526  N NE2   . GLN C 1 46  ? 87.615  103.131 88.761  1.00 59.23  ? 45  GLN C NE2   1 
ATOM 2527  N N     . ASP C 1 47  ? 86.331  107.239 87.554  1.00 63.65  ? 46  ASP C N     1 
ATOM 2528  C CA    . ASP C 1 47  ? 87.238  107.378 86.440  1.00 64.80  ? 46  ASP C CA    1 
ATOM 2529  C C     . ASP C 1 47  ? 87.450  108.789 85.844  1.00 65.27  ? 46  ASP C C     1 
ATOM 2530  O O     . ASP C 1 47  ? 88.550  109.049 85.369  1.00 67.65  ? 46  ASP C O     1 
ATOM 2531  C CB    . ASP C 1 47  ? 86.953  106.437 85.275  1.00 64.32  ? 46  ASP C CB    1 
ATOM 2532  C CG    . ASP C 1 47  ? 87.303  105.006 85.611  1.00 65.78  ? 46  ASP C CG    1 
ATOM 2533  O OD1   . ASP C 1 47  ? 88.013  104.798 86.610  1.00 67.55  ? 46  ASP C OD1   1 
ATOM 2534  O OD2   . ASP C 1 47  ? 86.865  104.089 84.893  1.00 65.41  ? 46  ASP C OD2   1 
ATOM 2535  N N     . GLY C 1 48  ? 86.486  109.708 85.838  1.00 58.60  ? 47  GLY C N     1 
ATOM 2536  C CA    . GLY C 1 48  ? 85.122  109.609 86.276  1.00 56.46  ? 47  GLY C CA    1 
ATOM 2537  C C     . GLY C 1 48  ? 84.441  109.890 84.945  1.00 55.22  ? 47  GLY C C     1 
ATOM 2538  O O     . GLY C 1 48  ? 84.884  110.765 84.171  1.00 55.70  ? 47  GLY C O     1 
ATOM 2539  N N     . LEU C 1 49  ? 83.366  109.142 84.691  1.00 42.38  ? 48  LEU C N     1 
ATOM 2540  C CA    . LEU C 1 49  ? 82.786  109.001 83.373  1.00 41.34  ? 48  LEU C CA    1 
ATOM 2541  C C     . LEU C 1 49  ? 81.994  110.234 82.973  1.00 40.41  ? 48  LEU C C     1 
ATOM 2542  O O     . LEU C 1 49  ? 81.574  111.009 83.819  1.00 40.21  ? 48  LEU C O     1 
ATOM 2543  C CB    . LEU C 1 49  ? 81.876  107.784 83.386  1.00 40.20  ? 48  LEU C CB    1 
ATOM 2544  C CG    . LEU C 1 49  ? 82.377  106.583 84.193  1.00 41.15  ? 48  LEU C CG    1 
ATOM 2545  C CD1   . LEU C 1 49  ? 81.263  105.565 84.410  1.00 40.11  ? 48  LEU C CD1   1 
ATOM 2546  C CD2   . LEU C 1 49  ? 83.491  105.944 83.459  1.00 42.65  ? 48  LEU C CD2   1 
ATOM 2547  N N     . THR C 1 50  ? 81.816  110.412 81.673  1.00 44.66  ? 49  THR C N     1 
ATOM 2548  C CA    . THR C 1 50  ? 80.903  111.391 81.115  1.00 43.98  ? 49  THR C CA    1 
ATOM 2549  C C     . THR C 1 50  ? 79.817  110.605 80.408  1.00 42.66  ? 49  THR C C     1 
ATOM 2550  O O     . THR C 1 50  ? 79.962  109.402 80.205  1.00 42.75  ? 49  THR C O     1 
ATOM 2551  C CB    . THR C 1 50  ? 81.589  112.189 80.043  1.00 45.16  ? 49  THR C CB    1 
ATOM 2552  O OG1   . THR C 1 50  ? 82.335  111.288 79.213  1.00 45.99  ? 49  THR C OG1   1 
ATOM 2553  C CG2   . THR C 1 50  ? 82.517  113.212 80.650  1.00 46.77  ? 49  THR C CG2   1 
ATOM 2554  N N     . GLN C 1 51  ? 78.749  111.273 79.989  1.00 35.50  ? 50  GLN C N     1 
ATOM 2555  C CA    . GLN C 1 51  ? 77.614  110.552 79.413  1.00 34.41  ? 50  GLN C CA    1 
ATOM 2556  C C     . GLN C 1 51  ? 78.096  109.831 78.172  1.00 34.82  ? 50  GLN C C     1 
ATOM 2557  O O     . GLN C 1 51  ? 77.693  108.705 77.869  1.00 34.42  ? 50  GLN C O     1 
ATOM 2558  C CB    . GLN C 1 51  ? 76.450  111.501 79.090  1.00 33.91  ? 50  GLN C CB    1 
ATOM 2559  C CG    . GLN C 1 51  ? 76.045  112.414 80.255  1.00 34.61  ? 50  GLN C CG    1 
ATOM 2560  C CD    . GLN C 1 51  ? 74.672  113.040 80.072  1.00 35.63  ? 50  GLN C CD    1 
ATOM 2561  O OE1   . GLN C 1 51  ? 74.034  112.902 79.009  1.00 35.71  ? 50  GLN C OE1   1 
ATOM 2562  N NE2   . GLN C 1 51  ? 74.199  113.730 81.120  1.00 37.45  ? 50  GLN C NE2   1 
ATOM 2563  N N     . ASN C 1 52  ? 79.011  110.488 77.483  1.00 36.35  ? 51  ASN C N     1 
ATOM 2564  C CA    . ASN C 1 52  ? 79.586  109.920 76.285  1.00 37.17  ? 51  ASN C CA    1 
ATOM 2565  C C     . ASN C 1 52  ? 80.409  108.664 76.549  1.00 37.82  ? 51  ASN C C     1 
ATOM 2566  O O     . ASN C 1 52  ? 80.437  107.760 75.726  1.00 38.14  ? 51  ASN C O     1 
ATOM 2567  C CB    . ASN C 1 52  ? 80.449  110.962 75.614  1.00 38.62  ? 51  ASN C CB    1 
ATOM 2568  C CG    . ASN C 1 52  ? 80.644  110.686 74.155  1.00 39.47  ? 51  ASN C CG    1 
ATOM 2569  O OD1   . ASN C 1 52  ? 79.737  110.184 73.480  1.00 38.69  ? 51  ASN C OD1   1 
ATOM 2570  N ND2   . ASN C 1 52  ? 81.838  111.029 73.642  1.00 41.36  ? 51  ASN C ND2   1 
ATOM 2571  N N     . ASP C 1 53  ? 81.090  108.621 77.693  1.00 38.24  ? 52  ASP C N     1 
ATOM 2572  C CA    . ASP C 1 53  ? 81.854  107.444 78.055  1.00 39.12  ? 52  ASP C CA    1 
ATOM 2573  C C     . ASP C 1 53  ? 80.895  106.324 78.279  1.00 38.03  ? 52  ASP C C     1 
ATOM 2574  O O     . ASP C 1 53  ? 81.111  105.201 77.837  1.00 38.66  ? 52  ASP C O     1 
ATOM 2575  C CB    . ASP C 1 53  ? 82.623  107.686 79.334  1.00 39.87  ? 52  ASP C CB    1 
ATOM 2576  C CG    . ASP C 1 53  ? 83.731  108.664 79.151  1.00 41.46  ? 52  ASP C CG    1 
ATOM 2577  O OD1   . ASP C 1 53  ? 84.370  108.650 78.062  1.00 42.69  ? 52  ASP C OD1   1 
ATOM 2578  O OD2   . ASP C 1 53  ? 83.969  109.443 80.097  1.00 41.72  ? 52  ASP C OD2   1 
ATOM 2579  N N     . ILE C 1 54  ? 79.827  106.641 78.991  1.00 36.28  ? 53  ILE C N     1 
ATOM 2580  C CA    . ILE C 1 54  ? 78.804  105.658 79.248  1.00 35.44  ? 53  ILE C CA    1 
ATOM 2581  C C     . ILE C 1 54  ? 78.245  105.159 77.927  1.00 35.26  ? 53  ILE C C     1 
ATOM 2582  O O     . ILE C 1 54  ? 78.063  103.950 77.744  1.00 35.56  ? 53  ILE C O     1 
ATOM 2583  C CB    . ILE C 1 54  ? 77.682  106.216 80.145  1.00 34.31  ? 53  ILE C CB    1 
ATOM 2584  C CG1   . ILE C 1 54  ? 78.321  106.851 81.394  1.00 34.76  ? 53  ILE C CG1   1 
ATOM 2585  C CG2   . ILE C 1 54  ? 76.630  105.124 80.442  1.00 33.83  ? 53  ILE C CG2   1 
ATOM 2586  C CD1   . ILE C 1 54  ? 77.530  106.693 82.653  1.00 34.31  ? 53  ILE C CD1   1 
ATOM 2587  N N     . ALA C 1 55  ? 78.015  106.082 77.000  1.00 35.05  ? 54  ALA C N     1 
ATOM 2588  C CA    . ALA C 1 55  ? 77.459  105.709 75.711  1.00 35.05  ? 54  ALA C CA    1 
ATOM 2589  C C     . ALA C 1 55  ? 78.310  104.642 75.049  1.00 36.33  ? 54  ALA C C     1 
ATOM 2590  O O     . ALA C 1 55  ? 77.791  103.612 74.619  1.00 36.42  ? 54  ALA C O     1 
ATOM 2591  C CB    . ALA C 1 55  ? 77.315  106.915 74.820  1.00 35.08  ? 54  ALA C CB    1 
ATOM 2592  N N     . LYS C 1 56  ? 79.620  104.878 75.012  1.00 37.58  ? 55  LYS C N     1 
ATOM 2593  C CA    . LYS C 1 56  ? 80.546  103.940 74.383  1.00 39.26  ? 55  LYS C CA    1 
ATOM 2594  C C     . LYS C 1 56  ? 80.540  102.613 75.164  1.00 39.52  ? 55  LYS C C     1 
ATOM 2595  O O     . LYS C 1 56  ? 80.517  101.531 74.584  1.00 40.38  ? 55  LYS C O     1 
ATOM 2596  C CB    . LYS C 1 56  ? 81.962  104.549 74.223  1.00 40.93  ? 55  LYS C CB    1 
ATOM 2597  N N     . ALA C 1 57  ? 80.497  102.700 76.483  1.00 38.94  ? 56  ALA C N     1 
ATOM 2598  C CA    . ALA C 1 57  ? 80.534  101.498 77.297  1.00 39.48  ? 56  ALA C CA    1 
ATOM 2599  C C     . ALA C 1 57  ? 79.334  100.583 77.059  1.00 38.85  ? 56  ALA C C     1 
ATOM 2600  O O     . ALA C 1 57  ? 79.488  99.372  76.917  1.00 40.02  ? 56  ALA C O     1 
ATOM 2601  C CB    . ALA C 1 57  ? 80.629  101.868 78.749  1.00 39.07  ? 56  ALA C CB    1 
ATOM 2602  N N     . LEU C 1 58  ? 78.139  101.160 76.996  1.00 38.57  ? 57  LEU C N     1 
ATOM 2603  C CA    . LEU C 1 58  ? 76.932  100.346 76.981  1.00 38.35  ? 57  LEU C CA    1 
ATOM 2604  C C     . LEU C 1 58  ? 76.402  100.102 75.566  1.00 38.76  ? 57  LEU C C     1 
ATOM 2605  O O     . LEU C 1 58  ? 75.381  99.412  75.374  1.00 39.30  ? 57  LEU C O     1 
ATOM 2606  C CB    . LEU C 1 58  ? 75.858  100.978 77.872  1.00 37.35  ? 57  LEU C CB    1 
ATOM 2607  C CG    . LEU C 1 58  ? 76.294  101.359 79.293  1.00 37.05  ? 57  LEU C CG    1 
ATOM 2608  C CD1   . LEU C 1 58  ? 75.121  101.877 80.136  1.00 36.99  ? 57  LEU C CD1   1 
ATOM 2609  C CD2   . LEU C 1 58  ? 76.973  100.173 79.960  1.00 38.16  ? 57  LEU C CD2   1 
ATOM 2610  N N     . GLN C 1 59  ? 77.114  100.661 74.585  1.00 48.67  ? 58  GLN C N     1 
ATOM 2611  C CA    . GLN C 1 59  ? 76.764  100.522 73.177  1.00 49.36  ? 58  GLN C CA    1 
ATOM 2612  C C     . GLN C 1 59  ? 75.390  101.109 72.934  1.00 48.45  ? 58  GLN C C     1 
ATOM 2613  O O     . GLN C 1 59  ? 74.524  100.463 72.355  1.00 49.14  ? 58  GLN C O     1 
ATOM 2614  C CB    . GLN C 1 59  ? 76.775  99.058  72.749  1.00 51.44  ? 58  GLN C CB    1 
ATOM 2615  C CG    . GLN C 1 59  ? 78.057  98.298  73.060  1.00 52.95  ? 58  GLN C CG    1 
ATOM 2616  C CD    . GLN C 1 59  ? 79.130  98.489  72.009  1.00 54.52  ? 58  GLN C CD    1 
ATOM 2617  O OE1   . GLN C 1 59  ? 80.295  98.694  72.344  1.00 55.63  ? 58  GLN C OE1   1 
ATOM 2618  N NE2   . GLN C 1 59  ? 78.747  98.412  70.727  1.00 55.07  ? 58  GLN C NE2   1 
ATOM 2619  N N     . ARG C 1 60  ? 75.182  102.328 73.412  1.00 35.65  ? 59  ARG C N     1 
ATOM 2620  C CA    . ARG C 1 60  ? 73.972  103.068 73.102  1.00 34.79  ? 59  ARG C CA    1 
ATOM 2621  C C     . ARG C 1 60  ? 74.370  104.451 72.600  1.00 34.71  ? 59  ARG C C     1 
ATOM 2622  O O     . ARG C 1 60  ? 75.480  104.916 72.873  1.00 35.06  ? 59  ARG C O     1 
ATOM 2623  C CB    . ARG C 1 60  ? 73.062  103.179 74.320  1.00 33.86  ? 59  ARG C CB    1 
ATOM 2624  C CG    . ARG C 1 60  ? 72.516  101.842 74.787  1.00 34.21  ? 59  ARG C CG    1 
ATOM 2625  C CD    . ARG C 1 60  ? 71.876  101.111 73.630  1.00 34.92  ? 59  ARG C CD    1 
ATOM 2626  N NE    . ARG C 1 60  ? 71.346  99.795  73.972  1.00 35.62  ? 59  ARG C NE    1 
ATOM 2627  C CZ    . ARG C 1 60  ? 72.075  98.683  74.003  1.00 36.67  ? 59  ARG C CZ    1 
ATOM 2628  N NH1   . ARG C 1 60  ? 73.383  98.738  73.751  1.00 37.14  ? 59  ARG C NH1   1 
ATOM 2629  N NH2   . ARG C 1 60  ? 71.502  97.519  74.302  1.00 37.54  ? 59  ARG C NH2   1 
ATOM 2630  N N     . THR C 1 61  ? 73.467  105.090 71.857  1.00 34.54  ? 60  THR C N     1 
ATOM 2631  C CA    . THR C 1 61  ? 73.691  106.418 71.333  1.00 34.72  ? 60  THR C CA    1 
ATOM 2632  C C     . THR C 1 61  ? 73.556  107.459 72.437  1.00 33.94  ? 60  THR C C     1 
ATOM 2633  O O     . THR C 1 61  ? 73.089  107.182 73.529  1.00 33.23  ? 60  THR C O     1 
ATOM 2634  C CB    . THR C 1 61  ? 72.666  106.756 70.254  1.00 35.02  ? 60  THR C CB    1 
ATOM 2635  O OG1   . THR C 1 61  ? 71.449  107.150 70.878  1.00 34.27  ? 60  THR C OG1   1 
ATOM 2636  C CG2   . THR C 1 61  ? 72.363  105.569 69.411  1.00 35.68  ? 60  THR C CG2   1 
ATOM 2637  N N     . GLY C 1 62  ? 73.961  108.673 72.118  1.00 34.36  ? 61  GLY C N     1 
ATOM 2638  C CA    . GLY C 1 62  ? 73.976  109.774 73.052  1.00 34.03  ? 61  GLY C CA    1 
ATOM 2639  C C     . GLY C 1 62  ? 72.641  110.180 73.617  1.00 33.38  ? 61  GLY C C     1 
ATOM 2640  O O     . GLY C 1 62  ? 72.532  110.359 74.830  1.00 32.89  ? 61  GLY C O     1 
ATOM 2641  N N     . PRO C 1 63  ? 71.629  110.354 72.759  1.00 34.44  ? 62  PRO C N     1 
ATOM 2642  C CA    . PRO C 1 63  ? 70.296  110.643 73.290  1.00 34.78  ? 62  PRO C CA    1 
ATOM 2643  C C     . PRO C 1 63  ? 69.827  109.546 74.242  1.00 34.65  ? 62  PRO C C     1 
ATOM 2644  O O     . PRO C 1 63  ? 69.367  109.844 75.348  1.00 35.48  ? 62  PRO C O     1 
ATOM 2645  C CB    . PRO C 1 63  ? 69.421  110.647 72.035  1.00 35.30  ? 62  PRO C CB    1 
ATOM 2646  C CG    . PRO C 1 63  ? 70.319  111.044 70.967  1.00 35.47  ? 62  PRO C CG    1 
ATOM 2647  C CD    . PRO C 1 63  ? 71.639  110.417 71.291  1.00 34.90  ? 62  PRO C CD    1 
ATOM 2648  N N     . THR C 1 64  ? 69.976  108.298 73.812  1.00 32.67  ? 63  THR C N     1 
ATOM 2649  C CA    . THR C 1 64  ? 69.600  107.159 74.610  1.00 32.37  ? 63  THR C CA    1 
ATOM 2650  C C     . THR C 1 64  ? 70.170  107.222 76.004  1.00 31.94  ? 63  THR C C     1 
ATOM 2651  O O     . THR C 1 64  ? 69.456  106.988 76.986  1.00 31.82  ? 63  THR C O     1 
ATOM 2652  C CB    . THR C 1 64  ? 70.092  105.887 73.960  1.00 32.70  ? 63  THR C CB    1 
ATOM 2653  O OG1   . THR C 1 64  ? 69.552  105.823 72.632  1.00 33.30  ? 63  THR C OG1   1 
ATOM 2654  C CG2   . THR C 1 64  ? 69.649  104.670 74.760  1.00 32.71  ? 63  THR C CG2   1 
ATOM 2655  N N     . VAL C 1 65  ? 71.455  107.539 76.109  1.00 31.95  ? 64  VAL C N     1 
ATOM 2656  C CA    . VAL C 1 65  ? 72.055  107.607 77.427  1.00 31.76  ? 64  VAL C CA    1 
ATOM 2657  C C     . VAL C 1 65  ? 71.512  108.828 78.157  1.00 31.66  ? 64  VAL C C     1 
ATOM 2658  O O     . VAL C 1 65  ? 71.233  108.760 79.345  1.00 31.58  ? 64  VAL C O     1 
ATOM 2659  C CB    . VAL C 1 65  ? 73.590  107.604 77.381  1.00 32.15  ? 64  VAL C CB    1 
ATOM 2660  C CG1   . VAL C 1 65  ? 74.170  107.800 78.772  1.00 32.17  ? 64  VAL C CG1   1 
ATOM 2661  C CG2   . VAL C 1 65  ? 74.092  106.292 76.841  1.00 32.56  ? 64  VAL C CG2   1 
ATOM 2662  N N     . SER C 1 66  ? 71.314  109.933 77.447  1.00 31.91  ? 65  SER C N     1 
ATOM 2663  C CA    . SER C 1 66  ? 70.805  111.132 78.109  1.00 32.15  ? 65  SER C CA    1 
ATOM 2664  C C     . SER C 1 66  ? 69.497  110.849 78.784  1.00 32.83  ? 65  SER C C     1 
ATOM 2665  O O     . SER C 1 66  ? 69.239  111.301 79.892  1.00 34.23  ? 65  SER C O     1 
ATOM 2666  C CB    . SER C 1 66  ? 70.562  112.264 77.128  1.00 32.74  ? 65  SER C CB    1 
ATOM 2667  O OG    . SER C 1 66  ? 70.119  113.422 77.830  1.00 33.26  ? 65  SER C OG    1 
ATOM 2668  N N     . ASN C 1 67  ? 68.629  110.146 78.082  1.00 32.16  ? 66  ASN C N     1 
ATOM 2669  C CA    . ASN C 1 67  ? 67.314  109.847 78.609  1.00 32.51  ? 66  ASN C CA    1 
ATOM 2670  C C     . ASN C 1 67  ? 67.326  108.957 79.836  1.00 32.40  ? 66  ASN C C     1 
ATOM 2671  O O     . ASN C 1 67  ? 66.648  109.233 80.804  1.00 32.88  ? 66  ASN C O     1 
ATOM 2672  C CB    . ASN C 1 67  ? 66.472  109.202 77.518  1.00 32.83  ? 66  ASN C CB    1 
ATOM 2673  C CG    . ASN C 1 67  ? 64.997  109.387 77.737  1.00 33.71  ? 66  ASN C CG    1 
ATOM 2674  O OD1   . ASN C 1 67  ? 64.446  110.433 77.445  1.00 34.37  ? 66  ASN C OD1   1 
ATOM 2675  N ND2   . ASN C 1 67  ? 64.349  108.365 78.246  1.00 34.02  ? 66  ASN C ND2   1 
ATOM 2676  N N     . LEU C 1 68  ? 68.115  107.896 79.803  1.00 32.02  ? 67  LEU C N     1 
ATOM 2677  C CA    . LEU C 1 68  ? 68.172  106.978 80.922  1.00 32.17  ? 67  LEU C CA    1 
ATOM 2678  C C     . LEU C 1 68  ? 68.727  107.673 82.128  1.00 32.21  ? 67  LEU C C     1 
ATOM 2679  O O     . LEU C 1 68  ? 68.227  107.543 83.227  1.00 32.70  ? 67  LEU C O     1 
ATOM 2680  C CB    . LEU C 1 68  ? 69.056  105.792 80.583  1.00 32.03  ? 67  LEU C CB    1 
ATOM 2681  C CG    . LEU C 1 68  ? 68.849  104.544 81.429  1.00 32.56  ? 67  LEU C CG    1 
ATOM 2682  C CD1   . LEU C 1 68  ? 68.690  103.321 80.548  1.00 32.91  ? 67  LEU C CD1   1 
ATOM 2683  C CD2   . LEU C 1 68  ? 70.017  104.371 82.375  1.00 32.61  ? 67  LEU C CD2   1 
ATOM 2684  N N     . LEU C 1 69  ? 69.767  108.443 81.900  1.00 31.93  ? 68  LEU C N     1 
ATOM 2685  C CA    . LEU C 1 69  ? 70.392  109.170 82.964  1.00 32.16  ? 68  LEU C CA    1 
ATOM 2686  C C     . LEU C 1 69  ? 69.396  110.150 83.511  1.00 32.67  ? 68  LEU C C     1 
ATOM 2687  O O     . LEU C 1 69  ? 69.339  110.375 84.698  1.00 33.19  ? 68  LEU C O     1 
ATOM 2688  C CB    . LEU C 1 69  ? 71.631  109.884 82.452  1.00 32.09  ? 68  LEU C CB    1 
ATOM 2689  C CG    . LEU C 1 69  ? 72.766  108.963 82.024  1.00 31.99  ? 68  LEU C CG    1 
ATOM 2690  C CD1   . LEU C 1 69  ? 74.063  109.727 81.985  1.00 32.40  ? 68  LEU C CD1   1 
ATOM 2691  C CD2   . LEU C 1 69  ? 72.882  107.774 82.957  1.00 32.18  ? 68  LEU C CD2   1 
ATOM 2692  N N     . ARG C 1 70  ? 68.605  110.754 82.649  1.00 32.79  ? 69  ARG C N     1 
ATOM 2693  C CA    . ARG C 1 70  ? 67.642  111.711 83.159  1.00 33.64  ? 69  ARG C CA    1 
ATOM 2694  C C     . ARG C 1 70  ? 66.695  110.932 84.073  1.00 34.18  ? 69  ARG C C     1 
ATOM 2695  O O     . ARG C 1 70  ? 66.301  111.405 85.149  1.00 35.06  ? 69  ARG C O     1 
ATOM 2696  C CB    . ARG C 1 70  ? 66.899  112.447 82.044  1.00 34.00  ? 69  ARG C CB    1 
ATOM 2697  N N     . ASN C 1 71  ? 66.372  109.708 83.685  1.00 33.92  ? 70  ASN C N     1 
ATOM 2698  C CA    . ASN C 1 71  ? 65.467  108.920 84.501  1.00 34.74  ? 70  ASN C CA    1 
ATOM 2699  C C     . ASN C 1 71  ? 66.023  108.513 85.853  1.00 35.03  ? 70  ASN C C     1 
ATOM 2700  O O     . ASN C 1 71  ? 65.307  108.536 86.843  1.00 36.14  ? 70  ASN C O     1 
ATOM 2701  C CB    . ASN C 1 71  ? 65.012  107.702 83.740  1.00 34.68  ? 70  ASN C CB    1 
ATOM 2702  C CG    . ASN C 1 71  ? 64.093  108.058 82.651  1.00 34.99  ? 70  ASN C CG    1 
ATOM 2703  O OD1   . ASN C 1 71  ? 63.669  109.207 82.543  1.00 35.43  ? 70  ASN C OD1   1 
ATOM 2704  N ND2   . ASN C 1 71  ? 63.752  107.092 81.832  1.00 35.03  ? 70  ASN C ND2   1 
ATOM 2705  N N     . LEU C 1 72  ? 67.295  108.132 85.884  1.00 34.28  ? 71  LEU C N     1 
ATOM 2706  C CA    . LEU C 1 72  ? 67.964  107.850 87.138  1.00 34.71  ? 71  LEU C CA    1 
ATOM 2707  C C     . LEU C 1 72  ? 68.070  109.092 88.011  1.00 35.29  ? 71  LEU C C     1 
ATOM 2708  O O     . LEU C 1 72  ? 67.847  109.021 89.222  1.00 36.29  ? 71  LEU C O     1 
ATOM 2709  C CB    . LEU C 1 72  ? 69.354  107.281 86.892  1.00 34.08  ? 71  LEU C CB    1 
ATOM 2710  C CG    . LEU C 1 72  ? 69.325  105.879 86.318  1.00 33.97  ? 71  LEU C CG    1 
ATOM 2711  C CD1   . LEU C 1 72  ? 70.725  105.391 86.087  1.00 33.70  ? 71  LEU C CD1   1 
ATOM 2712  C CD2   . LEU C 1 72  ? 68.595  104.965 87.246  1.00 35.01  ? 71  LEU C CD2   1 
ATOM 2713  N N     . GLU C 1 73  ? 68.433  110.221 87.412  1.00 34.90  ? 72  GLU C N     1 
ATOM 2714  C CA    . GLU C 1 73  ? 68.613  111.447 88.186  1.00 35.67  ? 72  GLU C CA    1 
ATOM 2715  C C     . GLU C 1 73  ? 67.276  111.831 88.822  1.00 36.91  ? 72  GLU C C     1 
ATOM 2716  O O     . GLU C 1 73  ? 67.223  112.267 89.977  1.00 38.03  ? 72  GLU C O     1 
ATOM 2717  C CB    . GLU C 1 73  ? 69.150  112.566 87.288  1.00 35.31  ? 72  GLU C CB    1 
ATOM 2718  C CG    . GLU C 1 73  ? 69.398  113.928 87.915  1.00 36.31  ? 72  GLU C CG    1 
ATOM 2719  C CD    . GLU C 1 73  ? 70.060  114.883 86.907  1.00 36.11  ? 72  GLU C CD    1 
ATOM 2720  O OE1   . GLU C 1 73  ? 69.476  115.138 85.828  1.00 35.88  ? 72  GLU C OE1   1 
ATOM 2721  O OE2   . GLU C 1 73  ? 71.189  115.370 87.150  1.00 36.39  ? 72  GLU C OE2   1 
ATOM 2722  N N     . ARG C 1 74  ? 66.200  111.648 88.061  1.00 40.51  ? 73  ARG C N     1 
ATOM 2723  C CA    . ARG C 1 74  ? 64.853  111.909 88.535  1.00 43.15  ? 73  ARG C CA    1 
ATOM 2724  C C     . ARG C 1 74  ? 64.589  111.095 89.825  1.00 43.19  ? 73  ARG C C     1 
ATOM 2725  O O     . ARG C 1 74  ? 64.028  111.593 90.792  1.00 45.25  ? 73  ARG C O     1 
ATOM 2726  C CB    . ARG C 1 74  ? 63.889  111.535 87.411  1.00 42.69  ? 73  ARG C CB    1 
ATOM 2727  C CG    . ARG C 1 74  ? 62.594  112.327 87.313  1.00 45.02  ? 73  ARG C CG    1 
ATOM 2728  C CD    . ARG C 1 74  ? 61.994  112.210 85.881  1.00 43.87  ? 73  ARG C CD    1 
ATOM 2729  N NE    . ARG C 1 74  ? 62.681  113.061 84.893  1.00 42.66  ? 73  ARG C NE    1 
ATOM 2730  C CZ    . ARG C 1 74  ? 62.347  113.156 83.605  1.00 41.46  ? 73  ARG C CZ    1 
ATOM 2731  N NH1   . ARG C 1 74  ? 61.328  112.459 83.102  1.00 41.42  ? 73  ARG C NH1   1 
ATOM 2732  N NH2   . ARG C 1 74  ? 63.028  113.963 82.809  1.00 40.35  ? 73  ARG C NH2   1 
ATOM 2733  N N     . LYS C 1 75  ? 65.041  109.849 89.842  1.00 38.78  ? 74  LYS C N     1 
ATOM 2734  C CA    . LYS C 1 75  ? 64.914  108.990 90.998  1.00 39.84  ? 74  LYS C CA    1 
ATOM 2735  C C     . LYS C 1 75  ? 65.981  109.290 92.059  1.00 40.07  ? 74  LYS C C     1 
ATOM 2736  O O     . LYS C 1 75  ? 66.040  108.620 93.085  1.00 41.08  ? 74  LYS C O     1 
ATOM 2737  C CB    . LYS C 1 75  ? 65.042  107.539 90.562  1.00 39.30  ? 74  LYS C CB    1 
ATOM 2738  C CG    . LYS C 1 75  ? 64.040  107.119 89.508  1.00 39.26  ? 74  LYS C CG    1 
ATOM 2739  C CD    . LYS C 1 75  ? 64.316  105.696 89.053  1.00 38.85  ? 74  LYS C CD    1 
ATOM 2740  C CE    . LYS C 1 75  ? 63.176  105.136 88.239  1.00 39.41  ? 74  LYS C CE    1 
ATOM 2741  N NZ    . LYS C 1 75  ? 62.035  104.740 89.109  1.00 41.50  ? 74  LYS C NZ    1 
ATOM 2742  N N     . LYS C 1 76  ? 66.836  110.275 91.799  1.00 41.23  ? 75  LYS C N     1 
ATOM 2743  C CA    . LYS C 1 76  ? 67.851  110.693 92.758  1.00 40.66  ? 75  LYS C CA    1 
ATOM 2744  C C     . LYS C 1 76  ? 68.932  109.626 93.000  1.00 39.35  ? 75  LYS C C     1 
ATOM 2745  O O     . LYS C 1 76  ? 69.707  109.707 93.967  1.00 40.12  ? 75  LYS C O     1 
ATOM 2746  C CB    . LYS C 1 76  ? 67.209  111.166 94.074  1.00 42.96  ? 75  LYS C CB    1 
ATOM 2747  C CG    . LYS C 1 76  ? 66.799  112.637 94.080  1.00 45.66  ? 75  LYS C CG    1 
ATOM 2748  C CD    . LYS C 1 76  ? 65.719  112.924 95.111  1.00 48.51  ? 75  LYS C CD    1 
ATOM 2749  C CE    . LYS C 1 76  ? 64.563  111.874 95.036  1.00 48.95  ? 75  LYS C CE    1 
ATOM 2750  N NZ    . LYS C 1 76  ? 63.457  112.003 96.081  1.00 51.69  ? 75  LYS C NZ    1 
ATOM 2751  N N     . LEU C 1 77  ? 69.012  108.650 92.099  1.00 38.32  ? 76  LEU C N     1 
ATOM 2752  C CA    . LEU C 1 77  ? 70.024  107.598 92.207  1.00 38.12  ? 76  LEU C CA    1 
ATOM 2753  C C     . LEU C 1 77  ? 71.402  107.953 91.626  1.00 37.26  ? 76  LEU C C     1 
ATOM 2754  O O     . LEU C 1 77  ? 72.361  107.250 91.857  1.00 37.49  ? 76  LEU C O     1 
ATOM 2755  C CB    . LEU C 1 77  ? 69.509  106.324 91.552  1.00 37.82  ? 76  LEU C CB    1 
ATOM 2756  C CG    . LEU C 1 77  ? 68.164  105.861 92.086  1.00 39.00  ? 76  LEU C CG    1 
ATOM 2757  C CD1   . LEU C 1 77  ? 67.543  104.889 91.120  1.00 38.64  ? 76  LEU C CD1   1 
ATOM 2758  C CD2   . LEU C 1 77  ? 68.418  105.214 93.397  1.00 40.47  ? 76  LEU C CD2   1 
ATOM 2759  N N     . ILE C 1 78  ? 71.507  109.017 90.850  1.00 36.57  ? 77  ILE C N     1 
ATOM 2760  C CA    . ILE C 1 78  ? 72.816  109.483 90.433  1.00 36.22  ? 77  ILE C CA    1 
ATOM 2761  C C     . ILE C 1 78  ? 72.896  110.984 90.628  1.00 36.65  ? 77  ILE C C     1 
ATOM 2762  O O     . ILE C 1 78  ? 71.940  111.616 91.087  1.00 37.99  ? 77  ILE C O     1 
ATOM 2763  C CB    . ILE C 1 78  ? 73.042  109.257 88.957  1.00 35.10  ? 77  ILE C CB    1 
ATOM 2764  C CG1   . ILE C 1 78  ? 71.904  109.919 88.182  1.00 34.62  ? 77  ILE C CG1   1 
ATOM 2765  C CG2   . ILE C 1 78  ? 73.178  107.779 88.641  1.00 34.88  ? 77  ILE C CG2   1 
ATOM 2766  C CD1   . ILE C 1 78  ? 72.005  109.769 86.694  1.00 33.69  ? 77  ILE C CD1   1 
ATOM 2767  N N     . TYR C 1 79  ? 74.038  111.558 90.275  1.00 36.67  ? 78  TYR C N     1 
ATOM 2768  C CA    . TYR C 1 79  ? 74.135  113.000 90.207  1.00 37.17  ? 78  TYR C CA    1 
ATOM 2769  C C     . TYR C 1 79  ? 75.002  113.380 89.039  1.00 36.75  ? 78  TYR C C     1 
ATOM 2770  O O     . TYR C 1 79  ? 75.826  112.576 88.617  1.00 36.43  ? 78  TYR C O     1 
ATOM 2771  C CB    . TYR C 1 79  ? 74.715  113.563 91.481  1.00 38.59  ? 78  TYR C CB    1 
ATOM 2772  C CG    . TYR C 1 79  ? 76.137  113.208 91.721  1.00 39.10  ? 78  TYR C CG    1 
ATOM 2773  C CD1   . TYR C 1 79  ? 77.131  114.129 91.508  1.00 39.85  ? 78  TYR C CD1   1 
ATOM 2774  C CD2   . TYR C 1 79  ? 76.487  111.957 92.190  1.00 39.18  ? 78  TYR C CD2   1 
ATOM 2775  C CE1   . TYR C 1 79  ? 78.450  113.816 91.740  1.00 40.67  ? 78  TYR C CE1   1 
ATOM 2776  C CE2   . TYR C 1 79  ? 77.796  111.630 92.430  1.00 39.99  ? 78  TYR C CE2   1 
ATOM 2777  C CZ    . TYR C 1 79  ? 78.786  112.567 92.208  1.00 40.75  ? 78  TYR C CZ    1 
ATOM 2778  O OH    . TYR C 1 79  ? 80.117  112.261 92.454  1.00 41.91  ? 78  TYR C OH    1 
ATOM 2779  N N     . ARG C 1 80  ? 74.813  114.579 88.493  1.00 40.01  ? 79  ARG C N     1 
ATOM 2780  C CA    . ARG C 1 80  ? 75.584  114.992 87.329  1.00 38.64  ? 79  ARG C CA    1 
ATOM 2781  C C     . ARG C 1 80  ? 75.974  116.455 87.403  1.00 39.78  ? 79  ARG C C     1 
ATOM 2782  O O     . ARG C 1 80  ? 75.113  117.330 87.451  1.00 41.76  ? 79  ARG C O     1 
ATOM 2783  C CB    . ARG C 1 80  ? 74.765  114.812 86.069  1.00 38.62  ? 79  ARG C CB    1 
ATOM 2784  C CG    . ARG C 1 80  ? 74.093  113.486 85.910  1.00 38.30  ? 79  ARG C CG    1 
ATOM 2785  C CD    . ARG C 1 80  ? 73.349  113.469 84.596  1.00 38.44  ? 79  ARG C CD    1 
ATOM 2786  N NE    . ARG C 1 80  ? 72.308  114.489 84.598  1.00 40.60  ? 79  ARG C NE    1 
ATOM 2787  C CZ    . ARG C 1 80  ? 71.483  114.719 83.582  1.00 40.67  ? 79  ARG C CZ    1 
ATOM 2788  N NH1   . ARG C 1 80  ? 71.576  113.999 82.469  1.00 38.94  ? 79  ARG C NH1   1 
ATOM 2789  N NH2   . ARG C 1 80  ? 70.563  115.671 83.684  1.00 43.08  ? 79  ARG C NH2   1 
ATOM 2790  N N     . TYR C 1 81  ? 77.265  116.744 87.389  1.00 39.02  ? 80  TYR C N     1 
ATOM 2791  C CA    . TYR C 1 81  ? 77.678  118.128 87.336  1.00 40.47  ? 80  TYR C CA    1 
ATOM 2792  C C     . TYR C 1 81  ? 78.341  118.428 86.004  1.00 40.67  ? 80  TYR C C     1 
ATOM 2793  O O     . TYR C 1 81  ? 78.715  117.514 85.264  1.00 39.84  ? 80  TYR C O     1 
ATOM 2794  C CB    . TYR C 1 81  ? 78.595  118.463 88.510  1.00 42.01  ? 80  TYR C CB    1 
ATOM 2795  C CG    . TYR C 1 81  ? 79.856  117.633 88.582  1.00 42.28  ? 80  TYR C CG    1 
ATOM 2796  C CD1   . TYR C 1 81  ? 81.094  118.174 88.249  1.00 43.77  ? 80  TYR C CD1   1 
ATOM 2797  C CD2   . TYR C 1 81  ? 79.811  116.308 88.986  1.00 41.37  ? 80  TYR C CD2   1 
ATOM 2798  C CE1   . TYR C 1 81  ? 82.249  117.410 88.311  1.00 44.36  ? 80  TYR C CE1   1 
ATOM 2799  C CE2   . TYR C 1 81  ? 80.962  115.540 89.043  1.00 41.93  ? 80  TYR C CE2   1 
ATOM 2800  C CZ    . TYR C 1 81  ? 82.183  116.090 88.707  1.00 43.44  ? 80  TYR C CZ    1 
ATOM 2801  O OH    . TYR C 1 81  ? 83.322  115.302 88.788  1.00 44.33  ? 80  TYR C OH    1 
ATOM 2802  N N     . VAL C 1 82  ? 78.453  119.712 85.683  1.00 41.99  ? 81  VAL C N     1 
ATOM 2803  C CA    . VAL C 1 82  ? 79.258  120.159 84.548  1.00 42.83  ? 81  VAL C CA    1 
ATOM 2804  C C     . VAL C 1 82  ? 80.748  120.016 84.855  1.00 44.12  ? 81  VAL C C     1 
ATOM 2805  O O     . VAL C 1 82  ? 81.230  120.502 85.886  1.00 45.45  ? 81  VAL C O     1 
ATOM 2806  C CB    . VAL C 1 82  ? 79.016  121.621 84.282  1.00 44.38  ? 81  VAL C CB    1 
ATOM 2807  C CG1   . VAL C 1 82  ? 79.952  122.115 83.194  1.00 45.70  ? 81  VAL C CG1   1 
ATOM 2808  C CG2   . VAL C 1 82  ? 77.569  121.858 83.954  1.00 43.57  ? 81  VAL C CG2   1 
ATOM 2809  N N     . ASP C 1 83  ? 81.472  119.343 83.970  1.00 43.97  ? 82  ASP C N     1 
ATOM 2810  C CA    . ASP C 1 83  ? 82.915  119.183 84.109  1.00 45.55  ? 82  ASP C CA    1 
ATOM 2811  C C     . ASP C 1 83  ? 83.568  120.537 84.230  1.00 47.94  ? 82  ASP C C     1 
ATOM 2812  O O     . ASP C 1 83  ? 83.118  121.479 83.596  1.00 48.43  ? 82  ASP C O     1 
ATOM 2813  C CB    . ASP C 1 83  ? 83.485  118.504 82.874  1.00 45.49  ? 82  ASP C CB    1 
ATOM 2814  C CG    . ASP C 1 83  ? 84.951  118.220 83.003  1.00 47.34  ? 82  ASP C CG    1 
ATOM 2815  O OD1   . ASP C 1 83  ? 85.295  117.094 83.409  1.00 46.89  ? 82  ASP C OD1   1 
ATOM 2816  O OD2   . ASP C 1 83  ? 85.757  119.118 82.708  1.00 49.51  ? 82  ASP C OD2   1 
ATOM 2817  N N     . ALA C 1 84  ? 84.636  120.637 85.016  1.00 55.88  ? 83  ALA C N     1 
ATOM 2818  C CA    . ALA C 1 84  ? 85.323  121.916 85.217  1.00 58.77  ? 83  ALA C CA    1 
ATOM 2819  C C     . ALA C 1 84  ? 86.183  122.379 84.033  1.00 60.61  ? 83  ALA C C     1 
ATOM 2820  O O     . ALA C 1 84  ? 86.156  123.553 83.679  1.00 62.28  ? 83  ALA C O     1 
ATOM 2821  C CB    . ALA C 1 84  ? 86.163  121.872 86.495  1.00 60.24  ? 83  ALA C CB    1 
ATOM 2822  N N     . GLN C 1 85  ? 86.951  121.468 83.438  1.00 76.46  ? 84  GLN C N     1 
ATOM 2823  C CA    . GLN C 1 85  ? 87.871  121.828 82.352  1.00 78.83  ? 84  GLN C CA    1 
ATOM 2824  C C     . GLN C 1 85  ? 87.172  122.034 81.018  1.00 78.07  ? 84  GLN C C     1 
ATOM 2825  O O     . GLN C 1 85  ? 87.537  122.931 80.251  1.00 80.13  ? 84  GLN C O     1 
ATOM 2826  C CB    . GLN C 1 85  ? 88.996  120.796 82.216  1.00 79.35  ? 84  GLN C CB    1 
ATOM 2827  C CG    . GLN C 1 85  ? 89.967  120.856 83.384  1.00 81.36  ? 84  GLN C CG    1 
ATOM 2828  C CD    . GLN C 1 85  ? 91.102  119.845 83.304  1.00 82.72  ? 84  GLN C CD    1 
ATOM 2829  O OE1   . GLN C 1 85  ? 91.554  119.463 82.216  1.00 83.44  ? 84  GLN C OE1   1 
ATOM 2830  N NE2   . GLN C 1 85  ? 91.580  119.414 84.475  1.00 83.38  ? 84  GLN C NE2   1 
ATOM 2831  N N     . ASP C 1 86  ? 86.163  121.200 80.763  1.00 67.00  ? 85  ASP C N     1 
ATOM 2832  C CA    . ASP C 1 86  ? 85.396  121.222 79.521  1.00 66.01  ? 85  ASP C CA    1 
ATOM 2833  C C     . ASP C 1 86  ? 83.917  121.385 79.819  1.00 63.90  ? 85  ASP C C     1 
ATOM 2834  O O     . ASP C 1 86  ? 83.244  120.403 80.106  1.00 61.55  ? 85  ASP C O     1 
ATOM 2835  C CB    . ASP C 1 86  ? 85.588  119.910 78.764  1.00 65.09  ? 85  ASP C CB    1 
ATOM 2836  C CG    . ASP C 1 86  ? 85.093  119.990 77.330  1.00 65.10  ? 85  ASP C CG    1 
ATOM 2837  O OD1   . ASP C 1 86  ? 84.337  120.929 77.022  1.00 65.33  ? 85  ASP C OD1   1 
ATOM 2838  O OD2   . ASP C 1 86  ? 85.461  119.121 76.508  1.00 65.05  ? 85  ASP C OD2   1 
ATOM 2839  N N     . THR C 1 87  ? 83.401  122.606 79.715  1.00 53.40  ? 86  THR C N     1 
ATOM 2840  C CA    . THR C 1 87  ? 82.014  122.900 80.095  1.00 51.89  ? 86  THR C CA    1 
ATOM 2841  C C     . THR C 1 87  ? 80.987  122.161 79.232  1.00 49.80  ? 86  THR C C     1 
ATOM 2842  O O     . THR C 1 87  ? 79.813  122.073 79.582  1.00 48.24  ? 86  THR C O     1 
ATOM 2843  C CB    . THR C 1 87  ? 81.778  124.430 80.129  1.00 54.50  ? 86  THR C CB    1 
ATOM 2844  O OG1   . THR C 1 87  ? 82.567  124.983 81.187  1.00 56.20  ? 86  THR C OG1   1 
ATOM 2845  C CG2   . THR C 1 87  ? 80.313  124.783 80.389  1.00 53.42  ? 86  THR C CG2   1 
ATOM 2846  N N     . ARG C 1 88  ? 81.447  121.595 78.123  1.00 50.48  ? 87  ARG C N     1 
ATOM 2847  C CA    . ARG C 1 88  ? 80.599  120.752 77.286  1.00 48.70  ? 87  ARG C CA    1 
ATOM 2848  C C     . ARG C 1 88  ? 80.230  119.447 77.990  1.00 46.82  ? 87  ARG C C     1 
ATOM 2849  O O     . ARG C 1 88  ? 79.157  118.877 77.749  1.00 45.19  ? 87  ARG C O     1 
ATOM 2850  C CB    . ARG C 1 88  ? 81.291  120.402 75.965  1.00 49.58  ? 87  ARG C CB    1 
ATOM 2851  C CG    . ARG C 1 88  ? 81.422  121.524 74.981  1.00 51.67  ? 87  ARG C CG    1 
ATOM 2852  C CD    . ARG C 1 88  ? 82.131  121.012 73.746  1.00 52.62  ? 87  ARG C CD    1 
ATOM 2853  N NE    . ARG C 1 88  ? 83.471  120.500 74.040  1.00 53.66  ? 87  ARG C NE    1 
ATOM 2854  C CZ    . ARG C 1 88  ? 84.309  120.037 73.117  1.00 55.01  ? 87  ARG C CZ    1 
ATOM 2855  N NH1   . ARG C 1 88  ? 83.933  120.017 71.847  1.00 55.36  ? 87  ARG C NH1   1 
ATOM 2856  N NH2   . ARG C 1 88  ? 85.519  119.604 73.459  1.00 56.27  ? 87  ARG C NH2   1 
ATOM 2857  N N     . ARG C 1 89  ? 81.129  118.954 78.836  1.00 59.47  ? 88  ARG C N     1 
ATOM 2858  C CA    . ARG C 1 89  ? 80.963  117.619 79.397  1.00 57.67  ? 88  ARG C CA    1 
ATOM 2859  C C     . ARG C 1 89  ? 80.076  117.610 80.618  1.00 56.38  ? 88  ARG C C     1 
ATOM 2860  O O     . ARG C 1 89  ? 79.806  118.647 81.203  1.00 57.34  ? 88  ARG C O     1 
ATOM 2861  C CB    . ARG C 1 89  ? 82.314  117.003 79.737  1.00 58.72  ? 88  ARG C CB    1 
ATOM 2862  C CG    . ARG C 1 89  ? 83.264  116.955 78.582  1.00 60.29  ? 88  ARG C CG    1 
ATOM 2863  C CD    . ARG C 1 89  ? 84.360  115.954 78.856  1.00 61.23  ? 88  ARG C CD    1 
ATOM 2864  N NE    . ARG C 1 89  ? 85.207  115.739 77.684  1.00 62.94  ? 88  ARG C NE    1 
ATOM 2865  C CZ    . ARG C 1 89  ? 86.255  114.921 77.668  1.00 64.29  ? 88  ARG C CZ    1 
ATOM 2866  N NH1   . ARG C 1 89  ? 86.576  114.244 78.773  1.00 64.11  ? 88  ARG C NH1   1 
ATOM 2867  N NH2   . ARG C 1 89  ? 86.979  114.786 76.553  1.00 65.91  ? 88  ARG C NH2   1 
ATOM 2868  N N     . LYS C 1 90  ? 79.609  116.419 80.975  1.00 39.11  ? 89  LYS C N     1 
ATOM 2869  C CA    . LYS C 1 90  ? 78.819  116.211 82.195  1.00 38.26  ? 89  LYS C CA    1 
ATOM 2870  C C     . LYS C 1 90  ? 79.302  114.958 82.914  1.00 37.85  ? 89  LYS C C     1 
ATOM 2871  O O     . LYS C 1 90  ? 79.176  113.843 82.400  1.00 37.01  ? 89  LYS C O     1 
ATOM 2872  C CB    . LYS C 1 90  ? 77.332  116.094 81.885  1.00 37.02  ? 89  LYS C CB    1 
ATOM 2873  C CG    . LYS C 1 90  ? 76.665  117.403 81.552  1.00 37.69  ? 89  LYS C CG    1 
ATOM 2874  C CD    . LYS C 1 90  ? 75.202  117.317 81.870  1.00 36.89  ? 89  LYS C CD    1 
ATOM 2875  C CE    . LYS C 1 90  ? 74.404  118.422 81.241  1.00 37.62  ? 89  LYS C CE    1 
ATOM 2876  N NZ    . LYS C 1 90  ? 72.967  118.158 81.533  1.00 37.01  ? 89  LYS C NZ    1 
ATOM 2877  N N     . ASN C 1 91  ? 79.890  115.140 84.087  1.00 44.07  ? 90  ASN C N     1 
ATOM 2878  C CA    . ASN C 1 91  ? 80.420  114.000 84.809  1.00 44.10  ? 90  ASN C CA    1 
ATOM 2879  C C     . ASN C 1 91  ? 79.295  113.329 85.586  1.00 43.23  ? 90  ASN C C     1 
ATOM 2880  O O     . ASN C 1 91  ? 78.435  114.008 86.135  1.00 43.43  ? 90  ASN C O     1 
ATOM 2881  C CB    . ASN C 1 91  ? 81.584  114.429 85.705  1.00 45.85  ? 90  ASN C CB    1 
ATOM 2882  C CG    . ASN C 1 91  ? 82.701  115.152 84.918  1.00 47.59  ? 90  ASN C CG    1 
ATOM 2883  O OD1   . ASN C 1 91  ? 83.286  116.114 85.407  1.00 49.51  ? 90  ASN C OD1   1 
ATOM 2884  N ND2   . ASN C 1 91  ? 82.987  114.687 83.702  1.00 47.43  ? 90  ASN C ND2   1 
ATOM 2885  N N     . ILE C 1 92  ? 79.276  112.001 85.594  1.00 36.98  ? 91  ILE C N     1 
ATOM 2886  C CA    . ILE C 1 92  ? 78.217  111.238 86.247  1.00 36.14  ? 91  ILE C CA    1 
ATOM 2887  C C     . ILE C 1 92  ? 78.755  110.474 87.436  1.00 36.92  ? 91  ILE C C     1 
ATOM 2888  O O     . ILE C 1 92  ? 79.862  109.943 87.378  1.00 37.75  ? 91  ILE C O     1 
ATOM 2889  C CB    . ILE C 1 92  ? 77.716  110.180 85.326  1.00 35.19  ? 91  ILE C CB    1 
ATOM 2890  C CG1   . ILE C 1 92  ? 77.591  110.763 83.921  1.00 34.80  ? 91  ILE C CG1   1 
ATOM 2891  C CG2   . ILE C 1 92  ? 76.404  109.632 85.815  1.00 34.48  ? 91  ILE C CG2   1 
ATOM 2892  C CD1   . ILE C 1 92  ? 76.587  111.911 83.797  1.00 34.47  ? 91  ILE C CD1   1 
ATOM 2893  N N     . GLY C 1 93  ? 77.983  110.407 88.512  1.00 36.93  ? 92  GLY C N     1 
ATOM 2894  C CA    . GLY C 1 93  ? 78.311  109.515 89.608  1.00 37.73  ? 92  GLY C CA    1 
ATOM 2895  C C     . GLY C 1 93  ? 77.080  108.987 90.315  1.00 37.42  ? 92  GLY C C     1 
ATOM 2896  O O     . GLY C 1 93  ? 75.989  109.550 90.185  1.00 36.82  ? 92  GLY C O     1 
ATOM 2897  N N     . LEU C 1 94  ? 77.254  107.901 91.060  1.00 43.61  ? 93  LEU C N     1 
ATOM 2898  C CA    . LEU C 1 94  ? 76.193  107.377 91.913  1.00 44.36  ? 93  LEU C CA    1 
ATOM 2899  C C     . LEU C 1 94  ? 76.025  108.156 93.201  1.00 45.40  ? 93  LEU C C     1 
ATOM 2900  O O     . LEU C 1 94  ? 76.991  108.422 93.897  1.00 46.37  ? 93  LEU C O     1 
ATOM 2901  C CB    . LEU C 1 94  ? 76.497  105.939 92.297  1.00 45.20  ? 93  LEU C CB    1 
ATOM 2902  C CG    . LEU C 1 94  ? 76.318  104.884 91.217  1.00 44.47  ? 93  LEU C CG    1 
ATOM 2903  C CD1   . LEU C 1 94  ? 76.706  103.570 91.804  1.00 45.45  ? 93  LEU C CD1   1 
ATOM 2904  C CD2   . LEU C 1 94  ? 74.872  104.834 90.766  1.00 44.59  ? 93  LEU C CD2   1 
ATOM 2905  N N     . THR C 1 95  ? 74.791  108.498 93.536  1.00 39.36  ? 94  THR C N     1 
ATOM 2906  C CA    . THR C 1 95  ? 74.478  108.979 94.878  1.00 40.74  ? 94  THR C CA    1 
ATOM 2907  C C     . THR C 1 95  ? 74.436  107.812 95.855  1.00 41.92  ? 94  THR C C     1 
ATOM 2908  O O     . THR C 1 95  ? 74.195  106.675 95.456  1.00 41.58  ? 94  THR C O     1 
ATOM 2909  C CB    . THR C 1 95  ? 73.119  109.675 94.931  1.00 40.68  ? 94  THR C CB    1 
ATOM 2910  O OG1   . THR C 1 95  ? 72.100  108.819 94.383  1.00 40.03  ? 94  THR C OG1   1 
ATOM 2911  C CG2   . THR C 1 95  ? 73.181  110.973 94.156  1.00 40.02  ? 94  THR C CG2   1 
ATOM 2912  N N     . THR C 1 96  ? 74.667  108.108 97.129  1.00 43.54  ? 95  THR C N     1 
ATOM 2913  C CA    . THR C 1 96  ? 74.607  107.118 98.201  1.00 45.11  ? 95  THR C CA    1 
ATOM 2914  C C     . THR C 1 96  ? 73.426  106.183 98.046  1.00 44.98  ? 95  THR C C     1 
ATOM 2915  O O     . THR C 1 96  ? 73.596  104.970 98.076  1.00 45.43  ? 95  THR C O     1 
ATOM 2916  C CB    . THR C 1 96  ? 74.557  107.793 99.587  1.00 47.00  ? 95  THR C CB    1 
ATOM 2917  O OG1   . THR C 1 96  ? 75.857  108.297 99.914  1.00 47.73  ? 95  THR C OG1   1 
ATOM 2918  C CG2   . THR C 1 96  ? 74.173  106.805 100.623 1.00 48.73  ? 95  THR C CG2   1 
ATOM 2919  N N     . SER C 1 97  ? 72.238  106.743 97.831  1.00 44.57  ? 96  SER C N     1 
ATOM 2920  C CA    . SER C 1 97  ? 71.055  105.908 97.632  1.00 44.69  ? 96  SER C CA    1 
ATOM 2921  C C     . SER C 1 97  ? 71.286  104.973 96.484  1.00 43.39  ? 96  SER C C     1 
ATOM 2922  O O     . SER C 1 97  ? 71.008  103.779 96.602  1.00 44.12  ? 96  SER C O     1 
ATOM 2923  C CB    . SER C 1 97  ? 69.827  106.735 97.336  1.00 44.44  ? 96  SER C CB    1 
ATOM 2924  O OG    . SER C 1 97  ? 70.049  107.505 96.186  1.00 42.69  ? 96  SER C OG    1 
ATOM 2925  N N     . GLY C 1 98  ? 71.797  105.523 95.378  1.00 42.72  ? 97  GLY C N     1 
ATOM 2926  C CA    . GLY C 1 98  ? 72.226  104.724 94.241  1.00 41.69  ? 97  GLY C CA    1 
ATOM 2927  C C     . GLY C 1 98  ? 73.177  103.606 94.660  1.00 41.63  ? 97  GLY C C     1 
ATOM 2928  O O     . GLY C 1 98  ? 72.921  102.425 94.384  1.00 42.09  ? 97  GLY C O     1 
ATOM 2929  N N     . ILE C 1 99  ? 74.262  103.969 95.347  1.00 42.40  ? 98  ILE C N     1 
ATOM 2930  C CA    . ILE C 1 99  ? 75.242  102.987 95.797  1.00 43.71  ? 98  ILE C CA    1 
ATOM 2931  C C     . ILE C 1 99  ? 74.563  101.905 96.606  1.00 45.25  ? 98  ILE C C     1 
ATOM 2932  O O     . ILE C 1 99  ? 74.919  100.740 96.494  1.00 46.06  ? 98  ILE C O     1 
ATOM 2933  C CB    . ILE C 1 99  ? 76.356  103.576 96.696  1.00 44.90  ? 98  ILE C CB    1 
ATOM 2934  C CG1   . ILE C 1 99  ? 76.899  104.893 96.165  1.00 43.86  ? 98  ILE C CG1   1 
ATOM 2935  C CG2   . ILE C 1 99  ? 77.498  102.614 96.807  1.00 46.15  ? 98  ILE C CG2   1 
ATOM 2936  C CD1   . ILE C 1 99  ? 78.009  105.467 97.035  1.00 45.31  ? 98  ILE C CD1   1 
ATOM 2937  N N     . LYS C 1 100 ? 73.590  102.264 97.430  1.00 45.96  ? 99  LYS C N     1 
ATOM 2938  C CA    . LYS C 1 100 ? 72.951  101.219 98.230  1.00 47.80  ? 99  LYS C CA    1 
ATOM 2939  C C     . LYS C 1 100 ? 72.103  100.347 97.306  1.00 47.22  ? 99  LYS C C     1 
ATOM 2940  O O     . LYS C 1 100 ? 72.200  99.124  97.330  1.00 48.35  ? 99  LYS C O     1 
ATOM 2941  C CB    . LYS C 1 100 ? 72.139  101.789 99.408  1.00 49.18  ? 99  LYS C CB    1 
ATOM 2942  N N     . LEU C 1 101 ? 71.319  101.003 96.458  1.00 45.62  ? 100 LEU C N     1 
ATOM 2943  C CA    . LEU C 1 101 ? 70.444  100.327 95.525  1.00 45.11  ? 100 LEU C CA    1 
ATOM 2944  C C     . LEU C 1 101 ? 71.184  99.248  94.734  1.00 44.93  ? 100 LEU C C     1 
ATOM 2945  O O     . LEU C 1 101 ? 70.675  98.140  94.577  1.00 45.92  ? 100 LEU C O     1 
ATOM 2946  C CB    . LEU C 1 101 ? 69.815  101.345 94.576  1.00 43.43  ? 100 LEU C CB    1 
ATOM 2947  C CG    . LEU C 1 101 ? 68.819  100.720 93.607  1.00 43.99  ? 100 LEU C CG    1 
ATOM 2948  C CD1   . LEU C 1 101 ? 67.698  100.068 94.416  1.00 45.88  ? 100 LEU C CD1   1 
ATOM 2949  C CD2   . LEU C 1 101 ? 68.273  101.726 92.612  1.00 43.52  ? 100 LEU C CD2   1 
ATOM 2950  N N     . VAL C 1 102 ? 72.387  99.558  94.250  1.00 45.27  ? 101 VAL C N     1 
ATOM 2951  C CA    . VAL C 1 102 ? 73.156  98.575  93.481  1.00 45.29  ? 101 VAL C CA    1 
ATOM 2952  C C     . VAL C 1 102 ? 73.533  97.391  94.355  1.00 47.31  ? 101 VAL C C     1 
ATOM 2953  O O     . VAL C 1 102 ? 73.404  96.239  93.942  1.00 48.31  ? 101 VAL C O     1 
ATOM 2954  C CB    . VAL C 1 102 ? 74.431  99.175  92.837  1.00 43.98  ? 101 VAL C CB    1 
ATOM 2955  C CG1   . VAL C 1 102 ? 75.360  98.060  92.319  1.00 44.87  ? 101 VAL C CG1   1 
ATOM 2956  C CG2   . VAL C 1 102 ? 74.057  100.128 91.700  1.00 42.19  ? 101 VAL C CG2   1 
ATOM 2957  N N     . GLU C 1 103 ? 73.981  97.673  95.570  1.00 47.62  ? 102 GLU C N     1 
ATOM 2958  C CA    . GLU C 1 103 ? 74.396  96.606  96.462  1.00 50.09  ? 102 GLU C CA    1 
ATOM 2959  C C     . GLU C 1 103 ? 73.202  95.719  96.797  1.00 51.48  ? 102 GLU C C     1 
ATOM 2960  O O     . GLU C 1 103 ? 73.364  94.541  97.107  1.00 53.53  ? 102 GLU C O     1 
ATOM 2961  C CB    . GLU C 1 103 ? 75.069  97.167  97.724  1.00 51.31  ? 102 GLU C CB    1 
ATOM 2962  C CG    . GLU C 1 103 ? 76.419  97.846  97.477  1.00 50.67  ? 102 GLU C CG    1 
ATOM 2963  C CD    . GLU C 1 103 ? 76.877  98.729  98.635  1.00 51.55  ? 102 GLU C CD    1 
ATOM 2964  O OE1   . GLU C 1 103 ? 76.124  98.899  99.622  1.00 52.53  ? 102 GLU C OE1   1 
ATOM 2965  O OE2   . GLU C 1 103 ? 78.007  99.261  98.562  1.00 51.52  ? 102 GLU C OE2   1 
ATOM 2966  N N     . ALA C 1 104 ? 72.000  96.289  96.699  1.00 50.61  ? 103 ALA C N     1 
ATOM 2967  C CA    . ALA C 1 104 ? 70.763  95.542  96.921  1.00 52.04  ? 103 ALA C CA    1 
ATOM 2968  C C     . ALA C 1 104 ? 70.432  94.591  95.751  1.00 51.80  ? 103 ALA C C     1 
ATOM 2969  O O     . ALA C 1 104 ? 70.397  93.365  95.952  1.00 53.86  ? 103 ALA C O     1 
ATOM 2970  C CB    . ALA C 1 104 ? 69.617  96.480  97.197  1.00 51.56  ? 103 ALA C CB    1 
ATOM 2971  N N     . PHE C 1 105 ? 70.162  95.155  94.579  1.00 49.58  ? 104 PHE C N     1 
ATOM 2972  C CA    . PHE C 1 105 ? 69.686  94.398  93.422  1.00 49.35  ? 104 PHE C CA    1 
ATOM 2973  C C     . PHE C 1 105 ? 70.742  93.559  92.723  1.00 49.55  ? 104 PHE C C     1 
ATOM 2974  O O     . PHE C 1 105 ? 70.425  92.725  91.885  1.00 49.97  ? 104 PHE C O     1 
ATOM 2975  C CB    . PHE C 1 105 ? 68.968  95.310  92.420  1.00 47.21  ? 104 PHE C CB    1 
ATOM 2976  C CG    . PHE C 1 105 ? 69.886  96.170  91.599  1.00 44.99  ? 104 PHE C CG    1 
ATOM 2977  C CD1   . PHE C 1 105 ? 70.808  95.608  90.737  1.00 44.69  ? 104 PHE C CD1   1 
ATOM 2978  C CD2   . PHE C 1 105 ? 69.806  97.544  91.674  1.00 43.64  ? 104 PHE C CD2   1 
ATOM 2979  C CE1   . PHE C 1 105 ? 71.643  96.399  89.983  1.00 43.07  ? 104 PHE C CE1   1 
ATOM 2980  C CE2   . PHE C 1 105 ? 70.635  98.341  90.921  1.00 41.96  ? 104 PHE C CE2   1 
ATOM 2981  C CZ    . PHE C 1 105 ? 71.556  97.769  90.074  1.00 41.62  ? 104 PHE C CZ    1 
ATOM 2982  N N     . THR C 1 106 ? 71.998  93.769  93.074  1.00 64.51  ? 105 THR C N     1 
ATOM 2983  C CA    . THR C 1 106 ? 73.098  93.251  92.287  1.00 63.72  ? 105 THR C CA    1 
ATOM 2984  C C     . THR C 1 106 ? 72.988  91.742  92.171  1.00 65.55  ? 105 THR C C     1 
ATOM 2985  O O     . THR C 1 106 ? 73.326  91.167  91.144  1.00 65.45  ? 105 THR C O     1 
ATOM 2986  C CB    . THR C 1 106 ? 74.454  93.629  92.902  1.00 62.21  ? 105 THR C CB    1 
ATOM 2987  O OG1   . THR C 1 106 ? 75.496  93.362  91.960  1.00 61.57  ? 105 THR C OG1   1 
ATOM 2988  C CG2   . THR C 1 106 ? 74.710  92.833  94.168  1.00 63.88  ? 105 THR C CG2   1 
ATOM 2989  N N     . SER C 1 107 ? 72.519  91.101  93.229  1.00 69.31  ? 106 SER C N     1 
ATOM 2990  C CA    . SER C 1 107 ? 72.400  89.653  93.241  1.00 71.38  ? 106 SER C CA    1 
ATOM 2991  C C     . SER C 1 107 ? 71.461  89.156  92.151  1.00 71.88  ? 106 SER C C     1 
ATOM 2992  O O     . SER C 1 107 ? 71.733  88.143  91.515  1.00 72.83  ? 106 SER C O     1 
ATOM 2993  C CB    . SER C 1 107 ? 71.884  89.191  94.597  1.00 73.52  ? 106 SER C CB    1 
ATOM 2994  O OG    . SER C 1 107 ? 70.639  89.795  94.885  1.00 73.77  ? 106 SER C OG    1 
ATOM 2995  N N     . ILE C 1 108 ? 70.355  89.859  91.935  1.00 57.42  ? 107 ILE C N     1 
ATOM 2996  C CA    . ILE C 1 108 ? 69.405  89.458  90.892  1.00 57.87  ? 107 ILE C CA    1 
ATOM 2997  C C     . ILE C 1 108 ? 70.067  89.157  89.545  1.00 57.32  ? 107 ILE C C     1 
ATOM 2998  O O     . ILE C 1 108 ? 69.733  88.176  88.874  1.00 58.76  ? 107 ILE C O     1 
ATOM 2999  C CB    . ILE C 1 108 ? 68.340  90.526  90.653  1.00 56.87  ? 107 ILE C CB    1 
ATOM 3000  C CG1   . ILE C 1 108 ? 67.514  90.757  91.913  1.00 57.91  ? 107 ILE C CG1   1 
ATOM 3001  C CG2   . ILE C 1 108 ? 67.421  90.117  89.511  1.00 57.54  ? 107 ILE C CG2   1 
ATOM 3002  C CD1   . ILE C 1 108 ? 66.314  91.666  91.651  1.00 57.75  ? 107 ILE C CD1   1 
ATOM 3003  N N     . PHE C 1 109 ? 70.992  90.016  89.139  1.00 56.67  ? 108 PHE C N     1 
ATOM 3004  C CA    . PHE C 1 109 ? 71.749  89.760  87.930  1.00 55.85  ? 108 PHE C CA    1 
ATOM 3005  C C     . PHE C 1 109 ? 72.569  88.495  88.142  1.00 57.38  ? 108 PHE C C     1 
ATOM 3006  O O     . PHE C 1 109 ? 72.636  87.643  87.259  1.00 58.48  ? 108 PHE C O     1 
ATOM 3007  C CB    . PHE C 1 109 ? 72.616  90.965  87.561  1.00 53.42  ? 108 PHE C CB    1 
ATOM 3008  C CG    . PHE C 1 109 ? 71.817  92.182  87.140  1.00 53.00  ? 108 PHE C CG    1 
ATOM 3009  C CD1   . PHE C 1 109 ? 70.609  92.043  86.491  1.00 54.26  ? 108 PHE C CD1   1 
ATOM 3010  C CD2   . PHE C 1 109 ? 72.272  93.456  87.404  1.00 51.65  ? 108 PHE C CD2   1 
ATOM 3011  C CE1   . PHE C 1 109 ? 69.878  93.143  86.102  1.00 53.63  ? 108 PHE C CE1   1 
ATOM 3012  C CE2   . PHE C 1 109 ? 71.539  94.558  87.026  1.00 51.30  ? 108 PHE C CE2   1 
ATOM 3013  C CZ    . PHE C 1 109 ? 70.337  94.398  86.374  1.00 52.26  ? 108 PHE C CZ    1 
ATOM 3014  N N     . ASP C 1 110 ? 73.150  88.353  89.330  1.00 58.17  ? 109 ASP C N     1 
ATOM 3015  C CA    . ASP C 1 110 ? 73.825  87.111  89.715  1.00 60.65  ? 109 ASP C CA    1 
ATOM 3016  C C     . ASP C 1 110 ? 72.876  85.907  89.673  1.00 63.02  ? 109 ASP C C     1 
ATOM 3017  O O     . ASP C 1 110 ? 73.194  84.887  89.064  1.00 64.90  ? 109 ASP C O     1 
ATOM 3018  C CB    . ASP C 1 110 ? 74.437  87.237  91.112  1.00 61.85  ? 109 ASP C CB    1 
ATOM 3019  C CG    . ASP C 1 110 ? 75.546  88.272  91.182  1.00 60.21  ? 109 ASP C CG    1 
ATOM 3020  O OD1   . ASP C 1 110 ? 75.952  88.798  90.123  1.00 58.41  ? 109 ASP C OD1   1 
ATOM 3021  O OD2   . ASP C 1 110 ? 76.023  88.555  92.301  1.00 60.97  ? 109 ASP C OD2   1 
ATOM 3022  N N     . GLU C 1 111 ? 71.713  86.035  90.310  1.00 88.94  ? 110 GLU C N     1 
ATOM 3023  C CA    . GLU C 1 111 ? 70.727  84.951  90.382  1.00 91.25  ? 110 GLU C CA    1 
ATOM 3024  C C     . GLU C 1 111 ? 70.273  84.428  89.020  1.00 91.80  ? 110 GLU C C     1 
ATOM 3025  O O     . GLU C 1 111 ? 69.687  83.352  88.942  1.00 93.89  ? 110 GLU C O     1 
ATOM 3026  C CB    . GLU C 1 111 ? 69.496  85.378  91.196  1.00 90.96  ? 110 GLU C CB    1 
ATOM 3027  C CG    . GLU C 1 111 ? 69.645  85.268  92.722  1.00 91.88  ? 110 GLU C CG    1 
ATOM 3028  C CD    . GLU C 1 111 ? 68.769  86.274  93.502  1.00 91.30  ? 110 GLU C CD    1 
ATOM 3029  O OE1   . GLU C 1 111 ? 68.278  87.261  92.906  1.00 89.78  ? 110 GLU C OE1   1 
ATOM 3030  O OE2   . GLU C 1 111 ? 68.581  86.080  94.724  1.00 92.58  ? 110 GLU C OE2   1 
ATOM 3031  N N     . MET C 1 112 ? 70.523  85.193  87.957  1.00 85.26  ? 111 MET C N     1 
ATOM 3032  C CA    . MET C 1 112 ? 70.186  84.762  86.599  1.00 85.51  ? 111 MET C CA    1 
ATOM 3033  C C     . MET C 1 112 ? 71.409  84.216  85.882  1.00 85.49  ? 111 MET C C     1 
ATOM 3034  O O     . MET C 1 112 ? 71.337  83.215  85.174  0.73 87.22  ? 111 MET C O     1 
ATOM 3035  C CB    . MET C 1 112 ? 69.653  85.924  85.781  1.00 83.78  ? 111 MET C CB    1 
ATOM 3036  C CG    . MET C 1 112 ? 68.483  86.672  86.381  1.00 83.77  ? 111 MET C CG    1 
ATOM 3037  S SD    . MET C 1 112 ? 67.808  87.816  85.145  1.00 82.94  ? 111 MET C SD    1 
ATOM 3038  C CE    . MET C 1 112 ? 69.328  88.566  84.554  1.00 80.37  ? 111 MET C CE    1 
ATOM 3039  N N     . GLU C 1 113 ? 72.526  84.910  86.055  1.00 67.37  ? 112 GLU C N     1 
ATOM 3040  C CA    . GLU C 1 113 ? 73.774  84.547  85.412  1.00 67.34  ? 112 GLU C CA    1 
ATOM 3041  C C     . GLU C 1 113 ? 74.257  83.180  85.867  1.00 70.51  ? 112 GLU C C     1 
ATOM 3042  O O     . GLU C 1 113 ? 74.700  82.373  85.054  1.00 72.30  ? 112 GLU C O     1 
ATOM 3043  C CB    . GLU C 1 113 ? 74.834  85.587  85.747  1.00 65.12  ? 112 GLU C CB    1 
ATOM 3044  C CG    . GLU C 1 113 ? 76.231  85.213  85.304  1.00 66.34  ? 112 GLU C CG    1 
ATOM 3045  C CD    . GLU C 1 113 ? 76.332  85.081  83.806  1.00 66.04  ? 112 GLU C CD    1 
ATOM 3046  O OE1   . GLU C 1 113 ? 77.262  84.382  83.345  1.00 68.18  ? 112 GLU C OE1   1 
ATOM 3047  O OE2   . GLU C 1 113 ? 75.481  85.676  83.095  1.00 63.97  ? 112 GLU C OE2   1 
ATOM 3048  N N     . GLN C 1 114 ? 74.185  82.926  87.173  1.00 108.31 ? 113 GLN C N     1 
ATOM 3049  C CA    . GLN C 1 114 ? 74.588  81.634  87.715  1.00 112.47 ? 113 GLN C CA    1 
ATOM 3050  C C     . GLN C 1 114 ? 73.508  80.591  87.455  1.00 114.84 ? 113 GLN C C     1 
ATOM 3051  O O     . GLN C 1 114 ? 73.762  79.392  87.537  1.00 118.37 ? 113 GLN C O     1 
ATOM 3052  C CB    . GLN C 1 114 ? 74.895  81.729  89.209  1.00 113.39 ? 113 GLN C CB    1 
ATOM 3053  N N     . THR C 1 115 ? 72.300  81.051  87.145  1.00 70.72  ? 114 THR C N     1 
ATOM 3054  C CA    . THR C 1 115 ? 71.234  80.154  86.707  1.00 72.75  ? 114 THR C CA    1 
ATOM 3055  C C     . THR C 1 115 ? 71.480  79.709  85.273  1.00 73.08  ? 114 THR C C     1 
ATOM 3056  O O     . THR C 1 115 ? 71.195  78.576  84.906  1.00 76.11  ? 114 THR C O     1 
ATOM 3057  C CB    . THR C 1 115 ? 69.865  80.834  86.764  1.00 70.96  ? 114 THR C CB    1 
ATOM 3058  O OG1   . THR C 1 115 ? 69.646  81.351  88.080  1.00 70.62  ? 114 THR C OG1   1 
ATOM 3059  C CG2   . THR C 1 115 ? 68.757  79.850  86.401  1.00 73.60  ? 114 THR C CG2   1 
ATOM 3060  N N     . LEU C 1 116 ? 72.008  80.613  84.458  1.00 87.64  ? 115 LEU C N     1 
ATOM 3061  C CA    . LEU C 1 116 ? 72.316  80.284  83.078  1.00 87.72  ? 115 LEU C CA    1 
ATOM 3062  C C     . LEU C 1 116 ? 73.504  79.342  82.985  1.00 90.95  ? 115 LEU C C     1 
ATOM 3063  O O     . LEU C 1 116 ? 73.422  78.302  82.339  1.00 93.98  ? 115 LEU C O     1 
ATOM 3064  C CB    . LEU C 1 116 ? 72.593  81.544  82.257  1.00 84.75  ? 115 LEU C CB    1 
ATOM 3065  C CG    . LEU C 1 116 ? 71.420  82.402  81.775  1.00 83.36  ? 115 LEU C CG    1 
ATOM 3066  C CD1   . LEU C 1 116 ? 71.917  83.388  80.738  1.00 80.68  ? 115 LEU C CD1   1 
ATOM 3067  C CD2   . LEU C 1 116 ? 70.288  81.552  81.213  1.00 85.11  ? 115 LEU C CD2   1 
ATOM 3068  N N     . VAL C 1 117 ? 74.607  79.695  83.636  1.00 88.21  ? 116 VAL C N     1 
ATOM 3069  C CA    . VAL C 1 117 ? 75.837  78.922  83.484  1.00 91.07  ? 116 VAL C CA    1 
ATOM 3070  C C     . VAL C 1 117 ? 75.698  77.501  84.010  1.00 95.52  ? 116 VAL C C     1 
ATOM 3071  O O     . VAL C 1 117 ? 76.531  76.641  83.724  1.00 98.72  ? 116 VAL C O     1 
ATOM 3072  C CB    . VAL C 1 117 ? 77.042  79.585  84.181  1.00 90.17  ? 116 VAL C CB    1 
ATOM 3073  C CG1   . VAL C 1 117 ? 77.163  81.046  83.767  1.00 85.74  ? 116 VAL C CG1   1 
ATOM 3074  C CG2   . VAL C 1 117 ? 76.924  79.455  85.683  1.00 91.32  ? 116 VAL C CG2   1 
ATOM 3075  N N     . SER C 1 118 ? 74.633  77.260  84.769  1.00 116.62 ? 117 SER C N     1 
ATOM 3076  C CA    . SER C 1 118 ? 74.419  75.968  85.407  1.00 121.13 ? 117 SER C CA    1 
ATOM 3077  C C     . SER C 1 118 ? 74.149  74.670  84.648  1.00 124.76 ? 117 SER C C     1 
ATOM 3078  O O     . SER C 1 118 ? 74.496  73.588  85.127  1.00 129.05 ? 117 SER C O     1 
ATOM 3079  C CB    . SER C 1 118 ? 73.317  76.066  86.470  1.00 121.28 ? 117 SER C CB    1 
ATOM 3080  O OG    . SER C 1 118 ? 72.049  76.291  85.880  1.00 120.21 ? 117 SER C OG    1 
ATOM 3081  N N     . GLN C 1 119 ? 73.514  74.790  83.487  1.00 113.80 ? 118 GLN C N     1 
ATOM 3082  C CA    . GLN C 1 119 ? 73.296  73.620  82.623  1.00 117.21 ? 118 GLN C CA    1 
ATOM 3083  C C     . GLN C 1 119 ? 74.575  73.315  81.718  1.00 118.83 ? 118 GLN C C     1 
ATOM 3084  O O     . GLN C 1 119 ? 74.853  72.249  81.170  1.00 122.75 ? 118 GLN C O     1 
ATOM 3085  C CB    . GLN C 1 119 ? 72.283  73.980  81.534  1.00 115.18 ? 118 GLN C CB    1 
ATOM 3086  C CG    . GLN C 1 119 ? 70.895  74.304  82.060  1.00 114.00 ? 118 GLN C CG    1 
ATOM 3087  C CD    . GLN C 1 119 ? 70.756  75.751  82.488  1.00 110.43 ? 118 GLN C CD    1 
ATOM 3088  O OE1   . GLN C 1 119 ? 71.703  76.532  82.396  1.00 108.24 ? 118 GLN C OE1   1 
ATOM 3089  N NE2   . GLN C 1 119 ? 69.570  76.116  82.963  1.00 109.46 ? 118 GLN C NE2   1 
ATOM 3090  N N     . LEU C 1 120 ? 75.416  74.345  81.759  1.00 131.24 ? 119 LEU C N     1 
ATOM 3091  C CA    . LEU C 1 120 ? 76.782  74.236  81.231  1.00 132.56 ? 119 LEU C CA    1 
ATOM 3092  C C     . LEU C 1 120 ? 78.161  74.145  81.854  1.00 134.12 ? 119 LEU C C     1 
ATOM 3093  O O     . LEU C 1 120 ? 78.469  74.939  82.744  1.00 132.03 ? 119 LEU C O     1 
ATOM 3094  C CB    . LEU C 1 120 ? 77.071  75.362  80.234  1.00 130.09 ? 119 LEU C CB    1 
ATOM 3095  C CG    . LEU C 1 120 ? 76.600  75.134  78.797  1.00 132.32 ? 119 LEU C CG    1 
ATOM 3096  C CD1   . LEU C 1 120 ? 75.081  75.084  78.730  1.00 131.78 ? 119 LEU C CD1   1 
ATOM 3097  C CD2   . LEU C 1 120 ? 77.145  76.213  77.874  1.00 129.89 ? 119 LEU C CD2   1 
ATOM 3098  N N     . SER C 1 121 ? 78.864  73.081  81.487  1.00 131.26 ? 120 SER C N     1 
ATOM 3099  C CA    . SER C 1 121 ? 80.078  72.622  82.118  1.00 134.39 ? 120 SER C CA    1 
ATOM 3100  C C     . SER C 1 121 ? 81.055  73.659  81.644  1.00 131.84 ? 120 SER C C     1 
ATOM 3101  O O     . SER C 1 121 ? 80.864  74.258  80.595  1.00 130.13 ? 120 SER C O     1 
ATOM 3102  C CB    . SER C 1 121 ? 80.646  71.237  81.837  1.00 140.02 ? 120 SER C CB    1 
ATOM 3103  N N     . GLU C 1 122 ? 82.105  73.874  82.420  1.00 219.28 ? 121 GLU C N     1 
ATOM 3104  C CA    . GLU C 1 122 ? 83.031  74.952  82.136  1.00 220.03 ? 121 GLU C CA    1 
ATOM 3105  C C     . GLU C 1 122 ? 83.679  74.781  80.766  1.00 220.61 ? 121 GLU C C     1 
ATOM 3106  O O     . GLU C 1 122 ? 83.800  75.743  80.008  1.00 217.71 ? 121 GLU C O     1 
ATOM 3107  C CB    . GLU C 1 122 ? 84.105  75.015  83.222  1.00 228.05 ? 121 GLU C CB    1 
ATOM 3108  N N     . GLU C 1 123 ? 84.075  73.562  80.427  1.00 149.17 ? 122 GLU C N     1 
ATOM 3109  C CA    . GLU C 1 123 ? 84.607  73.326  79.097  1.00 150.28 ? 122 GLU C CA    1 
ATOM 3110  C C     . GLU C 1 123 ? 83.734  73.713  77.926  1.00 143.11 ? 122 GLU C C     1 
ATOM 3111  O O     . GLU C 1 123 ? 84.149  74.418  77.012  1.00 141.78 ? 122 GLU C O     1 
ATOM 3112  C CB    . GLU C 1 123 ? 85.051  71.875  78.951  1.00 157.36 ? 122 GLU C CB    1 
ATOM 3113  N N     . GLU C 1 124 ? 82.500  73.210  77.957  1.00 160.19 ? 123 GLU C N     1 
ATOM 3114  C CA    . GLU C 1 124 ? 81.494  73.686  76.980  1.00 154.17 ? 123 GLU C CA    1 
ATOM 3115  C C     . GLU C 1 124 ? 80.687  75.073  77.040  1.00 147.32 ? 123 GLU C C     1 
ATOM 3116  O O     . GLU C 1 124 ? 80.308  75.726  76.075  1.00 144.21 ? 123 GLU C O     1 
ATOM 3117  C CB    . GLU C 1 124 ? 80.293  72.717  77.045  1.00 151.13 ? 123 GLU C CB    1 
ATOM 3118  C CG    . GLU C 1 124 ? 79.544  72.673  78.380  1.00 148.80 ? 123 GLU C CG    1 
ATOM 3119  C CD    . GLU C 1 124 ? 78.444  71.623  78.444  1.00 147.25 ? 123 GLU C CD    1 
ATOM 3120  O OE1   . GLU C 1 124 ? 78.018  71.153  77.376  1.00 146.26 ? 123 GLU C OE1   1 
ATOM 3121  O OE2   . GLU C 1 124 ? 77.991  71.281  79.556  1.00 146.87 ? 123 GLU C OE2   1 
ATOM 3122  N N     . ASN C 1 125 ? 80.681  75.550  78.276  1.00 121.40 ? 124 ASN C N     1 
ATOM 3123  C CA    . ASN C 1 125 ? 80.333  76.937  78.552  1.00 117.12 ? 124 ASN C CA    1 
ATOM 3124  C C     . ASN C 1 125 ? 81.503  77.848  78.152  1.00 119.07 ? 124 ASN C C     1 
ATOM 3125  O O     . ASN C 1 125 ? 81.367  78.890  77.524  1.00 115.53 ? 124 ASN C O     1 
ATOM 3126  C CB    . ASN C 1 125 ? 79.879  77.445  79.916  1.00 116.55 ? 124 ASN C CB    1 
ATOM 3127  N N     . GLU C 1 126 ? 82.685  77.355  78.483  1.00 127.61 ? 125 GLU C N     1 
ATOM 3128  C CA    . GLU C 1 126 ? 83.899  78.113  78.263  1.00 130.79 ? 125 GLU C CA    1 
ATOM 3129  C C     . GLU C 1 126 ? 83.922  78.262  76.766  1.00 128.41 ? 125 GLU C C     1 
ATOM 3130  O O     . GLU C 1 126 ? 84.218  79.331  76.242  1.00 126.64 ? 125 GLU C O     1 
ATOM 3131  C CB    . GLU C 1 126 ? 85.189  77.447  78.732  1.00 139.14 ? 125 GLU C CB    1 
ATOM 3132  N N     . GLN C 1 127 ? 83.638  77.172  76.066  1.00 182.94 ? 126 GLN C N     1 
ATOM 3133  C CA    . GLN C 1 127 ? 83.559  77.199  74.612  1.00 182.38 ? 126 GLN C CA    1 
ATOM 3134  C C     . GLN C 1 127 ? 82.501  78.119  74.018  1.00 176.51 ? 126 GLN C C     1 
ATOM 3135  O O     . GLN C 1 127 ? 82.752  78.845  73.060  1.00 175.77 ? 126 GLN C O     1 
ATOM 3136  C CB    . GLN C 1 127 ? 83.387  75.783  74.057  1.00 185.53 ? 126 GLN C CB    1 
ATOM 3137  N N     . MET C 1 128 ? 81.308  78.074  74.591  0.89 128.99 ? 127 MET C N     1 
ATOM 3138  C CA    . MET C 1 128 ? 80.219  78.905  74.107  1.00 124.08 ? 127 MET C CA    1 
ATOM 3139  C C     . MET C 1 128 ? 80.378  80.397  74.405  1.00 121.36 ? 127 MET C C     1 
ATOM 3140  O O     . MET C 1 128 ? 79.976  81.268  73.648  1.00 119.01 ? 127 MET C O     1 
ATOM 3141  C CB    . MET C 1 128 ? 78.935  78.512  74.819  1.00 121.06 ? 127 MET C CB    1 
ATOM 3142  C CG    . MET C 1 128 ? 77.737  79.327  74.397  1.00 117.05 ? 127 MET C CG    1 
ATOM 3143  S SD    . MET C 1 128 ? 76.238  78.631  75.083  1.00 115.25 ? 127 MET C SD    1 
ATOM 3144  C CE    . MET C 1 128 ? 75.057  79.875  74.582  1.00 111.40 ? 127 MET C CE    1 
ATOM 3145  N N     . LYS C 1 129 ? 81.040  80.666  75.515  1.00 108.83 ? 128 LYS C N     1 
ATOM 3146  C CA    . LYS C 1 129 ? 81.297  82.033  75.909  1.00 107.99 ? 128 LYS C CA    1 
ATOM 3147  C C     . LYS C 1 129 ? 82.207  82.523  74.814  1.00 109.36 ? 128 LYS C C     1 
ATOM 3148  O O     . LYS C 1 129 ? 82.071  83.635  74.322  1.00 106.96 ? 128 LYS C O     1 
ATOM 3149  C CB    . LYS C 1 129 ? 81.971  82.226  77.264  1.00 111.88 ? 128 LYS C CB    1 
ATOM 3150  N N     . ALA C 1 130 ? 83.154  81.679  74.442  1.00 150.55 ? 129 ALA C N     1 
ATOM 3151  C CA    . ALA C 1 130 ? 84.209  82.104  73.527  1.00 153.26 ? 129 ALA C CA    1 
ATOM 3152  C C     . ALA C 1 130 ? 83.646  82.364  72.135  1.00 151.01 ? 129 ALA C C     1 
ATOM 3153  O O     . ALA C 1 130 ? 84.015  83.336  71.477  1.00 150.69 ? 129 ALA C O     1 
ATOM 3154  C CB    . ALA C 1 130 ? 85.315  81.062  73.468  1.00 159.04 ? 129 ALA C CB    1 
ATOM 3155  N N     . ASN C 1 131 ? 82.748  81.487  71.697  1.00 111.53 ? 130 ASN C N     1 
ATOM 3156  C CA    . ASN C 1 131 ? 82.102  81.621  70.399  1.00 109.20 ? 130 ASN C CA    1 
ATOM 3157  C C     . ASN C 1 131 ? 81.242  82.874  70.326  1.00 104.27 ? 130 ASN C C     1 
ATOM 3158  O O     . ASN C 1 131 ? 81.291  83.607  69.338  1.00 103.69 ? 130 ASN C O     1 
ATOM 3159  C CB    . ASN C 1 131 ? 81.251  80.388  70.095  1.00 108.99 ? 130 ASN C CB    1 
ATOM 3160  C CG    . ASN C 1 131 ? 82.033  79.094  70.213  1.00 114.54 ? 130 ASN C CG    1 
ATOM 3161  O OD1   . ASN C 1 131 ? 83.220  79.039  69.888  1.00 119.20 ? 130 ASN C OD1   1 
ATOM 3162  N ND2   . ASN C 1 131 ? 81.371  78.044  70.692  1.00 114.59 ? 130 ASN C ND2   1 
ATOM 3163  N N     . LEU C 1 132 ? 80.457  83.112  71.373  1.00 101.39 ? 131 LEU C N     1 
ATOM 3164  C CA    . LEU C 1 132 ? 79.628  84.315  71.454  1.00 97.57  ? 131 LEU C CA    1 
ATOM 3165  C C     . LEU C 1 132 ? 80.460  85.593  71.324  1.00 98.54  ? 131 LEU C C     1 
ATOM 3166  O O     . LEU C 1 132 ? 80.060  86.538  70.642  1.00 96.71  ? 131 LEU C O     1 
ATOM 3167  C CB    . LEU C 1 132 ? 78.816  84.339  72.752  1.00 95.64  ? 131 LEU C CB    1 
ATOM 3168  C CG    . LEU C 1 132 ? 77.741  83.265  72.923  1.00 94.08  ? 131 LEU C CG    1 
ATOM 3169  C CD1   . LEU C 1 132 ? 77.037  83.447  74.242  1.00 92.75  ? 131 LEU C CD1   1 
ATOM 3170  C CD2   . LEU C 1 132 ? 76.738  83.321  71.799  1.00 91.69  ? 131 LEU C CD2   1 
ATOM 3171  N N     . THR C 1 133 ? 81.621  85.614  71.972  1.00 109.95 ? 132 THR C N     1 
ATOM 3172  C CA    . THR C 1 133 ? 82.538  86.743  71.849  1.00 110.61 ? 132 THR C CA    1 
ATOM 3173  C C     . THR C 1 133 ? 82.994  86.880  70.399  1.00 112.15 ? 132 THR C C     1 
ATOM 3174  O O     . THR C 1 133 ? 83.026  87.985  69.856  1.00 110.83 ? 132 THR C O     1 
ATOM 3175  C CB    . THR C 1 133 ? 83.774  86.588  72.761  1.00 114.78 ? 132 THR C CB    1 
ATOM 3176  O OG1   . THR C 1 133 ? 83.372  86.065  74.031  1.00 114.69 ? 132 THR C OG1   1 
ATOM 3177  C CG2   . THR C 1 133 ? 84.460  87.930  72.964  1.00 115.76 ? 132 THR C CG2   1 
ATOM 3178  N N     . LYS C 1 134 ? 83.338  85.749  69.781  1.00 112.76 ? 133 LYS C N     1 
ATOM 3179  C CA    . LYS C 1 134 ? 83.722  85.718  68.374  1.00 114.59 ? 133 LYS C CA    1 
ATOM 3180  C C     . LYS C 1 134 ? 82.543  86.119  67.490  1.00 111.98 ? 133 LYS C C     1 
ATOM 3181  O O     . LYS C 1 134 ? 82.704  86.886  66.538  1.00 111.98 ? 133 LYS C O     1 
ATOM 3182  C CB    . LYS C 1 134 ? 84.233  84.331  67.981  1.00 118.85 ? 133 LYS C CB    1 
ATOM 3183  N N     . MET C 1 135 ? 81.357  85.608  67.815  1.00 102.64 ? 134 MET C N     1 
ATOM 3184  C CA    . MET C 1 135 ? 80.152  85.941  67.060  0.77 100.84 ? 134 MET C CA    1 
ATOM 3185  C C     . MET C 1 135 ? 79.813  87.418  67.169  1.00 97.39  ? 134 MET C C     1 
ATOM 3186  O O     . MET C 1 135 ? 79.289  88.011  66.226  0.32 96.85  ? 134 MET C O     1 
ATOM 3187  C CB    . MET C 1 135 ? 78.964  85.098  67.519  1.00 99.64  ? 134 MET C CB    1 
ATOM 3188  C CG    . MET C 1 135 ? 79.043  83.650  67.078  1.00 102.55 ? 134 MET C CG    1 
ATOM 3189  S SD    . MET C 1 135 ? 77.725  82.632  67.761  1.00 100.75 ? 134 MET C SD    1 
ATOM 3190  C CE    . MET C 1 135 ? 76.297  83.399  67.003  1.00 94.58  ? 134 MET C CE    1 
ATOM 3191  N N     . LEU C 1 136 ? 80.110  88.010  68.323  1.00 107.74 ? 135 LEU C N     1 
ATOM 3192  C CA    . LEU C 1 136 ? 79.872  89.434  68.515  1.00 103.99 ? 135 LEU C CA    1 
ATOM 3193  C C     . LEU C 1 136 ? 80.830  90.264  67.664  1.00 105.97 ? 135 LEU C C     1 
ATOM 3194  O O     . LEU C 1 136 ? 80.458  91.330  67.175  1.00 104.27 ? 135 LEU C O     1 
ATOM 3195  C CB    . LEU C 1 136 ? 79.985  89.819  69.985  1.00 102.54 ? 135 LEU C CB    1 
ATOM 3196  C CG    . LEU C 1 136 ? 79.289  91.125  70.371  1.00 100.34 ? 135 LEU C CG    1 
ATOM 3197  C CD1   . LEU C 1 136 ? 78.856  91.044  71.809  1.00 99.84  ? 135 LEU C CD1   1 
ATOM 3198  C CD2   . LEU C 1 136 ? 80.185  92.338  70.170  1.00 102.71 ? 135 LEU C CD2   1 
ATOM 3199  N N     . SER C 1 137 ? 82.055  89.774  67.484  1.00 100.91 ? 136 SER C N     1 
ATOM 3200  C CA    . SER C 1 137 ? 83.015  90.434  66.604  1.00 103.68 ? 136 SER C CA    1 
ATOM 3201  C C     . SER C 1 137 ? 82.448  90.512  65.193  1.00 103.47 ? 136 SER C C     1 
ATOM 3202  O O     . SER C 1 137 ? 82.663  91.491  64.478  1.00 104.46 ? 136 SER C O     1 
ATOM 3203  C CB    . SER C 1 137 ? 84.351  89.694  66.593  1.00 107.84 ? 136 SER C CB    1 
ATOM 3204  N N     . SER C 1 138 ? 81.692  89.488  64.811  1.00 113.01 ? 137 SER C N     1 
ATOM 3205  C CA    . SER C 1 138 ? 81.103  89.416  63.478  1.00 114.85 ? 137 SER C CA    1 
ATOM 3206  C C     . SER C 1 138 ? 80.128  90.549  63.173  1.00 110.24 ? 137 SER C C     1 
ATOM 3207  O O     . SER C 1 138 ? 79.767  90.755  62.018  1.00 108.77 ? 137 SER C O     1 
ATOM 3208  C CB    . SER C 1 138 ? 80.385  88.081  63.294  1.00 114.58 ? 137 SER C CB    1 
ATOM 3209  O OG    . SER C 1 138 ? 81.183  87.020  63.774  1.00 117.06 ? 137 SER C OG    1 
ATOM 3210  N N     . LEU C 1 139 ? 79.702  91.279  64.200  1.00 109.08 ? 138 LEU C N     1 
ATOM 3211  C CA    . LEU C 1 139 ? 78.642  92.269  64.029  1.00 106.81 ? 138 LEU C CA    1 
ATOM 3212  C C     . LEU C 1 139 ? 79.090  93.711  64.263  1.00 107.35 ? 138 LEU C C     1 
ATOM 3213  O O     . LEU C 1 139 ? 78.254  94.603  64.443  1.00 106.57 ? 138 LEU C O     1 
ATOM 3214  C CB    . LEU C 1 139 ? 77.461  91.939  64.940  1.00 103.80 ? 138 LEU C CB    1 
ATOM 3215  C CG    . LEU C 1 139 ? 76.984  90.488  64.896  1.00 103.35 ? 138 LEU C CG    1 
ATOM 3216  C CD1   . LEU C 1 139 ? 75.951  90.252  65.982  1.00 100.61 ? 138 LEU C CD1   1 
ATOM 3217  C CD2   . LEU C 1 139 ? 76.426  90.124  63.532  1.00 104.86 ? 138 LEU C CD2   1 
ATOM 3218  N N     . GLN C 1 140 ? 80.403  93.932  64.246  1.00 159.51 ? 139 GLN C N     1 
ATOM 3219  C CA    . GLN C 1 140 ? 80.979  95.257  64.475  1.00 160.79 ? 139 GLN C CA    1 
ATOM 3220  C C     . GLN C 1 140 ? 80.544  95.841  65.818  1.00 159.04 ? 139 GLN C C     1 
ATOM 3221  O O     . GLN C 1 140 ? 80.292  95.104  66.775  1.00 157.47 ? 139 GLN C O     1 
ATOM 3222  C CB    . GLN C 1 140 ? 80.629  96.216  63.330  1.00 162.03 ? 139 GLN C CB    1 
ATOM 3223  N N     . PHE D 1 4   ? 82.697  86.800  79.597  1.00 96.66  ? 3   PHE D N     1 
ATOM 3224  C CA    . PHE D 1 4   ? 81.823  87.875  80.037  1.00 95.09  ? 3   PHE D CA    1 
ATOM 3225  C C     . PHE D 1 4   ? 80.465  87.354  80.482  1.00 91.57  ? 3   PHE D C     1 
ATOM 3226  O O     . PHE D 1 4   ? 80.120  86.202  80.250  1.00 90.11  ? 3   PHE D O     1 
ATOM 3227  C CB    . PHE D 1 4   ? 81.646  88.893  78.922  1.00 95.13  ? 3   PHE D CB    1 
ATOM 3228  C CG    . PHE D 1 4   ? 82.426  90.148  79.126  1.00 98.97  ? 3   PHE D CG    1 
ATOM 3229  C CD1   . PHE D 1 4   ? 82.490  90.741  80.372  1.00 100.49 ? 3   PHE D CD1   1 
ATOM 3230  C CD2   . PHE D 1 4   ? 83.095  90.735  78.075  1.00 101.15 ? 3   PHE D CD2   1 
ATOM 3231  C CE1   . PHE D 1 4   ? 83.207  91.903  80.568  1.00 103.96 ? 3   PHE D CE1   1 
ATOM 3232  C CE2   . PHE D 1 4   ? 83.817  91.897  78.261  1.00 104.76 ? 3   PHE D CE2   1 
ATOM 3233  C CZ    . PHE D 1 4   ? 83.874  92.482  79.510  1.00 106.02 ? 3   PHE D CZ    1 
ATOM 3234  N N     . THR D 1 5   ? 79.695  88.219  81.123  1.00 98.30  ? 4   THR D N     1 
ATOM 3235  C CA    . THR D 1 5   ? 78.397  87.832  81.625  1.00 95.20  ? 4   THR D CA    1 
ATOM 3236  C C     . THR D 1 5   ? 77.522  87.451  80.464  1.00 92.12  ? 4   THR D C     1 
ATOM 3237  O O     . THR D 1 5   ? 77.525  88.119  79.444  1.00 91.93  ? 4   THR D O     1 
ATOM 3238  C CB    . THR D 1 5   ? 77.718  89.006  82.328  1.00 95.81  ? 4   THR D CB    1 
ATOM 3239  O OG1   . THR D 1 5   ? 78.673  89.689  83.140  1.00 96.83  ? 4   THR D OG1   1 
ATOM 3240  C CG2   . THR D 1 5   ? 76.582  88.521  83.193  1.00 97.54  ? 4   THR D CG2   1 
ATOM 3241  N N     . TYR D 1 6   ? 76.750  86.391  80.621  1.00 100.29 ? 5   TYR D N     1 
ATOM 3242  C CA    . TYR D 1 6   ? 75.830  86.018  79.575  1.00 97.53  ? 5   TYR D CA    1 
ATOM 3243  C C     . TYR D 1 6   ? 74.859  87.152  79.376  1.00 95.62  ? 5   TYR D C     1 
ATOM 3244  O O     . TYR D 1 6   ? 74.440  87.420  78.262  1.00 93.48  ? 5   TYR D O     1 
ATOM 3245  C CB    . TYR D 1 6   ? 75.104  84.724  79.924  1.00 97.30  ? 5   TYR D CB    1 
ATOM 3246  C CG    . TYR D 1 6   ? 75.926  83.479  79.680  1.00 99.64  ? 5   TYR D CG    1 
ATOM 3247  C CD1   . TYR D 1 6   ? 77.226  83.559  79.209  1.00 101.39 ? 5   TYR D CD1   1 
ATOM 3248  C CD2   . TYR D 1 6   ? 75.401  82.225  79.922  1.00 100.92 ? 5   TYR D CD2   1 
ATOM 3249  C CE1   . TYR D 1 6   ? 77.977  82.429  78.986  1.00 104.11 ? 5   TYR D CE1   1 
ATOM 3250  C CE2   . TYR D 1 6   ? 76.147  81.087  79.698  1.00 103.66 ? 5   TYR D CE2   1 
ATOM 3251  C CZ    . TYR D 1 6   ? 77.434  81.200  79.231  1.00 105.28 ? 5   TYR D CZ    1 
ATOM 3252  O OH    . TYR D 1 6   ? 78.192  80.081  79.005  1.00 108.85 ? 5   TYR D OH    1 
ATOM 3253  N N     . SER D 1 7   ? 74.505  87.843  80.450  1.00 74.23  ? 6   SER D N     1 
ATOM 3254  C CA    . SER D 1 7   ? 73.612  88.975  80.259  1.00 72.58  ? 6   SER D CA    1 
ATOM 3255  C C     . SER D 1 7   ? 74.204  89.937  79.248  1.00 73.04  ? 6   SER D C     1 
ATOM 3256  O O     . SER D 1 7   ? 73.517  90.416  78.358  1.00 70.74  ? 6   SER D O     1 
ATOM 3257  C CB    . SER D 1 7   ? 73.370  89.694  81.588  1.00 74.85  ? 6   SER D CB    1 
ATOM 3258  O OG    . SER D 1 7   ? 72.878  91.008  81.388  1.00 75.40  ? 6   SER D OG    1 
ATOM 3259  N N     . TYR D 1 8   ? 75.497  90.191  79.368  1.00 65.73  ? 7   TYR D N     1 
ATOM 3260  C CA    . TYR D 1 8   ? 76.127  91.225  78.567  1.00 64.57  ? 7   TYR D CA    1 
ATOM 3261  C C     . TYR D 1 8   ? 76.319  90.786  77.135  1.00 61.53  ? 7   TYR D C     1 
ATOM 3262  O O     . TYR D 1 8   ? 76.089  91.573  76.218  1.00 60.73  ? 7   TYR D O     1 
ATOM 3263  C CB    . TYR D 1 8   ? 77.465  91.641  79.167  1.00 66.79  ? 7   TYR D CB    1 
ATOM 3264  C CG    . TYR D 1 8   ? 78.354  92.391  78.218  1.00 68.76  ? 7   TYR D CG    1 
ATOM 3265  C CD1   . TYR D 1 8   ? 79.292  91.721  77.442  1.00 69.27  ? 7   TYR D CD1   1 
ATOM 3266  C CD2   . TYR D 1 8   ? 78.264  93.762  78.098  1.00 70.60  ? 7   TYR D CD2   1 
ATOM 3267  C CE1   . TYR D 1 8   ? 80.106  92.394  76.566  1.00 71.51  ? 7   TYR D CE1   1 
ATOM 3268  C CE2   . TYR D 1 8   ? 79.083  94.449  77.225  1.00 73.07  ? 7   TYR D CE2   1 
ATOM 3269  C CZ    . TYR D 1 8   ? 80.002  93.754  76.462  1.00 73.59  ? 7   TYR D CZ    1 
ATOM 3270  O OH    . TYR D 1 8   ? 80.821  94.419  75.588  1.00 76.69  ? 7   TYR D OH    1 
ATOM 3271  N N     . LEU D 1 9   ? 76.759  89.548  76.928  1.00 59.53  ? 8   LEU D N     1 
ATOM 3272  C CA    . LEU D 1 9   ? 76.942  89.057  75.560  1.00 57.21  ? 8   LEU D CA    1 
ATOM 3273  C C     . LEU D 1 9   ? 75.623  89.014  74.787  1.00 55.68  ? 8   LEU D C     1 
ATOM 3274  O O     . LEU D 1 9   ? 75.558  89.482  73.667  1.00 54.13  ? 8   LEU D O     1 
ATOM 3275  C CB    . LEU D 1 9   ? 77.637  87.699  75.540  1.00 57.31  ? 8   LEU D CB    1 
ATOM 3276  C CG    . LEU D 1 9   ? 79.134  87.759  75.848  1.00 58.39  ? 8   LEU D CG    1 
ATOM 3277  C CD1   . LEU D 1 9   ? 79.599  86.479  76.499  1.00 59.52  ? 8   LEU D CD1   1 
ATOM 3278  C CD2   . LEU D 1 9   ? 79.929  88.029  74.583  1.00 57.56  ? 8   LEU D CD2   1 
ATOM 3279  N N     . PHE D 1 10  ? 74.565  88.486  75.392  1.00 70.43  ? 9   PHE D N     1 
ATOM 3280  C CA    . PHE D 1 10  ? 73.259  88.478  74.741  1.00 66.52  ? 9   PHE D CA    1 
ATOM 3281  C C     . PHE D 1 10  ? 72.694  89.872  74.499  1.00 65.53  ? 9   PHE D C     1 
ATOM 3282  O O     . PHE D 1 10  ? 72.183  90.159  73.421  1.00 62.91  ? 9   PHE D O     1 
ATOM 3283  C CB    . PHE D 1 10  ? 72.256  87.662  75.544  1.00 65.74  ? 9   PHE D CB    1 
ATOM 3284  C CG    . PHE D 1 10  ? 72.538  86.193  75.546  1.00 67.18  ? 9   PHE D CG    1 
ATOM 3285  C CD1   . PHE D 1 10  ? 73.339  85.628  74.572  1.00 68.14  ? 9   PHE D CD1   1 
ATOM 3286  C CD2   . PHE D 1 10  ? 72.010  85.374  76.530  1.00 68.45  ? 9   PHE D CD2   1 
ATOM 3287  C CE1   . PHE D 1 10  ? 73.600  84.269  74.572  1.00 70.61  ? 9   PHE D CE1   1 
ATOM 3288  C CE2   . PHE D 1 10  ? 72.266  84.015  76.532  1.00 70.79  ? 9   PHE D CE2   1 
ATOM 3289  C CZ    . PHE D 1 10  ? 73.062  83.465  75.553  1.00 71.89  ? 9   PHE D CZ    1 
ATOM 3290  N N     . ARG D 1 11  ? 72.771  90.740  75.497  1.00 90.34  ? 10  ARG D N     1 
ATOM 3291  C CA    . ARG D 1 11  ? 72.257  92.094  75.332  1.00 90.18  ? 10  ARG D CA    1 
ATOM 3292  C C     . ARG D 1 11  ? 72.991  92.850  74.210  1.00 92.62  ? 10  ARG D C     1 
ATOM 3293  O O     . ARG D 1 11  ? 72.385  93.638  73.487  1.00 91.64  ? 10  ARG D O     1 
ATOM 3294  C CB    . ARG D 1 11  ? 72.317  92.857  76.660  1.00 92.66  ? 10  ARG D CB    1 
ATOM 3295  C CG    . ARG D 1 11  ? 71.662  94.234  76.644  1.00 92.56  ? 10  ARG D CG    1 
ATOM 3296  C CD    . ARG D 1 11  ? 71.623  94.871  78.032  1.00 94.86  ? 10  ARG D CD    1 
ATOM 3297  N NE    . ARG D 1 11  ? 72.952  95.155  78.565  1.00 98.98  ? 10  ARG D NE    1 
ATOM 3298  C CZ    . ARG D 1 11  ? 73.625  94.337  79.373  1.00 100.36 ? 10  ARG D CZ    1 
ATOM 3299  N NH1   . ARG D 1 11  ? 73.096  93.177  79.739  1.00 97.92  ? 10  ARG D NH1   1 
ATOM 3300  N NH2   . ARG D 1 11  ? 74.830  94.673  79.818  1.00 104.51 ? 10  ARG D NH2   1 
ATOM 3301  N N     . MET D 1 12  ? 74.286  92.581  74.053  1.00 58.52  ? 11  MET D N     1 
ATOM 3302  C CA    . MET D 1 12  ? 75.109  93.268  73.062  1.00 61.08  ? 11  MET D CA    1 
ATOM 3303  C C     . MET D 1 12  ? 74.945  92.701  71.661  0.91 58.10  ? 11  MET D C     1 
ATOM 3304  O O     . MET D 1 12  ? 75.190  93.379  70.663  0.43 59.60  ? 11  MET D O     1 
ATOM 3305  C CB    . MET D 1 12  ? 76.583  93.208  73.457  1.00 66.07  ? 11  MET D CB    1 
ATOM 3306  C CG    . MET D 1 12  ? 76.939  94.154  74.560  1.00 70.19  ? 11  MET D CG    1 
ATOM 3307  S SD    . MET D 1 12  ? 76.114  95.747  74.350  1.00 71.15  ? 11  MET D SD    1 
ATOM 3308  C CE    . MET D 1 12  ? 76.390  96.478  75.978  1.00 73.74  ? 11  MET D CE    1 
ATOM 3309  N N     . ILE D 1 13  ? 74.545  91.441  71.601  1.00 63.61  ? 12  ILE D N     1 
ATOM 3310  C CA    . ILE D 1 13  ? 74.429  90.743  70.339  1.00 60.90  ? 12  ILE D CA    1 
ATOM 3311  C C     . ILE D 1 13  ? 73.074  91.026  69.721  1.00 56.35  ? 12  ILE D C     1 
ATOM 3312  O O     . ILE D 1 13  ? 72.997  91.444  68.562  1.00 55.44  ? 12  ILE D O     1 
ATOM 3313  C CB    . ILE D 1 13  ? 74.606  89.231  70.515  1.00 60.10  ? 12  ILE D CB    1 
ATOM 3314  C CG1   . ILE D 1 13  ? 76.077  88.879  70.745  1.00 64.48  ? 12  ILE D CG1   1 
ATOM 3315  C CG2   . ILE D 1 13  ? 74.105  88.502  69.284  1.00 57.50  ? 12  ILE D CG2   1 
ATOM 3316  C CD1   . ILE D 1 13  ? 76.289  87.428  71.064  1.00 65.29  ? 12  ILE D CD1   1 
ATOM 3317  N N     . SER D 1 14  ? 72.011  90.803  70.492  1.00 56.13  ? 13  SER D N     1 
ATOM 3318  C CA    . SER D 1 14  ? 70.658  91.103  70.028  1.00 52.74  ? 13  SER D CA    1 
ATOM 3319  C C     . SER D 1 14  ? 70.602  92.516  69.428  1.00 53.00  ? 13  SER D C     1 
ATOM 3320  O O     . SER D 1 14  ? 70.209  92.704  68.275  1.00 50.89  ? 13  SER D O     1 
ATOM 3321  C CB    . SER D 1 14  ? 69.641  90.944  71.163  1.00 53.02  ? 13  SER D CB    1 
ATOM 3322  N N     . HIS D 1 15  ? 71.054  93.493  70.205  1.00 56.60  ? 14  HIS D N     1 
ATOM 3323  C CA    . HIS D 1 15  ? 71.069  94.886  69.786  1.00 59.14  ? 14  HIS D CA    1 
ATOM 3324  C C     . HIS D 1 15  ? 71.850  95.104  68.496  1.00 61.70  ? 14  HIS D C     1 
ATOM 3325  O O     . HIS D 1 15  ? 71.365  95.762  67.565  1.00 61.06  ? 14  HIS D O     1 
ATOM 3326  C CB    . HIS D 1 15  ? 71.677  95.733  70.894  1.00 64.56  ? 14  HIS D CB    1 
ATOM 3327  C CG    . HIS D 1 15  ? 71.593  97.204  70.650  1.00 68.14  ? 14  HIS D CG    1 
ATOM 3328  N ND1   . HIS D 1 15  ? 70.466  97.940  70.941  1.00 65.80  ? 14  HIS D ND1   1 
ATOM 3329  C CD2   . HIS D 1 15  ? 72.502  98.077  70.156  1.00 74.19  ? 14  HIS D CD2   1 
ATOM 3330  C CE1   . HIS D 1 15  ? 70.683  99.207  70.635  1.00 69.74  ? 14  HIS D CE1   1 
ATOM 3331  N NE2   . HIS D 1 15  ? 71.910  99.315  70.153  1.00 75.39  ? 14  HIS D NE2   1 
ATOM 3332  N N     . GLU D 1 16  ? 73.059  94.559  68.439  1.00 76.44  ? 15  GLU D N     1 
ATOM 3333  C CA    . GLU D 1 16  ? 73.883  94.750  67.264  1.00 79.03  ? 15  GLU D CA    1 
ATOM 3334  C C     . GLU D 1 16  ? 73.270  94.120  66.018  1.00 73.63  ? 15  GLU D C     1 
ATOM 3335  O O     . GLU D 1 16  ? 73.433  94.636  64.907  1.00 74.29  ? 15  GLU D O     1 
ATOM 3336  C CB    . GLU D 1 16  ? 75.304  94.261  67.501  1.00 83.02  ? 15  GLU D CB    1 
ATOM 3337  C CG    . GLU D 1 16  ? 76.175  95.318  68.132  1.00 89.99  ? 15  GLU D CG    1 
ATOM 3338  C CD    . GLU D 1 16  ? 75.957  96.690  67.509  1.00 92.73  ? 15  GLU D CD    1 
ATOM 3339  O OE1   . GLU D 1 16  ? 76.043  96.810  66.260  1.00 91.99  ? 15  GLU D OE1   1 
ATOM 3340  O OE2   . GLU D 1 16  ? 75.694  97.649  68.272  1.00 95.45  ? 15  GLU D OE2   1 
ATOM 3341  N N     . MET D 1 17  ? 72.546  93.023  66.197  1.00 62.07  ? 16  MET D N     1 
ATOM 3342  C CA    . MET D 1 17  ? 71.834  92.435  65.075  1.00 57.32  ? 16  MET D CA    1 
ATOM 3343  C C     . MET D 1 17  ? 70.645  93.292  64.654  1.00 54.28  ? 16  MET D C     1 
ATOM 3344  O O     . MET D 1 17  ? 70.410  93.480  63.455  0.60 52.51  ? 16  MET D O     1 
ATOM 3345  C CB    . MET D 1 17  ? 71.388  91.017  65.396  1.00 54.39  ? 16  MET D CB    1 
ATOM 3346  C CG    . MET D 1 17  ? 72.519  89.998  65.322  1.00 57.64  ? 16  MET D CG    1 
ATOM 3347  S SD    . MET D 1 17  ? 71.889  88.311  65.325  1.00 56.80  ? 16  MET D SD    1 
ATOM 3348  C CE    . MET D 1 17  ? 70.399  88.610  66.288  1.00 53.63  ? 16  MET D CE    1 
ATOM 3349  N N     . LYS D 1 18  ? 69.903  93.807  65.640  1.00 44.07  ? 17  LYS D N     1 
ATOM 3350  C CA    . LYS D 1 18  ? 68.815  94.752  65.381  1.00 43.72  ? 17  LYS D CA    1 
ATOM 3351  C C     . LYS D 1 18  ? 69.364  95.917  64.566  1.00 44.31  ? 17  LYS D C     1 
ATOM 3352  O O     . LYS D 1 18  ? 68.857  96.248  63.487  1.00 43.41  ? 17  LYS D O     1 
ATOM 3353  C CB    . LYS D 1 18  ? 68.223  95.275  66.684  1.00 45.21  ? 17  LYS D CB    1 
ATOM 3354  N N     . GLN D 1 19  ? 70.434  96.512  65.074  1.00 47.36  ? 18  GLN D N     1 
ATOM 3355  C CA    . GLN D 1 19  ? 71.058  97.644  64.407  1.00 52.19  ? 18  GLN D CA    1 
ATOM 3356  C C     . GLN D 1 19  ? 71.481  97.375  62.965  1.00 50.90  ? 18  GLN D C     1 
ATOM 3357  O O     . GLN D 1 19  ? 71.167  98.161  62.067  1.00 51.47  ? 18  GLN D O     1 
ATOM 3358  C CB    . GLN D 1 19  ? 72.248  98.139  65.223  1.00 58.91  ? 18  GLN D CB    1 
ATOM 3359  C CG    . GLN D 1 19  ? 71.824  98.970  66.400  1.00 61.74  ? 18  GLN D CG    1 
ATOM 3360  C CD    . GLN D 1 19  ? 70.655  99.862  66.060  1.00 60.32  ? 18  GLN D CD    1 
ATOM 3361  O OE1   . GLN D 1 19  ? 70.718  100.682 65.135  1.00 63.27  ? 18  GLN D OE1   1 
ATOM 3362  N NE2   . GLN D 1 19  ? 69.568  99.698  66.802  1.00 55.76  ? 18  GLN D NE2   1 
ATOM 3363  N N     . LYS D 1 20  ? 72.203  96.274  62.756  1.00 66.30  ? 19  LYS D N     1 
ATOM 3364  C CA    . LYS D 1 20  ? 72.687  95.924  61.425  1.00 65.69  ? 19  LYS D CA    1 
ATOM 3365  C C     . LYS D 1 20  ? 71.520  95.616  60.495  1.00 59.51  ? 19  LYS D C     1 
ATOM 3366  O O     . LYS D 1 20  ? 71.522  96.061  59.355  1.00 59.54  ? 19  LYS D O     1 
ATOM 3367  C CB    . LYS D 1 20  ? 73.668  94.747  61.471  1.00 66.40  ? 19  LYS D CB    1 
ATOM 3368  C CG    . LYS D 1 20  ? 75.115  95.128  61.208  1.00 73.20  ? 19  LYS D CG    1 
ATOM 3369  C CD    . LYS D 1 20  ? 75.708  95.905  62.373  1.00 78.54  ? 19  LYS D CD    1 
ATOM 3370  C CE    . LYS D 1 20  ? 77.116  96.408  62.046  1.00 84.36  ? 19  LYS D CE    1 
ATOM 3371  N NZ    . LYS D 1 20  ? 77.783  97.086  63.205  1.00 88.93  ? 19  LYS D NZ    1 
ATOM 3372  N N     . ALA D 1 21  ? 70.525  94.871  60.985  1.00 51.60  ? 20  ALA D N     1 
ATOM 3373  C CA    . ALA D 1 21  ? 69.318  94.630  60.192  1.00 46.94  ? 20  ALA D CA    1 
ATOM 3374  C C     . ALA D 1 21  ? 68.691  95.967  59.788  1.00 47.33  ? 20  ALA D C     1 
ATOM 3375  O O     . ALA D 1 21  ? 68.545  96.250  58.593  1.00 47.18  ? 20  ALA D O     1 
ATOM 3376  C CB    . ALA D 1 21  ? 68.325  93.775  60.935  1.00 45.05  ? 20  ALA D CB    1 
ATOM 3377  N N     . ASP D 1 22  ? 68.438  96.846  60.734  1.00 44.31  ? 21  ASP D N     1 
ATOM 3378  C CA    . ASP D 1 22  ? 67.698  98.042  60.402  1.00 45.09  ? 21  ASP D CA    1 
ATOM 3379  C C     . ASP D 1 22  ? 68.447  98.846  59.358  1.00 48.82  ? 21  ASP D C     1 
ATOM 3380  O O     . ASP D 1 22  ? 67.844  99.361  58.427  1.00 47.59  ? 21  ASP D O     1 
ATOM 3381  C CB    . ASP D 1 22  ? 67.522  98.898  61.643  1.00 49.07  ? 21  ASP D CB    1 
ATOM 3382  C CG    . ASP D 1 22  ? 66.556  98.304  62.619  1.00 45.05  ? 21  ASP D CG    1 
ATOM 3383  O OD1   . ASP D 1 22  ? 65.878  97.329  62.271  1.00 42.54  ? 21  ASP D OD1   1 
ATOM 3384  O OD2   . ASP D 1 22  ? 66.474  98.820  63.742  1.00 47.20  ? 21  ASP D OD2   1 
ATOM 3385  N N     . GLN D 1 23  ? 69.759  98.947  59.491  1.00 76.39  ? 22  GLN D N     1 
ATOM 3386  C CA    . GLN D 1 23  ? 70.518  99.743  58.538  1.00 79.93  ? 22  GLN D CA    1 
ATOM 3387  C C     . GLN D 1 23  ? 70.318  99.174  57.151  1.00 75.52  ? 22  GLN D C     1 
ATOM 3388  O O     . GLN D 1 23  ? 69.985  99.886  56.218  1.00 75.49  ? 22  GLN D O     1 
ATOM 3389  C CB    . GLN D 1 23  ? 72.004  99.764  58.894  1.00 85.04  ? 22  GLN D CB    1 
ATOM 3390  C CG    . GLN D 1 23  ? 72.357  100.477 60.191  1.00 89.60  ? 22  GLN D CG    1 
ATOM 3391  C CD    . GLN D 1 23  ? 73.829  100.401 60.522  1.00 94.81  ? 22  GLN D CD    1 
ATOM 3392  O OE1   . GLN D 1 23  ? 74.525  99.485  60.092  1.00 94.67  ? 22  GLN D OE1   1 
ATOM 3393  N NE2   . GLN D 1 23  ? 74.312  101.363 61.295  1.00 99.28  ? 22  GLN D NE2   1 
ATOM 3394  N N     . LYS D 1 24  ? 70.487  97.868  57.034  1.00 61.23  ? 23  LYS D N     1 
ATOM 3395  C CA    . LYS D 1 24  ? 70.249  97.181  55.782  1.00 57.41  ? 23  LYS D CA    1 
ATOM 3396  C C     . LYS D 1 24  ? 68.801  97.259  55.358  1.00 53.79  ? 23  LYS D C     1 
ATOM 3397  O O     . LYS D 1 24  ? 68.487  97.383  54.187  1.00 53.44  ? 23  LYS D O     1 
ATOM 3398  C CB    . LYS D 1 24  ? 70.690  95.736  55.932  1.00 56.35  ? 23  LYS D CB    1 
ATOM 3399  C CG    . LYS D 1 24  ? 72.192  95.562  55.858  1.00 61.48  ? 23  LYS D CG    1 
ATOM 3400  C CD    . LYS D 1 24  ? 72.611  94.193  56.352  1.00 60.76  ? 23  LYS D CD    1 
ATOM 3401  C CE    . LYS D 1 24  ? 74.118  94.103  56.506  1.00 66.80  ? 23  LYS D CE    1 
ATOM 3402  N NZ    . LYS D 1 24  ? 74.817  94.169  55.195  1.00 68.64  ? 23  LYS D NZ    1 
ATOM 3403  N N     . LEU D 1 25  ? 67.914  97.167  56.329  1.00 41.98  ? 24  LEU D N     1 
ATOM 3404  C CA    . LEU D 1 25  ? 66.492  97.247  56.054  1.00 40.05  ? 24  LEU D CA    1 
ATOM 3405  C C     . LEU D 1 25  ? 66.024  98.668  55.693  1.00 40.66  ? 24  LEU D C     1 
ATOM 3406  O O     . LEU D 1 25  ? 64.896  98.861  55.225  1.00 39.38  ? 24  LEU D O     1 
ATOM 3407  C CB    . LEU D 1 25  ? 65.706  96.700  57.244  1.00 38.56  ? 24  LEU D CB    1 
ATOM 3408  C CG    . LEU D 1 25  ? 65.584  95.186  57.168  1.00 37.84  ? 24  LEU D CG    1 
ATOM 3409  C CD1   . LEU D 1 25  ? 65.032  94.584  58.439  1.00 37.31  ? 24  LEU D CD1   1 
ATOM 3410  C CD2   . LEU D 1 25  ? 64.679  94.859  56.018  1.00 37.03  ? 24  LEU D CD2   1 
ATOM 3411  N N     . GLU D 1 26  ? 66.889  99.656  55.904  1.00 50.92  ? 25  GLU D N     1 
ATOM 3412  C CA    . GLU D 1 26  ? 66.486  101.059 55.786  1.00 54.52  ? 25  GLU D CA    1 
ATOM 3413  C C     . GLU D 1 26  ? 65.838  101.355 54.443  1.00 52.34  ? 25  GLU D C     1 
ATOM 3414  O O     . GLU D 1 26  ? 64.925  102.172 54.337  1.00 52.58  ? 25  GLU D O     1 
ATOM 3415  C CB    . GLU D 1 26  ? 67.688  101.976 56.037  1.00 61.60  ? 25  GLU D CB    1 
ATOM 3416  C CG    . GLU D 1 26  ? 67.648  103.354 55.382  1.00 65.35  ? 25  GLU D CG    1 
ATOM 3417  C CD    . GLU D 1 26  ? 68.700  104.294 55.984  1.00 71.51  ? 25  GLU D CD    1 
ATOM 3418  O OE1   . GLU D 1 26  ? 69.359  103.860 56.968  1.00 73.49  ? 25  GLU D OE1   1 
ATOM 3419  O OE2   . GLU D 1 26  ? 68.859  105.451 55.500  1.00 73.66  ? 25  GLU D OE2   1 
ATOM 3420  N N     . GLN D 1 27  ? 66.287  100.634 53.427  1.00 44.86  ? 26  GLN D N     1 
ATOM 3421  C CA    . GLN D 1 27  ? 65.901  100.942 52.065  1.00 45.39  ? 26  GLN D CA    1 
ATOM 3422  C C     . GLN D 1 27  ? 64.492  100.496 51.754  1.00 42.47  ? 26  GLN D C     1 
ATOM 3423  O O     . GLN D 1 27  ? 63.813  101.122 50.949  1.00 42.54  ? 26  GLN D O     1 
ATOM 3424  C CB    . GLN D 1 27  ? 66.884  100.344 51.084  1.00 47.46  ? 26  GLN D CB    1 
ATOM 3425  C CG    . GLN D 1 27  ? 66.627  98.921  50.714  1.00 45.85  ? 26  GLN D CG    1 
ATOM 3426  C CD    . GLN D 1 27  ? 67.770  98.355  49.897  1.00 48.89  ? 26  GLN D CD    1 
ATOM 3427  O OE1   . GLN D 1 27  ? 68.066  98.838  48.792  1.00 51.60  ? 26  GLN D OE1   1 
ATOM 3428  N NE2   . GLN D 1 27  ? 68.450  97.352  50.451  1.00 49.01  ? 26  GLN D NE2   1 
ATOM 3429  N N     . PHE D 1 28  ? 64.042  99.433  52.408  1.00 40.55  ? 27  PHE D N     1 
ATOM 3430  C CA    . PHE D 1 28  ? 62.665  98.997  52.266  1.00 38.28  ? 27  PHE D CA    1 
ATOM 3431  C C     . PHE D 1 28  ? 61.723  99.735  53.219  1.00 37.46  ? 27  PHE D C     1 
ATOM 3432  O O     . PHE D 1 28  ? 60.553  99.383  53.322  1.00 35.96  ? 27  PHE D O     1 
ATOM 3433  C CB    . PHE D 1 28  ? 62.567  97.503  52.507  1.00 37.23  ? 27  PHE D CB    1 
ATOM 3434  C CG    . PHE D 1 28  ? 63.550  96.712  51.726  1.00 38.71  ? 27  PHE D CG    1 
ATOM 3435  C CD1   . PHE D 1 28  ? 63.428  96.598  50.350  1.00 39.61  ? 27  PHE D CD1   1 
ATOM 3436  C CD2   . PHE D 1 28  ? 64.600  96.075  52.354  1.00 39.63  ? 27  PHE D CD2   1 
ATOM 3437  C CE1   . PHE D 1 28  ? 64.336  95.859  49.606  1.00 41.79  ? 27  PHE D CE1   1 
ATOM 3438  C CE2   . PHE D 1 28  ? 65.523  95.328  51.614  1.00 41.61  ? 27  PHE D CE2   1 
ATOM 3439  C CZ    . PHE D 1 28  ? 65.386  95.225  50.237  1.00 42.88  ? 27  PHE D CZ    1 
ATOM 3440  N N     . ASP D 1 29  ? 62.231  100.746 53.919  1.00 45.85  ? 28  ASP D N     1 
ATOM 3441  C CA    . ASP D 1 29  ? 61.418  101.563 54.823  1.00 45.27  ? 28  ASP D CA    1 
ATOM 3442  C C     . ASP D 1 29  ? 60.713  100.736 55.894  1.00 46.41  ? 28  ASP D C     1 
ATOM 3443  O O     . ASP D 1 29  ? 59.614  101.081 56.321  1.00 46.27  ? 28  ASP D O     1 
ATOM 3444  C CB    . ASP D 1 29  ? 60.379  102.383 54.052  1.00 44.37  ? 28  ASP D CB    1 
ATOM 3445  C CG    . ASP D 1 29  ? 59.805  103.531 54.877  1.00 43.56  ? 28  ASP D CG    1 
ATOM 3446  O OD1   . ASP D 1 29  ? 60.549  104.466 55.200  1.00 42.74  ? 28  ASP D OD1   1 
ATOM 3447  O OD2   . ASP D 1 29  ? 58.598  103.516 55.190  1.00 43.83  ? 28  ASP D OD2   1 
ATOM 3448  N N     . ILE D 1 30  ? 61.317  99.634  56.328  1.00 47.62  ? 29  ILE D N     1 
ATOM 3449  C CA    . ILE D 1 30  ? 60.760  98.885  57.462  1.00 48.73  ? 29  ILE D CA    1 
ATOM 3450  C C     . ILE D 1 30  ? 61.810  98.681  58.530  1.00 49.23  ? 29  ILE D C     1 
ATOM 3451  O O     . ILE D 1 30  ? 63.008  98.883  58.289  1.00 48.98  ? 29  ILE D O     1 
ATOM 3452  C CB    . ILE D 1 30  ? 60.223  97.511  57.044  1.00 50.15  ? 29  ILE D CB    1 
ATOM 3453  C CG1   . ILE D 1 30  ? 61.344  96.690  56.398  1.00 50.88  ? 29  ILE D CG1   1 
ATOM 3454  C CG2   . ILE D 1 30  ? 59.078  97.682  56.080  1.00 49.85  ? 29  ILE D CG2   1 
ATOM 3455  C CD1   . ILE D 1 30  ? 61.026  95.236  56.197  1.00 52.57  ? 29  ILE D CD1   1 
ATOM 3456  N N     . THR D 1 31  ? 61.350  98.212  59.685  1.00 50.08  ? 30  THR D N     1 
ATOM 3457  C CA    . THR D 1 31  ? 62.200  97.828  60.799  1.00 50.87  ? 30  THR D CA    1 
ATOM 3458  C C     . THR D 1 31  ? 62.220  96.314  60.884  1.00 52.57  ? 30  THR D C     1 
ATOM 3459  O O     . THR D 1 31  ? 61.293  95.654  60.429  1.00 53.15  ? 30  THR D O     1 
ATOM 3460  C CB    . THR D 1 31  ? 61.666  98.387  62.122  1.00 50.72  ? 30  THR D CB    1 
ATOM 3461  O OG1   . THR D 1 31  ? 60.535  97.620  62.546  1.00 51.65  ? 30  THR D OG1   1 
ATOM 3462  C CG2   . THR D 1 31  ? 61.249  99.829  61.946  1.00 49.18  ? 30  THR D CG2   1 
ATOM 3463  N N     . ASN D 1 32  ? 63.267  95.759  61.476  1.00 68.43  ? 31  ASN D N     1 
ATOM 3464  C CA    . ASN D 1 32  ? 63.426  94.314  61.507  1.00 70.21  ? 31  ASN D CA    1 
ATOM 3465  C C     . ASN D 1 32  ? 62.260  93.661  62.223  1.00 71.15  ? 31  ASN D C     1 
ATOM 3466  O O     . ASN D 1 32  ? 61.807  92.593  61.834  1.00 72.32  ? 31  ASN D O     1 
ATOM 3467  C CB    . ASN D 1 32  ? 64.752  93.910  62.143  1.00 71.27  ? 31  ASN D CB    1 
ATOM 3468  C CG    . ASN D 1 32  ? 64.818  94.256  63.604  1.00 71.62  ? 31  ASN D CG    1 
ATOM 3469  O OD1   . ASN D 1 32  ? 63.954  94.956  64.119  1.00 71.27  ? 31  ASN D OD1   1 
ATOM 3470  N ND2   . ASN D 1 32  ? 65.845  93.771  64.283  1.00 72.59  ? 31  ASN D ND2   1 
ATOM 3471  N N     . GLU D 1 33  ? 61.757  94.304  63.264  1.00 55.66  ? 32  GLU D N     1 
ATOM 3472  C CA    . GLU D 1 33  ? 60.597  93.772  63.948  1.00 56.47  ? 32  GLU D CA    1 
ATOM 3473  C C     . GLU D 1 33  ? 59.466  93.701  62.937  1.00 56.22  ? 32  GLU D C     1 
ATOM 3474  O O     . GLU D 1 33  ? 58.720  92.731  62.896  1.00 57.43  ? 32  GLU D O     1 
ATOM 3475  C CB    . GLU D 1 33  ? 60.198  94.685  65.099  1.00 55.80  ? 32  GLU D CB    1 
ATOM 3476  C CG    . GLU D 1 33  ? 61.171  94.679  66.259  1.00 56.29  ? 32  GLU D CG    1 
ATOM 3477  C CD    . GLU D 1 33  ? 62.263  95.703  66.093  1.00 55.18  ? 32  GLU D CD    1 
ATOM 3478  O OE1   . GLU D 1 33  ? 62.119  96.584  65.229  1.00 53.85  ? 32  GLU D OE1   1 
ATOM 3479  O OE2   . GLU D 1 33  ? 63.269  95.625  66.819  1.00 55.72  ? 32  GLU D OE2   1 
ATOM 3480  N N     . GLN D 1 34  ? 59.353  94.728  62.107  1.00 54.76  ? 33  GLN D N     1 
ATOM 3481  C CA    . GLN D 1 34  ? 58.381  94.730  61.036  1.00 54.52  ? 33  GLN D CA    1 
ATOM 3482  C C     . GLN D 1 34  ? 58.808  93.700  60.000  1.00 55.45  ? 33  GLN D C     1 
ATOM 3483  O O     . GLN D 1 34  ? 57.995  92.943  59.465  1.00 56.35  ? 33  GLN D O     1 
ATOM 3484  C CB    . GLN D 1 34  ? 58.316  96.116  60.422  1.00 52.75  ? 33  GLN D CB    1 
ATOM 3485  C CG    . GLN D 1 34  ? 57.457  97.079  61.183  1.00 52.00  ? 33  GLN D CG    1 
ATOM 3486  C CD    . GLN D 1 34  ? 57.608  98.493  60.689  1.00 50.34  ? 33  GLN D CD    1 
ATOM 3487  O OE1   . GLN D 1 34  ? 58.294  98.747  59.693  1.00 49.69  ? 33  GLN D OE1   1 
ATOM 3488  N NE2   . GLN D 1 34  ? 56.981  99.434  61.385  1.00 49.69  ? 33  GLN D NE2   1 
ATOM 3489  N N     . GLY D 1 35  ? 60.107  93.663  59.742  1.00 55.35  ? 34  GLY D N     1 
ATOM 3490  C CA    . GLY D 1 35  ? 60.673  92.688  58.831  1.00 56.35  ? 34  GLY D CA    1 
ATOM 3491  C C     . GLY D 1 35  ? 60.428  91.245  59.222  1.00 58.33  ? 34  GLY D C     1 
ATOM 3492  O O     . GLY D 1 35  ? 60.120  90.430  58.355  1.00 59.26  ? 34  GLY D O     1 
ATOM 3493  N N     . HIS D 1 36  ? 60.563  90.931  60.512  1.00 63.08  ? 35  HIS D N     1 
ATOM 3494  C CA    . HIS D 1 36  ? 60.360  89.569  60.996  1.00 65.05  ? 35  HIS D CA    1 
ATOM 3495  C C     . HIS D 1 36  ? 58.882  89.162  61.026  1.00 65.66  ? 35  HIS D C     1 
ATOM 3496  O O     . HIS D 1 36  ? 58.537  88.023  60.704  1.00 67.48  ? 35  HIS D O     1 
ATOM 3497  C CB    . HIS D 1 36  ? 60.985  89.374  62.376  1.00 65.72  ? 35  HIS D CB    1 
ATOM 3498  C CG    . HIS D 1 36  ? 62.478  89.263  62.358  1.00 66.34  ? 35  HIS D CG    1 
ATOM 3499  N ND1   . HIS D 1 36  ? 63.268  89.654  63.421  1.00 66.31  ? 35  HIS D ND1   1 
ATOM 3500  C CD2   . HIS D 1 36  ? 63.328  88.807  61.407  1.00 66.85  ? 35  HIS D CD2   1 
ATOM 3501  C CE1   . HIS D 1 36  ? 64.539  89.453  63.121  1.00 66.54  ? 35  HIS D CE1   1 
ATOM 3502  N NE2   . HIS D 1 36  ? 64.604  88.938  61.908  1.00 66.98  ? 35  HIS D NE2   1 
ATOM 3503  N N     . THR D 1 37  ? 58.014  90.087  61.418  1.00 60.52  ? 36  THR D N     1 
ATOM 3504  C CA    . THR D 1 37  ? 56.582  89.820  61.460  1.00 61.07  ? 36  THR D CA    1 
ATOM 3505  C C     . THR D 1 37  ? 56.062  89.478  60.082  1.00 61.36  ? 36  THR D C     1 
ATOM 3506  O O     . THR D 1 37  ? 55.471  88.423  59.871  1.00 62.93  ? 36  THR D O     1 
ATOM 3507  C CB    . THR D 1 37  ? 55.837  91.041  61.933  1.00 59.68  ? 36  THR D CB    1 
ATOM 3508  O OG1   . THR D 1 37  ? 56.539  91.602  63.045  1.00 59.11  ? 36  THR D OG1   1 
ATOM 3509  C CG2   . THR D 1 37  ? 54.435  90.682  62.347  1.00 60.53  ? 36  THR D CG2   1 
ATOM 3510  N N     . LEU D 1 38  ? 56.279  90.390  59.142  1.00 59.91  ? 37  LEU D N     1 
ATOM 3511  C CA    . LEU D 1 38  ? 55.912  90.167  57.753  1.00 60.07  ? 37  LEU D CA    1 
ATOM 3512  C C     . LEU D 1 38  ? 56.497  88.851  57.280  1.00 61.74  ? 37  LEU D C     1 
ATOM 3513  O O     . LEU D 1 38  ? 55.786  88.035  56.705  1.00 63.01  ? 37  LEU D O     1 
ATOM 3514  C CB    . LEU D 1 38  ? 56.423  91.306  56.875  1.00 58.28  ? 37  LEU D CB    1 
ATOM 3515  C CG    . LEU D 1 38  ? 55.873  92.721  57.061  1.00 56.57  ? 37  LEU D CG    1 
ATOM 3516  C CD1   . LEU D 1 38  ? 56.612  93.631  56.120  1.00 55.10  ? 37  LEU D CD1   1 
ATOM 3517  C CD2   . LEU D 1 38  ? 54.372  92.824  56.828  1.00 56.81  ? 37  LEU D CD2   1 
ATOM 3518  N N     . GLY D 1 39  ? 57.788  88.642  57.532  1.00 61.85  ? 38  GLY D N     1 
ATOM 3519  C CA    . GLY D 1 39  ? 58.429  87.376  57.211  1.00 63.59  ? 38  GLY D CA    1 
ATOM 3520  C C     . GLY D 1 39  ? 57.658  86.172  57.744  1.00 65.57  ? 38  GLY D C     1 
ATOM 3521  O O     . GLY D 1 39  ? 57.451  85.184  57.037  1.00 67.07  ? 38  GLY D O     1 
ATOM 3522  N N     . TYR D 1 40  ? 57.227  86.257  59.000  1.00 65.66  ? 39  TYR D N     1 
ATOM 3523  C CA    . TYR D 1 40  ? 56.398  85.217  59.576  1.00 67.47  ? 39  TYR D CA    1 
ATOM 3524  C C     . TYR D 1 40  ? 55.105  85.085  58.775  1.00 67.85  ? 39  TYR D C     1 
ATOM 3525  O O     . TYR D 1 40  ? 54.758  83.987  58.350  1.00 69.63  ? 39  TYR D O     1 
ATOM 3526  C CB    . TYR D 1 40  ? 56.101  85.500  61.048  1.00 67.29  ? 39  TYR D CB    1 
ATOM 3527  C CG    . TYR D 1 40  ? 55.375  84.371  61.731  1.00 69.26  ? 39  TYR D CG    1 
ATOM 3528  C CD1   . TYR D 1 40  ? 55.998  83.142  61.928  1.00 71.12  ? 39  TYR D CD1   1 
ATOM 3529  C CD2   . TYR D 1 40  ? 54.066  84.522  62.167  1.00 69.38  ? 39  TYR D CD2   1 
ATOM 3530  C CE1   . TYR D 1 40  ? 55.341  82.102  62.542  1.00 73.00  ? 39  TYR D CE1   1 
ATOM 3531  C CE2   . TYR D 1 40  ? 53.402  83.484  62.791  1.00 71.25  ? 39  TYR D CE2   1 
ATOM 3532  C CZ    . TYR D 1 40  ? 54.041  82.274  62.973  1.00 73.05  ? 39  TYR D CZ    1 
ATOM 3533  O OH    . TYR D 1 40  ? 53.376  81.231  63.597  1.00 75.00  ? 39  TYR D OH    1 
ATOM 3534  N N     . LEU D 1 41  ? 54.403  86.198  58.558  1.00 66.29  ? 40  LEU D N     1 
ATOM 3535  C CA    . LEU D 1 41  ? 53.210  86.207  57.700  1.00 66.57  ? 40  LEU D CA    1 
ATOM 3536  C C     . LEU D 1 41  ? 53.493  85.624  56.305  1.00 67.30  ? 40  LEU D C     1 
ATOM 3537  O O     . LEU D 1 41  ? 52.668  84.915  55.728  1.00 68.70  ? 40  LEU D O     1 
ATOM 3538  C CB    . LEU D 1 41  ? 52.658  87.623  57.558  1.00 64.63  ? 40  LEU D CB    1 
ATOM 3539  C CG    . LEU D 1 41  ? 52.100  88.288  58.807  1.00 63.98  ? 40  LEU D CG    1 
ATOM 3540  C CD1   . LEU D 1 41  ? 51.663  89.704  58.501  1.00 62.12  ? 40  LEU D CD1   1 
ATOM 3541  C CD2   . LEU D 1 41  ? 50.935  87.485  59.299  1.00 65.65  ? 40  LEU D CD2   1 
ATOM 3542  N N     . TYR D 1 42  ? 54.666  85.923  55.765  1.00 66.44  ? 41  TYR D N     1 
ATOM 3543  C CA    . TYR D 1 42  ? 55.048  85.346  54.494  1.00 67.20  ? 41  TYR D CA    1 
ATOM 3544  C C     . TYR D 1 42  ? 55.016  83.833  54.604  1.00 69.66  ? 41  TYR D C     1 
ATOM 3545  O O     . TYR D 1 42  ? 54.581  83.151  53.691  1.00 70.93  ? 41  TYR D O     1 
ATOM 3546  C CB    . TYR D 1 42  ? 56.438  85.815  54.073  1.00 66.08  ? 41  TYR D CB    1 
ATOM 3547  C CG    . TYR D 1 42  ? 56.836  85.390  52.677  1.00 66.64  ? 41  TYR D CG    1 
ATOM 3548  C CD1   . TYR D 1 42  ? 57.663  84.296  52.468  1.00 68.26  ? 41  TYR D CD1   1 
ATOM 3549  C CD2   . TYR D 1 42  ? 56.388  86.090  51.571  1.00 65.63  ? 41  TYR D CD2   1 
ATOM 3550  C CE1   . TYR D 1 42  ? 58.034  83.914  51.190  1.00 68.85  ? 41  TYR D CE1   1 
ATOM 3551  C CE2   . TYR D 1 42  ? 56.746  85.712  50.292  1.00 66.18  ? 41  TYR D CE2   1 
ATOM 3552  C CZ    . TYR D 1 42  ? 57.567  84.623  50.102  1.00 67.79  ? 41  TYR D CZ    1 
ATOM 3553  O OH    . TYR D 1 42  ? 57.914  84.256  48.816  1.00 68.40  ? 41  TYR D OH    1 
ATOM 3554  N N     . ALA D 1 43  ? 55.447  83.303  55.738  1.00 70.44  ? 42  ALA D N     1 
ATOM 3555  C CA    . ALA D 1 43  ? 55.530  81.858  55.872  1.00 72.86  ? 42  ALA D CA    1 
ATOM 3556  C C     . ALA D 1 43  ? 54.246  81.198  56.379  1.00 74.35  ? 42  ALA D C     1 
ATOM 3557  O O     . ALA D 1 43  ? 53.962  80.071  56.012  1.00 76.41  ? 42  ALA D O     1 
ATOM 3558  C CB    . ALA D 1 43  ? 56.726  81.463  56.721  1.00 73.31  ? 42  ALA D CB    1 
ATOM 3559  N N     . HIS D 1 44  ? 53.459  81.888  57.196  1.00 82.54  ? 43  HIS D N     1 
ATOM 3560  C CA    . HIS D 1 44  ? 52.332  81.222  57.847  1.00 84.12  ? 43  HIS D CA    1 
ATOM 3561  C C     . HIS D 1 44  ? 50.947  81.756  57.490  1.00 84.04  ? 43  HIS D C     1 
ATOM 3562  O O     . HIS D 1 44  ? 49.963  81.228  57.982  1.00 85.42  ? 43  HIS D O     1 
ATOM 3563  C CB    . HIS D 1 44  ? 52.471  81.265  59.377  1.00 84.16  ? 43  HIS D CB    1 
ATOM 3564  C CG    . HIS D 1 44  ? 53.679  80.557  59.910  1.00 85.16  ? 43  HIS D CG    1 
ATOM 3565  N ND1   . HIS D 1 44  ? 54.946  80.751  59.404  1.00 84.30  ? 43  HIS D ND1   1 
ATOM 3566  C CD2   . HIS D 1 44  ? 53.815  79.675  60.928  1.00 86.91  ? 43  HIS D CD2   1 
ATOM 3567  C CE1   . HIS D 1 44  ? 55.808  80.010  60.076  1.00 85.71  ? 43  HIS D CE1   1 
ATOM 3568  N NE2   . HIS D 1 44  ? 55.147  79.347  61.007  1.00 87.36  ? 43  HIS D NE2   1 
ATOM 3569  N N     . GLN D 1 45  ? 50.855  82.787  56.657  1.00 92.73  ? 44  GLN D N     1 
ATOM 3570  C CA    . GLN D 1 45  ? 49.576  83.488  56.477  1.00 92.09  ? 44  GLN D CA    1 
ATOM 3571  C C     . GLN D 1 45  ? 48.327  82.723  56.102  1.00 94.43  ? 44  GLN D C     1 
ATOM 3572  O O     . GLN D 1 45  ? 47.261  82.960  56.666  1.00 94.85  ? 44  GLN D O     1 
ATOM 3573  C CB    . GLN D 1 45  ? 49.703  84.638  55.487  1.00 90.10  ? 44  GLN D CB    1 
ATOM 3574  C CG    . GLN D 1 45  ? 50.142  84.229  54.102  1.00 90.29  ? 44  GLN D CG    1 
ATOM 3575  C CD    . GLN D 1 45  ? 50.231  85.421  53.205  1.00 88.66  ? 44  GLN D CD    1 
ATOM 3576  O OE1   . GLN D 1 45  ? 50.068  86.550  53.670  1.00 87.46  ? 44  GLN D OE1   1 
ATOM 3577  N NE2   . GLN D 1 45  ? 50.484  85.195  51.912  1.00 88.81  ? 44  GLN D NE2   1 
ATOM 3578  N N     . GLN D 1 46  ? 48.457  81.786  55.176  1.00 87.39  ? 45  GLN D N     1 
ATOM 3579  C CA    . GLN D 1 46  ? 47.325  80.951  54.854  1.00 89.56  ? 45  GLN D CA    1 
ATOM 3580  C C     . GLN D 1 46  ? 47.312  79.854  55.896  1.00 91.42  ? 45  GLN D C     1 
ATOM 3581  O O     . GLN D 1 46  ? 47.292  78.671  55.581  1.00 93.70  ? 45  GLN D O     1 
ATOM 3582  C CB    . GLN D 1 46  ? 47.483  80.352  53.459  1.00 90.68  ? 45  GLN D CB    1 
ATOM 3583  N N     . ASP D 1 47  ? 47.344  80.277  57.152  1.00 93.23  ? 46  ASP D N     1 
ATOM 3584  C CA    . ASP D 1 47  ? 47.164  79.394  58.290  1.00 94.93  ? 46  ASP D CA    1 
ATOM 3585  C C     . ASP D 1 47  ? 46.142  79.989  59.248  1.00 94.47  ? 46  ASP D C     1 
ATOM 3586  O O     . ASP D 1 47  ? 46.115  79.642  60.424  1.00 94.99  ? 46  ASP D O     1 
ATOM 3587  C CB    . ASP D 1 47  ? 48.492  79.135  58.999  1.00 94.57  ? 46  ASP D CB    1 
ATOM 3588  N N     . GLY D 1 48  ? 45.317  80.901  58.743  1.00 139.86 ? 47  GLY D N     1 
ATOM 3589  C CA    . GLY D 1 48  ? 44.350  81.604  59.570  1.00 139.32 ? 47  GLY D CA    1 
ATOM 3590  C C     . GLY D 1 48  ? 44.931  82.323  60.776  1.00 137.59 ? 47  GLY D C     1 
ATOM 3591  O O     . GLY D 1 48  ? 44.332  82.346  61.846  1.00 137.95 ? 47  GLY D O     1 
ATOM 3592  N N     . LEU D 1 49  ? 46.111  82.904  60.593  1.00 87.19  ? 48  LEU D N     1 
ATOM 3593  C CA    . LEU D 1 49  ? 46.832  83.613  61.653  1.00 85.65  ? 48  LEU D CA    1 
ATOM 3594  C C     . LEU D 1 49  ? 46.020  84.786  62.182  1.00 84.35  ? 48  LEU D C     1 
ATOM 3595  O O     . LEU D 1 49  ? 45.651  85.684  61.423  1.00 83.18  ? 48  LEU D O     1 
ATOM 3596  C CB    . LEU D 1 49  ? 48.179  84.108  61.113  1.00 84.12  ? 48  LEU D CB    1 
ATOM 3597  C CG    . LEU D 1 49  ? 49.287  83.145  60.680  1.00 85.06  ? 48  LEU D CG    1 
ATOM 3598  C CD1   . LEU D 1 49  ? 50.413  83.933  60.066  1.00 83.27  ? 48  LEU D CD1   1 
ATOM 3599  C CD2   . LEU D 1 49  ? 49.809  82.327  61.828  1.00 86.21  ? 48  LEU D CD2   1 
ATOM 3600  N N     . THR D 1 50  ? 45.719  84.773  63.476  1.00 72.68  ? 49  THR D N     1 
ATOM 3601  C CA    . THR D 1 50  ? 45.094  85.934  64.098  1.00 71.40  ? 49  THR D CA    1 
ATOM 3602  C C     . THR D 1 50  ? 46.170  86.814  64.715  1.00 69.55  ? 49  THR D C     1 
ATOM 3603  O O     . THR D 1 50  ? 47.346  86.444  64.736  1.00 69.45  ? 49  THR D O     1 
ATOM 3604  C CB    . THR D 1 50  ? 44.164  85.440  65.189  1.00 72.81  ? 49  THR D CB    1 
ATOM 3605  O OG1   . THR D 1 50  ? 44.899  84.607  66.086  1.00 73.66  ? 49  THR D OG1   1 
ATOM 3606  C CG2   . THR D 1 50  ? 43.052  84.641  64.576  1.00 74.70  ? 49  THR D CG2   1 
ATOM 3607  N N     . GLN D 1 51  ? 45.782  87.981  65.203  1.00 59.33  ? 50  GLN D N     1 
ATOM 3608  C CA    . GLN D 1 51  ? 46.759  88.832  65.856  1.00 57.77  ? 50  GLN D CA    1 
ATOM 3609  C C     . GLN D 1 51  ? 47.381  88.070  67.016  1.00 58.84  ? 50  GLN D C     1 
ATOM 3610  O O     . GLN D 1 51  ? 48.594  87.918  67.104  1.00 58.40  ? 50  GLN D O     1 
ATOM 3611  C CB    . GLN D 1 51  ? 46.123  90.134  66.346  1.00 56.84  ? 50  GLN D CB    1 
ATOM 3612  C CG    . GLN D 1 51  ? 45.587  90.987  65.229  1.00 55.78  ? 50  GLN D CG    1 
ATOM 3613  C CD    . GLN D 1 51  ? 45.371  92.417  65.635  1.00 54.55  ? 50  GLN D CD    1 
ATOM 3614  O OE1   . GLN D 1 51  ? 44.979  93.243  64.812  1.00 53.65  ? 50  GLN D OE1   1 
ATOM 3615  N NE2   . GLN D 1 51  ? 45.636  92.731  66.899  1.00 54.63  ? 50  GLN D NE2   1 
ATOM 3616  N N     . ASN D 1 52  ? 46.537  87.552  67.888  1.00 61.29  ? 51  ASN D N     1 
ATOM 3617  C CA    . ASN D 1 52  ? 47.048  86.847  69.037  1.00 62.48  ? 51  ASN D CA    1 
ATOM 3618  C C     . ASN D 1 52  ? 47.909  85.621  68.714  1.00 63.47  ? 51  ASN D C     1 
ATOM 3619  O O     . ASN D 1 52  ? 48.773  85.246  69.513  1.00 64.01  ? 51  ASN D O     1 
ATOM 3620  C CB    . ASN D 1 52  ? 45.917  86.462  69.967  1.00 64.19  ? 51  ASN D CB    1 
ATOM 3621  C CG    . ASN D 1 52  ? 46.422  85.856  71.232  1.00 65.42  ? 51  ASN D CG    1 
ATOM 3622  O OD1   . ASN D 1 52  ? 46.262  84.654  71.469  1.00 67.26  ? 51  ASN D OD1   1 
ATOM 3623  N ND2   . ASN D 1 52  ? 47.091  86.675  72.044  1.00 64.56  ? 51  ASN D ND2   1 
ATOM 3624  N N     . ASP D 1 53  ? 47.671  84.998  67.561  1.00 67.19  ? 52  ASP D N     1 
ATOM 3625  C CA    . ASP D 1 53  ? 48.532  83.913  67.087  1.00 68.12  ? 52  ASP D CA    1 
ATOM 3626  C C     . ASP D 1 53  ? 49.915  84.475  66.885  1.00 66.58  ? 52  ASP D C     1 
ATOM 3627  O O     . ASP D 1 53  ? 50.906  83.924  67.368  1.00 67.28  ? 52  ASP D O     1 
ATOM 3628  C CB    . ASP D 1 53  ? 48.045  83.360  65.746  1.00 68.75  ? 52  ASP D CB    1 
ATOM 3629  C CG    . ASP D 1 53  ? 47.255  82.072  65.892  1.00 71.32  ? 52  ASP D CG    1 
ATOM 3630  O OD1   . ASP D 1 53  ? 47.340  81.431  66.972  1.00 72.63  ? 52  ASP D OD1   1 
ATOM 3631  O OD2   . ASP D 1 53  ? 46.553  81.696  64.919  1.00 72.17  ? 52  ASP D OD2   1 
ATOM 3632  N N     . ILE D 1 54  ? 49.956  85.582  66.147  1.00 60.52  ? 53  ILE D N     1 
ATOM 3633  C CA    . ILE D 1 54  ? 51.180  86.300  65.835  1.00 58.91  ? 53  ILE D CA    1 
ATOM 3634  C C     . ILE D 1 54  ? 51.871  86.672  67.127  1.00 58.84  ? 53  ILE D C     1 
ATOM 3635  O O     . ILE D 1 54  ? 53.055  86.412  67.301  1.00 59.06  ? 53  ILE D O     1 
ATOM 3636  C CB    . ILE D 1 54  ? 50.854  87.589  65.054  1.00 56.90  ? 53  ILE D CB    1 
ATOM 3637  C CG1   . ILE D 1 54  ? 50.457  87.270  63.612  1.00 56.96  ? 53  ILE D CG1   1 
ATOM 3638  C CG2   . ILE D 1 54  ? 52.016  88.574  65.101  1.00 55.23  ? 53  ILE D CG2   1 
ATOM 3639  C CD1   . ILE D 1 54  ? 49.782  88.430  62.928  1.00 55.45  ? 53  ILE D CD1   1 
ATOM 3640  N N     . ALA D 1 55  ? 51.101  87.276  68.027  1.00 58.74  ? 54  ALA D N     1 
ATOM 3641  C CA    . ALA D 1 55  ? 51.557  87.626  69.368  1.00 59.03  ? 54  ALA D CA    1 
ATOM 3642  C C     . ALA D 1 55  ? 52.236  86.467  70.065  1.00 60.88  ? 54  ALA D C     1 
ATOM 3643  O O     . ALA D 1 55  ? 53.324  86.611  70.624  1.00 60.99  ? 54  ALA D O     1 
ATOM 3644  C CB    . ALA D 1 55  ? 50.393  88.114  70.192  1.00 59.30  ? 54  ALA D CB    1 
ATOM 3645  N N     . LYS D 1 56  ? 51.583  85.313  70.015  1.00 67.39  ? 55  LYS D N     1 
ATOM 3646  C CA    . LYS D 1 56  ? 52.114  84.099  70.600  1.00 69.40  ? 55  LYS D CA    1 
ATOM 3647  C C     . LYS D 1 56  ? 53.401  83.624  69.918  1.00 69.51  ? 55  LYS D C     1 
ATOM 3648  O O     . LYS D 1 56  ? 54.374  83.288  70.596  1.00 70.46  ? 55  LYS D O     1 
ATOM 3649  C CB    . LYS D 1 56  ? 51.065  82.999  70.536  1.00 71.15  ? 55  LYS D CB    1 
ATOM 3650  C CG    . LYS D 1 56  ? 49.877  83.217  71.447  1.00 71.72  ? 55  LYS D CG    1 
ATOM 3651  C CD    . LYS D 1 56  ? 48.811  82.148  71.211  1.00 73.52  ? 55  LYS D CD    1 
ATOM 3652  C CE    . LYS D 1 56  ? 49.302  80.753  71.595  1.00 75.72  ? 55  LYS D CE    1 
ATOM 3653  N NZ    . LYS D 1 56  ? 48.204  79.747  71.469  1.00 77.68  ? 55  LYS D NZ    1 
ATOM 3654  N N     . ALA D 1 57  ? 53.413  83.611  68.585  1.00 63.80  ? 56  ALA D N     1 
ATOM 3655  C CA    . ALA D 1 57  ? 54.539  83.059  67.829  1.00 64.17  ? 56  ALA D CA    1 
ATOM 3656  C C     . ALA D 1 57  ? 55.813  83.887  67.985  1.00 63.05  ? 56  ALA D C     1 
ATOM 3657  O O     . ALA D 1 57  ? 56.898  83.345  68.210  1.00 64.17  ? 56  ALA D O     1 
ATOM 3658  C CB    . ALA D 1 57  ? 54.199  82.913  66.374  1.00 63.66  ? 56  ALA D CB    1 
ATOM 3659  N N     . LEU D 1 58  ? 55.675  85.200  67.837  1.00 67.46  ? 57  LEU D N     1 
ATOM 3660  C CA    . LEU D 1 58  ? 56.784  86.122  67.999  1.00 66.60  ? 57  LEU D CA    1 
ATOM 3661  C C     . LEU D 1 58  ? 57.063  86.347  69.475  1.00 67.63  ? 57  LEU D C     1 
ATOM 3662  O O     . LEU D 1 58  ? 58.087  86.927  69.842  1.00 67.43  ? 57  LEU D O     1 
ATOM 3663  C CB    . LEU D 1 58  ? 56.453  87.468  67.358  1.00 64.09  ? 57  LEU D CB    1 
ATOM 3664  C CG    . LEU D 1 58  ? 56.310  87.591  65.840  1.00 63.40  ? 57  LEU D CG    1 
ATOM 3665  C CD1   . LEU D 1 58  ? 56.063  89.052  65.492  1.00 61.57  ? 57  LEU D CD1   1 
ATOM 3666  C CD2   . LEU D 1 58  ? 57.542  87.059  65.117  1.00 64.17  ? 57  LEU D CD2   1 
ATOM 3667  N N     . GLN D 1 59  ? 56.127  85.915  70.313  1.00 68.18  ? 58  GLN D N     1 
ATOM 3668  C CA    . GLN D 1 59  ? 56.289  85.996  71.755  1.00 69.43  ? 58  GLN D CA    1 
ATOM 3669  C C     . GLN D 1 59  ? 56.456  87.424  72.243  1.00 67.95  ? 58  GLN D C     1 
ATOM 3670  O O     . GLN D 1 59  ? 57.421  87.759  72.934  1.00 68.38  ? 58  GLN D O     1 
ATOM 3671  C CB    . GLN D 1 59  ? 57.473  85.153  72.203  1.00 71.22  ? 58  GLN D CB    1 
ATOM 3672  C CG    . GLN D 1 59  ? 57.169  83.687  72.353  1.00 73.60  ? 58  GLN D CG    1 
ATOM 3673  C CD    . GLN D 1 59  ? 58.334  82.959  72.960  1.00 76.00  ? 58  GLN D CD    1 
ATOM 3674  O OE1   . GLN D 1 59  ? 59.482  83.150  72.548  1.00 75.98  ? 58  GLN D OE1   1 
ATOM 3675  N NE2   . GLN D 1 59  ? 58.059  82.137  73.966  1.00 78.28  ? 58  GLN D NE2   1 
ATOM 3676  N N     . ARG D 1 60  ? 55.501  88.260  71.865  1.00 60.09  ? 59  ARG D N     1 
ATOM 3677  C CA    . ARG D 1 60  ? 55.422  89.625  72.336  1.00 58.97  ? 59  ARG D CA    1 
ATOM 3678  C C     . ARG D 1 60  ? 53.973  89.803  72.720  1.00 59.02  ? 59  ARG D C     1 
ATOM 3679  O O     . ARG D 1 60  ? 53.137  89.019  72.297  1.00 59.49  ? 59  ARG D O     1 
ATOM 3680  C CB    . ARG D 1 60  ? 55.809  90.590  71.224  1.00 56.91  ? 59  ARG D CB    1 
ATOM 3681  C CG    . ARG D 1 60  ? 57.154  91.282  71.438  1.00 56.66  ? 59  ARG D CG    1 
ATOM 3682  C CD    . ARG D 1 60  ? 58.262  90.273  71.537  1.00 58.17  ? 59  ARG D CD    1 
ATOM 3683  N NE    . ARG D 1 60  ? 59.573  90.897  71.542  1.00 58.02  ? 59  ARG D NE    1 
ATOM 3684  C CZ    . ARG D 1 60  ? 60.719  90.223  71.586  1.00 59.37  ? 59  ARG D CZ    1 
ATOM 3685  N NH1   . ARG D 1 60  ? 60.715  88.899  71.632  1.00 60.92  ? 59  ARG D NH1   1 
ATOM 3686  N NH2   . ARG D 1 60  ? 61.875  90.876  71.590  1.00 59.34  ? 59  ARG D NH2   1 
ATOM 3687  N N     . THR D 1 61  ? 53.665  90.816  73.523  1.00 58.76  ? 60  THR D N     1 
ATOM 3688  C CA    . THR D 1 61  ? 52.325  90.928  74.094  1.00 59.26  ? 60  THR D CA    1 
ATOM 3689  C C     . THR D 1 61  ? 51.257  91.251  73.052  1.00 58.04  ? 60  THR D C     1 
ATOM 3690  O O     . THR D 1 61  ? 51.512  91.251  71.862  1.00 56.89  ? 60  THR D O     1 
ATOM 3691  C CB    . THR D 1 61  ? 52.249  91.937  75.264  1.00 59.58  ? 60  THR D CB    1 
ATOM 3692  O OG1   . THR D 1 61  ? 52.181  93.270  74.758  1.00 57.86  ? 60  THR D OG1   1 
ATOM 3693  C CG2   . THR D 1 61  ? 53.445  91.802  76.160  1.00 60.73  ? 60  THR D CG2   1 
ATOM 3694  N N     . GLY D 1 62  ? 50.050  91.504  73.521  1.00 58.51  ? 61  GLY D N     1 
ATOM 3695  C CA    . GLY D 1 62  ? 48.930  91.740  72.649  1.00 57.83  ? 61  GLY D CA    1 
ATOM 3696  C C     . GLY D 1 62  ? 48.837  93.172  72.210  1.00 56.16  ? 61  GLY D C     1 
ATOM 3697  O O     . GLY D 1 62  ? 48.515  93.422  71.044  1.00 55.06  ? 61  GLY D O     1 
ATOM 3698  N N     . PRO D 1 63  ? 49.086  94.128  73.126  1.00 56.11  ? 62  PRO D N     1 
ATOM 3699  C CA    . PRO D 1 63  ? 49.141  95.493  72.595  1.00 54.50  ? 62  PRO D CA    1 
ATOM 3700  C C     . PRO D 1 63  ? 50.327  95.668  71.651  1.00 53.06  ? 62  PRO D C     1 
ATOM 3701  O O     . PRO D 1 63  ? 50.136  96.235  70.590  1.00 51.70  ? 62  PRO D O     1 
ATOM 3702  C CB    . PRO D 1 63  ? 49.314  96.357  73.845  1.00 55.11  ? 62  PRO D CB    1 
ATOM 3703  C CG    . PRO D 1 63  ? 48.839  95.537  74.952  1.00 57.04  ? 62  PRO D CG    1 
ATOM 3704  C CD    . PRO D 1 63  ? 49.149  94.119  74.596  1.00 57.60  ? 62  PRO D CD    1 
ATOM 3705  N N     . THR D 1 64  ? 51.504  95.167  72.023  1.00 53.85  ? 63  THR D N     1 
ATOM 3706  C CA    . THR D 1 64  ? 52.699  95.287  71.189  1.00 52.75  ? 63  THR D CA    1 
ATOM 3707  C C     . THR D 1 64  ? 52.374  94.919  69.755  1.00 51.77  ? 63  THR D C     1 
ATOM 3708  O O     . THR D 1 64  ? 52.710  95.663  68.829  1.00 50.28  ? 63  THR D O     1 
ATOM 3709  C CB    . THR D 1 64  ? 53.882  94.390  71.668  1.00 53.89  ? 63  THR D CB    1 
ATOM 3710  O OG1   . THR D 1 64  ? 54.313  94.782  72.977  1.00 54.95  ? 63  THR D OG1   1 
ATOM 3711  C CG2   . THR D 1 64  ? 55.067  94.516  70.719  1.00 52.87  ? 63  THR D CG2   1 
ATOM 3712  N N     . VAL D 1 65  ? 51.695  93.791  69.577  1.00 52.43  ? 64  VAL D N     1 
ATOM 3713  C CA    . VAL D 1 65  ? 51.344  93.325  68.242  1.00 51.92  ? 64  VAL D CA    1 
ATOM 3714  C C     . VAL D 1 65  ? 50.258  94.193  67.606  1.00 50.99  ? 64  VAL D C     1 
ATOM 3715  O O     . VAL D 1 65  ? 50.234  94.375  66.395  1.00 50.02  ? 64  VAL D O     1 
ATOM 3716  C CB    . VAL D 1 65  ? 50.975  91.830  68.242  1.00 53.54  ? 64  VAL D CB    1 
ATOM 3717  C CG1   . VAL D 1 65  ? 50.412  91.405  66.913  1.00 53.33  ? 64  VAL D CG1   1 
ATOM 3718  C CG2   . VAL D 1 65  ? 52.195  91.021  68.521  1.00 54.30  ? 64  VAL D CG2   1 
ATOM 3719  N N     . SER D 1 66  ? 49.351  94.730  68.397  1.00 51.44  ? 65  SER D N     1 
ATOM 3720  C CA    . SER D 1 66  ? 48.331  95.552  67.793  1.00 50.79  ? 65  SER D CA    1 
ATOM 3721  C C     . SER D 1 66  ? 49.013  96.729  67.163  1.00 49.02  ? 65  SER D C     1 
ATOM 3722  O O     . SER D 1 66  ? 48.700  97.113  66.052  1.00 48.12  ? 65  SER D O     1 
ATOM 3723  C CB    . SER D 1 66  ? 47.349  96.049  68.843  1.00 51.69  ? 65  SER D CB    1 
ATOM 3724  O OG    . SER D 1 66  ? 46.666  97.208  68.408  1.00 50.91  ? 65  SER D OG    1 
ATOM 3725  N N     . ASN D 1 67  ? 49.950  97.315  67.888  1.00 48.67  ? 66  ASN D N     1 
ATOM 3726  C CA    . ASN D 1 67  ? 50.635  98.495  67.399  1.00 47.15  ? 66  ASN D CA    1 
ATOM 3727  C C     . ASN D 1 67  ? 51.473  98.255  66.172  1.00 46.09  ? 66  ASN D C     1 
ATOM 3728  O O     . ASN D 1 67  ? 51.421  99.008  65.224  1.00 44.87  ? 66  ASN D O     1 
ATOM 3729  C CB    . ASN D 1 67  ? 51.525  99.055  68.489  1.00 47.39  ? 66  ASN D CB    1 
ATOM 3730  C CG    . ASN D 1 67  ? 51.233  100.499 68.781  1.00 46.86  ? 66  ASN D CG    1 
ATOM 3731  O OD1   . ASN D 1 67  ? 50.184  100.829 69.321  1.00 47.53  ? 66  ASN D OD1   1 
ATOM 3732  N ND2   . ASN D 1 67  ? 52.157  101.370 68.423  1.00 45.79  ? 66  ASN D ND2   1 
ATOM 3733  N N     . LEU D 1 68  ? 52.233  97.181  66.185  1.00 46.71  ? 67  LEU D N     1 
ATOM 3734  C CA    . LEU D 1 68  ? 53.083  96.877  65.063  1.00 45.96  ? 67  LEU D CA    1 
ATOM 3735  C C     . LEU D 1 68  ? 52.256  96.600  63.838  1.00 45.65  ? 67  LEU D C     1 
ATOM 3736  O O     . LEU D 1 68  ? 52.593  97.034  62.755  1.00 44.54  ? 67  LEU D O     1 
ATOM 3737  C CB    . LEU D 1 68  ? 53.962  95.680  65.367  1.00 47.07  ? 67  LEU D CB    1 
ATOM 3738  C CG    . LEU D 1 68  ? 54.908  95.295  64.239  1.00 46.57  ? 67  LEU D CG    1 
ATOM 3739  C CD1   . LEU D 1 68  ? 56.351  95.440  64.677  1.00 46.68  ? 67  LEU D CD1   1 
ATOM 3740  C CD2   . LEU D 1 68  ? 54.641  93.872  63.798  1.00 47.77  ? 67  LEU D CD2   1 
ATOM 3741  N N     . LEU D 1 69  ? 51.165  95.871  64.008  1.00 46.80  ? 68  LEU D N     1 
ATOM 3742  C CA    . LEU D 1 69  ? 50.324  95.500  62.863  1.00 46.94  ? 68  LEU D CA    1 
ATOM 3743  C C     . LEU D 1 69  ? 49.620  96.717  62.336  1.00 45.91  ? 68  LEU D C     1 
ATOM 3744  O O     . LEU D 1 69  ? 49.475  96.910  61.126  1.00 45.31  ? 68  LEU D O     1 
ATOM 3745  C CB    . LEU D 1 69  ? 49.279  94.468  63.234  1.00 48.68  ? 68  LEU D CB    1 
ATOM 3746  C CG    . LEU D 1 69  ? 49.802  93.060  63.449  1.00 49.98  ? 68  LEU D CG    1 
ATOM 3747  C CD1   . LEU D 1 69  ? 48.622  92.111  63.697  1.00 51.78  ? 68  LEU D CD1   1 
ATOM 3748  C CD2   . LEU D 1 69  ? 50.663  92.615  62.283  1.00 49.58  ? 68  LEU D CD2   1 
ATOM 3749  N N     . ARG D 1 70  ? 49.194  97.552  63.264  1.00 45.86  ? 69  ARG D N     1 
ATOM 3750  C CA    . ARG D 1 70  ? 48.567  98.799  62.898  1.00 45.04  ? 69  ARG D CA    1 
ATOM 3751  C C     . ARG D 1 70  ? 49.501  99.656  62.044  1.00 43.38  ? 69  ARG D C     1 
ATOM 3752  O O     . ARG D 1 70  ? 49.064  100.408 61.189  1.00 42.67  ? 69  ARG D O     1 
ATOM 3753  C CB    . ARG D 1 70  ? 48.147  99.536  64.162  1.00 45.44  ? 69  ARG D CB    1 
ATOM 3754  C CG    . ARG D 1 70  ? 47.774  100.974 63.922  1.00 44.57  ? 69  ARG D CG    1 
ATOM 3755  C CD    . ARG D 1 70  ? 48.868  101.851 64.399  1.00 43.64  ? 69  ARG D CD    1 
ATOM 3756  N NE    . ARG D 1 70  ? 48.524  102.440 65.673  1.00 44.41  ? 69  ARG D NE    1 
ATOM 3757  C CZ    . ARG D 1 70  ? 49.366  103.127 66.430  1.00 44.19  ? 69  ARG D CZ    1 
ATOM 3758  N NH1   . ARG D 1 70  ? 50.630  103.321 66.026  1.00 43.18  ? 69  ARG D NH1   1 
ATOM 3759  N NH2   . ARG D 1 70  ? 48.932  103.617 67.594  1.00 45.18  ? 69  ARG D NH2   1 
ATOM 3760  N N     . ASN D 1 71  ? 50.792  99.525  62.296  1.00 42.92  ? 70  ASN D N     1 
ATOM 3761  C CA    . ASN D 1 71  ? 51.821  100.220 61.560  1.00 41.55  ? 70  ASN D CA    1 
ATOM 3762  C C     . ASN D 1 71  ? 51.985  99.671  60.162  1.00 41.22  ? 70  ASN D C     1 
ATOM 3763  O O     . ASN D 1 71  ? 51.965  100.420 59.200  1.00 40.21  ? 70  ASN D O     1 
ATOM 3764  C CB    . ASN D 1 71  ? 53.136  100.063 62.296  1.00 41.62  ? 70  ASN D CB    1 
ATOM 3765  C CG    . ASN D 1 71  ? 53.342  101.126 63.334  1.00 41.49  ? 70  ASN D CG    1 
ATOM 3766  O OD1   . ASN D 1 71  ? 52.478  101.977 63.535  1.00 41.33  ? 70  ASN D OD1   1 
ATOM 3767  N ND2   . ASN D 1 71  ? 54.493  101.095 64.003  1.00 41.75  ? 70  ASN D ND2   1 
ATOM 3768  N N     . LEU D 1 72  ? 52.152  98.352  60.063  1.00 42.22  ? 71  LEU D N     1 
ATOM 3769  C CA    . LEU D 1 72  ? 52.278  97.674  58.781  1.00 42.31  ? 71  LEU D CA    1 
ATOM 3770  C C     . LEU D 1 72  ? 51.052  97.925  57.974  1.00 42.42  ? 71  LEU D C     1 
ATOM 3771  O O     . LEU D 1 72  ? 51.096  97.914  56.757  1.00 42.11  ? 71  LEU D O     1 
ATOM 3772  C CB    . LEU D 1 72  ? 52.435  96.175  58.954  1.00 43.78  ? 71  LEU D CB    1 
ATOM 3773  C CG    . LEU D 1 72  ? 53.734  95.749  59.626  1.00 44.01  ? 71  LEU D CG    1 
ATOM 3774  C CD1   . LEU D 1 72  ? 53.663  94.308  60.148  1.00 45.77  ? 71  LEU D CD1   1 
ATOM 3775  C CD2   . LEU D 1 72  ? 54.914  95.936  58.682  1.00 43.17  ? 71  LEU D CD2   1 
ATOM 3776  N N     . GLU D 1 73  ? 49.938  98.148  58.646  1.00 46.87  ? 72  GLU D N     1 
ATOM 3777  C CA    . GLU D 1 73  ? 48.716  98.417  57.923  1.00 47.25  ? 72  GLU D CA    1 
ATOM 3778  C C     . GLU D 1 73  ? 48.706  99.847  57.366  1.00 45.87  ? 72  GLU D C     1 
ATOM 3779  O O     . GLU D 1 73  ? 48.244  100.078 56.250  1.00 45.81  ? 72  GLU D O     1 
ATOM 3780  C CB    . GLU D 1 73  ? 47.520  98.146  58.811  1.00 48.63  ? 72  GLU D CB    1 
ATOM 3781  C CG    . GLU D 1 73  ? 46.210  98.260  58.119  1.00 49.51  ? 72  GLU D CG    1 
ATOM 3782  C CD    . GLU D 1 73  ? 45.072  98.203  59.099  1.00 50.85  ? 72  GLU D CD    1 
ATOM 3783  O OE1   . GLU D 1 73  ? 45.199  98.840  60.178  1.00 50.68  ? 72  GLU D OE1   1 
ATOM 3784  O OE2   . GLU D 1 73  ? 44.064  97.506  58.809  1.00 52.47  ? 72  GLU D OE2   1 
ATOM 3785  N N     . ARG D 1 74  ? 49.239  100.800 58.122  1.00 58.95  ? 73  ARG D N     1 
ATOM 3786  C CA    . ARG D 1 74  ? 49.315  102.175 57.638  1.00 57.64  ? 73  ARG D CA    1 
ATOM 3787  C C     . ARG D 1 74  ? 50.134  102.248 56.360  1.00 56.66  ? 73  ARG D C     1 
ATOM 3788  O O     . ARG D 1 74  ? 49.836  103.032 55.474  1.00 56.09  ? 73  ARG D O     1 
ATOM 3789  C CB    . ARG D 1 74  ? 49.901  103.093 58.706  1.00 57.22  ? 73  ARG D CB    1 
ATOM 3790  C CG    . ARG D 1 74  ? 48.918  103.404 59.801  1.00 58.14  ? 73  ARG D CG    1 
ATOM 3791  C CD    . ARG D 1 74  ? 49.552  104.030 61.043  1.00 57.99  ? 73  ARG D CD    1 
ATOM 3792  N NE    . ARG D 1 74  ? 48.537  104.213 62.100  1.00 59.13  ? 73  ARG D NE    1 
ATOM 3793  C CZ    . ARG D 1 74  ? 48.759  104.757 63.300  1.00 59.48  ? 73  ARG D CZ    1 
ATOM 3794  N NH1   . ARG D 1 74  ? 49.979  105.157 63.648  1.00 58.84  ? 73  ARG D NH1   1 
ATOM 3795  N NH2   . ARG D 1 74  ? 47.759  104.868 64.169  1.00 60.68  ? 73  ARG D NH2   1 
ATOM 3796  N N     . LYS D 1 75  ? 51.153  101.394 56.290  1.00 46.06  ? 74  LYS D N     1 
ATOM 3797  C CA    . LYS D 1 75  ? 52.057  101.241 55.155  1.00 45.39  ? 74  LYS D CA    1 
ATOM 3798  C C     . LYS D 1 75  ? 51.404  100.410 54.076  1.00 46.32  ? 74  LYS D C     1 
ATOM 3799  O O     . LYS D 1 75  ? 52.002  100.184 53.030  1.00 46.07  ? 74  LYS D O     1 
ATOM 3800  C CB    . LYS D 1 75  ? 53.312  100.479 55.586  1.00 45.50  ? 74  LYS D CB    1 
ATOM 3801  C CG    . LYS D 1 75  ? 54.160  101.142 56.664  1.00 44.92  ? 74  LYS D CG    1 
ATOM 3802  C CD    . LYS D 1 75  ? 55.256  102.013 56.046  1.00 43.78  ? 74  LYS D CD    1 
ATOM 3803  C CE    . LYS D 1 75  ? 56.416  102.214 57.005  1.00 43.62  ? 74  LYS D CE    1 
ATOM 3804  N NZ    . LYS D 1 75  ? 57.095  100.927 57.335  1.00 44.66  ? 74  LYS D NZ    1 
ATOM 3805  N N     . LYS D 1 76  ? 50.197  99.923  54.356  1.00 40.41  ? 75  LYS D N     1 
ATOM 3806  C CA    . LYS D 1 76  ? 49.449  99.050  53.446  1.00 41.74  ? 75  LYS D CA    1 
ATOM 3807  C C     . LYS D 1 76  ? 50.159  97.742  53.062  1.00 42.56  ? 75  LYS D C     1 
ATOM 3808  O O     . LYS D 1 76  ? 49.794  97.103  52.086  1.00 43.59  ? 75  LYS D O     1 
ATOM 3809  C CB    . LYS D 1 76  ? 48.967  99.807  52.193  1.00 41.41  ? 75  LYS D CB    1 
ATOM 3810  C CG    . LYS D 1 76  ? 47.928  100.882 52.479  1.00 41.30  ? 75  LYS D CG    1 
ATOM 3811  C CD    . LYS D 1 76  ? 46.795  100.874 51.461  1.00 42.49  ? 75  LYS D CD    1 
ATOM 3812  C CE    . LYS D 1 76  ? 45.830  102.060 51.616  1.00 42.45  ? 75  LYS D CE    1 
ATOM 3813  N NZ    . LYS D 1 76  ? 44.927  102.279 50.418  1.00 43.48  ? 75  LYS D NZ    1 
ATOM 3814  N N     . LEU D 1 77  ? 51.149  97.339  53.843  1.00 42.33  ? 76  LEU D N     1 
ATOM 3815  C CA    . LEU D 1 77  ? 51.831  96.082  53.610  1.00 43.32  ? 76  LEU D CA    1 
ATOM 3816  C C     . LEU D 1 77  ? 51.019  94.874  54.080  1.00 45.22  ? 76  LEU D C     1 
ATOM 3817  O O     . LEU D 1 77  ? 51.383  93.734  53.799  1.00 46.42  ? 76  LEU D O     1 
ATOM 3818  C CB    . LEU D 1 77  ? 53.162  96.081  54.350  1.00 42.67  ? 76  LEU D CB    1 
ATOM 3819  C CG    . LEU D 1 77  ? 54.188  97.154  53.990  1.00 41.02  ? 76  LEU D CG    1 
ATOM 3820  C CD1   . LEU D 1 77  ? 55.218  97.264  55.084  1.00 40.73  ? 76  LEU D CD1   1 
ATOM 3821  C CD2   . LEU D 1 77  ? 54.851  96.825  52.651  1.00 41.05  ? 76  LEU D CD2   1 
ATOM 3822  N N     . ILE D 1 78  ? 49.948  95.106  54.835  1.00 45.65  ? 77  ILE D N     1 
ATOM 3823  C CA    . ILE D 1 78  ? 49.055  94.032  55.264  1.00 47.57  ? 77  ILE D CA    1 
ATOM 3824  C C     . ILE D 1 78  ? 47.641  94.539  55.213  1.00 48.10  ? 77  ILE D C     1 
ATOM 3825  O O     . ILE D 1 78  ? 47.409  95.741  55.030  1.00 46.92  ? 77  ILE D O     1 
ATOM 3826  C CB    . ILE D 1 78  ? 49.295  93.590  56.714  1.00 47.98  ? 77  ILE D CB    1 
ATOM 3827  C CG1   . ILE D 1 78  ? 49.127  94.766  57.670  1.00 46.82  ? 77  ILE D CG1   1 
ATOM 3828  C CG2   . ILE D 1 78  ? 50.653  92.924  56.898  1.00 47.94  ? 77  ILE D CG2   1 
ATOM 3829  C CD1   . ILE D 1 78  ? 49.332  94.360  59.098  1.00 47.39  ? 77  ILE D CD1   1 
ATOM 3830  N N     . TYR D 1 79  ? 46.693  93.622  55.372  1.00 73.85  ? 78  TYR D N     1 
ATOM 3831  C CA    . TYR D 1 79  ? 45.279  93.975  55.423  1.00 74.44  ? 78  TYR D CA    1 
ATOM 3832  C C     . TYR D 1 79  ? 44.739  93.209  56.591  1.00 75.98  ? 78  TYR D C     1 
ATOM 3833  O O     . TYR D 1 79  ? 45.202  92.104  56.860  1.00 77.24  ? 78  TYR D O     1 
ATOM 3834  C CB    . TYR D 1 79  ? 44.540  93.569  54.134  1.00 75.88  ? 78  TYR D CB    1 
ATOM 3835  C CG    . TYR D 1 79  ? 44.405  92.070  53.954  1.00 78.32  ? 78  TYR D CG    1 
ATOM 3836  C CD1   . TYR D 1 79  ? 45.514  91.284  53.652  1.00 78.20  ? 78  TYR D CD1   1 
ATOM 3837  C CD2   . TYR D 1 79  ? 43.173  91.439  54.094  1.00 80.79  ? 78  TYR D CD2   1 
ATOM 3838  C CE1   . TYR D 1 79  ? 45.404  89.916  53.504  1.00 80.65  ? 78  TYR D CE1   1 
ATOM 3839  C CE2   . TYR D 1 79  ? 43.057  90.067  53.948  1.00 83.21  ? 78  TYR D CE2   1 
ATOM 3840  C CZ    . TYR D 1 79  ? 44.179  89.314  53.659  1.00 83.15  ? 78  TYR D CZ    1 
ATOM 3841  O OH    . TYR D 1 79  ? 44.077  87.952  53.510  1.00 85.52  ? 78  TYR D OH    1 
ATOM 3842  N N     . ARG D 1 80  ? 43.780  93.790  57.302  1.00 69.47  ? 79  ARG D N     1 
ATOM 3843  C CA    . ARG D 1 80  ? 43.179  93.100  58.442  1.00 71.11  ? 79  ARG D CA    1 
ATOM 3844  C C     . ARG D 1 80  ? 41.672  93.123  58.339  1.00 72.98  ? 79  ARG D C     1 
ATOM 3845  O O     . ARG D 1 80  ? 41.053  94.186  58.327  1.00 72.88  ? 79  ARG D O     1 
ATOM 3846  C CB    . ARG D 1 80  ? 43.630  93.720  59.768  1.00 70.72  ? 79  ARG D CB    1 
ATOM 3847  C CG    . ARG D 1 80  ? 45.126  93.617  59.993  1.00 69.24  ? 79  ARG D CG    1 
ATOM 3848  C CD    . ARG D 1 80  ? 45.743  94.921  60.455  1.00 66.77  ? 79  ARG D CD    1 
ATOM 3849  N NE    . ARG D 1 80  ? 45.743  95.076  61.907  1.00 67.04  ? 79  ARG D NE    1 
ATOM 3850  C CZ    . ARG D 1 80  ? 45.062  96.017  62.546  1.00 66.90  ? 79  ARG D CZ    1 
ATOM 3851  N NH1   . ARG D 1 80  ? 44.316  96.883  61.860  1.00 66.50  ? 79  ARG D NH1   1 
ATOM 3852  N NH2   . ARG D 1 80  ? 45.128  96.091  63.867  1.00 67.51  ? 79  ARG D NH2   1 
ATOM 3853  N N     . TYR D 1 81  ? 41.071  91.950  58.246  1.00 88.52  ? 80  TYR D N     1 
ATOM 3854  C CA    . TYR D 1 81  ? 39.624  91.908  58.184  1.00 90.63  ? 80  TYR D CA    1 
ATOM 3855  C C     . TYR D 1 81  ? 39.053  91.073  59.312  1.00 92.52  ? 80  TYR D C     1 
ATOM 3856  O O     . TYR D 1 81  ? 39.664  90.103  59.773  1.00 92.95  ? 80  TYR D O     1 
ATOM 3857  C CB    . TYR D 1 81  ? 39.116  91.437  56.809  1.00 92.23  ? 80  TYR D CB    1 
ATOM 3858  C CG    . TYR D 1 81  ? 39.331  89.968  56.518  1.00 94.09  ? 80  TYR D CG    1 
ATOM 3859  C CD1   . TYR D 1 81  ? 38.442  89.003  56.996  1.00 96.71  ? 80  TYR D CD1   1 
ATOM 3860  C CD2   . TYR D 1 81  ? 40.409  89.541  55.749  1.00 93.15  ? 80  TYR D CD2   1 
ATOM 3861  C CE1   . TYR D 1 81  ? 38.633  87.654  56.737  1.00 98.67  ? 80  TYR D CE1   1 
ATOM 3862  C CE2   . TYR D 1 81  ? 40.606  88.187  55.476  1.00 95.09  ? 80  TYR D CE2   1 
ATOM 3863  C CZ    . TYR D 1 81  ? 39.712  87.248  55.977  1.00 97.85  ? 80  TYR D CZ    1 
ATOM 3864  O OH    . TYR D 1 81  ? 39.889  85.903  55.719  1.00 100.09 ? 80  TYR D OH    1 
ATOM 3865  N N     . VAL D 1 82  ? 37.871  91.489  59.749  1.00 84.01  ? 81  VAL D N     1 
ATOM 3866  C CA    . VAL D 1 82  ? 37.105  90.792  60.762  1.00 86.02  ? 81  VAL D CA    1 
ATOM 3867  C C     . VAL D 1 82  ? 36.713  89.392  60.285  1.00 88.50  ? 81  VAL D C     1 
ATOM 3868  O O     . VAL D 1 82  ? 35.958  89.237  59.319  1.00 90.28  ? 81  VAL D O     1 
ATOM 3869  C CB    . VAL D 1 82  ? 35.826  91.585  61.095  1.00 87.15  ? 81  VAL D CB    1 
ATOM 3870  C CG1   . VAL D 1 82  ? 34.950  90.803  62.045  1.00 89.55  ? 81  VAL D CG1   1 
ATOM 3871  C CG2   . VAL D 1 82  ? 36.173  92.957  61.663  1.00 85.00  ? 81  VAL D CG2   1 
ATOM 3872  N N     . ASP D 1 83  ? 37.240  88.375  60.957  1.00 92.30  ? 82  ASP D N     1 
ATOM 3873  C CA    . ASP D 1 83  ? 36.799  87.003  60.731  1.00 93.87  ? 82  ASP D CA    1 
ATOM 3874  C C     . ASP D 1 83  ? 35.287  86.902  60.938  1.00 95.20  ? 82  ASP D C     1 
ATOM 3875  O O     . ASP D 1 83  ? 34.788  87.161  62.032  1.00 95.25  ? 82  ASP D O     1 
ATOM 3876  C CB    . ASP D 1 83  ? 37.517  86.059  61.695  1.00 93.68  ? 82  ASP D CB    1 
ATOM 3877  C CG    . ASP D 1 83  ? 37.309  84.600  61.348  1.00 95.87  ? 82  ASP D CG    1 
ATOM 3878  O OD1   . ASP D 1 83  ? 36.387  84.286  60.566  1.00 97.37  ? 82  ASP D OD1   1 
ATOM 3879  O OD2   . ASP D 1 83  ? 38.075  83.762  61.863  1.00 96.05  ? 82  ASP D OD2   1 
ATOM 3880  N N     . ALA D 1 84  ? 34.567  86.526  59.883  1.00 88.61  ? 83  ALA D N     1 
ATOM 3881  C CA    . ALA D 1 84  ? 33.107  86.406  59.943  1.00 90.10  ? 83  ALA D CA    1 
ATOM 3882  C C     . ALA D 1 84  ? 32.623  85.338  60.933  1.00 91.22  ? 83  ALA D C     1 
ATOM 3883  O O     . ALA D 1 84  ? 31.619  85.531  61.624  1.00 91.99  ? 83  ALA D O     1 
ATOM 3884  C CB    . ALA D 1 84  ? 32.549  86.134  58.563  1.00 91.38  ? 83  ALA D CB    1 
ATOM 3885  N N     . GLN D 1 85  ? 33.339  84.220  61.001  1.00 85.68  ? 84  GLN D N     1 
ATOM 3886  C CA    . GLN D 1 85  ? 32.952  83.110  61.866  1.00 86.73  ? 84  GLN D CA    1 
ATOM 3887  C C     . GLN D 1 85  ? 33.285  83.350  63.349  1.00 85.75  ? 84  GLN D C     1 
ATOM 3888  O O     . GLN D 1 85  ? 32.760  82.669  64.226  1.00 86.57  ? 84  GLN D O     1 
ATOM 3889  C CB    . GLN D 1 85  ? 33.575  81.803  61.368  1.00 87.61  ? 84  GLN D CB    1 
ATOM 3890  N N     . ASP D 1 86  ? 34.165  84.315  63.610  1.00 78.94  ? 85  ASP D N     1 
ATOM 3891  C CA    . ASP D 1 86  ? 34.434  84.831  64.960  1.00 78.08  ? 85  ASP D CA    1 
ATOM 3892  C C     . ASP D 1 86  ? 34.877  86.300  64.843  1.00 76.70  ? 85  ASP D C     1 
ATOM 3893  O O     . ASP D 1 86  ? 36.041  86.589  64.534  1.00 75.66  ? 85  ASP D O     1 
ATOM 3894  C CB    . ASP D 1 86  ? 35.520  84.014  65.670  1.00 77.79  ? 85  ASP D CB    1 
ATOM 3895  C CG    . ASP D 1 86  ? 35.739  84.454  67.120  1.00 77.20  ? 85  ASP D CG    1 
ATOM 3896  O OD1   . ASP D 1 86  ? 35.230  85.530  67.496  1.00 76.93  ? 85  ASP D OD1   1 
ATOM 3897  O OD2   . ASP D 1 86  ? 36.411  83.725  67.890  1.00 77.29  ? 85  ASP D OD2   1 
ATOM 3898  N N     . THR D 1 87  ? 33.954  87.226  65.098  1.00 69.72  ? 86  THR D N     1 
ATOM 3899  C CA    . THR D 1 87  ? 34.225  88.646  64.866  1.00 68.75  ? 86  THR D CA    1 
ATOM 3900  C C     . THR D 1 87  ? 35.078  89.305  65.972  1.00 67.80  ? 86  THR D C     1 
ATOM 3901  O O     . THR D 1 87  ? 35.439  90.486  65.884  1.00 67.06  ? 86  THR D O     1 
ATOM 3902  C CB    . THR D 1 87  ? 32.920  89.418  64.602  1.00 69.56  ? 86  THR D CB    1 
ATOM 3903  O OG1   . THR D 1 87  ? 32.285  89.742  65.839  1.00 70.03  ? 86  THR D OG1   1 
ATOM 3904  C CG2   . THR D 1 87  ? 32.003  88.563  63.798  1.00 70.91  ? 86  THR D CG2   1 
ATOM 3905  N N     . ARG D 1 88  ? 35.412  88.531  66.997  1.00 105.73 ? 87  ARG D N     1 
ATOM 3906  C CA    . ARG D 1 88  ? 36.288  89.028  68.048  1.00 105.04 ? 87  ARG D CA    1 
ATOM 3907  C C     . ARG D 1 88  ? 37.690  89.222  67.501  1.00 103.99 ? 87  ARG D C     1 
ATOM 3908  O O     . ARG D 1 88  ? 38.450  90.062  67.986  1.00 103.38 ? 87  ARG D O     1 
ATOM 3909  C CB    . ARG D 1 88  ? 36.344  88.057  69.231  1.00 104.90 ? 87  ARG D CB    1 
ATOM 3910  C CG    . ARG D 1 88  ? 35.053  87.911  70.005  1.00 105.93 ? 87  ARG D CG    1 
ATOM 3911  C CD    . ARG D 1 88  ? 35.223  86.897  71.117  1.00 106.44 ? 87  ARG D CD    1 
ATOM 3912  N NE    . ARG D 1 88  ? 35.855  85.681  70.620  1.00 106.51 ? 87  ARG D NE    1 
ATOM 3913  C CZ    . ARG D 1 88  ? 36.524  84.824  71.378  1.00 106.72 ? 87  ARG D CZ    1 
ATOM 3914  N NH1   . ARG D 1 88  ? 36.655  85.048  72.678  1.00 106.82 ? 87  ARG D NH1   1 
ATOM 3915  N NH2   . ARG D 1 88  ? 37.068  83.748  70.832  1.00 106.99 ? 87  ARG D NH2   1 
ATOM 3916  N N     . ARG D 1 89  ? 38.034  88.430  66.495  1.00 84.24  ? 88  ARG D N     1 
ATOM 3917  C CA    . ARG D 1 89  ? 39.390  88.442  65.986  1.00 83.48  ? 88  ARG D CA    1 
ATOM 3918  C C     . ARG D 1 89  ? 39.468  89.122  64.635  1.00 82.80  ? 88  ARG D C     1 
ATOM 3919  O O     . ARG D 1 89  ? 38.499  89.158  63.879  1.00 83.29  ? 88  ARG D O     1 
ATOM 3920  C CB    . ARG D 1 89  ? 39.939  87.021  65.891  1.00 83.98  ? 88  ARG D CB    1 
ATOM 3921  C CG    . ARG D 1 89  ? 39.068  86.098  65.086  1.00 84.98  ? 88  ARG D CG    1 
ATOM 3922  C CD    . ARG D 1 89  ? 39.627  84.687  65.007  1.00 85.93  ? 88  ARG D CD    1 
ATOM 3923  N NE    . ARG D 1 89  ? 39.512  83.959  66.269  1.00 86.56  ? 88  ARG D NE    1 
ATOM 3924  C CZ    . ARG D 1 89  ? 39.671  82.642  66.385  1.00 87.58  ? 88  ARG D CZ    1 
ATOM 3925  N NH1   . ARG D 1 89  ? 39.947  81.915  65.308  1.00 88.33  ? 88  ARG D NH1   1 
ATOM 3926  N NH2   . ARG D 1 89  ? 39.548  82.052  67.569  1.00 87.81  ? 88  ARG D NH2   1 
ATOM 3927  N N     . LYS D 1 90  ? 40.630  89.686  64.345  1.00 61.04  ? 89  LYS D N     1 
ATOM 3928  C CA    . LYS D 1 90  ? 40.885  90.221  63.031  1.00 59.38  ? 89  LYS D CA    1 
ATOM 3929  C C     . LYS D 1 90  ? 41.795  89.225  62.327  1.00 59.36  ? 89  LYS D C     1 
ATOM 3930  O O     . LYS D 1 90  ? 42.573  88.517  62.976  1.00 59.72  ? 89  LYS D O     1 
ATOM 3931  C CB    . LYS D 1 90  ? 41.495  91.621  63.121  1.00 56.69  ? 89  LYS D CB    1 
ATOM 3932  C CG    . LYS D 1 90  ? 40.554  92.627  63.767  1.00 56.85  ? 89  LYS D CG    1 
ATOM 3933  C CD    . LYS D 1 90  ? 40.949  94.097  63.511  1.00 54.43  ? 89  LYS D CD    1 
ATOM 3934  C CE    . LYS D 1 90  ? 40.337  95.014  64.592  1.00 54.52  ? 89  LYS D CE    1 
ATOM 3935  N NZ    . LYS D 1 90  ? 39.800  96.327  64.131  1.00 53.70  ? 89  LYS D NZ    1 
ATOM 3936  N N     . ASN D 1 91  ? 41.657  89.142  61.005  1.00 84.70  ? 90  ASN D N     1 
ATOM 3937  C CA    . ASN D 1 91  ? 42.480  88.245  60.201  1.00 84.63  ? 90  ASN D CA    1 
ATOM 3938  C C     . ASN D 1 91  ? 43.597  88.978  59.470  1.00 82.07  ? 90  ASN D C     1 
ATOM 3939  O O     . ASN D 1 91  ? 43.366  89.980  58.789  1.00 81.27  ? 90  ASN D O     1 
ATOM 3940  C CB    . ASN D 1 91  ? 41.623  87.454  59.211  1.00 86.67  ? 90  ASN D CB    1 
ATOM 3941  C CG    . ASN D 1 91  ? 41.139  86.125  59.781  1.00 89.54  ? 90  ASN D CG    1 
ATOM 3942  O OD1   . ASN D 1 91  ? 41.437  85.766  60.930  1.00 90.18  ? 90  ASN D OD1   1 
ATOM 3943  N ND2   . ASN D 1 91  ? 40.382  85.390  58.977  1.00 91.49  ? 90  ASN D ND2   1 
ATOM 3944  N N     . ILE D 1 92  ? 44.813  88.467  59.623  1.00 68.09  ? 91  ILE D N     1 
ATOM 3945  C CA    . ILE D 1 92  ? 45.992  89.112  59.061  1.00 65.98  ? 91  ILE D CA    1 
ATOM 3946  C C     . ILE D 1 92  ? 46.518  88.379  57.847  1.00 66.38  ? 91  ILE D C     1 
ATOM 3947  O O     . ILE D 1 92  ? 46.525  87.144  57.787  1.00 68.22  ? 91  ILE D O     1 
ATOM 3948  C CB    . ILE D 1 92  ? 47.152  89.150  60.056  1.00 65.11  ? 91  ILE D CB    1 
ATOM 3949  C CG1   . ILE D 1 92  ? 46.649  89.459  61.464  1.00 65.68  ? 91  ILE D CG1   1 
ATOM 3950  C CG2   . ILE D 1 92  ? 48.192  90.142  59.599  1.00 62.79  ? 91  ILE D CG2   1 
ATOM 3951  C CD1   . ILE D 1 92  ? 45.926  90.772  61.589  1.00 64.36  ? 91  ILE D CD1   1 
ATOM 3952  N N     . GLY D 1 93  ? 46.977  89.161  56.885  1.00 69.69  ? 92  GLY D N     1 
ATOM 3953  C CA    . GLY D 1 93  ? 47.659  88.633  55.727  1.00 69.43  ? 92  GLY D CA    1 
ATOM 3954  C C     . GLY D 1 93  ? 48.431  89.723  55.013  1.00 67.38  ? 92  GLY D C     1 
ATOM 3955  O O     . GLY D 1 93  ? 48.155  90.923  55.162  1.00 66.47  ? 92  GLY D O     1 
ATOM 3956  N N     . LEU D 1 94  ? 49.415  89.290  54.239  1.00 50.28  ? 93  LEU D N     1 
ATOM 3957  C CA    . LEU D 1 94  ? 50.165  90.180  53.375  1.00 48.75  ? 93  LEU D CA    1 
ATOM 3958  C C     . LEU D 1 94  ? 49.281  90.778  52.267  1.00 48.65  ? 93  LEU D C     1 
ATOM 3959  O O     . LEU D 1 94  ? 48.371  90.121  51.741  1.00 50.02  ? 93  LEU D O     1 
ATOM 3960  C CB    . LEU D 1 94  ? 51.317  89.405  52.739  1.00 49.05  ? 93  LEU D CB    1 
ATOM 3961  C CG    . LEU D 1 94  ? 52.435  88.968  53.673  1.00 49.13  ? 93  LEU D CG    1 
ATOM 3962  C CD1   . LEU D 1 94  ? 53.431  88.089  52.959  1.00 49.87  ? 93  LEU D CD1   1 
ATOM 3963  C CD2   . LEU D 1 94  ? 53.109  90.203  54.222  1.00 47.45  ? 93  LEU D CD2   1 
ATOM 3964  N N     . THR D 1 95  ? 49.544  92.033  51.922  1.00 47.22  ? 94  THR D N     1 
ATOM 3965  C CA    . THR D 1 95  ? 48.995  92.579  50.706  1.00 47.23  ? 94  THR D CA    1 
ATOM 3966  C C     . THR D 1 95  ? 49.980  92.168  49.635  1.00 47.19  ? 94  THR D C     1 
ATOM 3967  O O     . THR D 1 95  ? 51.010  91.562  49.932  1.00 47.14  ? 94  THR D O     1 
ATOM 3968  C CB    . THR D 1 95  ? 48.894  94.096  50.744  1.00 45.97  ? 94  THR D CB    1 
ATOM 3969  O OG1   . THR D 1 95  ? 50.182  94.636  51.028  1.00 44.68  ? 94  THR D OG1   1 
ATOM 3970  C CG2   . THR D 1 95  ? 47.918  94.539  51.812  1.00 46.09  ? 94  THR D CG2   1 
ATOM 3971  N N     . THR D 1 96  ? 49.663  92.487  48.387  1.00 47.39  ? 95  THR D N     1 
ATOM 3972  C CA    . THR D 1 96  ? 50.558  92.143  47.299  1.00 47.48  ? 95  THR D CA    1 
ATOM 3973  C C     . THR D 1 96  ? 51.911  92.857  47.460  1.00 46.18  ? 95  THR D C     1 
ATOM 3974  O O     . THR D 1 96  ? 52.981  92.263  47.267  1.00 46.33  ? 95  THR D O     1 
ATOM 3975  C CB    . THR D 1 96  ? 49.927  92.462  45.941  1.00 48.02  ? 95  THR D CB    1 
ATOM 3976  O OG1   . THR D 1 96  ? 50.948  92.413  44.944  1.00 47.88  ? 95  THR D OG1   1 
ATOM 3977  N N     . SER D 1 97  ? 51.855  94.127  47.852  1.00 45.10  ? 96  SER D N     1 
ATOM 3978  C CA    . SER D 1 97  ? 53.064  94.913  47.984  1.00 44.05  ? 96  SER D CA    1 
ATOM 3979  C C     . SER D 1 97  ? 53.861  94.387  49.147  1.00 43.84  ? 96  SER D C     1 
ATOM 3980  O O     . SER D 1 97  ? 55.100  94.416  49.127  1.00 43.58  ? 96  SER D O     1 
ATOM 3981  C CB    . SER D 1 97  ? 52.706  96.344  48.247  1.00 43.16  ? 96  SER D CB    1 
ATOM 3982  O OG    . SER D 1 97  ? 51.888  96.388  49.381  1.00 43.05  ? 96  SER D OG    1 
ATOM 3983  N N     . GLY D 1 98  ? 53.126  93.908  50.158  1.00 46.51  ? 97  GLY D N     1 
ATOM 3984  C CA    . GLY D 1 98  ? 53.682  93.262  51.339  1.00 46.67  ? 97  GLY D CA    1 
ATOM 3985  C C     . GLY D 1 98  ? 54.525  92.053  50.994  1.00 47.64  ? 97  GLY D C     1 
ATOM 3986  O O     . GLY D 1 98  ? 55.613  91.881  51.530  1.00 47.58  ? 97  GLY D O     1 
ATOM 3987  N N     . ILE D 1 99  ? 54.027  91.218  50.086  1.00 48.09  ? 98  ILE D N     1 
ATOM 3988  C CA    . ILE D 1 99  ? 54.782  90.055  49.619  1.00 49.18  ? 98  ILE D CA    1 
ATOM 3989  C C     . ILE D 1 99  ? 56.094  90.454  48.945  1.00 48.72  ? 98  ILE D C     1 
ATOM 3990  O O     . ILE D 1 99  ? 57.167  90.007  49.363  1.00 49.09  ? 98  ILE D O     1 
ATOM 3991  C CB    . ILE D 1 99  ? 54.000  89.223  48.590  1.00 50.38  ? 98  ILE D CB    1 
ATOM 3992  C CG1   . ILE D 1 99  ? 52.770  88.587  49.217  1.00 51.36  ? 98  ILE D CG1   1 
ATOM 3993  C CG2   . ILE D 1 99  ? 54.900  88.159  47.997  1.00 51.45  ? 98  ILE D CG2   1 
ATOM 3994  C CD1   . ILE D 1 99  ? 51.883  87.968  48.216  1.00 52.55  ? 98  ILE D CD1   1 
ATOM 3995  N N     . LYS D 1 100 ? 56.027  91.311  47.948  1.00 46.89  ? 99  LYS D N     1 
ATOM 3996  C CA    . LYS D 1 100 ? 57.199  91.572  47.150  1.00 46.84  ? 99  LYS D CA    1 
ATOM 3997  C C     . LYS D 1 100 ? 58.264  92.082  48.088  1.00 46.23  ? 99  LYS D C     1 
ATOM 3998  O O     . LYS D 1 100 ? 59.442  91.785  47.937  1.00 46.73  ? 99  LYS D O     1 
ATOM 3999  C CB    . LYS D 1 100 ? 56.885  92.584  46.060  1.00 46.33  ? 99  LYS D CB    1 
ATOM 4000  C CG    . LYS D 1 100 ? 55.452  92.515  45.567  1.00 46.65  ? 99  LYS D CG    1 
ATOM 4001  C CD    . LYS D 1 100 ? 55.277  93.232  44.241  1.00 46.69  ? 99  LYS D CD    1 
ATOM 4002  C CE    . LYS D 1 100 ? 56.042  92.547  43.125  1.00 47.59  ? 99  LYS D CE    1 
ATOM 4003  N NZ    . LYS D 1 100 ? 55.718  93.132  41.796  1.00 47.90  ? 99  LYS D NZ    1 
ATOM 4004  N N     . LEU D 1 101 ? 57.844  92.847  49.077  1.00 48.98  ? 100 LEU D N     1 
ATOM 4005  C CA    . LEU D 1 101 ? 58.791  93.405  50.002  1.00 48.44  ? 100 LEU D CA    1 
ATOM 4006  C C     . LEU D 1 101 ? 59.501  92.270  50.686  1.00 49.46  ? 100 LEU D C     1 
ATOM 4007  O O     . LEU D 1 101 ? 60.708  92.296  50.862  1.00 49.76  ? 100 LEU D O     1 
ATOM 4008  C CB    . LEU D 1 101 ? 58.040  94.199  51.054  1.00 47.46  ? 100 LEU D CB    1 
ATOM 4009  C CG    . LEU D 1 101 ? 58.820  94.834  52.196  1.00 46.88  ? 100 LEU D CG    1 
ATOM 4010  C CD1   . LEU D 1 101 ? 59.767  95.854  51.611  1.00 46.44  ? 100 LEU D CD1   1 
ATOM 4011  C CD2   . LEU D 1 101 ? 57.886  95.488  53.191  1.00 46.09  ? 100 LEU D CD2   1 
ATOM 4012  N N     . VAL D 1 102 ? 58.752  91.248  51.053  1.00 50.92  ? 101 VAL D N     1 
ATOM 4013  C CA    . VAL D 1 102 ? 59.334  90.151  51.794  1.00 52.13  ? 101 VAL D CA    1 
ATOM 4014  C C     . VAL D 1 102 ? 60.378  89.459  50.957  1.00 53.21  ? 101 VAL D C     1 
ATOM 4015  O O     . VAL D 1 102 ? 61.425  89.073  51.450  1.00 54.17  ? 101 VAL D O     1 
ATOM 4016  C CB    . VAL D 1 102 ? 58.282  89.133  52.228  1.00 53.09  ? 101 VAL D CB    1 
ATOM 4017  C CG1   . VAL D 1 102 ? 58.942  87.952  52.908  1.00 54.66  ? 101 VAL D CG1   1 
ATOM 4018  C CG2   . VAL D 1 102 ? 57.281  89.795  53.150  1.00 52.24  ? 101 VAL D CG2   1 
ATOM 4019  N N     . GLU D 1 103 ? 60.082  89.290  49.682  1.00 50.43  ? 102 GLU D N     1 
ATOM 4020  C CA    . GLU D 1 103 ? 60.996  88.570  48.817  1.00 51.61  ? 102 GLU D CA    1 
ATOM 4021  C C     . GLU D 1 103 ? 62.280  89.362  48.638  1.00 51.30  ? 102 GLU D C     1 
ATOM 4022  O O     . GLU D 1 103 ? 63.384  88.813  48.646  1.00 52.46  ? 102 GLU D O     1 
ATOM 4023  C CB    . GLU D 1 103 ? 60.345  88.317  47.474  1.00 51.86  ? 102 GLU D CB    1 
ATOM 4024  C CG    . GLU D 1 103 ? 58.867  88.099  47.562  1.00 51.74  ? 102 GLU D CG    1 
ATOM 4025  C CD    . GLU D 1 103 ? 58.329  87.343  46.363  1.00 52.72  ? 102 GLU D CD    1 
ATOM 4026  O OE1   . GLU D 1 103 ? 58.288  87.896  45.228  1.00 52.38  ? 102 GLU D OE1   1 
ATOM 4027  O OE2   . GLU D 1 103 ? 57.959  86.167  46.565  1.00 54.02  ? 102 GLU D OE2   1 
ATOM 4028  N N     . ALA D 1 104 ? 62.127  90.671  48.512  1.00 54.60  ? 103 ALA D N     1 
ATOM 4029  C CA    . ALA D 1 104 ? 63.264  91.543  48.328  1.00 54.40  ? 103 ALA D CA    1 
ATOM 4030  C C     . ALA D 1 104 ? 64.103  91.768  49.600  1.00 54.45  ? 103 ALA D C     1 
ATOM 4031  O O     . ALA D 1 104 ? 65.286  92.087  49.495  1.00 54.99  ? 103 ALA D O     1 
ATOM 4032  C CB    . ALA D 1 104 ? 62.797  92.849  47.783  1.00 53.17  ? 103 ALA D CB    1 
ATOM 4033  N N     . PHE D 1 105 ? 63.524  91.628  50.793  1.00 51.24  ? 104 PHE D N     1 
ATOM 4034  C CA    . PHE D 1 105 ? 64.333  91.889  51.991  1.00 51.38  ? 104 PHE D CA    1 
ATOM 4035  C C     . PHE D 1 105 ? 64.825  90.627  52.674  1.00 53.09  ? 104 PHE D C     1 
ATOM 4036  O O     . PHE D 1 105 ? 65.786  90.650  53.449  1.00 55.45  ? 104 PHE D O     1 
ATOM 4037  C CB    . PHE D 1 105 ? 63.659  92.856  53.007  1.00 49.96  ? 104 PHE D CB    1 
ATOM 4038  C CG    . PHE D 1 105 ? 62.500  92.264  53.785  1.00 49.87  ? 104 PHE D CG    1 
ATOM 4039  C CD1   . PHE D 1 105 ? 62.693  91.242  54.712  1.00 51.06  ? 104 PHE D CD1   1 
ATOM 4040  C CD2   . PHE D 1 105 ? 61.225  92.781  53.633  1.00 48.78  ? 104 PHE D CD2   1 
ATOM 4041  C CE1   . PHE D 1 105 ? 61.638  90.720  55.421  1.00 51.19  ? 104 PHE D CE1   1 
ATOM 4042  C CE2   . PHE D 1 105 ? 60.161  92.267  54.348  1.00 48.92  ? 104 PHE D CE2   1 
ATOM 4043  C CZ    . PHE D 1 105 ? 60.368  91.233  55.237  1.00 50.12  ? 104 PHE D CZ    1 
ATOM 4044  N N     . THR D 1 106 ? 64.153  89.525  52.395  1.00 50.02  ? 105 THR D N     1 
ATOM 4045  C CA    . THR D 1 106 ? 64.438  88.301  53.115  1.00 51.69  ? 105 THR D CA    1 
ATOM 4046  C C     . THR D 1 106 ? 65.894  87.873  52.925  1.00 53.27  ? 105 THR D C     1 
ATOM 4047  O O     . THR D 1 106 ? 66.431  87.096  53.718  1.00 54.80  ? 105 THR D O     1 
ATOM 4048  C CB    . THR D 1 106 ? 63.506  87.187  52.694  1.00 52.50  ? 105 THR D CB    1 
ATOM 4049  O OG1   . THR D 1 106 ? 63.973  85.969  53.260  1.00 54.49  ? 105 THR D OG1   1 
ATOM 4050  C CG2   . THR D 1 106 ? 63.541  87.053  51.217  1.00 52.61  ? 105 THR D CG2   1 
ATOM 4051  N N     . SER D 1 107 ? 66.528  88.404  51.885  1.00 77.18  ? 106 SER D N     1 
ATOM 4052  C CA    . SER D 1 107 ? 67.947  88.188  51.673  1.00 80.05  ? 106 SER D CA    1 
ATOM 4053  C C     . SER D 1 107 ? 68.730  88.569  52.918  1.00 83.32  ? 106 SER D C     1 
ATOM 4054  O O     . SER D 1 107 ? 69.479  87.764  53.458  1.00 88.38  ? 106 SER D O     1 
ATOM 4055  C CB    . SER D 1 107 ? 68.427  89.025  50.494  1.00 78.38  ? 106 SER D CB    1 
ATOM 4056  O OG    . SER D 1 107 ? 67.468  88.985  49.452  1.00 76.67  ? 106 SER D OG    1 
ATOM 4057  N N     . ILE D 1 108 ? 68.514  89.795  53.377  1.00 66.42  ? 107 ILE D N     1 
ATOM 4058  C CA    . ILE D 1 108 ? 69.283  90.407  54.458  1.00 69.91  ? 107 ILE D CA    1 
ATOM 4059  C C     . ILE D 1 108 ? 69.400  89.526  55.682  1.00 75.20  ? 107 ILE D C     1 
ATOM 4060  O O     . ILE D 1 108 ? 70.451  89.440  56.314  1.00 80.07  ? 107 ILE D O     1 
ATOM 4061  C CB    . ILE D 1 108 ? 68.613  91.700  54.911  1.00 67.27  ? 107 ILE D CB    1 
ATOM 4062  C CG1   . ILE D 1 108 ? 68.375  92.603  53.715  1.00 62.42  ? 107 ILE D CG1   1 
ATOM 4063  C CG2   . ILE D 1 108 ? 69.463  92.413  55.914  1.00 70.57  ? 107 ILE D CG2   1 
ATOM 4064  C CD1   . ILE D 1 108 ? 67.689  93.873  54.087  1.00 60.02  ? 107 ILE D CD1   1 
ATOM 4065  N N     . PHE D 1 109 ? 68.297  88.877  56.009  1.00 63.50  ? 108 PHE D N     1 
ATOM 4066  C CA    . PHE D 1 109 ? 68.225  88.036  57.179  1.00 66.64  ? 108 PHE D CA    1 
ATOM 4067  C C     . PHE D 1 109 ? 69.072  86.784  57.013  1.00 71.18  ? 108 PHE D C     1 
ATOM 4068  O O     . PHE D 1 109 ? 69.765  86.365  57.947  1.00 76.61  ? 108 PHE D O     1 
ATOM 4069  C CB    . PHE D 1 109 ? 66.768  87.690  57.455  1.00 60.26  ? 108 PHE D CB    1 
ATOM 4070  C CG    . PHE D 1 109 ? 65.981  88.837  58.029  1.00 56.01  ? 108 PHE D CG    1 
ATOM 4071  C CD1   . PHE D 1 109 ? 66.514  89.621  59.028  1.00 58.01  ? 108 PHE D CD1   1 
ATOM 4072  C CD2   . PHE D 1 109 ? 64.722  89.138  57.564  1.00 51.50  ? 108 PHE D CD2   1 
ATOM 4073  C CE1   . PHE D 1 109 ? 65.805  90.657  59.558  1.00 53.70  ? 108 PHE D CE1   1 
ATOM 4074  C CE2   . PHE D 1 109 ? 64.012  90.188  58.094  1.00 49.80  ? 108 PHE D CE2   1 
ATOM 4075  C CZ    . PHE D 1 109 ? 64.556  90.941  59.091  1.00 49.46  ? 108 PHE D CZ    1 
ATOM 4076  N N     . ASP D 1 110 ? 69.028  86.209  55.814  1.00 89.16  ? 109 ASP D N     1 
ATOM 4077  C CA    . ASP D 1 110 ? 69.761  84.990  55.501  1.00 92.69  ? 109 ASP D CA    1 
ATOM 4078  C C     . ASP D 1 110 ? 71.273  85.181  55.545  1.00 97.29  ? 109 ASP D C     1 
ATOM 4079  O O     . ASP D 1 110 ? 71.989  84.364  56.129  1.00 102.13 ? 109 ASP D O     1 
ATOM 4080  C CB    . ASP D 1 110 ? 69.331  84.479  54.134  1.00 88.77  ? 109 ASP D CB    1 
ATOM 4081  C CG    . ASP D 1 110 ? 67.872  84.072  54.108  1.00 84.16  ? 109 ASP D CG    1 
ATOM 4082  O OD1   . ASP D 1 110 ? 67.342  83.734  55.191  1.00 84.38  ? 109 ASP D OD1   1 
ATOM 4083  O OD2   . ASP D 1 110 ? 67.256  84.085  53.015  1.00 80.85  ? 109 ASP D OD2   1 
ATOM 4084  N N     . GLU D 1 111 ? 71.748  86.254  54.916  1.00 61.85  ? 110 GLU D N     1 
ATOM 4085  C CA    . GLU D 1 111 ? 73.161  86.642  54.970  1.00 63.24  ? 110 GLU D CA    1 
ATOM 4086  C C     . GLU D 1 111 ? 73.657  86.781  56.410  1.00 64.10  ? 110 GLU D C     1 
ATOM 4087  O O     . GLU D 1 111 ? 74.673  86.197  56.775  1.00 66.58  ? 110 GLU D O     1 
ATOM 4088  C CB    . GLU D 1 111 ? 73.406  87.956  54.207  1.00 61.70  ? 110 GLU D CB    1 
ATOM 4089  N N     . MET D 1 112 ? 72.935  87.553  57.216  0.38 85.85  ? 111 MET D N     1 
ATOM 4090  C CA    . MET D 1 112 ? 73.315  87.814  58.600  0.90 90.14  ? 111 MET D CA    1 
ATOM 4091  C C     . MET D 1 112 ? 73.480  86.516  59.375  1.00 95.27  ? 111 MET D C     1 
ATOM 4092  O O     . MET D 1 112 ? 74.437  86.334  60.128  0.24 99.44  ? 111 MET D O     1 
ATOM 4093  C CB    . MET D 1 112 ? 72.250  88.681  59.259  1.00 88.21  ? 111 MET D CB    1 
ATOM 4094  C CG    . MET D 1 112 ? 72.772  89.600  60.352  1.00 89.97  ? 111 MET D CG    1 
ATOM 4095  S SD    . MET D 1 112 ? 71.702  91.040  60.605  1.00 85.23  ? 111 MET D SD    1 
ATOM 4096  C CE    . MET D 1 112 ? 70.143  90.205  60.935  1.00 85.42  ? 111 MET D CE    1 
ATOM 4097  N N     . GLU D 1 113 ? 72.527  85.617  59.172  1.00 74.94  ? 112 GLU D N     1 
ATOM 4098  C CA    . GLU D 1 113 ? 72.584  84.263  59.706  1.00 78.28  ? 112 GLU D CA    1 
ATOM 4099  C C     . GLU D 1 113 ? 73.768  83.482  59.145  1.00 80.93  ? 112 GLU D C     1 
ATOM 4100  O O     . GLU D 1 113 ? 74.592  82.962  59.894  1.00 85.45  ? 112 GLU D O     1 
ATOM 4101  C CB    . GLU D 1 113 ? 71.302  83.520  59.357  1.00 73.74  ? 112 GLU D CB    1 
ATOM 4102  C CG    . GLU D 1 113 ? 71.365  82.050  59.650  1.00 75.15  ? 112 GLU D CG    1 
ATOM 4103  C CD    . GLU D 1 113 ? 70.888  81.728  61.041  1.00 74.75  ? 112 GLU D CD    1 
ATOM 4104  O OE1   . GLU D 1 113 ? 70.897  80.528  61.400  1.00 75.27  ? 112 GLU D OE1   1 
ATOM 4105  O OE2   . GLU D 1 113 ? 70.495  82.670  61.772  1.00 73.15  ? 112 GLU D OE2   1 
ATOM 4106  N N     . GLN D 1 114 ? 73.844  83.395  57.820  1.00 95.60  ? 113 GLN D N     1 
ATOM 4107  C CA    . GLN D 1 114 ? 74.917  82.658  57.162  1.00 97.84  ? 113 GLN D CA    1 
ATOM 4108  C C     . GLN D 1 114 ? 76.287  83.287  57.411  1.00 100.64 ? 113 GLN D C     1 
ATOM 4109  O O     . GLN D 1 114 ? 77.313  82.658  57.169  1.00 103.25 ? 113 GLN D O     1 
ATOM 4110  C CB    . GLN D 1 114 ? 74.653  82.535  55.661  1.00 92.65  ? 113 GLN D CB    1 
ATOM 4111  N N     . THR D 1 115 ? 76.303  84.574  57.721  1.00 78.24  ? 114 THR D N     1 
ATOM 4112  C CA    . THR D 1 115 ? 77.529  85.178  58.186  1.00 80.22  ? 114 THR D CA    1 
ATOM 4113  C C     . THR D 1 115 ? 77.951  84.616  59.524  1.00 85.07  ? 114 THR D C     1 
ATOM 4114  O O     . THR D 1 115 ? 79.107  84.281  59.741  1.00 87.80  ? 114 THR D O     1 
ATOM 4115  C CB    . THR D 1 115 ? 77.426  86.701  58.274  1.00 77.14  ? 114 THR D CB    1 
ATOM 4116  O OG1   . THR D 1 115 ? 77.293  87.241  56.959  1.00 72.78  ? 114 THR D OG1   1 
ATOM 4117  C CG2   . THR D 1 115 ? 78.671  87.265  58.903  1.00 79.42  ? 114 THR D CG2   1 
ATOM 4118  N N     . LEU D 1 116 ? 76.986  84.524  60.428  1.00 74.50  ? 115 LEU D N     1 
ATOM 4119  C CA    . LEU D 1 116 ? 77.262  84.029  61.762  1.00 76.55  ? 115 LEU D CA    1 
ATOM 4120  C C     . LEU D 1 116 ? 77.535  82.542  61.827  1.00 79.74  ? 115 LEU D C     1 
ATOM 4121  O O     . LEU D 1 116 ? 78.385  82.075  62.569  1.00 82.64  ? 115 LEU D O     1 
ATOM 4122  C CB    . LEU D 1 116 ? 76.050  84.257  62.657  1.00 75.68  ? 115 LEU D CB    1 
ATOM 4123  C CG    . LEU D 1 116 ? 75.684  85.708  62.925  1.00 73.30  ? 115 LEU D CG    1 
ATOM 4124  C CD1   . LEU D 1 116 ? 74.383  85.773  63.700  1.00 71.97  ? 115 LEU D CD1   1 
ATOM 4125  C CD2   . LEU D 1 116 ? 76.803  86.388  63.687  1.00 75.00  ? 115 LEU D CD2   1 
ATOM 4126  N N     . VAL D 1 117 ? 76.776  81.806  61.035  1.00 79.36  ? 116 VAL D N     1 
ATOM 4127  C CA    . VAL D 1 117 ? 76.919  80.371  60.959  1.00 82.22  ? 116 VAL D CA    1 
ATOM 4128  C C     . VAL D 1 117 ? 78.296  80.065  60.426  1.00 84.97  ? 116 VAL D C     1 
ATOM 4129  O O     . VAL D 1 117 ? 78.878  79.037  60.739  1.00 88.33  ? 116 VAL D O     1 
ATOM 4130  C CB    . VAL D 1 117 ? 75.874  79.748  60.037  1.00 81.09  ? 116 VAL D CB    1 
ATOM 4131  C CG1   . VAL D 1 117 ? 76.147  78.268  59.876  1.00 84.43  ? 116 VAL D CG1   1 
ATOM 4132  C CG2   . VAL D 1 117 ? 74.482  79.980  60.591  1.00 78.75  ? 116 VAL D CG2   1 
ATOM 4133  N N     . SER D 1 118 ? 78.814  80.973  59.615  1.00 112.17 ? 117 SER D N     1 
ATOM 4134  C CA    . SER D 1 118 ? 80.016  80.719  58.852  1.00 112.91 ? 117 SER D CA    1 
ATOM 4135  C C     . SER D 1 118 ? 81.191  80.393  59.757  1.00 117.18 ? 117 SER D C     1 
ATOM 4136  O O     . SER D 1 118 ? 82.000  79.533  59.438  1.00 118.89 ? 117 SER D O     1 
ATOM 4137  C CB    . SER D 1 118 ? 80.351  81.935  57.992  1.00 109.33 ? 117 SER D CB    1 
ATOM 4138  O OG    . SER D 1 118 ? 81.094  82.890  58.726  1.00 110.17 ? 117 SER D OG    1 
ATOM 4139  N N     . GLN D 1 119 ? 81.298  81.081  60.881  1.00 107.43 ? 118 GLN D N     1 
ATOM 4140  C CA    . GLN D 1 119 ? 82.380  80.802  61.817  1.00 111.68 ? 118 GLN D CA    1 
ATOM 4141  C C     . GLN D 1 119 ? 82.313  79.380  62.387  1.00 115.62 ? 118 GLN D C     1 
ATOM 4142  O O     . GLN D 1 119 ? 83.335  78.721  62.555  1.00 119.26 ? 118 GLN D O     1 
ATOM 4143  C CB    . GLN D 1 119 ? 82.382  81.829  62.947  1.00 111.99 ? 118 GLN D CB    1 
ATOM 4144  N N     . LEU D 1 120 ? 81.103  78.922  62.683  1.00 133.81 ? 119 LEU D N     1 
ATOM 4145  C CA    . LEU D 1 120 ? 80.860  77.622  63.324  1.00 135.55 ? 119 LEU D CA    1 
ATOM 4146  C C     . LEU D 1 120 ? 81.051  76.362  62.462  1.00 136.48 ? 119 LEU D C     1 
ATOM 4147  O O     . LEU D 1 120 ? 80.802  76.377  61.260  1.00 135.99 ? 119 LEU D O     1 
ATOM 4148  C CB    . LEU D 1 120 ? 79.460  77.602  63.944  1.00 135.36 ? 119 LEU D CB    1 
ATOM 4149  N N     . SER D 1 121 ? 81.477  75.274  63.104  1.00 91.73  ? 120 SER D N     1 
ATOM 4150  C CA    . SER D 1 121 ? 81.518  73.952  62.490  1.00 94.29  ? 120 SER D CA    1 
ATOM 4151  C C     . SER D 1 121 ? 80.134  73.327  62.534  1.00 95.07  ? 120 SER D C     1 
ATOM 4152  O O     . SER D 1 121 ? 79.320  73.676  63.387  1.00 94.24  ? 120 SER D O     1 
ATOM 4153  C CB    . SER D 1 121 ? 82.514  73.048  63.225  1.00 97.51  ? 120 SER D CB    1 
ATOM 4154  N N     . GLU D 1 122 ? 79.874  72.401  61.614  1.00 127.98 ? 121 GLU D N     1 
ATOM 4155  C CA    . GLU D 1 122 ? 78.619  71.657  61.609  1.00 129.44 ? 121 GLU D CA    1 
ATOM 4156  C C     . GLU D 1 122 ? 78.377  71.064  62.995  1.00 131.48 ? 121 GLU D C     1 
ATOM 4157  O O     . GLU D 1 122 ? 77.239  70.953  63.449  1.00 131.70 ? 121 GLU D O     1 
ATOM 4158  C CB    . GLU D 1 122 ? 78.650  70.551  60.549  1.00 131.81 ? 121 GLU D CB    1 
ATOM 4159  N N     . GLU D 1 123 ? 79.468  70.706  63.664  1.00 182.36 ? 122 GLU D N     1 
ATOM 4160  C CA    . GLU D 1 123 ? 79.414  70.243  65.040  1.00 184.59 ? 122 GLU D CA    1 
ATOM 4161  C C     . GLU D 1 123 ? 79.347  71.420  66.014  1.00 181.76 ? 122 GLU D C     1 
ATOM 4162  O O     . GLU D 1 123 ? 78.578  71.389  66.975  1.00 182.07 ? 122 GLU D O     1 
ATOM 4163  C CB    . GLU D 1 123 ? 80.625  69.362  65.354  1.00 188.22 ? 122 GLU D CB    1 
ATOM 4164  N N     . GLU D 1 124 ? 80.147  72.456  65.766  1.00 103.50 ? 123 GLU D N     1 
ATOM 4165  C CA    . GLU D 1 124 ? 80.182  73.617  66.662  1.00 101.30 ? 123 GLU D CA    1 
ATOM 4166  C C     . GLU D 1 124 ? 78.836  74.348  66.710  1.00 99.69  ? 123 GLU D C     1 
ATOM 4167  O O     . GLU D 1 124 ? 78.229  74.466  67.777  1.00 99.92  ? 123 GLU D O     1 
ATOM 4168  C CB    . GLU D 1 124 ? 81.309  74.585  66.278  1.00 100.48 ? 123 GLU D CB    1 
ATOM 4169  N N     . ASN D 1 125 ? 78.384  74.834  65.552  1.00 105.43 ? 124 ASN D N     1 
ATOM 4170  C CA    . ASN D 1 125 ? 77.059  75.445  65.418  1.00 103.67 ? 124 ASN D CA    1 
ATOM 4171  C C     . ASN D 1 125 ? 75.952  74.581  66.032  1.00 105.07 ? 124 ASN D C     1 
ATOM 4172  O O     . ASN D 1 125 ? 75.154  75.066  66.834  1.00 104.53 ? 124 ASN D O     1 
ATOM 4173  C CB    . ASN D 1 125 ? 76.741  75.746  63.947  1.00 102.30 ? 124 ASN D CB    1 
ATOM 4174  N N     . GLU D 1 126 ? 75.912  73.304  65.660  1.00 119.03 ? 125 GLU D N     1 
ATOM 4175  C CA    . GLU D 1 126 ? 74.924  72.386  66.212  1.00 121.02 ? 125 GLU D CA    1 
ATOM 4176  C C     . GLU D 1 126 ? 74.983  72.410  67.732  1.00 121.52 ? 125 GLU D C     1 
ATOM 4177  O O     . GLU D 1 126 ? 73.953  72.504  68.397  1.00 121.33 ? 125 GLU D O     1 
ATOM 4178  C CB    . GLU D 1 126 ? 75.142  70.961  65.693  1.00 124.82 ? 125 GLU D CB    1 
ATOM 4179  N N     . GLN D 1 127 ? 76.197  72.353  68.272  1.00 144.45 ? 126 GLN D N     1 
ATOM 4180  C CA    . GLN D 1 127 ? 76.398  72.375  69.718  1.00 145.86 ? 126 GLN D CA    1 
ATOM 4181  C C     . GLN D 1 127 ? 75.936  73.695  70.334  1.00 143.60 ? 126 GLN D C     1 
ATOM 4182  O O     . GLN D 1 127 ? 75.248  73.704  71.354  1.00 143.92 ? 126 GLN D O     1 
ATOM 4183  C CB    . GLN D 1 127 ? 77.867  72.110  70.064  1.00 148.14 ? 126 GLN D CB    1 
ATOM 4184  N N     . MET D 1 128 ? 76.310  74.806  69.710  0.97 114.78 ? 127 MET D N     1 
ATOM 4185  C CA    . MET D 1 128 ? 75.911  76.119  70.208  0.64 112.83 ? 127 MET D CA    1 
ATOM 4186  C C     . MET D 1 128 ? 74.401  76.334  70.181  1.00 111.76 ? 127 MET D C     1 
ATOM 4187  O O     . MET D 1 128 ? 73.804  76.686  71.191  1.00 111.26 ? 127 MET D O     1 
ATOM 4188  C CB    . MET D 1 128 ? 76.596  77.233  69.427  1.00 111.53 ? 127 MET D CB    1 
ATOM 4189  C CG    . MET D 1 128 ? 75.859  78.552  69.535  1.00 109.59 ? 127 MET D CG    1 
ATOM 4190  S SD    . MET D 1 128 ? 76.939  79.987  69.659  1.00 109.82 ? 127 MET D SD    1 
ATOM 4191  C CE    . MET D 1 128 ? 77.726  79.667  71.234  1.00 111.57 ? 127 MET D CE    1 
ATOM 4192  N N     . LYS D 1 129 ? 73.790  76.133  69.019  1.00 90.14  ? 128 LYS D N     1 
ATOM 4193  C CA    . LYS D 1 129 ? 72.345  76.277  68.882  1.00 89.37  ? 128 LYS D CA    1 
ATOM 4194  C C     . LYS D 1 129 ? 71.606  75.370  69.860  1.00 91.54  ? 128 LYS D C     1 
ATOM 4195  O O     . LYS D 1 129 ? 70.558  75.737  70.385  1.00 90.64  ? 128 LYS D O     1 
ATOM 4196  C CB    . LYS D 1 129 ? 71.905  75.979  67.444  1.00 89.72  ? 128 LYS D CB    1 
ATOM 4197  N N     . ALA D 1 130 ? 72.164  74.187  70.105  1.00 129.82 ? 129 ALA D N     1 
ATOM 4198  C CA    . ALA D 1 130 ? 71.567  73.240  71.040  1.00 131.75 ? 129 ALA D CA    1 
ATOM 4199  C C     . ALA D 1 130 ? 71.518  73.836  72.440  1.00 131.31 ? 129 ALA D C     1 
ATOM 4200  O O     . ALA D 1 130 ? 70.452  73.947  73.044  1.00 130.82 ? 129 ALA D O     1 
ATOM 4201  C CB    . ALA D 1 130 ? 72.346  71.932  71.047  1.00 135.08 ? 129 ALA D CB    1 
ATOM 4202  N N     . ASN D 1 131 ? 72.682  74.224  72.945  1.00 111.83 ? 130 ASN D N     1 
ATOM 4203  C CA    . ASN D 1 131 ? 72.785  74.820  74.267  1.00 111.21 ? 130 ASN D CA    1 
ATOM 4204  C C     . ASN D 1 131 ? 72.039  76.151  74.466  1.00 107.96 ? 130 ASN D C     1 
ATOM 4205  O O     . ASN D 1 131 ? 71.593  76.464  75.577  1.00 107.24 ? 130 ASN D O     1 
ATOM 4206  C CB    . ASN D 1 131 ? 74.260  74.981  74.645  1.00 112.39 ? 130 ASN D CB    1 
ATOM 4207  N N     . LEU D 1 132 ? 71.900  76.912  73.377  1.00 104.53 ? 131 LEU D N     1 
ATOM 4208  C CA    . LEU D 1 132 ? 71.193  78.206  73.361  1.00 101.76 ? 131 LEU D CA    1 
ATOM 4209  C C     . LEU D 1 132 ? 69.664  78.077  73.446  1.00 101.38 ? 131 LEU D C     1 
ATOM 4210  O O     . LEU D 1 132 ? 68.988  78.832  74.149  1.00 99.09  ? 131 LEU D O     1 
ATOM 4211  C CB    . LEU D 1 132 ? 71.498  78.939  72.056  1.00 100.77 ? 131 LEU D CB    1 
ATOM 4212  C CG    . LEU D 1 132 ? 72.762  79.793  71.978  1.00 99.93  ? 131 LEU D CG    1 
ATOM 4213  C CD1   . LEU D 1 132 ? 74.004  78.945  72.072  1.00 102.42 ? 131 LEU D CD1   1 
ATOM 4214  C CD2   . LEU D 1 132 ? 72.765  80.561  70.680  1.00 98.40  ? 131 LEU D CD2   1 
ATOM 4215  N N     . THR D 1 133 ? 69.146  77.089  72.721  1.00 88.35  ? 132 THR D N     1 
ATOM 4216  C CA    . THR D 1 133 ? 67.751  76.674  72.815  1.00 89.10  ? 132 THR D CA    1 
ATOM 4217  C C     . THR D 1 133 ? 67.470  76.338  74.279  1.00 90.20  ? 132 THR D C     1 
ATOM 4218  O O     . THR D 1 133 ? 66.418  76.696  74.827  1.00 89.38  ? 132 THR D O     1 
ATOM 4219  C CB    . THR D 1 133 ? 67.423  75.416  71.998  1.00 91.95  ? 132 THR D CB    1 
ATOM 4220  O OG1   . THR D 1 133 ? 68.039  75.501  70.707  1.00 91.57  ? 132 THR D OG1   1 
ATOM 4221  C CG2   . THR D 1 133 ? 65.920  75.248  71.851  1.00 92.58  ? 132 THR D CG2   1 
ATOM 4222  N N     . LYS D 1 134 ? 68.415  75.632  74.897  1.00 101.49 ? 133 LYS D N     1 
ATOM 4223  C CA    . LYS D 1 134 ? 68.270  75.168  76.270  1.00 102.66 ? 133 LYS D CA    1 
ATOM 4224  C C     . LYS D 1 134 ? 68.062  76.332  77.228  1.00 100.20 ? 133 LYS D C     1 
ATOM 4225  O O     . LYS D 1 134 ? 67.133  76.332  78.035  1.00 100.44 ? 133 LYS D O     1 
ATOM 4226  C CB    . LYS D 1 134 ? 69.496  74.350  76.687  1.00 105.31 ? 133 LYS D CB    1 
ATOM 4227  N N     . MET D 1 135 ? 68.929  77.330  77.122  0.71 90.69  ? 134 MET D N     1 
ATOM 4228  C CA    . MET D 1 135 ? 68.872  78.476  78.012  0.97 88.81  ? 134 MET D CA    1 
ATOM 4229  C C     . MET D 1 135 ? 67.540  79.213  77.901  0.34 86.51  ? 134 MET D C     1 
ATOM 4230  O O     . MET D 1 135 ? 66.978  79.639  78.905  1.00 85.97  ? 134 MET D O     1 
ATOM 4231  C CB    . MET D 1 135 ? 70.041  79.413  77.731  1.00 87.62  ? 134 MET D CB    1 
ATOM 4232  C CG    . MET D 1 135 ? 71.392  78.715  77.729  1.00 90.05  ? 134 MET D CG    1 
ATOM 4233  S SD    . MET D 1 135 ? 72.814  79.838  77.777  1.00 89.79  ? 134 MET D SD    1 
ATOM 4234  C CE    . MET D 1 135 ? 74.152  78.677  77.500  1.00 94.54  ? 134 MET D CE    1 
ATOM 4235  N N     . LEU D 1 136 ? 67.026  79.341  76.682  1.00 87.13  ? 135 LEU D N     1 
ATOM 4236  C CA    . LEU D 1 136 ? 65.744  80.013  76.468  1.00 85.43  ? 135 LEU D CA    1 
ATOM 4237  C C     . LEU D 1 136 ? 64.590  79.249  77.126  1.00 87.07  ? 135 LEU D C     1 
ATOM 4238  O O     . LEU D 1 136 ? 63.659  79.859  77.662  1.00 85.93  ? 135 LEU D O     1 
ATOM 4239  C CB    . LEU D 1 136 ? 65.474  80.231  74.971  1.00 84.56  ? 135 LEU D CB    1 
ATOM 4240  N N     . SER D 1 137 ? 64.671  77.929  77.136  1.00 96.70  ? 136 SER D N     1 
ATOM 4241  C CA    . SER D 1 137 ? 63.574  77.152  77.680  1.00 98.51  ? 136 SER D CA    1 
ATOM 4242  C C     . SER D 1 137 ? 63.371  77.495  79.147  1.00 98.01  ? 136 SER D C     1 
ATOM 4243  O O     . SER D 1 137 ? 62.238  77.647  79.601  1.00 97.80  ? 136 SER D O     1 
ATOM 4244  C CB    . SER D 1 137 ? 63.854  75.659  77.523  1.00 102.08 ? 136 SER D CB    1 
ATOM 4245  N N     . SER D 1 138 ? 64.466  77.628  79.886  1.00 103.04 ? 137 SER D N     1 
ATOM 4246  C CA    . SER D 1 138 ? 64.374  77.937  81.307  1.00 103.55 ? 137 SER D CA    1 
ATOM 4247  C C     . SER D 1 138 ? 63.751  79.300  81.598  1.00 100.75 ? 137 SER D C     1 
ATOM 4248  O O     . SER D 1 138 ? 62.889  79.420  82.463  1.00 100.89 ? 137 SER D O     1 
ATOM 4249  C CB    . SER D 1 138 ? 65.757  77.850  81.955  1.00 104.90 ? 137 SER D CB    1 
ATOM 4250  O OG    . SER D 1 138 ? 66.429  79.095  81.908  1.00 102.49 ? 137 SER D OG    1 
ATOM 4251  N N     . LEU D 1 139 ? 64.177  80.324  80.868  1.00 99.48  ? 138 LEU D N     1 
ATOM 4252  C CA    . LEU D 1 139 ? 63.622  81.658  81.053  1.00 96.88  ? 138 LEU D CA    1 
ATOM 4253  C C     . LEU D 1 139 ? 62.155  81.663  80.672  1.00 96.40  ? 138 LEU D C     1 
ATOM 4254  O O     . LEU D 1 139 ? 61.318  82.251  81.349  1.00 95.40  ? 138 LEU D O     1 
ATOM 4255  C CB    . LEU D 1 139 ? 64.387  82.677  80.213  1.00 95.04  ? 138 LEU D CB    1 
ATOM 4256  C CG    . LEU D 1 139 ? 65.909  82.656  80.362  1.00 95.77  ? 138 LEU D CG    1 
ATOM 4257  C CD1   . LEU D 1 139 ? 66.593  82.848  79.021  1.00 95.18  ? 138 LEU D CD1   1 
ATOM 4258  C CD2   . LEU D 1 139 ? 66.370  83.712  81.351  1.00 95.28  ? 138 LEU D CD2   1 
ATOM 4259  N N     . GLN D 1 140 ? 61.857  80.984  79.575  1.00 108.76 ? 139 GLN D N     1 
ATOM 4260  C CA    . GLN D 1 140 ? 60.493  80.884  79.060  1.00 108.78 ? 139 GLN D CA    1 
ATOM 4261  C C     . GLN D 1 140 ? 59.590  80.165  80.057  1.00 110.43 ? 139 GLN D C     1 
ATOM 4262  O O     . GLN D 1 140 ? 59.248  80.714  81.105  1.00 109.57 ? 139 GLN D O     1 
ATOM 4263  C CB    . GLN D 1 140 ? 60.471  80.178  77.699  1.00 109.83 ? 139 GLN D CB    1 
ATOM 4264  N N     . PHE E 1 4   ? 97.889  54.843  41.837  1.00 103.21 ? 3   PHE I N     1 
ATOM 4265  C CA    . PHE E 1 4   ? 96.545  55.016  42.373  1.00 101.70 ? 3   PHE I CA    1 
ATOM 4266  C C     . PHE E 1 4   ? 95.926  53.657  42.690  1.00 100.42 ? 3   PHE I C     1 
ATOM 4267  O O     . PHE E 1 4   ? 96.472  52.612  42.336  1.00 100.41 ? 3   PHE I O     1 
ATOM 4268  C CB    . PHE E 1 4   ? 95.663  55.787  41.383  1.00 101.31 ? 3   PHE I CB    1 
ATOM 4269  C CG    . PHE E 1 4   ? 94.629  56.673  42.037  1.00 101.43 ? 3   PHE I CG    1 
ATOM 4270  C CD1   . PHE E 1 4   ? 94.383  56.601  43.402  1.00 101.42 ? 3   PHE I CD1   1 
ATOM 4271  C CD2   . PHE E 1 4   ? 93.901  57.578  41.282  1.00 102.13 ? 3   PHE I CD2   1 
ATOM 4272  C CE1   . PHE E 1 4   ? 93.431  57.401  43.995  1.00 102.01 ? 3   PHE I CE1   1 
ATOM 4273  C CE2   . PHE E 1 4   ? 92.951  58.390  41.873  1.00 102.57 ? 3   PHE I CE2   1 
ATOM 4274  C CZ    . PHE E 1 4   ? 92.716  58.302  43.230  1.00 102.45 ? 3   PHE I CZ    1 
ATOM 4275  N N     . THR E 1 5   ? 94.781  53.685  43.361  1.00 86.52  ? 4   THR I N     1 
ATOM 4276  C CA    . THR E 1 5   ? 94.113  52.481  43.830  1.00 86.12  ? 4   THR I CA    1 
ATOM 4277  C C     . THR E 1 5   ? 93.717  51.551  42.692  1.00 85.22  ? 4   THR I C     1 
ATOM 4278  O O     . THR E 1 5   ? 93.127  51.976  41.701  1.00 83.57  ? 4   THR I O     1 
ATOM 4279  C CB    . THR E 1 5   ? 92.882  52.828  44.715  1.00 86.48  ? 4   THR I CB    1 
ATOM 4280  O OG1   . THR E 1 5   ? 92.375  51.638  45.332  1.00 87.17  ? 4   THR I OG1   1 
ATOM 4281  C CG2   . THR E 1 5   ? 91.783  53.491  43.892  1.00 85.36  ? 4   THR I CG2   1 
ATOM 4282  N N     . TYR E 1 6   ? 94.075  50.283  42.847  1.00 104.17 ? 5   TYR I N     1 
ATOM 4283  C CA    . TYR E 1 6   ? 93.765  49.240  41.877  1.00 103.46 ? 5   TYR I CA    1 
ATOM 4284  C C     . TYR E 1 6   ? 92.274  49.192  41.522  1.00 101.79 ? 5   TYR I C     1 
ATOM 4285  O O     . TYR E 1 6   ? 91.901  49.271  40.348  1.00 99.56  ? 5   TYR I O     1 
ATOM 4286  C CB    . TYR E 1 6   ? 94.199  47.878  42.420  1.00 106.15 ? 5   TYR I CB    1 
ATOM 4287  C CG    . TYR E 1 6   ? 95.639  47.514  42.142  1.00 106.61 ? 5   TYR I CG    1 
ATOM 4288  C CD1   . TYR E 1 6   ? 96.256  47.894  40.957  1.00 105.26 ? 5   TYR I CD1   1 
ATOM 4289  C CD2   . TYR E 1 6   ? 96.381  46.774  43.059  1.00 108.26 ? 5   TYR I CD2   1 
ATOM 4290  C CE1   . TYR E 1 6   ? 97.576  47.553  40.691  1.00 106.14 ? 5   TYR I CE1   1 
ATOM 4291  C CE2   . TYR E 1 6   ? 97.704  46.431  42.803  1.00 108.61 ? 5   TYR I CE2   1 
ATOM 4292  C CZ    . TYR E 1 6   ? 98.295  46.825  41.617  1.00 107.90 ? 5   TYR I CZ    1 
ATOM 4293  O OH    . TYR E 1 6   ? 99.605  46.495  41.349  1.00 109.23 ? 5   TYR I OH    1 
ATOM 4294  N N     . SER E 1 7   ? 91.428  49.075  42.545  1.00 102.83 ? 6   SER I N     1 
ATOM 4295  C CA    . SER E 1 7   ? 89.989  48.918  42.354  1.00 101.29 ? 6   SER I CA    1 
ATOM 4296  C C     . SER E 1 7   ? 89.365  50.097  41.625  1.00 98.68  ? 6   SER I C     1 
ATOM 4297  O O     . SER E 1 7   ? 88.197  50.057  41.248  1.00 97.38  ? 6   SER I O     1 
ATOM 4298  C CB    . SER E 1 7   ? 89.290  48.699  43.696  1.00 103.05 ? 6   SER I CB    1 
ATOM 4299  O OG    . SER E 1 7   ? 89.650  49.693  44.640  1.00 103.74 ? 6   SER I OG    1 
ATOM 4300  N N     . TYR E 1 8   ? 90.146  51.152  41.444  1.00 96.61  ? 7   TYR I N     1 
ATOM 4301  C CA    . TYR E 1 8   ? 89.735  52.273  40.621  1.00 95.42  ? 7   TYR I CA    1 
ATOM 4302  C C     . TYR E 1 8   ? 90.151  51.997  39.196  1.00 94.46  ? 7   TYR I C     1 
ATOM 4303  O O     . TYR E 1 8   ? 89.328  51.976  38.281  1.00 93.26  ? 7   TYR I O     1 
ATOM 4304  C CB    . TYR E 1 8   ? 90.423  53.548  41.092  1.00 96.99  ? 7   TYR I CB    1 
ATOM 4305  C CG    . TYR E 1 8   ? 90.137  54.754  40.231  1.00 97.13  ? 7   TYR I CG    1 
ATOM 4306  C CD1   . TYR E 1 8   ? 88.953  55.466  40.381  1.00 97.18  ? 7   TYR I CD1   1 
ATOM 4307  C CD2   . TYR E 1 8   ? 91.054  55.191  39.280  1.00 97.70  ? 7   TYR I CD2   1 
ATOM 4308  C CE1   . TYR E 1 8   ? 88.683  56.575  39.606  1.00 98.03  ? 7   TYR I CE1   1 
ATOM 4309  C CE2   . TYR E 1 8   ? 90.796  56.302  38.495  1.00 98.88  ? 7   TYR I CE2   1 
ATOM 4310  C CZ    . TYR E 1 8   ? 89.607  56.991  38.664  1.00 99.35  ? 7   TYR I CZ    1 
ATOM 4311  O OH    . TYR E 1 8   ? 89.328  58.102  37.898  1.00 101.42 ? 7   TYR I OH    1 
ATOM 4312  N N     . LEU E 1 9   ? 91.452  51.775  39.031  1.00 80.50  ? 8   LEU I N     1 
ATOM 4313  C CA    . LEU E 1 9   ? 92.071  51.638  37.720  1.00 80.09  ? 8   LEU I CA    1 
ATOM 4314  C C     . LEU E 1 9   ? 91.481  50.492  36.902  1.00 78.27  ? 8   LEU I C     1 
ATOM 4315  O O     . LEU E 1 9   ? 91.351  50.599  35.690  1.00 77.05  ? 8   LEU I O     1 
ATOM 4316  C CB    . LEU E 1 9   ? 93.590  51.481  37.859  1.00 81.95  ? 8   LEU I CB    1 
ATOM 4317  N N     . PHE E 1 10  ? 91.113  49.402  37.564  1.00 95.42  ? 9   PHE I N     1 
ATOM 4318  C CA    . PHE E 1 10  ? 90.529  48.264  36.858  1.00 94.58  ? 9   PHE I CA    1 
ATOM 4319  C C     . PHE E 1 10  ? 89.079  48.539  36.440  1.00 93.05  ? 9   PHE I C     1 
ATOM 4320  O O     . PHE E 1 10  ? 88.678  48.230  35.314  1.00 91.48  ? 9   PHE I O     1 
ATOM 4321  C CB    . PHE E 1 10  ? 90.620  46.991  37.704  1.00 96.99  ? 9   PHE I CB    1 
ATOM 4322  N N     . ARG E 1 11  ? 88.297  49.122  37.343  1.00 96.55  ? 10  ARG I N     1 
ATOM 4323  C CA    . ARG E 1 11  ? 86.918  49.469  37.031  1.00 96.00  ? 10  ARG I CA    1 
ATOM 4324  C C     . ARG E 1 11  ? 86.825  50.446  35.860  1.00 95.61  ? 10  ARG I C     1 
ATOM 4325  O O     . ARG E 1 11  ? 86.076  50.222  34.910  1.00 95.91  ? 10  ARG I O     1 
ATOM 4326  C CB    . ARG E 1 11  ? 86.211  50.038  38.265  1.00 96.42  ? 10  ARG I CB    1 
ATOM 4327  N N     . MET E 1 12  ? 87.597  51.520  35.920  0.79 95.11  ? 11  MET I N     1 
ATOM 4328  C CA    . MET E 1 12  ? 87.561  52.504  34.852  1.00 95.50  ? 11  MET I CA    1 
ATOM 4329  C C     . MET E 1 12  ? 88.076  51.948  33.528  0.78 95.06  ? 11  MET I C     1 
ATOM 4330  O O     . MET E 1 12  ? 87.537  52.249  32.467  1.00 95.38  ? 11  MET I O     1 
ATOM 4331  C CB    . MET E 1 12  ? 88.401  53.724  35.226  1.00 97.50  ? 11  MET I CB    1 
ATOM 4332  C CG    . MET E 1 12  ? 87.873  54.492  36.424  1.00 98.96  ? 11  MET I CG    1 
ATOM 4333  S SD    . MET E 1 12  ? 86.243  55.185  36.112  1.00 99.70  ? 11  MET I SD    1 
ATOM 4334  C CE    . MET E 1 12  ? 85.212  54.037  37.017  1.00 98.28  ? 11  MET I CE    1 
ATOM 4335  N N     . ILE E 1 13  ? 89.120  51.130  33.592  1.00 76.22  ? 12  ILE I N     1 
ATOM 4336  C CA    . ILE E 1 13  ? 89.727  50.609  32.375  1.00 75.91  ? 12  ILE I CA    1 
ATOM 4337  C C     . ILE E 1 13  ? 88.738  49.696  31.660  1.00 75.77  ? 12  ILE I C     1 
ATOM 4338  O O     . ILE E 1 13  ? 88.563  49.788  30.451  1.00 76.05  ? 12  ILE I O     1 
ATOM 4339  C CB    . ILE E 1 13  ? 91.022  49.821  32.641  1.00 76.53  ? 12  ILE I CB    1 
ATOM 4340  N N     . SER E 1 14  ? 88.076  48.830  32.414  1.00 78.32  ? 13  SER I N     1 
ATOM 4341  C CA    . SER E 1 14  ? 87.126  47.897  31.830  1.00 78.24  ? 13  SER I CA    1 
ATOM 4342  C C     . SER E 1 14  ? 86.014  48.673  31.156  1.00 78.35  ? 13  SER I C     1 
ATOM 4343  O O     . SER E 1 14  ? 85.588  48.367  30.049  1.00 78.29  ? 13  SER I O     1 
ATOM 4344  C CB    . SER E 1 14  ? 86.577  46.970  32.908  1.00 78.78  ? 13  SER I CB    1 
ATOM 4345  O OG    . SER E 1 14  ? 85.829  47.702  33.860  1.00 79.26  ? 13  SER I OG    1 
ATOM 4346  N N     . HIS E 1 15  ? 85.556  49.693  31.860  1.00 83.99  ? 14  HIS I N     1 
ATOM 4347  C CA    . HIS E 1 15  ? 84.421  50.506  31.451  1.00 84.34  ? 14  HIS I CA    1 
ATOM 4348  C C     . HIS E 1 15  ? 84.588  51.199  30.092  1.00 84.34  ? 14  HIS I C     1 
ATOM 4349  O O     . HIS E 1 15  ? 83.761  51.028  29.197  1.00 84.76  ? 14  HIS I O     1 
ATOM 4350  C CB    . HIS E 1 15  ? 84.154  51.517  32.564  1.00 85.29  ? 14  HIS I CB    1 
ATOM 4351  C CG    . HIS E 1 15  ? 82.953  52.378  32.331  1.00 86.91  ? 14  HIS I CG    1 
ATOM 4352  N ND1   . HIS E 1 15  ? 83.047  53.737  32.117  1.00 87.75  ? 14  HIS I ND1   1 
ATOM 4353  C CD2   . HIS E 1 15  ? 81.634  52.081  32.298  1.00 87.94  ? 14  HIS I CD2   1 
ATOM 4354  C CE1   . HIS E 1 15  ? 81.835  54.238  31.953  1.00 89.21  ? 14  HIS I CE1   1 
ATOM 4355  N NE2   . HIS E 1 15  ? 80.960  53.254  32.060  1.00 89.21  ? 14  HIS I NE2   1 
ATOM 4356  N N     . GLU E 1 16  ? 85.659  51.967  29.928  1.00 105.68 ? 15  GLU I N     1 
ATOM 4357  C CA    . GLU E 1 16  ? 85.892  52.647  28.658  1.00 106.23 ? 15  GLU I CA    1 
ATOM 4358  C C     . GLU E 1 16  ? 86.070  51.713  27.448  1.00 105.63 ? 15  GLU I C     1 
ATOM 4359  O O     . GLU E 1 16  ? 85.615  52.014  26.342  1.00 105.92 ? 15  GLU I O     1 
ATOM 4360  C CB    . GLU E 1 16  ? 87.061  53.631  28.774  1.00 107.02 ? 15  GLU I CB    1 
ATOM 4361  C CG    . GLU E 1 16  ? 86.778  54.815  29.696  1.00 108.62 ? 15  GLU I CG    1 
ATOM 4362  C CD    . GLU E 1 16  ? 85.652  55.714  29.189  1.00 110.36 ? 15  GLU I CD    1 
ATOM 4363  O OE1   . GLU E 1 16  ? 85.598  55.962  27.964  1.00 110.94 ? 15  GLU I OE1   1 
ATOM 4364  O OE2   . GLU E 1 16  ? 84.822  56.170  30.011  1.00 111.40 ? 15  GLU I OE2   1 
ATOM 4365  N N     . MET E 1 17  ? 86.720  50.576  27.680  1.00 78.67  ? 16  MET I N     1 
ATOM 4366  C CA    . MET E 1 17  ? 86.870  49.541  26.667  0.31 78.07  ? 16  MET I CA    1 
ATOM 4367  C C     . MET E 1 17  ? 85.524  49.039  26.148  1.00 77.76  ? 16  MET I C     1 
ATOM 4368  O O     . MET E 1 17  ? 85.313  48.897  24.945  0.22 77.38  ? 16  MET I O     1 
ATOM 4369  C CB    . MET E 1 17  ? 87.603  48.343  27.267  1.00 77.89  ? 16  MET I CB    1 
ATOM 4370  C CG    . MET E 1 17  ? 89.063  48.598  27.607  1.00 78.40  ? 16  MET I CG    1 
ATOM 4371  S SD    . MET E 1 17  ? 89.889  47.174  28.403  1.00 78.95  ? 16  MET I SD    1 
ATOM 4372  C CE    . MET E 1 17  ? 90.014  46.075  26.992  1.00 79.16  ? 16  MET I CE    1 
ATOM 4373  N N     . LYS E 1 18  ? 84.610  48.795  27.083  1.00 88.73  ? 17  LYS I N     1 
ATOM 4374  C CA    . LYS E 1 18  ? 83.266  48.343  26.749  1.00 89.07  ? 17  LYS I CA    1 
ATOM 4375  C C     . LYS E 1 18  ? 82.587  49.477  26.012  1.00 89.94  ? 17  LYS I C     1 
ATOM 4376  O O     . LYS E 1 18  ? 81.818  49.246  25.085  1.00 90.29  ? 17  LYS I O     1 
ATOM 4377  C CB    . LYS E 1 18  ? 82.420  47.929  27.956  1.00 89.22  ? 17  LYS I CB    1 
ATOM 4378  N N     . GLN E 1 19  ? 82.872  50.707  26.424  1.00 78.66  ? 18  GLN I N     1 
ATOM 4379  C CA    . GLN E 1 19  ? 82.306  51.863  25.746  1.00 79.59  ? 18  GLN I CA    1 
ATOM 4380  C C     . GLN E 1 19  ? 82.836  51.996  24.318  1.00 79.77  ? 18  GLN I C     1 
ATOM 4381  O O     . GLN E 1 19  ? 82.054  51.977  23.362  1.00 80.38  ? 18  GLN I O     1 
ATOM 4382  C CB    . GLN E 1 19  ? 82.543  53.140  26.547  1.00 80.93  ? 18  GLN I CB    1 
ATOM 4383  C CG    . GLN E 1 19  ? 81.261  53.777  27.065  1.00 82.56  ? 18  GLN I CG    1 
ATOM 4384  C CD    . GLN E 1 19  ? 80.351  52.785  27.784  1.00 82.60  ? 18  GLN I CD    1 
ATOM 4385  O OE1   . GLN E 1 19  ? 79.422  52.234  27.184  1.00 82.78  ? 18  GLN I OE1   1 
ATOM 4386  N NE2   . GLN E 1 19  ? 80.610  52.558  29.072  1.00 82.69  ? 18  GLN I NE2   1 
ATOM 4387  N N     . LYS E 1 20  ? 84.157  52.109  24.170  1.00 84.62  ? 19  LYS I N     1 
ATOM 4388  C CA    . LYS E 1 20  ? 84.758  52.292  22.845  1.00 85.16  ? 19  LYS I CA    1 
ATOM 4389  C C     . LYS E 1 20  ? 84.323  51.167  21.920  1.00 84.59  ? 19  LYS I C     1 
ATOM 4390  O O     . LYS E 1 20  ? 84.053  51.391  20.740  1.00 85.14  ? 19  LYS I O     1 
ATOM 4391  C CB    . LYS E 1 20  ? 86.287  52.371  22.920  1.00 84.85  ? 19  LYS I CB    1 
ATOM 4392  N N     . ALA E 1 21  ? 84.229  49.963  22.478  1.00 80.80  ? 20  ALA I N     1 
ATOM 4393  C CA    . ALA E 1 21  ? 83.752  48.811  21.728  1.00 80.15  ? 20  ALA I CA    1 
ATOM 4394  C C     . ALA E 1 21  ? 82.320  49.042  21.283  1.00 80.44  ? 20  ALA I C     1 
ATOM 4395  O O     . ALA E 1 21  ? 81.996  48.865  20.111  1.00 80.41  ? 20  ALA I O     1 
ATOM 4396  C CB    . ALA E 1 21  ? 83.845  47.555  22.563  1.00 79.48  ? 20  ALA I CB    1 
ATOM 4397  N N     . ASP E 1 22  ? 81.469  49.439  22.223  1.00 71.85  ? 21  ASP I N     1 
ATOM 4398  C CA    . ASP E 1 22  ? 80.063  49.652  21.912  1.00 72.55  ? 21  ASP I CA    1 
ATOM 4399  C C     . ASP E 1 22  ? 79.936  50.615  20.743  1.00 73.75  ? 21  ASP I C     1 
ATOM 4400  O O     . ASP E 1 22  ? 79.301  50.285  19.735  1.00 74.05  ? 21  ASP I O     1 
ATOM 4401  C CB    . ASP E 1 22  ? 79.293  50.178  23.122  1.00 73.64  ? 21  ASP I CB    1 
ATOM 4402  C CG    . ASP E 1 22  ? 78.815  49.069  24.042  1.00 73.75  ? 21  ASP I CG    1 
ATOM 4403  O OD1   . ASP E 1 22  ? 78.788  47.907  23.599  1.00 73.33  ? 21  ASP I OD1   1 
ATOM 4404  O OD2   . ASP E 1 22  ? 78.448  49.364  25.201  1.00 74.57  ? 21  ASP I OD2   1 
ATOM 4405  N N     . GLN E 1 23  ? 80.569  51.782  20.871  1.00 77.80  ? 22  GLN I N     1 
ATOM 4406  C CA    . GLN E 1 23  ? 80.562  52.797  19.820  1.00 79.30  ? 22  GLN I CA    1 
ATOM 4407  C C     . GLN E 1 23  ? 80.982  52.212  18.466  1.00 78.86  ? 22  GLN I C     1 
ATOM 4408  O O     . GLN E 1 23  ? 80.282  52.362  17.462  1.00 79.67  ? 22  GLN I O     1 
ATOM 4409  C CB    . GLN E 1 23  ? 81.470  53.973  20.202  1.00 80.31  ? 22  GLN I CB    1 
ATOM 4410  N N     . LYS E 1 24  ? 82.105  51.506  18.451  1.00 64.56  ? 23  LYS I N     1 
ATOM 4411  C CA    . LYS E 1 24  ? 82.632  50.943  17.210  1.00 64.52  ? 23  LYS I CA    1 
ATOM 4412  C C     . LYS E 1 24  ? 81.768  49.805  16.664  1.00 63.60  ? 23  LYS I C     1 
ATOM 4413  O O     . LYS E 1 24  ? 82.103  49.199  15.649  1.00 63.58  ? 23  LYS I O     1 
ATOM 4414  C CB    . LYS E 1 24  ? 84.082  50.461  17.404  1.00 64.56  ? 23  LYS I CB    1 
ATOM 4415  N N     . LEU E 1 25  ? 80.659  49.516  17.336  1.00 84.75  ? 24  LEU I N     1 
ATOM 4416  C CA    . LEU E 1 25  ? 79.865  48.339  17.008  1.00 83.76  ? 24  LEU I CA    1 
ATOM 4417  C C     . LEU E 1 25  ? 78.422  48.673  16.688  1.00 84.89  ? 24  LEU I C     1 
ATOM 4418  O O     . LEU E 1 25  ? 77.644  47.785  16.335  1.00 84.82  ? 24  LEU I O     1 
ATOM 4419  C CB    . LEU E 1 25  ? 79.896  47.342  18.166  1.00 82.95  ? 24  LEU I CB    1 
ATOM 4420  C CG    . LEU E 1 25  ? 81.096  46.406  18.199  1.00 82.44  ? 24  LEU I CG    1 
ATOM 4421  C CD1   . LEU E 1 25  ? 80.996  45.438  19.357  1.00 82.20  ? 24  LEU I CD1   1 
ATOM 4422  C CD2   . LEU E 1 25  ? 81.145  45.667  16.895  1.00 81.92  ? 24  LEU I CD2   1 
ATOM 4423  N N     . GLU E 1 26  ? 78.063  49.948  16.812  1.00 70.61  ? 25  GLU I N     1 
ATOM 4424  C CA    . GLU E 1 26  ? 76.674  50.359  16.634  1.00 69.95  ? 25  GLU I CA    1 
ATOM 4425  C C     . GLU E 1 26  ? 76.247  50.198  15.175  1.00 72.17  ? 25  GLU I C     1 
ATOM 4426  O O     . GLU E 1 26  ? 75.066  50.296  14.851  1.00 72.20  ? 25  GLU I O     1 
ATOM 4427  C CB    . GLU E 1 26  ? 76.462  51.793  17.132  1.00 68.87  ? 25  GLU I CB    1 
ATOM 4428  N N     . GLN E 1 27  ? 77.223  49.933  14.309  1.00 103.43 ? 26  GLN I N     1 
ATOM 4429  C CA    . GLN E 1 27  ? 76.992  49.683  12.888  1.00 105.91 ? 26  GLN I CA    1 
ATOM 4430  C C     . GLN E 1 27  ? 76.664  48.220  12.636  1.00 106.03 ? 26  GLN I C     1 
ATOM 4431  O O     . GLN E 1 27  ? 76.019  47.871  11.650  1.00 107.64 ? 26  GLN I O     1 
ATOM 4432  C CB    . GLN E 1 27  ? 78.246  50.044  12.106  1.00 106.22 ? 26  GLN I CB    1 
ATOM 4433  C CG    . GLN E 1 27  ? 79.513  49.606  12.809  1.00 105.62 ? 26  GLN I CG    1 
ATOM 4434  C CD    . GLN E 1 27  ? 80.754  49.956  12.030  1.00 108.23 ? 26  GLN I CD    1 
ATOM 4435  O OE1   . GLN E 1 27  ? 80.732  49.997  10.802  1.00 110.40 ? 26  GLN I OE1   1 
ATOM 4436  N NE2   . GLN E 1 27  ? 81.849  50.217  12.738  1.00 109.21 ? 26  GLN I NE2   1 
ATOM 4437  N N     . PHE E 1 28  ? 77.140  47.365  13.529  1.00 82.60  ? 27  PHE I N     1 
ATOM 4438  C CA    . PHE E 1 28  ? 76.834  45.950  13.480  1.00 82.80  ? 27  PHE I CA    1 
ATOM 4439  C C     . PHE E 1 28  ? 75.659  45.629  14.398  1.00 80.92  ? 27  PHE I C     1 
ATOM 4440  O O     . PHE E 1 28  ? 75.308  44.465  14.591  1.00 81.24  ? 27  PHE I O     1 
ATOM 4441  C CB    . PHE E 1 28  ? 78.050  45.157  13.924  1.00 83.37  ? 27  PHE I CB    1 
ATOM 4442  C CG    . PHE E 1 28  ? 79.171  45.188  12.949  1.00 86.30  ? 27  PHE I CG    1 
ATOM 4443  C CD1   . PHE E 1 28  ? 78.936  44.988  11.604  1.00 88.75  ? 27  PHE I CD1   1 
ATOM 4444  C CD2   . PHE E 1 28  ? 80.467  45.412  13.376  1.00 88.23  ? 27  PHE I CD2   1 
ATOM 4445  C CE1   . PHE E 1 28  ? 79.979  45.005  10.696  1.00 92.40  ? 27  PHE I CE1   1 
ATOM 4446  C CE2   . PHE E 1 28  ? 81.515  45.431  12.478  1.00 92.56  ? 27  PHE I CE2   1 
ATOM 4447  C CZ    . PHE E 1 28  ? 81.271  45.228  11.136  1.00 94.63  ? 27  PHE I CZ    1 
ATOM 4448  N N     . ASP E 1 29  ? 75.076  46.669  14.982  1.00 89.15  ? 28  ASP I N     1 
ATOM 4449  C CA    . ASP E 1 29  ? 73.887  46.538  15.815  1.00 87.78  ? 28  ASP I CA    1 
ATOM 4450  C C     . ASP E 1 29  ? 74.040  45.549  16.967  1.00 86.55  ? 28  ASP I C     1 
ATOM 4451  O O     . ASP E 1 29  ? 73.058  44.958  17.403  1.00 86.15  ? 28  ASP I O     1 
ATOM 4452  C CB    . ASP E 1 29  ? 72.678  46.152  14.956  1.00 89.06  ? 28  ASP I CB    1 
ATOM 4453  C CG    . ASP E 1 29  ? 71.358  46.472  15.631  1.00 87.96  ? 28  ASP I CG    1 
ATOM 4454  O OD1   . ASP E 1 29  ? 70.967  47.656  15.625  1.00 87.56  ? 28  ASP I OD1   1 
ATOM 4455  O OD2   . ASP E 1 29  ? 70.714  45.544  16.167  1.00 87.74  ? 28  ASP I OD2   1 
ATOM 4456  N N     . ILE E 1 30  ? 75.259  45.352  17.462  1.00 86.45  ? 29  ILE I N     1 
ATOM 4457  C CA    . ILE E 1 30  ? 75.432  44.488  18.635  1.00 85.64  ? 29  ILE I CA    1 
ATOM 4458  C C     . ILE E 1 30  ? 76.188  45.166  19.775  1.00 84.24  ? 29  ILE I C     1 
ATOM 4459  O O     . ILE E 1 30  ? 77.021  46.043  19.550  1.00 84.33  ? 29  ILE I O     1 
ATOM 4460  C CB    . ILE E 1 30  ? 76.124  43.139  18.308  1.00 87.63  ? 29  ILE I CB    1 
ATOM 4461  C CG1   . ILE E 1 30  ? 77.605  43.352  18.004  1.00 88.91  ? 29  ILE I CG1   1 
ATOM 4462  C CG2   . ILE E 1 30  ? 75.414  42.420  17.177  1.00 89.40  ? 29  ILE I CG2   1 
ATOM 4463  C CD1   . ILE E 1 30  ? 78.361  42.075  17.762  1.00 91.18  ? 29  ILE I CD1   1 
ATOM 4464  N N     . THR E 1 31  ? 75.882  44.751  21.000  1.00 69.43  ? 30  THR I N     1 
ATOM 4465  C CA    . THR E 1 31  ? 76.553  45.270  22.183  1.00 68.04  ? 30  THR I CA    1 
ATOM 4466  C C     . THR E 1 31  ? 77.920  44.632  22.317  1.00 69.19  ? 30  THR I C     1 
ATOM 4467  O O     . THR E 1 31  ? 78.226  43.672  21.614  1.00 70.97  ? 30  THR I O     1 
ATOM 4468  C CB    . THR E 1 31  ? 75.743  44.982  23.467  1.00 66.69  ? 30  THR I CB    1 
ATOM 4469  O OG1   . THR E 1 31  ? 75.899  43.610  23.848  1.00 67.74  ? 30  THR I OG1   1 
ATOM 4470  C CG2   . THR E 1 31  ? 74.262  45.281  23.242  1.00 66.24  ? 30  THR I CG2   1 
ATOM 4471  N N     . ASN E 1 32  ? 78.734  45.162  23.227  1.00 61.90  ? 31  ASN I N     1 
ATOM 4472  C CA    . ASN E 1 32  ? 80.066  44.621  23.505  1.00 62.76  ? 31  ASN I CA    1 
ATOM 4473  C C     . ASN E 1 32  ? 80.063  43.170  24.015  1.00 60.01  ? 31  ASN I C     1 
ATOM 4474  O O     . ASN E 1 32  ? 80.815  42.333  23.521  1.00 59.78  ? 31  ASN I O     1 
ATOM 4475  C CB    . ASN E 1 32  ? 80.791  45.510  24.516  1.00 65.41  ? 31  ASN I CB    1 
ATOM 4476  C CG    . ASN E 1 32  ? 82.165  44.980  24.874  1.00 66.45  ? 31  ASN I CG    1 
ATOM 4477  O OD1   . ASN E 1 32  ? 82.939  44.582  23.996  1.00 67.12  ? 31  ASN I OD1   1 
ATOM 4478  N ND2   . ASN E 1 32  ? 82.473  44.960  26.170  1.00 66.75  ? 31  ASN I ND2   1 
ATOM 4479  N N     . GLU E 1 33  ? 79.224  42.893  25.010  1.00 74.49  ? 32  GLU I N     1 
ATOM 4480  C CA    . GLU E 1 33  ? 79.095  41.562  25.604  1.00 74.20  ? 32  GLU I CA    1 
ATOM 4481  C C     . GLU E 1 33  ? 78.670  40.542  24.568  1.00 72.02  ? 32  GLU I C     1 
ATOM 4482  O O     . GLU E 1 33  ? 79.143  39.404  24.554  1.00 72.67  ? 32  GLU I O     1 
ATOM 4483  C CB    . GLU E 1 33  ? 78.050  41.587  26.722  1.00 72.17  ? 32  GLU I CB    1 
ATOM 4484  C CG    . GLU E 1 33  ? 78.453  42.356  27.967  1.00 74.07  ? 32  GLU I CG    1 
ATOM 4485  C CD    . GLU E 1 33  ? 78.697  43.830  27.693  1.00 75.03  ? 32  GLU I CD    1 
ATOM 4486  O OE1   . GLU E 1 33  ? 78.943  44.588  28.660  1.00 76.22  ? 32  GLU I OE1   1 
ATOM 4487  O OE2   . GLU E 1 33  ? 78.648  44.231  26.508  1.00 74.85  ? 32  GLU I OE2   1 
ATOM 4488  N N     . GLN E 1 34  ? 77.752  40.966  23.712  1.00 54.95  ? 33  GLN I N     1 
ATOM 4489  C CA    . GLN E 1 34  ? 77.305  40.158  22.595  1.00 52.93  ? 33  GLN I CA    1 
ATOM 4490  C C     . GLN E 1 34  ? 78.464  39.860  21.685  1.00 55.47  ? 33  GLN I C     1 
ATOM 4491  O O     . GLN E 1 34  ? 78.588  38.749  21.188  1.00 55.06  ? 33  GLN I O     1 
ATOM 4492  C CB    . GLN E 1 34  ? 76.211  40.883  21.824  1.00 52.78  ? 33  GLN I CB    1 
ATOM 4493  C CG    . GLN E 1 34  ? 74.858  40.632  22.417  1.00 50.67  ? 33  GLN I CG    1 
ATOM 4494  C CD    . GLN E 1 34  ? 73.908  41.755  22.199  1.00 51.35  ? 33  GLN I CD    1 
ATOM 4495  O OE1   . GLN E 1 34  ? 74.125  42.595  21.342  1.00 53.06  ? 33  GLN I OE1   1 
ATOM 4496  N NE2   . GLN E 1 34  ? 72.842  41.787  22.982  1.00 50.25  ? 33  GLN I NE2   1 
ATOM 4497  N N     . GLY E 1 35  ? 79.319  40.853  21.475  1.00 61.88  ? 34  GLY I N     1 
ATOM 4498  C CA    . GLY E 1 35  ? 80.489  40.682  20.636  1.00 65.52  ? 34  GLY I CA    1 
ATOM 4499  C C     . GLY E 1 35  ? 81.336  39.484  21.011  1.00 67.70  ? 34  GLY I C     1 
ATOM 4500  O O     . GLY E 1 35  ? 81.721  38.700  20.151  1.00 68.98  ? 34  GLY I O     1 
ATOM 4501  N N     . HIS E 1 36  ? 81.598  39.327  22.302  1.00 61.27  ? 35  HIS I N     1 
ATOM 4502  C CA    . HIS E 1 36  ? 82.498  38.284  22.771  1.00 63.89  ? 35  HIS I CA    1 
ATOM 4503  C C     . HIS E 1 36  ? 81.863  36.898  22.878  1.00 61.50  ? 35  HIS I C     1 
ATOM 4504  O O     . HIS E 1 36  ? 82.542  35.879  22.717  1.00 63.86  ? 35  HIS I O     1 
ATOM 4505  C CB    . HIS E 1 36  ? 83.137  38.698  24.095  1.00 66.20  ? 35  HIS I CB    1 
ATOM 4506  C CG    . HIS E 1 36  ? 84.099  39.835  23.952  1.00 69.97  ? 35  HIS I CG    1 
ATOM 4507  N ND1   . HIS E 1 36  ? 85.311  39.705  23.309  1.00 73.75  ? 35  HIS I ND1   1 
ATOM 4508  C CD2   . HIS E 1 36  ? 84.019  41.130  24.345  1.00 70.21  ? 35  HIS I CD2   1 
ATOM 4509  C CE1   . HIS E 1 36  ? 85.943  40.865  23.326  1.00 75.62  ? 35  HIS I CE1   1 
ATOM 4510  N NE2   . HIS E 1 36  ? 85.180  41.747  23.948  1.00 73.68  ? 35  HIS I NE2   1 
ATOM 4511  N N     . THR E 1 37  ? 80.567  36.858  23.148  1.00 68.27  ? 36  THR I N     1 
ATOM 4512  C CA    . THR E 1 37  ? 79.878  35.583  23.224  1.00 65.47  ? 36  THR I CA    1 
ATOM 4513  C C     . THR E 1 37  ? 79.703  34.912  21.881  1.00 65.34  ? 36  THR I C     1 
ATOM 4514  O O     . THR E 1 37  ? 80.014  33.733  21.716  1.00 66.34  ? 36  THR I O     1 
ATOM 4515  C CB    . THR E 1 37  ? 78.521  35.715  23.896  1.00 60.88  ? 36  THR I CB    1 
ATOM 4516  O OG1   . THR E 1 37  ? 78.708  36.048  25.281  1.00 61.52  ? 36  THR I OG1   1 
ATOM 4517  C CG2   . THR E 1 37  ? 77.766  34.404  23.792  1.00 57.90  ? 36  THR I CG2   1 
ATOM 4518  N N     . LEU E 1 38  ? 79.199  35.680  20.923  1.00 71.22  ? 37  LEU I N     1 
ATOM 4519  C CA    . LEU E 1 38  ? 79.174  35.249  19.531  1.00 71.60  ? 37  LEU I CA    1 
ATOM 4520  C C     . LEU E 1 38  ? 80.596  34.933  19.029  1.00 76.93  ? 37  LEU I C     1 
ATOM 4521  O O     . LEU E 1 38  ? 80.813  34.035  18.212  1.00 78.32  ? 37  LEU I O     1 
ATOM 4522  C CB    . LEU E 1 38  ? 78.643  36.390  18.657  1.00 70.45  ? 37  LEU I CB    1 
ATOM 4523  C CG    . LEU E 1 38  ? 77.201  36.890  18.792  1.00 67.20  ? 37  LEU I CG    1 
ATOM 4524  C CD1   . LEU E 1 38  ? 76.936  38.103  17.946  1.00 67.46  ? 37  LEU I CD1   1 
ATOM 4525  C CD2   . LEU E 1 38  ? 76.274  35.779  18.373  1.00 63.30  ? 37  LEU I CD2   1 
ATOM 4526  N N     . GLY E 1 39  ? 81.562  35.663  19.587  1.00 67.21  ? 38  GLY I N     1 
ATOM 4527  C CA    . GLY E 1 39  ? 82.965  35.457  19.273  1.00 72.18  ? 38  GLY I CA    1 
ATOM 4528  C C     . GLY E 1 39  ? 83.354  34.102  19.834  1.00 74.01  ? 38  GLY I C     1 
ATOM 4529  O O     . GLY E 1 39  ? 83.955  33.279  19.138  1.00 76.86  ? 38  GLY I O     1 
ATOM 4530  N N     . TYR E 1 40  ? 83.011  33.868  21.097  1.00 74.42  ? 39  TYR I N     1 
ATOM 4531  C CA    . TYR E 1 40  ? 83.347  32.609  21.749  1.00 75.83  ? 39  TYR I CA    1 
ATOM 4532  C C     . TYR E 1 40  ? 82.538  31.471  21.147  1.00 73.14  ? 39  TYR I C     1 
ATOM 4533  O O     . TYR E 1 40  ? 83.018  30.336  21.044  1.00 75.28  ? 39  TYR I O     1 
ATOM 4534  C CB    . TYR E 1 40  ? 83.117  32.687  23.258  1.00 73.73  ? 39  TYR I CB    1 
ATOM 4535  C CG    . TYR E 1 40  ? 83.454  31.404  23.971  1.00 74.99  ? 39  TYR I CG    1 
ATOM 4536  C CD1   . TYR E 1 40  ? 84.750  31.127  24.369  1.00 80.39  ? 39  TYR I CD1   1 
ATOM 4537  C CD2   . TYR E 1 40  ? 82.474  30.467  24.236  1.00 71.06  ? 39  TYR I CD2   1 
ATOM 4538  C CE1   . TYR E 1 40  ? 85.059  29.948  25.015  1.00 81.98  ? 39  TYR I CE1   1 
ATOM 4539  C CE2   . TYR E 1 40  ? 82.768  29.283  24.873  1.00 72.97  ? 39  TYR I CE2   1 
ATOM 4540  C CZ    . TYR E 1 40  ? 84.061  29.022  25.260  1.00 78.45  ? 39  TYR I CZ    1 
ATOM 4541  O OH    . TYR E 1 40  ? 84.343  27.828  25.899  1.00 80.34  ? 39  TYR I OH    1 
ATOM 4542  N N     . LEU E 1 41  ? 81.325  31.789  20.718  1.00 67.66  ? 40  LEU I N     1 
ATOM 4543  C CA    . LEU E 1 41  ? 80.485  30.820  20.044  1.00 64.82  ? 40  LEU I CA    1 
ATOM 4544  C C     . LEU E 1 41  ? 81.144  30.380  18.749  1.00 67.89  ? 40  LEU I C     1 
ATOM 4545  O O     . LEU E 1 41  ? 81.155  29.201  18.415  1.00 68.14  ? 40  LEU I O     1 
ATOM 4546  C CB    . LEU E 1 41  ? 79.135  31.451  19.716  1.00 59.97  ? 40  LEU I CB    1 
ATOM 4547  C CG    . LEU E 1 41  ? 77.959  31.206  20.656  1.00 55.22  ? 40  LEU I CG    1 
ATOM 4548  C CD1   . LEU E 1 41  ? 76.679  31.716  20.017  1.00 51.60  ? 40  LEU I CD1   1 
ATOM 4549  C CD2   . LEU E 1 41  ? 77.835  29.729  20.981  1.00 54.72  ? 40  LEU I CD2   1 
ATOM 4550  N N     . TYR E 1 42  ? 81.696  31.340  18.021  1.00 67.98  ? 41  TYR I N     1 
ATOM 4551  C CA    . TYR E 1 42  ? 82.302  31.065  16.727  1.00 70.38  ? 41  TYR I CA    1 
ATOM 4552  C C     . TYR E 1 42  ? 83.512  30.140  16.823  1.00 74.90  ? 41  TYR I C     1 
ATOM 4553  O O     . TYR E 1 42  ? 83.677  29.229  16.018  1.00 75.30  ? 41  TYR I O     1 
ATOM 4554  C CB    . TYR E 1 42  ? 82.698  32.382  16.059  1.00 71.96  ? 41  TYR I CB    1 
ATOM 4555  C CG    . TYR E 1 42  ? 83.536  32.226  14.813  1.00 75.14  ? 41  TYR I CG    1 
ATOM 4556  C CD1   . TYR E 1 42  ? 83.024  32.549  13.566  1.00 73.61  ? 41  TYR I CD1   1 
ATOM 4557  C CD2   . TYR E 1 42  ? 84.840  31.763  14.884  1.00 79.97  ? 41  TYR I CD2   1 
ATOM 4558  C CE1   . TYR E 1 42  ? 83.785  32.412  12.424  1.00 76.31  ? 41  TYR I CE1   1 
ATOM 4559  C CE2   . TYR E 1 42  ? 85.610  31.622  13.747  1.00 82.33  ? 41  TYR I CE2   1 
ATOM 4560  C CZ    . TYR E 1 42  ? 85.077  31.949  12.521  1.00 80.48  ? 41  TYR I CZ    1 
ATOM 4561  O OH    . TYR E 1 42  ? 85.839  31.810  11.385  1.00 82.38  ? 41  TYR I OH    1 
ATOM 4562  N N     . ALA E 1 43  ? 84.355  30.388  17.814  1.00 74.30  ? 42  ALA I N     1 
ATOM 4563  C CA    . ALA E 1 43  ? 85.562  29.600  18.031  1.00 78.79  ? 42  ALA I CA    1 
ATOM 4564  C C     . ALA E 1 43  ? 85.288  28.148  18.398  1.00 77.38  ? 42  ALA I C     1 
ATOM 4565  O O     . ALA E 1 43  ? 86.012  27.242  17.993  1.00 80.02  ? 42  ALA I O     1 
ATOM 4566  C CB    . ALA E 1 43  ? 86.430  30.254  19.091  1.00 82.41  ? 42  ALA I CB    1 
ATOM 4567  N N     . HIS E 1 44  ? 84.255  27.946  19.203  1.00 75.22  ? 43  HIS I N     1 
ATOM 4568  C CA    . HIS E 1 44  ? 84.052  26.697  19.923  1.00 74.42  ? 43  HIS I CA    1 
ATOM 4569  C C     . HIS E 1 44  ? 82.724  26.090  19.529  1.00 69.00  ? 43  HIS I C     1 
ATOM 4570  O O     . HIS E 1 44  ? 82.241  25.180  20.189  1.00 67.34  ? 43  HIS I O     1 
ATOM 4571  C CB    . HIS E 1 44  ? 84.038  26.938  21.439  1.00 74.95  ? 43  HIS I CB    1 
ATOM 4572  C CG    . HIS E 1 44  ? 85.331  27.445  21.996  1.00 80.54  ? 43  HIS I CG    1 
ATOM 4573  N ND1   . HIS E 1 44  ? 85.915  28.623  21.578  1.00 82.98  ? 43  HIS I ND1   1 
ATOM 4574  C CD2   . HIS E 1 44  ? 86.140  26.946  22.959  1.00 84.34  ? 43  HIS I CD2   1 
ATOM 4575  C CE1   . HIS E 1 44  ? 87.035  28.819  22.248  1.00 87.67  ? 43  HIS I CE1   1 
ATOM 4576  N NE2   . HIS E 1 44  ? 87.194  27.816  23.093  1.00 88.65  ? 43  HIS I NE2   1 
ATOM 4577  N N     . GLN E 1 45  ? 82.124  26.606  18.466  1.00 81.24  ? 44  GLN I N     1 
ATOM 4578  C CA    . GLN E 1 45  ? 80.778  26.191  18.096  1.00 76.62  ? 44  GLN I CA    1 
ATOM 4579  C C     . GLN E 1 45  ? 80.702  24.697  17.833  1.00 76.30  ? 44  GLN I C     1 
ATOM 4580  O O     . GLN E 1 45  ? 79.728  24.045  18.199  1.00 71.34  ? 44  GLN I O     1 
ATOM 4581  C CB    . GLN E 1 45  ? 80.318  26.955  16.864  1.00 79.12  ? 44  GLN I CB    1 
ATOM 4582  C CG    . GLN E 1 45  ? 78.827  27.036  16.689  1.00 73.64  ? 44  GLN I CG    1 
ATOM 4583  C CD    . GLN E 1 45  ? 78.471  27.551  15.313  1.00 77.16  ? 44  GLN I CD    1 
ATOM 4584  O OE1   . GLN E 1 45  ? 77.317  27.481  14.891  1.00 75.06  ? 44  GLN I OE1   1 
ATOM 4585  N NE2   . GLN E 1 45  ? 79.470  28.065  14.595  1.00 82.94  ? 44  GLN I NE2   1 
ATOM 4586  N N     . GLN E 1 46  ? 81.757  24.162  17.227  1.00 86.06  ? 45  GLN I N     1 
ATOM 4587  C CA    . GLN E 1 46  ? 81.822  22.746  16.875  1.00 85.93  ? 45  GLN I CA    1 
ATOM 4588  C C     . GLN E 1 46  ? 81.824  21.719  18.002  1.00 81.24  ? 45  GLN I C     1 
ATOM 4589  O O     . GLN E 1 46  ? 81.830  20.514  17.745  1.00 80.44  ? 45  GLN I O     1 
ATOM 4590  C CB    . GLN E 1 46  ? 83.056  22.449  16.021  1.00 92.69  ? 45  GLN I CB    1 
ATOM 4591  C CG    . GLN E 1 46  ? 84.371  22.551  16.766  1.00 97.64  ? 45  GLN I CG    1 
ATOM 4592  C CD    . GLN E 1 46  ? 84.778  23.975  17.022  1.00 99.50  ? 45  GLN I CD    1 
ATOM 4593  O OE1   . GLN E 1 46  ? 84.071  24.907  16.638  1.00 97.46  ? 45  GLN I OE1   1 
ATOM 4594  N NE2   . GLN E 1 46  ? 85.925  24.158  17.665  1.00 103.42 ? 45  GLN I NE2   1 
ATOM 4595  N N     . ASP E 1 47  ? 81.793  22.196  19.242  1.00 90.56  ? 46  ASP I N     1 
ATOM 4596  C CA    . ASP E 1 47  ? 82.021  21.335  20.390  1.00 87.15  ? 46  ASP I CA    1 
ATOM 4597  C C     . ASP E 1 47  ? 80.895  20.491  21.054  1.00 81.40  ? 46  ASP I C     1 
ATOM 4598  O O     . ASP E 1 47  ? 81.211  19.569  21.794  1.00 80.23  ? 46  ASP I O     1 
ATOM 4599  C CB    . ASP E 1 47  ? 82.699  22.033  21.566  1.00 87.27  ? 46  ASP I CB    1 
ATOM 4600  C CG    . ASP E 1 47  ? 84.158  22.340  21.284  1.00 93.85  ? 46  ASP I CG    1 
ATOM 4601  O OD1   . ASP E 1 47  ? 84.703  21.767  20.315  1.00 97.50  ? 46  ASP I OD1   1 
ATOM 4602  O OD2   . ASP E 1 47  ? 84.761  23.147  22.026  1.00 95.67  ? 46  ASP I OD2   1 
ATOM 4603  N N     . GLY E 1 48  ? 79.614  20.794  20.854  1.00 76.88  ? 47  GLY I N     1 
ATOM 4604  C CA    . GLY E 1 48  ? 79.099  22.086  20.477  1.00 77.00  ? 47  GLY I CA    1 
ATOM 4605  C C     . GLY E 1 48  ? 78.435  22.467  21.782  1.00 72.16  ? 47  GLY I C     1 
ATOM 4606  O O     . GLY E 1 48  ? 77.876  21.621  22.480  1.00 68.72  ? 47  GLY I O     1 
ATOM 4607  N N     . LEU E 1 49  ? 78.502  23.745  22.116  1.00 76.16  ? 48  LEU I N     1 
ATOM 4608  C CA    . LEU E 1 49  ? 78.211  24.200  23.462  1.00 72.29  ? 48  LEU I CA    1 
ATOM 4609  C C     . LEU E 1 49  ? 76.740  24.099  23.901  1.00 67.87  ? 48  LEU I C     1 
ATOM 4610  O O     . LEU E 1 49  ? 75.815  24.192  23.088  1.00 67.98  ? 48  LEU I O     1 
ATOM 4611  C CB    . LEU E 1 49  ? 78.722  25.622  23.592  1.00 73.80  ? 48  LEU I CB    1 
ATOM 4612  C CG    . LEU E 1 49  ? 80.171  25.619  23.129  1.00 79.10  ? 48  LEU I CG    1 
ATOM 4613  C CD1   . LEU E 1 49  ? 80.603  26.989  22.643  1.00 82.62  ? 48  LEU I CD1   1 
ATOM 4614  C CD2   . LEU E 1 49  ? 81.044  25.147  24.266  1.00 79.10  ? 48  LEU I CD2   1 
ATOM 4615  N N     . THR E 1 50  ? 76.547  23.877  25.198  1.00 81.45  ? 49  THR I N     1 
ATOM 4616  C CA    . THR E 1 50  ? 75.252  24.061  25.835  1.00 78.85  ? 49  THR I CA    1 
ATOM 4617  C C     . THR E 1 50  ? 75.317  25.441  26.467  1.00 78.12  ? 49  THR I C     1 
ATOM 4618  O O     . THR E 1 50  ? 76.386  26.051  26.507  1.00 79.72  ? 49  THR I O     1 
ATOM 4619  C CB    . THR E 1 50  ? 74.982  22.995  26.921  1.00 77.57  ? 49  THR I CB    1 
ATOM 4620  O OG1   . THR E 1 50  ? 75.141  23.574  28.224  1.00 76.53  ? 49  THR I OG1   1 
ATOM 4621  C CG2   . THR E 1 50  ? 75.937  21.816  26.764  1.00 78.72  ? 49  THR I CG2   1 
ATOM 4622  N N     . GLN E 1 51  ? 74.194  25.944  26.961  1.00 52.65  ? 50  GLN I N     1 
ATOM 4623  C CA    . GLN E 1 51  ? 74.186  27.324  27.432  1.00 52.07  ? 50  GLN I CA    1 
ATOM 4624  C C     . GLN E 1 51  ? 75.024  27.450  28.686  1.00 51.57  ? 50  GLN I C     1 
ATOM 4625  O O     . GLN E 1 51  ? 75.691  28.453  28.910  1.00 51.37  ? 50  GLN I O     1 
ATOM 4626  C CB    . GLN E 1 51  ? 72.764  27.847  27.661  1.00 51.92  ? 50  GLN I CB    1 
ATOM 4627  C CG    . GLN E 1 51  ? 71.939  27.972  26.393  1.00 52.61  ? 50  GLN I CG    1 
ATOM 4628  C CD    . GLN E 1 51  ? 70.563  28.579  26.628  1.00 52.79  ? 50  GLN I CD    1 
ATOM 4629  O OE1   . GLN E 1 51  ? 69.789  28.766  25.688  1.00 53.53  ? 50  GLN I OE1   1 
ATOM 4630  N NE2   . GLN E 1 51  ? 70.254  28.895  27.882  1.00 52.33  ? 50  GLN I NE2   1 
ATOM 4631  N N     . ASN E 1 52  ? 75.016  26.417  29.505  1.00 63.35  ? 51  ASN I N     1 
ATOM 4632  C CA    . ASN E 1 52  ? 75.819  26.494  30.707  1.00 63.54  ? 51  ASN I CA    1 
ATOM 4633  C C     . ASN E 1 52  ? 77.318  26.395  30.422  1.00 65.75  ? 51  ASN I C     1 
ATOM 4634  O O     . ASN E 1 52  ? 78.144  26.838  31.218  1.00 67.12  ? 51  ASN I O     1 
ATOM 4635  C CB    . ASN E 1 52  ? 75.379  25.460  31.732  1.00 63.27  ? 51  ASN I CB    1 
ATOM 4636  C CG    . ASN E 1 52  ? 75.964  25.727  33.086  1.00 64.03  ? 51  ASN I CG    1 
ATOM 4637  O OD1   . ASN E 1 52  ? 75.497  26.608  33.820  1.00 64.44  ? 51  ASN I OD1   1 
ATOM 4638  N ND2   . ASN E 1 52  ? 77.013  24.988  33.424  1.00 65.08  ? 51  ASN I ND2   1 
ATOM 4639  N N     . ASP E 1 53  ? 77.663  25.828  29.275  1.00 65.53  ? 52  ASP I N     1 
ATOM 4640  C CA    . ASP E 1 53  ? 79.050  25.781  28.866  1.00 68.81  ? 52  ASP I CA    1 
ATOM 4641  C C     . ASP E 1 53  ? 79.552  27.200  28.755  1.00 70.68  ? 52  ASP I C     1 
ATOM 4642  O O     . ASP E 1 53  ? 80.691  27.503  29.097  1.00 73.90  ? 52  ASP I O     1 
ATOM 4643  C CB    . ASP E 1 53  ? 79.193  25.046  27.535  1.00 70.48  ? 52  ASP I CB    1 
ATOM 4644  C CG    . ASP E 1 53  ? 78.899  23.569  27.664  1.00 69.56  ? 52  ASP I CG    1 
ATOM 4645  O OD1   . ASP E 1 53  ? 78.792  23.091  28.821  1.00 68.15  ? 52  ASP I OD1   1 
ATOM 4646  O OD2   . ASP E 1 53  ? 78.786  22.882  26.624  1.00 70.62  ? 52  ASP I OD2   1 
ATOM 4647  N N     . ILE E 1 54  ? 78.668  28.076  28.301  1.00 73.33  ? 53  ILE I N     1 
ATOM 4648  C CA    . ILE E 1 54  ? 79.017  29.466  28.045  1.00 74.89  ? 53  ILE I CA    1 
ATOM 4649  C C     . ILE E 1 54  ? 79.087  30.254  29.344  1.00 73.91  ? 53  ILE I C     1 
ATOM 4650  O O     . ILE E 1 54  ? 79.968  31.095  29.536  1.00 76.19  ? 53  ILE I O     1 
ATOM 4651  C CB    . ILE E 1 54  ? 78.013  30.096  27.074  1.00 73.30  ? 53  ILE I CB    1 
ATOM 4652  C CG1   . ILE E 1 54  ? 78.212  29.495  25.686  1.00 75.86  ? 53  ILE I CG1   1 
ATOM 4653  C CG2   . ILE E 1 54  ? 78.184  31.584  27.017  1.00 73.90  ? 53  ILE I CG2   1 
ATOM 4654  C CD1   . ILE E 1 54  ? 76.921  29.237  24.952  1.00 74.00  ? 53  ILE I CD1   1 
ATOM 4655  N N     . ALA E 1 55  ? 78.169  29.945  30.249  1.00 62.06  ? 54  ALA I N     1 
ATOM 4656  C CA    . ALA E 1 55  ? 78.136  30.572  31.564  1.00 61.78  ? 54  ALA I CA    1 
ATOM 4657  C C     . ALA E 1 55  ? 79.437  30.378  32.325  1.00 64.63  ? 54  ALA I C     1 
ATOM 4658  O O     . ALA E 1 55  ? 79.772  31.164  33.202  1.00 65.56  ? 54  ALA I O     1 
ATOM 4659  C CB    . ALA E 1 55  ? 76.981  30.011  32.371  1.00 59.69  ? 54  ALA I CB    1 
ATOM 4660  N N     . LYS E 1 56  ? 80.156  29.315  31.988  1.00 59.29  ? 55  LYS I N     1 
ATOM 4661  C CA    . LYS E 1 56  ? 81.380  28.947  32.689  1.00 62.35  ? 55  LYS I CA    1 
ATOM 4662  C C     . LYS E 1 56  ? 82.572  29.571  31.984  1.00 67.14  ? 55  LYS I C     1 
ATOM 4663  O O     . LYS E 1 56  ? 83.488  30.080  32.623  1.00 70.50  ? 55  LYS I O     1 
ATOM 4664  C CB    . LYS E 1 56  ? 81.520  27.416  32.759  1.00 62.29  ? 55  LYS I CB    1 
ATOM 4665  N N     . ALA E 1 57  ? 82.536  29.530  30.658  1.00 57.95  ? 56  ALA I N     1 
ATOM 4666  C CA    . ALA E 1 57  ? 83.592  30.082  29.819  1.00 62.64  ? 56  ALA I CA    1 
ATOM 4667  C C     . ALA E 1 57  ? 83.712  31.581  30.025  1.00 63.22  ? 56  ALA I C     1 
ATOM 4668  O O     . ALA E 1 57  ? 84.802  32.107  30.279  1.00 67.65  ? 56  ALA I O     1 
ATOM 4669  C CB    . ALA E 1 57  ? 83.293  29.794  28.360  1.00 63.28  ? 56  ALA I CB    1 
ATOM 4670  N N     . LEU E 1 58  ? 82.575  32.256  29.908  1.00 70.93  ? 57  LEU I N     1 
ATOM 4671  C CA    . LEU E 1 58  ? 82.534  33.703  29.911  1.00 70.71  ? 57  LEU I CA    1 
ATOM 4672  C C     . LEU E 1 58  ? 82.248  34.218  31.328  1.00 68.45  ? 57  LEU I C     1 
ATOM 4673  O O     . LEU E 1 58  ? 82.120  35.423  31.558  1.00 67.88  ? 57  LEU I O     1 
ATOM 4674  C CB    . LEU E 1 58  ? 81.505  34.202  28.883  1.00 67.80  ? 57  LEU I CB    1 
ATOM 4675  N N     . GLN E 1 59  ? 82.163  33.293  32.275  1.00 71.53  ? 58  GLN I N     1 
ATOM 4676  C CA    . GLN E 1 59  ? 82.007  33.635  33.689  1.00 70.80  ? 58  GLN I CA    1 
ATOM 4677  C C     . GLN E 1 59  ? 80.865  34.595  34.029  1.00 67.26  ? 58  GLN I C     1 
ATOM 4678  O O     . GLN E 1 59  ? 81.084  35.644  34.632  1.00 68.02  ? 58  GLN I O     1 
ATOM 4679  C CB    . GLN E 1 59  ? 83.321  34.155  34.262  1.00 75.64  ? 58  GLN I CB    1 
ATOM 4680  C CG    . GLN E 1 59  ? 84.178  33.070  34.861  1.00 79.10  ? 58  GLN I CG    1 
ATOM 4681  C CD    . GLN E 1 59  ? 85.543  33.572  35.273  1.00 84.89  ? 58  GLN I CD    1 
ATOM 4682  O OE1   . GLN E 1 59  ? 86.044  33.226  36.343  1.00 87.19  ? 58  GLN I OE1   1 
ATOM 4683  N NE2   . GLN E 1 59  ? 86.161  34.387  34.420  1.00 87.57  ? 58  GLN I NE2   1 
ATOM 4684  N N     . ARG E 1 60  ? 79.648  34.227  33.642  1.00 61.50  ? 59  ARG I N     1 
ATOM 4685  C CA    . ARG E 1 60  ? 78.447  34.930  34.077  1.00 58.88  ? 59  ARG I CA    1 
ATOM 4686  C C     . ARG E 1 60  ? 77.414  33.925  34.574  1.00 57.48  ? 59  ARG I C     1 
ATOM 4687  O O     . ARG E 1 60  ? 77.432  32.752  34.185  1.00 57.41  ? 59  ARG I O     1 
ATOM 4688  C CB    . ARG E 1 60  ? 77.847  35.733  32.928  1.00 57.76  ? 59  ARG I CB    1 
ATOM 4689  C CG    . ARG E 1 60  ? 78.745  36.823  32.386  1.00 59.65  ? 59  ARG I CG    1 
ATOM 4690  C CD    . ARG E 1 60  ? 78.847  37.995  33.339  1.00 60.00  ? 59  ARG I CD    1 
ATOM 4691  N NE    . ARG E 1 60  ? 79.972  38.832  32.956  1.00 62.28  ? 59  ARG I NE    1 
ATOM 4692  C CZ    . ARG E 1 60  ? 81.214  38.631  33.381  1.00 65.67  ? 59  ARG I CZ    1 
ATOM 4693  N NH1   . ARG E 1 60  ? 81.470  37.633  34.216  1.00 66.45  ? 59  ARG I NH1   1 
ATOM 4694  N NH2   . ARG E 1 60  ? 82.194  39.430  32.978  1.00 68.53  ? 59  ARG I NH2   1 
ATOM 4695  N N     . THR E 1 61  ? 76.508  34.386  35.428  1.00 65.92  ? 60  THR I N     1 
ATOM 4696  C CA    . THR E 1 61  ? 75.473  33.513  35.964  1.00 65.50  ? 60  THR I CA    1 
ATOM 4697  C C     . THR E 1 61  ? 74.548  33.006  34.861  1.00 64.21  ? 60  THR I C     1 
ATOM 4698  O O     . THR E 1 61  ? 74.332  33.695  33.864  1.00 63.31  ? 60  THR I O     1 
ATOM 4699  C CB    . THR E 1 61  ? 74.612  34.238  37.000  1.00 66.36  ? 60  THR I CB    1 
ATOM 4700  O OG1   . THR E 1 61  ? 73.767  35.182  36.334  1.00 65.72  ? 60  THR I OG1   1 
ATOM 4701  C CG2   . THR E 1 61  ? 75.487  34.952  38.015  1.00 67.87  ? 60  THR I CG2   1 
ATOM 4702  N N     . GLY E 1 62  ? 74.009  31.803  35.056  1.00 49.76  ? 61  GLY I N     1 
ATOM 4703  C CA    . GLY E 1 62  ? 73.017  31.228  34.165  1.00 49.99  ? 61  GLY I CA    1 
ATOM 4704  C C     . GLY E 1 62  ? 71.865  32.106  33.692  1.00 50.53  ? 61  GLY I C     1 
ATOM 4705  O O     . GLY E 1 62  ? 71.530  32.080  32.512  1.00 50.87  ? 61  GLY I O     1 
ATOM 4706  N N     . PRO E 1 63  ? 71.230  32.866  34.600  1.00 62.63  ? 62  PRO I N     1 
ATOM 4707  C CA    . PRO E 1 63  ? 70.201  33.813  34.146  1.00 63.12  ? 62  PRO I CA    1 
ATOM 4708  C C     . PRO E 1 63  ? 70.740  34.820  33.133  1.00 61.63  ? 62  PRO I C     1 
ATOM 4709  O O     . PRO E 1 63  ? 70.070  35.062  32.129  1.00 61.68  ? 62  PRO I O     1 
ATOM 4710  C CB    . PRO E 1 63  ? 69.818  34.549  35.430  1.00 64.62  ? 62  PRO I CB    1 
ATOM 4711  C CG    . PRO E 1 63  ? 70.053  33.558  36.492  1.00 65.62  ? 62  PRO I CG    1 
ATOM 4712  C CD    . PRO E 1 63  ? 71.275  32.782  36.069  1.00 63.84  ? 62  PRO I CD    1 
ATOM 4713  N N     . THR E 1 64  ? 71.919  35.386  33.393  1.00 60.32  ? 63  THR I N     1 
ATOM 4714  C CA    . THR E 1 64  ? 72.526  36.339  32.470  1.00 59.48  ? 63  THR I CA    1 
ATOM 4715  C C     . THR E 1 64  ? 72.587  35.733  31.087  1.00 58.97  ? 63  THR I C     1 
ATOM 4716  O O     . THR E 1 64  ? 71.969  36.234  30.154  1.00 59.03  ? 63  THR I O     1 
ATOM 4717  C CB    . THR E 1 64  ? 73.960  36.736  32.858  1.00 59.41  ? 63  THR I CB    1 
ATOM 4718  O OG1   . THR E 1 64  ? 73.974  37.357  34.149  1.00 60.47  ? 63  THR I OG1   1 
ATOM 4719  C CG2   . THR E 1 64  ? 74.542  37.679  31.801  1.00 59.32  ? 63  THR I CG2   1 
ATOM 4720  N N     . VAL E 1 65  ? 73.336  34.647  30.966  1.00 51.69  ? 64  VAL I N     1 
ATOM 4721  C CA    . VAL E 1 65  ? 73.467  33.947  29.696  1.00 51.86  ? 64  VAL I CA    1 
ATOM 4722  C C     . VAL E 1 65  ? 72.143  33.745  28.927  1.00 52.46  ? 64  VAL I C     1 
ATOM 4723  O O     . VAL E 1 65  ? 72.078  33.990  27.720  1.00 53.20  ? 64  VAL I O     1 
ATOM 4724  C CB    . VAL E 1 65  ? 74.209  32.625  29.921  1.00 51.19  ? 64  VAL I CB    1 
ATOM 4725  C CG1   . VAL E 1 65  ? 74.265  31.824  28.650  1.00 51.54  ? 64  VAL I CG1   1 
ATOM 4726  C CG2   . VAL E 1 65  ? 75.607  32.912  30.414  1.00 50.98  ? 64  VAL I CG2   1 
ATOM 4727  N N     . SER E 1 66  ? 71.082  33.353  29.629  1.00 52.37  ? 65  SER I N     1 
ATOM 4728  C CA    . SER E 1 66  ? 69.786  33.156  28.976  1.00 53.14  ? 65  SER I CA    1 
ATOM 4729  C C     . SER E 1 66  ? 69.268  34.473  28.384  1.00 54.39  ? 65  SER I C     1 
ATOM 4730  O O     . SER E 1 66  ? 68.658  34.501  27.320  1.00 55.31  ? 65  SER I O     1 
ATOM 4731  C CB    . SER E 1 66  ? 68.765  32.548  29.950  1.00 53.06  ? 65  SER I CB    1 
ATOM 4732  O OG    . SER E 1 66  ? 67.576  32.150  29.284  1.00 53.89  ? 65  SER I OG    1 
ATOM 4733  N N     . ASN E 1 67  ? 69.533  35.567  29.071  1.00 62.21  ? 66  ASN I N     1 
ATOM 4734  C CA    . ASN E 1 67  ? 69.034  36.849  28.616  1.00 63.11  ? 66  ASN I CA    1 
ATOM 4735  C C     . ASN E 1 67  ? 69.826  37.364  27.417  1.00 63.58  ? 66  ASN I C     1 
ATOM 4736  O O     . ASN E 1 67  ? 69.248  37.904  26.470  1.00 65.14  ? 66  ASN I O     1 
ATOM 4737  C CB    . ASN E 1 67  ? 69.067  37.870  29.750  1.00 63.32  ? 66  ASN I CB    1 
ATOM 4738  C CG    . ASN E 1 67  ? 68.032  38.933  29.584  1.00 65.23  ? 66  ASN I CG    1 
ATOM 4739  O OD1   . ASN E 1 67  ? 68.342  40.067  29.226  1.00 66.40  ? 66  ASN I OD1   1 
ATOM 4740  N ND2   . ASN E 1 67  ? 66.779  38.573  29.825  1.00 65.99  ? 66  ASN I ND2   1 
ATOM 4741  N N     . LEU E 1 68  ? 71.147  37.198  27.466  1.00 70.25  ? 67  LEU I N     1 
ATOM 4742  C CA    . LEU E 1 68  ? 72.009  37.629  26.375  1.00 70.95  ? 67  LEU I CA    1 
ATOM 4743  C C     . LEU E 1 68  ? 71.683  36.836  25.119  1.00 71.86  ? 67  LEU I C     1 
ATOM 4744  O O     . LEU E 1 68  ? 71.533  37.404  24.028  1.00 73.40  ? 67  LEU I O     1 
ATOM 4745  C CB    . LEU E 1 68  ? 73.473  37.443  26.738  1.00 69.98  ? 67  LEU I CB    1 
ATOM 4746  C CG    . LEU E 1 68  ? 74.368  38.080  25.680  1.00 71.16  ? 67  LEU I CG    1 
ATOM 4747  C CD1   . LEU E 1 68  ? 75.641  38.638  26.292  1.00 71.33  ? 67  LEU I CD1   1 
ATOM 4748  C CD2   . LEU E 1 68  ? 74.678  37.091  24.576  1.00 71.94  ? 67  LEU I CD2   1 
ATOM 4749  N N     . LEU E 1 69  ? 71.563  35.518  25.293  1.00 61.09  ? 68  LEU I N     1 
ATOM 4750  C CA    . LEU E 1 69  ? 71.204  34.608  24.216  1.00 61.65  ? 68  LEU I CA    1 
ATOM 4751  C C     . LEU E 1 69  ? 69.795  34.845  23.694  1.00 62.89  ? 68  LEU I C     1 
ATOM 4752  O O     . LEU E 1 69  ? 69.553  34.693  22.497  1.00 64.25  ? 68  LEU I O     1 
ATOM 4753  C CB    . LEU E 1 69  ? 71.360  33.165  24.686  1.00 61.42  ? 68  LEU I CB    1 
ATOM 4754  C CG    . LEU E 1 69  ? 72.798  32.701  24.937  1.00 61.07  ? 68  LEU I CG    1 
ATOM 4755  C CD1   . LEU E 1 69  ? 72.857  31.206  25.197  1.00 61.09  ? 68  LEU I CD1   1 
ATOM 4756  C CD2   . LEU E 1 69  ? 73.712  33.081  23.782  1.00 62.54  ? 68  LEU I CD2   1 
ATOM 4757  N N     . ARG E 1 70  ? 68.871  35.217  24.584  1.00 70.94  ? 69  ARG I N     1 
ATOM 4758  C CA    . ARG E 1 70  ? 67.501  35.553  24.175  1.00 72.87  ? 69  ARG I CA    1 
ATOM 4759  C C     . ARG E 1 70  ? 67.565  36.679  23.186  1.00 74.37  ? 69  ARG I C     1 
ATOM 4760  O O     . ARG E 1 70  ? 66.890  36.662  22.165  1.00 76.33  ? 69  ARG I O     1 
ATOM 4761  C CB    . ARG E 1 70  ? 66.636  36.001  25.356  1.00 73.08  ? 69  ARG I CB    1 
ATOM 4762  N N     . ASN E 1 71  ? 68.394  37.661  23.507  1.00 77.39  ? 70  ASN I N     1 
ATOM 4763  C CA    . ASN E 1 71  ? 68.560  38.810  22.651  1.00 79.10  ? 70  ASN I CA    1 
ATOM 4764  C C     . ASN E 1 71  ? 69.221  38.401  21.342  1.00 79.76  ? 70  ASN I C     1 
ATOM 4765  O O     . ASN E 1 71  ? 68.802  38.829  20.270  1.00 81.85  ? 70  ASN I O     1 
ATOM 4766  C CB    . ASN E 1 71  ? 69.351  39.898  23.375  1.00 79.28  ? 70  ASN I CB    1 
ATOM 4767  C CG    . ASN E 1 71  ? 68.649  40.387  24.636  1.00 79.52  ? 70  ASN I CG    1 
ATOM 4768  O OD1   . ASN E 1 71  ? 67.442  40.199  24.804  1.00 80.52  ? 70  ASN I OD1   1 
ATOM 4769  N ND2   . ASN E 1 71  ? 69.408  41.020  25.528  1.00 78.99  ? 70  ASN I ND2   1 
ATOM 4770  N N     . LEU E 1 72  ? 70.232  37.544  21.422  1.00 64.04  ? 71  LEU I N     1 
ATOM 4771  C CA    . LEU E 1 72  ? 70.897  37.063  20.212  1.00 64.42  ? 71  LEU I CA    1 
ATOM 4772  C C     . LEU E 1 72  ? 69.983  36.220  19.316  1.00 65.73  ? 71  LEU I C     1 
ATOM 4773  O O     . LEU E 1 72  ? 70.000  36.354  18.090  1.00 67.86  ? 71  LEU I O     1 
ATOM 4774  C CB    . LEU E 1 72  ? 72.180  36.311  20.556  1.00 63.46  ? 71  LEU I CB    1 
ATOM 4775  C CG    . LEU E 1 72  ? 73.263  37.263  21.060  1.00 63.23  ? 71  LEU I CG    1 
ATOM 4776  C CD1   . LEU E 1 72  ? 74.493  36.517  21.570  1.00 63.36  ? 71  LEU I CD1   1 
ATOM 4777  C CD2   . LEU E 1 72  ? 73.638  38.215  19.948  1.00 65.15  ? 71  LEU I CD2   1 
ATOM 4778  N N     . GLU E 1 73  ? 69.180  35.356  19.923  1.00 61.14  ? 72  GLU I N     1 
ATOM 4779  C CA    . GLU E 1 73  ? 68.206  34.601  19.158  1.00 61.82  ? 72  GLU I CA    1 
ATOM 4780  C C     . GLU E 1 73  ? 67.256  35.592  18.451  1.00 64.00  ? 72  GLU I C     1 
ATOM 4781  O O     . GLU E 1 73  ? 66.880  35.393  17.299  1.00 65.30  ? 72  GLU I O     1 
ATOM 4782  C CB    . GLU E 1 73  ? 67.468  33.605  20.066  1.00 60.67  ? 72  GLU I CB    1 
ATOM 4783  C CG    . GLU E 1 73  ? 66.575  32.617  19.331  1.00 61.26  ? 72  GLU I CG    1 
ATOM 4784  C CD    . GLU E 1 73  ? 66.524  31.217  19.972  1.00 59.92  ? 72  GLU I CD    1 
ATOM 4785  O OE1   . GLU E 1 73  ? 66.347  31.096  21.215  1.00 58.94  ? 72  GLU I OE1   1 
ATOM 4786  O OE2   . GLU E 1 73  ? 66.656  30.226  19.210  1.00 60.05  ? 72  GLU I OE2   1 
ATOM 4787  N N     . ARG E 1 74  ? 66.912  36.689  19.120  1.00 64.64  ? 73  ARG I N     1 
ATOM 4788  C CA    . ARG E 1 74  ? 65.983  37.655  18.545  1.00 67.05  ? 73  ARG I CA    1 
ATOM 4789  C C     . ARG E 1 74  ? 66.598  38.345  17.326  1.00 68.68  ? 73  ARG I C     1 
ATOM 4790  O O     . ARG E 1 74  ? 65.892  38.724  16.391  1.00 70.84  ? 73  ARG I O     1 
ATOM 4791  C CB    . ARG E 1 74  ? 65.529  38.674  19.597  1.00 67.61  ? 73  ARG I CB    1 
ATOM 4792  N N     . LYS E 1 75  ? 67.922  38.486  17.332  1.00 67.84  ? 74  LYS I N     1 
ATOM 4793  C CA    . LYS E 1 75  ? 68.633  39.105  16.218  1.00 69.45  ? 74  LYS I CA    1 
ATOM 4794  C C     . LYS E 1 75  ? 68.863  38.098  15.102  1.00 69.47  ? 74  LYS I C     1 
ATOM 4795  O O     . LYS E 1 75  ? 69.379  38.449  14.040  1.00 70.99  ? 74  LYS I O     1 
ATOM 4796  C CB    . LYS E 1 75  ? 69.974  39.667  16.682  1.00 68.79  ? 74  LYS I CB    1 
ATOM 4797  C CG    . LYS E 1 75  ? 69.866  40.672  17.816  1.00 68.82  ? 74  LYS I CG    1 
ATOM 4798  C CD    . LYS E 1 75  ? 70.958  41.729  17.741  1.00 69.77  ? 74  LYS I CD    1 
ATOM 4799  C CE    . LYS E 1 75  ? 71.066  42.499  19.043  1.00 69.30  ? 74  LYS I CE    1 
ATOM 4800  N NZ    . LYS E 1 75  ? 71.853  43.760  18.895  1.00 70.99  ? 74  LYS I NZ    1 
ATOM 4801  N N     . LYS E 1 76  ? 68.481  36.848  15.367  1.00 67.96  ? 75  LYS I N     1 
ATOM 4802  C CA    . LYS E 1 76  ? 68.647  35.730  14.439  1.00 67.88  ? 75  LYS I CA    1 
ATOM 4803  C C     . LYS E 1 76  ? 70.119  35.446  14.103  1.00 67.35  ? 75  LYS I C     1 
ATOM 4804  O O     . LYS E 1 76  ? 70.436  34.914  13.045  1.00 68.16  ? 75  LYS I O     1 
ATOM 4805  C CB    . LYS E 1 76  ? 67.804  35.930  13.174  1.00 70.21  ? 75  LYS I CB    1 
ATOM 4806  N N     . LEU E 1 77  ? 71.012  35.781  15.025  1.00 66.15  ? 76  LEU I N     1 
ATOM 4807  C CA    . LEU E 1 77  ? 72.437  35.555  14.826  1.00 65.81  ? 76  LEU I CA    1 
ATOM 4808  C C     . LEU E 1 77  ? 72.906  34.208  15.392  1.00 63.98  ? 76  LEU I C     1 
ATOM 4809  O O     . LEU E 1 77  ? 73.955  33.691  15.007  1.00 65.01  ? 76  LEU I O     1 
ATOM 4810  C CB    . LEU E 1 77  ? 73.234  36.698  15.445  1.00 65.88  ? 76  LEU I CB    1 
ATOM 4811  C CG    . LEU E 1 77  ? 72.953  38.058  14.806  1.00 68.13  ? 76  LEU I CG    1 
ATOM 4812  C CD1   . LEU E 1 77  ? 73.455  39.158  15.701  1.00 68.06  ? 76  LEU I CD1   1 
ATOM 4813  C CD2   . LEU E 1 77  ? 73.606  38.136  13.443  1.00 69.95  ? 76  LEU I CD2   1 
ATOM 4814  N N     . ILE E 1 78  ? 72.136  33.649  16.315  1.00 69.03  ? 77  ILE I N     1 
ATOM 4815  C CA    . ILE E 1 78  ? 72.366  32.287  16.762  1.00 69.13  ? 77  ILE I CA    1 
ATOM 4816  C C     . ILE E 1 78  ? 71.084  31.523  16.567  1.00 69.86  ? 77  ILE I C     1 
ATOM 4817  O O     . ILE E 1 78  ? 70.101  32.064  16.059  1.00 70.67  ? 77  ILE I O     1 
ATOM 4818  C CB    . ILE E 1 78  ? 72.687  32.221  18.248  1.00 65.92  ? 77  ILE I CB    1 
ATOM 4819  C CG1   . ILE E 1 78  ? 71.463  32.656  19.058  1.00 63.73  ? 77  ILE I CG1   1 
ATOM 4820  C CG2   . ILE E 1 78  ? 73.899  33.075  18.563  1.00 65.75  ? 77  ILE I CG2   1 
ATOM 4821  C CD1   . ILE E 1 78  ? 71.702  32.754  20.535  1.00 61.12  ? 77  ILE I CD1   1 
ATOM 4822  N N     . TYR E 1 79  ? 71.096  30.262  16.976  1.00 61.30  ? 78  TYR I N     1 
ATOM 4823  C CA    . TYR E 1 79  ? 69.894  29.453  16.994  1.00 61.52  ? 78  TYR I CA    1 
ATOM 4824  C C     . TYR E 1 79  ? 70.070  28.470  18.129  1.00 59.79  ? 78  TYR I C     1 
ATOM 4825  O O     . TYR E 1 79  ? 71.197  28.096  18.452  1.00 59.18  ? 78  TYR I O     1 
ATOM 4826  C CB    . TYR E 1 79  ? 69.685  28.732  15.652  1.00 64.11  ? 78  TYR I CB    1 
ATOM 4827  C CG    . TYR E 1 79  ? 70.746  27.709  15.329  1.00 65.55  ? 78  TYR I CG    1 
ATOM 4828  C CD1   . TYR E 1 79  ? 70.568  26.373  15.659  1.00 65.55  ? 78  TYR I CD1   1 
ATOM 4829  C CD2   . TYR E 1 79  ? 71.936  28.081  14.710  1.00 67.36  ? 78  TYR I CD2   1 
ATOM 4830  C CE1   . TYR E 1 79  ? 71.545  25.433  15.389  1.00 67.03  ? 78  TYR I CE1   1 
ATOM 4831  C CE2   . TYR E 1 79  ? 72.923  27.141  14.434  1.00 69.60  ? 78  TYR I CE2   1 
ATOM 4832  C CZ    . TYR E 1 79  ? 72.716  25.822  14.780  1.00 69.26  ? 78  TYR I CZ    1 
ATOM 4833  O OH    . TYR E 1 79  ? 73.675  24.881  14.511  1.00 71.57  ? 78  TYR I OH    1 
ATOM 4834  N N     . ARG E 1 80  ? 68.972  28.066  18.757  1.00 75.81  ? 79  ARG I N     1 
ATOM 4835  C CA    . ARG E 1 80  ? 69.054  27.151  19.887  1.00 73.92  ? 79  ARG I CA    1 
ATOM 4836  C C     . ARG E 1 80  ? 68.099  25.989  19.694  1.00 75.98  ? 79  ARG I C     1 
ATOM 4837  O O     . ARG E 1 80  ? 67.010  26.166  19.150  1.00 78.58  ? 79  ARG I O     1 
ATOM 4838  C CB    . ARG E 1 80  ? 68.721  27.880  21.186  1.00 71.62  ? 79  ARG I CB    1 
ATOM 4839  C CG    . ARG E 1 80  ? 69.418  29.218  21.331  1.00 70.15  ? 79  ARG I CG    1 
ATOM 4840  C CD    . ARG E 1 80  ? 69.246  29.796  22.715  1.00 68.10  ? 79  ARG I CD    1 
ATOM 4841  N NE    . ARG E 1 80  ? 67.909  30.331  22.908  1.00 69.37  ? 79  ARG I NE    1 
ATOM 4842  C CZ    . ARG E 1 80  ? 67.334  30.453  24.095  1.00 68.59  ? 79  ARG I CZ    1 
ATOM 4843  N NH1   . ARG E 1 80  ? 67.982  30.057  25.183  1.00 66.45  ? 79  ARG I NH1   1 
ATOM 4844  N NH2   . ARG E 1 80  ? 66.112  30.960  24.193  1.00 70.97  ? 79  ARG I NH2   1 
ATOM 4845  N N     . TYR E 1 81  ? 68.508  24.803  20.138  1.00 60.67  ? 80  TYR I N     1 
ATOM 4846  C CA    . TYR E 1 81  ? 67.657  23.616  20.052  1.00 62.32  ? 80  TYR I CA    1 
ATOM 4847  C C     . TYR E 1 81  ? 67.892  22.646  21.199  1.00 60.19  ? 80  TYR I C     1 
ATOM 4848  O O     . TYR E 1 81  ? 69.008  22.512  21.688  1.00 58.10  ? 80  TYR I O     1 
ATOM 4849  C CB    . TYR E 1 81  ? 67.850  22.898  18.714  1.00 65.09  ? 80  TYR I CB    1 
ATOM 4850  C CG    . TYR E 1 81  ? 69.170  22.153  18.546  1.00 64.44  ? 80  TYR I CG    1 
ATOM 4851  C CD1   . TYR E 1 81  ? 69.239  20.768  18.702  1.00 64.42  ? 80  TYR I CD1   1 
ATOM 4852  C CD2   . TYR E 1 81  ? 70.335  22.830  18.193  1.00 64.40  ? 80  TYR I CD2   1 
ATOM 4853  C CE1   . TYR E 1 81  ? 70.435  20.088  18.527  1.00 64.38  ? 80  TYR I CE1   1 
ATOM 4854  C CE2   . TYR E 1 81  ? 71.531  22.156  18.017  1.00 65.05  ? 80  TYR I CE2   1 
ATOM 4855  C CZ    . TYR E 1 81  ? 71.580  20.782  18.186  1.00 64.97  ? 80  TYR I CZ    1 
ATOM 4856  O OH    . TYR E 1 81  ? 72.779  20.115  18.010  1.00 65.86  ? 80  TYR I OH    1 
ATOM 4857  N N     . VAL E 1 82  ? 66.826  21.973  21.617  1.00 61.02  ? 81  VAL I N     1 
ATOM 4858  C CA    . VAL E 1 82  ? 66.883  20.996  22.697  1.00 59.43  ? 81  VAL I CA    1 
ATOM 4859  C C     . VAL E 1 82  ? 67.854  19.867  22.357  1.00 58.51  ? 81  VAL I C     1 
ATOM 4860  O O     . VAL E 1 82  ? 67.899  19.408  21.215  1.00 60.41  ? 81  VAL I O     1 
ATOM 4861  C CB    . VAL E 1 82  ? 65.486  20.383  22.923  1.00 61.56  ? 81  VAL I CB    1 
ATOM 4862  C CG1   . VAL E 1 82  ? 65.328  19.871  24.361  1.00 60.49  ? 81  VAL I CG1   1 
ATOM 4863  C CG2   . VAL E 1 82  ? 64.406  21.401  22.585  1.00 64.36  ? 81  VAL I CG2   1 
ATOM 4864  N N     . ASP E 1 83  ? 68.623  19.414  23.344  1.00 87.96  ? 82  ASP I N     1 
ATOM 4865  C CA    . ASP E 1 83  ? 69.550  18.297  23.138  1.00 88.51  ? 82  ASP I CA    1 
ATOM 4866  C C     . ASP E 1 83  ? 68.845  16.943  23.139  1.00 86.47  ? 82  ASP I C     1 
ATOM 4867  O O     . ASP E 1 83  ? 68.091  16.620  24.060  1.00 84.47  ? 82  ASP I O     1 
ATOM 4868  C CB    . ASP E 1 83  ? 70.659  18.287  24.190  1.00 88.59  ? 82  ASP I CB    1 
ATOM 4869  C CG    . ASP E 1 83  ? 71.693  17.222  23.920  1.00 89.62  ? 82  ASP I CG    1 
ATOM 4870  O OD1   . ASP E 1 83  ? 72.438  17.387  22.934  1.00 92.33  ? 82  ASP I OD1   1 
ATOM 4871  O OD2   . ASP E 1 83  ? 71.755  16.224  24.674  1.00 88.19  ? 82  ASP I OD2   1 
ATOM 4872  N N     . ALA E 1 84  ? 69.126  16.151  22.109  1.00 76.06  ? 83  ALA I N     1 
ATOM 4873  C CA    . ALA E 1 84  ? 68.472  14.859  21.901  1.00 74.57  ? 83  ALA I CA    1 
ATOM 4874  C C     . ALA E 1 84  ? 68.626  13.854  23.050  1.00 72.73  ? 83  ALA I C     1 
ATOM 4875  O O     . ALA E 1 84  ? 67.676  13.153  23.395  1.00 70.88  ? 83  ALA I O     1 
ATOM 4876  C CB    . ALA E 1 84  ? 68.951  14.246  20.596  1.00 76.25  ? 83  ALA I CB    1 
ATOM 4877  N N     . GLN E 1 85  ? 69.817  13.780  23.634  1.00 66.66  ? 84  GLN I N     1 
ATOM 4878  C CA    . GLN E 1 85  ? 70.072  12.813  24.694  1.00 65.27  ? 84  GLN I CA    1 
ATOM 4879  C C     . GLN E 1 85  ? 69.715  13.339  26.096  1.00 63.98  ? 84  GLN I C     1 
ATOM 4880  O O     . GLN E 1 85  ? 69.157  12.613  26.919  1.00 62.26  ? 84  GLN I O     1 
ATOM 4881  C CB    . GLN E 1 85  ? 71.528  12.343  24.644  1.00 66.77  ? 84  GLN I CB    1 
ATOM 4882  N N     . ASP E 1 86  ? 70.039  14.603  26.357  1.00 74.24  ? 85  ASP I N     1 
ATOM 4883  C CA    . ASP E 1 86  ? 69.827  15.218  27.669  1.00 73.41  ? 85  ASP I CA    1 
ATOM 4884  C C     . ASP E 1 86  ? 68.874  16.392  27.500  1.00 73.32  ? 85  ASP I C     1 
ATOM 4885  O O     . ASP E 1 86  ? 69.313  17.509  27.227  1.00 74.80  ? 85  ASP I O     1 
ATOM 4886  C CB    . ASP E 1 86  ? 71.170  15.715  28.221  1.00 75.17  ? 85  ASP I CB    1 
ATOM 4887  C CG    . ASP E 1 86  ? 71.080  16.224  29.657  1.00 74.75  ? 85  ASP I CG    1 
ATOM 4888  O OD1   . ASP E 1 86  ? 69.966  16.497  30.155  1.00 73.46  ? 85  ASP I OD1   1 
ATOM 4889  O OD2   . ASP E 1 86  ? 72.148  16.359  30.289  1.00 75.82  ? 85  ASP I OD2   1 
ATOM 4890  N N     . THR E 1 87  ? 67.577  16.155  27.669  1.00 67.83  ? 86  THR I N     1 
ATOM 4891  C CA    . THR E 1 87  ? 66.590  17.166  27.275  1.00 67.78  ? 86  THR I CA    1 
ATOM 4892  C C     . THR E 1 87  ? 66.511  18.419  28.166  1.00 67.98  ? 86  THR I C     1 
ATOM 4893  O O     . THR E 1 87  ? 65.754  19.344  27.879  1.00 67.99  ? 86  THR I O     1 
ATOM 4894  C CB    . THR E 1 87  ? 65.177  16.564  27.012  1.00 66.28  ? 86  THR I CB    1 
ATOM 4895  O OG1   . THR E 1 87  ? 64.754  15.789  28.135  1.00 64.25  ? 86  THR I OG1   1 
ATOM 4896  C CG2   . THR E 1 87  ? 65.192  15.692  25.773  1.00 67.02  ? 86  THR I CG2   1 
ATOM 4897  N N     . ARG E 1 88  ? 67.303  18.463  29.227  1.00 75.47  ? 87  ARG I N     1 
ATOM 4898  C CA    . ARG E 1 88  ? 67.389  19.682  30.020  1.00 75.78  ? 87  ARG I CA    1 
ATOM 4899  C C     . ARG E 1 88  ? 68.178  20.724  29.248  1.00 78.20  ? 87  ARG I C     1 
ATOM 4900  O O     . ARG E 1 88  ? 68.115  21.915  29.550  1.00 79.23  ? 87  ARG I O     1 
ATOM 4901  C CB    . ARG E 1 88  ? 68.109  19.434  31.348  1.00 75.74  ? 87  ARG I CB    1 
ATOM 4902  C CG    . ARG E 1 88  ? 67.447  18.459  32.298  1.00 73.78  ? 87  ARG I CG    1 
ATOM 4903  C CD    . ARG E 1 88  ? 68.388  18.152  33.448  1.00 74.52  ? 87  ARG I CD    1 
ATOM 4904  N NE    . ARG E 1 88  ? 69.498  17.300  33.026  1.00 75.52  ? 87  ARG I NE    1 
ATOM 4905  C CZ    . ARG E 1 88  ? 70.617  17.143  33.724  1.00 76.68  ? 87  ARG I CZ    1 
ATOM 4906  N NH1   . ARG E 1 88  ? 70.779  17.792  34.870  1.00 77.08  ? 87  ARG I NH1   1 
ATOM 4907  N NH2   . ARG E 1 88  ? 71.576  16.345  33.273  1.00 77.42  ? 87  ARG I NH2   1 
ATOM 4908  N N     . ARG E 1 89  ? 68.935  20.270  28.257  1.00 86.11  ? 88  ARG I N     1 
ATOM 4909  C CA    . ARG E 1 89  ? 69.930  21.121  27.626  1.00 88.45  ? 88  ARG I CA    1 
ATOM 4910  C C     . ARG E 1 89  ? 69.441  21.853  26.388  1.00 89.44  ? 88  ARG I C     1 
ATOM 4911  O O     . ARG E 1 89  ? 68.466  21.456  25.750  1.00 88.72  ? 88  ARG I O     1 
ATOM 4912  C CB    . ARG E 1 89  ? 71.174  20.313  27.269  1.00 89.66  ? 88  ARG I CB    1 
ATOM 4913  C CG    . ARG E 1 89  ? 71.864  19.703  28.453  1.00 89.20  ? 88  ARG I CG    1 
ATOM 4914  C CD    . ARG E 1 89  ? 73.183  19.113  28.030  1.00 91.03  ? 88  ARG I CD    1 
ATOM 4915  N NE    . ARG E 1 89  ? 73.831  18.406  29.124  1.00 91.21  ? 88  ARG I NE    1 
ATOM 4916  C CZ    . ARG E 1 89  ? 75.032  17.850  29.032  1.00 93.57  ? 88  ARG I CZ    1 
ATOM 4917  N NH1   . ARG E 1 89  ? 75.711  17.931  27.891  1.00 95.75  ? 88  ARG I NH1   1 
ATOM 4918  N NH2   . ARG E 1 89  ? 75.554  17.218  30.078  1.00 93.63  ? 88  ARG I NH2   1 
ATOM 4919  N N     . LYS E 1 90  ? 70.148  22.931  26.063  1.00 64.73  ? 89  LYS I N     1 
ATOM 4920  C CA    . LYS E 1 90  ? 69.939  23.661  24.831  1.00 64.21  ? 89  LYS I CA    1 
ATOM 4921  C C     . LYS E 1 90  ? 71.288  23.860  24.139  1.00 62.88  ? 89  LYS I C     1 
ATOM 4922  O O     . LYS E 1 90  ? 72.162  24.542  24.669  1.00 61.14  ? 89  LYS I O     1 
ATOM 4923  C CB    . LYS E 1 90  ? 69.272  25.000  25.120  1.00 63.07  ? 89  LYS I CB    1 
ATOM 4924  C CG    . LYS E 1 90  ? 67.848  24.862  25.574  1.00 64.80  ? 89  LYS I CG    1 
ATOM 4925  C CD    . LYS E 1 90  ? 67.066  26.143  25.351  1.00 64.48  ? 89  LYS I CD    1 
ATOM 4926  C CE    . LYS E 1 90  ? 65.684  26.088  26.024  1.00 66.35  ? 89  LYS I CE    1 
ATOM 4927  N NZ    . LYS E 1 90  ? 64.903  27.353  25.816  1.00 66.51  ? 89  LYS I NZ    1 
ATOM 4928  N N     . ASN E 1 91  ? 71.468  23.245  22.972  1.00 77.46  ? 90  ASN I N     1 
ATOM 4929  C CA    . ASN E 1 91  ? 72.716  23.392  22.236  1.00 78.01  ? 90  ASN I CA    1 
ATOM 4930  C C     . ASN E 1 91  ? 72.704  24.698  21.473  1.00 77.16  ? 90  ASN I C     1 
ATOM 4931  O O     . ASN E 1 91  ? 71.693  25.074  20.884  1.00 76.87  ? 90  ASN I O     1 
ATOM 4932  C CB    . ASN E 1 91  ? 72.952  22.232  21.262  1.00 79.95  ? 90  ASN I CB    1 
ATOM 4933  C CG    . ASN E 1 91  ? 73.197  20.910  21.961  1.00 81.51  ? 90  ASN I CG    1 
ATOM 4934  O OD1   . ASN E 1 91  ? 73.504  20.866  23.152  1.00 81.38  ? 90  ASN I OD1   1 
ATOM 4935  N ND2   . ASN E 1 91  ? 73.065  19.816  21.213  1.00 83.64  ? 90  ASN I ND2   1 
ATOM 4936  N N     . ILE E 1 92  ? 73.839  25.381  21.472  1.00 63.81  ? 91  ILE I N     1 
ATOM 4937  C CA    . ILE E 1 92  ? 73.920  26.713  20.909  1.00 63.02  ? 91  ILE I CA    1 
ATOM 4938  C C     . ILE E 1 92  ? 74.783  26.658  19.683  1.00 63.88  ? 91  ILE I C     1 
ATOM 4939  O O     . ILE E 1 92  ? 75.706  25.837  19.625  1.00 65.01  ? 91  ILE I O     1 
ATOM 4940  C CB    . ILE E 1 92  ? 74.535  27.672  21.925  1.00 62.65  ? 91  ILE I CB    1 
ATOM 4941  C CG1   . ILE E 1 92  ? 73.724  27.610  23.219  1.00 62.10  ? 91  ILE I CG1   1 
ATOM 4942  C CG2   . ILE E 1 92  ? 74.553  29.081  21.395  1.00 62.15  ? 91  ILE I CG2   1 
ATOM 4943  C CD1   . ILE E 1 92  ? 72.216  27.707  22.992  1.00 61.48  ? 91  ILE I CD1   1 
ATOM 4944  N N     . GLY E 1 93  ? 74.473  27.511  18.703  1.00 59.08  ? 92  GLY I N     1 
ATOM 4945  C CA    . GLY E 1 93  ? 75.268  27.631  17.490  1.00 59.30  ? 92  GLY I CA    1 
ATOM 4946  C C     . GLY E 1 93  ? 74.922  28.859  16.665  1.00 59.14  ? 92  GLY I C     1 
ATOM 4947  O O     . GLY E 1 93  ? 73.863  29.451  16.827  1.00 59.32  ? 92  GLY I O     1 
ATOM 4948  N N     . LEU E 1 94  ? 75.818  29.240  15.769  1.00 68.56  ? 93  LEU I N     1 
ATOM 4949  C CA    . LEU E 1 94  ? 75.632  30.441  14.974  1.00 68.48  ? 93  LEU I CA    1 
ATOM 4950  C C     . LEU E 1 94  ? 74.812  30.183  13.720  1.00 68.98  ? 93  LEU I C     1 
ATOM 4951  O O     . LEU E 1 94  ? 75.079  29.221  12.992  1.00 70.33  ? 93  LEU I O     1 
ATOM 4952  C CB    . LEU E 1 94  ? 76.990  30.973  14.528  1.00 69.56  ? 93  LEU I CB    1 
ATOM 4953  C CG    . LEU E 1 94  ? 77.965  31.447  15.589  1.00 69.73  ? 93  LEU I CG    1 
ATOM 4954  C CD1   . LEU E 1 94  ? 79.189  32.041  14.916  1.00 70.99  ? 93  LEU I CD1   1 
ATOM 4955  C CD2   . LEU E 1 94  ? 77.273  32.471  16.463  1.00 68.47  ? 93  LEU I CD2   1 
ATOM 4956  N N     . THR E 1 95  ? 73.842  31.051  13.437  1.00 61.32  ? 94  THR I N     1 
ATOM 4957  C CA    . THR E 1 95  ? 73.250  31.066  12.106  1.00 63.00  ? 94  THR I CA    1 
ATOM 4958  C C     . THR E 1 95  ? 74.318  31.554  11.148  1.00 63.00  ? 94  THR I C     1 
ATOM 4959  O O     . THR E 1 95  ? 75.342  32.100  11.580  1.00 61.86  ? 94  THR I O     1 
ATOM 4960  C CB    . THR E 1 95  ? 72.060  32.025  11.992  1.00 63.99  ? 94  THR I CB    1 
ATOM 4961  O OG1   . THR E 1 95  ? 72.493  33.361  12.275  1.00 63.28  ? 94  THR I OG1   1 
ATOM 4962  C CG2   . THR E 1 95  ? 70.952  31.629  12.946  1.00 64.29  ? 94  THR I CG2   1 
ATOM 4963  N N     . THR E 1 96  ? 74.077  31.361  9.854   1.00 71.96  ? 95  THR I N     1 
ATOM 4964  C CA    . THR E 1 96  ? 74.961  31.895  8.826   1.00 72.15  ? 95  THR I CA    1 
ATOM 4965  C C     . THR E 1 96  ? 75.168  33.400  9.017   1.00 70.72  ? 95  THR I C     1 
ATOM 4966  O O     . THR E 1 96  ? 76.289  33.907  8.861   1.00 70.21  ? 95  THR I O     1 
ATOM 4967  C CB    . THR E 1 96  ? 74.417  31.593  7.409   1.00 74.33  ? 95  THR I CB    1 
ATOM 4968  O OG1   . THR E 1 96  ? 74.762  30.254  7.044   1.00 75.93  ? 95  THR I OG1   1 
ATOM 4969  C CG2   . THR E 1 96  ? 74.994  32.550  6.369   1.00 74.62  ? 95  THR I CG2   1 
ATOM 4970  N N     . SER E 1 97  ? 74.095  34.106  9.379   1.00 75.21  ? 96  SER I N     1 
ATOM 4971  C CA    . SER E 1 97  ? 74.169  35.557  9.542   1.00 74.33  ? 96  SER I CA    1 
ATOM 4972  C C     . SER E 1 97  ? 75.168  35.908  10.632  1.00 72.55  ? 96  SER I C     1 
ATOM 4973  O O     . SER E 1 97  ? 76.067  36.737  10.423  1.00 72.20  ? 96  SER I O     1 
ATOM 4974  C CB    . SER E 1 97  ? 72.804  36.142  9.878   1.00 74.69  ? 96  SER I CB    1 
ATOM 4975  O OG    . SER E 1 97  ? 72.404  35.740  11.165  1.00 73.87  ? 96  SER I OG    1 
ATOM 4976  N N     . GLY E 1 98  ? 75.007  35.253  11.784  1.00 93.50  ? 97  GLY I N     1 
ATOM 4977  C CA    . GLY E 1 98  ? 75.927  35.389  12.898  1.00 92.22  ? 97  GLY I CA    1 
ATOM 4978  C C     . GLY E 1 98  ? 77.365  35.184  12.461  1.00 92.34  ? 97  GLY I C     1 
ATOM 4979  O O     . GLY E 1 98  ? 78.212  36.051  12.676  1.00 91.66  ? 97  GLY I O     1 
ATOM 4980  N N     . ILE E 1 99  ? 77.631  34.044  11.827  1.00 88.03  ? 98  ILE I N     1 
ATOM 4981  C CA    . ILE E 1 99  ? 78.976  33.712  11.359  1.00 88.63  ? 98  ILE I CA    1 
ATOM 4982  C C     . ILE E 1 99  ? 79.592  34.862  10.593  1.00 88.77  ? 98  ILE I C     1 
ATOM 4983  O O     . ILE E 1 99  ? 80.681  35.323  10.931  1.00 88.20  ? 98  ILE I O     1 
ATOM 4984  C CB    . ILE E 1 99  ? 78.992  32.474  10.442  1.00 91.13  ? 98  ILE I CB    1 
ATOM 4985  C CG1   . ILE E 1 99  ? 78.419  31.256  11.163  1.00 92.12  ? 98  ILE I CG1   1 
ATOM 4986  C CG2   . ILE E 1 99  ? 80.409  32.190  9.968   1.00 92.75  ? 98  ILE I CG2   1 
ATOM 4987  C CD1   . ILE E 1 99  ? 78.462  29.997  10.334  1.00 95.13  ? 98  ILE I CD1   1 
ATOM 4988  N N     . LYS E 1 100 ? 78.887  35.331  9.569   1.00 90.28  ? 99  LYS I N     1 
ATOM 4989  C CA    . LYS E 1 100 ? 79.391  36.434  8.764   1.00 91.09  ? 99  LYS I CA    1 
ATOM 4990  C C     . LYS E 1 100 ? 79.596  37.660  9.646   1.00 89.86  ? 99  LYS I C     1 
ATOM 4991  O O     . LYS E 1 100 ? 80.594  38.373  9.511   1.00 90.17  ? 99  LYS I O     1 
ATOM 4992  C CB    . LYS E 1 100 ? 78.444  36.752  7.605   1.00 92.08  ? 99  LYS I CB    1 
ATOM 4993  N N     . LEU E 1 101 ? 78.663  37.880  10.570  1.00 72.91  ? 100 LEU I N     1 
ATOM 4994  C CA    . LEU E 1 101 ? 78.742  39.038  11.445  1.00 71.96  ? 100 LEU I CA    1 
ATOM 4995  C C     . LEU E 1 101 ? 79.993  38.991  12.302  1.00 71.13  ? 100 LEU I C     1 
ATOM 4996  O O     . LEU E 1 101 ? 80.655  40.008  12.489  1.00 71.22  ? 100 LEU I O     1 
ATOM 4997  C CB    . LEU E 1 101 ? 77.515  39.134  12.344  1.00 71.15  ? 100 LEU I CB    1 
ATOM 4998  C CG    . LEU E 1 101 ? 77.460  40.458  13.101  1.00 70.69  ? 100 LEU I CG    1 
ATOM 4999  C CD1   . LEU E 1 101 ? 77.360  41.592  12.087  1.00 72.12  ? 100 LEU I CD1   1 
ATOM 5000  C CD2   . LEU E 1 101 ? 76.304  40.492  14.079  1.00 70.17  ? 100 LEU I CD2   1 
ATOM 5001  N N     . VAL E 1 102 ? 80.314  37.805  12.818  1.00 80.67  ? 101 VAL I N     1 
ATOM 5002  C CA    . VAL E 1 102 ? 81.527  37.620  13.609  1.00 80.14  ? 101 VAL I CA    1 
ATOM 5003  C C     . VAL E 1 102 ? 82.759  37.844  12.749  1.00 81.79  ? 101 VAL I C     1 
ATOM 5004  O O     . VAL E 1 102 ? 83.761  38.396  13.209  1.00 81.92  ? 101 VAL I O     1 
ATOM 5005  C CB    . VAL E 1 102 ? 81.599  36.224  14.241  1.00 79.74  ? 101 VAL I CB    1 
ATOM 5006  C CG1   . VAL E 1 102 ? 82.956  36.008  14.882  1.00 80.16  ? 101 VAL I CG1   1 
ATOM 5007  C CG2   . VAL E 1 102 ? 80.504  36.051  15.276  1.00 78.59  ? 101 VAL I CG2   1 
ATOM 5008  N N     . GLU E 1 103 ? 82.677  37.428  11.489  1.00 71.45  ? 102 GLU I N     1 
ATOM 5009  C CA    . GLU E 1 103 ? 83.771  37.656  10.561  1.00 73.23  ? 102 GLU I CA    1 
ATOM 5010  C C     . GLU E 1 103 ? 83.915  39.164  10.337  1.00 73.64  ? 102 GLU I C     1 
ATOM 5011  O O     . GLU E 1 103 ? 85.012  39.675  10.069  1.00 74.95  ? 102 GLU I O     1 
ATOM 5012  C CB    . GLU E 1 103 ? 83.531  36.915  9.243   1.00 74.88  ? 102 GLU I CB    1 
ATOM 5013  N N     . ALA E 1 104 ? 82.802  39.877  10.475  1.00 77.44  ? 103 ALA I N     1 
ATOM 5014  C CA    . ALA E 1 104 ? 82.791  41.306  10.202  1.00 78.31  ? 103 ALA I CA    1 
ATOM 5015  C C     . ALA E 1 104 ? 83.521  42.107  11.276  1.00 77.75  ? 103 ALA I C     1 
ATOM 5016  O O     . ALA E 1 104 ? 84.388  42.925  10.957  1.00 79.40  ? 103 ALA I O     1 
ATOM 5017  C CB    . ALA E 1 104 ? 81.361  41.814  10.022  1.00 78.17  ? 103 ALA I CB    1 
ATOM 5018  N N     . PHE E 1 105 ? 83.187  41.857  12.542  1.00 89.30  ? 104 PHE I N     1 
ATOM 5019  C CA    . PHE E 1 105 ? 83.644  42.726  13.628  1.00 88.91  ? 104 PHE I CA    1 
ATOM 5020  C C     . PHE E 1 105 ? 84.887  42.293  14.399  1.00 88.83  ? 104 PHE I C     1 
ATOM 5021  O O     . PHE E 1 105 ? 85.325  43.006  15.300  1.00 88.83  ? 104 PHE I O     1 
ATOM 5022  C CB    . PHE E 1 105 ? 82.514  42.989  14.628  1.00 87.25  ? 104 PHE I CB    1 
ATOM 5023  C CG    . PHE E 1 105 ? 82.118  41.790  15.456  1.00 85.55  ? 104 PHE I CG    1 
ATOM 5024  C CD1   . PHE E 1 105 ? 82.863  41.404  16.564  1.00 84.78  ? 104 PHE I CD1   1 
ATOM 5025  C CD2   . PHE E 1 105 ? 80.966  41.087  15.163  1.00 84.97  ? 104 PHE I CD2   1 
ATOM 5026  C CE1   . PHE E 1 105 ? 82.487  40.317  17.336  1.00 83.50  ? 104 PHE I CE1   1 
ATOM 5027  C CE2   . PHE E 1 105 ? 80.585  40.002  15.929  1.00 83.99  ? 104 PHE I CE2   1 
ATOM 5028  C CZ    . PHE E 1 105 ? 81.348  39.617  17.020  1.00 83.14  ? 104 PHE I CZ    1 
ATOM 5029  N N     . THR E 1 106 ? 85.444  41.133  14.074  1.00 90.88  ? 105 THR I N     1 
ATOM 5030  C CA    . THR E 1 106 ? 86.533  40.603  14.883  1.00 90.77  ? 105 THR I CA    1 
ATOM 5031  C C     . THR E 1 106 ? 87.727  41.549  14.915  1.00 92.27  ? 105 THR I C     1 
ATOM 5032  O O     . THR E 1 106 ? 88.351  41.741  15.965  1.00 91.96  ? 105 THR I O     1 
ATOM 5033  C CB    . THR E 1 106 ? 86.950  39.197  14.441  1.00 91.92  ? 105 THR I CB    1 
ATOM 5034  O OG1   . THR E 1 106 ? 85.828  38.319  14.593  1.00 91.21  ? 105 THR I OG1   1 
ATOM 5035  C CG2   . THR E 1 106 ? 88.103  38.677  15.291  1.00 94.65  ? 105 THR I CG2   1 
ATOM 5036  N N     . SER E 1 107 ? 88.000  42.169  13.770  1.00 93.66  ? 106 SER I N     1 
ATOM 5037  C CA    . SER E 1 107 ? 89.095  43.125  13.635  1.00 95.79  ? 106 SER I CA    1 
ATOM 5038  C C     . SER E 1 107 ? 89.127  44.106  14.801  1.00 95.02  ? 106 SER I C     1 
ATOM 5039  O O     . SER E 1 107 ? 90.191  44.406  15.340  1.00 96.17  ? 106 SER I O     1 
ATOM 5040  C CB    . SER E 1 107 ? 88.975  43.883  12.314  1.00 98.10  ? 106 SER I CB    1 
ATOM 5041  O OG    . SER E 1 107 ? 87.640  44.300  12.086  1.00 97.14  ? 106 SER I OG    1 
ATOM 5042  N N     . ILE E 1 108 ? 87.947  44.575  15.195  1.00 73.08  ? 107 ILE I N     1 
ATOM 5043  C CA    . ILE E 1 108 ? 87.790  45.500  16.315  1.00 72.55  ? 107 ILE I CA    1 
ATOM 5044  C C     . ILE E 1 108 ? 88.494  45.062  17.616  1.00 71.68  ? 107 ILE I C     1 
ATOM 5045  O O     . ILE E 1 108 ? 89.348  45.793  18.132  1.00 72.90  ? 107 ILE I O     1 
ATOM 5046  C CB    . ILE E 1 108 ? 86.298  45.768  16.601  1.00 71.06  ? 107 ILE I CB    1 
ATOM 5047  C CG1   . ILE E 1 108 ? 85.602  46.262  15.336  1.00 72.22  ? 107 ILE I CG1   1 
ATOM 5048  C CG2   . ILE E 1 108 ? 86.129  46.757  17.749  1.00 70.90  ? 107 ILE I CG2   1 
ATOM 5049  C CD1   . ILE E 1 108 ? 84.209  46.752  15.577  1.00 71.50  ? 107 ILE I CD1   1 
ATOM 5050  N N     . PHE E 1 109 ? 88.144  43.888  18.143  1.00 86.76  ? 108 PHE I N     1 
ATOM 5051  C CA    . PHE E 1 109 ? 88.750  43.409  19.391  1.00 86.27  ? 108 PHE I CA    1 
ATOM 5052  C C     . PHE E 1 109 ? 90.265  43.290  19.270  1.00 88.81  ? 108 PHE I C     1 
ATOM 5053  O O     . PHE E 1 109 ? 91.000  43.704  20.168  1.00 89.95  ? 108 PHE I O     1 
ATOM 5054  C CB    . PHE E 1 109 ? 88.160  42.062  19.826  1.00 86.62  ? 108 PHE I CB    1 
ATOM 5055  C CG    . PHE E 1 109 ? 86.700  42.115  20.132  1.00 84.33  ? 108 PHE I CG    1 
ATOM 5056  C CD1   . PHE E 1 109 ? 86.160  43.197  20.799  1.00 82.69  ? 108 PHE I CD1   1 
ATOM 5057  C CD2   . PHE E 1 109 ? 85.860  41.091  19.738  1.00 84.13  ? 108 PHE I CD2   1 
ATOM 5058  C CE1   . PHE E 1 109 ? 84.808  43.257  21.076  1.00 81.12  ? 108 PHE I CE1   1 
ATOM 5059  C CE2   . PHE E 1 109 ? 84.506  41.143  20.013  1.00 81.94  ? 108 PHE I CE2   1 
ATOM 5060  C CZ    . PHE E 1 109 ? 83.981  42.230  20.682  1.00 80.62  ? 108 PHE I CZ    1 
ATOM 5061  N N     . ASP E 1 110 ? 90.723  42.728  18.156  1.00 93.18  ? 109 ASP I N     1 
ATOM 5062  C CA    . ASP E 1 110 ? 92.150  42.572  17.906  1.00 95.48  ? 109 ASP I CA    1 
ATOM 5063  C C     . ASP E 1 110 ? 92.851  43.926  17.826  1.00 97.18  ? 109 ASP I C     1 
ATOM 5064  O O     . ASP E 1 110 ? 93.951  44.099  18.354  1.00 98.97  ? 109 ASP I O     1 
ATOM 5065  C CB    . ASP E 1 110 ? 92.371  41.776  16.620  1.00 96.81  ? 109 ASP I CB    1 
ATOM 5066  C CG    . ASP E 1 110 ? 91.604  40.471  16.613  1.00 97.23  ? 109 ASP I CG    1 
ATOM 5067  O OD1   . ASP E 1 110 ? 91.095  40.088  17.691  1.00 97.01  ? 109 ASP I OD1   1 
ATOM 5068  O OD2   . ASP E 1 110 ? 91.511  39.832  15.539  1.00 98.06  ? 109 ASP I OD2   1 
ATOM 5069  N N     . GLU E 1 111 ? 92.204  44.878  17.161  1.00 89.97  ? 110 GLU I N     1 
ATOM 5070  C CA    . GLU E 1 111 ? 92.704  46.240  17.095  1.00 92.18  ? 110 GLU I CA    1 
ATOM 5071  C C     . GLU E 1 111 ? 92.924  46.755  18.508  1.00 91.70  ? 110 GLU I C     1 
ATOM 5072  O O     . GLU E 1 111 ? 94.025  47.182  18.860  1.00 93.83  ? 110 GLU I O     1 
ATOM 5073  C CB    . GLU E 1 111 ? 91.715  47.142  16.351  1.00 92.70  ? 110 GLU I CB    1 
ATOM 5074  N N     . MET E 1 112 ? 91.875  46.687  19.323  1.00 75.89  ? 111 MET I N     1 
ATOM 5075  C CA    . MET E 1 112 ? 91.942  47.158  20.703  1.00 75.33  ? 111 MET I CA    1 
ATOM 5076  C C     . MET E 1 112 ? 93.038  46.460  21.505  1.00 75.69  ? 111 MET I C     1 
ATOM 5077  O O     . MET E 1 112 ? 93.670  47.076  22.355  0.73 76.77  ? 111 MET I O     1 
ATOM 5078  C CB    . MET E 1 112 ? 90.589  47.000  21.393  1.00 72.68  ? 111 MET I CB    1 
ATOM 5079  N N     . GLU E 1 113 ? 93.274  45.184  21.224  1.00 91.11  ? 112 GLU I N     1 
ATOM 5080  C CA    . GLU E 1 113 ? 94.343  44.447  21.893  1.00 93.35  ? 112 GLU I CA    1 
ATOM 5081  C C     . GLU E 1 113 ? 95.723  44.914  21.435  1.00 95.52  ? 112 GLU I C     1 
ATOM 5082  O O     . GLU E 1 113 ? 96.599  45.189  22.255  1.00 96.84  ? 112 GLU I O     1 
ATOM 5083  C CB    . GLU E 1 113 ? 94.204  42.948  21.638  1.00 93.77  ? 112 GLU I CB    1 
ATOM 5084  C CG    . GLU E 1 113 ? 95.319  42.118  22.252  1.00 96.09  ? 112 GLU I CG    1 
ATOM 5085  C CD    . GLU E 1 113 ? 95.182  41.985  23.755  1.00 96.59  ? 112 GLU I CD    1 
ATOM 5086  O OE1   . GLU E 1 113 ? 96.131  41.486  24.401  1.00 98.20  ? 112 GLU I OE1   1 
ATOM 5087  O OE2   . GLU E 1 113 ? 94.119  42.369  24.288  1.00 95.05  ? 112 GLU I OE2   1 
ATOM 5088  N N     . GLN E 1 114 ? 95.915  44.987  20.121  1.00 124.36 ? 113 GLN I N     1 
ATOM 5089  C CA    . GLN E 1 114 ? 97.185  45.438  19.564  1.00 128.34 ? 113 GLN I CA    1 
ATOM 5090  C C     . GLN E 1 114 ? 97.455  46.878  19.980  1.00 130.11 ? 113 GLN I C     1 
ATOM 5091  O O     . GLN E 1 114 ? 98.607  47.277  20.156  1.00 133.11 ? 113 GLN I O     1 
ATOM 5092  C CB    . GLN E 1 114 ? 97.186  45.320  18.037  1.00 129.74 ? 113 GLN I CB    1 
ATOM 5093  N N     . THR E 1 115 ? 96.381  47.648  20.144  1.00 106.87 ? 114 THR I N     1 
ATOM 5094  C CA    . THR E 1 115 ? 96.499  49.049  20.529  1.00 108.43 ? 114 THR I CA    1 
ATOM 5095  C C     . THR E 1 115 ? 97.015  49.148  21.963  1.00 108.43 ? 114 THR I C     1 
ATOM 5096  O O     . THR E 1 115 ? 97.646  50.135  22.343  1.00 111.26 ? 114 THR I O     1 
ATOM 5097  C CB    . THR E 1 115 ? 95.153  49.813  20.375  1.00 106.72 ? 114 THR I CB    1 
ATOM 5098  O OG1   . THR E 1 115 ? 94.603  49.573  19.071  1.00 106.56 ? 114 THR I OG1   1 
ATOM 5099  C CG2   . THR E 1 115 ? 95.353  51.325  20.567  1.00 109.35 ? 114 THR I CG2   1 
ATOM 5100  N N     . LEU E 1 116 ? 96.764  48.106  22.747  1.00 108.33 ? 115 LEU I N     1 
ATOM 5101  C CA    . LEU E 1 116 ? 97.215  48.072  24.133  1.00 107.92 ? 115 LEU I CA    1 
ATOM 5102  C C     . LEU E 1 116 ? 98.712  47.809  24.230  1.00 111.27 ? 115 LEU I C     1 
ATOM 5103  O O     . LEU E 1 116 ? 99.455  48.642  24.748  1.00 114.01 ? 115 LEU I O     1 
ATOM 5104  C CB    . LEU E 1 116 ? 96.441  47.025  24.934  1.00 104.90 ? 115 LEU I CB    1 
ATOM 5105  N N     . VAL E 1 117 ? 99.153  46.660  23.722  1.00 110.13 ? 116 VAL I N     1 
ATOM 5106  C CA    . VAL E 1 117 ? 100.568 46.293  23.756  1.00 113.33 ? 116 VAL I CA    1 
ATOM 5107  C C     . VAL E 1 117 ? 101.442 47.365  23.118  1.00 117.45 ? 116 VAL I C     1 
ATOM 5108  O O     . VAL E 1 117 ? 102.631 47.466  23.409  1.00 120.78 ? 116 VAL I O     1 
ATOM 5109  C CB    . VAL E 1 117 ? 100.822 44.951  23.054  1.00 113.06 ? 116 VAL I CB    1 
ATOM 5110  C CG1   . VAL E 1 117 ? 100.221 43.816  23.858  1.00 110.13 ? 116 VAL I CG1   1 
ATOM 5111  C CG2   . VAL E 1 117 ? 100.258 44.978  21.639  1.00 112.86 ? 116 VAL I CG2   1 
ATOM 5112  N N     . SER E 1 118 ? 100.844 48.165  22.245  1.00 122.37 ? 117 SER I N     1 
ATOM 5113  C CA    . SER E 1 118 ? 101.519 49.333  21.712  1.00 126.50 ? 117 SER I CA    1 
ATOM 5114  C C     . SER E 1 118 ? 101.606 50.409  22.786  1.00 127.25 ? 117 SER I C     1 
ATOM 5115  O O     . SER E 1 118 ? 102.679 50.951  23.038  1.00 131.15 ? 117 SER I O     1 
ATOM 5116  C CB    . SER E 1 118 ? 100.769 49.877  20.496  1.00 126.68 ? 117 SER I CB    1 
ATOM 5117  N N     . GLN E 1 119 ? 100.475 50.689  23.434  1.00 122.62 ? 118 GLN I N     1 
ATOM 5118  C CA    . GLN E 1 119 ? 100.330 51.841  24.331  1.00 123.37 ? 118 GLN I CA    1 
ATOM 5119  C C     . GLN E 1 119 ? 101.275 51.841  25.531  1.00 125.23 ? 118 GLN I C     1 
ATOM 5120  O O     . GLN E 1 119 ? 101.266 52.779  26.332  1.00 126.51 ? 118 GLN I O     1 
ATOM 5121  C CB    . GLN E 1 119 ? 98.882  51.969  24.812  1.00 119.55 ? 118 GLN I CB    1 
ATOM 5122  N N     . LEU E 1 120 ? 102.074 50.784  25.655  1.00 112.46 ? 119 LEU I N     1 
ATOM 5123  C CA    . LEU E 1 120 ? 103.122 50.707  26.670  1.00 113.90 ? 119 LEU I CA    1 
ATOM 5124  C C     . LEU E 1 120 ? 104.209 49.784  26.157  1.00 118.47 ? 119 LEU I C     1 
ATOM 5125  O O     . LEU E 1 120 ? 103.970 48.996  25.242  1.00 118.82 ? 119 LEU I O     1 
ATOM 5126  C CB    . LEU E 1 120 ? 102.578 50.197  28.008  1.00 107.58 ? 119 LEU I CB    1 
ATOM 5127  N N     . SER E 1 121 ? 105.394 49.886  26.755  1.00 160.33 ? 120 SER I N     1 
ATOM 5128  C CA    . SER E 1 121 ? 106.583 49.174  26.287  1.00 166.00 ? 120 SER I CA    1 
ATOM 5129  C C     . SER E 1 121 ? 106.363 47.674  26.121  1.00 163.44 ? 120 SER I C     1 
ATOM 5130  O O     . SER E 1 121 ? 105.511 47.083  26.780  1.00 157.26 ? 120 SER I O     1 
ATOM 5131  C CB    . SER E 1 121 ? 107.758 49.422  27.238  1.00 169.17 ? 120 SER I CB    1 
ATOM 5132  N N     . GLU E 1 122 ? 107.136 47.067  25.228  1.00 144.54 ? 121 GLU I N     1 
ATOM 5133  C CA    . GLU E 1 122 ? 107.113 45.620  25.060  1.00 143.19 ? 121 GLU I CA    1 
ATOM 5134  C C     . GLU E 1 122 ? 107.669 44.949  26.315  1.00 141.68 ? 121 GLU I C     1 
ATOM 5135  O O     . GLU E 1 122 ? 107.395 43.778  26.593  1.00 138.75 ? 121 GLU I O     1 
ATOM 5136  C CB    . GLU E 1 122 ? 107.907 45.207  23.816  1.00 150.30 ? 121 GLU I CB    1 
ATOM 5137  C CG    . GLU E 1 122 ? 107.857 43.718  23.520  1.00 149.53 ? 121 GLU I CG    1 
ATOM 5138  C CD    . GLU E 1 122 ? 106.521 43.100  23.903  1.00 141.68 ? 121 GLU I CD    1 
ATOM 5139  O OE1   . GLU E 1 122 ? 105.479 43.521  23.352  1.00 139.09 ? 121 GLU I OE1   1 
ATOM 5140  O OE2   . GLU E 1 122 ? 106.516 42.205  24.775  1.00 138.59 ? 121 GLU I OE2   1 
ATOM 5141  N N     . GLU E 1 123 ? 108.453 45.705  27.075  1.00 129.22 ? 122 GLU I N     1 
ATOM 5142  C CA    . GLU E 1 123 ? 108.887 45.257  28.387  1.00 127.62 ? 122 GLU I CA    1 
ATOM 5143  C C     . GLU E 1 123 ? 107.657 45.148  29.285  1.00 119.59 ? 122 GLU I C     1 
ATOM 5144  O O     . GLU E 1 123 ? 107.597 44.308  30.180  1.00 116.69 ? 122 GLU I O     1 
ATOM 5145  C CB    . GLU E 1 123 ? 109.905 46.233  28.979  1.00 132.28 ? 122 GLU I CB    1 
ATOM 5146  N N     . GLU E 1 124 ? 106.664 45.990  29.016  1.00 163.40 ? 123 GLU I N     1 
ATOM 5147  C CA    . GLU E 1 124 ? 105.449 46.027  29.819  1.00 156.28 ? 123 GLU I CA    1 
ATOM 5148  C C     . GLU E 1 124 ? 104.333 45.130  29.275  1.00 152.07 ? 123 GLU I C     1 
ATOM 5149  O O     . GLU E 1 124 ? 103.506 44.632  30.038  1.00 148.15 ? 123 GLU I O     1 
ATOM 5150  C CB    . GLU E 1 124 ? 104.944 47.467  29.941  1.00 155.27 ? 123 GLU I CB    1 
ATOM 5151  N N     . ASN E 1 125 ? 104.315 44.919  27.961  1.00 147.20 ? 124 ASN I N     1 
ATOM 5152  C CA    . ASN E 1 125 ? 103.205 44.219  27.306  1.00 143.58 ? 124 ASN I CA    1 
ATOM 5153  C C     . ASN E 1 125 ? 103.110 42.715  27.590  1.00 142.52 ? 124 ASN I C     1 
ATOM 5154  O O     . ASN E 1 125 ? 102.158 42.060  27.173  1.00 140.60 ? 124 ASN I O     1 
ATOM 5155  C CB    . ASN E 1 125 ? 103.231 44.469  25.793  1.00 147.48 ? 124 ASN I CB    1 
ATOM 5156  N N     . GLU E 1 126 ? 104.092 42.177  28.303  1.00 123.37 ? 125 GLU I N     1 
ATOM 5157  C CA    . GLU E 1 126 ? 104.129 40.749  28.602  1.00 123.14 ? 125 GLU I CA    1 
ATOM 5158  C C     . GLU E 1 126 ? 104.244 40.501  30.104  1.00 121.16 ? 125 GLU I C     1 
ATOM 5159  O O     . GLU E 1 126 ? 103.726 39.506  30.616  1.00 119.32 ? 125 GLU I O     1 
ATOM 5160  C CB    . GLU E 1 126 ? 105.297 40.082  27.869  1.00 128.03 ? 125 GLU I CB    1 
ATOM 5161  N N     . GLN E 1 127 ? 104.878 41.422  30.817  1.00 128.35 ? 126 GLN I N     1 
ATOM 5162  C CA    . GLN E 1 127 ? 104.965 41.301  32.262  1.00 127.01 ? 126 GLN I CA    1 
ATOM 5163  C C     . GLN E 1 127 ? 103.577 41.356  32.889  1.00 123.00 ? 126 GLN I C     1 
ATOM 5164  O O     . GLN E 1 127 ? 103.266 40.599  33.805  1.00 121.07 ? 126 GLN I O     1 
ATOM 5165  C CB    . GLN E 1 127 ? 105.834 42.419  32.837  1.00 128.83 ? 126 GLN I CB    1 
ATOM 5166  N N     . MET E 1 128 ? 102.743 42.256  32.384  0.89 129.48 ? 127 MET I N     1 
ATOM 5167  C CA    . MET E 1 128 ? 101.436 42.501  32.978  1.00 125.58 ? 127 MET I CA    1 
ATOM 5168  C C     . MET E 1 128 ? 100.491 41.305  32.937  1.00 123.66 ? 127 MET I C     1 
ATOM 5169  O O     . MET E 1 128 ? 99.826  41.002  33.925  1.00 121.44 ? 127 MET I O     1 
ATOM 5170  C CB    . MET E 1 128 ? 100.772 43.692  32.291  1.00 124.74 ? 127 MET I CB    1 
ATOM 5171  C CG    . MET E 1 128 ? 99.573  44.244  33.037  1.00 121.54 ? 127 MET I CG    1 
ATOM 5172  S SD    . MET E 1 128 ? 99.611  46.039  33.118  1.00 121.40 ? 127 MET I SD    1 
ATOM 5173  C CE    . MET E 1 128 ? 99.072  46.469  31.467  1.00 121.88 ? 127 MET I CE    1 
ATOM 5174  N N     . LYS E 1 129 ? 100.447 40.615  31.805  1.00 116.57 ? 128 LYS I N     1 
ATOM 5175  C CA    . LYS E 1 129 ? 99.493  39.527  31.631  1.00 115.09 ? 128 LYS I CA    1 
ATOM 5176  C C     . LYS E 1 129 ? 99.780  38.441  32.651  1.00 115.05 ? 128 LYS I C     1 
ATOM 5177  O O     . LYS E 1 129 ? 98.875  37.857  33.241  1.00 113.17 ? 128 LYS I O     1 
ATOM 5178  C CB    . LYS E 1 129 ? 99.579  38.965  30.213  1.00 116.70 ? 128 LYS I CB    1 
ATOM 5179  N N     . ALA E 1 130 ? 101.061 38.188  32.854  1.00 135.32 ? 129 ALA I N     1 
ATOM 5180  C CA    . ALA E 1 130 ? 101.522 37.239  33.849  1.00 135.45 ? 129 ALA I CA    1 
ATOM 5181  C C     . ALA E 1 130 ? 101.261 37.763  35.257  1.00 133.38 ? 129 ALA I C     1 
ATOM 5182  O O     . ALA E 1 130 ? 100.752 37.037  36.103  1.00 132.04 ? 129 ALA I O     1 
ATOM 5183  C CB    . ALA E 1 130 ? 103.001 36.958  33.656  1.00 138.78 ? 129 ALA I CB    1 
ATOM 5184  N N     . ASN E 1 131 ? 101.582 39.026  35.509  1.00 121.34 ? 130 ASN I N     1 
ATOM 5185  C CA    . ASN E 1 131 ? 101.299 39.607  36.814  1.00 119.35 ? 130 ASN I CA    1 
ATOM 5186  C C     . ASN E 1 131 ? 99.802  39.701  37.037  1.00 116.38 ? 130 ASN I C     1 
ATOM 5187  O O     . ASN E 1 131 ? 99.282  39.405  38.106  1.00 114.81 ? 130 ASN I O     1 
ATOM 5188  C CB    . ASN E 1 131 ? 101.946 40.982  36.946  1.00 120.50 ? 130 ASN I CB    1 
ATOM 5189  N N     . LEU E 1 132 ? 99.127  40.107  35.977  1.00 122.62 ? 131 LEU I N     1 
ATOM 5190  C CA    . LEU E 1 132 ? 97.690  40.330  35.939  1.00 120.17 ? 131 LEU I CA    1 
ATOM 5191  C C     . LEU E 1 132 ? 96.936  39.049  36.304  1.00 119.48 ? 131 LEU I C     1 
ATOM 5192  O O     . LEU E 1 132 ? 95.925  39.094  37.008  1.00 117.72 ? 131 LEU I O     1 
ATOM 5193  C CB    . LEU E 1 132 ? 97.256  40.831  34.562  1.00 120.26 ? 131 LEU I CB    1 
ATOM 5194  N N     . THR E 1 133 ? 97.448  37.912  35.840  1.00 115.29 ? 132 THR I N     1 
ATOM 5195  C CA    . THR E 1 133 ? 96.786  36.617  36.024  1.00 114.78 ? 132 THR I CA    1 
ATOM 5196  C C     . THR E 1 133 ? 96.637  36.192  37.486  1.00 113.28 ? 132 THR I C     1 
ATOM 5197  O O     . THR E 1 133 ? 95.542  35.808  37.918  1.00 111.67 ? 132 THR I O     1 
ATOM 5198  C CB    . THR E 1 133 ? 97.504  35.498  35.231  1.00 116.92 ? 132 THR I CB    1 
ATOM 5199  O OG1   . THR E 1 133 ? 97.106  35.555  33.855  1.00 117.83 ? 132 THR I OG1   1 
ATOM 5200  C CG2   . THR E 1 133 ? 97.157  34.123  35.792  1.00 116.55 ? 132 THR I CG2   1 
ATOM 5201  N N     . LYS E 1 134 ? 97.738  36.258  38.234  1.00 111.82 ? 133 LYS I N     1 
ATOM 5202  C CA    . LYS E 1 134 ? 97.748  35.860  39.640  1.00 110.48 ? 133 LYS I CA    1 
ATOM 5203  C C     . LYS E 1 134 ? 96.681  36.600  40.452  1.00 108.03 ? 133 LYS I C     1 
ATOM 5204  O O     . LYS E 1 134 ? 95.999  36.000  41.288  1.00 106.37 ? 133 LYS I O     1 
ATOM 5205  C CB    . LYS E 1 134 ? 99.134  36.083  40.251  1.00 111.75 ? 133 LYS I CB    1 
ATOM 5206  N N     . MET E 1 135 ? 96.535  37.898  40.188  1.00 87.87  ? 134 MET I N     1 
ATOM 5207  C CA    . MET E 1 135 ? 95.557  38.729  40.883  0.77 85.72  ? 134 MET I CA    1 
ATOM 5208  C C     . MET E 1 135 ? 94.169  38.157  40.674  1.00 83.89  ? 134 MET I C     1 
ATOM 5209  O O     . MET E 1 135 ? 93.353  38.117  41.592  0.32 81.73  ? 134 MET I O     1 
ATOM 5210  C CB    . MET E 1 135 ? 95.612  40.170  40.370  1.00 86.34  ? 134 MET I CB    1 
ATOM 5211  N N     . LEU E 1 136 ? 93.917  37.699  39.458  1.00 90.42  ? 135 LEU I N     1 
ATOM 5212  C CA    . LEU E 1 136 ? 92.637  37.088  39.135  1.00 89.07  ? 135 LEU I CA    1 
ATOM 5213  C C     . LEU E 1 136 ? 92.478  35.712  39.795  1.00 88.48  ? 135 LEU I C     1 
ATOM 5214  O O     . LEU E 1 136 ? 91.385  35.347  40.241  1.00 86.42  ? 135 LEU I O     1 
ATOM 5215  C CB    . LEU E 1 136 ? 92.452  36.988  37.616  1.00 90.76  ? 135 LEU I CB    1 
ATOM 5216  C CG    . LEU E 1 136 ? 91.074  36.499  37.175  1.00 90.04  ? 135 LEU I CG    1 
ATOM 5217  C CD1   . LEU E 1 136 ? 89.987  37.239  37.929  1.00 86.63  ? 135 LEU I CD1   1 
ATOM 5218  C CD2   . LEU E 1 136 ? 90.885  36.676  35.687  1.00 91.79  ? 135 LEU I CD2   1 
ATOM 5219  N N     . SER E 1 137 ? 93.568  34.953  39.858  1.00 108.23 ? 136 SER I N     1 
ATOM 5220  C CA    . SER E 1 137 ? 93.534  33.645  40.501  1.00 107.73 ? 136 SER I CA    1 
ATOM 5221  C C     . SER E 1 137 ? 93.088  33.791  41.952  1.00 105.34 ? 136 SER I C     1 
ATOM 5222  O O     . SER E 1 137 ? 92.390  32.932  42.490  1.00 104.19 ? 136 SER I O     1 
ATOM 5223  C CB    . SER E 1 137 ? 94.903  32.964  40.423  1.00 109.97 ? 136 SER I CB    1 
ATOM 5224  N N     . SER E 1 138 ? 93.460  34.908  42.568  1.00 104.17 ? 137 SER I N     1 
ATOM 5225  C CA    . SER E 1 138 ? 93.139  35.156  43.967  1.00 102.53 ? 137 SER I CA    1 
ATOM 5226  C C     . SER E 1 138 ? 91.656  35.404  44.174  1.00 100.09 ? 137 SER I C     1 
ATOM 5227  O O     . SER E 1 138 ? 91.222  35.711  45.281  1.00 98.77  ? 137 SER I O     1 
ATOM 5228  C CB    . SER E 1 138 ? 93.913  36.363  44.487  1.00 103.13 ? 137 SER I CB    1 
ATOM 5229  O OG    . SER E 1 138 ? 93.360  37.571  43.996  1.00 102.82 ? 137 SER I OG    1 
ATOM 5230  N N     . LEU E 1 139 ? 90.877  35.290  43.108  1.00 107.20 ? 138 LEU I N     1 
ATOM 5231  C CA    . LEU E 1 139 ? 89.457  35.584  43.187  1.00 104.81 ? 138 LEU I CA    1 
ATOM 5232  C C     . LEU E 1 139 ? 88.637  34.421  42.623  1.00 104.24 ? 138 LEU I C     1 
ATOM 5233  O O     . LEU E 1 139 ? 88.146  34.478  41.493  1.00 104.25 ? 138 LEU I O     1 
ATOM 5234  C CB    . LEU E 1 139 ? 89.150  36.890  42.442  1.00 104.99 ? 138 LEU I CB    1 
ATOM 5235  C CG    . LEU E 1 139 ? 90.140  38.050  42.633  1.00 106.48 ? 138 LEU I CG    1 
ATOM 5236  C CD1   . LEU E 1 139 ? 89.769  39.239  41.761  1.00 107.06 ? 138 LEU I CD1   1 
ATOM 5237  C CD2   . LEU E 1 139 ? 90.234  38.474  44.087  1.00 105.43 ? 138 LEU I CD2   1 
ATOM 5238  N N     . GLN E 1 140 ? 88.501  33.362  43.415  1.00 119.32 ? 139 GLN I N     1 
ATOM 5239  C CA    . GLN E 1 140 ? 87.720  32.203  43.001  1.00 119.14 ? 139 GLN I CA    1 
ATOM 5240  C C     . GLN E 1 140 ? 86.232  32.551  42.907  1.00 116.91 ? 139 GLN I C     1 
ATOM 5241  O O     . GLN E 1 140 ? 85.372  31.809  43.385  1.00 118.43 ? 139 GLN I O     1 
ATOM 5242  C CB    . GLN E 1 140 ? 87.941  31.033  43.964  1.00 120.77 ? 139 GLN I CB    1 
ATOM 5243  N N     . GLU F 1 3   ? 99.173  34.686  27.954  1.00 148.17 ? 2   GLU J N     1 
ATOM 5244  C CA    . GLU F 1 3   ? 97.815  34.529  28.466  1.00 145.20 ? 2   GLU J CA    1 
ATOM 5245  C C     . GLU F 1 3   ? 96.789  34.881  27.397  1.00 144.60 ? 2   GLU J C     1 
ATOM 5246  O O     . GLU F 1 3   ? 97.144  35.164  26.248  1.00 146.87 ? 2   GLU J O     1 
ATOM 5247  C CB    . GLU F 1 3   ? 97.600  35.405  29.701  1.00 142.52 ? 2   GLU J CB    1 
ATOM 5248  N N     . PHE F 1 4   ? 95.515  34.864  27.781  1.00 152.13 ? 3   PHE J N     1 
ATOM 5249  C CA    . PHE F 1 4   ? 94.442  35.230  26.868  1.00 153.05 ? 3   PHE J CA    1 
ATOM 5250  C C     . PHE F 1 4   ? 94.444  36.728  26.603  1.00 152.39 ? 3   PHE J C     1 
ATOM 5251  O O     . PHE F 1 4   ? 95.252  37.464  27.169  1.00 150.61 ? 3   PHE J O     1 
ATOM 5252  C CB    . PHE F 1 4   ? 93.079  34.830  27.438  1.00 152.91 ? 3   PHE J CB    1 
ATOM 5253  N N     . THR F 1 5   ? 93.536  37.163  25.733  1.00 102.24 ? 4   THR J N     1 
ATOM 5254  C CA    . THR F 1 5   ? 93.396  38.571  25.368  1.00 101.83 ? 4   THR J CA    1 
ATOM 5255  C C     . THR F 1 5   ? 93.396  39.507  26.579  1.00 98.45  ? 4   THR J C     1 
ATOM 5256  O O     . THR F 1 5   ? 93.015  39.104  27.673  1.00 96.88  ? 4   THR J O     1 
ATOM 5257  C CB    . THR F 1 5   ? 92.096  38.795  24.570  1.00 105.77 ? 4   THR J CB    1 
ATOM 5258  O OG1   . THR F 1 5   ? 92.089  40.122  24.035  1.00 106.20 ? 4   THR J OG1   1 
ATOM 5259  C CG2   . THR F 1 5   ? 90.871  38.608  25.465  1.00 105.70 ? 4   THR J CG2   1 
ATOM 5260  N N     . TYR F 1 6   ? 93.837  40.748  26.387  1.00 126.98 ? 5   TYR J N     1 
ATOM 5261  C CA    . TYR F 1 6   ? 93.833  41.721  27.478  1.00 123.81 ? 5   TYR J CA    1 
ATOM 5262  C C     . TYR F 1 6   ? 92.388  42.035  27.863  1.00 124.22 ? 5   TYR J C     1 
ATOM 5263  O O     . TYR F 1 6   ? 92.082  42.183  29.046  1.00 121.56 ? 5   TYR J O     1 
ATOM 5264  C CB    . TYR F 1 6   ? 94.564  43.022  27.130  1.00 123.10 ? 5   TYR J CB    1 
ATOM 5265  C CG    . TYR F 1 6   ? 96.043  43.046  27.462  1.00 122.46 ? 5   TYR J CG    1 
ATOM 5266  C CD1   . TYR F 1 6   ? 96.618  42.075  28.272  1.00 122.27 ? 5   TYR J CD1   1 
ATOM 5267  C CD2   . TYR F 1 6   ? 96.862  44.053  26.969  1.00 123.00 ? 5   TYR J CD2   1 
ATOM 5268  C CE1   . TYR F 1 6   ? 97.978  42.104  28.573  1.00 123.34 ? 5   TYR J CE1   1 
ATOM 5269  C CE2   . TYR F 1 6   ? 98.217  44.091  27.261  1.00 123.52 ? 5   TYR J CE2   1 
ATOM 5270  C CZ    . TYR F 1 6   ? 98.771  43.116  28.063  1.00 124.07 ? 5   TYR J CZ    1 
ATOM 5271  O OH    . TYR F 1 6   ? 100.119 43.160  28.346  1.00 126.35 ? 5   TYR J OH    1 
ATOM 5272  N N     . SER F 1 7   ? 91.514  42.142  26.861  1.00 101.90 ? 6   SER J N     1 
ATOM 5273  C CA    . SER F 1 7   ? 90.093  42.419  27.086  1.00 102.55 ? 6   SER J CA    1 
ATOM 5274  C C     . SER F 1 7   ? 89.507  41.489  28.139  1.00 102.54 ? 6   SER J C     1 
ATOM 5275  O O     . SER F 1 7   ? 88.882  41.935  29.097  1.00 100.80 ? 6   SER J O     1 
ATOM 5276  C CB    . SER F 1 7   ? 89.292  42.273  25.788  1.00 104.27 ? 6   SER J CB    1 
ATOM 5277  O OG    . SER F 1 7   ? 88.927  40.918  25.547  1.00 106.43 ? 6   SER J OG    1 
ATOM 5278  N N     . TYR F 1 8   ? 89.728  40.193  27.944  1.00 81.95  ? 7   TYR J N     1 
ATOM 5279  C CA    . TYR F 1 8   ? 89.290  39.158  28.872  1.00 80.86  ? 7   TYR J CA    1 
ATOM 5280  C C     . TYR F 1 8   ? 89.848  39.400  30.261  1.00 77.97  ? 7   TYR J C     1 
ATOM 5281  O O     . TYR F 1 8   ? 89.136  39.283  31.249  1.00 75.84  ? 7   TYR J O     1 
ATOM 5282  C CB    . TYR F 1 8   ? 89.735  37.784  28.359  1.00 84.14  ? 7   TYR J CB    1 
ATOM 5283  C CG    . TYR F 1 8   ? 89.487  36.628  29.304  1.00 83.88  ? 7   TYR J CG    1 
ATOM 5284  C CD1   . TYR F 1 8   ? 90.495  36.155  30.132  1.00 83.76  ? 7   TYR J CD1   1 
ATOM 5285  C CD2   . TYR F 1 8   ? 88.253  35.996  29.348  1.00 84.45  ? 7   TYR J CD2   1 
ATOM 5286  C CE1   . TYR F 1 8   ? 90.277  35.093  30.988  1.00 84.15  ? 7   TYR J CE1   1 
ATOM 5287  C CE2   . TYR F 1 8   ? 88.023  34.928  30.202  1.00 84.80  ? 7   TYR J CE2   1 
ATOM 5288  C CZ    . TYR F 1 8   ? 89.039  34.480  31.023  1.00 84.63  ? 7   TYR J CZ    1 
ATOM 5289  O OH    . TYR F 1 8   ? 88.816  33.418  31.879  1.00 85.55  ? 7   TYR J OH    1 
ATOM 5290  N N     . LEU F 1 9   ? 91.124  39.751  30.326  1.00 101.71 ? 8   LEU J N     1 
ATOM 5291  C CA    . LEU F 1 9   ? 91.805  39.921  31.602  1.00 98.21  ? 8   LEU J CA    1 
ATOM 5292  C C     . LEU F 1 9   ? 91.202  41.058  32.440  1.00 95.94  ? 8   LEU J C     1 
ATOM 5293  O O     . LEU F 1 9   ? 91.106  40.941  33.668  1.00 93.85  ? 8   LEU J O     1 
ATOM 5294  C CB    . LEU F 1 9   ? 93.309  40.132  31.385  1.00 96.67  ? 8   LEU J CB    1 
ATOM 5295  C CG    . LEU F 1 9   ? 94.238  38.918  31.240  1.00 98.40  ? 8   LEU J CG    1 
ATOM 5296  C CD1   . LEU F 1 9   ? 93.641  37.810  30.381  1.00 100.53 ? 8   LEU J CD1   1 
ATOM 5297  C CD2   . LEU F 1 9   ? 95.578  39.352  30.662  1.00 99.61  ? 8   LEU J CD2   1 
ATOM 5298  N N     . PHE F 1 10  ? 90.789  42.143  31.778  1.00 75.17  ? 9   PHE J N     1 
ATOM 5299  C CA    . PHE F 1 10  ? 90.134  43.275  32.454  1.00 73.43  ? 9   PHE J CA    1 
ATOM 5300  C C     . PHE F 1 10  ? 88.637  43.045  32.687  1.00 75.31  ? 9   PHE J C     1 
ATOM 5301  O O     . PHE F 1 10  ? 88.081  43.493  33.694  1.00 71.82  ? 9   PHE J O     1 
ATOM 5302  C CB    . PHE F 1 10  ? 90.312  44.561  31.654  1.00 74.12  ? 9   PHE J CB    1 
ATOM 5303  C CG    . PHE F 1 10  ? 91.717  45.081  31.643  1.00 72.69  ? 9   PHE J CG    1 
ATOM 5304  C CD1   . PHE F 1 10  ? 92.469  45.100  32.799  1.00 71.53  ? 9   PHE J CD1   1 
ATOM 5305  C CD2   . PHE F 1 10  ? 92.285  45.555  30.465  1.00 75.53  ? 9   PHE J CD2   1 
ATOM 5306  C CE1   . PHE F 1 10  ? 93.760  45.579  32.786  1.00 73.24  ? 9   PHE J CE1   1 
ATOM 5307  C CE2   . PHE F 1 10  ? 93.576  46.033  30.448  1.00 77.17  ? 9   PHE J CE2   1 
ATOM 5308  C CZ    . PHE F 1 10  ? 94.315  46.046  31.612  1.00 76.05  ? 9   PHE J CZ    1 
ATOM 5309  N N     . ARG F 1 11  ? 87.990  42.374  31.735  1.00 97.09  ? 10  ARG J N     1 
ATOM 5310  C CA    . ARG F 1 11  ? 86.603  41.969  31.880  1.00 92.42  ? 10  ARG J CA    1 
ATOM 5311  C C     . ARG F 1 11  ? 86.471  41.257  33.217  1.00 91.79  ? 10  ARG J C     1 
ATOM 5312  O O     . ARG F 1 11  ? 85.769  41.725  34.110  1.00 87.04  ? 10  ARG J O     1 
ATOM 5313  C CB    . ARG F 1 11  ? 86.207  41.019  30.743  1.00 94.73  ? 10  ARG J CB    1 
ATOM 5314  C CG    . ARG F 1 11  ? 85.006  41.453  29.889  1.00 90.68  ? 10  ARG J CG    1 
ATOM 5315  C CD    . ARG F 1 11  ? 84.699  40.441  28.766  1.00 93.72  ? 10  ARG J CD    1 
ATOM 5316  N NE    . ARG F 1 11  ? 85.796  40.323  27.802  1.00 99.34  ? 10  ARG J NE    1 
ATOM 5317  C CZ    . ARG F 1 11  ? 85.836  39.451  26.794  1.00 102.58 ? 10  ARG J CZ    1 
ATOM 5318  N NH1   . ARG F 1 11  ? 84.837  38.599  26.600  1.00 101.32 ? 10  ARG J NH1   1 
ATOM 5319  N NH2   . ARG F 1 11  ? 86.883  39.426  25.975  1.00 106.87 ? 10  ARG J NH2   1 
ATOM 5320  N N     . MET F 1 12  ? 87.205  40.159  33.368  1.00 89.67  ? 11  MET J N     1 
ATOM 5321  C CA    . MET F 1 12  ? 87.010  39.243  34.493  1.00 87.79  ? 11  MET J CA    1 
ATOM 5322  C C     . MET F 1 12  ? 87.413  39.798  35.856  0.91 84.07  ? 11  MET J C     1 
ATOM 5323  O O     . MET F 1 12  ? 86.767  39.500  36.860  0.43 82.29  ? 11  MET J O     1 
ATOM 5324  C CB    . MET F 1 12  ? 87.732  37.917  34.236  1.00 89.36  ? 11  MET J CB    1 
ATOM 5325  C CG    . MET F 1 12  ? 87.316  37.240  32.943  1.00 93.95  ? 11  MET J CG    1 
ATOM 5326  S SD    . MET F 1 12  ? 85.558  36.854  32.901  1.00 94.21  ? 11  MET J SD    1 
ATOM 5327  C CE    . MET F 1 12  ? 85.134  37.332  31.224  1.00 94.22  ? 11  MET J CE    1 
ATOM 5328  N N     . ILE F 1 13  ? 88.481  40.586  35.902  1.00 83.04  ? 12  ILE J N     1 
ATOM 5329  C CA    . ILE F 1 13  ? 88.934  41.124  37.183  1.00 80.44  ? 12  ILE J CA    1 
ATOM 5330  C C     . ILE F 1 13  ? 87.945  42.147  37.734  1.00 78.40  ? 12  ILE J C     1 
ATOM 5331  O O     . ILE F 1 13  ? 87.475  42.018  38.877  1.00 77.05  ? 12  ILE J O     1 
ATOM 5332  C CB    . ILE F 1 13  ? 90.350  41.741  37.107  1.00 79.96  ? 12  ILE J CB    1 
ATOM 5333  C CG1   . ILE F 1 13  ? 91.394  40.635  36.931  1.00 81.84  ? 12  ILE J CG1   1 
ATOM 5334  C CG2   . ILE F 1 13  ? 90.648  42.535  38.370  1.00 78.27  ? 12  ILE J CG2   1 
ATOM 5335  C CD1   . ILE F 1 13  ? 92.818  41.086  37.166  1.00 82.79  ? 12  ILE J CD1   1 
ATOM 5336  N N     . SER F 1 14  ? 87.639  43.150  36.910  1.00 86.06  ? 13  SER J N     1 
ATOM 5337  C CA    . SER F 1 14  ? 86.674  44.189  37.253  1.00 81.74  ? 13  SER J CA    1 
ATOM 5338  C C     . SER F 1 14  ? 85.407  43.560  37.810  1.00 79.45  ? 13  SER J C     1 
ATOM 5339  O O     . SER F 1 14  ? 84.943  43.897  38.906  1.00 76.48  ? 13  SER J O     1 
ATOM 5340  C CB    . SER F 1 14  ? 86.329  45.002  36.008  1.00 80.38  ? 13  SER J CB    1 
ATOM 5341  O OG    . SER F 1 14  ? 85.406  46.034  36.307  1.00 74.82  ? 13  SER J OG    1 
ATOM 5342  N N     . HIS F 1 15  ? 84.877  42.612  37.047  1.00 74.91  ? 14  HIS J N     1 
ATOM 5343  C CA    . HIS F 1 15  ? 83.652  41.933  37.418  1.00 72.57  ? 14  HIS J CA    1 
ATOM 5344  C C     . HIS F 1 15  ? 83.774  41.154  38.718  1.00 74.42  ? 14  HIS J C     1 
ATOM 5345  O O     . HIS F 1 15  ? 82.847  41.154  39.535  1.00 71.68  ? 14  HIS J O     1 
ATOM 5346  C CB    . HIS F 1 15  ? 83.200  40.994  36.315  1.00 74.61  ? 14  HIS J CB    1 
ATOM 5347  C CG    . HIS F 1 15  ? 81.909  40.316  36.619  1.00 72.33  ? 14  HIS J CG    1 
ATOM 5348  N ND1   . HIS F 1 15  ? 80.775  41.015  36.963  1.00 67.95  ? 14  HIS J ND1   1 
ATOM 5349  C CD2   . HIS F 1 15  ? 81.574  39.007  36.655  1.00 74.55  ? 14  HIS J CD2   1 
ATOM 5350  C CE1   . HIS F 1 15  ? 79.790  40.166  37.189  1.00 70.01  ? 14  HIS J CE1   1 
ATOM 5351  N NE2   . HIS F 1 15  ? 80.248  38.940  37.004  1.00 71.80  ? 14  HIS J NE2   1 
ATOM 5352  N N     . GLU F 1 16  ? 84.911  40.489  38.911  1.00 73.97  ? 15  GLU J N     1 
ATOM 5353  C CA    . GLU F 1 16  ? 85.075  39.641  40.085  1.00 74.94  ? 15  GLU J CA    1 
ATOM 5354  C C     . GLU F 1 16  ? 85.184  40.468  41.352  1.00 73.07  ? 15  GLU J C     1 
ATOM 5355  O O     . GLU F 1 16  ? 84.713  40.052  42.407  1.00 72.70  ? 15  GLU J O     1 
ATOM 5356  C CB    . GLU F 1 16  ? 86.271  38.702  39.942  1.00 77.13  ? 15  GLU J CB    1 
ATOM 5357  C CG    . GLU F 1 16  ? 86.067  37.390  40.677  1.00 78.22  ? 15  GLU J CG    1 
ATOM 5358  C CD    . GLU F 1 16  ? 84.819  36.653  40.210  1.00 78.97  ? 15  GLU J CD    1 
ATOM 5359  O OE1   . GLU F 1 16  ? 84.358  35.742  40.937  1.00 78.92  ? 15  GLU J OE1   1 
ATOM 5360  O OE2   . GLU F 1 16  ? 84.300  36.981  39.118  1.00 79.48  ? 15  GLU J OE2   1 
ATOM 5361  N N     . MET F 1 17  ? 85.795  41.642  41.236  1.00 77.14  ? 16  MET J N     1 
ATOM 5362  C CA    . MET F 1 17  ? 85.883  42.557  42.362  1.00 75.55  ? 16  MET J CA    1 
ATOM 5363  C C     . MET F 1 17  ? 84.500  43.061  42.721  1.00 72.00  ? 16  MET J C     1 
ATOM 5364  O O     . MET F 1 17  ? 84.119  43.039  43.887  0.60 71.77  ? 16  MET J O     1 
ATOM 5365  C CB    . MET F 1 17  ? 86.790  43.738  42.044  1.00 74.63  ? 16  MET J CB    1 
ATOM 5366  C CG    . MET F 1 17  ? 88.210  43.352  41.684  1.00 77.06  ? 16  MET J CG    1 
ATOM 5367  S SD    . MET F 1 17  ? 89.295  44.790  41.550  1.00 76.27  ? 16  MET J SD    1 
ATOM 5368  C CE    . MET F 1 17  ? 89.686  45.099  43.273  1.00 76.80  ? 16  MET J CE    1 
ATOM 5369  N N     . LYS F 1 18  ? 83.752  43.516  41.717  1.00 56.78  ? 17  LYS J N     1 
ATOM 5370  C CA    . LYS F 1 18  ? 82.367  43.921  41.926  1.00 56.56  ? 17  LYS J CA    1 
ATOM 5371  C C     . LYS F 1 18  ? 81.619  42.804  42.646  1.00 58.02  ? 17  LYS J C     1 
ATOM 5372  O O     . LYS F 1 18  ? 80.945  43.042  43.653  1.00 57.71  ? 17  LYS J O     1 
ATOM 5373  C CB    . LYS F 1 18  ? 81.684  44.232  40.594  1.00 57.50  ? 17  LYS J CB    1 
ATOM 5374  N N     . GLN F 1 19  ? 81.777  41.585  42.130  1.00 76.58  ? 18  GLN J N     1 
ATOM 5375  C CA    . GLN F 1 19  ? 81.212  40.381  42.731  1.00 78.32  ? 18  GLN J CA    1 
ATOM 5376  C C     . GLN F 1 19  ? 81.719  40.124  44.146  1.00 80.91  ? 18  GLN J C     1 
ATOM 5377  O O     . GLN F 1 19  ? 80.938  39.791  45.041  1.00 80.63  ? 18  GLN J O     1 
ATOM 5378  C CB    . GLN F 1 19  ? 81.512  39.161  41.854  1.00 81.75  ? 18  GLN J CB    1 
ATOM 5379  C CG    . GLN F 1 19  ? 80.627  39.056  40.634  1.00 79.60  ? 18  GLN J CG    1 
ATOM 5380  C CD    . GLN F 1 19  ? 79.198  39.414  40.956  1.00 75.04  ? 18  GLN J CD    1 
ATOM 5381  O OE1   . GLN F 1 19  ? 78.748  40.527  40.676  1.00 72.65  ? 18  GLN J OE1   1 
ATOM 5382  N NE2   . GLN F 1 19  ? 78.475  38.479  41.568  1.00 75.91  ? 18  GLN J NE2   1 
ATOM 5383  N N     . LYS F 1 20  ? 83.028  40.264  44.342  1.00 67.88  ? 19  LYS J N     1 
ATOM 5384  C CA    . LYS F 1 20  ? 83.626  40.047  45.660  1.00 69.60  ? 19  LYS J CA    1 
ATOM 5385  C C     . LYS F 1 20  ? 83.163  41.117  46.645  1.00 68.25  ? 19  LYS J C     1 
ATOM 5386  O O     . LYS F 1 20  ? 82.757  40.803  47.775  1.00 69.15  ? 19  LYS J O     1 
ATOM 5387  C CB    . LYS F 1 20  ? 85.159  40.019  45.580  1.00 71.16  ? 19  LYS J CB    1 
ATOM 5388  N N     . ALA F 1 21  ? 83.217  42.374  46.196  1.00 70.25  ? 20  ALA J N     1 
ATOM 5389  C CA    . ALA F 1 21  ? 82.848  43.524  47.019  1.00 68.00  ? 20  ALA J CA    1 
ATOM 5390  C C     . ALA F 1 21  ? 81.395  43.490  47.464  1.00 65.33  ? 20  ALA J C     1 
ATOM 5391  O O     . ALA F 1 21  ? 81.100  43.753  48.635  1.00 66.18  ? 20  ALA J O     1 
ATOM 5392  C CB    . ALA F 1 21  ? 83.130  44.814  46.288  1.00 64.01  ? 20  ALA J CB    1 
ATOM 5393  N N     . ASP F 1 22  ? 80.491  43.166  46.542  1.00 74.75  ? 21  ASP J N     1 
ATOM 5394  C CA    . ASP F 1 22  ? 79.063  43.187  46.858  1.00 71.39  ? 21  ASP J CA    1 
ATOM 5395  C C     . ASP F 1 22  ? 78.711  42.265  48.015  1.00 74.90  ? 21  ASP J C     1 
ATOM 5396  O O     . ASP F 1 22  ? 77.907  42.620  48.877  1.00 73.86  ? 21  ASP J O     1 
ATOM 5397  C CB    . ASP F 1 22  ? 78.214  42.875  45.627  1.00 68.95  ? 21  ASP J CB    1 
ATOM 5398  C CG    . ASP F 1 22  ? 78.233  44.006  44.606  1.00 67.07  ? 21  ASP J CG    1 
ATOM 5399  O OD1   . ASP F 1 22  ? 78.486  45.162  44.997  1.00 65.69  ? 21  ASP J OD1   1 
ATOM 5400  O OD2   . ASP F 1 22  ? 77.999  43.740  43.410  1.00 68.22  ? 21  ASP J OD2   1 
ATOM 5401  N N     . GLN F 1 23  ? 79.338  41.096  48.046  1.00 85.49  ? 22  GLN J N     1 
ATOM 5402  C CA    . GLN F 1 23  ? 79.116  40.154  49.132  1.00 88.63  ? 22  GLN J CA    1 
ATOM 5403  C C     . GLN F 1 23  ? 79.671  40.712  50.425  1.00 91.24  ? 22  GLN J C     1 
ATOM 5404  O O     . GLN F 1 23  ? 79.042  40.612  51.476  1.00 92.23  ? 22  GLN J O     1 
ATOM 5405  C CB    . GLN F 1 23  ? 79.771  38.819  48.811  1.00 90.53  ? 22  GLN J CB    1 
ATOM 5406  C CG    . GLN F 1 23  ? 79.528  38.388  47.392  1.00 89.05  ? 22  GLN J CG    1 
ATOM 5407  C CD    . GLN F 1 23  ? 79.816  36.932  47.189  1.00 91.37  ? 22  GLN J CD    1 
ATOM 5408  O OE1   . GLN F 1 23  ? 79.624  36.127  48.102  1.00 92.60  ? 22  GLN J OE1   1 
ATOM 5409  N NE2   . GLN F 1 23  ? 80.287  36.573  45.990  1.00 91.85  ? 22  GLN J NE2   1 
ATOM 5410  N N     . LYS F 1 24  ? 80.856  41.302  50.336  1.00 81.70  ? 23  LYS J N     1 
ATOM 5411  C CA    . LYS F 1 24  ? 81.459  41.973  51.474  1.00 83.78  ? 23  LYS J CA    1 
ATOM 5412  C C     . LYS F 1 24  ? 80.575  43.134  51.927  1.00 81.71  ? 23  LYS J C     1 
ATOM 5413  O O     . LYS F 1 24  ? 80.444  43.411  53.125  1.00 83.76  ? 23  LYS J O     1 
ATOM 5414  C CB    . LYS F 1 24  ? 82.860  42.470  51.116  1.00 84.52  ? 23  LYS J CB    1 
ATOM 5415  C CG    . LYS F 1 24  ? 83.899  41.361  51.005  1.00 86.53  ? 23  LYS J CG    1 
ATOM 5416  C CD    . LYS F 1 24  ? 84.164  40.722  52.368  1.00 88.92  ? 23  LYS J CD    1 
ATOM 5417  C CE    . LYS F 1 24  ? 84.657  39.281  52.243  1.00 90.27  ? 23  LYS J CE    1 
ATOM 5418  N NZ    . LYS F 1 24  ? 83.597  38.336  51.751  1.00 88.95  ? 23  LYS J NZ    1 
ATOM 5419  N N     . LEU F 1 25  ? 79.943  43.789  50.958  1.00 64.93  ? 24  LEU J N     1 
ATOM 5420  C CA    . LEU F 1 25  ? 79.068  44.923  51.240  1.00 61.02  ? 24  LEU J CA    1 
ATOM 5421  C C     . LEU F 1 25  ? 77.591  44.582  51.453  1.00 60.74  ? 24  LEU J C     1 
ATOM 5422  O O     . LEU F 1 25  ? 76.835  45.446  51.880  1.00 60.59  ? 24  LEU J O     1 
ATOM 5423  C CB    . LEU F 1 25  ? 79.182  45.944  50.119  1.00 56.55  ? 24  LEU J CB    1 
ATOM 5424  C CG    . LEU F 1 25  ? 80.542  46.605  49.971  1.00 56.37  ? 24  LEU J CG    1 
ATOM 5425  C CD1   . LEU F 1 25  ? 80.656  47.155  48.574  1.00 53.64  ? 24  LEU J CD1   1 
ATOM 5426  C CD2   . LEU F 1 25  ? 80.723  47.705  51.007  1.00 55.67  ? 24  LEU J CD2   1 
ATOM 5427  N N     . GLU F 1 26  ? 77.181  43.350  51.145  1.00 71.71  ? 25  GLU J N     1 
ATOM 5428  C CA    . GLU F 1 26  ? 75.791  42.919  51.342  1.00 70.52  ? 25  GLU J CA    1 
ATOM 5429  C C     . GLU F 1 26  ? 75.369  43.115  52.792  1.00 72.45  ? 25  GLU J C     1 
ATOM 5430  O O     . GLU F 1 26  ? 74.197  43.346  53.104  1.00 73.50  ? 25  GLU J O     1 
ATOM 5431  C CB    . GLU F 1 26  ? 75.607  41.449  50.944  1.00 73.08  ? 25  GLU J CB    1 
ATOM 5432  N N     . GLN F 1 27  ? 76.354  43.039  53.674  1.00 67.67  ? 26  GLN J N     1 
ATOM 5433  C CA    . GLN F 1 27  ? 76.143  43.232  55.095  1.00 69.26  ? 26  GLN J CA    1 
ATOM 5434  C C     . GLN F 1 27  ? 75.743  44.669  55.418  1.00 67.54  ? 26  GLN J C     1 
ATOM 5435  O O     . GLN F 1 27  ? 75.233  44.941  56.498  1.00 69.19  ? 26  GLN J O     1 
ATOM 5436  C CB    . GLN F 1 27  ? 77.425  42.857  55.838  1.00 75.14  ? 26  GLN J CB    1 
ATOM 5437  C CG    . GLN F 1 27  ? 77.299  42.798  57.339  1.00 79.03  ? 26  GLN J CG    1 
ATOM 5438  C CD    . GLN F 1 27  ? 78.255  43.748  58.018  1.00 81.55  ? 26  GLN J CD    1 
ATOM 5439  O OE1   . GLN F 1 27  ? 79.162  44.295  57.380  1.00 80.80  ? 26  GLN J OE1   1 
ATOM 5440  N NE2   . GLN F 1 27  ? 78.056  43.959  59.321  1.00 84.33  ? 26  GLN J NE2   1 
ATOM 5441  N N     . PHE F 1 28  ? 75.975  45.585  54.483  1.00 77.06  ? 27  PHE J N     1 
ATOM 5442  C CA    . PHE F 1 28  ? 75.660  46.996  54.693  1.00 73.50  ? 27  PHE J CA    1 
ATOM 5443  C C     . PHE F 1 28  ? 74.477  47.453  53.842  1.00 72.44  ? 27  PHE J C     1 
ATOM 5444  O O     . PHE F 1 28  ? 74.187  48.651  53.766  1.00 71.48  ? 27  PHE J O     1 
ATOM 5445  C CB    . PHE F 1 28  ? 76.880  47.878  54.382  1.00 72.48  ? 27  PHE J CB    1 
ATOM 5446  C CG    . PHE F 1 28  ? 78.040  47.679  55.326  1.00 78.68  ? 27  PHE J CG    1 
ATOM 5447  C CD1   . PHE F 1 28  ? 78.083  48.334  56.546  1.00 81.59  ? 27  PHE J CD1   1 
ATOM 5448  C CD2   . PHE F 1 28  ? 79.087  46.840  54.993  1.00 83.40  ? 27  PHE J CD2   1 
ATOM 5449  C CE1   . PHE F 1 28  ? 79.143  48.152  57.416  1.00 89.56  ? 27  PHE J CE1   1 
ATOM 5450  C CE2   . PHE F 1 28  ? 80.148  46.659  55.862  1.00 90.52  ? 27  PHE J CE2   1 
ATOM 5451  C CZ    . PHE F 1 28  ? 80.171  47.314  57.074  1.00 93.57  ? 27  PHE J CZ    1 
ATOM 5452  N N     . ASP F 1 29  ? 73.809  46.500  53.198  1.00 69.43  ? 28  ASP J N     1 
ATOM 5453  C CA    . ASP F 1 29  ? 72.688  46.794  52.310  1.00 67.77  ? 28  ASP J CA    1 
ATOM 5454  C C     . ASP F 1 29  ? 73.051  47.787  51.194  1.00 67.62  ? 28  ASP J C     1 
ATOM 5455  O O     . ASP F 1 29  ? 72.212  48.585  50.779  1.00 67.37  ? 28  ASP J O     1 
ATOM 5456  C CB    . ASP F 1 29  ? 71.471  47.297  53.110  1.00 68.69  ? 28  ASP J CB    1 
ATOM 5457  C CG    . ASP F 1 29  ? 70.170  47.240  52.308  1.00 68.05  ? 28  ASP J CG    1 
ATOM 5458  O OD1   . ASP F 1 29  ? 69.709  46.123  51.993  1.00 66.90  ? 28  ASP J OD1   1 
ATOM 5459  O OD2   . ASP F 1 29  ? 69.600  48.308  51.992  1.00 69.00  ? 28  ASP J OD2   1 
ATOM 5460  N N     . ILE F 1 30  ? 74.295  47.757  50.713  1.00 57.88  ? 29  ILE J N     1 
ATOM 5461  C CA    . ILE F 1 30  ? 74.668  48.579  49.557  1.00 57.55  ? 29  ILE J CA    1 
ATOM 5462  C C     . ILE F 1 30  ? 75.466  47.815  48.520  1.00 58.30  ? 29  ILE J C     1 
ATOM 5463  O O     . ILE F 1 30  ? 76.172  46.862  48.838  1.00 59.38  ? 29  ILE J O     1 
ATOM 5464  C CB    . ILE F 1 30  ? 75.500  49.793  49.942  1.00 58.02  ? 29  ILE J CB    1 
ATOM 5465  C CG1   . ILE F 1 30  ? 76.705  49.361  50.776  1.00 59.53  ? 29  ILE J CG1   1 
ATOM 5466  C CG2   . ILE F 1 30  ? 74.656  50.795  50.682  1.00 57.29  ? 29  ILE J CG2   1 
ATOM 5467  C CD1   . ILE F 1 30  ? 77.788  50.421  50.864  1.00 60.48  ? 29  ILE J CD1   1 
ATOM 5468  N N     . THR F 1 31  ? 75.346  48.252  47.272  1.00 57.85  ? 30  THR J N     1 
ATOM 5469  C CA    . THR F 1 31  ? 76.142  47.717  46.182  1.00 58.69  ? 30  THR J CA    1 
ATOM 5470  C C     . THR F 1 31  ? 77.546  48.283  46.314  1.00 59.77  ? 30  THR J C     1 
ATOM 5471  O O     . THR F 1 31  ? 77.819  49.049  47.233  1.00 59.89  ? 30  THR J O     1 
ATOM 5472  C CB    . THR F 1 31  ? 75.564  48.136  44.825  1.00 58.03  ? 30  THR J CB    1 
ATOM 5473  O OG1   . THR F 1 31  ? 75.829  49.527  44.597  1.00 57.75  ? 30  THR J OG1   1 
ATOM 5474  C CG2   . THR F 1 31  ? 74.075  47.906  44.798  1.00 56.94  ? 30  THR J CG2   1 
ATOM 5475  N N     . ASN F 1 32  ? 78.438  47.921  45.399  1.00 69.55  ? 31  ASN J N     1 
ATOM 5476  C CA    . ASN F 1 32  ? 79.794  48.452  45.455  1.00 73.11  ? 31  ASN J CA    1 
ATOM 5477  C C     . ASN F 1 32  ? 79.934  49.845  44.847  1.00 73.80  ? 31  ASN J C     1 
ATOM 5478  O O     . ASN F 1 32  ? 80.708  50.651  45.347  1.00 76.36  ? 31  ASN J O     1 
ATOM 5479  C CB    . ASN F 1 32  ? 80.806  47.478  44.851  1.00 75.36  ? 31  ASN J CB    1 
ATOM 5480  C CG    . ASN F 1 32  ? 80.777  47.466  43.343  1.00 75.28  ? 31  ASN J CG    1 
ATOM 5481  O OD1   . ASN F 1 32  ? 79.976  46.760  42.730  1.00 73.29  ? 31  ASN J OD1   1 
ATOM 5482  N ND2   . ASN F 1 32  ? 81.664  48.240  42.731  1.00 78.02  ? 31  ASN J ND2   1 
ATOM 5483  N N     . GLU F 1 33  ? 79.185  50.126  43.784  1.00 68.81  ? 32  GLU J N     1 
ATOM 5484  C CA    . GLU F 1 33  ? 79.181  51.454  43.174  1.00 69.02  ? 32  GLU J CA    1 
ATOM 5485  C C     . GLU F 1 33  ? 78.724  52.468  44.191  1.00 68.01  ? 32  GLU J C     1 
ATOM 5486  O O     . GLU F 1 33  ? 79.413  53.451  44.460  1.00 69.68  ? 32  GLU J O     1 
ATOM 5487  C CB    . GLU F 1 33  ? 78.221  51.505  41.991  1.00 67.17  ? 32  GLU J CB    1 
ATOM 5488  C CG    . GLU F 1 33  ? 78.639  50.674  40.792  1.00 68.35  ? 32  GLU J CG    1 
ATOM 5489  C CD    . GLU F 1 33  ? 78.604  49.183  41.074  1.00 67.92  ? 32  GLU J CD    1 
ATOM 5490  O OE1   . GLU F 1 33  ? 78.009  48.773  42.103  1.00 66.28  ? 32  GLU J OE1   1 
ATOM 5491  O OE2   . GLU F 1 33  ? 79.185  48.427  40.266  1.00 69.32  ? 32  GLU J OE2   1 
ATOM 5492  N N     . GLN F 1 34  ? 77.541  52.220  44.742  1.00 68.53  ? 33  GLN J N     1 
ATOM 5493  C CA    . GLN F 1 34  ? 77.014  52.994  45.856  1.00 67.90  ? 33  GLN J CA    1 
ATOM 5494  C C     . GLN F 1 34  ? 78.103  53.231  46.892  1.00 70.50  ? 33  GLN J C     1 
ATOM 5495  O O     . GLN F 1 34  ? 78.284  54.347  47.374  1.00 71.30  ? 33  GLN J O     1 
ATOM 5496  C CB    . GLN F 1 34  ? 75.833  52.254  46.493  1.00 66.09  ? 33  GLN J CB    1 
ATOM 5497  C CG    . GLN F 1 34  ? 74.500  52.540  45.827  1.00 64.59  ? 33  GLN J CG    1 
ATOM 5498  C CD    . GLN F 1 34  ? 73.425  51.502  46.112  1.00 63.63  ? 33  GLN J CD    1 
ATOM 5499  O OE1   . GLN F 1 34  ? 73.409  50.843  47.163  1.00 63.58  ? 33  GLN J OE1   1 
ATOM 5500  N NE2   . GLN F 1 34  ? 72.504  51.360  45.169  1.00 63.29  ? 33  GLN J NE2   1 
ATOM 5501  N N     . GLY F 1 35  ? 78.847  52.177  47.203  1.00 66.29  ? 34  GLY J N     1 
ATOM 5502  C CA    . GLY F 1 35  ? 79.916  52.263  48.178  1.00 69.63  ? 34  GLY J CA    1 
ATOM 5503  C C     . GLY F 1 35  ? 81.016  53.238  47.804  1.00 72.74  ? 34  GLY J C     1 
ATOM 5504  O O     . GLY F 1 35  ? 81.512  53.978  48.650  1.00 74.85  ? 34  GLY J O     1 
ATOM 5505  N N     . HIS F 1 36  ? 81.403  53.238  46.536  1.00 78.60  ? 35  HIS J N     1 
ATOM 5506  C CA    . HIS F 1 36  ? 82.471  54.110  46.088  1.00 81.80  ? 35  HIS J CA    1 
ATOM 5507  C C     . HIS F 1 36  ? 81.940  55.502  45.830  1.00 79.48  ? 35  HIS J C     1 
ATOM 5508  O O     . HIS F 1 36  ? 82.676  56.484  45.931  1.00 81.68  ? 35  HIS J O     1 
ATOM 5509  C CB    . HIS F 1 36  ? 83.150  53.540  44.849  1.00 84.23  ? 35  HIS J CB    1 
ATOM 5510  C CG    . HIS F 1 36  ? 84.196  52.518  45.164  1.00 88.92  ? 35  HIS J CG    1 
ATOM 5511  N ND1   . HIS F 1 36  ? 84.327  51.341  44.458  1.00 88.76  ? 35  HIS J ND1   1 
ATOM 5512  C CD2   . HIS F 1 36  ? 85.161  52.496  46.115  1.00 93.01  ? 35  HIS J CD2   1 
ATOM 5513  C CE1   . HIS F 1 36  ? 85.329  50.639  44.959  1.00 92.31  ? 35  HIS J CE1   1 
ATOM 5514  N NE2   . HIS F 1 36  ? 85.848  51.315  45.969  1.00 95.45  ? 35  HIS J NE2   1 
ATOM 5515  N N     . THR F 1 37  ? 80.655  55.587  45.512  1.00 68.52  ? 36  THR J N     1 
ATOM 5516  C CA    . THR F 1 37  ? 80.004  56.883  45.363  1.00 66.37  ? 36  THR J CA    1 
ATOM 5517  C C     . THR F 1 37  ? 79.853  57.568  46.711  1.00 66.16  ? 36  THR J C     1 
ATOM 5518  O O     . THR F 1 37  ? 80.023  58.777  46.825  1.00 66.25  ? 36  THR J O     1 
ATOM 5519  C CB    . THR F 1 37  ? 78.631  56.738  44.751  1.00 63.26  ? 36  THR J CB    1 
ATOM 5520  O OG1   . THR F 1 37  ? 78.729  55.891  43.603  1.00 63.61  ? 36  THR J OG1   1 
ATOM 5521  C CG2   . THR F 1 37  ? 78.089  58.101  44.348  1.00 62.03  ? 36  THR J CG2   1 
ATOM 5522  N N     . LEU F 1 38  ? 79.516  56.792  47.732  1.00 71.35  ? 37  LEU J N     1 
ATOM 5523  C CA    . LEU F 1 38  ? 79.535  57.311  49.080  1.00 72.06  ? 37  LEU J CA    1 
ATOM 5524  C C     . LEU F 1 38  ? 80.958  57.741  49.389  1.00 76.07  ? 37  LEU J C     1 
ATOM 5525  O O     . LEU F 1 38  ? 81.207  58.904  49.705  1.00 76.55  ? 37  LEU J O     1 
ATOM 5526  C CB    . LEU F 1 38  ? 79.089  56.240  50.069  1.00 72.06  ? 37  LEU J CB    1 
ATOM 5527  C CG    . LEU F 1 38  ? 77.614  55.851  50.055  1.00 69.06  ? 37  LEU J CG    1 
ATOM 5528  C CD1   . LEU F 1 38  ? 77.360  54.897  51.199  1.00 69.80  ? 37  LEU J CD1   1 
ATOM 5529  C CD2   . LEU F 1 38  ? 76.726  57.075  50.162  1.00 67.50  ? 37  LEU J CD2   1 
ATOM 5530  N N     . GLY F 1 39  ? 81.887  56.795  49.269  1.00 72.44  ? 38  GLY J N     1 
ATOM 5531  C CA    . GLY F 1 39  ? 83.295  57.023  49.553  1.00 77.12  ? 38  GLY J CA    1 
ATOM 5532  C C     . GLY F 1 39  ? 83.880  58.294  48.966  1.00 77.56  ? 38  GLY J C     1 
ATOM 5533  O O     . GLY F 1 39  ? 84.712  58.945  49.590  1.00 80.76  ? 38  GLY J O     1 
ATOM 5534  N N     . TYR F 1 40  ? 83.447  58.653  47.768  1.00 80.43  ? 39  TYR J N     1 
ATOM 5535  C CA    . TYR F 1 40  ? 83.869  59.910  47.192  1.00 80.31  ? 39  TYR J CA    1 
ATOM 5536  C C     . TYR F 1 40  ? 83.319  61.078  48.008  1.00 78.20  ? 39  TYR J C     1 
ATOM 5537  O O     . TYR F 1 40  ? 84.036  62.047  48.277  1.00 79.68  ? 39  TYR J O     1 
ATOM 5538  C CB    . TYR F 1 40  ? 83.425  60.018  45.734  1.00 78.24  ? 39  TYR J CB    1 
ATOM 5539  C CG    . TYR F 1 40  ? 83.813  61.326  45.083  1.00 78.03  ? 39  TYR J CG    1 
ATOM 5540  C CD1   . TYR F 1 40  ? 85.121  61.795  45.152  1.00 81.29  ? 39  TYR J CD1   1 
ATOM 5541  C CD2   . TYR F 1 40  ? 82.874  62.091  44.397  1.00 74.78  ? 39  TYR J CD2   1 
ATOM 5542  C CE1   . TYR F 1 40  ? 85.485  62.992  44.561  1.00 80.89  ? 39  TYR J CE1   1 
ATOM 5543  C CE2   . TYR F 1 40  ? 83.229  63.294  43.794  1.00 74.65  ? 39  TYR J CE2   1 
ATOM 5544  C CZ    . TYR F 1 40  ? 84.539  63.743  43.882  1.00 77.54  ? 39  TYR J CZ    1 
ATOM 5545  O OH    . TYR F 1 40  ? 84.914  64.943  43.296  1.00 77.69  ? 39  TYR J OH    1 
ATOM 5546  N N     . LEU F 1 41  ? 82.080  60.957  48.459  1.00 87.39  ? 40  LEU J N     1 
ATOM 5547  C CA    . LEU F 1 41  ? 81.452  62.020  49.225  1.00 85.63  ? 40  LEU J CA    1 
ATOM 5548  C C     . LEU F 1 41  ? 82.216  62.280  50.509  1.00 88.86  ? 40  LEU J C     1 
ATOM 5549  O O     . LEU F 1 41  ? 82.368  63.423  50.932  1.00 88.94  ? 40  LEU J O     1 
ATOM 5550  C CB    . LEU F 1 41  ? 80.010  61.652  49.549  1.00 82.90  ? 40  LEU J CB    1 
ATOM 5551  C CG    . LEU F 1 41  ? 79.039  61.885  48.397  1.00 79.83  ? 40  LEU J CG    1 
ATOM 5552  C CD1   . LEU F 1 41  ? 77.616  61.557  48.814  1.00 78.06  ? 40  LEU J CD1   1 
ATOM 5553  C CD2   . LEU F 1 41  ? 79.145  63.323  47.922  1.00 78.97  ? 40  LEU J CD2   1 
ATOM 5554  N N     . TYR F 1 42  ? 82.691  61.214  51.136  1.00 73.03  ? 41  TYR J N     1 
ATOM 5555  C CA    . TYR F 1 42  ? 83.365  61.339  52.414  1.00 76.49  ? 41  TYR J CA    1 
ATOM 5556  C C     . TYR F 1 42  ? 84.619  62.194  52.286  1.00 79.12  ? 41  TYR J C     1 
ATOM 5557  O O     . TYR F 1 42  ? 84.853  63.087  53.094  1.00 79.81  ? 41  TYR J O     1 
ATOM 5558  C CB    . TYR F 1 42  ? 83.753  59.943  52.899  1.00 79.72  ? 41  TYR J CB    1 
ATOM 5559  C CG    . TYR F 1 42  ? 84.066  59.838  54.370  1.00 83.32  ? 41  TYR J CG    1 
ATOM 5560  C CD1   . TYR F 1 42  ? 85.328  59.472  54.802  1.00 88.87  ? 41  TYR J CD1   1 
ATOM 5561  C CD2   . TYR F 1 42  ? 83.096  60.085  55.325  1.00 81.74  ? 41  TYR J CD2   1 
ATOM 5562  C CE1   . TYR F 1 42  ? 85.620  59.365  56.147  1.00 92.85  ? 41  TYR J CE1   1 
ATOM 5563  C CE2   . TYR F 1 42  ? 83.378  59.982  56.671  1.00 85.49  ? 41  TYR J CE2   1 
ATOM 5564  C CZ    . TYR F 1 42  ? 84.642  59.623  57.076  1.00 91.07  ? 41  TYR J CZ    1 
ATOM 5565  O OH    . TYR F 1 42  ? 84.925  59.520  58.415  1.00 95.36  ? 41  TYR J OH    1 
ATOM 5566  N N     . ALA F 1 43  ? 85.414  61.927  51.260  1.00 128.25 ? 42  ALA J N     1 
ATOM 5567  C CA    . ALA F 1 43  ? 86.616  62.708  51.003  1.00 130.75 ? 42  ALA J CA    1 
ATOM 5568  C C     . ALA F 1 43  ? 86.305  64.167  50.688  1.00 127.30 ? 42  ALA J C     1 
ATOM 5569  O O     . ALA F 1 43  ? 87.010  65.072  51.123  1.00 128.77 ? 42  ALA J O     1 
ATOM 5570  C CB    . ALA F 1 43  ? 87.421  62.080  49.878  1.00 132.52 ? 42  ALA J CB    1 
ATOM 5571  N N     . HIS F 1 44  ? 85.254  64.406  49.915  1.00 112.81 ? 43  HIS J N     1 
ATOM 5572  C CA    . HIS F 1 44  ? 84.972  65.744  49.392  1.00 114.58 ? 43  HIS J CA    1 
ATOM 5573  C C     . HIS F 1 44  ? 83.798  66.463  50.054  1.00 116.77 ? 43  HIS J C     1 
ATOM 5574  O O     . HIS F 1 44  ? 83.217  67.382  49.482  1.00 117.51 ? 43  HIS J O     1 
ATOM 5575  C CB    . HIS F 1 44  ? 84.776  65.690  47.880  1.00 115.31 ? 43  HIS J CB    1 
ATOM 5576  C CG    . HIS F 1 44  ? 86.016  65.314  47.135  1.00 114.78 ? 43  HIS J CG    1 
ATOM 5577  N ND1   . HIS F 1 44  ? 86.409  64.004  46.966  1.00 112.40 ? 43  HIS J ND1   1 
ATOM 5578  C CD2   . HIS F 1 44  ? 86.955  66.071  46.521  1.00 116.91 ? 43  HIS J CD2   1 
ATOM 5579  C CE1   . HIS F 1 44  ? 87.536  63.971  46.278  1.00 113.05 ? 43  HIS J CE1   1 
ATOM 5580  N NE2   . HIS F 1 44  ? 87.888  65.212  45.994  1.00 115.75 ? 43  HIS J NE2   1 
ATOM 5581  N N     . GLN F 1 45  ? 83.435  66.014  51.247  1.00 162.09 ? 44  GLN J N     1 
ATOM 5582  C CA    . GLN F 1 45  ? 82.191  66.414  51.887  1.00 163.74 ? 44  GLN J CA    1 
ATOM 5583  C C     . GLN F 1 45  ? 82.012  67.931  51.949  1.00 167.99 ? 44  GLN J C     1 
ATOM 5584  O O     . GLN F 1 45  ? 80.913  68.423  51.701  1.00 168.50 ? 44  GLN J O     1 
ATOM 5585  C CB    . GLN F 1 45  ? 82.113  65.824  53.295  1.00 166.02 ? 44  GLN J CB    1 
ATOM 5586  N N     . GLN F 1 46  ? 83.067  68.683  52.254  1.00 148.34 ? 45  GLN J N     1 
ATOM 5587  C CA    . GLN F 1 46  ? 82.941  70.131  52.196  1.00 152.33 ? 45  GLN J CA    1 
ATOM 5588  C C     . GLN F 1 46  ? 83.475  70.649  50.863  1.00 151.33 ? 45  GLN J C     1 
ATOM 5589  O O     . GLN F 1 46  ? 84.415  71.438  50.819  1.00 154.49 ? 45  GLN J O     1 
ATOM 5590  C CB    . GLN F 1 46  ? 83.696  70.781  53.357  1.00 157.25 ? 45  GLN J CB    1 
ATOM 5591  N N     . ASP F 1 47  ? 82.858  70.189  49.774  1.00 157.29 ? 46  ASP J N     1 
ATOM 5592  C CA    . ASP F 1 47  ? 83.158  70.691  48.435  1.00 156.82 ? 46  ASP J CA    1 
ATOM 5593  C C     . ASP F 1 47  ? 81.946  71.186  47.634  1.00 156.36 ? 46  ASP J C     1 
ATOM 5594  O O     . ASP F 1 47  ? 82.103  71.684  46.521  1.00 156.59 ? 46  ASP J O     1 
ATOM 5595  C CB    . ASP F 1 47  ? 83.933  69.650  47.629  1.00 152.82 ? 46  ASP J CB    1 
ATOM 5596  C CG    . ASP F 1 47  ? 85.429  69.779  47.805  1.00 155.35 ? 46  ASP J CG    1 
ATOM 5597  O OD1   . ASP F 1 47  ? 85.868  70.090  48.930  1.00 158.63 ? 46  ASP J OD1   1 
ATOM 5598  O OD2   . ASP F 1 47  ? 86.167  69.570  46.820  1.00 154.40 ? 46  ASP J OD2   1 
ATOM 5599  N N     . GLY F 1 48  ? 80.745  71.045  48.189  1.00 155.72 ? 47  GLY J N     1 
ATOM 5600  C CA    . GLY F 1 48  ? 79.533  71.468  47.500  1.00 155.41 ? 47  GLY J CA    1 
ATOM 5601  C C     . GLY F 1 48  ? 79.295  70.849  46.128  1.00 150.77 ? 47  GLY J C     1 
ATOM 5602  O O     . GLY F 1 48  ? 78.877  71.536  45.199  1.00 151.70 ? 47  GLY J O     1 
ATOM 5603  N N     . LEU F 1 49  ? 79.559  69.550  46.007  1.00 107.06 ? 48  LEU J N     1 
ATOM 5604  C CA    . LEU F 1 49  ? 79.501  68.823  44.739  1.00 102.88 ? 48  LEU J CA    1 
ATOM 5605  C C     . LEU F 1 49  ? 78.071  68.646  44.232  1.00 100.65 ? 48  LEU J C     1 
ATOM 5606  O O     . LEU F 1 49  ? 77.152  68.426  45.018  1.00 100.57 ? 48  LEU J O     1 
ATOM 5607  C CB    . LEU F 1 49  ? 80.141  67.447  44.915  1.00 99.52  ? 48  LEU J CB    1 
ATOM 5608  C CG    . LEU F 1 49  ? 81.485  67.403  45.645  1.00 101.54 ? 48  LEU J CG    1 
ATOM 5609  C CD1   . LEU F 1 49  ? 81.805  65.990  46.092  1.00 98.78  ? 48  LEU J CD1   1 
ATOM 5610  C CD2   . LEU F 1 49  ? 82.595  67.936  44.752  1.00 102.99 ? 48  LEU J CD2   1 
ATOM 5611  N N     . THR F 1 50  ? 77.878  68.735  42.920  1.00 115.67 ? 49  THR J N     1 
ATOM 5612  C CA    . THR F 1 50  ? 76.561  68.462  42.342  1.00 113.21 ? 49  THR J CA    1 
ATOM 5613  C C     . THR F 1 50  ? 76.735  67.159  41.572  1.00 108.50 ? 49  THR J C     1 
ATOM 5614  O O     . THR F 1 50  ? 77.845  66.633  41.472  1.00 107.82 ? 49  THR J O     1 
ATOM 5615  C CB    . THR F 1 50  ? 76.031  69.634  41.489  1.00 115.89 ? 49  THR J CB    1 
ATOM 5616  O OG1   . THR F 1 50  ? 76.637  69.608  40.191  1.00 115.20 ? 49  THR J OG1   1 
ATOM 5617  C CG2   . THR F 1 50  ? 76.313  70.966  42.168  1.00 121.56 ? 49  THR J CG2   1 
ATOM 5618  N N     . GLN F 1 51  ? 75.632  66.652  41.030  1.00 116.66 ? 50  GLN J N     1 
ATOM 5619  C CA    . GLN F 1 51  ? 75.637  65.391  40.283  1.00 113.31 ? 50  GLN J CA    1 
ATOM 5620  C C     . GLN F 1 51  ? 76.612  65.289  39.088  1.00 112.17 ? 50  GLN J C     1 
ATOM 5621  O O     . GLN F 1 51  ? 77.285  64.280  38.878  1.00 110.14 ? 50  GLN J O     1 
ATOM 5622  C CB    . GLN F 1 51  ? 74.251  65.138  39.684  1.00 111.25 ? 50  GLN J CB    1 
ATOM 5623  C CG    . GLN F 1 51  ? 73.148  64.860  40.688  1.00 111.75 ? 50  GLN J CG    1 
ATOM 5624  C CD    . GLN F 1 51  ? 71.801  64.693  40.021  1.00 111.12 ? 50  GLN J CD    1 
ATOM 5625  O OE1   . GLN F 1 51  ? 71.576  65.209  38.932  1.00 111.30 ? 50  GLN J OE1   1 
ATOM 5626  N NE2   . GLN F 1 51  ? 70.898  63.964  40.672  1.00 110.61 ? 50  GLN J NE2   1 
ATOM 5627  N N     . ASN F 1 52  ? 76.723  66.385  38.349  1.00 118.14 ? 51  ASN J N     1 
ATOM 5628  C CA    . ASN F 1 52  ? 77.647  66.424  37.222  1.00 117.61 ? 51  ASN J CA    1 
ATOM 5629  C C     . ASN F 1 52  ? 79.065  66.453  37.768  1.00 118.35 ? 51  ASN J C     1 
ATOM 5630  O O     . ASN F 1 52  ? 79.987  65.945  37.129  1.00 117.64 ? 51  ASN J O     1 
ATOM 5631  C CB    . ASN F 1 52  ? 77.449  67.516  36.177  1.00 119.83 ? 51  ASN J CB    1 
ATOM 5632  C CG    . ASN F 1 52  ? 76.291  67.221  35.263  1.00 118.93 ? 51  ASN J CG    1 
ATOM 5633  O OD1   . ASN F 1 52  ? 76.478  66.884  34.093  1.00 118.02 ? 51  ASN J OD1   1 
ATOM 5634  N ND2   . ASN F 1 52  ? 75.078  67.309  35.801  1.00 119.46 ? 51  ASN J ND2   1 
ATOM 5635  N N     . ASP F 1 53  ? 79.235  67.044  38.948  1.00 89.87  ? 52  ASP J N     1 
ATOM 5636  C CA    . ASP F 1 53  ? 80.549  67.105  39.579  1.00 90.64  ? 52  ASP J CA    1 
ATOM 5637  C C     . ASP F 1 53  ? 81.011  65.696  39.908  1.00 88.26  ? 52  ASP J C     1 
ATOM 5638  O O     . ASP F 1 53  ? 82.174  65.337  39.709  1.00 87.87  ? 52  ASP J O     1 
ATOM 5639  C CB    . ASP F 1 53  ? 80.503  67.961  40.841  1.00 93.19  ? 52  ASP J CB    1 
ATOM 5640  C CG    . ASP F 1 53  ? 80.112  69.398  40.556  1.00 95.95  ? 52  ASP J CG    1 
ATOM 5641  O OD1   . ASP F 1 53  ? 80.716  70.020  39.654  1.00 96.88  ? 52  ASP J OD1   1 
ATOM 5642  O OD2   . ASP F 1 53  ? 79.192  69.902  41.235  1.00 97.44  ? 52  ASP J OD2   1 
ATOM 5643  N N     . ILE F 1 54  ? 80.075  64.894  40.394  1.00 96.76  ? 53  ILE J N     1 
ATOM 5644  C CA    . ILE F 1 54  ? 80.364  63.511  40.726  1.00 94.68  ? 53  ILE J CA    1 
ATOM 5645  C C     . ILE F 1 54  ? 80.317  62.641  39.475  1.00 92.17  ? 53  ILE J C     1 
ATOM 5646  O O     . ILE F 1 54  ? 81.000  61.629  39.394  1.00 90.92  ? 53  ILE J O     1 
ATOM 5647  C CB    . ILE F 1 54  ? 79.382  62.976  41.780  1.00 94.43  ? 53  ILE J CB    1 
ATOM 5648  C CG1   . ILE F 1 54  ? 79.133  64.041  42.852  1.00 97.27  ? 53  ILE J CG1   1 
ATOM 5649  C CG2   . ILE F 1 54  ? 79.918  61.713  42.414  1.00 92.91  ? 53  ILE J CG2   1 
ATOM 5650  C CD1   . ILE F 1 54  ? 78.116  63.635  43.907  1.00 97.90  ? 53  ILE J CD1   1 
ATOM 5651  N N     . ALA F 1 55  ? 79.518  63.042  38.495  1.00 80.94  ? 54  ALA J N     1 
ATOM 5652  C CA    . ALA F 1 55  ? 79.441  62.293  37.246  1.00 78.90  ? 54  ALA J CA    1 
ATOM 5653  C C     . ALA F 1 55  ? 80.776  62.323  36.509  1.00 79.11  ? 54  ALA J C     1 
ATOM 5654  O O     . ALA F 1 55  ? 81.247  61.293  36.015  1.00 77.43  ? 54  ALA J O     1 
ATOM 5655  C CB    . ALA F 1 55  ? 78.331  62.834  36.359  1.00 79.06  ? 54  ALA J CB    1 
ATOM 5656  N N     . LYS F 1 56  ? 81.382  63.507  36.436  1.00 83.95  ? 55  LYS J N     1 
ATOM 5657  C CA    . LYS F 1 56  ? 82.688  63.653  35.807  1.00 84.67  ? 55  LYS J CA    1 
ATOM 5658  C C     . LYS F 1 56  ? 83.738  62.956  36.656  1.00 84.36  ? 55  LYS J C     1 
ATOM 5659  O O     . LYS F 1 56  ? 84.632  62.304  36.136  1.00 83.72  ? 55  LYS J O     1 
ATOM 5660  C CB    . LYS F 1 56  ? 83.048  65.131  35.622  1.00 87.54  ? 55  LYS J CB    1 
ATOM 5661  N N     . ALA F 1 57  ? 83.614  63.087  37.970  1.00 90.15  ? 56  ALA J N     1 
ATOM 5662  C CA    . ALA F 1 57  ? 84.549  62.448  38.883  1.00 90.14  ? 56  ALA J CA    1 
ATOM 5663  C C     . ALA F 1 57  ? 84.590  60.932  38.688  1.00 87.83  ? 56  ALA J C     1 
ATOM 5664  O O     . ALA F 1 57  ? 85.648  60.316  38.799  1.00 88.10  ? 56  ALA J O     1 
ATOM 5665  C CB    . ALA F 1 57  ? 84.193  62.792  40.327  1.00 91.41  ? 56  ALA J CB    1 
ATOM 5666  N N     . LEU F 1 58  ? 83.438  60.343  38.381  1.00 83.95  ? 57  LEU J N     1 
ATOM 5667  C CA    . LEU F 1 58  ? 83.303  58.892  38.301  1.00 81.86  ? 57  LEU J CA    1 
ATOM 5668  C C     . LEU F 1 58  ? 83.292  58.367  36.875  1.00 80.31  ? 57  LEU J C     1 
ATOM 5669  O O     . LEU F 1 58  ? 83.053  57.172  36.663  1.00 78.54  ? 57  LEU J O     1 
ATOM 5670  C CB    . LEU F 1 58  ? 82.013  58.446  38.984  1.00 80.99  ? 57  LEU J CB    1 
ATOM 5671  C CG    . LEU F 1 58  ? 81.896  58.772  40.464  1.00 82.60  ? 57  LEU J CG    1 
ATOM 5672  C CD1   . LEU F 1 58  ? 80.513  58.406  40.936  1.00 81.95  ? 57  LEU J CD1   1 
ATOM 5673  C CD2   . LEU F 1 58  ? 82.958  58.033  41.260  1.00 83.08  ? 57  LEU J CD2   1 
ATOM 5674  N N     . GLN F 1 59  ? 83.546  59.254  35.914  1.00 92.48  ? 58  GLN J N     1 
ATOM 5675  C CA    . GLN F 1 59  ? 83.457  58.925  34.490  1.00 91.62  ? 58  GLN J CA    1 
ATOM 5676  C C     . GLN F 1 59  ? 82.166  58.165  34.161  1.00 89.36  ? 58  GLN J C     1 
ATOM 5677  O O     . GLN F 1 59  ? 82.178  57.185  33.413  1.00 87.75  ? 58  GLN J O     1 
ATOM 5678  C CB    . GLN F 1 59  ? 84.695  58.153  34.019  1.00 91.43  ? 58  GLN J CB    1 
ATOM 5679  C CG    . GLN F 1 59  ? 85.577  58.919  33.041  1.00 93.45  ? 58  GLN J CG    1 
ATOM 5680  C CD    . GLN F 1 59  ? 84.871  59.262  31.724  1.00 93.68  ? 58  GLN J CD    1 
ATOM 5681  O OE1   . GLN F 1 59  ? 84.676  60.439  31.391  1.00 95.45  ? 58  GLN J OE1   1 
ATOM 5682  N NE2   . GLN F 1 59  ? 84.499  58.231  30.963  1.00 92.14  ? 58  GLN J NE2   1 
ATOM 5683  N N     . ARG F 1 60  ? 81.060  58.629  34.741  1.00 89.16  ? 59  ARG J N     1 
ATOM 5684  C CA    . ARG F 1 60  ? 79.737  58.067  34.493  1.00 87.26  ? 59  ARG J CA    1 
ATOM 5685  C C     . ARG F 1 60  ? 78.806  59.120  33.911  1.00 88.49  ? 59  ARG J C     1 
ATOM 5686  O O     . ARG F 1 60  ? 79.055  60.316  34.058  1.00 90.72  ? 59  ARG J O     1 
ATOM 5687  C CB    . ARG F 1 60  ? 79.156  57.518  35.788  1.00 87.59  ? 59  ARG J CB    1 
ATOM 5688  C CG    . ARG F 1 60  ? 79.814  56.228  36.222  1.00 86.50  ? 59  ARG J CG    1 
ATOM 5689  C CD    . ARG F 1 60  ? 79.705  55.198  35.117  1.00 84.57  ? 59  ARG J CD    1 
ATOM 5690  N NE    . ARG F 1 60  ? 80.964  54.502  34.888  1.00 84.47  ? 59  ARG J NE    1 
ATOM 5691  C CZ    . ARG F 1 60  ? 81.455  53.578  35.703  1.00 84.32  ? 59  ARG J CZ    1 
ATOM 5692  N NH1   . ARG F 1 60  ? 80.793  53.254  36.803  1.00 84.28  ? 59  ARG J NH1   1 
ATOM 5693  N NH2   . ARG F 1 60  ? 82.603  52.977  35.425  1.00 84.48  ? 59  ARG J NH2   1 
ATOM 5694  N N     . THR F 1 61  ? 77.735  58.691  33.250  1.00 67.95  ? 60  THR J N     1 
ATOM 5695  C CA    . THR F 1 61  ? 76.842  59.657  32.614  1.00 69.03  ? 60  THR J CA    1 
ATOM 5696  C C     . THR F 1 61  ? 75.891  60.333  33.597  1.00 70.17  ? 60  THR J C     1 
ATOM 5697  O O     . THR F 1 61  ? 75.858  60.019  34.785  1.00 70.06  ? 60  THR J O     1 
ATOM 5698  C CB    . THR F 1 61  ? 76.013  59.063  31.452  1.00 67.57  ? 60  THR J CB    1 
ATOM 5699  O OG1   . THR F 1 61  ? 75.014  58.187  31.970  1.00 65.90  ? 60  THR J OG1   1 
ATOM 5700  C CG2   . THR F 1 61  ? 76.891  58.322  30.473  1.00 66.59  ? 60  THR J CG2   1 
ATOM 5701  N N     . GLY F 1 62  ? 75.126  61.278  33.073  1.00 65.70  ? 61  GLY J N     1 
ATOM 5702  C CA    . GLY F 1 62  ? 74.165  62.017  33.852  1.00 65.03  ? 61  GLY J CA    1 
ATOM 5703  C C     . GLY F 1 62  ? 73.147  61.120  34.503  1.00 65.84  ? 61  GLY J C     1 
ATOM 5704  O O     . GLY F 1 62  ? 73.037  61.105  35.740  1.00 64.02  ? 61  GLY J O     1 
ATOM 5705  N N     . PRO F 1 63  ? 72.393  60.367  33.686  1.00 57.77  ? 62  PRO J N     1 
ATOM 5706  C CA    . PRO F 1 63  ? 71.322  59.549  34.263  1.00 57.82  ? 62  PRO J CA    1 
ATOM 5707  C C     . PRO F 1 63  ? 71.896  58.439  35.132  1.00 57.56  ? 62  PRO J C     1 
ATOM 5708  O O     . PRO F 1 63  ? 71.306  58.119  36.158  1.00 57.22  ? 62  PRO J O     1 
ATOM 5709  C CB    . PRO F 1 63  ? 70.633  58.950  33.036  1.00 60.14  ? 62  PRO J CB    1 
ATOM 5710  C CG    . PRO F 1 63  ? 71.115  59.751  31.875  1.00 61.26  ? 62  PRO J CG    1 
ATOM 5711  C CD    . PRO F 1 63  ? 72.476  60.210  32.227  1.00 60.27  ? 62  PRO J CD    1 
ATOM 5712  N N     . THR F 1 64  ? 73.028  57.869  34.731  1.00 84.70  ? 63  THR J N     1 
ATOM 5713  C CA    . THR F 1 64  ? 73.674  56.830  35.525  1.00 83.65  ? 63  THR J CA    1 
ATOM 5714  C C     . THR F 1 64  ? 73.874  57.323  36.951  1.00 80.94  ? 63  THR J C     1 
ATOM 5715  O O     . THR F 1 64  ? 73.654  56.589  37.920  1.00 80.16  ? 63  THR J O     1 
ATOM 5716  C CB    . THR F 1 64  ? 75.025  56.398  34.921  1.00 82.68  ? 63  THR J CB    1 
ATOM 5717  O OG1   . THR F 1 64  ? 74.798  55.714  33.680  1.00 85.20  ? 63  THR J OG1   1 
ATOM 5718  C CG2   . THR F 1 64  ? 75.770  55.465  35.872  1.00 80.43  ? 63  THR J CG2   1 
ATOM 5719  N N     . VAL F 1 65  ? 74.254  58.587  37.073  1.00 65.36  ? 64  VAL J N     1 
ATOM 5720  C CA    . VAL F 1 65  ? 74.426  59.200  38.385  1.00 62.63  ? 64  VAL J CA    1 
ATOM 5721  C C     . VAL F 1 65  ? 73.082  59.550  39.034  1.00 62.55  ? 64  VAL J C     1 
ATOM 5722  O O     . VAL F 1 65  ? 72.907  59.382  40.248  1.00 61.19  ? 64  VAL J O     1 
ATOM 5723  C CB    . VAL F 1 65  ? 75.335  60.437  38.300  1.00 60.74  ? 64  VAL J CB    1 
ATOM 5724  C CG1   . VAL F 1 65  ? 75.511  61.073  39.672  1.00 58.28  ? 64  VAL J CG1   1 
ATOM 5725  C CG2   . VAL F 1 65  ? 76.677  60.032  37.739  1.00 60.17  ? 64  VAL J CG2   1 
ATOM 5726  N N     . SER F 1 66  ? 72.131  60.014  38.223  1.00 66.89  ? 65  SER J N     1 
ATOM 5727  C CA    . SER F 1 66  ? 70.827  60.429  38.735  1.00 67.08  ? 65  SER J CA    1 
ATOM 5728  C C     . SER F 1 66  ? 70.078  59.287  39.423  1.00 67.95  ? 65  SER J C     1 
ATOM 5729  O O     . SER F 1 66  ? 69.549  59.456  40.526  1.00 67.94  ? 65  SER J O     1 
ATOM 5730  C CB    . SER F 1 66  ? 69.975  61.015  37.613  1.00 68.96  ? 65  SER J CB    1 
ATOM 5731  O OG    . SER F 1 66  ? 68.730  61.463  38.115  1.00 71.06  ? 65  SER J OG    1 
ATOM 5732  N N     . ASN F 1 67  ? 70.038  58.128  38.766  1.00 61.42  ? 66  ASN J N     1 
ATOM 5733  C CA    . ASN F 1 67  ? 69.394  56.950  39.332  1.00 61.78  ? 66  ASN J CA    1 
ATOM 5734  C C     . ASN F 1 67  ? 70.148  56.488  40.572  1.00 59.82  ? 66  ASN J C     1 
ATOM 5735  O O     . ASN F 1 67  ? 69.545  56.231  41.608  1.00 60.35  ? 66  ASN J O     1 
ATOM 5736  C CB    . ASN F 1 67  ? 69.290  55.820  38.304  1.00 63.33  ? 66  ASN J CB    1 
ATOM 5737  N N     . LEU F 1 68  ? 71.471  56.412  40.476  1.00 56.47  ? 67  LEU J N     1 
ATOM 5738  C CA    . LEU F 1 68  ? 72.270  55.905  41.581  1.00 55.90  ? 67  LEU J CA    1 
ATOM 5739  C C     . LEU F 1 68  ? 72.184  56.806  42.788  1.00 55.10  ? 67  LEU J C     1 
ATOM 5740  O O     . LEU F 1 68  ? 72.179  56.325  43.914  1.00 55.37  ? 67  LEU J O     1 
ATOM 5741  C CB    . LEU F 1 68  ? 73.722  55.739  41.166  1.00 55.07  ? 67  LEU J CB    1 
ATOM 5742  C CG    . LEU F 1 68  ? 74.744  55.541  42.288  1.00 54.25  ? 67  LEU J CG    1 
ATOM 5743  C CD1   . LEU F 1 68  ? 74.880  54.083  42.668  1.00 55.19  ? 67  LEU J CD1   1 
ATOM 5744  C CD2   . LEU F 1 68  ? 76.093  56.112  41.828  1.00 53.33  ? 67  LEU J CD2   1 
ATOM 5745  N N     . LEU F 1 69  ? 72.113  58.114  42.560  1.00 69.60  ? 68  LEU J N     1 
ATOM 5746  C CA    . LEU F 1 69  ? 71.964  59.051  43.671  1.00 68.53  ? 68  LEU J CA    1 
ATOM 5747  C C     . LEU F 1 69  ? 70.586  58.929  44.297  1.00 70.56  ? 68  LEU J C     1 
ATOM 5748  O O     . LEU F 1 69  ? 70.453  58.949  45.524  1.00 70.11  ? 68  LEU J O     1 
ATOM 5749  C CB    . LEU F 1 69  ? 72.198  60.490  43.225  1.00 68.11  ? 68  LEU J CB    1 
ATOM 5750  C CG    . LEU F 1 69  ? 73.639  60.919  42.951  1.00 66.18  ? 68  LEU J CG    1 
ATOM 5751  C CD1   . LEU F 1 69  ? 73.671  62.393  42.604  1.00 66.24  ? 68  LEU J CD1   1 
ATOM 5752  C CD2   . LEU F 1 69  ? 74.547  60.625  44.135  1.00 64.03  ? 68  LEU J CD2   1 
ATOM 5753  N N     . ARG F 1 70  ? 69.567  58.806  43.445  1.00 63.28  ? 69  ARG J N     1 
ATOM 5754  C CA    . ARG F 1 70  ? 68.188  58.663  43.904  1.00 66.77  ? 69  ARG J CA    1 
ATOM 5755  C C     . ARG F 1 70  ? 68.078  57.458  44.830  1.00 66.31  ? 69  ARG J C     1 
ATOM 5756  O O     . ARG F 1 70  ? 67.516  57.564  45.911  1.00 68.39  ? 69  ARG J O     1 
ATOM 5757  C CB    . ARG F 1 70  ? 67.219  58.550  42.721  1.00 69.77  ? 69  ARG J CB    1 
ATOM 5758  N N     . ASN F 1 71  ? 68.636  56.327  44.404  1.00 90.38  ? 70  ASN J N     1 
ATOM 5759  C CA    . ASN F 1 71  ? 68.758  55.143  45.250  1.00 89.48  ? 70  ASN J CA    1 
ATOM 5760  C C     . ASN F 1 71  ? 69.287  55.524  46.618  1.00 87.90  ? 70  ASN J C     1 
ATOM 5761  O O     . ASN F 1 71  ? 68.633  55.310  47.633  1.00 89.40  ? 70  ASN J O     1 
ATOM 5762  C CB    . ASN F 1 71  ? 69.723  54.138  44.620  1.00 88.12  ? 70  ASN J CB    1 
ATOM 5763  C CG    . ASN F 1 71  ? 69.029  53.128  43.716  1.00 90.04  ? 70  ASN J CG    1 
ATOM 5764  O OD1   . ASN F 1 71  ? 67.903  52.693  43.987  1.00 91.65  ? 70  ASN J OD1   1 
ATOM 5765  N ND2   . ASN F 1 71  ? 69.713  52.732  42.644  1.00 90.51  ? 70  ASN J ND2   1 
ATOM 5766  N N     . LEU F 1 72  ? 70.478  56.110  46.626  1.00 69.65  ? 71  LEU J N     1 
ATOM 5767  C CA    . LEU F 1 72  ? 71.112  56.577  47.854  1.00 67.90  ? 71  LEU J CA    1 
ATOM 5768  C C     . LEU F 1 72  ? 70.265  57.564  48.659  1.00 70.47  ? 71  LEU J C     1 
ATOM 5769  O O     . LEU F 1 72  ? 70.328  57.574  49.885  1.00 70.51  ? 71  LEU J O     1 
ATOM 5770  C CB    . LEU F 1 72  ? 72.470  57.203  47.547  1.00 65.29  ? 71  LEU J CB    1 
ATOM 5771  C CG    . LEU F 1 72  ? 73.585  56.222  47.214  1.00 64.50  ? 71  LEU J CG    1 
ATOM 5772  C CD1   . LEU F 1 72  ? 74.910  56.951  47.120  1.00 62.89  ? 71  LEU J CD1   1 
ATOM 5773  C CD2   . LEU F 1 72  ? 73.642  55.112  48.252  1.00 64.15  ? 71  LEU J CD2   1 
ATOM 5774  N N     . GLU F 1 73  ? 69.483  58.400  47.984  1.00 67.41  ? 72  GLU J N     1 
ATOM 5775  C CA    . GLU F 1 73  ? 68.674  59.376  48.708  1.00 71.49  ? 72  GLU J CA    1 
ATOM 5776  C C     . GLU F 1 73  ? 67.483  58.725  49.397  1.00 75.98  ? 72  GLU J C     1 
ATOM 5777  O O     . GLU F 1 73  ? 66.979  59.239  50.394  1.00 79.72  ? 72  GLU J O     1 
ATOM 5778  C CB    . GLU F 1 73  ? 68.176  60.482  47.793  1.00 74.25  ? 72  GLU J CB    1 
ATOM 5779  C CG    . GLU F 1 73  ? 67.669  61.661  48.579  1.00 78.60  ? 72  GLU J CG    1 
ATOM 5780  C CD    . GLU F 1 73  ? 66.868  62.606  47.740  1.00 83.55  ? 72  GLU J CD    1 
ATOM 5781  O OE1   . GLU F 1 73  ? 66.238  62.125  46.773  1.00 85.93  ? 72  GLU J OE1   1 
ATOM 5782  O OE2   . GLU F 1 73  ? 66.873  63.823  48.045  1.00 83.93  ? 72  GLU J OE2   1 
ATOM 5783  N N     . ARG F 1 74  ? 67.036  57.602  48.842  1.00 83.17  ? 73  ARG J N     1 
ATOM 5784  C CA    . ARG F 1 74  ? 65.959  56.822  49.427  1.00 86.29  ? 73  ARG J CA    1 
ATOM 5785  C C     . ARG F 1 74  ? 66.398  56.283  50.781  1.00 84.41  ? 73  ARG J C     1 
ATOM 5786  O O     . ARG F 1 74  ? 65.691  56.422  51.779  1.00 87.51  ? 73  ARG J O     1 
ATOM 5787  C CB    . ARG F 1 74  ? 65.605  55.664  48.507  1.00 85.34  ? 73  ARG J CB    1 
ATOM 5788  C CG    . ARG F 1 74  ? 65.092  56.088  47.149  1.00 87.80  ? 73  ARG J CG    1 
ATOM 5789  C CD    . ARG F 1 74  ? 63.609  56.391  47.204  1.00 94.37  ? 73  ARG J CD    1 
ATOM 5790  N NE    . ARG F 1 74  ? 62.848  55.278  47.770  1.00 95.85  ? 73  ARG J NE    1 
ATOM 5791  C CZ    . ARG F 1 74  ? 61.533  55.132  47.640  1.00 100.81 ? 73  ARG J CZ    1 
ATOM 5792  N NH1   . ARG F 1 74  ? 60.835  56.028  46.953  1.00 105.07 ? 73  ARG J NH1   1 
ATOM 5793  N NH2   . ARG F 1 74  ? 60.916  54.093  48.190  1.00 101.43 ? 73  ARG J NH2   1 
ATOM 5794  N N     . LYS F 1 75  ? 67.588  55.693  50.813  1.00 98.95  ? 74  LYS J N     1 
ATOM 5795  C CA    . LYS F 1 75  ? 68.163  55.166  52.044  1.00 93.79  ? 74  LYS J CA    1 
ATOM 5796  C C     . LYS F 1 75  ? 68.422  56.263  53.067  1.00 92.20  ? 74  LYS J C     1 
ATOM 5797  O O     . LYS F 1 75  ? 68.809  55.982  54.200  1.00 90.66  ? 74  LYS J O     1 
ATOM 5798  C CB    . LYS F 1 75  ? 69.471  54.440  51.737  1.00 88.46  ? 74  LYS J CB    1 
ATOM 5799  C CG    . LYS F 1 75  ? 69.297  53.190  50.894  1.00 90.44  ? 74  LYS J CG    1 
ATOM 5800  C CD    . LYS F 1 75  ? 69.093  51.951  51.757  1.00 89.33  ? 74  LYS J CD    1 
ATOM 5801  C CE    . LYS F 1 75  ? 70.335  51.078  51.722  1.00 82.44  ? 74  LYS J CE    1 
ATOM 5802  N NZ    . LYS F 1 75  ? 70.707  50.766  50.308  1.00 84.02  ? 74  LYS J NZ    1 
ATOM 5803  N N     . LYS F 1 76  ? 68.212  57.510  52.659  1.00 81.49  ? 75  LYS J N     1 
ATOM 5804  C CA    . LYS F 1 76  ? 68.461  58.663  53.515  1.00 84.07  ? 75  LYS J CA    1 
ATOM 5805  C C     . LYS F 1 76  ? 69.944  58.729  53.897  1.00 81.57  ? 75  LYS J C     1 
ATOM 5806  O O     . LYS F 1 76  ? 70.312  59.266  54.942  1.00 83.19  ? 75  LYS J O     1 
ATOM 5807  C CB    . LYS F 1 76  ? 67.549  58.642  54.749  1.00 86.34  ? 75  LYS J CB    1 
ATOM 5808  N N     . LEU F 1 77  ? 70.787  58.180  53.028  1.00 74.21  ? 76  LEU J N     1 
ATOM 5809  C CA    . LEU F 1 77  ? 72.223  58.144  53.259  1.00 72.33  ? 76  LEU J CA    1 
ATOM 5810  C C     . LEU F 1 77  ? 72.897  59.390  52.712  1.00 76.14  ? 76  LEU J C     1 
ATOM 5811  O O     . LEU F 1 77  ? 74.064  59.646  53.004  1.00 78.96  ? 76  LEU J O     1 
ATOM 5812  C CB    . LEU F 1 77  ? 72.842  56.915  52.596  1.00 68.36  ? 76  LEU J CB    1 
ATOM 5813  C CG    . LEU F 1 77  ? 72.622  55.529  53.211  1.00 65.26  ? 76  LEU J CG    1 
ATOM 5814  C CD1   . LEU F 1 77  ? 73.129  54.448  52.268  1.00 62.41  ? 76  LEU J CD1   1 
ATOM 5815  C CD2   . LEU F 1 77  ? 73.319  55.429  54.556  1.00 64.20  ? 76  LEU J CD2   1 
ATOM 5816  N N     . ILE F 1 78  ? 72.172  60.154  51.897  1.00 75.33  ? 77  ILE J N     1 
ATOM 5817  C CA    . ILE F 1 78  ? 72.684  61.413  51.359  1.00 78.55  ? 77  ILE J CA    1 
ATOM 5818  C C     . ILE F 1 78  ? 71.574  62.447  51.271  1.00 82.53  ? 77  ILE J C     1 
ATOM 5819  O O     . ILE F 1 78  ? 70.400  62.093  51.209  1.00 82.50  ? 77  ILE J O     1 
ATOM 5820  C CB    . ILE F 1 78  ? 73.281  61.236  49.949  1.00 77.65  ? 77  ILE J CB    1 
ATOM 5821  C CG1   . ILE F 1 78  ? 72.225  60.716  48.972  1.00 76.97  ? 77  ILE J CG1   1 
ATOM 5822  C CG2   . ILE F 1 78  ? 74.499  60.315  49.976  1.00 74.49  ? 77  ILE J CG2   1 
ATOM 5823  C CD1   . ILE F 1 78  ? 72.677  60.761  47.521  1.00 77.47  ? 77  ILE J CD1   1 
ATOM 5824  N N     . TYR F 1 79  ? 71.941  63.725  51.265  1.00 105.55 ? 78  TYR J N     1 
ATOM 5825  C CA    . TYR F 1 79  ? 70.955  64.789  51.090  1.00 107.49 ? 78  TYR J CA    1 
ATOM 5826  C C     . TYR F 1 79  ? 71.142  65.529  49.774  1.00 110.98 ? 78  TYR J C     1 
ATOM 5827  O O     . TYR F 1 79  ? 72.262  65.849  49.379  1.00 114.92 ? 78  TYR J O     1 
ATOM 5828  C CB    . TYR F 1 79  ? 70.986  65.778  52.255  1.00 111.08 ? 78  TYR J CB    1 
ATOM 5829  C CG    . TYR F 1 79  ? 72.360  66.281  52.618  1.00 112.95 ? 78  TYR J CG    1 
ATOM 5830  C CD1   . TYR F 1 79  ? 73.067  65.715  53.666  1.00 111.27 ? 78  TYR J CD1   1 
ATOM 5831  C CD2   . TYR F 1 79  ? 72.945  67.332  51.926  1.00 117.56 ? 78  TYR J CD2   1 
ATOM 5832  C CE1   . TYR F 1 79  ? 74.322  66.172  54.011  1.00 113.35 ? 78  TYR J CE1   1 
ATOM 5833  C CE2   . TYR F 1 79  ? 74.205  67.798  52.262  1.00 119.91 ? 78  TYR J CE2   1 
ATOM 5834  C CZ    . TYR F 1 79  ? 74.888  67.213  53.308  1.00 117.32 ? 78  TYR J CZ    1 
ATOM 5835  O OH    . TYR F 1 79  ? 76.140  67.663  53.655  1.00 119.25 ? 78  TYR J OH    1 
ATOM 5836  N N     . ARG F 1 80  ? 70.035  65.792  49.091  1.00 107.95 ? 79  ARG J N     1 
ATOM 5837  C CA    . ARG F 1 80  ? 70.078  66.533  47.840  1.00 111.15 ? 79  ARG J CA    1 
ATOM 5838  C C     . ARG F 1 80  ? 69.185  67.755  47.939  1.00 113.90 ? 79  ARG J C     1 
ATOM 5839  O O     . ARG F 1 80  ? 67.982  67.675  47.697  1.00 114.71 ? 79  ARG J O     1 
ATOM 5840  C CB    . ARG F 1 80  ? 69.612  65.667  46.668  1.00 109.83 ? 79  ARG J CB    1 
ATOM 5841  C CG    . ARG F 1 80  ? 70.305  64.324  46.541  1.00 106.91 ? 79  ARG J CG    1 
ATOM 5842  C CD    . ARG F 1 80  ? 69.953  63.656  45.218  1.00 105.51 ? 79  ARG J CD    1 
ATOM 5843  N NE    . ARG F 1 80  ? 68.524  63.732  44.932  1.00 106.03 ? 79  ARG J NE    1 
ATOM 5844  C CZ    . ARG F 1 80  ? 67.954  63.220  43.847  1.00 107.00 ? 79  ARG J CZ    1 
ATOM 5845  N NH1   . ARG F 1 80  ? 68.695  62.591  42.947  1.00 106.07 ? 79  ARG J NH1   1 
ATOM 5846  N NH2   . ARG F 1 80  ? 66.646  63.336  43.664  1.00 110.37 ? 79  ARG J NH2   1 
ATOM 5847  N N     . TYR F 1 81  ? 69.766  68.887  48.305  1.00 115.80 ? 80  TYR J N     1 
ATOM 5848  C CA    . TYR F 1 81  ? 69.010  70.122  48.299  1.00 120.34 ? 80  TYR J CA    1 
ATOM 5849  C C     . TYR F 1 81  ? 69.284  70.886  47.006  1.00 122.42 ? 80  TYR J C     1 
ATOM 5850  O O     . TYR F 1 81  ? 70.245  70.591  46.291  1.00 123.27 ? 80  TYR J O     1 
ATOM 5851  C CB    . TYR F 1 81  ? 69.302  70.964  49.553  1.00 124.24 ? 80  TYR J CB    1 
ATOM 5852  C CG    . TYR F 1 81  ? 70.765  71.310  49.798  1.00 125.74 ? 80  TYR J CG    1 
ATOM 5853  C CD1   . TYR F 1 81  ? 71.267  72.571  49.471  1.00 130.64 ? 80  TYR J CD1   1 
ATOM 5854  C CD2   . TYR F 1 81  ? 71.638  70.390  50.379  1.00 122.40 ? 80  TYR J CD2   1 
ATOM 5855  C CE1   . TYR F 1 81  ? 72.600  72.900  49.701  1.00 132.84 ? 80  TYR J CE1   1 
ATOM 5856  C CE2   . TYR F 1 81  ? 72.974  70.710  50.611  1.00 124.25 ? 80  TYR J CE2   1 
ATOM 5857  C CZ    . TYR F 1 81  ? 73.447  71.967  50.271  1.00 129.57 ? 80  TYR J CZ    1 
ATOM 5858  O OH    . TYR F 1 81  ? 74.767  72.294  50.499  1.00 132.11 ? 80  TYR J OH    1 
ATOM 5859  N N     . VAL F 1 82  ? 68.422  71.848  46.697  1.00 114.83 ? 81  VAL J N     1 
ATOM 5860  C CA    . VAL F 1 82  ? 68.590  72.684  45.513  1.00 117.38 ? 81  VAL J CA    1 
ATOM 5861  C C     . VAL F 1 82  ? 69.565  73.828  45.808  1.00 122.22 ? 81  VAL J C     1 
ATOM 5862  O O     . VAL F 1 82  ? 69.593  74.359  46.918  1.00 125.30 ? 81  VAL J O     1 
ATOM 5863  C CB    . VAL F 1 82  ? 67.227  73.237  45.027  1.00 119.50 ? 81  VAL J CB    1 
ATOM 5864  C CG1   . VAL F 1 82  ? 67.393  74.069  43.774  1.00 122.07 ? 81  VAL J CG1   1 
ATOM 5865  C CG2   . VAL F 1 82  ? 66.259  72.096  44.765  1.00 115.53 ? 81  VAL J CG2   1 
ATOM 5866  N N     . ASP F 1 83  ? 70.382  74.182  44.820  1.00 122.17 ? 82  ASP J N     1 
ATOM 5867  C CA    . ASP F 1 83  ? 71.301  75.310  44.939  1.00 125.29 ? 82  ASP J CA    1 
ATOM 5868  C C     . ASP F 1 83  ? 70.531  76.622  44.994  1.00 129.87 ? 82  ASP J C     1 
ATOM 5869  O O     . ASP F 1 83  ? 69.524  76.787  44.304  1.00 132.01 ? 82  ASP J O     1 
ATOM 5870  C CB    . ASP F 1 83  ? 72.280  75.335  43.759  1.00 127.38 ? 82  ASP J CB    1 
ATOM 5871  C CG    . ASP F 1 83  ? 73.226  76.524  43.807  1.00 131.31 ? 82  ASP J CG    1 
ATOM 5872  O OD1   . ASP F 1 83  ? 73.815  76.782  44.880  1.00 130.35 ? 82  ASP J OD1   1 
ATOM 5873  O OD2   . ASP F 1 83  ? 73.375  77.205  42.770  1.00 135.58 ? 82  ASP J OD2   1 
ATOM 5874  N N     . ALA F 1 84  ? 70.943  77.499  45.906  1.00 142.15 ? 83  ALA J N     1 
ATOM 5875  C CA    . ALA F 1 84  ? 70.337  78.819  46.048  1.00 147.10 ? 83  ALA J CA    1 
ATOM 5876  C C     . ALA F 1 84  ? 70.575  79.715  44.836  1.00 152.26 ? 83  ALA J C     1 
ATOM 5877  O O     . ALA F 1 84  ? 69.669  80.414  44.381  1.00 156.33 ? 83  ALA J O     1 
ATOM 5878  C CB    . ALA F 1 84  ? 70.840  79.497  47.315  1.00 147.88 ? 83  ALA J CB    1 
ATOM 5879  N N     . GLN F 1 85  ? 71.801  79.691  44.321  1.00 152.68 ? 84  GLN J N     1 
ATOM 5880  C CA    . GLN F 1 85  ? 72.174  80.535  43.192  1.00 158.02 ? 84  GLN J CA    1 
ATOM 5881  C C     . GLN F 1 85  ? 71.377  80.171  41.948  1.00 159.12 ? 84  GLN J C     1 
ATOM 5882  O O     . GLN F 1 85  ? 70.921  81.043  41.209  1.00 164.28 ? 84  GLN J O     1 
ATOM 5883  C CB    . GLN F 1 85  ? 73.673  80.419  42.909  1.00 157.57 ? 84  GLN J CB    1 
ATOM 5884  N N     . ASP F 1 86  ? 71.215  78.872  41.728  1.00 162.61 ? 85  ASP J N     1 
ATOM 5885  C CA    . ASP F 1 86  ? 70.449  78.376  40.595  1.00 163.57 ? 85  ASP J CA    1 
ATOM 5886  C C     . ASP F 1 86  ? 69.539  77.238  41.033  1.00 158.59 ? 85  ASP J C     1 
ATOM 5887  O O     . ASP F 1 86  ? 69.871  76.480  41.944  1.00 154.15 ? 85  ASP J O     1 
ATOM 5888  C CB    . ASP F 1 86  ? 71.384  77.904  39.480  1.00 164.45 ? 85  ASP J CB    1 
ATOM 5889  N N     . THR F 1 87  ? 68.391  77.119  40.377  1.00 118.14 ? 86  THR J N     1 
ATOM 5890  C CA    . THR F 1 87  ? 67.460  76.033  40.664  1.00 114.75 ? 86  THR J CA    1 
ATOM 5891  C C     . THR F 1 87  ? 67.676  74.839  39.725  1.00 111.18 ? 86  THR J C     1 
ATOM 5892  O O     . THR F 1 87  ? 66.905  73.877  39.737  1.00 108.80 ? 86  THR J O     1 
ATOM 5893  C CB    . THR F 1 87  ? 65.991  76.500  40.591  1.00 119.01 ? 86  THR J CB    1 
ATOM 5894  N N     . ARG F 1 88  ? 68.733  74.895  38.921  1.00 142.08 ? 87  ARG J N     1 
ATOM 5895  C CA    . ARG F 1 88  ? 69.033  73.822  37.985  1.00 140.05 ? 87  ARG J CA    1 
ATOM 5896  C C     . ARG F 1 88  ? 70.060  72.832  38.549  1.00 135.34 ? 87  ARG J C     1 
ATOM 5897  O O     . ARG F 1 88  ? 70.428  71.863  37.886  1.00 133.24 ? 87  ARG J O     1 
ATOM 5898  C CB    . ARG F 1 88  ? 69.519  74.405  36.653  1.00 144.43 ? 87  ARG J CB    1 
ATOM 5899  N N     . ARG F 1 89  ? 70.512  73.070  39.776  1.00 111.76 ? 88  ARG J N     1 
ATOM 5900  C CA    . ARG F 1 89  ? 71.559  72.242  40.369  1.00 107.85 ? 88  ARG J CA    1 
ATOM 5901  C C     . ARG F 1 89  ? 71.166  71.683  41.738  1.00 105.78 ? 88  ARG J C     1 
ATOM 5902  O O     . ARG F 1 89  ? 70.622  72.399  42.581  1.00 107.03 ? 88  ARG J O     1 
ATOM 5903  C CB    . ARG F 1 89  ? 72.866  73.034  40.483  1.00 109.74 ? 88  ARG J CB    1 
ATOM 5904  N N     . LYS F 1 90  ? 71.439  70.398  41.955  1.00 87.60  ? 89  LYS J N     1 
ATOM 5905  C CA    . LYS F 1 90  ? 71.249  69.790  43.271  1.00 84.74  ? 89  LYS J CA    1 
ATOM 5906  C C     . LYS F 1 90  ? 72.609  69.611  43.952  1.00 82.59  ? 89  LYS J C     1 
ATOM 5907  O O     . LYS F 1 90  ? 73.586  69.229  43.301  1.00 81.30  ? 89  LYS J O     1 
ATOM 5908  C CB    . LYS F 1 90  ? 70.533  68.442  43.147  1.00 81.62  ? 89  LYS J CB    1 
ATOM 5909  C CG    . LYS F 1 90  ? 69.068  68.530  42.747  1.00 83.87  ? 89  LYS J CG    1 
ATOM 5910  C CD    . LYS F 1 90  ? 68.461  67.136  42.623  1.00 86.89  ? 89  LYS J CD    1 
ATOM 5911  C CE    . LYS F 1 90  ? 66.953  67.184  42.430  1.00 90.53  ? 89  LYS J CE    1 
ATOM 5912  N NZ    . LYS F 1 90  ? 66.213  67.049  43.718  1.00 94.66  ? 89  LYS J NZ    1 
ATOM 5913  N N     . ASN F 1 91  ? 72.672  69.876  45.255  1.00 120.34 ? 90  ASN J N     1 
ATOM 5914  C CA    . ASN F 1 91  ? 73.938  69.800  45.988  1.00 117.90 ? 90  ASN J CA    1 
ATOM 5915  C C     . ASN F 1 91  ? 74.042  68.629  46.975  1.00 118.15 ? 90  ASN J C     1 
ATOM 5916  O O     . ASN F 1 91  ? 73.198  68.474  47.855  1.00 121.71 ? 90  ASN J O     1 
ATOM 5917  C CB    . ASN F 1 91  ? 74.207  71.129  46.680  1.00 120.05 ? 90  ASN J CB    1 
ATOM 5918  C CG    . ASN F 1 91  ? 74.149  72.290  45.717  1.00 122.35 ? 90  ASN J CG    1 
ATOM 5919  O OD1   . ASN F 1 91  ? 74.441  72.133  44.531  1.00 122.51 ? 90  ASN J OD1   1 
ATOM 5920  N ND2   . ASN F 1 91  ? 73.760  73.462  46.212  1.00 126.39 ? 90  ASN J ND2   1 
ATOM 5921  N N     . ILE F 1 92  ? 75.101  67.828  46.831  1.00 78.77  ? 91  ILE J N     1 
ATOM 5922  C CA    . ILE F 1 92  ? 75.204  66.517  47.488  1.00 78.59  ? 91  ILE J CA    1 
ATOM 5923  C C     . ILE F 1 92  ? 76.121  66.460  48.713  1.00 75.84  ? 91  ILE J C     1 
ATOM 5924  O O     . ILE F 1 92  ? 77.219  67.022  48.706  1.00 74.35  ? 91  ILE J O     1 
ATOM 5925  C CB    . ILE F 1 92  ? 75.713  65.437  46.496  1.00 76.63  ? 91  ILE J CB    1 
ATOM 5926  C CG1   . ILE F 1 92  ? 75.015  65.552  45.135  1.00 78.42  ? 91  ILE J CG1   1 
ATOM 5927  C CG2   . ILE F 1 92  ? 75.547  64.054  47.084  1.00 76.74  ? 91  ILE J CG2   1 
ATOM 5928  C CD1   . ILE F 1 92  ? 73.519  65.371  45.184  1.00 83.34  ? 91  ILE J CD1   1 
ATOM 5929  N N     . GLY F 1 93  ? 75.667  65.756  49.750  1.00 74.76  ? 92  GLY J N     1 
ATOM 5930  C CA    . GLY F 1 93  ? 76.469  65.495  50.935  1.00 72.27  ? 92  GLY J CA    1 
ATOM 5931  C C     . GLY F 1 93  ? 75.974  64.282  51.710  1.00 71.91  ? 92  GLY J C     1 
ATOM 5932  O O     . GLY F 1 93  ? 74.870  63.803  51.476  1.00 75.57  ? 92  GLY J O     1 
ATOM 5933  N N     . LEU F 1 94  ? 76.792  63.788  52.636  1.00 74.90  ? 93  LEU J N     1 
ATOM 5934  C CA    . LEU F 1 94  ? 76.447  62.631  53.462  1.00 73.81  ? 93  LEU J CA    1 
ATOM 5935  C C     . LEU F 1 94  ? 75.634  63.019  54.688  1.00 76.24  ? 93  LEU J C     1 
ATOM 5936  O O     . LEU F 1 94  ? 75.966  63.996  55.356  1.00 76.72  ? 93  LEU J O     1 
ATOM 5937  C CB    . LEU F 1 94  ? 77.721  61.982  53.977  1.00 69.71  ? 93  LEU J CB    1 
ATOM 5938  C CG    . LEU F 1 94  ? 78.765  61.524  52.976  1.00 67.90  ? 93  LEU J CG    1 
ATOM 5939  C CD1   . LEU F 1 94  ? 80.017  61.144  53.725  1.00 66.53  ? 93  LEU J CD1   1 
ATOM 5940  C CD2   . LEU F 1 94  ? 78.215  60.334  52.231  1.00 67.55  ? 93  LEU J CD2   1 
ATOM 5941  N N     . THR F 1 95  ? 74.594  62.248  55.006  1.00 63.90  ? 94  THR J N     1 
ATOM 5942  C CA    . THR F 1 95  ? 73.936  62.381  56.308  1.00 65.13  ? 94  THR J CA    1 
ATOM 5943  C C     . THR F 1 95  ? 74.782  61.707  57.389  1.00 64.86  ? 94  THR J C     1 
ATOM 5944  O O     . THR F 1 95  ? 75.810  61.109  57.075  1.00 63.72  ? 94  THR J O     1 
ATOM 5945  C CB    . THR F 1 95  ? 72.539  61.757  56.309  1.00 68.81  ? 94  THR J CB    1 
ATOM 5946  O OG1   . THR F 1 95  ? 72.540  60.584  55.488  1.00 66.25  ? 94  THR J OG1   1 
ATOM 5947  C CG2   . THR F 1 95  ? 71.511  62.742  55.774  1.00 76.68  ? 94  THR J CG2   1 
ATOM 5948  N N     . THR F 1 96  ? 74.369  61.800  58.652  1.00 65.00  ? 95  THR J N     1 
ATOM 5949  C CA    . THR F 1 96  ? 75.097  61.093  59.706  1.00 65.13  ? 95  THR J CA    1 
ATOM 5950  C C     . THR F 1 96  ? 75.084  59.614  59.352  1.00 62.88  ? 95  THR J C     1 
ATOM 5951  O O     . THR F 1 96  ? 76.129  58.948  59.364  1.00 62.26  ? 95  THR J O     1 
ATOM 5952  C CB    . THR F 1 96  ? 74.455  61.248  61.093  1.00 66.98  ? 95  THR J CB    1 
ATOM 5953  O OG1   . THR F 1 96  ? 74.482  62.618  61.517  1.00 69.43  ? 95  THR J OG1   1 
ATOM 5954  N N     . SER F 1 97  ? 73.883  59.124  59.032  1.00 63.01  ? 96  SER J N     1 
ATOM 5955  C CA    . SER F 1 97  ? 73.654  57.770  58.543  1.00 61.13  ? 96  SER J CA    1 
ATOM 5956  C C     . SER F 1 97  ? 74.716  57.406  57.533  1.00 59.58  ? 96  SER J C     1 
ATOM 5957  O O     . SER F 1 97  ? 75.460  56.448  57.729  1.00 58.96  ? 96  SER J O     1 
ATOM 5958  C CB    . SER F 1 97  ? 72.280  57.701  57.876  1.00 60.78  ? 96  SER J CB    1 
ATOM 5959  O OG    . SER F 1 97  ? 71.972  56.415  57.358  1.00 59.30  ? 96  SER J OG    1 
ATOM 5960  N N     . GLY F 1 98  ? 74.795  58.198  56.465  1.00 68.01  ? 97  GLY J N     1 
ATOM 5961  C CA    . GLY F 1 98  ? 75.756  57.986  55.397  1.00 66.49  ? 97  GLY J CA    1 
ATOM 5962  C C     . GLY F 1 98  ? 77.189  58.048  55.878  1.00 64.38  ? 97  GLY J C     1 
ATOM 5963  O O     . GLY F 1 98  ? 78.009  57.199  55.530  1.00 63.20  ? 97  GLY J O     1 
ATOM 5964  N N     . ILE F 1 99  ? 77.484  59.052  56.692  1.00 77.03  ? 98  ILE J N     1 
ATOM 5965  C CA    . ILE F 1 99  ? 78.812  59.199  57.284  1.00 76.60  ? 98  ILE J CA    1 
ATOM 5966  C C     . ILE F 1 99  ? 79.229  57.973  58.105  1.00 75.41  ? 98  ILE J C     1 
ATOM 5967  O O     . ILE F 1 99  ? 80.339  57.457  57.931  1.00 75.28  ? 98  ILE J O     1 
ATOM 5968  C CB    . ILE F 1 99  ? 78.897  60.459  58.170  1.00 77.97  ? 98  ILE J CB    1 
ATOM 5969  C CG1   . ILE F 1 99  ? 79.002  61.702  57.294  1.00 79.57  ? 98  ILE J CG1   1 
ATOM 5970  C CG2   . ILE F 1 99  ? 80.086  60.371  59.097  1.00 79.27  ? 98  ILE J CG2   1 
ATOM 5971  C CD1   . ILE F 1 99  ? 78.555  62.964  57.975  1.00 81.55  ? 98  ILE J CD1   1 
ATOM 5972  N N     . LYS F 1 100 ? 78.344  57.507  58.989  1.00 68.93  ? 99  LYS J N     1 
ATOM 5973  C CA    . LYS F 1 100 ? 78.685  56.396  59.873  1.00 69.61  ? 99  LYS J CA    1 
ATOM 5974  C C     . LYS F 1 100 ? 78.867  55.117  59.061  1.00 68.18  ? 99  LYS J C     1 
ATOM 5975  O O     . LYS F 1 100 ? 79.665  54.248  59.411  1.00 68.57  ? 99  LYS J O     1 
ATOM 5976  C CB    . LYS F 1 100 ? 77.627  56.211  60.967  1.00 70.47  ? 99  LYS J CB    1 
ATOM 5977  C CG    . LYS F 1 100 ? 77.348  57.472  61.767  1.00 72.71  ? 99  LYS J CG    1 
ATOM 5978  C CD    . LYS F 1 100 ? 76.362  57.234  62.899  1.00 74.67  ? 99  LYS J CD    1 
ATOM 5979  C CE    . LYS F 1 100 ? 77.025  56.502  64.042  1.00 76.09  ? 99  LYS J CE    1 
ATOM 5980  N NZ    . LYS F 1 100 ? 78.340  57.127  64.392  1.00 77.59  ? 99  LYS J NZ    1 
ATOM 5981  N N     . LEU F 1 101 ? 78.128  55.015  57.964  1.00 60.63  ? 100 LEU J N     1 
ATOM 5982  C CA    . LEU F 1 101 ? 78.219  53.848  57.108  1.00 59.80  ? 100 LEU J CA    1 
ATOM 5983  C C     . LEU F 1 101 ? 79.590  53.805  56.447  1.00 60.22  ? 100 LEU J C     1 
ATOM 5984  O O     . LEU F 1 101 ? 80.270  52.775  56.480  1.00 60.99  ? 100 LEU J O     1 
ATOM 5985  C CB    . LEU F 1 101 ? 77.125  53.877  56.046  1.00 59.27  ? 100 LEU J CB    1 
ATOM 5986  C CG    . LEU F 1 101 ? 77.048  52.590  55.229  1.00 58.38  ? 100 LEU J CG    1 
ATOM 5987  C CD1   . LEU F 1 101 ? 76.712  51.468  56.169  1.00 58.20  ? 100 LEU J CD1   1 
ATOM 5988  C CD2   . LEU F 1 101 ? 76.024  52.682  54.111  1.00 58.43  ? 100 LEU J CD2   1 
ATOM 5989  N N     . VAL F 1 102 ? 79.993  54.930  55.861  1.00 78.33  ? 101 VAL J N     1 
ATOM 5990  C CA    . VAL F 1 102 ? 81.285  55.012  55.180  1.00 79.27  ? 101 VAL J CA    1 
ATOM 5991  C C     . VAL F 1 102 ? 82.430  54.628  56.111  1.00 80.93  ? 101 VAL J C     1 
ATOM 5992  O O     . VAL F 1 102 ? 83.361  53.934  55.701  1.00 82.73  ? 101 VAL J O     1 
ATOM 5993  C CB    . VAL F 1 102 ? 81.549  56.402  54.541  1.00 79.68  ? 101 VAL J CB    1 
ATOM 5994  C CG1   . VAL F 1 102 ? 82.906  56.424  53.868  1.00 80.70  ? 101 VAL J CG1   1 
ATOM 5995  C CG2   . VAL F 1 102 ? 80.476  56.731  53.526  1.00 79.40  ? 101 VAL J CG2   1 
ATOM 5996  N N     . GLU F 1 103 ? 82.346  55.052  57.369  1.00 78.35  ? 102 GLU J N     1 
ATOM 5997  C CA    . GLU F 1 103 ? 83.392  54.734  58.328  1.00 80.68  ? 102 GLU J CA    1 
ATOM 5998  C C     . GLU F 1 103 ? 83.454  53.225  58.540  1.00 81.95  ? 102 GLU J C     1 
ATOM 5999  O O     . GLU F 1 103 ? 84.519  52.656  58.765  1.00 85.13  ? 102 GLU J O     1 
ATOM 6000  C CB    . GLU F 1 103 ? 83.166  55.477  59.651  1.00 81.08  ? 102 GLU J CB    1 
ATOM 6001  C CG    . GLU F 1 103 ? 83.026  56.990  59.492  1.00 81.79  ? 102 GLU J CG    1 
ATOM 6002  C CD    . GLU F 1 103 ? 83.392  57.766  60.754  1.00 84.98  ? 102 GLU J CD    1 
ATOM 6003  O OE1   . GLU F 1 103 ? 83.561  57.133  61.820  1.00 86.62  ? 102 GLU J OE1   1 
ATOM 6004  O OE2   . GLU F 1 103 ? 83.522  59.011  60.685  1.00 86.18  ? 102 GLU J OE2   1 
ATOM 6005  N N     . ALA F 1 104 ? 82.304  52.574  58.423  1.00 87.61  ? 103 ALA J N     1 
ATOM 6006  C CA    . ALA F 1 104 ? 82.213  51.151  58.706  1.00 89.48  ? 103 ALA J CA    1 
ATOM 6007  C C     . ALA F 1 104 ? 82.714  50.261  57.571  1.00 91.04  ? 103 ALA J C     1 
ATOM 6008  O O     . ALA F 1 104 ? 83.568  49.400  57.790  1.00 95.43  ? 103 ALA J O     1 
ATOM 6009  C CB    . ALA F 1 104 ? 80.799  50.790  59.064  1.00 87.69  ? 103 ALA J CB    1 
ATOM 6010  N N     . PHE F 1 105 ? 82.183  50.457  56.366  1.00 73.19  ? 104 PHE J N     1 
ATOM 6011  C CA    . PHE F 1 105 ? 82.467  49.528  55.267  1.00 74.15  ? 104 PHE J CA    1 
ATOM 6012  C C     . PHE F 1 105 ? 83.789  49.726  54.530  1.00 77.70  ? 104 PHE J C     1 
ATOM 6013  O O     . PHE F 1 105 ? 84.214  48.863  53.750  1.00 80.32  ? 104 PHE J O     1 
ATOM 6014  C CB    . PHE F 1 105 ? 81.332  49.516  54.236  1.00 70.20  ? 104 PHE J CB    1 
ATOM 6015  C CG    . PHE F 1 105 ? 81.215  50.779  53.423  1.00 68.98  ? 104 PHE J CG    1 
ATOM 6016  C CD1   . PHE F 1 105 ? 82.079  51.034  52.369  1.00 70.99  ? 104 PHE J CD1   1 
ATOM 6017  C CD2   . PHE F 1 105 ? 80.208  51.688  53.682  1.00 67.22  ? 104 PHE J CD2   1 
ATOM 6018  C CE1   . PHE F 1 105 ? 81.960  52.181  51.611  1.00 70.58  ? 104 PHE J CE1   1 
ATOM 6019  C CE2   . PHE F 1 105 ? 80.077  52.834  52.921  1.00 67.28  ? 104 PHE J CE2   1 
ATOM 6020  C CZ    . PHE F 1 105 ? 80.957  53.082  51.885  1.00 68.86  ? 104 PHE J CZ    1 
ATOM 6021  N N     . THR F 1 106 ? 84.429  50.864  54.770  1.00 100.54 ? 105 THR J N     1 
ATOM 6022  C CA    . THR F 1 106 ? 85.609  51.237  54.006  1.00 103.96 ? 105 THR J CA    1 
ATOM 6023  C C     . THR F 1 106 ? 86.782  50.298  54.281  1.00 110.17 ? 105 THR J C     1 
ATOM 6024  O O     . THR F 1 106 ? 87.775  50.299  53.558  1.00 114.42 ? 105 THR J O     1 
ATOM 6025  C CB    . THR F 1 106 ? 86.040  52.679  54.306  1.00 101.86 ? 105 THR J CB    1 
ATOM 6026  O OG1   . THR F 1 106 ? 84.991  53.581  53.939  1.00 100.66 ? 105 THR J OG1   1 
ATOM 6027  C CG2   . THR F 1 106 ? 87.309  53.026  53.554  1.00 103.68 ? 105 THR J CG2   1 
ATOM 6028  N N     . SER F 1 107 ? 86.651  49.488  55.325  1.00 79.55  ? 106 SER J N     1 
ATOM 6029  C CA    . SER F 1 107 ? 87.613  48.425  55.578  1.00 86.09  ? 106 SER J CA    1 
ATOM 6030  C C     . SER F 1 107 ? 87.600  47.504  54.366  1.00 88.08  ? 106 SER J C     1 
ATOM 6031  O O     . SER F 1 107 ? 88.646  47.211  53.797  1.00 93.99  ? 106 SER J O     1 
ATOM 6032  C CB    . SER F 1 107 ? 87.261  47.618  56.829  1.00 87.23  ? 106 SER J CB    1 
ATOM 6033  O OG    . SER F 1 107 ? 87.004  48.470  57.928  1.00 84.75  ? 106 SER J OG    1 
ATOM 6034  N N     . ILE F 1 108 ? 86.406  47.071  53.968  1.00 97.76  ? 107 ILE J N     1 
ATOM 6035  C CA    . ILE F 1 108 ? 86.244  46.092  52.891  1.00 98.04  ? 107 ILE J CA    1 
ATOM 6036  C C     . ILE F 1 108 ? 86.911  46.524  51.589  1.00 99.48  ? 107 ILE J C     1 
ATOM 6037  O O     . ILE F 1 108 ? 87.485  45.705  50.868  1.00 103.57 ? 107 ILE J O     1 
ATOM 6038  C CB    . ILE F 1 108 ? 84.751  45.785  52.612  1.00 91.13  ? 107 ILE J CB    1 
ATOM 6039  N N     . PHE F 1 109 ? 86.831  47.815  51.292  1.00 87.87  ? 108 PHE J N     1 
ATOM 6040  C CA    . PHE F 1 109 ? 87.470  48.341  50.097  1.00 89.65  ? 108 PHE J CA    1 
ATOM 6041  C C     . PHE F 1 109 ? 88.989  48.211  50.207  1.00 98.14  ? 108 PHE J C     1 
ATOM 6042  O O     . PHE F 1 109 ? 89.652  47.775  49.266  1.00 102.27 ? 108 PHE J O     1 
ATOM 6043  C CB    . PHE F 1 109 ? 87.044  49.791  49.837  1.00 85.56  ? 108 PHE J CB    1 
ATOM 6044  C CG    . PHE F 1 109 ? 85.746  49.916  49.078  1.00 79.54  ? 108 PHE J CG    1 
ATOM 6045  C CD1   . PHE F 1 109 ? 85.369  48.957  48.159  1.00 78.06  ? 108 PHE J CD1   1 
ATOM 6046  C CD2   . PHE F 1 109 ? 84.904  50.992  49.286  1.00 75.78  ? 108 PHE J CD2   1 
ATOM 6047  C CE1   . PHE F 1 109 ? 84.173  49.064  47.462  1.00 73.11  ? 108 PHE J CE1   1 
ATOM 6048  C CE2   . PHE F 1 109 ? 83.705  51.106  48.588  1.00 71.88  ? 108 PHE J CE2   1 
ATOM 6049  C CZ    . PHE F 1 109 ? 83.346  50.141  47.674  1.00 70.68  ? 108 PHE J CZ    1 
ATOM 6050  N N     . ASP F 1 110 ? 89.531  48.555  51.368  1.00 87.93  ? 109 ASP J N     1 
ATOM 6051  C CA    . ASP F 1 110 ? 90.972  48.495  51.577  1.00 96.01  ? 109 ASP J CA    1 
ATOM 6052  C C     . ASP F 1 110 ? 91.535  47.080  51.608  1.00 101.66 ? 109 ASP J C     1 
ATOM 6053  O O     . ASP F 1 110 ? 92.601  46.841  51.047  1.00 106.84 ? 109 ASP J O     1 
ATOM 6054  C CB    . ASP F 1 110 ? 91.354  49.243  52.847  1.00 93.56  ? 109 ASP J CB    1 
ATOM 6055  C CG    . ASP F 1 110 ? 91.130  50.725  52.723  1.00 88.65  ? 109 ASP J CG    1 
ATOM 6056  O OD1   . ASP F 1 110 ? 90.621  51.145  51.661  1.00 85.99  ? 109 ASP J OD1   1 
ATOM 6057  O OD2   . ASP F 1 110 ? 91.454  51.466  53.679  1.00 87.12  ? 109 ASP J OD2   1 
ATOM 6058  N N     . GLU F 1 111 ? 90.834  46.156  52.264  1.00 107.12 ? 110 GLU J N     1 
ATOM 6059  C CA    . GLU F 1 111 ? 91.290  44.768  52.347  1.00 109.61 ? 110 GLU J CA    1 
ATOM 6060  C C     . GLU F 1 111 ? 91.711  44.175  51.014  1.00 110.51 ? 110 GLU J C     1 
ATOM 6061  O O     . GLU F 1 111 ? 92.820  43.661  50.869  1.00 114.20 ? 110 GLU J O     1 
ATOM 6062  C CB    . GLU F 1 111 ? 90.226  43.861  52.980  1.00 106.11 ? 110 GLU J CB    1 
ATOM 6063  C CG    . GLU F 1 111 ? 89.597  44.367  54.271  1.00 104.45 ? 110 GLU J CG    1 
ATOM 6064  C CD    . GLU F 1 111 ? 90.599  44.537  55.388  1.00 108.18 ? 110 GLU J CD    1 
ATOM 6065  O OE1   . GLU F 1 111 ? 91.623  43.822  55.372  1.00 112.22 ? 110 GLU J OE1   1 
ATOM 6066  O OE2   . GLU F 1 111 ? 90.365  45.385  56.280  1.00 106.32 ? 110 GLU J OE2   1 
ATOM 6067  N N     . MET F 1 112 ? 90.813  44.269  50.040  0.38 133.48 ? 111 MET J N     1 
ATOM 6068  C CA    . MET F 1 112 ? 91.072  43.786  48.691  0.90 132.81 ? 111 MET J CA    1 
ATOM 6069  C C     . MET F 1 112 ? 92.275  44.457  48.010  1.00 136.99 ? 111 MET J C     1 
ATOM 6070  O O     . MET F 1 112 ? 92.965  43.874  47.174  0.24 137.92 ? 111 MET J O     1 
ATOM 6071  C CB    . MET F 1 112 ? 89.876  44.108  47.798  1.00 125.96 ? 111 MET J CB    1 
ATOM 6072  C CG    . MET F 1 112 ? 88.607  43.345  48.142  1.00 118.82 ? 111 MET J CG    1 
ATOM 6073  S SD    . MET F 1 112 ? 87.214  43.837  47.102  1.00 108.45 ? 111 MET J SD    1 
ATOM 6074  C CE    . MET F 1 112 ? 85.917  42.825  47.794  1.00 103.86 ? 111 MET J CE    1 
ATOM 6075  N N     . GLU F 1 113 ? 92.525  45.694  48.424  1.00 89.53  ? 112 GLU J N     1 
ATOM 6076  C CA    . GLU F 1 113 ? 93.660  46.449  47.913  1.00 94.34  ? 112 GLU J CA    1 
ATOM 6077  C C     . GLU F 1 113 ? 94.866  45.749  48.510  1.00 99.46  ? 112 GLU J C     1 
ATOM 6078  O O     . GLU F 1 113 ? 95.730  45.271  47.787  1.00 101.46 ? 112 GLU J O     1 
ATOM 6079  C CB    . GLU F 1 113 ? 93.697  47.935  48.265  1.00 95.38  ? 112 GLU J CB    1 
ATOM 6080  C CG    . GLU F 1 113 ? 94.707  48.731  47.460  1.00 99.05  ? 112 GLU J CG    1 
ATOM 6081  C CD    . GLU F 1 113 ? 94.221  49.042  46.054  1.00 94.47  ? 112 GLU J CD    1 
ATOM 6082  O OE1   . GLU F 1 113 ? 93.105  48.607  45.691  1.00 87.98  ? 112 GLU J OE1   1 
ATOM 6083  O OE2   . GLU F 1 113 ? 94.950  49.731  45.310  1.00 96.45  ? 112 GLU J OE2   1 
ATOM 6084  N N     . GLN F 1 114 ? 94.910  45.681  49.835  1.00 131.11 ? 113 GLN J N     1 
ATOM 6085  C CA    . GLN F 1 114 ? 96.001  45.010  50.522  1.00 134.82 ? 113 GLN J CA    1 
ATOM 6086  C C     . GLN F 1 114 ? 96.100  43.550  50.109  1.00 133.19 ? 113 GLN J C     1 
ATOM 6087  O O     . GLN F 1 114 ? 97.174  42.959  50.170  1.00 135.56 ? 113 GLN J O     1 
ATOM 6088  C CB    . GLN F 1 114 ? 95.849  45.118  52.042  1.00 132.96 ? 113 GLN J CB    1 
ATOM 6089  C CG    . GLN F 1 114 ? 96.601  46.291  52.666  1.00 135.00 ? 113 GLN J CG    1 
ATOM 6090  C CD    . GLN F 1 114 ? 98.109  46.204  52.465  1.00 139.13 ? 113 GLN J CD    1 
ATOM 6091  O OE1   . GLN F 1 114 ? 98.778  47.216  52.259  1.00 140.63 ? 113 GLN J OE1   1 
ATOM 6092  N NE2   . GLN F 1 114 ? 98.648  44.991  52.530  1.00 140.18 ? 113 GLN J NE2   1 
ATOM 6093  N N     . THR F 1 115 ? 94.985  42.970  49.678  1.00 97.85  ? 114 THR J N     1 
ATOM 6094  C CA    . THR F 1 115 ? 94.994  41.573  49.261  1.00 94.70  ? 114 THR J CA    1 
ATOM 6095  C C     . THR F 1 115 ? 95.553  41.436  47.848  1.00 94.33  ? 114 THR J C     1 
ATOM 6096  O O     . THR F 1 115 ? 96.262  40.482  47.541  1.00 93.86  ? 114 THR J O     1 
ATOM 6097  C CB    . THR F 1 115 ? 93.598  40.928  49.348  1.00 88.54  ? 114 THR J CB    1 
ATOM 6098  O OG1   . THR F 1 115 ? 92.983  41.292  50.586  1.00 88.80  ? 114 THR J OG1   1 
ATOM 6099  C CG2   . THR F 1 115 ? 93.707  39.415  49.285  1.00 84.97  ? 114 THR J CG2   1 
ATOM 6100  N N     . LEU F 1 116 ? 95.239  42.396  46.990  1.00 97.31  ? 115 LEU J N     1 
ATOM 6101  C CA    . LEU F 1 116 ? 95.758  42.382  45.627  1.00 96.86  ? 115 LEU J CA    1 
ATOM 6102  C C     . LEU F 1 116 ? 97.212  42.850  45.558  1.00 102.22 ? 115 LEU J C     1 
ATOM 6103  O O     . LEU F 1 116 ? 98.088  42.083  45.158  1.00 102.65 ? 115 LEU J O     1 
ATOM 6104  C CB    . LEU F 1 116 ? 94.876  43.218  44.696  1.00 94.78  ? 115 LEU J CB    1 
ATOM 6105  C CG    . LEU F 1 116 ? 93.840  42.407  43.909  1.00 85.29  ? 115 LEU J CG    1 
ATOM 6106  C CD1   . LEU F 1 116 ? 92.807  41.770  44.846  1.00 81.20  ? 115 LEU J CD1   1 
ATOM 6107  C CD2   . LEU F 1 116 ? 93.170  43.251  42.828  1.00 79.07  ? 115 LEU J CD2   1 
ATOM 6108  N N     . VAL F 1 117 ? 97.454  44.102  45.952  1.00 96.12  ? 116 VAL J N     1 
ATOM 6109  C CA    . VAL F 1 117 ? 98.791  44.705  45.944  1.00 100.72 ? 116 VAL J CA    1 
ATOM 6110  C C     . VAL F 1 117 ? 99.869  43.773  46.481  1.00 102.38 ? 116 VAL J C     1 
ATOM 6111  O O     . VAL F 1 117 ? 100.962 43.689  45.916  1.00 103.90 ? 116 VAL J O     1 
ATOM 6112  C CB    . VAL F 1 117 ? 98.830  46.005  46.780  1.00 102.19 ? 116 VAL J CB    1 
ATOM 6113  C CG1   . VAL F 1 117 ? 100.229 46.596  46.784  1.00 106.64 ? 116 VAL J CG1   1 
ATOM 6114  C CG2   . VAL F 1 117 ? 97.831  47.017  46.250  1.00 100.02 ? 116 VAL J CG2   1 
ATOM 6115  N N     . SER F 1 118 ? 99.544  43.065  47.561  1.00 125.35 ? 117 SER J N     1 
ATOM 6116  C CA    . SER F 1 118 ? 100.497 42.181  48.230  1.00 126.47 ? 117 SER J CA    1 
ATOM 6117  C C     . SER F 1 118 ? 100.886 40.950  47.407  1.00 123.40 ? 117 SER J C     1 
ATOM 6118  O O     . SER F 1 118 ? 101.897 40.308  47.686  1.00 124.38 ? 117 SER J O     1 
ATOM 6119  C CB    . SER F 1 118 ? 99.966  41.749  49.599  1.00 125.89 ? 117 SER J CB    1 
ATOM 6120  O OG    . SER F 1 118 ? 98.753  41.030  49.472  1.00 121.61 ? 117 SER J OG    1 
ATOM 6121  N N     . GLN F 1 119 ? 100.089 40.623  46.395  1.00 144.92 ? 118 GLN J N     1 
ATOM 6122  C CA    . GLN F 1 119 ? 100.405 39.489  45.533  1.00 141.21 ? 118 GLN J CA    1 
ATOM 6123  C C     . GLN F 1 119 ? 101.657 39.755  44.692  1.00 143.51 ? 118 GLN J C     1 
ATOM 6124  O O     . GLN F 1 119 ? 102.326 38.823  44.248  1.00 142.63 ? 118 GLN J O     1 
ATOM 6125  C CB    . GLN F 1 119 ? 99.213  39.120  44.649  1.00 135.55 ? 118 GLN J CB    1 
ATOM 6126  C CG    . GLN F 1 119 ? 98.004  38.615  45.427  1.00 132.01 ? 118 GLN J CG    1 
ATOM 6127  C CD    . GLN F 1 119 ? 96.871  38.168  44.523  1.00 125.97 ? 118 GLN J CD    1 
ATOM 6128  O OE1   . GLN F 1 119 ? 95.823  38.813  44.454  1.00 123.66 ? 118 GLN J OE1   1 
ATOM 6129  N NE2   . GLN F 1 119 ? 97.073  37.056  43.827  1.00 124.79 ? 118 GLN J NE2   1 
ATOM 6130  N N     . LEU F 1 120 ? 101.969 41.029  44.476  1.00 123.50 ? 119 LEU J N     1 
ATOM 6131  C CA    . LEU F 1 120 ? 103.243 41.413  43.877  1.00 126.59 ? 119 LEU J CA    1 
ATOM 6132  C C     . LEU F 1 120 ? 104.070 42.196  44.905  1.00 126.93 ? 119 LEU J C     1 
ATOM 6133  O O     . LEU F 1 120 ? 103.724 43.323  45.271  1.00 124.88 ? 119 LEU J O     1 
ATOM 6134  C CB    . LEU F 1 120 ? 103.027 42.222  42.598  1.00 126.22 ? 119 LEU J CB    1 
ATOM 6135  N N     . SER F 1 121 ? 104.999 41.476  45.525  1.00 168.76 ? 120 SER J N     1 
ATOM 6136  C CA    . SER F 1 121 ? 105.648 41.912  46.755  1.00 168.43 ? 120 SER J CA    1 
ATOM 6137  C C     . SER F 1 121 ? 106.493 43.155  46.596  1.00 168.54 ? 120 SER J C     1 
ATOM 6138  O O     . SER F 1 121 ? 106.466 44.061  47.425  1.00 167.04 ? 120 SER J O     1 
ATOM 6139  C CB    . SER F 1 121 ? 106.507 40.781  47.319  1.00 170.27 ? 120 SER J CB    1 
ATOM 6140  N N     . GLU F 1 122 ? 107.204 43.215  45.481  1.00 134.40 ? 121 GLU J N     1 
ATOM 6141  C CA    . GLU F 1 122 ? 108.076 44.333  45.164  1.00 134.84 ? 121 GLU J CA    1 
ATOM 6142  C C     . GLU F 1 122 ? 107.329 45.560  44.671  1.00 132.14 ? 121 GLU J C     1 
ATOM 6143  O O     . GLU F 1 122 ? 106.149 45.504  44.347  1.00 130.20 ? 121 GLU J O     1 
ATOM 6144  C CB    . GLU F 1 122 ? 109.114 43.917  44.126  1.00 138.03 ? 121 GLU J CB    1 
ATOM 6145  N N     . GLU F 1 123 ? 108.060 46.662  44.593  1.00 147.51 ? 122 GLU J N     1 
ATOM 6146  C CA    . GLU F 1 123 ? 107.564 47.913  44.032  1.00 145.46 ? 122 GLU J CA    1 
ATOM 6147  C C     . GLU F 1 123 ? 107.343 47.620  42.548  1.00 145.81 ? 122 GLU J C     1 
ATOM 6148  O O     . GLU F 1 123 ? 106.814 48.444  41.805  1.00 144.11 ? 122 GLU J O     1 
ATOM 6149  C CB    . GLU F 1 123 ? 108.555 49.047  44.275  1.00 146.17 ? 122 GLU J CB    1 
ATOM 6150  N N     . GLU F 1 124 ? 107.587 46.353  42.242  1.00 130.60 ? 123 GLU J N     1 
ATOM 6151  C CA    . GLU F 1 124 ? 107.328 45.723  40.962  1.00 131.78 ? 123 GLU J CA    1 
ATOM 6152  C C     . GLU F 1 124 ? 105.915 46.002  40.476  1.00 129.20 ? 123 GLU J C     1 
ATOM 6153  O O     . GLU F 1 124 ? 105.680 46.419  39.347  1.00 128.63 ? 123 GLU J O     1 
ATOM 6154  C CB    . GLU F 1 124 ? 107.582 44.213  41.043  1.00 133.42 ? 123 GLU J CB    1 
ATOM 6155  C CG    . GLU F 1 124 ? 106.677 43.419  41.985  1.00 132.23 ? 123 GLU J CG    1 
ATOM 6156  C CD    . GLU F 1 124 ? 107.058 41.952  42.110  1.00 135.13 ? 123 GLU J CD    1 
ATOM 6157  O OE1   . GLU F 1 124 ? 107.796 41.441  41.237  1.00 138.22 ? 123 GLU J OE1   1 
ATOM 6158  O OE2   . GLU F 1 124 ? 106.617 41.307  43.080  1.00 134.37 ? 123 GLU J OE2   1 
ATOM 6159  N N     . ASN F 1 125 ? 104.973 45.808  41.387  1.00 146.73 ? 124 ASN J N     1 
ATOM 6160  C CA    . ASN F 1 125 ? 103.591 46.161  41.111  1.00 143.62 ? 124 ASN J CA    1 
ATOM 6161  C C     . ASN F 1 125 ? 103.337 47.657  40.872  1.00 141.09 ? 124 ASN J C     1 
ATOM 6162  O O     . ASN F 1 125 ? 102.397 48.091  40.218  1.00 139.00 ? 124 ASN J O     1 
ATOM 6163  C CB    . ASN F 1 125 ? 102.760 45.856  42.359  1.00 140.34 ? 124 ASN J CB    1 
ATOM 6164  C CG    . ASN F 1 125 ? 103.158 46.696  43.553  1.00 139.29 ? 124 ASN J CG    1 
ATOM 6165  O OD1   . ASN F 1 125 ? 103.545 47.851  43.402  1.00 138.55 ? 124 ASN J OD1   1 
ATOM 6166  N ND2   . ASN F 1 125 ? 103.059 46.122  44.746  1.00 139.35 ? 124 ASN J ND2   1 
ATOM 6167  N N     . GLU F 1 126 ? 104.286 48.431  41.372  1.00 148.02 ? 125 GLU J N     1 
ATOM 6168  C CA    . GLU F 1 126 ? 104.214 49.873  41.262  1.00 145.90 ? 125 GLU J CA    1 
ATOM 6169  C C     . GLU F 1 126 ? 104.246 50.096  39.762  1.00 146.02 ? 125 GLU J C     1 
ATOM 6170  O O     . GLU F 1 126 ? 103.541 50.956  39.247  1.00 143.61 ? 125 GLU J O     1 
ATOM 6171  C CB    . GLU F 1 126 ? 105.354 50.648  41.917  1.00 146.88 ? 125 GLU J CB    1 
ATOM 6172  N N     . GLN F 1 127 ? 105.074 49.341  39.055  1.00 142.49 ? 126 GLN J N     1 
ATOM 6173  C CA    . GLN F 1 127 ? 105.199 49.546  37.619  1.00 143.50 ? 126 GLN J CA    1 
ATOM 6174  C C     . GLN F 1 127 ? 103.905 49.298  36.831  1.00 141.89 ? 126 GLN J C     1 
ATOM 6175  O O     . GLN F 1 127 ? 103.555 50.076  35.945  1.00 140.54 ? 126 GLN J O     1 
ATOM 6176  C CB    . GLN F 1 127 ? 106.312 48.654  37.066  1.00 147.56 ? 126 GLN J CB    1 
ATOM 6177  N N     . MET F 1 128 ? 103.181 48.234  37.155  0.97 140.57 ? 127 MET J N     1 
ATOM 6178  C CA    . MET F 1 128 ? 101.968 47.936  36.412  0.64 139.03 ? 127 MET J CA    1 
ATOM 6179  C C     . MET F 1 128 ? 100.950 49.054  36.559  1.00 134.88 ? 127 MET J C     1 
ATOM 6180  O O     . MET F 1 128 ? 100.219 49.390  35.633  1.00 133.01 ? 127 MET J O     1 
ATOM 6181  C CB    . MET F 1 128 ? 101.310 46.667  36.949  1.00 139.84 ? 127 MET J CB    1 
ATOM 6182  C CG    . MET F 1 128 ? 100.065 46.251  36.186  1.00 138.08 ? 127 MET J CG    1 
ATOM 6183  S SD    . MET F 1 128 ? 99.359  44.692  36.752  1.00 138.57 ? 127 MET J SD    1 
ATOM 6184  C CE    . MET F 1 128 ? 100.462 43.504  35.985  1.00 142.13 ? 127 MET J CE    1 
ATOM 6185  N N     . LYS F 1 129 ? 100.950 49.674  37.727  1.00 112.56 ? 128 LYS J N     1 
ATOM 6186  C CA    . LYS F 1 129 ? 100.023 50.753  37.972  1.00 108.36 ? 128 LYS J CA    1 
ATOM 6187  C C     . LYS F 1 129 ? 100.332 51.833  36.958  1.00 107.51 ? 128 LYS J C     1 
ATOM 6188  O O     . LYS F 1 129 ? 99.432  52.449  36.396  1.00 104.19 ? 128 LYS J O     1 
ATOM 6189  C CB    . LYS F 1 129 ? 100.201 51.293  39.387  1.00 107.92 ? 128 LYS J CB    1 
ATOM 6190  N N     . ALA F 1 130 ? 101.614 52.076  36.738  1.00 116.10 ? 129 ALA J N     1 
ATOM 6191  C CA    . ALA F 1 130 ? 102.014 53.042  35.735  1.00 115.99 ? 129 ALA J CA    1 
ATOM 6192  C C     . ALA F 1 130 ? 101.564 52.535  34.385  1.00 116.47 ? 129 ALA J C     1 
ATOM 6193  O O     . ALA F 1 130 ? 101.065 53.288  33.551  1.00 114.37 ? 129 ALA J O     1 
ATOM 6194  C CB    . ALA F 1 130 ? 103.519 53.233  35.750  1.00 119.16 ? 129 ALA J CB    1 
ATOM 6195  N N     . ASN F 1 131 ? 101.741 51.240  34.178  1.00 122.90 ? 130 ASN J N     1 
ATOM 6196  C CA    . ASN F 1 131 ? 101.452 50.661  32.885  1.00 124.15 ? 130 ASN J CA    1 
ATOM 6197  C C     . ASN F 1 131 ? 99.985  50.799  32.534  1.00 119.44 ? 130 ASN J C     1 
ATOM 6198  O O     . ASN F 1 131 ? 99.631  51.185  31.424  1.00 117.78 ? 130 ASN J O     1 
ATOM 6199  C CB    . ASN F 1 131 ? 101.853 49.189  32.879  1.00 127.83 ? 130 ASN J CB    1 
ATOM 6200  N N     . LEU F 1 132 ? 99.128  50.525  33.502  1.00 119.72 ? 131 LEU J N     1 
ATOM 6201  C CA    . LEU F 1 132 ? 97.705  50.616  33.261  1.00 113.65 ? 131 LEU J CA    1 
ATOM 6202  C C     . LEU F 1 132 ? 97.396  52.055  32.918  1.00 110.64 ? 131 LEU J C     1 
ATOM 6203  O O     . LEU F 1 132 ? 96.623  52.351  32.009  1.00 107.12 ? 131 LEU J O     1 
ATOM 6204  C CB    . LEU F 1 132 ? 96.939  50.195  34.508  1.00 111.25 ? 131 LEU J CB    1 
ATOM 6205  N N     . THR F 1 133 ? 98.038  52.953  33.649  1.00 117.63 ? 132 THR J N     1 
ATOM 6206  C CA    . THR F 1 133 ? 97.790  54.379  33.498  1.00 115.00 ? 132 THR J CA    1 
ATOM 6207  C C     . THR F 1 133 ? 97.917  54.808  32.036  1.00 114.90 ? 132 THR J C     1 
ATOM 6208  O O     . THR F 1 133 ? 97.051  55.506  31.503  1.00 111.38 ? 132 THR J O     1 
ATOM 6209  C CB    . THR F 1 133 ? 98.760  55.195  34.367  1.00 117.30 ? 132 THR J CB    1 
ATOM 6210  O OG1   . THR F 1 133 ? 98.519  54.902  35.750  1.00 117.26 ? 132 THR J OG1   1 
ATOM 6211  C CG2   . THR F 1 133 ? 98.579  56.686  34.121  1.00 115.35 ? 132 THR J CG2   1 
ATOM 6212  N N     . LYS F 1 134 ? 98.993  54.391  31.392  1.00 134.68 ? 133 LYS J N     1 
ATOM 6213  C CA    . LYS F 1 134 ? 99.174  54.744  30.002  1.00 135.52 ? 133 LYS J CA    1 
ATOM 6214  C C     . LYS F 1 134 ? 98.036  54.134  29.210  1.00 132.10 ? 133 LYS J C     1 
ATOM 6215  O O     . LYS F 1 134 ? 97.466  54.765  28.323  1.00 129.76 ? 133 LYS J O     1 
ATOM 6216  C CB    . LYS F 1 134 ? 100.516 54.224  29.489  1.00 141.24 ? 133 LYS J CB    1 
ATOM 6217  N N     . MET F 1 135 ? 97.686  52.904  29.555  0.71 92.86  ? 134 MET J N     1 
ATOM 6218  C CA    . MET F 1 135 ? 96.690  52.187  28.791  0.97 89.32  ? 134 MET J CA    1 
ATOM 6219  C C     . MET F 1 135 ? 95.375  52.932  28.860  0.34 83.34  ? 134 MET J C     1 
ATOM 6220  O O     . MET F 1 135 ? 94.694  53.102  27.856  1.00 80.72  ? 134 MET J O     1 
ATOM 6221  C CB    . MET F 1 135 ? 96.525  50.775  29.340  1.00 89.71  ? 134 MET J CB    1 
ATOM 6222  N N     . LEU F 1 136 ? 95.038  53.415  30.044  1.00 99.34  ? 135 LEU J N     1 
ATOM 6223  C CA    . LEU F 1 136 ? 93.777  54.101  30.220  1.00 94.91  ? 135 LEU J CA    1 
ATOM 6224  C C     . LEU F 1 136 ? 93.792  55.323  29.339  1.00 94.64  ? 135 LEU J C     1 
ATOM 6225  O O     . LEU F 1 136 ? 92.822  55.640  28.659  1.00 91.74  ? 135 LEU J O     1 
ATOM 6226  C CB    . LEU F 1 136 ? 93.631  54.533  31.673  1.00 95.56  ? 135 LEU J CB    1 
ATOM 6227  C CG    . LEU F 1 136 ? 92.280  55.107  32.093  1.00 93.13  ? 135 LEU J CG    1 
ATOM 6228  C CD1   . LEU F 1 136 ? 91.986  54.742  33.534  1.00 93.47  ? 135 LEU J CD1   1 
ATOM 6229  C CD2   . LEU F 1 136 ? 92.256  56.615  31.917  1.00 92.78  ? 135 LEU J CD2   1 
ATOM 6230  N N     . SER F 1 137 ? 94.953  55.926  29.198  1.00 112.54 ? 136 SER J N     1 
ATOM 6231  C CA    . SER F 1 137 ? 94.980  57.210  28.557  1.00 112.36 ? 136 SER J CA    1 
ATOM 6232  C C     . SER F 1 137 ? 94.396  56.874  27.203  1.00 110.69 ? 136 SER J C     1 
ATOM 6233  O O     . SER F 1 137 ? 93.660  57.667  26.629  1.00 109.26 ? 136 SER J O     1 
ATOM 6234  C CB    . SER F 1 137 ? 96.418  57.681  28.394  1.00 116.93 ? 136 SER J CB    1 
ATOM 6235  N N     . SER F 1 138 ? 94.695  55.690  26.696  1.00 99.94  ? 137 SER J N     1 
ATOM 6236  C CA    . SER F 1 138 ? 94.244  55.364  25.357  1.00 99.47  ? 137 SER J CA    1 
ATOM 6237  C C     . SER F 1 138 ? 92.727  55.547  25.104  1.00 96.11  ? 137 SER J C     1 
ATOM 6238  O O     . SER F 1 138 ? 92.302  56.366  24.297  1.00 97.06  ? 137 SER J O     1 
ATOM 6239  C CB    . SER F 1 138 ? 94.705  53.946  25.043  1.00 101.54 ? 137 SER J CB    1 
ATOM 6240  O OG    . SER F 1 138 ? 96.119  53.885  25.052  1.00 106.94 ? 137 SER J OG    1 
ATOM 6241  N N     . LEU F 1 139 ? 91.921  54.829  25.875  1.00 134.14 ? 138 LEU J N     1 
ATOM 6242  C CA    . LEU F 1 139 ? 90.467  55.000  25.833  1.00 131.42 ? 138 LEU J CA    1 
ATOM 6243  C C     . LEU F 1 139 ? 89.797  56.297  26.300  1.00 131.41 ? 138 LEU J C     1 
ATOM 6244  O O     . LEU F 1 139 ? 88.837  56.788  25.707  1.00 132.20 ? 138 LEU J O     1 
ATOM 6245  C CB    . LEU F 1 139 ? 89.947  53.821  26.653  1.00 128.56 ? 138 LEU J CB    1 
ATOM 6246  N N     . GLN F 1 140 ? 90.348  56.833  27.377  1.00 116.07 ? 139 GLN J N     1 
ATOM 6247  C CA    . GLN F 1 140 ? 89.799  57.937  28.170  1.00 116.36 ? 139 GLN J CA    1 
ATOM 6248  C C     . GLN F 1 140 ? 89.400  59.133  27.309  1.00 119.78 ? 139 GLN J C     1 
ATOM 6249  O O     . GLN F 1 140 ? 88.226  59.302  26.978  1.00 119.55 ? 139 GLN J O     1 
ATOM 6250  C CB    . GLN F 1 140 ? 90.785  58.370  29.260  1.00 117.13 ? 139 GLN J CB    1 
ATOM 6251  N N     . SER G 1 7   ? 128.257 117.689 74.214  1.00 120.39 ? 6   SER M N     1 
ATOM 6252  C CA    . SER G 1 7   ? 129.379 117.133 73.465  1.00 118.80 ? 6   SER M CA    1 
ATOM 6253  C C     . SER G 1 7   ? 130.060 115.999 74.235  1.00 116.30 ? 6   SER M C     1 
ATOM 6254  O O     . SER G 1 7   ? 129.416 115.029 74.645  1.00 115.56 ? 6   SER M O     1 
ATOM 6255  C CB    . SER G 1 7   ? 130.394 118.231 73.121  1.00 119.17 ? 6   SER M CB    1 
ATOM 6256  O OG    . SER G 1 7   ? 130.786 118.957 74.278  1.00 119.17 ? 6   SER M OG    1 
ATOM 6257  N N     . TYR G 1 8   ? 131.368 116.127 74.423  1.00 134.88 ? 7   TYR M N     1 
ATOM 6258  C CA    . TYR G 1 8   ? 132.129 115.157 75.196  1.00 132.59 ? 7   TYR M CA    1 
ATOM 6259  C C     . TYR G 1 8   ? 131.616 115.100 76.626  1.00 132.46 ? 7   TYR M C     1 
ATOM 6260  O O     . TYR G 1 8   ? 131.639 114.050 77.260  1.00 130.91 ? 7   TYR M O     1 
ATOM 6261  C CB    . TYR G 1 8   ? 133.610 115.529 75.196  1.00 129.88 ? 7   TYR M CB    1 
ATOM 6262  N N     . LEU G 1 9   ? 131.153 116.239 77.127  1.00 115.29 ? 8   LEU M N     1 
ATOM 6263  C CA    . LEU G 1 9   ? 130.623 116.330 78.483  1.00 115.49 ? 8   LEU M CA    1 
ATOM 6264  C C     . LEU G 1 9   ? 129.357 115.491 78.632  1.00 115.70 ? 8   LEU M C     1 
ATOM 6265  O O     . LEU G 1 9   ? 129.084 114.933 79.691  1.00 114.96 ? 8   LEU M O     1 
ATOM 6266  C CB    . LEU G 1 9   ? 130.326 117.792 78.844  1.00 117.30 ? 8   LEU M CB    1 
ATOM 6267  N N     . PHE G 1 10  ? 128.590 115.406 77.553  1.00 115.64 ? 9   PHE M N     1 
ATOM 6268  C CA    . PHE G 1 10  ? 127.312 114.707 77.553  1.00 116.12 ? 9   PHE M CA    1 
ATOM 6269  C C     . PHE G 1 10  ? 127.459 113.247 77.985  1.00 113.96 ? 9   PHE M C     1 
ATOM 6270  O O     . PHE G 1 10  ? 126.634 112.721 78.729  1.00 113.93 ? 9   PHE M O     1 
ATOM 6271  C CB    . PHE G 1 10  ? 126.697 114.808 76.157  1.00 117.75 ? 9   PHE M CB    1 
ATOM 6272  C CG    . PHE G 1 10  ? 125.395 114.093 76.005  1.00 118.31 ? 9   PHE M CG    1 
ATOM 6273  C CD1   . PHE G 1 10  ? 124.203 114.755 76.226  1.00 120.44 ? 9   PHE M CD1   1 
ATOM 6274  C CD2   . PHE G 1 10  ? 125.361 112.763 75.606  1.00 116.79 ? 9   PHE M CD2   1 
ATOM 6275  C CE1   . PHE G 1 10  ? 122.999 114.103 76.074  1.00 121.00 ? 9   PHE M CE1   1 
ATOM 6276  C CE2   . PHE G 1 10  ? 124.160 112.103 75.453  1.00 117.31 ? 9   PHE M CE2   1 
ATOM 6277  C CZ    . PHE G 1 10  ? 122.977 112.776 75.689  1.00 119.42 ? 9   PHE M CZ    1 
ATOM 6278  N N     . ARG G 1 11  ? 128.519 112.600 77.515  1.00 134.63 ? 10  ARG M N     1 
ATOM 6279  C CA    . ARG G 1 11  ? 128.785 111.221 77.893  1.00 133.09 ? 10  ARG M CA    1 
ATOM 6280  C C     . ARG G 1 11  ? 129.031 111.112 79.395  1.00 136.20 ? 10  ARG M C     1 
ATOM 6281  O O     . ARG G 1 11  ? 128.690 110.104 80.014  1.00 137.84 ? 10  ARG M O     1 
ATOM 6282  C CB    . ARG G 1 11  ? 129.986 110.670 77.119  1.00 129.54 ? 10  ARG M CB    1 
ATOM 6283  N N     . MET G 1 12  ? 129.604 112.161 79.980  1.00 112.62 ? 11  MET M N     1 
ATOM 6284  C CA    . MET G 1 12  ? 129.992 112.140 81.391  1.00 115.50 ? 11  MET M CA    1 
ATOM 6285  C C     . MET G 1 12  ? 128.808 111.970 82.346  1.00 117.37 ? 11  MET M C     1 
ATOM 6286  O O     . MET G 1 12  ? 128.963 111.431 83.444  1.00 119.85 ? 11  MET M O     1 
ATOM 6287  C CB    . MET G 1 12  ? 130.791 113.397 81.753  1.00 115.83 ? 11  MET M CB    1 
ATOM 6288  C CG    . MET G 1 12  ? 132.084 113.557 80.971  1.00 114.31 ? 11  MET M CG    1 
ATOM 6289  S SD    . MET G 1 12  ? 133.499 112.767 81.764  1.00 116.29 ? 11  MET M SD    1 
ATOM 6290  C CE    . MET G 1 12  ? 134.045 114.081 82.853  1.00 117.77 ? 11  MET M CE    1 
ATOM 6291  N N     . ILE G 1 13  ? 127.630 112.427 81.932  1.00 141.92 ? 12  ILE M N     1 
ATOM 6292  C CA    . ILE G 1 13  ? 126.442 112.300 82.770  1.00 143.49 ? 12  ILE M CA    1 
ATOM 6293  C C     . ILE G 1 13  ? 126.095 110.826 82.962  1.00 144.74 ? 12  ILE M C     1 
ATOM 6294  O O     . ILE G 1 13  ? 125.770 110.394 84.070  1.00 147.37 ? 12  ILE M O     1 
ATOM 6295  C CB    . ILE G 1 13  ? 125.233 113.061 82.185  1.00 140.41 ? 12  ILE M CB    1 
ATOM 6296  N N     . SER G 1 14  ? 126.184 110.059 81.880  1.00 152.19 ? 13  SER M N     1 
ATOM 6297  C CA    . SER G 1 14  ? 125.936 108.624 81.935  1.00 153.27 ? 13  SER M CA    1 
ATOM 6298  C C     . SER G 1 14  ? 126.922 107.933 82.874  1.00 156.05 ? 13  SER M C     1 
ATOM 6299  O O     . SER G 1 14  ? 126.546 107.026 83.613  1.00 158.88 ? 13  SER M O     1 
ATOM 6300  C CB    . SER G 1 14  ? 126.009 108.005 80.537  1.00 149.46 ? 13  SER M CB    1 
ATOM 6301  N N     . HIS G 1 15  ? 128.176 108.377 82.855  1.00 102.97 ? 14  HIS M N     1 
ATOM 6302  C CA    . HIS G 1 15  ? 129.215 107.777 83.690  1.00 105.50 ? 14  HIS M CA    1 
ATOM 6303  C C     . HIS G 1 15  ? 128.980 107.764 85.201  1.00 108.93 ? 14  HIS M C     1 
ATOM 6304  O O     . HIS G 1 15  ? 129.199 106.751 85.861  1.00 112.21 ? 14  HIS M O     1 
ATOM 6305  C CB    . HIS G 1 15  ? 130.577 108.401 83.392  1.00 104.14 ? 14  HIS M CB    1 
ATOM 6306  C CG    . HIS G 1 15  ? 131.713 107.728 84.100  1.00 106.32 ? 14  HIS M CG    1 
ATOM 6307  N ND1   . HIS G 1 15  ? 132.868 108.393 84.457  1.00 106.51 ? 14  HIS M ND1   1 
ATOM 6308  C CD2   . HIS G 1 15  ? 131.875 106.448 84.509  1.00 108.46 ? 14  HIS M CD2   1 
ATOM 6309  C CE1   . HIS G 1 15  ? 133.689 107.551 85.059  1.00 108.34 ? 14  HIS M CE1   1 
ATOM 6310  N NE2   . HIS G 1 15  ? 133.113 106.364 85.103  1.00 109.73 ? 14  HIS M NE2   1 
ATOM 6311  N N     . GLU G 1 16  ? 128.549 108.890 85.751  1.00 153.33 ? 15  GLU M N     1 
ATOM 6312  C CA    . GLU G 1 16  ? 128.312 108.957 87.185  1.00 156.02 ? 15  GLU M CA    1 
ATOM 6313  C C     . GLU G 1 16  ? 126.992 108.280 87.583  1.00 158.06 ? 15  GLU M C     1 
ATOM 6314  O O     . GLU G 1 16  ? 126.792 107.852 88.720  1.00 161.50 ? 15  GLU M O     1 
ATOM 6315  C CB    . GLU G 1 16  ? 128.230 110.409 87.657  1.00 153.68 ? 15  GLU M CB    1 
ATOM 6316  C CG    . GLU G 1 16  ? 129.540 111.166 87.510  1.00 153.85 ? 15  GLU M CG    1 
ATOM 6317  C CD    . GLU G 1 16  ? 130.683 110.509 88.267  1.00 155.17 ? 15  GLU M CD    1 
ATOM 6318  O OE1   . GLU G 1 16  ? 130.453 110.030 89.400  1.00 157.96 ? 15  GLU M OE1   1 
ATOM 6319  O OE2   . GLU G 1 16  ? 131.812 110.472 87.731  1.00 153.34 ? 15  GLU M OE2   1 
ATOM 6320  N N     . MET G 1 17  ? 126.113 108.157 86.595  1.00 124.88 ? 16  MET M N     1 
ATOM 6321  C CA    . MET G 1 17  ? 124.835 107.488 86.792  1.00 126.87 ? 16  MET M CA    1 
ATOM 6322  C C     . MET G 1 17  ? 125.122 105.987 86.842  1.00 129.86 ? 16  MET M C     1 
ATOM 6323  O O     . MET G 1 17  ? 124.577 105.270 87.684  1.00 133.48 ? 16  MET M O     1 
ATOM 6324  C CB    . MET G 1 17  ? 123.767 107.797 85.743  1.00 123.92 ? 16  MET M CB    1 
ATOM 6325  C CG    . MET G 1 17  ? 123.239 109.218 85.815  1.00 121.93 ? 16  MET M CG    1 
ATOM 6326  S SD    . MET G 1 17  ? 121.777 109.492 84.793  1.00 119.44 ? 16  MET M SD    1 
ATOM 6327  C CE    . MET G 1 17  ? 122.418 109.015 83.189  1.00 116.48 ? 16  MET M CE    1 
ATOM 6328  N N     . LYS G 1 18  ? 125.979 105.520 85.939  1.00 135.12 ? 17  LYS M N     1 
ATOM 6329  C CA    . LYS G 1 18  ? 126.356 104.112 85.897  1.00 137.47 ? 17  LYS M CA    1 
ATOM 6330  C C     . LYS G 1 18  ? 127.076 103.721 87.177  1.00 141.83 ? 17  LYS M C     1 
ATOM 6331  O O     . LYS G 1 18  ? 126.756 102.705 87.795  1.00 145.62 ? 17  LYS M O     1 
ATOM 6332  C CB    . LYS G 1 18  ? 127.245 103.818 84.684  1.00 133.88 ? 17  LYS M CB    1 
ATOM 6333  N N     . GLN G 1 19  ? 128.048 104.532 87.576  1.00 122.69 ? 18  GLN M N     1 
ATOM 6334  C CA    . GLN G 1 19  ? 128.806 104.246 88.780  1.00 126.25 ? 18  GLN M CA    1 
ATOM 6335  C C     . GLN G 1 19  ? 127.900 104.206 89.995  1.00 129.39 ? 18  GLN M C     1 
ATOM 6336  O O     . GLN G 1 19  ? 128.108 103.402 90.892  1.00 133.05 ? 18  GLN M O     1 
ATOM 6337  C CB    . GLN G 1 19  ? 129.929 105.259 88.980  1.00 123.64 ? 18  GLN M CB    1 
ATOM 6338  C CG    . GLN G 1 19  ? 131.180 104.930 88.184  1.00 122.08 ? 18  GLN M CG    1 
ATOM 6339  C CD    . GLN G 1 19  ? 132.364 105.780 88.589  1.00 121.09 ? 18  GLN M CD    1 
ATOM 6340  O OE1   . GLN G 1 19  ? 132.229 106.715 89.387  1.00 121.25 ? 18  GLN M OE1   1 
ATOM 6341  N NE2   . GLN G 1 19  ? 133.537 105.458 88.045  1.00 119.55 ? 18  GLN M NE2   1 
ATOM 6342  N N     . LYS G 1 20  ? 126.878 105.054 90.006  1.00 90.69  ? 19  LYS M N     1 
ATOM 6343  C CA    . LYS G 1 20  ? 125.949 105.100 91.131  1.00 92.21  ? 19  LYS M CA    1 
ATOM 6344  C C     . LYS G 1 20  ? 125.192 103.772 91.286  1.00 93.86  ? 19  LYS M C     1 
ATOM 6345  O O     . LYS G 1 20  ? 124.851 103.366 92.399  1.00 95.76  ? 19  LYS M O     1 
ATOM 6346  C CB    . LYS G 1 20  ? 124.981 106.286 90.993  1.00 90.64  ? 19  LYS M CB    1 
ATOM 6347  N N     . ALA G 1 21  ? 124.941 103.101 90.163  1.00 102.53 ? 20  ALA M N     1 
ATOM 6348  C CA    . ALA G 1 21  ? 124.328 101.773 90.177  1.00 105.52 ? 20  ALA M CA    1 
ATOM 6349  C C     . ALA G 1 21  ? 125.395 100.729 90.482  1.00 108.37 ? 20  ALA M C     1 
ATOM 6350  O O     . ALA G 1 21  ? 125.174 99.806  91.265  1.00 112.42 ? 20  ALA M O     1 
ATOM 6351  C CB    . ALA G 1 21  ? 123.653 101.474 88.842  1.00 102.67 ? 20  ALA M CB    1 
ATOM 6352  N N     . ASP G 1 22  ? 126.559 100.895 89.859  1.00 95.00  ? 21  ASP M N     1 
ATOM 6353  C CA    . ASP G 1 22  ? 127.716 100.050 90.130  1.00 96.77  ? 21  ASP M CA    1 
ATOM 6354  C C     . ASP G 1 22  ? 128.179 100.167 91.589  1.00 99.39  ? 21  ASP M C     1 
ATOM 6355  O O     . ASP G 1 22  ? 128.867 99.284  92.095  1.00 100.66 ? 21  ASP M O     1 
ATOM 6356  C CB    . ASP G 1 22  ? 128.865 100.398 89.175  1.00 93.15  ? 21  ASP M CB    1 
ATOM 6357  N N     . GLN G 1 23  ? 127.807 101.258 92.255  1.00 116.12 ? 22  GLN M N     1 
ATOM 6358  C CA    . GLN G 1 23  ? 128.124 101.437 93.668  1.00 117.40 ? 22  GLN M CA    1 
ATOM 6359  C C     . GLN G 1 23  ? 127.180 100.621 94.548  1.00 120.08 ? 22  GLN M C     1 
ATOM 6360  O O     . GLN G 1 23  ? 127.626 99.866  95.414  1.00 120.61 ? 22  GLN M O     1 
ATOM 6361  C CB    . GLN G 1 23  ? 128.067 102.918 94.075  1.00 113.26 ? 22  GLN M CB    1 
ATOM 6362  C CG    . GLN G 1 23  ? 129.258 103.765 93.630  1.00 110.99 ? 22  GLN M CG    1 
ATOM 6363  C CD    . GLN G 1 23  ? 130.600 103.130 93.964  1.00 111.11 ? 22  GLN M CD    1 
ATOM 6364  O OE1   . GLN G 1 23  ? 130.756 102.486 95.002  1.00 110.60 ? 22  GLN M OE1   1 
ATOM 6365  N NE2   . GLN G 1 23  ? 131.578 103.311 93.080  1.00 108.95 ? 22  GLN M NE2   1 
ATOM 6366  N N     . LYS G 1 24  ? 125.877 100.780 94.325  1.00 105.95 ? 23  LYS M N     1 
ATOM 6367  C CA    . LYS G 1 24  ? 124.874 100.040 95.083  1.00 108.24 ? 23  LYS M CA    1 
ATOM 6368  C C     . LYS G 1 24  ? 125.033 98.536  94.857  1.00 110.97 ? 23  LYS M C     1 
ATOM 6369  O O     . LYS G 1 24  ? 124.985 97.751  95.807  1.00 111.21 ? 23  LYS M O     1 
ATOM 6370  C CB    . LYS G 1 24  ? 123.462 100.496 94.708  1.00 107.58 ? 23  LYS M CB    1 
ATOM 6371  N N     . LEU G 1 25  ? 125.242 98.143  93.601  1.00 98.05  ? 24  LEU M N     1 
ATOM 6372  C CA    . LEU G 1 25  ? 125.490 96.742  93.260  1.00 99.00  ? 24  LEU M CA    1 
ATOM 6373  C C     . LEU G 1 25  ? 126.745 96.217  93.948  1.00 95.88  ? 24  LEU M C     1 
ATOM 6374  O O     . LEU G 1 25  ? 126.831 95.036  94.271  1.00 93.68  ? 24  LEU M O     1 
ATOM 6375  C CB    . LEU G 1 25  ? 125.628 96.558  91.746  1.00 96.48  ? 24  LEU M CB    1 
ATOM 6376  C CG    . LEU G 1 25  ? 124.388 96.564  90.846  1.00 95.60  ? 24  LEU M CG    1 
ATOM 6377  C CD1   . LEU G 1 25  ? 124.802 96.343  89.392  1.00 92.73  ? 24  LEU M CD1   1 
ATOM 6378  C CD2   . LEU G 1 25  ? 123.380 95.514  91.269  1.00 98.48  ? 24  LEU M CD2   1 
ATOM 6379  N N     . GLU G 1 26  ? 127.717 97.099  94.161  1.00 98.18  ? 25  GLU M N     1 
ATOM 6380  C CA    . GLU G 1 26  ? 128.949 96.728  94.847  1.00 92.56  ? 25  GLU M CA    1 
ATOM 6381  C C     . GLU G 1 26  ? 128.723 96.615  96.348  1.00 89.49  ? 25  GLU M C     1 
ATOM 6382  O O     . GLU G 1 26  ? 129.235 95.694  96.983  1.00 84.07  ? 25  GLU M O     1 
ATOM 6383  C CB    . GLU G 1 26  ? 130.062 97.739  94.560  1.00 90.83  ? 25  GLU M CB    1 
ATOM 6384  N N     . GLN G 1 27  ? 127.965 97.556  96.909  1.00 105.78 ? 26  GLN M N     1 
ATOM 6385  C CA    . GLN G 1 27  ? 127.639 97.533  98.330  1.00 102.57 ? 26  GLN M CA    1 
ATOM 6386  C C     . GLN G 1 27  ? 127.018 96.195  98.692  1.00 101.39 ? 26  GLN M C     1 
ATOM 6387  O O     . GLN G 1 27  ? 127.536 95.470  99.538  1.00 94.80  ? 26  GLN M O     1 
ATOM 6388  C CB    . GLN G 1 27  ? 126.668 98.662  98.688  1.00 106.17 ? 26  GLN M CB    1 
ATOM 6389  C CG    . GLN G 1 27  ? 127.228 100.071 98.509  1.00 105.49 ? 26  GLN M CG    1 
ATOM 6390  C CD    . GLN G 1 27  ? 126.243 101.156 98.933  1.00 106.49 ? 26  GLN M CD    1 
ATOM 6391  O OE1   . GLN G 1 27  ? 125.062 100.886 99.169  1.00 108.25 ? 26  GLN M OE1   1 
ATOM 6392  N NE2   . GLN G 1 27  ? 126.731 102.391 99.037  1.00 105.46 ? 26  GLN M NE2   1 
ATOM 6393  N N     . PHE G 1 28  ? 125.923 95.862  98.018  1.00 113.60 ? 27  PHE M N     1 
ATOM 6394  C CA    . PHE G 1 28  ? 125.168 94.648  98.320  1.00 110.70 ? 27  PHE M CA    1 
ATOM 6395  C C     . PHE G 1 28  ? 125.680 93.418  97.570  1.00 110.28 ? 27  PHE M C     1 
ATOM 6396  O O     . PHE G 1 28  ? 125.090 92.347  97.657  1.00 107.91 ? 27  PHE M O     1 
ATOM 6397  C CB    . PHE G 1 28  ? 123.682 94.853  98.022  1.00 107.77 ? 27  PHE M CB    1 
ATOM 6398  C CG    . PHE G 1 28  ? 123.142 96.186  98.475  1.00 108.38 ? 27  PHE M CG    1 
ATOM 6399  C CD1   . PHE G 1 28  ? 123.090 96.511  99.821  1.00 109.04 ? 27  PHE M CD1   1 
ATOM 6400  C CD2   . PHE G 1 28  ? 122.666 97.108  97.551  1.00 108.51 ? 27  PHE M CD2   1 
ATOM 6401  C CE1   . PHE G 1 28  ? 122.590 97.736  100.233 1.00 109.67 ? 27  PHE M CE1   1 
ATOM 6402  C CE2   . PHE G 1 28  ? 122.163 98.336  97.959  1.00 109.09 ? 27  PHE M CE2   1 
ATOM 6403  C CZ    . PHE G 1 28  ? 122.124 98.648  99.300  1.00 109.64 ? 27  PHE M CZ    1 
ATOM 6404  N N     . ASP G 1 29  ? 126.760 93.592  96.817  1.00 97.29  ? 28  ASP M N     1 
ATOM 6405  C CA    . ASP G 1 29  ? 127.474 92.485  96.186  1.00 98.00  ? 28  ASP M CA    1 
ATOM 6406  C C     . ASP G 1 29  ? 126.630 91.595  95.258  1.00 93.98  ? 28  ASP M C     1 
ATOM 6407  O O     . ASP G 1 29  ? 126.718 90.363  95.322  1.00 93.37  ? 28  ASP M O     1 
ATOM 6408  C CB    . ASP G 1 29  ? 128.142 91.634  97.262  1.00 100.79 ? 28  ASP M CB    1 
ATOM 6409  C CG    . ASP G 1 29  ? 129.352 90.894  96.750  1.00 104.36 ? 28  ASP M CG    1 
ATOM 6410  O OD1   . ASP G 1 29  ? 130.274 90.651  97.553  1.00 108.83 ? 28  ASP M OD1   1 
ATOM 6411  O OD2   . ASP G 1 29  ? 129.388 90.560  95.548  1.00 103.03 ? 28  ASP M OD2   1 
ATOM 6412  N N     . ILE G 1 30  ? 125.831 92.204  94.383  1.00 80.14  ? 29  ILE M N     1 
ATOM 6413  C CA    . ILE G 1 30  ? 124.997 91.418  93.467  1.00 77.51  ? 29  ILE M CA    1 
ATOM 6414  C C     . ILE G 1 30  ? 125.171 91.761  91.991  1.00 79.45  ? 29  ILE M C     1 
ATOM 6415  O O     . ILE G 1 30  ? 125.354 92.917  91.617  1.00 81.48  ? 29  ILE M O     1 
ATOM 6416  C CB    . ILE G 1 30  ? 123.500 91.543  93.796  1.00 73.93  ? 29  ILE M CB    1 
ATOM 6417  C CG1   . ILE G 1 30  ? 123.091 93.017  93.867  1.00 74.51  ? 29  ILE M CG1   1 
ATOM 6418  C CG2   . ILE G 1 30  ? 123.176 90.819  95.088  1.00 72.15  ? 29  ILE M CG2   1 
ATOM 6419  C CD1   . ILE G 1 30  ? 121.669 93.258  93.428  1.00 72.26  ? 29  ILE M CD1   1 
ATOM 6420  N N     . THR G 1 31  ? 125.086 90.744  91.147  1.00 74.46  ? 30  THR M N     1 
ATOM 6421  C CA    . THR G 1 31  ? 125.194 90.961  89.715  1.00 77.11  ? 30  THR M CA    1 
ATOM 6422  C C     . THR G 1 31  ? 123.958 91.702  89.193  1.00 75.45  ? 30  THR M C     1 
ATOM 6423  O O     . THR G 1 31  ? 122.930 91.763  89.868  1.00 71.99  ? 30  THR M O     1 
ATOM 6424  C CB    . THR G 1 31  ? 125.381 89.621  88.968  1.00 76.75  ? 30  THR M CB    1 
ATOM 6425  O OG1   . THR G 1 31  ? 126.405 88.861  89.617  1.00 77.53  ? 30  THR M OG1   1 
ATOM 6426  C CG2   . THR G 1 31  ? 125.785 89.850  87.510  1.00 80.72  ? 30  THR M CG2   1 
ATOM 6427  N N     . ASN G 1 32  ? 124.080 92.292  88.009  1.00 89.96  ? 31  ASN M N     1 
ATOM 6428  C CA    . ASN G 1 32  ? 122.955 92.900  87.333  1.00 88.75  ? 31  ASN M CA    1 
ATOM 6429  C C     . ASN G 1 32  ? 121.856 91.891  87.158  1.00 85.65  ? 31  ASN M C     1 
ATOM 6430  O O     . ASN G 1 32  ? 120.696 92.137  87.502  1.00 82.69  ? 31  ASN M O     1 
ATOM 6431  C CB    . ASN G 1 32  ? 123.380 93.357  85.957  1.00 91.22  ? 31  ASN M CB    1 
ATOM 6432  C CG    . ASN G 1 32  ? 123.418 94.835  85.844  1.00 92.53  ? 31  ASN M CG    1 
ATOM 6433  O OD1   . ASN G 1 32  ? 122.378 95.485  85.706  1.00 90.93  ? 31  ASN M OD1   1 
ATOM 6434  N ND2   . ASN G 1 32  ? 124.618 95.398  85.904  1.00 96.20  ? 31  ASN M ND2   1 
ATOM 6435  N N     . GLU G 1 33  ? 122.250 90.753  86.596  1.00 76.68  ? 32  GLU M N     1 
ATOM 6436  C CA    . GLU G 1 33  ? 121.353 89.643  86.354  1.00 74.33  ? 32  GLU M CA    1 
ATOM 6437  C C     . GLU G 1 33  ? 120.694 89.266  87.670  1.00 70.20  ? 32  GLU M C     1 
ATOM 6438  O O     . GLU G 1 33  ? 119.484 89.065  87.736  1.00 67.96  ? 32  GLU M O     1 
ATOM 6439  C CB    . GLU G 1 33  ? 122.138 88.470  85.775  1.00 75.50  ? 32  GLU M CB    1 
ATOM 6440  C CG    . GLU G 1 33  ? 121.277 87.382  85.189  1.00 73.85  ? 32  GLU M CG    1 
ATOM 6441  C CD    . GLU G 1 33  ? 122.002 86.576  84.121  1.00 75.98  ? 32  GLU M CD    1 
ATOM 6442  O OE1   . GLU G 1 33  ? 122.972 85.869  84.481  1.00 76.91  ? 32  GLU M OE1   1 
ATOM 6443  O OE2   . GLU G 1 33  ? 121.601 86.653  82.926  1.00 76.42  ? 32  GLU M OE2   1 
ATOM 6444  N N     . GLN G 1 34  ? 121.498 89.205  88.725  1.00 75.25  ? 33  GLN M N     1 
ATOM 6445  C CA    . GLN G 1 34  ? 120.972 88.943  90.049  1.00 72.03  ? 33  GLN M CA    1 
ATOM 6446  C C     . GLN G 1 34  ? 119.982 90.029  90.432  1.00 71.10  ? 33  GLN M C     1 
ATOM 6447  O O     . GLN G 1 34  ? 118.842 89.731  90.784  1.00 69.10  ? 33  GLN M O     1 
ATOM 6448  C CB    . GLN G 1 34  ? 122.100 88.872  91.075  1.00 71.53  ? 33  GLN M CB    1 
ATOM 6449  C CG    . GLN G 1 34  ? 122.999 87.683  90.894  1.00 72.27  ? 33  GLN M CG    1 
ATOM 6450  C CD    . GLN G 1 34  ? 123.360 87.033  92.210  1.00 71.33  ? 33  GLN M CD    1 
ATOM 6451  O OE1   . GLN G 1 34  ? 123.938 87.667  93.087  1.00 72.85  ? 33  GLN M OE1   1 
ATOM 6452  N NE2   . GLN G 1 34  ? 123.019 85.760  92.355  1.00 69.36  ? 33  GLN M NE2   1 
ATOM 6453  N N     . GLY G 1 35  ? 120.426 91.283  90.358  1.00 73.97  ? 34  GLY M N     1 
ATOM 6454  C CA    . GLY G 1 35  ? 119.571 92.423  90.639  1.00 73.58  ? 34  GLY M CA    1 
ATOM 6455  C C     . GLY G 1 35  ? 118.272 92.342  89.855  1.00 72.77  ? 34  GLY M C     1 
ATOM 6456  O O     . GLY G 1 35  ? 117.188 92.561  90.403  1.00 71.89  ? 34  GLY M O     1 
ATOM 6457  N N     . HIS G 1 36  ? 118.375 92.007  88.575  1.00 71.04  ? 35  HIS M N     1 
ATOM 6458  C CA    . HIS G 1 36  ? 117.185 91.806  87.767  1.00 70.75  ? 35  HIS M CA    1 
ATOM 6459  C C     . HIS G 1 36  ? 116.281 90.735  88.364  1.00 68.73  ? 35  HIS M C     1 
ATOM 6460  O O     . HIS G 1 36  ? 115.083 90.952  88.515  1.00 68.76  ? 35  HIS M O     1 
ATOM 6461  C CB    . HIS G 1 36  ? 117.551 91.456  86.324  1.00 72.69  ? 35  HIS M CB    1 
ATOM 6462  C CG    . HIS G 1 36  ? 117.950 92.641  85.503  1.00 75.80  ? 35  HIS M CG    1 
ATOM 6463  N ND1   . HIS G 1 36  ? 119.061 93.406  85.790  1.00 77.55  ? 35  HIS M ND1   1 
ATOM 6464  C CD2   . HIS G 1 36  ? 117.379 93.204  84.410  1.00 77.91  ? 35  HIS M CD2   1 
ATOM 6465  C CE1   . HIS G 1 36  ? 119.161 94.383  84.906  1.00 80.50  ? 35  HIS M CE1   1 
ATOM 6466  N NE2   . HIS G 1 36  ? 118.152 94.281  84.057  1.00 81.69  ? 35  HIS M NE2   1 
ATOM 6467  N N     . THR G 1 37  ? 116.855 89.585  88.700  1.00 54.10  ? 36  THR M N     1 
ATOM 6468  C CA    . THR G 1 37  ? 116.088 88.504  89.316  1.00 51.96  ? 36  THR M CA    1 
ATOM 6469  C C     . THR G 1 37  ? 115.346 89.055  90.529  1.00 51.11  ? 36  THR M C     1 
ATOM 6470  O O     . THR G 1 37  ? 114.135 88.891  90.652  1.00 51.46  ? 36  THR M O     1 
ATOM 6471  C CB    . THR G 1 37  ? 117.003 87.312  89.722  1.00 51.19  ? 36  THR M CB    1 
ATOM 6472  O OG1   . THR G 1 37  ? 117.790 86.926  88.597  1.00 53.37  ? 36  THR M OG1   1 
ATOM 6473  C CG2   . THR G 1 37  ? 116.197 86.091  90.206  1.00 49.97  ? 36  THR M CG2   1 
ATOM 6474  N N     . LEU G 1 38  ? 116.077 89.742  91.403  1.00 50.64  ? 37  LEU M N     1 
ATOM 6475  C CA    . LEU G 1 38  ? 115.481 90.434  92.546  1.00 51.08  ? 37  LEU M CA    1 
ATOM 6476  C C     . LEU G 1 38  ? 114.380 91.403  92.124  1.00 54.22  ? 37  LEU M C     1 
ATOM 6477  O O     . LEU G 1 38  ? 113.355 91.527  92.789  1.00 54.74  ? 37  LEU M O     1 
ATOM 6478  C CB    . LEU G 1 38  ? 116.556 91.187  93.324  1.00 51.64  ? 37  LEU M CB    1 
ATOM 6479  C CG    . LEU G 1 38  ? 117.612 90.275  93.924  1.00 49.41  ? 37  LEU M CG    1 
ATOM 6480  C CD1   . LEU G 1 38  ? 118.618 91.083  94.712  1.00 50.91  ? 37  LEU M CD1   1 
ATOM 6481  C CD2   . LEU G 1 38  ? 116.933 89.231  94.797  1.00 47.29  ? 37  LEU M CD2   1 
ATOM 6482  N N     . GLY G 1 39  ? 114.596 92.090  91.018  1.00 56.99  ? 38  GLY M N     1 
ATOM 6483  C CA    . GLY G 1 39  ? 113.584 92.995  90.526  1.00 60.87  ? 38  GLY M CA    1 
ATOM 6484  C C     . GLY G 1 39  ? 112.370 92.236  90.026  1.00 61.18  ? 38  GLY M C     1 
ATOM 6485  O O     . GLY G 1 39  ? 111.230 92.561  90.360  1.00 63.09  ? 38  GLY M O     1 
ATOM 6486  N N     . TYR G 1 40  ? 112.620 91.220  89.212  1.00 60.55  ? 39  TYR M N     1 
ATOM 6487  C CA    . TYR G 1 40  ? 111.552 90.408  88.660  1.00 61.56  ? 39  TYR M CA    1 
ATOM 6488  C C     . TYR G 1 40  ? 110.773 89.796  89.818  1.00 62.16  ? 39  TYR M C     1 
ATOM 6489  O O     . TYR G 1 40  ? 109.548 89.712  89.801  1.00 64.50  ? 39  TYR M O     1 
ATOM 6490  C CB    . TYR G 1 40  ? 112.158 89.330  87.772  1.00 60.91  ? 39  TYR M CB    1 
ATOM 6491  C CG    . TYR G 1 40  ? 111.153 88.464  87.071  1.00 62.41  ? 39  TYR M CG    1 
ATOM 6492  C CD1   . TYR G 1 40  ? 110.067 89.021  86.409  1.00 65.64  ? 39  TYR M CD1   1 
ATOM 6493  C CD2   . TYR G 1 40  ? 111.302 87.082  87.042  1.00 61.66  ? 39  TYR M CD2   1 
ATOM 6494  C CE1   . TYR G 1 40  ? 109.138 88.216  85.742  1.00 67.87  ? 39  TYR M CE1   1 
ATOM 6495  C CE2   . TYR G 1 40  ? 110.380 86.270  86.388  1.00 63.50  ? 39  TYR M CE2   1 
ATOM 6496  C CZ    . TYR G 1 40  ? 109.301 86.841  85.735  1.00 66.20  ? 39  TYR M CZ    1 
ATOM 6497  O OH    . TYR G 1 40  ? 108.388 86.036  85.082  1.00 68.69  ? 39  TYR M OH    1 
ATOM 6498  N N     . LEU G 1 41  ? 111.508 89.416  90.852  1.00 55.05  ? 40  LEU M N     1 
ATOM 6499  C CA    . LEU G 1 41  ? 110.935 88.735  91.993  1.00 54.15  ? 40  LEU M CA    1 
ATOM 6500  C C     . LEU G 1 41  ? 110.073 89.654  92.825  1.00 55.84  ? 40  LEU M C     1 
ATOM 6501  O O     . LEU G 1 41  ? 109.032 89.241  93.328  1.00 57.11  ? 40  LEU M O     1 
ATOM 6502  C CB    . LEU G 1 41  ? 112.048 88.191  92.859  1.00 51.19  ? 40  LEU M CB    1 
ATOM 6503  C CG    . LEU G 1 41  ? 112.260 86.713  92.639  1.00 49.99  ? 40  LEU M CG    1 
ATOM 6504  C CD1   . LEU G 1 41  ? 113.485 86.313  93.395  1.00 48.20  ? 40  LEU M CD1   1 
ATOM 6505  C CD2   . LEU G 1 41  ? 111.043 85.957  93.135  1.00 51.09  ? 40  LEU M CD2   1 
ATOM 6506  N N     . TYR G 1 42  ? 110.525 90.898  92.976  1.00 57.08  ? 41  TYR M N     1 
ATOM 6507  C CA    . TYR G 1 42  ? 109.829 91.919  93.747  1.00 59.86  ? 41  TYR M CA    1 
ATOM 6508  C C     . TYR G 1 42  ? 108.417 92.102  93.226  1.00 63.60  ? 41  TYR M C     1 
ATOM 6509  O O     . TYR G 1 42  ? 107.556 92.633  93.917  1.00 66.23  ? 41  TYR M O     1 
ATOM 6510  C CB    . TYR G 1 42  ? 110.603 93.235  93.648  1.00 61.71  ? 41  TYR M CB    1 
ATOM 6511  C CG    . TYR G 1 42  ? 110.025 94.392  94.429  1.00 65.16  ? 41  TYR M CG    1 
ATOM 6512  C CD1   . TYR G 1 42  ? 110.314 94.557  95.780  1.00 64.40  ? 41  TYR M CD1   1 
ATOM 6513  C CD2   . TYR G 1 42  ? 109.215 95.328  93.820  1.00 69.87  ? 41  TYR M CD2   1 
ATOM 6514  C CE1   . TYR G 1 42  ? 109.792 95.615  96.507  1.00 68.09  ? 41  TYR M CE1   1 
ATOM 6515  C CE2   . TYR G 1 42  ? 108.691 96.389  94.535  1.00 73.60  ? 41  TYR M CE2   1 
ATOM 6516  C CZ    . TYR G 1 42  ? 108.983 96.530  95.881  1.00 72.61  ? 41  TYR M CZ    1 
ATOM 6517  O OH    . TYR G 1 42  ? 108.464 97.589  96.601  1.00 76.84  ? 41  TYR M OH    1 
ATOM 6518  N N     . ALA G 1 43  ? 108.191 91.648  91.998  1.00 77.17  ? 42  ALA M N     1 
ATOM 6519  C CA    . ALA G 1 43  ? 106.902 91.780  91.334  1.00 80.45  ? 42  ALA M CA    1 
ATOM 6520  C C     . ALA G 1 43  ? 105.954 90.617  91.653  1.00 81.97  ? 42  ALA M C     1 
ATOM 6521  O O     . ALA G 1 43  ? 104.779 90.647  91.273  1.00 85.15  ? 42  ALA M O     1 
ATOM 6522  C CB    . ALA G 1 43  ? 107.111 91.900  89.833  1.00 80.13  ? 42  ALA M CB    1 
ATOM 6523  N N     . HIS G 1 44  ? 106.466 89.597  92.345  1.00 80.12  ? 43  HIS M N     1 
ATOM 6524  C CA    . HIS G 1 44  ? 105.682 88.396  92.651  1.00 81.44  ? 43  HIS M CA    1 
ATOM 6525  C C     . HIS G 1 44  ? 105.839 87.915  94.098  1.00 79.85  ? 43  HIS M C     1 
ATOM 6526  O O     . HIS G 1 44  ? 106.312 86.807  94.351  1.00 78.17  ? 43  HIS M O     1 
ATOM 6527  C CB    . HIS G 1 44  ? 106.018 87.289  91.656  1.00 79.83  ? 43  HIS M CB    1 
ATOM 6528  C CG    . HIS G 1 44  ? 105.828 87.704  90.231  1.00 82.02  ? 43  HIS M CG    1 
ATOM 6529  N ND1   . HIS G 1 44  ? 106.728 88.507  89.563  1.00 80.50  ? 43  HIS M ND1   1 
ATOM 6530  C CD2   . HIS G 1 44  ? 104.826 87.455  89.354  1.00 85.57  ? 43  HIS M CD2   1 
ATOM 6531  C CE1   . HIS G 1 44  ? 106.297 88.725  88.333  1.00 82.45  ? 43  HIS M CE1   1 
ATOM 6532  N NE2   . HIS G 1 44  ? 105.146 88.095  88.180  1.00 85.59  ? 43  HIS M NE2   1 
ATOM 6533  N N     . GLN G 1 45  ? 105.426 88.763  95.039  1.00 77.24  ? 44  GLN M N     1 
ATOM 6534  C CA    . GLN G 1 45  ? 105.510 88.446  96.465  1.00 76.78  ? 44  GLN M CA    1 
ATOM 6535  C C     . GLN G 1 45  ? 104.369 87.533  96.918  1.00 79.78  ? 44  GLN M C     1 
ATOM 6536  O O     . GLN G 1 45  ? 104.607 86.460  97.473  1.00 79.24  ? 44  GLN M O     1 
ATOM 6537  C CB    . GLN G 1 45  ? 105.539 89.722  97.306  1.00 77.53  ? 44  GLN M CB    1 
ATOM 6538  C CG    . GLN G 1 45  ? 106.683 90.650  96.968  1.00 75.28  ? 44  GLN M CG    1 
ATOM 6539  C CD    . GLN G 1 45  ? 106.640 91.936  97.771  1.00 76.72  ? 44  GLN M CD    1 
ATOM 6540  O OE1   . GLN G 1 45  ? 107.112 92.982  97.319  1.00 76.48  ? 44  GLN M OE1   1 
ATOM 6541  N NE2   . GLN G 1 45  ? 106.068 91.867  98.973  1.00 78.73  ? 44  GLN M NE2   1 
ATOM 6542  N N     . GLN G 1 46  ? 103.132 87.941  96.700  1.00 99.68  ? 45  GLN M N     1 
ATOM 6543  C CA    . GLN G 1 46  ? 102.049 87.023  96.981  1.00 102.84 ? 45  GLN M CA    1 
ATOM 6544  C C     . GLN G 1 46  ? 102.095 85.804  96.059  1.00 102.51 ? 45  GLN M C     1 
ATOM 6545  O O     . GLN G 1 46  ? 101.939 84.674  96.510  1.00 103.31 ? 45  GLN M O     1 
ATOM 6546  C CB    . GLN G 1 46  ? 100.703 87.731  96.842  1.00 103.82 ? 45  GLN M CB    1 
ATOM 6547  N N     . ASP G 1 47  ? 102.296 86.041  94.764  1.00 122.90 ? 46  ASP M N     1 
ATOM 6548  C CA    . ASP G 1 47  ? 102.306 84.959  93.779  1.00 123.44 ? 46  ASP M CA    1 
ATOM 6549  C C     . ASP G 1 47  ? 103.481 83.984  93.837  1.00 119.82 ? 46  ASP M C     1 
ATOM 6550  O O     . ASP G 1 47  ? 103.291 82.772  93.854  1.00 120.57 ? 46  ASP M O     1 
ATOM 6551  C CB    . ASP G 1 47  ? 102.231 85.571  92.375  1.00 124.85 ? 46  ASP M CB    1 
ATOM 6552  C CG    . ASP G 1 47  ? 102.354 84.539  91.274  1.00 126.11 ? 46  ASP M CG    1 
ATOM 6553  O OD1   . ASP G 1 47  ? 103.343 84.593  90.522  1.00 124.24 ? 46  ASP M OD1   1 
ATOM 6554  O OD2   . ASP G 1 47  ? 101.459 83.679  91.153  1.00 129.41 ? 46  ASP M OD2   1 
ATOM 6555  N N     . GLY G 1 48  ? 104.693 84.526  93.900  1.00 94.87  ? 47  GLY M N     1 
ATOM 6556  C CA    . GLY G 1 48  ? 105.903 83.724  93.826  1.00 91.25  ? 47  GLY M CA    1 
ATOM 6557  C C     . GLY G 1 48  ? 106.262 83.369  92.389  1.00 91.29  ? 47  GLY M C     1 
ATOM 6558  O O     . GLY G 1 48  ? 105.432 83.498  91.500  1.00 94.81  ? 47  GLY M O     1 
ATOM 6559  N N     . LEU G 1 49  ? 107.479 82.873  92.178  1.00 58.23  ? 48  LEU M N     1 
ATOM 6560  C CA    . LEU G 1 49  ? 107.936 82.346  90.886  1.00 58.17  ? 48  LEU M CA    1 
ATOM 6561  C C     . LEU G 1 49  ? 108.479 80.918  91.012  1.00 56.16  ? 48  LEU M C     1 
ATOM 6562  O O     . LEU G 1 49  ? 108.826 80.469  92.103  1.00 54.85  ? 48  LEU M O     1 
ATOM 6563  C CB    . LEU G 1 49  ? 108.986 83.278  90.269  1.00 56.56  ? 48  LEU M CB    1 
ATOM 6564  C CG    . LEU G 1 49  ? 108.532 84.736  90.083  1.00 59.01  ? 48  LEU M CG    1 
ATOM 6565  C CD1   . LEU G 1 49  ? 109.705 85.640  89.735  1.00 57.30  ? 48  LEU M CD1   1 
ATOM 6566  C CD2   . LEU G 1 49  ? 107.418 84.878  89.043  1.00 64.02  ? 48  LEU M CD2   1 
ATOM 6567  N N     . THR G 1 50  ? 108.534 80.209  89.890  1.00 84.11  ? 49  THR M N     1 
ATOM 6568  C CA    . THR G 1 50  ? 109.206 78.915  89.837  1.00 82.55  ? 49  THR M CA    1 
ATOM 6569  C C     . THR G 1 50  ? 110.684 79.125  89.604  1.00 79.31  ? 49  THR M C     1 
ATOM 6570  O O     . THR G 1 50  ? 111.120 80.256  89.449  1.00 78.26  ? 49  THR M O     1 
ATOM 6571  C CB    . THR G 1 50  ? 108.700 78.079  88.653  1.00 83.70  ? 49  THR M CB    1 
ATOM 6572  O OG1   . THR G 1 50  ? 107.290 77.868  88.762  1.00 87.59  ? 49  THR M OG1   1 
ATOM 6573  C CG2   . THR G 1 50  ? 109.418 76.734  88.595  1.00 82.98  ? 49  THR M CG2   1 
ATOM 6574  N N     . GLN G 1 51  ? 111.466 78.059  89.572  1.00 78.50  ? 50  GLN M N     1 
ATOM 6575  C CA    . GLN G 1 51  ? 112.813 78.190  89.054  1.00 77.06  ? 50  GLN M CA    1 
ATOM 6576  C C     . GLN G 1 51  ? 112.706 78.293  87.534  1.00 78.31  ? 50  GLN M C     1 
ATOM 6577  O O     . GLN G 1 51  ? 113.454 79.033  86.885  1.00 77.83  ? 50  GLN M O     1 
ATOM 6578  C CB    . GLN G 1 51  ? 113.672 76.993  89.480  1.00 78.91  ? 50  GLN M CB    1 
ATOM 6579  C CG    . GLN G 1 51  ? 113.749 76.765  90.995  1.00 78.82  ? 50  GLN M CG    1 
ATOM 6580  C CD    . GLN G 1 51  ? 115.029 76.047  91.415  1.00 78.82  ? 50  GLN M CD    1 
ATOM 6581  O OE1   . GLN G 1 51  ? 115.239 75.745  92.598  1.00 79.32  ? 50  GLN M OE1   1 
ATOM 6582  N NE2   . GLN G 1 51  ? 115.900 75.773  90.436  1.00 78.84  ? 50  GLN M NE2   1 
ATOM 6583  N N     . ASN G 1 52  ? 111.748 77.560  86.976  1.00 67.33  ? 51  ASN M N     1 
ATOM 6584  C CA    . ASN G 1 52  ? 111.489 77.630  85.551  1.00 69.22  ? 51  ASN M CA    1 
ATOM 6585  C C     . ASN G 1 52  ? 111.104 79.031  85.124  1.00 69.52  ? 51  ASN M C     1 
ATOM 6586  O O     . ASN G 1 52  ? 111.757 79.601  84.265  1.00 69.47  ? 51  ASN M O     1 
ATOM 6587  C CB    . ASN G 1 52  ? 110.421 76.616  85.117  1.00 72.27  ? 51  ASN M CB    1 
ATOM 6588  C CG    . ASN G 1 52  ? 110.992 75.211  84.889  1.00 73.08  ? 51  ASN M CG    1 
ATOM 6589  O OD1   . ASN G 1 52  ? 112.023 74.843  85.476  1.00 71.53  ? 51  ASN M OD1   1 
ATOM 6590  N ND2   . ASN G 1 52  ? 110.324 74.422  84.038  1.00 76.05  ? 51  ASN M ND2   1 
ATOM 6591  N N     . ASP G 1 53  ? 110.054 79.575  85.731  1.00 71.97  ? 52  ASP M N     1 
ATOM 6592  C CA    . ASP G 1 53  ? 109.561 80.919  85.419  1.00 73.44  ? 52  ASP M CA    1 
ATOM 6593  C C     . ASP G 1 53  ? 110.689 81.936  85.282  1.00 71.16  ? 52  ASP M C     1 
ATOM 6594  O O     . ASP G 1 53  ? 110.710 82.757  84.372  1.00 72.03  ? 52  ASP M O     1 
ATOM 6595  C CB    . ASP G 1 53  ? 108.600 81.402  86.517  1.00 74.11  ? 52  ASP M CB    1 
ATOM 6596  C CG    . ASP G 1 53  ? 107.153 80.941  86.301  1.00 78.41  ? 52  ASP M CG    1 
ATOM 6597  O OD1   . ASP G 1 53  ? 106.843 80.365  85.221  1.00 79.94  ? 52  ASP M OD1   1 
ATOM 6598  O OD2   . ASP G 1 53  ? 106.323 81.179  87.221  1.00 80.71  ? 52  ASP M OD2   1 
ATOM 6599  N N     . ILE G 1 54  ? 111.631 81.855  86.206  1.00 54.90  ? 53  ILE M N     1 
ATOM 6600  C CA    . ILE G 1 54  ? 112.763 82.771  86.281  1.00 53.53  ? 53  ILE M CA    1 
ATOM 6601  C C     . ILE G 1 54  ? 113.757 82.541  85.156  1.00 54.86  ? 53  ILE M C     1 
ATOM 6602  O O     . ILE G 1 54  ? 114.284 83.494  84.576  1.00 56.50  ? 53  ILE M O     1 
ATOM 6603  C CB    . ILE G 1 54  ? 113.484 82.620  87.632  1.00 49.77  ? 53  ILE M CB    1 
ATOM 6604  C CG1   . ILE G 1 54  ? 112.550 83.053  88.755  1.00 49.16  ? 53  ILE M CG1   1 
ATOM 6605  C CG2   . ILE G 1 54  ? 114.765 83.426  87.654  1.00 48.98  ? 53  ILE M CG2   1 
ATOM 6606  C CD1   . ILE G 1 54  ? 113.147 82.919  90.090  1.00 46.44  ? 53  ILE M CD1   1 
ATOM 6607  N N     . ALA G 1 55  ? 114.012 81.267  84.869  1.00 54.72  ? 54  ALA M N     1 
ATOM 6608  C CA    . ALA G 1 55  ? 114.838 80.886  83.737  1.00 56.81  ? 54  ALA M CA    1 
ATOM 6609  C C     . ALA G 1 55  ? 114.376 81.607  82.486  1.00 61.27  ? 54  ALA M C     1 
ATOM 6610  O O     . ALA G 1 55  ? 115.154 82.330  81.865  1.00 63.00  ? 54  ALA M O     1 
ATOM 6611  C CB    . ALA G 1 55  ? 114.789 79.392  83.526  1.00 57.22  ? 54  ALA M CB    1 
ATOM 6612  N N     . LYS G 1 56  ? 113.104 81.428  82.134  1.00 64.86  ? 55  LYS M N     1 
ATOM 6613  C CA    . LYS G 1 56  ? 112.550 82.032  80.920  1.00 69.17  ? 55  LYS M CA    1 
ATOM 6614  C C     . LYS G 1 56  ? 112.702 83.547  80.965  1.00 70.05  ? 55  LYS M C     1 
ATOM 6615  O O     . LYS G 1 56  ? 113.003 84.167  79.950  1.00 74.18  ? 55  LYS M O     1 
ATOM 6616  C CB    . LYS G 1 56  ? 111.086 81.623  80.695  1.00 72.23  ? 55  LYS M CB    1 
ATOM 6617  N N     . ALA G 1 57  ? 112.537 84.135  82.145  1.00 66.71  ? 56  ALA M N     1 
ATOM 6618  C CA    . ALA G 1 57  ? 112.686 85.581  82.299  1.00 67.74  ? 56  ALA M CA    1 
ATOM 6619  C C     . ALA G 1 57  ? 114.080 86.096  81.975  1.00 67.83  ? 56  ALA M C     1 
ATOM 6620  O O     . ALA G 1 57  ? 114.247 87.134  81.334  1.00 71.66  ? 56  ALA M O     1 
ATOM 6621  C CB    . ALA G 1 57  ? 112.299 85.996  83.689  1.00 64.36  ? 56  ALA M CB    1 
ATOM 6622  N N     . LEU G 1 58  ? 115.080 85.354  82.431  1.00 64.24  ? 57  LEU M N     1 
ATOM 6623  C CA    . LEU G 1 58  ? 116.469 85.751  82.263  1.00 64.40  ? 57  LEU M CA    1 
ATOM 6624  C C     . LEU G 1 58  ? 117.117 85.269  80.973  1.00 67.95  ? 57  LEU M C     1 
ATOM 6625  O O     . LEU G 1 58  ? 118.267 85.606  80.689  1.00 69.19  ? 57  LEU M O     1 
ATOM 6626  C CB    . LEU G 1 58  ? 117.306 85.189  83.394  1.00 59.72  ? 57  LEU M CB    1 
ATOM 6627  C CG    . LEU G 1 58  ? 116.950 85.766  84.752  1.00 56.70  ? 57  LEU M CG    1 
ATOM 6628  C CD1   . LEU G 1 58  ? 117.712 85.066  85.868  1.00 52.88  ? 57  LEU M CD1   1 
ATOM 6629  C CD2   . LEU G 1 58  ? 117.255 87.239  84.695  1.00 58.94  ? 57  LEU M CD2   1 
ATOM 6630  N N     . GLN G 1 59  ? 116.358 84.490  80.202  1.00 91.90  ? 58  GLN M N     1 
ATOM 6631  C CA    . GLN G 1 59  ? 116.872 83.837  79.002  1.00 94.67  ? 58  GLN M CA    1 
ATOM 6632  C C     . GLN G 1 59  ? 118.162 83.080  79.287  1.00 94.68  ? 58  GLN M C     1 
ATOM 6633  O O     . GLN G 1 59  ? 119.207 83.379  78.719  1.00 97.07  ? 58  GLN M O     1 
ATOM 6634  C CB    . GLN G 1 59  ? 117.106 84.920  77.946  1.00 96.46  ? 58  GLN M CB    1 
ATOM 6635  C CG    . GLN G 1 59  ? 115.833 85.501  77.342  1.00 99.73  ? 58  GLN M CG    1 
ATOM 6636  C CD    . GLN G 1 59  ? 115.200 84.586  76.296  1.00 103.40 ? 58  GLN M CD    1 
ATOM 6637  O OE1   . GLN G 1 59  ? 114.620 83.548  76.630  1.00 101.50 ? 58  GLN M OE1   1 
ATOM 6638  N NE2   . GLN G 1 59  ? 115.314 84.969  75.020  1.00 110.14 ? 58  GLN M NE2   1 
ATOM 6639  N N     . ARG G 1 60  ? 118.079 82.108  80.186  1.00 70.80  ? 59  ARG M N     1 
ATOM 6640  C CA    . ARG G 1 60  ? 119.242 81.354  80.628  1.00 70.85  ? 59  ARG M CA    1 
ATOM 6641  C C     . ARG G 1 60  ? 118.866 79.904  80.876  1.00 70.02  ? 59  ARG M C     1 
ATOM 6642  O O     . ARG G 1 60  ? 117.755 79.602  81.307  1.00 68.28  ? 59  ARG M O     1 
ATOM 6643  C CB    . ARG G 1 60  ? 119.787 81.917  81.943  1.00 68.80  ? 59  ARG M CB    1 
ATOM 6644  C CG    . ARG G 1 60  ? 120.156 83.384  81.926  1.00 69.87  ? 59  ARG M CG    1 
ATOM 6645  C CD    . ARG G 1 60  ? 121.248 83.647  80.923  1.00 73.57  ? 59  ARG M CD    1 
ATOM 6646  N NE    . ARG G 1 60  ? 122.494 84.047  81.555  1.00 74.90  ? 59  ARG M NE    1 
ATOM 6647  C CZ    . ARG G 1 60  ? 123.636 84.189  80.895  1.00 78.59  ? 59  ARG M CZ    1 
ATOM 6648  N NH1   . ARG G 1 60  ? 123.680 83.950  79.584  1.00 80.70  ? 59  ARG M NH1   1 
ATOM 6649  N NH2   . ARG G 1 60  ? 124.733 84.561  81.547  1.00 80.84  ? 59  ARG M NH2   1 
ATOM 6650  N N     . THR G 1 61  ? 119.810 79.008  80.628  1.00 73.45  ? 60  THR M N     1 
ATOM 6651  C CA    . THR G 1 61  ? 119.639 77.605  80.960  1.00 73.14  ? 60  THR M CA    1 
ATOM 6652  C C     . THR G 1 61  ? 119.334 77.447  82.447  1.00 69.94  ? 60  THR M C     1 
ATOM 6653  O O     . THR G 1 61  ? 119.675 78.308  83.254  1.00 68.32  ? 60  THR M O     1 
ATOM 6654  C CB    . THR G 1 61  ? 120.900 76.830  80.604  1.00 75.67  ? 60  THR M CB    1 
ATOM 6655  O OG1   . THR G 1 61  ? 121.318 77.215  79.289  1.00 78.64  ? 60  THR M OG1   1 
ATOM 6656  C CG2   . THR G 1 61  ? 120.646 75.339  80.622  1.00 76.54  ? 60  THR M CG2   1 
ATOM 6657  N N     . GLY G 1 62  ? 118.667 76.351  82.792  1.00 59.21  ? 61  GLY M N     1 
ATOM 6658  C CA    . GLY G 1 62  ? 118.239 76.068  84.151  1.00 56.69  ? 61  GLY M CA    1 
ATOM 6659  C C     . GLY G 1 62  ? 119.313 76.112  85.218  1.00 55.81  ? 61  GLY M C     1 
ATOM 6660  O O     . GLY G 1 62  ? 119.150 76.825  86.197  1.00 54.34  ? 61  GLY M O     1 
ATOM 6661  N N     . PRO G 1 63  ? 120.405 75.337  85.048  1.00 54.43  ? 62  PRO M N     1 
ATOM 6662  C CA    . PRO G 1 63  ? 121.540 75.347  85.986  1.00 53.39  ? 62  PRO M CA    1 
ATOM 6663  C C     . PRO G 1 63  ? 122.190 76.726  86.164  1.00 52.50  ? 62  PRO M C     1 
ATOM 6664  O O     . PRO G 1 63  ? 122.547 77.092  87.283  1.00 50.80  ? 62  PRO M O     1 
ATOM 6665  C CB    . PRO G 1 63  ? 122.530 74.389  85.331  1.00 56.56  ? 62  PRO M CB    1 
ATOM 6666  C CG    . PRO G 1 63  ? 121.691 73.469  84.572  1.00 58.41  ? 62  PRO M CG    1 
ATOM 6667  C CD    . PRO G 1 63  ? 120.569 74.291  84.028  1.00 57.81  ? 62  PRO M CD    1 
ATOM 6668  N N     . THR G 1 64  ? 122.347 77.469  85.073  1.00 55.02  ? 63  THR M N     1 
ATOM 6669  C CA    . THR G 1 64  ? 122.856 78.823  85.139  1.00 55.23  ? 63  THR M CA    1 
ATOM 6670  C C     . THR G 1 64  ? 122.027 79.609  86.131  1.00 52.11  ? 63  THR M C     1 
ATOM 6671  O O     . THR G 1 64  ? 122.572 80.259  87.021  1.00 51.63  ? 63  THR M O     1 
ATOM 6672  C CB    . THR G 1 64  ? 122.794 79.487  83.771  1.00 57.76  ? 63  THR M CB    1 
ATOM 6673  O OG1   . THR G 1 64  ? 123.308 78.575  82.788  1.00 60.62  ? 63  THR M OG1   1 
ATOM 6674  C CG2   . THR G 1 64  ? 123.623 80.754  83.752  1.00 59.54  ? 63  THR M CG2   1 
ATOM 6675  N N     . VAL G 1 65  ? 120.707 79.516  85.997  1.00 50.66  ? 64  VAL M N     1 
ATOM 6676  C CA    . VAL G 1 65  ? 119.778 80.153  86.930  1.00 48.24  ? 64  VAL M CA    1 
ATOM 6677  C C     . VAL G 1 65  ? 119.921 79.601  88.348  1.00 46.22  ? 64  VAL M C     1 
ATOM 6678  O O     . VAL G 1 65  ? 119.924 80.357  89.312  1.00 44.90  ? 64  VAL M O     1 
ATOM 6679  C CB    . VAL G 1 65  ? 118.320 80.002  86.456  1.00 48.78  ? 64  VAL M CB    1 
ATOM 6680  C CG1   . VAL G 1 65  ? 117.340 80.313  87.570  1.00 46.81  ? 64  VAL M CG1   1 
ATOM 6681  C CG2   . VAL G 1 65  ? 118.062 80.888  85.273  1.00 51.40  ? 64  VAL M CG2   1 
ATOM 6682  N N     . SER G 1 66  ? 120.055 78.287  88.472  1.00 51.07  ? 65  SER M N     1 
ATOM 6683  C CA    . SER G 1 66  ? 120.156 77.632  89.773  1.00 50.28  ? 65  SER M CA    1 
ATOM 6684  C C     . SER G 1 66  ? 121.318 78.169  90.608  1.00 50.74  ? 65  SER M C     1 
ATOM 6685  O O     . SER G 1 66  ? 121.154 78.470  91.793  1.00 49.67  ? 65  SER M O     1 
ATOM 6686  C CB    . SER G 1 66  ? 120.310 76.129  89.585  1.00 51.74  ? 65  SER M CB    1 
ATOM 6687  O OG    . SER G 1 66  ? 119.907 75.424  90.747  1.00 51.17  ? 65  SER M OG    1 
ATOM 6688  N N     . ASN G 1 67  ? 122.487 78.283  89.984  1.00 54.18  ? 66  ASN M N     1 
ATOM 6689  C CA    . ASN G 1 67  ? 123.648 78.854  90.648  1.00 55.56  ? 66  ASN M CA    1 
ATOM 6690  C C     . ASN G 1 67  ? 123.335 80.245  91.127  1.00 54.33  ? 66  ASN M C     1 
ATOM 6691  O O     . ASN G 1 67  ? 123.569 80.584  92.271  1.00 54.17  ? 66  ASN M O     1 
ATOM 6692  C CB    . ASN G 1 67  ? 124.847 78.903  89.708  1.00 59.22  ? 66  ASN M CB    1 
ATOM 6693  C CG    . ASN G 1 67  ? 125.356 77.529  89.348  1.00 60.76  ? 66  ASN M CG    1 
ATOM 6694  O OD1   . ASN G 1 67  ? 124.913 76.937  88.374  1.00 61.05  ? 66  ASN M OD1   1 
ATOM 6695  N ND2   . ASN G 1 67  ? 126.293 77.007  90.139  1.00 61.62  ? 66  ASN M ND2   1 
ATOM 6696  N N     . LEU G 1 68  ? 122.795 81.044  90.227  1.00 59.72  ? 67  LEU M N     1 
ATOM 6697  C CA    . LEU G 1 68  ? 122.446 82.429  90.510  1.00 58.79  ? 67  LEU M CA    1 
ATOM 6698  C C     . LEU G 1 68  ? 121.553 82.540  91.740  1.00 56.41  ? 67  LEU M C     1 
ATOM 6699  O O     . LEU G 1 68  ? 121.792 83.353  92.630  1.00 56.49  ? 67  LEU M O     1 
ATOM 6700  C CB    . LEU G 1 68  ? 121.713 82.996  89.301  1.00 58.99  ? 67  LEU M CB    1 
ATOM 6701  C CG    . LEU G 1 68  ? 121.402 84.477  89.313  1.00 58.98  ? 67  LEU M CG    1 
ATOM 6702  C CD1   . LEU G 1 68  ? 122.407 85.209  88.425  1.00 62.26  ? 67  LEU M CD1   1 
ATOM 6703  C CD2   . LEU G 1 68  ? 119.992 84.662  88.831  1.00 57.89  ? 67  LEU M CD2   1 
ATOM 6704  N N     . LEU G 1 69  ? 120.523 81.705  91.773  1.00 65.44  ? 68  LEU M N     1 
ATOM 6705  C CA    . LEU G 1 69  ? 119.641 81.602  92.922  1.00 64.10  ? 68  LEU M CA    1 
ATOM 6706  C C     . LEU G 1 69  ? 120.377 81.135  94.184  1.00 64.74  ? 68  LEU M C     1 
ATOM 6707  O O     . LEU G 1 69  ? 120.128 81.656  95.262  1.00 64.70  ? 68  LEU M O     1 
ATOM 6708  C CB    . LEU G 1 69  ? 118.493 80.650  92.611  1.00 63.66  ? 68  LEU M CB    1 
ATOM 6709  C CG    . LEU G 1 69  ? 117.482 81.103  91.570  1.00 63.28  ? 68  LEU M CG    1 
ATOM 6710  C CD1   . LEU G 1 69  ? 116.603 79.937  91.167  1.00 63.44  ? 68  LEU M CD1   1 
ATOM 6711  C CD2   . LEU G 1 69  ? 116.652 82.218  92.154  1.00 62.36  ? 68  LEU M CD2   1 
ATOM 6712  N N     . ARG G 1 70  ? 121.268 80.153  94.055  1.00 66.63  ? 69  ARG M N     1 
ATOM 6713  C CA    . ARG G 1 70  ? 122.051 79.692  95.201  1.00 67.95  ? 69  ARG M CA    1 
ATOM 6714  C C     . ARG G 1 70  ? 122.809 80.838  95.824  1.00 69.81  ? 69  ARG M C     1 
ATOM 6715  O O     . ARG G 1 70  ? 122.802 81.021  97.042  1.00 70.88  ? 69  ARG M O     1 
ATOM 6716  C CB    . ARG G 1 70  ? 123.066 78.630  94.796  1.00 68.56  ? 69  ARG M CB    1 
ATOM 6717  C CG    . ARG G 1 70  ? 122.618 77.188  95.016  1.00 67.84  ? 69  ARG M CG    1 
ATOM 6718  C CD    . ARG G 1 70  ? 123.851 76.318  95.098  1.00 69.86  ? 69  ARG M CD    1 
ATOM 6719  N NE    . ARG G 1 70  ? 124.813 76.975  95.974  1.00 72.10  ? 69  ARG M NE    1 
ATOM 6720  C CZ    . ARG G 1 70  ? 125.291 76.438  97.091  1.00 73.36  ? 69  ARG M CZ    1 
ATOM 6721  N NH1   . ARG G 1 70  ? 124.917 75.210  97.456  1.00 72.25  ? 69  ARG M NH1   1 
ATOM 6722  N NH2   . ARG G 1 70  ? 126.155 77.126  97.836  1.00 76.34  ? 69  ARG M NH2   1 
ATOM 6723  N N     . ASN G 1 71  ? 123.472 81.612  94.980  1.00 66.65  ? 70  ASN M N     1 
ATOM 6724  C CA    . ASN G 1 71  ? 124.296 82.688  95.480  1.00 69.15  ? 70  ASN M CA    1 
ATOM 6725  C C     . ASN G 1 71  ? 123.460 83.664  96.273  1.00 68.09  ? 70  ASN M C     1 
ATOM 6726  O O     . ASN G 1 71  ? 123.823 84.015  97.397  1.00 70.36  ? 70  ASN M O     1 
ATOM 6727  C CB    . ASN G 1 71  ? 125.012 83.415  94.355  1.00 70.40  ? 70  ASN M CB    1 
ATOM 6728  C CG    . ASN G 1 71  ? 125.678 84.677  94.835  1.00 72.63  ? 70  ASN M CG    1 
ATOM 6729  O OD1   . ASN G 1 71  ? 126.748 84.634  95.443  1.00 76.20  ? 70  ASN M OD1   1 
ATOM 6730  N ND2   . ASN G 1 71  ? 125.038 85.816  94.582  1.00 70.73  ? 70  ASN M ND2   1 
ATOM 6731  N N     . LEU G 1 72  ? 122.333 84.078  95.693  1.00 56.76  ? 71  LEU M N     1 
ATOM 6732  C CA    . LEU G 1 72  ? 121.432 85.029  96.342  1.00 55.89  ? 71  LEU M CA    1 
ATOM 6733  C C     . LEU G 1 72  ? 120.893 84.470  97.649  1.00 56.30  ? 71  LEU M C     1 
ATOM 6734  O O     . LEU G 1 72  ? 120.709 85.207  98.618  1.00 56.63  ? 71  LEU M O     1 
ATOM 6735  C CB    . LEU G 1 72  ? 120.279 85.432  95.416  1.00 53.58  ? 71  LEU M CB    1 
ATOM 6736  C CG    . LEU G 1 72  ? 120.592 86.516  94.381  1.00 53.74  ? 71  LEU M CG    1 
ATOM 6737  C CD1   . LEU G 1 72  ? 119.369 86.865  93.566  1.00 52.57  ? 71  LEU M CD1   1 
ATOM 6738  C CD2   . LEU G 1 72  ? 121.150 87.751  95.053  1.00 55.05  ? 71  LEU M CD2   1 
ATOM 6739  N N     . GLU G 1 73  ? 120.661 83.162  97.688  1.00 59.46  ? 72  GLU M N     1 
ATOM 6740  C CA    . GLU G 1 73  ? 120.195 82.549  98.919  1.00 59.33  ? 72  GLU M CA    1 
ATOM 6741  C C     . GLU G 1 73  ? 121.213 82.669  100.042 1.00 61.53  ? 72  GLU M C     1 
ATOM 6742  O O     . GLU G 1 73  ? 120.834 83.001  101.156 1.00 61.17  ? 72  GLU M O     1 
ATOM 6743  C CB    . GLU G 1 73  ? 119.778 81.099  98.728  1.00 58.24  ? 72  GLU M CB    1 
ATOM 6744  C CG    . GLU G 1 73  ? 118.893 80.609  99.859  1.00 58.37  ? 72  GLU M CG    1 
ATOM 6745  C CD    . GLU G 1 73  ? 118.322 79.225  99.610  1.00 58.88  ? 72  GLU M CD    1 
ATOM 6746  O OE1   . GLU G 1 73  ? 117.328 78.861  100.286 1.00 60.34  ? 72  GLU M OE1   1 
ATOM 6747  O OE2   . GLU G 1 73  ? 118.871 78.504  98.739  1.00 58.61  ? 72  GLU M OE2   1 
ATOM 6748  N N     . ARG G 1 74  ? 122.492 82.422  99.761  1.00 68.83  ? 73  ARG M N     1 
ATOM 6749  C CA    . ARG G 1 74  ? 123.535 82.611  100.779 1.00 71.60  ? 73  ARG M CA    1 
ATOM 6750  C C     . ARG G 1 74  ? 123.559 84.039  101.342 1.00 72.18  ? 73  ARG M C     1 
ATOM 6751  O O     . ARG G 1 74  ? 123.878 84.258  102.516 1.00 73.09  ? 73  ARG M O     1 
ATOM 6752  C CB    . ARG G 1 74  ? 124.917 82.213  100.251 1.00 74.95  ? 73  ARG M CB    1 
ATOM 6753  C CG    . ARG G 1 74  ? 125.339 80.802  100.658 1.00 74.54  ? 73  ARG M CG    1 
ATOM 6754  C CD    . ARG G 1 74  ? 126.646 80.364  100.005 1.00 78.41  ? 73  ARG M CD    1 
ATOM 6755  N NE    . ARG G 1 74  ? 127.803 81.108  100.503 1.00 82.79  ? 73  ARG M NE    1 
ATOM 6756  C CZ    . ARG G 1 74  ? 128.472 80.800  101.614 1.00 83.87  ? 73  ARG M CZ    1 
ATOM 6757  N NH1   . ARG G 1 74  ? 128.087 79.770  102.362 1.00 81.58  ? 73  ARG M NH1   1 
ATOM 6758  N NH2   . ARG G 1 74  ? 129.519 81.533  101.989 1.00 87.76  ? 73  ARG M NH2   1 
ATOM 6759  N N     . LYS G 1 75  ? 123.196 85.000  100.499 1.00 69.61  ? 74  LYS M N     1 
ATOM 6760  C CA    . LYS G 1 75  ? 123.087 86.392  100.910 1.00 71.06  ? 74  LYS M CA    1 
ATOM 6761  C C     . LYS G 1 75  ? 121.843 86.606  101.781 1.00 71.88  ? 74  LYS M C     1 
ATOM 6762  O O     . LYS G 1 75  ? 121.649 87.680  102.356 1.00 73.28  ? 74  LYS M O     1 
ATOM 6763  C CB    . LYS G 1 75  ? 123.019 87.302  99.675  1.00 71.14  ? 74  LYS M CB    1 
ATOM 6764  C CG    . LYS G 1 75  ? 123.904 86.883  98.493  1.00 70.48  ? 74  LYS M CG    1 
ATOM 6765  C CD    . LYS G 1 75  ? 125.393 87.076  98.777  1.00 70.37  ? 74  LYS M CD    1 
ATOM 6766  C CE    . LYS G 1 75  ? 126.289 86.758  97.562  1.00 69.89  ? 74  LYS M CE    1 
ATOM 6767  N NZ    . LYS G 1 75  ? 126.368 87.840  96.519  1.00 70.81  ? 74  LYS M NZ    1 
ATOM 6768  N N     . LYS G 1 76  ? 121.008 85.574  101.863 1.00 66.42  ? 75  LYS M N     1 
ATOM 6769  C CA    . LYS G 1 76  ? 119.729 85.637  102.572 1.00 67.32  ? 75  LYS M CA    1 
ATOM 6770  C C     . LYS G 1 76  ? 118.759 86.677  101.963 1.00 70.93  ? 75  LYS M C     1 
ATOM 6771  O O     . LYS G 1 76  ? 117.857 87.177  102.635 1.00 72.71  ? 75  LYS M O     1 
ATOM 6772  C CB    . LYS G 1 76  ? 119.942 85.854  104.077 1.00 68.47  ? 75  LYS M CB    1 
ATOM 6773  N N     . LEU G 1 77  ? 118.944 86.974  100.677 1.00 54.34  ? 76  LEU M N     1 
ATOM 6774  C CA    . LEU G 1 77  ? 118.101 87.927  99.950  1.00 57.77  ? 76  LEU M CA    1 
ATOM 6775  C C     . LEU G 1 77  ? 116.838 87.288  99.365  1.00 59.76  ? 76  LEU M C     1 
ATOM 6776  O O     . LEU G 1 77  ? 115.838 87.971  99.120  1.00 61.51  ? 76  LEU M O     1 
ATOM 6777  C CB    . LEU G 1 77  ? 118.896 88.552  98.814  1.00 57.86  ? 76  LEU M CB    1 
ATOM 6778  C CG    . LEU G 1 77  ? 119.994 89.527  99.218  1.00 56.09  ? 76  LEU M CG    1 
ATOM 6779  C CD1   . LEU G 1 77  ? 120.864 89.848  98.012  1.00 55.96  ? 76  LEU M CD1   1 
ATOM 6780  C CD2   . LEU G 1 77  ? 119.391 90.791  99.814  1.00 58.22  ? 76  LEU M CD2   1 
ATOM 6781  N N     . ILE G 1 78  ? 116.899 85.981  99.120  1.00 67.91  ? 77  ILE M N     1 
ATOM 6782  C CA    . ILE G 1 78  ? 115.754 85.229  98.627  1.00 68.76  ? 77  ILE M CA    1 
ATOM 6783  C C     . ILE G 1 78  ? 115.593 83.965  99.461  1.00 66.91  ? 77  ILE M C     1 
ATOM 6784  O O     . ILE G 1 78  ? 116.481 83.623  100.248 1.00 64.86  ? 77  ILE M O     1 
ATOM 6785  C CB    . ILE G 1 78  ? 115.954 84.806  97.173  1.00 69.65  ? 77  ILE M CB    1 
ATOM 6786  C CG1   . ILE G 1 78  ? 116.886 83.600  97.097  1.00 68.02  ? 77  ILE M CG1   1 
ATOM 6787  C CG2   . ILE G 1 78  ? 116.515 85.956  96.342  1.00 71.42  ? 77  ILE M CG2   1 
ATOM 6788  C CD1   . ILE G 1 78  ? 116.931 82.969  95.731  1.00 69.02  ? 77  ILE M CD1   1 
ATOM 6789  N N     . TYR G 1 79  ? 114.466 83.275  99.300  1.00 56.71  ? 78  TYR M N     1 
ATOM 6790  C CA    . TYR G 1 79  ? 114.258 82.000  99.983  1.00 55.32  ? 78  TYR M CA    1 
ATOM 6791  C C     . TYR G 1 79  ? 113.549 81.010  99.070  1.00 54.77  ? 78  TYR M C     1 
ATOM 6792  O O     . TYR G 1 79  ? 112.823 81.416  98.167  1.00 54.92  ? 78  TYR M O     1 
ATOM 6793  C CB    . TYR G 1 79  ? 113.462 82.188  101.278 1.00 55.26  ? 78  TYR M CB    1 
ATOM 6794  C CG    . TYR G 1 79  ? 111.997 82.476  101.071 1.00 55.29  ? 78  TYR M CG    1 
ATOM 6795  C CD1   . TYR G 1 79  ? 111.062 81.446  101.013 1.00 54.35  ? 78  TYR M CD1   1 
ATOM 6796  C CD2   . TYR G 1 79  ? 111.545 83.780  100.937 1.00 55.93  ? 78  TYR M CD2   1 
ATOM 6797  C CE1   . TYR G 1 79  ? 109.723 81.709  100.816 1.00 53.91  ? 78  TYR M CE1   1 
ATOM 6798  C CE2   . TYR G 1 79  ? 110.205 84.056  100.742 1.00 55.42  ? 78  TYR M CE2   1 
ATOM 6799  C CZ    . TYR G 1 79  ? 109.299 83.018  100.683 1.00 54.51  ? 78  TYR M CZ    1 
ATOM 6800  O OH    . TYR G 1 79  ? 107.969 83.302  100.485 1.00 55.59  ? 78  TYR M OH    1 
ATOM 6801  N N     . ARG G 1 80  ? 113.763 79.716  99.301  1.00 68.95  ? 79  ARG M N     1 
ATOM 6802  C CA    . ARG G 1 80  ? 113.106 78.673  98.518  1.00 68.42  ? 79  ARG M CA    1 
ATOM 6803  C C     . ARG G 1 80  ? 111.986 78.074  99.335  1.00 67.88  ? 79  ARG M C     1 
ATOM 6804  O O     . ARG G 1 80  ? 112.064 78.033  100.555 1.00 67.87  ? 79  ARG M O     1 
ATOM 6805  C CB    . ARG G 1 80  ? 114.093 77.567  98.158  1.00 67.19  ? 79  ARG M CB    1 
ATOM 6806  C CG    . ARG G 1 80  ? 115.227 78.028  97.283  1.00 67.70  ? 79  ARG M CG    1 
ATOM 6807  C CD    . ARG G 1 80  ? 116.465 77.180  97.482  1.00 64.35  ? 79  ARG M CD    1 
ATOM 6808  N NE    . ARG G 1 80  ? 117.534 77.593  96.579  1.00 64.49  ? 79  ARG M NE    1 
ATOM 6809  C CZ    . ARG G 1 80  ? 117.669 77.119  95.346  1.00 65.30  ? 79  ARG M CZ    1 
ATOM 6810  N NH1   . ARG G 1 80  ? 116.791 76.224  94.901  1.00 65.64  ? 79  ARG M NH1   1 
ATOM 6811  N NH2   . ARG G 1 80  ? 118.670 77.527  94.564  1.00 65.55  ? 79  ARG M NH2   1 
ATOM 6812  N N     . TYR G 1 81  ? 110.940 77.602  98.679  1.00 52.05  ? 80  TYR M N     1 
ATOM 6813  C CA    . TYR G 1 81  ? 109.916 76.881  99.402  1.00 51.69  ? 80  TYR M CA    1 
ATOM 6814  C C     . TYR G 1 81  ? 109.344 75.783  98.539  1.00 50.75  ? 80  TYR M C     1 
ATOM 6815  O O     . TYR G 1 81  ? 109.262 75.931  97.322  1.00 50.02  ? 80  TYR M O     1 
ATOM 6816  C CB    . TYR G 1 81  ? 108.821 77.821  99.899  1.00 51.71  ? 80  TYR M CB    1 
ATOM 6817  C CG    . TYR G 1 81  ? 107.949 78.424  98.822  1.00 50.82  ? 80  TYR M CG    1 
ATOM 6818  C CD1   . TYR G 1 81  ? 108.251 79.670  98.267  1.00 51.06  ? 80  TYR M CD1   1 
ATOM 6819  C CD2   . TYR G 1 81  ? 106.803 77.767  98.375  1.00 50.03  ? 80  TYR M CD2   1 
ATOM 6820  C CE1   . TYR G 1 81  ? 107.447 80.235  97.281  1.00 50.66  ? 80  TYR M CE1   1 
ATOM 6821  C CE2   . TYR G 1 81  ? 105.995 78.324  97.382  1.00 49.73  ? 80  TYR M CE2   1 
ATOM 6822  C CZ    . TYR G 1 81  ? 106.322 79.560  96.846  1.00 50.82  ? 80  TYR M CZ    1 
ATOM 6823  O OH    . TYR G 1 81  ? 105.525 80.110  95.868  1.00 52.36  ? 80  TYR M OH    1 
ATOM 6824  N N     . VAL G 1 82  ? 108.971 74.673  99.167  1.00 44.83  ? 81  VAL M N     1 
ATOM 6825  C CA    . VAL G 1 82  ? 108.327 73.583  98.454  1.00 44.23  ? 81  VAL M CA    1 
ATOM 6826  C C     . VAL G 1 82  ? 106.938 74.009  97.990  1.00 44.54  ? 81  VAL M C     1 
ATOM 6827  O O     . VAL G 1 82  ? 106.164 74.552  98.759  1.00 45.60  ? 81  VAL M O     1 
ATOM 6828  C CB    . VAL G 1 82  ? 108.204 72.337  99.335  1.00 44.63  ? 81  VAL M CB    1 
ATOM 6829  C CG1   . VAL G 1 82  ? 107.535 71.212  98.572  1.00 43.66  ? 81  VAL M CG1   1 
ATOM 6830  C CG2   . VAL G 1 82  ? 109.572 71.914  99.837  1.00 42.84  ? 81  VAL M CG2   1 
ATOM 6831  N N     . ASP G 1 83  ? 106.629 73.784  96.724  1.00 53.82  ? 82  ASP M N     1 
ATOM 6832  C CA    . ASP G 1 83  ? 105.294 74.052  96.213  1.00 53.60  ? 82  ASP M CA    1 
ATOM 6833  C C     . ASP G 1 83  ? 104.372 72.866  96.501  1.00 54.11  ? 82  ASP M C     1 
ATOM 6834  O O     . ASP G 1 83  ? 104.487 71.827  95.856  1.00 53.69  ? 82  ASP M O     1 
ATOM 6835  C CB    . ASP G 1 83  ? 105.370 74.304  94.706  1.00 52.76  ? 82  ASP M CB    1 
ATOM 6836  C CG    . ASP G 1 83  ? 104.031 74.702  94.106  1.00 53.45  ? 82  ASP M CG    1 
ATOM 6837  O OD1   . ASP G 1 83  ? 103.023 74.799  94.871  1.00 54.45  ? 82  ASP M OD1   1 
ATOM 6838  O OD2   . ASP G 1 83  ? 104.003 74.934  92.865  1.00 53.46  ? 82  ASP M OD2   1 
ATOM 6839  N N     . ALA G 1 84  ? 103.449 73.024  97.447  1.00 45.75  ? 83  ALA M N     1 
ATOM 6840  C CA    . ALA G 1 84  ? 102.536 71.932  97.815  1.00 46.47  ? 83  ALA M CA    1 
ATOM 6841  C C     . ALA G 1 84  ? 101.710 71.431  96.636  1.00 47.16  ? 83  ALA M C     1 
ATOM 6842  O O     . ALA G 1 84  ? 101.231 70.298  96.641  1.00 47.44  ? 83  ALA M O     1 
ATOM 6843  C CB    . ALA G 1 84  ? 101.627 72.338  98.966  1.00 48.17  ? 83  ALA M CB    1 
ATOM 6844  N N     . GLN G 1 85  ? 101.555 72.281  95.628  1.00 58.72  ? 84  GLN M N     1 
ATOM 6845  C CA    . GLN G 1 85  ? 100.899 71.894  94.392  1.00 59.22  ? 84  GLN M CA    1 
ATOM 6846  C C     . GLN G 1 85  ? 101.720 70.812  93.701  1.00 58.56  ? 84  GLN M C     1 
ATOM 6847  O O     . GLN G 1 85  ? 101.265 69.692  93.476  1.00 59.16  ? 84  GLN M O     1 
ATOM 6848  C CB    . GLN G 1 85  ? 100.793 73.106  93.470  1.00 58.63  ? 84  GLN M CB    1 
ATOM 6849  C CG    . GLN G 1 85  ? 99.489  73.193  92.732  1.00 60.50  ? 84  GLN M CG    1 
ATOM 6850  C CD    . GLN G 1 85  ? 98.308  73.195  93.681  1.00 61.83  ? 84  GLN M CD    1 
ATOM 6851  O OE1   . GLN G 1 85  ? 97.685  72.155  93.916  1.00 62.60  ? 84  GLN M OE1   1 
ATOM 6852  N NE2   . GLN G 1 85  ? 98.004  74.365  94.250  1.00 62.14  ? 84  GLN M NE2   1 
ATOM 6853  N N     . ASP G 1 86  ? 102.950 71.172  93.377  1.00 52.27  ? 85  ASP M N     1 
ATOM 6854  C CA    . ASP G 1 86  ? 103.859 70.297  92.673  1.00 51.06  ? 85  ASP M CA    1 
ATOM 6855  C C     . ASP G 1 86  ? 105.103 70.187  93.529  1.00 49.81  ? 85  ASP M C     1 
ATOM 6856  O O     . ASP G 1 86  ? 105.977 71.044  93.434  1.00 49.36  ? 85  ASP M O     1 
ATOM 6857  C CB    . ASP G 1 86  ? 104.225 70.941  91.335  1.00 50.78  ? 85  ASP M CB    1 
ATOM 6858  C CG    . ASP G 1 86  ? 104.805 69.952  90.354  1.00 49.95  ? 85  ASP M CG    1 
ATOM 6859  O OD1   . ASP G 1 86  ? 105.508 69.020  90.794  1.00 48.66  ? 85  ASP M OD1   1 
ATOM 6860  O OD2   . ASP G 1 86  ? 104.552 70.101  89.142  1.00 50.85  ? 85  ASP M OD2   1 
ATOM 6861  N N     . THR G 1 87  ? 105.194 69.159  94.372  1.00 49.00  ? 86  THR M N     1 
ATOM 6862  C CA    . THR G 1 87  ? 106.348 69.053  95.263  1.00 47.82  ? 86  THR M CA    1 
ATOM 6863  C C     . THR G 1 87  ? 107.644 68.734  94.542  1.00 45.77  ? 86  THR M C     1 
ATOM 6864  O O     . THR G 1 87  ? 108.702 68.696  95.173  1.00 44.28  ? 86  THR M O     1 
ATOM 6865  C CB    . THR G 1 87  ? 106.166 68.072  96.440  1.00 46.16  ? 86  THR M CB    1 
ATOM 6866  O OG1   . THR G 1 87  ? 105.589 66.849  95.984  1.00 43.86  ? 86  THR M OG1   1 
ATOM 6867  C CG2   . THR G 1 87  ? 105.283 68.676  97.490  1.00 49.23  ? 86  THR M CG2   1 
ATOM 6868  N N     . ARG G 1 88  ? 107.573 68.522  93.233  1.00 44.02  ? 87  ARG M N     1 
ATOM 6869  C CA    . ARG G 1 88  ? 108.787 68.397  92.450  1.00 43.64  ? 87  ARG M CA    1 
ATOM 6870  C C     . ARG G 1 88  ? 109.512 69.726  92.439  1.00 44.32  ? 87  ARG M C     1 
ATOM 6871  O O     . ARG G 1 88  ? 110.725 69.767  92.318  1.00 44.06  ? 87  ARG M O     1 
ATOM 6872  C CB    . ARG G 1 88  ? 108.474 67.967  91.023  1.00 44.73  ? 87  ARG M CB    1 
ATOM 6873  C CG    . ARG G 1 88  ? 107.757 66.644  90.929  1.00 44.15  ? 87  ARG M CG    1 
ATOM 6874  C CD    . ARG G 1 88  ? 107.411 66.321  89.495  1.00 45.70  ? 87  ARG M CD    1 
ATOM 6875  N NE    . ARG G 1 88  ? 106.595 67.373  88.918  1.00 47.68  ? 87  ARG M NE    1 
ATOM 6876  C CZ    . ARG G 1 88  ? 106.182 67.390  87.663  1.00 49.43  ? 87  ARG M CZ    1 
ATOM 6877  N NH1   . ARG G 1 88  ? 106.506 66.404  86.847  1.00 49.57  ? 87  ARG M NH1   1 
ATOM 6878  N NH2   . ARG G 1 88  ? 105.444 68.394  87.227  1.00 51.34  ? 87  ARG M NH2   1 
ATOM 6879  N N     . ARG G 1 89  ? 108.730 70.801  92.491  1.00 86.31  ? 88  ARG M N     1 
ATOM 6880  C CA    . ARG G 1 89  ? 109.210 72.182  92.413  1.00 86.92  ? 88  ARG M CA    1 
ATOM 6881  C C     . ARG G 1 89  ? 109.643 72.719  93.777  1.00 87.91  ? 88  ARG M C     1 
ATOM 6882  O O     . ARG G 1 89  ? 109.231 72.220  94.817  1.00 88.48  ? 88  ARG M O     1 
ATOM 6883  C CB    . ARG G 1 89  ? 108.117 73.082  91.840  1.00 86.94  ? 88  ARG M CB    1 
ATOM 6884  C CG    . ARG G 1 89  ? 108.078 73.122  90.324  1.00 86.46  ? 88  ARG M CG    1 
ATOM 6885  C CD    . ARG G 1 89  ? 106.653 73.099  89.805  1.00 86.51  ? 88  ARG M CD    1 
ATOM 6886  N NE    . ARG G 1 89  ? 105.856 74.187  90.358  1.00 87.28  ? 88  ARG M NE    1 
ATOM 6887  C CZ    . ARG G 1 89  ? 104.694 74.588  89.858  1.00 88.18  ? 88  ARG M CZ    1 
ATOM 6888  N NH1   . ARG G 1 89  ? 104.189 73.988  88.789  1.00 88.71  ? 88  ARG M NH1   1 
ATOM 6889  N NH2   . ARG G 1 89  ? 104.036 75.588  90.427  1.00 88.98  ? 88  ARG M NH2   1 
ATOM 6890  N N     . LYS G 1 90  ? 110.472 73.756  93.746  1.00 55.42  ? 89  LYS M N     1 
ATOM 6891  C CA    . LYS G 1 90  ? 110.869 74.509  94.927  1.00 56.77  ? 89  LYS M CA    1 
ATOM 6892  C C     . LYS G 1 90  ? 110.866 75.998  94.538  1.00 57.17  ? 89  LYS M C     1 
ATOM 6893  O O     . LYS G 1 90  ? 111.855 76.523  94.045  1.00 58.14  ? 89  LYS M O     1 
ATOM 6894  C CB    . LYS G 1 90  ? 112.255 74.088  95.402  1.00 56.90  ? 89  LYS M CB    1 
ATOM 6895  N N     . ASN G 1 91  ? 109.724 76.653  94.712  1.00 46.28  ? 90  ASN M N     1 
ATOM 6896  C CA    . ASN G 1 91  ? 109.521 78.013  94.206  1.00 46.80  ? 90  ASN M CA    1 
ATOM 6897  C C     . ASN G 1 91  ? 110.277 79.074  95.000  1.00 48.07  ? 90  ASN M C     1 
ATOM 6898  O O     . ASN G 1 91  ? 110.633 78.853  96.150  1.00 48.46  ? 90  ASN M O     1 
ATOM 6899  C CB    . ASN G 1 91  ? 108.021 78.289  94.241  1.00 47.49  ? 90  ASN M CB    1 
ATOM 6900  C CG    . ASN G 1 91  ? 107.236 77.319  93.390  1.00 47.42  ? 90  ASN M CG    1 
ATOM 6901  O OD1   . ASN G 1 91  ? 107.776 76.710  92.476  1.00 46.92  ? 90  ASN M OD1   1 
ATOM 6902  N ND2   . ASN G 1 91  ? 105.957 77.167  93.690  1.00 48.27  ? 90  ASN M ND2   1 
ATOM 6903  N N     . ILE G 1 92  ? 110.532 80.217  94.367  1.00 51.66  ? 91  ILE M N     1 
ATOM 6904  C CA    . ILE G 1 92  ? 111.369 81.265  94.950  1.00 53.44  ? 91  ILE M CA    1 
ATOM 6905  C C     . ILE G 1 92  ? 110.583 82.454  95.517  1.00 53.60  ? 91  ILE M C     1 
ATOM 6906  O O     . ILE G 1 92  ? 109.612 82.924  94.921  1.00 53.22  ? 91  ILE M O     1 
ATOM 6907  C CB    . ILE G 1 92  ? 112.418 81.778  93.933  1.00 54.79  ? 91  ILE M CB    1 
ATOM 6908  C CG1   . ILE G 1 92  ? 113.235 80.607  93.388  1.00 54.76  ? 91  ILE M CG1   1 
ATOM 6909  C CG2   . ILE G 1 92  ? 113.335 82.822  94.557  1.00 56.90  ? 91  ILE M CG2   1 
ATOM 6910  C CD1   . ILE G 1 92  ? 113.837 79.723  94.482  1.00 55.05  ? 91  ILE M CD1   1 
ATOM 6911  N N     . GLY G 1 93  ? 111.016 82.927  96.683  1.00 54.50  ? 92  GLY M N     1 
ATOM 6912  C CA    . GLY G 1 93  ? 110.495 84.142  97.274  1.00 54.76  ? 92  GLY M CA    1 
ATOM 6913  C C     . GLY G 1 93  ? 111.566 85.142  97.702  1.00 56.61  ? 92  GLY M C     1 
ATOM 6914  O O     . GLY G 1 93  ? 112.635 84.789  98.200  1.00 57.49  ? 92  GLY M O     1 
ATOM 6915  N N     . LEU G 1 94  ? 111.261 86.413  97.492  1.00 50.35  ? 93  LEU M N     1 
ATOM 6916  C CA    . LEU G 1 94  ? 112.038 87.509  98.029  1.00 51.64  ? 93  LEU M CA    1 
ATOM 6917  C C     . LEU G 1 94  ? 111.910 87.540  99.554  1.00 52.79  ? 93  LEU M C     1 
ATOM 6918  O O     . LEU G 1 94  ? 110.811 87.418  100.096 1.00 53.70  ? 93  LEU M O     1 
ATOM 6919  C CB    . LEU G 1 94  ? 111.483 88.803  97.466  1.00 53.40  ? 93  LEU M CB    1 
ATOM 6920  C CG    . LEU G 1 94  ? 112.517 89.811  97.017  1.00 54.05  ? 93  LEU M CG    1 
ATOM 6921  C CD1   . LEU G 1 94  ? 113.405 89.175  95.977  1.00 52.31  ? 93  LEU M CD1   1 
ATOM 6922  C CD2   . LEU G 1 94  ? 111.825 91.047  96.460  1.00 56.01  ? 93  LEU M CD2   1 
ATOM 6923  N N     . THR G 1 95  ? 113.036 87.699  100.244 1.00 54.69  ? 94  THR M N     1 
ATOM 6924  C CA    . THR G 1 95  ? 113.039 87.916  101.692 1.00 55.35  ? 94  THR M CA    1 
ATOM 6925  C C     . THR G 1 95  ? 112.764 89.396  101.999 1.00 57.98  ? 94  THR M C     1 
ATOM 6926  O O     . THR G 1 95  ? 112.783 90.235  101.096 1.00 58.29  ? 94  THR M O     1 
ATOM 6927  C CB    . THR G 1 95  ? 114.390 87.504  102.320 1.00 55.02  ? 94  THR M CB    1 
ATOM 6928  O OG1   . THR G 1 95  ? 115.452 88.258  101.727 1.00 55.19  ? 94  THR M OG1   1 
ATOM 6929  C CG2   . THR G 1 95  ? 114.657 86.047  102.096 1.00 52.79  ? 94  THR M CG2   1 
ATOM 6930  N N     . THR G 1 96  ? 112.506 89.726  103.258 1.00 59.57  ? 95  THR M N     1 
ATOM 6931  C CA    . THR G 1 96  ? 112.286 91.125  103.601 1.00 62.43  ? 95  THR M CA    1 
ATOM 6932  C C     . THR G 1 96  ? 113.521 91.937  103.222 1.00 62.70  ? 95  THR M C     1 
ATOM 6933  O O     . THR G 1 96  ? 113.415 92.996  102.598 1.00 63.78  ? 95  THR M O     1 
ATOM 6934  C CB    . THR G 1 96  ? 111.925 91.318  105.091 1.00 65.15  ? 95  THR M CB    1 
ATOM 6935  O OG1   . THR G 1 96  ? 110.508 91.184  105.257 1.00 66.11  ? 95  THR M OG1   1 
ATOM 6936  C CG2   . THR G 1 96  ? 112.341 92.695  105.574 1.00 68.16  ? 95  THR M CG2   1 
ATOM 6937  N N     . SER G 1 97  ? 114.692 91.408  103.566 1.00 69.48  ? 96  SER M N     1 
ATOM 6938  C CA    . SER G 1 97  ? 115.946 92.079  103.261 1.00 69.18  ? 96  SER M CA    1 
ATOM 6939  C C     . SER G 1 97  ? 116.092 92.249  101.757 1.00 70.25  ? 96  SER M C     1 
ATOM 6940  O O     . SER G 1 97  ? 116.625 93.261  101.284 1.00 71.01  ? 96  SER M O     1 
ATOM 6941  C CB    . SER G 1 97  ? 117.133 91.315  103.842 1.00 66.51  ? 96  SER M CB    1 
ATOM 6942  O OG    . SER G 1 97  ? 117.080 89.947  103.502 1.00 65.60  ? 96  SER M OG    1 
ATOM 6943  N N     . GLY G 1 98  ? 115.595 91.264  101.011 1.00 62.79  ? 97  GLY M N     1 
ATOM 6944  C CA    . GLY G 1 98  ? 115.527 91.364  99.562  1.00 63.80  ? 97  GLY M CA    1 
ATOM 6945  C C     . GLY G 1 98  ? 114.591 92.464  99.067  1.00 65.60  ? 97  GLY M C     1 
ATOM 6946  O O     . GLY G 1 98  ? 114.929 93.199  98.135  1.00 67.13  ? 97  GLY M O     1 
ATOM 6947  N N     . ILE G 1 99  ? 113.414 92.573  99.690  1.00 59.86  ? 98  ILE M N     1 
ATOM 6948  C CA    . ILE G 1 99  ? 112.436 93.595  99.322  1.00 61.80  ? 98  ILE M CA    1 
ATOM 6949  C C     . ILE G 1 99  ? 112.991 94.995  99.601  1.00 64.29  ? 98  ILE M C     1 
ATOM 6950  O O     . ILE G 1 99  ? 112.850 95.914  98.782  1.00 65.37  ? 98  ILE M O     1 
ATOM 6951  C CB    . ILE G 1 99  ? 111.093 93.386  100.049 1.00 62.95  ? 98  ILE M CB    1 
ATOM 6952  C CG1   . ILE G 1 99  ? 110.454 92.079  99.587  1.00 60.70  ? 98  ILE M CG1   1 
ATOM 6953  C CG2   . ILE G 1 99  ? 110.149 94.523  99.761  1.00 65.49  ? 98  ILE M CG2   1 
ATOM 6954  C CD1   . ILE G 1 99  ? 109.240 91.649  100.387 1.00 61.69  ? 98  ILE M CD1   1 
ATOM 6955  N N     . LYS G 1 100 ? 113.654 95.143  100.743 1.00 82.20  ? 99  LYS M N     1 
ATOM 6956  C CA    . LYS G 1 100 ? 114.249 96.417  101.114 1.00 83.02  ? 99  LYS M CA    1 
ATOM 6957  C C     . LYS G 1 100 ? 115.332 96.831  100.116 1.00 83.13  ? 99  LYS M C     1 
ATOM 6958  O O     . LYS G 1 100 ? 115.604 98.025  99.940  1.00 83.84  ? 99  LYS M O     1 
ATOM 6959  C CB    . LYS G 1 100 ? 114.821 96.345  102.534 1.00 81.39  ? 99  LYS M CB    1 
ATOM 6960  N N     . LEU G 1 101 ? 115.936 95.842  99.457  1.00 68.14  ? 100 LEU M N     1 
ATOM 6961  C CA    . LEU G 1 101 ? 117.044 96.092  98.537  1.00 67.28  ? 100 LEU M CA    1 
ATOM 6962  C C     . LEU G 1 101 ? 116.571 96.553  97.163  1.00 68.48  ? 100 LEU M C     1 
ATOM 6963  O O     . LEU G 1 101 ? 117.188 97.423  96.545  1.00 68.69  ? 100 LEU M O     1 
ATOM 6964  C CB    . LEU G 1 101 ? 117.917 94.846  98.394  1.00 64.71  ? 100 LEU M CB    1 
ATOM 6965  C CG    . LEU G 1 101 ? 119.192 95.002  97.559  1.00 63.61  ? 100 LEU M CG    1 
ATOM 6966  C CD1   . LEU G 1 101 ? 120.280 94.153  98.146  1.00 62.80  ? 100 LEU M CD1   1 
ATOM 6967  C CD2   . LEU G 1 101 ? 118.987 94.593  96.115  1.00 63.59  ? 100 LEU M CD2   1 
ATOM 6968  N N     . VAL G 1 102 ? 115.495 95.948  96.673  1.00 62.79  ? 101 VAL M N     1 
ATOM 6969  C CA    . VAL G 1 102 ? 114.927 96.348  95.395  1.00 63.05  ? 101 VAL M CA    1 
ATOM 6970  C C     . VAL G 1 102 ? 114.445 97.787  95.508  1.00 66.02  ? 101 VAL M C     1 
ATOM 6971  O O     . VAL G 1 102 ? 114.606 98.585  94.576  1.00 67.13  ? 101 VAL M O     1 
ATOM 6972  C CB    . VAL G 1 102 ? 113.762 95.434  94.990  1.00 61.71  ? 101 VAL M CB    1 
ATOM 6973  C CG1   . VAL G 1 102 ? 113.087 95.943  93.712  1.00 62.60  ? 101 VAL M CG1   1 
ATOM 6974  C CG2   . VAL G 1 102 ? 114.266 94.006  94.818  1.00 58.96  ? 101 VAL M CG2   1 
ATOM 6975  N N     . GLU G 1 103 ? 113.875 98.110  96.670  1.00 67.57  ? 102 GLU M N     1 
ATOM 6976  C CA    . GLU G 1 103 ? 113.371 99.445  96.944  1.00 70.77  ? 102 GLU M CA    1 
ATOM 6977  C C     . GLU G 1 103 ? 114.503 100.435 97.186  1.00 72.48  ? 102 GLU M C     1 
ATOM 6978  O O     . GLU G 1 103 ? 114.339 101.642 96.991  1.00 75.09  ? 102 GLU M O     1 
ATOM 6979  C CB    . GLU G 1 103 ? 112.409 99.401  98.122  1.00 72.18  ? 102 GLU M CB    1 
ATOM 6980  C CG    . GLU G 1 103 ? 111.205 98.539  97.840  1.00 70.99  ? 102 GLU M CG    1 
ATOM 6981  C CD    . GLU G 1 103 ? 110.282 98.416  99.025  1.00 72.51  ? 102 GLU M CD    1 
ATOM 6982  O OE1   . GLU G 1 103 ? 110.309 99.314  99.888  1.00 75.31  ? 102 GLU M OE1   1 
ATOM 6983  O OE2   . GLU G 1 103 ? 109.534 97.416  99.099  1.00 71.15  ? 102 GLU M OE2   1 
ATOM 6984  N N     . ALA G 1 104 ? 115.652 99.913  97.602  1.00 79.97  ? 103 ALA M N     1 
ATOM 6985  C CA    . ALA G 1 104 ? 116.867 100.712 97.683  1.00 78.58  ? 103 ALA M CA    1 
ATOM 6986  C C     . ALA G 1 104 ? 117.216 101.224 96.296  1.00 78.90  ? 103 ALA M C     1 
ATOM 6987  O O     . ALA G 1 104 ? 117.579 102.390 96.124  1.00 79.19  ? 103 ALA M O     1 
ATOM 6988  C CB    . ALA G 1 104 ? 118.010 99.894  98.235  1.00 75.69  ? 103 ALA M CB    1 
ATOM 6989  N N     . PHE G 1 105 ? 117.086 100.345 95.309  1.00 107.84 ? 104 PHE M N     1 
ATOM 6990  C CA    . PHE G 1 105 ? 117.344 100.697 93.916  1.00 108.20 ? 104 PHE M CA    1 
ATOM 6991  C C     . PHE G 1 105 ? 116.353 101.706 93.335  1.00 110.10 ? 104 PHE M C     1 
ATOM 6992  O O     . PHE G 1 105 ? 116.755 102.613 92.607  1.00 110.01 ? 104 PHE M O     1 
ATOM 6993  C CB    . PHE G 1 105 ? 117.395 99.441  93.048  1.00 108.20 ? 104 PHE M CB    1 
ATOM 6994  C CG    . PHE G 1 105 ? 118.774 98.893  92.879  1.00 105.67 ? 104 PHE M CG    1 
ATOM 6995  C CD1   . PHE G 1 105 ? 119.459 99.069  91.690  1.00 105.25 ? 104 PHE M CD1   1 
ATOM 6996  C CD2   . PHE G 1 105 ? 119.399 98.228  93.916  1.00 103.37 ? 104 PHE M CD2   1 
ATOM 6997  C CE1   . PHE G 1 105 ? 120.737 98.576  91.534  1.00 102.63 ? 104 PHE M CE1   1 
ATOM 6998  C CE2   . PHE G 1 105 ? 120.675 97.734  93.767  1.00 100.52 ? 104 PHE M CE2   1 
ATOM 6999  C CZ    . PHE G 1 105 ? 121.347 97.913  92.576  1.00 100.16 ? 104 PHE M CZ    1 
ATOM 7000  N N     . THR G 1 106 ? 115.069 101.539 93.644  1.00 88.54  ? 105 THR M N     1 
ATOM 7001  C CA    . THR G 1 106 ? 114.052 102.478 93.189  1.00 89.51  ? 105 THR M CA    1 
ATOM 7002  C C     . THR G 1 106 ? 114.366 103.844 93.766  1.00 90.08  ? 105 THR M C     1 
ATOM 7003  O O     . THR G 1 106 ? 114.488 104.829 93.032  1.00 90.63  ? 105 THR M O     1 
ATOM 7004  C CB    . THR G 1 106 ? 112.646 102.073 93.651  1.00 90.06  ? 105 THR M CB    1 
ATOM 7005  O OG1   . THR G 1 106 ? 112.366 100.738 93.223  1.00 88.88  ? 105 THR M OG1   1 
ATOM 7006  C CG2   . THR G 1 106 ? 111.598 103.019 93.070  1.00 91.64  ? 105 THR M CG2   1 
ATOM 7007  N N     . SER G 1 107 ? 114.520 103.889 95.087  1.00 96.36  ? 106 SER M N     1 
ATOM 7008  C CA    . SER G 1 107 ? 114.807 105.133 95.795  1.00 96.92  ? 106 SER M CA    1 
ATOM 7009  C C     . SER G 1 107 ? 116.161 105.713 95.397  1.00 95.56  ? 106 SER M C     1 
ATOM 7010  O O     . SER G 1 107 ? 116.414 106.888 95.614  1.00 96.84  ? 106 SER M O     1 
ATOM 7011  C CB    . SER G 1 107 ? 114.740 104.920 97.312  1.00 96.36  ? 106 SER M CB    1 
ATOM 7012  N N     . ILE G 1 108 ? 117.030 104.884 94.826  1.00 115.38 ? 107 ILE M N     1 
ATOM 7013  C CA    . ILE G 1 108 ? 118.288 105.369 94.271  1.00 114.29 ? 107 ILE M CA    1 
ATOM 7014  C C     . ILE G 1 108 ? 118.055 105.938 92.874  1.00 115.19 ? 107 ILE M C     1 
ATOM 7015  O O     . ILE G 1 108 ? 118.599 106.986 92.530  1.00 116.55 ? 107 ILE M O     1 
ATOM 7016  C CB    . ILE G 1 108 ? 119.359 104.264 94.200  1.00 111.34 ? 107 ILE M CB    1 
ATOM 7017  N N     . PHE G 1 109 ? 117.244 105.248 92.073  1.00 120.30 ? 108 PHE M N     1 
ATOM 7018  C CA    . PHE G 1 109 ? 116.904 105.731 90.735  1.00 121.07 ? 108 PHE M CA    1 
ATOM 7019  C C     . PHE G 1 109 ? 116.081 107.010 90.810  1.00 123.03 ? 108 PHE M C     1 
ATOM 7020  O O     . PHE G 1 109 ? 116.267 107.928 90.011  1.00 124.40 ? 108 PHE M O     1 
ATOM 7021  C CB    . PHE G 1 109 ? 116.131 104.675 89.940  1.00 121.13 ? 108 PHE M CB    1 
ATOM 7022  C CG    . PHE G 1 109 ? 117.003 103.615 89.319  1.00 119.78 ? 108 PHE M CG    1 
ATOM 7023  C CD1   . PHE G 1 109 ? 116.445 102.454 88.805  1.00 120.02 ? 108 PHE M CD1   1 
ATOM 7024  C CD2   . PHE G 1 109 ? 118.380 103.776 89.251  1.00 118.21 ? 108 PHE M CD2   1 
ATOM 7025  C CE1   . PHE G 1 109 ? 117.241 101.479 88.240  1.00 119.10 ? 108 PHE M CE1   1 
ATOM 7026  C CE2   . PHE G 1 109 ? 119.182 102.798 88.688  1.00 117.03 ? 108 PHE M CE2   1 
ATOM 7027  C CZ    . PHE G 1 109 ? 118.613 101.652 88.182  1.00 117.65 ? 108 PHE M CZ    1 
ATOM 7028  N N     . ASP G 1 110 ? 115.169 107.061 91.775  1.00 101.08 ? 109 ASP M N     1 
ATOM 7029  C CA    . ASP G 1 110 ? 114.293 108.214 91.941  1.00 103.12 ? 109 ASP M CA    1 
ATOM 7030  C C     . ASP G 1 110 ? 115.008 109.419 92.540  1.00 104.89 ? 109 ASP M C     1 
ATOM 7031  O O     . ASP G 1 110 ? 114.641 110.558 92.262  1.00 107.50 ? 109 ASP M O     1 
ATOM 7032  C CB    . ASP G 1 110 ? 113.083 107.847 92.795  1.00 104.12 ? 109 ASP M CB    1 
ATOM 7033  C CG    . ASP G 1 110 ? 112.137 106.912 92.082  1.00 104.58 ? 109 ASP M CG    1 
ATOM 7034  O OD1   . ASP G 1 110 ? 112.568 106.245 91.112  1.00 103.66 ? 109 ASP M OD1   1 
ATOM 7035  O OD2   . ASP G 1 110 ? 110.961 106.842 92.493  1.00 105.85 ? 109 ASP M OD2   1 
ATOM 7036  N N     . GLU G 1 111 ? 116.020 109.167 93.367  1.00 104.68 ? 110 GLU M N     1 
ATOM 7037  C CA    . GLU G 1 111 ? 116.822 110.246 93.934  1.00 107.13 ? 110 GLU M CA    1 
ATOM 7038  C C     . GLU G 1 111 ? 117.703 110.844 92.852  1.00 107.80 ? 110 GLU M C     1 
ATOM 7039  O O     . GLU G 1 111 ? 118.115 111.993 92.948  1.00 110.73 ? 110 GLU M O     1 
ATOM 7040  C CB    . GLU G 1 111 ? 117.679 109.762 95.104  1.00 106.10 ? 110 GLU M CB    1 
ATOM 7041  N N     . MET G 1 112 ? 118.000 110.062 91.821  1.00 135.36 ? 111 MET M N     1 
ATOM 7042  C CA    . MET G 1 112 ? 118.629 110.619 90.633  1.00 136.36 ? 111 MET M CA    1 
ATOM 7043  C C     . MET G 1 112 ? 117.571 111.341 89.807  1.00 138.31 ? 111 MET M C     1 
ATOM 7044  O O     . MET G 1 112 ? 117.758 112.493 89.418  1.00 141.43 ? 111 MET M O     1 
ATOM 7045  C CB    . MET G 1 112 ? 119.302 109.529 89.795  1.00 132.12 ? 111 MET M CB    1 
ATOM 7046  C CG    . MET G 1 112 ? 120.777 109.327 90.099  1.00 131.41 ? 111 MET M CG    1 
ATOM 7047  S SD    . MET G 1 112 ? 121.612 108.232 88.922  1.00 129.10 ? 111 MET M SD    1 
ATOM 7048  C CE    . MET G 1 112 ? 120.712 106.698 89.174  1.00 126.26 ? 111 MET M CE    1 
ATOM 7049  N N     . GLU G 1 113 ? 116.454 110.656 89.565  1.00 116.17 ? 112 GLU M N     1 
ATOM 7050  C CA    . GLU G 1 113 ? 115.382 111.162 88.710  1.00 118.69 ? 112 GLU M CA    1 
ATOM 7051  C C     . GLU G 1 113 ? 114.865 112.496 89.212  1.00 122.57 ? 112 GLU M C     1 
ATOM 7052  O O     . GLU G 1 113 ? 114.626 113.417 88.430  1.00 125.17 ? 112 GLU M O     1 
ATOM 7053  C CB    . GLU G 1 113 ? 114.233 110.154 88.640  1.00 117.35 ? 112 GLU M CB    1 
ATOM 7054  N N     . GLN G 1 114 ? 114.698 112.593 90.527  1.00 117.39 ? 113 GLN M N     1 
ATOM 7055  C CA    . GLN G 1 114 ? 114.243 113.830 91.143  1.00 122.07 ? 113 GLN M CA    1 
ATOM 7056  C C     . GLN G 1 114 ? 115.339 114.892 91.133  1.00 124.84 ? 113 GLN M C     1 
ATOM 7057  O O     . GLN G 1 114 ? 115.127 115.991 90.624  1.00 128.11 ? 113 GLN M O     1 
ATOM 7058  C CB    . GLN G 1 114 ? 113.755 113.581 92.571  1.00 119.10 ? 113 GLN M CB    1 
ATOM 7059  N N     . THR G 1 115 ? 116.510 114.558 91.677  1.00 119.02 ? 114 THR M N     1 
ATOM 7060  C CA    . THR G 1 115 ? 117.594 115.532 91.843  1.00 119.89 ? 114 THR M CA    1 
ATOM 7061  C C     . THR G 1 115 ? 118.031 116.213 90.543  1.00 120.69 ? 114 THR M C     1 
ATOM 7062  O O     . THR G 1 115 ? 118.547 117.333 90.569  1.00 122.37 ? 114 THR M O     1 
ATOM 7063  C CB    . THR G 1 115 ? 118.831 114.919 92.534  1.00 117.86 ? 114 THR M CB    1 
ATOM 7064  N N     . GLU G 1 126 ? 112.086 121.855 81.757  1.00 171.87 ? 125 GLU M N     1 
ATOM 7065  C CA    . GLU G 1 126 ? 111.221 121.633 80.602  1.00 172.75 ? 125 GLU M CA    1 
ATOM 7066  C C     . GLU G 1 126 ? 111.854 122.136 79.304  1.00 172.62 ? 125 GLU M C     1 
ATOM 7067  O O     . GLU G 1 126 ? 111.408 121.780 78.214  1.00 172.72 ? 125 GLU M O     1 
ATOM 7068  C CB    . GLU G 1 126 ? 109.857 122.294 80.815  1.00 175.82 ? 125 GLU M CB    1 
ATOM 7069  N N     . GLN G 1 127 ? 112.888 122.966 79.427  1.00 202.05 ? 126 GLN M N     1 
ATOM 7070  C CA    . GLN G 1 127 ? 113.641 123.444 78.266  1.00 203.18 ? 126 GLN M CA    1 
ATOM 7071  C C     . GLN G 1 127 ? 114.705 122.429 77.853  1.00 201.02 ? 126 GLN M C     1 
ATOM 7072  O O     . GLN G 1 127 ? 114.979 122.245 76.664  1.00 200.14 ? 126 GLN M O     1 
ATOM 7073  C CB    . GLN G 1 127 ? 114.288 124.800 78.557  1.00 205.07 ? 126 GLN M CB    1 
ATOM 7074  N N     . MET G 1 128 ? 115.303 121.780 78.847  0.89 179.91 ? 127 MET M N     1 
ATOM 7075  C CA    . MET G 1 128 ? 116.200 120.654 78.615  1.00 177.23 ? 127 MET M CA    1 
ATOM 7076  C C     . MET G 1 128 ? 115.403 119.439 78.150  1.00 175.98 ? 127 MET M C     1 
ATOM 7077  O O     . MET G 1 128 ? 115.808 118.740 77.223  1.00 174.76 ? 127 MET M O     1 
ATOM 7078  C CB    . MET G 1 128 ? 116.959 120.308 79.895  1.00 176.63 ? 127 MET M CB    1 
ATOM 7079  C CG    . MET G 1 128 ? 117.928 121.382 80.358  1.00 177.68 ? 127 MET M CG    1 
ATOM 7080  S SD    . MET G 1 128 ? 119.181 121.698 79.095  1.00 177.56 ? 127 MET M SD    1 
ATOM 7081  C CE    . MET G 1 128 ? 120.068 120.129 79.122  1.00 174.34 ? 127 MET M CE    1 
ATOM 7082  N N     . LYS G 1 129 ? 114.278 119.195 78.822  1.00 129.32 ? 128 LYS M N     1 
ATOM 7083  C CA    . LYS G 1 129 ? 113.294 118.190 78.419  1.00 128.71 ? 128 LYS M CA    1 
ATOM 7084  C C     . LYS G 1 129 ? 112.985 118.347 76.935  1.00 129.64 ? 128 LYS M C     1 
ATOM 7085  O O     . LYS G 1 129 ? 113.032 117.381 76.170  1.00 128.35 ? 128 LYS M O     1 
ATOM 7086  C CB    . LYS G 1 129 ? 111.995 118.355 79.227  1.00 130.07 ? 128 LYS M CB    1 
ATOM 7087  C CG    . LYS G 1 129 ? 110.802 117.543 78.719  1.00 130.15 ? 128 LYS M CG    1 
ATOM 7088  C CD    . LYS G 1 129 ? 109.476 118.255 78.994  1.00 132.69 ? 128 LYS M CD    1 
ATOM 7089  C CE    . LYS G 1 129 ? 109.277 119.427 78.044  1.00 134.98 ? 128 LYS M CE    1 
ATOM 7090  N NZ    . LYS G 1 129 ? 107.923 120.042 78.157  1.00 137.56 ? 128 LYS M NZ    1 
ATOM 7091  N N     . ALA G 1 130 ? 112.662 119.580 76.552  1.00 137.56 ? 129 ALA M N     1 
ATOM 7092  C CA    . ALA G 1 130 ? 112.369 119.933 75.170  1.00 138.79 ? 129 ALA M CA    1 
ATOM 7093  C C     . ALA G 1 130 ? 113.576 119.715 74.254  1.00 137.60 ? 129 ALA M C     1 
ATOM 7094  O O     . ALA G 1 130 ? 113.435 119.220 73.130  1.00 137.39 ? 129 ALA M O     1 
ATOM 7095  C CB    . ALA G 1 130 ? 111.896 121.378 75.094  1.00 141.55 ? 129 ALA M CB    1 
ATOM 7096  N N     . ASN G 1 131 ? 114.756 120.094 74.735  1.00 164.53 ? 130 ASN M N     1 
ATOM 7097  C CA    . ASN G 1 131 ? 115.988 119.884 73.985  1.00 162.73 ? 130 ASN M CA    1 
ATOM 7098  C C     . ASN G 1 131 ? 116.295 118.401 73.828  1.00 160.11 ? 130 ASN M C     1 
ATOM 7099  O O     . ASN G 1 131 ? 116.541 117.925 72.721  1.00 159.98 ? 130 ASN M O     1 
ATOM 7100  C CB    . ASN G 1 131 ? 117.162 120.593 74.662  1.00 162.75 ? 130 ASN M CB    1 
ATOM 7101  N N     . LEU G 1 132 ? 116.252 117.676 74.943  1.00 142.91 ? 131 LEU M N     1 
ATOM 7102  C CA    . LEU G 1 132 ? 116.637 116.264 74.985  1.00 140.03 ? 131 LEU M CA    1 
ATOM 7103  C C     . LEU G 1 132 ? 115.789 115.321 74.125  1.00 140.53 ? 131 LEU M C     1 
ATOM 7104  O O     . LEU G 1 132 ? 116.301 114.332 73.593  1.00 139.35 ? 131 LEU M O     1 
ATOM 7105  C CB    . LEU G 1 132 ? 116.662 115.762 76.432  1.00 138.36 ? 131 LEU M CB    1 
ATOM 7106  N N     . THR G 1 133 ? 114.499 115.610 73.996  1.00 151.31 ? 132 THR M N     1 
ATOM 7107  C CA    . THR G 1 133 ? 113.623 114.751 73.208  1.00 151.30 ? 132 THR M CA    1 
ATOM 7108  C C     . THR G 1 133 ? 113.856 114.980 71.718  1.00 152.38 ? 132 THR M C     1 
ATOM 7109  O O     . THR G 1 133 ? 113.627 114.088 70.898  1.00 152.28 ? 132 THR M O     1 
ATOM 7110  C CB    . THR G 1 133 ? 112.141 114.982 73.542  1.00 152.38 ? 132 THR M CB    1 
ATOM 7111  O OG1   . THR G 1 133 ? 111.808 116.352 73.294  1.00 154.50 ? 132 THR M OG1   1 
ATOM 7112  C CG2   . THR G 1 133 ? 111.879 114.665 75.006  1.00 151.42 ? 132 THR M CG2   1 
ATOM 7113  N N     . LYS G 1 134 ? 114.329 116.176 71.382  1.00 147.77 ? 133 LYS M N     1 
ATOM 7114  C CA    . LYS G 1 134 ? 114.667 116.518 70.005  1.00 148.55 ? 133 LYS M CA    1 
ATOM 7115  C C     . LYS G 1 134 ? 115.930 115.783 69.556  1.00 147.11 ? 133 LYS M C     1 
ATOM 7116  O O     . LYS G 1 134 ? 115.987 115.241 68.450  1.00 147.42 ? 133 LYS M O     1 
ATOM 7117  C CB    . LYS G 1 134 ? 114.863 118.026 69.852  1.00 149.64 ? 133 LYS M CB    1 
ATOM 7118  N N     . MET G 1 135 ? 116.941 115.774 70.420  1.00 141.62 ? 134 MET M N     1 
ATOM 7119  C CA    . MET G 1 135 ? 118.196 115.085 70.137  0.77 139.37 ? 134 MET M CA    1 
ATOM 7120  C C     . MET G 1 135 ? 117.959 113.590 69.948  1.00 137.42 ? 134 MET M C     1 
ATOM 7121  O O     . MET G 1 135 ? 118.396 113.003 68.960  0.32 136.73 ? 134 MET M O     1 
ATOM 7122  C CB    . MET G 1 135 ? 119.198 115.287 71.278  1.00 136.69 ? 134 MET M CB    1 
ATOM 7123  C CG    . MET G 1 135 ? 119.279 116.705 71.849  1.00 138.30 ? 134 MET M CG    1 
ATOM 7124  S SD    . MET G 1 135 ? 120.321 117.853 70.926  1.00 139.79 ? 134 MET M SD    1 
ATOM 7125  C CE    . MET G 1 135 ? 121.056 118.795 72.264  1.00 140.10 ? 134 MET M CE    1 
ATOM 7126  N N     . LEU G 1 136 ? 117.272 112.981 70.911  1.00 157.94 ? 135 LEU M N     1 
ATOM 7127  C CA    . LEU G 1 136 ? 117.007 111.545 70.884  1.00 156.05 ? 135 LEU M CA    1 
ATOM 7128  C C     . LEU G 1 136 ? 116.228 111.149 69.632  1.00 158.65 ? 135 LEU M C     1 
ATOM 7129  O O     . LEU G 1 136 ? 116.516 110.127 69.005  1.00 158.20 ? 135 LEU M O     1 
ATOM 7130  C CB    . LEU G 1 136 ? 116.248 111.114 72.143  1.00 154.80 ? 135 LEU M CB    1 
ATOM 7131  N N     . SER G 1 137 ? 115.243 111.968 69.277  1.00 155.26 ? 136 SER M N     1 
ATOM 7132  C CA    . SER G 1 137 ? 114.481 111.754 68.059  1.00 156.56 ? 136 SER M CA    1 
ATOM 7133  C C     . SER G 1 137 ? 115.414 111.844 66.862  1.00 156.81 ? 136 SER M C     1 
ATOM 7134  O O     . SER G 1 137 ? 115.327 111.036 65.936  1.00 157.16 ? 136 SER M O     1 
ATOM 7135  C CB    . SER G 1 137 ? 113.363 112.789 67.933  1.00 158.15 ? 136 SER M CB    1 
ATOM 7136  N N     . SER G 1 138 ? 116.316 112.824 66.900  1.00 144.74 ? 137 SER M N     1 
ATOM 7137  C CA    . SER G 1 138 ? 117.270 113.042 65.818  1.00 145.45 ? 137 SER M CA    1 
ATOM 7138  C C     . SER G 1 138 ? 118.112 111.794 65.560  1.00 143.72 ? 137 SER M C     1 
ATOM 7139  O O     . SER G 1 138 ? 118.402 111.457 64.413  1.00 144.37 ? 137 SER M O     1 
ATOM 7140  C CB    . SER G 1 138 ? 118.172 114.245 66.117  1.00 145.64 ? 137 SER M CB    1 
ATOM 7141  N N     . LEU G 1 139 ? 118.488 111.101 66.628  1.00 153.25 ? 138 LEU M N     1 
ATOM 7142  C CA    . LEU G 1 139 ? 119.284 109.887 66.497  1.00 151.09 ? 138 LEU M CA    1 
ATOM 7143  C C     . LEU G 1 139 ? 118.445 108.728 65.970  1.00 150.83 ? 138 LEU M C     1 
ATOM 7144  O O     . LEU G 1 139 ? 118.874 108.008 65.068  1.00 149.95 ? 138 LEU M O     1 
ATOM 7145  C CB    . LEU G 1 139 ? 119.913 109.513 67.836  1.00 148.98 ? 138 LEU M CB    1 
ATOM 7146  N N     . GLN G 1 140 ? 117.260 108.553 66.553  1.00 143.13 ? 139 GLN M N     1 
ATOM 7147  C CA    . GLN G 1 140 ? 116.282 107.550 66.117  1.00 143.18 ? 139 GLN M CA    1 
ATOM 7148  C C     . GLN G 1 140 ? 116.845 106.139 65.917  1.00 141.37 ? 139 GLN M C     1 
ATOM 7149  O O     . GLN G 1 140 ? 117.905 105.793 66.440  1.00 139.72 ? 139 GLN M O     1 
ATOM 7150  C CB    . GLN G 1 140 ? 115.571 108.021 64.844  1.00 145.04 ? 139 GLN M CB    1 
ATOM 7151  N N     . TYR H 1 6   ? 113.769 111.714 85.447  1.00 84.18  ? 5   TYR O N     1 
ATOM 7152  C CA    . TYR H 1 6   ? 113.760 112.025 84.017  1.00 84.30  ? 5   TYR O CA    1 
ATOM 7153  C C     . TYR H 1 6   ? 115.133 111.766 83.406  1.00 84.37  ? 5   TYR O C     1 
ATOM 7154  O O     . TYR H 1 6   ? 115.553 112.452 82.469  1.00 85.64  ? 5   TYR O O     1 
ATOM 7155  C CB    . TYR H 1 6   ? 113.337 113.476 83.771  1.00 85.35  ? 5   TYR O CB    1 
ATOM 7156  N N     . SER H 1 7   ? 115.819 110.767 83.958  1.00 139.93 ? 6   SER O N     1 
ATOM 7157  C CA    . SER H 1 7   ? 117.161 110.384 83.528  1.00 140.18 ? 6   SER O CA    1 
ATOM 7158  C C     . SER H 1 7   ? 117.112 109.378 82.393  1.00 143.28 ? 6   SER O C     1 
ATOM 7159  O O     . SER H 1 7   ? 118.133 109.077 81.777  1.00 143.37 ? 6   SER O O     1 
ATOM 7160  C CB    . SER H 1 7   ? 117.949 109.784 84.694  1.00 136.88 ? 6   SER O CB    1 
ATOM 7161  O OG    . SER H 1 7   ? 119.104 109.101 84.231  1.00 136.45 ? 6   SER O OG    1 
ATOM 7162  N N     . TYR H 1 8   ? 115.920 108.851 82.133  1.00 132.79 ? 7   TYR O N     1 
ATOM 7163  C CA    . TYR H 1 8   ? 115.698 107.956 81.006  1.00 135.33 ? 7   TYR O CA    1 
ATOM 7164  C C     . TYR H 1 8   ? 116.177 108.611 79.718  1.00 138.78 ? 7   TYR O C     1 
ATOM 7165  O O     . TYR H 1 8   ? 116.586 107.931 78.780  1.00 141.16 ? 7   TYR O O     1 
ATOM 7166  C CB    . TYR H 1 8   ? 114.208 107.604 80.897  1.00 133.79 ? 7   TYR O CB    1 
ATOM 7167  C CG    . TYR H 1 8   ? 113.802 106.988 79.571  1.00 136.33 ? 7   TYR O CG    1 
ATOM 7168  C CD1   . TYR H 1 8   ? 113.433 107.788 78.489  1.00 140.03 ? 7   TYR O CD1   1 
ATOM 7169  C CD2   . TYR H 1 8   ? 113.776 105.609 79.403  1.00 134.55 ? 7   TYR O CD2   1 
ATOM 7170  C CE1   . TYR H 1 8   ? 113.066 107.234 77.279  1.00 142.51 ? 7   TYR O CE1   1 
ATOM 7171  C CE2   . TYR H 1 8   ? 113.404 105.045 78.194  1.00 136.50 ? 7   TYR O CE2   1 
ATOM 7172  C CZ    . TYR H 1 8   ? 113.049 105.863 77.135  1.00 140.74 ? 7   TYR O CZ    1 
ATOM 7173  O OH    . TYR H 1 8   ? 112.679 105.306 75.929  1.00 142.83 ? 7   TYR O OH    1 
ATOM 7174  N N     . LEU H 1 9   ? 116.114 109.939 79.690  1.00 147.92 ? 8   LEU O N     1 
ATOM 7175  C CA    . LEU H 1 9   ? 116.464 110.719 78.511  1.00 149.40 ? 8   LEU O CA    1 
ATOM 7176  C C     . LEU H 1 9   ? 117.838 110.382 77.936  1.00 148.40 ? 8   LEU O C     1 
ATOM 7177  O O     . LEU H 1 9   ? 117.940 109.927 76.799  1.00 150.79 ? 8   LEU O O     1 
ATOM 7178  C CB    . LEU H 1 9   ? 116.385 112.216 78.823  1.00 146.12 ? 8   LEU O CB    1 
ATOM 7179  N N     . PHE H 1 10  ? 118.889 110.584 78.723  1.00 127.87 ? 9   PHE O N     1 
ATOM 7180  C CA    . PHE H 1 10  ? 120.249 110.556 78.181  1.00 125.86 ? 9   PHE O CA    1 
ATOM 7181  C C     . PHE H 1 10  ? 121.057 109.283 78.437  1.00 124.46 ? 9   PHE O C     1 
ATOM 7182  O O     . PHE H 1 10  ? 122.256 109.243 78.175  1.00 122.15 ? 9   PHE O O     1 
ATOM 7183  C CB    . PHE H 1 10  ? 121.039 111.805 78.598  1.00 122.41 ? 9   PHE O CB    1 
ATOM 7184  C CG    . PHE H 1 10  ? 120.783 112.243 80.005  1.00 120.37 ? 9   PHE O CG    1 
ATOM 7185  C CD1   . PHE H 1 10  ? 121.696 111.966 81.001  1.00 117.21 ? 9   PHE O CD1   1 
ATOM 7186  C CD2   . PHE H 1 10  ? 119.628 112.942 80.332  1.00 121.58 ? 9   PHE O CD2   1 
ATOM 7187  C CE1   . PHE H 1 10  ? 121.459 112.367 82.301  1.00 115.41 ? 9   PHE O CE1   1 
ATOM 7188  C CE2   . PHE H 1 10  ? 119.381 113.340 81.629  1.00 119.56 ? 9   PHE O CE2   1 
ATOM 7189  C CZ    . PHE H 1 10  ? 120.297 113.056 82.615  1.00 116.55 ? 9   PHE O CZ    1 
ATOM 7190  N N     . ARG H 1 11  ? 120.409 108.247 78.952  1.00 130.49 ? 10  ARG O N     1 
ATOM 7191  C CA    . ARG H 1 11  ? 120.993 106.920 78.868  1.00 129.72 ? 10  ARG O CA    1 
ATOM 7192  C C     . ARG H 1 11  ? 120.637 106.445 77.473  1.00 133.11 ? 10  ARG O C     1 
ATOM 7193  O O     . ARG H 1 11  ? 121.440 105.814 76.791  1.00 132.22 ? 10  ARG O O     1 
ATOM 7194  C CB    . ARG H 1 11  ? 120.424 105.981 79.934  1.00 128.96 ? 10  ARG O CB    1 
ATOM 7195  C CG    . ARG H 1 11  ? 120.802 106.361 81.360  1.00 125.59 ? 10  ARG O CG    1 
ATOM 7196  C CD    . ARG H 1 11  ? 120.352 105.313 82.375  1.00 123.96 ? 10  ARG O CD    1 
ATOM 7197  N NE    . ARG H 1 11  ? 121.284 104.190 82.479  1.00 121.39 ? 10  ARG O NE    1 
ATOM 7198  C CZ    . ARG H 1 11  ? 122.179 104.043 83.454  1.00 118.37 ? 10  ARG O CZ    1 
ATOM 7199  N NH1   . ARG H 1 11  ? 122.268 104.948 84.419  1.00 117.28 ? 10  ARG O NH1   1 
ATOM 7200  N NH2   . ARG H 1 11  ? 122.986 102.988 83.468  1.00 115.82 ? 10  ARG O NH2   1 
ATOM 7201  N N     . MET H 1 12  ? 119.423 106.792 77.052  1.00 123.84 ? 11  MET O N     1 
ATOM 7202  C CA    . MET H 1 12  ? 118.938 106.500 75.710  1.00 127.73 ? 11  MET O CA    1 
ATOM 7203  C C     . MET H 1 12  ? 119.657 107.337 74.663  1.00 127.42 ? 11  MET O C     1 
ATOM 7204  O O     . MET H 1 12  ? 119.719 106.967 73.490  1.00 129.53 ? 11  MET O O     1 
ATOM 7205  C CB    . MET H 1 12  ? 117.436 106.757 75.622  1.00 130.92 ? 11  MET O CB    1 
ATOM 7206  C CG    . MET H 1 12  ? 116.588 105.547 75.948  1.00 129.97 ? 11  MET O CG    1 
ATOM 7207  S SD    . MET H 1 12  ? 116.849 104.189 74.787  1.00 129.67 ? 11  MET O SD    1 
ATOM 7208  C CE    . MET H 1 12  ? 116.489 105.000 73.229  1.00 135.99 ? 11  MET O CE    1 
ATOM 7209  N N     . ILE H 1 13  ? 120.195 108.474 75.086  1.00 110.76 ? 12  ILE O N     1 
ATOM 7210  C CA    . ILE H 1 13  ? 120.934 109.333 74.174  1.00 109.77 ? 12  ILE O CA    1 
ATOM 7211  C C     . ILE H 1 13  ? 122.444 109.114 74.321  1.00 105.85 ? 12  ILE O C     1 
ATOM 7212  O O     . ILE H 1 13  ? 123.234 109.650 73.543  1.00 104.81 ? 12  ILE O O     1 
ATOM 7213  C CB    . ILE H 1 13  ? 120.570 110.814 74.369  1.00 108.98 ? 12  ILE O CB    1 
ATOM 7214  N N     . SER H 1 14  ? 122.836 108.325 75.320  1.00 115.52 ? 13  SER O N     1 
ATOM 7215  C CA    . SER H 1 14  ? 124.218 107.863 75.440  1.00 112.21 ? 13  SER O CA    1 
ATOM 7216  C C     . SER H 1 14  ? 124.349 106.532 74.712  1.00 113.39 ? 13  SER O C     1 
ATOM 7217  O O     . SER H 1 14  ? 125.440 106.128 74.305  1.00 111.56 ? 13  SER O O     1 
ATOM 7218  C CB    . SER H 1 14  ? 124.615 107.696 76.907  1.00 107.95 ? 13  SER O CB    1 
ATOM 7219  N N     . HIS H 1 15  ? 123.216 105.857 74.554  1.00 106.13 ? 14  HIS O N     1 
ATOM 7220  C CA    . HIS H 1 15  ? 123.166 104.599 73.834  1.00 107.24 ? 14  HIS O CA    1 
ATOM 7221  C C     . HIS H 1 15  ? 123.486 104.813 72.363  1.00 109.01 ? 14  HIS O C     1 
ATOM 7222  O O     . HIS H 1 15  ? 124.326 104.120 71.793  1.00 107.77 ? 14  HIS O O     1 
ATOM 7223  C CB    . HIS H 1 15  ? 121.785 103.961 73.958  1.00 109.89 ? 14  HIS O CB    1 
ATOM 7224  C CG    . HIS H 1 15  ? 121.707 102.590 73.368  1.00 109.62 ? 14  HIS O CG    1 
ATOM 7225  N ND1   . HIS H 1 15  ? 122.108 101.463 74.053  1.00 105.64 ? 14  HIS O ND1   1 
ATOM 7226  C CD2   . HIS H 1 15  ? 121.299 102.164 72.148  1.00 112.33 ? 14  HIS O CD2   1 
ATOM 7227  C CE1   . HIS H 1 15  ? 121.939 100.400 73.286  1.00 105.48 ? 14  HIS O CE1   1 
ATOM 7228  N NE2   . HIS H 1 15  ? 121.449 100.799 72.125  1.00 109.56 ? 14  HIS O NE2   1 
ATOM 7229  N N     . GLU H 1 16  ? 122.806 105.778 71.756  1.00 107.52 ? 15  GLU O N     1 
ATOM 7230  C CA    . GLU H 1 16  ? 122.948 106.033 70.331  1.00 109.52 ? 15  GLU O CA    1 
ATOM 7231  C C     . GLU H 1 16  ? 124.388 106.367 69.970  1.00 106.25 ? 15  GLU O C     1 
ATOM 7232  O O     . GLU H 1 16  ? 124.927 105.835 69.004  1.00 106.59 ? 15  GLU O O     1 
ATOM 7233  C CB    . GLU H 1 16  ? 122.009 107.158 69.890  1.00 112.75 ? 15  GLU O CB    1 
ATOM 7234  C CG    . GLU H 1 16  ? 120.528 106.836 70.070  1.00 116.92 ? 15  GLU O CG    1 
ATOM 7235  C CD    . GLU H 1 16  ? 119.952 105.998 68.934  1.00 121.03 ? 15  GLU O CD    1 
ATOM 7236  O OE1   . GLU H 1 16  ? 120.402 106.164 67.780  1.00 121.53 ? 15  GLU O OE1   1 
ATOM 7237  O OE2   . GLU H 1 16  ? 119.044 105.179 69.198  1.00 123.58 ? 15  GLU O OE2   1 
ATOM 7238  N N     . MET H 1 17  ? 125.019 107.232 70.756  1.00 120.83 ? 16  MET O N     1 
ATOM 7239  C CA    . MET H 1 17  ? 126.392 107.638 70.465  1.00 117.87 ? 16  MET O CA    1 
ATOM 7240  C C     . MET H 1 17  ? 127.386 106.477 70.547  1.00 115.98 ? 16  MET O C     1 
ATOM 7241  O O     . MET H 1 17  ? 128.376 106.442 69.815  1.00 114.89 ? 16  MET O O     1 
ATOM 7242  C CB    . MET H 1 17  ? 126.819 108.790 71.371  1.00 115.04 ? 16  MET O CB    1 
ATOM 7243  C CG    . MET H 1 17  ? 125.957 110.022 71.196  1.00 116.58 ? 16  MET O CG    1 
ATOM 7244  S SD    . MET H 1 17  ? 126.599 111.508 72.000  1.00 113.21 ? 16  MET O SD    1 
ATOM 7245  C CE    . MET H 1 17  ? 128.086 111.834 71.050  1.00 111.27 ? 16  MET O CE    1 
ATOM 7246  N N     . LYS H 1 18  ? 127.115 105.527 71.435  1.00 126.49 ? 17  LYS O N     1 
ATOM 7247  C CA    . LYS H 1 18  ? 127.913 104.311 71.498  1.00 124.79 ? 17  LYS O CA    1 
ATOM 7248  C C     . LYS H 1 18  ? 127.691 103.485 70.231  1.00 127.15 ? 17  LYS O C     1 
ATOM 7249  O O     . LYS H 1 18  ? 128.598 102.812 69.748  1.00 125.86 ? 17  LYS O O     1 
ATOM 7250  C CB    . LYS H 1 18  ? 127.564 103.496 72.748  1.00 121.94 ? 17  LYS O CB    1 
ATOM 7251  N N     . GLN H 1 19  ? 126.482 103.553 69.688  1.00 115.71 ? 18  GLN O N     1 
ATOM 7252  C CA    . GLN H 1 19  ? 126.142 102.794 68.491  1.00 118.10 ? 18  GLN O CA    1 
ATOM 7253  C C     . GLN H 1 19  ? 126.890 103.286 67.250  1.00 117.99 ? 18  GLN O C     1 
ATOM 7254  O O     . GLN H 1 19  ? 127.236 102.495 66.371  1.00 117.54 ? 18  GLN O O     1 
ATOM 7255  C CB    . GLN H 1 19  ? 124.628 102.824 68.244  1.00 122.37 ? 18  GLN O CB    1 
ATOM 7256  C CG    . GLN H 1 19  ? 123.799 102.112 69.305  1.00 122.11 ? 18  GLN O CG    1 
ATOM 7257  C CD    . GLN H 1 19  ? 123.852 100.598 69.181  1.00 120.47 ? 18  GLN O CD    1 
ATOM 7258  O OE1   . GLN H 1 19  ? 122.874 99.964  68.782  1.00 122.35 ? 18  GLN O OE1   1 
ATOM 7259  N NE2   . GLN H 1 19  ? 124.994 100.010 69.530  1.00 116.56 ? 18  GLN O NE2   1 
ATOM 7260  N N     . LYS H 1 20  ? 127.134 104.590 67.181  1.00 132.75 ? 19  LYS O N     1 
ATOM 7261  C CA    . LYS H 1 20  ? 127.806 105.170 66.023  1.00 131.81 ? 19  LYS O CA    1 
ATOM 7262  C C     . LYS H 1 20  ? 129.306 104.931 66.098  1.00 127.38 ? 19  LYS O C     1 
ATOM 7263  O O     . LYS H 1 20  ? 129.983 104.808 65.076  1.00 126.14 ? 19  LYS O O     1 
ATOM 7264  C CB    . LYS H 1 20  ? 127.513 106.668 65.920  1.00 131.41 ? 19  LYS O CB    1 
ATOM 7265  N N     . ALA H 1 21  ? 129.818 104.864 67.322  1.00 92.51  ? 20  ALA O N     1 
ATOM 7266  C CA    . ALA H 1 21  ? 131.233 104.623 67.541  1.00 88.56  ? 20  ALA O CA    1 
ATOM 7267  C C     . ALA H 1 21  ? 131.545 103.149 67.355  1.00 87.68  ? 20  ALA O C     1 
ATOM 7268  O O     . ALA H 1 21  ? 132.546 102.786 66.744  1.00 85.40  ? 20  ALA O O     1 
ATOM 7269  C CB    . ALA H 1 21  ? 131.631 105.077 68.923  1.00 86.64  ? 20  ALA O CB    1 
ATOM 7270  N N     . ASP H 1 22  ? 130.673 102.298 67.876  1.00 95.68  ? 21  ASP O N     1 
ATOM 7271  C CA    . ASP H 1 22  ? 130.888 100.865 67.789  1.00 94.41  ? 21  ASP O CA    1 
ATOM 7272  C C     . ASP H 1 22  ? 130.617 100.348 66.377  1.00 95.79  ? 21  ASP O C     1 
ATOM 7273  O O     . ASP H 1 22  ? 131.100 99.281  65.999  1.00 93.98  ? 21  ASP O O     1 
ATOM 7274  C CB    . ASP H 1 22  ? 130.047 100.133 68.840  1.00 94.77  ? 21  ASP O CB    1 
ATOM 7275  C CG    . ASP H 1 22  ? 130.534 100.393 70.269  1.00 92.72  ? 21  ASP O CG    1 
ATOM 7276  O OD1   . ASP H 1 22  ? 131.328 101.341 70.479  1.00 91.34  ? 21  ASP O OD1   1 
ATOM 7277  O OD2   . ASP H 1 22  ? 130.118 99.650  71.186  1.00 92.26  ? 21  ASP O OD2   1 
ATOM 7278  N N     . GLN H 1 23  ? 129.856 101.114 65.599  1.00 89.27  ? 22  GLN O N     1 
ATOM 7279  C CA    . GLN H 1 23  ? 129.627 100.786 64.196  1.00 90.89  ? 22  GLN O CA    1 
ATOM 7280  C C     . GLN H 1 23  ? 130.901 101.017 63.385  1.00 88.01  ? 22  GLN O C     1 
ATOM 7281  O O     . GLN H 1 23  ? 131.267 100.202 62.541  1.00 87.28  ? 22  GLN O O     1 
ATOM 7282  C CB    . GLN H 1 23  ? 128.447 101.588 63.620  1.00 95.86  ? 22  GLN O CB    1 
ATOM 7283  N N     . LYS H 1 24  ? 131.584 102.124 63.649  1.00 82.07  ? 23  LYS O N     1 
ATOM 7284  C CA    . LYS H 1 24  ? 132.831 102.417 62.951  1.00 79.12  ? 23  LYS O CA    1 
ATOM 7285  C C     . LYS H 1 24  ? 133.933 101.469 63.419  1.00 75.42  ? 23  LYS O C     1 
ATOM 7286  O O     . LYS H 1 24  ? 134.790 101.069 62.632  1.00 73.49  ? 23  LYS O O     1 
ATOM 7287  C CB    . LYS H 1 24  ? 133.259 103.880 63.149  1.00 78.27  ? 23  LYS O CB    1 
ATOM 7288  C CG    . LYS H 1 24  ? 132.320 104.907 62.539  1.00 81.37  ? 23  LYS O CG    1 
ATOM 7289  C CD    . LYS H 1 24  ? 132.262 104.794 61.025  1.00 82.45  ? 23  LYS O CD    1 
ATOM 7290  C CE    . LYS H 1 24  ? 133.561 105.250 60.375  1.00 79.24  ? 23  LYS O CE    1 
ATOM 7291  N NZ    . LYS H 1 24  ? 133.457 105.293 58.880  1.00 80.38  ? 23  LYS O NZ    1 
ATOM 7292  N N     . LEU H 1 25  ? 133.911 101.123 64.704  1.00 68.68  ? 24  LEU O N     1 
ATOM 7293  C CA    . LEU H 1 25  ? 134.838 100.141 65.249  1.00 66.65  ? 24  LEU O CA    1 
ATOM 7294  C C     . LEU H 1 25  ? 134.690 98.845  64.475  1.00 66.29  ? 24  LEU O C     1 
ATOM 7295  O O     . LEU H 1 25  ? 135.658 98.338  63.918  1.00 65.96  ? 24  LEU O O     1 
ATOM 7296  C CB    . LEU H 1 25  ? 134.557 99.894  66.733  1.00 65.62  ? 24  LEU O CB    1 
ATOM 7297  C CG    . LEU H 1 25  ? 134.981 100.993 67.710  1.00 65.69  ? 24  LEU O CG    1 
ATOM 7298  C CD1   . LEU H 1 25  ? 134.566 100.628 69.116  1.00 64.81  ? 24  LEU O CD1   1 
ATOM 7299  C CD2   . LEU H 1 25  ? 136.479 101.231 67.639  1.00 65.46  ? 24  LEU O CD2   1 
ATOM 7300  N N     . GLU H 1 26  ? 133.459 98.340  64.440  1.00 76.28  ? 25  GLU O N     1 
ATOM 7301  C CA    . GLU H 1 26  ? 133.091 97.148  63.689  1.00 76.57  ? 25  GLU O CA    1 
ATOM 7302  C C     . GLU H 1 26  ? 133.585 97.204  62.233  1.00 76.69  ? 25  GLU O C     1 
ATOM 7303  O O     . GLU H 1 26  ? 134.179 96.250  61.723  1.00 74.49  ? 25  GLU O O     1 
ATOM 7304  C CB    . GLU H 1 26  ? 131.569 97.010  63.720  1.00 80.44  ? 25  GLU O CB    1 
ATOM 7305  C CG    . GLU H 1 26  ? 131.043 95.600  63.558  1.00 79.76  ? 25  GLU O CG    1 
ATOM 7306  C CD    . GLU H 1 26  ? 129.936 95.285  64.563  1.00 80.72  ? 25  GLU O CD    1 
ATOM 7307  O OE1   . GLU H 1 26  ? 129.999 94.208  65.205  1.00 77.52  ? 25  GLU O OE1   1 
ATOM 7308  O OE2   . GLU H 1 26  ? 129.010 96.120  64.719  1.00 84.46  ? 25  GLU O OE2   1 
ATOM 7309  N N     . GLN H 1 27  ? 133.340 98.337  61.581  1.00 67.79  ? 26  GLN O N     1 
ATOM 7310  C CA    . GLN H 1 27  ? 133.653 98.524  60.172  1.00 69.01  ? 26  GLN O CA    1 
ATOM 7311  C C     . GLN H 1 27  ? 135.145 98.421  59.888  1.00 68.56  ? 26  GLN O C     1 
ATOM 7312  O O     . GLN H 1 27  ? 135.552 97.922  58.836  1.00 68.99  ? 26  GLN O O     1 
ATOM 7313  C CB    . GLN H 1 27  ? 133.136 99.880  59.702  1.00 70.71  ? 26  GLN O CB    1 
ATOM 7314  C CG    . GLN H 1 27  ? 133.514 100.218 58.276  1.00 72.21  ? 26  GLN O CG    1 
ATOM 7315  C CD    . GLN H 1 27  ? 133.227 101.660 57.927  1.00 73.89  ? 26  GLN O CD    1 
ATOM 7316  O OE1   . GLN H 1 27  ? 132.612 102.385 58.711  1.00 73.95  ? 26  GLN O OE1   1 
ATOM 7317  N NE2   . GLN H 1 27  ? 133.671 102.090 56.743  1.00 75.35  ? 26  GLN O NE2   1 
ATOM 7318  N N     . PHE H 1 28  ? 135.958 98.901  60.825  1.00 67.81  ? 27  PHE O N     1 
ATOM 7319  C CA    . PHE H 1 28  ? 137.412 98.811  60.707  1.00 67.36  ? 27  PHE O CA    1 
ATOM 7320  C C     . PHE H 1 28  ? 137.913 97.653  61.537  1.00 65.59  ? 27  PHE O C     1 
ATOM 7321  O O     . PHE H 1 28  ? 139.098 97.308  61.514  1.00 65.01  ? 27  PHE O O     1 
ATOM 7322  C CB    . PHE H 1 28  ? 138.073 100.108 61.151  1.00 67.88  ? 27  PHE O CB    1 
ATOM 7323  C CG    . PHE H 1 28  ? 137.874 101.226 60.196  1.00 69.74  ? 27  PHE O CG    1 
ATOM 7324  C CD1   . PHE H 1 28  ? 136.695 101.939 60.189  1.00 70.69  ? 27  PHE O CD1   1 
ATOM 7325  C CD2   . PHE H 1 28  ? 138.854 101.548 59.286  1.00 70.67  ? 27  PHE O CD2   1 
ATOM 7326  C CE1   . PHE H 1 28  ? 136.502 102.969 59.296  1.00 72.53  ? 27  PHE O CE1   1 
ATOM 7327  C CE2   . PHE H 1 28  ? 138.670 102.577 58.388  1.00 72.57  ? 27  PHE O CE2   1 
ATOM 7328  C CZ    . PHE H 1 28  ? 137.493 103.291 58.395  1.00 73.49  ? 27  PHE O CZ    1 
ATOM 7329  N N     . ASP H 1 29  ? 136.981 97.061  62.266  1.00 76.51  ? 28  ASP O N     1 
ATOM 7330  C CA    . ASP H 1 29  ? 137.252 95.873  63.042  1.00 75.82  ? 28  ASP O CA    1 
ATOM 7331  C C     . ASP H 1 29  ? 138.459 96.041  63.955  1.00 74.36  ? 28  ASP O C     1 
ATOM 7332  O O     . ASP H 1 29  ? 139.390 95.243  63.904  1.00 74.42  ? 28  ASP O O     1 
ATOM 7333  C CB    . ASP H 1 29  ? 137.437 94.679  62.122  1.00 76.87  ? 28  ASP O CB    1 
ATOM 7334  C CG    . ASP H 1 29  ? 137.342 93.380  62.863  1.00 79.89  ? 28  ASP O CG    1 
ATOM 7335  O OD1   . ASP H 1 29  ? 136.223 93.035  63.315  1.00 81.50  ? 28  ASP O OD1   1 
ATOM 7336  O OD2   . ASP H 1 29  ? 138.390 92.718  63.008  1.00 80.95  ? 28  ASP O OD2   1 
ATOM 7337  N N     . ILE H 1 30  ? 138.440 97.109  64.755  1.00 60.23  ? 29  ILE O N     1 
ATOM 7338  C CA    . ILE H 1 30  ? 139.404 97.324  65.843  1.00 59.38  ? 29  ILE O CA    1 
ATOM 7339  C C     . ILE H 1 30  ? 138.655 97.409  67.160  1.00 60.57  ? 29  ILE O C     1 
ATOM 7340  O O     . ILE H 1 30  ? 137.429 97.536  67.180  1.00 63.21  ? 29  ILE O O     1 
ATOM 7341  C CB    . ILE H 1 30  ? 140.174 98.641  65.707  1.00 56.90  ? 29  ILE O CB    1 
ATOM 7342  C CG1   . ILE H 1 30  ? 139.204 99.813  65.839  1.00 60.99  ? 29  ILE O CG1   1 
ATOM 7343  C CG2   . ILE H 1 30  ? 140.922 98.693  64.398  1.00 55.95  ? 29  ILE O CG2   1 
ATOM 7344  C CD1   . ILE H 1 30  ? 139.802 101.147 65.561  1.00 62.33  ? 29  ILE O CD1   1 
ATOM 7345  N N     . THR H 1 31  ? 139.399 97.351  68.256  1.00 68.33  ? 30  THR O N     1 
ATOM 7346  C CA    . THR H 1 31  ? 138.813 97.475  69.578  1.00 71.67  ? 30  THR O CA    1 
ATOM 7347  C C     . THR H 1 31  ? 138.915 98.906  70.069  1.00 74.97  ? 30  THR O C     1 
ATOM 7348  O O     . THR H 1 31  ? 139.583 99.741  69.454  1.00 74.32  ? 30  THR O O     1 
ATOM 7349  C CB    . THR H 1 31  ? 139.528 96.575  70.589  1.00 69.72  ? 30  THR O CB    1 
ATOM 7350  O OG1   . THR H 1 31  ? 140.868 97.051  70.806  1.00 68.15  ? 30  THR O OG1   1 
ATOM 7351  C CG2   . THR H 1 31  ? 139.558 95.141  70.080  1.00 68.09  ? 30  THR O CG2   1 
ATOM 7352  N N     . ASN H 1 32  ? 138.251 99.182  71.185  1.00 80.47  ? 31  ASN O N     1 
ATOM 7353  C CA    . ASN H 1 32  ? 138.326 100.493 71.804  1.00 84.25  ? 31  ASN O CA    1 
ATOM 7354  C C     . ASN H 1 32  ? 139.753 100.797 72.213  1.00 81.22  ? 31  ASN O C     1 
ATOM 7355  O O     . ASN H 1 32  ? 140.278 101.870 71.913  1.00 82.29  ? 31  ASN O O     1 
ATOM 7356  C CB    . ASN H 1 32  ? 137.416 100.568 73.023  1.00 87.01  ? 31  ASN O CB    1 
ATOM 7357  C CG    . ASN H 1 32  ? 137.044 101.985 73.366  1.00 92.57  ? 31  ASN O CG    1 
ATOM 7358  O OD1   . ASN H 1 32  ? 136.587 102.733 72.503  1.00 95.94  ? 31  ASN O OD1   1 
ATOM 7359  N ND2   . ASN H 1 32  ? 137.262 102.377 74.622  1.00 93.17  ? 31  ASN O ND2   1 
ATOM 7360  N N     . GLU H 1 33  ? 140.370 99.837  72.896  1.00 89.03  ? 32  GLU O N     1 
ATOM 7361  C CA    . GLU H 1 33  ? 141.768 99.929  73.291  1.00 87.10  ? 32  GLU O CA    1 
ATOM 7362  C C     . GLU H 1 33  ? 142.659 100.179 72.078  1.00 84.84  ? 32  GLU O C     1 
ATOM 7363  O O     . GLU H 1 33  ? 143.493 101.082 72.085  1.00 85.58  ? 32  GLU O O     1 
ATOM 7364  C CB    . GLU H 1 33  ? 142.194 98.642  73.989  1.00 84.04  ? 32  GLU O CB    1 
ATOM 7365  C CG    . GLU H 1 33  ? 143.025 98.868  75.236  1.00 85.05  ? 32  GLU O CG    1 
ATOM 7366  C CD    . GLU H 1 33  ? 142.205 99.423  76.391  1.00 87.89  ? 32  GLU O CD    1 
ATOM 7367  O OE1   . GLU H 1 33  ? 141.385 98.667  76.971  1.00 88.48  ? 32  GLU O OE1   1 
ATOM 7368  O OE2   . GLU H 1 33  ? 142.382 100.620 76.719  1.00 89.68  ? 32  GLU O OE2   1 
ATOM 7369  N N     . GLN H 1 34  ? 142.471 99.372  71.039  1.00 79.98  ? 33  GLN O N     1 
ATOM 7370  C CA    . GLN H 1 34  ? 143.157 99.575  69.768  1.00 77.75  ? 33  GLN O CA    1 
ATOM 7371  C C     . GLN H 1 34  ? 142.823 100.957 69.213  1.00 80.07  ? 33  GLN O C     1 
ATOM 7372  O O     . GLN H 1 34  ? 143.674 101.628 68.625  1.00 79.62  ? 33  GLN O O     1 
ATOM 7373  C CB    . GLN H 1 34  ? 142.757 98.492  68.751  1.00 74.18  ? 33  GLN O CB    1 
ATOM 7374  C CG    . GLN H 1 34  ? 143.470 97.147  68.917  1.00 72.33  ? 33  GLN O CG    1 
ATOM 7375  C CD    . GLN H 1 34  ? 142.708 95.975  68.296  1.00 72.94  ? 33  GLN O CD    1 
ATOM 7376  O OE1   . GLN H 1 34  ? 141.557 96.103  67.878  1.00 72.78  ? 33  GLN O OE1   1 
ATOM 7377  N NE2   . GLN H 1 34  ? 143.353 94.826  68.247  1.00 74.82  ? 33  GLN O NE2   1 
ATOM 7378  N N     . GLY H 1 35  ? 141.578 101.382 69.410  1.00 56.79  ? 34  GLY O N     1 
ATOM 7379  C CA    . GLY H 1 35  ? 141.123 102.662 68.897  1.00 59.04  ? 34  GLY O CA    1 
ATOM 7380  C C     . GLY H 1 35  ? 141.925 103.844 69.415  1.00 61.04  ? 34  GLY O C     1 
ATOM 7381  O O     . GLY H 1 35  ? 142.577 104.549 68.635  1.00 60.74  ? 34  GLY O O     1 
ATOM 7382  N N     . HIS H 1 36  ? 141.877 104.050 70.732  1.00 60.43  ? 35  HIS O N     1 
ATOM 7383  C CA    . HIS H 1 36  ? 142.558 105.172 71.371  1.00 62.29  ? 35  HIS O CA    1 
ATOM 7384  C C     . HIS H 1 36  ? 144.041 105.184 71.054  1.00 60.34  ? 35  HIS O C     1 
ATOM 7385  O O     . HIS H 1 36  ? 144.610 106.223 70.716  1.00 61.58  ? 35  HIS O O     1 
ATOM 7386  C CB    . HIS H 1 36  ? 142.352 105.132 72.880  1.00 63.98  ? 35  HIS O CB    1 
ATOM 7387  C CG    . HIS H 1 36  ? 140.949 105.437 73.305  1.00 67.96  ? 35  HIS O CG    1 
ATOM 7388  N ND1   . HIS H 1 36  ? 140.025 104.453 73.589  1.00 68.28  ? 35  HIS O ND1   1 
ATOM 7389  C CD2   . HIS H 1 36  ? 140.312 106.617 73.491  1.00 72.04  ? 35  HIS O CD2   1 
ATOM 7390  C CE1   . HIS H 1 36  ? 138.882 105.014 73.939  1.00 73.19  ? 35  HIS O CE1   1 
ATOM 7391  N NE2   . HIS H 1 36  ? 139.029 106.325 73.887  1.00 75.34  ? 35  HIS O NE2   1 
ATOM 7392  N N     . THR H 1 37  ? 144.649 104.010 71.153  1.00 58.77  ? 36  THR O N     1 
ATOM 7393  C CA    . THR H 1 37  ? 146.063 103.803 70.851  1.00 59.12  ? 36  THR O CA    1 
ATOM 7394  C C     . THR H 1 37  ? 146.506 104.407 69.519  1.00 57.32  ? 36  THR O C     1 
ATOM 7395  O O     . THR H 1 37  ? 147.625 104.886 69.395  1.00 58.17  ? 36  THR O O     1 
ATOM 7396  C CB    . THR H 1 37  ? 146.375 102.300 70.847  1.00 59.80  ? 36  THR O CB    1 
ATOM 7397  O OG1   . THR H 1 37  ? 145.699 101.673 71.949  1.00 61.50  ? 36  THR O OG1   1 
ATOM 7398  C CG2   . THR H 1 37  ? 147.880 102.045 70.932  1.00 61.61  ? 36  THR O CG2   1 
ATOM 7399  N N     . LEU H 1 38  ? 145.629 104.381 68.521  1.00 55.37  ? 37  LEU O N     1 
ATOM 7400  C CA    . LEU H 1 38  ? 145.942 104.990 67.228  1.00 54.07  ? 37  LEU O CA    1 
ATOM 7401  C C     . LEU H 1 38  ? 145.685 106.483 67.288  1.00 54.37  ? 37  LEU O C     1 
ATOM 7402  O O     . LEU H 1 38  ? 146.302 107.247 66.554  1.00 54.33  ? 37  LEU O O     1 
ATOM 7403  C CB    . LEU H 1 38  ? 145.106 104.381 66.087  1.00 52.60  ? 37  LEU O CB    1 
ATOM 7404  C CG    . LEU H 1 38  ? 145.230 102.904 65.713  1.00 52.73  ? 37  LEU O CG    1 
ATOM 7405  C CD1   . LEU H 1 38  ? 144.003 102.476 64.957  1.00 52.12  ? 37  LEU O CD1   1 
ATOM 7406  C CD2   . LEU H 1 38  ? 146.458 102.662 64.880  1.00 52.97  ? 37  LEU O CD2   1 
ATOM 7407  N N     . GLY H 1 39  ? 144.743 106.887 68.137  1.00 74.35  ? 38  GLY O N     1 
ATOM 7408  C CA    . GLY H 1 39  ? 144.466 108.296 68.342  1.00 76.36  ? 38  GLY O CA    1 
ATOM 7409  C C     . GLY H 1 39  ? 145.645 108.952 69.034  1.00 77.44  ? 38  GLY O C     1 
ATOM 7410  O O     . GLY H 1 39  ? 146.090 110.039 68.653  1.00 77.56  ? 38  GLY O O     1 
ATOM 7411  N N     . TYR H 1 40  ? 146.157 108.276 70.056  1.00 84.12  ? 39  TYR O N     1 
ATOM 7412  C CA    . TYR H 1 40  ? 147.352 108.737 70.732  1.00 85.17  ? 39  TYR O CA    1 
ATOM 7413  C C     . TYR H 1 40  ? 148.482 108.885 69.728  1.00 84.93  ? 39  TYR O C     1 
ATOM 7414  O O     . TYR H 1 40  ? 149.223 109.864 69.760  1.00 86.43  ? 39  TYR O O     1 
ATOM 7415  C CB    . TYR H 1 40  ? 147.758 107.770 71.845  1.00 84.55  ? 39  TYR O CB    1 
ATOM 7416  N N     . LEU H 1 41  ? 148.601 107.921 68.824  1.00 73.14  ? 40  LEU O N     1 
ATOM 7417  C CA    . LEU H 1 41  ? 149.641 107.978 67.799  1.00 73.31  ? 40  LEU O CA    1 
ATOM 7418  C C     . LEU H 1 41  ? 149.389 109.075 66.775  1.00 74.14  ? 40  LEU O C     1 
ATOM 7419  O O     . LEU H 1 41  ? 150.313 109.510 66.106  1.00 75.34  ? 40  LEU O O     1 
ATOM 7420  C CB    . LEU H 1 41  ? 149.787 106.634 67.082  1.00 69.72  ? 40  LEU O CB    1 
ATOM 7421  C CG    . LEU H 1 41  ? 150.480 105.505 67.846  1.00 68.49  ? 40  LEU O CG    1 
ATOM 7422  C CD1   . LEU H 1 41  ? 150.270 104.200 67.116  1.00 64.30  ? 40  LEU O CD1   1 
ATOM 7423  C CD2   . LEU H 1 41  ? 151.973 105.783 68.022  1.00 71.66  ? 40  LEU O CD2   1 
ATOM 7424  N N     . TYR H 1 42  ? 148.140 109.513 66.645  1.00 99.55  ? 41  TYR O N     1 
ATOM 7425  C CA    . TYR H 1 42  ? 147.812 110.576 65.706  1.00 98.45  ? 41  TYR O CA    1 
ATOM 7426  C C     . TYR H 1 42  ? 148.299 111.902 66.272  1.00 99.41  ? 41  TYR O C     1 
ATOM 7427  O O     . TYR H 1 42  ? 148.481 112.875 65.542  1.00 98.64  ? 41  TYR O O     1 
ATOM 7428  C CB    . TYR H 1 42  ? 146.306 110.629 65.453  1.00 96.47  ? 41  TYR O CB    1 
ATOM 7429  C CG    . TYR H 1 42  ? 145.905 111.480 64.268  1.00 94.28  ? 41  TYR O CG    1 
ATOM 7430  C CD1   . TYR H 1 42  ? 145.827 112.859 64.372  1.00 94.54  ? 41  TYR O CD1   1 
ATOM 7431  C CD2   . TYR H 1 42  ? 145.593 110.899 63.049  1.00 92.40  ? 41  TYR O CD2   1 
ATOM 7432  C CE1   . TYR H 1 42  ? 145.466 113.637 63.299  1.00 92.91  ? 41  TYR O CE1   1 
ATOM 7433  C CE2   . TYR H 1 42  ? 145.222 111.669 61.966  1.00 90.25  ? 41  TYR O CE2   1 
ATOM 7434  C CZ    . TYR H 1 42  ? 145.160 113.040 62.098  1.00 90.50  ? 41  TYR O CZ    1 
ATOM 7435  O OH    . TYR H 1 42  ? 144.793 113.820 61.024  1.00 88.89  ? 41  TYR O OH    1 
ATOM 7436  N N     . ALA H 1 43  ? 148.524 111.930 67.579  1.00 72.82  ? 42  ALA O N     1 
ATOM 7437  C CA    . ALA H 1 43  ? 148.941 113.152 68.253  1.00 74.26  ? 42  ALA O CA    1 
ATOM 7438  C C     . ALA H 1 43  ? 150.432 113.187 68.558  1.00 76.05  ? 42  ALA O C     1 
ATOM 7439  O O     . ALA H 1 43  ? 151.108 114.183 68.297  1.00 77.17  ? 42  ALA O O     1 
ATOM 7440  C CB    . ALA H 1 43  ? 148.152 113.329 69.538  1.00 75.59  ? 42  ALA O CB    1 
ATOM 7441  N N     . HIS H 1 44  ? 150.934 112.090 69.114  1.00 95.79  ? 43  HIS O N     1 
ATOM 7442  C CA    . HIS H 1 44  ? 152.250 112.081 69.743  1.00 98.10  ? 43  HIS O CA    1 
ATOM 7443  C C     . HIS H 1 44  ? 153.250 111.155 69.042  1.00 99.56  ? 43  HIS O C     1 
ATOM 7444  O O     . HIS H 1 44  ? 154.294 110.813 69.596  1.00 101.83 ? 43  HIS O O     1 
ATOM 7445  C CB    . HIS H 1 44  ? 152.099 111.716 71.225  1.00 98.72  ? 43  HIS O CB    1 
ATOM 7446  C CG    . HIS H 1 44  ? 150.953 112.412 71.901  1.00 98.26  ? 43  HIS O CG    1 
ATOM 7447  N ND1   . HIS H 1 44  ? 150.852 113.783 71.976  1.00 99.14  ? 43  HIS O ND1   1 
ATOM 7448  C CD2   . HIS H 1 44  ? 149.852 111.920 72.523  1.00 97.65  ? 43  HIS O CD2   1 
ATOM 7449  C CE1   . HIS H 1 44  ? 149.742 114.110 72.616  1.00 99.48  ? 43  HIS O CE1   1 
ATOM 7450  N NE2   . HIS H 1 44  ? 149.120 112.997 72.959  1.00 98.68  ? 43  HIS O NE2   1 
ATOM 7451  N N     . GLN H 1 45  ? 152.919 110.767 67.815  1.00 82.04  ? 44  GLN O N     1 
ATOM 7452  C CA    . GLN H 1 45  ? 153.763 109.892 67.005  1.00 83.53  ? 44  GLN O CA    1 
ATOM 7453  C C     . GLN H 1 45  ? 155.176 110.451 66.919  1.00 87.55  ? 44  GLN O C     1 
ATOM 7454  O O     . GLN H 1 45  ? 156.163 109.734 67.115  1.00 90.15  ? 44  GLN O O     1 
ATOM 7455  C CB    . GLN H 1 45  ? 153.175 109.790 65.591  1.00 80.78  ? 44  GLN O CB    1 
ATOM 7456  C CG    . GLN H 1 45  ? 153.690 108.658 64.713  1.00 79.93  ? 44  GLN O CG    1 
ATOM 7457  C CD    . GLN H 1 45  ? 152.953 108.598 63.383  1.00 77.05  ? 44  GLN O CD    1 
ATOM 7458  O OE1   . GLN H 1 45  ? 151.937 109.257 63.197  1.00 75.66  ? 44  GLN O OE1   1 
ATOM 7459  N NE2   . GLN H 1 45  ? 153.470 107.815 62.452  1.00 74.19  ? 44  GLN O NE2   1 
ATOM 7460  N N     . GLN H 1 46  ? 155.241 111.749 66.638  1.00 96.30  ? 45  GLN O N     1 
ATOM 7461  C CA    . GLN H 1 46  ? 156.481 112.453 66.336  1.00 98.86  ? 45  GLN O CA    1 
ATOM 7462  C C     . GLN H 1 46  ? 157.515 112.384 67.462  1.00 101.32 ? 45  GLN O C     1 
ATOM 7463  O O     . GLN H 1 46  ? 158.718 112.488 67.217  1.00 104.47 ? 45  GLN O O     1 
ATOM 7464  C CB    . GLN H 1 46  ? 156.170 113.910 65.968  1.00 94.56  ? 45  GLN O CB    1 
ATOM 7465  C CG    . GLN H 1 46  ? 155.473 114.728 67.067  1.00 92.65  ? 45  GLN O CG    1 
ATOM 7466  C CD    . GLN H 1 46  ? 154.003 114.369 67.271  1.00 89.97  ? 45  GLN O CD    1 
ATOM 7467  O OE1   . GLN H 1 46  ? 153.449 113.518 66.573  1.00 89.03  ? 45  GLN O OE1   1 
ATOM 7468  N NE2   . GLN H 1 46  ? 153.368 115.022 68.238  1.00 89.40  ? 45  GLN O NE2   1 
ATOM 7469  N N     . ASP H 1 47  ? 157.044 112.176 68.681  1.00 120.17 ? 46  ASP O N     1 
ATOM 7470  C CA    . ASP H 1 47  ? 157.931 112.127 69.828  1.00 122.30 ? 46  ASP O CA    1 
ATOM 7471  C C     . ASP H 1 47  ? 158.906 110.981 69.649  1.00 125.70 ? 46  ASP O C     1 
ATOM 7472  O O     . ASP H 1 47  ? 160.065 111.073 70.036  1.00 128.76 ? 46  ASP O O     1 
ATOM 7473  C CB    . ASP H 1 47  ? 157.136 111.966 71.120  1.00 120.46 ? 46  ASP O CB    1 
ATOM 7474  C CG    . ASP H 1 47  ? 156.478 113.255 71.555  1.00 118.89 ? 46  ASP O CG    1 
ATOM 7475  O OD1   . ASP H 1 47  ? 156.133 113.378 72.747  1.00 118.77 ? 46  ASP O OD1   1 
ATOM 7476  O OD2   . ASP H 1 47  ? 156.308 114.149 70.702  1.00 118.37 ? 46  ASP O OD2   1 
ATOM 7477  N N     . GLY H 1 48  ? 158.425 109.893 69.067  1.00 97.40  ? 47  GLY O N     1 
ATOM 7478  C CA    . GLY H 1 48  ? 159.221 108.691 68.947  1.00 99.68  ? 47  GLY O CA    1 
ATOM 7479  C C     . GLY H 1 48  ? 158.857 107.777 70.091  1.00 97.76  ? 47  GLY O C     1 
ATOM 7480  O O     . GLY H 1 48  ? 159.519 107.747 71.124  1.00 99.87  ? 47  GLY O O     1 
ATOM 7481  N N     . LEU H 1 49  ? 157.777 107.035 69.896  1.00 81.24  ? 48  LEU O N     1 
ATOM 7482  C CA    . LEU H 1 49  ? 157.202 106.232 70.952  1.00 81.30  ? 48  LEU O CA    1 
ATOM 7483  C C     . LEU H 1 49  ? 157.632 104.782 70.863  1.00 82.45  ? 48  LEU O C     1 
ATOM 7484  O O     . LEU H 1 49  ? 157.581 104.158 69.812  1.00 80.37  ? 48  LEU O O     1 
ATOM 7485  C CB    . LEU H 1 49  ? 155.683 106.338 70.919  1.00 76.68  ? 48  LEU O CB    1 
ATOM 7486  C CG    . LEU H 1 49  ? 155.188 107.763 70.702  1.00 75.49  ? 48  LEU O CG    1 
ATOM 7487  C CD1   . LEU H 1 49  ? 153.739 107.769 70.249  1.00 70.95  ? 48  LEU O CD1   1 
ATOM 7488  C CD2   . LEU H 1 49  ? 155.362 108.577 71.971  1.00 79.26  ? 48  LEU O CD2   1 
ATOM 7489  N N     . THR H 1 50  ? 158.074 104.271 71.998  1.00 91.82  ? 49  THR O N     1 
ATOM 7490  C CA    . THR H 1 50  ? 158.544 102.899 72.144  1.00 93.69  ? 49  THR O CA    1 
ATOM 7491  C C     . THR H 1 50  ? 157.406 102.039 72.734  1.00 90.72  ? 49  THR O C     1 
ATOM 7492  O O     . THR H 1 50  ? 156.384 102.582 73.164  1.00 87.91  ? 49  THR O O     1 
ATOM 7493  C CB    . THR H 1 50  ? 159.867 102.866 72.999  1.00 98.89  ? 49  THR O CB    1 
ATOM 7494  O OG1   . THR H 1 50  ? 160.905 103.616 72.348  1.00 100.58 ? 49  THR O OG1   1 
ATOM 7495  C CG2   . THR H 1 50  ? 160.338 101.444 73.287  1.00 101.63 ? 49  THR O CG2   1 
ATOM 7496  N N     . GLN H 1 51  ? 157.567 100.713 72.710  1.00 99.98  ? 50  GLN O N     1 
ATOM 7497  C CA    . GLN H 1 51  ? 156.594 99.781  73.284  1.00 98.18  ? 50  GLN O CA    1 
ATOM 7498  C C     . GLN H 1 51  ? 156.093 100.231 74.652  1.00 98.76  ? 50  GLN O C     1 
ATOM 7499  O O     . GLN H 1 51  ? 154.887 100.311 74.883  1.00 95.58  ? 50  GLN O O     1 
ATOM 7500  C CB    . GLN H 1 51  ? 157.194 98.375  73.393  1.00 101.04 ? 50  GLN O CB    1 
ATOM 7501  N N     . ASN H 1 52  ? 157.025 100.543 75.549  1.00 161.93 ? 51  ASN O N     1 
ATOM 7502  C CA    . ASN H 1 52  ? 156.683 100.965 76.906  1.00 162.83 ? 51  ASN O CA    1 
ATOM 7503  C C     . ASN H 1 52  ? 156.312 102.450 77.026  1.00 161.93 ? 51  ASN O C     1 
ATOM 7504  O O     . ASN H 1 52  ? 155.865 102.894 78.084  1.00 162.30 ? 51  ASN O O     1 
ATOM 7505  C CB    . ASN H 1 52  ? 157.814 100.618 77.881  1.00 168.59 ? 51  ASN O CB    1 
ATOM 7506  N N     . ASP H 1 53  ? 156.503 103.211 75.949  1.00 104.12 ? 52  ASP O N     1 
ATOM 7507  C CA    . ASP H 1 53  ? 156.116 104.623 75.925  1.00 102.23 ? 52  ASP O CA    1 
ATOM 7508  C C     . ASP H 1 53  ? 154.608 104.735 75.960  1.00 98.06  ? 52  ASP O C     1 
ATOM 7509  O O     . ASP H 1 53  ? 154.037 105.479 76.765  1.00 97.94  ? 52  ASP O O     1 
ATOM 7510  C CB    . ASP H 1 53  ? 156.634 105.313 74.665  1.00 101.42 ? 52  ASP O CB    1 
ATOM 7511  C CG    . ASP H 1 53  ? 157.916 106.074 74.906  1.00 104.60 ? 52  ASP O CG    1 
ATOM 7512  O OD1   . ASP H 1 53  ? 158.875 105.904 74.118  1.00 106.36 ? 52  ASP O OD1   1 
ATOM 7513  O OD2   . ASP H 1 53  ? 157.957 106.849 75.884  1.00 105.52 ? 52  ASP O OD2   1 
ATOM 7514  N N     . ILE H 1 54  ? 153.971 103.993 75.062  1.00 86.52  ? 53  ILE O N     1 
ATOM 7515  C CA    . ILE H 1 54  ? 152.524 103.889 75.028  1.00 82.73  ? 53  ILE O CA    1 
ATOM 7516  C C     . ILE H 1 54  ? 152.005 103.454 76.393  1.00 84.40  ? 53  ILE O C     1 
ATOM 7517  O O     . ILE H 1 54  ? 151.151 104.122 76.983  1.00 83.52  ? 53  ILE O O     1 
ATOM 7518  C CB    . ILE H 1 54  ? 152.080 102.866 73.976  1.00 80.07  ? 53  ILE O CB    1 
ATOM 7519  C CG1   . ILE H 1 54  ? 152.662 103.237 72.617  1.00 79.06  ? 53  ILE O CG1   1 
ATOM 7520  C CG2   . ILE H 1 54  ? 150.572 102.807 73.900  1.00 76.53  ? 53  ILE O CG2   1 
ATOM 7521  C CD1   . ILE H 1 54  ? 152.342 104.647 72.207  1.00 77.01  ? 53  ILE O CD1   1 
ATOM 7522  N N     . ALA H 1 55  ? 152.554 102.345 76.888  1.00 88.89  ? 54  ALA O N     1 
ATOM 7523  C CA    . ALA H 1 55  ? 152.165 101.759 78.170  1.00 91.08  ? 54  ALA O CA    1 
ATOM 7524  C C     . ALA H 1 55  ? 152.011 102.789 79.284  1.00 93.09  ? 54  ALA O C     1 
ATOM 7525  O O     . ALA H 1 55  ? 151.093 102.696 80.090  1.00 93.15  ? 54  ALA O O     1 
ATOM 7526  C CB    . ALA H 1 55  ? 153.156 100.680 78.579  1.00 94.96  ? 54  ALA O CB    1 
ATOM 7527  N N     . LYS H 1 56  ? 152.902 103.774 79.309  1.00 115.97 ? 55  LYS O N     1 
ATOM 7528  C CA    . LYS H 1 56  ? 152.853 104.828 80.316  1.00 118.23 ? 55  LYS O CA    1 
ATOM 7529  C C     . LYS H 1 56  ? 151.768 105.848 79.982  1.00 115.37 ? 55  LYS O C     1 
ATOM 7530  O O     . LYS H 1 56  ? 151.026 106.296 80.857  1.00 115.82 ? 55  LYS O O     1 
ATOM 7531  C CB    . LYS H 1 56  ? 154.218 105.519 80.443  1.00 121.74 ? 55  LYS O CB    1 
ATOM 7532  N N     . ALA H 1 57  ? 151.679 106.213 78.709  1.00 102.26 ? 56  ALA O N     1 
ATOM 7533  C CA    . ALA H 1 57  ? 150.664 107.160 78.273  1.00 99.64  ? 56  ALA O CA    1 
ATOM 7534  C C     . ALA H 1 57  ? 149.273 106.531 78.309  1.00 97.39  ? 56  ALA O C     1 
ATOM 7535  O O     . ALA H 1 57  ? 148.278 107.224 78.500  1.00 96.67  ? 56  ALA O O     1 
ATOM 7536  C CB    . ALA H 1 57  ? 150.979 107.666 76.883  1.00 98.01  ? 56  ALA O CB    1 
ATOM 7537  N N     . LEU H 1 58  ? 149.213 105.215 78.129  1.00 89.60  ? 57  LEU O N     1 
ATOM 7538  C CA    . LEU H 1 58  ? 147.939 104.503 78.096  1.00 87.44  ? 57  LEU O CA    1 
ATOM 7539  C C     . LEU H 1 58  ? 147.655 103.768 79.391  1.00 90.48  ? 57  LEU O C     1 
ATOM 7540  O O     . LEU H 1 58  ? 146.598 103.157 79.532  1.00 89.51  ? 57  LEU O O     1 
ATOM 7541  C CB    . LEU H 1 58  ? 147.892 103.520 76.926  1.00 84.90  ? 57  LEU O CB    1 
ATOM 7542  C CG    . LEU H 1 58  ? 147.161 104.013 75.678  1.00 80.80  ? 57  LEU O CG    1 
ATOM 7543  C CD1   . LEU H 1 58  ? 147.097 102.926 74.625  1.00 79.11  ? 57  LEU O CD1   1 
ATOM 7544  C CD2   . LEU H 1 58  ? 145.763 104.486 76.050  1.00 79.50  ? 57  LEU O CD2   1 
ATOM 7545  N N     . GLN H 1 59  ? 148.603 103.832 80.323  1.00 94.00  ? 58  GLN O N     1 
ATOM 7546  C CA    . GLN H 1 59  ? 148.454 103.246 81.662  1.00 97.69  ? 58  GLN O CA    1 
ATOM 7547  C C     . GLN H 1 59  ? 148.026 101.777 81.620  1.00 97.25  ? 58  GLN O C     1 
ATOM 7548  O O     . GLN H 1 59  ? 147.123 101.354 82.348  1.00 98.17  ? 58  GLN O O     1 
ATOM 7549  C CB    . GLN H 1 59  ? 147.501 104.079 82.524  1.00 98.64  ? 58  GLN O CB    1 
ATOM 7550  C CG    . GLN H 1 59  ? 147.839 104.053 84.003  1.00 103.93 ? 58  GLN O CG    1 
ATOM 7551  C CD    . GLN H 1 59  ? 147.239 105.228 84.755  1.00 105.62 ? 58  GLN O CD    1 
ATOM 7552  O OE1   . GLN H 1 59  ? 146.725 106.166 84.138  1.00 102.89 ? 58  GLN O OE1   1 
ATOM 7553  N NE2   . GLN H 1 59  ? 147.304 105.187 86.093  1.00 110.96 ? 58  GLN O NE2   1 
ATOM 7554  N N     . ARG H 1 60  ? 148.682 101.020 80.745  1.00 119.78 ? 59  ARG O N     1 
ATOM 7555  C CA    . ARG H 1 60  ? 148.439 99.590  80.606  1.00 119.64 ? 59  ARG O CA    1 
ATOM 7556  C C     . ARG H 1 60  ? 149.754 98.824  80.741  1.00 122.37 ? 59  ARG O C     1 
ATOM 7557  O O     . ARG H 1 60  ? 150.811 99.311  80.330  1.00 123.11 ? 59  ARG O O     1 
ATOM 7558  C CB    . ARG H 1 60  ? 147.779 99.282  79.258  1.00 116.02 ? 59  ARG O CB    1 
ATOM 7559  N N     . THR H 1 61  ? 149.685 97.631  81.324  1.00 95.93  ? 60  THR O N     1 
ATOM 7560  C CA    . THR H 1 61  ? 150.865 96.794  81.513  1.00 100.38 ? 60  THR O CA    1 
ATOM 7561  C C     . THR H 1 61  ? 151.556 96.440  80.198  1.00 98.05  ? 60  THR O C     1 
ATOM 7562  O O     . THR H 1 61  ? 150.938 96.435  79.138  1.00 93.18  ? 60  THR O O     1 
ATOM 7563  C CB    . THR H 1 61  ? 150.501 95.496  82.236  1.00 104.42 ? 60  THR O CB    1 
ATOM 7564  O OG1   . THR H 1 61  ? 149.404 94.868  81.559  1.00 100.87 ? 60  THR O OG1   1 
ATOM 7565  C CG2   . THR H 1 61  ? 150.103 95.792  83.666  1.00 108.39 ? 60  THR O CG2   1 
ATOM 7566  N N     . GLY H 1 62  ? 152.847 96.145  80.284  1.00 85.16  ? 61  GLY O N     1 
ATOM 7567  C CA    . GLY H 1 62  ? 153.635 95.777  79.121  1.00 82.85  ? 61  GLY O CA    1 
ATOM 7568  C C     . GLY H 1 62  ? 153.008 94.771  78.172  1.00 81.83  ? 61  GLY O C     1 
ATOM 7569  O O     . GLY H 1 62  ? 152.717 95.117  77.027  1.00 79.32  ? 61  GLY O O     1 
ATOM 7570  N N     . PRO H 1 63  ? 152.797 93.525  78.642  1.00 93.37  ? 62  PRO O N     1 
ATOM 7571  C CA    . PRO H 1 63  ? 152.316 92.407  77.818  1.00 95.90  ? 62  PRO O CA    1 
ATOM 7572  C C     . PRO H 1 63  ? 150.932 92.654  77.234  1.00 94.15  ? 62  PRO O C     1 
ATOM 7573  O O     . PRO H 1 63  ? 150.572 92.056  76.214  1.00 95.35  ? 62  PRO O O     1 
ATOM 7574  C CB    . PRO H 1 63  ? 152.262 91.243  78.810  1.00 99.03  ? 62  PRO O CB    1 
ATOM 7575  C CG    . PRO H 1 63  ? 152.135 91.884  80.134  1.00 97.73  ? 62  PRO O CG    1 
ATOM 7576  C CD    . PRO H 1 63  ? 152.982 93.107  80.041  1.00 94.83  ? 62  PRO O CD    1 
ATOM 7577  N N     . THR H 1 64  ? 150.166 93.512  77.902  1.00 75.81  ? 63  THR O N     1 
ATOM 7578  C CA    . THR H 1 64  ? 148.915 94.022  77.365  1.00 74.35  ? 63  THR O CA    1 
ATOM 7579  C C     . THR H 1 64  ? 149.214 94.795  76.080  1.00 71.09  ? 63  THR O C     1 
ATOM 7580  O O     . THR H 1 64  ? 148.657 94.496  75.017  1.00 69.39  ? 63  THR O O     1 
ATOM 7581  C CB    . THR H 1 64  ? 148.226 94.933  78.393  1.00 75.88  ? 63  THR O CB    1 
ATOM 7582  O OG1   . THR H 1 64  ? 147.964 94.183  79.587  1.00 79.34  ? 63  THR O OG1   1 
ATOM 7583  C CG2   . THR H 1 64  ? 146.933 95.500  77.851  1.00 74.51  ? 63  THR O CG2   1 
ATOM 7584  N N     . VAL H 1 65  ? 150.120 95.767  76.179  1.00 75.78  ? 64  VAL O N     1 
ATOM 7585  C CA    . VAL H 1 65  ? 150.511 96.591  75.035  1.00 73.21  ? 64  VAL O CA    1 
ATOM 7586  C C     . VAL H 1 65  ? 151.114 95.751  73.894  1.00 72.69  ? 64  VAL O C     1 
ATOM 7587  O O     . VAL H 1 65  ? 150.889 96.023  72.700  1.00 70.91  ? 64  VAL O O     1 
ATOM 7588  C CB    . VAL H 1 65  ? 151.509 97.690  75.459  1.00 73.49  ? 64  VAL O CB    1 
ATOM 7589  C CG1   . VAL H 1 65  ? 151.706 98.691  74.347  1.00 71.34  ? 64  VAL O CG1   1 
ATOM 7590  C CG2   . VAL H 1 65  ? 151.008 98.397  76.695  1.00 75.49  ? 64  VAL O CG2   1 
ATOM 7591  N N     . SER H 1 66  ? 151.878 94.728  74.265  1.00 83.95  ? 65  SER O N     1 
ATOM 7592  C CA    . SER H 1 66  ? 152.512 93.855  73.282  1.00 86.39  ? 65  SER O CA    1 
ATOM 7593  C C     . SER H 1 66  ? 151.481 93.233  72.347  1.00 87.37  ? 65  SER O C     1 
ATOM 7594  O O     . SER H 1 66  ? 151.609 93.343  71.128  1.00 86.41  ? 65  SER O O     1 
ATOM 7595  C CB    . SER H 1 66  ? 153.334 92.769  73.979  1.00 91.20  ? 65  SER O CB    1 
ATOM 7596  O OG    . SER H 1 66  ? 154.121 92.048  73.050  1.00 94.50  ? 65  SER O OG    1 
ATOM 7597  N N     . ASN H 1 67  ? 150.459 92.602  72.934  1.00 108.30 ? 66  ASN O N     1 
ATOM 7598  C CA    . ASN H 1 67  ? 149.361 91.977  72.190  1.00 109.81 ? 66  ASN O CA    1 
ATOM 7599  C C     . ASN H 1 67  ? 148.569 93.009  71.392  1.00 104.55 ? 66  ASN O C     1 
ATOM 7600  O O     . ASN H 1 67  ? 148.094 92.739  70.288  1.00 104.49 ? 66  ASN O O     1 
ATOM 7601  C CB    . ASN H 1 67  ? 148.406 91.249  73.145  1.00 113.05 ? 66  ASN O CB    1 
ATOM 7602  C CG    . ASN H 1 67  ? 149.122 90.315  74.110  1.00 118.12 ? 66  ASN O CG    1 
ATOM 7603  O OD1   . ASN H 1 67  ? 150.089 89.639  73.750  1.00 121.68 ? 66  ASN O OD1   1 
ATOM 7604  N ND2   . ASN H 1 67  ? 148.637 90.267  75.348  1.00 118.71 ? 66  ASN O ND2   1 
ATOM 7605  N N     . LEU H 1 68  ? 148.427 94.190  71.987  1.00 83.61  ? 67  LEU O N     1 
ATOM 7606  C CA    . LEU H 1 68  ? 147.757 95.339  71.385  1.00 79.34  ? 67  LEU O CA    1 
ATOM 7607  C C     . LEU H 1 68  ? 148.446 95.765  70.077  1.00 77.32  ? 67  LEU O C     1 
ATOM 7608  O O     . LEU H 1 68  ? 147.827 95.771  69.006  1.00 75.94  ? 67  LEU O O     1 
ATOM 7609  C CB    . LEU H 1 68  ? 147.762 96.480  72.402  1.00 78.10  ? 67  LEU O CB    1 
ATOM 7610  C CG    . LEU H 1 68  ? 146.847 97.690  72.280  1.00 77.13  ? 67  LEU O CG    1 
ATOM 7611  C CD1   . LEU H 1 68  ? 145.437 97.269  71.930  1.00 76.76  ? 67  LEU O CD1   1 
ATOM 7612  C CD2   . LEU H 1 68  ? 146.869 98.449  73.601  1.00 78.93  ? 67  LEU O CD2   1 
ATOM 7613  N N     . LEU H 1 69  ? 149.729 96.104  70.167  1.00 63.64  ? 68  LEU O N     1 
ATOM 7614  C CA    . LEU H 1 69  ? 150.519 96.456  68.994  1.00 62.49  ? 68  LEU O CA    1 
ATOM 7615  C C     . LEU H 1 69  ? 150.633 95.327  67.958  1.00 64.80  ? 68  LEU O C     1 
ATOM 7616  O O     . LEU H 1 69  ? 150.598 95.576  66.746  1.00 63.30  ? 68  LEU O O     1 
ATOM 7617  C CB    . LEU H 1 69  ? 151.913 96.880  69.434  1.00 63.04  ? 68  LEU O CB    1 
ATOM 7618  C CG    . LEU H 1 69  ? 151.979 98.220  70.148  1.00 61.69  ? 68  LEU O CG    1 
ATOM 7619  C CD1   . LEU H 1 69  ? 153.170 98.264  71.092  1.00 63.18  ? 68  LEU O CD1   1 
ATOM 7620  C CD2   . LEU H 1 69  ? 152.080 99.319  69.113  1.00 60.32  ? 68  LEU O CD2   1 
ATOM 7621  N N     . ARG H 1 70  ? 150.790 94.092  68.434  1.00 61.19  ? 69  ARG O N     1 
ATOM 7622  C CA    . ARG H 1 70  ? 150.924 92.949  67.538  1.00 61.69  ? 69  ARG O CA    1 
ATOM 7623  C C     . ARG H 1 70  ? 149.674 92.912  66.683  1.00 60.55  ? 69  ARG O C     1 
ATOM 7624  O O     . ARG H 1 70  ? 149.712 92.632  65.482  1.00 60.08  ? 69  ARG O O     1 
ATOM 7625  C CB    . ARG H 1 70  ? 151.090 91.641  68.324  1.00 64.03  ? 69  ARG O CB    1 
ATOM 7626  N N     . ASN H 1 71  ? 148.565 93.247  67.322  1.00 67.20  ? 70  ASN O N     1 
ATOM 7627  C CA    . ASN H 1 71  ? 147.293 93.253  66.653  1.00 65.65  ? 70  ASN O CA    1 
ATOM 7628  C C     . ASN H 1 71  ? 147.191 94.396  65.645  1.00 60.90  ? 70  ASN O C     1 
ATOM 7629  O O     . ASN H 1 71  ? 146.758 94.185  64.511  1.00 60.25  ? 70  ASN O O     1 
ATOM 7630  C CB    . ASN H 1 71  ? 146.163 93.301  67.674  1.00 65.73  ? 70  ASN O CB    1 
ATOM 7631  C CG    . ASN H 1 71  ? 144.954 92.509  67.230  1.00 67.57  ? 70  ASN O CG    1 
ATOM 7632  O OD1   . ASN H 1 71  ? 144.709 92.342  66.033  1.00 66.79  ? 70  ASN O OD1   1 
ATOM 7633  N ND2   . ASN H 1 71  ? 144.183 92.019  68.194  1.00 70.18  ? 70  ASN O ND2   1 
ATOM 7634  N N     . LEU H 1 72  ? 147.598 95.599  66.047  1.00 56.63  ? 71  LEU O N     1 
ATOM 7635  C CA    . LEU H 1 72  ? 147.543 96.744  65.139  1.00 55.14  ? 71  LEU O CA    1 
ATOM 7636  C C     . LEU H 1 72  ? 148.471 96.534  63.954  1.00 55.01  ? 71  LEU O C     1 
ATOM 7637  O O     . LEU H 1 72  ? 148.125 96.852  62.813  1.00 54.11  ? 71  LEU O O     1 
ATOM 7638  C CB    . LEU H 1 72  ? 147.875 98.048  65.857  1.00 55.14  ? 71  LEU O CB    1 
ATOM 7639  C CG    . LEU H 1 72  ? 146.928 98.466  66.982  1.00 55.60  ? 71  LEU O CG    1 
ATOM 7640  C CD1   . LEU H 1 72  ? 147.427 99.746  67.624  1.00 56.08  ? 71  LEU O CD1   1 
ATOM 7641  C CD2   . LEU H 1 72  ? 145.520 98.646  66.468  1.00 54.60  ? 71  LEU O CD2   1 
ATOM 7642  N N     . GLU H 1 73  ? 149.641 95.968  64.224  1.00 60.41  ? 72  GLU O N     1 
ATOM 7643  C CA    . GLU H 1 73  ? 150.599 95.654  63.171  1.00 61.16  ? 72  GLU O CA    1 
ATOM 7644  C C     . GLU H 1 73  ? 150.028 94.689  62.131  1.00 62.19  ? 72  GLU O C     1 
ATOM 7645  O O     . GLU H 1 73  ? 150.017 94.988  60.939  1.00 60.94  ? 72  GLU O O     1 
ATOM 7646  C CB    . GLU H 1 73  ? 151.848 95.056  63.783  1.00 64.28  ? 72  GLU O CB    1 
ATOM 7647  C CG    . GLU H 1 73  ? 153.006 94.977  62.844  1.00 66.09  ? 72  GLU O CG    1 
ATOM 7648  C CD    . GLU H 1 73  ? 154.292 95.081  63.597  1.00 68.08  ? 72  GLU O CD    1 
ATOM 7649  O OE1   . GLU H 1 73  ? 154.232 95.011  64.848  1.00 68.44  ? 72  GLU O OE1   1 
ATOM 7650  O OE2   . GLU H 1 73  ? 155.352 95.256  62.964  1.00 69.33  ? 72  GLU O OE2   1 
ATOM 7651  N N     . ARG H 1 74  ? 149.551 93.533  62.585  1.00 74.30  ? 73  ARG O N     1 
ATOM 7652  C CA    . ARG H 1 74  ? 148.964 92.558  61.671  1.00 76.53  ? 73  ARG O CA    1 
ATOM 7653  C C     . ARG H 1 74  ? 147.670 93.083  61.043  1.00 72.42  ? 73  ARG O C     1 
ATOM 7654  O O     . ARG H 1 74  ? 147.214 92.572  60.024  1.00 72.87  ? 73  ARG O O     1 
ATOM 7655  C CB    . ARG H 1 74  ? 148.736 91.197  62.351  1.00 82.39  ? 73  ARG O CB    1 
ATOM 7656  C CG    . ARG H 1 74  ? 147.612 91.152  63.380  1.00 82.29  ? 73  ARG O CG    1 
ATOM 7657  C CD    . ARG H 1 74  ? 146.933 89.768  63.443  1.00 88.04  ? 73  ARG O CD    1 
ATOM 7658  N NE    . ARG H 1 74  ? 147.886 88.665  63.582  1.00 94.80  ? 73  ARG O NE    1 
ATOM 7659  C CZ    . ARG H 1 74  ? 147.560 87.377  63.490  1.00 100.92 ? 73  ARG O CZ    1 
ATOM 7660  N NH1   . ARG H 1 74  ? 146.299 87.022  63.263  1.00 100.87 ? 73  ARG O NH1   1 
ATOM 7661  N NH2   . ARG H 1 74  ? 148.494 86.441  63.622  1.00 107.27 ? 73  ARG O NH2   1 
ATOM 7662  N N     . LYS H 1 75  ? 147.085 94.109  61.653  1.00 70.37  ? 74  LYS O N     1 
ATOM 7663  C CA    . LYS H 1 75  ? 145.933 94.774  61.061  1.00 66.66  ? 74  LYS O CA    1 
ATOM 7664  C C     . LYS H 1 75  ? 146.403 95.833  60.058  1.00 63.97  ? 74  LYS O C     1 
ATOM 7665  O O     . LYS H 1 75  ? 145.596 96.432  59.329  1.00 62.20  ? 74  LYS O O     1 
ATOM 7666  C CB    . LYS H 1 75  ? 144.999 95.336  62.143  1.00 65.60  ? 74  LYS O CB    1 
ATOM 7667  C CG    . LYS H 1 75  ? 143.826 94.405  62.415  1.00 67.52  ? 74  LYS O CG    1 
ATOM 7668  C CD    . LYS H 1 75  ? 143.120 94.645  63.746  1.00 67.71  ? 74  LYS O CD    1 
ATOM 7669  C CE    . LYS H 1 75  ? 141.952 93.641  63.900  1.00 70.63  ? 74  LYS O CE    1 
ATOM 7670  N NZ    . LYS H 1 75  ? 141.370 93.502  65.284  1.00 72.69  ? 74  LYS O NZ    1 
ATOM 7671  N N     . LYS H 1 76  ? 147.723 96.023  60.017  1.00 56.38  ? 75  LYS O N     1 
ATOM 7672  C CA    . LYS H 1 76  ? 148.378 96.891  59.039  1.00 55.77  ? 75  LYS O CA    1 
ATOM 7673  C C     . LYS H 1 76  ? 148.056 98.351  59.307  1.00 54.71  ? 75  LYS O C     1 
ATOM 7674  O O     . LYS H 1 76  ? 148.031 99.165  58.392  1.00 54.48  ? 75  LYS O O     1 
ATOM 7675  C CB    . LYS H 1 76  ? 148.011 96.510  57.595  1.00 55.89  ? 75  LYS O CB    1 
ATOM 7676  C CG    . LYS H 1 76  ? 148.866 95.413  56.981  1.00 57.88  ? 75  LYS O CG    1 
ATOM 7677  C CD    . LYS H 1 76  ? 148.886 94.161  57.849  1.00 59.89  ? 75  LYS O CD    1 
ATOM 7678  C CE    . LYS H 1 76  ? 149.807 93.075  57.301  1.00 64.00  ? 75  LYS O CE    1 
ATOM 7679  N NZ    . LYS H 1 76  ? 149.234 92.421  56.085  1.00 64.70  ? 75  LYS O NZ    1 
ATOM 7680  N N     . LEU H 1 77  ? 147.819 98.676  60.571  1.00 52.45  ? 76  LEU O N     1 
ATOM 7681  C CA    . LEU H 1 77  ? 147.432 100.027 60.947  1.00 51.93  ? 76  LEU O CA    1 
ATOM 7682  C C     . LEU H 1 77  ? 148.614 100.791 61.527  1.00 52.78  ? 76  LEU O C     1 
ATOM 7683  O O     . LEU H 1 77  ? 148.650 102.018 61.471  1.00 52.88  ? 76  LEU O O     1 
ATOM 7684  C CB    . LEU H 1 77  ? 146.290 99.986  61.961  1.00 51.56  ? 76  LEU O CB    1 
ATOM 7685  C CG    . LEU H 1 77  ? 145.032 99.237  61.526  1.00 50.85  ? 76  LEU O CG    1 
ATOM 7686  C CD1   . LEU H 1 77  ? 144.112 98.998  62.709  1.00 51.06  ? 76  LEU O CD1   1 
ATOM 7687  C CD2   . LEU H 1 77  ? 144.327 100.027 60.444  1.00 49.91  ? 76  LEU O CD2   1 
ATOM 7688  N N     . ILE H 1 78  ? 149.570 100.068 62.105  1.00 65.20  ? 77  ILE O N     1 
ATOM 7689  C CA    . ILE H 1 78  ? 150.795 100.682 62.610  1.00 66.25  ? 77  ILE O CA    1 
ATOM 7690  C C     . ILE H 1 78  ? 152.006 100.004 62.001  1.00 67.62  ? 77  ILE O C     1 
ATOM 7691  O O     . ILE H 1 78  ? 151.893 98.928  61.415  1.00 68.10  ? 77  ILE O O     1 
ATOM 7692  C CB    . ILE H 1 78  ? 150.931 100.526 64.123  1.00 66.72  ? 77  ILE O CB    1 
ATOM 7693  C CG1   . ILE H 1 78  ? 150.875 99.040  64.483  1.00 67.40  ? 77  ILE O CG1   1 
ATOM 7694  C CG2   . ILE H 1 78  ? 149.849 101.302 64.832  1.00 66.41  ? 77  ILE O CG2   1 
ATOM 7695  C CD1   . ILE H 1 78  ? 151.700 98.653  65.680  1.00 68.92  ? 77  ILE O CD1   1 
ATOM 7696  N N     . TYR H 1 79  ? 153.164 100.633 62.157  1.00 59.61  ? 78  TYR O N     1 
ATOM 7697  C CA    . TYR H 1 79  ? 154.432 100.039 61.761  1.00 61.93  ? 78  TYR O CA    1 
ATOM 7698  C C     . TYR H 1 79  ? 155.418 100.622 62.759  1.00 63.10  ? 78  TYR O C     1 
ATOM 7699  O O     . TYR H 1 79  ? 155.163 101.651 63.398  1.00 62.14  ? 78  TYR O O     1 
ATOM 7700  C CB    . TYR H 1 79  ? 154.804 100.454 60.348  1.00 62.86  ? 78  TYR O CB    1 
ATOM 7701  C CG    . TYR H 1 79  ? 155.174 101.915 60.220  1.00 63.31  ? 78  TYR O CG    1 
ATOM 7702  C CD1   . TYR H 1 79  ? 156.508 102.323 60.239  1.00 65.75  ? 78  TYR O CD1   1 
ATOM 7703  C CD2   . TYR H 1 79  ? 154.192 102.889 60.072  1.00 61.99  ? 78  TYR O CD2   1 
ATOM 7704  C CE1   . TYR H 1 79  ? 156.851 103.669 60.110  1.00 66.84  ? 78  TYR O CE1   1 
ATOM 7705  C CE2   . TYR H 1 79  ? 154.518 104.226 59.942  1.00 63.52  ? 78  TYR O CE2   1 
ATOM 7706  C CZ    . TYR H 1 79  ? 155.848 104.615 59.963  1.00 65.68  ? 78  TYR O CZ    1 
ATOM 7707  O OH    . TYR H 1 79  ? 156.176 105.947 59.835  1.00 67.47  ? 78  TYR O OH    1 
ATOM 7708  N N     . ARG H 1 80  ? 156.557 99.952  62.880  1.00 72.05  ? 79  ARG O N     1 
ATOM 7709  C CA    . ARG H 1 80  ? 157.648 100.402 63.725  1.00 73.45  ? 79  ARG O CA    1 
ATOM 7710  C C     . ARG H 1 80  ? 158.925 100.525 62.910  1.00 75.95  ? 79  ARG O C     1 
ATOM 7711  O O     . ARG H 1 80  ? 159.254 99.628  62.148  1.00 77.71  ? 79  ARG O O     1 
ATOM 7712  C CB    . ARG H 1 80  ? 157.864 99.424  64.874  1.00 79.81  ? 79  ARG O CB    1 
ATOM 7713  C CG    . ARG H 1 80  ? 157.386 98.010  64.610  1.00 80.08  ? 79  ARG O CG    1 
ATOM 7714  C CD    . ARG H 1 80  ? 156.983 97.328  65.908  1.00 80.49  ? 79  ARG O CD    1 
ATOM 7715  N NE    . ARG H 1 80  ? 157.613 96.023  66.083  1.00 82.89  ? 79  ARG O NE    1 
ATOM 7716  C CZ    . ARG H 1 80  ? 158.185 95.610  67.210  1.00 84.49  ? 79  ARG O CZ    1 
ATOM 7717  N NH1   . ARG H 1 80  ? 158.223 96.399  68.274  1.00 83.71  ? 79  ARG O NH1   1 
ATOM 7718  N NH2   . ARG H 1 80  ? 158.731 94.406  67.275  1.00 87.27  ? 79  ARG O NH2   1 
ATOM 7719  N N     . TYR H 1 81  ? 159.646 101.630 63.068  1.00 101.23 ? 80  TYR O N     1 
ATOM 7720  C CA    . TYR H 1 81  ? 160.873 101.845 62.314  1.00 103.73 ? 80  TYR O CA    1 
ATOM 7721  C C     . TYR H 1 81  ? 161.894 102.155 63.392  1.00 104.72 ? 80  TYR O C     1 
ATOM 7722  O O     . TYR H 1 81  ? 161.523 102.561 64.491  1.00 103.28 ? 80  TYR O O     1 
ATOM 7723  C CB    . TYR H 1 81  ? 160.640 103.086 61.457  1.00 103.74 ? 80  TYR O CB    1 
ATOM 7724  C CG    . TYR H 1 81  ? 160.203 104.281 62.270  1.00 102.56 ? 80  TYR O CG    1 
ATOM 7725  C CD1   . TYR H 1 81  ? 161.105 105.267 62.637  1.00 104.09 ? 80  TYR O CD1   1 
ATOM 7726  C CD2   . TYR H 1 81  ? 158.889 104.412 62.689  1.00 100.13 ? 80  TYR O CD2   1 
ATOM 7727  C CE1   . TYR H 1 81  ? 160.705 106.356 63.395  1.00 103.44 ? 80  TYR O CE1   1 
ATOM 7728  C CE2   . TYR H 1 81  ? 158.482 105.494 63.448  1.00 99.72  ? 80  TYR O CE2   1 
ATOM 7729  C CZ    . TYR H 1 81  ? 159.389 106.468 63.790  1.00 101.74 ? 80  TYR O CZ    1 
ATOM 7730  O OH    . TYR H 1 81  ? 158.976 107.539 64.552  1.00 102.33 ? 80  TYR O OH    1 
ATOM 7731  N N     . VAL H 1 82  ? 163.175 101.978 63.088  1.00 74.20  ? 81  VAL O N     1 
ATOM 7732  C CA    . VAL H 1 82  ? 164.228 102.177 64.092  1.00 75.17  ? 81  VAL O CA    1 
ATOM 7733  C C     . VAL H 1 82  ? 164.606 103.649 64.317  1.00 75.27  ? 81  VAL O C     1 
ATOM 7734  O O     . VAL H 1 82  ? 164.747 104.420 63.358  1.00 76.19  ? 81  VAL O O     1 
ATOM 7735  C CB    . VAL H 1 82  ? 165.496 101.386 63.729  1.00 77.26  ? 81  VAL O CB    1 
ATOM 7736  C CG1   . VAL H 1 82  ? 166.239 101.020 64.972  1.00 77.80  ? 81  VAL O CG1   1 
ATOM 7737  C CG2   . VAL H 1 82  ? 165.124 100.130 62.982  1.00 78.19  ? 81  VAL O CG2   1 
ATOM 7738  N N     . ASP H 1 83  ? 164.772 104.032 65.583  1.00 90.86  ? 82  ASP O N     1 
ATOM 7739  C CA    . ASP H 1 83  ? 165.235 105.381 65.933  1.00 91.52  ? 82  ASP O CA    1 
ATOM 7740  C C     . ASP H 1 83  ? 166.682 105.604 65.477  1.00 93.85  ? 82  ASP O C     1 
ATOM 7741  O O     . ASP H 1 83  ? 167.592 104.900 65.917  1.00 94.93  ? 82  ASP O O     1 
ATOM 7742  C CB    . ASP H 1 83  ? 165.111 105.602 67.451  1.00 90.36  ? 82  ASP O CB    1 
ATOM 7743  C CG    . ASP H 1 83  ? 165.573 106.990 67.898  1.00 92.17  ? 82  ASP O CG    1 
ATOM 7744  O OD1   . ASP H 1 83  ? 165.278 107.372 69.056  1.00 92.51  ? 82  ASP O OD1   1 
ATOM 7745  O OD2   . ASP H 1 83  ? 166.224 107.698 67.099  1.00 93.85  ? 82  ASP O OD2   1 
ATOM 7746  N N     . ALA H 1 84  ? 166.896 106.588 64.606  1.00 98.09  ? 83  ALA O N     1 
ATOM 7747  C CA    . ALA H 1 84  ? 168.239 106.870 64.076  1.00 100.35 ? 83  ALA O CA    1 
ATOM 7748  C C     . ALA H 1 84  ? 169.144 107.632 65.058  1.00 100.84 ? 83  ALA O C     1 
ATOM 7749  O O     . ALA H 1 84  ? 170.154 108.223 64.671  1.00 102.54 ? 83  ALA O O     1 
ATOM 7750  C CB    . ALA H 1 84  ? 168.152 107.611 62.735  1.00 101.27 ? 83  ALA O CB    1 
ATOM 7751  N N     . GLN H 1 85  ? 168.761 107.623 66.327  1.00 78.06  ? 84  GLN O N     1 
ATOM 7752  C CA    . GLN H 1 85  ? 169.588 108.163 67.384  1.00 79.10  ? 84  GLN O CA    1 
ATOM 7753  C C     . GLN H 1 85  ? 169.925 107.012 68.321  1.00 78.29  ? 84  GLN O C     1 
ATOM 7754  O O     . GLN H 1 85  ? 171.046 106.908 68.822  1.00 79.26  ? 84  GLN O O     1 
ATOM 7755  C CB    . GLN H 1 85  ? 168.847 109.273 68.130  1.00 79.29  ? 84  GLN O CB    1 
ATOM 7756  N N     . ASP H 1 86  ? 168.939 106.146 68.548  1.00 74.33  ? 85  ASP O N     1 
ATOM 7757  C CA    . ASP H 1 86  ? 169.130 104.945 69.352  1.00 73.64  ? 85  ASP O CA    1 
ATOM 7758  C C     . ASP H 1 86  ? 168.552 103.739 68.618  1.00 72.12  ? 85  ASP O C     1 
ATOM 7759  O O     . ASP H 1 86  ? 167.366 103.496 68.694  1.00 70.77  ? 85  ASP O O     1 
ATOM 7760  C CB    . ASP H 1 86  ? 168.468 105.107 70.724  1.00 73.49  ? 85  ASP O CB    1 
ATOM 7761  C CG    . ASP H 1 86  ? 169.107 104.224 71.793  1.00 73.91  ? 85  ASP O CG    1 
ATOM 7762  O OD1   . ASP H 1 86  ? 169.654 103.163 71.435  1.00 73.66  ? 85  ASP O OD1   1 
ATOM 7763  O OD2   . ASP H 1 86  ? 169.066 104.584 72.994  1.00 74.78  ? 85  ASP O OD2   1 
ATOM 7764  N N     . THR H 1 87  ? 169.397 102.994 67.908  1.00 72.62  ? 86  THR O N     1 
ATOM 7765  C CA    . THR H 1 87  ? 168.989 101.796 67.170  1.00 71.76  ? 86  THR O CA    1 
ATOM 7766  C C     . THR H 1 87  ? 168.335 100.741 68.057  1.00 70.82  ? 86  THR O C     1 
ATOM 7767  O O     . THR H 1 87  ? 167.653 99.842  67.561  1.00 70.03  ? 86  THR O O     1 
ATOM 7768  C CB    . THR H 1 87  ? 170.193 101.076 66.522  1.00 73.11  ? 86  THR O CB    1 
ATOM 7769  O OG1   . THR H 1 87  ? 171.286 101.979 66.358  1.00 74.72  ? 86  THR O OG1   1 
ATOM 7770  C CG2   . THR H 1 87  ? 169.816 100.490 65.184  1.00 72.98  ? 86  THR O CG2   1 
ATOM 7771  N N     . ARG H 1 88  ? 168.579 100.828 69.362  1.00 71.24  ? 87  ARG O N     1 
ATOM 7772  C CA    . ARG H 1 88  ? 168.017 99.883  70.316  1.00 70.87  ? 87  ARG O CA    1 
ATOM 7773  C C     . ARG H 1 88  ? 166.502 99.851  70.291  1.00 69.48  ? 87  ARG O C     1 
ATOM 7774  O O     . ARG H 1 88  ? 165.894 98.826  70.589  1.00 69.17  ? 87  ARG O O     1 
ATOM 7775  C CB    . ARG H 1 88  ? 168.450 100.240 71.725  1.00 71.84  ? 87  ARG O CB    1 
ATOM 7776  C CG    . ARG H 1 88  ? 169.658 99.516  72.188  1.00 73.13  ? 87  ARG O CG    1 
ATOM 7777  C CD    . ARG H 1 88  ? 170.054 100.026 73.539  1.00 74.21  ? 87  ARG O CD    1 
ATOM 7778  N NE    . ARG H 1 88  ? 169.975 101.475 73.585  1.00 74.40  ? 87  ARG O NE    1 
ATOM 7779  C CZ    . ARG H 1 88  ? 170.639 102.216 74.452  1.00 75.79  ? 87  ARG O CZ    1 
ATOM 7780  N NH1   . ARG H 1 88  ? 171.433 101.632 75.328  1.00 76.89  ? 87  ARG O NH1   1 
ATOM 7781  N NH2   . ARG H 1 88  ? 170.507 103.531 74.433  1.00 76.30  ? 87  ARG O NH2   1 
ATOM 7782  N N     . ARG H 1 89  ? 165.896 100.978 69.950  1.00 80.41  ? 88  ARG O N     1 
ATOM 7783  C CA    . ARG H 1 89  ? 164.456 101.086 70.006  1.00 78.12  ? 88  ARG O CA    1 
ATOM 7784  C C     . ARG H 1 89  ? 163.797 101.122 68.630  1.00 77.51  ? 88  ARG O C     1 
ATOM 7785  O O     . ARG H 1 89  ? 164.374 101.624 67.661  1.00 78.74  ? 88  ARG O O     1 
ATOM 7786  C CB    . ARG H 1 89  ? 164.067 102.312 70.818  1.00 76.24  ? 88  ARG O CB    1 
ATOM 7787  C CG    . ARG H 1 89  ? 164.596 103.599 70.254  1.00 77.00  ? 88  ARG O CG    1 
ATOM 7788  C CD    . ARG H 1 89  ? 164.419 104.729 71.233  1.00 77.53  ? 88  ARG O CD    1 
ATOM 7789  N NE    . ARG H 1 89  ? 165.048 104.417 72.512  1.00 78.27  ? 88  ARG O NE    1 
ATOM 7790  C CZ    . ARG H 1 89  ? 164.380 104.194 73.641  1.00 77.87  ? 88  ARG O CZ    1 
ATOM 7791  N NH1   . ARG H 1 89  ? 163.055 104.255 73.651  1.00 76.64  ? 88  ARG O NH1   1 
ATOM 7792  N NH2   . ARG H 1 89  ? 165.039 103.922 74.764  1.00 78.83  ? 88  ARG O NH2   1 
ATOM 7793  N N     . LYS H 1 90  ? 162.583 100.571 68.569  1.00 65.46  ? 89  LYS O N     1 
ATOM 7794  C CA    . LYS H 1 90  ? 161.745 100.562 67.371  1.00 64.35  ? 89  LYS O CA    1 
ATOM 7795  C C     . LYS H 1 90  ? 160.605 101.550 67.568  1.00 63.58  ? 89  LYS O C     1 
ATOM 7796  O O     . LYS H 1 90  ? 159.766 101.363 68.442  1.00 63.28  ? 89  LYS O O     1 
ATOM 7797  C CB    . LYS H 1 90  ? 161.168 99.162  67.137  1.00 63.87  ? 89  LYS O CB    1 
ATOM 7798  C CG    . LYS H 1 90  ? 162.197 98.052  67.175  1.00 65.03  ? 89  LYS O CG    1 
ATOM 7799  C CD    . LYS H 1 90  ? 161.621 96.733  66.699  1.00 64.98  ? 89  LYS O CD    1 
ATOM 7800  C CE    . LYS H 1 90  ? 162.730 95.700  66.503  1.00 66.56  ? 89  LYS O CE    1 
ATOM 7801  N NZ    . LYS H 1 90  ? 162.284 94.457  65.797  1.00 67.05  ? 89  LYS O NZ    1 
ATOM 7802  N N     . ASN H 1 91  ? 160.569 102.608 66.770  1.00 92.27  ? 90  ASN O N     1 
ATOM 7803  C CA    . ASN H 1 91  ? 159.524 103.611 66.934  1.00 90.85  ? 90  ASN O CA    1 
ATOM 7804  C C     . ASN H 1 91  ? 158.208 103.261 66.232  1.00 89.10  ? 90  ASN O C     1 
ATOM 7805  O O     . ASN H 1 91  ? 158.197 102.791 65.093  1.00 89.08  ? 90  ASN O O     1 
ATOM 7806  C CB    . ASN H 1 91  ? 160.014 104.985 66.491  1.00 92.45  ? 90  ASN O CB    1 
ATOM 7807  C CG    . ASN H 1 91  ? 160.952 105.619 67.486  1.00 94.07  ? 90  ASN O CG    1 
ATOM 7808  O OD1   . ASN H 1 91  ? 161.085 105.147 68.616  1.00 93.87  ? 90  ASN O OD1   1 
ATOM 7809  N ND2   . ASN H 1 91  ? 161.601 106.707 67.079  1.00 95.93  ? 90  ASN O ND2   1 
ATOM 7810  N N     . ILE H 1 92  ? 157.100 103.497 66.928  1.00 63.33  ? 91  ILE O N     1 
ATOM 7811  C CA    . ILE H 1 92  ? 155.780 103.155 66.410  1.00 61.68  ? 91  ILE O CA    1 
ATOM 7812  C C     . ILE H 1 92  ? 155.287 104.200 65.421  1.00 61.72  ? 91  ILE O C     1 
ATOM 7813  O O     . ILE H 1 92  ? 155.368 105.401 65.668  1.00 62.86  ? 91  ILE O O     1 
ATOM 7814  C CB    . ILE H 1 92  ? 154.747 102.988 67.544  1.00 60.87  ? 91  ILE O CB    1 
ATOM 7815  C CG1   . ILE H 1 92  ? 155.274 102.029 68.618  1.00 61.65  ? 91  ILE O CG1   1 
ATOM 7816  C CG2   . ILE H 1 92  ? 153.440 102.469 66.988  1.00 59.55  ? 91  ILE O CG2   1 
ATOM 7817  C CD1   . ILE H 1 92  ? 155.674 100.661 68.091  1.00 61.63  ? 91  ILE O CD1   1 
ATOM 7818  N N     . GLY H 1 93  ? 154.789 103.732 64.287  1.00 64.30  ? 92  GLY O N     1 
ATOM 7819  C CA    . GLY H 1 93  ? 154.287 104.628 63.272  1.00 64.57  ? 92  GLY O CA    1 
ATOM 7820  C C     . GLY H 1 93  ? 152.857 104.350 62.861  1.00 62.79  ? 92  GLY O C     1 
ATOM 7821  O O     . GLY H 1 93  ? 152.514 103.248 62.439  1.00 61.57  ? 92  GLY O O     1 
ATOM 7822  N N     . LEU H 1 94  ? 152.011 105.360 62.999  1.00 81.36  ? 93  LEU O N     1 
ATOM 7823  C CA    . LEU H 1 94  ? 150.660 105.287 62.480  1.00 79.92  ? 93  LEU O CA    1 
ATOM 7824  C C     . LEU H 1 94  ? 150.774 105.201 60.959  1.00 80.12  ? 93  LEU O C     1 
ATOM 7825  O O     . LEU H 1 94  ? 151.240 106.134 60.311  1.00 81.92  ? 93  LEU O O     1 
ATOM 7826  C CB    . LEU H 1 94  ? 149.900 106.544 62.876  1.00 80.73  ? 93  LEU O CB    1 
ATOM 7827  C CG    . LEU H 1 94  ? 148.402 106.541 62.621  1.00 79.38  ? 93  LEU O CG    1 
ATOM 7828  C CD1   . LEU H 1 94  ? 147.705 105.706 63.671  1.00 77.85  ? 93  LEU O CD1   1 
ATOM 7829  C CD2   . LEU H 1 94  ? 147.894 107.966 62.627  1.00 81.09  ? 93  LEU O CD2   1 
ATOM 7830  N N     . THR H 1 95  ? 150.363 104.071 60.398  1.00 81.16  ? 94  THR O N     1 
ATOM 7831  C CA    . THR H 1 95  ? 150.475 103.835 58.960  1.00 81.40  ? 94  THR O CA    1 
ATOM 7832  C C     . THR H 1 95  ? 149.463 104.697 58.195  1.00 81.41  ? 94  THR O C     1 
ATOM 7833  O O     . THR H 1 95  ? 148.624 105.351 58.817  1.00 81.08  ? 94  THR O O     1 
ATOM 7834  C CB    . THR H 1 95  ? 150.291 102.325 58.635  1.00 78.96  ? 94  THR O CB    1 
ATOM 7835  O OG1   . THR H 1 95  ? 150.596 102.076 57.257  1.00 79.57  ? 94  THR O OG1   1 
ATOM 7836  C CG2   . THR H 1 95  ? 148.880 101.858 58.952  1.00 77.15  ? 94  THR O CG2   1 
ATOM 7837  N N     . THR H 1 96  ? 149.486 104.644 56.870  1.00 78.38  ? 95  THR O N     1 
ATOM 7838  C CA    . THR H 1 96  ? 148.583 105.467 56.077  1.00 78.81  ? 95  THR O CA    1 
ATOM 7839  C C     . THR H 1 96  ? 147.130 105.138 56.348  1.00 79.76  ? 95  THR O C     1 
ATOM 7840  O O     . THR H 1 96  ? 146.294 106.026 56.464  1.00 83.50  ? 95  THR O O     1 
ATOM 7841  C CB    . THR H 1 96  ? 148.807 105.249 54.579  1.00 77.72  ? 95  THR O CB    1 
ATOM 7842  O OG1   . THR H 1 96  ? 150.164 105.549 54.247  1.00 78.67  ? 95  THR O OG1   1 
ATOM 7843  C CG2   . THR H 1 96  ? 147.889 106.146 53.786  1.00 80.11  ? 95  THR O CG2   1 
ATOM 7844  N N     . SER H 1 97  ? 146.834 103.851 56.444  1.00 71.99  ? 96  SER O N     1 
ATOM 7845  C CA    . SER H 1 97  ? 145.500 103.401 56.774  1.00 73.03  ? 96  SER O CA    1 
ATOM 7846  C C     . SER H 1 97  ? 145.179 103.884 58.163  1.00 75.09  ? 96  SER O C     1 
ATOM 7847  O O     . SER H 1 97  ? 144.062 104.294 58.450  1.00 78.09  ? 96  SER O O     1 
ATOM 7848  C CB    . SER H 1 97  ? 145.432 101.889 56.718  1.00 71.13  ? 96  SER O CB    1 
ATOM 7849  O OG    . SER H 1 97  ? 146.665 101.376 56.271  1.00 70.79  ? 96  SER O OG    1 
ATOM 7850  N N     . GLY H 1 98  ? 146.176 103.842 59.032  1.00 43.26  ? 97  GLY O N     1 
ATOM 7851  C CA    . GLY H 1 98  ? 145.952 104.217 60.404  1.00 44.95  ? 97  GLY O CA    1 
ATOM 7852  C C     . GLY H 1 98  ? 145.505 105.653 60.440  1.00 48.57  ? 97  GLY O C     1 
ATOM 7853  O O     . GLY H 1 98  ? 144.575 105.994 61.150  1.00 51.31  ? 97  GLY O O     1 
ATOM 7854  N N     . ILE H 1 99  ? 146.137 106.503 59.647  1.00 68.01  ? 98  ILE O N     1 
ATOM 7855  C CA    . ILE H 1 99  ? 145.672 107.891 59.584  1.00 72.55  ? 98  ILE O CA    1 
ATOM 7856  C C     . ILE H 1 99  ? 144.250 107.934 59.040  1.00 75.11  ? 98  ILE O C     1 
ATOM 7857  O O     . ILE H 1 99  ? 143.365 108.582 59.598  1.00 78.62  ? 98  ILE O O     1 
ATOM 7858  C CB    . ILE H 1 99  ? 146.552 108.742 58.651  1.00 73.33  ? 98  ILE O CB    1 
ATOM 7859  C CG1   . ILE H 1 99  ? 148.036 108.541 58.962  1.00 70.34  ? 98  ILE O CG1   1 
ATOM 7860  C CG2   . ILE H 1 99  ? 146.177 110.208 58.759  1.00 77.93  ? 98  ILE O CG2   1 
ATOM 7861  C CD1   . ILE H 1 99  ? 148.949 109.084 57.877  1.00 70.27  ? 98  ILE O CD1   1 
ATOM 7862  N N     . LYS H 1 100 ? 144.048 107.231 57.938  1.00 63.41  ? 99  LYS O N     1 
ATOM 7863  C CA    . LYS H 1 100 ? 142.742 107.126 57.325  1.00 65.49  ? 99  LYS O CA    1 
ATOM 7864  C C     . LYS H 1 100 ? 141.706 106.726 58.366  1.00 67.10  ? 99  LYS O C     1 
ATOM 7865  O O     . LYS H 1 100 ? 140.677 107.388 58.507  1.00 70.54  ? 99  LYS O O     1 
ATOM 7866  C CB    . LYS H 1 100 ? 142.791 106.108 56.190  1.00 63.02  ? 99  LYS O CB    1 
ATOM 7867  C CG    . LYS H 1 100 ? 141.470 105.883 55.492  1.00 64.96  ? 99  LYS O CG    1 
ATOM 7868  C CD    . LYS H 1 100 ? 141.085 107.043 54.602  1.00 67.80  ? 99  LYS O CD    1 
ATOM 7869  C CE    . LYS H 1 100 ? 139.719 106.809 53.991  1.00 69.93  ? 99  LYS O CE    1 
ATOM 7870  N NZ    . LYS H 1 100 ? 139.653 105.510 53.244  1.00 67.32  ? 99  LYS O NZ    1 
ATOM 7871  N N     . LEU H 1 101 ? 141.999 105.662 59.112  1.00 54.74  ? 100 LEU O N     1 
ATOM 7872  C CA    . LEU H 1 101 ? 141.100 105.165 60.161  1.00 56.04  ? 100 LEU O CA    1 
ATOM 7873  C C     . LEU H 1 101 ? 140.781 106.232 61.218  1.00 59.30  ? 100 LEU O C     1 
ATOM 7874  O O     . LEU H 1 101 ? 139.613 106.517 61.497  1.00 62.43  ? 100 LEU O O     1 
ATOM 7875  C CB    . LEU H 1 101 ? 141.681 103.898 60.815  1.00 52.75  ? 100 LEU O CB    1 
ATOM 7876  C CG    . LEU H 1 101 ? 140.842 103.053 61.788  1.00 53.36  ? 100 LEU O CG    1 
ATOM 7877  C CD1   . LEU H 1 101 ? 141.464 101.689 61.989  1.00 49.64  ? 100 LEU O CD1   1 
ATOM 7878  C CD2   . LEU H 1 101 ? 140.724 103.716 63.129  1.00 55.64  ? 100 LEU O CD2   1 
ATOM 7879  N N     . VAL H 1 102 ? 141.810 106.866 61.742  1.00 58.73  ? 101 VAL O N     1 
ATOM 7880  C CA    . VAL H 1 102 ? 141.609 107.832 62.793  1.00 61.62  ? 101 VAL O CA    1 
ATOM 7881  C C     . VAL H 1 102 ? 140.739 108.950 62.279  1.00 65.35  ? 101 VAL O C     1 
ATOM 7882  O O     . VAL H 1 102 ? 139.822 109.400 62.948  1.00 68.55  ? 101 VAL O O     1 
ATOM 7883  C CB    . VAL H 1 102 ? 142.944 108.444 63.201  1.00 60.39  ? 101 VAL O CB    1 
ATOM 7884  C CG1   . VAL H 1 102 ? 142.788 109.266 64.462  1.00 63.10  ? 101 VAL O CG1   1 
ATOM 7885  C CG2   . VAL H 1 102 ? 143.979 107.354 63.382  1.00 56.30  ? 101 VAL O CG2   1 
ATOM 7886  N N     . GLU H 1 103 ? 141.011 109.383 61.064  1.00 81.37  ? 102 GLU O N     1 
ATOM 7887  C CA    . GLU H 1 103 ? 140.277 110.494 60.503  1.00 86.09  ? 102 GLU O CA    1 
ATOM 7888  C C     . GLU H 1 103 ? 138.823 110.122 60.383  1.00 88.19  ? 102 GLU O C     1 
ATOM 7889  O O     . GLU H 1 103 ? 137.943 110.930 60.644  1.00 92.66  ? 102 GLU O O     1 
ATOM 7890  C CB    . GLU H 1 103 ? 140.842 110.860 59.148  1.00 82.71  ? 102 GLU O CB    1 
ATOM 7891  C CG    . GLU H 1 103 ? 142.350 110.802 59.113  1.00 79.56  ? 102 GLU O CG    1 
ATOM 7892  C CD    . GLU H 1 103 ? 142.921 111.728 58.075  1.00 79.98  ? 102 GLU O CD    1 
ATOM 7893  O OE1   . GLU H 1 103 ? 142.867 111.378 56.881  1.00 78.98  ? 102 GLU O OE1   1 
ATOM 7894  O OE2   . GLU H 1 103 ? 143.413 112.804 58.455  1.00 81.41  ? 102 GLU O OE2   1 
ATOM 7895  N N     . ALA H 1 104 ? 138.574 108.877 60.012  1.00 69.80  ? 103 ALA O N     1 
ATOM 7896  C CA    . ALA H 1 104 ? 137.229 108.439 59.725  1.00 71.68  ? 103 ALA O CA    1 
ATOM 7897  C C     . ALA H 1 104 ? 136.421 108.647 60.977  1.00 74.52  ? 103 ALA O C     1 
ATOM 7898  O O     . ALA H 1 104 ? 135.259 109.032 60.929  1.00 77.88  ? 103 ALA O O     1 
ATOM 7899  C CB    . ALA H 1 104 ? 137.234 106.979 59.350  1.00 68.58  ? 103 ALA O CB    1 
ATOM 7900  N N     . PHE H 1 105 ? 137.053 108.380 62.105  1.00 71.99  ? 104 PHE O N     1 
ATOM 7901  C CA    . PHE H 1 105 ? 136.451 108.629 63.401  1.00 74.62  ? 104 PHE O CA    1 
ATOM 7902  C C     . PHE H 1 105 ? 136.284 110.108 63.742  1.00 78.19  ? 104 PHE O C     1 
ATOM 7903  O O     . PHE H 1 105 ? 135.253 110.508 64.261  1.00 81.70  ? 104 PHE O O     1 
ATOM 7904  C CB    . PHE H 1 105 ? 137.263 107.936 64.485  1.00 72.14  ? 104 PHE O CB    1 
ATOM 7905  C CG    . PHE H 1 105 ? 136.956 106.477 64.634  1.00 70.07  ? 104 PHE O CG    1 
ATOM 7906  C CD1   . PHE H 1 105 ? 135.865 106.062 65.363  1.00 72.25  ? 104 PHE O CD1   1 
ATOM 7907  C CD2   . PHE H 1 105 ? 137.770 105.524 64.063  1.00 66.02  ? 104 PHE O CD2   1 
ATOM 7908  C CE1   . PHE H 1 105 ? 135.584 104.724 65.510  1.00 70.43  ? 104 PHE O CE1   1 
ATOM 7909  C CE2   . PHE H 1 105 ? 137.496 104.183 64.208  1.00 64.14  ? 104 PHE O CE2   1 
ATOM 7910  C CZ    . PHE H 1 105 ? 136.401 103.783 64.933  1.00 66.35  ? 104 PHE O CZ    1 
ATOM 7911  N N     . THR H 1 106 ? 137.286 110.927 63.446  1.00 126.04 ? 105 THR O N     1 
ATOM 7912  C CA    . THR H 1 106 ? 137.244 112.312 63.897  1.00 129.28 ? 105 THR O CA    1 
ATOM 7913  C C     . THR H 1 106 ? 136.039 112.949 63.263  1.00 132.90 ? 105 THR O C     1 
ATOM 7914  O O     . THR H 1 106 ? 135.266 113.643 63.910  1.00 136.53 ? 105 THR O O     1 
ATOM 7915  C CB    . THR H 1 106 ? 138.494 113.090 63.450  1.00 129.19 ? 105 THR O CB    1 
ATOM 7916  O OG1   . THR H 1 106 ? 139.637 112.612 64.165  1.00 126.18 ? 105 THR O OG1   1 
ATOM 7917  C CG2   . THR H 1 106 ? 138.334 114.582 63.714  1.00 132.83 ? 105 THR O CG2   1 
ATOM 7918  N N     . SER H 1 107 ? 135.874 112.676 61.984  1.00 110.44 ? 106 SER O N     1 
ATOM 7919  C CA    . SER H 1 107 ? 134.630 113.015 61.282  1.00 113.59 ? 106 SER O CA    1 
ATOM 7920  C C     . SER H 1 107 ? 133.340 112.608 61.993  1.00 116.14 ? 106 SER O C     1 
ATOM 7921  O O     . SER H 1 107 ? 132.505 113.462 62.296  1.00 120.11 ? 106 SER O O     1 
ATOM 7922  C CB    . SER H 1 107 ? 134.627 112.413 59.879  1.00 113.11 ? 106 SER O CB    1 
ATOM 7923  O OG    . SER H 1 107 ? 134.074 111.109 59.900  1.00 111.69 ? 106 SER O OG    1 
ATOM 7924  N N     . ILE H 1 108 ? 133.177 111.307 62.234  1.00 110.45 ? 107 ILE O N     1 
ATOM 7925  C CA    . ILE H 1 108 ? 131.962 110.768 62.846  1.00 112.65 ? 107 ILE O CA    1 
ATOM 7926  C C     . ILE H 1 108 ? 131.574 111.528 64.119  1.00 116.01 ? 107 ILE O C     1 
ATOM 7927  O O     . ILE H 1 108 ? 130.400 111.831 64.351  1.00 119.71 ? 107 ILE O O     1 
ATOM 7928  C CB    . ILE H 1 108 ? 132.114 109.262 63.153  1.00 111.16 ? 107 ILE O CB    1 
ATOM 7929  C CG1   . ILE H 1 108 ? 132.349 108.484 61.864  1.00 108.20 ? 107 ILE O CG1   1 
ATOM 7930  C CG2   . ILE H 1 108 ? 130.881 108.722 63.848  1.00 113.57 ? 107 ILE O CG2   1 
ATOM 7931  C CD1   . ILE H 1 108 ? 131.319 108.755 60.792  1.00 110.58 ? 107 ILE O CD1   1 
ATOM 7932  N N     . PHE H 1 109 ? 132.577 111.849 64.929  1.00 106.45 ? 108 PHE O N     1 
ATOM 7933  C CA    . PHE H 1 109 ? 132.371 112.662 66.116  1.00 109.53 ? 108 PHE O CA    1 
ATOM 7934  C C     . PHE H 1 109 ? 132.146 114.121 65.735  1.00 112.83 ? 108 PHE O C     1 
ATOM 7935  O O     . PHE H 1 109 ? 131.196 114.750 66.204  1.00 116.85 ? 108 PHE O O     1 
ATOM 7936  C CB    . PHE H 1 109 ? 133.569 112.537 67.052  1.00 107.66 ? 108 PHE O CB    1 
ATOM 7937  C CG    . PHE H 1 109 ? 133.718 111.172 67.656  1.00 105.01 ? 108 PHE O CG    1 
ATOM 7938  C CD1   . PHE H 1 109 ? 132.602 110.455 68.060  1.00 106.61 ? 108 PHE O CD1   1 
ATOM 7939  C CD2   . PHE H 1 109 ? 134.971 110.597 67.812  1.00 101.00 ? 108 PHE O CD2   1 
ATOM 7940  C CE1   . PHE H 1 109 ? 132.733 109.195 68.617  1.00 104.25 ? 108 PHE O CE1   1 
ATOM 7941  C CE2   . PHE H 1 109 ? 135.105 109.338 68.367  1.00 98.63  ? 108 PHE O CE2   1 
ATOM 7942  C CZ    . PHE H 1 109 ? 133.985 108.638 68.768  1.00 100.25 ? 108 PHE O CZ    1 
ATOM 7943  N N     . ASP H 1 110 ? 133.019 114.648 64.879  1.00 109.95 ? 109 ASP O N     1 
ATOM 7944  C CA    . ASP H 1 110 ? 132.912 116.030 64.414  1.00 112.82 ? 109 ASP O CA    1 
ATOM 7945  C C     . ASP H 1 110 ? 131.577 116.272 63.720  1.00 116.11 ? 109 ASP O C     1 
ATOM 7946  O O     . ASP H 1 110 ? 131.044 117.380 63.753  1.00 119.83 ? 109 ASP O O     1 
ATOM 7947  C CB    . ASP H 1 110 ? 134.061 116.376 63.466  1.00 110.21 ? 109 ASP O CB    1 
ATOM 7948  N N     . GLU H 1 111 ? 131.041 115.228 63.096  1.00 109.40 ? 110 GLU O N     1 
ATOM 7949  C CA    . GLU H 1 111 ? 129.737 115.310 62.457  1.00 112.41 ? 110 GLU O CA    1 
ATOM 7950  C C     . GLU H 1 111 ? 128.623 115.276 63.495  1.00 115.85 ? 110 GLU O C     1 
ATOM 7951  O O     . GLU H 1 111 ? 127.563 115.859 63.290  1.00 119.70 ? 110 GLU O O     1 
ATOM 7952  C CB    . GLU H 1 111 ? 129.545 114.164 61.462  1.00 109.83 ? 110 GLU O CB    1 
ATOM 7953  N N     . MET H 1 112 ? 128.862 114.594 64.608  1.00 139.78 ? 111 MET O N     1 
ATOM 7954  C CA    . MET H 1 112 ? 127.814 114.406 65.605  1.00 142.45 ? 111 MET O CA    1 
ATOM 7955  C C     . MET H 1 112 ? 127.415 115.682 66.333  1.00 146.82 ? 111 MET O C     1 
ATOM 7956  O O     . MET H 1 112 ? 126.238 115.908 66.594  0.73 151.16 ? 111 MET O O     1 
ATOM 7957  C CB    . MET H 1 112 ? 128.215 113.340 66.618  1.00 140.57 ? 111 MET O CB    1 
ATOM 7958  C CG    . MET H 1 112 ? 127.552 112.004 66.371  1.00 139.33 ? 111 MET O CG    1 
ATOM 7959  S SD    . MET H 1 112 ? 127.766 110.859 67.747  1.00 137.63 ? 111 MET O SD    1 
ATOM 7960  C CE    . MET H 1 112 ? 126.494 109.668 67.334  1.00 138.24 ? 111 MET O CE    1 
ATOM 7961  N N     . GLU H 1 113 ? 128.399 116.505 66.675  1.00 125.49 ? 112 GLU O N     1 
ATOM 7962  C CA    . GLU H 1 113 ? 128.123 117.774 67.341  1.00 129.51 ? 112 GLU O CA    1 
ATOM 7963  C C     . GLU H 1 113 ? 127.415 118.749 66.393  1.00 132.70 ? 112 GLU O C     1 
ATOM 7964  O O     . GLU H 1 113 ? 126.522 119.495 66.803  1.00 137.06 ? 112 GLU O O     1 
ATOM 7965  C CB    . GLU H 1 113 ? 129.412 118.397 67.883  1.00 127.98 ? 112 GLU O CB    1 
ATOM 7966  N N     . GLN H 1 114 ? 127.817 118.732 65.124  1.00 210.18 ? 113 GLN O N     1 
ATOM 7967  C CA    . GLN H 1 114 ? 127.205 119.587 64.112  1.00 213.53 ? 113 GLN O CA    1 
ATOM 7968  C C     . GLN H 1 114 ? 125.793 119.118 63.777  1.00 216.32 ? 113 GLN O C     1 
ATOM 7969  O O     . GLN H 1 114 ? 124.912 119.931 63.491  1.00 220.16 ? 113 GLN O O     1 
ATOM 7970  C CB    . GLN H 1 114 ? 128.062 119.624 62.846  1.00 205.28 ? 113 GLN O CB    1 
ATOM 7971  N N     . THR H 1 115 ? 125.583 117.805 63.811  1.00 120.92 ? 114 THR O N     1 
ATOM 7972  C CA    . THR H 1 115 ? 124.252 117.243 63.597  1.00 123.15 ? 114 THR O CA    1 
ATOM 7973  C C     . THR H 1 115 ? 123.341 117.479 64.810  1.00 127.11 ? 114 THR O C     1 
ATOM 7974  O O     . THR H 1 115 ? 122.114 117.433 64.697  1.00 130.37 ? 114 THR O O     1 
ATOM 7975  C CB    . THR H 1 115 ? 124.304 115.739 63.265  1.00 119.52 ? 114 THR O CB    1 
ATOM 7976  N N     . LEU H 1 116 ? 123.946 117.741 65.966  1.00 169.83 ? 115 LEU O N     1 
ATOM 7977  C CA    . LEU H 1 116 ? 123.185 118.046 67.177  1.00 172.80 ? 115 LEU O CA    1 
ATOM 7978  C C     . LEU H 1 116 ? 122.759 119.510 67.211  1.00 178.18 ? 115 LEU O C     1 
ATOM 7979  O O     . LEU H 1 116 ? 121.603 119.825 67.506  1.00 183.25 ? 115 LEU O O     1 
ATOM 7980  C CB    . LEU H 1 116 ? 123.999 117.714 68.429  1.00 171.32 ? 115 LEU O CB    1 
ATOM 7981  N N     . VAL H 1 117 ? 123.704 120.396 66.911  1.00 183.98 ? 116 VAL O N     1 
ATOM 7982  C CA    . VAL H 1 117 ? 123.444 121.831 66.877  1.00 187.79 ? 116 VAL O CA    1 
ATOM 7983  C C     . VAL H 1 117 ? 122.348 122.170 65.870  1.00 190.79 ? 116 VAL O C     1 
ATOM 7984  O O     . VAL H 1 117 ? 121.519 123.050 66.111  1.00 195.54 ? 116 VAL O O     1 
ATOM 7985  C CB    . VAL H 1 117 ? 124.715 122.622 66.521  1.00 185.35 ? 116 VAL O CB    1 
ATOM 7986  N N     . SER H 1 118 ? 122.350 121.467 64.741  1.00 179.76 ? 117 SER O N     1 
ATOM 7987  C CA    . SER H 1 118 ? 121.308 121.637 63.736  1.00 182.73 ? 117 SER O CA    1 
ATOM 7988  C C     . SER H 1 118 ? 119.956 121.173 64.277  1.00 185.72 ? 117 SER O C     1 
ATOM 7989  O O     . SER H 1 118 ? 118.929 121.818 64.053  1.00 190.47 ? 117 SER O O     1 
ATOM 7990  C CB    . SER H 1 118 ? 121.664 120.864 62.466  1.00 179.70 ? 117 SER O CB    1 
ATOM 7991  N N     . GLN H 1 119 ? 119.971 120.055 65.000  1.00 164.59 ? 118 GLN O N     1 
ATOM 7992  C CA    . GLN H 1 119 ? 118.759 119.468 65.560  1.00 167.08 ? 118 GLN O CA    1 
ATOM 7993  C C     . GLN H 1 119 ? 118.064 120.412 66.538  1.00 173.04 ? 118 GLN O C     1 
ATOM 7994  O O     . GLN H 1 119 ? 116.834 120.496 66.567  1.00 177.49 ? 118 GLN O O     1 
ATOM 7995  C CB    . GLN H 1 119 ? 119.083 118.145 66.257  1.00 163.73 ? 118 GLN O CB    1 
ATOM 7996  N N     . LEU H 1 120 ? 118.859 121.121 67.335  1.00 198.15 ? 119 LEU O N     1 
ATOM 7997  C CA    . LEU H 1 120 ? 118.328 122.063 68.316  1.00 197.90 ? 119 LEU O CA    1 
ATOM 7998  C C     . LEU H 1 120 ? 119.019 123.423 68.213  1.00 201.43 ? 119 LEU O C     1 
ATOM 7999  O O     . LEU H 1 120 ? 120.234 123.519 68.387  1.00 199.40 ? 119 LEU O O     1 
ATOM 8000  C CB    . LEU H 1 120 ? 118.465 121.496 69.731  1.00 191.89 ? 119 LEU O CB    1 
ATOM 8001  N N     . SER H 1 121 ? 118.221 124.458 67.941  1.00 220.36 ? 120 SER O N     1 
ATOM 8002  C CA    . SER H 1 121 ? 118.685 125.831 67.700  1.00 224.78 ? 120 SER O CA    1 
ATOM 8003  C C     . SER H 1 121 ? 119.902 126.265 68.519  1.00 222.36 ? 120 SER O C     1 
ATOM 8004  O O     . SER H 1 121 ? 119.975 126.009 69.719  1.00 218.43 ? 120 SER O O     1 
ATOM 8005  C CB    . SER H 1 121 ? 117.538 126.821 67.920  1.00 228.21 ? 120 SER O CB    1 
ATOM 8006  N N     . GLU H 1 122 ? 120.839 126.935 67.851  1.00 227.31 ? 121 GLU O N     1 
ATOM 8007  C CA    . GLU H 1 122 ? 122.143 127.283 68.420  1.00 225.20 ? 121 GLU O CA    1 
ATOM 8008  C C     . GLU H 1 122 ? 122.094 128.088 69.720  1.00 224.35 ? 121 GLU O C     1 
ATOM 8009  O O     . GLU H 1 122 ? 122.791 127.757 70.680  1.00 220.29 ? 121 GLU O O     1 
ATOM 8010  C CB    . GLU H 1 122 ? 122.989 128.027 67.385  1.00 230.34 ? 121 GLU O CB    1 
ATOM 8011  N N     . GLU H 1 123 ? 121.291 129.147 69.749  1.00 174.45 ? 122 GLU O N     1 
ATOM 8012  C CA    . GLU H 1 123 ? 121.170 129.971 70.949  1.00 174.29 ? 122 GLU O CA    1 
ATOM 8013  C C     . GLU H 1 123 ? 120.590 129.167 72.107  1.00 169.03 ? 122 GLU O C     1 
ATOM 8014  O O     . GLU H 1 123 ? 121.070 129.255 73.237  1.00 165.91 ? 122 GLU O O     1 
ATOM 8015  C CB    . GLU H 1 123 ? 120.309 131.206 70.682  1.00 180.59 ? 122 GLU O CB    1 
ATOM 8016  N N     . GLU H 1 124 ? 119.556 128.382 71.816  1.00 173.26 ? 123 GLU O N     1 
ATOM 8017  C CA    . GLU H 1 124 ? 118.968 127.497 72.813  1.00 168.35 ? 123 GLU O CA    1 
ATOM 8018  C C     . GLU H 1 124 ? 119.888 126.307 73.083  1.00 162.64 ? 123 GLU O C     1 
ATOM 8019  O O     . GLU H 1 124 ? 119.814 125.689 74.143  1.00 158.11 ? 123 GLU O O     1 
ATOM 8020  C CB    . GLU H 1 124 ? 117.584 127.017 72.368  1.00 169.65 ? 123 GLU O CB    1 
ATOM 8021  N N     . ASN H 1 125 ? 120.757 125.993 72.125  1.00 224.43 ? 124 ASN O N     1 
ATOM 8022  C CA    . ASN H 1 125 ? 121.731 124.916 72.300  1.00 219.46 ? 124 ASN O CA    1 
ATOM 8023  C C     . ASN H 1 125 ? 122.823 125.283 73.301  1.00 215.86 ? 124 ASN O C     1 
ATOM 8024  O O     . ASN H 1 125 ? 123.285 124.433 74.069  1.00 210.45 ? 124 ASN O O     1 
ATOM 8025  C CB    . ASN H 1 125 ? 122.362 124.524 70.962  1.00 219.77 ? 124 ASN O CB    1 
ATOM 8026  N N     . GLU H 1 126 ? 123.235 126.549 73.281  1.00 177.04 ? 125 GLU O N     1 
ATOM 8027  C CA    . GLU H 1 126 ? 124.220 127.058 74.231  1.00 175.76 ? 125 GLU O CA    1 
ATOM 8028  C C     . GLU H 1 126 ? 123.654 127.022 75.648  1.00 172.60 ? 125 GLU O C     1 
ATOM 8029  O O     . GLU H 1 126 ? 124.393 126.853 76.619  1.00 169.34 ? 125 GLU O O     1 
ATOM 8030  C CB    . GLU H 1 126 ? 124.638 128.484 73.867  1.00 181.56 ? 125 GLU O CB    1 
ATOM 8031  N N     . GLN H 1 127 ? 122.337 127.178 75.754  1.00 209.78 ? 126 GLN O N     1 
ATOM 8032  C CA    . GLN H 1 127 ? 121.652 127.139 77.042  1.00 208.41 ? 126 GLN O CA    1 
ATOM 8033  C C     . GLN H 1 127 ? 121.539 125.712 77.581  1.00 203.21 ? 126 GLN O C     1 
ATOM 8034  O O     . GLN H 1 127 ? 121.641 125.491 78.787  1.00 199.38 ? 126 GLN O O     1 
ATOM 8035  C CB    . GLN H 1 127 ? 120.263 127.774 76.932  1.00 212.29 ? 126 GLN O CB    1 
ATOM 8036  N N     . MET H 1 128 ? 121.324 124.749 76.688  0.89 160.72 ? 127 MET O N     1 
ATOM 8037  C CA    . MET H 1 128 ? 121.254 123.344 77.076  1.00 156.74 ? 127 MET O CA    1 
ATOM 8038  C C     . MET H 1 128 ? 122.596 122.896 77.635  1.00 151.14 ? 127 MET O C     1 
ATOM 8039  O O     . MET H 1 128 ? 122.657 122.263 78.689  1.00 146.55 ? 127 MET O O     1 
ATOM 8040  C CB    . MET H 1 128 ? 120.867 122.464 75.883  1.00 160.41 ? 127 MET O CB    1 
ATOM 8041  N N     . LYS H 1 129 ? 123.668 123.246 76.925  1.00 142.66 ? 128 LYS O N     1 
ATOM 8042  C CA    . LYS H 1 129 ? 125.028 122.905 77.338  1.00 139.46 ? 128 LYS O CA    1 
ATOM 8043  C C     . LYS H 1 129 ? 125.396 123.531 78.688  1.00 138.44 ? 128 LYS O C     1 
ATOM 8044  O O     . LYS H 1 129 ? 126.020 122.886 79.533  1.00 134.44 ? 128 LYS O O     1 
ATOM 8045  C CB    . LYS H 1 129 ? 126.039 123.311 76.262  1.00 141.82 ? 128 LYS O CB    1 
ATOM 8046  N N     . ALA H 1 130 ? 125.003 124.786 78.885  1.00 184.39 ? 129 ALA O N     1 
ATOM 8047  C CA    . ALA H 1 130 ? 125.261 125.477 80.145  1.00 184.21 ? 129 ALA O CA    1 
ATOM 8048  C C     . ALA H 1 130 ? 124.495 124.816 81.284  1.00 180.86 ? 129 ALA O C     1 
ATOM 8049  O O     . ALA H 1 130 ? 124.939 124.820 82.433  1.00 179.30 ? 129 ALA O O     1 
ATOM 8050  C CB    . ALA H 1 130 ? 124.886 126.944 80.033  1.00 189.71 ? 129 ALA O CB    1 
ATOM 8051  N N     . ASN H 1 131 ? 123.339 124.247 80.954  1.00 176.42 ? 130 ASN O N     1 
ATOM 8052  C CA    . ASN H 1 131 ? 122.525 123.539 81.934  1.00 172.60 ? 130 ASN O CA    1 
ATOM 8053  C C     . ASN H 1 131 ? 122.958 122.080 82.065  1.00 167.61 ? 130 ASN O C     1 
ATOM 8054  O O     . ASN H 1 131 ? 122.750 121.451 83.103  1.00 164.68 ? 130 ASN O O     1 
ATOM 8055  C CB    . ASN H 1 131 ? 121.043 123.633 81.567  1.00 174.85 ? 130 ASN O CB    1 
ATOM 8056  N N     . LEU H 1 132 ? 123.564 121.550 81.006  1.00 157.11 ? 131 LEU O N     1 
ATOM 8057  C CA    . LEU H 1 132 ? 124.108 120.197 81.036  1.00 152.41 ? 131 LEU O CA    1 
ATOM 8058  C C     . LEU H 1 132 ? 125.278 120.121 82.014  1.00 150.43 ? 131 LEU O C     1 
ATOM 8059  O O     . LEU H 1 132 ? 125.507 119.089 82.647  1.00 146.93 ? 131 LEU O O     1 
ATOM 8060  C CB    . LEU H 1 132 ? 124.552 119.755 79.639  1.00 152.99 ? 131 LEU O CB    1 
ATOM 8061  N N     . THR H 1 133 ? 126.013 121.223 82.137  1.00 152.55 ? 132 THR O N     1 
ATOM 8062  C CA    . THR H 1 133 ? 127.132 121.299 83.069  1.00 150.55 ? 132 THR O CA    1 
ATOM 8063  C C     . THR H 1 133 ? 126.638 121.277 84.512  1.00 148.91 ? 132 THR O C     1 
ATOM 8064  O O     . THR H 1 133 ? 127.273 120.691 85.388  1.00 145.76 ? 132 THR O O     1 
ATOM 8065  C CB    . THR H 1 133 ? 127.973 122.572 82.842  1.00 153.93 ? 132 THR O CB    1 
ATOM 8066  N N     . LYS H 1 134 ? 125.496 121.911 84.752  1.00 172.22 ? 133 LYS O N     1 
ATOM 8067  C CA    . LYS H 1 134 ? 124.941 122.000 86.098  1.00 170.98 ? 133 LYS O CA    1 
ATOM 8068  C C     . LYS H 1 134 ? 124.410 120.657 86.596  1.00 167.37 ? 133 LYS O C     1 
ATOM 8069  O O     . LYS H 1 134 ? 124.540 120.326 87.776  1.00 165.43 ? 133 LYS O O     1 
ATOM 8070  C CB    . LYS H 1 134 ? 123.835 123.055 86.149  1.00 173.77 ? 133 LYS O CB    1 
ATOM 8071  N N     . MET H 1 135 ? 123.805 119.894 85.690  1.00 136.93 ? 134 MET O N     1 
ATOM 8072  C CA    . MET H 1 135 ? 123.293 118.568 86.011  0.77 132.96 ? 134 MET O CA    1 
ATOM 8073  C C     . MET H 1 135 ? 124.432 117.654 86.460  1.00 129.04 ? 134 MET O C     1 
ATOM 8074  O O     . MET H 1 135 ? 124.329 116.963 87.473  0.32 126.03 ? 134 MET O O     1 
ATOM 8075  C CB    . MET H 1 135 ? 122.608 117.961 84.783  1.00 132.48 ? 134 MET O CB    1 
ATOM 8076  C CG    . MET H 1 135 ? 121.498 118.807 84.164  1.00 136.39 ? 134 MET O CG    1 
ATOM 8077  S SD    . MET H 1 135 ? 119.849 118.399 84.782  1.00 135.97 ? 134 MET O SD    1 
ATOM 8078  C CE    . MET H 1 135 ? 118.897 118.430 83.259  1.00 139.36 ? 134 MET O CE    1 
ATOM 8079  N N     . LEU H 1 136 ? 125.517 117.664 85.689  1.00 136.64 ? 135 LEU O N     1 
ATOM 8080  C CA    . LEU H 1 136 ? 126.680 116.813 85.941  1.00 133.18 ? 135 LEU O CA    1 
ATOM 8081  C C     . LEU H 1 136 ? 127.377 117.158 87.255  1.00 133.74 ? 135 LEU O C     1 
ATOM 8082  O O     . LEU H 1 136 ? 127.802 116.269 87.996  1.00 131.20 ? 135 LEU O O     1 
ATOM 8083  C CB    . LEU H 1 136 ? 127.673 116.906 84.774  1.00 133.52 ? 135 LEU O CB    1 
ATOM 8084  N N     . SER H 1 137 ? 127.498 118.454 87.531  1.00 151.58 ? 136 SER O N     1 
ATOM 8085  C CA    . SER H 1 137 ? 128.067 118.923 88.789  1.00 151.32 ? 136 SER O CA    1 
ATOM 8086  C C     . SER H 1 137 ? 127.202 118.451 89.957  1.00 149.66 ? 136 SER O C     1 
ATOM 8087  O O     . SER H 1 137 ? 127.712 118.091 91.020  1.00 148.19 ? 136 SER O O     1 
ATOM 8088  C CB    . SER H 1 137 ? 128.184 120.448 88.787  1.00 154.55 ? 136 SER O CB    1 
ATOM 8089  N N     . SER H 1 138 ? 125.889 118.450 89.742  1.00 153.06 ? 137 SER O N     1 
ATOM 8090  C CA    . SER H 1 138 ? 124.952 117.931 90.725  1.00 151.82 ? 137 SER O CA    1 
ATOM 8091  C C     . SER H 1 138 ? 125.200 116.443 90.912  1.00 148.16 ? 137 SER O C     1 
ATOM 8092  O O     . SER H 1 138 ? 125.022 115.907 92.006  1.00 146.51 ? 137 SER O O     1 
ATOM 8093  C CB    . SER H 1 138 ? 123.511 118.176 90.279  1.00 153.25 ? 137 SER O CB    1 
ATOM 8094  N N     . LEU H 1 139 ? 125.617 115.777 89.838  1.00 162.49 ? 138 LEU O N     1 
ATOM 8095  C CA    . LEU H 1 139 ? 125.961 114.360 89.906  1.00 158.78 ? 138 LEU O CA    1 
ATOM 8096  C C     . LEU H 1 139 ? 127.353 114.176 90.501  1.00 157.10 ? 138 LEU O C     1 
ATOM 8097  O O     . LEU H 1 139 ? 127.780 113.050 90.756  1.00 153.71 ? 138 LEU O O     1 
ATOM 8098  C CB    . LEU H 1 139 ? 125.885 113.712 88.522  1.00 158.50 ? 138 LEU O CB    1 
ATOM 8099  N N     . GLN H 1 140 ? 128.049 115.294 90.717  1.00 146.73 ? 139 GLN O N     1 
ATOM 8100  C CA    . GLN H 1 140 ? 129.368 115.305 91.353  1.00 145.66 ? 139 GLN O CA    1 
ATOM 8101  C C     . GLN H 1 140 ? 130.391 114.466 90.594  1.00 143.61 ? 139 GLN O C     1 
ATOM 8102  O O     . GLN H 1 140 ? 130.397 114.444 89.364  1.00 144.29 ? 139 GLN O O     1 
ATOM 8103  C CB    . GLN H 1 140 ? 129.275 114.843 92.813  1.00 143.62 ? 139 GLN O CB    1 
ATOM 8104  O "O5'" . DA  I 2 1   ? 82.599  130.315 58.721  1.00 123.42 ? 1   DA  E "O5'" 1 
ATOM 8105  C "C5'" . DA  I 2 1   ? 83.942  130.788 58.662  1.00 125.62 ? 1   DA  E "C5'" 1 
ATOM 8106  C "C4'" . DA  I 2 1   ? 84.929  129.643 58.806  1.00 124.41 ? 1   DA  E "C4'" 1 
ATOM 8107  O "O4'" . DA  I 2 1   ? 85.560  129.684 60.117  1.00 121.95 ? 1   DA  E "O4'" 1 
ATOM 8108  C "C3'" . DA  I 2 1   ? 84.331  128.244 58.683  1.00 122.04 ? 1   DA  E "C3'" 1 
ATOM 8109  O "O3'" . DA  I 2 1   ? 85.346  127.383 58.190  1.00 123.12 ? 1   DA  E "O3'" 1 
ATOM 8110  C "C2'" . DA  I 2 1   ? 84.008  127.946 60.142  1.00 117.99 ? 1   DA  E "C2'" 1 
ATOM 8111  C "C1'" . DA  I 2 1   ? 85.310  128.443 60.765  1.00 118.36 ? 1   DA  E "C1'" 1 
ATOM 8112  N N9    . DA  I 2 1   ? 85.312  128.595 62.227  1.00 115.52 ? 1   DA  E N9    1 
ATOM 8113  C C8    . DA  I 2 1   ? 84.664  129.554 62.963  1.00 114.86 ? 1   DA  E C8    1 
ATOM 8114  N N7    . DA  I 2 1   ? 84.852  129.458 64.256  1.00 112.44 ? 1   DA  E N7    1 
ATOM 8115  C C5    . DA  I 2 1   ? 85.685  128.361 64.370  1.00 111.48 ? 1   DA  E C5    1 
ATOM 8116  C C6    . DA  I 2 1   ? 86.250  127.739 65.490  1.00 109.32 ? 1   DA  E C6    1 
ATOM 8117  N N6    . DA  I 2 1   ? 86.014  128.200 66.720  1.00 107.68 ? 1   DA  E N6    1 
ATOM 8118  N N1    . DA  I 2 1   ? 87.041  126.658 65.294  1.00 109.22 ? 1   DA  E N1    1 
ATOM 8119  C C2    . DA  I 2 1   ? 87.247  126.233 64.040  1.00 111.12 ? 1   DA  E C2    1 
ATOM 8120  N N3    . DA  I 2 1   ? 86.765  126.739 62.904  1.00 113.35 ? 1   DA  E N3    1 
ATOM 8121  C C4    . DA  I 2 1   ? 85.984  127.810 63.140  1.00 113.37 ? 1   DA  E C4    1 
ATOM 8122  P P     . DT  I 2 2   ? 85.019  125.876 57.727  1.00 101.35 ? 2   DT  E P     1 
ATOM 8123  O OP1   . DT  I 2 2   ? 85.657  125.732 56.404  1.00 105.11 ? 2   DT  E OP1   1 
ATOM 8124  O OP2   . DT  I 2 2   ? 83.575  125.551 57.899  1.00 98.88  ? 2   DT  E OP2   1 
ATOM 8125  O "O5'" . DT  I 2 2   ? 85.872  124.967 58.725  1.00 98.21  ? 2   DT  E "O5'" 1 
ATOM 8126  C "C5'" . DT  I 2 2   ? 85.648  124.899 60.139  1.00 94.72  ? 2   DT  E "C5'" 1 
ATOM 8127  C "C4'" . DT  I 2 2   ? 86.014  123.509 60.621  1.00 92.67  ? 2   DT  E "C4'" 1 
ATOM 8128  O "O4'" . DT  I 2 2   ? 85.990  123.459 62.057  1.00 89.65  ? 2   DT  E "O4'" 1 
ATOM 8129  C "C3'" . DT  I 2 2   ? 85.031  122.424 60.232  1.00 91.42  ? 2   DT  E "C3'" 1 
ATOM 8130  O "O3'" . DT  I 2 2   ? 85.698  121.186 60.390  1.00 90.69  ? 2   DT  E "O3'" 1 
ATOM 8131  C "C2'" . DT  I 2 2   ? 83.905  122.687 61.232  1.00 88.47  ? 2   DT  E "C2'" 1 
ATOM 8132  C "C1'" . DT  I 2 2   ? 84.704  123.049 62.481  1.00 87.12  ? 2   DT  E "C1'" 1 
ATOM 8133  N N1    . DT  I 2 2   ? 84.185  124.162 63.325  1.00 86.16  ? 2   DT  E N1    1 
ATOM 8134  C C2    . DT  I 2 2   ? 84.635  124.204 64.627  1.00 84.36  ? 2   DT  E C2    1 
ATOM 8135  O O2    . DT  I 2 2   ? 85.411  123.374 65.084  1.00 83.55  ? 2   DT  E O2    1 
ATOM 8136  N N3    . DT  I 2 2   ? 84.144  125.252 65.369  1.00 83.74  ? 2   DT  E N3    1 
ATOM 8137  C C4    . DT  I 2 2   ? 83.268  126.239 64.954  1.00 84.75  ? 2   DT  E C4    1 
ATOM 8138  O O4    . DT  I 2 2   ? 82.883  127.134 65.704  1.00 84.24  ? 2   DT  E O4    1 
ATOM 8139  C C5    . DT  I 2 2   ? 82.846  126.136 63.576  1.00 86.67  ? 2   DT  E C5    1 
ATOM 8140  C C7    . DT  I 2 2   ? 81.898  127.159 63.025  1.00 88.13  ? 2   DT  E C7    1 
ATOM 8141  C C6    . DT  I 2 2   ? 83.318  125.119 62.830  1.00 87.28  ? 2   DT  E C6    1 
ATOM 8142  P P     . DT  I 2 3   ? 84.852  119.855 60.675  1.00 83.31  ? 3   DT  E P     1 
ATOM 8143  O OP1   . DT  I 2 3   ? 85.614  118.646 60.264  1.00 84.12  ? 3   DT  E OP1   1 
ATOM 8144  O OP2   . DT  I 2 3   ? 83.490  120.066 60.126  1.00 82.89  ? 3   DT  E OP2   1 
ATOM 8145  O "O5'" . DT  I 2 3   ? 84.780  119.830 62.269  1.00 79.96  ? 3   DT  E "O5'" 1 
ATOM 8146  C "C5'" . DT  I 2 3   ? 86.015  119.716 62.970  1.00 79.83  ? 3   DT  E "C5'" 1 
ATOM 8147  C "C4'" . DT  I 2 3   ? 85.823  119.187 64.384  1.00 76.85  ? 3   DT  E "C4'" 1 
ATOM 8148  O "O4'" . DT  I 2 3   ? 85.152  120.188 65.180  1.00 75.58  ? 3   DT  E "O4'" 1 
ATOM 8149  C "C3'" . DT  I 2 3   ? 85.025  117.907 64.560  1.00 74.93  ? 3   DT  E "C3'" 1 
ATOM 8150  O "O3'" . DT  I 2 3   ? 85.688  117.213 65.585  1.00 73.62  ? 3   DT  E "O3'" 1 
ATOM 8151  C "C2'" . DT  I 2 3   ? 83.644  118.431 64.957  1.00 73.31  ? 3   DT  E "C2'" 1 
ATOM 8152  C "C1'" . DT  I 2 3   ? 84.006  119.656 65.786  1.00 73.18  ? 3   DT  E "C1'" 1 
ATOM 8153  N N1    . DT  I 2 3   ? 83.104  120.829 65.771  1.00 73.26  ? 3   DT  E N1    1 
ATOM 8154  C C2    . DT  I 2 3   ? 83.028  121.578 66.921  1.00 72.09  ? 3   DT  E C2    1 
ATOM 8155  O O2    . DT  I 2 3   ? 83.640  121.291 67.934  1.00 70.98  ? 3   DT  E O2    1 
ATOM 8156  N N3    . DT  I 2 3   ? 82.199  122.664 66.852  1.00 72.43  ? 3   DT  E N3    1 
ATOM 8157  C C4    . DT  I 2 3   ? 81.468  123.070 65.755  1.00 73.88  ? 3   DT  E C4    1 
ATOM 8158  O O4    . DT  I 2 3   ? 80.746  124.061 65.774  1.00 74.27  ? 3   DT  E O4    1 
ATOM 8159  C C5    . DT  I 2 3   ? 81.604  122.248 64.579  1.00 75.08  ? 3   DT  E C5    1 
ATOM 8160  C C7    . DT  I 2 3   ? 80.843  122.608 63.339  1.00 76.90  ? 3   DT  E C7    1 
ATOM 8161  C C6    . DT  I 2 3   ? 82.413  121.178 64.633  1.00 74.73  ? 3   DT  E C6    1 
ATOM 8162  P P     . DT  I 2 4   ? 85.146  115.787 66.096  1.00 65.19  ? 4   DT  E P     1 
ATOM 8163  O OP1   . DT  I 2 4   ? 86.232  114.804 65.876  1.00 66.15  ? 4   DT  E OP1   1 
ATOM 8164  O OP2   . DT  I 2 4   ? 83.762  115.556 65.578  1.00 64.48  ? 4   DT  E OP2   1 
ATOM 8165  O "O5'" . DT  I 2 4   ? 85.039  115.975 67.689  1.00 62.93  ? 4   DT  E "O5'" 1 
ATOM 8166  C "C5'" . DT  I 2 4   ? 84.630  117.240 68.228  1.00 62.45  ? 4   DT  E "C5'" 1 
ATOM 8167  C "C4'" . DT  I 2 4   ? 84.247  117.110 69.688  1.00 60.28  ? 4   DT  E "C4'" 1 
ATOM 8168  O "O4'" . DT  I 2 4   ? 83.308  118.162 70.012  1.00 59.68  ? 4   DT  E "O4'" 1 
ATOM 8169  C "C3'" . DT  I 2 4   ? 83.454  115.875 70.017  1.00 58.69  ? 4   DT  E "C3'" 1 
ATOM 8170  O "O3'" . DT  I 2 4   ? 83.131  115.888 71.375  1.00 57.05  ? 4   DT  E "O3'" 1 
ATOM 8171  C "C2'" . DT  I 2 4   ? 82.208  116.274 69.260  1.00 58.71  ? 4   DT  E "C2'" 1 
ATOM 8172  C "C1'" . DT  I 2 4   ? 82.018  117.632 69.910  1.00 58.52  ? 4   DT  E "C1'" 1 
ATOM 8173  N N1    . DT  I 2 4   ? 81.257  118.545 69.089  1.00 59.40  ? 4   DT  E N1    1 
ATOM 8174  C C2    . DT  I 2 4   ? 80.764  119.673 69.674  1.00 59.10  ? 4   DT  E C2    1 
ATOM 8175  O O2    . DT  I 2 4   ? 80.950  119.941 70.834  1.00 58.16  ? 4   DT  E O2    1 
ATOM 8176  N N3    . DT  I 2 4   ? 80.044  120.478 68.846  1.00 60.15  ? 4   DT  E N3    1 
ATOM 8177  C C4    . DT  I 2 4   ? 79.793  120.259 67.513  1.00 61.49  ? 4   DT  E C4    1 
ATOM 8178  O O4    . DT  I 2 4   ? 79.143  121.047 66.847  1.00 62.58  ? 4   DT  E O4    1 
ATOM 8179  C C5    . DT  I 2 4   ? 80.343  119.049 66.966  1.00 61.74  ? 4   DT  E C5    1 
ATOM 8180  C C7    . DT  I 2 4   ? 80.124  118.710 65.532  1.00 63.37  ? 4   DT  E C7    1 
ATOM 8181  C C6    . DT  I 2 4   ? 81.046  118.248 67.765  1.00 60.68  ? 4   DT  E C6    1 
ATOM 8182  P P     . DA  I 2 5   ? 83.193  114.524 72.224  1.00 46.44  ? 5   DA  E P     1 
ATOM 8183  O OP1   . DA  I 2 5   ? 84.640  114.486 72.553  1.00 47.32  ? 5   DA  E OP1   1 
ATOM 8184  O OP2   . DA  I 2 5   ? 82.507  113.377 71.539  1.00 46.18  ? 5   DA  E OP2   1 
ATOM 8185  O "O5'" . DA  I 2 5   ? 82.251  114.787 73.508  1.00 44.79  ? 5   DA  E "O5'" 1 
ATOM 8186  C "C5'" . DA  I 2 5   ? 82.411  115.992 74.245  1.00 44.80  ? 5   DA  E "C5'" 1 
ATOM 8187  C "C4'" . DA  I 2 5   ? 81.168  116.328 75.048  1.00 43.63  ? 5   DA  E "C4'" 1 
ATOM 8188  O "O4'" . DA  I 2 5   ? 80.343  117.253 74.311  1.00 44.04  ? 5   DA  E "O4'" 1 
ATOM 8189  C "C3'" . DA  I 2 5   ? 80.290  115.157 75.441  1.00 42.49  ? 5   DA  E "C3'" 1 
ATOM 8190  O "O3'" . DA  I 2 5   ? 79.858  115.364 76.780  1.00 41.71  ? 5   DA  E "O3'" 1 
ATOM 8191  C "C2'" . DA  I 2 5   ? 79.153  115.255 74.436  1.00 42.54  ? 5   DA  E "C2'" 1 
ATOM 8192  C "C1'" . DA  I 2 5   ? 79.051  116.746 74.129  1.00 43.29  ? 5   DA  E "C1'" 1 
ATOM 8193  N N9    . DA  I 2 5   ? 78.710  117.032 72.745  1.00 44.24  ? 5   DA  E N9    1 
ATOM 8194  C C8    . DA  I 2 5   ? 79.187  116.338 71.686  1.00 45.01  ? 5   DA  E C8    1 
ATOM 8195  N N7    . DA  I 2 5   ? 78.737  116.783 70.544  1.00 46.02  ? 5   DA  E N7    1 
ATOM 8196  C C5    . DA  I 2 5   ? 77.926  117.845 70.873  1.00 45.87  ? 5   DA  E C5    1 
ATOM 8197  C C6    . DA  I 2 5   ? 77.176  118.728 70.081  1.00 46.82  ? 5   DA  E C6    1 
ATOM 8198  N N6    . DA  I 2 5   ? 77.141  118.648 68.745  1.00 48.15  ? 5   DA  E N6    1 
ATOM 8199  N N1    . DA  I 2 5   ? 76.472  119.686 70.714  1.00 46.57  ? 5   DA  E N1    1 
ATOM 8200  C C2    . DA  I 2 5   ? 76.535  119.740 72.042  1.00 45.49  ? 5   DA  E C2    1 
ATOM 8201  N N3    . DA  I 2 5   ? 77.206  118.951 72.881  1.00 44.57  ? 5   DA  E N3    1 
ATOM 8202  C C4    . DA  I 2 5   ? 77.893  118.013 72.230  1.00 44.79  ? 5   DA  E C4    1 
ATOM 8203  P P     . DG  I 2 6   ? 78.772  114.384 77.460  1.00 38.11  ? 6   DG  E P     1 
ATOM 8204  O OP1   . DG  I 2 6   ? 79.041  114.450 78.916  1.00 37.83  ? 6   DG  E OP1   1 
ATOM 8205  O OP2   . DG  I 2 6   ? 78.713  113.045 76.805  1.00 37.95  ? 6   DG  E OP2   1 
ATOM 8206  O "O5'" . DG  I 2 6   ? 77.396  115.154 77.210  1.00 38.01  ? 6   DG  E "O5'" 1 
ATOM 8207  C "C5'" . DG  I 2 6   ? 77.069  116.254 78.034  1.00 38.13  ? 6   DG  E "C5'" 1 
ATOM 8208  C "C4'" . DG  I 2 6   ? 75.736  116.820 77.596  1.00 38.27  ? 6   DG  E "C4'" 1 
ATOM 8209  O "O4'" . DG  I 2 6   ? 75.796  117.184 76.188  1.00 38.88  ? 6   DG  E "O4'" 1 
ATOM 8210  C "C3'" . DG  I 2 6   ? 74.543  115.896 77.762  1.00 37.73  ? 6   DG  E "C3'" 1 
ATOM 8211  O "O3'" . DG  I 2 6   ? 73.596  116.643 78.431  1.00 38.00  ? 6   DG  E "O3'" 1 
ATOM 8212  C "C2'" . DG  I 2 6   ? 74.084  115.626 76.344  1.00 37.95  ? 6   DG  E "C2'" 1 
ATOM 8213  C "C1'" . DG  I 2 6   ? 74.573  116.849 75.581  1.00 38.80  ? 6   DG  E "C1'" 1 
ATOM 8214  N N9    . DG  I 2 6   ? 74.768  116.572 74.157  1.00 39.33  ? 6   DG  E N9    1 
ATOM 8215  C C8    . DG  I 2 6   ? 75.514  115.574 73.605  1.00 39.34  ? 6   DG  E C8    1 
ATOM 8216  N N7    . DG  I 2 6   ? 75.463  115.578 72.304  1.00 40.17  ? 6   DG  E N7    1 
ATOM 8217  C C5    . DG  I 2 6   ? 74.640  116.632 71.966  1.00 40.70  ? 6   DG  E C5    1 
ATOM 8218  C C6    . DG  I 2 6   ? 74.239  117.110 70.701  1.00 41.85  ? 6   DG  E C6    1 
ATOM 8219  O O6    . DG  I 2 6   ? 74.535  116.687 69.573  1.00 42.71  ? 6   DG  E O6    1 
ATOM 8220  N N1    . DG  I 2 6   ? 73.416  118.215 70.826  1.00 42.24  ? 6   DG  E N1    1 
ATOM 8221  C C2    . DG  I 2 6   ? 73.023  118.759 72.020  1.00 41.65  ? 6   DG  E C2    1 
ATOM 8222  N N2    . DG  I 2 6   ? 72.209  119.813 71.950  1.00 42.70  ? 6   DG  E N2    1 
ATOM 8223  N N3    . DG  I 2 6   ? 73.389  118.324 73.212  1.00 40.65  ? 6   DG  E N3    1 
ATOM 8224  C C4    . DG  I 2 6   ? 74.205  117.255 73.102  1.00 40.19  ? 6   DG  E C4    1 
ATOM 8225  P P     . DT  I 2 7   ? 72.125  116.073 78.678  1.00 37.91  ? 7   DT  E P     1 
ATOM 8226  O OP1   . DT  I 2 7   ? 71.708  116.586 79.992  1.00 38.29  ? 7   DT  E OP1   1 
ATOM 8227  O OP2   . DT  I 2 7   ? 72.089  114.623 78.393  1.00 37.29  ? 7   DT  E OP2   1 
ATOM 8228  O "O5'" . DT  I 2 7   ? 71.248  116.863 77.619  1.00 38.58  ? 7   DT  E "O5'" 1 
ATOM 8229  C "C5'" . DT  I 2 7   ? 71.300  118.251 77.692  1.00 39.37  ? 7   DT  E "C5'" 1 
ATOM 8230  C "C4'" . DT  I 2 7   ? 70.197  118.793 76.830  1.00 40.18  ? 7   DT  E "C4'" 1 
ATOM 8231  O "O4'" . DT  I 2 7   ? 70.539  118.657 75.424  1.00 40.25  ? 7   DT  E "O4'" 1 
ATOM 8232  C "C3'" . DT  I 2 7   ? 68.855  118.116 76.991  1.00 40.26  ? 7   DT  E "C3'" 1 
ATOM 8233  O "O3'" . DT  I 2 7   ? 68.012  119.161 76.742  1.00 41.95  ? 7   DT  E "O3'" 1 
ATOM 8234  C "C2'" . DT  I 2 7   ? 68.793  117.185 75.795  1.00 39.84  ? 7   DT  E "C2'" 1 
ATOM 8235  C "C1'" . DT  I 2 7   ? 69.513  117.975 74.713  1.00 40.33  ? 7   DT  E "C1'" 1 
ATOM 8236  N N1    . DT  I 2 7   ? 70.147  117.124 73.644  1.00 40.00  ? 7   DT  E N1    1 
ATOM 8237  C C2    . DT  I 2 7   ? 69.990  117.419 72.316  1.00 40.84  ? 7   DT  E C2    1 
ATOM 8238  O O2    . DT  I 2 7   ? 69.350  118.350 71.906  1.00 42.39  ? 7   DT  E O2    1 
ATOM 8239  N N3    . DT  I 2 7   ? 70.611  116.583 71.452  1.00 40.79  ? 7   DT  E N3    1 
ATOM 8240  C C4    . DT  I 2 7   ? 71.370  115.494 71.782  1.00 40.00  ? 7   DT  E C4    1 
ATOM 8241  O O4    . DT  I 2 7   ? 71.898  114.799 70.933  1.00 40.29  ? 7   DT  E O4    1 
ATOM 8242  C C5    . DT  I 2 7   ? 71.504  115.218 73.185  1.00 39.07  ? 7   DT  E C5    1 
ATOM 8243  C C7    . DT  I 2 7   ? 72.301  114.047 73.665  1.00 38.35  ? 7   DT  E C7    1 
ATOM 8244  C C6    . DT  I 2 7   ? 70.898  116.041 74.036  1.00 39.12  ? 7   DT  E C6    1 
ATOM 8245  P P     . DT  I 2 8   ? 66.439  119.075 77.038  1.00 44.00  ? 8   DT  E P     1 
ATOM 8246  O OP1   . DT  I 2 8   ? 66.106  120.348 77.715  1.00 45.75  ? 8   DT  E OP1   1 
ATOM 8247  O OP2   . DT  I 2 8   ? 66.101  117.780 77.718  1.00 42.73  ? 8   DT  E OP2   1 
ATOM 8248  O "O5'" . DT  I 2 8   ? 65.766  119.067 75.574  1.00 44.98  ? 8   DT  E "O5'" 1 
ATOM 8249  C "C5'" . DT  I 2 8   ? 65.905  120.154 74.696  1.00 46.54  ? 8   DT  E "C5'" 1 
ATOM 8250  C "C4'" . DT  I 2 8   ? 65.238  119.850 73.359  1.00 47.39  ? 8   DT  E "C4'" 1 
ATOM 8251  O "O4'" . DT  I 2 8   ? 66.042  118.963 72.528  1.00 45.98  ? 8   DT  E "O4'" 1 
ATOM 8252  C "C3'" . DT  I 2 8   ? 63.882  119.182 73.466  1.00 47.84  ? 8   DT  E "C3'" 1 
ATOM 8253  O "O3'" . DT  I 2 8   ? 62.981  119.813 72.543  1.00 50.14  ? 8   DT  E "O3'" 1 
ATOM 8254  C "C2'" . DT  I 2 8   ? 64.193  117.723 73.109  1.00 45.89  ? 8   DT  E "C2'" 1 
ATOM 8255  C "C1'" . DT  I 2 8   ? 65.263  117.885 72.046  1.00 45.65  ? 8   DT  E "C1'" 1 
ATOM 8256  N N1    . DT  I 2 8   ? 66.183  116.728 71.805  1.00 43.73  ? 8   DT  E N1    1 
ATOM 8257  C C2    . DT  I 2 8   ? 66.494  116.418 70.503  1.00 44.06  ? 8   DT  E C2    1 
ATOM 8258  O O2    . DT  I 2 8   ? 66.027  117.020 69.567  1.00 45.79  ? 8   DT  E O2    1 
ATOM 8259  N N3    . DT  I 2 8   ? 67.356  115.373 70.318  1.00 42.56  ? 8   DT  E N3    1 
ATOM 8260  C C4    . DT  I 2 8   ? 67.935  114.605 71.314  1.00 41.29  ? 8   DT  E C4    1 
ATOM 8261  O O4    . DT  I 2 8   ? 68.702  113.671 71.076  1.00 40.86  ? 8   DT  E O4    1 
ATOM 8262  C C5    . DT  I 2 8   ? 67.575  114.979 72.663  1.00 40.92  ? 8   DT  E C5    1 
ATOM 8263  C C7    . DT  I 2 8   ? 68.157  114.207 73.795  1.00 39.94  ? 8   DT  E C7    1 
ATOM 8264  C C6    . DT  I 2 8   ? 66.736  116.013 72.853  1.00 41.98  ? 8   DT  E C6    1 
ATOM 8265  P P     . DA  I 2 9   ? 61.394  119.483 72.589  1.00 50.66  ? 9   DA  E P     1 
ATOM 8266  O OP1   . DA  I 2 9   ? 60.800  120.832 72.451  1.00 53.45  ? 9   DA  E OP1   1 
ATOM 8267  O OP2   . DA  I 2 9   ? 61.023  118.612 73.746  1.00 49.43  ? 9   DA  E OP2   1 
ATOM 8268  O "O5'" . DA  I 2 9   ? 61.142  118.668 71.233  1.00 50.63  ? 9   DA  E "O5'" 1 
ATOM 8269  C "C5'" . DA  I 2 9   ? 61.912  119.129 70.109  1.00 51.09  ? 9   DA  E "C5'" 1 
ATOM 8270  C "C4'" . DA  I 2 9   ? 61.489  118.388 68.857  1.00 51.56  ? 9   DA  E "C4'" 1 
ATOM 8271  O "O4'" . DA  I 2 9   ? 62.496  117.410 68.479  1.00 49.49  ? 9   DA  E "O4'" 1 
ATOM 8272  C "C3'" . DA  I 2 9   ? 60.171  117.633 68.994  1.00 52.06  ? 9   DA  E "C3'" 1 
ATOM 8273  O "O3'" . DA  I 2 9   ? 59.493  117.737 67.748  1.00 54.12  ? 9   DA  E "O3'" 1 
ATOM 8274  C "C2'" . DA  I 2 9   ? 60.617  116.215 69.328  1.00 49.48  ? 9   DA  E "C2'" 1 
ATOM 8275  C "C1'" . DA  I 2 9   ? 61.950  116.104 68.590  1.00 48.41  ? 9   DA  E "C1'" 1 
ATOM 8276  N N9    . DA  I 2 9   ? 62.917  115.246 69.271  1.00 45.92  ? 9   DA  E N9    1 
ATOM 8277  C C8    . DA  I 2 9   ? 63.222  115.237 70.596  1.00 44.65  ? 9   DA  E C8    1 
ATOM 8278  N N7    . DA  I 2 9   ? 64.128  114.351 70.923  1.00 42.71  ? 9   DA  E N7    1 
ATOM 8279  C C5    . DA  I 2 9   ? 64.434  113.747 69.730  1.00 42.72  ? 9   DA  E C5    1 
ATOM 8280  C C6    . DA  I 2 9   ? 65.335  112.730 69.408  1.00 41.59  ? 9   DA  E C6    1 
ATOM 8281  N N6    . DA  I 2 9   ? 66.086  112.141 70.318  1.00 40.54  ? 9   DA  E N6    1 
ATOM 8282  N N1    . DA  I 2 9   ? 65.419  112.348 68.116  1.00 42.33  ? 9   DA  E N1    1 
ATOM 8283  C C2    . DA  I 2 9   ? 64.641  112.964 67.214  1.00 44.01  ? 9   DA  E C2    1 
ATOM 8284  N N3    . DA  I 2 9   ? 63.755  113.942 67.399  1.00 45.44  ? 9   DA  E N3    1 
ATOM 8285  C C4    . DA  I 2 9   ? 63.704  114.288 68.695  1.00 44.67  ? 9   DA  E C4    1 
ATOM 8286  P P     . DG  I 2 10  ? 57.968  117.231 67.580  1.00 55.67  ? 10  DG  E P     1 
ATOM 8287  O OP1   . DG  I 2 10  ? 57.325  118.261 66.725  1.00 58.84  ? 10  DG  E OP1   1 
ATOM 8288  O OP2   . DG  I 2 10  ? 57.385  116.769 68.875  1.00 54.85  ? 10  DG  E OP2   1 
ATOM 8289  O "O5'" . DG  I 2 10  ? 58.112  115.906 66.710  1.00 54.53  ? 10  DG  E "O5'" 1 
ATOM 8290  C "C5'" . DG  I 2 10  ? 59.066  115.846 65.687  1.00 54.21  ? 10  DG  E "C5'" 1 
ATOM 8291  C "C4'" . DG  I 2 10  ? 59.168  114.402 65.278  1.00 52.80  ? 10  DG  E "C4'" 1 
ATOM 8292  O "O4'" . DG  I 2 10  ? 60.223  113.744 65.998  1.00 50.10  ? 10  DG  E "O4'" 1 
ATOM 8293  C "C3'" . DG  I 2 10  ? 57.939  113.586 65.595  1.00 53.12  ? 10  DG  E "C3'" 1 
ATOM 8294  O "O3'" . DG  I 2 10  ? 57.865  112.635 64.591  1.00 53.25  ? 10  DG  E "O3'" 1 
ATOM 8295  C "C2'" . DG  I 2 10  ? 58.278  112.915 66.903  1.00 50.73  ? 10  DG  E "C2'" 1 
ATOM 8296  C "C1'" . DG  I 2 10  ? 59.702  112.561 66.563  1.00 48.95  ? 10  DG  E "C1'" 1 
ATOM 8297  N N9    . DG  I 2 10  ? 60.480  112.228 67.745  1.00 46.72  ? 10  DG  E N9    1 
ATOM 8298  C C8    . DG  I 2 10  ? 60.290  112.735 69.003  1.00 46.41  ? 10  DG  E C8    1 
ATOM 8299  N N7    . DG  I 2 10  ? 61.143  112.274 69.872  1.00 44.44  ? 10  DG  E N7    1 
ATOM 8300  C C5    . DG  I 2 10  ? 61.930  111.403 69.136  1.00 43.43  ? 10  DG  E C5    1 
ATOM 8301  C C6    . DG  I 2 10  ? 63.002  110.608 69.551  1.00 41.88  ? 10  DG  E C6    1 
ATOM 8302  O O6    . DG  I 2 10  ? 63.502  110.502 70.677  1.00 41.01  ? 10  DG  E O6    1 
ATOM 8303  N N1    . DG  I 2 10  ? 63.531  109.887 68.514  1.00 42.04  ? 10  DG  E N1    1 
ATOM 8304  C C2    . DG  I 2 10  ? 63.092  109.922 67.244  1.00 43.15  ? 10  DG  E C2    1 
ATOM 8305  N N2    . DG  I 2 10  ? 63.767  109.129 66.417  1.00 43.40  ? 10  DG  E N2    1 
ATOM 8306  N N3    . DG  I 2 10  ? 62.087  110.656 66.824  1.00 44.62  ? 10  DG  E N3    1 
ATOM 8307  C C4    . DG  I 2 10  ? 61.550  111.368 67.830  1.00 44.80  ? 10  DG  E C4    1 
ATOM 8308  P P     . DA  I 2 11  ? 56.447  111.999 64.199  1.00 54.90  ? 11  DA  E P     1 
ATOM 8309  O OP1   . DA  I 2 11  ? 56.204  112.343 62.785  1.00 57.22  ? 11  DA  E OP1   1 
ATOM 8310  O OP2   . DA  I 2 11  ? 55.474  112.368 65.256  1.00 55.57  ? 11  DA  E OP2   1 
ATOM 8311  O "O5'" . DA  I 2 11  ? 56.726  110.426 64.296  1.00 52.90  ? 11  DA  E "O5'" 1 
ATOM 8312  C "C5'" . DA  I 2 11  ? 57.556  109.885 63.266  1.00 52.53  ? 11  DA  E "C5'" 1 
ATOM 8313  C "C4'" . DA  I 2 11  ? 58.369  108.727 63.781  1.00 50.07  ? 11  DA  E "C4'" 1 
ATOM 8314  O "O4'" . DA  I 2 11  ? 59.042  109.167 64.961  1.00 48.38  ? 11  DA  E "O4'" 1 
ATOM 8315  C "C3'" . DA  I 2 11  ? 57.596  107.558 64.324  1.00 49.56  ? 11  DA  E "C3'" 1 
ATOM 8316  O "O3'" . DA  I 2 11  ? 57.402  106.696 63.276  1.00 50.38  ? 11  DA  E "O3'" 1 
ATOM 8317  C "C2'" . DA  I 2 11  ? 58.594  106.916 65.262  1.00 47.10  ? 11  DA  E "C2'" 1 
ATOM 8318  C "C1'" . DA  I 2 11  ? 59.597  108.021 65.527  1.00 46.44  ? 11  DA  E "C1'" 1 
ATOM 8319  N N9    . DA  I 2 11  ? 59.677  108.343 66.916  1.00 45.29  ? 11  DA  E N9    1 
ATOM 8320  C C8    . DA  I 2 11  ? 58.930  109.265 67.568  1.00 46.20  ? 11  DA  E C8    1 
ATOM 8321  N N7    . DA  I 2 11  ? 59.212  109.344 68.844  1.00 44.97  ? 11  DA  E N7    1 
ATOM 8322  C C5    . DA  I 2 11  ? 60.213  108.412 69.006  1.00 43.41  ? 11  DA  E C5    1 
ATOM 8323  C C6    . DA  I 2 11  ? 60.935  108.025 70.122  1.00 42.30  ? 11  DA  E C6    1 
ATOM 8324  N N6    . DA  I 2 11  ? 60.742  108.548 71.333  1.00 42.13  ? 11  DA  E N6    1 
ATOM 8325  N N1    . DA  I 2 11  ? 61.860  107.071 69.929  1.00 41.66  ? 11  DA  E N1    1 
ATOM 8326  C C2    . DA  I 2 11  ? 62.045  106.546 68.713  1.00 42.16  ? 11  DA  E C2    1 
ATOM 8327  N N3    . DA  I 2 11  ? 61.425  106.833 67.582  1.00 43.22  ? 11  DA  E N3    1 
ATOM 8328  C C4    . DA  I 2 11  ? 60.515  107.781 67.822  1.00 43.71  ? 11  DA  E C4    1 
ATOM 8329  P P     . DT  I 2 12  ? 56.365  105.486 63.433  1.00 50.74  ? 12  DT  E P     1 
ATOM 8330  O OP1   . DT  I 2 12  ? 55.957  105.085 62.060  1.00 52.57  ? 12  DT  E OP1   1 
ATOM 8331  O OP2   . DT  I 2 12  ? 55.408  105.873 64.514  1.00 51.05  ? 12  DT  E OP2   1 
ATOM 8332  O "O5'" . DT  I 2 12  ? 57.223  104.339 64.160  1.00 48.42  ? 12  DT  E "O5'" 1 
ATOM 8333  C "C5'" . DT  I 2 12  ? 58.338  103.763 63.525  1.00 48.13  ? 12  DT  E "C5'" 1 
ATOM 8334  C "C4'" . DT  I 2 12  ? 58.908  102.774 64.496  1.00 47.03  ? 12  DT  E "C4'" 1 
ATOM 8335  O "O4'" . DT  I 2 12  ? 59.120  103.487 65.718  1.00 45.85  ? 12  DT  E "O4'" 1 
ATOM 8336  C "C3'" . DT  I 2 12  ? 57.962  101.681 64.901  1.00 47.42  ? 12  DT  E "C3'" 1 
ATOM 8337  O "O3'" . DT  I 2 12  ? 58.583  100.525 64.475  1.00 47.65  ? 12  DT  E "O3'" 1 
ATOM 8338  C "C2'" . DT  I 2 12  ? 57.940  101.778 66.427  1.00 46.33  ? 12  DT  E "C2'" 1 
ATOM 8339  C "C1'" . DT  I 2 12  ? 59.157  102.589 66.783  1.00 45.19  ? 12  DT  E "C1'" 1 
ATOM 8340  N N1    . DT  I 2 12  ? 59.033  103.492 67.918  1.00 44.47  ? 12  DT  E N1    1 
ATOM 8341  C C2    . DT  I 2 12  ? 59.843  103.411 69.034  1.00 43.36  ? 12  DT  E C2    1 
ATOM 8342  O O2    . DT  I 2 12  ? 60.706  102.563 69.229  1.00 42.86  ? 12  DT  E O2    1 
ATOM 8343  N N3    . DT  I 2 12  ? 59.584  104.383 69.963  1.00 43.07  ? 12  DT  E N3    1 
ATOM 8344  C C4    . DT  I 2 12  ? 58.651  105.382 69.874  1.00 43.85  ? 12  DT  E C4    1 
ATOM 8345  O O4    . DT  I 2 12  ? 58.442  106.210 70.722  1.00 43.85  ? 12  DT  E O4    1 
ATOM 8346  C C5    . DT  I 2 12  ? 57.881  105.419 68.703  1.00 44.98  ? 12  DT  E C5    1 
ATOM 8347  C C7    . DT  I 2 12  ? 56.863  106.502 68.595  1.00 46.20  ? 12  DT  E C7    1 
ATOM 8348  C C6    . DT  I 2 12  ? 58.103  104.489 67.781  1.00 45.19  ? 12  DT  E C6    1 
ATOM 8349  P P     . DA  I 2 13  ? 57.958  99.088  64.798  1.00 48.16  ? 13  DA  E P     1 
ATOM 8350  O OP1   . DA  I 2 13  ? 58.628  98.144  63.881  1.00 48.88  ? 13  DA  E OP1   1 
ATOM 8351  O OP2   . DA  I 2 13  ? 56.483  99.199  64.820  1.00 49.05  ? 13  DA  E OP2   1 
ATOM 8352  O "O5'" . DA  I 2 13  ? 58.450  98.775  66.277  1.00 46.91  ? 13  DA  E "O5'" 1 
ATOM 8353  C "C5'" . DA  I 2 13  ? 59.756  98.387  66.502  1.00 46.18  ? 13  DA  E "C5'" 1 
ATOM 8354  C "C4'" . DA  I 2 13  ? 59.892  97.979  67.949  1.00 45.37  ? 13  DA  E "C4'" 1 
ATOM 8355  O "O4'" . DA  I 2 13  ? 59.745  99.147  68.782  1.00 44.55  ? 13  DA  E "O4'" 1 
ATOM 8356  C "C3'" . DA  I 2 13  ? 58.833  97.010  68.450  1.00 46.14  ? 13  DA  E "C3'" 1 
ATOM 8357  O "O3'" . DA  I 2 13  ? 59.503  95.840  68.902  1.00 46.11  ? 13  DA  E "O3'" 1 
ATOM 8358  C "C2'" . DA  I 2 13  ? 58.116  97.749  69.594  1.00 45.79  ? 13  DA  E "C2'" 1 
ATOM 8359  C "C1'" . DA  I 2 13  ? 59.114  98.809  69.994  1.00 44.54  ? 13  DA  E "C1'" 1 
ATOM 8360  N N9    . DA  I 2 13  ? 58.527  100.039 70.506  1.00 44.36  ? 13  DA  E N9    1 
ATOM 8361  C C8    . DA  I 2 13  ? 57.656  100.869 69.858  1.00 45.04  ? 13  DA  E C8    1 
ATOM 8362  N N7    . DA  I 2 13  ? 57.300  101.921 70.548  1.00 44.94  ? 13  DA  E N7    1 
ATOM 8363  C C5    . DA  I 2 13  ? 58.003  101.766 71.723  1.00 44.07  ? 13  DA  E C5    1 
ATOM 8364  C C6    . DA  I 2 13  ? 58.061  102.555 72.861  1.00 43.74  ? 13  DA  E C6    1 
ATOM 8365  N N6    . DA  I 2 13  ? 57.355  103.674 72.950  1.00 44.36  ? 13  DA  E N6    1 
ATOM 8366  N N1    . DA  I 2 13  ? 58.858  102.150 73.873  1.00 43.00  ? 13  DA  E N1    1 
ATOM 8367  C C2    . DA  I 2 13  ? 59.549  101.011 73.743  1.00 42.66  ? 13  DA  E C2    1 
ATOM 8368  N N3    . DA  I 2 13  ? 59.588  100.178 72.717  1.00 42.99  ? 13  DA  E N3    1 
ATOM 8369  C C4    . DA  I 2 13  ? 58.779  100.625 71.728  1.00 43.68  ? 13  DA  E C4    1 
ATOM 8370  P P     . DT  I 2 14  ? 58.671  94.558  69.410  1.00 47.13  ? 14  DT  E P     1 
ATOM 8371  O OP1   . DT  I 2 14  ? 59.729  93.538  69.657  1.00 47.03  ? 14  DT  E OP1   1 
ATOM 8372  O OP2   . DT  I 2 14  ? 57.478  94.340  68.536  1.00 48.41  ? 14  DT  E OP2   1 
ATOM 8373  O "O5'" . DT  I 2 14  ? 58.209  94.947  70.891  1.00 46.72  ? 14  DT  E "O5'" 1 
ATOM 8374  C "C5'" . DT  I 2 14  ? 59.221  94.950  71.870  1.00 45.78  ? 14  DT  E "C5'" 1 
ATOM 8375  C "C4'" . DT  I 2 14  ? 58.727  95.476  73.201  1.00 45.61  ? 14  DT  E "C4'" 1 
ATOM 8376  O "O4'" . DT  I 2 14  ? 58.372  96.866  73.079  1.00 45.16  ? 14  DT  E "O4'" 1 
ATOM 8377  C "C3'" . DT  I 2 14  ? 57.439  94.866  73.706  1.00 46.96  ? 14  DT  E "C3'" 1 
ATOM 8378  O "O3'" . DT  I 2 14  ? 57.704  93.714  74.503  1.00 47.46  ? 14  DT  E "O3'" 1 
ATOM 8379  C "C2'" . DT  I 2 14  ? 56.852  95.989  74.556  1.00 46.87  ? 14  DT  E "C2'" 1 
ATOM 8380  C "C1'" . DT  I 2 14  ? 57.704  97.209  74.262  1.00 45.50  ? 14  DT  E "C1'" 1 
ATOM 8381  N N1    . DT  I 2 14  ? 56.876  98.379  73.987  1.00 45.78  ? 14  DT  E N1    1 
ATOM 8382  C C2    . DT  I 2 14  ? 56.775  99.423  74.878  1.00 45.58  ? 14  DT  E C2    1 
ATOM 8383  O O2    . DT  I 2 14  ? 57.342  99.502  75.946  1.00 45.11  ? 14  DT  E O2    1 
ATOM 8384  N N3    . DT  I 2 14  ? 55.952  100.416 74.466  1.00 46.18  ? 14  DT  E N3    1 
ATOM 8385  C C4    . DT  I 2 14  ? 55.244  100.465 73.304  1.00 46.92  ? 14  DT  E C4    1 
ATOM 8386  O O4    . DT  I 2 14  ? 54.536  101.408 73.056  1.00 47.63  ? 14  DT  E O4    1 
ATOM 8387  C C5    . DT  I 2 14  ? 55.390  99.351  72.427  1.00 47.02  ? 14  DT  E C5    1 
ATOM 8388  C C7    . DT  I 2 14  ? 54.664  99.287  71.138  1.00 47.95  ? 14  DT  E C7    1 
ATOM 8389  C C6    . DT  I 2 14  ? 56.189  98.369  72.800  1.00 46.48  ? 14  DT  E C6    1 
ATOM 8390  P P     . DC  I 2 15  ? 56.484  92.850  75.076  1.00 49.17  ? 15  DC  E P     1 
ATOM 8391  O OP1   . DC  I 2 15  ? 57.011  91.525  75.424  1.00 49.72  ? 15  DC  E OP1   1 
ATOM 8392  O OP2   . DC  I 2 15  ? 55.368  92.997  74.127  1.00 50.05  ? 15  DC  E OP2   1 
ATOM 8393  O "O5'" . DC  I 2 15  ? 56.038  93.636  76.394  1.00 49.29  ? 15  DC  E "O5'" 1 
ATOM 8394  C "C5'" . DC  I 2 15  ? 56.922  93.682  77.516  1.00 48.66  ? 15  DC  E "C5'" 1 
ATOM 8395  C "C4'" . DC  I 2 15  ? 56.425  94.682  78.537  1.00 48.86  ? 15  DC  E "C4'" 1 
ATOM 8396  O "O4'" . DC  I 2 15  ? 56.163  95.907  77.830  1.00 48.22  ? 15  DC  E "O4'" 1 
ATOM 8397  C "C3'" . DC  I 2 15  ? 55.073  94.399  79.140  1.00 50.78  ? 15  DC  E "C3'" 1 
ATOM 8398  O "O3'" . DC  I 2 15  ? 55.247  93.581  80.254  1.00 51.62  ? 15  DC  E "O3'" 1 
ATOM 8399  C "C2'" . DC  I 2 15  ? 54.558  95.793  79.509  1.00 50.82  ? 15  DC  E "C2'" 1 
ATOM 8400  C "C1'" . DC  I 2 15  ? 55.310  96.733  78.580  1.00 49.06  ? 15  DC  E "C1'" 1 
ATOM 8401  N N1    . DC  I 2 15  ? 54.530  97.499  77.569  1.00 49.32  ? 15  DC  E N1    1 
ATOM 8402  C C2    . DC  I 2 15  ? 54.090  98.772  77.878  1.00 49.60  ? 15  DC  E C2    1 
ATOM 8403  O O2    . DC  I 2 15  ? 54.344  99.199  78.995  1.00 49.61  ? 15  DC  E O2    1 
ATOM 8404  N N3    . DC  I 2 15  ? 53.399  99.492  76.984  1.00 50.05  ? 15  DC  E N3    1 
ATOM 8405  C C4    . DC  I 2 15  ? 53.170  98.962  75.800  1.00 50.13  ? 15  DC  E C4    1 
ATOM 8406  N N4    . DC  I 2 15  ? 52.502  99.702  74.922  1.00 50.72  ? 15  DC  E N4    1 
ATOM 8407  C C5    . DC  I 2 15  ? 53.612  97.662  75.449  1.00 49.83  ? 15  DC  E C5    1 
ATOM 8408  C C6    . DC  I 2 15  ? 54.290  96.968  76.352  1.00 49.45  ? 15  DC  E C6    1 
ATOM 8409  P P     . DT  I 2 16  ? 53.978  92.870  80.940  1.00 54.05  ? 16  DT  E P     1 
ATOM 8410  O OP1   . DT  I 2 16  ? 54.628  92.074  82.006  1.00 54.48  ? 16  DT  E OP1   1 
ATOM 8411  O OP2   . DT  I 2 16  ? 53.043  92.273  79.948  1.00 55.09  ? 16  DT  E OP2   1 
ATOM 8412  O "O5'" . DT  I 2 16  ? 53.152  94.052  81.644  1.00 54.84  ? 16  DT  E "O5'" 1 
ATOM 8413  C "C5'" . DT  I 2 16  ? 53.720  94.779  82.697  1.00 54.38  ? 16  DT  E "C5'" 1 
ATOM 8414  C "C4'" . DT  I 2 16  ? 52.719  95.815  83.149  1.00 55.63  ? 16  DT  E "C4'" 1 
ATOM 8415  O "O4'" . DT  I 2 16  ? 52.437  96.788  82.114  1.00 54.87  ? 16  DT  E "O4'" 1 
ATOM 8416  C "C3'" . DT  I 2 16  ? 51.366  95.269  83.526  1.00 58.28  ? 16  DT  E "C3'" 1 
ATOM 8417  O "O3'" . DT  I 2 16  ? 50.968  96.023  84.634  1.00 59.58  ? 16  DT  E "O3'" 1 
ATOM 8418  C "C2'" . DT  I 2 16  ? 50.477  95.600  82.341  1.00 58.62  ? 16  DT  E "C2'" 1 
ATOM 8419  C "C1'" . DT  I 2 16  ? 51.040  96.931  81.907  1.00 56.87  ? 16  DT  E "C1'" 1 
ATOM 8420  N N1    . DT  I 2 16  ? 50.824  97.213  80.447  1.00 56.14  ? 16  DT  E N1    1 
ATOM 8421  C C2    . DT  I 2 16  ? 50.243  98.383  80.023  1.00 56.56  ? 16  DT  E C2    1 
ATOM 8422  O O2    . DT  I 2 16  ? 49.857  99.254  80.763  1.00 57.56  ? 16  DT  E O2    1 
ATOM 8423  N N3    . DT  I 2 16  ? 50.122  98.512  78.678  1.00 55.98  ? 16  DT  E N3    1 
ATOM 8424  C C4    . DT  I 2 16  ? 50.506  97.602  77.716  1.00 55.07  ? 16  DT  E C4    1 
ATOM 8425  O O4    . DT  I 2 16  ? 50.343  97.823  76.518  1.00 54.78  ? 16  DT  E O4    1 
ATOM 8426  C C5    . DT  I 2 16  ? 51.107  96.392  78.221  1.00 54.73  ? 16  DT  E C5    1 
ATOM 8427  C C7    . DT  I 2 16  ? 51.569  95.306  77.294  1.00 54.07  ? 16  DT  E C7    1 
ATOM 8428  C C6    . DT  I 2 16  ? 51.232  96.265  79.540  1.00 55.27  ? 16  DT  E C6    1 
ATOM 8429  P P     . DA  I 2 17  ? 49.826  95.481  85.629  1.00 62.74  ? 17  DA  E P     1 
ATOM 8430  O OP1   . DA  I 2 17  ? 50.515  94.897  86.807  1.00 63.04  ? 17  DA  E OP1   1 
ATOM 8431  O OP2   . DA  I 2 17  ? 48.891  94.642  84.818  1.00 63.99  ? 17  DA  E OP2   1 
ATOM 8432  O "O5'" . DA  I 2 17  ? 49.065  96.830  86.040  1.00 64.05  ? 17  DA  E "O5'" 1 
ATOM 8433  C "C5'" . DA  I 2 17  ? 48.954  97.761  84.983  1.00 62.94  ? 17  DA  E "C5'" 1 
ATOM 8434  C "C4'" . DA  I 2 17  ? 47.980  98.881  85.248  1.00 64.89  ? 17  DA  E "C4'" 1 
ATOM 8435  O "O4'" . DA  I 2 17  ? 47.670  99.489  83.971  1.00 64.23  ? 17  DA  E "O4'" 1 
ATOM 8436  C "C3'" . DA  I 2 17  ? 46.617  98.463  85.754  1.00 68.28  ? 17  DA  E "C3'" 1 
ATOM 8437  O "O3'" . DA  I 2 17  ? 45.946  99.636  86.198  1.00 70.12  ? 17  DA  E "O3'" 1 
ATOM 8438  C "C2'" . DA  I 2 17  ? 46.008  97.888  84.481  1.00 68.35  ? 17  DA  E "C2'" 1 
ATOM 8439  C "C1'" . DA  I 2 17  ? 46.468  98.917  83.454  1.00 66.28  ? 17  DA  E "C1'" 1 
ATOM 8440  N N9    . DA  I 2 17  ? 46.717  98.334  82.136  1.00 64.68  ? 17  DA  E N9    1 
ATOM 8441  C C8    . DA  I 2 17  ? 47.241  97.094  81.902  1.00 63.65  ? 17  DA  E C8    1 
ATOM 8442  N N7    . DA  I 2 17  ? 47.380  96.805  80.624  1.00 62.47  ? 17  DA  E N7    1 
ATOM 8443  C C5    . DA  I 2 17  ? 46.916  97.935  79.972  1.00 62.71  ? 17  DA  E C5    1 
ATOM 8444  C C6    . DA  I 2 17  ? 46.801  98.236  78.605  1.00 62.05  ? 17  DA  E C6    1 
ATOM 8445  N N6    . DA  I 2 17  ? 47.160  97.390  77.635  1.00 60.93  ? 17  DA  E N6    1 
ATOM 8446  N N1    . DA  I 2 17  ? 46.298  99.442  78.294  1.00 62.84  ? 17  DA  E N1    1 
ATOM 8447  C C2    . DA  I 2 17  ? 45.944  100.268 79.284  1.00 64.20  ? 17  DA  E C2    1 
ATOM 8448  N N3    . DA  I 2 17  ? 46.005  100.103 80.603  1.00 64.94  ? 17  DA  E N3    1 
ATOM 8449  C C4    . DA  I 2 17  ? 46.503  98.894  80.887  1.00 64.10  ? 17  DA  E C4    1 
ATOM 8450  P P     . DA  I 2 18  ? 44.392  99.583  86.601  1.00 74.12  ? 18  DA  E P     1 
ATOM 8451  O OP1   . DA  I 2 18  ? 44.117  100.739 87.486  1.00 75.85  ? 18  DA  E OP1   1 
ATOM 8452  O OP2   . DA  I 2 18  ? 44.076  98.205  87.036  1.00 75.45  ? 18  DA  E OP2   1 
ATOM 8453  O "O5'" . DA  I 2 18  ? 43.636  99.846  85.232  1.00 74.40  ? 18  DA  E "O5'" 1 
ATOM 8454  C "C5'" . DA  I 2 18  ? 43.757  101.121 84.636  1.00 73.61  ? 18  DA  E "C5'" 1 
ATOM 8455  C "C4'" . DA  I 2 18  ? 42.869  101.191 83.409  1.00 74.60  ? 18  DA  E "C4'" 1 
ATOM 8456  O "O4'" . DA  I 2 18  ? 43.392  100.388 82.319  1.00 72.22  ? 18  DA  E "O4'" 1 
ATOM 8457  C "C3'" . DA  I 2 18  ? 41.457  100.675 83.637  1.00 78.29  ? 18  DA  E "C3'" 1 
ATOM 8458  O "O3'" . DA  I 2 18  ? 40.645  101.550 82.940  1.00 79.94  ? 18  DA  E "O3'" 1 
ATOM 8459  C "C2'" . DA  I 2 18  ? 41.458  99.298  82.988  1.00 77.48  ? 18  DA  E "C2'" 1 
ATOM 8460  C "C1'" . DA  I 2 18  ? 42.323  99.633  81.792  1.00 74.27  ? 18  DA  E "C1'" 1 
ATOM 8461  N N9    . DA  I 2 18  ? 42.859  98.475  81.108  1.00 72.35  ? 18  DA  E N9    1 
ATOM 8462  C C8    . DA  I 2 18  ? 43.262  97.288  81.637  1.00 71.89  ? 18  DA  E C8    1 
ATOM 8463  N N7    . DA  I 2 18  ? 43.711  96.439  80.749  1.00 70.25  ? 18  DA  E N7    1 
ATOM 8464  C C5    . DA  I 2 18  ? 43.584  97.127  79.561  1.00 69.56  ? 18  DA  E C5    1 
ATOM 8465  C C6    . DA  I 2 18  ? 43.869  96.777  78.239  1.00 68.09  ? 18  DA  E C6    1 
ATOM 8466  N N6    . DA  I 2 18  ? 44.376  95.594  77.882  1.00 66.98  ? 18  DA  E N6    1 
ATOM 8467  N N1    . DA  I 2 18  ? 43.607  97.704  77.300  1.00 68.06  ? 18  DA  E N1    1 
ATOM 8468  C C2    . DA  I 2 18  ? 43.102  98.894  77.652  1.00 69.42  ? 18  DA  E C2    1 
ATOM 8469  N N3    . DA  I 2 18  ? 42.795  99.343  78.858  1.00 70.91  ? 18  DA  E N3    1 
ATOM 8470  C C4    . DA  I 2 18  ? 43.062  98.389  79.764  1.00 70.84  ? 18  DA  E C4    1 
ATOM 8471  P P     . DC  I 2 19  ? 39.102  101.689 83.326  1.00 84.57  ? 19  DC  E P     1 
ATOM 8472  O OP1   . DC  I 2 19  ? 38.921  103.105 83.736  1.00 86.00  ? 19  DC  E OP1   1 
ATOM 8473  O OP2   . DC  I 2 19  ? 38.745  100.579 84.240  1.00 86.20  ? 19  DC  E OP2   1 
ATOM 8474  O "O5'" . DC  I 2 19  ? 38.342  101.388 81.933  1.00 85.31  ? 19  DC  E "O5'" 1 
ATOM 8475  C "C5'" . DC  I 2 19  ? 38.695  102.078 80.700  1.00 83.52  ? 19  DC  E "C5'" 1 
ATOM 8476  C "C4'" . DC  I 2 19  ? 38.587  101.208 79.448  1.00 82.56  ? 19  DC  E "C4'" 1 
ATOM 8477  O "O4'" . DC  I 2 19  ? 39.382  100.011 79.565  1.00 80.13  ? 19  DC  E "O4'" 1 
ATOM 8478  C "C3'" . DC  I 2 19  ? 37.268  100.530 79.137  1.00 85.84  ? 19  DC  E "C3'" 1 
ATOM 8479  O "O3'" . DC  I 2 19  ? 36.317  101.348 78.495  1.00 88.48  ? 19  DC  E "O3'" 1 
ATOM 8480  C "C2'" . DC  I 2 19  ? 37.684  99.432  78.161  1.00 83.67  ? 19  DC  E "C2'" 1 
ATOM 8481  C "C1'" . DC  I 2 19  ? 39.183  99.362  78.340  1.00 79.67  ? 19  DC  E "C1'" 1 
ATOM 8482  N N1    . DC  I 2 19  ? 39.743  98.003  78.393  1.00 78.04  ? 19  DC  E N1    1 
ATOM 8483  C C2    . DC  I 2 19  ? 40.100  97.360  77.201  1.00 76.34  ? 19  DC  E C2    1 
ATOM 8484  O O2    . DC  I 2 19  ? 39.924  97.928  76.116  1.00 76.24  ? 19  DC  E O2    1 
ATOM 8485  N N3    . DC  I 2 19  ? 40.626  96.118  77.258  1.00 75.07  ? 19  DC  E N3    1 
ATOM 8486  C C4    . DC  I 2 19  ? 40.794  95.534  78.436  1.00 75.47  ? 19  DC  E C4    1 
ATOM 8487  N N4    . DC  I 2 19  ? 41.313  94.306  78.438  1.00 74.45  ? 19  DC  E N4    1 
ATOM 8488  C C5    . DC  I 2 19  ? 40.442  96.176  79.653  1.00 77.15  ? 19  DC  E C5    1 
ATOM 8489  C C6    . DC  I 2 19  ? 39.926  97.403  79.589  1.00 78.38  ? 19  DC  E C6    1 
ATOM 8490  P P     . DT  I 2 20  ? 34.859  100.741 78.183  1.00 92.42  ? 20  DT  E P     1 
ATOM 8491  O OP1   . DT  I 2 20  ? 33.942  101.899 78.122  1.00 95.79  ? 20  DT  E OP1   1 
ATOM 8492  O OP2   . DT  I 2 20  ? 34.562  99.613  79.094  1.00 93.57  ? 20  DT  E OP2   1 
ATOM 8493  O "O5'" . DT  I 2 20  ? 35.014  100.084 76.737  1.00 90.79  ? 20  DT  E "O5'" 1 
ATOM 8494  C "C5'" . DT  I 2 20  ? 35.000  100.868 75.562  1.00 90.54  ? 20  DT  E "C5'" 1 
ATOM 8495  C "C4'" . DT  I 2 20  ? 35.080  99.908  74.407  1.00 89.39  ? 20  DT  E "C4'" 1 
ATOM 8496  O "O4'" . DT  I 2 20  ? 36.051  98.915  74.784  1.00 86.34  ? 20  DT  E "O4'" 1 
ATOM 8497  C "C3'" . DT  I 2 20  ? 33.791  99.145  74.155  1.00 92.91  ? 20  DT  E "C3'" 1 
ATOM 8498  O "O3'" . DT  I 2 20  ? 33.331  99.414  72.834  1.00 93.98  ? 20  DT  E "O3'" 1 
ATOM 8499  C "C2'" . DT  I 2 20  ? 34.172  97.679  74.361  1.00 91.37  ? 20  DT  E "C2'" 1 
ATOM 8500  C "C1'" . DT  I 2 20  ? 35.693  97.680  74.247  1.00 86.83  ? 20  DT  E "C1'" 1 
ATOM 8501  N N1    . DT  I 2 20  ? 36.352  96.615  75.052  1.00 85.13  ? 20  DT  E N1    1 
ATOM 8502  C C2    . DT  I 2 20  ? 36.962  95.541  74.429  1.00 83.08  ? 20  DT  E C2    1 
ATOM 8503  O O2    . DT  I 2 20  ? 37.025  95.375  73.224  1.00 82.44  ? 20  DT  E O2    1 
ATOM 8504  N N3    . DT  I 2 20  ? 37.517  94.631  75.284  1.00 82.01  ? 20  DT  E N3    1 
ATOM 8505  C C4    . DT  I 2 20  ? 37.517  94.679  76.658  1.00 82.77  ? 20  DT  E C4    1 
ATOM 8506  O O4    . DT  I 2 20  ? 38.045  93.804  77.326  1.00 81.90  ? 20  DT  E O4    1 
ATOM 8507  C C5    . DT  I 2 20  ? 36.866  95.814  77.247  1.00 84.87  ? 20  DT  E C5    1 
ATOM 8508  C C7    . DT  I 2 20  ? 36.815  95.951  78.737  1.00 86.05  ? 20  DT  E C7    1 
ATOM 8509  C C6    . DT  I 2 20  ? 36.324  96.718  76.427  1.00 85.94  ? 20  DT  E C6    1 
ATOM 8510  P P     . DA  I 2 21  ? 31.867  98.955  72.377  1.00 98.29  ? 21  DA  E P     1 
ATOM 8511  O OP1   . DA  I 2 21  ? 31.511  99.686  71.154  1.00 99.50  ? 21  DA  E OP1   1 
ATOM 8512  O OP2   . DA  I 2 21  ? 31.004  99.064  73.560  1.00 101.55 ? 21  DA  E OP2   1 
ATOM 8513  O "O5'" . DA  I 2 21  ? 32.037  97.418  72.038  1.00 97.07  ? 21  DA  E "O5'" 1 
ATOM 8514  C "C5'" . DA  I 2 21  ? 32.694  97.035  70.869  1.00 94.62  ? 21  DA  E "C5'" 1 
ATOM 8515  C "C4'" . DA  I 2 21  ? 33.046  95.571  70.968  1.00 93.22  ? 21  DA  E "C4'" 1 
ATOM 8516  O "O4'" . DA  I 2 21  ? 33.632  95.328  72.261  1.00 91.75  ? 21  DA  E "O4'" 1 
ATOM 8517  C "C3'" . DA  I 2 21  ? 31.866  94.613  70.956  1.00 96.68  ? 21  DA  E "C3'" 1 
ATOM 8518  O "O3'" . DA  I 2 21  ? 31.647  94.119  69.637  1.00 97.05  ? 21  DA  E "O3'" 1 
ATOM 8519  C "C2'" . DA  I 2 21  ? 32.280  93.509  71.942  1.00 95.58  ? 21  DA  E "C2'" 1 
ATOM 8520  C "C1'" . DA  I 2 21  ? 33.658  93.934  72.446  1.00 91.63  ? 21  DA  E "C1'" 1 
ATOM 8521  N N9    . DA  I 2 21  ? 34.029  93.642  73.840  1.00 91.09  ? 21  DA  E N9    1 
ATOM 8522  C C8    . DA  I 2 21  ? 33.777  94.400  74.952  1.00 92.36  ? 21  DA  E C8    1 
ATOM 8523  N N7    . DA  I 2 21  ? 34.253  93.894  76.065  1.00 91.59  ? 21  DA  E N7    1 
ATOM 8524  C C5    . DA  I 2 21  ? 34.874  92.723  75.662  1.00 89.66  ? 21  DA  E C5    1 
ATOM 8525  C C6    . DA  I 2 21  ? 35.580  91.719  76.360  1.00 88.31  ? 21  DA  E C6    1 
ATOM 8526  N N6    . DA  I 2 21  ? 35.783  91.722  77.677  1.00 88.65  ? 21  DA  E N6    1 
ATOM 8527  N N1    . DA  I 2 21  ? 36.073  90.690  75.647  1.00 86.82  ? 21  DA  E N1    1 
ATOM 8528  C C2    . DA  I 2 21  ? 35.873  90.666  74.325  1.00 86.64  ? 21  DA  E C2    1 
ATOM 8529  N N3    . DA  I 2 21  ? 35.232  91.546  73.561  1.00 87.80  ? 21  DA  E N3    1 
ATOM 8530  C C4    . DA  I 2 21  ? 34.750  92.560  74.294  1.00 89.31  ? 21  DA  E C4    1 
ATOM 8531  P P     . DA  I 2 22  ? 30.285  93.357  69.284  1.00 101.19 ? 22  DA  E P     1 
ATOM 8532  O OP1   . DA  I 2 22  ? 29.730  93.960  68.057  1.00 102.97 ? 22  DA  E OP1   1 
ATOM 8533  O OP2   . DA  I 2 22  ? 29.489  93.328  70.529  1.00 103.98 ? 22  DA  E OP2   1 
ATOM 8534  O "O5'" . DA  I 2 22  ? 30.737  91.863  68.959  1.00 99.66  ? 22  DA  E "O5'" 1 
ATOM 8535  C "C5'" . DA  I 2 22  ? 32.105  91.501  68.906  1.00 95.50  ? 22  DA  E "C5'" 1 
ATOM 8536  C "C4'" . DA  I 2 22  ? 32.296  90.095  69.445  1.00 95.19  ? 22  DA  E "C4'" 1 
ATOM 8537  O "O4'" . DA  I 2 22  ? 32.872  90.125  70.784  1.00 93.79  ? 22  DA  E "O4'" 1 
ATOM 8538  C "C3'" . DA  I 2 22  ? 31.011  89.282  69.576  1.00 99.20  ? 22  DA  E "C3'" 1 
ATOM 8539  O "O3'" . DA  I 2 22  ? 31.292  87.911  69.384  1.00 98.69  ? 22  DA  E "O3'" 1 
ATOM 8540  C "C2'" . DA  I 2 22  ? 30.666  89.498  71.045  1.00 100.58 ? 22  DA  E "C2'" 1 
ATOM 8541  C "C1'" . DA  I 2 22  ? 32.055  89.358  71.655  1.00 96.63  ? 22  DA  E "C1'" 1 
ATOM 8542  N N9    . DA  I 2 22  ? 32.100  89.824  73.043  1.00 96.93  ? 22  DA  E N9    1 
ATOM 8543  C C8    . DA  I 2 22  ? 31.468  90.916  73.572  1.00 98.86  ? 22  DA  E C8    1 
ATOM 8544  N N7    . DA  I 2 22  ? 31.667  91.108  74.858  1.00 98.90  ? 22  DA  E N7    1 
ATOM 8545  C C5    . DA  I 2 22  ? 32.479  90.048  75.209  1.00 96.89  ? 22  DA  E C5    1 
ATOM 8546  C C6    . DA  I 2 22  ? 33.040  89.672  76.442  1.00 96.16  ? 22  DA  E C6    1 
ATOM 8547  N N6    . DA  I 2 22  ? 32.855  90.358  77.578  1.00 97.33  ? 22  DA  E N6    1 
ATOM 8548  N N1    . DA  I 2 22  ? 33.807  88.561  76.446  1.00 94.38  ? 22  DA  E N1    1 
ATOM 8549  C C2    . DA  I 2 22  ? 33.992  87.888  75.298  1.00 93.40  ? 22  DA  E C2    1 
ATOM 8550  N N3    . DA  I 2 22  ? 33.511  88.140  74.080  1.00 93.93  ? 22  DA  E N3    1 
ATOM 8551  C C4    . DA  I 2 22  ? 32.755  89.247  74.105  1.00 95.69  ? 22  DA  E C4    1 
ATOM 8552  P P     . DA  I 2 23  ? 30.891  87.165  68.022  1.00 99.93  ? 23  DA  E P     1 
ATOM 8553  O OP1   . DA  I 2 23  ? 31.995  87.419  67.061  1.00 96.58  ? 23  DA  E OP1   1 
ATOM 8554  O OP2   . DA  I 2 23  ? 29.489  87.521  67.684  1.00 104.03 ? 23  DA  E OP2   1 
ATOM 8555  O "O5'" . DA  I 2 23  ? 30.960  85.623  68.433  1.00 100.42 ? 23  DA  E "O5'" 1 
ATOM 8556  C "C5'" . DA  I 2 23  ? 32.220  85.092  68.846  1.00 97.18  ? 23  DA  E "C5'" 1 
ATOM 8557  C "C4'" . DA  I 2 23  ? 32.102  84.176  70.051  1.00 98.33  ? 23  DA  E "C4'" 1 
ATOM 8558  O "O4'" . DA  I 2 23  ? 32.115  84.966  71.263  1.00 98.21  ? 23  DA  E "O4'" 1 
ATOM 8559  C "C3'" . DA  I 2 23  ? 30.839  83.325  70.114  1.00 102.48 ? 23  DA  E "C3'" 1 
ATOM 8560  O "O3'" . DA  I 2 23  ? 31.227  81.974  70.260  1.00 102.42 ? 23  DA  E "O3'" 1 
ATOM 8561  C "C2'" . DA  I 2 23  ? 30.064  83.842  71.329  1.00 104.85 ? 23  DA  E "C2'" 1 
ATOM 8562  C "C1'" . DA  I 2 23  ? 31.160  84.474  72.192  1.00 101.62 ? 23  DA  E "C1'" 1 
ATOM 8563  N N9    . DA  I 2 23  ? 30.734  85.585  73.064  1.00 102.66 ? 23  DA  E N9    1 
ATOM 8564  C C8    . DA  I 2 23  ? 29.964  86.663  72.704  1.00 104.29 ? 23  DA  E C8    1 
ATOM 8565  N N7    . DA  I 2 23  ? 29.735  87.521  73.667  1.00 105.15 ? 23  DA  E N7    1 
ATOM 8566  C C5    . DA  I 2 23  ? 30.405  86.970  74.743  1.00 103.94 ? 23  DA  E C5    1 
ATOM 8567  C C6    . DA  I 2 23  ? 30.548  87.409  76.071  1.00 104.22 ? 23  DA  E C6    1 
ATOM 8568  N N6    . DA  I 2 23  ? 29.991  88.539  76.528  1.00 105.86 ? 23  DA  E N6    1 
ATOM 8569  N N1    . DA  I 2 23  ? 31.284  86.636  76.897  1.00 102.97 ? 23  DA  E N1    1 
ATOM 8570  C C2    . DA  I 2 23  ? 31.830  85.512  76.416  1.00 101.62 ? 23  DA  E C2    1 
ATOM 8571  N N3    . DA  I 2 23  ? 31.763  84.999  75.189  1.00 101.25 ? 23  DA  E N3    1 
ATOM 8572  C C4    . DA  I 2 23  ? 31.028  85.784  74.395  1.00 102.43 ? 23  DA  E C4    1 
ATOM 8573  P P     . DT  I 2 24  ? 30.182  80.810  69.920  1.00 106.21 ? 24  DT  E P     1 
ATOM 8574  O OP1   . DT  I 2 24  ? 30.926  79.628  69.438  1.00 105.03 ? 24  DT  E OP1   1 
ATOM 8575  O OP2   . DT  I 2 24  ? 29.124  81.429  69.088  1.00 108.54 ? 24  DT  E OP2   1 
ATOM 8576  O "O5'" . DT  I 2 24  ? 29.585  80.433  71.355  1.00 108.83 ? 24  DT  E "O5'" 1 
ATOM 8577  C "C5'" . DT  I 2 24  ? 30.501  80.016  72.368  1.00 107.08 ? 24  DT  E "C5'" 1 
ATOM 8578  C "C4'" . DT  I 2 24  ? 29.981  80.263  73.773  1.00 109.16 ? 24  DT  E "C4'" 1 
ATOM 8579  O "O4'" . DT  I 2 24  ? 29.948  81.673  74.097  1.00 108.24 ? 24  DT  E "O4'" 1 
ATOM 8580  C "C3'" . DT  I 2 24  ? 28.551  79.839  73.998  1.00 113.94 ? 24  DT  E "C3'" 1 
ATOM 8581  O "O3'" . DT  I 2 24  ? 28.562  78.463  74.304  1.00 115.46 ? 24  DT  E "O3'" 1 
ATOM 8582  C "C2'" . DT  I 2 24  ? 28.149  80.691  75.203  1.00 115.28 ? 24  DT  E "C2'" 1 
ATOM 8583  C "C1'" . DT  I 2 24  ? 29.186  81.816  75.271  1.00 111.22 ? 24  DT  E "C1'" 1 
ATOM 8584  N N1    . DT  I 2 24  ? 28.575  83.181  75.359  1.00 112.15 ? 24  DT  E N1    1 
ATOM 8585  C C2    . DT  I 2 24  ? 28.626  83.842  76.558  1.00 112.50 ? 24  DT  E C2    1 
ATOM 8586  O O2    . DT  I 2 24  ? 29.162  83.373  77.544  1.00 112.01 ? 24  DT  E O2    1 
ATOM 8587  N N3    . DT  I 2 24  ? 28.032  85.076  76.571  1.00 113.67 ? 24  DT  E N3    1 
ATOM 8588  C C4    . DT  I 2 24  ? 27.398  85.706  75.528  1.00 114.61 ? 24  DT  E C4    1 
ATOM 8589  O O4    . DT  I 2 24  ? 26.892  86.816  75.639  1.00 115.92 ? 24  DT  E O4    1 
ATOM 8590  C C5    . DT  I 2 24  ? 27.377  84.957  74.305  1.00 114.18 ? 24  DT  E C5    1 
ATOM 8591  C C7    . DT  I 2 24  ? 26.723  85.546  73.100  1.00 115.33 ? 24  DT  E C7    1 
ATOM 8592  C C6    . DT  I 2 24  ? 27.950  83.750  74.272  1.00 112.99 ? 24  DT  E C6    1 
ATOM 8593  O "O5'" . DA  J 2 1   ? 26.961  89.810  85.855  1.00 114.74 ? 1   DA  F "O5'" 1 
ATOM 8594  C "C5'" . DA  J 2 1   ? 28.225  89.886  86.530  1.00 111.96 ? 1   DA  F "C5'" 1 
ATOM 8595  C "C4'" . DA  J 2 1   ? 28.778  88.502  86.766  1.00 111.48 ? 1   DA  F "C4'" 1 
ATOM 8596  O "O4'" . DA  J 2 1   ? 28.213  87.589  85.806  1.00 112.20 ? 1   DA  F "O4'" 1 
ATOM 8597  C "C3'" . DA  J 2 1   ? 30.280  88.370  86.591  1.00 107.07 ? 1   DA  F "C3'" 1 
ATOM 8598  O "O3'" . DA  J 2 1   ? 30.635  87.126  87.142  1.00 108.02 ? 1   DA  F "O3'" 1 
ATOM 8599  C "C2'" . DA  J 2 1   ? 30.411  88.049  85.122  1.00 104.67 ? 1   DA  F "C2'" 1 
ATOM 8600  C "C1'" . DA  J 2 1   ? 29.192  87.192  84.859  1.00 108.34 ? 1   DA  F "C1'" 1 
ATOM 8601  N N9    . DA  J 2 1   ? 28.647  87.427  83.527  1.00 107.91 ? 1   DA  F N9    1 
ATOM 8602  C C8    . DA  J 2 1   ? 27.923  88.506  83.090  1.00 108.73 ? 1   DA  F C8    1 
ATOM 8603  N N7    . DA  J 2 1   ? 27.611  88.452  81.821  1.00 108.28 ? 1   DA  F N7    1 
ATOM 8604  C C5    . DA  J 2 1   ? 28.180  87.264  81.390  1.00 107.00 ? 1   DA  F C5    1 
ATOM 8605  C C6    . DA  J 2 1   ? 28.206  86.631  80.142  1.00 106.32 ? 1   DA  F C6    1 
ATOM 8606  N N6    . DA  J 2 1   ? 27.627  87.128  79.050  1.00 106.77 ? 1   DA  F N6    1 
ATOM 8607  N N1    . DA  J 2 1   ? 28.858  85.454  80.049  1.00 105.53 ? 1   DA  F N1    1 
ATOM 8608  C C2    . DA  J 2 1   ? 29.438  84.956  81.146  1.00 105.45 ? 1   DA  F C2    1 
ATOM 8609  N N3    . DA  J 2 1   ? 29.489  85.461  82.373  1.00 106.02 ? 1   DA  F N3    1 
ATOM 8610  C C4    . DA  J 2 1   ? 28.832  86.629  82.428  1.00 106.75 ? 1   DA  F C4    1 
ATOM 8611  P P     . DT  J 2 2   ? 32.100  86.620  87.318  1.00 105.01 ? 2   DT  F P     1 
ATOM 8612  O OP1   . DT  J 2 2   ? 31.826  85.988  88.631  1.00 108.74 ? 2   DT  F OP1   1 
ATOM 8613  O OP2   . DT  J 2 2   ? 33.269  87.512  87.144  1.00 100.94 ? 2   DT  F OP2   1 
ATOM 8614  O "O5'" . DT  J 2 2   ? 32.255  85.473  86.216  1.00 104.03 ? 2   DT  F "O5'" 1 
ATOM 8615  C "C5'" . DT  J 2 2   ? 33.478  84.767  86.118  1.00 101.81 ? 2   DT  F "C5'" 1 
ATOM 8616  C "C4'" . DT  J 2 2   ? 33.653  84.221  84.714  1.00 100.02 ? 2   DT  F "C4'" 1 
ATOM 8617  O "O4'" . DT  J 2 2   ? 32.769  84.895  83.776  1.00 99.95  ? 2   DT  F "O4'" 1 
ATOM 8618  C "C3'" . DT  J 2 2   ? 35.042  84.427  84.147  1.00 95.83  ? 2   DT  F "C3'" 1 
ATOM 8619  O "O3'" . DT  J 2 2   ? 35.363  83.312  83.322  1.00 95.71  ? 2   DT  F "O3'" 1 
ATOM 8620  C "C2'" . DT  J 2 2   ? 34.815  85.701  83.346  1.00 93.62  ? 2   DT  F "C2'" 1 
ATOM 8621  C "C1'" . DT  J 2 2   ? 33.539  85.264  82.656  1.00 96.28  ? 2   DT  F "C1'" 1 
ATOM 8622  N N1    . DT  J 2 2   ? 32.781  86.263  81.812  1.00 96.03  ? 2   DT  F N1    1 
ATOM 8623  C C2    . DT  J 2 2   ? 32.666  86.047  80.443  1.00 95.23  ? 2   DT  F C2    1 
ATOM 8624  O O2    . DT  J 2 2   ? 33.166  85.090  79.872  1.00 94.65  ? 2   DT  F O2    1 
ATOM 8625  N N3    . DT  J 2 2   ? 31.941  87.001  79.757  1.00 95.50  ? 2   DT  F N3    1 
ATOM 8626  C C4    . DT  J 2 2   ? 31.327  88.127  80.286  1.00 96.57  ? 2   DT  F C4    1 
ATOM 8627  O O4    . DT  J 2 2   ? 30.691  88.938  79.611  1.00 97.16  ? 2   DT  F O4    1 
ATOM 8628  C C5    . DT  J 2 2   ? 31.481  88.284  81.715  1.00 97.39  ? 2   DT  F C5    1 
ATOM 8629  C C7    . DT  J 2 2   ? 30.857  89.473  82.386  1.00 98.98  ? 2   DT  F C7    1 
ATOM 8630  C C6    . DT  J 2 2   ? 32.183  87.361  82.405  1.00 97.08  ? 2   DT  F C6    1 
ATOM 8631  P P     . DT  J 2 3   ? 36.639  82.390  83.665  1.00 95.25  ? 3   DT  F P     1 
ATOM 8632  O OP1   . DT  J 2 3   ? 36.133  81.182  84.353  1.00 99.54  ? 3   DT  F OP1   1 
ATOM 8633  O OP2   . DT  J 2 3   ? 37.707  83.253  84.237  1.00 92.54  ? 3   DT  F OP2   1 
ATOM 8634  O "O5'" . DT  J 2 3   ? 37.188  81.937  82.251  1.00 93.38  ? 3   DT  F "O5'" 1 
ATOM 8635  C "C5'" . DT  J 2 3   ? 37.668  82.973  81.434  1.00 89.59  ? 3   DT  F "C5'" 1 
ATOM 8636  C "C4'" . DT  J 2 3   ? 37.663  82.527  79.994  1.00 89.00  ? 3   DT  F "C4'" 1 
ATOM 8637  O "O4'" . DT  J 2 3   ? 36.651  83.240  79.240  1.00 89.09  ? 3   DT  F "O4'" 1 
ATOM 8638  C "C3'" . DT  J 2 3   ? 38.950  82.902  79.320  1.00 85.56  ? 3   DT  F "C3'" 1 
ATOM 8639  O "O3'" . DT  J 2 3   ? 38.968  82.224  78.102  1.00 85.92  ? 3   DT  F "O3'" 1 
ATOM 8640  C "C2'" . DT  J 2 3   ? 38.693  84.385  79.134  1.00 83.19  ? 3   DT  F "C2'" 1 
ATOM 8641  C "C1'" . DT  J 2 3   ? 37.271  84.323  78.593  1.00 85.70  ? 3   DT  F "C1'" 1 
ATOM 8642  N N1    . DT  J 2 3   ? 36.501  85.552  78.850  1.00 85.75  ? 3   DT  F N1    1 
ATOM 8643  C C2    . DT  J 2 3   ? 35.619  85.934  77.888  1.00 86.58  ? 3   DT  F C2    1 
ATOM 8644  O O2    . DT  J 2 3   ? 35.471  85.279  76.876  1.00 87.23  ? 3   DT  F O2    1 
ATOM 8645  N N3    . DT  J 2 3   ? 34.933  87.090  78.160  1.00 86.98  ? 3   DT  F N3    1 
ATOM 8646  C C4    . DT  J 2 3   ? 35.044  87.892  79.279  1.00 86.68  ? 3   DT  F C4    1 
ATOM 8647  O O4    . DT  J 2 3   ? 34.381  88.917  79.439  1.00 87.49  ? 3   DT  F O4    1 
ATOM 8648  C C5    . DT  J 2 3   ? 36.002  87.429  80.246  1.00 85.72  ? 3   DT  F C5    1 
ATOM 8649  C C7    . DT  J 2 3   ? 36.216  88.220  81.499  1.00 85.64  ? 3   DT  F C7    1 
ATOM 8650  C C6    . DT  J 2 3   ? 36.681  86.299  79.994  1.00 85.30  ? 3   DT  F C6    1 
ATOM 8651  P P     . DT  J 2 4   ? 40.338  81.572  77.571  1.00 91.68  ? 4   DT  F P     1 
ATOM 8652  O OP1   . DT  J 2 4   ? 40.185  80.102  77.730  1.00 95.58  ? 4   DT  F OP1   1 
ATOM 8653  O OP2   . DT  J 2 4   ? 41.463  82.305  78.209  1.00 88.82  ? 4   DT  F OP2   1 
ATOM 8654  O "O5'" . DT  J 2 4   ? 40.365  81.956  76.009  1.00 89.84  ? 4   DT  F "O5'" 1 
ATOM 8655  C "C5'" . DT  J 2 4   ? 39.129  82.156  75.298  1.00 90.96  ? 4   DT  F "C5'" 1 
ATOM 8656  C "C4'" . DT  J 2 4   ? 39.215  83.282  74.270  1.00 88.59  ? 4   DT  F "C4'" 1 
ATOM 8657  O "O4'" . DT  J 2 4   ? 38.468  84.473  74.664  1.00 88.14  ? 4   DT  F "O4'" 1 
ATOM 8658  C "C3'" . DT  J 2 4   ? 40.605  83.802  73.971  1.00 85.20  ? 4   DT  F "C3'" 1 
ATOM 8659  O "O3'" . DT  J 2 4   ? 40.508  84.262  72.664  1.00 84.59  ? 4   DT  F "O3'" 1 
ATOM 8660  C "C2'" . DT  J 2 4   ? 40.687  84.985  74.927  1.00 83.30  ? 4   DT  F "C2'" 1 
ATOM 8661  C "C1'" . DT  J 2 4   ? 39.330  85.586  74.608  1.00 84.85  ? 4   DT  F "C1'" 1 
ATOM 8662  N N1    . DT  J 2 4   ? 38.838  86.653  75.523  1.00 84.60  ? 4   DT  F N1    1 
ATOM 8663  C C2    . DT  J 2 4   ? 37.817  87.437  75.063  1.00 85.65  ? 4   DT  F C2    1 
ATOM 8664  O O2    . DT  J 2 4   ? 37.325  87.276  73.972  1.00 86.69  ? 4   DT  F O2    1 
ATOM 8665  N N3    . DT  J 2 4   ? 37.394  88.414  75.914  1.00 85.76  ? 4   DT  F N3    1 
ATOM 8666  C C4    . DT  J 2 4   ? 37.887  88.674  77.171  1.00 84.98  ? 4   DT  F C4    1 
ATOM 8667  O O4    . DT  J 2 4   ? 37.431  89.576  77.868  1.00 85.91  ? 4   DT  F O4    1 
ATOM 8668  C C5    . DT  J 2 4   ? 38.964  87.816  77.600  1.00 83.84  ? 4   DT  F C5    1 
ATOM 8669  C C7    . DT  J 2 4   ? 39.572  88.021  78.954  1.00 83.28  ? 4   DT  F C7    1 
ATOM 8670  C C6    . DT  J 2 4   ? 39.391  86.857  76.768  1.00 83.71  ? 4   DT  F C6    1 
ATOM 8671  P P     . DA  J 2 5   ? 41.613  83.862  71.570  1.00 76.83  ? 5   DA  F P     1 
ATOM 8672  O OP1   . DA  J 2 5   ? 41.151  82.621  70.903  1.00 79.97  ? 5   DA  F OP1   1 
ATOM 8673  O OP2   . DA  J 2 5   ? 42.948  83.929  72.211  1.00 74.67  ? 5   DA  F OP2   1 
ATOM 8674  O "O5'" . DA  J 2 5   ? 41.512  85.056  70.504  1.00 75.33  ? 5   DA  F "O5'" 1 
ATOM 8675  C "C5'" . DA  J 2 5   ? 40.208  85.631  70.267  1.00 76.88  ? 5   DA  F "C5'" 1 
ATOM 8676  C "C4'" . DA  J 2 5   ? 40.262  87.113  69.899  1.00 74.94  ? 5   DA  F "C4'" 1 
ATOM 8677  O "O4'" . DA  J 2 5   ? 39.640  87.920  70.941  1.00 74.83  ? 5   DA  F "O4'" 1 
ATOM 8678  C "C3'" . DA  J 2 5   ? 41.654  87.701  69.630  1.00 71.76  ? 5   DA  F "C3'" 1 
ATOM 8679  O "O3'" . DA  J 2 5   ? 41.626  88.320  68.343  1.00 71.76  ? 5   DA  F "O3'" 1 
ATOM 8680  C "C2'" . DA  J 2 5   ? 41.831  88.709  70.761  1.00 69.87  ? 5   DA  F "C2'" 1 
ATOM 8681  C "C1'" . DA  J 2 5   ? 40.388  89.110  71.070  1.00 72.09  ? 5   DA  F "C1'" 1 
ATOM 8682  N N9    . DA  J 2 5   ? 40.229  89.675  72.406  1.00 71.63  ? 5   DA  F N9    1 
ATOM 8683  C C8    . DA  J 2 5   ? 40.759  89.186  73.570  1.00 71.03  ? 5   DA  F C8    1 
ATOM 8684  N N7    . DA  J 2 5   ? 40.455  89.901  74.629  1.00 71.07  ? 5   DA  F N7    1 
ATOM 8685  C C5    . DA  J 2 5   ? 39.682  90.931  74.117  1.00 71.74  ? 5   DA  F C5    1 
ATOM 8686  C C6    . DA  J 2 5   ? 39.055  92.026  74.731  1.00 72.46  ? 5   DA  F C6    1 
ATOM 8687  N N6    . DA  J 2 5   ? 39.132  92.246  76.041  1.00 72.54  ? 5   DA  F N6    1 
ATOM 8688  N N1    . DA  J 2 5   ? 38.360  92.873  73.944  1.00 73.48  ? 5   DA  F N1    1 
ATOM 8689  C C2    . DA  J 2 5   ? 38.296  92.624  72.634  1.00 73.72  ? 5   DA  F C2    1 
ATOM 8690  N N3    . DA  J 2 5   ? 38.837  91.625  71.938  1.00 73.12  ? 5   DA  F N3    1 
ATOM 8691  C C4    . DA  J 2 5   ? 39.530  90.812  72.747  1.00 72.10  ? 5   DA  F C4    1 
ATOM 8692  P P     . DG  J 2 6   ? 42.938  88.998  67.714  1.00 69.07  ? 6   DG  F P     1 
ATOM 8693  O OP1   . DG  J 2 6   ? 43.047  88.575  66.290  1.00 70.44  ? 6   DG  F OP1   1 
ATOM 8694  O OP2   . DG  J 2 6   ? 44.089  88.760  68.624  1.00 66.84  ? 6   DG  F OP2   1 
ATOM 8695  O "O5'" . DG  J 2 6   ? 42.610  90.560  67.808  1.00 68.06  ? 6   DG  F "O5'" 1 
ATOM 8696  C "C5'" . DG  J 2 6   ? 41.352  91.117  67.489  1.00 70.20  ? 6   DG  F "C5'" 1 
ATOM 8697  C "C4'" . DG  J 2 6   ? 41.330  92.571  67.929  1.00 68.99  ? 6   DG  F "C4'" 1 
ATOM 8698  O "O4'" . DG  J 2 6   ? 41.003  92.657  69.336  1.00 68.82  ? 6   DG  F "O4'" 1 
ATOM 8699  C "C3'" . DG  J 2 6   ? 42.648  93.355  67.825  1.00 66.06  ? 6   DG  F "C3'" 1 
ATOM 8700  O "O3'" . DG  J 2 6   ? 42.344  94.715  67.635  1.00 66.23  ? 6   DG  F "O3'" 1 
ATOM 8701  C "C2'" . DG  J 2 6   ? 43.221  93.243  69.229  1.00 64.24  ? 6   DG  F "C2'" 1 
ATOM 8702  C "C1'" . DG  J 2 6   ? 41.931  93.518  69.977  1.00 66.25  ? 6   DG  F "C1'" 1 
ATOM 8703  N N9    . DG  J 2 6   ? 42.090  93.259  71.406  1.00 65.63  ? 6   DG  F N9    1 
ATOM 8704  C C8    . DG  J 2 6   ? 42.741  92.192  71.988  1.00 64.90  ? 6   DG  F C8    1 
ATOM 8705  N N7    . DG  J 2 6   ? 42.752  92.225  73.295  1.00 64.78  ? 6   DG  F N7    1 
ATOM 8706  C C5    . DG  J 2 6   ? 42.068  93.392  73.593  1.00 65.44  ? 6   DG  F C5    1 
ATOM 8707  C C6    . DG  J 2 6   ? 41.775  93.945  74.849  1.00 65.95  ? 6   DG  F C6    1 
ATOM 8708  O O6    . DG  J 2 6   ? 42.059  93.481  75.965  1.00 65.91  ? 6   DG  F O6    1 
ATOM 8709  N N1    . DG  J 2 6   ? 41.070  95.136  74.727  1.00 67.01  ? 6   DG  F N1    1 
ATOM 8710  C C2    . DG  J 2 6   ? 40.697  95.698  73.540  1.00 67.56  ? 6   DG  F C2    1 
ATOM 8711  N N2    . DG  J 2 6   ? 40.025  96.835  73.654  1.00 69.00  ? 6   DG  F N2    1 
ATOM 8712  N N3    . DG  J 2 6   ? 40.953  95.201  72.343  1.00 67.12  ? 6   DG  F N3    1 
ATOM 8713  C C4    . DG  J 2 6   ? 41.648  94.044  72.451  1.00 66.01  ? 6   DG  F C4    1 
ATOM 8714  P P     . DT  J 2 7   ? 43.396  95.704  66.965  1.00 64.38  ? 7   DT  F P     1 
ATOM 8715  O OP1   . DT  J 2 7   ? 43.271  95.535  65.510  1.00 65.90  ? 7   DT  F OP1   1 
ATOM 8716  O OP2   . DT  J 2 7   ? 44.701  95.490  67.607  1.00 61.52  ? 7   DT  F OP2   1 
ATOM 8717  O "O5'" . DT  J 2 7   ? 42.827  97.129  67.356  1.00 65.06  ? 7   DT  F "O5'" 1 
ATOM 8718  C "C5'" . DT  J 2 7   ? 42.463  97.230  68.681  1.00 64.97  ? 7   DT  F "C5'" 1 
ATOM 8719  C "C4'" . DT  J 2 7   ? 41.983  98.605  69.064  1.00 65.94  ? 7   DT  F "C4'" 1 
ATOM 8720  O "O4'" . DT  J 2 7   ? 41.815  98.609  70.501  1.00 65.71  ? 7   DT  F "O4'" 1 
ATOM 8721  C "C3'" . DT  J 2 7   ? 42.977  99.719  68.884  1.00 64.20  ? 7   DT  F "C3'" 1 
ATOM 8722  O "O3'" . DT  J 2 7   ? 42.324  100.961 69.046  1.00 66.05  ? 7   DT  F "O3'" 1 
ATOM 8723  C "C2'" . DT  J 2 7   ? 43.938  99.427  70.030  1.00 61.62  ? 7   DT  F "C2'" 1 
ATOM 8724  C "C1'" . DT  J 2 7   ? 42.980  99.057  71.163  1.00 63.15  ? 7   DT  F "C1'" 1 
ATOM 8725  N N1    . DT  J 2 7   ? 43.472  98.013  72.163  1.00 61.80  ? 7   DT  F N1    1 
ATOM 8726  C C2    . DT  J 2 7   ? 43.314  98.210  73.509  1.00 62.10  ? 7   DT  F C2    1 
ATOM 8727  O O2    . DT  J 2 7   ? 42.786  99.184  73.985  1.00 63.41  ? 7   DT  F O2    1 
ATOM 8728  N N3    . DT  J 2 7   ? 43.800  97.221  74.304  1.00 61.18  ? 7   DT  F N3    1 
ATOM 8729  C C4    . DT  J 2 7   ? 44.422  96.068  73.911  1.00 60.09  ? 7   DT  F C4    1 
ATOM 8730  O O4    . DT  J 2 7   ? 44.813  95.238  74.712  1.00 59.73  ? 7   DT  F O4    1 
ATOM 8731  C C5    . DT  J 2 7   ? 44.570  95.906  72.497  1.00 59.83  ? 7   DT  F C5    1 
ATOM 8732  C C7    . DT  J 2 7   ? 45.231  94.689  71.921  1.00 59.10  ? 7   DT  F C7    1 
ATOM 8733  C C6    . DT  J 2 7   ? 44.088  96.869  71.715  1.00 60.66  ? 7   DT  F C6    1 
ATOM 8734  P P     . DT  J 2 8   ? 43.180  102.312 68.928  1.00 65.02  ? 8   DT  F P     1 
ATOM 8735  O OP1   . DT  J 2 8   ? 42.388  103.373 68.275  1.00 67.94  ? 8   DT  F OP1   1 
ATOM 8736  O OP2   . DT  J 2 8   ? 44.520  101.958 68.381  1.00 62.25  ? 8   DT  F OP2   1 
ATOM 8737  O "O5'" . DT  J 2 8   ? 43.384  102.744 70.439  1.00 64.24  ? 8   DT  F "O5'" 1 
ATOM 8738  C "C5'" . DT  J 2 8   ? 42.558  103.727 70.990  1.00 66.69  ? 8   DT  F "C5'" 1 
ATOM 8739  C "C4'" . DT  J 2 8   ? 42.970  103.841 72.432  1.00 65.62  ? 8   DT  F "C4'" 1 
ATOM 8740  O "O4'" . DT  J 2 8   ? 43.623  102.617 72.809  1.00 63.21  ? 8   DT  F "O4'" 1 
ATOM 8741  C "C3'" . DT  J 2 8   ? 44.059  104.855 72.670  1.00 64.12  ? 8   DT  F "C3'" 1 
ATOM 8742  O "O3'" . DT  J 2 8   ? 43.533  105.950 73.328  1.00 66.43  ? 8   DT  F "O3'" 1 
ATOM 8743  C "C2'" . DT  J 2 8   ? 45.098  104.142 73.539  1.00 61.27  ? 8   DT  F "C2'" 1 
ATOM 8744  C "C1'" . DT  J 2 8   ? 44.328  102.914 73.976  1.00 61.98  ? 8   DT  F "C1'" 1 
ATOM 8745  N N1    . DT  J 2 8   ? 45.052  101.677 74.263  1.00 59.79  ? 8   DT  F N1    1 
ATOM 8746  C C2    . DT  J 2 8   ? 45.223  101.276 75.565  1.00 59.57  ? 8   DT  F C2    1 
ATOM 8747  O O2    . DT  J 2 8   ? 44.840  101.912 76.520  1.00 61.01  ? 8   DT  F O2    1 
ATOM 8748  N N3    . DT  J 2 8   ? 45.884  100.099 75.721  1.00 57.93  ? 8   DT  F N3    1 
ATOM 8749  C C4    . DT  J 2 8   ? 46.370  99.301  74.713  1.00 56.60  ? 8   DT  F C4    1 
ATOM 8750  O O4    . DT  J 2 8   ? 46.956  98.250  74.945  1.00 55.55  ? 8   DT  F O4    1 
ATOM 8751  C C5    . DT  J 2 8   ? 46.150  99.782  73.373  1.00 56.91  ? 8   DT  F C5    1 
ATOM 8752  C C7    . DT  J 2 8   ? 46.653  98.993  72.212  1.00 55.90  ? 8   DT  F C7    1 
ATOM 8753  C C6    . DT  J 2 8   ? 45.501  100.931 73.205  1.00 58.48  ? 8   DT  F C6    1 
ATOM 8754  P P     . DA  J 2 9   ? 44.501  107.194 73.598  1.00 65.75  ? 9   DA  F P     1 
ATOM 8755  O OP1   . DA  J 2 9   ? 43.689  108.431 73.707  1.00 69.29  ? 9   DA  F OP1   1 
ATOM 8756  O OP2   . DA  J 2 9   ? 45.589  107.102 72.591  1.00 63.25  ? 9   DA  F OP2   1 
ATOM 8757  O "O5'" . DA  J 2 9   ? 45.106  106.886 75.041  1.00 64.28  ? 9   DA  F "O5'" 1 
ATOM 8758  C "C5'" . DA  J 2 9   ? 44.245  106.599 76.135  1.00 66.19  ? 9   DA  F "C5'" 1 
ATOM 8759  C "C4'" . DA  J 2 9   ? 45.088  106.509 77.396  1.00 64.83  ? 9   DA  F "C4'" 1 
ATOM 8760  O "O4'" . DA  J 2 9   ? 45.709  105.198 77.471  1.00 62.20  ? 9   DA  F "O4'" 1 
ATOM 8761  C "C3'" . DA  J 2 9   ? 46.235  107.517 77.488  1.00 63.66  ? 9   DA  F "C3'" 1 
ATOM 8762  O "O3'" . DA  J 2 9   ? 46.357  107.930 78.849  1.00 64.82  ? 9   DA  F "O3'" 1 
ATOM 8763  C "C2'" . DA  J 2 9   ? 47.443  106.710 77.002  1.00 60.02  ? 9   DA  F "C2'" 1 
ATOM 8764  C "C1'" . DA  J 2 9   ? 47.119  105.327 77.553  1.00 59.56  ? 9   DA  F "C1'" 1 
ATOM 8765  N N9    . DA  J 2 9   ? 47.662  104.188 76.822  1.00 57.20  ? 9   DA  F N9    1 
ATOM 8766  C C8    . DA  J 2 9   ? 47.720  104.008 75.467  1.00 56.41  ? 9   DA  F C8    1 
ATOM 8767  N N7    . DA  J 2 9   ? 48.247  102.857 75.111  1.00 54.63  ? 9   DA  F N7    1 
ATOM 8768  C C5    . DA  J 2 9   ? 48.547  102.246 76.319  1.00 54.22  ? 9   DA  F C5    1 
ATOM 8769  C C6    . DA  J 2 9   ? 49.129  101.015 76.634  1.00 52.94  ? 9   DA  F C6    1 
ATOM 8770  N N6    . DA  J 2 9   ? 49.520  100.137 75.723  1.00 51.76  ? 9   DA  F N6    1 
ATOM 8771  N N1    . DA  J 2 9   ? 49.298  100.723 77.933  1.00 53.31  ? 9   DA  F N1    1 
ATOM 8772  C C2    . DA  J 2 9   ? 48.905  101.603 78.856  1.00 54.84  ? 9   DA  F C2    1 
ATOM 8773  N N3    . DA  J 2 9   ? 48.344  102.792 78.686  1.00 56.20  ? 9   DA  F N3    1 
ATOM 8774  C C4    . DA  J 2 9   ? 48.192  103.051 77.382  1.00 55.78  ? 9   DA  F C4    1 
ATOM 8775  P P     . DG  J 2 10  ? 47.065  109.326 79.240  1.00 65.56  ? 10  DG  F P     1 
ATOM 8776  O OP1   . DG  J 2 10  ? 46.175  109.912 80.275  1.00 69.21  ? 10  DG  F OP1   1 
ATOM 8777  O OP2   . DG  J 2 10  ? 47.485  110.105 78.051  1.00 65.00  ? 10  DG  F OP2   1 
ATOM 8778  O "O5'" . DG  J 2 10  ? 48.438  108.881 79.919  1.00 62.75  ? 10  DG  F "O5'" 1 
ATOM 8779  C "C5'" . DG  J 2 10  ? 48.335  108.001 81.023  1.00 62.86  ? 10  DG  F "C5'" 1 
ATOM 8780  C "C4'" . DG  J 2 10  ? 49.624  107.237 81.192  1.00 59.78  ? 10  DG  F "C4'" 1 
ATOM 8781  O "O4'" . DG  J 2 10  ? 49.674  106.173 80.206  1.00 57.65  ? 10  DG  F "O4'" 1 
ATOM 8782  C "C3'" . DG  J 2 10  ? 50.865  108.100 80.997  1.00 58.40  ? 10  DG  F "C3'" 1 
ATOM 8783  O "O3'" . DG  J 2 10  ? 51.781  107.787 82.038  1.00 57.67  ? 10  DG  F "O3'" 1 
ATOM 8784  C "C2'" . DG  J 2 10  ? 51.353  107.644 79.625  1.00 55.79  ? 10  DG  F "C2'" 1 
ATOM 8785  C "C1'" . DG  J 2 10  ? 50.992  106.167 79.704  1.00 54.99  ? 10  DG  F "C1'" 1 
ATOM 8786  N N9    . DG  J 2 10  ? 51.081  105.449 78.433  1.00 53.25  ? 10  DG  F N9    1 
ATOM 8787  C C8    . DG  J 2 10  ? 50.718  105.900 77.196  1.00 53.45  ? 10  DG  F C8    1 
ATOM 8788  N N7    . DG  J 2 10  ? 50.927  105.030 76.260  1.00 51.95  ? 10  DG  F N7    1 
ATOM 8789  C C5    . DG  J 2 10  ? 51.460  103.944 76.912  1.00 50.71  ? 10  DG  F C5    1 
ATOM 8790  C C6    . DG  J 2 10  ? 51.887  102.715 76.403  1.00 49.23  ? 10  DG  F C6    1 
ATOM 8791  O O6    . DG  J 2 10  ? 51.882  102.331 75.240  1.00 48.65  ? 10  DG  F O6    1 
ATOM 8792  N N1    . DG  J 2 10  ? 52.363  101.868 77.380  1.00 48.77  ? 10  DG  F N1    1 
ATOM 8793  C C2    . DG  J 2 10  ? 52.424  102.187 78.697  1.00 49.64  ? 10  DG  F C2    1 
ATOM 8794  N N2    . DG  J 2 10  ? 52.921  101.233 79.472  1.00 49.36  ? 10  DG  F N2    1 
ATOM 8795  N N3    . DG  J 2 10  ? 52.037  103.344 79.212  1.00 51.04  ? 10  DG  F N3    1 
ATOM 8796  C C4    . DG  J 2 10  ? 51.564  104.175 78.249  1.00 51.48  ? 10  DG  F C4    1 
ATOM 8797  P P     . DA  J 2 11  ? 52.841  108.881 82.576  1.00 57.88  ? 11  DA  F P     1 
ATOM 8798  O OP1   . DA  J 2 11  ? 52.564  108.878 84.031  1.00 60.22  ? 11  DA  F OP1   1 
ATOM 8799  O OP2   . DA  J 2 11  ? 52.830  110.140 81.786  1.00 58.57  ? 11  DA  F OP2   1 
ATOM 8800  O "O5'" . DA  J 2 11  ? 54.281  108.238 82.270  1.00 54.66  ? 11  DA  F "O5'" 1 
ATOM 8801  C "C5'" . DA  J 2 11  ? 54.761  107.264 83.155  1.00 54.15  ? 11  DA  F "C5'" 1 
ATOM 8802  C "C4'" . DA  J 2 11  ? 55.355  106.076 82.432  1.00 51.51  ? 11  DA  F "C4'" 1 
ATOM 8803  O "O4'" . DA  J 2 11  ? 54.649  105.795 81.222  1.00 50.83  ? 11  DA  F "O4'" 1 
ATOM 8804  C "C3'" . DA  J 2 11  ? 56.730  106.255 81.846  1.00 49.33  ? 11  DA  F "C3'" 1 
ATOM 8805  O "O3'" . DA  J 2 11  ? 57.666  106.288 82.885  1.00 49.59  ? 11  DA  F "O3'" 1 
ATOM 8806  C "C2'" . DA  J 2 11  ? 56.828  104.978 81.021  1.00 47.53  ? 11  DA  F "C2'" 1 
ATOM 8807  C "C1'" . DA  J 2 11  ? 55.382  104.762 80.597  1.00 48.62  ? 11  DA  F "C1'" 1 
ATOM 8808  N N9    . DA  J 2 11  ? 55.114  104.795 79.162  1.00 47.68  ? 11  DA  F N9    1 
ATOM 8809  C C8    . DA  J 2 11  ? 54.515  105.810 78.486  1.00 48.58  ? 11  DA  F C8    1 
ATOM 8810  N N7    . DA  J 2 11  ? 54.385  105.580 77.207  1.00 47.77  ? 11  DA  F N7    1 
ATOM 8811  C C5    . DA  J 2 11  ? 54.917  104.326 77.043  1.00 46.25  ? 11  DA  F C5    1 
ATOM 8812  C C6    . DA  J 2 11  ? 55.066  103.542 75.910  1.00 45.18  ? 11  DA  F C6    1 
ATOM 8813  N N6    . DA  J 2 11  ? 54.661  103.956 74.717  1.00 45.47  ? 11  DA  F N6    1 
ATOM 8814  N N1    . DA  J 2 11  ? 55.646  102.345 76.058  1.00 44.20  ? 11  DA  F N1    1 
ATOM 8815  C C2    . DA  J 2 11  ? 56.044  101.972 77.272  1.00 44.30  ? 11  DA  F C2    1 
ATOM 8816  N N3    . DA  J 2 11  ? 55.952  102.623 78.424  1.00 45.27  ? 11  DA  F N3    1 
ATOM 8817  C C4    . DA  J 2 11  ? 55.371  103.815 78.232  1.00 46.20  ? 11  DA  F C4    1 
ATOM 8818  P P     . DT  J 2 12  ? 59.168  106.728 82.586  1.00 48.03  ? 12  DT  F P     1 
ATOM 8819  O OP1   . DT  J 2 12  ? 59.839  106.943 83.886  1.00 49.30  ? 12  DT  F OP1   1 
ATOM 8820  O OP2   . DT  J 2 12  ? 59.148  107.792 81.543  1.00 47.62  ? 12  DT  F OP2   1 
ATOM 8821  O "O5'" . DT  J 2 12  ? 59.789  105.439 81.902  1.00 45.91  ? 12  DT  F "O5'" 1 
ATOM 8822  C "C5'" . DT  J 2 12  ? 59.826  104.214 82.562  1.00 46.17  ? 12  DT  F "C5'" 1 
ATOM 8823  C "C4'" . DT  J 2 12  ? 60.613  103.304 81.663  1.00 44.30  ? 12  DT  F "C4'" 1 
ATOM 8824  O "O4'" . DT  J 2 12  ? 59.874  103.214 80.437  1.00 43.52  ? 12  DT  F "O4'" 1 
ATOM 8825  C "C3'" . DT  J 2 12  ? 61.963  103.856 81.258  1.00 43.09  ? 12  DT  F "C3'" 1 
ATOM 8826  O "O3'" . DT  J 2 12  ? 62.957  102.874 81.463  1.00 42.66  ? 12  DT  F "O3'" 1 
ATOM 8827  C "C2'" . DT  J 2 12  ? 61.785  104.226 79.787  1.00 41.82  ? 12  DT  F "C2'" 1 
ATOM 8828  C "C1'" . DT  J 2 12  ? 60.751  103.224 79.344  1.00 41.90  ? 12  DT  F "C1'" 1 
ATOM 8829  N N1    . DT  J 2 12  ? 59.936  103.682 78.227  1.00 41.72  ? 12  DT  F N1    1 
ATOM 8830  C C2    . DT  J 2 12  ? 59.840  102.951 77.061  1.00 40.91  ? 12  DT  F C2    1 
ATOM 8831  O O2    . DT  J 2 12  ? 60.435  101.902 76.890  1.00 40.32  ? 12  DT  F O2    1 
ATOM 8832  N N3    . DT  J 2 12  ? 59.019  103.497 76.101  1.00 41.21  ? 12  DT  F N3    1 
ATOM 8833  C C4    . DT  J 2 12  ? 58.307  104.679 76.228  1.00 42.32  ? 12  DT  F C4    1 
ATOM 8834  O O4    . DT  J 2 12  ? 57.603  105.138 75.340  1.00 42.89  ? 12  DT  F O4    1 
ATOM 8835  C C5    . DT  J 2 12  ? 58.451  105.358 77.488  1.00 43.17  ? 12  DT  F C5    1 
ATOM 8836  C C7    . DT  J 2 12  ? 57.735  106.631 77.752  1.00 44.85  ? 12  DT  F C7    1 
ATOM 8837  C C6    . DT  J 2 12  ? 59.243  104.842 78.411  1.00 42.81  ? 12  DT  F C6    1 
ATOM 8838  P P     . DA  J 2 13  ? 64.478  103.192 81.070  1.00 41.61  ? 13  DA  F P     1 
ATOM 8839  O OP1   . DA  J 2 13  ? 65.348  102.208 81.697  1.00 42.10  ? 13  DA  F OP1   1 
ATOM 8840  O OP2   . DA  J 2 13  ? 64.752  104.625 81.241  1.00 41.86  ? 13  DA  F OP2   1 
ATOM 8841  O "O5'" . DA  J 2 13  ? 64.552  102.831 79.525  1.00 40.08  ? 13  DA  F "O5'" 1 
ATOM 8842  C "C5'" . DA  J 2 13  ? 64.662  101.466 79.225  1.00 40.54  ? 13  DA  F "C5'" 1 
ATOM 8843  C "C4'" . DA  J 2 13  ? 64.741  101.229 77.740  1.00 39.81  ? 13  DA  F "C4'" 1 
ATOM 8844  O "O4'" . DA  J 2 13  ? 63.598  101.808 77.090  1.00 39.22  ? 13  DA  F "O4'" 1 
ATOM 8845  C "C3'" . DA  J 2 13  ? 65.934  101.904 77.125  1.00 39.02  ? 13  DA  F "C3'" 1 
ATOM 8846  O "O3'" . DA  J 2 13  ? 66.826  100.926 76.701  1.00 39.58  ? 13  DA  F "O3'" 1 
ATOM 8847  C "C2'" . DA  J 2 13  ? 65.394  102.683 75.933  1.00 38.13  ? 13  DA  F "C2'" 1 
ATOM 8848  C "C1'" . DA  J 2 13  ? 63.966  102.216 75.788  1.00 38.48  ? 13  DA  F "C1'" 1 
ATOM 8849  N N9    . DA  J 2 13  ? 63.065  103.272 75.340  1.00 38.14  ? 13  DA  F N9    1 
ATOM 8850  C C8    . DA  J 2 13  ? 62.684  104.373 76.052  1.00 38.81  ? 13  DA  F C8    1 
ATOM 8851  N N7    . DA  J 2 13  ? 61.850  105.164 75.436  1.00 39.32  ? 13  DA  F N7    1 
ATOM 8852  C C5    . DA  J 2 13  ? 61.669  104.519 74.230  1.00 38.88  ? 13  DA  F C5    1 
ATOM 8853  C C6    . DA  J 2 13  ? 60.890  104.856 73.124  1.00 39.39  ? 13  DA  F C6    1 
ATOM 8854  N N6    . DA  J 2 13  ? 60.153  105.957 73.109  1.00 40.47  ? 13  DA  F N6    1 
ATOM 8855  N N1    . DA  J 2 13  ? 60.900  104.027 72.068  1.00 39.12  ? 13  DA  F N1    1 
ATOM 8856  C C2    . DA  J 2 13  ? 61.661  102.933 72.132  1.00 38.46  ? 13  DA  F C2    1 
ATOM 8857  N N3    . DA  J 2 13  ? 62.443  102.508 73.124  1.00 38.34  ? 13  DA  F N3    1 
ATOM 8858  C C4    . DA  J 2 13  ? 62.402  103.358 74.151  1.00 38.17  ? 13  DA  F C4    1 
ATOM 8859  P P     . DT  J 2 14  ? 68.307  101.344 76.267  1.00 39.27  ? 14  DT  F P     1 
ATOM 8860  O OP1   . DT  J 2 14  ? 69.105  100.100 76.252  1.00 40.36  ? 14  DT  F OP1   1 
ATOM 8861  O OP2   . DT  J 2 14  ? 68.682  102.545 77.059  1.00 38.79  ? 14  DT  F OP2   1 
ATOM 8862  O "O5'" . DT  J 2 14  ? 68.143  101.814 74.754  1.00 38.56  ? 14  DT  F "O5'" 1 
ATOM 8863  C "C5'" . DT  J 2 14  ? 67.662  100.896 73.808  1.00 39.04  ? 14  DT  F "C5'" 1 
ATOM 8864  C "C4'" . DT  J 2 14  ? 67.307  101.559 72.491  1.00 38.61  ? 14  DT  F "C4'" 1 
ATOM 8865  O "O4'" . DT  J 2 14  ? 66.077  102.306 72.647  1.00 38.10  ? 14  DT  F "O4'" 1 
ATOM 8866  C "C3'" . DT  J 2 14  ? 68.302  102.573 71.974  1.00 38.19  ? 14  DT  F "C3'" 1 
ATOM 8867  O "O3'" . DT  J 2 14  ? 69.367  101.968 71.196  1.00 38.87  ? 14  DT  F "O3'" 1 
ATOM 8868  C "C2'" . DT  J 2 14  ? 67.383  103.467 71.147  1.00 37.88  ? 14  DT  F "C2'" 1 
ATOM 8869  C "C1'" . DT  J 2 14  ? 65.946  103.193 71.582  1.00 37.85  ? 14  DT  F "C1'" 1 
ATOM 8870  N N1    . DT  J 2 14  ? 65.191  104.415 72.012  1.00 37.28  ? 14  DT  F N1    1 
ATOM 8871  C C2    . DT  J 2 14  ? 64.233  104.925 71.171  1.00 37.48  ? 14  DT  F C2    1 
ATOM 8872  O O2    . DT  J 2 14  ? 63.971  104.421 70.103  1.00 38.10  ? 14  DT  F O2    1 
ATOM 8873  N N3    . DT  J 2 14  ? 63.590  106.050 71.611  1.00 38.12  ? 14  DT  F N3    1 
ATOM 8874  C C4    . DT  J 2 14  ? 63.806  106.717 72.790  1.00 38.27  ? 14  DT  F C4    1 
ATOM 8875  O O4    . DT  J 2 14  ? 63.189  107.726 73.100  1.00 39.25  ? 14  DT  F O4    1 
ATOM 8876  C C5    . DT  J 2 14  ? 64.823  106.152 73.635  1.00 37.57  ? 14  DT  F C5    1 
ATOM 8877  C C7    . DT  J 2 14  ? 65.128  106.822 74.933  1.00 38.02  ? 14  DT  F C7    1 
ATOM 8878  C C6    . DT  J 2 14  ? 65.459  105.045 73.219  1.00 36.91  ? 14  DT  F C6    1 
ATOM 8879  P P     . DC  J 2 15  ? 70.521  102.882 70.539  1.00 38.81  ? 15  DC  F P     1 
ATOM 8880  O OP1   . DC  J 2 15  ? 71.586  102.028 70.026  1.00 39.74  ? 15  DC  F OP1   1 
ATOM 8881  O OP2   . DC  J 2 15  ? 70.863  104.000 71.428  1.00 38.07  ? 15  DC  F OP2   1 
ATOM 8882  O "O5'" . DC  J 2 15  ? 69.845  103.498 69.246  1.00 38.94  ? 15  DC  F "O5'" 1 
ATOM 8883  C "C5'" . DC  J 2 15  ? 69.602  102.699 68.109  1.00 39.91  ? 15  DC  F "C5'" 1 
ATOM 8884  C "C4'" . DC  J 2 15  ? 68.767  103.488 67.131  1.00 40.14  ? 15  DC  F "C4'" 1 
ATOM 8885  O "O4'" . DC  J 2 15  ? 67.605  103.989 67.828  1.00 39.36  ? 15  DC  F "O4'" 1 
ATOM 8886  C "C3'" . DC  J 2 15  ? 69.473  104.712 66.588  1.00 40.28  ? 15  DC  F "C3'" 1 
ATOM 8887  O "O3'" . DC  J 2 15  ? 70.018  104.322 65.350  1.00 41.58  ? 15  DC  F "O3'" 1 
ATOM 8888  C "C2'" . DC  J 2 15  ? 68.353  105.734 66.420  1.00 40.10  ? 15  DC  F "C2'" 1 
ATOM 8889  C "C1'" . DC  J 2 15  ? 67.207  105.231 67.301  1.00 39.42  ? 15  DC  F "C1'" 1 
ATOM 8890  N N1    . DC  J 2 15  ? 66.848  106.185 68.395  1.00 38.46  ? 15  DC  F N1    1 
ATOM 8891  C C2    . DC  J 2 15  ? 65.792  107.056 68.199  1.00 38.60  ? 15  DC  F C2    1 
ATOM 8892  O O2    . DC  J 2 15  ? 65.167  107.012 67.140  1.00 39.51  ? 15  DC  F O2    1 
ATOM 8893  N N3    . DC  J 2 15  ? 65.461  107.932 69.167  1.00 38.74  ? 15  DC  F N3    1 
ATOM 8894  C C4    . DC  J 2 15  ? 66.132  107.969 70.292  1.00 38.09  ? 15  DC  F C4    1 
ATOM 8895  N N4    . DC  J 2 15  ? 65.729  108.865 71.186  1.00 38.67  ? 15  DC  F N4    1 
ATOM 8896  C C5    . DC  J 2 15  ? 67.220  107.092 70.527  1.00 37.19  ? 15  DC  F C5    1 
ATOM 8897  C C6    . DC  J 2 15  ? 67.539  106.235 69.559  1.00 37.72  ? 15  DC  F C6    1 
ATOM 8898  P P     . DT  J 2 16  ? 71.072  105.251 64.570  1.00 42.35  ? 16  DT  F P     1 
ATOM 8899  O OP1   . DT  J 2 16  ? 71.477  104.425 63.405  1.00 43.92  ? 16  DT  F OP1   1 
ATOM 8900  O OP2   . DT  J 2 16  ? 72.063  105.806 65.516  1.00 41.52  ? 16  DT  F OP2   1 
ATOM 8901  O "O5'" . DT  J 2 16  ? 70.203  106.457 64.008  1.00 42.69  ? 16  DT  F "O5'" 1 
ATOM 8902  C "C5'" . DT  J 2 16  ? 69.495  106.235 62.833  1.00 44.04  ? 16  DT  F "C5'" 1 
ATOM 8903  C "C4'" . DT  J 2 16  ? 68.755  107.491 62.471  1.00 44.52  ? 16  DT  F "C4'" 1 
ATOM 8904  O "O4'" . DT  J 2 16  ? 68.044  108.022 63.609  1.00 43.10  ? 16  DT  F "O4'" 1 
ATOM 8905  C "C3'" . DT  J 2 16  ? 69.617  108.616 61.968  1.00 45.44  ? 16  DT  F "C3'" 1 
ATOM 8906  O "O3'" . DT  J 2 16  ? 68.945  109.145 60.846  1.00 47.23  ? 16  DT  F "O3'" 1 
ATOM 8907  C "C2'" . DT  J 2 16  ? 69.652  109.596 63.138  1.00 44.09  ? 16  DT  F "C2'" 1 
ATOM 8908  C "C1'" . DT  J 2 16  ? 68.294  109.406 63.763  1.00 43.20  ? 16  DT  F "C1'" 1 
ATOM 8909  N N1    . DT  J 2 16  ? 68.151  109.720 65.239  1.00 41.55  ? 16  DT  F N1    1 
ATOM 8910  C C2    . DT  J 2 16  ? 67.191  110.613 65.668  1.00 42.14  ? 16  DT  F C2    1 
ATOM 8911  O O2    . DT  J 2 16  ? 66.471  111.209 64.906  1.00 43.72  ? 16  DT  F O2    1 
ATOM 8912  N N3    . DT  J 2 16  ? 67.095  110.806 67.021  1.00 41.34  ? 16  DT  F N3    1 
ATOM 8913  C C4    . DT  J 2 16  ? 67.867  110.196 68.000  1.00 39.90  ? 16  DT  F C4    1 
ATOM 8914  O O4    . DT  J 2 16  ? 67.735  110.429 69.201  1.00 39.58  ? 16  DT  F O4    1 
ATOM 8915  C C5    . DT  J 2 16  ? 68.846  109.263 67.506  1.00 39.23  ? 16  DT  F C5    1 
ATOM 8916  C C7    . DT  J 2 16  ? 69.739  108.547 68.474  1.00 38.44  ? 16  DT  F C7    1 
ATOM 8917  C C6    . DT  J 2 16  ? 68.933  109.071 66.176  1.00 40.42  ? 16  DT  F C6    1 
ATOM 8918  P P     . DA  J 2 17  ? 69.681  110.173 59.859  1.00 49.38  ? 17  DA  F P     1 
ATOM 8919  O OP1   . DA  J 2 17  ? 69.191  109.758 58.518  1.00 51.54  ? 17  DA  F OP1   1 
ATOM 8920  O OP2   . DA  J 2 17  ? 71.117  110.268 60.276  1.00 48.82  ? 17  DA  F OP2   1 
ATOM 8921  O "O5'" . DA  J 2 17  ? 69.049  111.601 60.213  1.00 49.51  ? 17  DA  F "O5'" 1 
ATOM 8922  C "C5'" . DA  J 2 17  ? 67.637  111.751 60.237  1.00 49.66  ? 17  DA  F "C5'" 1 
ATOM 8923  C "C4'" . DA  J 2 17  ? 67.273  113.170 60.654  1.00 50.72  ? 17  DA  F "C4'" 1 
ATOM 8924  O "O4'" . DA  J 2 17  ? 67.160  113.329 62.096  1.00 49.00  ? 17  DA  F "O4'" 1 
ATOM 8925  C "C3'" . DA  J 2 17  ? 68.221  114.267 60.213  1.00 52.28  ? 17  DA  F "C3'" 1 
ATOM 8926  O "O3'" . DA  J 2 17  ? 67.381  115.373 59.989  1.00 54.67  ? 17  DA  F "O3'" 1 
ATOM 8927  C "C2'" . DA  J 2 17  ? 69.106  114.454 61.435  1.00 50.38  ? 17  DA  F "C2'" 1 
ATOM 8928  C "C1'" . DA  J 2 17  ? 68.091  114.299 62.565  1.00 49.19  ? 17  DA  F "C1'" 1 
ATOM 8929  N N9    . DA  J 2 17  ? 68.625  113.835 63.863  1.00 46.85  ? 17  DA  F N9    1 
ATOM 8930  C C8    . DA  J 2 17  ? 69.616  112.914 64.054  1.00 45.18  ? 17  DA  F C8    1 
ATOM 8931  N N7    . DA  J 2 17  ? 69.879  112.661 65.313  1.00 43.63  ? 17  DA  F N7    1 
ATOM 8932  C C5    . DA  J 2 17  ? 69.001  113.463 66.009  1.00 44.27  ? 17  DA  F C5    1 
ATOM 8933  C C6    . DA  J 2 17  ? 68.790  113.656 67.381  1.00 43.62  ? 17  DA  F C6    1 
ATOM 8934  N N6    . DA  J 2 17  ? 69.484  113.020 68.320  1.00 42.10  ? 17  DA  F N6    1 
ATOM 8935  N N1    . DA  J 2 17  ? 67.852  114.525 67.767  1.00 44.97  ? 17  DA  F N1    1 
ATOM 8936  C C2    . DA  J 2 17  ? 67.169  115.152 66.819  1.00 46.85  ? 17  DA  F C2    1 
ATOM 8937  N N3    . DA  J 2 17  ? 67.271  115.060 65.498  1.00 47.67  ? 17  DA  F N3    1 
ATOM 8938  C C4    . DA  J 2 17  ? 68.222  114.190 65.143  1.00 46.25  ? 17  DA  F C4    1 
ATOM 8939  P P     . DA  J 2 18  ? 67.921  116.674 59.216  1.00 57.48  ? 18  DA  F P     1 
ATOM 8940  O OP1   . DA  J 2 18  ? 66.946  117.052 58.165  1.00 60.56  ? 18  DA  F OP1   1 
ATOM 8941  O OP2   . DA  J 2 18  ? 69.343  116.426 58.865  1.00 56.88  ? 18  DA  F OP2   1 
ATOM 8942  O "O5'" . DA  J 2 18  ? 67.925  117.788 60.369  1.00 57.62  ? 18  DA  F "O5'" 1 
ATOM 8943  C "C5'" . DA  J 2 18  ? 66.784  117.873 61.201  1.00 57.37  ? 18  DA  F "C5'" 1 
ATOM 8944  C "C4'" . DA  J 2 18  ? 67.070  118.677 62.450  1.00 57.06  ? 18  DA  F "C4'" 1 
ATOM 8945  O "O4'" . DA  J 2 18  ? 67.626  117.842 63.493  1.00 53.87  ? 18  DA  F "O4'" 1 
ATOM 8946  C "C3'" . DA  J 2 18  ? 68.048  119.806 62.245  1.00 58.88  ? 18  DA  F "C3'" 1 
ATOM 8947  O "O3'" . DA  J 2 18  ? 67.354  120.990 62.590  1.00 61.54  ? 18  DA  F "O3'" 1 
ATOM 8948  C "C2'" . DA  J 2 18  ? 69.204  119.466 63.194  1.00 56.31  ? 18  DA  F "C2'" 1 
ATOM 8949  C "C1'" . DA  J 2 18  ? 68.536  118.599 64.252  1.00 53.90  ? 18  DA  F "C1'" 1 
ATOM 8950  N N9    . DA  J 2 18  ? 69.455  117.693 64.944  1.00 51.07  ? 18  DA  F N9    1 
ATOM 8951  C C8    . DA  J 2 18  ? 70.332  116.841 64.349  1.00 49.82  ? 18  DA  F C8    1 
ATOM 8952  N N7    . DA  J 2 18  ? 71.046  116.123 65.182  1.00 47.68  ? 18  DA  F N7    1 
ATOM 8953  C C5    . DA  J 2 18  ? 70.608  116.533 66.421  1.00 47.45  ? 18  DA  F C5    1 
ATOM 8954  C C6    . DA  J 2 18  ? 70.991  116.152 67.711  1.00 45.91  ? 18  DA  F C6    1 
ATOM 8955  N N6    . DA  J 2 18  ? 71.921  115.232 67.946  1.00 44.25  ? 18  DA  F N6    1 
ATOM 8956  N N1    . DA  J 2 18  ? 70.387  116.746 68.745  1.00 46.51  ? 18  DA  F N1    1 
ATOM 8957  C C2    . DA  J 2 18  ? 69.452  117.653 68.479  1.00 48.55  ? 18  DA  F C2    1 
ATOM 8958  N N3    . DA  J 2 18  ? 68.998  118.091 67.309  1.00 50.21  ? 18  DA  F N3    1 
ATOM 8959  C C4    . DA  J 2 18  ? 69.628  117.491 66.299  1.00 49.51  ? 18  DA  F C4    1 
ATOM 8960  P P     . DC  J 2 19  ? 68.074  122.427 62.487  1.00 64.45  ? 19  DC  F P     1 
ATOM 8961  O OP1   . DC  J 2 19  ? 66.924  123.328 62.297  1.00 67.93  ? 19  DC  F OP1   1 
ATOM 8962  O OP2   . DC  J 2 19  ? 69.218  122.405 61.543  1.00 64.76  ? 19  DC  F OP2   1 
ATOM 8963  O "O5'" . DC  J 2 19  ? 68.674  122.684 63.951  1.00 62.96  ? 19  DC  F "O5'" 1 
ATOM 8964  C "C5'" . DC  J 2 19  ? 67.738  122.975 64.992  1.00 63.40  ? 19  DC  F "C5'" 1 
ATOM 8965  C "C4'" . DC  J 2 19  ? 68.357  122.949 66.373  1.00 61.70  ? 19  DC  F "C4'" 1 
ATOM 8966  O "O4'" . DC  J 2 19  ? 69.006  121.669 66.537  1.00 58.06  ? 19  DC  F "O4'" 1 
ATOM 8967  C "C3'" . DC  J 2 19  ? 69.478  123.944 66.575  1.00 63.24  ? 19  DC  F "C3'" 1 
ATOM 8968  O "O3'" . DC  J 2 19  ? 69.095  125.230 67.086  1.00 66.60  ? 19  DC  F "O3'" 1 
ATOM 8969  C "C2'" . DC  J 2 19  ? 70.410  123.209 67.542  1.00 60.16  ? 19  DC  F "C2'" 1 
ATOM 8970  C "C1'" . DC  J 2 19  ? 69.912  121.776 67.596  1.00 57.05  ? 19  DC  F "C1'" 1 
ATOM 8971  N N1    . DC  J 2 19  ? 70.967  120.791 67.372  1.00 54.46  ? 19  DC  F N1    1 
ATOM 8972  C C2    . DC  J 2 19  ? 71.628  120.200 68.448  1.00 52.38  ? 19  DC  F C2    1 
ATOM 8973  O O2    . DC  J 2 19  ? 71.305  120.524 69.599  1.00 52.72  ? 19  DC  F O2    1 
ATOM 8974  N N3    . DC  J 2 19  ? 72.603  119.287 68.202  1.00 50.42  ? 19  DC  F N3    1 
ATOM 8975  C C4    . DC  J 2 19  ? 72.899  118.969 66.951  1.00 50.48  ? 19  DC  F C4    1 
ATOM 8976  N N4    . DC  J 2 19  ? 73.846  118.065 66.724  1.00 48.90  ? 19  DC  F N4    1 
ATOM 8977  C C5    . DC  J 2 19  ? 72.227  119.558 65.861  1.00 52.55  ? 19  DC  F C5    1 
ATOM 8978  C C6    . DC  J 2 19  ? 71.279  120.455 66.108  1.00 54.49  ? 19  DC  F C6    1 
ATOM 8979  P P     . DT  J 2 20  ? 70.249  126.352 67.290  1.00 72.01  ? 20  DT  F P     1 
ATOM 8980  O OP1   . DT  J 2 20  ? 69.685  127.723 67.368  1.00 76.47  ? 20  DT  F OP1   1 
ATOM 8981  O OP2   . DT  J 2 20  ? 71.329  126.090 66.302  1.00 71.20  ? 20  DT  F OP2   1 
ATOM 8982  O "O5'" . DT  J 2 20  ? 70.858  126.006 68.730  1.00 69.86  ? 20  DT  F "O5'" 1 
ATOM 8983  C "C5'" . DT  J 2 20  ? 70.033  125.721 69.868  1.00 69.22  ? 20  DT  F "C5'" 1 
ATOM 8984  C "C4'" . DT  J 2 20  ? 70.947  125.437 71.038  1.00 67.56  ? 20  DT  F "C4'" 1 
ATOM 8985  O "O4'" . DT  J 2 20  ? 71.602  124.160 70.809  1.00 63.87  ? 20  DT  F "O4'" 1 
ATOM 8986  C "C3'" . DT  J 2 20  ? 72.051  126.477 71.193  1.00 69.76  ? 20  DT  F "C3'" 1 
ATOM 8987  O "O3'" . DT  J 2 20  ? 72.390  126.665 72.562  1.00 70.06  ? 20  DT  F "O3'" 1 
ATOM 8988  C "C2'" . DT  J 2 20  ? 73.221  125.804 70.482  1.00 67.43  ? 20  DT  F "C2'" 1 
ATOM 8989  C "C1'" . DT  J 2 20  ? 73.002  124.352 70.896  1.00 63.69  ? 20  DT  F "C1'" 1 
ATOM 8990  N N1    . DT  J 2 20  ? 73.740  123.366 70.051  1.00 61.20  ? 20  DT  F N1    1 
ATOM 8991  C C2    . DT  J 2 20  ? 74.546  122.428 70.662  1.00 58.73  ? 20  DT  F C2    1 
ATOM 8992  O O2    . DT  J 2 20  ? 74.701  122.338 71.869  1.00 58.37  ? 20  DT  F O2    1 
ATOM 8993  N N3    . DT  J 2 20  ? 75.175  121.576 69.794  1.00 57.01  ? 20  DT  F N3    1 
ATOM 8994  C C4    . DT  J 2 20  ? 75.096  121.575 68.419  1.00 57.53  ? 20  DT  F C4    1 
ATOM 8995  O O4    . DT  J 2 20  ? 75.704  120.770 67.725  1.00 56.21  ? 20  DT  F O4    1 
ATOM 8996  C C5    . DT  J 2 20  ? 74.245  122.586 67.863  1.00 60.14  ? 20  DT  F C5    1 
ATOM 8997  C C7    . DT  J 2 20  ? 74.081  122.666 66.384  1.00 61.29  ? 20  DT  F C7    1 
ATOM 8998  C C6    . DT  J 2 20  ? 73.617  123.425 68.685  1.00 61.85  ? 20  DT  F C6    1 
ATOM 8999  P P     . DA  J 2 21  ? 72.394  128.130 73.235  1.00 71.14  ? 21  DA  F P     1 
ATOM 9000  O OP1   . DA  J 2 21  ? 71.077  128.188 73.938  1.00 72.29  ? 21  DA  F OP1   1 
ATOM 9001  O OP2   . DA  J 2 21  ? 72.839  129.163 72.258  1.00 73.99  ? 21  DA  F OP2   1 
ATOM 9002  O "O5'" . DA  J 2 21  ? 73.600  128.075 74.276  1.00 70.54  ? 21  DA  F "O5'" 1 
ATOM 9003  C "C5'" . DA  J 2 21  ? 73.723  126.939 75.066  1.00 67.44  ? 21  DA  F "C5'" 1 
ATOM 9004  C "C4'" . DA  J 2 21  ? 75.053  126.281 74.805  1.00 65.06  ? 21  DA  F "C4'" 1 
ATOM 9005  O "O4'" . DA  J 2 21  ? 75.265  125.969 73.425  1.00 63.82  ? 21  DA  F "O4'" 1 
ATOM 9006  C "C3'" . DA  J 2 21  ? 76.255  127.142 75.107  1.00 67.20  ? 21  DA  F "C3'" 1 
ATOM 9007  O "O3'" . DA  J 2 21  ? 76.570  126.764 76.404  1.00 66.71  ? 21  DA  F "O3'" 1 
ATOM 9008  C "C2'" . DA  J 2 21  ? 77.305  126.711 74.069  1.00 65.53  ? 21  DA  F "C2'" 1 
ATOM 9009  C "C1'" . DA  J 2 21  ? 76.601  125.525 73.427  1.00 62.40  ? 21  DA  F "C1'" 1 
ATOM 9010  N N9    . DA  J 2 21  ? 76.907  125.095 72.060  1.00 61.17  ? 21  DA  F N9    1 
ATOM 9011  C C8    . DA  J 2 21  ? 76.467  125.665 70.901  1.00 62.74  ? 21  DA  F C8    1 
ATOM 9012  N N7    . DA  J 2 21  ? 76.848  125.042 69.814  1.00 61.36  ? 21  DA  F N7    1 
ATOM 9013  C C5    . DA  J 2 21  ? 77.586  123.986 70.284  1.00 58.69  ? 21  DA  F C5    1 
ATOM 9014  C C6    . DA  J 2 21  ? 78.259  122.959 69.622  1.00 56.62  ? 21  DA  F C6    1 
ATOM 9015  N N6    . DA  J 2 21  ? 78.299  122.849 68.300  1.00 56.89  ? 21  DA  F N6    1 
ATOM 9016  N N1    . DA  J 2 21  ? 78.893  122.047 70.379  1.00 54.63  ? 21  DA  F N1    1 
ATOM 9017  C C2    . DA  J 2 21  ? 78.848  122.165 71.714  1.00 54.70  ? 21  DA  F C2    1 
ATOM 9018  N N3    . DA  J 2 21  ? 78.242  123.091 72.457  1.00 56.55  ? 21  DA  F N3    1 
ATOM 9019  C C4    . DA  J 2 21  ? 77.625  123.985 71.666  1.00 58.51  ? 21  DA  F C4    1 
ATOM 9020  P P     . DA  J 2 22  ? 77.644  127.590 77.235  1.00 69.31  ? 22  DA  F P     1 
ATOM 9021  O OP1   . DA  J 2 22  ? 77.432  127.245 78.661  1.00 69.44  ? 22  DA  F OP1   1 
ATOM 9022  O OP2   . DA  J 2 22  ? 77.580  128.988 76.759  1.00 73.02  ? 22  DA  F OP2   1 
ATOM 9023  O "O5'" . DA  J 2 22  ? 79.035  126.998 76.735  1.00 67.34  ? 22  DA  F "O5'" 1 
ATOM 9024  C "C5'" . DA  J 2 22  ? 79.318  125.675 77.103  1.00 64.22  ? 22  DA  F "C5'" 1 
ATOM 9025  C "C4'" . DA  J 2 22  ? 80.454  125.157 76.258  1.00 62.65  ? 22  DA  F "C4'" 1 
ATOM 9026  O "O4'" . DA  J 2 22  ? 80.035  125.154 74.888  1.00 61.95  ? 22  DA  F "O4'" 1 
ATOM 9027  C "C3'" . DA  J 2 22  ? 81.699  126.027 76.255  1.00 65.04  ? 22  DA  F "C3'" 1 
ATOM 9028  O "O3'" . DA  J 2 22  ? 82.652  125.440 77.136  1.00 64.50  ? 22  DA  F "O3'" 1 
ATOM 9029  C "C2'" . DA  J 2 22  ? 82.144  126.019 74.798  1.00 64.50  ? 22  DA  F "C2'" 1 
ATOM 9030  C "C1'" . DA  J 2 22  ? 81.200  125.039 74.122  1.00 61.70  ? 22  DA  F "C1'" 1 
ATOM 9031  N N9    . DA  J 2 22  ? 80.892  125.370 72.729  1.00 62.13  ? 22  DA  F N9    1 
ATOM 9032  C C8    . DA  J 2 22  ? 80.247  126.481 72.265  1.00 64.69  ? 22  DA  F C8    1 
ATOM 9033  N N7    . DA  J 2 22  ? 80.111  126.508 70.965  1.00 64.80  ? 22  DA  F N7    1 
ATOM 9034  C C5    . DA  J 2 22  ? 80.710  125.338 70.540  1.00 62.10  ? 22  DA  F C5    1 
ATOM 9035  C C6    . DA  J 2 22  ? 80.903  124.780 69.260  1.00 61.18  ? 22  DA  F C6    1 
ATOM 9036  N N6    . DA  J 2 22  ? 80.484  125.358 68.125  1.00 62.89  ? 22  DA  F N6    1 
ATOM 9037  N N1    . DA  J 2 22  ? 81.544  123.599 69.186  1.00 58.80  ? 22  DA  F N1    1 
ATOM 9038  C C2    . DA  J 2 22  ? 81.954  123.022 70.322  1.00 57.46  ? 22  DA  F C2    1 
ATOM 9039  N N3    . DA  J 2 22  ? 81.834  123.446 71.579  1.00 58.13  ? 22  DA  F N3    1 
ATOM 9040  C C4    . DA  J 2 22  ? 81.196  124.624 71.615  1.00 60.46  ? 22  DA  F C4    1 
ATOM 9041  P P     . DA  J 2 23  ? 84.227  125.577 76.864  1.00 65.37  ? 23  DA  F P     1 
ATOM 9042  O OP1   . DA  J 2 23  ? 84.851  125.127 78.118  1.00 65.60  ? 23  DA  F OP1   1 
ATOM 9043  O OP2   . DA  J 2 23  ? 84.550  126.913 76.291  1.00 68.34  ? 23  DA  F OP2   1 
ATOM 9044  O "O5'" . DA  J 2 23  ? 84.546  124.462 75.771  1.00 62.50  ? 23  DA  F "O5'" 1 
ATOM 9045  C "C5'" . DA  J 2 23  ? 85.575  123.516 76.010  1.00 61.36  ? 23  DA  F "C5'" 1 
ATOM 9046  C "C4'" . DA  J 2 23  ? 85.964  122.786 74.733  1.00 59.70  ? 23  DA  F "C4'" 1 
ATOM 9047  O "O4'" . DA  J 2 23  ? 84.993  123.040 73.687  1.00 59.17  ? 23  DA  F "O4'" 1 
ATOM 9048  C "C3'" . DA  J 2 23  ? 87.302  123.245 74.181  1.00 61.45  ? 23  DA  F "C3'" 1 
ATOM 9049  O "O3'" . DA  J 2 23  ? 88.301  122.322 74.619  1.00 60.88  ? 23  DA  F "O3'" 1 
ATOM 9050  C "C2'" . DA  J 2 23  ? 87.127  123.251 72.664  1.00 61.01  ? 23  DA  F "C2'" 1 
ATOM 9051  C "C1'" . DA  J 2 23  ? 85.620  123.237 72.437  1.00 59.79  ? 23  DA  F "C1'" 1 
ATOM 9052  N N9    . DA  J 2 23  ? 85.025  124.431 71.831  1.00 61.76  ? 23  DA  F N9    1 
ATOM 9053  C C8    . DA  J 2 23  ? 84.500  125.522 72.467  1.00 63.84  ? 23  DA  F C8    1 
ATOM 9054  N N7    . DA  J 2 23  ? 84.004  126.435 71.665  1.00 65.69  ? 23  DA  F N7    1 
ATOM 9055  C C5    . DA  J 2 23  ? 84.217  125.899 70.409  1.00 64.66  ? 23  DA  F C5    1 
ATOM 9056  C C6    . DA  J 2 23  ? 83.929  126.375 69.128  1.00 65.97  ? 23  DA  F C6    1 
ATOM 9057  N N6    . DA  J 2 23  ? 83.336  127.544 68.881  1.00 68.71  ? 23  DA  F N6    1 
ATOM 9058  N N1    . DA  J 2 23  ? 84.280  125.593 68.102  1.00 64.74  ? 23  DA  F N1    1 
ATOM 9059  C C2    . DA  J 2 23  ? 84.876  124.424 68.337  1.00 62.41  ? 23  DA  F C2    1 
ATOM 9060  N N3    . DA  J 2 23  ? 85.201  123.865 69.485  1.00 61.05  ? 23  DA  F N3    1 
ATOM 9061  C C4    . DA  J 2 23  ? 84.841  124.668 70.490  1.00 62.26  ? 23  DA  F C4    1 
ATOM 9062  P P     . DT  J 2 24  ? 89.802  122.437 74.057  1.00 67.06  ? 24  DT  F P     1 
ATOM 9063  O OP1   . DT  J 2 24  ? 90.746  122.162 75.177  1.00 68.10  ? 24  DT  F OP1   1 
ATOM 9064  O OP2   . DT  J 2 24  ? 89.912  123.758 73.376  1.00 69.31  ? 24  DT  F OP2   1 
ATOM 9065  O "O5'" . DT  J 2 24  ? 89.857  121.269 72.935  1.00 65.03  ? 24  DT  F "O5'" 1 
ATOM 9066  C "C5'" . DT  J 2 24  ? 90.816  121.316 71.846  1.00 66.14  ? 24  DT  F "C5'" 1 
ATOM 9067  C "C4'" . DT  J 2 24  ? 90.179  121.676 70.513  1.00 66.01  ? 24  DT  F "C4'" 1 
ATOM 9068  O "O4'" . DT  J 2 24  ? 89.456  122.923 70.617  1.00 67.24  ? 24  DT  F "O4'" 1 
ATOM 9069  C "C3'" . DT  J 2 24  ? 91.119  121.910 69.327  1.00 67.75  ? 24  DT  F "C3'" 1 
ATOM 9070  O "O3'" . DT  J 2 24  ? 90.745  121.052 68.280  1.00 66.39  ? 24  DT  F "O3'" 1 
ATOM 9071  C "C2'" . DT  J 2 24  ? 90.822  123.337 68.866  1.00 69.88  ? 24  DT  F "C2'" 1 
ATOM 9072  C "C1'" . DT  J 2 24  ? 89.371  123.389 69.289  1.00 68.27  ? 24  DT  F "C1'" 1 
ATOM 9073  N N1    . DT  J 2 24  ? 88.678  124.693 69.259  1.00 70.08  ? 24  DT  F N1    1 
ATOM 9074  C C2    . DT  J 2 24  ? 88.291  125.160 68.048  1.00 71.15  ? 24  DT  F C2    1 
ATOM 9075  O O2    . DT  J 2 24  ? 88.533  124.546 67.031  1.00 70.65  ? 24  DT  F O2    1 
ATOM 9076  N N3    . DT  J 2 24  ? 87.631  126.362 68.082  1.00 73.19  ? 24  DT  F N3    1 
ATOM 9077  C C4    . DT  J 2 24  ? 87.312  127.119 69.192  1.00 74.27  ? 24  DT  F C4    1 
ATOM 9078  O O4    . DT  J 2 24  ? 86.709  128.188 69.137  1.00 76.49  ? 24  DT  F O4    1 
ATOM 9079  C C5    . DT  J 2 24  ? 87.740  126.552 70.435  1.00 72.97  ? 24  DT  F C5    1 
ATOM 9080  C C7    . DT  J 2 24  ? 87.435  127.280 71.706  1.00 74.33  ? 24  DT  F C7    1 
ATOM 9081  C C6    . DT  J 2 24  ? 88.390  125.382 70.413  1.00 70.95  ? 24  DT  F C6    1 
ATOM 9082  O "O5'" . DA  K 2 1   ? 129.616 51.164  26.470  1.00 95.38  ? 1   DA  G "O5'" 1 
ATOM 9083  C "C5'" . DA  K 2 1   ? 128.950 49.912  26.216  1.00 98.25  ? 1   DA  G "C5'" 1 
ATOM 9084  C "C4'" . DA  K 2 1   ? 127.436 50.071  26.304  1.00 97.45  ? 1   DA  G "C4'" 1 
ATOM 9085  O "O4'" . DA  K 2 1   ? 126.924 49.416  27.502  1.00 95.88  ? 1   DA  G "O4'" 1 
ATOM 9086  C "C3'" . DA  K 2 1   ? 126.993 51.524  26.388  1.00 94.28  ? 1   DA  G "C3'" 1 
ATOM 9087  O "O3'" . DA  K 2 1   ? 125.740 51.776  25.752  1.00 95.08  ? 1   DA  G "O3'" 1 
ATOM 9088  C "C2'" . DA  K 2 1   ? 126.882 51.759  27.890  1.00 90.30  ? 1   DA  G "C2'" 1 
ATOM 9089  C "C1'" . DA  K 2 1   ? 126.567 50.387  28.488  1.00 91.61  ? 1   DA  G "C1'" 1 
ATOM 9090  N N9    . DA  K 2 1   ? 127.286 50.167  29.759  1.00 89.36  ? 1   DA  G N9    1 
ATOM 9091  C C8    . DA  K 2 1   ? 128.643 50.061  29.938  1.00 89.39  ? 1   DA  G C8    1 
ATOM 9092  N N7    . DA  K 2 1   ? 129.032 49.872  31.177  1.00 87.21  ? 1   DA  G N7    1 
ATOM 9093  C C5    . DA  K 2 1   ? 127.841 49.855  31.875  1.00 85.65  ? 1   DA  G C5    1 
ATOM 9094  C C6    . DA  K 2 1   ? 127.561 49.694  33.248  1.00 83.25  ? 1   DA  G C6    1 
ATOM 9095  N N6    . DA  K 2 1   ? 128.510 49.509  34.175  1.00 81.99  ? 1   DA  G N6    1 
ATOM 9096  N N1    . DA  K 2 1   ? 126.265 49.727  33.631  1.00 82.35  ? 1   DA  G N1    1 
ATOM 9097  C C2    . DA  K 2 1   ? 125.320 49.914  32.699  1.00 83.68  ? 1   DA  G C2    1 
ATOM 9098  N N3    . DA  K 2 1   ? 125.465 50.075  31.379  1.00 85.97  ? 1   DA  G N3    1 
ATOM 9099  C C4    . DA  K 2 1   ? 126.760 50.040  31.025  1.00 86.88  ? 1   DA  G C4    1 
ATOM 9100  P P     . DT  K 2 2   ? 125.140 53.278  25.746  1.00 92.02  ? 2   DT  G P     1 
ATOM 9101  O OP1   . DT  K 2 2   ? 124.085 53.396  24.704  1.00 94.28  ? 2   DT  G OP1   1 
ATOM 9102  O OP2   . DT  K 2 2   ? 126.300 54.206  25.741  1.00 90.55  ? 2   DT  G OP2   1 
ATOM 9103  O "O5'" . DT  K 2 2   ? 124.446 53.429  27.184  1.00 88.20  ? 2   DT  G "O5'" 1 
ATOM 9104  C "C5'" . DT  K 2 2   ? 123.117 52.986  27.461  1.00 88.56  ? 2   DT  G "C5'" 1 
ATOM 9105  C "C4'" . DT  K 2 2   ? 122.833 53.355  28.899  1.00 84.57  ? 2   DT  G "C4'" 1 
ATOM 9106  O "O4'" . DT  K 2 2   ? 123.937 52.801  29.674  1.00 83.84  ? 2   DT  G "O4'" 1 
ATOM 9107  C "C3'" . DT  K 2 2   ? 122.813 54.863  29.159  1.00 81.02  ? 2   DT  G "C3'" 1 
ATOM 9108  O "O3'" . DT  K 2 2   ? 121.791 55.203  30.071  1.00 78.59  ? 2   DT  G "O3'" 1 
ATOM 9109  C "C2'" . DT  K 2 2   ? 124.166 55.086  29.827  1.00 79.16  ? 2   DT  G "C2'" 1 
ATOM 9110  C "C1'" . DT  K 2 2   ? 124.306 53.778  30.623  1.00 80.02  ? 2   DT  G "C1'" 1 
ATOM 9111  N N1    . DT  K 2 2   ? 125.661 53.504  31.314  1.00 79.39  ? 2   DT  G N1    1 
ATOM 9112  C C2    . DT  K 2 2   ? 125.662 53.162  32.657  1.00 77.40  ? 2   DT  G C2    1 
ATOM 9113  O O2    . DT  K 2 2   ? 124.644 53.033  33.321  1.00 76.23  ? 2   DT  G O2    1 
ATOM 9114  N N3    . DT  K 2 2   ? 126.904 52.958  33.204  1.00 76.98  ? 2   DT  G N3    1 
ATOM 9115  C C4    . DT  K 2 2   ? 128.121 53.069  32.567  1.00 78.26  ? 2   DT  G C4    1 
ATOM 9116  O O4    . DT  K 2 2   ? 129.197 52.876  33.119  1.00 77.82  ? 2   DT  G O4    1 
ATOM 9117  C C5    . DT  K 2 2   ? 128.053 53.432  31.186  1.00 80.33  ? 2   DT  G C5    1 
ATOM 9118  C C7    . DT  K 2 2   ? 129.343 53.571  30.440  1.00 82.00  ? 2   DT  G C7    1 
ATOM 9119  C C6    . DT  K 2 2   ? 126.853 53.635  30.626  1.00 80.81  ? 2   DT  G C6    1 
ATOM 9120  P P     . DT  K 2 3   ? 120.381 55.807  29.572  1.00 78.85  ? 3   DT  G P     1 
ATOM 9121  O OP1   . DT  K 2 3   ? 119.779 54.762  28.704  1.00 83.01  ? 3   DT  G OP1   1 
ATOM 9122  O OP2   . DT  K 2 3   ? 120.600 57.185  29.071  1.00 77.25  ? 3   DT  G OP2   1 
ATOM 9123  O "O5'" . DT  K 2 3   ? 119.538 55.974  30.934  1.00 75.85  ? 3   DT  G "O5'" 1 
ATOM 9124  C "C5'" . DT  K 2 3   ? 119.629 55.022  32.027  1.00 75.41  ? 3   DT  G "C5'" 1 
ATOM 9125  C "C4'" . DT  K 2 3   ? 120.414 55.443  33.283  1.00 71.89  ? 3   DT  G "C4'" 1 
ATOM 9126  O "O4'" . DT  K 2 3   ? 121.859 55.396  33.133  1.00 71.94  ? 3   DT  G "O4'" 1 
ATOM 9127  C "C3'" . DT  K 2 3   ? 120.157 56.805  33.918  1.00 68.19  ? 3   DT  G "C3'" 1 
ATOM 9128  O "O3'" . DT  K 2 3   ? 119.529 56.527  35.097  1.00 66.67  ? 3   DT  G "O3'" 1 
ATOM 9129  C "C2'" . DT  K 2 3   ? 121.535 57.341  34.285  1.00 66.25  ? 3   DT  G "C2'" 1 
ATOM 9130  C "C1'" . DT  K 2 3   ? 122.361 56.063  34.271  1.00 68.46  ? 3   DT  G "C1'" 1 
ATOM 9131  N N1    . DT  K 2 3   ? 123.866 56.150  34.150  1.00 68.77  ? 3   DT  G N1    1 
ATOM 9132  C C2    . DT  K 2 3   ? 124.628 55.847  35.256  1.00 67.57  ? 3   DT  G C2    1 
ATOM 9133  O O2    . DT  K 2 3   ? 124.135 55.536  36.323  1.00 66.25  ? 3   DT  G O2    1 
ATOM 9134  N N3    . DT  K 2 3   ? 125.989 55.929  35.085  1.00 68.05  ? 3   DT  G N3    1 
ATOM 9135  C C4    . DT  K 2 3   ? 126.663 56.270  33.932  1.00 69.70  ? 3   DT  G C4    1 
ATOM 9136  O O4    . DT  K 2 3   ? 127.888 56.316  33.843  1.00 70.18  ? 3   DT  G O4    1 
ATOM 9137  C C5    . DT  K 2 3   ? 125.818 56.572  32.813  1.00 70.99  ? 3   DT  G C5    1 
ATOM 9138  C C7    . DT  K 2 3   ? 126.490 56.958  31.526  1.00 73.03  ? 3   DT  G C7    1 
ATOM 9139  C C6    . DT  K 2 3   ? 124.481 56.495  32.962  1.00 70.47  ? 3   DT  G C6    1 
ATOM 9140  P P     . DT  K 2 4   ? 118.489 57.581  35.712  1.00 63.91  ? 4   DT  G P     1 
ATOM 9141  O OP1   . DT  K 2 4   ? 117.180 56.882  35.851  1.00 65.32  ? 4   DT  G OP1   1 
ATOM 9142  O OP2   . DT  K 2 4   ? 118.631 58.816  34.889  1.00 63.14  ? 4   DT  G OP2   1 
ATOM 9143  O "O5'" . DT  K 2 4   ? 119.055 57.868  37.191  1.00 60.70  ? 4   DT  G "O5'" 1 
ATOM 9144  C "C5'" . DT  K 2 4   ? 119.514 56.745  37.935  1.00 61.36  ? 4   DT  G "C5'" 1 
ATOM 9145  C "C4'" . DT  K 2 4   ? 120.632 57.067  38.919  1.00 59.01  ? 4   DT  G "C4'" 1 
ATOM 9146  O "O4'" . DT  K 2 4   ? 121.944 57.120  38.314  1.00 59.93  ? 4   DT  G "O4'" 1 
ATOM 9147  C "C3'" . DT  K 2 4   ? 120.488 58.387  39.623  1.00 55.68  ? 4   DT  G "C3'" 1 
ATOM 9148  O "O3'" . DT  K 2 4   ? 120.356 58.075  40.960  1.00 54.39  ? 4   DT  G "O3'" 1 
ATOM 9149  C "C2'" . DT  K 2 4   ? 121.805 59.110  39.383  1.00 54.92  ? 4   DT  G "C2'" 1 
ATOM 9150  C "C1'" . DT  K 2 4   ? 122.751 57.981  39.061  1.00 57.51  ? 4   DT  G "C1'" 1 
ATOM 9151  N N1    . DT  K 2 4   ? 123.832 58.342  38.148  1.00 58.47  ? 4   DT  G N1    1 
ATOM 9152  C C2    . DT  K 2 4   ? 125.121 58.188  38.574  1.00 58.48  ? 4   DT  G C2    1 
ATOM 9153  O O2    . DT  K 2 4   ? 125.403 57.782  39.675  1.00 57.67  ? 4   DT  G O2    1 
ATOM 9154  N N3    . DT  K 2 4   ? 126.078 58.535  37.664  1.00 59.58  ? 4   DT  G N3    1 
ATOM 9155  C C4    . DT  K 2 4   ? 125.858 58.996  36.386  1.00 60.77  ? 4   DT  G C4    1 
ATOM 9156  O O4    . DT  K 2 4   ? 126.776 59.267  35.631  1.00 61.93  ? 4   DT  G O4    1 
ATOM 9157  C C5    . DT  K 2 4   ? 124.482 59.135  36.001  1.00 60.69  ? 4   DT  G C5    1 
ATOM 9158  C C7    . DT  K 2 4   ? 124.165 59.632  34.630  1.00 62.06  ? 4   DT  G C7    1 
ATOM 9159  C C6    . DT  K 2 4   ? 123.536 58.807  36.886  1.00 59.52  ? 4   DT  G C6    1 
ATOM 9160  P P     . DA  K 2 5   ? 119.873 59.198  41.993  1.00 51.09  ? 5   DA  G P     1 
ATOM 9161  O OP1   . DA  K 2 5   ? 119.224 58.416  43.062  1.00 51.19  ? 5   DA  G OP1   1 
ATOM 9162  O OP2   . DA  K 2 5   ? 119.107 60.245  41.272  1.00 50.44  ? 5   DA  G OP2   1 
ATOM 9163  O "O5'" . DA  K 2 5   ? 121.250 59.802  42.539  1.00 49.70  ? 5   DA  G "O5'" 1 
ATOM 9164  C "C5'" . DA  K 2 5   ? 122.264 58.870  42.896  1.00 51.08  ? 5   DA  G "C5'" 1 
ATOM 9165  C "C4'" . DA  K 2 5   ? 123.309 59.508  43.782  1.00 49.33  ? 5   DA  G "C4'" 1 
ATOM 9166  O "O4'" . DA  K 2 5   ? 124.562 59.622  43.064  1.00 50.28  ? 5   DA  G "O4'" 1 
ATOM 9167  C "C3'" . DA  K 2 5   ? 122.950 60.916  44.185  1.00 46.60  ? 5   DA  G "C3'" 1 
ATOM 9168  O "O3'" . DA  K 2 5   ? 123.510 61.231  45.429  1.00 45.09  ? 5   DA  G "O3'" 1 
ATOM 9169  C "C2'" . DA  K 2 5   ? 123.611 61.747  43.093  1.00 46.70  ? 5   DA  G "C2'" 1 
ATOM 9170  C "C1'" . DA  K 2 5   ? 124.891 60.968  42.819  1.00 48.62  ? 5   DA  G "C1'" 1 
ATOM 9171  N N9    . DA  K 2 5   ? 125.353 61.170  41.453  1.00 50.09  ? 5   DA  G N9    1 
ATOM 9172  C C8    . DA  K 2 5   ? 124.568 61.281  40.353  1.00 51.01  ? 5   DA  G C8    1 
ATOM 9173  N N7    . DA  K 2 5   ? 125.247 61.479  39.255  1.00 52.46  ? 5   DA  G N7    1 
ATOM 9174  C C5    . DA  K 2 5   ? 126.559 61.508  39.668  1.00 52.42  ? 5   DA  G C5    1 
ATOM 9175  C C6    . DA  K 2 5   ? 127.758 61.685  38.970  1.00 53.71  ? 5   DA  G C6    1 
ATOM 9176  N N6    . DA  K 2 5   ? 127.801 61.873  37.653  1.00 55.40  ? 5   DA  G N6    1 
ATOM 9177  N N1    . DA  K 2 5   ? 128.904 61.670  39.673  1.00 53.33  ? 5   DA  G N1    1 
ATOM 9178  C C2    . DA  K 2 5   ? 128.839 61.484  40.990  1.00 51.80  ? 5   DA  G C2    1 
ATOM 9179  N N3    . DA  K 2 5   ? 127.766 61.296  41.756  1.00 50.58  ? 5   DA  G N3    1 
ATOM 9180  C C4    . DA  K 2 5   ? 126.646 61.328  41.023  1.00 50.94  ? 5   DA  G C4    1 
ATOM 9181  P P     . DG  K 2 6   ? 123.253 62.680  46.062  1.00 42.31  ? 6   DG  G P     1 
ATOM 9182  O OP1   . DG  K 2 6   ? 123.023 62.452  47.511  1.00 41.38  ? 6   DG  G OP1   1 
ATOM 9183  O OP2   . DG  K 2 6   ? 122.235 63.355  45.206  1.00 41.73  ? 6   DG  G OP2   1 
ATOM 9184  O "O5'" . DG  K 2 6   ? 124.647 63.418  45.889  1.00 41.97  ? 6   DG  G "O5'" 1 
ATOM 9185  C "C5'" . DG  K 2 6   ? 125.720 63.145  46.724  1.00 42.08  ? 6   DG  G "C5'" 1 
ATOM 9186  C "C4'" . DG  K 2 6   ? 126.910 63.739  46.025  1.00 42.47  ? 6   DG  G "C4'" 1 
ATOM 9187  O "O4'" . DG  K 2 6   ? 126.661 63.583  44.614  1.00 43.87  ? 6   DG  G "O4'" 1 
ATOM 9188  C "C3'" . DG  K 2 6   ? 127.089 65.245  46.175  1.00 40.60  ? 6   DG  G "C3'" 1 
ATOM 9189  O "O3'" . DG  K 2 6   ? 128.195 65.559  46.978  1.00 40.19  ? 6   DG  G "O3'" 1 
ATOM 9190  C "C2'" . DG  K 2 6   ? 127.344 65.749  44.753  1.00 41.46  ? 6   DG  G "C2'" 1 
ATOM 9191  C "C1'" . DG  K 2 6   ? 127.517 64.475  43.955  1.00 43.86  ? 6   DG  G "C1'" 1 
ATOM 9192  N N9    . DG  K 2 6   ? 127.126 64.597  42.564  1.00 45.01  ? 6   DG  G N9    1 
ATOM 9193  C C8    . DG  K 2 6   ? 125.873 64.590  42.025  1.00 44.96  ? 6   DG  G C8    1 
ATOM 9194  N N7    . DG  K 2 6   ? 125.870 64.730  40.727  1.00 46.35  ? 6   DG  G N7    1 
ATOM 9195  C C5    . DG  K 2 6   ? 127.204 64.825  40.398  1.00 47.39  ? 6   DG  G C5    1 
ATOM 9196  C C6    . DG  K 2 6   ? 127.820 64.988  39.153  1.00 49.22  ? 6   DG  G C6    1 
ATOM 9197  O O6    . DG  K 2 6   ? 127.323 65.078  38.031  1.00 50.40  ? 6   DG  G O6    1 
ATOM 9198  N N1    . DG  K 2 6   ? 129.185 65.039  39.271  1.00 49.86  ? 6   DG  G N1    1 
ATOM 9199  C C2    . DG  K 2 6   ? 129.885 64.949  40.432  1.00 48.86  ? 6   DG  G C2    1 
ATOM 9200  N N2    . DG  K 2 6   ? 131.214 65.021  40.297  1.00 49.86  ? 6   DG  G N2    1 
ATOM 9201  N N3    . DG  K 2 6   ? 129.331 64.794  41.620  1.00 47.19  ? 6   DG  G N3    1 
ATOM 9202  C C4    . DG  K 2 6   ? 127.987 64.742  41.515  1.00 46.55  ? 6   DG  G C4    1 
ATOM 9203  P P     . DT  K 2 7   ? 128.553 67.088  47.256  1.00 38.55  ? 7   DT  G P     1 
ATOM 9204  O OP1   . DT  K 2 7   ? 129.246 67.133  48.537  1.00 38.01  ? 7   DT  G OP1   1 
ATOM 9205  O OP2   . DT  K 2 7   ? 127.364 67.926  47.011  1.00 37.09  ? 7   DT  G OP2   1 
ATOM 9206  O "O5'" . DT  K 2 7   ? 129.612 67.450  46.141  1.00 39.82  ? 7   DT  G "O5'" 1 
ATOM 9207  C "C5'" . DT  K 2 7   ? 130.719 66.604  46.097  1.00 41.47  ? 7   DT  G "C5'" 1 
ATOM 9208  C "C4'" . DT  K 2 7   ? 131.853 67.188  45.286  1.00 42.49  ? 7   DT  G "C4'" 1 
ATOM 9209  O "O4'" . DT  K 2 7   ? 131.600 67.024  43.870  1.00 43.87  ? 7   DT  G "O4'" 1 
ATOM 9210  C "C3'" . DT  K 2 7   ? 132.117 68.656  45.510  1.00 41.19  ? 7   DT  G "C3'" 1 
ATOM 9211  O "O3'" . DT  K 2 7   ? 133.527 68.756  45.514  1.00 42.29  ? 7   DT  G "O3'" 1 
ATOM 9212  C "C2'" . DT  K 2 7   ? 131.482 69.300  44.285  1.00 41.30  ? 7   DT  G "C2'" 1 
ATOM 9213  C "C1'" . DT  K 2 7   ? 131.651 68.255  43.195  1.00 43.50  ? 7   DT  G "C1'" 1 
ATOM 9214  N N1    . DT  K 2 7   ? 130.559 68.240  42.183  1.00 43.78  ? 7   DT  G N1    1 
ATOM 9215  C C2    . DT  K 2 7   ? 130.887 68.308  40.860  1.00 45.58  ? 7   DT  G C2    1 
ATOM 9216  O O2    . DT  K 2 7   ? 132.026 68.394  40.482  1.00 46.92  ? 7   DT  G O2    1 
ATOM 9217  N N3    . DT  K 2 7   ? 129.844 68.295  39.981  1.00 45.89  ? 7   DT  G N3    1 
ATOM 9218  C C4    . DT  K 2 7   ? 128.508 68.222  40.307  1.00 44.53  ? 7   DT  G C4    1 
ATOM 9219  O O4    . DT  K 2 7   ? 127.602 68.231  39.485  1.00 44.94  ? 7   DT  G O4    1 
ATOM 9220  C C5    . DT  K 2 7   ? 128.219 68.155  41.702  1.00 42.67  ? 7   DT  G C5    1 
ATOM 9221  C C7    . DT  K 2 7   ? 126.785 68.074  42.101  1.00 41.30  ? 7   DT  G C7    1 
ATOM 9222  C C6    . DT  K 2 7   ? 129.238 68.164  42.571  1.00 42.40  ? 7   DT  G C6    1 
ATOM 9223  P P     . DT  K 2 8   ? 134.268 70.104  45.993  1.00 42.09  ? 8   DT  G P     1 
ATOM 9224  O OP1   . DT  K 2 8   ? 135.531 69.706  46.650  1.00 42.97  ? 8   DT  G OP1   1 
ATOM 9225  O OP2   . DT  K 2 8   ? 133.334 70.949  46.781  1.00 39.96  ? 8   DT  G OP2   1 
ATOM 9226  O "O5'" . DT  K 2 8   ? 134.611 70.815  44.610  1.00 43.24  ? 8   DT  G "O5'" 1 
ATOM 9227  C "C5'" . DT  K 2 8   ? 135.312 70.069  43.682  1.00 45.38  ? 8   DT  G "C5'" 1 
ATOM 9228  C "C4'" . DT  K 2 8   ? 135.477 70.926  42.456  1.00 46.34  ? 8   DT  G "C4'" 1 
ATOM 9229  O "O4'" . DT  K 2 8   ? 134.344 70.745  41.572  1.00 46.38  ? 8   DT  G "O4'" 1 
ATOM 9230  C "C3'" . DT  K 2 8   ? 135.578 72.423  42.706  1.00 45.36  ? 8   DT  G "C3'" 1 
ATOM 9231  O "O3'" . DT  K 2 8   ? 136.585 72.869  41.830  1.00 47.44  ? 8   DT  G "O3'" 1 
ATOM 9232  C "C2'" . DT  K 2 8   ? 134.208 72.935  42.255  1.00 44.14  ? 8   DT  G "C2'" 1 
ATOM 9233  C "C1'" . DT  K 2 8   ? 133.909 71.999  41.088  1.00 45.69  ? 8   DT  G "C1'" 1 
ATOM 9234  N N1    . DT  K 2 8   ? 132.468 71.847  40.707  1.00 44.84  ? 8   DT  G N1    1 
ATOM 9235  C C2    . DT  K 2 8   ? 132.149 71.779  39.370  1.00 46.32  ? 8   DT  G C2    1 
ATOM 9236  O O2    . DT  K 2 8   ? 132.986 71.870  38.502  1.00 48.29  ? 8   DT  G O2    1 
ATOM 9237  N N3    . DT  K 2 8   ? 130.815 71.625  39.094  1.00 45.54  ? 8   DT  G N3    1 
ATOM 9238  C C4    . DT  K 2 8   ? 129.789 71.548  40.017  1.00 43.45  ? 8   DT  G C4    1 
ATOM 9239  O O4    . DT  K 2 8   ? 128.616 71.420  39.701  1.00 42.94  ? 8   DT  G O4    1 
ATOM 9240  C C5    . DT  K 2 8   ? 130.193 71.620  41.392  1.00 42.04  ? 8   DT  G C5    1 
ATOM 9241  C C7    . DT  K 2 8   ? 129.160 71.524  42.453  1.00 39.99  ? 8   DT  G C7    1 
ATOM 9242  C C6    . DT  K 2 8   ? 131.489 71.762  41.681  1.00 42.78  ? 8   DT  G C6    1 
ATOM 9243  P P     . DA  K 2 9   ? 137.287 74.303  42.018  1.00 52.60  ? 9   DA  G P     1 
ATOM 9244  O OP1   . DA  K 2 9   ? 138.409 74.152  42.966  1.00 53.01  ? 9   DA  G OP1   1 
ATOM 9245  O OP2   . DA  K 2 9   ? 136.284 75.336  42.363  1.00 51.20  ? 9   DA  G OP2   1 
ATOM 9246  O "O5'" . DA  K 2 9   ? 137.793 74.613  40.543  1.00 54.81  ? 9   DA  G "O5'" 1 
ATOM 9247  C "C5'" . DA  K 2 9   ? 136.949 74.132  39.510  1.00 55.09  ? 9   DA  G "C5'" 1 
ATOM 9248  C "C4'" . DA  K 2 9   ? 136.654 75.185  38.440  1.00 56.23  ? 9   DA  G "C4'" 1 
ATOM 9249  O "O4'" . DA  K 2 9   ? 135.314 74.952  37.916  1.00 55.48  ? 9   DA  G "O4'" 1 
ATOM 9250  C "C3'" . DA  K 2 9   ? 136.603 76.651  38.856  1.00 55.59  ? 9   DA  G "C3'" 1 
ATOM 9251  O "O3'" . DA  K 2 9   ? 136.413 77.416  37.667  1.00 57.01  ? 9   DA  G "O3'" 1 
ATOM 9252  C "C2'" . DA  K 2 9   ? 135.282 76.591  39.589  1.00 53.12  ? 9   DA  G "C2'" 1 
ATOM 9253  C "C1'" . DA  K 2 9   ? 134.488 75.993  38.421  1.00 53.80  ? 9   DA  G "C1'" 1 
ATOM 9254  N N9    . DA  K 2 9   ? 133.115 75.583  38.748  1.00 51.64  ? 9   DA  G N9    1 
ATOM 9255  C C8    . DA  K 2 9   ? 132.637 75.279  39.979  1.00 49.34  ? 9   DA  G C8    1 
ATOM 9256  N N7    . DA  K 2 9   ? 131.361 74.991  39.998  1.00 47.34  ? 9   DA  G N7    1 
ATOM 9257  C C5    . DA  K 2 9   ? 130.977 75.112  38.694  1.00 48.27  ? 9   DA  G C5    1 
ATOM 9258  C C6    . DA  K 2 9   ? 129.742 74.925  38.080  1.00 46.49  ? 9   DA  G C6    1 
ATOM 9259  N N6    . DA  K 2 9   ? 128.661 74.559  38.760  1.00 44.72  ? 9   DA  G N6    1 
ATOM 9260  N N1    . DA  K 2 9   ? 129.667 75.122  36.752  1.00 48.21  ? 9   DA  G N1    1 
ATOM 9261  C C2    . DA  K 2 9   ? 130.773 75.483  36.100  1.00 51.17  ? 9   DA  G C2    1 
ATOM 9262  N N3    . DA  K 2 9   ? 131.999 75.690  36.579  1.00 53.06  ? 9   DA  G N3    1 
ATOM 9263  C C4    . DA  K 2 9   ? 132.035 75.482  37.902  1.00 51.22  ? 9   DA  G C4    1 
ATOM 9264  P P     . DG  K 2 10  ? 137.283 78.741  37.361  1.00 55.07  ? 10  DG  G P     1 
ATOM 9265  O OP1   . DG  K 2 10  ? 138.527 78.274  36.687  1.00 57.47  ? 10  DG  G OP1   1 
ATOM 9266  O OP2   . DG  K 2 10  ? 137.317 79.570  38.582  1.00 53.47  ? 10  DG  G OP2   1 
ATOM 9267  O "O5'" . DG  K 2 10  ? 136.442 79.509  36.236  1.00 55.58  ? 10  DG  G "O5'" 1 
ATOM 9268  C "C5'" . DG  K 2 10  ? 136.264 78.889  34.967  1.00 57.54  ? 10  DG  G "C5'" 1 
ATOM 9269  C "C4'" . DG  K 2 10  ? 135.017 79.437  34.293  1.00 57.32  ? 10  DG  G "C4'" 1 
ATOM 9270  O "O4'" . DG  K 2 10  ? 133.825 78.832  34.853  1.00 55.43  ? 10  DG  G "O4'" 1 
ATOM 9271  C "C3'" . DG  K 2 10  ? 134.796 80.940  34.404  1.00 56.31  ? 10  DG  G "C3'" 1 
ATOM 9272  O "O3'" . DG  K 2 10  ? 134.441 81.426  33.122  1.00 57.94  ? 10  DG  G "O3'" 1 
ATOM 9273  C "C2'" . DG  K 2 10  ? 133.677 81.077  35.428  1.00 53.56  ? 10  DG  G "C2'" 1 
ATOM 9274  C "C1'" . DG  K 2 10  ? 132.866 79.821  35.187  1.00 53.61  ? 10  DG  G "C1'" 1 
ATOM 9275  N N9    . DG  K 2 10  ? 132.179 79.346  36.381  1.00 50.96  ? 10  DG  G N9    1 
ATOM 9276  C C8    . DG  K 2 10  ? 132.748 79.187  37.612  1.00 49.70  ? 10  DG  G C8    1 
ATOM 9277  N N7    . DG  K 2 10  ? 131.926 78.725  38.507  1.00 47.45  ? 10  DG  G N7    1 
ATOM 9278  C C5    . DG  K 2 10  ? 130.730 78.556  37.820  1.00 46.81  ? 10  DG  G C5    1 
ATOM 9279  C C6    . DG  K 2 10  ? 129.468 78.092  38.268  1.00 43.84  ? 10  DG  G C6    1 
ATOM 9280  O O6    . DG  K 2 10  ? 129.102 77.722  39.395  1.00 41.51  ? 10  DG  G O6    1 
ATOM 9281  N N1    . DG  K 2 10  ? 128.541 78.080  37.251  1.00 43.01  ? 10  DG  G N1    1 
ATOM 9282  C C2    . DG  K 2 10  ? 128.777 78.467  35.977  1.00 45.40  ? 10  DG  G C2    1 
ATOM 9283  N N2    . DG  K 2 10  ? 127.725 78.378  35.165  1.00 44.64  ? 10  DG  G N2    1 
ATOM 9284  N N3    . DG  K 2 10  ? 129.940 78.905  35.540  1.00 48.97  ? 10  DG  G N3    1 
ATOM 9285  C C4    . DG  K 2 10  ? 130.874 78.929  36.512  1.00 49.08  ? 10  DG  G C4    1 
ATOM 9286  P P     . DA  K 2 11  ? 133.947 82.940  32.924  1.00 52.85  ? 11  DA  G P     1 
ATOM 9287  O OP1   . DA  K 2 11  ? 134.765 83.549  31.854  1.00 55.90  ? 11  DA  G OP1   1 
ATOM 9288  O OP2   . DA  K 2 11  ? 133.793 83.616  34.233  1.00 50.27  ? 11  DA  G OP2   1 
ATOM 9289  O "O5'" . DA  K 2 11  ? 132.486 82.715  32.359  1.00 51.81  ? 11  DA  G "O5'" 1 
ATOM 9290  C "C5'" . DA  K 2 11  ? 131.622 83.757  32.069  1.00 50.86  ? 11  DA  G "C5'" 1 
ATOM 9291  C "C4'" . DA  K 2 11  ? 130.242 83.240  32.327  1.00 48.60  ? 11  DA  G "C4'" 1 
ATOM 9292  O "O4'" . DA  K 2 11  ? 130.262 82.569  33.574  1.00 46.67  ? 11  DA  G "O4'" 1 
ATOM 9293  C "C3'" . DA  K 2 11  ? 129.333 84.355  32.690  1.00 46.39  ? 11  DA  G "C3'" 1 
ATOM 9294  O "O3'" . DA  K 2 11  ? 128.800 84.771  31.526  1.00 47.61  ? 11  DA  G "O3'" 1 
ATOM 9295  C "C2'" . DA  K 2 11  ? 128.272 83.764  33.605  1.00 43.58  ? 11  DA  G "C2'" 1 
ATOM 9296  C "C1'" . DA  K 2 11  ? 128.942 82.500  34.047  1.00 44.17  ? 11  DA  G "C1'" 1 
ATOM 9297  N N9    . DA  K 2 11  ? 129.056 82.245  35.459  1.00 42.15  ? 11  DA  G N9    1 
ATOM 9298  C C8    . DA  K 2 11  ? 130.206 82.281  36.163  1.00 42.55  ? 11  DA  G C8    1 
ATOM 9299  N N7    . DA  K 2 11  ? 130.072 81.943  37.415  1.00 40.65  ? 11  DA  G N7    1 
ATOM 9300  C C5    . DA  K 2 11  ? 128.734 81.663  37.520  1.00 38.93  ? 11  DA  G C5    1 
ATOM 9301  C C6    . DA  K 2 11  ? 127.962 81.254  38.599  1.00 36.69  ? 11  DA  G C6    1 
ATOM 9302  N N6    . DA  K 2 11  ? 128.478 81.061  39.810  1.00 35.84  ? 11  DA  G N6    1 
ATOM 9303  N N1    . DA  K 2 11  ? 126.653 81.055  38.378  1.00 35.54  ? 11  DA  G N1    1 
ATOM 9304  C C2    . DA  K 2 11  ? 126.157 81.264  37.166  1.00 36.53  ? 11  DA  G C2    1 
ATOM 9305  N N3    . DA  K 2 11  ? 126.795 81.649  36.067  1.00 38.69  ? 11  DA  G N3    1 
ATOM 9306  C C4    . DA  K 2 11  ? 128.092 81.830  36.321  1.00 39.80  ? 11  DA  G C4    1 
ATOM 9307  P P     . DT  K 2 12  ? 128.470 86.315  31.393  1.00 47.00  ? 12  DT  G P     1 
ATOM 9308  O OP1   . DT  K 2 12  ? 128.116 86.628  29.983  1.00 49.05  ? 12  DT  G OP1   1 
ATOM 9309  O OP2   . DT  K 2 12  ? 129.651 86.965  31.985  1.00 47.53  ? 12  DT  G OP2   1 
ATOM 9310  O "O5'" . DT  K 2 12  ? 127.236 86.460  32.413  1.00 43.41  ? 12  DT  G "O5'" 1 
ATOM 9311  C "C5'" . DT  K 2 12  ? 126.084 85.732  32.065  1.00 42.65  ? 12  DT  G "C5'" 1 
ATOM 9312  C "C4'" . DT  K 2 12  ? 125.022 85.808  33.112  1.00 39.43  ? 12  DT  G "C4'" 1 
ATOM 9313  O "O4'" . DT  K 2 12  ? 125.449 85.131  34.300  1.00 38.29  ? 12  DT  G "O4'" 1 
ATOM 9314  C "C3'" . DT  K 2 12  ? 124.703 87.211  33.534  1.00 37.85  ? 12  DT  G "C3'" 1 
ATOM 9315  O "O3'" . DT  K 2 12  ? 123.356 87.330  33.195  1.00 36.58  ? 12  DT  G "O3'" 1 
ATOM 9316  C "C2'" . DT  K 2 12  ? 124.955 87.197  35.043  1.00 35.81  ? 12  DT  G "C2'" 1 
ATOM 9317  C "C1'" . DT  K 2 12  ? 124.854 85.734  35.416  1.00 35.58  ? 12  DT  G "C1'" 1 
ATOM 9318  N N1    . DT  K 2 12  ? 125.678 85.319  36.571  1.00 35.08  ? 12  DT  G N1    1 
ATOM 9319  C C2    . DT  K 2 12  ? 125.145 84.623  37.630  1.00 33.19  ? 12  DT  G C2    1 
ATOM 9320  O O2    . DT  K 2 12  ? 123.974 84.333  37.717  1.00 31.77  ? 12  DT  G O2    1 
ATOM 9321  N N3    . DT  K 2 12  ? 126.016 84.279  38.619  1.00 33.09  ? 12  DT  G N3    1 
ATOM 9322  C C4    . DT  K 2 12  ? 127.353 84.562  38.644  1.00 34.65  ? 12  DT  G C4    1 
ATOM 9323  O O4    . DT  K 2 12  ? 128.084 84.235  39.557  1.00 34.54  ? 12  DT  G O4    1 
ATOM 9324  C C5    . DT  K 2 12  ? 127.846 85.274  37.512  1.00 36.61  ? 12  DT  G C5    1 
ATOM 9325  C C7    . DT  K 2 12  ? 129.287 85.629  37.428  1.00 38.61  ? 12  DT  G C7    1 
ATOM 9326  C C6    . DT  K 2 12  ? 127.007 85.610  36.545  1.00 36.76  ? 12  DT  G C6    1 
ATOM 9327  P P     . DA  K 2 13  ? 122.548 88.680  33.472  1.00 36.70  ? 13  DA  G P     1 
ATOM 9328  O OP1   . DA  K 2 13  ? 121.408 88.623  32.557  1.00 36.72  ? 13  DA  G OP1   1 
ATOM 9329  O OP2   . DA  K 2 13  ? 123.461 89.831  33.400  1.00 39.99  ? 13  DA  G OP2   1 
ATOM 9330  O "O5'" . DA  K 2 13  ? 122.008 88.507  34.958  1.00 33.73  ? 13  DA  G "O5'" 1 
ATOM 9331  C "C5'" . DA  K 2 13  ? 120.999 87.585  35.151  1.00 32.50  ? 13  DA  G "C5'" 1 
ATOM 9332  C "C4'" . DA  K 2 13  ? 120.537 87.624  36.574  1.00 29.87  ? 13  DA  G "C4'" 1 
ATOM 9333  O "O4'" . DA  K 2 13  ? 121.561 87.039  37.392  1.00 30.25  ? 13  DA  G "O4'" 1 
ATOM 9334  C "C3'" . DA  K 2 13  ? 120.367 89.017  37.128  1.00 28.38  ? 13  DA  G "C3'" 1 
ATOM 9335  O "O3'" . DA  K 2 13  ? 119.122 89.098  37.766  1.00 26.25  ? 13  DA  G "O3'" 1 
ATOM 9336  C "C2'" . DA  K 2 13  ? 121.466 89.174  38.174  1.00 28.38  ? 13  DA  G "C2'" 1 
ATOM 9337  C "C1'" . DA  K 2 13  ? 121.707 87.749  38.601  1.00 28.61  ? 13  DA  G "C1'" 1 
ATOM 9338  N N9    . DA  K 2 13  ? 123.056 87.571  39.106  1.00 29.74  ? 13  DA  G N9    1 
ATOM 9339  C C8    . DA  K 2 13  ? 124.210 87.878  38.466  1.00 32.95  ? 13  DA  G C8    1 
ATOM 9340  N N7    . DA  K 2 13  ? 125.296 87.626  39.140  1.00 34.26  ? 13  DA  G N7    1 
ATOM 9341  C C5    . DA  K 2 13  ? 124.807 87.104  40.304  1.00 31.36  ? 13  DA  G C5    1 
ATOM 9342  C C6    . DA  K 2 13  ? 125.460 86.641  41.447  1.00 31.08  ? 13  DA  G C6    1 
ATOM 9343  N N6    . DA  K 2 13  ? 126.787 86.651  41.541  1.00 33.52  ? 13  DA  G N6    1 
ATOM 9344  N N1    . DA  K 2 13  ? 124.710 86.190  42.471  1.00 28.53  ? 13  DA  G N1    1 
ATOM 9345  C C2    . DA  K 2 13  ? 123.384 86.222  42.336  1.00 27.02  ? 13  DA  G C2    1 
ATOM 9346  N N3    . DA  K 2 13  ? 122.650 86.632  41.305  1.00 27.05  ? 13  DA  G N3    1 
ATOM 9347  C C4    . DA  K 2 13  ? 123.434 87.062  40.309  1.00 28.96  ? 13  DA  G C4    1 
ATOM 9348  P P     . DT  K 2 14  ? 118.506 90.528  38.121  1.00 43.38  ? 14  DT  G P     1 
ATOM 9349  O OP1   . DT  K 2 14  ? 117.059 90.309  38.277  1.00 42.65  ? 14  DT  G OP1   1 
ATOM 9350  O OP2   . DT  K 2 14  ? 119.065 91.512  37.147  1.00 46.42  ? 14  DT  G OP2   1 
ATOM 9351  O "O5'" . DT  K 2 14  ? 119.011 90.795  39.590  1.00 41.29  ? 14  DT  G "O5'" 1 
ATOM 9352  C "C5'" . DT  K 2 14  ? 118.295 90.132  40.577  1.00 38.77  ? 14  DT  G "C5'" 1 
ATOM 9353  C "C4'" . DT  K 2 14  ? 119.136 89.952  41.825  1.00 36.82  ? 14  DT  G "C4'" 1 
ATOM 9354  O "O4'" . DT  K 2 14  ? 120.495 89.558  41.526  1.00 37.14  ? 14  DT  G "O4'" 1 
ATOM 9355  C "C3'" . DT  K 2 14  ? 119.474 91.242  42.491  1.00 37.54  ? 14  DT  G "C3'" 1 
ATOM 9356  O "O3'" . DT  K 2 14  ? 118.316 91.776  43.113  1.00 37.08  ? 14  DT  G "O3'" 1 
ATOM 9357  C "C2'" . DT  K 2 14  ? 120.572 90.788  43.451  1.00 35.98  ? 14  DT  G "C2'" 1 
ATOM 9358  C "C1'" . DT  K 2 14  ? 121.218 89.624  42.723  1.00 35.71  ? 14  DT  G "C1'" 1 
ATOM 9359  N N1    . DT  K 2 14  ? 122.645 89.796  42.413  1.00 36.91  ? 14  DT  G N1    1 
ATOM 9360  C C2    . DT  K 2 14  ? 123.594 89.411  43.323  1.00 35.58  ? 14  DT  G C2    1 
ATOM 9361  O O2    . DT  K 2 14  ? 123.339 88.938  44.401  1.00 33.45  ? 14  DT  G O2    1 
ATOM 9362  N N3    . DT  K 2 14  ? 124.876 89.616  42.950  1.00 37.01  ? 14  DT  G N3    1 
ATOM 9363  C C4    . DT  K 2 14  ? 125.275 90.145  41.764  1.00 39.60  ? 14  DT  G C4    1 
ATOM 9364  O O4    . DT  K 2 14  ? 126.441 90.294  41.489  1.00 40.91  ? 14  DT  G O4    1 
ATOM 9365  C C5    . DT  K 2 14  ? 124.248 90.514  40.859  1.00 40.88  ? 14  DT  G C5    1 
ATOM 9366  C C7    . DT  K 2 14  ? 124.613 91.105  39.555  1.00 43.91  ? 14  DT  G C7    1 
ATOM 9367  C C6    . DT  K 2 14  ? 122.993 90.332  41.210  1.00 39.50  ? 14  DT  G C6    1 
ATOM 9368  P P     . DC  K 2 15  ? 118.388 93.245  43.744  1.00 38.21  ? 15  DC  G P     1 
ATOM 9369  O OP1   . DC  K 2 15  ? 117.056 93.554  44.267  1.00 37.66  ? 15  DC  G OP1   1 
ATOM 9370  O OP2   . DC  K 2 15  ? 119.022 94.144  42.756  1.00 40.92  ? 15  DC  G OP2   1 
ATOM 9371  O "O5'" . DC  K 2 15  ? 119.371 93.067  44.987  1.00 36.72  ? 15  DC  G "O5'" 1 
ATOM 9372  C "C5'" . DC  K 2 15  ? 118.900 92.403  46.147  1.00 34.36  ? 15  DC  G "C5'" 1 
ATOM 9373  C "C4'" . DC  K 2 15  ? 120.034 92.186  47.122  1.00 33.39  ? 15  DC  G "C4'" 1 
ATOM 9374  O "O4'" . DC  K 2 15  ? 121.163 91.669  46.399  1.00 33.85  ? 15  DC  G "O4'" 1 
ATOM 9375  C "C3'" . DC  K 2 15  ? 120.599 93.429  47.748  1.00 34.78  ? 15  DC  G "C3'" 1 
ATOM 9376  O "O3'" . DC  K 2 15  ? 119.763 93.691  48.855  1.00 33.85  ? 15  DC  G "O3'" 1 
ATOM 9377  C "C2'" . DC  K 2 15  ? 122.006 92.972  48.133  1.00 34.37  ? 15  DC  G "C2'" 1 
ATOM 9378  C "C1'" . DC  K 2 15  ? 122.343 91.884  47.123  1.00 33.91  ? 15  DC  G "C1'" 1 
ATOM 9379  N N1    . DC  K 2 15  ? 123.368 92.215  46.109  1.00 35.96  ? 15  DC  G N1    1 
ATOM 9380  C C2    . DC  K 2 15  ? 124.708 92.003  46.357  1.00 36.14  ? 15  DC  G C2    1 
ATOM 9381  O O2    . DC  K 2 15  ? 125.047 91.553  47.441  1.00 34.59  ? 15  DC  G O2    1 
ATOM 9382  N N3    . DC  K 2 15  ? 125.618 92.298  45.426  1.00 38.16  ? 15  DC  G N3    1 
ATOM 9383  C C4    . DC  K 2 15  ? 125.231 92.788  44.280  1.00 39.98  ? 15  DC  G C4    1 
ATOM 9384  N N4    . DC  K 2 15  ? 126.181 93.063  43.401  1.00 42.12  ? 15  DC  G N4    1 
ATOM 9385  C C5    . DC  K 2 15  ? 123.868 93.018  43.981  1.00 39.86  ? 15  DC  G C5    1 
ATOM 9386  C C6    . DC  K 2 15  ? 122.975 92.714  44.916  1.00 37.81  ? 15  DC  G C6    1 
ATOM 9387  P P     . DT  K 2 16  ? 119.767 95.124  49.592  1.00 35.42  ? 16  DT  G P     1 
ATOM 9388  O OP1   . DT  K 2 16  ? 118.739 94.925  50.635  1.00 33.96  ? 16  DT  G OP1   1 
ATOM 9389  O OP2   . DT  K 2 16  ? 119.663 96.249  48.640  1.00 37.90  ? 16  DT  G OP2   1 
ATOM 9390  O "O5'" . DT  K 2 16  ? 121.170 95.190  50.325  1.00 35.62  ? 16  DT  G "O5'" 1 
ATOM 9391  C "C5'" . DT  K 2 16  ? 121.268 94.396  51.436  1.00 33.67  ? 16  DT  G "C5'" 1 
ATOM 9392  C "C4'" . DT  K 2 16  ? 122.636 94.658  52.011  1.00 34.47  ? 16  DT  G "C4'" 1 
ATOM 9393  O "O4'" . DT  K 2 16  ? 123.621 94.424  50.979  1.00 35.30  ? 16  DT  G "O4'" 1 
ATOM 9394  C "C3'" . DT  K 2 16  ? 122.921 96.055  52.513  1.00 36.70  ? 16  DT  G "C3'" 1 
ATOM 9395  O "O3'" . DT  K 2 16  ? 123.676 95.936  53.684  1.00 36.45  ? 16  DT  G "O3'" 1 
ATOM 9396  C "C2'" . DT  K 2 16  ? 123.757 96.685  51.401  1.00 38.92  ? 16  DT  G "C2'" 1 
ATOM 9397  C "C1'" . DT  K 2 16  ? 124.516 95.509  50.828  1.00 37.78  ? 16  DT  G "C1'" 1 
ATOM 9398  N N1    . DT  K 2 16  ? 124.917 95.538  49.353  1.00 39.14  ? 16  DT  G N1    1 
ATOM 9399  C C2    . DT  K 2 16  ? 126.238 95.306  49.020  1.00 39.98  ? 16  DT  G C2    1 
ATOM 9400  O O2    . DT  K 2 16  ? 127.116 95.121  49.846  1.00 39.75  ? 16  DT  G O2    1 
ATOM 9401  N N3    . DT  K 2 16  ? 126.531 95.306  47.687  1.00 41.32  ? 16  DT  G N3    1 
ATOM 9402  C C4    . DT  K 2 16  ? 125.659 95.504  46.649  1.00 41.96  ? 16  DT  G C4    1 
ATOM 9403  O O4    . DT  K 2 16  ? 126.057 95.495  45.484  1.00 43.43  ? 16  DT  G O4    1 
ATOM 9404  C C5    . DT  K 2 16  ? 124.284 95.722  47.056  1.00 40.96  ? 16  DT  G C5    1 
ATOM 9405  C C7    . DT  K 2 16  ? 123.210 95.955  46.028  1.00 41.68  ? 16  DT  G C7    1 
ATOM 9406  C C6    . DT  K 2 16  ? 123.983 95.725  48.363  1.00 39.60  ? 16  DT  G C6    1 
ATOM 9407  P P     . DA  K 2 17  ? 123.912 97.225  54.611  1.00 38.55  ? 17  DA  G P     1 
ATOM 9408  O OP1   . DA  K 2 17  ? 123.808 96.764  56.023  1.00 37.29  ? 17  DA  G OP1   1 
ATOM 9409  O OP2   . DA  K 2 17  ? 123.133 98.371  54.045  1.00 40.26  ? 17  DA  G OP2   1 
ATOM 9410  O "O5'" . DA  K 2 17  ? 125.446 97.549  54.408  1.00 40.36  ? 17  DA  G "O5'" 1 
ATOM 9411  C "C5'" . DA  K 2 17  ? 126.397 96.639  54.854  1.00 39.34  ? 17  DA  G "C5'" 1 
ATOM 9412  C "C4'" . DA  K 2 17  ? 127.675 97.156  54.240  1.00 41.61  ? 17  DA  G "C4'" 1 
ATOM 9413  O "O4'" . DA  K 2 17  ? 127.522 97.124  52.803  1.00 41.96  ? 17  DA  G "O4'" 1 
ATOM 9414  C "C3'" . DA  K 2 17  ? 128.048 98.605  54.517  1.00 44.64  ? 17  DA  G "C3'" 1 
ATOM 9415  O "O3'" . DA  K 2 17  ? 129.409 98.571  54.602  1.00 45.93  ? 17  DA  G "O3'" 1 
ATOM 9416  C "C2'" . DA  K 2 17  ? 127.730 99.348  53.233  1.00 46.21  ? 17  DA  G "C2'" 1 
ATOM 9417  C "C1'" . DA  K 2 17  ? 128.133 98.271  52.241  1.00 44.93  ? 17  DA  G "C1'" 1 
ATOM 9418  N N9    . DA  K 2 17  ? 127.661 98.404  50.857  1.00 45.47  ? 17  DA  G N9    1 
ATOM 9419  C C8    . DA  K 2 17  ? 126.391 98.663  50.457  1.00 45.05  ? 17  DA  G C8    1 
ATOM 9420  N N7    . DA  K 2 17  ? 126.245 98.706  49.158  1.00 45.88  ? 17  DA  G N7    1 
ATOM 9421  C C5    . DA  K 2 17  ? 127.500 98.447  48.668  1.00 46.87  ? 17  DA  G C5    1 
ATOM 9422  C C6    . DA  K 2 17  ? 127.992 98.366  47.363  1.00 48.24  ? 17  DA  G C6    1 
ATOM 9423  N N6    . DA  K 2 17  ? 127.216 98.554  46.296  1.00 48.85  ? 17  DA  G N6    1 
ATOM 9424  N N1    . DA  K 2 17  ? 129.296 98.098  47.196  1.00 49.15  ? 17  DA  G N1    1 
ATOM 9425  C C2    . DA  K 2 17  ? 130.044 97.924  48.278  1.00 48.69  ? 17  DA  G C2    1 
ATOM 9426  N N3    . DA  K 2 17  ? 129.695 97.979  49.563  1.00 47.48  ? 17  DA  G N3    1 
ATOM 9427  C C4    . DA  K 2 17  ? 128.389 98.249  49.695  1.00 46.60  ? 17  DA  G C4    1 
ATOM 9428  P P     . DA  K 2 18  ? 130.182 99.711  55.400  1.00 48.89  ? 18  DA  G P     1 
ATOM 9429  O OP1   . DA  K 2 18  ? 130.936 98.990  56.458  1.00 48.12  ? 18  DA  G OP1   1 
ATOM 9430  O OP2   . DA  K 2 18  ? 129.191 100.796 55.646  1.00 50.00  ? 18  DA  G OP2   1 
ATOM 9431  O "O5'" . DA  K 2 18  ? 131.222 100.306 54.346  1.00 51.56  ? 18  DA  G "O5'" 1 
ATOM 9432  C "C5'" . DA  K 2 18  ? 132.160 99.473  53.694  1.00 51.14  ? 18  DA  G "C5'" 1 
ATOM 9433  C "C4'" . DA  K 2 18  ? 132.508 100.060 52.340  1.00 53.29  ? 18  DA  G "C4'" 1 
ATOM 9434  O "O4'" . DA  K 2 18  ? 131.408 99.900  51.403  1.00 52.05  ? 18  DA  G "O4'" 1 
ATOM 9435  C "C3'" . DA  K 2 18  ? 132.830 101.552 52.355  1.00 56.85  ? 18  DA  G "C3'" 1 
ATOM 9436  O "O3'" . DA  K 2 18  ? 134.091 101.682 51.755  1.00 59.06  ? 18  DA  G "O3'" 1 
ATOM 9437  C "C2'" . DA  K 2 18  ? 131.750 102.174 51.481  1.00 57.18  ? 18  DA  G "C2'" 1 
ATOM 9438  C "C1'" . DA  K 2 18  ? 131.493 101.012 50.538  1.00 54.90  ? 18  DA  G "C1'" 1 
ATOM 9439  N N9    . DA  K 2 18  ? 130.297 101.189 49.733  1.00 54.34  ? 18  DA  G N9    1 
ATOM 9440  C C8    . DA  K 2 18  ? 129.050 101.442 50.186  1.00 53.20  ? 18  DA  G C8    1 
ATOM 9441  N N7    . DA  K 2 18  ? 128.158 101.578 49.234  1.00 53.14  ? 18  DA  G N7    1 
ATOM 9442  C C5    . DA  K 2 18  ? 128.880 101.407 48.077  1.00 54.38  ? 18  DA  G C5    1 
ATOM 9443  C C6    . DA  K 2 18  ? 128.506 101.437 46.730  1.00 55.15  ? 18  DA  G C6    1 
ATOM 9444  N N6    . DA  K 2 18  ? 127.260 101.657 46.320  1.00 54.71  ? 18  DA  G N6    1 
ATOM 9445  N N1    . DA  K 2 18  ? 129.466 101.231 45.821  1.00 56.58  ? 18  DA  G N1    1 
ATOM 9446  C C2    . DA  K 2 18  ? 130.709 101.003 46.242  1.00 57.11  ? 18  DA  G C2    1 
ATOM 9447  N N3    . DA  K 2 18  ? 131.177 100.950 47.482  1.00 56.48  ? 18  DA  G N3    1 
ATOM 9448  C C4    . DA  K 2 18  ? 130.200 101.165 48.365  1.00 55.11  ? 18  DA  G C4    1 
ATOM 9449  P P     . DC  K 2 19  ? 135.055 102.899 52.139  1.00 62.96  ? 19  DC  G P     1 
ATOM 9450  O OP1   . DC  K 2 19  ? 136.265 102.400 52.822  1.00 63.38  ? 19  DC  G OP1   1 
ATOM 9451  O OP2   . DC  K 2 19  ? 134.182 103.916 52.756  1.00 63.80  ? 19  DC  G OP2   1 
ATOM 9452  O "O5'" . DC  K 2 19  ? 135.532 103.453 50.727  1.00 65.53  ? 19  DC  G "O5'" 1 
ATOM 9453  C "C5'" . DC  K 2 19  ? 136.311 102.656 49.857  1.00 65.36  ? 19  DC  G "C5'" 1 
ATOM 9454  C "C4'" . DC  K 2 19  ? 135.800 102.800 48.433  1.00 65.81  ? 19  DC  G "C4'" 1 
ATOM 9455  O "O4'" . DC  K 2 19  ? 134.363 102.848 48.426  1.00 63.86  ? 19  DC  G "O4'" 1 
ATOM 9456  C "C3'" . DC  K 2 19  ? 136.058 104.100 47.712  1.00 69.62  ? 19  DC  G "C3'" 1 
ATOM 9457  O "O3'" . DC  K 2 19  ? 137.388 104.205 47.291  1.00 72.24  ? 19  DC  G "O3'" 1 
ATOM 9458  C "C2'" . DC  K 2 19  ? 135.126 103.958 46.519  1.00 68.85  ? 19  DC  G "C2'" 1 
ATOM 9459  C "C1'" . DC  K 2 19  ? 134.026 103.073 47.086  1.00 64.88  ? 19  DC  G "C1'" 1 
ATOM 9460  N N1    . DC  K 2 19  ? 132.686 103.638 47.121  1.00 64.28  ? 19  DC  G N1    1 
ATOM 9461  C C2    . DC  K 2 19  ? 131.974 103.922 45.942  1.00 64.96  ? 19  DC  G C2    1 
ATOM 9462  O O2    . DC  K 2 19  ? 132.481 103.709 44.836  1.00 66.19  ? 19  DC  G O2    1 
ATOM 9463  N N3    . DC  K 2 19  ? 130.726 104.423 46.049  1.00 64.39  ? 19  DC  G N3    1 
ATOM 9464  C C4    . DC  K 2 19  ? 130.213 104.629 47.261  1.00 63.21  ? 19  DC  G C4    1 
ATOM 9465  N N4    . DC  K 2 19  ? 128.983 105.125 47.345  1.00 62.78  ? 19  DC  G N4    1 
ATOM 9466  C C5    . DC  K 2 19  ? 130.924 104.333 48.457  1.00 62.55  ? 19  DC  G C5    1 
ATOM 9467  C C6    . DC  K 2 19  ? 132.152 103.839 48.349  1.00 63.10  ? 19  DC  G C6    1 
ATOM 9468  P P     . DT  K 2 20  ? 138.033 105.662 47.102  1.00 76.83  ? 20  DT  G P     1 
ATOM 9469  O OP1   . DT  K 2 20  ? 139.487 105.556 47.332  1.00 78.88  ? 20  DT  G OP1   1 
ATOM 9470  O OP2   . DT  K 2 20  ? 137.231 106.640 47.869  1.00 77.31  ? 20  DT  G OP2   1 
ATOM 9471  O "O5'" . DT  K 2 20  ? 137.763 105.990 45.568  1.00 78.40  ? 20  DT  G "O5'" 1 
ATOM 9472  C "C5'" . DT  K 2 20  ? 137.955 104.992 44.566  1.00 77.30  ? 20  DT  G "C5'" 1 
ATOM 9473  C "C4'" . DT  K 2 20  ? 137.354 105.518 43.285  1.00 78.84  ? 20  DT  G "C4'" 1 
ATOM 9474  O "O4'" . DT  K 2 20  ? 135.924 105.576 43.484  1.00 76.53  ? 20  DT  G "O4'" 1 
ATOM 9475  C "C3'" . DT  K 2 20  ? 137.790 106.931 42.916  1.00 83.24  ? 20  DT  G "C3'" 1 
ATOM 9476  O "O3'" . DT  K 2 20  ? 137.995 107.000 41.505  1.00 85.33  ? 20  DT  G "O3'" 1 
ATOM 9477  C "C2'" . DT  K 2 20  ? 136.615 107.789 43.391  1.00 82.86  ? 20  DT  G "C2'" 1 
ATOM 9478  C "C1'" . DT  K 2 20  ? 135.450 106.850 43.129  1.00 79.10  ? 20  DT  G "C1'" 1 
ATOM 9479  N N1    . DT  K 2 20  ? 134.242 107.092 43.936  1.00 77.03  ? 20  DT  G N1    1 
ATOM 9480  C C2    . DT  K 2 20  ? 133.076 107.339 43.271  1.00 76.61  ? 20  DT  G C2    1 
ATOM 9481  O O2    . DT  K 2 20  ? 133.027 107.371 42.060  1.00 77.96  ? 20  DT  G O2    1 
ATOM 9482  N N3    . DT  K 2 20  ? 131.976 107.554 44.061  1.00 74.78  ? 20  DT  G N3    1 
ATOM 9483  C C4    . DT  K 2 20  ? 131.938 107.541 45.438  1.00 73.41  ? 20  DT  G C4    1 
ATOM 9484  O O4    . DT  K 2 20  ? 130.900 107.744 46.066  1.00 71.97  ? 20  DT  G O4    1 
ATOM 9485  C C5    . DT  K 2 20  ? 133.207 107.265 46.069  1.00 73.99  ? 20  DT  G C5    1 
ATOM 9486  C C7    . DT  K 2 20  ? 133.302 107.213 47.561  1.00 72.86  ? 20  DT  G C7    1 
ATOM 9487  C C6    . DT  K 2 20  ? 134.284 107.059 45.305  1.00 75.72  ? 20  DT  G C6    1 
ATOM 9488  P P     . DA  K 2 21  ? 138.615 108.323 40.818  1.00 94.22  ? 21  DA  G P     1 
ATOM 9489  O OP1   . DA  K 2 21  ? 140.021 107.996 40.486  1.00 96.32  ? 21  DA  G OP1   1 
ATOM 9490  O OP2   . DA  K 2 21  ? 138.359 109.566 41.600  1.00 95.90  ? 21  DA  G OP2   1 
ATOM 9491  O "O5'" . DA  K 2 21  ? 137.746 108.448 39.475  1.00 94.76  ? 21  DA  G "O5'" 1 
ATOM 9492  C "C5'" . DA  K 2 21  ? 136.435 107.835 39.360  1.00 91.39  ? 21  DA  G "C5'" 1 
ATOM 9493  C "C4'" . DA  K 2 21  ? 135.453 108.794 38.690  1.00 93.06  ? 21  DA  G "C4'" 1 
ATOM 9494  O "O4'" . DA  K 2 21  ? 134.300 108.908 39.569  1.00 90.39  ? 21  DA  G "O4'" 1 
ATOM 9495  C "C3'" . DA  K 2 21  ? 135.978 110.228 38.438  1.00 97.60  ? 21  DA  G "C3'" 1 
ATOM 9496  O "O3'" . DA  K 2 21  ? 135.551 110.847 37.169  1.00 100.29 ? 21  DA  G "O3'" 1 
ATOM 9497  C "C2'" . DA  K 2 21  ? 135.452 110.982 39.658  1.00 96.94  ? 21  DA  G "C2'" 1 
ATOM 9498  C "C1'" . DA  K 2 21  ? 134.119 110.277 39.906  1.00 92.90  ? 21  DA  G "C1'" 1 
ATOM 9499  N N9    . DA  K 2 21  ? 133.682 110.421 41.291  1.00 90.88  ? 21  DA  G N9    1 
ATOM 9500  C C8    . DA  K 2 21  ? 134.477 110.385 42.400  1.00 90.70  ? 21  DA  G C8    1 
ATOM 9501  N N7    . DA  K 2 21  ? 133.825 110.550 43.525  1.00 88.95  ? 21  DA  G N7    1 
ATOM 9502  C C5    . DA  K 2 21  ? 132.518 110.710 43.121  1.00 87.87  ? 21  DA  G C5    1 
ATOM 9503  C C6    . DA  K 2 21  ? 131.342 110.927 43.845  1.00 86.03  ? 21  DA  G C6    1 
ATOM 9504  N N6    . DA  K 2 21  ? 131.336 111.018 45.175  1.00 85.00  ? 21  DA  G N6    1 
ATOM 9505  N N1    . DA  K 2 21  ? 130.192 111.046 43.157  1.00 85.50  ? 21  DA  G N1    1 
ATOM 9506  C C2    . DA  K 2 21  ? 130.236 110.954 41.827  1.00 86.80  ? 21  DA  G C2    1 
ATOM 9507  N N3    . DA  K 2 21  ? 131.282 110.749 41.031  1.00 88.63  ? 21  DA  G N3    1 
ATOM 9508  C C4    . DA  K 2 21  ? 132.405 110.636 41.750  1.00 89.04  ? 21  DA  G C4    1 
ATOM 9509  P P     . DA  K 2 22  ? 135.791 112.429 36.898  1.00 101.00 ? 22  DA  G P     1 
ATOM 9510  O OP1   . DA  K 2 22  ? 135.852 112.697 35.443  1.00 104.03 ? 22  DA  G OP1   1 
ATOM 9511  O OP2   . DA  K 2 22  ? 136.924 112.859 37.744  1.00 102.75 ? 22  DA  G OP2   1 
ATOM 9512  O "O5'" . DA  K 2 22  ? 134.457 113.142 37.432  1.00 99.85  ? 22  DA  G "O5'" 1 
ATOM 9513  C "C5'" . DA  K 2 22  ? 133.233 113.080 36.685  1.00 98.92  ? 22  DA  G "C5'" 1 
ATOM 9514  C "C4'" . DA  K 2 22  ? 132.095 113.743 37.440  1.00 97.74  ? 22  DA  G "C4'" 1 
ATOM 9515  O "O4'" . DA  K 2 22  ? 132.010 113.142 38.771  1.00 94.27  ? 22  DA  G "O4'" 1 
ATOM 9516  C "C3'" . DA  K 2 22  ? 132.284 115.260 37.630  1.00 101.54 ? 22  DA  G "C3'" 1 
ATOM 9517  O "O3'" . DA  K 2 22  ? 131.068 115.975 37.685  1.00 101.49 ? 22  DA  G "O3'" 1 
ATOM 9518  C "C2'" . DA  K 2 22  ? 132.830 115.299 39.035  1.00 100.57 ? 22  DA  G "C2'" 1 
ATOM 9519  C "C1'" . DA  K 2 22  ? 131.870 114.256 39.625  1.00 95.72  ? 22  DA  G "C1'" 1 
ATOM 9520  N N9    . DA  K 2 22  ? 132.186 114.093 41.035  1.00 94.07  ? 22  DA  G N9    1 
ATOM 9521  C C8    . DA  K 2 22  ? 133.407 113.850 41.594  1.00 94.68  ? 22  DA  G C8    1 
ATOM 9522  N N7    . DA  K 2 22  ? 133.384 113.826 42.904  1.00 93.20  ? 22  DA  G N7    1 
ATOM 9523  C C5    . DA  K 2 22  ? 132.063 114.093 43.217  1.00 91.57  ? 22  DA  G C5    1 
ATOM 9524  C C6    . DA  K 2 22  ? 131.383 114.199 44.442  1.00 89.70  ? 22  DA  G C6    1 
ATOM 9525  N N6    . DA  K 2 22  ? 131.985 114.042 45.625  1.00 89.21  ? 22  DA  G N6    1 
ATOM 9526  N N1    . DA  K 2 22  ? 130.064 114.473 44.404  1.00 88.56  ? 22  DA  G N1    1 
ATOM 9527  C C2    . DA  K 2 22  ? 129.472 114.617 43.214  1.00 89.22  ? 22  DA  G C2    1 
ATOM 9528  N N3    . DA  K 2 22  ? 130.005 114.538 41.995  1.00 91.00  ? 22  DA  G N3    1 
ATOM 9529  C C4    . DA  K 2 22  ? 131.315 114.274 42.075  1.00 92.10  ? 22  DA  G C4    1 
ATOM 9530  P P     . DA  K 2 23  ? 130.718 117.077 36.571  1.00 105.41 ? 23  DA  G P     1 
ATOM 9531  O OP1   . DA  K 2 23  ? 131.674 116.882 35.462  1.00 108.01 ? 23  DA  G OP1   1 
ATOM 9532  O OP2   . DA  K 2 23  ? 130.662 118.446 37.152  1.00 108.05 ? 23  DA  G OP2   1 
ATOM 9533  O "O5'" . DA  K 2 23  ? 129.233 116.670 36.125  1.00 102.97 ? 23  DA  G "O5'" 1 
ATOM 9534  C "C5'" . DA  K 2 23  ? 128.204 117.647 36.151  1.00 104.02 ? 23  DA  G "C5'" 1 
ATOM 9535  C "C4'" . DA  K 2 23  ? 127.441 117.577 37.459  1.00 100.93 ? 23  DA  G "C4'" 1 
ATOM 9536  O "O4'" . DA  K 2 23  ? 128.217 116.876 38.454  1.00 98.79  ? 23  DA  G "O4'" 1 
ATOM 9537  C "C3'" . DA  K 2 23  ? 127.166 118.932 38.076  1.00 103.20 ? 23  DA  G "C3'" 1 
ATOM 9538  O "O3'" . DA  K 2 23  ? 125.961 119.469 37.562  1.00 103.77 ? 23  DA  G "O3'" 1 
ATOM 9539  C "C2'" . DA  K 2 23  ? 127.070 118.633 39.574  1.00 100.36 ? 23  DA  G "C2'" 1 
ATOM 9540  C "C1'" . DA  K 2 23  ? 127.887 117.362 39.746  1.00 97.93  ? 23  DA  G "C1'" 1 
ATOM 9541  N N9    . DA  K 2 23  ? 129.115 117.423 40.549  1.00 98.78  ? 23  DA  G N9    1 
ATOM 9542  C C8    . DA  K 2 23  ? 130.398 117.283 40.108  1.00 100.75 ? 23  DA  G C8    1 
ATOM 9543  N N7    . DA  K 2 23  ? 131.317 117.337 41.038  1.00 101.18 ? 23  DA  G N7    1 
ATOM 9544  C C5    . DA  K 2 23  ? 130.580 117.525 42.188  1.00 99.35  ? 23  DA  G C5    1 
ATOM 9545  C C6    . DA  K 2 23  ? 130.963 117.651 43.537  1.00 98.97  ? 23  DA  G C6    1 
ATOM 9546  N N6    . DA  K 2 23  ? 132.235 117.621 43.945  1.00 100.49 ? 23  DA  G N6    1 
ATOM 9547  N N1    . DA  K 2 23  ? 129.977 117.812 44.448  1.00 97.15  ? 23  DA  G N1    1 
ATOM 9548  C C2    . DA  K 2 23  ? 128.701 117.834 44.023  1.00 95.76  ? 23  DA  G C2    1 
ATOM 9549  N N3    . DA  K 2 23  ? 128.217 117.721 42.782  1.00 95.94  ? 23  DA  G N3    1 
ATOM 9550  C C4    . DA  K 2 23  ? 129.221 117.571 41.906  1.00 97.82  ? 23  DA  G C4    1 
ATOM 9551  P P     . DT  K 2 24  ? 125.369 120.807 38.221  1.00 112.88 ? 24  DT  G P     1 
ATOM 9552  O OP1   . DT  K 2 24  ? 124.400 121.407 37.268  1.00 114.61 ? 24  DT  G OP1   1 
ATOM 9553  O OP2   . DT  K 2 24  ? 126.549 121.606 38.649  1.00 115.92 ? 24  DT  G OP2   1 
ATOM 9554  O "O5'" . DT  K 2 24  ? 124.586 120.269 39.525  1.00 108.86 ? 24  DT  G "O5'" 1 
ATOM 9555  C "C5'" . DT  K 2 24  ? 124.084 121.194 40.489  1.00 109.56 ? 24  DT  G "C5'" 1 
ATOM 9556  C "C4'" . DT  K 2 24  ? 124.174 120.733 41.942  1.00 106.85 ? 24  DT  G "C4'" 1 
ATOM 9557  O "O4'" . DT  K 2 24  ? 125.476 120.170 42.274  1.00 106.56 ? 24  DT  G "O4'" 1 
ATOM 9558  C "C3'" . DT  K 2 24  ? 123.963 121.886 42.924  1.00 108.72 ? 24  DT  G "C3'" 1 
ATOM 9559  O "O3'" . DT  K 2 24  ? 123.215 121.452 44.062  1.00 105.67 ? 24  DT  G "O3'" 1 
ATOM 9560  C "C2'" . DT  K 2 24  ? 125.392 122.292 43.287  1.00 111.25 ? 24  DT  G "C2'" 1 
ATOM 9561  C "C1'" . DT  K 2 24  ? 126.094 120.937 43.301  1.00 108.41 ? 24  DT  G "C1'" 1 
ATOM 9562  N N1    . DT  K 2 24  ? 127.598 120.989 43.107  1.00 110.72 ? 24  DT  G N1    1 
ATOM 9563  C C2    . DT  K 2 24  ? 128.397 121.114 44.219  1.00 111.19 ? 24  DT  G C2    1 
ATOM 9564  O O2    . DT  K 2 24  ? 127.941 121.189 45.347  1.00 109.87 ? 24  DT  G O2    1 
ATOM 9565  N N3    . DT  K 2 24  ? 129.748 121.143 43.953  1.00 113.45 ? 24  DT  G N3    1 
ATOM 9566  C C4    . DT  K 2 24  ? 130.370 121.060 42.717  1.00 115.25 ? 24  DT  G C4    1 
ATOM 9567  O O4    . DT  K 2 24  ? 131.589 121.094 42.594  1.00 117.34 ? 24  DT  G O4    1 
ATOM 9568  C C5    . DT  K 2 24  ? 129.484 120.930 41.586  1.00 114.69 ? 24  DT  G C5    1 
ATOM 9569  C C7    . DT  K 2 24  ? 130.034 120.831 40.188  1.00 116.76 ? 24  DT  G C7    1 
ATOM 9570  C C6    . DT  K 2 24  ? 128.164 120.905 41.842  1.00 112.49 ? 24  DT  G C6    1 
ATOM 9571  O "O5'" . DA  L 2 1   ? 132.083 124.952 52.448  1.00 127.26 ? 1   DA  H "O5'" 1 
ATOM 9572  C "C5'" . DA  L 2 1   ? 132.621 123.747 53.037  1.00 124.49 ? 1   DA  H "C5'" 1 
ATOM 9573  C "C4'" . DA  L 2 1   ? 131.730 122.557 52.723  1.00 120.58 ? 1   DA  H "C4'" 1 
ATOM 9574  O "O4'" . DA  L 2 1   ? 131.736 122.325 51.289  1.00 118.78 ? 1   DA  H "O4'" 1 
ATOM 9575  C "C3'" . DA  L 2 1   ? 132.166 121.220 53.296  1.00 117.71 ? 1   DA  H "C3'" 1 
ATOM 9576  O "O3'" . DA  L 2 1   ? 131.090 120.284 53.170  1.00 115.07 ? 1   DA  H "O3'" 1 
ATOM 9577  C "C2'" . DA  L 2 1   ? 133.225 120.865 52.264  1.00 116.26 ? 1   DA  H "C2'" 1 
ATOM 9578  C "C1'" . DA  L 2 1   ? 132.326 121.062 51.048  1.00 115.54 ? 1   DA  H "C1'" 1 
ATOM 9579  N N9    . DA  L 2 1   ? 132.982 121.035 49.739  1.00 114.60 ? 1   DA  H N9    1 
ATOM 9580  C C8    . DA  L 2 1   ? 134.324 120.963 49.470  1.00 114.74 ? 1   DA  H C8    1 
ATOM 9581  N N7    . DA  L 2 1   ? 134.610 120.951 48.187  1.00 113.53 ? 1   DA  H N7    1 
ATOM 9582  C C5    . DA  L 2 1   ? 133.369 121.020 47.570  1.00 112.67 ? 1   DA  H C5    1 
ATOM 9583  C C6    . DA  L 2 1   ? 132.981 121.044 46.211  1.00 111.80 ? 1   DA  H C6    1 
ATOM 9584  N N6    . DA  L 2 1   ? 133.846 120.998 45.187  1.00 111.43 ? 1   DA  H N6    1 
ATOM 9585  N N1    . DA  L 2 1   ? 131.656 121.119 45.951  1.00 111.50 ? 1   DA  H N1    1 
ATOM 9586  C C2    . DA  L 2 1   ? 130.792 121.167 46.977  1.00 111.91 ? 1   DA  H C2    1 
ATOM 9587  N N3    . DA  L 2 1   ? 131.036 121.146 48.286  1.00 113.04 ? 1   DA  H N3    1 
ATOM 9588  C C4    . DA  L 2 1   ? 132.357 121.072 48.515  1.00 113.37 ? 1   DA  H C4    1 
ATOM 9589  P P     . DT  L 2 2   ? 130.121 119.944 54.414  1.00 126.36 ? 2   DT  H P     1 
ATOM 9590  O OP1   . DT  L 2 2   ? 129.753 121.237 55.045  1.00 130.15 ? 2   DT  H OP1   1 
ATOM 9591  O OP2   . DT  L 2 2   ? 130.757 118.871 55.223  1.00 124.53 ? 2   DT  H OP2   1 
ATOM 9592  O "O5'" . DT  L 2 2   ? 128.813 119.323 53.716  1.00 123.36 ? 2   DT  H "O5'" 1 
ATOM 9593  C "C5'" . DT  L 2 2   ? 128.066 120.106 52.772  1.00 124.32 ? 2   DT  H "C5'" 1 
ATOM 9594  C "C4'" . DT  L 2 2   ? 127.750 119.326 51.505  1.00 121.26 ? 2   DT  H "C4'" 1 
ATOM 9595  O "O4'" . DT  L 2 2   ? 128.829 119.430 50.539  1.00 120.94 ? 2   DT  H "O4'" 1 
ATOM 9596  C "C3'" . DT  L 2 2   ? 127.541 117.827 51.713  1.00 117.74 ? 2   DT  H "C3'" 1 
ATOM 9597  O "O3'" . DT  L 2 2   ? 126.220 117.430 51.365  1.00 116.45 ? 2   DT  H "O3'" 1 
ATOM 9598  C "C2'" . DT  L 2 2   ? 128.578 117.182 50.804  1.00 115.77 ? 2   DT  H "C2'" 1 
ATOM 9599  C "C1'" . DT  L 2 2   ? 128.702 118.268 49.755  1.00 117.55 ? 2   DT  H "C1'" 1 
ATOM 9600  N N1    . DT  L 2 2   ? 129.848 118.096 48.827  1.00 116.87 ? 2   DT  H N1    1 
ATOM 9601  C C2    . DT  L 2 2   ? 129.561 118.043 47.485  1.00 115.96 ? 2   DT  H C2    1 
ATOM 9602  O O2    . DT  L 2 2   ? 128.426 118.141 47.056  1.00 115.75 ? 2   DT  H O2    1 
ATOM 9603  N N3    . DT  L 2 2   ? 130.653 117.877 46.669  1.00 115.27 ? 2   DT  H N3    1 
ATOM 9604  C C4    . DT  L 2 2   ? 131.975 117.756 47.062  1.00 115.61 ? 2   DT  H C4    1 
ATOM 9605  O O4    . DT  L 2 2   ? 132.895 117.607 46.262  1.00 115.03 ? 2   DT  H O4    1 
ATOM 9606  C C5    . DT  L 2 2   ? 132.202 117.815 48.483  1.00 116.75 ? 2   DT  H C5    1 
ATOM 9607  C C7    . DT  L 2 2   ? 133.602 117.692 49.006  1.00 117.49 ? 2   DT  H C7    1 
ATOM 9608  C C6    . DT  L 2 2   ? 131.143 117.979 49.294  1.00 117.19 ? 2   DT  H C6    1 
ATOM 9609  P P     . DT  L 2 3   ? 125.300 116.715 52.474  1.00 107.21 ? 3   DT  H P     1 
ATOM 9610  O OP1   . DT  L 2 3   ? 125.148 117.709 53.562  1.00 110.30 ? 3   DT  H OP1   1 
ATOM 9611  O OP2   . DT  L 2 3   ? 125.847 115.356 52.736  1.00 104.29 ? 3   DT  H OP2   1 
ATOM 9612  O "O5'" . DT  L 2 3   ? 123.889 116.504 51.762  1.00 105.77 ? 3   DT  H "O5'" 1 
ATOM 9613  C "C5'" . DT  L 2 3   ? 123.749 115.351 50.968  1.00 102.78 ? 3   DT  H "C5'" 1 
ATOM 9614  C "C4'" . DT  L 2 3   ? 123.744 115.692 49.487  1.00 102.44 ? 3   DT  H "C4'" 1 
ATOM 9615  O "O4'" . DT  L 2 3   ? 125.066 115.972 48.927  1.00 102.75 ? 3   DT  H "O4'" 1 
ATOM 9616  C "C3'" . DT  L 2 3   ? 123.249 114.544 48.645  1.00 99.66  ? 3   DT  H "C3'" 1 
ATOM 9617  O "O3'" . DT  L 2 3   ? 122.787 115.140 47.503  1.00 100.35 ? 3   DT  H "O3'" 1 
ATOM 9618  C "C2'" . DT  L 2 3   ? 124.540 113.800 48.343  1.00 97.92  ? 3   DT  H "C2'" 1 
ATOM 9619  C "C1'" . DT  L 2 3   ? 125.334 115.023 47.903  1.00 100.08 ? 3   DT  H "C1'" 1 
ATOM 9620  N N1    . DT  L 2 3   ? 126.815 114.820 47.758  1.00 99.41  ? 3   DT  H N1    1 
ATOM 9621  C C2    . DT  L 2 3   ? 127.409 114.966 46.520  1.00 99.03  ? 3   DT  H C2    1 
ATOM 9622  O O2    . DT  L 2 3   ? 126.795 115.250 45.506  1.00 99.19  ? 3   DT  H O2    1 
ATOM 9623  N N3    . DT  L 2 3   ? 128.767 114.769 46.511  1.00 98.97  ? 3   DT  H N3    1 
ATOM 9624  C C4    . DT  L 2 3   ? 129.570 114.448 47.585  1.00 99.16  ? 3   DT  H C4    1 
ATOM 9625  O O4    . DT  L 2 3   ? 130.780 114.289 47.502  1.00 99.16  ? 3   DT  H O4    1 
ATOM 9626  C C5    . DT  L 2 3   ? 128.890 114.308 48.835  1.00 99.49  ? 3   DT  H C5    1 
ATOM 9627  C C7    . DT  L 2 3   ? 129.689 113.955 50.053  1.00 99.69  ? 3   DT  H C7    1 
ATOM 9628  C C6    . DT  L 2 3   ? 127.565 114.502 48.869  1.00 99.69  ? 3   DT  H C6    1 
ATOM 9629  P P     . DT  L 2 4   ? 121.450 114.587 46.828  1.00 81.31  ? 4   DT  H P     1 
ATOM 9630  O OP1   . DT  L 2 4   ? 120.395 115.572 47.181  1.00 83.99  ? 4   DT  H OP1   1 
ATOM 9631  O OP2   . DT  L 2 4   ? 121.330 113.130 47.146  1.00 78.31  ? 4   DT  H OP2   1 
ATOM 9632  O "O5'" . DT  L 2 4   ? 121.749 114.707 45.269  1.00 80.71  ? 4   DT  H "O5'" 1 
ATOM 9633  C "C5'" . DT  L 2 4   ? 123.095 114.621 44.876  1.00 79.94  ? 4   DT  H "C5'" 1 
ATOM 9634  C "C4'" . DT  L 2 4   ? 123.205 113.740 43.658  1.00 77.65  ? 4   DT  H "C4'" 1 
ATOM 9635  O "O4'" . DT  L 2 4   ? 124.584 113.304 43.585  1.00 76.62  ? 4   DT  H "O4'" 1 
ATOM 9636  C "C3'" . DT  L 2 4   ? 122.453 112.427 43.666  1.00 75.37  ? 4   DT  H "C3'" 1 
ATOM 9637  O "O3'" . DT  L 2 4   ? 122.684 111.949 42.368  1.00 74.13  ? 4   DT  H "O3'" 1 
ATOM 9638  C "C2'" . DT  L 2 4   ? 123.343 111.676 44.646  1.00 74.21  ? 4   DT  H "C2'" 1 
ATOM 9639  C "C1'" . DT  L 2 4   ? 124.656 111.938 43.915  1.00 74.35  ? 4   DT  H "C1'" 1 
ATOM 9640  N N1    . DT  L 2 4   ? 125.935 111.773 44.636  1.00 74.11  ? 4   DT  H N1    1 
ATOM 9641  C C2    . DT  L 2 4   ? 127.079 111.820 43.883  1.00 73.85  ? 4   DT  H C2    1 
ATOM 9642  O O2    . DT  L 2 4   ? 127.052 111.977 42.680  1.00 73.76  ? 4   DT  H O2    1 
ATOM 9643  N N3    . DT  L 2 4   ? 128.246 111.661 44.580  1.00 73.98  ? 4   DT  H N3    1 
ATOM 9644  C C4    . DT  L 2 4   ? 128.363 111.477 45.943  1.00 74.43  ? 4   DT  H C4    1 
ATOM 9645  O O4    . DT  L 2 4   ? 129.436 111.348 46.522  1.00 74.94  ? 4   DT  H O4    1 
ATOM 9646  C C5    . DT  L 2 4   ? 127.127 111.449 46.667  1.00 74.48  ? 4   DT  H C5    1 
ATOM 9647  C C7    . DT  L 2 4   ? 127.178 111.252 48.149  1.00 74.82  ? 4   DT  H C7    1 
ATOM 9648  C C6    . DT  L 2 4   ? 125.978 111.595 45.997  1.00 74.40  ? 4   DT  H C6    1 
ATOM 9649  P P     . DA  L 2 5   ? 121.635 110.982 41.633  1.00 65.12  ? 5   DA  H P     1 
ATOM 9650  O OP1   . DA  L 2 5   ? 120.576 111.866 41.085  1.00 66.88  ? 5   DA  H OP1   1 
ATOM 9651  O OP2   . DA  L 2 5   ? 121.353 109.819 42.522  1.00 63.40  ? 5   DA  H OP2   1 
ATOM 9652  O "O5'" . DA  L 2 5   ? 122.455 110.376 40.393  1.00 63.70  ? 5   DA  H "O5'" 1 
ATOM 9653  C "C5'" . DA  L 2 5   ? 123.253 111.234 39.591  1.00 64.88  ? 5   DA  H "C5'" 1 
ATOM 9654  C "C4'" . DA  L 2 5   ? 124.232 110.415 38.774  1.00 63.23  ? 5   DA  H "C4'" 1 
ATOM 9655  O "O4'" . DA  L 2 5   ? 125.461 110.126 39.492  1.00 62.62  ? 5   DA  H "O4'" 1 
ATOM 9656  C "C3'" . DA  L 2 5   ? 123.663 109.077 38.396  1.00 61.16  ? 5   DA  H "C3'" 1 
ATOM 9657  O "O3'" . DA  L 2 5   ? 124.009 108.795 37.057  1.00 60.64  ? 5   DA  H "O3'" 1 
ATOM 9658  C "C2'" . DA  L 2 5   ? 124.292 108.102 39.397  1.00 59.54  ? 5   DA  H "C2'" 1 
ATOM 9659  C "C1'" . DA  L 2 5   ? 125.626 108.743 39.742  1.00 60.37  ? 5   DA  H "C1'" 1 
ATOM 9660  N N9    . DA  L 2 5   ? 125.995 108.648 41.149  1.00 60.37  ? 5   DA  H N9    1 
ATOM 9661  C C8    . DA  L 2 5   ? 125.180 108.891 42.222  1.00 61.06  ? 5   DA  H C8    1 
ATOM 9662  N N7    . DA  L 2 5   ? 125.776 108.753 43.388  1.00 61.06  ? 5   DA  H N7    1 
ATOM 9663  C C5    . DA  L 2 5   ? 127.078 108.403 43.060  1.00 60.33  ? 5   DA  H C5    1 
ATOM 9664  C C6    . DA  L 2 5   ? 128.215 108.125 43.851  1.00 60.12  ? 5   DA  H C6    1 
ATOM 9665  N N6    . DA  L 2 5   ? 128.225 108.148 45.180  1.00 60.61  ? 5   DA  H N6    1 
ATOM 9666  N N1    . DA  L 2 5   ? 129.350 107.813 43.212  1.00 59.49  ? 5   DA  H N1    1 
ATOM 9667  C C2    . DA  L 2 5   ? 129.336 107.784 41.872  1.00 59.09  ? 5   DA  H C2    1 
ATOM 9668  N N3    . DA  L 2 5   ? 128.343 108.031 41.012  1.00 59.27  ? 5   DA  H N3    1 
ATOM 9669  C C4    . DA  L 2 5   ? 127.226 108.337 41.680  1.00 59.90  ? 5   DA  H C4    1 
ATOM 9670  P P     . DG  L 2 6   ? 123.688 107.339 36.462  1.00 58.54  ? 6   DG  H P     1 
ATOM 9671  O OP1   . DG  L 2 6   ? 123.829 107.426 34.990  1.00 58.80  ? 6   DG  H OP1   1 
ATOM 9672  O OP2   . DG  L 2 6   ? 122.407 106.861 37.057  1.00 58.14  ? 6   DG  H OP2   1 
ATOM 9673  O "O5'" . DG  L 2 6   ? 124.924 106.458 36.966  1.00 56.94  ? 6   DG  H "O5'" 1 
ATOM 9674  C "C5'" . DG  L 2 6   ? 126.170 106.719 36.317  1.00 57.15  ? 6   DG  H "C5'" 1 
ATOM 9675  C "C4'" . DG  L 2 6   ? 127.300 105.848 36.818  1.00 55.74  ? 6   DG  H "C4'" 1 
ATOM 9676  O "O4'" . DG  L 2 6   ? 127.436 106.055 38.243  1.00 56.01  ? 6   DG  H "O4'" 1 
ATOM 9677  C "C3'" . DG  L 2 6   ? 127.140 104.338 36.626  1.00 53.68  ? 6   DG  H "C3'" 1 
ATOM 9678  O "O3'" . DG  L 2 6   ? 128.358 103.835 36.223  1.00 52.94  ? 6   DG  H "O3'" 1 
ATOM 9679  C "C2'" . DG  L 2 6   ? 126.857 103.818 38.021  1.00 52.96  ? 6   DG  H "C2'" 1 
ATOM 9680  C "C1'" . DG  L 2 6   ? 127.689 104.795 38.828  1.00 54.23  ? 6   DG  H "C1'" 1 
ATOM 9681  N N9    . DG  L 2 6   ? 127.337 104.867 40.238  1.00 54.45  ? 6   DG  H N9    1 
ATOM 9682  C C8    . DG  L 2 6   ? 126.122 105.082 40.857  1.00 54.93  ? 6   DG  H C8    1 
ATOM 9683  N N7    . DG  L 2 6   ? 126.182 105.089 42.164  1.00 55.13  ? 6   DG  H N7    1 
ATOM 9684  C C5    . DG  L 2 6   ? 127.526 104.866 42.415  1.00 54.78  ? 6   DG  H C5    1 
ATOM 9685  C C6    . DG  L 2 6   ? 128.216 104.767 43.627  1.00 54.92  ? 6   DG  H C6    1 
ATOM 9686  O O6    . DG  L 2 6   ? 127.740 104.860 44.759  1.00 55.38  ? 6   DG  H O6    1 
ATOM 9687  N N1    . DG  L 2 6   ? 129.579 104.549 43.436  1.00 54.62  ? 6   DG  H N1    1 
ATOM 9688  C C2    . DG  L 2 6   ? 130.195 104.438 42.208  1.00 54.21  ? 6   DG  H C2    1 
ATOM 9689  N N2    . DG  L 2 6   ? 131.518 104.227 42.187  1.00 54.07  ? 6   DG  H N2    1 
ATOM 9690  N N3    . DG  L 2 6   ? 129.562 104.523 41.053  1.00 54.07  ? 6   DG  H N3    1 
ATOM 9691  C C4    . DG  L 2 6   ? 128.241 104.737 41.248  1.00 54.37  ? 6   DG  H C4    1 
ATOM 9692  P P     . DT  L 2 7   ? 128.511 102.298 35.814  1.00 51.01  ? 7   DT  H P     1 
ATOM 9693  O OP1   . DT  L 2 7   ? 129.183 102.283 34.509  1.00 51.14  ? 7   DT  H OP1   1 
ATOM 9694  O OP2   . DT  L 2 7   ? 127.254 101.575 36.075  1.00 50.22  ? 7   DT  H OP2   1 
ATOM 9695  O "O5'" . DT  L 2 7   ? 129.573 101.741 36.837  1.00 50.21  ? 7   DT  H "O5'" 1 
ATOM 9696  C "C5'" . DT  L 2 7   ? 130.737 102.506 36.945  1.00 51.18  ? 7   DT  H "C5'" 1 
ATOM 9697  C "C4'" . DT  L 2 7   ? 131.620 101.938 38.022  1.00 50.52  ? 7   DT  H "C4'" 1 
ATOM 9698  O "O4'" . DT  L 2 7   ? 131.046 102.117 39.333  1.00 50.75  ? 7   DT  H "O4'" 1 
ATOM 9699  C "C3'" . DT  L 2 7   ? 131.858 100.463 37.878  1.00 48.76  ? 7   DT  H "C3'" 1 
ATOM 9700  O "O3'" . DT  L 2 7   ? 133.195 100.371 38.122  1.00 48.83  ? 7   DT  H "O3'" 1 
ATOM 9701  C "C2'" . DT  L 2 7   ? 131.040 99.846  39.002  1.00 47.99  ? 7   DT  H "C2'" 1 
ATOM 9702  C "C1'" . DT  L 2 7   ? 131.129 100.921 40.064  1.00 49.33  ? 7   DT  H "C1'" 1 
ATOM 9703  N N1    . DT  L 2 7   ? 129.990 101.062 40.975  1.00 49.52  ? 7   DT  H N1    1 
ATOM 9704  C C2    . DT  L 2 7   ? 130.204 101.105 42.310  1.00 49.80  ? 7   DT  H C2    1 
ATOM 9705  O O2    . DT  L 2 7   ? 131.314 100.999 42.778  1.00 49.88  ? 7   DT  H O2    1 
ATOM 9706  N N3    . DT  L 2 7   ? 129.070 101.271 43.057  1.00 50.10  ? 7   DT  H N3    1 
ATOM 9707  C C4    . DT  L 2 7   ? 127.775 101.409 42.608  1.00 50.18  ? 7   DT  H C4    1 
ATOM 9708  O O4    . DT  L 2 7   ? 126.797 101.573 43.325  1.00 50.57  ? 7   DT  H O4    1 
ATOM 9709  C C5    . DT  L 2 7   ? 127.633 101.356 41.199  1.00 49.91  ? 7   DT  H C5    1 
ATOM 9710  C C7    . DT  L 2 7   ? 126.275 101.479 40.601  1.00 50.12  ? 7   DT  H C7    1 
ATOM 9711  C C6    . DT  L 2 7   ? 128.728 101.201 40.461  1.00 49.61  ? 7   DT  H C6    1 
ATOM 9712  P P     . DT  L 2 8   ? 133.947 98.980  37.935  1.00 47.37  ? 8   DT  H P     1 
ATOM 9713  O OP1   . DT  L 2 8   ? 135.194 99.321  37.211  1.00 48.02  ? 8   DT  H OP1   1 
ATOM 9714  O OP2   . DT  L 2 8   ? 133.020 97.987  37.339  1.00 46.17  ? 8   DT  H OP2   1 
ATOM 9715  O "O5'" . DT  L 2 8   ? 134.236 98.504  39.437  1.00 46.97  ? 8   DT  H "O5'" 1 
ATOM 9716  C "C5'" . DT  L 2 8   ? 135.158 99.170  40.249  1.00 48.02  ? 8   DT  H "C5'" 1 
ATOM 9717  C "C4'" . DT  L 2 8   ? 135.200 98.519  41.616  1.00 47.51  ? 8   DT  H "C4'" 1 
ATOM 9718  O "O4'" . DT  L 2 8   ? 133.958 98.722  42.328  1.00 47.56  ? 8   DT  H "O4'" 1 
ATOM 9719  C "C3'" . DT  L 2 8   ? 135.423 97.015  41.678  1.00 45.95  ? 8   DT  H "C3'" 1 
ATOM 9720  O "O3'" . DT  L 2 8   ? 136.222 96.874  42.806  1.00 46.28  ? 8   DT  H "O3'" 1 
ATOM 9721  C "C2'" . DT  L 2 8   ? 134.027 96.452  41.935  1.00 45.06  ? 8   DT  H "C2'" 1 
ATOM 9722  C "C1'" . DT  L 2 8   ? 133.508 97.505  42.895  1.00 46.23  ? 8   DT  H "C1'" 1 
ATOM 9723  N N1    . DT  L 2 8   ? 132.031 97.660  43.062  1.00 46.16  ? 8   DT  H N1    1 
ATOM 9724  C C2    . DT  L 2 8   ? 131.561 97.875  44.318  1.00 46.62  ? 8   DT  H C2    1 
ATOM 9725  O O2    . DT  L 2 8   ? 132.281 97.905  45.285  1.00 47.06  ? 8   DT  H O2    1 
ATOM 9726  N N3    . DT  L 2 8   ? 130.216 98.039  44.416  1.00 46.68  ? 8   DT  H N3    1 
ATOM 9727  C C4    . DT  L 2 8   ? 129.297 98.021  43.404  1.00 46.37  ? 8   DT  H C4    1 
ATOM 9728  O O4    . DT  L 2 8   ? 128.103 98.177  43.591  1.00 46.57  ? 8   DT  H O4    1 
ATOM 9729  C C5    . DT  L 2 8   ? 129.836 97.803  42.104  1.00 45.93  ? 8   DT  H C5    1 
ATOM 9730  C C7    . DT  L 2 8   ? 128.904 97.759  40.937  1.00 45.74  ? 8   DT  H C7    1 
ATOM 9731  C C6    . DT  L 2 8   ? 131.161 97.639  41.992  1.00 45.84  ? 8   DT  H C6    1 
ATOM 9732  P P     . DA  L 2 9   ? 137.073 95.544  43.067  1.00 45.28  ? 9   DA  H P     1 
ATOM 9733  O OP1   . DA  L 2 9   ? 138.437 95.800  42.583  1.00 45.97  ? 9   DA  H OP1   1 
ATOM 9734  O OP2   . DA  L 2 9   ? 136.324 94.333  42.666  1.00 43.77  ? 9   DA  H OP2   1 
ATOM 9735  O "O5'" . DA  L 2 9   ? 137.130 95.485  44.649  1.00 45.68  ? 9   DA  H "O5'" 1 
ATOM 9736  C "C5'" . DA  L 2 9   ? 135.997 95.841  45.369  1.00 45.86  ? 9   DA  H "C5'" 1 
ATOM 9737  C "C4'" . DA  L 2 9   ? 135.929 95.048  46.640  1.00 45.50  ? 9   DA  H "C4'" 1 
ATOM 9738  O "O4'" . DA  L 2 9   ? 134.539 95.086  46.999  1.00 45.23  ? 9   DA  H "O4'" 1 
ATOM 9739  C "C3'" . DA  L 2 9   ? 136.251 93.566  46.572  1.00 44.17  ? 9   DA  H "C3'" 1 
ATOM 9740  O "O3'" . DA  L 2 9   ? 136.501 93.083  47.872  1.00 44.34  ? 9   DA  H "O3'" 1 
ATOM 9741  C "C2'" . DA  L 2 9   ? 134.943 93.018  46.032  1.00 43.06  ? 9   DA  H "C2'" 1 
ATOM 9742  C "C1'" . DA  L 2 9   ? 133.926 93.825  46.810  1.00 43.78  ? 9   DA  H "C1'" 1 
ATOM 9743  N N9    . DA  L 2 9   ? 132.713 94.130  46.069  1.00 43.53  ? 9   DA  H N9    1 
ATOM 9744  C C8    . DA  L 2 9   ? 132.639 94.302  44.724  1.00 43.29  ? 9   DA  H C8    1 
ATOM 9745  N N7    . DA  L 2 9   ? 131.433 94.598  44.308  1.00 43.27  ? 9   DA  H N7    1 
ATOM 9746  C C5    . DA  L 2 9   ? 130.670 94.633  45.458  1.00 43.51  ? 9   DA  H C5    1 
ATOM 9747  C C6    . DA  L 2 9   ? 129.304 94.892  45.671  1.00 43.72  ? 9   DA  H C6    1 
ATOM 9748  N N6    . DA  L 2 9   ? 128.437 95.179  44.693  1.00 43.73  ? 9   DA  H N6    1 
ATOM 9749  N N1    . DA  L 2 9   ? 128.872 94.848  46.943  1.00 44.04  ? 9   DA  H N1    1 
ATOM 9750  C C2    . DA  L 2 9   ? 129.745 94.574  47.908  1.00 44.17  ? 9   DA  H C2    1 
ATOM 9751  N N3    . DA  L 2 9   ? 131.044 94.319  47.820  1.00 44.04  ? 9   DA  H N3    1 
ATOM 9752  C C4    . DA  L 2 9   ? 131.449 94.358  46.553  1.00 43.68  ? 9   DA  H C4    1 
ATOM 9753  P P     . DG  L 2 10  ? 137.250 91.680  48.108  1.00 43.51  ? 10  DG  H P     1 
ATOM 9754  O OP1   . DG  L 2 10  ? 138.163 91.860  49.252  1.00 44.60  ? 10  DG  H OP1   1 
ATOM 9755  O OP2   . DG  L 2 10  ? 137.726 91.062  46.846  1.00 42.69  ? 10  DG  H OP2   1 
ATOM 9756  O "O5'" . DG  L 2 10  ? 136.093 90.721  48.592  1.00 42.49  ? 10  DG  H "O5'" 1 
ATOM 9757  C "C5'" . DG  L 2 10  ? 135.322 91.104  49.694  1.00 43.04  ? 10  DG  H "C5'" 1 
ATOM 9758  C "C4'" . DG  L 2 10  ? 133.983 90.412  49.643  1.00 42.05  ? 10  DG  H "C4'" 1 
ATOM 9759  O "O4'" . DG  L 2 10  ? 133.166 91.121  48.682  1.00 41.98  ? 10  DG  H "O4'" 1 
ATOM 9760  C "C3'" . DG  L 2 10  ? 134.029 88.969  49.156  1.00 40.78  ? 10  DG  H "C3'" 1 
ATOM 9761  O "O3'" . DG  L 2 10  ? 133.052 88.204  49.791  1.00 40.29  ? 10  DG  H "O3'" 1 
ATOM 9762  C "C2'" . DG  L 2 10  ? 133.592 89.104  47.714  1.00 40.21  ? 10  DG  H "C2'" 1 
ATOM 9763  C "C1'" . DG  L 2 10  ? 132.495 90.102  47.984  1.00 40.78  ? 10  DG  H "C1'" 1 
ATOM 9764  N N9    . DG  L 2 10  ? 131.863 90.577  46.774  1.00 40.62  ? 10  DG  H N9    1 
ATOM 9765  C C8    . DG  L 2 10  ? 132.432 90.672  45.541  1.00 40.43  ? 10  DG  H C8    1 
ATOM 9766  N N7    . DG  L 2 10  ? 131.600 91.109  44.639  1.00 40.43  ? 10  DG  H N7    1 
ATOM 9767  C C5    . DG  L 2 10  ? 130.418 91.314  45.329  1.00 40.63  ? 10  DG  H C5    1 
ATOM 9768  C C6    . DG  L 2 10  ? 129.173 91.778  44.879  1.00 40.83  ? 10  DG  H C6    1 
ATOM 9769  O O6    . DG  L 2 10  ? 128.850 92.126  43.739  1.00 40.90  ? 10  DG  H O6    1 
ATOM 9770  N N1    . DG  L 2 10  ? 128.246 91.840  45.889  1.00 41.11  ? 10  DG  H N1    1 
ATOM 9771  C C2    . DG  L 2 10  ? 128.488 91.499  47.165  1.00 41.18  ? 10  DG  H C2    1 
ATOM 9772  N N2    . DG  L 2 10  ? 127.457 91.630  47.982  1.00 41.55  ? 10  DG  H N2    1 
ATOM 9773  N N3    . DG  L 2 10  ? 129.633 91.062  47.615  1.00 41.02  ? 10  DG  H N3    1 
ATOM 9774  C C4    . DG  L 2 10  ? 130.558 90.991  46.640  1.00 40.74  ? 10  DG  H C4    1 
ATOM 9775  P P     . DA  L 2 11  ? 133.391 86.703  50.271  1.00 39.65  ? 11  DA  H P     1 
ATOM 9776  O OP1   . DA  L 2 11  ? 134.205 86.908  51.506  1.00 40.57  ? 11  DA  H OP1   1 
ATOM 9777  O OP2   . DA  L 2 11  ? 133.858 85.881  49.107  1.00 38.81  ? 11  DA  H OP2   1 
ATOM 9778  O "O5'" . DA  L 2 11  ? 131.967 86.079  50.672  1.00 39.17  ? 11  DA  H "O5'" 1 
ATOM 9779  C "C5'" . DA  L 2 11  ? 131.200 86.581  51.757  1.00 39.84  ? 11  DA  H "C5'" 1 
ATOM 9780  C "C4'" . DA  L 2 11  ? 129.784 86.780  51.271  1.00 39.55  ? 11  DA  H "C4'" 1 
ATOM 9781  O "O4'" . DA  L 2 11  ? 129.873 87.587  50.098  1.00 39.54  ? 11  DA  H "O4'" 1 
ATOM 9782  C "C3'" . DA  L 2 11  ? 129.096 85.583  50.667  1.00 38.59  ? 11  DA  H "C3'" 1 
ATOM 9783  O "O3'" . DA  L 2 11  ? 128.516 84.747  51.610  1.00 38.55  ? 11  DA  H "O3'" 1 
ATOM 9784  C "C2'" . DA  L 2 11  ? 127.981 86.233  49.864  1.00 38.60  ? 11  DA  H "C2'" 1 
ATOM 9785  C "C1'" . DA  L 2 11  ? 128.623 87.543  49.477  1.00 39.21  ? 11  DA  H "C1'" 1 
ATOM 9786  N N9    . DA  L 2 11  ? 128.885 87.737  48.074  1.00 38.86  ? 11  DA  H N9    1 
ATOM 9787  C C8    . DA  L 2 11  ? 130.083 87.677  47.441  1.00 38.68  ? 11  DA  H C8    1 
ATOM 9788  N N7    . DA  L 2 11  ? 129.994 87.937  46.167  1.00 38.50  ? 11  DA  H N7    1 
ATOM 9789  C C5    . DA  L 2 11  ? 128.658 88.221  45.975  1.00 38.60  ? 11  DA  H C5    1 
ATOM 9790  C C6    . DA  L 2 11  ? 127.913 88.585  44.856  1.00 38.64  ? 11  DA  H C6    1 
ATOM 9791  N N6    . DA  L 2 11  ? 128.437 88.740  43.660  1.00 38.55  ? 11  DA  H N6    1 
ATOM 9792  N N1    . DA  L 2 11  ? 126.604 88.784  44.993  1.00 38.89  ? 11  DA  H N1    1 
ATOM 9793  C C2    . DA  L 2 11  ? 126.063 88.642  46.205  1.00 39.08  ? 11  DA  H C2    1 
ATOM 9794  N N3    . DA  L 2 11  ? 126.643 88.310  47.350  1.00 39.08  ? 11  DA  H N3    1 
ATOM 9795  C C4    . DA  L 2 11  ? 127.957 88.107  47.147  1.00 38.82  ? 11  DA  H C4    1 
ATOM 9796  P P     . DT  L 2 12  ? 128.066 83.288  51.145  1.00 27.23  ? 12  DT  H P     1 
ATOM 9797  O OP1   . DT  L 2 12  ? 127.819 82.417  52.323  1.00 27.77  ? 12  DT  H OP1   1 
ATOM 9798  O OP2   . DT  L 2 12  ? 129.028 82.908  50.083  1.00 28.77  ? 12  DT  H OP2   1 
ATOM 9799  O "O5'" . DT  L 2 12  ? 126.676 83.553  50.421  1.00 26.18  ? 12  DT  H "O5'" 1 
ATOM 9800  C "C5'" . DT  L 2 12  ? 125.512 83.870  51.136  1.00 24.94  ? 12  DT  H "C5'" 1 
ATOM 9801  C "C4'" . DT  L 2 12  ? 124.355 83.715  50.166  1.00 25.11  ? 12  DT  H "C4'" 1 
ATOM 9802  O "O4'" . DT  L 2 12  ? 124.704 84.455  48.977  1.00 24.80  ? 12  DT  H "O4'" 1 
ATOM 9803  C "C3'" . DT  L 2 12  ? 124.052 82.317  49.667  1.00 27.08  ? 12  DT  H "C3'" 1 
ATOM 9804  O "O3'" . DT  L 2 12  ? 122.687 82.112  49.887  1.00 27.11  ? 12  DT  H "O3'" 1 
ATOM 9805  C "C2'" . DT  L 2 12  ? 124.390 82.346  48.183  1.00 27.85  ? 12  DT  H "C2'" 1 
ATOM 9806  C "C1'" . DT  L 2 12  ? 124.263 83.803  47.818  1.00 26.14  ? 12  DT  H "C1'" 1 
ATOM 9807  N N1    . DT  L 2 12  ? 125.180 84.307  46.785  1.00 26.33  ? 12  DT  H N1    1 
ATOM 9808  C C2    . DT  L 2 12  ? 124.720 84.782  45.593  1.00 26.37  ? 12  DT  H C2    1 
ATOM 9809  O O2    . DT  L 2 12  ? 123.543 84.795  45.290  1.00 26.40  ? 12  DT  H O2    1 
ATOM 9810  N N3    . DT  L 2 12  ? 125.676 85.237  44.739  1.00 26.66  ? 12  DT  H N3    1 
ATOM 9811  C C4    . DT  L 2 12  ? 127.029 85.268  44.960  1.00 27.09  ? 12  DT  H C4    1 
ATOM 9812  O O4    . DT  L 2 12  ? 127.800 85.693  44.105  1.00 27.63  ? 12  DT  H O4    1 
ATOM 9813  C C5    . DT  L 2 12  ? 127.440 84.770  46.253  1.00 27.12  ? 12  DT  H C5    1 
ATOM 9814  C C7    . DT  L 2 12  ? 128.864 84.718  46.699  1.00 27.98  ? 12  DT  H C7    1 
ATOM 9815  C C6    . DT  L 2 12  ? 126.505 84.332  47.078  1.00 26.66  ? 12  DT  H C6    1 
ATOM 9816  P P     . DA  L 2 13  ? 122.032 80.667  49.642  1.00 28.09  ? 13  DA  H P     1 
ATOM 9817  O OP1   . DA  L 2 13  ? 120.870 80.578  50.529  1.00 27.89  ? 13  DA  H OP1   1 
ATOM 9818  O OP2   . DA  L 2 13  ? 123.059 79.600  49.618  1.00 29.52  ? 13  DA  H OP2   1 
ATOM 9819  O "O5'" . DA  L 2 13  ? 121.516 80.745  48.143  1.00 28.83  ? 13  DA  H "O5'" 1 
ATOM 9820  C "C5'" . DA  L 2 13  ? 120.539 81.668  47.732  1.00 28.01  ? 13  DA  H "C5'" 1 
ATOM 9821  C "C4'" . DA  L 2 13  ? 120.411 81.638  46.215  1.00 29.05  ? 13  DA  H "C4'" 1 
ATOM 9822  O "O4'" . DA  L 2 13  ? 121.532 82.294  45.588  1.00 28.44  ? 13  DA  H "O4'" 1 
ATOM 9823  C "C3'" . DA  L 2 13  ? 120.346 80.239  45.620  1.00 31.32  ? 13  DA  H "C3'" 1 
ATOM 9824  O "O3'" . DA  L 2 13  ? 119.026 80.077  45.202  1.00 32.17  ? 13  DA  H "O3'" 1 
ATOM 9825  C "C2'" . DA  L 2 13  ? 121.335 80.245  44.459  1.00 32.00  ? 13  DA  H "C2'" 1 
ATOM 9826  C "C1'" . DA  L 2 13  ? 121.714 81.714  44.325  1.00 30.11  ? 13  DA  H "C1'" 1 
ATOM 9827  N N9    . DA  L 2 13  ? 123.089 81.947  43.929  1.00 30.04  ? 13  DA  H N9    1 
ATOM 9828  C C8    . DA  L 2 13  ? 124.201 81.686  44.662  1.00 29.89  ? 13  DA  H C8    1 
ATOM 9829  N N7    . DA  L 2 13  ? 125.322 82.002  44.073  1.00 30.12  ? 13  DA  H N7    1 
ATOM 9830  C C5    . DA  L 2 13  ? 124.896 82.503  42.857  1.00 30.34  ? 13  DA  H C5    1 
ATOM 9831  C C6    . DA  L 2 13  ? 125.600 83.004  41.765  1.00 30.79  ? 13  DA  H C6    1 
ATOM 9832  N N6    . DA  L 2 13  ? 126.921 83.065  41.773  1.00 31.14  ? 13  DA  H N6    1 
ATOM 9833  N N1    . DA  L 2 13  ? 124.908 83.438  40.698  1.00 31.05  ? 13  DA  H N1    1 
ATOM 9834  C C2    . DA  L 2 13  ? 123.581 83.354  40.729  1.00 30.99  ? 13  DA  H C2    1 
ATOM 9835  N N3    . DA  L 2 13  ? 122.798 82.897  41.698  1.00 30.68  ? 13  DA  H N3    1 
ATOM 9836  C C4    . DA  L 2 13  ? 123.527 82.483  42.748  1.00 30.31  ? 13  DA  H C4    1 
ATOM 9837  P P     . DT  L 2 14  ? 118.493 78.653  44.727  1.00 34.20  ? 14  DT  H P     1 
ATOM 9838  O OP1   . DT  L 2 14  ? 117.019 78.639  44.695  1.00 34.76  ? 14  DT  H OP1   1 
ATOM 9839  O OP2   . DT  L 2 14  ? 119.206 77.656  45.538  1.00 34.75  ? 14  DT  H OP2   1 
ATOM 9840  O "O5'" . DT  L 2 14  ? 118.999 78.571  43.216  1.00 35.36  ? 14  DT  H "O5'" 1 
ATOM 9841  C "C5'" . DT  L 2 14  ? 118.445 79.401  42.243  1.00 35.24  ? 14  DT  H "C5'" 1 
ATOM 9842  C "C4'" . DT  L 2 14  ? 119.209 79.367  40.940  1.00 36.24  ? 14  DT  H "C4'" 1 
ATOM 9843  O "O4'" . DT  L 2 14  ? 120.484 79.998  41.134  1.00 34.90  ? 14  DT  H "O4'" 1 
ATOM 9844  C "C3'" . DT  L 2 14  ? 119.574 77.997  40.396  1.00 38.52  ? 14  DT  H "C3'" 1 
ATOM 9845  O "O3'" . DT  L 2 14  ? 118.484 77.428  39.646  1.00 40.35  ? 14  DT  H "O3'" 1 
ATOM 9846  C "C2'" . DT  L 2 14  ? 120.761 78.362  39.507  1.00 38.64  ? 14  DT  H "C2'" 1 
ATOM 9847  C "C1'" . DT  L 2 14  ? 121.293 79.683  40.035  1.00 36.24  ? 14  DT  H "C1'" 1 
ATOM 9848  N N1    . DT  L 2 14  ? 122.689 79.631  40.498  1.00 35.73  ? 14  DT  H N1    1 
ATOM 9849  C C2    . DT  L 2 14  ? 123.646 80.174  39.716  1.00 35.76  ? 14  DT  H C2    1 
ATOM 9850  O O2    . DT  L 2 14  ? 123.402 80.684  38.653  1.00 36.16  ? 14  DT  H O2    1 
ATOM 9851  N N3    . DT  L 2 14  ? 124.911 80.101  40.201  1.00 35.49  ? 14  DT  H N3    1 
ATOM 9852  C C4    . DT  L 2 14  ? 125.317 79.542  41.375  1.00 35.20  ? 14  DT  H C4    1 
ATOM 9853  O O4    . DT  L 2 14  ? 126.492 79.537  41.694  1.00 35.21  ? 14  DT  H O4    1 
ATOM 9854  C C5    . DT  L 2 14  ? 124.276 78.969  42.169  1.00 35.12  ? 14  DT  H C5    1 
ATOM 9855  C C7    . DT  L 2 14  ? 124.581 78.319  43.474  1.00 34.94  ? 14  DT  H C7    1 
ATOM 9856  C C6    . DT  L 2 14  ? 123.035 79.048  41.694  1.00 35.39  ? 14  DT  H C6    1 
ATOM 9857  P P     . DC  L 2 15  ? 118.617 75.978  38.977  1.00 43.01  ? 15  DC  H P     1 
ATOM 9858  O OP1   . DC  L 2 15  ? 117.315 75.608  38.422  1.00 44.56  ? 15  DC  H OP1   1 
ATOM 9859  O OP2   . DC  L 2 15  ? 119.309 75.082  39.907  1.00 43.13  ? 15  DC  H OP2   1 
ATOM 9860  O "O5'" . DC  L 2 15  ? 119.548 76.219  37.731  1.00 43.74  ? 15  DC  H "O5'" 1 
ATOM 9861  C "C5'" . DC  L 2 15  ? 119.027 76.835  36.590  1.00 44.29  ? 15  DC  H "C5'" 1 
ATOM 9862  C "C4'" . DC  L 2 15  ? 120.162 77.164  35.656  1.00 44.64  ? 15  DC  H "C4'" 1 
ATOM 9863  O "O4'" . DC  L 2 15  ? 121.232 77.701  36.448  1.00 42.78  ? 15  DC  H "O4'" 1 
ATOM 9864  C "C3'" . DC  L 2 15  ? 120.798 75.946  35.046  1.00 46.95  ? 15  DC  H "C3'" 1 
ATOM 9865  O "O3'" . DC  L 2 15  ? 120.148 75.669  33.858  1.00 48.95  ? 15  DC  H "O3'" 1 
ATOM 9866  C "C2'" . DC  L 2 15  ? 122.239 76.375  34.815  1.00 46.45  ? 15  DC  H "C2'" 1 
ATOM 9867  C "C1'" . DC  L 2 15  ? 122.460 77.506  35.802  1.00 43.67  ? 15  DC  H "C1'" 1 
ATOM 9868  N N1    . DC  L 2 15  ? 123.478 77.263  36.854  1.00 42.75  ? 15  DC  H N1    1 
ATOM 9869  C C2    . DC  L 2 15  ? 124.792 77.651  36.655  1.00 42.52  ? 15  DC  H C2    1 
ATOM 9870  O O2    . DC  L 2 15  ? 125.090 78.172  35.579  1.00 43.11  ? 15  DC  H O2    1 
ATOM 9871  N N3    . DC  L 2 15  ? 125.704 77.439  37.629  1.00 41.84  ? 15  DC  H N3    1 
ATOM 9872  C C4    . DC  L 2 15  ? 125.353 76.875  38.773  1.00 41.33  ? 15  DC  H C4    1 
ATOM 9873  N N4    . DC  L 2 15  ? 126.295 76.696  39.703  1.00 40.81  ? 15  DC  H N4    1 
ATOM 9874  C C5    . DC  L 2 15  ? 124.012 76.473  39.004  1.00 41.52  ? 15  DC  H C5    1 
ATOM 9875  C C6    . DC  L 2 15  ? 123.126 76.684  38.026  1.00 42.26  ? 15  DC  H C6    1 
ATOM 9876  P P     . DT  L 2 16  ? 120.357 74.253  33.150  1.00 51.83  ? 16  DT  H P     1 
ATOM 9877  O OP1   . DT  L 2 16  ? 119.427 74.250  31.999  1.00 53.59  ? 16  DT  H OP1   1 
ATOM 9878  O OP2   . DT  L 2 16  ? 120.385 73.188  34.168  1.00 52.05  ? 16  DT  H OP2   1 
ATOM 9879  O "O5'" . DT  L 2 16  ? 121.831 74.309  32.579  1.00 52.27  ? 16  DT  H "O5'" 1 
ATOM 9880  C "C5'" . DT  L 2 16  ? 122.089 75.058  31.433  1.00 52.74  ? 16  DT  H "C5'" 1 
ATOM 9881  C "C4'" . DT  L 2 16  ? 123.560 74.941  31.103  1.00 53.29  ? 16  DT  H "C4'" 1 
ATOM 9882  O "O4'" . DT  L 2 16  ? 124.356 75.307  32.247  1.00 51.22  ? 16  DT  H "O4'" 1 
ATOM 9883  C "C3'" . DT  L 2 16  ? 124.078 73.596  30.649  1.00 55.83  ? 16  DT  H "C3'" 1 
ATOM 9884  O "O3'" . DT  L 2 16  ? 124.834 73.921  29.527  1.00 57.04  ? 16  DT  H "O3'" 1 
ATOM 9885  C "C2'" . DT  L 2 16  ? 124.996 73.154  31.770  1.00 54.93  ? 16  DT  H "C2'" 1 
ATOM 9886  C "C1'" . DT  L 2 16  ? 125.455 74.451  32.393  1.00 52.31  ? 16  DT  H "C1'" 1 
ATOM 9887  N N1    . DT  L 2 16  ? 125.685 74.366  33.865  1.00 50.52  ? 16  DT  H N1    1 
ATOM 9888  C C2    . DT  L 2 16  ? 126.912 74.652  34.429  1.00 49.64  ? 16  DT  H C2    1 
ATOM 9889  O O2    . DT  L 2 16  ? 127.907 74.976  33.822  1.00 50.22  ? 16  DT  H O2    1 
ATOM 9890  N N3    . DT  L 2 16  ? 126.960 74.530  35.783  1.00 48.17  ? 16  DT  H N3    1 
ATOM 9891  C C4    . DT  L 2 16  ? 125.941 74.163  36.626  1.00 47.50  ? 16  DT  H C4    1 
ATOM 9892  O O4    . DT  L 2 16  ? 126.133 74.102  37.828  1.00 46.28  ? 16  DT  H O4    1 
ATOM 9893  C C5    . DT  L 2 16  ? 124.678 73.882  35.992  1.00 48.49  ? 16  DT  H C5    1 
ATOM 9894  C C7    . DT  L 2 16  ? 123.472 73.484  36.786  1.00 48.11  ? 16  DT  H C7    1 
ATOM 9895  C C6    . DT  L 2 16  ? 124.623 73.995  34.664  1.00 49.93  ? 16  DT  H C6    1 
ATOM 9896  P P     . DA  L 2 17  ? 125.420 72.795  28.544  1.00 60.15  ? 17  DA  H P     1 
ATOM 9897  O OP1   . DA  L 2 17  ? 125.340 73.451  27.216  1.00 61.28  ? 17  DA  H OP1   1 
ATOM 9898  O OP2   . DA  L 2 17  ? 124.801 71.457  28.796  1.00 61.64  ? 17  DA  H OP2   1 
ATOM 9899  O "O5'" . DA  L 2 17  ? 126.959 72.662  28.985  1.00 59.90  ? 17  DA  H "O5'" 1 
ATOM 9900  C "C5'" . DA  L 2 17  ? 127.804 73.785  29.062  1.00 58.42  ? 17  DA  H "C5'" 1 
ATOM 9901  C "C4'" . DA  L 2 17  ? 129.205 73.373  29.478  1.00 58.82  ? 17  DA  H "C4'" 1 
ATOM 9902  O "O4'" . DA  L 2 17  ? 129.309 73.327  30.923  1.00 56.83  ? 17  DA  H "O4'" 1 
ATOM 9903  C "C3'" . DA  L 2 17  ? 129.734 72.025  28.999  1.00 61.58  ? 17  DA  H "C3'" 1 
ATOM 9904  O "O3'" . DA  L 2 17  ? 131.093 72.213  28.581  1.00 62.54  ? 17  DA  H "O3'" 1 
ATOM 9905  C "C2'" . DA  L 2 17  ? 129.609 71.123  30.230  1.00 60.97  ? 17  DA  H "C2'" 1 
ATOM 9906  C "C1'" . DA  L 2 17  ? 129.868 72.092  31.375  1.00 58.11  ? 17  DA  H "C1'" 1 
ATOM 9907  N N9    . DA  L 2 17  ? 129.188 71.835  32.649  1.00 56.48  ? 17  DA  H N9    1 
ATOM 9908  C C8    . DA  L 2 17  ? 127.859 71.558  32.795  1.00 56.27  ? 17  DA  H C8    1 
ATOM 9909  N N7    . DA  L 2 17  ? 127.471 71.406  34.042  1.00 54.78  ? 17  DA  H N7    1 
ATOM 9910  C C5    . DA  L 2 17  ? 128.619 71.615  34.773  1.00 53.89  ? 17  DA  H C5    1 
ATOM 9911  C C6    . DA  L 2 17  ? 128.852 71.590  36.147  1.00 52.37  ? 17  DA  H C6    1 
ATOM 9912  N N6    . DA  L 2 17  ? 127.886 71.333  37.021  1.00 51.44  ? 17  DA  H N6    1 
ATOM 9913  N N1    . DA  L 2 17  ? 130.095 71.829  36.586  1.00 52.04  ? 17  DA  H N1    1 
ATOM 9914  C C2    . DA  L 2 17  ? 131.034 72.082  35.683  1.00 53.18  ? 17  DA  H C2    1 
ATOM 9915  N N3    . DA  L 2 17  ? 130.939 72.131  34.353  1.00 54.65  ? 17  DA  H N3    1 
ATOM 9916  C C4    . DA  L 2 17  ? 129.687 71.888  33.944  1.00 54.93  ? 17  DA  H C4    1 
ATOM 9917  P P     . DA  L 2 18  ? 131.928 71.005  27.917  1.00 65.61  ? 18  DA  H P     1 
ATOM 9918  O OP1   . DA  L 2 18  ? 133.042 71.600  27.144  1.00 66.64  ? 18  DA  H OP1   1 
ATOM 9919  O OP2   . DA  L 2 18  ? 130.992 70.095  27.197  1.00 67.53  ? 18  DA  H OP2   1 
ATOM 9920  O "O5'" . DA  L 2 18  ? 132.566 70.275  29.193  1.00 65.02  ? 18  DA  H "O5'" 1 
ATOM 9921  C "C5'" . DA  L 2 18  ? 133.409 71.030  30.031  1.00 63.29  ? 18  DA  H "C5'" 1 
ATOM 9922  C "C4'" . DA  L 2 18  ? 133.852 70.254  31.249  1.00 62.92  ? 18  DA  H "C4'" 1 
ATOM 9923  O "O4'" . DA  L 2 18  ? 132.818 70.290  32.254  1.00 60.86  ? 18  DA  H "O4'" 1 
ATOM 9924  C "C3'" . DA  L 2 18  ? 134.134 68.780  31.008  1.00 65.42  ? 18  DA  H "C3'" 1 
ATOM 9925  O "O3'" . DA  L 2 18  ? 135.435 68.483  31.499  1.00 66.07  ? 18  DA  H "O3'" 1 
ATOM 9926  C "C2'" . DA  L 2 18  ? 133.052 68.045  31.795  1.00 64.68  ? 18  DA  H "C2'" 1 
ATOM 9927  C "C1'" . DA  L 2 18  ? 132.797 69.029  32.922  1.00 61.69  ? 18  DA  H "C1'" 1 
ATOM 9928  N N9    . DA  L 2 18  ? 131.517 68.775  33.606  1.00 60.48  ? 18  DA  H N9    1 
ATOM 9929  C C8    . DA  L 2 18  ? 130.307 68.563  33.002  1.00 61.02  ? 18  DA  H C8    1 
ATOM 9930  N N7    . DA  L 2 18  ? 129.308 68.361  33.822  1.00 59.90  ? 18  DA  H N7    1 
ATOM 9931  C C5    . DA  L 2 18  ? 129.910 68.437  35.047  1.00 58.48  ? 18  DA  H C5    1 
ATOM 9932  C C6    . DA  L 2 18  ? 129.368 68.286  36.310  1.00 57.02  ? 18  DA  H C6    1 
ATOM 9933  N N6    . DA  L 2 18  ? 128.074 68.043  36.465  1.00 56.82  ? 18  DA  H N6    1 
ATOM 9934  N N1    . DA  L 2 18  ? 130.191 68.406  37.365  1.00 55.98  ? 18  DA  H N1    1 
ATOM 9935  C C2    . DA  L 2 18  ? 131.483 68.656  37.118  1.00 56.49  ? 18  DA  H C2    1 
ATOM 9936  N N3    . DA  L 2 18  ? 132.117 68.819  35.956  1.00 57.90  ? 18  DA  H N3    1 
ATOM 9937  C C4    . DA  L 2 18  ? 131.257 68.693  34.949  1.00 58.81  ? 18  DA  H C4    1 
ATOM 9938  P P     . DC  L 2 19  ? 136.207 67.149  31.028  1.00 69.09  ? 19  DC  H P     1 
ATOM 9939  O OP1   . DC  L 2 19  ? 137.626 67.558  30.870  1.00 69.95  ? 19  DC  H OP1   1 
ATOM 9940  O OP2   . DC  L 2 19  ? 135.460 66.529  29.897  1.00 70.95  ? 19  DC  H OP2   1 
ATOM 9941  O "O5'" . DC  L 2 19  ? 136.108 66.199  32.324  1.00 68.56  ? 19  DC  H "O5'" 1 
ATOM 9942  C "C5'" . DC  L 2 19  ? 136.642 66.762  33.513  1.00 66.72  ? 19  DC  H "C5'" 1 
ATOM 9943  C "C4'" . DC  L 2 19  ? 136.028 66.240  34.800  1.00 65.37  ? 19  DC  H "C4'" 1 
ATOM 9944  O "O4'" . DC  L 2 19  ? 134.613 66.493  34.884  1.00 63.89  ? 19  DC  H "O4'" 1 
ATOM 9945  C "C3'" . DC  L 2 19  ? 136.093 64.747  35.045  1.00 67.16  ? 19  DC  H "C3'" 1 
ATOM 9946  O "O3'" . DC  L 2 19  ? 137.387 64.446  35.510  1.00 68.08  ? 19  DC  H "O3'" 1 
ATOM 9947  C "C2'" . DC  L 2 19  ? 135.069 64.585  36.166  1.00 65.36  ? 19  DC  H "C2'" 1 
ATOM 9948  C "C1'" . DC  L 2 19  ? 134.170 65.804  36.033  1.00 63.21  ? 19  DC  H "C1'" 1 
ATOM 9949  N N1    . DC  L 2 19  ? 132.739 65.514  35.847  1.00 62.98  ? 19  DC  H N1    1 
ATOM 9950  C C2    . DC  L 2 19  ? 131.932 65.344  36.958  1.00 61.56  ? 19  DC  H C2    1 
ATOM 9951  O O2    . DC  L 2 19  ? 132.439 65.414  38.082  1.00 60.52  ? 19  DC  H O2    1 
ATOM 9952  N N3    . DC  L 2 19  ? 130.621 65.097  36.760  1.00 61.57  ? 19  DC  H N3    1 
ATOM 9953  C C4    . DC  L 2 19  ? 130.125 65.030  35.532  1.00 62.90  ? 19  DC  H C4    1 
ATOM 9954  N N4    . DC  L 2 19  ? 128.821 64.795  35.399  1.00 63.02  ? 19  DC  H N4    1 
ATOM 9955  C C5    . DC  L 2 19  ? 130.937 65.211  34.392  1.00 64.31  ? 19  DC  H C5    1 
ATOM 9956  C C6    . DC  L 2 19  ? 132.225 65.450  34.597  1.00 64.29  ? 19  DC  H C6    1 
ATOM 9957  P P     . DT  L 2 20  ? 137.882 62.923  35.624  1.00 70.44  ? 20  DT  H P     1 
ATOM 9958  O OP1   . DT  L 2 20  ? 139.323 63.077  35.931  1.00 71.21  ? 20  DT  H OP1   1 
ATOM 9959  O OP2   . DT  L 2 20  ? 137.367 62.119  34.482  1.00 72.44  ? 20  DT  H OP2   1 
ATOM 9960  O "O5'" . DT  L 2 20  ? 137.189 62.384  36.961  1.00 69.14  ? 20  DT  H "O5'" 1 
ATOM 9961  C "C5'" . DT  L 2 20  ? 137.564 62.996  38.170  1.00 67.37  ? 20  DT  H "C5'" 1 
ATOM 9962  C "C4'" . DT  L 2 20  ? 136.697 62.450  39.277  1.00 66.33  ? 20  DT  H "C4'" 1 
ATOM 9963  O "O4'" . DT  L 2 20  ? 135.302 62.732  39.015  1.00 65.14  ? 20  DT  H "O4'" 1 
ATOM 9964  C "C3'" . DT  L 2 20  ? 136.785 60.950  39.412  1.00 68.36  ? 20  DT  H "C3'" 1 
ATOM 9965  O "O3'" . DT  L 2 20  ? 136.871 60.696  40.775  1.00 67.55  ? 20  DT  H "O3'" 1 
ATOM 9966  C "C2'" . DT  L 2 20  ? 135.458 60.451  38.852  1.00 68.65  ? 20  DT  H "C2'" 1 
ATOM 9967  C "C1'" . DT  L 2 20  ? 134.527 61.582  39.255  1.00 66.03  ? 20  DT  H "C1'" 1 
ATOM 9968  N N1    . DT  L 2 20  ? 133.319 61.664  38.400  1.00 66.06  ? 20  DT  H N1    1 
ATOM 9969  C C2    . DT  L 2 20  ? 132.038 61.660  38.938  1.00 64.89  ? 20  DT  H C2    1 
ATOM 9970  O O2    . DT  L 2 20  ? 131.787 61.590  40.131  1.00 63.73  ? 20  DT  H O2    1 
ATOM 9971  N N3    . DT  L 2 20  ? 131.041 61.742  37.998  1.00 65.33  ? 20  DT  H N3    1 
ATOM 9972  C C4    . DT  L 2 20  ? 131.204 61.829  36.627  1.00 66.75  ? 20  DT  H C4    1 
ATOM 9973  O O4    . DT  L 2 20  ? 130.267 61.896  35.846  1.00 67.23  ? 20  DT  H O4    1 
ATOM 9974  C C5    . DT  L 2 20  ? 132.561 61.830  36.155  1.00 67.86  ? 20  DT  H C5    1 
ATOM 9975  C C7    . DT  L 2 20  ? 132.839 61.913  34.692  1.00 69.59  ? 20  DT  H C7    1 
ATOM 9976  C C6    . DT  L 2 20  ? 133.542 61.747  37.046  1.00 67.48  ? 20  DT  H C6    1 
ATOM 9977  P P     . DA  L 2 21  ? 137.775 59.485  41.317  1.00 69.51  ? 21  DA  H P     1 
ATOM 9978  O OP1   . DA  L 2 21  ? 138.653 60.182  42.299  1.00 68.52  ? 21  DA  H OP1   1 
ATOM 9979  O OP2   . DA  L 2 21  ? 138.317 58.677  40.189  1.00 72.07  ? 21  DA  H OP2   1 
ATOM 9980  O "O5'" . DA  L 2 21  ? 136.732 58.530  42.085  1.00 69.41  ? 21  DA  H "O5'" 1 
ATOM 9981  C "C5'" . DA  L 2 21  ? 135.803 59.062  42.983  1.00 67.27  ? 21  DA  H "C5'" 1 
ATOM 9982  C "C4'" . DA  L 2 21  ? 134.440 58.461  42.725  1.00 67.47  ? 21  DA  H "C4'" 1 
ATOM 9983  O "O4'" . DA  L 2 21  ? 133.938 58.819  41.420  1.00 67.73  ? 21  DA  H "O4'" 1 
ATOM 9984  C "C3'" . DA  L 2 21  ? 134.350 56.940  42.756  1.00 69.65  ? 21  DA  H "C3'" 1 
ATOM 9985  O "O3'" . DA  L 2 21  ? 133.813 56.521  44.020  1.00 69.03  ? 21  DA  H "O3'" 1 
ATOM 9986  C "C2'" . DA  L 2 21  ? 133.435 56.591  41.569  1.00 70.69  ? 21  DA  H "C2'" 1 
ATOM 9987  C "C1'" . DA  L 2 21  ? 132.833 57.955  41.252  1.00 68.62  ? 21  DA  H "C1'" 1 
ATOM 9988  N N9    . DA  L 2 21  ? 132.159 58.154  39.957  1.00 69.21  ? 21  DA  H N9    1 
ATOM 9989  C C8    . DA  L 2 21  ? 132.719 58.380  38.731  1.00 70.31  ? 21  DA  H C8    1 
ATOM 9990  N N7    . DA  L 2 21  ? 131.842 58.543  37.773  1.00 70.70  ? 21  DA  H N7    1 
ATOM 9991  C C5    . DA  L 2 21  ? 130.620 58.427  38.402  1.00 69.80  ? 21  DA  H C5    1 
ATOM 9992  C C6    . DA  L 2 21  ? 129.294 58.508  37.939  1.00 69.82  ? 21  DA  H C6    1 
ATOM 9993  N N6    . DA  L 2 21  ? 128.973 58.726  36.668  1.00 70.82  ? 21  DA  H N6    1 
ATOM 9994  N N1    . DA  L 2 21  ? 128.298 58.348  38.833  1.00 68.95  ? 21  DA  H N1    1 
ATOM 9995  C C2    . DA  L 2 21  ? 128.612 58.125  40.111  1.00 68.08  ? 21  DA  H C2    1 
ATOM 9996  N N3    . DA  L 2 21  ? 129.816 58.038  40.671  1.00 67.94  ? 21  DA  H N3    1 
ATOM 9997  C C4    . DA  L 2 21  ? 130.791 58.192  39.752  1.00 68.86  ? 21  DA  H C4    1 
ATOM 9998  P P     . DA  L 2 22  ? 133.829 54.970  44.435  1.00 71.10  ? 22  DA  H P     1 
ATOM 9999  O OP1   . DA  L 2 22  ? 133.978 54.918  45.899  1.00 70.26  ? 22  DA  H OP1   1 
ATOM 10000 O OP2   . DA  L 2 22  ? 134.783 54.248  43.558  1.00 73.34  ? 22  DA  H OP2   1 
ATOM 10001 O "O5'" . DA  L 2 22  ? 132.376 54.461  44.073  1.00 71.50  ? 22  DA  H "O5'" 1 
ATOM 10002 C "C5'" . DA  L 2 22  ? 131.348 55.302  44.445  1.00 69.54  ? 22  DA  H "C5'" 1 
ATOM 10003 C "C4'" . DA  L 2 22  ? 130.089 54.840  43.772  1.00 70.41  ? 22  DA  H "C4'" 1 
ATOM 10004 O "O4'" . DA  L 2 22  ? 130.227 55.183  42.394  1.00 71.01  ? 22  DA  H "O4'" 1 
ATOM 10005 C "C3'" . DA  L 2 22  ? 129.872 53.343  43.739  1.00 72.78  ? 22  DA  H "C3'" 1 
ATOM 10006 O "O3'" . DA  L 2 22  ? 128.700 53.081  44.475  1.00 72.44  ? 22  DA  H "O3'" 1 
ATOM 10007 C "C2'" . DA  L 2 22  ? 129.694 53.028  42.253  1.00 74.47  ? 22  DA  H "C2'" 1 
ATOM 10008 C "C1'" . DA  L 2 22  ? 129.345 54.387  41.676  1.00 72.71  ? 22  DA  H "C1'" 1 
ATOM 10009 N N9    . DA  L 2 22  ? 129.663 54.636  40.276  1.00 73.66  ? 22  DA  H N9    1 
ATOM 10010 C C8    . DA  L 2 22  ? 130.907 54.704  39.730  1.00 74.37  ? 22  DA  H C8    1 
ATOM 10011 N N7    . DA  L 2 22  ? 130.885 54.961  38.447  1.00 75.25  ? 22  DA  H N7    1 
ATOM 10012 C C5    . DA  L 2 22  ? 129.540 55.084  38.138  1.00 75.08  ? 22  DA  H C5    1 
ATOM 10013 C C6    . DA  L 2 22  ? 128.844 55.352  36.940  1.00 75.84  ? 22  DA  H C6    1 
ATOM 10014 N N6    . DA  L 2 22  ? 129.452 55.541  35.761  1.00 76.99  ? 22  DA  H N6    1 
ATOM 10015 N N1    . DA  L 2 22  ? 127.497 55.419  36.987  1.00 75.54  ? 22  DA  H N1    1 
ATOM 10016 C C2    . DA  L 2 22  ? 126.886 55.227  38.151  1.00 74.55  ? 22  DA  H C2    1 
ATOM 10017 N N3    . DA  L 2 22  ? 127.435 54.964  39.329  1.00 73.77  ? 22  DA  H N3    1 
ATOM 10018 C C4    . DA  L 2 22  ? 128.773 54.901  39.259  1.00 74.08  ? 22  DA  H C4    1 
ATOM 10019 P P     . DA  L 2 23  ? 128.354 51.584  44.912  1.00 74.54  ? 23  DA  H P     1 
ATOM 10020 O OP1   . DA  L 2 23  ? 128.164 51.529  46.376  1.00 73.59  ? 23  DA  H OP1   1 
ATOM 10021 O OP2   . DA  L 2 23  ? 129.404 50.755  44.277  1.00 76.51  ? 23  DA  H OP2   1 
ATOM 10022 O "O5'" . DA  L 2 23  ? 126.981 51.278  44.153  1.00 75.54  ? 23  DA  H "O5'" 1 
ATOM 10023 C "C5'" . DA  L 2 23  ? 125.886 52.121  44.385  1.00 73.96  ? 23  DA  H "C5'" 1 
ATOM 10024 C "C4'" . DA  L 2 23  ? 124.885 52.119  43.243  1.00 74.94  ? 23  DA  H "C4'" 1 
ATOM 10025 O "O4'" . DA  L 2 23  ? 125.483 52.643  42.027  1.00 75.06  ? 23  DA  H "O4'" 1 
ATOM 10026 C "C3'" . DA  L 2 23  ? 124.298 50.762  42.892  1.00 77.62  ? 23  DA  H "C3'" 1 
ATOM 10027 O "O3'" . DA  L 2 23  ? 122.887 50.856  42.833  1.00 77.77  ? 23  DA  H "O3'" 1 
ATOM 10028 C "C2'" . DA  L 2 23  ? 124.865 50.448  41.516  1.00 79.30  ? 23  DA  H "C2'" 1 
ATOM 10029 C "C1'" . DA  L 2 23  ? 125.133 51.822  40.922  1.00 77.48  ? 23  DA  H "C1'" 1 
ATOM 10030 N N9    . DA  L 2 23  ? 126.255 51.821  39.983  1.00 78.31  ? 23  DA  H N9    1 
ATOM 10031 C C8    . DA  L 2 23  ? 127.553 51.615  40.339  1.00 78.31  ? 23  DA  H C8    1 
ATOM 10032 N N7    . DA  L 2 23  ? 128.410 51.666  39.356  1.00 79.24  ? 23  DA  H N7    1 
ATOM 10033 C C5    . DA  L 2 23  ? 127.619 51.916  38.258  1.00 79.92  ? 23  DA  H C5    1 
ATOM 10034 C C6    . DA  L 2 23  ? 127.969 52.073  36.909  1.00 81.15  ? 23  DA  H C6    1 
ATOM 10035 N N6    . DA  L 2 23  ? 129.235 51.992  36.481  1.00 81.89  ? 23  DA  H N6    1 
ATOM 10036 N N1    . DA  L 2 23  ? 126.958 52.318  36.051  1.00 81.71  ? 23  DA  H N1    1 
ATOM 10037 C C2    . DA  L 2 23  ? 125.705 52.395  36.536  1.00 81.06  ? 23  DA  H C2    1 
ATOM 10038 N N3    . DA  L 2 23  ? 125.254 52.265  37.789  1.00 79.91  ? 23  DA  H N3    1 
ATOM 10039 C C4    . DA  L 2 23  ? 126.281 52.017  38.615  1.00 79.37  ? 23  DA  H C4    1 
ATOM 10040 P P     . DT  L 2 24  ? 121.998 49.516  42.764  1.00 80.38  ? 24  DT  H P     1 
ATOM 10041 O OP1   . DT  L 2 24  ? 121.122 49.487  43.964  1.00 79.69  ? 24  DT  H OP1   1 
ATOM 10042 O OP2   . DT  L 2 24  ? 122.901 48.354  42.505  1.00 82.41  ? 24  DT  H OP2   1 
ATOM 10043 O "O5'" . DT  L 2 24  ? 121.042 49.794  41.511  1.00 81.31  ? 24  DT  H "O5'" 1 
ATOM 10044 C "C5'" . DT  L 2 24  ? 121.559 50.406  40.332  1.00 81.20  ? 24  DT  H "C5'" 1 
ATOM 10045 C "C4'" . DT  L 2 24  ? 120.723 50.061  39.110  1.00 83.32  ? 24  DT  H "C4'" 1 
ATOM 10046 O "O4'" . DT  L 2 24  ? 121.561 50.059  37.925  1.00 84.31  ? 24  DT  H "O4'" 1 
ATOM 10047 C "C3'" . DT  L 2 24  ? 120.196 48.649  39.103  1.00 86.02  ? 24  DT  H "C3'" 1 
ATOM 10048 O "O3'" . DT  L 2 24  ? 119.292 48.561  38.027  1.00 87.70  ? 24  DT  H "O3'" 1 
ATOM 10049 C "C2'" . DT  L 2 24  ? 121.507 47.912  38.849  1.00 87.13  ? 24  DT  H "C2'" 1 
ATOM 10050 C "C1'" . DT  L 2 24  ? 122.083 48.761  37.719  1.00 86.66  ? 24  DT  H "C1'" 1 
ATOM 10051 N N1    . DT  L 2 24  ? 123.588 48.785  37.583  1.00 86.39  ? 24  DT  H N1    1 
ATOM 10052 C C2    . DT  L 2 24  ? 124.076 49.127  36.363  1.00 87.08  ? 24  DT  H C2    1 
ATOM 10053 O O2    . DT  L 2 24  ? 123.332 49.406  35.450  1.00 87.83  ? 24  DT  H O2    1 
ATOM 10054 N N3    . DT  L 2 24  ? 125.439 49.134  36.246  1.00 86.99  ? 24  DT  H N3    1 
ATOM 10055 C C4    . DT  L 2 24  ? 126.364 48.834  37.214  1.00 86.31  ? 24  DT  H C4    1 
ATOM 10056 O O4    . DT  L 2 24  ? 127.578 48.857  37.039  1.00 86.42  ? 24  DT  H O4    1 
ATOM 10057 C C5    . DT  L 2 24  ? 125.797 48.486  38.473  1.00 85.59  ? 24  DT  H C5    1 
ATOM 10058 C C7    . DT  L 2 24  ? 126.752 48.153  39.576  1.00 84.95  ? 24  DT  H C7    1 
ATOM 10059 C C6    . DT  L 2 24  ? 124.457 48.472  38.606  1.00 85.65  ? 24  DT  H C6    1 
ATOM 10060 O "O5'" . DA  M 2 1   ? 63.306  11.910  48.734  1.00 84.06  ? 1   DA  K "O5'" 1 
ATOM 10061 C "C5'" . DA  M 2 1   ? 64.153  12.337  49.816  1.00 83.24  ? 1   DA  K "C5'" 1 
ATOM 10062 C "C4'" . DA  M 2 1   ? 65.609  12.471  49.390  1.00 81.21  ? 1   DA  K "C4'" 1 
ATOM 10063 O "O4'" . DA  M 2 1   ? 65.858  11.473  48.359  1.00 80.99  ? 1   DA  K "O4'" 1 
ATOM 10064 C "C3'" . DA  M 2 1   ? 65.986  13.836  48.815  1.00 79.88  ? 1   DA  K "C3'" 1 
ATOM 10065 O "O3'" . DA  M 2 1   ? 66.782  14.620  49.759  1.00 78.96  ? 1   DA  K "O3'" 1 
ATOM 10066 C "C2'" . DA  M 2 1   ? 66.721  13.492  47.524  1.00 78.66  ? 1   DA  K "C2'" 1 
ATOM 10067 C "C1'" . DA  M 2 1   ? 66.478  12.022  47.213  1.00 79.52  ? 1   DA  K "C1'" 1 
ATOM 10068 N N9    . DA  M 2 1   ? 65.669  11.885  45.989  1.00 80.11  ? 1   DA  K N9    1 
ATOM 10069 C C8    . DA  M 2 1   ? 64.302  11.815  45.869  1.00 81.77  ? 1   DA  K C8    1 
ATOM 10070 N N7    . DA  M 2 1   ? 63.875  11.728  44.628  1.00 81.90  ? 1   DA  K N7    1 
ATOM 10071 C C5    . DA  M 2 1   ? 65.040  11.748  43.885  1.00 80.21  ? 1   DA  K C5    1 
ATOM 10072 C C6    . DA  M 2 1   ? 65.264  11.682  42.504  1.00 79.54  ? 1   DA  K C6    1 
ATOM 10073 N N6    . DA  M 2 1   ? 64.274  11.578  41.604  1.00 80.53  ? 1   DA  K N6    1 
ATOM 10074 N N1    . DA  M 2 1   ? 66.549  11.719  42.099  1.00 77.86  ? 1   DA  K N1    1 
ATOM 10075 C C2    . DA  M 2 1   ? 67.523  11.820  43.011  1.00 76.94  ? 1   DA  K C2    1 
ATOM 10076 N N3    . DA  M 2 1   ? 67.437  11.894  44.327  1.00 77.43  ? 1   DA  K N3    1 
ATOM 10077 C C4    . DA  M 2 1   ? 66.153  11.850  44.700  1.00 79.09  ? 1   DA  K C4    1 
ATOM 10078 P P     . DT  M 2 2   ? 68.171  15.333  49.322  1.00 83.65  ? 2   DT  K P     1 
ATOM 10079 O OP1   . DT  M 2 2   ? 68.747  15.947  50.540  1.00 83.23  ? 2   DT  K OP1   1 
ATOM 10080 O OP2   . DT  M 2 2   ? 67.963  16.208  48.139  1.00 83.11  ? 2   DT  K OP2   1 
ATOM 10081 O "O5'" . DT  M 2 2   ? 69.120  14.101  48.915  1.00 82.92  ? 2   DT  K "O5'" 1 
ATOM 10082 C "C5'" . DT  M 2 2   ? 70.448  14.257  48.430  1.00 81.17  ? 2   DT  K "C5'" 1 
ATOM 10083 C "C4'" . DT  M 2 2   ? 70.540  14.684  46.975  1.00 80.35  ? 2   DT  K "C4'" 1 
ATOM 10084 O "O4'" . DT  M 2 2   ? 69.349  14.412  46.198  1.00 81.52  ? 2   DT  K "O4'" 1 
ATOM 10085 C "C3'" . DT  M 2 2   ? 70.770  16.174  46.808  1.00 79.46  ? 2   DT  K "C3'" 1 
ATOM 10086 O "O3'" . DT  M 2 2   ? 72.100  16.342  46.401  1.00 77.81  ? 2   DT  K "O3'" 1 
ATOM 10087 C "C2'" . DT  M 2 2   ? 69.799  16.613  45.708  1.00 80.02  ? 2   DT  K "C2'" 1 
ATOM 10088 C "C1'" . DT  M 2 2   ? 69.418  15.280  45.077  1.00 80.73  ? 2   DT  K "C1'" 1 
ATOM 10089 N N1    . DT  M 2 2   ? 68.123  15.251  44.294  1.00 81.98  ? 2   DT  K N1    1 
ATOM 10090 C C2    . DT  M 2 2   ? 68.157  15.127  42.925  1.00 81.58  ? 2   DT  K C2    1 
ATOM 10091 O O2    . DT  M 2 2   ? 69.198  15.042  42.302  1.00 80.24  ? 2   DT  K O2    1 
ATOM 10092 N N3    . DT  M 2 2   ? 66.918  15.102  42.325  1.00 82.87  ? 2   DT  K N3    1 
ATOM 10093 C C4    . DT  M 2 2   ? 65.676  15.182  42.938  1.00 84.50  ? 2   DT  K C4    1 
ATOM 10094 O O4    . DT  M 2 2   ? 64.617  15.149  42.321  1.00 85.63  ? 2   DT  K O4    1 
ATOM 10095 C C5    . DT  M 2 2   ? 65.711  15.308  44.369  1.00 84.83  ? 2   DT  K C5    1 
ATOM 10096 C C7    . DT  M 2 2   ? 64.440  15.403  45.161  1.00 86.61  ? 2   DT  K C7    1 
ATOM 10097 C C6    . DT  M 2 2   ? 66.913  15.341  44.953  1.00 83.57  ? 2   DT  K C6    1 
ATOM 10098 P P     . DT  M 2 3   ? 72.735  17.813  46.374  1.00 87.25  ? 3   DT  K P     1 
ATOM 10099 O OP1   . DT  M 2 3   ? 73.841  17.795  47.359  1.00 86.46  ? 3   DT  K OP1   1 
ATOM 10100 O OP2   . DT  M 2 3   ? 71.634  18.803  46.508  1.00 87.91  ? 3   DT  K OP2   1 
ATOM 10101 O "O5'" . DT  M 2 3   ? 73.339  17.934  44.902  1.00 85.89  ? 3   DT  K "O5'" 1 
ATOM 10102 C "C5'" . DT  M 2 3   ? 73.517  16.756  44.122  1.00 85.78  ? 3   DT  K "C5'" 1 
ATOM 10103 C "C4'" . DT  M 2 3   ? 73.235  17.066  42.660  1.00 85.58  ? 3   DT  K "C4'" 1 
ATOM 10104 O "O4'" . DT  M 2 3   ? 71.825  16.880  42.357  1.00 87.06  ? 3   DT  K "O4'" 1 
ATOM 10105 C "C3'" . DT  M 2 3   ? 73.527  18.495  42.236  1.00 84.76  ? 3   DT  K "C3'" 1 
ATOM 10106 O "O3'" . DT  M 2 3   ? 73.887  18.443  40.890  1.00 84.08  ? 3   DT  K "O3'" 1 
ATOM 10107 C "C2'" . DT  M 2 3   ? 72.151  19.143  42.342  1.00 86.10  ? 3   DT  K "C2'" 1 
ATOM 10108 C "C1'" . DT  M 2 3   ? 71.368  18.029  41.669  1.00 87.05  ? 3   DT  K "C1'" 1 
ATOM 10109 N N1    . DT  M 2 3   ? 69.870  18.122  41.725  1.00 88.71  ? 3   DT  K N1    1 
ATOM 10110 C C2    . DT  M 2 3   ? 69.166  17.852  40.572  1.00 89.30  ? 3   DT  K C2    1 
ATOM 10111 O O2    . DT  M 2 3   ? 69.709  17.545  39.520  1.00 88.58  ? 3   DT  K O2    1 
ATOM 10112 N N3    . DT  M 2 3   ? 67.800  17.949  40.692  1.00 90.88  ? 3   DT  K N3    1 
ATOM 10113 C C4    . DT  M 2 3   ? 67.082  18.287  41.820  1.00 92.00  ? 3   DT  K C4    1 
ATOM 10114 O O4    . DT  M 2 3   ? 65.858  18.356  41.844  1.00 93.52  ? 3   DT  K O4    1 
ATOM 10115 C C5    . DT  M 2 3   ? 67.875  18.555  42.983  1.00 91.22  ? 3   DT  K C5    1 
ATOM 10116 C C7    . DT  M 2 3   ? 67.170  18.924  44.252  1.00 92.29  ? 3   DT  K C7    1 
ATOM 10117 C C6    . DT  M 2 3   ? 69.213  18.463  42.889  1.00 89.66  ? 3   DT  K C6    1 
ATOM 10118 P P     . DT  M 2 4   ? 75.178  19.240  40.355  1.00 75.52  ? 4   DT  K P     1 
ATOM 10119 O OP1   . DT  M 2 4   ? 76.320  18.416  40.821  1.00 74.56  ? 4   DT  K OP1   1 
ATOM 10120 O OP2   . DT  M 2 4   ? 75.101  20.687  40.723  1.00 75.35  ? 4   DT  K OP2   1 
ATOM 10121 O "O5'" . DT  M 2 4   ? 75.052  19.105  38.762  1.00 75.25  ? 4   DT  K "O5'" 1 
ATOM 10122 C "C5'" . DT  M 2 4   ? 73.906  18.412  38.293  1.00 76.50  ? 4   DT  K "C5'" 1 
ATOM 10123 C "C4'" . DT  M 2 4   ? 73.340  18.950  36.991  1.00 76.75  ? 4   DT  K "C4'" 1 
ATOM 10124 O "O4'" . DT  M 2 4   ? 71.897  19.056  37.123  1.00 78.29  ? 4   DT  K "O4'" 1 
ATOM 10125 C "C3'" . DT  M 2 4   ? 73.760  20.341  36.570  1.00 76.01  ? 4   DT  K "C3'" 1 
ATOM 10126 O "O3'" . DT  M 2 4   ? 73.404  20.447  35.230  1.00 76.19  ? 4   DT  K "O3'" 1 
ATOM 10127 C "C2'" . DT  M 2 4   ? 72.795  21.185  37.388  1.00 77.02  ? 4   DT  K "C2'" 1 
ATOM 10128 C "C1'" . DT  M 2 4   ? 71.526  20.415  37.056  1.00 78.45  ? 4   DT  K "C1'" 1 
ATOM 10129 N N1    . DT  M 2 4   ? 70.399  20.654  37.983  1.00 79.80  ? 4   DT  K N1    1 
ATOM 10130 C C2    . DT  M 2 4   ? 69.129  20.434  37.517  1.00 81.20  ? 4   DT  K C2    1 
ATOM 10131 O O2    . DT  M 2 4   ? 68.911  20.042  36.385  1.00 81.34  ? 4   DT  K O2    1 
ATOM 10132 N N3    . DT  M 2 4   ? 68.128  20.683  38.417  1.00 82.46  ? 4   DT  K N3    1 
ATOM 10133 C C4    . DT  M 2 4   ? 68.285  21.124  39.717  1.00 82.45  ? 4   DT  K C4    1 
ATOM 10134 O O4    . DT  M 2 4   ? 67.331  21.326  40.463  1.00 83.76  ? 4   DT  K O4    1 
ATOM 10135 C C5    . DT  M 2 4   ? 69.648  21.336  40.140  1.00 80.93  ? 4   DT  K C5    1 
ATOM 10136 C C7    . DT  M 2 4   ? 69.928  21.818  41.533  1.00 80.83  ? 4   DT  K C7    1 
ATOM 10137 C C6    . DT  M 2 4   ? 70.633  21.096  39.265  1.00 79.70  ? 4   DT  K C6    1 
ATOM 10138 P P     . DA  M 2 5   ? 74.491  20.856  34.121  1.00 64.82  ? 5   DA  K P     1 
ATOM 10139 O OP1   . DA  M 2 5   ? 74.998  19.571  33.574  1.00 64.43  ? 5   DA  K OP1   1 
ATOM 10140 O OP2   . DA  M 2 5   ? 75.434  21.857  34.683  1.00 63.81  ? 5   DA  K OP2   1 
ATOM 10141 O "O5'" . DA  M 2 5   ? 73.615  21.600  32.997  1.00 65.57  ? 5   DA  K "O5'" 1 
ATOM 10142 C "C5'" . DA  M 2 5   ? 72.596  20.839  32.348  1.00 66.67  ? 5   DA  K "C5'" 1 
ATOM 10143 C "C4'" . DA  M 2 5   ? 71.402  21.684  31.955  1.00 67.87  ? 5   DA  K "C4'" 1 
ATOM 10144 O "O4'" . DA  M 2 5   ? 70.508  21.806  33.078  1.00 68.92  ? 5   DA  K "O4'" 1 
ATOM 10145 C "C3'" . DA  M 2 5   ? 71.754  23.102  31.545  1.00 67.40  ? 5   DA  K "C3'" 1 
ATOM 10146 O "O3'" . DA  M 2 5   ? 71.360  23.344  30.194  1.00 67.80  ? 5   DA  K "O3'" 1 
ATOM 10147 C "C2'" . DA  M 2 5   ? 71.010  23.983  32.555  1.00 68.25  ? 5   DA  K "C2'" 1 
ATOM 10148 C "C1'" . DA  M 2 5   ? 69.897  23.065  33.033  1.00 69.54  ? 5   DA  K "C1'" 1 
ATOM 10149 N N9    . DA  M 2 5   ? 69.391  23.306  34.376  1.00 70.20  ? 5   DA  K N9    1 
ATOM 10150 C C8    . DA  M 2 5   ? 70.121  23.390  35.524  1.00 69.47  ? 5   DA  K C8    1 
ATOM 10151 N N7    . DA  M 2 5   ? 69.410  23.595  36.607  1.00 70.39  ? 5   DA  K N7    1 
ATOM 10152 C C5    . DA  M 2 5   ? 68.118  23.638  36.130  1.00 71.83  ? 5   DA  K C5    1 
ATOM 10153 C C6    . DA  M 2 5   ? 66.895  23.824  36.783  1.00 73.35  ? 5   DA  K C6    1 
ATOM 10154 N N6    . DA  M 2 5   ? 66.817  24.010  38.101  1.00 73.61  ? 5   DA  K N6    1 
ATOM 10155 N N1    . DA  M 2 5   ? 65.773  23.816  36.028  1.00 74.62  ? 5   DA  K N1    1 
ATOM 10156 C C2    . DA  M 2 5   ? 65.882  23.643  34.704  1.00 74.36  ? 5   DA  K C2    1 
ATOM 10157 N N3    . DA  M 2 5   ? 66.984  23.451  33.979  1.00 72.98  ? 5   DA  K N3    1 
ATOM 10158 C C4    . DA  M 2 5   ? 68.079  23.461  34.760  1.00 71.75  ? 5   DA  K C4    1 
ATOM 10159 P P     . DG  M 2 6   ? 71.631  24.783  29.541  1.00 67.54  ? 6   DG  K P     1 
ATOM 10160 O OP1   . DG  M 2 6   ? 71.868  24.644  28.090  1.00 67.31  ? 6   DG  K OP1   1 
ATOM 10161 O OP2   . DG  M 2 6   ? 72.642  25.450  30.390  1.00 66.48  ? 6   DG  K OP2   1 
ATOM 10162 O "O5'" . DG  M 2 6   ? 70.265  25.563  29.756  1.00 69.11  ? 6   DG  K "O5'" 1 
ATOM 10163 C "C5'" . DG  M 2 6   ? 69.101  25.201  29.063  1.00 70.42  ? 6   DG  K "C5'" 1 
ATOM 10164 C "C4'" . DG  M 2 6   ? 67.948  25.879  29.766  1.00 71.80  ? 6   DG  K "C4'" 1 
ATOM 10165 O "O4'" . DG  M 2 6   ? 68.114  25.673  31.185  1.00 71.59  ? 6   DG  K "O4'" 1 
ATOM 10166 C "C3'" . DG  M 2 6   ? 67.879  27.396  29.610  1.00 72.07  ? 6   DG  K "C3'" 1 
ATOM 10167 O "O3'" . DG  M 2 6   ? 66.783  27.721  28.795  1.00 73.46  ? 6   DG  K "O3'" 1 
ATOM 10168 C "C2'" . DG  M 2 6   ? 67.649  27.936  31.019  1.00 72.40  ? 6   DG  K "C2'" 1 
ATOM 10169 C "C1'" . DG  M 2 6   ? 67.334  26.668  31.799  1.00 72.61  ? 6   DG  K "C1'" 1 
ATOM 10170 N N9    . DG  M 2 6   ? 67.635  26.784  33.221  1.00 72.30  ? 6   DG  K N9    1 
ATOM 10171 C C8    . DG  M 2 6   ? 68.858  26.809  33.843  1.00 70.89  ? 6   DG  K C8    1 
ATOM 10172 N N7    . DG  M 2 6   ? 68.778  26.943  35.140  1.00 71.07  ? 6   DG  K N7    1 
ATOM 10173 C C5    . DG  M 2 6   ? 67.418  27.012  35.383  1.00 72.70  ? 6   DG  K C5    1 
ATOM 10174 C C6    . DG  M 2 6   ? 66.731  27.158  36.594  1.00 73.64  ? 6   DG  K C6    1 
ATOM 10175 O O6    . DG  M 2 6   ? 67.212  27.253  37.726  1.00 73.19  ? 6   DG  K O6    1 
ATOM 10176 N N1    . DG  M 2 6   ? 65.357  27.184  36.391  1.00 75.30  ? 6   DG  K N1    1 
ATOM 10177 C C2    . DG  M 2 6   ? 64.729  27.076  35.173  1.00 75.98  ? 6   DG  K C2    1 
ATOM 10178 N N2    . DG  M 2 6   ? 63.391  27.118  35.168  1.00 77.67  ? 6   DG  K N2    1 
ATOM 10179 N N3    . DG  M 2 6   ? 65.365  26.938  34.028  1.00 75.10  ? 6   DG  K N3    1 
ATOM 10180 C C4    . DG  M 2 6   ? 66.702  26.914  34.218  1.00 73.48  ? 6   DG  K C4    1 
ATOM 10181 P P     . DT  M 2 7   ? 66.564  29.231  28.305  1.00 74.04  ? 7   DT  K P     1 
ATOM 10182 O OP1   . DT  M 2 7   ? 66.053  29.208  26.912  1.00 74.76  ? 7   DT  K OP1   1 
ATOM 10183 O OP2   . DT  M 2 7   ? 67.796  29.978  28.640  1.00 72.71  ? 7   DT  K OP2   1 
ATOM 10184 O "O5'" . DT  M 2 7   ? 65.414  29.777  29.260  1.00 75.52  ? 7   DT  K "O5'" 1 
ATOM 10185 C "C5'" . DT  M 2 7   ? 64.168  29.125  29.213  1.00 76.93  ? 7   DT  K "C5'" 1 
ATOM 10186 C "C4'" . DT  M 2 7   ? 63.236  29.638  30.291  1.00 78.19  ? 7   DT  K "C4'" 1 
ATOM 10187 O "O4'" . DT  M 2 7   ? 63.779  29.349  31.603  1.00 77.41  ? 7   DT  K "O4'" 1 
ATOM 10188 C "C3'" . DT  M 2 7   ? 62.978  31.129  30.238  1.00 78.90  ? 7   DT  K "C3'" 1 
ATOM 10189 O "O3'" . DT  M 2 7   ? 61.599  31.309  30.058  1.00 80.77  ? 7   DT  K "O3'" 1 
ATOM 10190 C "C2'" . DT  M 2 7   ? 63.444  31.641  31.594  1.00 78.40  ? 7   DT  K "C2'" 1 
ATOM 10191 C "C1'" . DT  M 2 7   ? 63.446  30.401  32.472  1.00 78.07  ? 7   DT  K "C1'" 1 
ATOM 10192 N N1    . DT  M 2 7   ? 64.465  30.440  33.557  1.00 76.79  ? 7   DT  K N1    1 
ATOM 10193 C C2    . DT  M 2 7   ? 64.049  30.473  34.861  1.00 77.37  ? 7   DT  K C2    1 
ATOM 10194 O O2    . DT  M 2 7   ? 62.884  30.471  35.194  1.00 78.88  ? 7   DT  K O2    1 
ATOM 10195 N N3    . DT  M 2 7   ? 65.054  30.505  35.776  1.00 76.15  ? 7   DT  K N3    1 
ATOM 10196 C C4    . DT  M 2 7   ? 66.403  30.508  35.522  1.00 74.47  ? 7   DT  K C4    1 
ATOM 10197 O O4    . DT  M 2 7   ? 67.232  30.539  36.420  1.00 73.53  ? 7   DT  K O4    1 
ATOM 10198 C C5    . DT  M 2 7   ? 66.773  30.477  34.142  1.00 73.96  ? 7   DT  K C5    1 
ATOM 10199 C C7    . DT  M 2 7   ? 68.218  30.485  33.769  1.00 72.22  ? 7   DT  K C7    1 
ATOM 10200 C C6    . DT  M 2 7   ? 65.802  30.439  33.235  1.00 75.12  ? 7   DT  K C6    1 
ATOM 10201 P P     . DT  M 2 8   ? 60.996  32.777  29.801  1.00 83.23  ? 8   DT  K P     1 
ATOM 10202 O OP1   . DT  M 2 8   ? 59.705  32.552  29.117  1.00 84.94  ? 8   DT  K OP1   1 
ATOM 10203 O OP2   . DT  M 2 8   ? 62.024  33.679  29.212  1.00 82.22  ? 8   DT  K OP2   1 
ATOM 10204 O "O5'" . DT  M 2 8   ? 60.693  33.321  31.266  1.00 83.75  ? 8   DT  K "O5'" 1 
ATOM 10205 C "C5'" . DT  M 2 8   ? 59.892  32.557  32.134  1.00 84.56  ? 8   DT  K "C5'" 1 
ATOM 10206 C "C4'" . DT  M 2 8   ? 59.748  33.319  33.431  1.00 84.99  ? 8   DT  K "C4'" 1 
ATOM 10207 O "O4'" . DT  M 2 8   ? 60.885  33.041  34.291  1.00 83.36  ? 8   DT  K "O4'" 1 
ATOM 10208 C "C3'" . DT  M 2 8   ? 59.679  34.833  33.258  1.00 85.64  ? 8   DT  K "C3'" 1 
ATOM 10209 O "O3'" . DT  M 2 8   ? 58.650  35.318  34.092  1.00 87.25  ? 8   DT  K "O3'" 1 
ATOM 10210 C "C2'" . DT  M 2 8   ? 61.064  35.298  33.709  1.00 83.93  ? 8   DT  K "C2'" 1 
ATOM 10211 C "C1'" . DT  M 2 8   ? 61.399  34.267  34.785  1.00 83.10  ? 8   DT  K "C1'" 1 
ATOM 10212 N N1    . DT  M 2 8   ? 62.865  34.084  35.116  1.00 81.10  ? 8   DT  K N1    1 
ATOM 10213 C C2    . DT  M 2 8   ? 63.261  33.973  36.434  1.00 80.60  ? 8   DT  K C2    1 
ATOM 10214 O O2    . DT  M 2 8   ? 62.490  34.030  37.373  1.00 81.67  ? 8   DT  K O2    1 
ATOM 10215 N N3    . DT  M 2 8   ? 64.610  33.798  36.623  1.00 78.82  ? 8   DT  K N3    1 
ATOM 10216 C C4    . DT  M 2 8   ? 65.594  33.727  35.655  1.00 77.52  ? 8   DT  K C4    1 
ATOM 10217 O O4    . DT  M 2 8   ? 66.782  33.570  35.929  1.00 76.02  ? 8   DT  K O4    1 
ATOM 10218 C C5    . DT  M 2 8   ? 65.111  33.849  34.303  1.00 78.14  ? 8   DT  K C5    1 
ATOM 10219 C C7    . DT  M 2 8   ? 66.067  33.791  33.152  1.00 76.93  ? 8   DT  K C7    1 
ATOM 10220 C C6    . DT  M 2 8   ? 63.796  34.018  34.103  1.00 79.86  ? 8   DT  K C6    1 
ATOM 10221 P P     . DA  M 2 9   ? 58.095  36.815  33.920  1.00 92.48  ? 9   DA  K P     1 
ATOM 10222 O OP1   . DA  M 2 9   ? 56.632  36.713  33.709  1.00 94.52  ? 9   DA  K OP1   1 
ATOM 10223 O OP2   . DA  M 2 9   ? 58.934  37.540  32.933  1.00 91.67  ? 9   DA  K OP2   1 
ATOM 10224 O "O5'" . DA  M 2 9   ? 58.379  37.489  35.344  1.00 92.38  ? 9   DA  K "O5'" 1 
ATOM 10225 C "C5'" . DA  M 2 9   ? 58.047  36.800  36.539  1.00 92.56  ? 9   DA  K "C5'" 1 
ATOM 10226 C "C4'" . DA  M 2 9   ? 58.829  37.390  37.697  1.00 91.76  ? 9   DA  K "C4'" 1 
ATOM 10227 O "O4'" . DA  M 2 9   ? 60.192  36.887  37.656  1.00 89.65  ? 9   DA  K "O4'" 1 
ATOM 10228 C "C3'" . DA  M 2 9   ? 58.929  38.912  37.687  1.00 92.34  ? 9   DA  K "C3'" 1 
ATOM 10229 O "O3'" . DA  M 2 9   ? 58.661  39.424  38.985  1.00 93.03  ? 9   DA  K "O3'" 1 
ATOM 10230 C "C2'" . DA  M 2 9   ? 60.379  39.166  37.283  1.00 90.45  ? 9   DA  K "C2'" 1 
ATOM 10231 C "C1'" . DA  M 2 9   ? 61.073  37.965  37.912  1.00 88.95  ? 9   DA  K "C1'" 1 
ATOM 10232 N N9    . DA  M 2 9   ? 62.410  37.669  37.382  1.00 87.00  ? 9   DA  K N9    1 
ATOM 10233 C C8    . DA  M 2 9   ? 62.750  37.447  36.076  1.00 86.42  ? 9   DA  K C8    1 
ATOM 10234 N N7    . DA  M 2 9   ? 64.026  37.199  35.884  1.00 84.65  ? 9   DA  K N7    1 
ATOM 10235 C C5    . DA  M 2 9   ? 64.568  37.258  37.157  1.00 84.02  ? 9   DA  K C5    1 
ATOM 10236 C C6    . DA  M 2 9   ? 65.881  37.089  37.637  1.00 82.31  ? 9   DA  K C6    1 
ATOM 10237 N N6    . DA  M 2 9   ? 66.922  36.815  36.853  1.00 80.87  ? 9   DA  K N6    1 
ATOM 10238 N N1    . DA  M 2 9   ? 66.088  37.215  38.959  1.00 82.17  ? 9   DA  K N1    1 
ATOM 10239 C C2    . DA  M 2 9   ? 65.046  37.496  39.746  1.00 83.65  ? 9   DA  K C2    1 
ATOM 10240 N N3    . DA  M 2 9   ? 63.771  37.679  39.412  1.00 85.34  ? 9   DA  K N3    1 
ATOM 10241 C C4    . DA  M 2 9   ? 63.590  37.547  38.089  1.00 85.43  ? 9   DA  K C4    1 
ATOM 10242 P P     . DG  M 2 10  ? 57.859  40.811  39.175  1.00 89.91  ? 10  DG  K P     1 
ATOM 10243 O OP1   . DG  M 2 10  ? 56.645  40.425  39.937  1.00 91.49  ? 10  DG  K OP1   1 
ATOM 10244 O OP2   . DG  M 2 10  ? 57.782  41.550  37.891  1.00 90.40  ? 10  DG  K OP2   1 
ATOM 10245 O "O5'" . DG  M 2 10  ? 58.813  41.688  40.109  1.00 89.10  ? 10  DG  K "O5'" 1 
ATOM 10246 C "C5'" . DG  M 2 10  ? 59.308  41.107  41.307  1.00 88.16  ? 10  DG  K "C5'" 1 
ATOM 10247 C "C4'" . DG  M 2 10  ? 60.700  41.621  41.604  1.00 86.55  ? 10  DG  K "C4'" 1 
ATOM 10248 O "O4'" . DG  M 2 10  ? 61.695  40.959  40.778  1.00 84.77  ? 10  DG  K "O4'" 1 
ATOM 10249 C "C3'" . DG  M 2 10  ? 60.864  43.110  41.341  1.00 87.18  ? 10  DG  K "C3'" 1 
ATOM 10250 O "O3'" . DG  M 2 10  ? 61.593  43.641  42.415  1.00 86.59  ? 10  DG  K "O3'" 1 
ATOM 10251 C "C2'" . DG  M 2 10  ? 61.674  43.152  40.049  1.00 86.03  ? 10  DG  K "C2'" 1 
ATOM 10252 C "C1'" . DG  M 2 10  ? 62.585  41.968  40.328  1.00 84.12  ? 10  DG  K "C1'" 1 
ATOM 10253 N N9    . DG  M 2 10  ? 63.393  41.535  39.182  1.00 82.75  ? 10  DG  K N9    1 
ATOM 10254 C C8    . DG  M 2 10  ? 63.022  41.479  37.859  1.00 83.17  ? 10  DG  K C8    1 
ATOM 10255 N N7    . DG  M 2 10  ? 63.966  41.043  37.066  1.00 81.68  ? 10  DG  K N7    1 
ATOM 10256 C C5    . DG  M 2 10  ? 65.033  40.809  37.916  1.00 80.19  ? 10  DG  K C5    1 
ATOM 10257 C C6    . DG  M 2 10  ? 66.328  40.345  37.625  1.00 78.31  ? 10  DG  K C6    1 
ATOM 10258 O O6    . DG  M 2 10  ? 66.780  40.042  36.517  1.00 77.58  ? 10  DG  K O6    1 
ATOM 10259 N N1    . DG  M 2 10  ? 67.114  40.242  38.773  1.00 77.32  ? 10  DG  K N1    1 
ATOM 10260 C C2    . DG  M 2 10  ? 66.693  40.556  40.044  1.00 78.06  ? 10  DG  K C2    1 
ATOM 10261 N N2    . DG  M 2 10  ? 67.573  40.398  41.045  1.00 76.97  ? 10  DG  K N2    1 
ATOM 10262 N N3    . DG  M 2 10  ? 65.478  41.000  40.324  1.00 79.83  ? 10  DG  K N3    1 
ATOM 10263 C C4    . DG  M 2 10  ? 64.703  41.102  39.216  1.00 80.82  ? 10  DG  K C4    1 
ATOM 10264 P P     . DA  M 2 11  ? 61.575  45.221  42.702  1.00 87.66  ? 11  DA  K P     1 
ATOM 10265 O OP1   . DA  M 2 11  ? 61.039  45.379  44.076  1.00 88.61  ? 11  DA  K OP1   1 
ATOM 10266 O OP2   . DA  M 2 11  ? 60.950  45.919  41.545  1.00 88.92  ? 11  DA  K OP2   1 
ATOM 10267 O "O5'" . DA  M 2 11  ? 63.122  45.631  42.696  1.00 85.86  ? 11  DA  K "O5'" 1 
ATOM 10268 C "C5'" . DA  M 2 11  ? 63.956  45.239  43.766  1.00 84.59  ? 11  DA  K "C5'" 1 
ATOM 10269 C "C4'" . DA  M 2 11  ? 65.367  45.116  43.251  1.00 82.64  ? 11  DA  K "C4'" 1 
ATOM 10270 O "O4'" . DA  M 2 11  ? 65.333  44.248  42.108  1.00 82.04  ? 11  DA  K "O4'" 1 
ATOM 10271 C "C3'" . DA  M 2 11  ? 65.959  46.369  42.641  1.00 82.70  ? 11  DA  K "C3'" 1 
ATOM 10272 O "O3'" . DA  M 2 11  ? 66.514  47.193  43.629  1.00 82.65  ? 11  DA  K "O3'" 1 
ATOM 10273 C "C2'" . DA  M 2 11  ? 67.063  45.804  41.762  1.00 80.87  ? 11  DA  K "C2'" 1 
ATOM 10274 C "C1'" . DA  M 2 11  ? 66.556  44.404  41.426  1.00 80.55  ? 11  DA  K "C1'" 1 
ATOM 10275 N N9    . DA  M 2 11  ? 66.341  44.179  40.005  1.00 80.61  ? 11  DA  K N9    1 
ATOM 10276 C C8    . DA  M 2 11  ? 65.172  44.280  39.303  1.00 82.14  ? 11  DA  K C8    1 
ATOM 10277 N N7    . DA  M 2 11  ? 65.300  44.013  38.024  1.00 81.79  ? 11  DA  K N7    1 
ATOM 10278 C C5    . DA  M 2 11  ? 66.647  43.723  37.890  1.00 79.90  ? 11  DA  K C5    1 
ATOM 10279 C C6    . DA  M 2 11  ? 67.427  43.358  36.784  1.00 78.72  ? 11  DA  K C6    1 
ATOM 10280 N N6    . DA  M 2 11  ? 66.928  43.223  35.554  1.00 79.28  ? 11  DA  K N6    1 
ATOM 10281 N N1    . DA  M 2 11  ? 68.739  43.138  37.000  1.00 76.99  ? 11  DA  K N1    1 
ATOM 10282 C C2    . DA  M 2 11  ? 69.234  43.278  38.235  1.00 76.48  ? 11  DA  K C2    1 
ATOM 10283 N N3    . DA  M 2 11  ? 68.603  43.613  39.352  1.00 77.46  ? 11  DA  K N3    1 
ATOM 10284 C C4    . DA  M 2 11  ? 67.303  43.820  39.100  1.00 79.17  ? 11  DA  K C4    1 
ATOM 10285 P P     . DT  M 2 12  ? 66.839  48.724  43.286  1.00 83.37  ? 12  DT  K P     1 
ATOM 10286 O OP1   . DT  M 2 12  ? 66.848  49.490  44.550  1.00 84.04  ? 12  DT  K OP1   1 
ATOM 10287 O OP2   . DT  M 2 12  ? 65.969  49.137  42.158  1.00 84.74  ? 12  DT  K OP2   1 
ATOM 10288 O "O5'" . DT  M 2 12  ? 68.334  48.656  42.747  1.00 81.45  ? 12  DT  K "O5'" 1 
ATOM 10289 C "C5'" . DT  M 2 12  ? 69.311  47.941  43.496  1.00 79.76  ? 12  DT  K "C5'" 1 
ATOM 10290 C "C4'" . DT  M 2 12  ? 70.539  47.823  42.631  1.00 78.17  ? 12  DT  K "C4'" 1 
ATOM 10291 O "O4'" . DT  M 2 12  ? 70.123  47.110  41.454  1.00 78.09  ? 12  DT  K "O4'" 1 
ATOM 10292 C "C3'" . DT  M 2 12  ? 71.069  49.156  42.131  1.00 78.56  ? 12  DT  K "C3'" 1 
ATOM 10293 O "O3'" . DT  M 2 12  ? 72.419  49.318  42.532  1.00 77.15  ? 12  DT  K "O3'" 1 
ATOM 10294 C "C2'" . DT  M 2 12  ? 70.908  49.112  40.610  1.00 78.68  ? 12  DT  K "C2'" 1 
ATOM 10295 C "C1'" . DT  M 2 12  ? 70.801  47.626  40.341  1.00 77.65  ? 12  DT  K "C1'" 1 
ATOM 10296 N N1    . DT  M 2 12  ? 70.001  47.282  39.151  1.00 78.33  ? 12  DT  K N1    1 
ATOM 10297 C C2    . DT  M 2 12  ? 70.622  46.711  38.066  1.00 77.19  ? 12  DT  K C2    1 
ATOM 10298 O O2    . DT  M 2 12  ? 71.819  46.471  38.016  1.00 75.63  ? 12  DT  K O2    1 
ATOM 10299 N N3    . DT  M 2 12  ? 69.781  46.433  37.025  1.00 78.00  ? 12  DT  K N3    1 
ATOM 10300 C C4    . DT  M 2 12  ? 68.422  46.655  36.969  1.00 79.79  ? 12  DT  K C4    1 
ATOM 10301 O O4    . DT  M 2 12  ? 67.743  46.374  35.995  1.00 80.45  ? 12  DT  K O4    1 
ATOM 10302 C C5    . DT  M 2 12  ? 67.843  47.243  38.134  1.00 80.90  ? 12  DT  K C5    1 
ATOM 10303 C C7    . DT  M 2 12  ? 66.373  47.520  38.152  1.00 82.94  ? 12  DT  K C7    1 
ATOM 10304 C C6    . DT  M 2 12  ? 68.649  47.526  39.159  1.00 80.12  ? 12  DT  K C6    1 
ATOM 10305 P P     . DA  M 2 13  ? 73.208  50.681  42.194  1.00 77.37  ? 13  DA  K P     1 
ATOM 10306 O OP1   . DA  M 2 13  ? 74.360  50.732  43.116  1.00 76.16  ? 13  DA  K OP1   1 
ATOM 10307 O OP2   . DA  M 2 13  ? 72.261  51.820  42.157  1.00 79.42  ? 13  DA  K OP2   1 
ATOM 10308 O "O5'" . DA  M 2 13  ? 73.752  50.438  40.718  1.00 76.55  ? 13  DA  K "O5'" 1 
ATOM 10309 C "C5'" . DA  M 2 13  ? 74.870  49.610  40.566  1.00 74.64  ? 13  DA  K "C5'" 1 
ATOM 10310 C "C4'" . DA  M 2 13  ? 75.185  49.592  39.103  1.00 74.31  ? 13  DA  K "C4'" 1 
ATOM 10311 O "O4'" . DA  M 2 13  ? 73.974  49.183  38.455  1.00 75.30  ? 13  DA  K "O4'" 1 
ATOM 10312 C "C3'" . DA  M 2 13  ? 75.462  50.964  38.529  1.00 75.19  ? 13  DA  K "C3'" 1 
ATOM 10313 O "O3'" . DA  M 2 13  ? 76.771  50.993  38.057  1.00 73.86  ? 13  DA  K "O3'" 1 
ATOM 10314 C "C2'" . DA  M 2 13  ? 74.476  51.118  37.372  1.00 76.45  ? 13  DA  K "C2'" 1 
ATOM 10315 C "C1'" . DA  M 2 13  ? 74.032  49.687  37.150  1.00 75.72  ? 13  DA  K "C1'" 1 
ATOM 10316 N N9    . DA  M 2 13  ? 72.709  49.573  36.558  1.00 77.13  ? 13  DA  K N9    1 
ATOM 10317 C C8    . DA  M 2 13  ? 71.521  49.916  37.128  1.00 78.73  ? 13  DA  K C8    1 
ATOM 10318 N N7    . DA  M 2 13  ? 70.485  49.705  36.355  1.00 79.80  ? 13  DA  K N7    1 
ATOM 10319 C C5    . DA  M 2 13  ? 71.033  49.170  35.209  1.00 78.80  ? 13  DA  K C5    1 
ATOM 10320 C C6    . DA  M 2 13  ? 70.461  48.725  34.007  1.00 79.21  ? 13  DA  K C6    1 
ATOM 10321 N N6    . DA  M 2 13  ? 69.149  48.754  33.761  1.00 80.81  ? 13  DA  K N6    1 
ATOM 10322 N N1    . DA  M 2 13  ? 71.297  48.247  33.060  1.00 77.95  ? 13  DA  K N1    1 
ATOM 10323 C C2    . DA  M 2 13  ? 72.614  48.221  33.307  1.00 76.40  ? 13  DA  K C2    1 
ATOM 10324 N N3    . DA  M 2 13  ? 73.263  48.609  34.403  1.00 75.88  ? 13  DA  K N3    1 
ATOM 10325 C C4    . DA  M 2 13  ? 72.403  49.078  35.319  1.00 77.15  ? 13  DA  K C4    1 
ATOM 10326 P P     . DT  M 2 14  ? 77.385  52.361  37.488  1.00 74.48  ? 14  DT  K P     1 
ATOM 10327 O OP1   . DT  M 2 14  ? 78.849  52.174  37.519  1.00 72.83  ? 14  DT  K OP1   1 
ATOM 10328 O OP2   . DT  M 2 14  ? 76.692  53.494  38.149  1.00 76.22  ? 14  DT  K OP2   1 
ATOM 10329 O "O5'" . DT  M 2 14  ? 76.946  52.406  35.960  1.00 75.11  ? 14  DT  K "O5'" 1 
ATOM 10330 C "C5'" . DT  M 2 14  ? 77.757  51.822  34.979  1.00 73.84  ? 14  DT  K "C5'" 1 
ATOM 10331 C "C4'" . DT  M 2 14  ? 76.952  51.766  33.708  1.00 74.77  ? 14  DT  K "C4'" 1 
ATOM 10332 O "O4'" . DT  M 2 14  ? 75.604  51.405  34.032  1.00 75.81  ? 14  DT  K "O4'" 1 
ATOM 10333 C "C3'" . DT  M 2 14  ? 76.646  53.093  33.065  1.00 76.44  ? 14  DT  K "C3'" 1 
ATOM 10334 O "O3'" . DT  M 2 14  ? 77.749  53.567  32.326  1.00 75.89  ? 14  DT  K "O3'" 1 
ATOM 10335 C "C2'" . DT  M 2 14  ? 75.516  52.696  32.132  1.00 77.40  ? 14  DT  K "C2'" 1 
ATOM 10336 C "C1'" . DT  M 2 14  ? 74.903  51.499  32.824  1.00 76.81  ? 14  DT  K "C1'" 1 
ATOM 10337 N N1    . DT  M 2 14  ? 73.485  51.709  33.086  1.00 78.52  ? 14  DT  K N1    1 
ATOM 10338 C C2    . DT  M 2 14  ? 72.587  51.421  32.088  1.00 79.40  ? 14  DT  K C2    1 
ATOM 10339 O O2    . DT  M 2 14  ? 72.915  50.990  30.992  1.00 78.81  ? 14  DT  K O2    1 
ATOM 10340 N N3    . DT  M 2 14  ? 71.282  51.658  32.431  1.00 81.07  ? 14  DT  K N3    1 
ATOM 10341 C C4    . DT  M 2 14  ? 70.805  52.141  33.632  1.00 81.91  ? 14  DT  K C4    1 
ATOM 10342 O O4    . DT  M 2 14  ? 69.611  52.321  33.832  1.00 83.46  ? 14  DT  K O4    1 
ATOM 10343 C C5    . DT  M 2 14  ? 71.808  52.417  34.624  1.00 80.88  ? 14  DT  K C5    1 
ATOM 10344 C C7    . DT  M 2 14  ? 71.425  52.960  35.970  1.00 81.70  ? 14  DT  K C7    1 
ATOM 10345 C C6    . DT  M 2 14  ? 73.086  52.190  34.305  1.00 79.26  ? 14  DT  K C6    1 
ATOM 10346 P P     . DC  M 2 15  ? 77.759  55.076  31.795  1.00 77.52  ? 15  DC  K P     1 
ATOM 10347 O OP1   . DC  M 2 15  ? 79.157  55.399  31.474  1.00 76.51  ? 15  DC  K OP1   1 
ATOM 10348 O OP2   . DC  M 2 15  ? 77.009  55.888  32.764  1.00 78.98  ? 15  DC  K OP2   1 
ATOM 10349 O "O5'" . DC  M 2 15  ? 76.904  55.022  30.456  1.00 78.62  ? 15  DC  K "O5'" 1 
ATOM 10350 C "C5'" . DC  M 2 15  ? 77.464  54.425  29.310  1.00 77.66  ? 15  DC  K "C5'" 1 
ATOM 10351 C "C4'" . DC  M 2 15  ? 76.356  54.104  28.337  1.00 78.70  ? 15  DC  K "C4'" 1 
ATOM 10352 O "O4'" . DC  M 2 15  ? 75.213  53.697  29.107  1.00 79.31  ? 15  DC  K "O4'" 1 
ATOM 10353 C "C3'" . DC  M 2 15  ? 75.793  55.281  27.578  1.00 80.74  ? 15  DC  K "C3'" 1 
ATOM 10354 O "O3'" . DC  M 2 15  ? 76.553  55.528  26.419  1.00 80.53  ? 15  DC  K "O3'" 1 
ATOM 10355 C "C2'" . DC  M 2 15  ? 74.376  54.829  27.229  1.00 81.87  ? 15  DC  K "C2'" 1 
ATOM 10356 C "C1'" . DC  M 2 15  ? 74.048  53.829  28.325  1.00 80.90  ? 15  DC  K "C1'" 1 
ATOM 10357 N N1    . DC  M 2 15  ? 72.943  54.170  29.259  1.00 82.27  ? 15  DC  K N1    1 
ATOM 10358 C C2    . DC  M 2 15  ? 71.614  54.062  28.856  1.00 83.76  ? 15  DC  K C2    1 
ATOM 10359 O O2    . DC  M 2 15  ? 71.361  53.719  27.702  1.00 83.97  ? 15  DC  K O2    1 
ATOM 10360 N N3    . DC  M 2 15  ? 70.631  54.351  29.741  1.00 85.01  ? 15  DC  K N3    1 
ATOM 10361 C C4    . DC  M 2 15  ? 70.938  54.734  30.983  1.00 84.80  ? 15  DC  K C4    1 
ATOM 10362 N N4    . DC  M 2 15  ? 69.933  55.020  31.822  1.00 86.13  ? 15  DC  K N4    1 
ATOM 10363 C C5    . DC  M 2 15  ? 72.292  54.844  31.418  1.00 83.27  ? 15  DC  K C5    1 
ATOM 10364 C C6    . DC  M 2 15  ? 73.245  54.552  30.530  1.00 82.06  ? 15  DC  K C6    1 
ATOM 10365 P P     . DT  M 2 16  ? 76.390  56.933  25.654  1.00 82.52  ? 16  DT  K P     1 
ATOM 10366 O OP1   . DT  M 2 16  ? 77.426  56.958  24.594  1.00 81.80  ? 16  DT  K OP1   1 
ATOM 10367 O OP2   . DT  M 2 16  ? 76.252  58.023  26.659  1.00 83.64  ? 16  DT  K OP2   1 
ATOM 10368 O "O5'" . DT  M 2 16  ? 74.990  56.809  24.919  1.00 84.10  ? 16  DT  K "O5'" 1 
ATOM 10369 C "C5'" . DT  M 2 16  ? 74.872  55.941  23.820  1.00 83.58  ? 16  DT  K "C5'" 1 
ATOM 10370 C "C4'" . DT  M 2 16  ? 73.513  56.213  23.226  1.00 85.59  ? 16  DT  K "C4'" 1 
ATOM 10371 O "O4'" . DT  M 2 16  ? 72.550  56.101  24.297  1.00 86.19  ? 16  DT  K "O4'" 1 
ATOM 10372 C "C3'" . DT  M 2 16  ? 73.313  57.614  22.662  1.00 87.67  ? 16  DT  K "C3'" 1 
ATOM 10373 O "O3'" . DT  M 2 16  ? 72.486  57.507  21.506  1.00 88.90  ? 16  DT  K "O3'" 1 
ATOM 10374 C "C2'" . DT  M 2 16  ? 72.641  58.365  23.813  1.00 88.94  ? 16  DT  K "C2'" 1 
ATOM 10375 C "C1'" . DT  M 2 16  ? 71.759  57.268  24.377  1.00 88.43  ? 16  DT  K "C1'" 1 
ATOM 10376 N N1    . DT  M 2 16  ? 71.345  57.363  25.801  1.00 88.57  ? 16  DT  K N1    1 
ATOM 10377 C C2    . DT  M 2 16  ? 70.008  57.220  26.102  1.00 89.89  ? 16  DT  K C2    1 
ATOM 10378 O O2    . DT  M 2 16  ? 69.160  57.057  25.240  1.00 90.98  ? 16  DT  K O2    1 
ATOM 10379 N N3    . DT  M 2 16  ? 69.698  57.286  27.439  1.00 89.95  ? 16  DT  K N3    1 
ATOM 10380 C C4    . DT  M 2 16  ? 70.585  57.473  28.477  1.00 88.84  ? 16  DT  K C4    1 
ATOM 10381 O O4    . DT  M 2 16  ? 70.195  57.522  29.637  1.00 89.07  ? 16  DT  K O4    1 
ATOM 10382 C C5    . DT  M 2 16  ? 71.977  57.603  28.088  1.00 87.47  ? 16  DT  K C5    1 
ATOM 10383 C C7    . DT  M 2 16  ? 73.058  57.811  29.106  1.00 86.22  ? 16  DT  K C7    1 
ATOM 10384 C C6    . DT  M 2 16  ? 72.288  57.540  26.788  1.00 87.40  ? 16  DT  K C6    1 
ATOM 10385 P P     . DA  M 2 17  ? 72.174  58.797  20.599  1.00 91.21  ? 17  DA  K P     1 
ATOM 10386 O OP1   . DA  M 2 17  ? 72.753  58.553  19.252  1.00 90.80  ? 17  DA  K OP1   1 
ATOM 10387 O OP2   . DA  M 2 17  ? 72.589  60.002  21.365  1.00 91.98  ? 17  DA  K OP2   1 
ATOM 10388 O "O5'" . DA  M 2 17  ? 70.573  58.795  20.493  1.00 93.12  ? 17  DA  K "O5'" 1 
ATOM 10389 C "C5'" . DA  M 2 17  ? 69.808  58.288  21.584  1.00 92.96  ? 17  DA  K "C5'" 1 
ATOM 10390 C "C4'" . DA  M 2 17  ? 68.350  58.696  21.505  1.00 95.27  ? 17  DA  K "C4'" 1 
ATOM 10391 O "O4'" . DA  M 2 17  ? 67.780  58.666  22.840  1.00 95.44  ? 17  DA  K "O4'" 1 
ATOM 10392 C "C3'" . DA  M 2 17  ? 68.109  60.105  20.983  1.00 97.59  ? 17  DA  K "C3'" 1 
ATOM 10393 O "O3'" . DA  M 2 17  ? 66.896  60.167  20.232  1.00 99.50  ? 17  DA  K "O3'" 1 
ATOM 10394 C "C2'" . DA  M 2 17  ? 68.046  60.958  22.250  1.00 98.30  ? 17  DA  K "C2'" 1 
ATOM 10395 C "C1'" . DA  M 2 17  ? 67.532  59.987  23.310  1.00 97.26  ? 17  DA  K "C1'" 1 
ATOM 10396 N N9    . DA  M 2 17  ? 68.179  60.139  24.618  1.00 96.19  ? 17  DA  K N9    1 
ATOM 10397 C C8    . DA  M 2 17  ? 69.515  60.305  24.866  1.00 94.69  ? 17  DA  K C8    1 
ATOM 10398 N N7    . DA  M 2 17  ? 69.824  60.406  26.137  1.00 94.03  ? 17  DA  K N7    1 
ATOM 10399 C C5    . DA  M 2 17  ? 68.602  60.294  26.766  1.00 95.17  ? 17  DA  K C5    1 
ATOM 10400 C C6    . DA  M 2 17  ? 68.253  60.320  28.124  1.00 95.24  ? 17  DA  K C6    1 
ATOM 10401 N N6    . DA  M 2 17  ? 69.159  60.475  29.094  1.00 94.05  ? 17  DA  K N6    1 
ATOM 10402 N N1    . DA  M 2 17  ? 66.944  60.183  28.431  1.00 96.61  ? 17  DA  K N1    1 
ATOM 10403 C C2    . DA  M 2 17  ? 66.055  60.030  27.438  1.00 97.83  ? 17  DA  K C2    1 
ATOM 10404 N N3    . DA  M 2 17  ? 66.266  59.988  26.122  1.00 97.91  ? 17  DA  K N3    1 
ATOM 10405 C C4    . DA  M 2 17  ? 67.575  60.129  25.853  1.00 96.52  ? 17  DA  K C4    1 
ATOM 10406 P P     . DA  M 2 18  ? 66.370  61.588  19.690  1.00 102.32 ? 18  DA  K P     1 
ATOM 10407 O OP1   . DA  M 2 18  ? 65.479  61.395  18.518  1.00 103.72 ? 18  DA  K OP1   1 
ATOM 10408 O OP2   . DA  M 2 18  ? 67.587  62.418  19.527  1.00 102.01 ? 18  DA  K OP2   1 
ATOM 10409 O "O5'" . DA  M 2 18  ? 65.493  62.159  20.908  1.00 103.72 ? 18  DA  K "O5'" 1 
ATOM 10410 C "C5'" . DA  M 2 18  ? 64.261  61.541  21.273  1.00 104.32 ? 18  DA  K "C5'" 1 
ATOM 10411 C "C4'" . DA  M 2 18  ? 63.731  62.054  22.603  1.00 105.20 ? 18  DA  K "C4'" 1 
ATOM 10412 O "O4'" . DA  M 2 18  ? 64.779  61.998  23.604  1.00 103.36 ? 18  DA  K "O4'" 1 
ATOM 10413 C "C3'" . DA  M 2 18  ? 63.221  63.501  22.618  1.00 107.92 ? 18  DA  K "C3'" 1 
ATOM 10414 O "O3'" . DA  M 2 18  ? 61.826  63.498  22.907  1.00 109.70 ? 18  DA  K "O3'" 1 
ATOM 10415 C "C2'" . DA  M 2 18  ? 64.030  64.207  23.715  1.00 107.42 ? 18  DA  K "C2'" 1 
ATOM 10416 C "C1'" . DA  M 2 18  ? 64.486  63.013  24.552  1.00 104.80 ? 18  DA  K "C1'" 1 
ATOM 10417 N N9    . DA  M 2 18  ? 65.642  63.210  25.440  1.00 103.25 ? 18  DA  K N9    1 
ATOM 10418 C C8    . DA  M 2 18  ? 66.953  63.417  25.092  1.00 101.98 ? 18  DA  K C8    1 
ATOM 10419 N N7    . DA  M 2 18  ? 67.762  63.542  26.120  1.00 100.78 ? 18  DA  K N7    1 
ATOM 10420 C C5    . DA  M 2 18  ? 66.926  63.396  27.216  1.00 101.27 ? 18  DA  K C5    1 
ATOM 10421 C C6    . DA  M 2 18  ? 67.165  63.417  28.599  1.00 100.57 ? 18  DA  K C6    1 
ATOM 10422 N N6    . DA  M 2 18  ? 68.378  63.606  29.124  1.00 99.15  ? 18  DA  K N6    1 
ATOM 10423 N N1    . DA  M 2 18  ? 66.109  63.240  29.421  1.00 101.44 ? 18  DA  K N1    1 
ATOM 10424 C C2    . DA  M 2 18  ? 64.895  63.052  28.895  1.00 102.91 ? 18  DA  K C2    1 
ATOM 10425 N N3    . DA  M 2 18  ? 64.546  63.008  27.615  1.00 103.69 ? 18  DA  K N3    1 
ATOM 10426 C C4    . DA  M 2 18  ? 65.617  63.189  26.821  1.00 102.79 ? 18  DA  K C4    1 
ATOM 10427 P P     . DC  M 2 19  ? 60.945  64.821  22.675  1.00 112.94 ? 19  DC  K P     1 
ATOM 10428 O OP1   . DC  M 2 19  ? 59.608  64.405  22.198  1.00 114.41 ? 19  DC  K OP1   1 
ATOM 10429 O OP2   . DC  M 2 19  ? 61.748  65.753  21.853  1.00 113.56 ? 19  DC  K OP2   1 
ATOM 10430 O "O5'" . DC  M 2 19  ? 60.794  65.433  24.146  1.00 113.48 ? 19  DC  K "O5'" 1 
ATOM 10431 C "C5'" . DC  M 2 19  ? 60.271  64.614  25.188  1.00 112.62 ? 19  DC  K "C5'" 1 
ATOM 10432 C "C4'" . DC  M 2 19  ? 60.633  65.162  26.555  1.00 112.43 ? 19  DC  K "C4'" 1 
ATOM 10433 O "O4'" . DC  M 2 19  ? 62.063  65.084  26.760  1.00 110.26 ? 19  DC  K "O4'" 1 
ATOM 10434 C "C3'" . DC  M 2 19  ? 60.285  66.629  26.781  1.00 115.03 ? 19  DC  K "C3'" 1 
ATOM 10435 O "O3'" . DC  M 2 19  ? 59.216  66.738  27.697  1.00 116.41 ? 19  DC  K "O3'" 1 
ATOM 10436 C "C2'" . DC  M 2 19  ? 61.556  67.244  27.363  1.00 113.98 ? 19  DC  K "C2'" 1 
ATOM 10437 C "C1'" . DC  M 2 19  ? 62.366  66.027  27.761  1.00 110.89 ? 19  DC  K "C1'" 1 
ATOM 10438 N N1    . DC  M 2 19  ? 63.830  66.265  27.788  1.00 109.25 ? 19  DC  K N1    1 
ATOM 10439 C C2    . DC  M 2 19  ? 64.484  66.419  29.016  1.00 108.21 ? 19  DC  K C2    1 
ATOM 10440 O O2    . DC  M 2 19  ? 63.826  66.357  30.063  1.00 108.69 ? 19  DC  K O2    1 
ATOM 10441 N N3    . DC  M 2 19  ? 65.826  66.632  29.021  1.00 106.76 ? 19  DC  K N3    1 
ATOM 10442 C C4    . DC  M 2 19  ? 66.493  66.688  27.870  1.00 106.36 ? 19  DC  K C4    1 
ATOM 10443 N N4    . DC  M 2 19  ? 67.809  66.897  27.921  1.00 104.98 ? 19  DC  K N4    1 
ATOM 10444 C C5    . DC  M 2 19  ? 65.842  66.533  26.615  1.00 107.39 ? 19  DC  K C5    1 
ATOM 10445 C C6    . DC  M 2 19  ? 64.523  66.326  26.618  1.00 108.81 ? 19  DC  K C6    1 
ATOM 10446 P P     . DT  M 2 20  ? 58.631  68.185  28.093  1.00 119.35 ? 20  DT  K P     1 
ATOM 10447 O OP1   . DT  M 2 20  ? 57.236  68.244  27.599  1.00 121.67 ? 20  DT  K OP1   1 
ATOM 10448 O OP2   . DT  M 2 20  ? 59.563  69.272  27.679  1.00 119.86 ? 20  DT  K OP2   1 
ATOM 10449 O "O5'" . DT  M 2 20  ? 58.587  68.128  29.693  1.00 118.82 ? 20  DT  K "O5'" 1 
ATOM 10450 C "C5'" . DT  M 2 20  ? 59.740  67.750  30.443  1.00 116.34 ? 20  DT  K "C5'" 1 
ATOM 10451 C "C4'" . DT  M 2 20  ? 60.055  68.811  31.486  1.00 117.23 ? 20  DT  K "C4'" 1 
ATOM 10452 O "O4'" . DT  M 2 20  ? 61.496  68.901  31.626  1.00 115.29 ? 20  DT  K "O4'" 1 
ATOM 10453 C "C3'" . DT  M 2 20  ? 59.638  70.228  31.122  1.00 120.17 ? 20  DT  K "C3'" 1 
ATOM 10454 O "O3'" . DT  M 2 20  ? 59.751  71.063  32.260  1.00 121.03 ? 20  DT  K "O3'" 1 
ATOM 10455 C "C2'" . DT  M 2 20  ? 60.766  70.553  30.164  1.00 119.38 ? 20  DT  K "C2'" 1 
ATOM 10456 C "C1'" . DT  M 2 20  ? 61.894  70.150  31.105  1.00 116.85 ? 20  DT  K "C1'" 1 
ATOM 10457 N N1    . DT  M 2 20  ? 63.234  70.082  30.464  1.00 115.09 ? 20  DT  K N1    1 
ATOM 10458 C C2    . DT  M 2 20  ? 64.357  70.099  31.268  1.00 113.36 ? 20  DT  K C2    1 
ATOM 10459 O O2    . DT  M 2 20  ? 64.311  70.143  32.488  1.00 113.14 ? 20  DT  K O2    1 
ATOM 10460 N N3    . DT  M 2 20  ? 65.545  70.055  30.584  1.00 111.92 ? 20  DT  K N3    1 
ATOM 10461 C C4    . DT  M 2 20  ? 65.704  70.008  29.214  1.00 112.08 ? 20  DT  K C4    1 
ATOM 10462 O O4    . DT  M 2 20  ? 66.812  69.974  28.698  1.00 110.76 ? 20  DT  K O4    1 
ATOM 10463 C C5    . DT  M 2 20  ? 64.489  69.999  28.437  1.00 113.93 ? 20  DT  K C5    1 
ATOM 10464 C C7    . DT  M 2 20  ? 64.550  69.941  26.941  1.00 114.29 ? 20  DT  K C7    1 
ATOM 10465 C C6    . DT  M 2 20  ? 63.323  70.039  29.088  1.00 115.35 ? 20  DT  K C6    1 
ATOM 10466 P P     . DA  M 2 21  ? 58.466  71.845  32.826  1.00 124.02 ? 21  DA  K P     1 
ATOM 10467 O OP1   . DA  M 2 21  ? 57.588  70.799  33.400  1.00 123.45 ? 21  DA  K OP1   1 
ATOM 10468 O OP2   . DA  M 2 21  ? 57.964  72.773  31.785  1.00 126.62 ? 21  DA  K OP2   1 
ATOM 10469 O "O5'" . DA  M 2 21  ? 59.051  72.749  34.012  1.00 124.34 ? 21  DA  K "O5'" 1 
ATOM 10470 C "C5'" . DA  M 2 21  ? 59.500  72.121  35.206  1.00 122.34 ? 21  DA  K "C5'" 1 
ATOM 10471 C "C4'" . DA  M 2 21  ? 60.855  72.655  35.637  1.00 121.18 ? 21  DA  K "C4'" 1 
ATOM 10472 O "O4'" . DA  M 2 21  ? 61.842  72.355  34.615  1.00 119.54 ? 21  DA  K "O4'" 1 
ATOM 10473 C "C3'" . DA  M 2 21  ? 60.924  74.157  35.895  1.00 123.54 ? 21  DA  K "C3'" 1 
ATOM 10474 O "O3'" . DA  M 2 21  ? 61.490  74.352  37.184  1.00 122.77 ? 21  DA  K "O3'" 1 
ATOM 10475 C "C2'" . DA  M 2 21  ? 61.828  74.686  34.783  1.00 123.45 ? 21  DA  K "C2'" 1 
ATOM 10476 C "C1'" . DA  M 2 21  ? 62.676  73.476  34.404  1.00 120.31 ? 21  DA  K "C1'" 1 
ATOM 10477 N N9    . DA  M 2 21  ? 63.124  73.446  33.008  1.00 120.03 ? 21  DA  K N9    1 
ATOM 10478 C C8    . DA  M 2 21  ? 62.335  73.412  31.890  1.00 121.39 ? 21  DA  K C8    1 
ATOM 10479 N N7    . DA  M 2 21  ? 63.001  73.382  30.760  1.00 120.78 ? 21  DA  K N7    1 
ATOM 10480 C C5    . DA  M 2 21  ? 64.322  73.395  31.168  1.00 118.87 ? 21  DA  K C5    1 
ATOM 10481 C C6    . DA  M 2 21  ? 65.527  73.379  30.448  1.00 117.47 ? 21  DA  K C6    1 
ATOM 10482 N N6    . DA  M 2 21  ? 65.569  73.345  29.116  1.00 117.82 ? 21  DA  K N6    1 
ATOM 10483 N N1    . DA  M 2 21  ? 66.681  73.400  31.147  1.00 115.77 ? 21  DA  K N1    1 
ATOM 10484 C C2    . DA  M 2 21  ? 66.622  73.436  32.482  1.00 115.49 ? 21  DA  K C2    1 
ATOM 10485 N N3    . DA  M 2 21  ? 65.549  73.455  33.271  1.00 116.70 ? 21  DA  K N3    1 
ATOM 10486 C C4    . DA  M 2 21  ? 64.421  73.433  32.546  1.00 118.38 ? 21  DA  K C4    1 
ATOM 10487 P P     . DA  M 2 22  ? 61.469  75.801  37.879  1.00 125.14 ? 22  DA  K P     1 
ATOM 10488 O OP1   . DA  M 2 22  ? 61.463  75.615  39.347  1.00 124.51 ? 22  DA  K OP1   1 
ATOM 10489 O OP2   . DA  M 2 22  ? 60.395  76.593  37.238  1.00 128.21 ? 22  DA  K OP2   1 
ATOM 10490 O "O5'" . DA  M 2 22  ? 62.880  76.435  37.474  1.00 124.37 ? 22  DA  K "O5'" 1 
ATOM 10491 C "C5'" . DA  M 2 22  ? 64.053  75.655  37.663  1.00 121.34 ? 22  DA  K "C5'" 1 
ATOM 10492 C "C4'" . DA  M 2 22  ? 65.217  76.173  36.838  1.00 120.88 ? 22  DA  K "C4'" 1 
ATOM 10493 O "O4'" . DA  M 2 22  ? 65.102  75.784  35.437  1.00 120.70 ? 22  DA  K "O4'" 1 
ATOM 10494 C "C3'" . DA  M 2 22  ? 65.374  77.691  36.840  1.00 123.37 ? 22  DA  K "C3'" 1 
ATOM 10495 O "O3'" . DA  M 2 22  ? 66.752  77.982  36.959  1.00 122.05 ? 22  DA  K "O3'" 1 
ATOM 10496 C "C2'" . DA  M 2 22  ? 64.870  78.063  35.451  1.00 125.10 ? 22  DA  K "C2'" 1 
ATOM 10497 C "C1'" . DA  M 2 22  ? 65.494  76.910  34.674  1.00 122.39 ? 22  DA  K "C1'" 1 
ATOM 10498 N N9    . DA  M 2 22  ? 65.082  76.815  33.268  1.00 123.19 ? 22  DA  K N9    1 
ATOM 10499 C C8    . DA  M 2 22  ? 63.810  76.798  32.765  1.00 125.04 ? 22  DA  K C8    1 
ATOM 10500 N N7    . DA  M 2 22  ? 63.754  76.716  31.456  1.00 125.40 ? 22  DA  K N7    1 
ATOM 10501 C C5    . DA  M 2 22  ? 65.084  76.681  31.072  1.00 123.67 ? 22  DA  K C5    1 
ATOM 10502 C C6    . DA  M 2 22  ? 65.707  76.597  29.811  1.00 123.14 ? 22  DA  K C6    1 
ATOM 10503 N N6    . DA  M 2 22  ? 65.029  76.528  28.660  1.00 124.35 ? 22  DA  K N6    1 
ATOM 10504 N N1    . DA  M 2 22  ? 67.055  76.585  29.777  1.00 121.36 ? 22  DA  K N1    1 
ATOM 10505 C C2    . DA  M 2 22  ? 67.727  76.648  30.930  1.00 120.20 ? 22  DA  K C2    1 
ATOM 10506 N N3    . DA  M 2 22  ? 67.256  76.736  32.173  1.00 120.54 ? 22  DA  K N3    1 
ATOM 10507 C C4    . DA  M 2 22  ? 65.915  76.744  32.175  1.00 122.30 ? 22  DA  K C4    1 
ATOM 10508 P P     . DA  M 2 23  ? 67.253  79.262  37.789  1.00 123.53 ? 23  DA  K P     1 
ATOM 10509 O OP1   . DA  M 2 23  ? 66.763  79.135  39.174  1.00 123.61 ? 23  DA  K OP1   1 
ATOM 10510 O OP2   . DA  M 2 23  ? 66.917  80.478  37.008  1.00 126.46 ? 23  DA  K OP2   1 
ATOM 10511 O "O5'" . DA  M 2 23  ? 68.841  79.090  37.800  1.00 121.18 ? 23  DA  K "O5'" 1 
ATOM 10512 C "C5'" . DA  M 2 23  ? 69.656  80.147  37.318  1.00 122.25 ? 23  DA  K "C5'" 1 
ATOM 10513 C "C4'" . DA  M 2 23  ? 70.321  79.803  35.999  1.00 121.14 ? 23  DA  K "C4'" 1 
ATOM 10514 O "O4'" . DA  M 2 23  ? 69.368  79.198  35.096  1.00 121.46 ? 23  DA  K "O4'" 1 
ATOM 10515 C "C3'" . DA  M 2 23  ? 70.836  81.021  35.253  1.00 123.04 ? 23  DA  K "C3'" 1 
ATOM 10516 O "O3'" . DA  M 2 23  ? 72.147  81.322  35.702  1.00 121.90 ? 23  DA  K "O3'" 1 
ATOM 10517 C "C2'" . DA  M 2 23  ? 70.781  80.604  33.783  1.00 122.78 ? 23  DA  K "C2'" 1 
ATOM 10518 C "C1'" . DA  M 2 23  ? 69.772  79.454  33.763  1.00 121.85 ? 23  DA  K "C1'" 1 
ATOM 10519 N N9    . DA  M 2 23  ? 68.561  79.631  32.956  1.00 123.97 ? 23  DA  K N9    1 
ATOM 10520 C C8    . DA  M 2 23  ? 67.284  79.780  33.427  1.00 125.73 ? 23  DA  K C8    1 
ATOM 10521 N N7    . DA  M 2 23  ? 66.376  79.900  32.487  1.00 127.46 ? 23  DA  K N7    1 
ATOM 10522 C C5    . DA  M 2 23  ? 67.104  79.819  31.311  1.00 126.78 ? 23  DA  K C5    1 
ATOM 10523 C C6    . DA  M 2 23  ? 66.719  79.870  29.955  1.00 127.89 ? 23  DA  K C6    1 
ATOM 10524 N N6    . DA  M 2 23  ? 65.454  80.027  29.550  1.00 130.02 ? 23  DA  K N6    1 
ATOM 10525 N N1    . DA  M 2 23  ? 67.693  79.753  29.028  1.00 126.77 ? 23  DA  K N1    1 
ATOM 10526 C C2    . DA  M 2 23  ? 68.960  79.595  29.437  1.00 124.68 ? 23  DA  K C2    1 
ATOM 10527 N N3    . DA  M 2 23  ? 69.442  79.529  30.679  1.00 123.47 ? 23  DA  K N3    1 
ATOM 10528 C C4    . DA  M 2 23  ? 68.453  79.653  31.581  1.00 124.63 ? 23  DA  K C4    1 
ATOM 10529 P P     . DT  M 2 24  ? 72.691  82.835  35.641  1.00 124.22 ? 24  DT  K P     1 
ATOM 10530 O OP1   . DT  M 2 24  ? 73.132  83.233  37.001  1.00 124.08 ? 24  DT  K OP1   1 
ATOM 10531 O OP2   . DT  M 2 24  ? 71.667  83.688  34.984  1.00 127.37 ? 24  DT  K OP2   1 
ATOM 10532 O "O5'" . DT  M 2 24  ? 73.976  82.715  34.677  1.00 122.79 ? 24  DT  K "O5'" 1 
ATOM 10533 C "C5'" . DT  M 2 24  ? 74.052  81.741  33.630  1.00 121.14 ? 24  DT  K "C5'" 1 
ATOM 10534 C "C4'" . DT  M 2 24  ? 73.944  82.382  32.254  1.00 123.02 ? 24  DT  K "C4'" 1 
ATOM 10535 O "O4'" . DT  M 2 24  ? 72.752  81.922  31.577  1.00 123.76 ? 24  DT  K "O4'" 1 
ATOM 10536 C "C3'" . DT  M 2 24  ? 73.751  83.891  32.222  1.00 126.29 ? 24  DT  K "C3'" 1 
ATOM 10537 O "O3'" . DT  M 2 24  ? 74.987  84.580  32.400  1.00 126.20 ? 24  DT  K "O3'" 1 
ATOM 10538 C "C2'" . DT  M 2 24  ? 73.175  84.124  30.824  1.00 127.99 ? 24  DT  K "C2'" 1 
ATOM 10539 C "C1'" . DT  M 2 24  ? 72.478  82.804  30.501  1.00 126.26 ? 24  DT  K "C1'" 1 
ATOM 10540 N N1    . DT  M 2 24  ? 70.989  82.902  30.311  1.00 128.33 ? 24  DT  K N1    1 
ATOM 10541 C C2    . DT  M 2 24  ? 70.456  82.830  29.038  1.00 129.37 ? 24  DT  K C2    1 
ATOM 10542 O O2    . DT  M 2 24  ? 71.126  82.696  28.032  1.00 128.71 ? 24  DT  K O2    1 
ATOM 10543 N N3    . DT  M 2 24  ? 69.088  82.923  28.980  1.00 131.29 ? 24  DT  K N3    1 
ATOM 10544 C C4    . DT  M 2 24  ? 68.216  83.079  30.041  1.00 132.27 ? 24  DT  K C4    1 
ATOM 10545 O O4    . DT  M 2 24  ? 67.002  83.147  29.876  1.00 134.05 ? 24  DT  K O4    1 
ATOM 10546 C C5    . DT  M 2 24  ? 68.834  83.151  31.344  1.00 131.11 ? 24  DT  K C5    1 
ATOM 10547 C C7    . DT  M 2 24  ? 67.993  83.323  32.576  1.00 132.07 ? 24  DT  K C7    1 
ATOM 10548 C C6    . DT  M 2 24  ? 70.170  83.059  31.413  1.00 129.22 ? 24  DT  K C6    1 
ATOM 10549 O "O5'" . DA  N 2 1   ? 64.439  84.743  18.313  1.00 131.89 ? 1   DA  L "O5'" 1 
ATOM 10550 C "C5'" . DA  N 2 1   ? 64.807  83.387  18.685  1.00 128.17 ? 1   DA  L "C5'" 1 
ATOM 10551 C "C4'" . DA  N 2 1   ? 65.801  83.357  19.841  1.00 126.64 ? 1   DA  L "C4'" 1 
ATOM 10552 O "O4'" . DA  N 2 1   ? 65.167  83.501  21.135  1.00 127.48 ? 1   DA  L "O4'" 1 
ATOM 10553 C "C3'" . DA  N 2 1   ? 66.562  82.055  20.053  1.00 122.73 ? 1   DA  L "C3'" 1 
ATOM 10554 O "O3'" . DA  N 2 1   ? 67.667  81.948  19.172  1.00 121.42 ? 1   DA  L "O3'" 1 
ATOM 10555 C "C2'" . DA  N 2 1   ? 67.032  82.139  21.509  1.00 122.09 ? 1   DA  L "C2'" 1 
ATOM 10556 C "C1'" . DA  N 2 1   ? 66.237  83.322  22.047  1.00 125.62 ? 1   DA  L "C1'" 1 
ATOM 10557 N N9    . DA  N 2 1   ? 65.790  83.190  23.436  1.00 125.67 ? 1   DA  L N9    1 
ATOM 10558 C C8    . DA  N 2 1   ? 64.510  83.098  23.917  1.00 127.01 ? 1   DA  L C8    1 
ATOM 10559 N N7    . DA  N 2 1   ? 64.443  83.005  25.225  1.00 126.80 ? 1   DA  L N7    1 
ATOM 10560 C C5    . DA  N 2 1   ? 65.770  83.040  25.624  1.00 125.17 ? 1   DA  L C5    1 
ATOM 10561 C C6    . DA  N 2 1   ? 66.387  82.981  26.888  1.00 124.21 ? 1   DA  L C6    1 
ATOM 10562 N N6    . DA  N 2 1   ? 65.699  82.872  28.027  1.00 124.83 ? 1   DA  L N6    1 
ATOM 10563 N N1    . DA  N 2 1   ? 67.735  83.041  26.937  1.00 122.68 ? 1   DA  L N1    1 
ATOM 10564 C C2    . DA  N 2 1   ? 68.423  83.155  25.796  1.00 122.18 ? 1   DA  L C2    1 
ATOM 10565 N N3    . DA  N 2 1   ? 67.956  83.222  24.552  1.00 123.00 ? 1   DA  L N3    1 
ATOM 10566 C C4    . DA  N 2 1   ? 66.613  83.157  24.537  1.00 124.47 ? 1   DA  L C4    1 
ATOM 10567 P P     . DT  N 2 2   ? 68.258  80.497  18.812  1.00 117.61 ? 2   DT  L P     1 
ATOM 10568 O OP1   . DT  N 2 2   ? 69.108  80.720  17.618  1.00 117.49 ? 2   DT  L OP1   1 
ATOM 10569 O OP2   . DT  N 2 2   ? 67.144  79.514  18.808  1.00 116.74 ? 2   DT  L OP2   1 
ATOM 10570 O "O5'" . DT  N 2 2   ? 69.195  80.121  20.054  1.00 115.46 ? 2   DT  L "O5'" 1 
ATOM 10571 C "C5'" . DT  N 2 2   ? 70.396  80.850  20.238  1.00 115.71 ? 2   DT  L "C5'" 1 
ATOM 10572 C "C4'" . DT  N 2 2   ? 71.126  80.359  21.470  1.00 113.59 ? 2   DT  L "C4'" 1 
ATOM 10573 O "O4'" . DT  N 2 2   ? 70.343  80.666  22.648  1.00 114.88 ? 2   DT  L "O4'" 1 
ATOM 10574 C "C3'" . DT  N 2 2   ? 71.403  78.864  21.500  1.00 110.09 ? 2   DT  L "C3'" 1 
ATOM 10575 O "O3'" . DT  N 2 2   ? 72.805  78.707  21.638  1.00 108.27 ? 2   DT  L "O3'" 1 
ATOM 10576 C "C2'" . DT  N 2 2   ? 70.617  78.353  22.710  1.00 109.67 ? 2   DT  L "C2'" 1 
ATOM 10577 C "C1'" . DT  N 2 2   ? 70.425  79.602  23.567  1.00 112.38 ? 2   DT  L "C1'" 1 
ATOM 10578 N N1    . DT  N 2 2   ? 69.165  79.618  24.374  1.00 113.74 ? 2   DT  L N1    1 
ATOM 10579 C C2    . DT  N 2 2   ? 69.227  79.714  25.747  1.00 113.77 ? 2   DT  L C2    1 
ATOM 10580 O O2    . DT  N 2 2   ? 70.272  79.783  26.368  1.00 112.68 ? 2   DT  L O2    1 
ATOM 10581 N N3    . DT  N 2 2   ? 68.000  79.720  26.364  1.00 115.21 ? 2   DT  L N3    1 
ATOM 10582 C C4    . DT  N 2 2   ? 66.753  79.648  25.764  1.00 116.60 ? 2   DT  L C4    1 
ATOM 10583 O O4    . DT  N 2 2   ? 65.705  79.660  26.403  1.00 117.92 ? 2   DT  L O4    1 
ATOM 10584 C C5    . DT  N 2 2   ? 66.766  79.556  24.329  1.00 116.46 ? 2   DT  L C5    1 
ATOM 10585 C C7    . DT  N 2 2   ? 65.480  79.471  23.564  1.00 117.92 ? 2   DT  L C7    1 
ATOM 10586 C C6    . DT  N 2 2   ? 67.954  79.547  23.714  1.00 115.07 ? 2   DT  L C6    1 
ATOM 10587 P P     . DT  N 2 3   ? 73.459  77.242  21.734  1.00 104.56 ? 3   DT  L P     1 
ATOM 10588 O OP1   . DT  N 2 3   ? 74.885  77.358  21.354  1.00 103.47 ? 3   DT  L OP1   1 
ATOM 10589 O OP2   . DT  N 2 3   ? 72.580  76.268  21.033  1.00 103.62 ? 3   DT  L OP2   1 
ATOM 10590 O "O5'" . DT  N 2 3   ? 73.449  76.927  23.300  1.00 103.67 ? 3   DT  L "O5'" 1 
ATOM 10591 C "C5'" . DT  N 2 3   ? 74.440  77.489  24.157  1.00 103.68 ? 3   DT  L "C5'" 1 
ATOM 10592 C "C4'" . DT  N 2 3   ? 73.973  77.286  25.583  1.00 103.59 ? 3   DT  L "C4'" 1 
ATOM 10593 O "O4'" . DT  N 2 3   ? 72.536  77.170  25.552  1.00 104.87 ? 3   DT  L "O4'" 1 
ATOM 10594 C "C3'" . DT  N 2 3   ? 74.412  76.002  26.280  1.00 100.54 ? 3   DT  L "C3'" 1 
ATOM 10595 O "O3'" . DT  N 2 3   ? 75.368  76.314  27.301  1.00 100.12 ? 3   DT  L "O3'" 1 
ATOM 10596 C "C2'" . DT  N 2 3   ? 73.111  75.398  26.837  1.00 100.72 ? 3   DT  L "C2'" 1 
ATOM 10597 C "C1'" . DT  N 2 3   ? 72.187  76.601  26.781  1.00 104.06 ? 3   DT  L "C1'" 1 
ATOM 10598 N N1    . DT  N 2 3   ? 70.718  76.429  26.759  1.00 105.36 ? 3   DT  L N1    1 
ATOM 10599 C C2    . DT  N 2 3   ? 70.059  76.438  27.954  1.00 106.15 ? 3   DT  L C2    1 
ATOM 10600 O O2    . DT  N 2 3   ? 70.648  76.538  29.013  1.00 105.69 ? 3   DT  L O2    1 
ATOM 10601 N N3    . DT  N 2 3   ? 68.696  76.314  27.860  1.00 107.52 ? 3   DT  L N3    1 
ATOM 10602 C C4    . DT  N 2 3   ? 67.949  76.200  26.705  1.00 108.18 ? 3   DT  L C4    1 
ATOM 10603 O O4    . DT  N 2 3   ? 66.729  76.093  26.705  1.00 109.47 ? 3   DT  L O4    1 
ATOM 10604 C C5    . DT  N 2 3   ? 68.706  76.219  25.487  1.00 107.31 ? 3   DT  L C5    1 
ATOM 10605 C C7    . DT  N 2 3   ? 67.980  76.105  24.182  1.00 108.00 ? 3   DT  L C7    1 
ATOM 10606 C C6    . DT  N 2 3   ? 70.038  76.340  25.566  1.00 106.00 ? 3   DT  L C6    1 
ATOM 10607 P P     . DT  N 2 4   ? 76.497  75.234  27.703  1.00 96.89  ? 4   DT  L P     1 
ATOM 10608 O OP1   . DT  N 2 4   ? 77.703  75.966  28.153  1.00 97.10  ? 4   DT  L OP1   1 
ATOM 10609 O OP2   . DT  N 2 4   ? 76.568  74.227  26.613  1.00 94.97  ? 4   DT  L OP2   1 
ATOM 10610 O "O5'" . DT  N 2 4   ? 75.904  74.533  29.008  1.00 96.15  ? 4   DT  L "O5'" 1 
ATOM 10611 C "C5'" . DT  N 2 4   ? 75.516  75.358  30.100  1.00 98.12  ? 4   DT  L "C5'" 1 
ATOM 10612 C "C4'" . DT  N 2 4   ? 74.690  74.547  31.072  1.00 97.54  ? 4   DT  L "C4'" 1 
ATOM 10613 O "O4'" . DT  N 2 4   ? 73.269  74.708  30.819  1.00 99.37  ? 4   DT  L "O4'" 1 
ATOM 10614 C "C3'" . DT  N 2 4   ? 74.943  73.065  30.945  1.00 94.58  ? 4   DT  L "C3'" 1 
ATOM 10615 O "O3'" . DT  N 2 4   ? 74.798  72.524  32.230  1.00 93.92  ? 4   DT  L "O3'" 1 
ATOM 10616 C "C2'" . DT  N 2 4   ? 73.779  72.645  30.060  1.00 95.02  ? 4   DT  L "C2'" 1 
ATOM 10617 C "C1'" . DT  N 2 4   ? 72.709  73.426  30.791  1.00 97.67  ? 4   DT  L "C1'" 1 
ATOM 10618 N N1    . DT  N 2 4   ? 71.387  73.403  30.135  1.00 99.07  ? 4   DT  L N1    1 
ATOM 10619 C C2    . DT  N 2 4   ? 70.274  73.575  30.918  1.00 100.78 ? 4   DT  L C2    1 
ATOM 10620 O O2    . DT  N 2 4   ? 70.330  73.774  32.114  1.00 101.25 ? 4   DT  L O2    1 
ATOM 10621 N N3    . DT  N 2 4   ? 69.082  73.518  30.254  1.00 102.04 ? 4   DT  L N3    1 
ATOM 10622 C C4    . DT  N 2 4   ? 68.910  73.300  28.907  1.00 101.71 ? 4   DT  L C4    1 
ATOM 10623 O O4    . DT  N 2 4   ? 67.800  73.266  28.397  1.00 102.97 ? 4   DT  L O4    1 
ATOM 10624 C C5    . DT  N 2 4   ? 70.114  73.114  28.144  1.00 99.88  ? 4   DT  L C5    1 
ATOM 10625 C C7    . DT  N 2 4   ? 70.020  72.870  26.670  1.00 99.49  ? 4   DT  L C7    1 
ATOM 10626 C C6    . DT  N 2 4   ? 71.287  73.169  28.784  1.00 98.66  ? 4   DT  L C6    1 
ATOM 10627 P P     . DA  N 2 5   ? 76.080  72.338  33.184  1.00 92.35  ? 5   DA  L P     1 
ATOM 10628 O OP1   . DA  N 2 5   ? 76.498  73.707  33.613  1.00 94.37  ? 5   DA  L OP1   1 
ATOM 10629 O OP2   . DA  N 2 5   ? 77.028  71.419  32.497  1.00 89.69  ? 5   DA  L OP2   1 
ATOM 10630 O "O5'" . DA  N 2 5   ? 75.490  71.555  34.453  1.00 91.87  ? 5   DA  L "O5'" 1 
ATOM 10631 C "C5'" . DA  N 2 5   ? 74.861  72.371  35.443  1.00 94.15  ? 5   DA  L "C5'" 1 
ATOM 10632 C "C4'" . DA  N 2 5   ? 73.582  71.762  35.994  1.00 94.71  ? 5   DA  L "C4'" 1 
ATOM 10633 O "O4'" . DA  N 2 5   ? 72.511  71.866  35.027  1.00 95.91  ? 5   DA  L "O4'" 1 
ATOM 10634 C "C3'" . DA  N 2 5   ? 73.712  70.300  36.368  1.00 92.27  ? 5   DA  L "C3'" 1 
ATOM 10635 O "O3'" . DA  N 2 5   ? 73.542  70.230  37.779  1.00 92.77  ? 5   DA  L "O3'" 1 
ATOM 10636 C "C2'" . DA  N 2 5   ? 72.619  69.593  35.564  1.00 92.21  ? 5   DA  L "C2'" 1 
ATOM 10637 C "C1'" . DA  N 2 5   ? 71.728  70.705  35.030  1.00 94.92  ? 5   DA  L "C1'" 1 
ATOM 10638 N N9    . DA  N 2 5   ? 71.314  70.509  33.650  1.00 94.77  ? 5   DA  L N9    1 
ATOM 10639 C C8    . DA  N 2 5   ? 72.122  70.434  32.548  1.00 93.46  ? 5   DA  L C8    1 
ATOM 10640 N N7    . DA  N 2 5   ? 71.465  70.252  31.426  1.00 93.73  ? 5   DA  L N7    1 
ATOM 10641 C C5    . DA  N 2 5   ? 70.141  70.209  31.824  1.00 95.32  ? 5   DA  L C5    1 
ATOM 10642 C C6    . DA  N 2 5   ? 68.942  70.043  31.110  1.00 96.39  ? 5   DA  L C6    1 
ATOM 10643 N N6    . DA  N 2 5   ? 68.906  69.891  29.788  1.00 95.96  ? 5   DA  L N6    1 
ATOM 10644 N N1    . DA  N 2 5   ? 67.784  70.042  31.805  1.00 97.99  ? 5   DA  L N1    1 
ATOM 10645 C C2    . DA  N 2 5   ? 67.833  70.202  33.135  1.00 98.50  ? 5   DA  L C2    1 
ATOM 10646 N N3    . DA  N 2 5   ? 68.899  70.372  33.920  1.00 97.60  ? 5   DA  L N3    1 
ATOM 10647 C C4    . DA  N 2 5   ? 70.029  70.366  33.192  1.00 96.00  ? 5   DA  L C4    1 
ATOM 10648 P P     . DG  N 2 6   ? 72.982  68.893  38.470  1.00 91.60  ? 6   DG  L P     1 
ATOM 10649 O OP1   . DG  N 2 6   ? 73.321  68.970  39.917  1.00 91.84  ? 6   DG  L OP1   1 
ATOM 10650 O OP2   . DG  N 2 6   ? 73.424  67.754  37.627  1.00 89.06  ? 6   DG  L OP2   1 
ATOM 10651 O "O5'" . DG  N 2 6   ? 71.397  69.043  38.351  1.00 93.74  ? 6   DG  L "O5'" 1 
ATOM 10652 C "C5'" . DG  N 2 6   ? 70.580  68.146  39.033  1.00 93.69  ? 6   DG  L "C5'" 1 
ATOM 10653 C "C4'" . DG  N 2 6   ? 69.496  67.671  38.097  1.00 94.02  ? 6   DG  L "C4'" 1 
ATOM 10654 O "O4'" . DG  N 2 6   ? 69.887  67.826  36.718  1.00 93.23  ? 6   DG  L "O4'" 1 
ATOM 10655 C "C3'" . DG  N 2 6   ? 69.198  66.186  38.188  1.00 92.31  ? 6   DG  L "C3'" 1 
ATOM 10656 O "O3'" . DG  N 2 6   ? 68.152  65.967  39.063  1.00 93.78  ? 6   DG  L "O3'" 1 
ATOM 10657 C "C2'" . DG  N 2 6   ? 68.755  65.803  36.784  1.00 91.80  ? 6   DG  L "C2'" 1 
ATOM 10658 C "C1'" . DG  N 2 6   ? 68.870  67.123  36.039  1.00 93.27  ? 6   DG  L "C1'" 1 
ATOM 10659 N N9    . DG  N 2 6   ? 69.161  67.017  34.615  1.00 92.27  ? 6   DG  L N9    1 
ATOM 10660 C C8    . DG  N 2 6   ? 70.382  67.000  33.992  1.00 90.52  ? 6   DG  L C8    1 
ATOM 10661 N N7    . DG  N 2 6   ? 70.285  66.909  32.696  1.00 90.17  ? 6   DG  L N7    1 
ATOM 10662 C C5    . DG  N 2 6   ? 68.919  66.866  32.450  1.00 91.75  ? 6   DG  L C5    1 
ATOM 10663 C C6    . DG  N 2 6   ? 68.199  66.767  31.236  1.00 92.22  ? 6   DG  L C6    1 
ATOM 10664 O O6    . DG  N 2 6   ? 68.634  66.697  30.079  1.00 91.33  ? 6   DG  L O6    1 
ATOM 10665 N N1    . DG  N 2 6   ? 66.825  66.755  31.444  1.00 94.03  ? 6   DG  L N1    1 
ATOM 10666 C C2    . DG  N 2 6   ? 66.225  66.829  32.673  1.00 95.26  ? 6   DG  L C2    1 
ATOM 10667 N N2    . DG  N 2 6   ? 64.887  66.798  32.676  1.00 97.04  ? 6   DG  L N2    1 
ATOM 10668 N N3    . DG  N 2 6   ? 66.884  66.924  33.817  1.00 94.86  ? 6   DG  L N3    1 
ATOM 10669 C C4    . DG  N 2 6   ? 68.220  66.934  33.625  1.00 93.06  ? 6   DG  L C4    1 
ATOM 10670 P P     . DT  N 2 7   ? 67.775  64.466  39.441  1.00 92.44  ? 7   DT  L P     1 
ATOM 10671 O OP1   . DT  N 2 7   ? 67.175  64.464  40.797  1.00 93.96  ? 7   DT  L OP1   1 
ATOM 10672 O OP2   . DT  N 2 7   ? 68.982  63.662  39.131  1.00 89.61  ? 7   DT  L OP2   1 
ATOM 10673 O "O5'" . DT  N 2 7   ? 66.651  64.084  38.378  1.00 93.00  ? 7   DT  L "O5'" 1 
ATOM 10674 C "C5'" . DT  N 2 7   ? 65.445  64.804  38.419  1.00 95.67  ? 7   DT  L "C5'" 1 
ATOM 10675 C "C4'" . DT  N 2 7   ? 64.581  64.400  37.248  1.00 95.83  ? 7   DT  L "C4'" 1 
ATOM 10676 O "O4'" . DT  N 2 7   ? 65.332  64.604  36.035  1.00 94.51  ? 7   DT  L "O4'" 1 
ATOM 10677 C "C3'" . DT  N 2 7   ? 64.175  62.937  37.239  1.00 94.51  ? 7   DT  L "C3'" 1 
ATOM 10678 O "O3'" . DT  N 2 7   ? 62.762  62.829  37.222  1.00 96.45  ? 7   DT  L "O3'" 1 
ATOM 10679 C "C2'" . DT  N 2 7   ? 64.787  62.385  35.957  1.00 92.35  ? 7   DT  L "C2'" 1 
ATOM 10680 C "C1'" . DT  N 2 7   ? 64.955  63.624  35.108  1.00 93.36  ? 7   DT  L "C1'" 1 
ATOM 10681 N N1    . DT  N 2 7   ? 66.057  63.546  34.135  1.00 91.36  ? 7   DT  L N1    1 
ATOM 10682 C C2    . DT  N 2 7   ? 65.778  63.444  32.791  1.00 91.14  ? 7   DT  L C2    1 
ATOM 10683 O O2    . DT  N 2 7   ? 64.648  63.397  32.334  1.00 92.48  ? 7   DT  L O2    1 
ATOM 10684 N N3    . DT  N 2 7   ? 66.890  63.395  31.995  1.00 89.34  ? 7   DT  L N3    1 
ATOM 10685 C C4    . DT  N 2 7   ? 68.207  63.440  32.401  1.00 87.80  ? 7   DT  L C4    1 
ATOM 10686 O O4    . DT  N 2 7   ? 69.143  63.394  31.621  1.00 86.33  ? 7   DT  L O4    1 
ATOM 10687 C C5    . DT  N 2 7   ? 68.424  63.551  33.810  1.00 88.10  ? 7   DT  L C5    1 
ATOM 10688 C C7    . DT  N 2 7   ? 69.828  63.603  34.328  1.00 86.54  ? 7   DT  L C7    1 
ATOM 10689 C C6    . DT  N 2 7   ? 67.351  63.603  34.603  1.00 89.85  ? 7   DT  L C6    1 
ATOM 10690 P P     . DT  N 2 8   ? 62.055  61.384  37.123  1.00 95.69  ? 8   DT  L P     1 
ATOM 10691 O OP1   . DT  N 2 8   ? 60.661  61.593  37.596  1.00 98.33  ? 8   DT  L OP1   1 
ATOM 10692 O OP2   . DT  N 2 8   ? 62.937  60.339  37.720  1.00 93.44  ? 8   DT  L OP2   1 
ATOM 10693 O "O5'" . DT  N 2 8   ? 62.010  61.083  35.556  1.00 94.63  ? 8   DT  L "O5'" 1 
ATOM 10694 C "C5'" . DT  N 2 8   ? 61.203  61.912  34.745  1.00 96.49  ? 8   DT  L "C5'" 1 
ATOM 10695 C "C4'" . DT  N 2 8   ? 61.002  61.193  33.437  1.00 95.35  ? 8   DT  L "C4'" 1 
ATOM 10696 O "O4'" . DT  N 2 8   ? 62.206  61.315  32.651  1.00 93.40  ? 8   DT  L "O4'" 1 
ATOM 10697 C "C3'" . DT  N 2 8   ? 60.745  59.709  33.632  1.00 94.05  ? 8   DT  L "C3'" 1 
ATOM 10698 O "O3'" . DT  N 2 8   ? 59.501  59.433  32.998  1.00 95.36  ? 8   DT  L "O3'" 1 
ATOM 10699 C "C2'" . DT  N 2 8   ? 61.984  59.010  33.066  1.00 91.15  ? 8   DT  L "C2'" 1 
ATOM 10700 C "C1'" . DT  N 2 8   ? 62.577  60.058  32.138  1.00 91.14  ? 8   DT  L "C1'" 1 
ATOM 10701 N N1    . DT  N 2 8   ? 64.057  60.069  32.060  1.00 89.01  ? 8   DT  L N1    1 
ATOM 10702 C C2    . DT  N 2 8   ? 64.622  60.014  30.807  1.00 87.74  ? 8   DT  L C2    1 
ATOM 10703 O O2    . DT  N 2 8   ? 63.962  59.946  29.783  1.00 88.25  ? 8   DT  L O2    1 
ATOM 10704 N N3    . DT  N 2 8   ? 65.992  60.039  30.802  1.00 85.90  ? 8   DT  L N3    1 
ATOM 10705 C C4    . DT  N 2 8   ? 66.819  60.119  31.904  1.00 85.24  ? 8   DT  L C4    1 
ATOM 10706 O O4    . DT  N 2 8   ? 68.035  60.137  31.811  1.00 83.64  ? 8   DT  L O4    1 
ATOM 10707 C C5    . DT  N 2 8   ? 66.170  60.178  33.181  1.00 86.62  ? 8   DT  L C5    1 
ATOM 10708 C C7    . DT  N 2 8   ? 67.026  60.252  34.409  1.00 86.01  ? 8   DT  L C7    1 
ATOM 10709 C C6    . DT  N 2 8   ? 64.828  60.152  33.206  1.00 88.45  ? 8   DT  L C6    1 
ATOM 10710 P P     . DA  N 2 9   ? 59.339  58.237  31.936  1.00 99.22  ? 9   DA  L P     1 
ATOM 10711 O OP1   . DA  N 2 9   ? 57.872  58.098  31.765  1.00 101.40 ? 9   DA  L OP1   1 
ATOM 10712 O OP2   . DA  N 2 9   ? 60.102  57.031  32.377  1.00 96.68  ? 9   DA  L OP2   1 
ATOM 10713 O "O5'" . DA  N 2 9   ? 59.986  58.850  30.583  1.00 98.27  ? 9   DA  L "O5'" 1 
ATOM 10714 C "C5'" . DA  N 2 9   ? 59.368  58.750  29.272  1.00 98.73  ? 9   DA  L "C5'" 1 
ATOM 10715 C "C4'" . DA  N 2 9   ? 59.909  57.644  28.355  1.00 96.32  ? 9   DA  L "C4'" 1 
ATOM 10716 O "O4'" . DA  N 2 9   ? 61.364  57.646  28.318  1.00 94.16  ? 9   DA  L "O4'" 1 
ATOM 10717 C "C3'" . DA  N 2 9   ? 59.555  56.207  28.709  1.00 95.52  ? 9   DA  L "C3'" 1 
ATOM 10718 O "O3'" . DA  N 2 9   ? 59.688  55.419  27.537  1.00 94.20  ? 9   DA  L "O3'" 1 
ATOM 10719 C "C2'" . DA  N 2 9   ? 60.690  55.888  29.666  1.00 93.84  ? 9   DA  L "C2'" 1 
ATOM 10720 C "C1'" . DA  N 2 9   ? 61.835  56.399  28.798  1.00 92.50  ? 9   DA  L "C1'" 1 
ATOM 10721 N N9    . DA  N 2 9   ? 63.111  56.568  29.503  1.00 91.10  ? 9   DA  L N9    1 
ATOM 10722 C C8    . DA  N 2 9   ? 63.286  56.701  30.853  1.00 91.31  ? 9   DA  L C8    1 
ATOM 10723 N N7    . DA  N 2 9   ? 64.539  56.838  31.225  1.00 89.71  ? 9   DA  L N7    1 
ATOM 10724 C C5    . DA  N 2 9   ? 65.238  56.792  30.040  1.00 88.20  ? 9   DA  L C5    1 
ATOM 10725 C C6    . DA  N 2 9   ? 66.607  56.884  29.770  1.00 86.17  ? 9   DA  L C6    1 
ATOM 10726 N N6    . DA  N 2 9   ? 67.523  57.040  30.724  1.00 85.33  ? 9   DA  L N6    1 
ATOM 10727 N N1    . DA  N 2 9   ? 66.999  56.802  28.487  1.00 85.16  ? 9   DA  L N1    1 
ATOM 10728 C C2    . DA  N 2 9   ? 66.060  56.638  27.546  1.00 85.88  ? 9   DA  L C2    1 
ATOM 10729 N N3    . DA  N 2 9   ? 64.736  56.539  27.676  1.00 88.06  ? 9   DA  L N3    1 
ATOM 10730 C C4    . DA  N 2 9   ? 64.384  56.624  28.967  1.00 89.11  ? 9   DA  L C4    1 
ATOM 10731 P P     . DG  N 2 10  ? 58.804  54.084  27.328  1.00 91.53  ? 10  DG  L P     1 
ATOM 10732 O OP1   . DG  N 2 10  ? 57.428  54.569  27.075  1.00 94.08  ? 10  DG  L OP1   1 
ATOM 10733 O OP2   . DG  N 2 10  ? 59.048  53.058  28.382  1.00 90.58  ? 10  DG  L OP2   1 
ATOM 10734 O "O5'" . DG  N 2 10  ? 59.386  53.464  25.978  1.00 89.20  ? 10  DG  L "O5'" 1 
ATOM 10735 C "C5'" . DG  N 2 10  ? 60.552  54.033  25.380  1.00 87.94  ? 10  DG  L "C5'" 1 
ATOM 10736 C "C4'" . DG  N 2 10  ? 61.798  53.157  25.540  1.00 85.25  ? 10  DG  L "C4'" 1 
ATOM 10737 O "O4'" . DG  N 2 10  ? 62.582  53.594  26.670  1.00 85.09  ? 10  DG  L "O4'" 1 
ATOM 10738 C "C3'" . DG  N 2 10  ? 61.639  51.649  25.723  1.00 84.14  ? 10  DG  L "C3'" 1 
ATOM 10739 O "O3'" . DG  N 2 10  ? 61.852  51.107  24.443  1.00 83.08  ? 10  DG  L "O3'" 1 
ATOM 10740 C "C2'" . DG  N 2 10  ? 62.757  51.284  26.703  1.00 82.52  ? 10  DG  L "C2'" 1 
ATOM 10741 C "C1'" . DG  N 2 10  ? 63.541  52.588  26.862  1.00 82.76  ? 10  DG  L "C1'" 1 
ATOM 10742 N N9    . DG  N 2 10  ? 64.130  52.870  28.169  1.00 82.54  ? 10  DG  L N9    1 
ATOM 10743 C C8    . DG  N 2 10  ? 63.454  52.941  29.359  1.00 84.11  ? 10  DG  L C8    1 
ATOM 10744 N N7    . DG  N 2 10  ? 64.225  53.226  30.369  1.00 83.59  ? 10  DG  L N7    1 
ATOM 10745 C C5    . DG  N 2 10  ? 65.494  53.365  29.818  1.00 81.63  ? 10  DG  L C5    1 
ATOM 10746 C C6    . DG  N 2 10  ? 66.735  53.671  30.434  1.00 80.46  ? 10  DG  L C6    1 
ATOM 10747 O O6    . DG  N 2 10  ? 66.972  53.892  31.631  1.00 80.78  ? 10  DG  L O6    1 
ATOM 10748 N N1    . DG  N 2 10  ? 67.780  53.711  29.525  1.00 78.84  ? 10  DG  L N1    1 
ATOM 10749 C C2    . DG  N 2 10  ? 67.637  53.492  28.189  1.00 78.43  ? 10  DG  L C2    1 
ATOM 10750 N N2    . DG  N 2 10  ? 68.760  53.585  27.475  1.00 76.93  ? 10  DG  L N2    1 
ATOM 10751 N N3    . DG  N 2 10  ? 66.489  53.207  27.590  1.00 79.47  ? 10  DG  L N3    1 
ATOM 10752 C C4    . DG  N 2 10  ? 65.453  53.155  28.462  1.00 81.05  ? 10  DG  L C4    1 
ATOM 10753 P P     . DA  N 2 11  ? 62.075  49.526  24.221  1.00 79.97  ? 11  DA  L P     1 
ATOM 10754 O OP1   . DA  N 2 11  ? 61.309  49.213  22.992  1.00 80.59  ? 11  DA  L OP1   1 
ATOM 10755 O OP2   . DA  N 2 11  ? 61.857  48.741  25.474  1.00 79.96  ? 11  DA  L OP2   1 
ATOM 10756 O "O5'" . DA  N 2 11  ? 63.622  49.402  23.841  1.00 77.53  ? 11  DA  L "O5'" 1 
ATOM 10757 C "C5'" . DA  N 2 11  ? 64.364  48.247  24.213  1.00 75.71  ? 11  DA  L "C5'" 1 
ATOM 10758 C "C4'" . DA  N 2 11  ? 65.790  48.687  24.472  1.00 74.24  ? 11  DA  L "C4'" 1 
ATOM 10759 O "O4'" . DA  N 2 11  ? 65.798  49.734  25.459  1.00 75.31  ? 11  DA  L "O4'" 1 
ATOM 10760 C "C3'" . DA  N 2 11  ? 66.693  47.661  25.103  1.00 72.45  ? 11  DA  L "C3'" 1 
ATOM 10761 O "O3'" . DA  N 2 11  ? 67.214  46.891  24.097  1.00 70.99  ? 11  DA  L "O3'" 1 
ATOM 10762 C "C2'" . DA  N 2 11  ? 67.811  48.501  25.695  1.00 71.81  ? 11  DA  L "C2'" 1 
ATOM 10763 C "C1'" . DA  N 2 11  ? 67.079  49.783  26.051  1.00 73.84  ? 11  DA  L "C1'" 1 
ATOM 10764 N N9    . DA  N 2 11  ? 66.902  49.962  27.482  1.00 74.61  ? 11  DA  L N9    1 
ATOM 10765 C C8    . DA  N 2 11  ? 65.742  49.932  28.203  1.00 76.33  ? 11  DA  L C8    1 
ATOM 10766 N N7    . DA  N 2 11  ? 65.920  50.142  29.486  1.00 76.70  ? 11  DA  L N7    1 
ATOM 10767 C C5    . DA  N 2 11  ? 67.290  50.321  29.606  1.00 75.07  ? 11  DA  L C5    1 
ATOM 10768 C C6    . DA  N 2 11  ? 68.133  50.581  30.704  1.00 74.58  ? 11  DA  L C6    1 
ATOM 10769 N N6    . DA  N 2 11  ? 67.704  50.713  31.960  1.00 75.73  ? 11  DA  L N6    1 
ATOM 10770 N N1    . DA  N 2 11  ? 69.452  50.701  30.459  1.00 72.91  ? 11  DA  L N1    1 
ATOM 10771 C C2    . DA  N 2 11  ? 69.898  50.568  29.205  1.00 71.84  ? 11  DA  L C2    1 
ATOM 10772 N N3    . DA  N 2 11  ? 69.209  50.326  28.093  1.00 72.16  ? 11  DA  L N3    1 
ATOM 10773 C C4    . DA  N 2 11  ? 67.905  50.214  28.375  1.00 73.79  ? 11  DA  L C4    1 
ATOM 10774 P P     . DT  N 2 12  ? 67.465  45.345  24.382  1.00 68.64  ? 12  DT  L P     1 
ATOM 10775 O OP1   . DT  N 2 12  ? 67.704  44.638  23.100  1.00 67.60  ? 12  DT  L OP1   1 
ATOM 10776 O OP2   . DT  N 2 12  ? 66.362  44.965  25.304  1.00 70.06  ? 12  DT  L OP2   1 
ATOM 10777 O "O5'" . DT  N 2 12  ? 68.824  45.336  25.207  1.00 67.16  ? 12  DT  L "O5'" 1 
ATOM 10778 C "C5'" . DT  N 2 12  ? 69.934  45.868  24.550  1.00 66.01  ? 12  DT  L "C5'" 1 
ATOM 10779 C "C4'" . DT  N 2 12  ? 71.137  45.705  25.437  1.00 64.69  ? 12  DT  L "C4'" 1 
ATOM 10780 O "O4'" . DT  N 2 12  ? 70.892  46.459  26.638  1.00 65.78  ? 12  DT  L "O4'" 1 
ATOM 10781 C "C3'" . DT  N 2 12  ? 71.393  44.282  25.877  1.00 63.62  ? 12  DT  L "C3'" 1 
ATOM 10782 O "O3'" . DT  N 2 12  ? 72.770  44.053  25.755  1.00 61.88  ? 12  DT  L "O3'" 1 
ATOM 10783 C "C2'" . DT  N 2 12  ? 70.944  44.262  27.334  1.00 64.54  ? 12  DT  L "C2'" 1 
ATOM 10784 C "C1'" . DT  N 2 12  ? 71.241  45.684  27.759  1.00 65.17  ? 12  DT  L "C1'" 1 
ATOM 10785 N N1    . DT  N 2 12  ? 70.390  46.203  28.849  1.00 66.87  ? 12  DT  L N1    1 
ATOM 10786 C C2    . DT  N 2 12  ? 70.966  46.889  29.886  1.00 66.97  ? 12  DT  L C2    1 
ATOM 10787 O O2    . DT  N 2 12  ? 72.156  47.071  29.965  1.00 65.69  ? 12  DT  L O2    1 
ATOM 10788 N N3    . DT  N 2 12  ? 70.096  47.345  30.832  1.00 68.68  ? 12  DT  L N3    1 
ATOM 10789 C C4    . DT  N 2 12  ? 68.723  47.181  30.840  1.00 70.31  ? 12  DT  L C4    1 
ATOM 10790 O O4    . DT  N 2 12  ? 68.012  47.623  31.740  1.00 71.90  ? 12  DT  L O4    1 
ATOM 10791 C C5    . DT  N 2 12  ? 68.183  46.460  29.714  1.00 70.10  ? 12  DT  L C5    1 
ATOM 10792 C C7    . DT  N 2 12  ? 66.710  46.221  29.601  1.00 71.84  ? 12  DT  L C7    1 
ATOM 10793 C C6    . DT  N 2 12  ? 69.028  46.016  28.780  1.00 68.41  ? 12  DT  L C6    1 
ATOM 10794 P P     . DA  N 2 13  ? 73.376  42.604  26.095  1.00 60.49  ? 13  DA  L P     1 
ATOM 10795 O OP1   . DA  N 2 13  ? 74.573  42.431  25.239  1.00 58.89  ? 13  DA  L OP1   1 
ATOM 10796 O OP2   . DA  N 2 13  ? 72.285  41.591  26.063  1.00 61.20  ? 13  DA  L OP2   1 
ATOM 10797 O "O5'" . DA  N 2 13  ? 73.844  42.745  27.608  1.00 60.45  ? 13  DA  L "O5'" 1 
ATOM 10798 C "C5'" . DA  N 2 13  ? 74.889  43.631  27.879  1.00 59.85  ? 13  DA  L "C5'" 1 
ATOM 10799 C "C4'" . DA  N 2 13  ? 75.171  43.604  29.361  1.00 59.97  ? 13  DA  L "C4'" 1 
ATOM 10800 O "O4'" . DA  N 2 13  ? 74.097  44.293  30.042  1.00 61.77  ? 13  DA  L "O4'" 1 
ATOM 10801 C "C3'" . DA  N 2 13  ? 75.253  42.208  29.955  1.00 59.38  ? 13  DA  L "C3'" 1 
ATOM 10802 O "O3'" . DA  N 2 13  ? 76.546  41.978  30.467  1.00 58.04  ? 13  DA  L "O3'" 1 
ATOM 10803 C "C2'" . DA  N 2 13  ? 74.211  42.197  31.069  1.00 60.95  ? 13  DA  L "C2'" 1 
ATOM 10804 C "C1'" . DA  N 2 13  ? 73.897  43.666  31.286  1.00 62.11  ? 13  DA  L "C1'" 1 
ATOM 10805 N N9    . DA  N 2 13  ? 72.518  43.910  31.678  1.00 64.01  ? 13  DA  L N9    1 
ATOM 10806 C C8    . DA  N 2 13  ? 71.403  43.666  30.928  1.00 64.92  ? 13  DA  L C8    1 
ATOM 10807 N N7    . DA  N 2 13  ? 70.284  43.988  31.528  1.00 66.72  ? 13  DA  L N7    1 
ATOM 10808 C C5    . DA  N 2 13  ? 70.707  44.480  32.746  1.00 66.98  ? 13  DA  L C5    1 
ATOM 10809 C C6    . DA  N 2 13  ? 70.000  44.976  33.832  1.00 68.65  ? 13  DA  L C6    1 
ATOM 10810 N N6    . DA  N 2 13  ? 68.676  45.057  33.832  1.00 70.42  ? 13  DA  L N6    1 
ATOM 10811 N N1    . DA  N 2 13  ? 70.704  45.381  34.897  1.00 68.50  ? 13  DA  L N1    1 
ATOM 10812 C C2    . DA  N 2 13  ? 72.032  45.291  34.873  1.00 66.77  ? 13  DA  L C2    1 
ATOM 10813 N N3    . DA  N 2 13  ? 72.812  44.838  33.906  1.00 65.11  ? 13  DA  L N3    1 
ATOM 10814 C C4    . DA  N 2 13  ? 72.075  44.445  32.862  1.00 65.32  ? 13  DA  L C4    1 
ATOM 10815 P P     . DT  N 2 14  ? 76.986  40.492  30.907  1.00 59.18  ? 14  DT  L P     1 
ATOM 10816 O OP1   . DT  N 2 14  ? 78.465  40.440  30.956  1.00 57.63  ? 14  DT  L OP1   1 
ATOM 10817 O OP2   . DT  N 2 14  ? 76.233  39.504  30.086  1.00 59.32  ? 14  DT  L OP2   1 
ATOM 10818 O "O5'" . DT  N 2 14  ? 76.457  40.355  32.413  1.00 60.29  ? 14  DT  L "O5'" 1 
ATOM 10819 C "C5'" . DT  N 2 14  ? 77.044  41.122  33.423  1.00 60.37  ? 14  DT  L "C5'" 1 
ATOM 10820 C "C4'" . DT  N 2 14  ? 76.115  41.268  34.611  1.00 62.00  ? 14  DT  L "C4'" 1 
ATOM 10821 O "O4'" . DT  N 2 14  ? 74.818  41.764  34.213  1.00 63.49  ? 14  DT  L "O4'" 1 
ATOM 10822 C "C3'" . DT  N 2 14  ? 75.690  40.007  35.330  1.00 62.39  ? 14  DT  L "C3'" 1 
ATOM 10823 O "O3'" . DT  N 2 14  ? 76.745  39.463  36.092  1.00 61.41  ? 14  DT  L "O3'" 1 
ATOM 10824 C "C2'" . DT  N 2 14  ? 74.580  40.568  36.214  1.00 64.34  ? 14  DT  L "C2'" 1 
ATOM 10825 C "C1'" . DT  N 2 14  ? 74.062  41.750  35.402  1.00 64.96  ? 14  DT  L "C1'" 1 
ATOM 10826 N N1    . DT  N 2 14  ? 72.638  41.689  35.057  1.00 66.49  ? 14  DT  L N1    1 
ATOM 10827 C C2    . DT  N 2 14  ? 71.731  42.126  35.977  1.00 68.28  ? 14  DT  L C2    1 
ATOM 1082