data_4LOX
# 
_entry.id   4LOX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4LOX         
NDB   NA2613       
RCSB  RCSB080902   
WWPDB D_1000080902 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4LQ0 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4LOX 
_pdbx_database_status.recvd_initial_deposition_date   2013-07-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chik, J.'     1 
'Shen, B.'     2 
'Stoddard, B.' 3 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of a LAGLIDADG endonuclease from 
the Sordaria Macrospore.
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chik, J.'     1 
primary 'Shen, B.'     2 
primary 'Stoddard, B.' 3 
# 
_cell.entry_id           4LOX 
_cell.length_a           61.284 
_cell.length_b           67.429 
_cell.length_c           98.090 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4LOX 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'LAGLIDADG homing endonuclease I-SmaMI'                       34124.738 1   ? ? 
'LHE homing endnuclease, UNP residues 114-415' ? 
2 polymer     syn 
;DNA (5'-D(*CP*GP*TP*AP*CP*AP*CP*CP*TP*GP*AP*TP*AP*A)-3')
;
4248.794  1   ? ? 'product of LHE cleavage'                      ? 
3 polymer     syn 
;DNA (5'-D(P*TP*GP*GP*AP*GP*GP*AP*TP*AP*CP*C)-3')
;
3398.235  1   ? ? 'product of LHE cleavage'                      ? 
4 polymer     syn 
;DNA (5'-D(*GP*GP*TP*AP*TP*CP*CP*TP*CP*CP*AP*TP*TP*AP*T)-3')
;
4534.958  1   ? ? 'product of LHE cleavage'                      ? 
5 polymer     syn 
;DNA (5'-D(P*CP*AP*GP*GP*TP*GP*TP*AP*CP*G)-3')
;
3085.028  1   ? ? 'product of LHE cleavage'                      ? 
6 non-polymer syn 'MAGNESIUM ION'                                               24.305    2   ? ? ? ? 
7 water       nat water                                                         18.015    116 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;SKGENGKLNPWAVVGFIDAEGSFMVRVRKNSKYKTGWLVVAIFSVTVDKKDLFLLESLKTFFGGLGSIKKSGNSTFSYRI
ESSEQLTKIILPFFDKYSLITEKLGDYLLFKKVLELMGTKEHLTQRGLEKIVSLKASINKGLSEELQAAFPQCVPTPRPE
INNKLIPDPFWLAGFVSGDGSFKSILKKSESIKVGFQSILVFQITQHARDVKLMESLISYLGCGFIEKDSRGPWLYYTVT
NFSDIQGKIIPFFHQYKIIGSKYGDYMDWCKIALIMQNKNHLTPEGLNEIRALKGGMNKGRL
;
;SKGENGKLNPWAVVGFIDAEGSFMVRVRKNSKYKTGWLVVAIFSVTVDKKDLFLLESLKTFFGGLGSIKKSGNSTFSYRI
ESSEQLTKIILPFFDKYSLITEKLGDYLLFKKVLELMGTKEHLTQRGLEKIVSLKASINKGLSEELQAAFPQCVPTPRPE
INNKLIPDPFWLAGFVSGDGSFKSILKKSESIKVGFQSILVFQITQHARDVKLMESLISYLGCGFIEKDSRGPWLYYTVT
NFSDIQGKIIPFFHQYKIIGSKYGDYMDWCKIALIMQNKNHLTPEGLNEIRALKGGMNKGRL
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DG)(DT)(DA)(DC)(DA)(DC)(DC)(DT)(DG)(DA)(DT)(DA)(DA)' CGTACACCTGATAA B ? 
3 polydeoxyribonucleotide no no '(DT)(DG)(DG)(DA)(DG)(DG)(DA)(DT)(DA)(DC)(DC)' TGGAGGATACC C ? 
4 polydeoxyribonucleotide no no '(DG)(DG)(DT)(DA)(DT)(DC)(DC)(DT)(DC)(DC)(DA)(DT)(DT)(DA)(DT)' GGTATCCTCCATTAT D ? 
5 polydeoxyribonucleotide no no '(DC)(DA)(DG)(DG)(DT)(DG)(DT)(DA)(DC)(DG)' CAGGTGTACG E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   LYS n 
1 3   GLY n 
1 4   GLU n 
1 5   ASN n 
1 6   GLY n 
1 7   LYS n 
1 8   LEU n 
1 9   ASN n 
1 10  PRO n 
1 11  TRP n 
1 12  ALA n 
1 13  VAL n 
1 14  VAL n 
1 15  GLY n 
1 16  PHE n 
1 17  ILE n 
1 18  ASP n 
1 19  ALA n 
1 20  GLU n 
1 21  GLY n 
1 22  SER n 
1 23  PHE n 
1 24  MET n 
1 25  VAL n 
1 26  ARG n 
1 27  VAL n 
1 28  ARG n 
1 29  LYS n 
1 30  ASN n 
1 31  SER n 
1 32  LYS n 
1 33  TYR n 
1 34  LYS n 
1 35  THR n 
1 36  GLY n 
1 37  TRP n 
1 38  LEU n 
1 39  VAL n 
1 40  VAL n 
1 41  ALA n 
1 42  ILE n 
1 43  PHE n 
1 44  SER n 
1 45  VAL n 
1 46  THR n 
1 47  VAL n 
1 48  ASP n 
1 49  LYS n 
1 50  LYS n 
1 51  ASP n 
1 52  LEU n 
1 53  PHE n 
1 54  LEU n 
1 55  LEU n 
1 56  GLU n 
1 57  SER n 
1 58  LEU n 
1 59  LYS n 
1 60  THR n 
1 61  PHE n 
1 62  PHE n 
1 63  GLY n 
1 64  GLY n 
1 65  LEU n 
1 66  GLY n 
1 67  SER n 
1 68  ILE n 
1 69  LYS n 
1 70  LYS n 
1 71  SER n 
1 72  GLY n 
1 73  ASN n 
1 74  SER n 
1 75  THR n 
1 76  PHE n 
1 77  SER n 
1 78  TYR n 
1 79  ARG n 
1 80  ILE n 
1 81  GLU n 
1 82  SER n 
1 83  SER n 
1 84  GLU n 
1 85  GLN n 
1 86  LEU n 
1 87  THR n 
1 88  LYS n 
1 89  ILE n 
1 90  ILE n 
1 91  LEU n 
1 92  PRO n 
1 93  PHE n 
1 94  PHE n 
1 95  ASP n 
1 96  LYS n 
1 97  TYR n 
1 98  SER n 
1 99  LEU n 
1 100 ILE n 
1 101 THR n 
1 102 GLU n 
1 103 LYS n 
1 104 LEU n 
1 105 GLY n 
1 106 ASP n 
1 107 TYR n 
1 108 LEU n 
1 109 LEU n 
1 110 PHE n 
1 111 LYS n 
1 112 LYS n 
1 113 VAL n 
1 114 LEU n 
1 115 GLU n 
1 116 LEU n 
1 117 MET n 
1 118 GLY n 
1 119 THR n 
1 120 LYS n 
1 121 GLU n 
1 122 HIS n 
1 123 LEU n 
1 124 THR n 
1 125 GLN n 
1 126 ARG n 
1 127 GLY n 
1 128 LEU n 
1 129 GLU n 
1 130 LYS n 
1 131 ILE n 
1 132 VAL n 
1 133 SER n 
1 134 LEU n 
1 135 LYS n 
1 136 ALA n 
1 137 SER n 
1 138 ILE n 
1 139 ASN n 
1 140 LYS n 
1 141 GLY n 
1 142 LEU n 
1 143 SER n 
1 144 GLU n 
1 145 GLU n 
1 146 LEU n 
1 147 GLN n 
1 148 ALA n 
1 149 ALA n 
1 150 PHE n 
1 151 PRO n 
1 152 GLN n 
1 153 CYS n 
1 154 VAL n 
1 155 PRO n 
1 156 THR n 
1 157 PRO n 
1 158 ARG n 
1 159 PRO n 
1 160 GLU n 
1 161 ILE n 
1 162 ASN n 
1 163 ASN n 
1 164 LYS n 
1 165 LEU n 
1 166 ILE n 
1 167 PRO n 
1 168 ASP n 
1 169 PRO n 
1 170 PHE n 
1 171 TRP n 
1 172 LEU n 
1 173 ALA n 
1 174 GLY n 
1 175 PHE n 
1 176 VAL n 
1 177 SER n 
1 178 GLY n 
1 179 ASP n 
1 180 GLY n 
1 181 SER n 
1 182 PHE n 
1 183 LYS n 
1 184 SER n 
1 185 ILE n 
1 186 LEU n 
1 187 LYS n 
1 188 LYS n 
1 189 SER n 
1 190 GLU n 
1 191 SER n 
1 192 ILE n 
1 193 LYS n 
1 194 VAL n 
1 195 GLY n 
1 196 PHE n 
1 197 GLN n 
1 198 SER n 
1 199 ILE n 
1 200 LEU n 
1 201 VAL n 
1 202 PHE n 
1 203 GLN n 
1 204 ILE n 
1 205 THR n 
1 206 GLN n 
1 207 HIS n 
1 208 ALA n 
1 209 ARG n 
1 210 ASP n 
1 211 VAL n 
1 212 LYS n 
1 213 LEU n 
1 214 MET n 
1 215 GLU n 
1 216 SER n 
1 217 LEU n 
1 218 ILE n 
1 219 SER n 
1 220 TYR n 
1 221 LEU n 
1 222 GLY n 
1 223 CYS n 
1 224 GLY n 
1 225 PHE n 
1 226 ILE n 
1 227 GLU n 
1 228 LYS n 
1 229 ASP n 
1 230 SER n 
1 231 ARG n 
1 232 GLY n 
1 233 PRO n 
1 234 TRP n 
1 235 LEU n 
1 236 TYR n 
1 237 TYR n 
1 238 THR n 
1 239 VAL n 
1 240 THR n 
1 241 ASN n 
1 242 PHE n 
1 243 SER n 
1 244 ASP n 
1 245 ILE n 
1 246 GLN n 
1 247 GLY n 
1 248 LYS n 
1 249 ILE n 
1 250 ILE n 
1 251 PRO n 
1 252 PHE n 
1 253 PHE n 
1 254 HIS n 
1 255 GLN n 
1 256 TYR n 
1 257 LYS n 
1 258 ILE n 
1 259 ILE n 
1 260 GLY n 
1 261 SER n 
1 262 LYS n 
1 263 TYR n 
1 264 GLY n 
1 265 ASP n 
1 266 TYR n 
1 267 MET n 
1 268 ASP n 
1 269 TRP n 
1 270 CYS n 
1 271 LYS n 
1 272 ILE n 
1 273 ALA n 
1 274 LEU n 
1 275 ILE n 
1 276 MET n 
1 277 GLN n 
1 278 ASN n 
1 279 LYS n 
1 280 ASN n 
1 281 HIS n 
1 282 LEU n 
1 283 THR n 
1 284 PRO n 
1 285 GLU n 
1 286 GLY n 
1 287 LEU n 
1 288 ASN n 
1 289 GLU n 
1 290 ILE n 
1 291 ARG n 
1 292 ALA n 
1 293 LEU n 
1 294 LYS n 
1 295 GLY n 
1 296 GLY n 
1 297 MET n 
1 298 ASN n 
1 299 LYS n 
1 300 GLY n 
1 301 ARG n 
1 302 LEU n 
2 1   DC  n 
2 2   DG  n 
2 3   DT  n 
2 4   DA  n 
2 5   DC  n 
2 6   DA  n 
2 7   DC  n 
2 8   DC  n 
2 9   DT  n 
2 10  DG  n 
2 11  DA  n 
2 12  DT  n 
2 13  DA  n 
2 14  DA  n 
3 1   DT  n 
3 2   DG  n 
3 3   DG  n 
3 4   DA  n 
3 5   DG  n 
3 6   DG  n 
3 7   DA  n 
3 8   DT  n 
3 9   DA  n 
3 10  DC  n 
3 11  DC  n 
4 1   DG  n 
4 2   DG  n 
4 3   DT  n 
4 4   DA  n 
4 5   DT  n 
4 6   DC  n 
4 7   DC  n 
4 8   DT  n 
4 9   DC  n 
4 10  DC  n 
4 11  DA  n 
4 12  DT  n 
4 13  DT  n 
4 14  DA  n 
4 15  DT  n 
5 1   DC  n 
5 2   DA  n 
5 3   DG  n 
5 4   DG  n 
5 5   DT  n 
5 6   DG  n 
5 7   DT  n 
5 8   DA  n 
5 9   DC  n 
5 10  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Cytochrome c oxidase subunit 1, mitochondrial Introne encoded, SMAC_12671' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC MYA-333 / DSM 997 / K(L3346) / K-hell' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sordaria macrospora' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     771870 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3), IRL+' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP F7WD42_SORMK F7WD42 1 
;SKGENSKLNPWAVVGFIDAEGSFMVRVRKNSKYKTGWLVVAIFSVTVDKKDLFLLESLKTFFGGLGSIKKSGNSTFSYRI
ESSEQLTKIILPFFDKYSLITEKLGDYLLFKKVLELMGTKEHLTQRGLEKIVSLKASINKGLSEELQAAFPQCVPTPRPE
INNKLIPDPFWLAGFVSGDGSFKSILKKSESIKVGFQSILVFQITQHARDVKLMESLISYLGCGFIEKDSRGPWLYYTVT
NFSDIQGKIIPFFHQYKIIGSKYGDYMDWCKIALIMQNKNHLTPEGLNEIRALKGGMNKGRL
;
114 ? 
2 PDB 4LOX         4LOX   2 CGTACACCTGATAA ?   ? 
3 PDB 4LOX         4LOX   3 TGGAGGATACC ?   ? 
4 PDB 4LOX         4LOX   4 GGTATCCTCCATTAT ?   ? 
5 PDB 4LOX         4LOX   5 CAGGTGTACG ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4LOX A 1 ? 302 ? F7WD42 114 ? 415 ? 1  302 
2 2 4LOX B 1 ? 14  ? 4LOX   1   ? 14  ? 1  14  
3 3 4LOX C 1 ? 11  ? 4LOX   15  ? 25  ? 15 25  
4 4 4LOX D 1 ? 15  ? 4LOX   1   ? 15  ? 1  15  
5 5 4LOX E 1 ? 10  ? 4LOX   16  ? 25  ? 16 25  
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             4LOX 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      6 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   F7WD42 
_struct_ref_seq_dif.db_mon_id                    SER 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          119 
_struct_ref_seq_dif.details                      'CLONING ARTIFACT' 
_struct_ref_seq_dif.pdbx_auth_seq_num            6 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4LOX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.05 
_exptl_crystal.density_percent_sol   40.01 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'20% PEG550 MME, 50mM magnesium chloride, 0.1M TrisHCl, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           170 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV++' 
_diffrn_detector.pdbx_collection_date   2012 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4LOX 
_reflns.observed_criterion_sigma_I   2.92 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            1.98 
_reflns.number_obs                   29068 
_reflns.number_all                   26452 
_reflns.percent_possible_obs         91.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.054 
_reflns.pdbx_netI_over_sigmaI        13.52 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.9 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
1 1 1.98 2.06 55.3 ? 0.300 ? 1.8 ? ? ? ? ? ? 
1 2 2.06 2.14 71.1 ? 0.223 ? 2.1 ? ? ? ? ? ? 
1 3 2.14 2.24 89.0 ? 0.176 ? 2.5 ? ? ? ? ? ? 
1 4 2.24 2.36 100  ? 0.151 ? 3.1 ? ? ? ? ? ? 
1 5 2.36 2.51 100  ? 0.120 ? 3.1 ? ? ? ? ? ? 
1 6 2.51 2.70 100  ? 0.094 ? 3.1 ? ? ? ? ? ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4LOX 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     25028 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.56 
_refine.ls_d_res_high                            1.98 
_refine.ls_percent_reflns_obs                    91.08 
_refine.ls_R_factor_obs                          0.19059 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18606 
_refine.ls_R_factor_R_free                       0.27697 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1334 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.960 
_refine.correlation_coeff_Fo_to_Fc_free          0.915 
_refine.B_iso_mean                               37.069 
_refine.aniso_B[1][1]                            2.56 
_refine.aniso_B[2][2]                            -0.57 
_refine.aniso_B[3][3]                            -2.00 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3QQY' 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.216 
_refine.overall_SU_ML                            0.150 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             11.836 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2391 
_refine_hist.pdbx_number_atoms_nucleic_acid   1021 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             116 
_refine_hist.number_atoms_total               3530 
_refine_hist.d_res_high                       1.98 
_refine_hist.d_res_low                        29.56 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.017  ? 3592 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.691  1.697  ? 5052 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.489  5.000  ? 301  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.231 24.300 ? 100  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.959 15.000 ? 465  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       13.060 15.000 ? 9    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.122  0.200  ? 511  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.009  0.021  ? 2324 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           3.343  3.000  ? 3592 'X-RAY DIFFRACTION' ? 
r_sphericity_free            24.822 5.000  ? 35   'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          10.729 5.000  ? 3500 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.981 
_refine_ls_shell.d_res_low                        2.033 
_refine_ls_shell.number_reflns_R_work             981 
_refine_ls_shell.R_factor_R_work                  0.223 
_refine_ls_shell.percent_reflns_obs               49.76 
_refine_ls_shell.R_factor_R_free                  0.373 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             68 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  4LOX 
_struct.title                     'Crystal structure of the I-SmaMI LAGLIDADG homing endonuclease bound to cleaved DNA' 
_struct.pdbx_descriptor           'LAGLIDADG homing endonuclease I-SmaMI' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4LOX 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            
'LHE, homing endonuclease, protein-DNA complex, endonuclease, DNA binding, Mitochrodrial, HYDROLASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
L N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 9   ? GLU A 20  ? ASN A 9   GLU A 20  1 ? 12 
HELX_P HELX_P2  2  ASP A 51  ? PHE A 62  ? ASP A 51  PHE A 62  1 ? 12 
HELX_P HELX_P3  3  SER A 82  ? ILE A 89  ? SER A 82  ILE A 89  1 ? 8  
HELX_P HELX_P4  4  ILE A 89  ? TYR A 97  ? ILE A 89  TYR A 97  1 ? 9  
HELX_P HELX_P5  5  GLU A 102 ? THR A 119 ? GLU A 102 THR A 119 1 ? 18 
HELX_P HELX_P6  6  LYS A 120 ? LEU A 123 ? LYS A 120 LEU A 123 5 ? 4  
HELX_P HELX_P7  7  THR A 124 ? ALA A 136 ? THR A 124 ALA A 136 1 ? 13 
HELX_P HELX_P8  8  SER A 143 ? PHE A 150 ? SER A 143 PHE A 150 1 ? 8  
HELX_P HELX_P9  9  ASP A 168 ? ASP A 179 ? ASP A 168 ASP A 179 1 ? 12 
HELX_P HELX_P10 10 ASP A 210 ? GLY A 222 ? ASP A 210 GLY A 222 1 ? 13 
HELX_P HELX_P11 11 ASN A 241 ? LYS A 248 ? ASN A 241 LYS A 248 1 ? 8  
HELX_P HELX_P12 12 LYS A 248 ? TYR A 256 ? LYS A 248 TYR A 256 1 ? 9  
HELX_P HELX_P13 13 SER A 261 ? ASN A 278 ? SER A 261 ASN A 278 1 ? 18 
HELX_P HELX_P14 14 LYS A 279 ? LEU A 282 ? LYS A 279 LEU A 282 5 ? 4  
HELX_P HELX_P15 15 THR A 283 ? GLY A 296 ? THR A 283 GLY A 296 1 ? 14 
HELX_P HELX_P16 16 MET A 297 ? ARG A 301 ? MET A 297 ARG A 301 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C DT  1   OP1   ? ? ? 1_555 F MG  .  MG ? ? C DT  15  A MG  401 1_555 ? ? ? ? ? ? ?            2.048 ? 
metalc2  metalc ? ? A GLU 20  OE2   ? ? ? 1_555 G MG  .  MG ? ? A GLU 20  A MG  402 1_555 ? ? ? ? ? ? ?            2.096 ? 
metalc3  metalc ? ? A ALA 19  O     ? ? ? 1_555 F MG  .  MG ? ? A ALA 19  A MG  401 1_555 ? ? ? ? ? ? ?            2.160 ? 
metalc4  metalc ? ? D DT  15  OP1   ? ? ? 1_555 F MG  .  MG ? ? D DT  15  A MG  401 1_555 ? ? ? ? ? ? ?            2.174 ? 
metalc5  metalc ? ? A ASP 179 OD1   ? ? ? 1_555 G MG  .  MG ? ? A ASP 179 A MG  402 1_555 ? ? ? ? ? ? ?            2.189 ? 
metalc6  metalc ? ? A ASP 179 OD2   ? ? ? 1_555 F MG  .  MG ? ? A ASP 179 A MG  401 1_555 ? ? ? ? ? ? ?            2.323 ? 
metalc7  metalc ? ? E DC  1   OP3   ? ? ? 1_555 G MG  .  MG ? ? E DC  16  A MG  402 1_555 ? ? ? ? ? ? ?            2.404 ? 
metalc8  metalc ? ? D DT  15  "O3'" ? ? ? 1_555 G MG  .  MG ? ? D DT  15  A MG  402 1_555 ? ? ? ? ? ? ?            2.409 ? 
metalc9  metalc ? ? C DT  1   OP2   ? ? ? 1_555 G MG  .  MG ? ? C DT  15  A MG  402 1_555 ? ? ? ? ? ? ?            2.589 ? 
metalc10 metalc ? ? C DT  1   OP1   ? ? ? 1_555 G MG  .  MG ? ? C DT  15  A MG  402 1_555 ? ? ? ? ? ? ?            2.813 ? 
metalc11 metalc ? ? A GLY 178 O     ? ? ? 1_555 G MG  .  MG ? ? A GLY 178 A MG  402 1_555 ? ? ? ? ? ? ?            2.882 ? 
metalc12 metalc ? ? A ASP 179 OD1   ? ? ? 1_555 F MG  .  MG ? ? A ASP 179 A MG  401 1_555 ? ? ? ? ? ? ?            2.960 ? 
metalc13 metalc ? ? F MG  .   MG    ? ? ? 1_555 K HOH .  O  ? ? A MG  401 D HOH 101 1_555 ? ? ? ? ? ? ?            2.140 ? 
metalc14 metalc ? ? F MG  .   MG    ? ? ? 1_555 H HOH .  O  ? ? A MG  401 A HOH 501 1_555 ? ? ? ? ? ? ?            2.339 ? 
hydrog1  hydrog ? ? B DC  1   N3    ? ? ? 1_555 E DG  10 N1 ? ? B DC  1   E DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  1   N4    ? ? ? 1_555 E DG  10 O6 ? ? B DC  1   E DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  1   O2    ? ? ? 1_555 E DG  10 N2 ? ? B DC  1   E DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2   N1    ? ? ? 1_555 E DC  9  N3 ? ? B DG  2   E DC  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2   N2    ? ? ? 1_555 E DC  9  O2 ? ? B DG  2   E DC  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  2   O6    ? ? ? 1_555 E DC  9  N4 ? ? B DG  2   E DC  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DT  3   N3    ? ? ? 1_555 E DA  8  N1 ? ? B DT  3   E DA  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DT  3   O4    ? ? ? 1_555 E DA  8  N6 ? ? B DT  3   E DA  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  4   N1    ? ? ? 1_555 E DT  7  N3 ? ? B DA  4   E DT  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  4   N6    ? ? ? 1_555 E DT  7  O4 ? ? B DA  4   E DT  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  5   N3    ? ? ? 1_555 E DG  6  N1 ? ? B DC  5   E DG  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  5   N4    ? ? ? 1_555 E DG  6  O6 ? ? B DC  5   E DG  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  5   O2    ? ? ? 1_555 E DG  6  N2 ? ? B DC  5   E DG  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DA  6   N1    ? ? ? 1_555 E DT  5  N3 ? ? B DA  6   E DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DA  6   N6    ? ? ? 1_555 E DT  5  O4 ? ? B DA  6   E DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  7   N3    ? ? ? 1_555 E DG  4  N1 ? ? B DC  7   E DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  7   N4    ? ? ? 1_555 E DG  4  O6 ? ? B DC  7   E DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  7   O2    ? ? ? 1_555 E DG  4  N2 ? ? B DC  7   E DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  8   N3    ? ? ? 1_555 E DG  3  N1 ? ? B DC  8   E DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC  8   N4    ? ? ? 1_555 E DG  3  O6 ? ? B DC  8   E DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DC  8   O2    ? ? ? 1_555 E DG  3  N2 ? ? B DC  8   E DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  9   N3    ? ? ? 1_555 E DA  2  N1 ? ? B DT  9   E DA  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DT  9   O4    ? ? ? 1_555 E DA  2  N6 ? ? B DT  9   E DA  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DG  10  N1    ? ? ? 1_555 E DC  1  N3 ? ? B DG  10  E DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DG  10  N2    ? ? ? 1_555 E DC  1  O2 ? ? B DG  10  E DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DG  10  O6    ? ? ? 1_555 E DC  1  N4 ? ? B DG  10  E DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DA  11  N1    ? ? ? 1_555 D DT  15 N3 ? ? B DA  11  D DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DA  11  N6    ? ? ? 1_555 D DT  15 O4 ? ? B DA  11  D DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DT  12  N3    ? ? ? 1_555 D DA  14 N1 ? ? B DT  12  D DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DT  12  O4    ? ? ? 1_555 D DA  14 N6 ? ? B DT  12  D DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DA  13  N1    ? ? ? 1_555 D DT  13 N3 ? ? B DA  13  D DT  13  1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
hydrog32 hydrog ? ? B DA  14  N1    ? ? ? 1_555 D DT  12 N3 ? ? B DA  14  D DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DA  14  N6    ? ? ? 1_555 D DT  12 O4 ? ? B DA  14  D DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DT  1   N3    ? ? ? 1_555 D DA  11 N1 ? ? C DT  15  D DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DT  1   O4    ? ? ? 1_555 D DA  11 N6 ? ? C DT  15  D DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DG  2   N1    ? ? ? 1_555 D DC  10 N3 ? ? C DG  16  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DG  2   N2    ? ? ? 1_555 D DC  10 O2 ? ? C DG  16  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DG  2   O6    ? ? ? 1_555 D DC  10 N4 ? ? C DG  16  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DG  3   N1    ? ? ? 1_555 D DC  9  N3 ? ? C DG  17  D DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? C DG  3   N2    ? ? ? 1_555 D DC  9  O2 ? ? C DG  17  D DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? C DG  3   O6    ? ? ? 1_555 D DC  9  N4 ? ? C DG  17  D DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? C DA  4   N1    ? ? ? 1_555 D DT  8  N3 ? ? C DA  18  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? C DA  4   N6    ? ? ? 1_555 D DT  8  O4 ? ? C DA  18  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? C DG  5   N1    ? ? ? 1_555 D DC  7  N3 ? ? C DG  19  D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? C DG  5   N2    ? ? ? 1_555 D DC  7  O2 ? ? C DG  19  D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? C DG  5   O6    ? ? ? 1_555 D DC  7  N4 ? ? C DG  19  D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? C DG  6   N1    ? ? ? 1_555 D DC  6  N3 ? ? C DG  20  D DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? C DG  6   N2    ? ? ? 1_555 D DC  6  O2 ? ? C DG  20  D DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? C DG  6   O6    ? ? ? 1_555 D DC  6  N4 ? ? C DG  20  D DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? C DA  7   N1    ? ? ? 1_555 D DT  5  N3 ? ? C DA  21  D DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? C DA  7   N6    ? ? ? 1_555 D DT  5  O4 ? ? C DA  21  D DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? C DT  8   N3    ? ? ? 1_555 D DA  4  N1 ? ? C DT  22  D DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? C DT  8   O4    ? ? ? 1_555 D DA  4  N6 ? ? C DT  22  D DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? C DA  9   N1    ? ? ? 1_555 D DT  3  N3 ? ? C DA  23  D DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? C DA  9   N6    ? ? ? 1_555 D DT  3  O4 ? ? C DA  23  D DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? C DC  10  N3    ? ? ? 1_555 D DG  2  N1 ? ? C DC  24  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? C DC  10  N4    ? ? ? 1_555 D DG  2  O6 ? ? C DC  24  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? C DC  10  O2    ? ? ? 1_555 D DG  2  N2 ? ? C DC  24  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? C DC  11  N3    ? ? ? 1_555 D DG  1  N1 ? ? C DC  25  D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? C DC  11  N4    ? ? ? 1_555 D DG  1  O6 ? ? C DC  25  D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? C DC  11  O2    ? ? ? 1_555 D DG  1  N2 ? ? C DC  25  D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 21  ? LYS A 29  ? GLY A 21  LYS A 29  
A 2 TRP A 37  ? ASP A 48  ? TRP A 37  ASP A 48  
A 3 THR A 75  ? ILE A 80  ? THR A 75  ILE A 80  
A 4 SER A 67  ? GLY A 72  ? SER A 67  GLY A 72  
B 1 GLY A 180 ? LYS A 188 ? GLY A 180 LYS A 188 
B 2 PHE A 196 ? HIS A 207 ? PHE A 196 HIS A 207 
B 3 TRP A 234 ? VAL A 239 ? TRP A 234 VAL A 239 
B 4 PHE A 225 ? LYS A 228 ? PHE A 225 LYS A 228 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 28  ? N ARG A 28  O LEU A 38  ? O LEU A 38  
A 2 3 N VAL A 45  ? N VAL A 45  O TYR A 78  ? O TYR A 78  
A 3 4 O SER A 77  ? O SER A 77  N LYS A 69  ? N LYS A 69  
B 1 2 N ILE A 185 ? N ILE A 185 O ILE A 199 ? O ILE A 199 
B 2 3 N ILE A 204 ? N ILE A 204 O TYR A 237 ? O TYR A 237 
B 3 4 O THR A 238 ? O THR A 238 N PHE A 225 ? N PHE A 225 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 401' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ALA A 19  ? ALA A 19  . ? 1_555 ? 
2  AC1 6 ASP A 179 ? ASP A 179 . ? 1_555 ? 
3  AC1 6 HOH H .   ? HOH A 501 . ? 1_555 ? 
4  AC1 6 DT  C 1   ? DT  C 15  . ? 1_555 ? 
5  AC1 6 DT  D 15  ? DT  D 15  . ? 1_555 ? 
6  AC1 6 HOH K .   ? HOH D 101 . ? 1_555 ? 
7  AC2 7 GLU A 20  ? GLU A 20  . ? 1_555 ? 
8  AC2 7 GLY A 178 ? GLY A 178 . ? 1_555 ? 
9  AC2 7 ASP A 179 ? ASP A 179 . ? 1_555 ? 
10 AC2 7 DA  B 14  ? DA  B 14  . ? 1_555 ? 
11 AC2 7 DT  C 1   ? DT  C 15  . ? 1_555 ? 
12 AC2 7 DT  D 15  ? DT  D 15  . ? 1_555 ? 
13 AC2 7 DC  E 1   ? DC  E 16  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4LOX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4LOX 
_atom_sites.fract_transf_matrix[1][1]   0.016317 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014830 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010195 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 3   ? -7.124  21.522  5.033   1.00   46.33 ? 3   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 3   ? -5.692  21.076  5.112   1.00   44.83 ? 3   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 3   ? -5.563  19.584  5.360   1.00   41.46 ? 3   GLY A C     1 
ATOM   4    O  O     . GLY A 1 3   ? -4.720  18.904  4.769   1.00   56.82 ? 3   GLY A O     1 
ATOM   5    N  N     . GLU A 1 4   ? -6.394  19.072  6.261   1.00   64.19 ? 4   GLU A N     1 
ATOM   6    C  CA    . GLU A 1 4   ? -6.325  17.669  6.650   1.00   52.69 ? 4   GLU A CA    1 
ATOM   7    C  C     . GLU A 1 4   ? -7.750  17.231  6.929   1.00   56.22 ? 4   GLU A C     1 
ATOM   8    O  O     . GLU A 1 4   ? -8.532  17.967  7.548   1.00   68.39 ? 4   GLU A O     1 
ATOM   9    C  CB    . GLU A 1 4   ? -5.434  17.522  7.891   1.00   55.80 ? 4   GLU A CB    1 
ATOM   10   C  CG    . GLU A 1 4   ? -4.146  18.352  7.852   1.00   62.28 ? 4   GLU A CG    1 
ATOM   11   C  CD    . GLU A 1 4   ? -2.866  17.506  7.801   1.00   58.00 ? 4   GLU A CD    1 
ATOM   12   O  OE1   . GLU A 1 4   ? -2.913  16.336  8.233   1.00   62.12 ? 4   GLU A OE1   1 
ATOM   13   O  OE2   . GLU A 1 4   ? -1.797  18.021  7.356   1.00   67.01 ? 4   GLU A OE2   1 
ATOM   14   N  N     . ASN A 1 5   ? -8.113  16.045  6.449   1.00   49.53 ? 5   ASN A N     1 
ATOM   15   C  CA    . ASN A 1 5   ? -9.501  15.644  6.539   1.00   39.10 ? 5   ASN A CA    1 
ATOM   16   C  C     . ASN A 1 5   ? -9.660  14.210  7.088   1.00   35.69 ? 5   ASN A C     1 
ATOM   17   O  O     . ASN A 1 5   ? -9.085  13.267  6.559   1.00   38.33 ? 5   ASN A O     1 
ATOM   18   C  CB    . ASN A 1 5   ? -10.140 15.820  5.158   1.00   36.93 ? 5   ASN A CB    1 
ATOM   19   C  CG    . ASN A 1 5   ? -11.564 15.285  5.092   1.00   39.48 ? 5   ASN A CG    1 
ATOM   20   O  OD1   . ASN A 1 5   ? -12.395 15.437  6.029   1.00   44.73 ? 5   ASN A OD1   1 
ATOM   21   N  ND2   . ASN A 1 5   ? -11.852 14.656  3.988   1.00   35.80 ? 5   ASN A ND2   1 
ATOM   22   N  N     . GLY A 1 6   ? -10.418 14.064  8.173   1.00   38.10 ? 6   GLY A N     1 
ATOM   23   C  CA    . GLY A 1 6   ? -10.692 12.737  8.769   1.00   46.13 ? 6   GLY A CA    1 
ATOM   24   C  C     . GLY A 1 6   ? -12.156 12.338  9.011   1.00   44.32 ? 6   GLY A C     1 
ATOM   25   O  O     . GLY A 1 6   ? -12.398 11.338  9.706   1.00   53.33 ? 6   GLY A O     1 
ATOM   26   N  N     . LYS A 1 7   ? -13.130 13.092  8.477   1.00   45.10 ? 7   LYS A N     1 
ATOM   27   C  CA    . LYS A 1 7   ? -14.582 12.712  8.565   1.00   38.15 ? 7   LYS A CA    1 
ATOM   28   C  C     . LYS A 1 7   ? -14.787 11.482  7.701   1.00   38.79 ? 7   LYS A C     1 
ATOM   29   O  O     . LYS A 1 7   ? -14.238 11.427  6.571   1.00   41.38 ? 7   LYS A O     1 
ATOM   30   C  CB    . LYS A 1 7   ? -15.507 13.813  8.061   1.00   41.52 ? 7   LYS A CB    1 
ATOM   31   C  CG    . LYS A 1 7   ? -16.076 14.739  9.134   1.00   50.35 ? 7   LYS A CG    1 
ATOM   32   C  CD    . LYS A 1 7   ? -15.081 15.804  9.589   1.00   45.97 ? 7   LYS A CD    1 
ATOM   33   C  CE    . LYS A 1 7   ? -15.791 17.129  9.844   1.00   41.16 ? 7   LYS A CE    1 
ATOM   34   N  NZ    . LYS A 1 7   ? -17.029 17.031  10.701  1.00   44.18 ? 7   LYS A NZ    1 
ATOM   35   N  N     . LEU A 1 8   ? -15.534 10.495  8.216   1.00   38.31 ? 8   LEU A N     1 
ATOM   36   C  CA    . LEU A 1 8   ? -15.589 9.161   7.560   1.00   32.04 ? 8   LEU A CA    1 
ATOM   37   C  C     . LEU A 1 8   ? -17.017 8.732   7.283   1.00   31.52 ? 8   LEU A C     1 
ATOM   38   O  O     . LEU A 1 8   ? -17.879 8.853   8.089   1.00   37.30 ? 8   LEU A O     1 
ATOM   39   C  CB    . LEU A 1 8   ? -14.914 8.095   8.399   1.00   31.62 ? 8   LEU A CB    1 
ATOM   40   C  CG    . LEU A 1 8   ? -13.397 8.128   8.579   1.00   30.24 ? 8   LEU A CG    1 
ATOM   41   C  CD1   . LEU A 1 8   ? -12.993 6.973   9.496   1.00   35.45 ? 8   LEU A CD1   1 
ATOM   42   C  CD2   . LEU A 1 8   ? -12.632 8.070   7.263   1.00   30.45 ? 8   LEU A CD2   1 
ATOM   43   N  N     . ASN A 1 9   ? -17.242 8.243   6.104   1.00   32.44 ? 9   ASN A N     1 
ATOM   44   C  CA    . ASN A 1 9   ? -18.541 7.788   5.640   1.00   30.90 ? 9   ASN A CA    1 
ATOM   45   C  C     . ASN A 1 9   ? -18.270 6.296   5.385   1.00   28.90 ? 9   ASN A C     1 
ATOM   46   O  O     . ASN A 1 9   ? -17.098 5.932   5.023   1.00   27.99 ? 9   ASN A O     1 
ATOM   47   C  CB    . ASN A 1 9   ? -18.768 8.642   4.367   1.00   35.52 ? 9   ASN A CB    1 
ATOM   48   C  CG    . ASN A 1 9   ? -19.743 8.055   3.410   1.00   36.24 ? 9   ASN A CG    1 
ATOM   49   O  OD1   . ASN A 1 9   ? -19.517 7.009   2.825   1.00   40.81 ? 9   ASN A OD1   1 
ATOM   50   N  ND2   . ASN A 1 9   ? -20.849 8.739   3.227   1.00   40.44 ? 9   ASN A ND2   1 
ATOM   51   N  N     . PRO A 1 10  ? -19.282 5.403   5.583   1.00   27.07 ? 10  PRO A N     1 
ATOM   52   C  CA    . PRO A 1 10  ? -19.003 3.952   5.369   1.00   27.22 ? 10  PRO A CA    1 
ATOM   53   C  C     . PRO A 1 10  ? -18.304 3.614   4.010   1.00   26.13 ? 10  PRO A C     1 
ATOM   54   O  O     . PRO A 1 10  ? -17.346 2.859   3.988   1.00   22.83 ? 10  PRO A O     1 
ATOM   55   C  CB    . PRO A 1 10  ? -20.389 3.314   5.434   1.00   28.40 ? 10  PRO A CB    1 
ATOM   56   C  CG    . PRO A 1 10  ? -21.174 4.256   6.279   1.00   31.79 ? 10  PRO A CG    1 
ATOM   57   C  CD    . PRO A 1 10  ? -20.693 5.632   5.904   1.00   27.97 ? 10  PRO A CD    1 
ATOM   58   N  N     . TRP A 1 11  ? -18.762 4.228   2.914   1.00   26.88 ? 11  TRP A N     1 
ATOM   59   C  CA    . TRP A 1 11  ? -18.216 3.959   1.569   1.00   23.93 ? 11  TRP A CA    1 
ATOM   60   C  C     . TRP A 1 11  ? -16.788 4.489   1.435   1.00   24.45 ? 11  TRP A C     1 
ATOM   61   O  O     . TRP A 1 11  ? -15.890 3.830   0.817   1.00   22.64 ? 11  TRP A O     1 
ATOM   62   C  CB    . TRP A 1 11  ? -19.175 4.557   0.520   1.00   24.47 ? 11  TRP A CB    1 
ATOM   63   C  CG    . TRP A 1 11  ? -20.437 3.689   0.365   1.00   25.12 ? 11  TRP A CG    1 
ATOM   64   C  CD1   . TRP A 1 11  ? -21.748 4.056   0.540   1.00   26.57 ? 11  TRP A CD1   1 
ATOM   65   C  CD2   . TRP A 1 11  ? -20.453 2.308   -0.008  1.00   26.34 ? 11  TRP A CD2   1 
ATOM   66   N  NE1   . TRP A 1 11  ? -22.582 2.982   0.292   1.00   29.58 ? 11  TRP A NE1   1 
ATOM   67   C  CE2   . TRP A 1 11  ? -21.798 1.893   -0.039  1.00   28.67 ? 11  TRP A CE2   1 
ATOM   68   C  CE3   . TRP A 1 11  ? -19.439 1.371   -0.308  1.00   27.02 ? 11  TRP A CE3   1 
ATOM   69   C  CZ2   . TRP A 1 11  ? -22.167 0.570   -0.348  1.00   30.78 ? 11  TRP A CZ2   1 
ATOM   70   C  CZ3   . TRP A 1 11  ? -19.816 0.050   -0.621  1.00   27.59 ? 11  TRP A CZ3   1 
ATOM   71   C  CH2   . TRP A 1 11  ? -21.166 -0.324  -0.643  1.00   28.71 ? 11  TRP A CH2   1 
ATOM   72   N  N     . ALA A 1 12  ? -16.535 5.651   2.054   1.00   23.83 ? 12  ALA A N     1 
ATOM   73   C  CA    . ALA A 1 12  ? -15.156 6.167   2.048   1.00   24.55 ? 12  ALA A CA    1 
ATOM   74   C  C     . ALA A 1 12  ? -14.256 5.178   2.759   1.00   25.01 ? 12  ALA A C     1 
ATOM   75   O  O     . ALA A 1 12  ? -13.114 4.914   2.317   1.00   24.52 ? 12  ALA A O     1 
ATOM   76   C  CB    . ALA A 1 12  ? -15.079 7.547   2.689   1.00   26.08 ? 12  ALA A CB    1 
ATOM   77   N  N     . VAL A 1 13  ? -14.773 4.589   3.837   1.00   24.73 ? 13  VAL A N     1 
ATOM   78   C  CA    . VAL A 1 13  ? -13.973 3.586   4.569   1.00   24.63 ? 13  VAL A CA    1 
ATOM   79   C  C     . VAL A 1 13  ? -13.677 2.411   3.663   1.00   24.25 ? 13  VAL A C     1 
ATOM   80   O  O     . VAL A 1 13  ? -12.533 1.947   3.582   1.00   22.97 ? 13  VAL A O     1 
ATOM   81   C  CB    . VAL A 1 13  ? -14.635 3.143   5.882   1.00   25.47 ? 13  VAL A CB    1 
ATOM   82   C  CG1   . VAL A 1 13  ? -13.882 1.974   6.497   1.00   26.60 ? 13  VAL A CG1   1 
ATOM   83   C  CG2   . VAL A 1 13  ? -14.611 4.306   6.872   1.00   28.31 ? 13  VAL A CG2   1 
ATOM   84   N  N     . VAL A 1 14  ? -14.712 1.936   2.975   1.00   25.30 ? 14  VAL A N     1 
ATOM   85   C  CA    . VAL A 1 14  ? -14.541 0.829   2.048   1.00   25.35 ? 14  VAL A CA    1 
ATOM   86   C  C     . VAL A 1 14  ? -13.528 1.122   0.940   1.00   24.27 ? 14  VAL A C     1 
ATOM   87   O  O     . VAL A 1 14  ? -12.666 0.280   0.631   1.00   23.74 ? 14  VAL A O     1 
ATOM   88   C  CB    . VAL A 1 14  ? -15.864 0.411   1.389   1.00   23.86 ? 14  VAL A CB    1 
ATOM   89   C  CG1   . VAL A 1 14  ? -15.589 -0.789  0.496   1.00   23.21 ? 14  VAL A CG1   1 
ATOM   90   C  CG2   . VAL A 1 14  ? -16.917 0.017   2.449   1.00   23.89 ? 14  VAL A CG2   1 
ATOM   91   N  N     . GLY A 1 15  ? -13.647 2.297   0.324   1.00   23.88 ? 15  GLY A N     1 
ATOM   92   C  CA    . GLY A 1 15  ? -12.670 2.713   -0.676  1.00   22.79 ? 15  GLY A CA    1 
ATOM   93   C  C     . GLY A 1 15  ? -11.262 2.750   -0.097  1.00   21.48 ? 15  GLY A C     1 
ATOM   94   O  O     . GLY A 1 15  ? -10.291 2.297   -0.748  1.00   21.49 ? 15  GLY A O     1 
ATOM   95   N  N     . PHE A 1 16  ? -11.127 3.297   1.111   1.00   21.61 ? 16  PHE A N     1 
ATOM   96   C  CA    . PHE A 1 16  ? -9.775  3.411   1.673   1.00   21.45 ? 16  PHE A CA    1 
ATOM   97   C  C     . PHE A 1 16  ? -9.153  2.042   1.914   1.00   22.78 ? 16  PHE A C     1 
ATOM   98   O  O     . PHE A 1 16  ? -7.934  1.852   1.699   1.00   22.07 ? 16  PHE A O     1 
ATOM   99   C  CB    . PHE A 1 16  ? -9.748  4.229   2.983   1.00   21.63 ? 16  PHE A CB    1 
ATOM   100  C  CG    . PHE A 1 16  ? -8.355  4.680   3.377   1.00   21.64 ? 16  PHE A CG    1 
ATOM   101  C  CD1   . PHE A 1 16  ? -7.659  5.596   2.586   1.00   22.97 ? 16  PHE A CD1   1 
ATOM   102  C  CD2   . PHE A 1 16  ? -7.716  4.170   4.505   1.00   23.62 ? 16  PHE A CD2   1 
ATOM   103  C  CE1   . PHE A 1 16  ? -6.371  6.022   2.920   1.00   23.04 ? 16  PHE A CE1   1 
ATOM   104  C  CE2   . PHE A 1 16  ? -6.412  4.598   4.852   1.00   22.69 ? 16  PHE A CE2   1 
ATOM   105  C  CZ    . PHE A 1 16  ? -5.748  5.526   4.062   1.00   22.69 ? 16  PHE A CZ    1 
ATOM   106  N  N     . ILE A 1 17  ? -9.986  1.094   2.362   1.00   22.88 ? 17  ILE A N     1 
ATOM   107  C  CA    . ILE A 1 17  ? -9.499  -0.276  2.638   1.00   23.14 ? 17  ILE A CA    1 
ATOM   108  C  C     . ILE A 1 17  ? -9.241  -1.029  1.345   1.00   22.89 ? 17  ILE A C     1 
ATOM   109  O  O     . ILE A 1 17  ? -8.187  -1.719  1.218   1.00   23.60 ? 17  ILE A O     1 
ATOM   110  C  CB    . ILE A 1 17  ? -10.471 -1.082  3.516   1.00   24.32 ? 17  ILE A CB    1 
ATOM   111  C  CG1   . ILE A 1 17  ? -10.769 -0.354  4.832   1.00   24.59 ? 17  ILE A CG1   1 
ATOM   112  C  CG2   . ILE A 1 17  ? -9.958  -2.501  3.792   1.00   23.09 ? 17  ILE A CG2   1 
ATOM   113  C  CD1   . ILE A 1 17  ? -9.550  0.046   5.667   1.00   24.14 ? 17  ILE A CD1   1 
ATOM   114  N  N     . ASP A 1 18  ? -10.124 -0.859  0.349   1.00   21.29 ? 18  ASP A N     1 
ATOM   115  C  CA    . ASP A 1 18  ? -9.810  -1.404  -1.016  1.00   22.54 ? 18  ASP A CA    1 
ATOM   116  C  C     . ASP A 1 18  ? -8.399  -0.970  -1.434  1.00   22.88 ? 18  ASP A C     1 
ATOM   117  O  O     . ASP A 1 18  ? -7.624  -1.764  -2.012  1.00   21.56 ? 18  ASP A O     1 
ATOM   118  C  CB    . ASP A 1 18  ? -10.855 -0.946  -2.060  1.00   22.42 ? 18  ASP A CB    1 
ATOM   119  C  CG    . ASP A 1 18  ? -11.848 -2.065  -2.455  1.00   23.36 ? 18  ASP A CG    1 
ATOM   120  O  OD1   . ASP A 1 18  ? -11.409 -3.254  -2.588  1.00   23.44 ? 18  ASP A OD1   1 
ATOM   121  O  OD2   . ASP A 1 18  ? -13.077 -1.759  -2.644  1.00   24.23 ? 18  ASP A OD2   1 
ATOM   122  N  N     . ALA A 1 19  ? -8.049  0.289   -1.116  1.00   21.84 ? 19  ALA A N     1 
ATOM   123  C  CA    . ALA A 1 19  ? -6.760  0.865   -1.448  1.00   21.61 ? 19  ALA A CA    1 
ATOM   124  C  C     . ALA A 1 19  ? -5.635  0.369   -0.519  1.00   22.93 ? 19  ALA A C     1 
ATOM   125  O  O     . ALA A 1 19  ? -4.571  -0.102  -1.002  1.00   21.74 ? 19  ALA A O     1 
ATOM   126  C  CB    . ALA A 1 19  ? -6.840  2.410   -1.455  1.00   19.99 ? 19  ALA A CB    1 
ATOM   127  N  N     . GLU A 1 20  ? -5.856  0.450   0.797   1.00   22.86 ? 20  GLU A N     1 
ATOM   128  C  CA    . GLU A 1 20  ? -4.730  0.422   1.721   1.00   26.33 ? 20  GLU A CA    1 
ATOM   129  C  C     . GLU A 1 20  ? -4.763  -0.776  2.696   1.00   27.53 ? 20  GLU A C     1 
ATOM   130  O  O     . GLU A 1 20  ? -3.769  -1.039  3.354   1.00   29.21 ? 20  GLU A O     1 
ATOM   131  C  CB    . GLU A 1 20  ? -4.652  1.740   2.521   1.00   26.26 ? 20  GLU A CB    1 
ATOM   132  C  CG    . GLU A 1 20  ? -4.379  2.995   1.677   1.00   27.40 ? 20  GLU A CG    1 
ATOM   133  C  CD    . GLU A 1 20  ? -3.131  2.810   0.842   1.00   30.25 ? 20  GLU A CD    1 
ATOM   134  O  OE1   . GLU A 1 20  ? -2.058  2.562   1.404   1.00   35.32 ? 20  GLU A OE1   1 
ATOM   135  O  OE2   . GLU A 1 20  ? -3.211  2.834   -0.394  1.00   35.83 ? 20  GLU A OE2   1 
ATOM   136  N  N     . GLY A 1 21  ? -5.890  -1.484  2.778   1.00   25.94 ? 21  GLY A N     1 
ATOM   137  C  CA    . GLY A 1 21  ? -6.103  -2.475  3.812   1.00   26.03 ? 21  GLY A CA    1 
ATOM   138  C  C     . GLY A 1 21  ? -5.551  -3.844  3.483   1.00   27.92 ? 21  GLY A C     1 
ATOM   139  O  O     . GLY A 1 21  ? -5.260  -4.116  2.333   1.00   28.96 ? 21  GLY A O     1 
ATOM   140  N  N     . SER A 1 22  ? -5.404  -4.703  4.499   1.00   27.94 ? 22  SER A N     1 
ATOM   141  C  CA    . SER A 1 22  ? -5.088  -6.122  4.296   1.00   23.52 ? 22  SER A CA    1 
ATOM   142  C  C     . SER A 1 22  ? -5.892  -6.977  5.226   1.00   23.31 ? 22  SER A C     1 
ATOM   143  O  O     . SER A 1 22  ? -6.163  -6.594  6.375   1.00   22.89 ? 22  SER A O     1 
ATOM   144  C  CB    . SER A 1 22  ? -3.614  -6.426  4.498   1.00   26.37 ? 22  SER A CB    1 
ATOM   145  O  OG    . SER A 1 22  ? -2.852  -5.629  3.631   1.00   29.75 ? 22  SER A OG    1 
ATOM   146  N  N     . PHE A 1 23  ? -6.287  -8.134  4.702   1.00   21.57 ? 23  PHE A N     1 
ATOM   147  C  CA    . PHE A 1 23  ? -6.979  -9.179  5.446   1.00   22.51 ? 23  PHE A CA    1 
ATOM   148  C  C     . PHE A 1 23  ? -6.002  -10.372 5.481   1.00   23.85 ? 23  PHE A C     1 
ATOM   149  O  O     . PHE A 1 23  ? -5.677  -10.957 4.452   1.00   25.29 ? 23  PHE A O     1 
ATOM   150  C  CB    . PHE A 1 23  ? -8.295  -9.496  4.764   1.00   21.74 ? 23  PHE A CB    1 
ATOM   151  C  CG    . PHE A 1 23  ? -9.244  -8.316  4.746   1.00   23.07 ? 23  PHE A CG    1 
ATOM   152  C  CD1   . PHE A 1 23  ? -10.067 -8.055  5.828   1.00   23.04 ? 23  PHE A CD1   1 
ATOM   153  C  CD2   . PHE A 1 23  ? -9.282  -7.449  3.651   1.00   23.98 ? 23  PHE A CD2   1 
ATOM   154  C  CE1   . PHE A 1 23  ? -10.927 -6.954  5.817   1.00   24.01 ? 23  PHE A CE1   1 
ATOM   155  C  CE2   . PHE A 1 23  ? -10.152 -6.366  3.623   1.00   23.02 ? 23  PHE A CE2   1 
ATOM   156  C  CZ    . PHE A 1 23  ? -10.969 -6.107  4.713   1.00   21.84 ? 23  PHE A CZ    1 
ATOM   157  N  N     . MET A 1 24  ? -5.461  -10.657 6.661   1.00   23.72 ? 24  MET A N     1 
ATOM   158  C  CA    . MET A 1 24  ? -4.317  -11.542 6.753   1.00   25.84 ? 24  MET A CA    1 
ATOM   159  C  C     . MET A 1 24  ? -4.645  -12.717 7.654   1.00   26.93 ? 24  MET A C     1 
ATOM   160  O  O     . MET A 1 24  ? -5.519  -12.628 8.524   1.00   27.35 ? 24  MET A O     1 
ATOM   161  C  CB    . MET A 1 24  ? -3.105  -10.785 7.300   1.00   26.87 ? 24  MET A CB    1 
ATOM   162  C  CG    . MET A 1 24  ? -2.660  -9.605  6.421   1.00   27.31 ? 24  MET A CG    1 
ATOM   163  S  SD    . MET A 1 24  ? -1.158  -8.837  7.050   1.00   33.66 ? 24  MET A SD    1 
ATOM   164  C  CE    . MET A 1 24  ? -1.847  -7.737  8.262   1.00   33.01 ? 24  MET A CE    1 
ATOM   165  N  N     . VAL A 1 25  ? -3.960  -13.821 7.430   1.00   29.16 ? 25  VAL A N     1 
ATOM   166  C  CA    . VAL A 1 25  ? -4.088  -15.015 8.272   1.00   30.69 ? 25  VAL A CA    1 
ATOM   167  C  C     . VAL A 1 25  ? -2.657  -15.523 8.493   1.00   30.66 ? 25  VAL A C     1 
ATOM   168  O  O     . VAL A 1 25  ? -1.957  -15.801 7.543   1.00   31.86 ? 25  VAL A O     1 
ATOM   169  C  CB    . VAL A 1 25  ? -4.988  -16.092 7.601   1.00   31.17 ? 25  VAL A CB    1 
ATOM   170  C  CG1   . VAL A 1 25  ? -4.949  -17.432 8.338   1.00   33.03 ? 25  VAL A CG1   1 
ATOM   171  C  CG2   . VAL A 1 25  ? -6.435  -15.582 7.465   1.00   25.98 ? 25  VAL A CG2   1 
ATOM   172  N  N     . ARG A 1 26  ? -2.227  -15.536 9.746   1.00   27.68 ? 26  ARG A N     1 
ATOM   173  C  CA    . ARG A 1 26  ? -1.006  -16.146 10.151  1.00   30.69 ? 26  ARG A CA    1 
ATOM   174  C  C     . ARG A 1 26  ? -1.310  -17.575 10.612  1.00   31.79 ? 26  ARG A C     1 
ATOM   175  O  O     . ARG A 1 26  ? -2.307  -17.811 11.315  1.00   32.05 ? 26  ARG A O     1 
ATOM   176  C  CB    . ARG A 1 26  ? -0.419  -15.373 11.323  1.00   33.97 ? 26  ARG A CB    1 
ATOM   177  C  CG    . ARG A 1 26  ? -0.041  -13.930 11.010  1.00   33.19 ? 26  ARG A CG    1 
ATOM   178  C  CD    . ARG A 1 26  ? 0.712   -13.351 12.197  1.00   36.43 ? 26  ARG A CD    1 
ATOM   179  N  NE    . ARG A 1 26  ? 2.087   -13.879 12.321  1.00   37.12 ? 26  ARG A NE    1 
ATOM   180  C  CZ    . ARG A 1 26  ? 2.982   -13.436 13.198  1.00   37.76 ? 26  ARG A CZ    1 
ATOM   181  N  NH1   . ARG A 1 26  ? 2.646   -12.469 14.038  1.00   39.17 ? 26  ARG A NH1   1 
ATOM   182  N  NH2   . ARG A 1 26  ? 4.221   -13.953 13.235  1.00   41.50 ? 26  ARG A NH2   1 
ATOM   183  N  N     . VAL A 1 27  ? -0.531  -18.516 10.271  1.00   30.80 ? 27  VAL A N     1 
ATOM   184  C  CA    . VAL A 1 27  ? -0.470  -19.923 10.705  1.00   33.21 ? 27  VAL A CA    1 
ATOM   185  C  C     . VAL A 1 27  ? 0.889   -20.304 11.348  1.00   34.09 ? 27  VAL A C     1 
ATOM   186  O  O     . VAL A 1 27  ? 1.944   -20.376 10.695  1.00   33.81 ? 27  VAL A O     1 
ATOM   187  C  CB    . VAL A 1 27  ? -1.189  -20.960 9.755   1.00   33.97 ? 27  VAL A CB    1 
ATOM   188  C  CG1   . VAL A 1 27  ? -1.015  -22.412 10.153  1.00   35.66 ? 27  VAL A CG1   1 
ATOM   189  C  CG2   . VAL A 1 27  ? -2.615  -20.584 9.376   1.00   34.61 ? 27  VAL A CG2   1 
ATOM   190  N  N     . ARG A 1 28  ? 1.175   -20.292 12.519  1.00   33.63 ? 28  ARG A N     1 
ATOM   191  C  CA    . ARG A 1 28  ? 2.465   -20.228 13.146  1.00   34.86 ? 28  ARG A CA    1 
ATOM   192  C  C     . ARG A 1 28  ? 2.767   -21.543 13.825  1.00   35.18 ? 28  ARG A C     1 
ATOM   193  O  O     . ARG A 1 28  ? 1.961   -22.108 14.587  1.00   35.91 ? 28  ARG A O     1 
ATOM   194  C  CB    . ARG A 1 28  ? 2.534   -19.086 14.173  1.00   36.79 ? 28  ARG A CB    1 
ATOM   195  C  CG    . ARG A 1 28  ? 2.293   -17.662 13.630  1.00   36.04 ? 28  ARG A CG    1 
ATOM   196  C  CD    . ARG A 1 28  ? 2.337   -16.647 14.777  1.00   36.10 ? 28  ARG A CD    1 
ATOM   197  N  NE    . ARG A 1 28  ? 3.651   -16.613 15.435  1.00   38.46 ? 28  ARG A NE    1 
ATOM   198  C  CZ    . ARG A 1 28  ? 4.022   -15.726 16.367  1.00   36.21 ? 28  ARG A CZ    1 
ATOM   199  N  NH1   . ARG A 1 28  ? 3.179   -14.798 16.818  1.00   36.27 ? 28  ARG A NH1   1 
ATOM   200  N  NH2   . ARG A 1 28  ? 5.236   -15.774 16.860  1.00   35.03 ? 28  ARG A NH2   1 
ATOM   201  N  N     . LYS A 1 29  ? 3.946   -22.031 13.536  1.00   36.64 ? 29  LYS A N     1 
ATOM   202  C  CA    . LYS A 1 29  ? 4.398   -23.274 14.109  1.00   38.44 ? 29  LYS A CA    1 
ATOM   203  C  C     . LYS A 1 29  ? 4.683   -23.054 15.572  1.00   39.01 ? 29  LYS A C     1 
ATOM   204  O  O     . LYS A 1 29  ? 5.432   -22.148 15.950  1.00   38.75 ? 29  LYS A O     1 
ATOM   205  C  CB    . LYS A 1 29  ? 5.654   -23.743 13.425  1.00   38.39 ? 29  LYS A CB    1 
ATOM   206  C  CG    . LYS A 1 29  ? 6.048   -25.141 13.909  1.00   40.86 ? 29  LYS A CG    1 
ATOM   207  C  CD    . LYS A 1 29  ? 7.268   -25.662 13.163  1.00   48.74 ? 29  LYS A CD    1 
ATOM   208  C  CE    . LYS A 1 29  ? 7.047   -25.749 11.652  1.00   44.94 ? 29  LYS A CE    1 
ATOM   209  N  NZ    . LYS A 1 29  ? 8.187   -26.480 11.000  1.00   45.15 ? 29  LYS A NZ    1 
ATOM   210  N  N     . ASN A 1 30  ? 4.086   -23.904 16.392  1.00   40.38 ? 30  ASN A N     1 
ATOM   211  C  CA    . ASN A 1 30  ? 4.199   -23.760 17.829  1.00   41.45 ? 30  ASN A CA    1 
ATOM   212  C  C     . ASN A 1 30  ? 3.699   -25.009 18.512  1.00   40.22 ? 30  ASN A C     1 
ATOM   213  O  O     . ASN A 1 30  ? 2.465   -25.245 18.612  1.00   39.05 ? 30  ASN A O     1 
ATOM   214  C  CB    . ASN A 1 30  ? 3.413   -22.529 18.317  1.00   40.68 ? 30  ASN A CB    1 
ATOM   215  C  CG    . ASN A 1 30  ? 3.776   -22.145 19.737  1.00   44.63 ? 30  ASN A CG    1 
ATOM   216  O  OD1   . ASN A 1 30  ? 3.917   -23.004 20.621  1.00   44.38 ? 30  ASN A OD1   1 
ATOM   217  N  ND2   . ASN A 1 30  ? 3.946   -20.851 19.964  1.00   49.33 ? 30  ASN A ND2   1 
ATOM   218  N  N     . SER A 1 31  ? 4.665   -25.796 18.984  1.00   40.60 ? 31  SER A N     1 
ATOM   219  C  CA    . SER A 1 31  ? 4.427   -27.119 19.572  1.00   42.51 ? 31  SER A CA    1 
ATOM   220  C  C     . SER A 1 31  ? 3.545   -27.071 20.819  1.00   41.42 ? 31  SER A C     1 
ATOM   221  O  O     . SER A 1 31  ? 3.066   -28.107 21.287  1.00   40.33 ? 31  SER A O     1 
ATOM   222  C  CB    . SER A 1 31  ? 5.761   -27.828 19.865  1.00   44.84 ? 31  SER A CB    1 
ATOM   223  O  OG    . SER A 1 31  ? 6.527   -27.069 20.772  1.00   47.42 ? 31  SER A OG    1 
ATOM   224  N  N     . LYS A 1 32  ? 3.286   -25.867 21.328  1.00   41.47 ? 32  LYS A N     1 
ATOM   225  C  CA    . LYS A 1 32  ? 2.486   -25.732 22.544  1.00   42.26 ? 32  LYS A CA    1 
ATOM   226  C  C     . LYS A 1 32  ? 0.985   -25.838 22.265  1.00   39.76 ? 32  LYS A C     1 
ATOM   227  O  O     . LYS A 1 32  ? 0.166   -25.891 23.191  1.00   36.63 ? 32  LYS A O     1 
ATOM   228  C  CB    . LYS A 1 32  ? 2.847   -24.443 23.298  1.00   41.77 ? 32  LYS A CB    1 
ATOM   229  C  CG    . LYS A 1 32  ? 4.080   -24.640 24.172  1.00   44.15 ? 32  LYS A CG    1 
ATOM   230  C  CD    . LYS A 1 32  ? 4.729   -23.320 24.541  1.00   47.08 ? 32  LYS A CD    1 
ATOM   231  C  CE    . LYS A 1 32  ? 5.416   -22.721 23.317  1.00   47.81 ? 32  LYS A CE    1 
ATOM   232  N  NZ    . LYS A 1 32  ? 6.787   -22.164 23.557  1.00   52.08 ? 32  LYS A NZ    1 
ATOM   233  N  N     . TYR A 1 33  ? 0.636   -25.858 20.984  1.00   40.41 ? 33  TYR A N     1 
ATOM   234  C  CA    . TYR A 1 33  ? -0.776  -26.037 20.581  1.00   38.67 ? 33  TYR A CA    1 
ATOM   235  C  C     . TYR A 1 33  ? -0.974  -27.474 20.168  1.00   39.37 ? 33  TYR A C     1 
ATOM   236  O  O     . TYR A 1 33  ? -0.071  -28.057 19.586  1.00   42.52 ? 33  TYR A O     1 
ATOM   237  C  CB    . TYR A 1 33  ? -1.134  -25.105 19.428  1.00   37.26 ? 33  TYR A CB    1 
ATOM   238  C  CG    . TYR A 1 33  ? -1.035  -23.665 19.858  1.00   37.01 ? 33  TYR A CG    1 
ATOM   239  C  CD1   . TYR A 1 33  ? 0.230   -23.050 20.041  1.00   37.03 ? 33  TYR A CD1   1 
ATOM   240  C  CD2   . TYR A 1 33  ? -2.195  -22.934 20.158  1.00   35.16 ? 33  TYR A CD2   1 
ATOM   241  C  CE1   . TYR A 1 33  ? 0.321   -21.724 20.464  1.00   35.80 ? 33  TYR A CE1   1 
ATOM   242  C  CE2   . TYR A 1 33  ? -2.126  -21.607 20.595  1.00   34.55 ? 33  TYR A CE2   1 
ATOM   243  C  CZ    . TYR A 1 33  ? -0.877  -21.013 20.746  1.00   34.39 ? 33  TYR A CZ    1 
ATOM   244  O  OH    . TYR A 1 33  ? -0.804  -19.727 21.198  1.00   33.40 ? 33  TYR A OH    1 
ATOM   245  N  N     . LYS A 1 34  ? -2.153  -28.015 20.459  1.00   38.92 ? 34  LYS A N     1 
ATOM   246  C  CA    . LYS A 1 34  ? -2.489  -29.392 20.175  1.00   40.94 ? 34  LYS A CA    1 
ATOM   247  C  C     . LYS A 1 34  ? -2.248  -29.810 18.735  1.00   41.17 ? 34  LYS A C     1 
ATOM   248  O  O     . LYS A 1 34  ? -1.693  -30.875 18.506  1.00   42.19 ? 34  LYS A O     1 
ATOM   249  C  CB    . LYS A 1 34  ? -3.937  -29.653 20.602  1.00   43.79 ? 34  LYS A CB    1 
ATOM   250  C  CG    . LYS A 1 34  ? -4.024  -29.911 22.101  1.00   46.32 ? 34  LYS A CG    1 
ATOM   251  C  CD    . LYS A 1 34  ? -5.403  -29.623 22.691  1.00   48.92 ? 34  LYS A CD    1 
ATOM   252  C  CE    . LYS A 1 34  ? -6.196  -30.874 22.966  1.00   47.37 ? 34  LYS A CE    1 
ATOM   253  N  NZ    . LYS A 1 34  ? -6.282  -31.624 21.690  1.00   46.98 ? 34  LYS A NZ    1 
ATOM   254  N  N     . THR A 1 35  ? -2.640  -28.966 17.771  1.00   40.49 ? 35  THR A N     1 
ATOM   255  C  CA    . THR A 1 35  ? -2.361  -29.240 16.364  1.00   40.16 ? 35  THR A CA    1 
ATOM   256  C  C     . THR A 1 35  ? -0.897  -29.005 15.968  1.00   41.37 ? 35  THR A C     1 
ATOM   257  O  O     . THR A 1 35  ? -0.513  -29.438 14.904  1.00   46.07 ? 35  THR A O     1 
ATOM   258  C  CB    . THR A 1 35  ? -3.191  -28.356 15.410  1.00   39.64 ? 35  THR A CB    1 
ATOM   259  O  OG1   . THR A 1 35  ? -2.675  -27.010 15.449  1.00   42.44 ? 35  THR A OG1   1 
ATOM   260  C  CG2   . THR A 1 35  ? -4.672  -28.345 15.769  1.00   38.55 ? 35  THR A CG2   1 
ATOM   261  N  N     . GLY A 1 36  ? -0.096  -28.298 16.766  1.00   39.31 ? 36  GLY A N     1 
ATOM   262  C  CA    . GLY A 1 36  ? 1.287   -27.913 16.368  1.00   38.92 ? 36  GLY A CA    1 
ATOM   263  C  C     . GLY A 1 36  ? 1.345   -26.488 15.785  1.00   37.26 ? 36  GLY A C     1 
ATOM   264  O  O     . GLY A 1 36  ? 2.428   -25.930 15.531  1.00   36.50 ? 36  GLY A O     1 
ATOM   265  N  N     . TRP A 1 37  ? 0.179   -25.878 15.584  1.00   35.97 ? 37  TRP A N     1 
ATOM   266  C  CA    . TRP A 1 37  ? 0.110   -24.614 14.877  1.00   36.65 ? 37  TRP A CA    1 
ATOM   267  C  C     . TRP A 1 37  ? -0.867  -23.646 15.535  1.00   35.32 ? 37  TRP A C     1 
ATOM   268  O  O     . TRP A 1 37  ? -1.946  -24.046 15.952  1.00   36.16 ? 37  TRP A O     1 
ATOM   269  C  CB    . TRP A 1 37  ? -0.317  -24.859 13.423  1.00   37.89 ? 37  TRP A CB    1 
ATOM   270  C  CG    . TRP A 1 37  ? 0.614   -25.770 12.723  1.00   38.55 ? 37  TRP A CG    1 
ATOM   271  C  CD1   . TRP A 1 37  ? 0.598   -27.131 12.725  1.00   39.20 ? 37  TRP A CD1   1 
ATOM   272  C  CD2   . TRP A 1 37  ? 1.755   -25.372 11.955  1.00   39.54 ? 37  TRP A CD2   1 
ATOM   273  N  NE1   . TRP A 1 37  ? 1.664   -27.612 11.978  1.00   41.78 ? 37  TRP A NE1   1 
ATOM   274  C  CE2   . TRP A 1 37  ? 2.380   -26.542 11.497  1.00   41.27 ? 37  TRP A CE2   1 
ATOM   275  C  CE3   . TRP A 1 37  ? 2.281   -24.126 11.579  1.00   40.03 ? 37  TRP A CE3   1 
ATOM   276  C  CZ2   . TRP A 1 37  ? 3.538   -26.510 10.701  1.00   43.46 ? 37  TRP A CZ2   1 
ATOM   277  C  CZ3   . TRP A 1 37  ? 3.421   -24.087 10.776  1.00   39.97 ? 37  TRP A CZ3   1 
ATOM   278  C  CH2   . TRP A 1 37  ? 4.042   -25.269 10.357  1.00   43.48 ? 37  TRP A CH2   1 
ATOM   279  N  N     . LEU A 1 38  ? -0.466  -22.377 15.592  1.00   36.40 ? 38  LEU A N     1 
ATOM   280  C  CA    . LEU A 1 38  ? -1.308  -21.269 16.008  1.00   34.75 ? 38  LEU A CA    1 
ATOM   281  C  C     . LEU A 1 38  ? -1.874  -20.468 14.795  1.00   32.41 ? 38  LEU A C     1 
ATOM   282  O  O     . LEU A 1 38  ? -1.127  -20.055 13.881  1.00   31.17 ? 38  LEU A O     1 
ATOM   283  C  CB    . LEU A 1 38  ? -0.512  -20.347 16.951  1.00   35.60 ? 38  LEU A CB    1 
ATOM   284  C  CG    . LEU A 1 38  ? -0.961  -18.874 17.167  1.00   33.86 ? 38  LEU A CG    1 
ATOM   285  C  CD1   . LEU A 1 38  ? -2.368  -18.714 17.735  1.00   32.82 ? 38  LEU A CD1   1 
ATOM   286  C  CD2   . LEU A 1 38  ? 0.051   -18.048 17.997  1.00   34.96 ? 38  LEU A CD2   1 
ATOM   287  N  N     . VAL A 1 39  ? -3.178  -20.205 14.852  1.00   29.15 ? 39  VAL A N     1 
ATOM   288  C  CA    . VAL A 1 39  ? -3.940  -19.609 13.767  1.00   29.87 ? 39  VAL A CA    1 
ATOM   289  C  C     . VAL A 1 39  ? -4.427  -18.269 14.214  1.00   29.24 ? 39  VAL A C     1 
ATOM   290  O  O     . VAL A 1 39  ? -5.100  -18.190 15.235  1.00   30.59 ? 39  VAL A O     1 
ATOM   291  C  CB    . VAL A 1 39  ? -5.161  -20.489 13.438  1.00   31.20 ? 39  VAL A CB    1 
ATOM   292  C  CG1   . VAL A 1 39  ? -6.086  -19.849 12.384  1.00   30.26 ? 39  VAL A CG1   1 
ATOM   293  C  CG2   . VAL A 1 39  ? -4.685  -21.871 13.029  1.00   34.34 ? 39  VAL A CG2   1 
ATOM   294  N  N     . VAL A 1 40  ? -4.091  -17.230 13.444  1.00   30.37 ? 40  VAL A N     1 
ATOM   295  C  CA    . VAL A 1 40  ? -4.453  -15.824 13.751  1.00   31.02 ? 40  VAL A CA    1 
ATOM   296  C  C     . VAL A 1 40  ? -5.007  -15.133 12.498  1.00   29.45 ? 40  VAL A C     1 
ATOM   297  O  O     . VAL A 1 40  ? -4.383  -15.183 11.416  1.00   28.62 ? 40  VAL A O     1 
ATOM   298  C  CB    . VAL A 1 40  ? -3.248  -14.923 14.219  1.00   29.06 ? 40  VAL A CB    1 
ATOM   299  C  CG1   . VAL A 1 40  ? -3.786  -13.718 14.977  1.00   28.59 ? 40  VAL A CG1   1 
ATOM   300  C  CG2   . VAL A 1 40  ? -2.304  -15.632 15.168  1.00   30.58 ? 40  VAL A CG2   1 
ATOM   301  N  N     . ALA A 1 41  ? -6.151  -14.471 12.662  1.00   26.90 ? 41  ALA A N     1 
ATOM   302  C  CA    . ALA A 1 41  ? -6.686  -13.570 11.631  1.00   27.38 ? 41  ALA A CA    1 
ATOM   303  C  C     . ALA A 1 41  ? -6.465  -12.067 11.981  1.00   26.50 ? 41  ALA A C     1 
ATOM   304  O  O     . ALA A 1 41  ? -6.685  -11.630 13.145  1.00   26.64 ? 41  ALA A O     1 
ATOM   305  C  CB    . ALA A 1 41  ? -8.188  -13.864 11.378  1.00   24.41 ? 41  ALA A CB    1 
ATOM   306  N  N     . ILE A 1 42  ? -6.035  -11.278 10.993  1.00   23.48 ? 42  ILE A N     1 
ATOM   307  C  CA    . ILE A 1 42  ? -5.687  -9.846  11.242  1.00   25.03 ? 42  ILE A CA    1 
ATOM   308  C  C     . ILE A 1 42  ? -6.260  -8.897  10.185  1.00   24.38 ? 42  ILE A C     1 
ATOM   309  O  O     . ILE A 1 42  ? -6.036  -9.114  8.973   1.00   25.47 ? 42  ILE A O     1 
ATOM   310  C  CB    . ILE A 1 42  ? -4.153  -9.619  11.366  1.00   25.55 ? 42  ILE A CB    1 
ATOM   311  C  CG1   . ILE A 1 42  ? -3.575  -10.437 12.512  1.00   27.53 ? 42  ILE A CG1   1 
ATOM   312  C  CG2   . ILE A 1 42  ? -3.803  -8.146  11.627  1.00   25.93 ? 42  ILE A CG2   1 
ATOM   313  C  CD1   . ILE A 1 42  ? -3.110  -11.791 12.071  1.00   33.91 ? 42  ILE A CD1   1 
ATOM   314  N  N     . PHE A 1 43  ? -7.014  -7.875  10.632  1.00   21.96 ? 43  PHE A N     1 
ATOM   315  C  CA    . PHE A 1 43  ? -7.390  -6.767  9.749   1.00   21.94 ? 43  PHE A CA    1 
ATOM   316  C  C     . PHE A 1 43  ? -6.362  -5.657  10.025  1.00   21.82 ? 43  PHE A C     1 
ATOM   317  O  O     . PHE A 1 43  ? -6.112  -5.324  11.177  1.00   22.22 ? 43  PHE A O     1 
ATOM   318  C  CB    . PHE A 1 43  ? -8.807  -6.291  10.058  1.00   24.15 ? 43  PHE A CB    1 
ATOM   319  C  CG    . PHE A 1 43  ? -9.212  -4.997  9.334   1.00   25.17 ? 43  PHE A CG    1 
ATOM   320  C  CD1   . PHE A 1 43  ? -9.231  -4.934  7.950   1.00   24.09 ? 43  PHE A CD1   1 
ATOM   321  C  CD2   . PHE A 1 43  ? -9.607  -3.877  10.053  1.00   27.66 ? 43  PHE A CD2   1 
ATOM   322  C  CE1   . PHE A 1 43  ? -9.611  -3.778  7.286   1.00   27.69 ? 43  PHE A CE1   1 
ATOM   323  C  CE2   . PHE A 1 43  ? -9.986  -2.710  9.413   1.00   27.38 ? 43  PHE A CE2   1 
ATOM   324  C  CZ    . PHE A 1 43  ? -9.992  -2.660  8.023   1.00   29.66 ? 43  PHE A CZ    1 
ATOM   325  N  N     . SER A 1 44  ? -5.781  -5.098  8.976   1.00   21.16 ? 44  SER A N     1 
ATOM   326  C  CA    . SER A 1 44  ? -4.663  -4.154  9.067   1.00   23.07 ? 44  SER A CA    1 
ATOM   327  C  C     . SER A 1 44  ? -4.811  -3.022  8.049   1.00   24.09 ? 44  SER A C     1 
ATOM   328  O  O     . SER A 1 44  ? -5.271  -3.209  6.928   1.00   25.70 ? 44  SER A O     1 
ATOM   329  C  CB    . SER A 1 44  ? -3.321  -4.873  8.860   1.00   23.49 ? 44  SER A CB    1 
ATOM   330  O  OG    . SER A 1 44  ? -2.196  -3.988  9.136   1.00   26.66 ? 44  SER A OG    1 
ATOM   331  N  N     . VAL A 1 45  ? -4.408  -1.831  8.443   1.00   22.53 ? 45  VAL A N     1 
ATOM   332  C  CA    . VAL A 1 45  ? -4.269  -0.757  7.477   1.00   23.87 ? 45  VAL A CA    1 
ATOM   333  C  C     . VAL A 1 45  ? -3.123  0.046   8.015   1.00   24.93 ? 45  VAL A C     1 
ATOM   334  O  O     . VAL A 1 45  ? -3.006  0.202   9.251   1.00   27.80 ? 45  VAL A O     1 
ATOM   335  C  CB    . VAL A 1 45  ? -5.614  0.021   7.287   1.00   24.49 ? 45  VAL A CB    1 
ATOM   336  C  CG1   . VAL A 1 45  ? -6.306  0.289   8.592   1.00   27.97 ? 45  VAL A CG1   1 
ATOM   337  C  CG2   . VAL A 1 45  ? -5.463  1.305   6.472   1.00   30.37 ? 45  VAL A CG2   1 
ATOM   338  N  N     . THR A 1 46  ? -2.240  0.485   7.122   1.00   24.46 ? 46  THR A N     1 
ATOM   339  C  CA    . THR A 1 46  ? -1.018  1.226   7.526   1.00   26.18 ? 46  THR A CA    1 
ATOM   340  C  C     . THR A 1 46  ? -0.958  2.590   6.793   1.00   28.75 ? 46  THR A C     1 
ATOM   341  O  O     . THR A 1 46  ? -1.344  2.663   5.630   1.00   31.70 ? 46  THR A O     1 
ATOM   342  C  CB    . THR A 1 46  ? 0.219   0.366   7.201   1.00   25.52 ? 46  THR A CB    1 
ATOM   343  O  OG1   . THR A 1 46  ? 0.105   -0.859  7.907   1.00   26.88 ? 46  THR A OG1   1 
ATOM   344  C  CG2   . THR A 1 46  ? 1.550   1.044   7.585   1.00   32.41 ? 46  THR A CG2   1 
ATOM   345  N  N     . VAL A 1 47  ? -0.553  3.661   7.476   1.00   27.09 ? 47  VAL A N     1 
ATOM   346  C  CA    . VAL A 1 47  ? -0.382  4.991   6.854   1.00   25.32 ? 47  VAL A CA    1 
ATOM   347  C  C     . VAL A 1 47  ? 0.915   5.651   7.302   1.00   26.69 ? 47  VAL A C     1 
ATOM   348  O  O     . VAL A 1 47  ? 1.501   5.266   8.283   1.00   27.21 ? 47  VAL A O     1 
ATOM   349  C  CB    . VAL A 1 47  ? -1.555  5.936   7.159   1.00   25.50 ? 47  VAL A CB    1 
ATOM   350  C  CG1   . VAL A 1 47  ? -2.885  5.325   6.699   1.00   28.07 ? 47  VAL A CG1   1 
ATOM   351  C  CG2   . VAL A 1 47  ? -1.609  6.287   8.644   1.00   27.70 ? 47  VAL A CG2   1 
ATOM   352  N  N     . ASP A 1 48  ? 1.352   6.662   6.566   1.00   29.12 ? 48  ASP A N     1 
ATOM   353  C  CA    . ASP A 1 48  ? 2.468   7.495   6.987   1.00   30.99 ? 48  ASP A CA    1 
ATOM   354  C  C     . ASP A 1 48  ? 2.111   8.208   8.302   1.00   28.94 ? 48  ASP A C     1 
ATOM   355  O  O     . ASP A 1 48  ? 0.938   8.452   8.623   1.00   26.70 ? 48  ASP A O     1 
ATOM   356  C  CB    . ASP A 1 48  ? 2.829   8.511   5.885   1.00   35.08 ? 48  ASP A CB    1 
ATOM   357  C  CG    . ASP A 1 48  ? 4.106   9.332   6.228   1.00   38.66 ? 48  ASP A CG    1 
ATOM   358  O  OD1   . ASP A 1 48  ? 5.253   8.858   5.967   1.00   42.67 ? 48  ASP A OD1   1 
ATOM   359  O  OD2   . ASP A 1 48  ? 3.968   10.455  6.775   1.00   41.92 ? 48  ASP A OD2   1 
ATOM   360  N  N     . LYS A 1 49  ? 3.125   8.558   9.061   1.00   30.35 ? 49  LYS A N     1 
ATOM   361  C  CA    . LYS A 1 49  ? 2.889   9.121   10.396  1.00   31.33 ? 49  LYS A CA    1 
ATOM   362  C  C     . LYS A 1 49  ? 2.155   10.440  10.314  1.00   32.18 ? 49  LYS A C     1 
ATOM   363  O  O     . LYS A 1 49  ? 1.476   10.826  11.268  1.00   35.14 ? 49  LYS A O     1 
ATOM   364  C  CB    . LYS A 1 49  ? 4.185   9.306   11.145  1.00   33.01 ? 49  LYS A CB    1 
ATOM   365  C  CG    . LYS A 1 49  ? 5.286   10.076  10.415  1.00   33.68 ? 49  LYS A CG    1 
ATOM   366  C  CD    . LYS A 1 49  ? 6.600   9.865   11.221  1.00   38.36 ? 49  LYS A CD    1 
ATOM   367  C  CE    . LYS A 1 49  ? 7.532   11.057  11.213  1.00   40.26 ? 49  LYS A CE    1 
ATOM   368  N  NZ    . LYS A 1 49  ? 7.965   11.419  9.838   1.00   40.06 ? 49  LYS A NZ    1 
ATOM   369  N  N     . LYS A 1 50  ? 2.272   11.123  9.172   1.00   33.15 ? 50  LYS A N     1 
ATOM   370  C  CA    . LYS A 1 50  ? 1.533   12.372  9.005   1.00   33.96 ? 50  LYS A CA    1 
ATOM   371  C  C     . LYS A 1 50  ? 0.025   12.116  8.909   1.00   32.17 ? 50  LYS A C     1 
ATOM   372  O  O     . LYS A 1 50  ? -0.715  13.051  8.932   1.00   32.09 ? 50  LYS A O     1 
ATOM   373  C  CB    . LYS A 1 50  ? 2.059   13.235  7.840   1.00   38.94 ? 50  LYS A CB    1 
ATOM   374  C  CG    . LYS A 1 50  ? 1.655   12.760  6.448   1.00   40.97 ? 50  LYS A CG    1 
ATOM   375  C  CD    . LYS A 1 50  ? 2.575   13.362  5.383   1.00   48.79 ? 50  LYS A CD    1 
ATOM   376  C  CE    . LYS A 1 50  ? 2.642   12.464  4.157   1.00   44.55 ? 50  LYS A CE    1 
ATOM   377  N  NZ    . LYS A 1 50  ? 1.302   11.923  3.755   1.00   47.01 ? 50  LYS A NZ    1 
ATOM   378  N  N     . ASP A 1 51  ? -0.391  10.847  8.816   1.00   32.03 ? 51  ASP A N     1 
ATOM   379  C  CA    . ASP A 1 51  ? -1.817  10.469  8.779   1.00   28.25 ? 51  ASP A CA    1 
ATOM   380  C  C     . ASP A 1 51  ? -2.293  9.690   10.008  1.00   30.20 ? 51  ASP A C     1 
ATOM   381  O  O     . ASP A 1 51  ? -3.311  8.956   9.932   1.00   30.54 ? 51  ASP A O     1 
ATOM   382  C  CB    . ASP A 1 51  ? -2.136  9.639   7.541   1.00   26.37 ? 51  ASP A CB    1 
ATOM   383  C  CG    . ASP A 1 51  ? -2.276  10.483  6.297   1.00   30.38 ? 51  ASP A CG    1 
ATOM   384  O  OD1   . ASP A 1 51  ? -2.761  11.639  6.406   1.00   36.84 ? 51  ASP A OD1   1 
ATOM   385  O  OD2   . ASP A 1 51  ? -1.909  9.993   5.197   1.00   29.96 ? 51  ASP A OD2   1 
ATOM   386  N  N     . LEU A 1 52  ? -1.579  9.836   11.128  1.00   30.55 ? 52  LEU A N     1 
ATOM   387  C  CA    . LEU A 1 52  ? -2.086  9.330   12.405  1.00   31.77 ? 52  LEU A CA    1 
ATOM   388  C  C     . LEU A 1 52  ? -3.520  9.765   12.669  1.00   31.77 ? 52  LEU A C     1 
ATOM   389  O  O     . LEU A 1 52  ? -4.298  8.948   13.110  1.00   33.28 ? 52  LEU A O     1 
ATOM   390  C  CB    . LEU A 1 52  ? -1.204  9.679   13.624  1.00   32.26 ? 52  LEU A CB    1 
ATOM   391  C  CG    . LEU A 1 52  ? -0.114  8.612   13.767  1.00   35.74 ? 52  LEU A CG    1 
ATOM   392  C  CD1   . LEU A 1 52  ? 1.013   9.076   14.650  1.00   36.37 ? 52  LEU A CD1   1 
ATOM   393  C  CD2   . LEU A 1 52  ? -0.696  7.310   14.300  1.00   38.86 ? 52  LEU A CD2   1 
ATOM   394  N  N     . PHE A 1 53  ? -3.877  11.024  12.406  1.00   32.14 ? 53  PHE A N     1 
ATOM   395  C  CA    . PHE A 1 53  ? -5.258  11.485  12.726  1.00   30.96 ? 53  PHE A CA    1 
ATOM   396  C  C     . PHE A 1 53  ? -6.278  10.627  11.981  1.00   28.96 ? 53  PHE A C     1 
ATOM   397  O  O     . PHE A 1 53  ? -7.378  10.355  12.519  1.00   27.06 ? 53  PHE A O     1 
ATOM   398  C  CB    . PHE A 1 53  ? -5.466  12.984  12.445  1.00   34.70 ? 53  PHE A CB    1 
ATOM   399  C  CG    . PHE A 1 53  ? -5.461  13.332  10.982  1.00   36.44 ? 53  PHE A CG    1 
ATOM   400  C  CD1   . PHE A 1 53  ? -4.240  13.452  10.274  1.00   38.55 ? 53  PHE A CD1   1 
ATOM   401  C  CD2   . PHE A 1 53  ? -6.680  13.520  10.293  1.00   36.76 ? 53  PHE A CD2   1 
ATOM   402  C  CE1   . PHE A 1 53  ? -4.236  13.725  8.905   1.00   41.31 ? 53  PHE A CE1   1 
ATOM   403  C  CE2   . PHE A 1 53  ? -6.682  13.805  8.932   1.00   35.98 ? 53  PHE A CE2   1 
ATOM   404  C  CZ    . PHE A 1 53  ? -5.449  13.924  8.243   1.00   43.10 ? 53  PHE A CZ    1 
ATOM   405  N  N     . LEU A 1 54  ? -5.900  10.178  10.768  1.00   27.11 ? 54  LEU A N     1 
ATOM   406  C  CA    . LEU A 1 54  ? -6.781  9.323   9.979   1.00   27.67 ? 54  LEU A CA    1 
ATOM   407  C  C     . LEU A 1 54  ? -6.964  7.961   10.621  1.00   27.35 ? 54  LEU A C     1 
ATOM   408  O  O     . LEU A 1 54  ? -8.065  7.399   10.623  1.00   27.60 ? 54  LEU A O     1 
ATOM   409  C  CB    . LEU A 1 54  ? -6.305  9.183   8.531   1.00   29.28 ? 54  LEU A CB    1 
ATOM   410  C  CG    . LEU A 1 54  ? -7.222  8.418   7.555   1.00   30.48 ? 54  LEU A CG    1 
ATOM   411  C  CD1   . LEU A 1 54  ? -8.674  8.939   7.561   1.00   30.44 ? 54  LEU A CD1   1 
ATOM   412  C  CD2   . LEU A 1 54  ? -6.657  8.431   6.137   1.00   28.71 ? 54  LEU A CD2   1 
ATOM   413  N  N     . LEU A 1 55  ? -5.877  7.409   11.155  1.00   28.34 ? 55  LEU A N     1 
ATOM   414  C  CA    . LEU A 1 55  ? -5.990  6.138   11.802  1.00   29.57 ? 55  LEU A CA    1 
ATOM   415  C  C     . LEU A 1 55  ? -6.826  6.222   13.078  1.00   29.54 ? 55  LEU A C     1 
ATOM   416  O  O     . LEU A 1 55  ? -7.659  5.321   13.352  1.00   31.28 ? 55  LEU A O     1 
ATOM   417  C  CB    . LEU A 1 55  ? -4.627  5.570   12.135  1.00   30.40 ? 55  LEU A CB    1 
ATOM   418  C  CG    . LEU A 1 55  ? -3.721  4.990   11.070  1.00   28.83 ? 55  LEU A CG    1 
ATOM   419  C  CD1   . LEU A 1 55  ? -2.537  4.249   11.760  1.00   27.22 ? 55  LEU A CD1   1 
ATOM   420  C  CD2   . LEU A 1 55  ? -4.546  4.064   10.211  1.00   25.95 ? 55  LEU A CD2   1 
ATOM   421  N  N     . GLU A 1 56  ? -6.620  7.280   13.859  1.00   29.14 ? 56  GLU A N     1 
ATOM   422  C  CA    . GLU A 1 56  ? -7.455  7.452   15.062  1.00   31.82 ? 56  GLU A CA    1 
ATOM   423  C  C     . GLU A 1 56  ? -8.947  7.563   14.682  1.00   31.32 ? 56  GLU A C     1 
ATOM   424  O  O     . GLU A 1 56  ? -9.786  7.081   15.444  1.00   29.93 ? 56  GLU A O     1 
ATOM   425  C  CB    . GLU A 1 56  ? -7.047  8.665   15.901  1.00   34.10 ? 56  GLU A CB    1 
ATOM   426  C  CG    . GLU A 1 56  ? -5.558  8.947   15.914  1.00   39.85 ? 56  GLU A CG    1 
ATOM   427  C  CD    . GLU A 1 56  ? -4.825  8.593   17.206  1.00   46.33 ? 56  GLU A CD    1 
ATOM   428  O  OE1   . GLU A 1 56  ? -5.288  7.692   17.957  1.00   50.51 ? 56  GLU A OE1   1 
ATOM   429  O  OE2   . GLU A 1 56  ? -3.746  9.221   17.453  1.00   55.91 ? 56  GLU A OE2   1 
ATOM   430  N  N     . SER A 1 57  ? -9.268  8.178   13.532  1.00   28.77 ? 57  SER A N     1 
ATOM   431  C  CA    . SER A 1 57  ? -10.693 8.238   13.063  1.00   28.76 ? 57  SER A CA    1 
ATOM   432  C  C     . SER A 1 57  ? -11.235 6.902   12.687  1.00   27.20 ? 57  SER A C     1 
ATOM   433  O  O     . SER A 1 57  ? -12.394 6.581   12.984  1.00   28.82 ? 57  SER A O     1 
ATOM   434  C  CB    . SER A 1 57  ? -10.885 9.129   11.837  1.00   31.11 ? 57  SER A CB    1 
ATOM   435  O  OG    . SER A 1 57  ? -10.617 10.452  12.186  1.00   33.28 ? 57  SER A OG    1 
ATOM   436  N  N     . LEU A 1 58  ? -10.424 6.139   11.968  1.00   26.39 ? 58  LEU A N     1 
ATOM   437  C  CA    . LEU A 1 58  ? -10.792 4.762   11.647  1.00   27.32 ? 58  LEU A CA    1 
ATOM   438  C  C     . LEU A 1 58  ? -11.111 3.933   12.889  1.00   27.06 ? 58  LEU A C     1 
ATOM   439  O  O     . LEU A 1 58  ? -12.137 3.225   12.949  1.00   27.39 ? 58  LEU A O     1 
ATOM   440  C  CB    . LEU A 1 58  ? -9.664  4.103   10.827  1.00   30.49 ? 58  LEU A CB    1 
ATOM   441  C  CG    . LEU A 1 58  ? -9.777  3.658   9.356   1.00   33.87 ? 58  LEU A CG    1 
ATOM   442  C  CD1   . LEU A 1 58  ? -10.708 4.424   8.428   1.00   35.41 ? 58  LEU A CD1   1 
ATOM   443  C  CD2   . LEU A 1 58  ? -8.392  3.437   8.688   1.00   40.78 ? 58  LEU A CD2   1 
ATOM   444  N  N     . LYS A 1 59  ? -10.248 4.024   13.894  1.00   26.51 ? 59  LYS A N     1 
ATOM   445  C  CA    . LYS A 1 59  ? -10.449 3.256   15.112  1.00   26.94 ? 59  LYS A CA    1 
ATOM   446  C  C     . LYS A 1 59  ? -11.753 3.673   15.776  1.00   26.82 ? 59  LYS A C     1 
ATOM   447  O  O     . LYS A 1 59  ? -12.533 2.821   16.178  1.00   26.90 ? 59  LYS A O     1 
ATOM   448  C  CB    . LYS A 1 59  ? -9.272  3.423   16.075  1.00   26.81 ? 59  LYS A CB    1 
ATOM   449  C  CG    . LYS A 1 59  ? -9.524  2.864   17.470  1.00   28.53 ? 59  LYS A CG    1 
ATOM   450  C  CD    . LYS A 1 59  ? -8.209  2.491   18.148  1.00   30.54 ? 59  LYS A CD    1 
ATOM   451  C  CE    . LYS A 1 59  ? -8.366  2.427   19.663  1.00   34.47 ? 59  LYS A CE    1 
ATOM   452  N  NZ    . LYS A 1 59  ? -7.333  1.511   20.170  1.00   36.93 ? 59  LYS A NZ    1 
ATOM   453  N  N     . THR A 1 60  ? -12.000 4.973   15.865  1.00   28.23 ? 60  THR A N     1 
ATOM   454  C  CA    . THR A 1 60  ? -13.296 5.467   16.394  1.00   30.58 ? 60  THR A CA    1 
ATOM   455  C  C     . THR A 1 60  ? -14.456 4.946   15.568  1.00   29.93 ? 60  THR A C     1 
ATOM   456  O  O     . THR A 1 60  ? -15.485 4.544   16.123  1.00   29.01 ? 60  THR A O     1 
ATOM   457  C  CB    . THR A 1 60  ? -13.347 6.998   16.365  1.00   33.21 ? 60  THR A CB    1 
ATOM   458  O  OG1   . THR A 1 60  ? -12.240 7.479   17.133  1.00   36.59 ? 60  THR A OG1   1 
ATOM   459  C  CG2   . THR A 1 60  ? -14.657 7.543   16.966  1.00   32.90 ? 60  THR A CG2   1 
ATOM   460  N  N     . PHE A 1 61  ? -14.273 4.956   14.236  1.00   28.80 ? 61  PHE A N     1 
ATOM   461  C  CA    . PHE A 1 61  ? -15.297 4.470   13.322  1.00   28.17 ? 61  PHE A CA    1 
ATOM   462  C  C     . PHE A 1 61  ? -15.661 3.013   13.634  1.00   27.09 ? 61  PHE A C     1 
ATOM   463  O  O     . PHE A 1 61  ? -16.832 2.624   13.641  1.00   26.98 ? 61  PHE A O     1 
ATOM   464  C  CB    . PHE A 1 61  ? -14.827 4.597   11.872  1.00   28.19 ? 61  PHE A CB    1 
ATOM   465  C  CG    . PHE A 1 61  ? -15.877 4.196   10.868  1.00   28.00 ? 61  PHE A CG    1 
ATOM   466  C  CD1   . PHE A 1 61  ? -16.861 5.101   10.483  1.00   27.89 ? 61  PHE A CD1   1 
ATOM   467  C  CD2   . PHE A 1 61  ? -15.890 2.916   10.316  1.00   26.09 ? 61  PHE A CD2   1 
ATOM   468  C  CE1   . PHE A 1 61  ? -17.819 4.755   9.540   1.00   28.76 ? 61  PHE A CE1   1 
ATOM   469  C  CE2   . PHE A 1 61  ? -16.856 2.573   9.386   1.00   29.28 ? 61  PHE A CE2   1 
ATOM   470  C  CZ    . PHE A 1 61  ? -17.829 3.487   9.013   1.00   27.30 ? 61  PHE A CZ    1 
ATOM   471  N  N     . PHE A 1 62  ? -14.639 2.208   13.913  1.00   28.09 ? 62  PHE A N     1 
ATOM   472  C  CA    . PHE A 1 62  ? -14.864 0.826   14.383  1.00   27.87 ? 62  PHE A CA    1 
ATOM   473  C  C     . PHE A 1 62  ? -15.011 0.635   15.905  1.00   28.64 ? 62  PHE A C     1 
ATOM   474  O  O     . PHE A 1 62  ? -14.600 -0.405  16.471  1.00   27.81 ? 62  PHE A O     1 
ATOM   475  C  CB    . PHE A 1 62  ? -13.783 -0.068  13.788  1.00   28.19 ? 62  PHE A CB    1 
ATOM   476  C  CG    . PHE A 1 62  ? -13.937 -0.239  12.301  1.00   28.39 ? 62  PHE A CG    1 
ATOM   477  C  CD1   . PHE A 1 62  ? -15.156 -0.739  11.766  1.00   28.34 ? 62  PHE A CD1   1 
ATOM   478  C  CD2   . PHE A 1 62  ? -12.937 0.161   11.441  1.00   25.54 ? 62  PHE A CD2   1 
ATOM   479  C  CE1   . PHE A 1 62  ? -15.317 -0.911  10.391  1.00   26.82 ? 62  PHE A CE1   1 
ATOM   480  C  CE2   . PHE A 1 62  ? -13.095 0.010   10.063  1.00   28.60 ? 62  PHE A CE2   1 
ATOM   481  C  CZ    . PHE A 1 62  ? -14.276 -0.537  9.538   1.00   23.32 ? 62  PHE A CZ    1 
ATOM   482  N  N     . GLY A 1 63  ? -15.615 1.642   16.548  1.00   30.04 ? 63  GLY A N     1 
ATOM   483  C  CA    . GLY A 1 63  ? -16.012 1.592   17.962  1.00   31.96 ? 63  GLY A CA    1 
ATOM   484  C  C     . GLY A 1 63  ? -14.872 1.454   18.951  1.00   33.32 ? 63  GLY A C     1 
ATOM   485  O  O     . GLY A 1 63  ? -15.081 0.998   20.061  1.00   36.04 ? 63  GLY A O     1 
ATOM   486  N  N     . GLY A 1 64  ? -13.658 1.845   18.559  1.00   33.21 ? 64  GLY A N     1 
ATOM   487  C  CA    . GLY A 1 64  ? -12.551 1.921   19.509  1.00   32.73 ? 64  GLY A CA    1 
ATOM   488  C  C     . GLY A 1 64  ? -11.837 0.604   19.658  1.00   31.94 ? 64  GLY A C     1 
ATOM   489  O  O     . GLY A 1 64  ? -10.963 0.467   20.504  1.00   34.69 ? 64  GLY A O     1 
ATOM   490  N  N     . LEU A 1 65  ? -12.204 -0.365  18.824  1.00   32.36 ? 65  LEU A N     1 
ATOM   491  C  CA    . LEU A 1 65  ? -11.579 -1.699  18.803  1.00   31.81 ? 65  LEU A CA    1 
ATOM   492  C  C     . LEU A 1 65  ? -10.181 -1.648  18.206  1.00   29.24 ? 65  LEU A C     1 
ATOM   493  O  O     . LEU A 1 65  ? -9.952  -0.829  17.365  1.00   28.00 ? 65  LEU A O     1 
ATOM   494  C  CB    . LEU A 1 65  ? -12.423 -2.605  17.929  1.00   33.95 ? 65  LEU A CB    1 
ATOM   495  C  CG    . LEU A 1 65  ? -13.512 -3.515  18.553  1.00   36.92 ? 65  LEU A CG    1 
ATOM   496  C  CD1   . LEU A 1 65  ? -14.511 -2.806  19.473  1.00   39.73 ? 65  LEU A CD1   1 
ATOM   497  C  CD2   . LEU A 1 65  ? -14.206 -4.244  17.391  1.00   43.20 ? 65  LEU A CD2   1 
ATOM   498  N  N     . GLY A 1 66  ? -9.266  -2.527  18.613  1.00   29.09 ? 66  GLY A N     1 
ATOM   499  C  CA    . GLY A 1 66  ? -7.990  -2.668  17.885  1.00   29.87 ? 66  GLY A CA    1 
ATOM   500  C  C     . GLY A 1 66  ? -6.891  -1.756  18.408  1.00   30.57 ? 66  GLY A C     1 
ATOM   501  O  O     . GLY A 1 66  ? -7.098  -1.055  19.356  1.00   31.00 ? 66  GLY A O     1 
ATOM   502  N  N     . SER A 1 67  ? -5.726  -1.770  17.773  1.00   28.29 ? 67  SER A N     1 
ATOM   503  C  CA    . SER A 1 67  ? -4.554  -1.073  18.276  1.00   28.68 ? 67  SER A CA    1 
ATOM   504  C  C     . SER A 1 67  ? -3.807  -0.327  17.175  1.00   27.71 ? 67  SER A C     1 
ATOM   505  O  O     . SER A 1 67  ? -3.688  -0.838  16.055  1.00   26.94 ? 67  SER A O     1 
ATOM   506  C  CB    . SER A 1 67  ? -3.591  -2.101  18.895  1.00   31.86 ? 67  SER A CB    1 
ATOM   507  O  OG    . SER A 1 67  ? -4.324  -2.856  19.858  1.00   38.37 ? 67  SER A OG    1 
ATOM   508  N  N     . ILE A 1 68  ? -3.269  0.847   17.512  1.00   28.34 ? 68  ILE A N     1 
ATOM   509  C  CA    . ILE A 1 68  ? -2.452  1.610   16.575  1.00   27.96 ? 68  ILE A CA    1 
ATOM   510  C  C     . ILE A 1 68  ? -1.055  1.599   17.157  1.00   29.67 ? 68  ILE A C     1 
ATOM   511  O  O     . ILE A 1 68  ? -0.883  1.907   18.344  1.00   31.70 ? 68  ILE A O     1 
ATOM   512  C  CB    . ILE A 1 68  ? -2.929  3.065   16.452  1.00   27.61 ? 68  ILE A CB    1 
ATOM   513  C  CG1   . ILE A 1 68  ? -4.359  3.123   15.847  1.00   27.44 ? 68  ILE A CG1   1 
ATOM   514  C  CG2   . ILE A 1 68  ? -1.876  3.915   15.722  1.00   27.56 ? 68  ILE A CG2   1 
ATOM   515  C  CD1   . ILE A 1 68  ? -5.013  4.482   15.975  1.00   25.68 ? 68  ILE A CD1   1 
ATOM   516  N  N     . LYS A 1 69  ? -0.084  1.228   16.323  1.00   28.94 ? 69  LYS A N     1 
ATOM   517  C  CA    . LYS A 1 69  ? 1.310   1.033   16.714  1.00   31.07 ? 69  LYS A CA    1 
ATOM   518  C  C     . LYS A 1 69  ? 2.256   1.457   15.600  1.00   29.98 ? 69  LYS A C     1 
ATOM   519  O  O     . LYS A 1 69  ? 1.927   1.357   14.424  1.00   28.80 ? 69  LYS A O     1 
ATOM   520  C  CB    . LYS A 1 69  ? 1.568   -0.460  17.008  1.00   32.16 ? 69  LYS A CB    1 
ATOM   521  C  CG    . LYS A 1 69  ? 0.814   -1.074  18.197  1.00   35.04 ? 69  LYS A CG    1 
ATOM   522  C  CD    . LYS A 1 69  ? 1.398   -0.782  19.575  1.00   36.37 ? 69  LYS A CD    1 
ATOM   523  C  CE    . LYS A 1 69  ? 0.534   -1.456  20.669  1.00   41.12 ? 69  LYS A CE    1 
ATOM   524  N  NZ    . LYS A 1 69  ? 0.709   -2.941  20.922  1.00   43.24 ? 69  LYS A NZ    1 
ATOM   525  N  N     . LYS A 1 70  ? 3.462   1.872   15.963  1.00   31.32 ? 70  LYS A N     1 
ATOM   526  C  CA    . LYS A 1 70  ? 4.514   2.177   14.979  1.00   33.02 ? 70  LYS A CA    1 
ATOM   527  C  C     . LYS A 1 70  ? 4.723   0.927   14.106  1.00   33.46 ? 70  LYS A C     1 
ATOM   528  O  O     . LYS A 1 70  ? 4.787   -0.194  14.615  1.00   34.04 ? 70  LYS A O     1 
ATOM   529  C  CB    . LYS A 1 70  ? 5.817   2.540   15.706  1.00   35.55 ? 70  LYS A CB    1 
ATOM   530  C  CG    . LYS A 1 70  ? 7.010   2.950   14.809  1.00   34.40 ? 70  LYS A CG    1 
ATOM   531  C  CD    . LYS A 1 70  ? 8.293   3.074   15.619  1.00   37.63 ? 70  LYS A CD    1 
ATOM   532  C  CE    . LYS A 1 70  ? 9.509   3.472   14.761  1.00   38.70 ? 70  LYS A CE    1 
ATOM   533  N  NZ    . LYS A 1 70  ? 10.601  3.930   15.682  1.00   44.35 ? 70  LYS A NZ    1 
ATOM   534  N  N     . SER A 1 71  ? 4.824   1.115   12.791  1.00   33.30 ? 71  SER A N     1 
ATOM   535  C  CA    . SER A 1 71  ? 4.979   -0.020  11.903  1.00   34.15 ? 71  SER A CA    1 
ATOM   536  C  C     . SER A 1 71  ? 6.361   -0.111  11.267  1.00   38.39 ? 71  SER A C     1 
ATOM   537  O  O     . SER A 1 71  ? 6.935   -1.178  11.210  1.00   43.87 ? 71  SER A O     1 
ATOM   538  C  CB    . SER A 1 71  ? 3.895   -0.051  10.848  1.00   34.35 ? 71  SER A CB    1 
ATOM   539  O  OG    . SER A 1 71  ? 4.039   -1.252  10.145  1.00   39.47 ? 71  SER A OG    1 
ATOM   540  N  N     . GLY A 1 72  ? 6.874   1.014   10.790  1.00   39.56 ? 72  GLY A N     1 
ATOM   541  C  CA    . GLY A 1 72  ? 8.194   1.120   10.216  1.00   39.74 ? 72  GLY A CA    1 
ATOM   542  C  C     . GLY A 1 72  ? 8.628   2.513   10.597  1.00   40.18 ? 72  GLY A C     1 
ATOM   543  O  O     . GLY A 1 72  ? 7.907   3.193   11.343  1.00   42.48 ? 72  GLY A O     1 
ATOM   544  N  N     . ASN A 1 73  ? 9.784   2.956   10.091  1.00   37.77 ? 73  ASN A N     1 
ATOM   545  C  CA    . ASN A 1 73  ? 10.329  4.249   10.446  1.00   42.84 ? 73  ASN A CA    1 
ATOM   546  C  C     . ASN A 1 73  ? 9.388   5.434   10.431  1.00   41.51 ? 73  ASN A C     1 
ATOM   547  O  O     . ASN A 1 73  ? 9.503   6.310   11.278  1.00   47.11 ? 73  ASN A O     1 
ATOM   548  C  CB    . ASN A 1 73  ? 11.506  4.586   9.555   1.00   43.15 ? 73  ASN A CB    1 
ATOM   549  C  CG    . ASN A 1 73  ? 12.787  4.320   10.231  1.00   52.38 ? 73  ASN A CG    1 
ATOM   550  O  OD1   . ASN A 1 73  ? 13.171  3.153   10.415  1.00   64.18 ? 73  ASN A OD1   1 
ATOM   551  N  ND2   . ASN A 1 73  ? 13.463  5.395   10.662  1.00   56.80 ? 73  ASN A ND2   1 
ATOM   552  N  N     . SER A 1 74  ? 8.485   5.484   9.460   1.00   38.88 ? 74  SER A N     1 
ATOM   553  C  CA    . SER A 1 74  ? 7.594   6.632   9.357   1.00   36.15 ? 74  SER A CA    1 
ATOM   554  C  C     . SER A 1 74  ? 6.150   6.232   9.129   1.00   33.15 ? 74  SER A C     1 
ATOM   555  O  O     . SER A 1 74  ? 5.350   7.041   8.615   1.00   34.39 ? 74  SER A O     1 
ATOM   556  C  CB    . SER A 1 74  ? 8.082   7.619   8.287   1.00   41.27 ? 74  SER A CB    1 
ATOM   557  O  OG    . SER A 1 74  ? 8.234   6.974   7.031   1.00   50.25 ? 74  SER A OG    1 
ATOM   558  N  N     . THR A 1 75  ? 5.808   5.003   9.508   1.00   31.84 ? 75  THR A N     1 
ATOM   559  C  CA    . THR A 1 75  ? 4.389   4.529   9.345   1.00   31.11 ? 75  THR A CA    1 
ATOM   560  C  C     . THR A 1 75  ? 3.806   3.986   10.632  1.00   29.52 ? 75  THR A C     1 
ATOM   561  O  O     . THR A 1 75  ? 4.530   3.700   11.568  1.00   28.48 ? 75  THR A O     1 
ATOM   562  C  CB    . THR A 1 75  ? 4.277   3.428   8.284   1.00   33.56 ? 75  THR A CB    1 
ATOM   563  O  OG1   . THR A 1 75  ? 5.079   2.314   8.692   1.00   35.34 ? 75  THR A OG1   1 
ATOM   564  C  CG2   . THR A 1 75  ? 4.814   3.930   6.968   1.00   36.18 ? 75  THR A CG2   1 
ATOM   565  N  N     . PHE A 1 76  ? 2.480   3.865   10.685  1.00   26.19 ? 76  PHE A N     1 
ATOM   566  C  CA    . PHE A 1 76  ? 1.824   3.370   11.877  1.00   27.15 ? 76  PHE A CA    1 
ATOM   567  C  C     . PHE A 1 76  ? 0.777   2.473   11.333  1.00   25.95 ? 76  PHE A C     1 
ATOM   568  O  O     . PHE A 1 76  ? 0.213   2.784   10.288  1.00   24.82 ? 76  PHE A O     1 
ATOM   569  C  CB    . PHE A 1 76  ? 1.149   4.484   12.716  1.00   26.29 ? 76  PHE A CB    1 
ATOM   570  C  CG    . PHE A 1 76  ? 2.088   5.186   13.645  1.00   30.11 ? 76  PHE A CG    1 
ATOM   571  C  CD1   . PHE A 1 76  ? 2.960   6.154   13.147  1.00   31.93 ? 76  PHE A CD1   1 
ATOM   572  C  CD2   . PHE A 1 76  ? 2.116   4.884   15.029  1.00   30.40 ? 76  PHE A CD2   1 
ATOM   573  C  CE1   . PHE A 1 76  ? 3.863   6.784   13.985  1.00   37.14 ? 76  PHE A CE1   1 
ATOM   574  C  CE2   . PHE A 1 76  ? 3.012   5.531   15.864  1.00   33.43 ? 76  PHE A CE2   1 
ATOM   575  C  CZ    . PHE A 1 76  ? 3.881   6.485   15.347  1.00   35.96 ? 76  PHE A CZ    1 
ATOM   576  N  N     . SER A 1 77  ? 0.561   1.359   12.024  1.00   28.65 ? 77  SER A N     1 
ATOM   577  C  CA    . SER A 1 77  ? -0.481  0.344   11.724  1.00   28.37 ? 77  SER A CA    1 
ATOM   578  C  C     . SER A 1 77  ? -1.717  0.514   12.595  1.00   26.96 ? 77  SER A C     1 
ATOM   579  O  O     . SER A 1 77  ? -1.549  0.763   13.790  1.00   28.89 ? 77  SER A O     1 
ATOM   580  C  CB    . SER A 1 77  ? 0.087   -1.016  12.135  1.00   33.85 ? 77  SER A CB    1 
ATOM   581  O  OG    . SER A 1 77  ? 0.327   -1.795  10.992  1.00   47.70 ? 77  SER A OG    1 
ATOM   582  N  N     . TYR A 1 78  ? -2.932  0.361   12.036  1.00   22.86 ? 78  TYR A N     1 
ATOM   583  C  CA    . TYR A 1 78  ? -4.123  0.081   12.827  1.00   24.25 ? 78  TYR A CA    1 
ATOM   584  C  C     . TYR A 1 78  ? -4.530  -1.364  12.568  1.00   24.52 ? 78  TYR A C     1 
ATOM   585  O  O     . TYR A 1 78  ? -4.762  -1.751  11.411  1.00   25.07 ? 78  TYR A O     1 
ATOM   586  C  CB    . TYR A 1 78  ? -5.295  0.999   12.439  1.00   23.80 ? 78  TYR A CB    1 
ATOM   587  C  CG    . TYR A 1 78  ? -6.656  0.645   13.053  1.00   26.38 ? 78  TYR A CG    1 
ATOM   588  C  CD1   . TYR A 1 78  ? -6.835  0.577   14.435  1.00   25.95 ? 78  TYR A CD1   1 
ATOM   589  C  CD2   . TYR A 1 78  ? -7.788  0.404   12.231  1.00   27.18 ? 78  TYR A CD2   1 
ATOM   590  C  CE1   . TYR A 1 78  ? -8.095  0.283   14.986  1.00   27.68 ? 78  TYR A CE1   1 
ATOM   591  C  CE2   . TYR A 1 78  ? -9.052  0.118   12.774  1.00   29.07 ? 78  TYR A CE2   1 
ATOM   592  C  CZ    . TYR A 1 78  ? -9.194  0.049   14.157  1.00   27.93 ? 78  TYR A CZ    1 
ATOM   593  O  OH    . TYR A 1 78  ? -10.410 -0.236  14.719  1.00   27.56 ? 78  TYR A OH    1 
ATOM   594  N  N     . ARG A 1 79  ? -4.651  -2.158  13.634  1.00   24.28 ? 79  ARG A N     1 
ATOM   595  C  CA    . ARG A 1 79  ? -4.911  -3.590  13.488  1.00   24.08 ? 79  ARG A CA    1 
ATOM   596  C  C     . ARG A 1 79  ? -5.974  -4.080  14.414  1.00   24.42 ? 79  ARG A C     1 
ATOM   597  O  O     . ARG A 1 79  ? -6.033  -3.650  15.553  1.00   27.39 ? 79  ARG A O     1 
ATOM   598  C  CB    . ARG A 1 79  ? -3.628  -4.390  13.730  1.00   24.94 ? 79  ARG A CB    1 
ATOM   599  C  CG    . ARG A 1 79  ? -2.810  -4.399  12.489  1.00   25.30 ? 79  ARG A CG    1 
ATOM   600  C  CD    . ARG A 1 79  ? -1.498  -5.147  12.694  1.00   28.49 ? 79  ARG A CD    1 
ATOM   601  N  NE    . ARG A 1 79  ? -0.814  -5.142  11.426  1.00   28.19 ? 79  ARG A NE    1 
ATOM   602  C  CZ    . ARG A 1 79  ? 0.372   -5.699  11.200  1.00   30.02 ? 79  ARG A CZ    1 
ATOM   603  N  NH1   . ARG A 1 79  ? 1.010   -6.326  12.173  1.00   29.16 ? 79  ARG A NH1   1 
ATOM   604  N  NH2   . ARG A 1 79  ? 0.916   -5.630  9.979   1.00   32.88 ? 79  ARG A NH2   1 
ATOM   605  N  N     . ILE A 1 80  ? -6.833  -4.948  13.897  1.00   24.10 ? 80  ILE A N     1 
ATOM   606  C  CA    . ILE A 1 80  ? -7.723  -5.751  14.748  1.00   27.27 ? 80  ILE A CA    1 
ATOM   607  C  C     . ILE A 1 80  ? -7.358  -7.224  14.562  1.00   30.07 ? 80  ILE A C     1 
ATOM   608  O  O     . ILE A 1 80  ? -7.352  -7.771  13.438  1.00   27.74 ? 80  ILE A O     1 
ATOM   609  C  CB    . ILE A 1 80  ? -9.209  -5.495  14.469  1.00   27.51 ? 80  ILE A CB    1 
ATOM   610  C  CG1   . ILE A 1 80  ? -9.514  -3.996  14.667  1.00   27.58 ? 80  ILE A CG1   1 
ATOM   611  C  CG2   . ILE A 1 80  ? -10.092 -6.368  15.389  1.00   25.65 ? 80  ILE A CG2   1 
ATOM   612  C  CD1   . ILE A 1 80  ? -10.844 -3.531  14.098  1.00   26.23 ? 80  ILE A CD1   1 
ATOM   613  N  N     . GLU A 1 81  ? -7.016  -7.871  15.661  1.00   32.00 ? 81  GLU A N     1 
ATOM   614  C  CA    . GLU A 1 81  ? -6.592  -9.256  15.567  1.00   30.13 ? 81  GLU A CA    1 
ATOM   615  C  C     . GLU A 1 81  ? -7.331  -10.212 16.513  1.00   34.12 ? 81  GLU A C     1 
ATOM   616  O  O     . GLU A 1 81  ? -7.025  -11.422 16.556  1.00   34.06 ? 81  GLU A O     1 
ATOM   617  C  CB    . GLU A 1 81  ? -5.102  -9.334  15.770  1.00   31.59 ? 81  GLU A CB    1 
ATOM   618  C  CG    . GLU A 1 81  ? -4.652  -9.014  17.174  1.00   34.07 ? 81  GLU A CG    1 
ATOM   619  C  CD    . GLU A 1 81  ? -3.235  -9.493  17.373  1.00   39.90 ? 81  GLU A CD    1 
ATOM   620  O  OE1   . GLU A 1 81  ? -2.306  -8.669  17.157  1.00   49.89 ? 81  GLU A OE1   1 
ATOM   621  O  OE2   . GLU A 1 81  ? -3.058  -10.707 17.694  1.00   43.71 ? 81  GLU A OE2   1 
ATOM   622  N  N     . SER A 1 82  ? -8.312  -9.682  17.254  1.00   36.90 ? 82  SER A N     1 
ATOM   623  C  CA    . SER A 1 82  ? -9.233  -10.549 18.004  1.00   30.01 ? 82  SER A CA    1 
ATOM   624  C  C     . SER A 1 82  ? -10.313 -11.162 17.099  1.00   32.49 ? 82  SER A C     1 
ATOM   625  O  O     . SER A 1 82  ? -11.215 -10.474 16.565  1.00   32.76 ? 82  SER A O     1 
ATOM   626  C  CB    . SER A 1 82  ? -9.797  -9.850  19.240  1.00   31.02 ? 82  SER A CB    1 
ATOM   627  O  OG    . SER A 1 82  ? -11.097 -10.331 19.529  1.00   36.04 ? 82  SER A OG    1 
ATOM   628  N  N     . SER A 1 83  ? -10.165 -12.473 16.925  1.00   35.24 ? 83  SER A N     1 
ATOM   629  C  CA    . SER A 1 83  ? -11.137 -13.373 16.294  1.00   34.55 ? 83  SER A CA    1 
ATOM   630  C  C     . SER A 1 83  ? -12.590 -12.964 16.536  1.00   32.76 ? 83  SER A C     1 
ATOM   631  O  O     . SER A 1 83  ? -13.419 -12.806 15.612  1.00   30.13 ? 83  SER A O     1 
ATOM   632  C  CB    . SER A 1 83  ? -10.937 -14.743 16.932  1.00   35.56 ? 83  SER A CB    1 
ATOM   633  O  OG    . SER A 1 83  ? -10.888 -15.702 15.945  1.00   45.37 ? 83  SER A OG    1 
ATOM   634  N  N     . GLU A 1 84  ? -12.871 -12.807 17.813  1.00   29.67 ? 84  GLU A N     1 
ATOM   635  C  CA    . GLU A 1 84  ? -14.149 -12.458 18.280  1.00   32.34 ? 84  GLU A CA    1 
ATOM   636  C  C     . GLU A 1 84  ? -14.655 -11.062 17.813  1.00   30.42 ? 84  GLU A C     1 
ATOM   637  O  O     . GLU A 1 84  ? -15.796 -10.910 17.353  1.00   32.68 ? 84  GLU A O     1 
ATOM   638  C  CB    . GLU A 1 84  ? -14.026 -12.492 19.793  1.00   36.77 ? 84  GLU A CB    1 
ATOM   639  C  CG    . GLU A 1 84  ? -15.356 -12.624 20.461  1.00   43.16 ? 84  GLU A CG    1 
ATOM   640  C  CD    . GLU A 1 84  ? -15.228 -12.457 21.952  1.00   48.13 ? 84  GLU A CD    1 
ATOM   641  O  OE1   . GLU A 1 84  ? -14.112 -12.662 22.499  1.00   54.90 ? 84  GLU A OE1   1 
ATOM   642  O  OE2   . GLU A 1 84  ? -16.254 -12.104 22.564  1.00   55.57 ? 84  GLU A OE2   1 
ATOM   643  N  N     A GLN A 1 85  ? -13.808 -10.059 17.950  0.50   28.87 ? 85  GLN A N     1 
ATOM   644  N  N     B GLN A 1 85  ? -13.773 -10.072 17.984  0.50   29.18 ? 85  GLN A N     1 
ATOM   645  C  CA    A GLN A 1 85  ? -14.141 -8.720  17.549  0.50   29.95 ? 85  GLN A CA    1 
ATOM   646  C  CA    B GLN A 1 85  ? -13.939 -8.682  17.567  0.50   30.22 ? 85  GLN A CA    1 
ATOM   647  C  C     A GLN A 1 85  ? -14.232 -8.606  16.010  0.50   24.54 ? 85  GLN A C     1 
ATOM   648  C  C     B GLN A 1 85  ? -14.164 -8.577  16.047  0.50   24.78 ? 85  GLN A C     1 
ATOM   649  O  O     A GLN A 1 85  ? -15.108 -7.890  15.497  0.50   25.16 ? 85  GLN A O     1 
ATOM   650  O  O     B GLN A 1 85  ? -15.059 -7.845  15.590  0.50   25.11 ? 85  GLN A O     1 
ATOM   651  C  CB    A GLN A 1 85  ? -13.118 -7.737  18.152  0.50   31.11 ? 85  GLN A CB    1 
ATOM   652  C  CB    B GLN A 1 85  ? -12.703 -7.819  18.009  0.50   29.64 ? 85  GLN A CB    1 
ATOM   653  C  CG    A GLN A 1 85  ? -13.117 -7.777  19.686  0.50   31.98 ? 85  GLN A CG    1 
ATOM   654  C  CG    B GLN A 1 85  ? -12.688 -7.487  19.518  0.50   32.63 ? 85  GLN A CG    1 
ATOM   655  C  CD    A GLN A 1 85  ? -14.518 -7.741  20.267  0.50   33.27 ? 85  GLN A CD    1 
ATOM   656  C  CD    B GLN A 1 85  ? -11.528 -6.600  20.007  0.50   32.12 ? 85  GLN A CD    1 
ATOM   657  O  OE1   A GLN A 1 85  ? -14.806 -8.374  21.286  0.50   37.21 ? 85  GLN A OE1   1 
ATOM   658  O  OE1   B GLN A 1 85  ? -10.636 -6.204  19.254  0.50   32.96 ? 85  GLN A OE1   1 
ATOM   659  N  NE2   A GLN A 1 85  ? -15.399 -7.012  19.619  0.50   33.61 ? 85  GLN A NE2   1 
ATOM   660  N  NE2   B GLN A 1 85  ? -11.536 -6.309  21.302  0.50   36.28 ? 85  GLN A NE2   1 
ATOM   661  N  N     . LEU A 1 86  ? -13.369 -9.324  15.280  1.00   25.74 ? 86  LEU A N     1 
ATOM   662  C  CA    . LEU A 1 86  ? -13.469 -9.329  13.796  1.00   25.39 ? 86  LEU A CA    1 
ATOM   663  C  C     . LEU A 1 86  ? -14.857 -9.865  13.365  1.00   28.04 ? 86  LEU A C     1 
ATOM   664  O  O     . LEU A 1 86  ? -15.531 -9.282  12.495  1.00   29.91 ? 86  LEU A O     1 
ATOM   665  C  CB    . LEU A 1 86  ? -12.342 -10.177 13.204  1.00   23.81 ? 86  LEU A CB    1 
ATOM   666  C  CG    . LEU A 1 86  ? -10.913 -9.576  13.340  1.00   24.51 ? 86  LEU A CG    1 
ATOM   667  C  CD1   . LEU A 1 86  ? -9.788  -10.596 13.086  1.00   24.36 ? 86  LEU A CD1   1 
ATOM   668  C  CD2   . LEU A 1 86  ? -10.716 -8.389  12.388  1.00   24.50 ? 86  LEU A CD2   1 
ATOM   669  N  N     . THR A 1 87  ? -15.319 -10.930 14.018  1.00   28.42 ? 87  THR A N     1 
ATOM   670  C  CA    . THR A 1 87  ? -16.603 -11.551 13.628  1.00   28.22 ? 87  THR A CA    1 
ATOM   671  C  C     . THR A 1 87  ? -17.734 -10.679 14.040  1.00   31.92 ? 87  THR A C     1 
ATOM   672  O  O     . THR A 1 87  ? -18.759 -10.595 13.355  1.00   35.16 ? 87  THR A O     1 
ATOM   673  C  CB    . THR A 1 87  ? -16.802 -12.933 14.243  1.00   30.17 ? 87  THR A CB    1 
ATOM   674  O  OG1   . THR A 1 87  ? -15.848 -13.825 13.665  1.00   37.28 ? 87  THR A OG1   1 
ATOM   675  C  CG2   . THR A 1 87  ? -18.241 -13.486 13.989  1.00   28.83 ? 87  THR A CG2   1 
ATOM   676  N  N     . LYS A 1 88  ? -17.551 -10.010 15.164  1.00   34.46 ? 88  LYS A N     1 
ATOM   677  C  CA    . LYS A 1 88  ? -18.633 -9.235  15.727  1.00   33.64 ? 88  LYS A CA    1 
ATOM   678  C  C     . LYS A 1 88  ? -18.819 -7.926  14.994  1.00   32.94 ? 88  LYS A C     1 
ATOM   679  O  O     . LYS A 1 88  ? -19.945 -7.507  14.732  1.00   37.27 ? 88  LYS A O     1 
ATOM   680  C  CB    . LYS A 1 88  ? -18.342 -8.948  17.176  1.00   38.44 ? 88  LYS A CB    1 
ATOM   681  C  CG    . LYS A 1 88  ? -19.539 -8.393  17.906  1.00   39.28 ? 88  LYS A CG    1 
ATOM   682  C  CD    . LYS A 1 88  ? -19.373 -8.448  19.423  1.00   46.87 ? 88  LYS A CD    1 
ATOM   683  C  CE    . LYS A 1 88  ? -18.932 -7.086  19.964  1.00   46.73 ? 88  LYS A CE    1 
ATOM   684  N  NZ    . LYS A 1 88  ? -19.617 -6.796  21.253  1.00   51.32 ? 88  LYS A NZ    1 
ATOM   685  N  N     . ILE A 1 89  ? -17.709 -7.276  14.641  1.00   31.93 ? 89  ILE A N     1 
ATOM   686  C  CA    . ILE A 1 89  ? -17.787 -5.893  14.148  1.00   34.56 ? 89  ILE A CA    1 
ATOM   687  C  C     . ILE A 1 89  ? -17.418 -5.725  12.642  1.00   31.17 ? 89  ILE A C     1 
ATOM   688  O  O     . ILE A 1 89  ? -18.200 -5.149  11.843  1.00   32.65 ? 89  ILE A O     1 
ATOM   689  C  CB    . ILE A 1 89  ? -16.955 -4.974  15.091  1.00   35.56 ? 89  ILE A CB    1 
ATOM   690  C  CG1   . ILE A 1 89  ? -17.675 -4.727  16.461  1.00   39.16 ? 89  ILE A CG1   1 
ATOM   691  C  CG2   . ILE A 1 89  ? -16.506 -3.687  14.401  1.00   36.11 ? 89  ILE A CG2   1 
ATOM   692  C  CD1   . ILE A 1 89  ? -19.204 -4.553  16.485  1.00   44.36 ? 89  ILE A CD1   1 
ATOM   693  N  N     . ILE A 1 90  ? -16.252 -6.267  12.278  1.00   26.41 ? 90  ILE A N     1 
ATOM   694  C  CA    . ILE A 1 90  ? -15.619 -6.118  10.965  1.00   26.20 ? 90  ILE A CA    1 
ATOM   695  C  C     . ILE A 1 90  ? -16.335 -6.911  9.835   1.00   26.65 ? 90  ILE A C     1 
ATOM   696  O  O     . ILE A 1 90  ? -16.646 -6.306  8.811   1.00   27.88 ? 90  ILE A O     1 
ATOM   697  C  CB    . ILE A 1 90  ? -14.106 -6.507  11.051  1.00   25.28 ? 90  ILE A CB    1 
ATOM   698  C  CG1   . ILE A 1 90  ? -13.318 -5.500  11.906  1.00   30.19 ? 90  ILE A CG1   1 
ATOM   699  C  CG2   . ILE A 1 90  ? -13.494 -6.735  9.677   1.00   21.77 ? 90  ILE A CG2   1 
ATOM   700  C  CD1   . ILE A 1 90  ? -13.386 -4.050  11.428  1.00   30.02 ? 90  ILE A CD1   1 
ATOM   701  N  N     . LEU A 1 91  ? -16.590 -8.231  10.012  1.00   25.72 ? 91  LEU A N     1 
ATOM   702  C  CA    . LEU A 1 91  ? -17.424 -9.010  9.044   1.00   25.74 ? 91  LEU A CA    1 
ATOM   703  C  C     . LEU A 1 91  ? -18.781 -8.339  8.731   1.00   27.04 ? 91  LEU A C     1 
ATOM   704  O  O     . LEU A 1 91  ? -19.129 -8.146  7.567   1.00   24.33 ? 91  LEU A O     1 
ATOM   705  C  CB    . LEU A 1 91  ? -17.669 -10.481 9.485   1.00   27.58 ? 91  LEU A CB    1 
ATOM   706  C  CG    . LEU A 1 91  ? -16.398 -11.347 9.601   1.00   28.96 ? 91  LEU A CG    1 
ATOM   707  C  CD1   . LEU A 1 91  ? -16.721 -12.822 9.759   1.00   32.09 ? 91  LEU A CD1   1 
ATOM   708  C  CD2   . LEU A 1 91  ? -15.481 -11.165 8.388   1.00   31.70 ? 91  LEU A CD2   1 
ATOM   709  N  N     . PRO A 1 92  ? -19.568 -7.987  9.760   1.00   28.36 ? 92  PRO A N     1 
ATOM   710  C  CA    . PRO A 1 92  ? -20.860 -7.357  9.380   1.00   27.90 ? 92  PRO A CA    1 
ATOM   711  C  C     . PRO A 1 92  ? -20.730 -6.038  8.624   1.00   27.13 ? 92  PRO A C     1 
ATOM   712  O  O     . PRO A 1 92  ? -21.553 -5.718  7.741   1.00   29.53 ? 92  PRO A O     1 
ATOM   713  C  CB    . PRO A 1 92  ? -21.577 -7.155  10.721  1.00   28.66 ? 92  PRO A CB    1 
ATOM   714  C  CG    . PRO A 1 92  ? -20.948 -8.164  11.633  1.00   27.55 ? 92  PRO A CG    1 
ATOM   715  C  CD    . PRO A 1 92  ? -19.530 -8.399  11.181  1.00   28.06 ? 92  PRO A CD    1 
ATOM   716  N  N     . PHE A 1 93  ? -19.696 -5.266  8.912   1.00   26.80 ? 93  PHE A N     1 
ATOM   717  C  CA    . PHE A 1 93  ? -19.522 -4.049  8.132   1.00   26.24 ? 93  PHE A CA    1 
ATOM   718  C  C     . PHE A 1 93  ? -19.180 -4.371  6.656   1.00   26.11 ? 93  PHE A C     1 
ATOM   719  O  O     . PHE A 1 93  ? -19.871 -3.939  5.734   1.00   25.08 ? 93  PHE A O     1 
ATOM   720  C  CB    . PHE A 1 93  ? -18.422 -3.191  8.736   1.00   24.58 ? 93  PHE A CB    1 
ATOM   721  C  CG    . PHE A 1 93  ? -18.129 -1.986  7.933   1.00   24.55 ? 93  PHE A CG    1 
ATOM   722  C  CD1   . PHE A 1 93  ? -19.043 -0.932  7.914   1.00   25.16 ? 93  PHE A CD1   1 
ATOM   723  C  CD2   . PHE A 1 93  ? -16.988 -1.912  7.145   1.00   24.01 ? 93  PHE A CD2   1 
ATOM   724  C  CE1   . PHE A 1 93  ? -18.810 0.204   7.138   1.00   24.49 ? 93  PHE A CE1   1 
ATOM   725  C  CE2   . PHE A 1 93  ? -16.751 -0.779  6.355   1.00   25.11 ? 93  PHE A CE2   1 
ATOM   726  C  CZ    . PHE A 1 93  ? -17.655 0.292   6.378   1.00   24.46 ? 93  PHE A CZ    1 
ATOM   727  N  N     . PHE A 1 94  ? -18.103 -5.122  6.425   1.00   26.29 ? 94  PHE A N     1 
ATOM   728  C  CA    . PHE A 1 94  ? -17.742 -5.437  5.059   1.00   25.22 ? 94  PHE A CA    1 
ATOM   729  C  C     . PHE A 1 94  ? -18.693 -6.367  4.327   1.00   25.72 ? 94  PHE A C     1 
ATOM   730  O  O     . PHE A 1 94  ? -18.646 -6.431  3.112   1.00   28.31 ? 94  PHE A O     1 
ATOM   731  C  CB    . PHE A 1 94  ? -16.312 -5.944  4.996   1.00   26.80 ? 94  PHE A CB    1 
ATOM   732  C  CG    . PHE A 1 94  ? -15.306 -4.880  5.302   1.00   26.77 ? 94  PHE A CG    1 
ATOM   733  C  CD1   . PHE A 1 94  ? -15.149 -3.780  4.442   1.00   27.60 ? 94  PHE A CD1   1 
ATOM   734  C  CD2   . PHE A 1 94  ? -14.538 -4.944  6.461   1.00   26.88 ? 94  PHE A CD2   1 
ATOM   735  C  CE1   . PHE A 1 94  ? -14.205 -2.788  4.713   1.00   27.81 ? 94  PHE A CE1   1 
ATOM   736  C  CE2   . PHE A 1 94  ? -13.585 -3.956  6.734   1.00   27.29 ? 94  PHE A CE2   1 
ATOM   737  C  CZ    . PHE A 1 94  ? -13.410 -2.883  5.862   1.00   27.09 ? 94  PHE A CZ    1 
ATOM   738  N  N     . ASP A 1 95  ? -19.532 -7.115  5.040   1.00   26.14 ? 95  ASP A N     1 
ATOM   739  C  CA    . ASP A 1 95  ? -20.580 -7.890  4.344   1.00   26.95 ? 95  ASP A CA    1 
ATOM   740  C  C     . ASP A 1 95  ? -21.665 -6.952  3.821   1.00   29.14 ? 95  ASP A C     1 
ATOM   741  O  O     . ASP A 1 95  ? -22.331 -7.247  2.831   1.00   29.64 ? 95  ASP A O     1 
ATOM   742  C  CB    . ASP A 1 95  ? -21.228 -8.921  5.251   1.00   27.27 ? 95  ASP A CB    1 
ATOM   743  C  CG    . ASP A 1 95  ? -20.333 -10.079 5.561   1.00   28.23 ? 95  ASP A CG    1 
ATOM   744  O  OD1   . ASP A 1 95  ? -19.248 -10.248 4.950   1.00   27.66 ? 95  ASP A OD1   1 
ATOM   745  O  OD2   . ASP A 1 95  ? -20.730 -10.848 6.467   1.00   30.50 ? 95  ASP A OD2   1 
ATOM   746  N  N     . LYS A 1 96  ? -21.870 -5.830  4.503   1.00   29.13 ? 96  LYS A N     1 
ATOM   747  C  CA    . LYS A 1 96  ? -22.926 -4.931  4.073   1.00   30.00 ? 96  LYS A CA    1 
ATOM   748  C  C     . LYS A 1 96  ? -22.417 -3.917  3.033   1.00   29.41 ? 96  LYS A C     1 
ATOM   749  O  O     . LYS A 1 96  ? -23.119 -3.592  2.063   1.00   30.39 ? 96  LYS A O     1 
ATOM   750  C  CB    . LYS A 1 96  ? -23.565 -4.241  5.261   1.00   30.21 ? 96  LYS A CB    1 
ATOM   751  C  CG    . LYS A 1 96  ? -24.541 -3.119  4.888   1.00   30.74 ? 96  LYS A CG    1 
ATOM   752  C  CD    . LYS A 1 96  ? -25.807 -3.701  4.290   1.00   34.25 ? 96  LYS A CD    1 
ATOM   753  C  CE    . LYS A 1 96  ? -26.769 -2.616  3.826   1.00   40.15 ? 96  LYS A CE    1 
ATOM   754  N  NZ    . LYS A 1 96  ? -27.683 -2.267  4.940   1.00   48.09 ? 96  LYS A NZ    1 
ATOM   755  N  N     . TYR A 1 97  ? -21.230 -3.392  3.282   1.00   25.99 ? 97  TYR A N     1 
ATOM   756  C  CA    . TYR A 1 97  ? -20.567 -2.389  2.451   1.00   27.90 ? 97  TYR A CA    1 
ATOM   757  C  C     . TYR A 1 97  ? -19.345 -3.038  1.849   1.00   26.53 ? 97  TYR A C     1 
ATOM   758  O  O     . TYR A 1 97  ? -18.317 -3.073  2.482   1.00   26.98 ? 97  TYR A O     1 
ATOM   759  C  CB    . TYR A 1 97  ? -20.143 -1.187  3.328   1.00   25.78 ? 97  TYR A CB    1 
ATOM   760  C  CG    . TYR A 1 97  ? -21.352 -0.633  4.061   1.00   26.95 ? 97  TYR A CG    1 
ATOM   761  C  CD1   . TYR A 1 97  ? -22.302 0.136   3.387   1.00   26.32 ? 97  TYR A CD1   1 
ATOM   762  C  CD2   . TYR A 1 97  ? -21.579 -0.956  5.402   1.00   27.19 ? 97  TYR A CD2   1 
ATOM   763  C  CE1   . TYR A 1 97  ? -23.442 0.593   4.041   1.00   28.16 ? 97  TYR A CE1   1 
ATOM   764  C  CE2   . TYR A 1 97  ? -22.697 -0.499  6.071   1.00   27.87 ? 97  TYR A CE2   1 
ATOM   765  C  CZ    . TYR A 1 97  ? -23.620 0.289   5.391   1.00   28.77 ? 97  TYR A CZ    1 
ATOM   766  O  OH    . TYR A 1 97  ? -24.712 0.738   6.032   1.00   31.51 ? 97  TYR A OH    1 
ATOM   767  N  N     . SER A 1 98  ? -19.481 -3.620  0.666   1.00   28.00 ? 98  SER A N     1 
ATOM   768  C  CA    . SER A 1 98  ? -18.444 -4.574  0.166   1.00   28.38 ? 98  SER A CA    1 
ATOM   769  C  C     . SER A 1 98  ? -17.338 -3.986  -0.683  1.00   25.00 ? 98  SER A C     1 
ATOM   770  O  O     . SER A 1 98  ? -17.552 -3.033  -1.438  1.00   25.81 ? 98  SER A O     1 
ATOM   771  C  CB    . SER A 1 98  ? -19.109 -5.718  -0.602  1.00   33.13 ? 98  SER A CB    1 
ATOM   772  O  OG    . SER A 1 98  ? -19.884 -6.484  0.297   1.00   35.49 ? 98  SER A OG    1 
ATOM   773  N  N     . LEU A 1 99  ? -16.161 -4.578  -0.554  1.00   22.12 ? 99  LEU A N     1 
ATOM   774  C  CA    . LEU A 1 99  ? -14.989 -4.221  -1.307  1.00   23.67 ? 99  LEU A CA    1 
ATOM   775  C  C     . LEU A 1 99  ? -15.202 -4.491  -2.774  1.00   24.87 ? 99  LEU A C     1 
ATOM   776  O  O     . LEU A 1 99  ? -15.936 -5.399  -3.125  1.00   26.62 ? 99  LEU A O     1 
ATOM   777  C  CB    . LEU A 1 99  ? -13.807 -5.062  -0.822  1.00   23.36 ? 99  LEU A CB    1 
ATOM   778  C  CG    . LEU A 1 99  ? -13.532 -4.734  0.656   1.00   24.42 ? 99  LEU A CG    1 
ATOM   779  C  CD1   . LEU A 1 99  ? -12.834 -5.905  1.327   1.00   27.69 ? 99  LEU A CD1   1 
ATOM   780  C  CD2   . LEU A 1 99  ? -12.717 -3.456  0.785   1.00   24.25 ? 99  LEU A CD2   1 
ATOM   781  N  N     . ILE A 1 100 ? -14.589 -3.708  -3.653  1.00   25.45 ? 100 ILE A N     1 
ATOM   782  C  CA    . ILE A 1 100 ? -14.764 -4.071  -5.059  1.00   26.18 ? 100 ILE A CA    1 
ATOM   783  C  C     . ILE A 1 100 ? -13.478 -4.447  -5.827  1.00   23.66 ? 100 ILE A C     1 
ATOM   784  O  O     . ILE A 1 100 ? -13.565 -4.828  -6.961  1.00   24.61 ? 100 ILE A O     1 
ATOM   785  C  CB    . ILE A 1 100 ? -15.616 -3.070  -5.832  1.00   26.62 ? 100 ILE A CB    1 
ATOM   786  C  CG1   . ILE A 1 100 ? -14.892 -1.739  -6.004  1.00   28.50 ? 100 ILE A CG1   1 
ATOM   787  C  CG2   . ILE A 1 100 ? -17.037 -2.940  -5.221  1.00   28.15 ? 100 ILE A CG2   1 
ATOM   788  C  CD1   . ILE A 1 100 ? -15.631 -0.818  -6.963  1.00   29.81 ? 100 ILE A CD1   1 
ATOM   789  N  N     . THR A 1 101 ? -12.294 -4.285  -5.251  1.00   23.63 ? 101 THR A N     1 
ATOM   790  C  CA    . THR A 1 101 ? -11.098 -4.692  -5.983  1.00   25.46 ? 101 THR A CA    1 
ATOM   791  C  C     . THR A 1 101 ? -10.937 -6.179  -5.786  1.00   27.91 ? 101 THR A C     1 
ATOM   792  O  O     . THR A 1 101 ? -11.796 -6.818  -5.148  1.00   28.43 ? 101 THR A O     1 
ATOM   793  C  CB    . THR A 1 101 ? -9.821  -4.004  -5.484  1.00   24.10 ? 101 THR A CB    1 
ATOM   794  O  OG1   . THR A 1 101 ? -9.603  -4.339  -4.111  1.00   27.17 ? 101 THR A OG1   1 
ATOM   795  C  CG2   . THR A 1 101 ? -9.940  -2.484  -5.582  1.00   24.80 ? 101 THR A CG2   1 
ATOM   796  N  N     . GLU A 1 102 ? -9.808  -6.720  -6.277  1.00   28.90 ? 102 GLU A N     1 
ATOM   797  C  CA    . GLU A 1 102 ? -9.459  -8.110  -6.077  1.00   31.28 ? 102 GLU A CA    1 
ATOM   798  C  C     . GLU A 1 102 ? -9.274  -8.461  -4.594  1.00   29.74 ? 102 GLU A C     1 
ATOM   799  O  O     . GLU A 1 102 ? -9.342  -9.617  -4.196  1.00   32.53 ? 102 GLU A O     1 
ATOM   800  C  CB    . GLU A 1 102 ? -8.175  -8.427  -6.813  1.00   29.69 ? 102 GLU A CB    1 
ATOM   801  C  CG    . GLU A 1 102 ? -8.373  -8.987  -8.176  1.00   31.69 ? 102 GLU A CG    1 
ATOM   802  C  CD    . GLU A 1 102 ? -9.022  -10.347 -8.126  1.00   34.99 ? 102 GLU A CD    1 
ATOM   803  O  OE1   . GLU A 1 102 ? -8.488  -11.279 -7.465  1.00   43.44 ? 102 GLU A OE1   1 
ATOM   804  O  OE2   . GLU A 1 102 ? -10.086 -10.463 -8.747  1.00   37.83 ? 102 GLU A OE2   1 
ATOM   805  N  N     . LYS A 1 103 ? -9.023  -7.464  -3.767  1.00   29.97 ? 103 LYS A N     1 
ATOM   806  C  CA    . LYS A 1 103 ? -8.897  -7.707  -2.343  1.00   27.79 ? 103 LYS A CA    1 
ATOM   807  C  C     . LYS A 1 103 ? -10.171 -8.297  -1.715  1.00   25.78 ? 103 LYS A C     1 
ATOM   808  O  O     . LYS A 1 103 ? -10.118 -8.889  -0.647  1.00   30.47 ? 103 LYS A O     1 
ATOM   809  C  CB    . LYS A 1 103 ? -8.516  -6.425  -1.653  1.00   27.23 ? 103 LYS A CB    1 
ATOM   810  C  CG    . LYS A 1 103 ? -8.250  -6.569  -0.179  1.00   27.55 ? 103 LYS A CG    1 
ATOM   811  C  CD    . LYS A 1 103 ? -7.857  -5.186  0.374   1.00   29.14 ? 103 LYS A CD    1 
ATOM   812  C  CE    . LYS A 1 103 ? -6.788  -4.473  -0.477  1.00   24.75 ? 103 LYS A CE    1 
ATOM   813  N  NZ    . LYS A 1 103 ? -5.445  -5.131  -0.363  1.00   28.17 ? 103 LYS A NZ    1 
ATOM   814  N  N     . LEU A 1 104 ? -11.307 -8.116  -2.361  1.00   25.14 ? 104 LEU A N     1 
ATOM   815  C  CA    . LEU A 1 104 ? -12.532 -8.784  -1.932  1.00   24.09 ? 104 LEU A CA    1 
ATOM   816  C  C     . LEU A 1 104 ? -12.367 -10.313 -1.841  1.00   25.83 ? 104 LEU A C     1 
ATOM   817  O  O     . LEU A 1 104 ? -12.936 -10.973 -0.952  1.00   24.21 ? 104 LEU A O     1 
ATOM   818  C  CB    . LEU A 1 104 ? -13.656 -8.455  -2.913  1.00   24.27 ? 104 LEU A CB    1 
ATOM   819  C  CG    . LEU A 1 104 ? -14.998 -9.177  -2.691  1.00   27.85 ? 104 LEU A CG    1 
ATOM   820  C  CD1   . LEU A 1 104 ? -15.619 -8.731  -1.373  1.00   28.93 ? 104 LEU A CD1   1 
ATOM   821  C  CD2   . LEU A 1 104 ? -15.992 -8.923  -3.824  1.00   27.90 ? 104 LEU A CD2   1 
ATOM   822  N  N     . GLY A 1 105 ? -11.631 -10.885 -2.796  1.00   27.39 ? 105 GLY A N     1 
ATOM   823  C  CA    . GLY A 1 105 ? -11.323 -12.301 -2.786  1.00   26.89 ? 105 GLY A CA    1 
ATOM   824  C  C     . GLY A 1 105 ? -10.622 -12.652 -1.495  1.00   24.41 ? 105 GLY A C     1 
ATOM   825  O  O     . GLY A 1 105 ? -10.895 -13.679 -0.894  1.00   25.95 ? 105 GLY A O     1 
ATOM   826  N  N     . ASP A 1 106 ? -9.703  -11.811 -1.054  1.00   25.67 ? 106 ASP A N     1 
ATOM   827  C  CA    . ASP A 1 106 ? -8.961  -12.141 0.161   1.00   26.53 ? 106 ASP A CA    1 
ATOM   828  C  C     . ASP A 1 106 ? -9.890  -11.958 1.368   1.00   26.28 ? 106 ASP A C     1 
ATOM   829  O  O     . ASP A 1 106 ? -9.865  -12.765 2.292   1.00   25.78 ? 106 ASP A O     1 
ATOM   830  C  CB    . ASP A 1 106 ? -7.749  -11.238 0.290   1.00   27.56 ? 106 ASP A CB    1 
ATOM   831  C  CG    . ASP A 1 106 ? -6.754  -11.463 -0.819  1.00   30.54 ? 106 ASP A CG    1 
ATOM   832  O  OD1   . ASP A 1 106 ? -6.278  -12.612 -1.008  1.00   31.10 ? 106 ASP A OD1   1 
ATOM   833  O  OD2   . ASP A 1 106 ? -6.464  -10.473 -1.529  1.00   38.72 ? 106 ASP A OD2   1 
ATOM   834  N  N     . TYR A 1 107 ? -10.726 -10.907 1.340   1.00   24.71 ? 107 TYR A N     1 
ATOM   835  C  CA    . TYR A 1 107 ? -11.721 -10.735 2.369   1.00   23.91 ? 107 TYR A CA    1 
ATOM   836  C  C     . TYR A 1 107 ? -12.563 -12.000 2.494   1.00   24.37 ? 107 TYR A C     1 
ATOM   837  O  O     . TYR A 1 107 ? -12.869 -12.476 3.598   1.00   27.10 ? 107 TYR A O     1 
ATOM   838  C  CB    . TYR A 1 107 ? -12.638 -9.537  2.072   1.00   24.11 ? 107 TYR A CB    1 
ATOM   839  C  CG    . TYR A 1 107 ? -13.777 -9.493  3.038   1.00   24.48 ? 107 TYR A CG    1 
ATOM   840  C  CD1   . TYR A 1 107 ? -13.575 -9.081  4.368   1.00   25.21 ? 107 TYR A CD1   1 
ATOM   841  C  CD2   . TYR A 1 107 ? -15.038 -9.922  2.660   1.00   26.19 ? 107 TYR A CD2   1 
ATOM   842  C  CE1   . TYR A 1 107 ? -14.628 -9.071  5.275   1.00   23.64 ? 107 TYR A CE1   1 
ATOM   843  C  CE2   . TYR A 1 107 ? -16.100 -9.912  3.547   1.00   25.09 ? 107 TYR A CE2   1 
ATOM   844  C  CZ    . TYR A 1 107 ? -15.885 -9.488  4.852   1.00   24.96 ? 107 TYR A CZ    1 
ATOM   845  O  OH    . TYR A 1 107 ? -16.942 -9.473  5.722   1.00   28.43 ? 107 TYR A OH    1 
ATOM   846  N  N     . LEU A 1 108 ? -12.976 -12.555 1.382   1.00   24.49 ? 108 LEU A N     1 
ATOM   847  C  CA    . LEU A 1 108 ? -14.009 -13.599 1.493   1.00   27.48 ? 108 LEU A CA    1 
ATOM   848  C  C     . LEU A 1 108 ? -13.378 -14.924 2.014   1.00   27.16 ? 108 LEU A C     1 
ATOM   849  O  O     . LEU A 1 108 ? -14.023 -15.681 2.741   1.00   28.19 ? 108 LEU A O     1 
ATOM   850  C  CB    . LEU A 1 108 ? -14.661 -13.801 0.139   1.00   29.82 ? 108 LEU A CB    1 
ATOM   851  C  CG    . LEU A 1 108 ? -16.043 -13.255 -0.302  1.00   33.07 ? 108 LEU A CG    1 
ATOM   852  C  CD1   . LEU A 1 108 ? -16.783 -12.199 0.548   1.00   33.71 ? 108 LEU A CD1   1 
ATOM   853  C  CD2   . LEU A 1 108 ? -15.920 -12.892 -1.773  1.00   30.87 ? 108 LEU A CD2   1 
ATOM   854  N  N     . LEU A 1 109 ? -12.117 -15.182 1.655   1.00   28.05 ? 109 LEU A N     1 
ATOM   855  C  CA    . LEU A 1 109 ? -11.386 -16.329 2.217   1.00   27.79 ? 109 LEU A CA    1 
ATOM   856  C  C     . LEU A 1 109 ? -11.101 -16.120 3.699   1.00   28.01 ? 109 LEU A C     1 
ATOM   857  O  O     . LEU A 1 109 ? -11.219 -17.042 4.500   1.00   28.95 ? 109 LEU A O     1 
ATOM   858  C  CB    . LEU A 1 109 ? -10.061 -16.512 1.495   1.00   29.74 ? 109 LEU A CB    1 
ATOM   859  C  CG    . LEU A 1 109 ? -9.895  -17.332 0.208   1.00   34.53 ? 109 LEU A CG    1 
ATOM   860  C  CD1   . LEU A 1 109 ? -11.177 -17.867 -0.414  1.00   32.42 ? 109 LEU A CD1   1 
ATOM   861  C  CD2   . LEU A 1 109 ? -8.999  -16.620 -0.813  1.00   37.31 ? 109 LEU A CD2   1 
ATOM   862  N  N     . PHE A 1 110 ? -10.764 -14.908 4.060   1.00   29.31 ? 110 PHE A N     1 
ATOM   863  C  CA    . PHE A 1 110 ? -10.537 -14.488 5.422   1.00   27.63 ? 110 PHE A CA    1 
ATOM   864  C  C     . PHE A 1 110 ? -11.792 -14.699 6.256   1.00   26.69 ? 110 PHE A C     1 
ATOM   865  O  O     . PHE A 1 110 ? -11.721 -15.121 7.356   1.00   27.84 ? 110 PHE A O     1 
ATOM   866  C  CB    . PHE A 1 110 ? -10.099 -13.032 5.349   1.00   26.73 ? 110 PHE A CB    1 
ATOM   867  C  CG    . PHE A 1 110 ? -10.060 -12.280 6.630   1.00   26.06 ? 110 PHE A CG    1 
ATOM   868  C  CD1   . PHE A 1 110 ? -8.935  -12.256 7.397   1.00   26.99 ? 110 PHE A CD1   1 
ATOM   869  C  CD2   . PHE A 1 110 ? -11.091 -11.456 6.966   1.00   26.55 ? 110 PHE A CD2   1 
ATOM   870  C  CE1   . PHE A 1 110 ? -8.878  -11.510 8.532   1.00   27.27 ? 110 PHE A CE1   1 
ATOM   871  C  CE2   . PHE A 1 110 ? -11.034 -10.693 8.092   1.00   26.45 ? 110 PHE A CE2   1 
ATOM   872  C  CZ    . PHE A 1 110 ? -9.944  -10.730 8.880   1.00   26.61 ? 110 PHE A CZ    1 
ATOM   873  N  N     . LYS A 1 111 ? -12.935 -14.385 5.695   1.00   25.41 ? 111 LYS A N     1 
ATOM   874  C  CA    . LYS A 1 111 ? -14.188 -14.603 6.380   1.00   26.55 ? 111 LYS A CA    1 
ATOM   875  C  C     . LYS A 1 111 ? -14.366 -16.067 6.712   1.00   27.73 ? 111 LYS A C     1 
ATOM   876  O  O     . LYS A 1 111 ? -14.741 -16.415 7.775   1.00   27.50 ? 111 LYS A O     1 
ATOM   877  C  CB    . LYS A 1 111 ? -15.351 -14.150 5.549   1.00   27.95 ? 111 LYS A CB    1 
ATOM   878  C  CG    . LYS A 1 111 ? -16.661 -14.423 6.222   1.00   29.13 ? 111 LYS A CG    1 
ATOM   879  C  CD    . LYS A 1 111 ? -17.741 -13.753 5.452   1.00   30.06 ? 111 LYS A CD    1 
ATOM   880  C  CE    . LYS A 1 111 ? -19.073 -14.388 5.707   1.00   32.28 ? 111 LYS A CE    1 
ATOM   881  N  NZ    . LYS A 1 111 ? -20.080 -13.343 5.678   1.00   31.48 ? 111 LYS A NZ    1 
ATOM   882  N  N     . LYS A 1 112 ? -14.055 -16.900 5.759   1.00   27.56 ? 112 LYS A N     1 
ATOM   883  C  CA    . LYS A 1 112 ? -14.194 -18.307 5.919   1.00   28.51 ? 112 LYS A CA    1 
ATOM   884  C  C     . LYS A 1 112 ? -13.320 -18.886 7.017   1.00   27.93 ? 112 LYS A C     1 
ATOM   885  O  O     . LYS A 1 112 ? -13.752 -19.674 7.780   1.00   27.17 ? 112 LYS A O     1 
ATOM   886  C  CB    . LYS A 1 112 ? -13.965 -18.980 4.602   1.00   29.69 ? 112 LYS A CB    1 
ATOM   887  C  CG    . LYS A 1 112 ? -15.113 -18.797 3.633   1.00   33.54 ? 112 LYS A CG    1 
ATOM   888  C  CD    . LYS A 1 112 ? -14.903 -19.697 2.448   1.00   39.59 ? 112 LYS A CD    1 
ATOM   889  C  CE    . LYS A 1 112 ? -15.730 -19.282 1.249   1.00   44.55 ? 112 LYS A CE    1 
ATOM   890  N  NZ    . LYS A 1 112 ? -15.269 -19.937 -0.007  1.00   44.67 ? 112 LYS A NZ    1 
ATOM   891  N  N     . VAL A 1 113 ? -12.095 -18.436 7.096   1.00   26.71 ? 113 VAL A N     1 
ATOM   892  C  CA    . VAL A 1 113 ? -11.233 -18.788 8.192   1.00   28.24 ? 113 VAL A CA    1 
ATOM   893  C  C     . VAL A 1 113 ? -11.883 -18.424 9.533   1.00   29.32 ? 113 VAL A C     1 
ATOM   894  O  O     . VAL A 1 113 ? -12.038 -19.242 10.372  1.00   32.52 ? 113 VAL A O     1 
ATOM   895  C  CB    . VAL A 1 113 ? -9.855  -18.145 8.016   1.00   29.98 ? 113 VAL A CB    1 
ATOM   896  C  CG1   . VAL A 1 113 ? -9.041  -18.228 9.267   1.00   29.64 ? 113 VAL A CG1   1 
ATOM   897  C  CG2   . VAL A 1 113 ? -9.144  -18.714 6.806   1.00   28.00 ? 113 VAL A CG2   1 
ATOM   898  N  N     . LEU A 1 114 ? -12.288 -17.187 9.699   1.00   26.32 ? 114 LEU A N     1 
ATOM   899  C  CA    . LEU A 1 114 ? -12.934 -16.737 10.915  1.00   27.29 ? 114 LEU A CA    1 
ATOM   900  C  C     . LEU A 1 114 ? -14.152 -17.571 11.282  1.00   28.68 ? 114 LEU A C     1 
ATOM   901  O  O     . LEU A 1 114 ? -14.501 -17.696 12.410  1.00   28.37 ? 114 LEU A O     1 
ATOM   902  C  CB    . LEU A 1 114 ? -13.409 -15.334 10.741  1.00   28.22 ? 114 LEU A CB    1 
ATOM   903  C  CG    . LEU A 1 114 ? -12.735 -14.118 11.326  1.00   33.10 ? 114 LEU A CG    1 
ATOM   904  C  CD1   . LEU A 1 114 ? -11.589 -14.302 12.254  1.00   31.79 ? 114 LEU A CD1   1 
ATOM   905  C  CD2   . LEU A 1 114 ? -12.504 -13.020 10.346  1.00   31.98 ? 114 LEU A CD2   1 
ATOM   906  N  N     . GLU A 1 115 ? -14.809 -18.094 10.282  1.00   28.85 ? 115 GLU A N     1 
ATOM   907  C  CA    . GLU A 1 115 ? -15.968 -18.914 10.493  1.00   30.47 ? 115 GLU A CA    1 
ATOM   908  C  C     . GLU A 1 115 ? -15.521 -20.208 11.140  1.00   31.69 ? 115 GLU A C     1 
ATOM   909  O  O     . GLU A 1 115 ? -16.100 -20.660 12.060  1.00   30.91 ? 115 GLU A O     1 
ATOM   910  C  CB    . GLU A 1 115 ? -16.713 -19.120 9.186   1.00   34.08 ? 115 GLU A CB    1 
ATOM   911  C  CG    . GLU A 1 115 ? -17.371 -17.829 8.714   1.00   36.77 ? 115 GLU A CG    1 
ATOM   912  C  CD    . GLU A 1 115 ? -18.270 -17.958 7.515   1.00   44.27 ? 115 GLU A CD    1 
ATOM   913  O  OE1   . GLU A 1 115 ? -18.089 -18.865 6.704   1.00   56.45 ? 115 GLU A OE1   1 
ATOM   914  O  OE2   . GLU A 1 115 ? -19.160 -17.132 7.378   1.00   49.07 ? 115 GLU A OE2   1 
ATOM   915  N  N     . LEU A 1 116 ? -14.430 -20.752 10.665  1.00   32.82 ? 116 LEU A N     1 
ATOM   916  C  CA    . LEU A 1 116 ? -13.870 -21.941 11.225  1.00   31.77 ? 116 LEU A CA    1 
ATOM   917  C  C     . LEU A 1 116 ? -13.346 -21.673 12.635  1.00   31.91 ? 116 LEU A C     1 
ATOM   918  O  O     . LEU A 1 116 ? -13.468 -22.484 13.496  1.00   33.97 ? 116 LEU A O     1 
ATOM   919  C  CB    . LEU A 1 116 ? -12.782 -22.456 10.327  1.00   30.81 ? 116 LEU A CB    1 
ATOM   920  C  CG    . LEU A 1 116 ? -13.155 -23.484 9.287   1.00   36.32 ? 116 LEU A CG    1 
ATOM   921  C  CD1   . LEU A 1 116 ? -14.609 -23.857 9.240   1.00   39.73 ? 116 LEU A CD1   1 
ATOM   922  C  CD2   . LEU A 1 116 ? -12.670 -23.139 7.913   1.00   37.01 ? 116 LEU A CD2   1 
ATOM   923  N  N     . MET A 1 117 ? -12.768 -20.518 12.846  1.00   29.44 ? 117 MET A N     1 
ATOM   924  C  CA    . MET A 1 117 ? -12.254 -20.153 14.139  1.00   30.42 ? 117 MET A CA    1 
ATOM   925  C  C     . MET A 1 117 ? -13.397 -19.983 15.107  1.00   31.32 ? 117 MET A C     1 
ATOM   926  O  O     . MET A 1 117 ? -13.279 -20.292 16.246  1.00   35.13 ? 117 MET A O     1 
ATOM   927  C  CB    . MET A 1 117 ? -11.426 -18.886 14.055  1.00   28.48 ? 117 MET A CB    1 
ATOM   928  C  CG    . MET A 1 117 ? -10.111 -19.053 13.338  1.00   30.01 ? 117 MET A CG    1 
ATOM   929  S  SD    . MET A 1 117 ? -9.134  -17.590 13.230  1.00   31.34 ? 117 MET A SD    1 
ATOM   930  C  CE    . MET A 1 117 ? -8.373  -17.521 14.810  1.00   31.12 ? 117 MET A CE    1 
ATOM   931  N  N     . GLY A 1 118 ? -14.504 -19.471 14.604  1.00   32.71 ? 118 GLY A N     1 
ATOM   932  C  CA    . GLY A 1 118 ? -15.723 -19.326 15.357  1.00   32.89 ? 118 GLY A CA    1 
ATOM   933  C  C     . GLY A 1 118 ? -16.170 -20.579 16.077  1.00   33.51 ? 118 GLY A C     1 
ATOM   934  O  O     . GLY A 1 118 ? -16.572 -20.516 17.182  1.00   36.41 ? 118 GLY A O     1 
ATOM   935  N  N     . THR A 1 119 ? -16.083 -21.711 15.423  1.00   37.06 ? 119 THR A N     1 
ATOM   936  C  CA    . THR A 1 119 ? -16.522 -22.953 16.011  1.00   38.65 ? 119 THR A CA    1 
ATOM   937  C  C     . THR A 1 119 ? -15.340 -23.714 16.577  1.00   38.58 ? 119 THR A C     1 
ATOM   938  O  O     . THR A 1 119 ? -15.426 -24.873 16.879  1.00   38.30 ? 119 THR A O     1 
ATOM   939  C  CB    . THR A 1 119 ? -17.215 -23.799 14.978  1.00   39.33 ? 119 THR A CB    1 
ATOM   940  O  OG1   . THR A 1 119 ? -16.294 -24.080 13.939  1.00   45.49 ? 119 THR A OG1   1 
ATOM   941  C  CG2   . THR A 1 119 ? -18.369 -23.047 14.397  1.00   37.71 ? 119 THR A CG2   1 
ATOM   942  N  N     . LYS A 1 120 ? -14.231 -23.014 16.714  1.00   38.23 ? 120 LYS A N     1 
ATOM   943  C  CA    . LYS A 1 120 ? -13.017 -23.568 17.263  1.00   36.83 ? 120 LYS A CA    1 
ATOM   944  C  C     . LYS A 1 120 ? -12.482 -24.704 16.475  1.00   35.28 ? 120 LYS A C     1 
ATOM   945  O  O     . LYS A 1 120 ? -11.703 -25.447 16.948  1.00   36.45 ? 120 LYS A O     1 
ATOM   946  C  CB    . LYS A 1 120 ? -13.242 -24.046 18.674  1.00   42.05 ? 120 LYS A CB    1 
ATOM   947  C  CG    . LYS A 1 120 ? -14.014 -23.104 19.529  1.00   41.74 ? 120 LYS A CG    1 
ATOM   948  C  CD    . LYS A 1 120 ? -13.085 -22.110 20.114  1.00   47.48 ? 120 LYS A CD    1 
ATOM   949  C  CE    . LYS A 1 120 ? -13.523 -21.712 21.487  1.00   48.22 ? 120 LYS A CE    1 
ATOM   950  N  NZ    . LYS A 1 120 ? -14.468 -20.577 21.422  1.00   57.27 ? 120 LYS A NZ    1 
ATOM   951  N  N     . GLU A 1 121 ? -12.900 -24.824 15.253  1.00   36.94 ? 121 GLU A N     1 
ATOM   952  C  CA    . GLU A 1 121 ? -12.402 -25.929 14.463  1.00   38.25 ? 121 GLU A CA    1 
ATOM   953  C  C     . GLU A 1 121 ? -10.922 -25.778 14.168  1.00   36.59 ? 121 GLU A C     1 
ATOM   954  O  O     . GLU A 1 121 ? -10.263 -26.767 13.839  1.00   39.30 ? 121 GLU A O     1 
ATOM   955  C  CB    . GLU A 1 121 ? -13.139 -26.013 13.135  1.00   43.87 ? 121 GLU A CB    1 
ATOM   956  C  CG    . GLU A 1 121 ? -14.521 -26.630 13.209  1.00   49.29 ? 121 GLU A CG    1 
ATOM   957  C  CD    . GLU A 1 121 ? -15.125 -26.750 11.820  1.00   55.24 ? 121 GLU A CD    1 
ATOM   958  O  OE1   . GLU A 1 121 ? -16.164 -26.080 11.580  1.00   62.82 ? 121 GLU A OE1   1 
ATOM   959  O  OE2   . GLU A 1 121 ? -14.546 -27.482 10.957  1.00   53.64 ? 121 GLU A OE2   1 
ATOM   960  N  N     . HIS A 1 122 ? -10.405 -24.545 14.262  1.00   35.99 ? 122 HIS A N     1 
ATOM   961  C  CA    . HIS A 1 122 ? -8.989  -24.301 14.025  1.00   35.29 ? 122 HIS A CA    1 
ATOM   962  C  C     . HIS A 1 122 ? -8.116  -25.114 14.962  1.00   37.36 ? 122 HIS A C     1 
ATOM   963  O  O     . HIS A 1 122 ? -6.945  -25.367 14.686  1.00   39.85 ? 122 HIS A O     1 
ATOM   964  C  CB    . HIS A 1 122 ? -8.645  -22.805 14.105  1.00   33.87 ? 122 HIS A CB    1 
ATOM   965  C  CG    . HIS A 1 122 ? -8.935  -22.179 15.432  1.00   33.55 ? 122 HIS A CG    1 
ATOM   966  N  ND1   . HIS A 1 122 ? -10.219 -21.984 15.894  1.00   34.34 ? 122 HIS A ND1   1 
ATOM   967  C  CD2   . HIS A 1 122 ? -8.110  -21.670 16.379  1.00   32.60 ? 122 HIS A CD2   1 
ATOM   968  C  CE1   . HIS A 1 122 ? -10.172 -21.423 17.087  1.00   35.33 ? 122 HIS A CE1   1 
ATOM   969  N  NE2   . HIS A 1 122 ? -8.908  -21.201 17.397  1.00   34.33 ? 122 HIS A NE2   1 
ATOM   970  N  N     . LEU A 1 123 ? -8.707  -25.535 16.076  1.00   39.24 ? 123 LEU A N     1 
ATOM   971  C  CA    . LEU A 1 123 ? -8.002  -26.331 17.056  1.00   38.51 ? 123 LEU A CA    1 
ATOM   972  C  C     . LEU A 1 123 ? -7.993  -27.805 16.668  1.00   38.28 ? 123 LEU A C     1 
ATOM   973  O  O     . LEU A 1 123 ? -7.577  -28.640 17.462  1.00   43.72 ? 123 LEU A O     1 
ATOM   974  C  CB    . LEU A 1 123 ? -8.649  -26.149 18.434  1.00   37.39 ? 123 LEU A CB    1 
ATOM   975  C  CG    . LEU A 1 123 ? -8.587  -24.705 18.941  1.00   37.08 ? 123 LEU A CG    1 
ATOM   976  C  CD1   . LEU A 1 123 ? -9.281  -24.563 20.293  1.00   39.84 ? 123 LEU A CD1   1 
ATOM   977  C  CD2   . LEU A 1 123 ? -7.138  -24.199 18.999  1.00   38.10 ? 123 LEU A CD2   1 
ATOM   978  N  N     . THR A 1 124 ? -8.488  -28.152 15.483  1.00   36.33 ? 124 THR A N     1 
ATOM   979  C  CA    . THR A 1 124 ? -8.550  -29.584 15.128  1.00   37.45 ? 124 THR A CA    1 
ATOM   980  C  C     . THR A 1 124 ? -7.704  -29.828 13.906  1.00   38.29 ? 124 THR A C     1 
ATOM   981  O  O     . THR A 1 124 ? -7.458  -28.896 13.141  1.00   37.45 ? 124 THR A O     1 
ATOM   982  C  CB    . THR A 1 124 ? -9.989  -30.053 14.864  1.00   38.63 ? 124 THR A CB    1 
ATOM   983  O  OG1   . THR A 1 124 ? -10.523 -29.332 13.743  1.00   41.01 ? 124 THR A OG1   1 
ATOM   984  C  CG2   . THR A 1 124 ? -10.903 -29.855 16.139  1.00   36.82 ? 124 THR A CG2   1 
ATOM   985  N  N     . GLN A 1 125 ? -7.246  -31.066 13.716  1.00   39.87 ? 125 GLN A N     1 
ATOM   986  C  CA    . GLN A 1 125 ? -6.415  -31.390 12.553  1.00   41.81 ? 125 GLN A CA    1 
ATOM   987  C  C     . GLN A 1 125 ? -7.134  -31.048 11.238  1.00   41.06 ? 125 GLN A C     1 
ATOM   988  O  O     . GLN A 1 125 ? -6.543  -30.415 10.350  1.00   40.99 ? 125 GLN A O     1 
ATOM   989  C  CB    . GLN A 1 125 ? -5.903  -32.836 12.580  1.00   43.91 ? 125 GLN A CB    1 
ATOM   990  C  CG    . GLN A 1 125 ? -4.817  -33.109 11.528  1.00   47.24 ? 125 GLN A CG    1 
ATOM   991  C  CD    . GLN A 1 125 ? -3.639  -32.132 11.574  1.00   48.40 ? 125 GLN A CD    1 
ATOM   992  O  OE1   . GLN A 1 125 ? -3.268  -31.613 12.637  1.00   52.97 ? 125 GLN A OE1   1 
ATOM   993  N  NE2   . GLN A 1 125 ? -3.026  -31.899 10.420  1.00   47.90 ? 125 GLN A NE2   1 
ATOM   994  N  N     . ARG A 1 126 ? -8.413  -31.417 11.140  1.00   41.61 ? 126 ARG A N     1 
ATOM   995  C  CA    . ARG A 1 126 ? -9.195  -31.152 9.939   1.00   41.89 ? 126 ARG A CA    1 
ATOM   996  C  C     . ARG A 1 126 ? -9.480  -29.667 9.707   1.00   38.55 ? 126 ARG A C     1 
ATOM   997  O  O     . ARG A 1 126 ? -9.432  -29.206 8.583   1.00   41.61 ? 126 ARG A O     1 
ATOM   998  C  CB    . ARG A 1 126 ? -10.526 -31.921 9.980   1.00   45.09 ? 126 ARG A CB    1 
ATOM   999  C  CG    . ARG A 1 126 ? -11.310 -31.895 8.655   1.00   46.02 ? 126 ARG A CG    1 
ATOM   1000 C  CD    . ARG A 1 126 ? -12.541 -32.815 8.687   1.00   51.82 ? 126 ARG A CD    1 
ATOM   1001 N  NE    . ARG A 1 126 ? -12.204 -34.263 8.733   1.00   57.18 ? 126 ARG A NE    1 
ATOM   1002 C  CZ    . ARG A 1 126 ? -12.118 -35.058 7.658   1.00   53.27 ? 126 ARG A CZ    1 
ATOM   1003 N  NH1   . ARG A 1 126 ? -12.327 -34.558 6.443   1.00   61.79 ? 126 ARG A NH1   1 
ATOM   1004 N  NH2   . ARG A 1 126 ? -11.822 -36.344 7.783   1.00   53.76 ? 126 ARG A NH2   1 
ATOM   1005 N  N     . GLY A 1 127 ? -9.811  -28.925 10.759  1.00   39.20 ? 127 GLY A N     1 
ATOM   1006 C  CA    . GLY A 1 127 ? -10.184 -27.517 10.623  1.00   36.42 ? 127 GLY A CA    1 
ATOM   1007 C  C     . GLY A 1 127 ? -8.916  -26.810 10.194  1.00   35.81 ? 127 GLY A C     1 
ATOM   1008 O  O     . GLY A 1 127 ? -8.967  -25.943 9.319   1.00   33.54 ? 127 GLY A O     1 
ATOM   1009 N  N     . LEU A 1 128 ? -7.775  -27.220 10.779  1.00   36.64 ? 128 LEU A N     1 
ATOM   1010 C  CA    . LEU A 1 128 ? -6.472  -26.639 10.439  1.00   35.25 ? 128 LEU A CA    1 
ATOM   1011 C  C     . LEU A 1 128 ? -6.141  -26.790 8.959   1.00   34.36 ? 128 LEU A C     1 
ATOM   1012 O  O     . LEU A 1 128 ? -5.775  -25.811 8.320   1.00   33.59 ? 128 LEU A O     1 
ATOM   1013 C  CB    . LEU A 1 128 ? -5.346  -27.216 11.286  1.00   34.54 ? 128 LEU A CB    1 
ATOM   1014 C  CG    . LEU A 1 128 ? -3.892  -26.848 10.910  1.00   34.65 ? 128 LEU A CG    1 
ATOM   1015 C  CD1   . LEU A 1 128 ? -3.613  -25.355 11.057  1.00   34.97 ? 128 LEU A CD1   1 
ATOM   1016 C  CD2   . LEU A 1 128 ? -2.913  -27.616 11.769  1.00   35.99 ? 128 LEU A CD2   1 
ATOM   1017 N  N     . GLU A 1 129 ? -6.263  -28.010 8.436   1.00   34.80 ? 129 GLU A N     1 
ATOM   1018 C  CA    . GLU A 1 129 ? -6.042  -28.262 7.028   1.00   36.51 ? 129 GLU A CA    1 
ATOM   1019 C  C     . GLU A 1 129 ? -6.922  -27.367 6.102   1.00   36.54 ? 129 GLU A C     1 
ATOM   1020 O  O     . GLU A 1 129 ? -6.412  -26.784 5.114   1.00   35.37 ? 129 GLU A O     1 
ATOM   1021 C  CB    . GLU A 1 129 ? -6.140  -29.766 6.741   1.00   39.96 ? 129 GLU A CB    1 
ATOM   1022 C  CG    . GLU A 1 129 ? -4.964  -30.477 7.397   1.00   42.41 ? 129 GLU A CG    1 
ATOM   1023 C  CD    . GLU A 1 129 ? -4.864  -31.965 7.096   1.00   47.77 ? 129 GLU A CD    1 
ATOM   1024 O  OE1   . GLU A 1 129 ? -4.239  -32.710 7.900   1.00   50.41 ? 129 GLU A OE1   1 
ATOM   1025 O  OE2   . GLU A 1 129 ? -5.393  -32.395 6.051   1.00   50.66 ? 129 GLU A OE2   1 
ATOM   1026 N  N     . LYS A 1 130 ? -8.209  -27.229 6.443   1.00   35.32 ? 130 LYS A N     1 
ATOM   1027 C  CA    . LYS A 1 130 ? -9.113  -26.336 5.696   1.00   34.47 ? 130 LYS A CA    1 
ATOM   1028 C  C     . LYS A 1 130 ? -8.583  -24.899 5.696   1.00   31.65 ? 130 LYS A C     1 
ATOM   1029 O  O     . LYS A 1 130 ? -8.602  -24.229 4.652   1.00   31.46 ? 130 LYS A O     1 
ATOM   1030 C  CB    . LYS A 1 130 ? -10.517 -26.338 6.313   1.00   35.18 ? 130 LYS A CB    1 
ATOM   1031 C  CG    . LYS A 1 130 ? -11.253 -27.668 6.159   1.00   39.05 ? 130 LYS A CG    1 
ATOM   1032 C  CD    . LYS A 1 130 ? -12.428 -27.720 7.137   1.00   43.08 ? 130 LYS A CD    1 
ATOM   1033 C  CE    . LYS A 1 130 ? -13.543 -28.675 6.741   1.00   45.47 ? 130 LYS A CE    1 
ATOM   1034 N  NZ    . LYS A 1 130 ? -14.786 -28.294 7.495   1.00   48.75 ? 130 LYS A NZ    1 
ATOM   1035 N  N     . ILE A 1 131 ? -8.099  -24.444 6.861   1.00   30.49 ? 131 ILE A N     1 
ATOM   1036 C  CA    . ILE A 1 131 ? -7.532  -23.095 7.004   1.00   30.73 ? 131 ILE A CA    1 
ATOM   1037 C  C     . ILE A 1 131 ? -6.230  -22.900 6.204   1.00   31.40 ? 131 ILE A C     1 
ATOM   1038 O  O     . ILE A 1 131 ? -6.066  -21.876 5.508   1.00   30.46 ? 131 ILE A O     1 
ATOM   1039 C  CB    . ILE A 1 131 ? -7.368  -22.714 8.475   1.00   30.16 ? 131 ILE A CB    1 
ATOM   1040 C  CG1   . ILE A 1 131 ? -8.753  -22.479 9.081   1.00   29.93 ? 131 ILE A CG1   1 
ATOM   1041 C  CG2   . ILE A 1 131 ? -6.536  -21.428 8.645   1.00   28.13 ? 131 ILE A CG2   1 
ATOM   1042 C  CD1   . ILE A 1 131 ? -8.751  -22.434 10.580  1.00   29.75 ? 131 ILE A CD1   1 
ATOM   1043 N  N     . VAL A 1 132 ? -5.349  -23.900 6.267   1.00   33.35 ? 132 VAL A N     1 
ATOM   1044 C  CA    . VAL A 1 132 ? -4.200  -23.934 5.385   1.00   33.97 ? 132 VAL A CA    1 
ATOM   1045 C  C     . VAL A 1 132 ? -4.607  -23.800 3.897   1.00   33.58 ? 132 VAL A C     1 
ATOM   1046 O  O     . VAL A 1 132 ? -4.021  -22.979 3.165   1.00   32.56 ? 132 VAL A O     1 
ATOM   1047 C  CB    . VAL A 1 132 ? -3.273  -25.151 5.662   1.00   35.83 ? 132 VAL A CB    1 
ATOM   1048 C  CG1   . VAL A 1 132 ? -2.144  -25.207 4.633   1.00   35.48 ? 132 VAL A CG1   1 
ATOM   1049 C  CG2   . VAL A 1 132 ? -2.689  -25.056 7.073   1.00   36.40 ? 132 VAL A CG2   1 
ATOM   1050 N  N     . SER A 1 133 ? -5.603  -24.578 3.455   1.00   35.46 ? 133 SER A N     1 
ATOM   1051 C  CA    . SER A 1 133 ? -6.150  -24.400 2.087   1.00   35.99 ? 133 SER A CA    1 
ATOM   1052 C  C     . SER A 1 133 ? -6.660  -23.002 1.765   1.00   33.00 ? 133 SER A C     1 
ATOM   1053 O  O     . SER A 1 133 ? -6.357  -22.500 0.679   1.00   33.01 ? 133 SER A O     1 
ATOM   1054 C  CB    . SER A 1 133 ? -7.264  -25.408 1.762   1.00   39.55 ? 133 SER A CB    1 
ATOM   1055 O  OG    . SER A 1 133 ? -6.666  -26.616 1.344   1.00   45.09 ? 133 SER A OG    1 
ATOM   1056 N  N     . LEU A 1 134 ? -7.464  -22.404 2.654   1.00   32.33 ? 134 LEU A N     1 
ATOM   1057 C  CA    . LEU A 1 134 ? -7.915  -21.013 2.483   1.00   30.93 ? 134 LEU A CA    1 
ATOM   1058 C  C     . LEU A 1 134 ? -6.708  -20.063 2.401   1.00   31.35 ? 134 LEU A C     1 
ATOM   1059 O  O     . LEU A 1 134 ? -6.621  -19.224 1.489   1.00   31.13 ? 134 LEU A O     1 
ATOM   1060 C  CB    . LEU A 1 134 ? -8.878  -20.625 3.607   1.00   29.71 ? 134 LEU A CB    1 
ATOM   1061 C  CG    . LEU A 1 134 ? -10.194 -21.469 3.622   1.00   31.00 ? 134 LEU A CG    1 
ATOM   1062 C  CD1   . LEU A 1 134 ? -10.824 -21.518 5.007   1.00   29.65 ? 134 LEU A CD1   1 
ATOM   1063 C  CD2   . LEU A 1 134 ? -11.209 -20.961 2.586   1.00   31.38 ? 134 LEU A CD2   1 
ATOM   1064 N  N     . LYS A 1 135 ? -5.752  -20.222 3.318   1.00   31.64 ? 135 LYS A N     1 
ATOM   1065 C  CA    . LYS A 1 135 ? -4.624  -19.280 3.425   1.00   30.15 ? 135 LYS A CA    1 
ATOM   1066 C  C     . LYS A 1 135 ? -3.770  -19.294 2.170   1.00   31.98 ? 135 LYS A C     1 
ATOM   1067 O  O     . LYS A 1 135 ? -3.213  -18.249 1.773   1.00   32.33 ? 135 LYS A O     1 
ATOM   1068 C  CB    . LYS A 1 135 ? -3.710  -19.613 4.612   1.00   30.44 ? 135 LYS A CB    1 
ATOM   1069 C  CG    . LYS A 1 135 ? -2.480  -18.710 4.585   1.00   29.39 ? 135 LYS A CG    1 
ATOM   1070 C  CD    . LYS A 1 135 ? -1.581  -18.820 5.779   1.00   32.90 ? 135 LYS A CD    1 
ATOM   1071 C  CE    . LYS A 1 135 ? -0.275  -18.077 5.498   1.00   33.21 ? 135 LYS A CE    1 
ATOM   1072 N  NZ    . LYS A 1 135 ? -0.470  -16.610 5.611   1.00   30.87 ? 135 LYS A NZ    1 
ATOM   1073 N  N     . ALA A 1 136 ? -3.646  -20.495 1.589   1.00   33.01 ? 136 ALA A N     1 
ATOM   1074 C  CA    . ALA A 1 136 ? -2.857  -20.721 0.390   1.00   34.43 ? 136 ALA A CA    1 
ATOM   1075 C  C     . ALA A 1 136 ? -3.305  -19.846 -0.788  1.00   33.75 ? 136 ALA A C     1 
ATOM   1076 O  O     . ALA A 1 136 ? -2.529  -19.614 -1.706  1.00   37.19 ? 136 ALA A O     1 
ATOM   1077 C  CB    . ALA A 1 136 ? -2.873  -22.196 0.006   1.00   35.05 ? 136 ALA A CB    1 
ATOM   1078 N  N     . SER A 1 137 ? -4.533  -19.330 -0.730  1.00   33.64 ? 137 SER A N     1 
ATOM   1079 C  CA    . SER A 1 137 ? -5.081  -18.493 -1.787  1.00   34.29 ? 137 SER A CA    1 
ATOM   1080 C  C     . SER A 1 137 ? -5.293  -17.036 -1.395  1.00   32.03 ? 137 SER A C     1 
ATOM   1081 O  O     . SER A 1 137 ? -5.832  -16.255 -2.192  1.00   37.28 ? 137 SER A O     1 
ATOM   1082 C  CB    . SER A 1 137 ? -6.420  -19.069 -2.229  1.00   34.13 ? 137 SER A CB    1 
ATOM   1083 O  OG    . SER A 1 137 ? -6.178  -20.227 -2.989  1.00   35.50 ? 137 SER A OG    1 
ATOM   1084 N  N     . ILE A 1 138 ? -4.930  -16.697 -0.162  1.00   29.22 ? 138 ILE A N     1 
ATOM   1085 C  CA    . ILE A 1 138 ? -5.019  -15.329 0.349   1.00   30.06 ? 138 ILE A CA    1 
ATOM   1086 C  C     . ILE A 1 138 ? -3.686  -14.648 0.108   1.00   29.71 ? 138 ILE A C     1 
ATOM   1087 O  O     . ILE A 1 138 ? -2.634  -15.208 0.407   1.00   31.72 ? 138 ILE A O     1 
ATOM   1088 C  CB    . ILE A 1 138 ? -5.327  -15.319 1.873   1.00   30.72 ? 138 ILE A CB    1 
ATOM   1089 C  CG1   . ILE A 1 138 ? -6.758  -15.796 2.122   1.00   31.12 ? 138 ILE A CG1   1 
ATOM   1090 C  CG2   . ILE A 1 138 ? -5.170  -13.915 2.447   1.00   27.78 ? 138 ILE A CG2   1 
ATOM   1091 C  CD1   . ILE A 1 138 ? -6.990  -16.306 3.536   1.00   33.77 ? 138 ILE A CD1   1 
ATOM   1092 N  N     . ASN A 1 139 ? -3.716  -13.444 -0.439  1.00   28.76 ? 139 ASN A N     1 
ATOM   1093 C  CA    . ASN A 1 139 ? -2.507  -12.625 -0.499  1.00   30.14 ? 139 ASN A CA    1 
ATOM   1094 C  C     . ASN A 1 139 ? -1.335  -13.382 -1.087  1.00   32.11 ? 139 ASN A C     1 
ATOM   1095 O  O     . ASN A 1 139 ? -1.462  -13.896 -2.174  1.00   33.66 ? 139 ASN A O     1 
ATOM   1096 C  CB    . ASN A 1 139 ? -2.144  -12.082 0.886   1.00   32.30 ? 139 ASN A CB    1 
ATOM   1097 C  CG    . ASN A 1 139 ? -3.215  -11.216 1.470   1.00   32.61 ? 139 ASN A CG    1 
ATOM   1098 O  OD1   . ASN A 1 139 ? -4.013  -10.627 0.745   1.00   37.37 ? 139 ASN A OD1   1 
ATOM   1099 N  ND2   . ASN A 1 139 ? -3.253  -11.142 2.790   1.00   34.28 ? 139 ASN A ND2   1 
ATOM   1100 N  N     . LYS A 1 140 ? -0.204  -13.440 -0.392  1.00   31.75 ? 140 LYS A N     1 
ATOM   1101 C  CA    . LYS A 1 140 ? 1.007   -14.048 -0.965  1.00   33.35 ? 140 LYS A CA    1 
ATOM   1102 C  C     . LYS A 1 140 ? 1.029   -15.575 -0.944  1.00   33.49 ? 140 LYS A C     1 
ATOM   1103 O  O     . LYS A 1 140 ? 2.002   -16.181 -1.418  1.00   32.38 ? 140 LYS A O     1 
ATOM   1104 C  CB    . LYS A 1 140 ? 2.292   -13.484 -0.302  1.00   35.06 ? 140 LYS A CB    1 
ATOM   1105 C  CG    . LYS A 1 140 ? 2.601   -12.047 -0.680  1.00   37.18 ? 140 LYS A CG    1 
ATOM   1106 C  CD    . LYS A 1 140 ? 2.974   -12.018 -2.156  1.00   47.66 ? 140 LYS A CD    1 
ATOM   1107 C  CE    . LYS A 1 140 ? 2.380   -10.834 -2.916  1.00   49.91 ? 140 LYS A CE    1 
ATOM   1108 N  NZ    . LYS A 1 140 ? 1.921   -11.263 -4.266  1.00   53.24 ? 140 LYS A NZ    1 
ATOM   1109 N  N     . GLY A 1 141 ? -0.015  -16.198 -0.390  1.00   33.17 ? 141 GLY A N     1 
ATOM   1110 C  CA    . GLY A 1 141 ? -0.062  -17.690 -0.290  1.00   35.89 ? 141 GLY A CA    1 
ATOM   1111 C  C     . GLY A 1 141 ? 0.762   -18.331 0.827   1.00   36.46 ? 141 GLY A C     1 
ATOM   1112 O  O     . GLY A 1 141 ? 1.043   -17.708 1.844   1.00   36.59 ? 141 GLY A O     1 
ATOM   1113 N  N     . LEU A 1 142 ? 1.161   -19.586 0.673   1.00   35.79 ? 142 LEU A N     1 
ATOM   1114 C  CA    . LEU A 1 142 ? 1.918   -20.233 1.743   1.00   35.87 ? 142 LEU A CA    1 
ATOM   1115 C  C     . LEU A 1 142 ? 3.384   -19.878 1.723   1.00   38.84 ? 142 LEU A C     1 
ATOM   1116 O  O     . LEU A 1 142 ? 4.021   -19.788 0.665   1.00   39.05 ? 142 LEU A O     1 
ATOM   1117 C  CB    . LEU A 1 142 ? 1.770   -21.770 1.749   1.00   36.86 ? 142 LEU A CB    1 
ATOM   1118 C  CG    . LEU A 1 142 ? 0.355   -22.357 1.594   1.00   36.16 ? 142 LEU A CG    1 
ATOM   1119 C  CD1   . LEU A 1 142 ? 0.423   -23.888 1.468   1.00   37.31 ? 142 LEU A CD1   1 
ATOM   1120 C  CD2   . LEU A 1 142 ? -0.551  -21.943 2.732   1.00   34.11 ? 142 LEU A CD2   1 
ATOM   1121 N  N     . SER A 1 143 ? 3.921   -19.683 2.919   1.00   38.83 ? 143 SER A N     1 
ATOM   1122 C  CA    . SER A 1 143 ? 5.359   -19.569 3.088   1.00   40.40 ? 143 SER A CA    1 
ATOM   1123 C  C     . SER A 1 143 ? 6.023   -20.899 2.680   1.00   42.63 ? 143 SER A C     1 
ATOM   1124 O  O     . SER A 1 143 ? 5.342   -21.917 2.440   1.00   42.78 ? 143 SER A O     1 
ATOM   1125 C  CB    . SER A 1 143 ? 5.670   -19.253 4.568   1.00   42.49 ? 143 SER A CB    1 
ATOM   1126 O  OG    . SER A 1 143 ? 5.181   -20.291 5.418   1.00   37.84 ? 143 SER A OG    1 
ATOM   1127 N  N     . GLU A 1 144 ? 7.347   -20.899 2.607   1.00   43.58 ? 144 GLU A N     1 
ATOM   1128 C  CA    . GLU A 1 144 ? 8.085   -22.148 2.422   1.00   44.39 ? 144 GLU A CA    1 
ATOM   1129 C  C     . GLU A 1 144 ? 7.801   -23.118 3.567   1.00   45.34 ? 144 GLU A C     1 
ATOM   1130 O  O     . GLU A 1 144 ? 7.653   -24.327 3.344   1.00   45.29 ? 144 GLU A O     1 
ATOM   1131 C  CB    . GLU A 1 144 ? 9.572   -21.885 2.297   1.00   46.93 ? 144 GLU A CB    1 
ATOM   1132 C  CG    . GLU A 1 144 ? 9.981   -21.318 0.944   1.00   49.12 ? 144 GLU A CG    1 
ATOM   1133 C  CD    . GLU A 1 144 ? 9.839   -19.808 0.868   1.00   50.23 ? 144 GLU A CD    1 
ATOM   1134 O  OE1   . GLU A 1 144 ? 9.208   -19.222 1.778   1.00   54.41 ? 144 GLU A OE1   1 
ATOM   1135 O  OE2   . GLU A 1 144 ? 10.357  -19.198 -0.100  1.00   55.47 ? 144 GLU A OE2   1 
ATOM   1136 N  N     . GLU A 1 145 ? 7.700   -22.588 4.787   1.00   44.06 ? 145 GLU A N     1 
ATOM   1137 C  CA    . GLU A 1 145 ? 7.501   -23.427 5.947   1.00   45.22 ? 145 GLU A CA    1 
ATOM   1138 C  C     . GLU A 1 145 ? 6.133   -24.149 5.890   1.00   42.43 ? 145 GLU A C     1 
ATOM   1139 O  O     . GLU A 1 145 ? 6.016   -25.308 6.264   1.00   44.11 ? 145 GLU A O     1 
ATOM   1140 C  CB    . GLU A 1 145 ? 7.683   -22.631 7.257   1.00   45.85 ? 145 GLU A CB    1 
ATOM   1141 C  CG    . GLU A 1 145 ? 7.697   -23.538 8.506   1.00   48.13 ? 145 GLU A CG    1 
ATOM   1142 C  CD    . GLU A 1 145 ? 7.718   -22.784 9.840   1.00   47.61 ? 145 GLU A CD    1 
ATOM   1143 O  OE1   . GLU A 1 145 ? 7.087   -21.720 9.913   1.00   44.36 ? 145 GLU A OE1   1 
ATOM   1144 O  OE2   . GLU A 1 145 ? 8.366   -23.266 10.816  1.00   52.06 ? 145 GLU A OE2   1 
ATOM   1145 N  N     . LEU A 1 146 ? 5.104   -23.455 5.421   1.00   41.27 ? 146 LEU A N     1 
ATOM   1146 C  CA    . LEU A 1 146 ? 3.779   -24.038 5.364   1.00   39.54 ? 146 LEU A CA    1 
ATOM   1147 C  C     . LEU A 1 146 ? 3.621   -25.041 4.219   1.00   41.49 ? 146 LEU A C     1 
ATOM   1148 O  O     . LEU A 1 146 ? 2.988   -26.086 4.399   1.00   43.46 ? 146 LEU A O     1 
ATOM   1149 C  CB    . LEU A 1 146 ? 2.736   -22.935 5.244   1.00   36.89 ? 146 LEU A CB    1 
ATOM   1150 C  CG    . LEU A 1 146 ? 2.280   -22.437 6.593   1.00   36.39 ? 146 LEU A CG    1 
ATOM   1151 C  CD1   . LEU A 1 146 ? 1.342   -21.220 6.428   1.00   34.56 ? 146 LEU A CD1   1 
ATOM   1152 C  CD2   . LEU A 1 146 ? 1.558   -23.608 7.237   1.00   36.63 ? 146 LEU A CD2   1 
ATOM   1153 N  N     . GLN A 1 147 ? 4.175   -24.704 3.051   1.00   42.06 ? 147 GLN A N     1 
ATOM   1154 C  CA    . GLN A 1 147 ? 4.244   -25.608 1.914   1.00   43.98 ? 147 GLN A CA    1 
ATOM   1155 C  C     . GLN A 1 147 ? 4.833   -26.922 2.350   1.00   44.35 ? 147 GLN A C     1 
ATOM   1156 O  O     . GLN A 1 147 ? 4.309   -27.992 2.032   1.00   44.06 ? 147 GLN A O     1 
ATOM   1157 C  CB    . GLN A 1 147 ? 5.239   -25.069 0.913   1.00   48.19 ? 147 GLN A CB    1 
ATOM   1158 C  CG    . GLN A 1 147 ? 4.972   -25.416 -0.517  1.00   50.15 ? 147 GLN A CG    1 
ATOM   1159 C  CD    . GLN A 1 147 ? 4.421   -24.178 -1.185  1.00   49.88 ? 147 GLN A CD    1 
ATOM   1160 O  OE1   . GLN A 1 147 ? 3.274   -23.844 -0.982  1.00   56.97 ? 147 GLN A OE1   1 
ATOM   1161 N  NE2   . GLN A 1 147 ? 5.265   -23.454 -1.924  1.00   51.71 ? 147 GLN A NE2   1 
ATOM   1162 N  N     . ALA A 1 148 ? 5.948   -26.841 3.063   1.00   43.43 ? 148 ALA A N     1 
ATOM   1163 C  CA    . ALA A 1 148 ? 6.615   -28.047 3.535   1.00   46.71 ? 148 ALA A CA    1 
ATOM   1164 C  C     . ALA A 1 148 ? 5.765   -28.845 4.529   1.00   45.70 ? 148 ALA A C     1 
ATOM   1165 O  O     . ALA A 1 148 ? 5.741   -30.077 4.487   1.00   47.61 ? 148 ALA A O     1 
ATOM   1166 C  CB    . ALA A 1 148 ? 7.974   -27.712 4.131   1.00   47.20 ? 148 ALA A CB    1 
ATOM   1167 N  N     . ALA A 1 149 ? 5.077   -28.155 5.431   1.00   44.74 ? 149 ALA A N     1 
ATOM   1168 C  CA    . ALA A 1 149 ? 4.344   -28.843 6.497   1.00   44.65 ? 149 ALA A CA    1 
ATOM   1169 C  C     . ALA A 1 149 ? 2.990   -29.385 6.032   1.00   44.14 ? 149 ALA A C     1 
ATOM   1170 O  O     . ALA A 1 149 ? 2.499   -30.364 6.594   1.00   44.89 ? 149 ALA A O     1 
ATOM   1171 C  CB    . ALA A 1 149 ? 4.199   -27.942 7.710   1.00   41.57 ? 149 ALA A CB    1 
ATOM   1172 N  N     . PHE A 1 150 ? 2.419   -28.775 4.989   1.00   42.64 ? 150 PHE A N     1 
ATOM   1173 C  CA    . PHE A 1 150 ? 1.151   -29.265 4.393   1.00   43.94 ? 150 PHE A CA    1 
ATOM   1174 C  C     . PHE A 1 150 ? 1.265   -29.548 2.889   1.00   44.44 ? 150 PHE A C     1 
ATOM   1175 O  O     . PHE A 1 150 ? 0.705   -28.851 2.076   1.00   41.37 ? 150 PHE A O     1 
ATOM   1176 C  CB    . PHE A 1 150 ? 0.019   -28.283 4.696   1.00   42.67 ? 150 PHE A CB    1 
ATOM   1177 C  CG    . PHE A 1 150 ? -0.239  -28.121 6.163   1.00   43.13 ? 150 PHE A CG    1 
ATOM   1178 C  CD1   . PHE A 1 150 ? -1.086  -28.996 6.835   1.00   45.80 ? 150 PHE A CD1   1 
ATOM   1179 C  CD2   . PHE A 1 150 ? 0.407   -27.122 6.888   1.00   42.00 ? 150 PHE A CD2   1 
ATOM   1180 C  CE1   . PHE A 1 150 ? -1.306  -28.859 8.212   1.00   43.46 ? 150 PHE A CE1   1 
ATOM   1181 C  CE2   . PHE A 1 150 ? 0.191   -26.977 8.254   1.00   44.59 ? 150 PHE A CE2   1 
ATOM   1182 C  CZ    . PHE A 1 150 ? -0.662  -27.851 8.916   1.00   43.78 ? 150 PHE A CZ    1 
ATOM   1183 N  N     . PRO A 1 151 ? 1.986   -30.613 2.517   1.00   47.03 ? 151 PRO A N     1 
ATOM   1184 C  CA    . PRO A 1 151 ? 2.292   -30.733 1.083   1.00   49.94 ? 151 PRO A CA    1 
ATOM   1185 C  C     . PRO A 1 151 ? 1.079   -31.173 0.251   1.00   49.40 ? 151 PRO A C     1 
ATOM   1186 O  O     . PRO A 1 151 ? 1.001   -30.891 -0.924  1.00   51.08 ? 151 PRO A O     1 
ATOM   1187 C  CB    . PRO A 1 151 ? 3.404   -31.792 1.059   1.00   50.88 ? 151 PRO A CB    1 
ATOM   1188 C  CG    . PRO A 1 151 ? 3.205   -32.604 2.293   1.00   50.46 ? 151 PRO A CG    1 
ATOM   1189 C  CD    . PRO A 1 151 ? 2.526   -31.738 3.311   1.00   48.15 ? 151 PRO A CD    1 
ATOM   1190 N  N     . GLN A 1 152 ? 0.138   -31.834 0.899   1.00   51.05 ? 152 GLN A N     1 
ATOM   1191 C  CA    . GLN A 1 152 ? -1.065  -32.347 0.266   1.00   52.95 ? 152 GLN A CA    1 
ATOM   1192 C  C     . GLN A 1 152 ? -2.173  -31.274 0.146   1.00   49.91 ? 152 GLN A C     1 
ATOM   1193 O  O     . GLN A 1 152 ? -3.268  -31.545 -0.331  1.00   52.79 ? 152 GLN A O     1 
ATOM   1194 C  CB    . GLN A 1 152 ? -1.523  -33.613 1.046   1.00   57.27 ? 152 GLN A CB    1 
ATOM   1195 C  CG    . GLN A 1 152 ? -2.369  -33.411 2.328   1.00   59.21 ? 152 GLN A CG    1 
ATOM   1196 C  CD    . GLN A 1 152 ? -1.711  -32.680 3.527   1.00   59.56 ? 152 GLN A CD    1 
ATOM   1197 O  OE1   . GLN A 1 152 ? -0.790  -31.864 3.378   1.00   62.95 ? 152 GLN A OE1   1 
ATOM   1198 N  NE2   . GLN A 1 152 ? -2.231  -32.952 4.733   1.00   60.35 ? 152 GLN A NE2   1 
ATOM   1199 N  N     . CYS A 1 153 ? -1.885  -30.047 0.553   1.00   48.90 ? 153 CYS A N     1 
ATOM   1200 C  CA    . CYS A 1 153 ? -2.916  -28.984 0.541   1.00   46.81 ? 153 CYS A CA    1 
ATOM   1201 C  C     . CYS A 1 153 ? -3.313  -28.525 -0.866  1.00   46.94 ? 153 CYS A C     1 
ATOM   1202 O  O     . CYS A 1 153 ? -2.471  -28.074 -1.655  1.00   48.62 ? 153 CYS A O     1 
ATOM   1203 C  CB    . CYS A 1 153 ? -2.457  -27.801 1.388   1.00   50.81 ? 153 CYS A CB    1 
ATOM   1204 S  SG    . CYS A 1 153 ? -3.161  -26.203 0.931   1.00   58.51 ? 153 CYS A SG    1 
ATOM   1205 N  N     . VAL A 1 154 ? -4.595  -28.638 -1.200  1.00   45.10 ? 154 VAL A N     1 
ATOM   1206 C  CA    . VAL A 1 154 ? -5.045  -28.050 -2.464  1.00   45.17 ? 154 VAL A CA    1 
ATOM   1207 C  C     . VAL A 1 154 ? -5.551  -26.628 -2.128  1.00   41.83 ? 154 VAL A C     1 
ATOM   1208 O  O     . VAL A 1 154 ? -6.377  -26.480 -1.246  1.00   40.98 ? 154 VAL A O     1 
ATOM   1209 C  CB    . VAL A 1 154 ? -6.076  -28.941 -3.222  1.00   46.12 ? 154 VAL A CB    1 
ATOM   1210 C  CG1   . VAL A 1 154 ? -5.521  -30.343 -3.453  1.00   47.24 ? 154 VAL A CG1   1 
ATOM   1211 C  CG2   . VAL A 1 154 ? -7.390  -29.037 -2.465  1.00   46.73 ? 154 VAL A CG2   1 
ATOM   1212 N  N     . PRO A 1 155 ? -5.017  -25.575 -2.794  1.00   40.48 ? 155 PRO A N     1 
ATOM   1213 C  CA    . PRO A 1 155 ? -5.454  -24.227 -2.415  1.00   37.98 ? 155 PRO A CA    1 
ATOM   1214 C  C     . PRO A 1 155 ? -6.944  -24.090 -2.720  1.00   38.59 ? 155 PRO A C     1 
ATOM   1215 O  O     . PRO A 1 155 ? -7.436  -24.696 -3.672  1.00   37.81 ? 155 PRO A O     1 
ATOM   1216 C  CB    . PRO A 1 155 ? -4.592  -23.318 -3.305  1.00   38.20 ? 155 PRO A CB    1 
ATOM   1217 C  CG    . PRO A 1 155 ? -3.388  -24.161 -3.605  1.00   39.00 ? 155 PRO A CG    1 
ATOM   1218 C  CD    . PRO A 1 155 ? -3.960  -25.528 -3.815  1.00   40.28 ? 155 PRO A CD    1 
ATOM   1219 N  N     . THR A 1 156 ? -7.690  -23.351 -1.908  1.00   38.55 ? 156 THR A N     1 
ATOM   1220 C  CA    . THR A 1 156 ? -9.116  -23.246 -2.248  1.00   39.68 ? 156 THR A CA    1 
ATOM   1221 C  C     . THR A 1 156 ? -9.258  -22.259 -3.389  1.00   36.69 ? 156 THR A C     1 
ATOM   1222 O  O     . THR A 1 156 ? -8.604  -21.198 -3.380  1.00   36.22 ? 156 THR A O     1 
ATOM   1223 C  CB    . THR A 1 156 ? -10.028 -22.851 -1.077  1.00   40.34 ? 156 THR A CB    1 
ATOM   1224 O  OG1   . THR A 1 156 ? -10.184 -21.450 -1.078  1.00   47.10 ? 156 THR A OG1   1 
ATOM   1225 C  CG2   . THR A 1 156 ? -9.479  -23.293 0.239   1.00   39.90 ? 156 THR A CG2   1 
ATOM   1226 N  N     . PRO A 1 157 ? -10.066 -22.613 -4.402  1.00   37.46 ? 157 PRO A N     1 
ATOM   1227 C  CA    . PRO A 1 157 ? -10.246 -21.756 -5.576  1.00   38.43 ? 157 PRO A CA    1 
ATOM   1228 C  C     . PRO A 1 157 ? -10.614 -20.329 -5.184  1.00   36.99 ? 157 PRO A C     1 
ATOM   1229 O  O     . PRO A 1 157 ? -11.499 -20.133 -4.351  1.00   38.99 ? 157 PRO A O     1 
ATOM   1230 C  CB    . PRO A 1 157 ? -11.399 -22.430 -6.328  1.00   41.45 ? 157 PRO A CB    1 
ATOM   1231 C  CG    . PRO A 1 157 ? -11.254 -23.868 -5.993  1.00   41.52 ? 157 PRO A CG    1 
ATOM   1232 C  CD    . PRO A 1 157 ? -10.751 -23.921 -4.570  1.00   40.15 ? 157 PRO A CD    1 
ATOM   1233 N  N     . ARG A 1 158 ? -9.899  -19.365 -5.752  1.00   34.01 ? 158 ARG A N     1 
ATOM   1234 C  CA    . ARG A 1 158 ? -10.065 -17.958 -5.427  1.00   34.56 ? 158 ARG A CA    1 
ATOM   1235 C  C     . ARG A 1 158 ? -11.423 -17.482 -5.945  1.00   36.60 ? 158 ARG A C     1 
ATOM   1236 O  O     . ARG A 1 158 ? -11.778 -17.820 -7.044  1.00   38.76 ? 158 ARG A O     1 
ATOM   1237 C  CB    . ARG A 1 158 ? -8.920  -17.179 -6.053  1.00   35.85 ? 158 ARG A CB    1 
ATOM   1238 C  CG    . ARG A 1 158 ? -8.904  -15.743 -5.649  1.00   35.96 ? 158 ARG A CG    1 
ATOM   1239 C  CD    . ARG A 1 158 ? -7.512  -15.139 -5.694  1.00   36.78 ? 158 ARG A CD    1 
ATOM   1240 N  NE    . ARG A 1 158 ? -7.682  -13.718 -5.423  1.00   37.69 ? 158 ARG A NE    1 
ATOM   1241 C  CZ    . ARG A 1 158 ? -7.594  -13.135 -4.236  1.00   36.06 ? 158 ARG A CZ    1 
ATOM   1242 N  NH1   . ARG A 1 158 ? -7.261  -13.860 -3.164  1.00   37.32 ? 158 ARG A NH1   1 
ATOM   1243 N  NH2   . ARG A 1 158 ? -7.819  -11.810 -4.137  1.00   29.86 ? 158 ARG A NH2   1 
ATOM   1244 N  N     . PRO A 1 159 ? -12.219 -16.748 -5.133  1.00   37.26 ? 159 PRO A N     1 
ATOM   1245 C  CA    . PRO A 1 159 ? -13.571 -16.380 -5.591  1.00   38.04 ? 159 PRO A CA    1 
ATOM   1246 C  C     . PRO A 1 159 ? -13.583 -15.620 -6.926  1.00   42.69 ? 159 PRO A C     1 
ATOM   1247 O  O     . PRO A 1 159 ? -12.719 -14.760 -7.177  1.00   50.38 ? 159 PRO A O     1 
ATOM   1248 C  CB    . PRO A 1 159 ? -14.094 -15.474 -4.452  1.00   36.43 ? 159 PRO A CB    1 
ATOM   1249 C  CG    . PRO A 1 159 ? -13.336 -15.942 -3.247  1.00   37.19 ? 159 PRO A CG    1 
ATOM   1250 C  CD    . PRO A 1 159 ? -11.968 -16.306 -3.743  1.00   35.00 ? 159 PRO A CD    1 
ATOM   1251 N  N     . GLU A 1 160 ? -14.551 -15.940 -7.773  1.00   49.70 ? 160 GLU A N     1 
ATOM   1252 C  CA    . GLU A 1 160 ? -14.634 -15.364 -9.115  1.00   48.16 ? 160 GLU A CA    1 
ATOM   1253 C  C     . GLU A 1 160 ? -15.698 -14.260 -9.048  1.00   50.97 ? 160 GLU A C     1 
ATOM   1254 O  O     . GLU A 1 160 ? -16.891 -14.489 -9.367  1.00   67.21 ? 160 GLU A O     1 
ATOM   1255 C  CB    . GLU A 1 160 ? -14.997 -16.476 -10.133 1.00   46.63 ? 160 GLU A CB    1 
ATOM   1256 C  CG    . GLU A 1 160 ? -15.254 -16.036 -11.575 0.50   46.61 ? 160 GLU A CG    1 
ATOM   1257 C  CD    . GLU A 1 160 ? -16.733 -16.020 -11.973 0.50   46.40 ? 160 GLU A CD    1 
ATOM   1258 O  OE1   . GLU A 1 160 ? -17.610 -16.401 -11.165 0.50   48.51 ? 160 GLU A OE1   1 
ATOM   1259 O  OE2   . GLU A 1 160 ? -17.024 -15.640 -13.119 0.50   43.91 ? 160 GLU A OE2   1 
ATOM   1260 N  N     . ILE A 1 161 ? -15.302 -13.084 -8.593  1.00   50.06 ? 161 ILE A N     1 
ATOM   1261 C  CA    . ILE A 1 161 ? -16.299 -12.007 -8.418  1.00   48.01 ? 161 ILE A CA    1 
ATOM   1262 C  C     . ILE A 1 161 ? -16.233 -11.010 -9.566  1.00   51.61 ? 161 ILE A C     1 
ATOM   1263 O  O     . ILE A 1 161 ? -15.245 -10.279 -9.728  1.00   59.24 ? 161 ILE A O     1 
ATOM   1264 C  CB    . ILE A 1 161 ? -16.215 -11.264 -7.069  0.50   44.14 ? 161 ILE A CB    1 
ATOM   1265 C  CG1   . ILE A 1 161 ? -15.229 -11.928 -6.089  0.50   41.08 ? 161 ILE A CG1   1 
ATOM   1266 C  CG2   . ILE A 1 161 ? -17.619 -11.074 -6.498  0.50   41.71 ? 161 ILE A CG2   1 
ATOM   1267 C  CD1   . ILE A 1 161 ? -13.896 -11.208 -5.957  0.50   35.56 ? 161 ILE A CD1   1 
ATOM   1268 N  N     . ASN A 1 162 ? -17.295 -11.007 -10.361 1.00   47.66 ? 162 ASN A N     1 
ATOM   1269 C  CA    . ASN A 1 162 ? -17.337 -10.300 -11.628 1.00   48.85 ? 162 ASN A CA    1 
ATOM   1270 C  C     . ASN A 1 162 ? -18.097 -8.994  -11.496 1.00   51.40 ? 162 ASN A C     1 
ATOM   1271 O  O     . ASN A 1 162 ? -18.688 -8.726  -10.450 1.00   55.18 ? 162 ASN A O     1 
ATOM   1272 C  CB    . ASN A 1 162 ? -17.980 -11.180 -12.718 1.00   53.26 ? 162 ASN A CB    1 
ATOM   1273 C  CG    . ASN A 1 162 ? -18.910 -12.236 -12.137 1.00   54.25 ? 162 ASN A CG    1 
ATOM   1274 O  OD1   . ASN A 1 162 ? -18.445 -13.194 -11.495 1.00   57.29 ? 162 ASN A OD1   1 
ATOM   1275 N  ND2   . ASN A 1 162 ? -20.239 -12.070 -12.355 1.00   59.34 ? 162 ASN A ND2   1 
ATOM   1276 N  N     . ASN A 1 163 ? -18.111 -8.205  -12.560 1.00   52.98 ? 163 ASN A N     1 
ATOM   1277 C  CA    . ASN A 1 163 ? -18.920 -6.995  -12.641 1.00   49.62 ? 163 ASN A CA    1 
ATOM   1278 C  C     . ASN A 1 163 ? -19.054 -6.263  -11.316 1.00   51.54 ? 163 ASN A C     1 
ATOM   1279 O  O     . ASN A 1 163 ? -20.117 -6.213  -10.731 1.00   60.25 ? 163 ASN A O     1 
ATOM   1280 C  CB    . ASN A 1 163 ? -20.322 -7.307  -13.195 1.00   50.60 ? 163 ASN A CB    1 
ATOM   1281 C  CG    . ASN A 1 163 ? -20.289 -7.875  -14.586 1.00   55.10 ? 163 ASN A CG    1 
ATOM   1282 O  OD1   . ASN A 1 163 ? -19.734 -7.279  -15.495 1.00   64.98 ? 163 ASN A OD1   1 
ATOM   1283 N  ND2   . ASN A 1 163 ? -20.868 -9.040  -14.756 1.00   57.80 ? 163 ASN A ND2   1 
ATOM   1284 N  N     . LYS A 1 164 ? -17.957 -5.694  -10.847 1.00   48.66 ? 164 LYS A N     1 
ATOM   1285 C  CA    . LYS A 1 164 ? -17.949 -4.998  -9.591  1.00   47.22 ? 164 LYS A CA    1 
ATOM   1286 C  C     . LYS A 1 164 ? -17.940 -3.496  -9.912  1.00   44.56 ? 164 LYS A C     1 
ATOM   1287 O  O     . LYS A 1 164 ? -16.887 -2.926  -10.249 1.00   59.35 ? 164 LYS A O     1 
ATOM   1288 C  CB    . LYS A 1 164 ? -16.725 -5.454  -8.757  1.00   49.75 ? 164 LYS A CB    1 
ATOM   1289 C  CG    . LYS A 1 164 ? -16.924 -6.834  -8.097  1.00   50.59 ? 164 LYS A CG    1 
ATOM   1290 C  CD    . LYS A 1 164 ? -15.685 -7.703  -8.190  1.00   46.70 ? 164 LYS A CD    1 
ATOM   1291 C  CE    . LYS A 1 164 ? -14.808 -7.664  -6.946  1.00   41.17 ? 164 LYS A CE    1 
ATOM   1292 N  NZ    . LYS A 1 164 ? -13.427 -8.168  -7.245  1.00   44.84 ? 164 LYS A NZ    1 
ATOM   1293 N  N     . LEU A 1 165 ? -19.126 -2.884  -9.832  1.00   40.53 ? 165 LEU A N     1 
ATOM   1294 C  CA    . LEU A 1 165 ? -19.352 -1.455  -10.141 1.00   35.10 ? 165 LEU A CA    1 
ATOM   1295 C  C     . LEU A 1 165 ? -19.015 -0.550  -8.961  1.00   36.27 ? 165 LEU A C     1 
ATOM   1296 O  O     . LEU A 1 165 ? -19.125 -0.962  -7.795  1.00   35.95 ? 165 LEU A O     1 
ATOM   1297 C  CB    . LEU A 1 165 ? -20.824 -1.245  -10.518 1.00   40.43 ? 165 LEU A CB    1 
ATOM   1298 C  CG    . LEU A 1 165 ? -21.264 -1.480  -11.980 1.00   44.03 ? 165 LEU A CG    1 
ATOM   1299 C  CD1   . LEU A 1 165 ? -20.906 -2.879  -12.477 1.00   47.10 ? 165 LEU A CD1   1 
ATOM   1300 C  CD2   . LEU A 1 165 ? -22.754 -1.191  -12.174 1.00   46.03 ? 165 LEU A CD2   1 
ATOM   1301 N  N     . ILE A 1 166 ? -18.618 0.693   -9.236  1.00   34.48 ? 166 ILE A N     1 
ATOM   1302 C  CA    . ILE A 1 166 ? -18.422 1.659   -8.141  1.00   30.34 ? 166 ILE A CA    1 
ATOM   1303 C  C     . ILE A 1 166 ? -19.724 1.863   -7.352  1.00   31.14 ? 166 ILE A C     1 
ATOM   1304 O  O     . ILE A 1 166 ? -20.693 2.413   -7.863  1.00   32.44 ? 166 ILE A O     1 
ATOM   1305 C  CB    . ILE A 1 166 ? -17.809 2.977   -8.609  1.00   29.38 ? 166 ILE A CB    1 
ATOM   1306 C  CG1   . ILE A 1 166 ? -16.354 2.723   -9.016  1.00   30.78 ? 166 ILE A CG1   1 
ATOM   1307 C  CG2   . ILE A 1 166 ? -17.819 4.011   -7.477  1.00   27.67 ? 166 ILE A CG2   1 
ATOM   1308 C  CD1   . ILE A 1 166 ? -15.786 3.782   -9.924  1.00   29.61 ? 166 ILE A CD1   1 
ATOM   1309 N  N     . PRO A 1 167 ? -19.724 1.412   -6.088  1.00   30.94 ? 167 PRO A N     1 
ATOM   1310 C  CA    . PRO A 1 167 ? -20.950 1.341   -5.300  1.00   31.27 ? 167 PRO A CA    1 
ATOM   1311 C  C     . PRO A 1 167 ? -21.459 2.710   -4.874  1.00   32.24 ? 167 PRO A C     1 
ATOM   1312 O  O     . PRO A 1 167 ? -22.614 2.857   -4.652  1.00   33.00 ? 167 PRO A O     1 
ATOM   1313 C  CB    . PRO A 1 167 ? -20.538 0.510   -4.096  1.00   28.75 ? 167 PRO A CB    1 
ATOM   1314 C  CG    . PRO A 1 167 ? -19.078 0.784   -3.922  1.00   30.18 ? 167 PRO A CG    1 
ATOM   1315 C  CD    . PRO A 1 167 ? -18.521 1.071   -5.297  1.00   28.12 ? 167 PRO A CD    1 
ATOM   1316 N  N     . ASP A 1 168 ? -20.589 3.716   -4.791  1.00   32.15 ? 168 ASP A N     1 
ATOM   1317 C  CA    . ASP A 1 168 ? -20.986 5.000   -4.214  1.00   29.97 ? 168 ASP A CA    1 
ATOM   1318 C  C     . ASP A 1 168 ? -19.855 5.972   -4.486  1.00   27.40 ? 168 ASP A C     1 
ATOM   1319 O  O     . ASP A 1 168 ? -18.683 5.562   -4.543  1.00   25.58 ? 168 ASP A O     1 
ATOM   1320 C  CB    . ASP A 1 168 ? -21.251 4.831   -2.690  1.00   29.92 ? 168 ASP A CB    1 
ATOM   1321 C  CG    . ASP A 1 168 ? -21.786 6.096   -2.044  1.00   30.43 ? 168 ASP A CG    1 
ATOM   1322 O  OD1   . ASP A 1 168 ? -21.007 6.985   -1.613  1.00   32.39 ? 168 ASP A OD1   1 
ATOM   1323 O  OD2   . ASP A 1 168 ? -22.998 6.224   -1.979  1.00   32.06 ? 168 ASP A OD2   1 
ATOM   1324 N  N     . PRO A 1 169 ? -20.194 7.256   -4.694  1.00   27.58 ? 169 PRO A N     1 
ATOM   1325 C  CA    . PRO A 1 169 ? -19.129 8.250   -4.928  1.00   26.09 ? 169 PRO A CA    1 
ATOM   1326 C  C     . PRO A 1 169 ? -18.114 8.321   -3.828  1.00   24.91 ? 169 PRO A C     1 
ATOM   1327 O  O     . PRO A 1 169 ? -16.923 8.536   -4.129  1.00   25.29 ? 169 PRO A O     1 
ATOM   1328 C  CB    . PRO A 1 169 ? -19.884 9.583   -5.046  1.00   28.48 ? 169 PRO A CB    1 
ATOM   1329 C  CG    . PRO A 1 169 ? -21.314 9.307   -4.604  1.00   30.94 ? 169 PRO A CG    1 
ATOM   1330 C  CD    . PRO A 1 169 ? -21.543 7.843   -4.814  1.00   30.45 ? 169 PRO A CD    1 
ATOM   1331 N  N     . PHE A 1 170 ? -18.554 8.093   -2.584  1.00   24.15 ? 170 PHE A N     1 
ATOM   1332 C  CA    . PHE A 1 170 ? -17.615 8.110   -1.477  1.00   25.61 ? 170 PHE A CA    1 
ATOM   1333 C  C     . PHE A 1 170 ? -16.619 6.971   -1.525  1.00   25.17 ? 170 PHE A C     1 
ATOM   1334 O  O     . PHE A 1 170 ? -15.468 7.151   -1.095  1.00   23.51 ? 170 PHE A O     1 
ATOM   1335 C  CB    . PHE A 1 170 ? -18.341 8.127   -0.144  1.00   26.05 ? 170 PHE A CB    1 
ATOM   1336 C  CG    . PHE A 1 170 ? -18.872 9.494   0.235   1.00   26.33 ? 170 PHE A CG    1 
ATOM   1337 C  CD1   . PHE A 1 170 ? -18.003 10.513  0.650   1.00   27.41 ? 170 PHE A CD1   1 
ATOM   1338 C  CD2   . PHE A 1 170 ? -20.237 9.746   0.211   1.00   27.96 ? 170 PHE A CD2   1 
ATOM   1339 C  CE1   . PHE A 1 170 ? -18.501 11.750  1.012   1.00   28.80 ? 170 PHE A CE1   1 
ATOM   1340 C  CE2   . PHE A 1 170 ? -20.745 11.000  0.549   1.00   28.83 ? 170 PHE A CE2   1 
ATOM   1341 C  CZ    . PHE A 1 170 ? -19.886 11.995  0.984   1.00   30.89 ? 170 PHE A CZ    1 
ATOM   1342 N  N     . TRP A 1 171 ? -17.022 5.813   -2.063  1.00   24.14 ? 171 TRP A N     1 
ATOM   1343 C  CA    . TRP A 1 171 ? -16.017 4.766   -2.319  1.00   22.58 ? 171 TRP A CA    1 
ATOM   1344 C  C     . TRP A 1 171 ? -14.790 5.355   -3.110  1.00   23.16 ? 171 TRP A C     1 
ATOM   1345 O  O     . TRP A 1 171 ? -13.595 5.124   -2.770  1.00   23.71 ? 171 TRP A O     1 
ATOM   1346 C  CB    . TRP A 1 171 ? -16.658 3.551   -3.042  1.00   22.33 ? 171 TRP A CB    1 
ATOM   1347 C  CG    . TRP A 1 171 ? -15.597 2.451   -3.221  1.00   22.31 ? 171 TRP A CG    1 
ATOM   1348 C  CD1   . TRP A 1 171 ? -15.355 1.392   -2.367  1.00   23.36 ? 171 TRP A CD1   1 
ATOM   1349 C  CD2   . TRP A 1 171 ? -14.644 2.360   -4.276  1.00   22.22 ? 171 TRP A CD2   1 
ATOM   1350 N  NE1   . TRP A 1 171 ? -14.281 0.630   -2.853  1.00   24.23 ? 171 TRP A NE1   1 
ATOM   1351 C  CE2   . TRP A 1 171 ? -13.815 1.221   -4.009  1.00   23.74 ? 171 TRP A CE2   1 
ATOM   1352 C  CE3   . TRP A 1 171 ? -14.373 3.153   -5.421  1.00   24.30 ? 171 TRP A CE3   1 
ATOM   1353 C  CZ2   . TRP A 1 171 ? -12.748 0.835   -4.857  1.00   23.30 ? 171 TRP A CZ2   1 
ATOM   1354 C  CZ3   . TRP A 1 171 ? -13.293 2.775   -6.270  1.00   23.53 ? 171 TRP A CZ3   1 
ATOM   1355 C  CH2   . TRP A 1 171 ? -12.511 1.596   -5.982  1.00   24.60 ? 171 TRP A CH2   1 
ATOM   1356 N  N     . LEU A 1 172 ? -15.077 6.159   -4.144  1.00   25.49 ? 172 LEU A N     1 
ATOM   1357 C  CA    . LEU A 1 172 ? -14.000 6.705   -4.975  1.00   24.15 ? 172 LEU A CA    1 
ATOM   1358 C  C     . LEU A 1 172 ? -13.147 7.672   -4.183  1.00   23.55 ? 172 LEU A C     1 
ATOM   1359 O  O     . LEU A 1 172 ? -11.903 7.621   -4.324  1.00   22.42 ? 172 LEU A O     1 
ATOM   1360 C  CB    . LEU A 1 172 ? -14.533 7.384   -6.243  1.00   25.27 ? 172 LEU A CB    1 
ATOM   1361 C  CG    . LEU A 1 172 ? -13.777 7.176   -7.559  1.00   29.46 ? 172 LEU A CG    1 
ATOM   1362 C  CD1   . LEU A 1 172 ? -13.889 8.376   -8.486  1.00   29.09 ? 172 LEU A CD1   1 
ATOM   1363 C  CD2   . LEU A 1 172 ? -12.331 6.663   -7.453  1.00   25.68 ? 172 LEU A CD2   1 
ATOM   1364 N  N     . ALA A 1 173 ? -13.780 8.537   -3.352  1.00   24.33 ? 173 ALA A N     1 
ATOM   1365 C  CA    . ALA A 1 173 ? -12.968 9.512   -2.560  1.00   25.52 ? 173 ALA A CA    1 
ATOM   1366 C  C     . ALA A 1 173 ? -12.016 8.705   -1.688  1.00   22.97 ? 173 ALA A C     1 
ATOM   1367 O  O     . ALA A 1 173 ? -10.822 9.054   -1.539  1.00   23.25 ? 173 ALA A O     1 
ATOM   1368 C  CB    . ALA A 1 173 ? -13.833 10.465  -1.706  1.00   23.28 ? 173 ALA A CB    1 
ATOM   1369 N  N     . GLY A 1 174 ? -12.516 7.599   -1.129  1.00   21.73 ? 174 GLY A N     1 
ATOM   1370 C  CA    . GLY A 1 174 ? -11.645 6.803   -0.240  1.00   21.15 ? 174 GLY A CA    1 
ATOM   1371 C  C     . GLY A 1 174 ? -10.530 6.039   -0.980  1.00   19.32 ? 174 GLY A C     1 
ATOM   1372 O  O     . GLY A 1 174 ? -9.382  6.047   -0.570  1.00   20.78 ? 174 GLY A O     1 
ATOM   1373 N  N     . PHE A 1 175 ? -10.873 5.399   -2.089  1.00   19.51 ? 175 PHE A N     1 
ATOM   1374 C  CA    . PHE A 1 175 ? -9.872  4.712   -2.896  1.00   20.50 ? 175 PHE A CA    1 
ATOM   1375 C  C     . PHE A 1 175 ? -8.746  5.669   -3.352  1.00   20.69 ? 175 PHE A C     1 
ATOM   1376 O  O     . PHE A 1 175 ? -7.544  5.343   -3.286  1.00   20.29 ? 175 PHE A O     1 
ATOM   1377 C  CB    . PHE A 1 175 ? -10.578 4.144   -4.118  1.00   21.02 ? 175 PHE A CB    1 
ATOM   1378 C  CG    . PHE A 1 175 ? -9.742  3.192   -4.916  1.00   22.43 ? 175 PHE A CG    1 
ATOM   1379 C  CD1   . PHE A 1 175 ? -9.311  1.990   -4.356  1.00   21.62 ? 175 PHE A CD1   1 
ATOM   1380 C  CD2   . PHE A 1 175 ? -9.435  3.477   -6.241  1.00   22.12 ? 175 PHE A CD2   1 
ATOM   1381 C  CE1   . PHE A 1 175 ? -8.550  1.095   -5.093  1.00   24.27 ? 175 PHE A CE1   1 
ATOM   1382 C  CE2   . PHE A 1 175 ? -8.704  2.575   -7.005  1.00   27.12 ? 175 PHE A CE2   1 
ATOM   1383 C  CZ    . PHE A 1 175 ? -8.236  1.395   -6.430  1.00   25.67 ? 175 PHE A CZ    1 
ATOM   1384 N  N     . VAL A 1 176 ? -9.150  6.852   -3.821  1.00   19.78 ? 176 VAL A N     1 
ATOM   1385 C  CA    . VAL A 1 176 ? -8.180  7.827   -4.315  1.00   20.67 ? 176 VAL A CA    1 
ATOM   1386 C  C     . VAL A 1 176 ? -7.267  8.306   -3.173  1.00   21.02 ? 176 VAL A C     1 
ATOM   1387 O  O     . VAL A 1 176 ? -6.104  8.502   -3.405  1.00   21.00 ? 176 VAL A O     1 
ATOM   1388 C  CB    . VAL A 1 176 ? -8.884  9.010   -5.034  1.00   21.14 ? 176 VAL A CB    1 
ATOM   1389 C  CG1   . VAL A 1 176 ? -7.891  10.136  -5.451  1.00   20.44 ? 176 VAL A CG1   1 
ATOM   1390 C  CG2   . VAL A 1 176 ? -9.567  8.479   -6.246  1.00   21.30 ? 176 VAL A CG2   1 
ATOM   1391 N  N     . SER A 1 177 ? -7.809  8.478   -1.955  1.00   21.56 ? 177 SER A N     1 
ATOM   1392 C  CA    . SER A 1 177 ? -7.026  8.853   -0.779  1.00   21.41 ? 177 SER A CA    1 
ATOM   1393 C  C     . SER A 1 177 ? -5.859  7.873   -0.545  1.00   20.79 ? 177 SER A C     1 
ATOM   1394 O  O     . SER A 1 177 ? -4.807  8.251   -0.029  1.00   23.11 ? 177 SER A O     1 
ATOM   1395 C  CB    . SER A 1 177 ? -7.941  8.905   0.442   1.00   22.21 ? 177 SER A CB    1 
ATOM   1396 O  OG    . SER A 1 177 ? -9.020  9.838   0.243   1.00   25.98 ? 177 SER A OG    1 
ATOM   1397 N  N     . GLY A 1 178 ? -6.024  6.614   -0.936  1.00   20.40 ? 178 GLY A N     1 
ATOM   1398 C  CA    . GLY A 1 178 ? -4.945  5.657   -0.704  1.00   22.60 ? 178 GLY A CA    1 
ATOM   1399 C  C     . GLY A 1 178 ? -4.089  5.487   -1.914  1.00   23.85 ? 178 GLY A C     1 
ATOM   1400 O  O     . GLY A 1 178 ? -2.864  5.430   -1.807  1.00   29.19 ? 178 GLY A O     1 
ATOM   1401 N  N     . ASP A 1 179 ? -4.722  5.373   -3.077  1.00   23.10 ? 179 ASP A N     1 
ATOM   1402 C  CA    . ASP A 1 179 ? -3.971  4.955   -4.256  1.00   24.15 ? 179 ASP A CA    1 
ATOM   1403 C  C     . ASP A 1 179 ? -3.982  5.990   -5.416  1.00   25.69 ? 179 ASP A C     1 
ATOM   1404 O  O     . ASP A 1 179 ? -3.557  5.694   -6.542  1.00   24.15 ? 179 ASP A O     1 
ATOM   1405 C  CB    . ASP A 1 179 ? -4.480  3.584   -4.752  1.00   22.83 ? 179 ASP A CB    1 
ATOM   1406 C  CG    . ASP A 1 179 ? -3.958  2.427   -3.943  1.00   22.31 ? 179 ASP A CG    1 
ATOM   1407 O  OD1   . ASP A 1 179 ? -2.949  2.585   -3.221  1.00   26.08 ? 179 ASP A OD1   1 
ATOM   1408 O  OD2   . ASP A 1 179 ? -4.544  1.334   -4.056  1.00   23.31 ? 179 ASP A OD2   1 
ATOM   1409 N  N     . GLY A 1 180 ? -4.456  7.201   -5.141  1.00   25.81 ? 180 GLY A N     1 
ATOM   1410 C  CA    . GLY A 1 180 ? -4.456  8.256   -6.155  1.00   21.85 ? 180 GLY A CA    1 
ATOM   1411 C  C     . GLY A 1 180 ? -3.385  9.328   -5.926  1.00   22.32 ? 180 GLY A C     1 
ATOM   1412 O  O     . GLY A 1 180 ? -2.716  9.342   -4.909  1.00   20.65 ? 180 GLY A O     1 
ATOM   1413 N  N     . SER A 1 181 ? -3.241  10.231  -6.887  1.00   22.71 ? 181 SER A N     1 
ATOM   1414 C  CA    . SER A 1 181 ? -2.178  11.241  -6.861  1.00   20.65 ? 181 SER A CA    1 
ATOM   1415 C  C     . SER A 1 181 ? -2.686  12.496  -7.596  1.00   23.22 ? 181 SER A C     1 
ATOM   1416 O  O     . SER A 1 181 ? -3.240  12.400  -8.676  1.00   21.23 ? 181 SER A O     1 
ATOM   1417 C  CB    . SER A 1 181 ? -0.918  10.683  -7.517  1.00   22.15 ? 181 SER A CB    1 
ATOM   1418 O  OG    . SER A 1 181 ? 0.228   11.496  -7.234  1.00   24.14 ? 181 SER A OG    1 
ATOM   1419 N  N     . PHE A 1 182 ? -2.520  13.659  -6.976  1.00   23.54 ? 182 PHE A N     1 
ATOM   1420 C  CA    . PHE A 1 182 ? -2.767  14.926  -7.623  1.00   23.24 ? 182 PHE A CA    1 
ATOM   1421 C  C     . PHE A 1 182 ? -1.410  15.497  -7.974  1.00   24.36 ? 182 PHE A C     1 
ATOM   1422 O  O     . PHE A 1 182 ? -0.659  15.983  -7.095  1.00   24.47 ? 182 PHE A O     1 
ATOM   1423 C  CB    . PHE A 1 182 ? -3.611  15.824  -6.708  1.00   20.75 ? 182 PHE A CB    1 
ATOM   1424 C  CG    . PHE A 1 182 ? -4.956  15.206  -6.363  1.00   22.53 ? 182 PHE A CG    1 
ATOM   1425 C  CD1   . PHE A 1 182 ? -6.046  15.354  -7.217  1.00   20.61 ? 182 PHE A CD1   1 
ATOM   1426 C  CD2   . PHE A 1 182 ? -5.125  14.452  -5.184  1.00   21.57 ? 182 PHE A CD2   1 
ATOM   1427 C  CE1   . PHE A 1 182 ? -7.288  14.816  -6.888  1.00   22.21 ? 182 PHE A CE1   1 
ATOM   1428 C  CE2   . PHE A 1 182 ? -6.358  13.895  -4.852  1.00   20.59 ? 182 PHE A CE2   1 
ATOM   1429 C  CZ    . PHE A 1 182 ? -7.450  14.066  -5.713  1.00   19.73 ? 182 PHE A CZ    1 
ATOM   1430 N  N     . LYS A 1 183 ? -1.061  15.368  -9.251  1.00   23.24 ? 183 LYS A N     1 
ATOM   1431 C  CA    . LYS A 1 183 ? 0.290   15.677  -9.692  1.00   25.50 ? 183 LYS A CA    1 
ATOM   1432 C  C     . LYS A 1 183 ? 0.343   17.057  -10.362 1.00   25.97 ? 183 LYS A C     1 
ATOM   1433 O  O     . LYS A 1 183 ? -0.557  17.430  -11.154 1.00   22.10 ? 183 LYS A O     1 
ATOM   1434 C  CB    . LYS A 1 183 ? 0.855   14.614  -10.656 1.00   27.51 ? 183 LYS A CB    1 
ATOM   1435 C  CG    . LYS A 1 183 ? 0.667   13.154  -10.232 1.00   28.05 ? 183 LYS A CG    1 
ATOM   1436 C  CD    . LYS A 1 183 ? 1.608   12.190  -10.975 1.00   29.28 ? 183 LYS A CD    1 
ATOM   1437 C  CE    . LYS A 1 183 ? 1.262   12.048  -12.455 1.00   24.90 ? 183 LYS A CE    1 
ATOM   1438 N  NZ    . LYS A 1 183 ? 2.425   11.403  -13.118 1.00   29.81 ? 183 LYS A NZ    1 
ATOM   1439 N  N     . SER A 1 184 ? 1.407   17.787  -10.030 1.00   25.23 ? 184 SER A N     1 
ATOM   1440 C  CA    . SER A 1 184 ? 1.718   19.054  -10.648 1.00   26.58 ? 184 SER A CA    1 
ATOM   1441 C  C     . SER A 1 184 ? 3.118   18.915  -11.257 1.00   27.51 ? 184 SER A C     1 
ATOM   1442 O  O     . SER A 1 184 ? 4.065   18.515  -10.591 1.00   30.30 ? 184 SER A O     1 
ATOM   1443 C  CB    . SER A 1 184 ? 1.661   20.173  -9.621  1.00   27.36 ? 184 SER A CB    1 
ATOM   1444 O  OG    . SER A 1 184 ? 2.258   21.355  -10.144 1.00   30.45 ? 184 SER A OG    1 
ATOM   1445 N  N     . ILE A 1 185 ? 3.215   19.205  -12.551 1.00   27.76 ? 185 ILE A N     1 
ATOM   1446 C  CA    . ILE A 1 185 ? 4.373   18.895  -13.351 1.00   27.06 ? 185 ILE A CA    1 
ATOM   1447 C  C     . ILE A 1 185 ? 4.824   20.213  -14.004 1.00   28.22 ? 185 ILE A C     1 
ATOM   1448 O  O     . ILE A 1 185 ? 3.980   21.026  -14.453 1.00   25.29 ? 185 ILE A O     1 
ATOM   1449 C  CB    . ILE A 1 185 ? 3.955   17.867  -14.439 1.00   27.69 ? 185 ILE A CB    1 
ATOM   1450 C  CG1   . ILE A 1 185 ? 3.279   16.607  -13.839 1.00   27.49 ? 185 ILE A CG1   1 
ATOM   1451 C  CG2   . ILE A 1 185 ? 5.139   17.492  -15.327 1.00   30.18 ? 185 ILE A CG2   1 
ATOM   1452 C  CD1   . ILE A 1 185 ? 4.272   15.637  -13.227 1.00   27.14 ? 185 ILE A CD1   1 
ATOM   1453 N  N     . LEU A 1 186 ? 6.140   20.453  -14.014 1.00   28.88 ? 186 LEU A N     1 
ATOM   1454 C  CA    . LEU A 1 186 ? 6.723   21.547  -14.779 1.00   31.04 ? 186 LEU A CA    1 
ATOM   1455 C  C     . LEU A 1 186 ? 7.732   20.977  -15.745 1.00   32.61 ? 186 LEU A C     1 
ATOM   1456 O  O     . LEU A 1 186 ? 8.757   20.402  -15.369 1.00   34.71 ? 186 LEU A O     1 
ATOM   1457 C  CB    . LEU A 1 186 ? 7.391   22.621  -13.911 1.00   34.21 ? 186 LEU A CB    1 
ATOM   1458 C  CG    . LEU A 1 186 ? 6.359   23.466  -13.151 1.00   33.70 ? 186 LEU A CG    1 
ATOM   1459 C  CD1   . LEU A 1 186 ? 7.006   24.175  -11.979 1.00   38.93 ? 186 LEU A CD1   1 
ATOM   1460 C  CD2   . LEU A 1 186 ? 5.714   24.484  -14.059 1.00   33.27 ? 186 LEU A CD2   1 
ATOM   1461 N  N     . LYS A 1 187 ? 7.405   21.158  -17.012 1.00   32.75 ? 187 LYS A N     1 
ATOM   1462 C  CA    . LYS A 1 187 ? 8.096   20.504  -18.099 1.00   33.06 ? 187 LYS A CA    1 
ATOM   1463 C  C     . LYS A 1 187 ? 8.828   21.576  -18.871 1.00   31.61 ? 187 LYS A C     1 
ATOM   1464 O  O     . LYS A 1 187 ? 8.238   22.588  -19.237 1.00   31.39 ? 187 LYS A O     1 
ATOM   1465 C  CB    . LYS A 1 187 ? 7.025   19.821  -18.975 1.00   31.07 ? 187 LYS A CB    1 
ATOM   1466 C  CG    . LYS A 1 187 ? 7.536   19.077  -20.182 1.00   32.44 ? 187 LYS A CG    1 
ATOM   1467 C  CD    . LYS A 1 187 ? 6.326   18.427  -20.859 1.00   33.30 ? 187 LYS A CD    1 
ATOM   1468 C  CE    . LYS A 1 187 ? 6.747   17.760  -22.153 1.00   36.34 ? 187 LYS A CE    1 
ATOM   1469 N  NZ    . LYS A 1 187 ? 7.241   18.762  -23.129 1.00   35.99 ? 187 LYS A NZ    1 
ATOM   1470 N  N     . LYS A 1 188 ? 10.110  21.370  -19.104 1.00   32.32 ? 188 LYS A N     1 
ATOM   1471 C  CA    . LYS A 1 188 ? 10.880  22.269  -19.933 1.00   36.53 ? 188 LYS A CA    1 
ATOM   1472 C  C     . LYS A 1 188 ? 10.232  22.323  -21.336 1.00   35.26 ? 188 LYS A C     1 
ATOM   1473 O  O     . LYS A 1 188 ? 9.794   21.312  -21.871 1.00   34.94 ? 188 LYS A O     1 
ATOM   1474 C  CB    . LYS A 1 188 ? 12.343  21.802  -19.978 1.00   40.53 ? 188 LYS A CB    1 
ATOM   1475 C  CG    . LYS A 1 188 ? 13.269  22.669  -20.830 1.00   51.80 ? 188 LYS A CG    1 
ATOM   1476 C  CD    . LYS A 1 188 ? 13.624  23.983  -20.134 1.00   57.86 ? 188 LYS A CD    1 
ATOM   1477 C  CE    . LYS A 1 188 ? 13.726  25.148  -21.117 1.00   54.44 ? 188 LYS A CE    1 
ATOM   1478 N  NZ    . LYS A 1 188 ? 13.257  26.412  -20.485 1.00   43.77 ? 188 LYS A NZ    1 
ATOM   1479 N  N     . SER A 1 189 ? 10.142  23.525  -21.897 1.00   35.91 ? 189 SER A N     1 
ATOM   1480 C  CA    . SER A 1 189 ? 9.455   23.754  -23.173 1.00   35.96 ? 189 SER A CA    1 
ATOM   1481 C  C     . SER A 1 189 ? 10.212  24.826  -23.943 1.00   37.90 ? 189 SER A C     1 
ATOM   1482 O  O     . SER A 1 189 ? 10.571  25.870  -23.386 1.00   39.13 ? 189 SER A O     1 
ATOM   1483 C  CB    . SER A 1 189 ? 7.993   24.148  -22.912 1.00   34.80 ? 189 SER A CB    1 
ATOM   1484 O  OG    . SER A 1 189 ? 7.431   24.903  -23.950 1.00   32.54 ? 189 SER A OG    1 
ATOM   1485 N  N     . GLU A 1 190 ? 10.494  24.545  -25.214 1.00   40.60 ? 190 GLU A N     1 
ATOM   1486 C  CA    . GLU A 1 190 ? 11.184  25.495  -26.072 1.00   41.08 ? 190 GLU A CA    1 
ATOM   1487 C  C     . GLU A 1 190 ? 10.243  26.537  -26.644 1.00   37.88 ? 190 GLU A C     1 
ATOM   1488 O  O     . GLU A 1 190 ? 10.684  27.564  -27.088 1.00   41.78 ? 190 GLU A O     1 
ATOM   1489 C  CB    . GLU A 1 190 ? 11.914  24.781  -27.202 1.00   46.15 ? 190 GLU A CB    1 
ATOM   1490 C  CG    . GLU A 1 190 ? 13.445  24.780  -27.069 1.00   51.72 ? 190 GLU A CG    1 
ATOM   1491 C  CD    . GLU A 1 190 ? 13.950  23.746  -26.077 1.00   56.87 ? 190 GLU A CD    1 
ATOM   1492 O  OE1   . GLU A 1 190 ? 14.913  23.013  -26.435 1.00   67.34 ? 190 GLU A OE1   1 
ATOM   1493 O  OE2   . GLU A 1 190 ? 13.400  23.660  -24.936 1.00   66.53 ? 190 GLU A OE2   1 
ATOM   1494 N  N     . SER A 1 191 ? 8.955   26.288  -26.644 1.00   34.74 ? 191 SER A N     1 
ATOM   1495 C  CA    . SER A 1 191 ? 8.039   27.216  -27.292 1.00   37.31 ? 191 SER A CA    1 
ATOM   1496 C  C     . SER A 1 191 ? 7.227   28.133  -26.356 1.00   37.46 ? 191 SER A C     1 
ATOM   1497 O  O     . SER A 1 191 ? 6.788   29.218  -26.779 1.00   40.17 ? 191 SER A O     1 
ATOM   1498 C  CB    . SER A 1 191 ? 7.090   26.452  -28.219 1.00   38.05 ? 191 SER A CB    1 
ATOM   1499 O  OG    . SER A 1 191 ? 6.429   25.453  -27.471 1.00   37.74 ? 191 SER A OG    1 
ATOM   1500 N  N     . ILE A 1 192 ? 7.015   27.737  -25.103 1.00   33.60 ? 192 ILE A N     1 
ATOM   1501 C  CA    . ILE A 1 192 ? 6.319   28.634  -24.188 1.00   32.52 ? 192 ILE A CA    1 
ATOM   1502 C  C     . ILE A 1 192 ? 7.239   29.803  -23.762 1.00   32.32 ? 192 ILE A C     1 
ATOM   1503 O  O     . ILE A 1 192 ? 8.425   29.577  -23.420 1.00   30.67 ? 192 ILE A O     1 
ATOM   1504 C  CB    . ILE A 1 192 ? 5.811   27.860  -22.974 1.00   31.47 ? 192 ILE A CB    1 
ATOM   1505 C  CG1   . ILE A 1 192 ? 4.799   26.807  -23.448 1.00   30.66 ? 192 ILE A CG1   1 
ATOM   1506 C  CG2   . ILE A 1 192 ? 5.238   28.807  -21.913 1.00   31.65 ? 192 ILE A CG2   1 
ATOM   1507 C  CD1   . ILE A 1 192 ? 4.034   26.158  -22.306 1.00   32.63 ? 192 ILE A CD1   1 
ATOM   1508 N  N     . LYS A 1 193 ? 6.710   31.039  -23.808 1.00   32.15 ? 193 LYS A N     1 
ATOM   1509 C  CA    . LYS A 1 193 ? 7.554   32.195  -23.538 1.00   35.61 ? 193 LYS A CA    1 
ATOM   1510 C  C     . LYS A 1 193 ? 8.302   32.079  -22.202 1.00   35.35 ? 193 LYS A C     1 
ATOM   1511 O  O     . LYS A 1 193 ? 9.494   32.333  -22.158 1.00   35.81 ? 193 LYS A O     1 
ATOM   1512 C  CB    . LYS A 1 193 ? 6.784   33.521  -23.662 1.00   40.16 ? 193 LYS A CB    1 
ATOM   1513 C  CG    . LYS A 1 193 ? 6.378   33.818  -25.107 1.00   39.70 ? 193 LYS A CG    1 
ATOM   1514 C  CD    . LYS A 1 193 ? 5.869   35.241  -25.319 1.00   39.28 ? 193 LYS A CD    1 
ATOM   1515 C  CE    . LYS A 1 193 ? 4.575   35.440  -24.537 1.00   38.30 ? 193 LYS A CE    1 
ATOM   1516 N  NZ    . LYS A 1 193 ? 3.485   36.085  -25.308 1.00   39.75 ? 193 LYS A NZ    1 
ATOM   1517 N  N     . VAL A 1 194 ? 7.607   31.634  -21.151 1.00   34.07 ? 194 VAL A N     1 
ATOM   1518 C  CA    . VAL A 1 194 ? 8.224   31.468  -19.833 1.00   34.74 ? 194 VAL A CA    1 
ATOM   1519 C  C     . VAL A 1 194 ? 9.125   30.242  -19.668 1.00   36.34 ? 194 VAL A C     1 
ATOM   1520 O  O     . VAL A 1 194 ? 9.741   30.082  -18.604 1.00   36.58 ? 194 VAL A O     1 
ATOM   1521 C  CB    . VAL A 1 194 ? 7.221   31.545  -18.644 1.00   33.24 ? 194 VAL A CB    1 
ATOM   1522 C  CG1   . VAL A 1 194 ? 6.606   32.937  -18.564 1.00   32.01 ? 194 VAL A CG1   1 
ATOM   1523 C  CG2   . VAL A 1 194 ? 6.134   30.458  -18.716 1.00   31.32 ? 194 VAL A CG2   1 
ATOM   1524 N  N     . GLY A 1 195 ? 9.199   29.370  -20.675 1.00   36.30 ? 195 GLY A N     1 
ATOM   1525 C  CA    . GLY A 1 195 ? 10.209  28.278  -20.654 1.00   36.89 ? 195 GLY A CA    1 
ATOM   1526 C  C     . GLY A 1 195 ? 9.832   26.906  -20.085 1.00   33.35 ? 195 GLY A C     1 
ATOM   1527 O  O     . GLY A 1 195 ? 10.571  25.933  -20.267 1.00   33.01 ? 195 GLY A O     1 
ATOM   1528 N  N     . PHE A 1 196 ? 8.703   26.830  -19.390 1.00   30.92 ? 196 PHE A N     1 
ATOM   1529 C  CA    . PHE A 1 196 ? 8.226   25.602  -18.760 1.00   30.74 ? 196 PHE A CA    1 
ATOM   1530 C  C     . PHE A 1 196 ? 6.743   25.567  -18.939 1.00   29.55 ? 196 PHE A C     1 
ATOM   1531 O  O     . PHE A 1 196 ? 6.095   26.615  -18.830 1.00   29.36 ? 196 PHE A O     1 
ATOM   1532 C  CB    . PHE A 1 196 ? 8.493   25.651  -17.242 1.00   31.76 ? 196 PHE A CB    1 
ATOM   1533 C  CG    . PHE A 1 196 ? 9.943   25.578  -16.903 1.00   32.64 ? 196 PHE A CG    1 
ATOM   1534 C  CD1   . PHE A 1 196 ? 10.709  26.743  -16.782 1.00   34.25 ? 196 PHE A CD1   1 
ATOM   1535 C  CD2   . PHE A 1 196 ? 10.567  24.349  -16.751 1.00   34.29 ? 196 PHE A CD2   1 
ATOM   1536 C  CE1   . PHE A 1 196 ? 12.085  26.690  -16.531 1.00   36.57 ? 196 PHE A CE1   1 
ATOM   1537 C  CE2   . PHE A 1 196 ? 11.946  24.282  -16.489 1.00   36.36 ? 196 PHE A CE2   1 
ATOM   1538 C  CZ    . PHE A 1 196 ? 12.688  25.458  -16.351 1.00   36.80 ? 196 PHE A CZ    1 
ATOM   1539 N  N     . GLN A 1 197 ? 6.202   24.378  -19.208 1.00   27.91 ? 197 GLN A N     1 
ATOM   1540 C  CA    . GLN A 1 197 ? 4.778   24.197  -19.287 1.00   28.74 ? 197 GLN A CA    1 
ATOM   1541 C  C     . GLN A 1 197 ? 4.323   23.685  -17.916 1.00   29.20 ? 197 GLN A C     1 
ATOM   1542 O  O     . GLN A 1 197 ? 4.987   22.806  -17.332 1.00   31.14 ? 197 GLN A O     1 
ATOM   1543 C  CB    . GLN A 1 197 ? 4.440   23.168  -20.374 1.00   29.40 ? 197 GLN A CB    1 
ATOM   1544 C  CG    . GLN A 1 197 ? 2.945   22.822  -20.482 1.00   28.68 ? 197 GLN A CG    1 
ATOM   1545 C  CD    . GLN A 1 197 ? 2.687   21.594  -21.346 1.00   27.50 ? 197 GLN A CD    1 
ATOM   1546 O  OE1   . GLN A 1 197 ? 3.625   21.027  -21.907 1.00   26.68 ? 197 GLN A OE1   1 
ATOM   1547 N  NE2   . GLN A 1 197 ? 1.412   21.172  -21.436 1.00   25.46 ? 197 GLN A NE2   1 
ATOM   1548 N  N     . SER A 1 198 ? 3.223   24.237  -17.407 1.00   25.08 ? 198 SER A N     1 
ATOM   1549 C  CA    . SER A 1 198 ? 2.643   23.807  -16.166 1.00   25.18 ? 198 SER A CA    1 
ATOM   1550 C  C     . SER A 1 198 ? 1.611   22.759  -16.472 1.00   25.07 ? 198 SER A C     1 
ATOM   1551 O  O     . SER A 1 198 ? 0.650   22.995  -17.220 1.00   25.75 ? 198 SER A O     1 
ATOM   1552 C  CB    . SER A 1 198 ? 1.979   24.968  -15.450 1.00   25.02 ? 198 SER A CB    1 
ATOM   1553 O  OG    . SER A 1 198 ? 1.168   24.541  -14.346 1.00   24.59 ? 198 SER A OG    1 
ATOM   1554 N  N     . ILE A 1 199 ? 1.776   21.575  -15.918 1.00   24.64 ? 199 ILE A N     1 
ATOM   1555 C  CA    . ILE A 1 199 ? 0.797   20.511  -16.243 1.00   23.32 ? 199 ILE A CA    1 
ATOM   1556 C  C     . ILE A 1 199 ? 0.178   19.990  -14.967 1.00   23.71 ? 199 ILE A C     1 
ATOM   1557 O  O     . ILE A 1 199 ? 0.900   19.773  -13.993 1.00   23.29 ? 199 ILE A O     1 
ATOM   1558 C  CB    . ILE A 1 199 ? 1.532   19.355  -16.981 1.00   25.05 ? 199 ILE A CB    1 
ATOM   1559 C  CG1   . ILE A 1 199 ? 1.935   19.805  -18.392 1.00   25.15 ? 199 ILE A CG1   1 
ATOM   1560 C  CG2   . ILE A 1 199 ? 0.709   18.061  -17.015 1.00   23.74 ? 199 ILE A CG2   1 
ATOM   1561 C  CD1   . ILE A 1 199 ? 2.901   18.870  -19.120 1.00   26.41 ? 199 ILE A CD1   1 
ATOM   1562 N  N     . LEU A 1 200 ? -1.138  19.757  -14.963 1.00   24.12 ? 200 LEU A N     1 
ATOM   1563 C  CA    . LEU A 1 200 ? -1.797  19.051  -13.820 1.00   24.17 ? 200 LEU A CA    1 
ATOM   1564 C  C     . LEU A 1 200 ? -2.218  17.680  -14.307 1.00   25.16 ? 200 LEU A C     1 
ATOM   1565 O  O     . LEU A 1 200 ? -2.793  17.554  -15.407 1.00   24.05 ? 200 LEU A O     1 
ATOM   1566 C  CB    . LEU A 1 200 ? -3.072  19.809  -13.320 1.00   24.70 ? 200 LEU A CB    1 
ATOM   1567 C  CG    . LEU A 1 200 ? -2.897  21.134  -12.574 1.00   24.16 ? 200 LEU A CG    1 
ATOM   1568 C  CD1   . LEU A 1 200 ? -4.219  21.577  -11.977 1.00   25.27 ? 200 LEU A CD1   1 
ATOM   1569 C  CD2   . LEU A 1 200 ? -1.876  20.971  -11.456 1.00   25.32 ? 200 LEU A CD2   1 
ATOM   1570 N  N     . VAL A 1 201 ? -1.914  16.652  -13.524 1.00   24.62 ? 201 VAL A N     1 
ATOM   1571 C  CA    . VAL A 1 201 ? -2.270  15.289  -13.877 1.00   24.50 ? 201 VAL A CA    1 
ATOM   1572 C  C     . VAL A 1 201 ? -2.996  14.666  -12.674 1.00   24.45 ? 201 VAL A C     1 
ATOM   1573 O  O     . VAL A 1 201 ? -2.571  14.807  -11.518 1.00   27.07 ? 201 VAL A O     1 
ATOM   1574 C  CB    . VAL A 1 201 ? -1.029  14.471  -14.277 1.00   26.08 ? 201 VAL A CB    1 
ATOM   1575 C  CG1   . VAL A 1 201 ? -1.417  13.027  -14.549 1.00   26.13 ? 201 VAL A CG1   1 
ATOM   1576 C  CG2   . VAL A 1 201 ? -0.371  15.086  -15.529 1.00   29.48 ? 201 VAL A CG2   1 
ATOM   1577 N  N     . PHE A 1 202 ? -4.145  14.062  -12.933 1.00   23.17 ? 202 PHE A N     1 
ATOM   1578 C  CA    . PHE A 1 202 ? -4.797  13.275  -11.906 1.00   22.66 ? 202 PHE A CA    1 
ATOM   1579 C  C     . PHE A 1 202 ? -4.562  11.832  -12.273 1.00   23.23 ? 202 PHE A C     1 
ATOM   1580 O  O     . PHE A 1 202 ? -4.755  11.443  -13.443 1.00   25.40 ? 202 PHE A O     1 
ATOM   1581 C  CB    . PHE A 1 202 ? -6.286  13.567  -11.854 1.00   21.97 ? 202 PHE A CB    1 
ATOM   1582 C  CG    . PHE A 1 202 ? -7.058  12.585  -10.983 1.00   23.19 ? 202 PHE A CG    1 
ATOM   1583 C  CD1   . PHE A 1 202 ? -6.958  12.653  -9.604  1.00   23.12 ? 202 PHE A CD1   1 
ATOM   1584 C  CD2   . PHE A 1 202 ? -7.850  11.595  -11.553 1.00   24.02 ? 202 PHE A CD2   1 
ATOM   1585 C  CE1   . PHE A 1 202 ? -7.636  11.755  -8.783  1.00   24.15 ? 202 PHE A CE1   1 
ATOM   1586 C  CE2   . PHE A 1 202 ? -8.544  10.693  -10.744 1.00   24.26 ? 202 PHE A CE2   1 
ATOM   1587 C  CZ    . PHE A 1 202 ? -8.427  10.755  -9.356  1.00   21.59 ? 202 PHE A CZ    1 
ATOM   1588 N  N     . GLN A 1 203 ? -4.145  11.016  -11.307 1.00   22.40 ? 203 GLN A N     1 
ATOM   1589 C  CA    . GLN A 1 203 ? -3.709  9.662   -11.650 1.00   24.70 ? 203 GLN A CA    1 
ATOM   1590 C  C     . GLN A 1 203 ? -4.065  8.656   -10.550 1.00   24.64 ? 203 GLN A C     1 
ATOM   1591 O  O     . GLN A 1 203 ? -3.787  8.905   -9.360  1.00   23.42 ? 203 GLN A O     1 
ATOM   1592 C  CB    . GLN A 1 203 ? -2.205  9.686   -11.910 1.00   28.49 ? 203 GLN A CB    1 
ATOM   1593 C  CG    . GLN A 1 203 ? -1.647  8.426   -12.569 1.00   31.81 ? 203 GLN A CG    1 
ATOM   1594 C  CD    . GLN A 1 203 ? -0.306  8.634   -13.249 1.00   31.56 ? 203 GLN A CD    1 
ATOM   1595 O  OE1   . GLN A 1 203 ? -0.208  8.587   -14.483 1.00   37.78 ? 203 GLN A OE1   1 
ATOM   1596 N  NE2   . GLN A 1 203 ? 0.720   8.840   -12.475 1.00   27.22 ? 203 GLN A NE2   1 
ATOM   1597 N  N     . ILE A 1 204 ? -4.719  7.548   -10.929 1.00   22.93 ? 204 ILE A N     1 
ATOM   1598 C  CA    . ILE A 1 204 ? -4.913  6.422   -9.992  1.00   21.81 ? 204 ILE A CA    1 
ATOM   1599 C  C     . ILE A 1 204 ? -4.027  5.230   -10.399 1.00   23.49 ? 204 ILE A C     1 
ATOM   1600 O  O     . ILE A 1 204 ? -4.021  4.829   -11.564 1.00   22.09 ? 204 ILE A O     1 
ATOM   1601 C  CB    . ILE A 1 204 ? -6.378  6.018   -9.919  1.00   21.66 ? 204 ILE A CB    1 
ATOM   1602 C  CG1   . ILE A 1 204 ? -7.228  7.198   -9.435  1.00   20.60 ? 204 ILE A CG1   1 
ATOM   1603 C  CG2   . ILE A 1 204 ? -6.581  4.760   -9.058  1.00   23.26 ? 204 ILE A CG2   1 
ATOM   1604 C  CD1   . ILE A 1 204 ? -8.752  6.955   -9.518  1.00   19.29 ? 204 ILE A CD1   1 
ATOM   1605 N  N     . THR A 1 205 ? -3.242  4.699   -9.460  1.00   22.71 ? 205 THR A N     1 
ATOM   1606 C  CA    . THR A 1 205 ? -2.441  3.494   -9.730  1.00   24.58 ? 205 THR A CA    1 
ATOM   1607 C  C     . THR A 1 205 ? -3.109  2.197   -9.198  1.00   24.82 ? 205 THR A C     1 
ATOM   1608 O  O     . THR A 1 205 ? -3.705  2.191   -8.100  1.00   23.60 ? 205 THR A O     1 
ATOM   1609 C  CB    . THR A 1 205 ? -1.030  3.656   -9.157  1.00   26.60 ? 205 THR A CB    1 
ATOM   1610 O  OG1   . THR A 1 205 ? -0.465  4.890   -9.669  1.00   28.14 ? 205 THR A OG1   1 
ATOM   1611 C  CG2   . THR A 1 205 ? -0.134  2.399   -9.510  1.00   27.00 ? 205 THR A CG2   1 
ATOM   1612 N  N     . GLN A 1 206 ? -3.020  1.111   -9.974  1.00   25.00 ? 206 GLN A N     1 
ATOM   1613 C  CA    . GLN A 1 206 ? -3.516  -0.205  -9.520  1.00   24.60 ? 206 GLN A CA    1 
ATOM   1614 C  C     . GLN A 1 206 ? -2.990  -1.412  -10.300 1.00   27.05 ? 206 GLN A C     1 
ATOM   1615 O  O     . GLN A 1 206 ? -2.841  -1.330  -11.546 1.00   29.44 ? 206 GLN A O     1 
ATOM   1616 C  CB    . GLN A 1 206 ? -5.043  -0.236  -9.485  1.00   24.32 ? 206 GLN A CB    1 
ATOM   1617 C  CG    . GLN A 1 206 ? -5.607  -1.341  -8.591  1.00   24.14 ? 206 GLN A CG    1 
ATOM   1618 C  CD    . GLN A 1 206 ? -5.531  -1.073  -7.083  1.00   23.65 ? 206 GLN A CD    1 
ATOM   1619 O  OE1   . GLN A 1 206 ? -5.975  -1.921  -6.299  1.00   26.36 ? 206 GLN A OE1   1 
ATOM   1620 N  NE2   . GLN A 1 206 ? -5.007  0.104   -6.666  1.00   21.37 ? 206 GLN A NE2   1 
ATOM   1621 N  N     . HIS A 1 207 ? -2.719  -2.529  -9.581  1.00   26.33 ? 207 HIS A N     1 
ATOM   1622 C  CA    . HIS A 1 207 ? -2.269  -3.790  -10.217 1.00   26.30 ? 207 HIS A CA    1 
ATOM   1623 C  C     . HIS A 1 207 ? -3.216  -4.145  -11.358 1.00   26.58 ? 207 HIS A C     1 
ATOM   1624 O  O     . HIS A 1 207 ? -4.448  -3.954  -11.229 1.00   25.47 ? 207 HIS A O     1 
ATOM   1625 C  CB    . HIS A 1 207 ? -2.258  -4.978  -9.224  1.00   25.08 ? 207 HIS A CB    1 
ATOM   1626 C  CG    . HIS A 1 207 ? -1.528  -6.181  -9.748  1.00   26.95 ? 207 HIS A CG    1 
ATOM   1627 N  ND1   . HIS A 1 207 ? -0.189  -6.391  -9.497  1.00   30.40 ? 207 HIS A ND1   1 
ATOM   1628 C  CD2   . HIS A 1 207 ? -1.922  -7.200  -10.546 1.00   28.14 ? 207 HIS A CD2   1 
ATOM   1629 C  CE1   . HIS A 1 207 ? 0.207   -7.512  -10.088 1.00   31.20 ? 207 HIS A CE1   1 
ATOM   1630 N  NE2   . HIS A 1 207 ? -0.821  -8.015  -10.744 1.00   30.58 ? 207 HIS A NE2   1 
ATOM   1631 N  N     . ALA A 1 208 ? -2.641  -4.647  -12.454 1.00   27.94 ? 208 ALA A N     1 
ATOM   1632 C  CA    . ALA A 1 208 ? -3.396  -5.005  -13.694 1.00   30.90 ? 208 ALA A CA    1 
ATOM   1633 C  C     . ALA A 1 208 ? -4.509  -6.011  -13.426 1.00   31.80 ? 208 ALA A C     1 
ATOM   1634 O  O     . ALA A 1 208 ? -5.411  -6.169  -14.238 1.00   35.17 ? 208 ALA A O     1 
ATOM   1635 C  CB    . ALA A 1 208 ? -2.452  -5.543  -14.785 1.00   30.59 ? 208 ALA A CB    1 
ATOM   1636 N  N     . ARG A 1 209 ? -4.474  -6.663  -12.273 1.00   30.69 ? 209 ARG A N     1 
ATOM   1637 C  CA    . ARG A 1 209 ? -5.465  -7.654  -11.953 1.00   30.89 ? 209 ARG A CA    1 
ATOM   1638 C  C     . ARG A 1 209 ? -6.823  -6.945  -11.904 1.00   29.63 ? 209 ARG A C     1 
ATOM   1639 O  O     . ARG A 1 209 ? -7.861  -7.554  -12.109 1.00   30.55 ? 209 ARG A O     1 
ATOM   1640 C  CB    . ARG A 1 209 ? -5.092  -8.335  -10.632 1.00   31.50 ? 209 ARG A CB    1 
ATOM   1641 C  CG    . ARG A 1 209 ? -5.240  -7.451  -9.413  1.00   32.89 ? 209 ARG A CG    1 
ATOM   1642 C  CD    . ARG A 1 209 ? -4.680  -8.132  -8.171  1.00   37.63 ? 209 ARG A CD    1 
ATOM   1643 N  NE    . ARG A 1 209 ? -4.937  -7.420  -6.911  1.00   37.19 ? 209 ARG A NE    1 
ATOM   1644 C  CZ    . ARG A 1 209 ? -4.894  -7.994  -5.706  1.00   33.36 ? 209 ARG A CZ    1 
ATOM   1645 N  NH1   . ARG A 1 209 ? -4.619  -9.282  -5.577  1.00   33.65 ? 209 ARG A NH1   1 
ATOM   1646 N  NH2   . ARG A 1 209 ? -5.160  -7.279  -4.624  1.00   31.86 ? 209 ARG A NH2   1 
ATOM   1647 N  N     . ASP A 1 210 ? -6.811  -5.630  -11.669 1.00   28.49 ? 210 ASP A N     1 
ATOM   1648 C  CA    . ASP A 1 210 ? -8.056  -4.900  -11.559 1.00   28.80 ? 210 ASP A CA    1 
ATOM   1649 C  C     . ASP A 1 210 ? -8.288  -4.018  -12.777 1.00   28.81 ? 210 ASP A C     1 
ATOM   1650 O  O     . ASP A 1 210 ? -8.856  -2.941  -12.666 1.00   28.61 ? 210 ASP A O     1 
ATOM   1651 C  CB    . ASP A 1 210 ? -8.096  -4.111  -10.250 1.00   26.70 ? 210 ASP A CB    1 
ATOM   1652 C  CG    . ASP A 1 210 ? -8.745  -4.906  -9.124  1.00   28.66 ? 210 ASP A CG    1 
ATOM   1653 O  OD1   . ASP A 1 210 ? -9.906  -5.315  -9.296  1.00   30.71 ? 210 ASP A OD1   1 
ATOM   1654 O  OD2   . ASP A 1 210 ? -8.129  -5.107  -8.053  1.00   31.48 ? 210 ASP A OD2   1 
ATOM   1655 N  N     . VAL A 1 211 ? -7.849  -4.478  -13.944 1.00   29.43 ? 211 VAL A N     1 
ATOM   1656 C  CA    . VAL A 1 211 ? -8.140  -3.757  -15.219 1.00   29.79 ? 211 VAL A CA    1 
ATOM   1657 C  C     . VAL A 1 211 ? -9.606  -3.330  -15.439 1.00   28.44 ? 211 VAL A C     1 
ATOM   1658 O  O     . VAL A 1 211 ? -9.884  -2.204  -15.889 1.00   30.29 ? 211 VAL A O     1 
ATOM   1659 C  CB    . VAL A 1 211 ? -7.625  -4.546  -16.456 1.00   29.89 ? 211 VAL A CB    1 
ATOM   1660 C  CG1   . VAL A 1 211 ? -8.373  -5.890  -16.659 1.00   31.17 ? 211 VAL A CG1   1 
ATOM   1661 C  CG2   . VAL A 1 211 ? -7.608  -3.668  -17.722 1.00   29.50 ? 211 VAL A CG2   1 
ATOM   1662 N  N     . LYS A 1 212 ? -10.543 -4.208  -15.140 1.00   28.94 ? 212 LYS A N     1 
ATOM   1663 C  CA    . LYS A 1 212 ? -11.943 -3.913  -15.408 1.00   31.29 ? 212 LYS A CA    1 
ATOM   1664 C  C     . LYS A 1 212 ? -12.365 -2.688  -14.589 1.00   31.03 ? 212 LYS A C     1 
ATOM   1665 O  O     . LYS A 1 212 ? -13.041 -1.799  -15.095 1.00   29.30 ? 212 LYS A O     1 
ATOM   1666 C  CB    . LYS A 1 212 ? -12.835 -5.128  -15.069 1.00   36.33 ? 212 LYS A CB    1 
ATOM   1667 C  CG    . LYS A 1 212 ? -13.228 -6.024  -16.239 1.00   42.51 ? 212 LYS A CG    1 
ATOM   1668 C  CD    . LYS A 1 212 ? -12.564 -7.390  -16.136 1.00   49.16 ? 212 LYS A CD    1 
ATOM   1669 C  CE    . LYS A 1 212 ? -12.728 -8.242  -17.389 1.00   55.24 ? 212 LYS A CE    1 
ATOM   1670 N  NZ    . LYS A 1 212 ? -12.693 -7.487  -18.678 1.00   58.66 ? 212 LYS A NZ    1 
ATOM   1671 N  N     . LEU A 1 213 ? -11.926 -2.626  -13.330 1.00   31.24 ? 213 LEU A N     1 
ATOM   1672 C  CA    . LEU A 1 213 ? -12.300 -1.521  -12.458 1.00   30.17 ? 213 LEU A CA    1 
ATOM   1673 C  C     . LEU A 1 213 ? -11.647 -0.207  -12.951 1.00   27.61 ? 213 LEU A C     1 
ATOM   1674 O  O     . LEU A 1 213 ? -12.285 0.866   -12.991 1.00   24.27 ? 213 LEU A O     1 
ATOM   1675 C  CB    . LEU A 1 213 ? -11.902 -1.832  -10.993 1.00   30.41 ? 213 LEU A CB    1 
ATOM   1676 C  CG    . LEU A 1 213 ? -12.156 -0.753  -9.928  1.00   29.43 ? 213 LEU A CG    1 
ATOM   1677 C  CD1   . LEU A 1 213 ? -13.647 -0.403  -9.801  1.00   30.78 ? 213 LEU A CD1   1 
ATOM   1678 C  CD2   . LEU A 1 213 ? -11.615 -1.161  -8.574  1.00   31.59 ? 213 LEU A CD2   1 
ATOM   1679 N  N     . MET A 1 214 ? -10.376 -0.297  -13.337 1.00   28.10 ? 214 MET A N     1 
ATOM   1680 C  CA    . MET A 1 214 ? -9.658  0.859   -13.822 1.00   26.30 ? 214 MET A CA    1 
ATOM   1681 C  C     . MET A 1 214 ? -10.356 1.375   -15.090 1.00   26.93 ? 214 MET A C     1 
ATOM   1682 O  O     . MET A 1 214 ? -10.599 2.594   -15.238 1.00   29.70 ? 214 MET A O     1 
ATOM   1683 C  CB    . MET A 1 214 ? -8.188  0.462   -14.079 1.00   26.39 ? 214 MET A CB    1 
ATOM   1684 C  CG    . MET A 1 214 ? -7.457  0.099   -12.781 1.00   28.80 ? 214 MET A CG    1 
ATOM   1685 S  SD    . MET A 1 214 ? -7.302  1.556   -11.715 1.00   33.00 ? 214 MET A SD    1 
ATOM   1686 C  CE    . MET A 1 214 ? -5.706  2.133   -12.309 1.00   29.51 ? 214 MET A CE    1 
ATOM   1687 N  N     . GLU A 1 215 ? -10.740 0.455   -15.977 1.00   28.12 ? 215 GLU A N     1 
ATOM   1688 C  CA    . GLU A 1 215 ? -11.470 0.840   -17.202 1.00   32.17 ? 215 GLU A CA    1 
ATOM   1689 C  C     . GLU A 1 215 ? -12.780 1.584   -16.894 1.00   31.84 ? 215 GLU A C     1 
ATOM   1690 O  O     . GLU A 1 215 ? -13.127 2.555   -17.561 1.00   32.09 ? 215 GLU A O     1 
ATOM   1691 C  CB    . GLU A 1 215 ? -11.710 -0.367  -18.125 1.00   34.26 ? 215 GLU A CB    1 
ATOM   1692 C  CG    . GLU A 1 215 ? -12.744 -0.134  -19.240 1.00   40.74 ? 215 GLU A CG    1 
ATOM   1693 C  CD    . GLU A 1 215 ? -12.206 0.664   -20.443 1.00   48.16 ? 215 GLU A CD    1 
ATOM   1694 O  OE1   . GLU A 1 215 ? -10.954 0.835   -20.565 1.00   68.28 ? 215 GLU A OE1   1 
ATOM   1695 O  OE2   . GLU A 1 215 ? -13.028 1.120   -21.282 1.00   56.28 ? 215 GLU A OE2   1 
ATOM   1696 N  N     . SER A 1 216 ? -13.483 1.155   -15.856 1.00   32.08 ? 216 SER A N     1 
ATOM   1697 C  CA    . SER A 1 216 ? -14.816 1.684   -15.604 1.00   32.83 ? 216 SER A CA    1 
ATOM   1698 C  C     . SER A 1 216 ? -14.749 3.122   -15.056 1.00   31.85 ? 216 SER A C     1 
ATOM   1699 O  O     . SER A 1 216 ? -15.760 3.847   -15.061 1.00   34.23 ? 216 SER A O     1 
ATOM   1700 C  CB    . SER A 1 216 ? -15.518 0.786   -14.599 1.00   30.95 ? 216 SER A CB    1 
ATOM   1701 O  OG    . SER A 1 216 ? -14.887 1.027   -13.346 1.00   32.34 ? 216 SER A OG    1 
ATOM   1702 N  N     . LEU A 1 217 ? -13.568 3.543   -14.588 1.00   27.73 ? 217 LEU A N     1 
ATOM   1703 C  CA    . LEU A 1 217 ? -13.363 4.924   -14.159 1.00   27.65 ? 217 LEU A CA    1 
ATOM   1704 C  C     . LEU A 1 217 ? -13.523 5.953   -15.295 1.00   29.95 ? 217 LEU A C     1 
ATOM   1705 O  O     . LEU A 1 217 ? -13.928 7.098   -15.049 1.00   29.94 ? 217 LEU A O     1 
ATOM   1706 C  CB    . LEU A 1 217 ? -11.975 5.102   -13.514 1.00   24.76 ? 217 LEU A CB    1 
ATOM   1707 C  CG    . LEU A 1 217 ? -11.711 4.362   -12.216 1.00   26.54 ? 217 LEU A CG    1 
ATOM   1708 C  CD1   . LEU A 1 217 ? -10.206 4.302   -11.902 1.00   27.43 ? 217 LEU A CD1   1 
ATOM   1709 C  CD2   . LEU A 1 217 ? -12.474 4.988   -11.060 1.00   25.92 ? 217 LEU A CD2   1 
ATOM   1710 N  N     . ILE A 1 218 ? -13.186 5.564   -16.528 1.00   29.35 ? 218 ILE A N     1 
ATOM   1711 C  CA    . ILE A 1 218 ? -13.279 6.494   -17.656 1.00   32.20 ? 218 ILE A CA    1 
ATOM   1712 C  C     . ILE A 1 218 ? -14.766 6.788   -17.776 1.00   34.25 ? 218 ILE A C     1 
ATOM   1713 O  O     . ILE A 1 218 ? -15.217 7.953   -17.927 1.00   31.55 ? 218 ILE A O     1 
ATOM   1714 C  CB    . ILE A 1 218 ? -12.733 5.833   -18.957 1.00   33.38 ? 218 ILE A CB    1 
ATOM   1715 C  CG1   . ILE A 1 218 ? -11.217 5.621   -18.849 1.00   29.99 ? 218 ILE A CG1   1 
ATOM   1716 C  CG2   . ILE A 1 218 ? -13.081 6.640   -20.210 1.00   35.54 ? 218 ILE A CG2   1 
ATOM   1717 C  CD1   . ILE A 1 218 ? -10.625 4.737   -19.949 1.00   31.79 ? 218 ILE A CD1   1 
ATOM   1718 N  N     . SER A 1 219 ? -15.540 5.724   -17.653 1.00   34.57 ? 219 SER A N     1 
ATOM   1719 C  CA    . SER A 1 219 ? -16.964 5.857   -17.748 1.00   36.30 ? 219 SER A CA    1 
ATOM   1720 C  C     . SER A 1 219 ? -17.527 6.659   -16.554 1.00   33.44 ? 219 SER A C     1 
ATOM   1721 O  O     . SER A 1 219 ? -18.288 7.637   -16.725 1.00   34.01 ? 219 SER A O     1 
ATOM   1722 C  CB    . SER A 1 219 ? -17.575 4.471   -17.831 1.00   38.36 ? 219 SER A CB    1 
ATOM   1723 O  OG    . SER A 1 219 ? -18.952 4.610   -17.710 1.00   48.88 ? 219 SER A OG    1 
ATOM   1724 N  N     . TYR A 1 220 ? -17.121 6.256   -15.359 1.00   30.92 ? 220 TYR A N     1 
ATOM   1725 C  CA    . TYR A 1 220 ? -17.632 6.840   -14.112 1.00   30.44 ? 220 TYR A CA    1 
ATOM   1726 C  C     . TYR A 1 220 ? -17.323 8.333   -14.033 1.00   28.16 ? 220 TYR A C     1 
ATOM   1727 O  O     . TYR A 1 220 ? -18.207 9.112   -13.695 1.00   27.65 ? 220 TYR A O     1 
ATOM   1728 C  CB    . TYR A 1 220 ? -17.016 6.144   -12.897 1.00   28.86 ? 220 TYR A CB    1 
ATOM   1729 C  CG    . TYR A 1 220 ? -17.740 6.424   -11.591 1.00   29.63 ? 220 TYR A CG    1 
ATOM   1730 C  CD1   . TYR A 1 220 ? -18.979 5.775   -11.290 1.00   32.56 ? 220 TYR A CD1   1 
ATOM   1731 C  CD2   . TYR A 1 220 ? -17.221 7.365   -10.680 1.00   28.00 ? 220 TYR A CD2   1 
ATOM   1732 C  CE1   . TYR A 1 220 ? -19.644 6.024   -10.095 1.00   33.41 ? 220 TYR A CE1   1 
ATOM   1733 C  CE2   . TYR A 1 220 ? -17.878 7.636   -9.495  1.00   30.08 ? 220 TYR A CE2   1 
ATOM   1734 C  CZ    . TYR A 1 220 ? -19.074 6.958   -9.205  1.00   29.27 ? 220 TYR A CZ    1 
ATOM   1735 O  OH    . TYR A 1 220 ? -19.709 7.200   -8.041  1.00   29.48 ? 220 TYR A OH    1 
ATOM   1736 N  N     . LEU A 1 221 ? -16.083 8.723   -14.361 1.00   27.77 ? 221 LEU A N     1 
ATOM   1737 C  CA    . LEU A 1 221 ? -15.690 10.145  -14.298 1.00   27.93 ? 221 LEU A CA    1 
ATOM   1738 C  C     . LEU A 1 221 ? -15.967 10.900  -15.599 1.00   29.91 ? 221 LEU A C     1 
ATOM   1739 O  O     . LEU A 1 221 ? -15.908 12.141  -15.622 1.00   29.96 ? 221 LEU A O     1 
ATOM   1740 C  CB    . LEU A 1 221 ? -14.212 10.316  -13.870 1.00   25.86 ? 221 LEU A CB    1 
ATOM   1741 C  CG    . LEU A 1 221 ? -14.047 9.852   -12.420 1.00   27.36 ? 221 LEU A CG    1 
ATOM   1742 C  CD1   . LEU A 1 221 ? -12.593 9.734   -12.007 1.00   25.17 ? 221 LEU A CD1   1 
ATOM   1743 C  CD2   . LEU A 1 221 ? -14.872 10.768  -11.481 1.00   28.97 ? 221 LEU A CD2   1 
ATOM   1744 N  N     . GLY A 1 222 ? -16.287 10.165  -16.660 1.00   29.40 ? 222 GLY A N     1 
ATOM   1745 C  CA    . GLY A 1 222 ? -16.588 10.757  -17.959 1.00   28.56 ? 222 GLY A CA    1 
ATOM   1746 C  C     . GLY A 1 222 ? -15.348 11.412  -18.581 1.00   29.68 ? 222 GLY A C     1 
ATOM   1747 O  O     . GLY A 1 222 ? -15.475 12.392  -19.312 1.00   32.31 ? 222 GLY A O     1 
ATOM   1748 N  N     . CYS A 1 223 ? -14.157 10.869  -18.303 1.00   29.89 ? 223 CYS A N     1 
ATOM   1749 C  CA    . CYS A 1 223 ? -12.898 11.376  -18.851 1.00   30.27 ? 223 CYS A CA    1 
ATOM   1750 C  C     . CYS A 1 223 ? -11.753 10.396  -18.533 1.00   29.55 ? 223 CYS A C     1 
ATOM   1751 O  O     . CYS A 1 223 ? -11.952 9.401   -17.836 1.00   29.12 ? 223 CYS A O     1 
ATOM   1752 C  CB    . CYS A 1 223 ? -12.564 12.784  -18.287 1.00   29.58 ? 223 CYS A CB    1 
ATOM   1753 S  SG    . CYS A 1 223 ? -12.287 12.962  -16.489 1.00   28.33 ? 223 CYS A SG    1 
ATOM   1754 N  N     . GLY A 1 224 ? -10.565 10.701  -19.047 1.00   29.51 ? 224 GLY A N     1 
ATOM   1755 C  CA    . GLY A 1 224 ? -9.339  10.003  -18.660 1.00   27.80 ? 224 GLY A CA    1 
ATOM   1756 C  C     . GLY A 1 224 ? -9.071  8.821   -19.584 1.00   28.12 ? 224 GLY A C     1 
ATOM   1757 O  O     . GLY A 1 224 ? -9.861  8.520   -20.460 1.00   27.57 ? 224 GLY A O     1 
ATOM   1758 N  N     . PHE A 1 225 ? -7.936  8.162   -19.401 1.00   27.01 ? 225 PHE A N     1 
ATOM   1759 C  CA    . PHE A 1 225 ? -7.618  6.999   -20.205 1.00   27.12 ? 225 PHE A CA    1 
ATOM   1760 C  C     . PHE A 1 225 ? -6.733  6.106   -19.368 1.00   26.64 ? 225 PHE A C     1 
ATOM   1761 O  O     . PHE A 1 225 ? -6.220  6.526   -18.336 1.00   26.28 ? 225 PHE A O     1 
ATOM   1762 C  CB    . PHE A 1 225 ? -6.876  7.406   -21.480 1.00   27.88 ? 225 PHE A CB    1 
ATOM   1763 C  CG    . PHE A 1 225 ? -5.713  8.310   -21.222 1.00   28.75 ? 225 PHE A CG    1 
ATOM   1764 C  CD1   . PHE A 1 225 ? -5.916  9.684   -21.060 1.00   29.06 ? 225 PHE A CD1   1 
ATOM   1765 C  CD2   . PHE A 1 225 ? -4.405  7.799   -21.120 1.00   31.19 ? 225 PHE A CD2   1 
ATOM   1766 C  CE1   . PHE A 1 225 ? -4.839  10.532  -20.809 1.00   28.88 ? 225 PHE A CE1   1 
ATOM   1767 C  CE2   . PHE A 1 225 ? -3.314  8.649   -20.870 1.00   31.23 ? 225 PHE A CE2   1 
ATOM   1768 C  CZ    . PHE A 1 225 ? -3.545  10.015  -20.710 1.00   29.47 ? 225 PHE A CZ    1 
ATOM   1769 N  N     . ILE A 1 226 ? -6.569  4.870   -19.813 1.00   27.74 ? 226 ILE A N     1 
ATOM   1770 C  CA    . ILE A 1 226 ? -5.836  3.886   -19.056 1.00   30.42 ? 226 ILE A CA    1 
ATOM   1771 C  C     . ILE A 1 226 ? -4.508  3.636   -19.745 1.00   31.58 ? 226 ILE A C     1 
ATOM   1772 O  O     . ILE A 1 226 ? -4.472  3.614   -20.971 1.00   32.05 ? 226 ILE A O     1 
ATOM   1773 C  CB    . ILE A 1 226 ? -6.667  2.612   -18.929 1.00   32.91 ? 226 ILE A CB    1 
ATOM   1774 C  CG1   . ILE A 1 226 ? -7.399  2.611   -17.588 1.00   37.16 ? 226 ILE A CG1   1 
ATOM   1775 C  CG2   . ILE A 1 226 ? -5.776  1.421   -18.838 1.00   35.65 ? 226 ILE A CG2   1 
ATOM   1776 C  CD1   . ILE A 1 226 ? -8.591  3.518   -17.504 1.00   34.24 ? 226 ILE A CD1   1 
ATOM   1777 N  N     . GLU A 1 227 ? -3.436  3.487   -18.967 1.00   31.65 ? 227 GLU A N     1 
ATOM   1778 C  CA    . GLU A 1 227 ? -2.087  3.114   -19.480 1.00   32.62 ? 227 GLU A CA    1 
ATOM   1779 C  C     . GLU A 1 227 ? -1.354  2.056   -18.633 1.00   33.86 ? 227 GLU A C     1 
ATOM   1780 O  O     . GLU A 1 227 ? -1.613  1.921   -17.443 1.00   35.55 ? 227 GLU A O     1 
ATOM   1781 C  CB    . GLU A 1 227 ? -1.187  4.342   -19.593 1.00   31.49 ? 227 GLU A CB    1 
ATOM   1782 C  CG    . GLU A 1 227 ? -1.582  5.446   -18.648 1.00   32.89 ? 227 GLU A CG    1 
ATOM   1783 C  CD    . GLU A 1 227 ? -0.726  6.707   -18.768 1.00   37.97 ? 227 GLU A CD    1 
ATOM   1784 O  OE1   . GLU A 1 227 ? -0.124  6.983   -19.831 1.00   41.87 ? 227 GLU A OE1   1 
ATOM   1785 O  OE2   . GLU A 1 227 ? -0.669  7.465   -17.771 1.00   52.60 ? 227 GLU A OE2   1 
ATOM   1786 N  N     . LYS A 1 228 ? -0.420  1.344   -19.252 1.00   31.64 ? 228 LYS A N     1 
ATOM   1787 C  CA    . LYS A 1 228 ? 0.321   0.327   -18.573 1.00   33.30 ? 228 LYS A CA    1 
ATOM   1788 C  C     . LYS A 1 228 ? 1.712   0.800   -18.279 1.00   33.31 ? 228 LYS A C     1 
ATOM   1789 O  O     . LYS A 1 228 ? 2.376   1.353   -19.139 1.00   33.38 ? 228 LYS A O     1 
ATOM   1790 C  CB    . LYS A 1 228 ? 0.400   -0.966  -19.370 1.00   38.43 ? 228 LYS A CB    1 
ATOM   1791 C  CG    . LYS A 1 228 ? 0.861   -2.098  -18.465 1.00   38.87 ? 228 LYS A CG    1 
ATOM   1792 C  CD    . LYS A 1 228 ? 1.199   -3.354  -19.215 1.00   44.46 ? 228 LYS A CD    1 
ATOM   1793 C  CE    . LYS A 1 228 ? 1.960   -4.288  -18.284 1.00   43.63 ? 228 LYS A CE    1 
ATOM   1794 N  NZ    . LYS A 1 228 ? 3.319   -3.761  -17.973 1.00   40.66 ? 228 LYS A NZ    1 
ATOM   1795 N  N     . ASP A 1 229 ? 2.139   0.594   -17.040 1.00   31.89 ? 229 ASP A N     1 
ATOM   1796 C  CA    . ASP A 1 229 ? 3.541   0.775   -16.688 1.00   33.62 ? 229 ASP A CA    1 
ATOM   1797 C  C     . ASP A 1 229 ? 4.400   -0.211  -17.481 1.00   34.20 ? 229 ASP A C     1 
ATOM   1798 O  O     . ASP A 1 229 ? 4.097   -1.386  -17.526 1.00   37.69 ? 229 ASP A O     1 
ATOM   1799 C  CB    . ASP A 1 229 ? 3.742   0.590   -15.185 1.00   32.48 ? 229 ASP A CB    1 
ATOM   1800 C  CG    . ASP A 1 229 ? 5.077   1.145   -14.709 1.00   32.86 ? 229 ASP A CG    1 
ATOM   1801 O  OD1   . ASP A 1 229 ? 6.145   0.637   -15.095 1.00   34.23 ? 229 ASP A OD1   1 
ATOM   1802 O  OD2   . ASP A 1 229 ? 5.054   2.111   -13.928 1.00   31.07 ? 229 ASP A OD2   1 
ATOM   1803 N  N     . SER A 1 230 ? 5.444   0.292   -18.128 1.00   36.41 ? 230 SER A N     1 
ATOM   1804 C  CA    . SER A 1 230 ? 6.506   -0.528  -18.770 1.00   41.48 ? 230 SER A CA    1 
ATOM   1805 C  C     . SER A 1 230 ? 7.156   -1.632  -17.940 1.00   43.22 ? 230 SER A C     1 
ATOM   1806 O  O     . SER A 1 230 ? 7.753   -2.595  -18.481 1.00   44.52 ? 230 SER A O     1 
ATOM   1807 C  CB    . SER A 1 230 ? 7.680   0.392   -19.099 1.00   44.33 ? 230 SER A CB    1 
ATOM   1808 O  OG    . SER A 1 230 ? 7.429   1.100   -20.266 1.00   51.40 ? 230 SER A OG    1 
ATOM   1809 N  N     . ARG A 1 231 ? 7.159   -1.446  -16.632 1.00   40.66 ? 231 ARG A N     1 
ATOM   1810 C  CA    . ARG A 1 231 ? 8.143   -2.154  -15.825 1.00   40.49 ? 231 ARG A CA    1 
ATOM   1811 C  C     . ARG A 1 231 ? 7.504   -3.307  -15.100 1.00   37.56 ? 231 ARG A C     1 
ATOM   1812 O  O     . ARG A 1 231 ? 8.177   -4.042  -14.422 1.00   36.86 ? 231 ARG A O     1 
ATOM   1813 C  CB    . ARG A 1 231 ? 8.840   -1.187  -14.841 1.00   39.62 ? 231 ARG A CB    1 
ATOM   1814 C  CG    . ARG A 1 231 ? 9.695   -0.125  -15.539 1.00   41.39 ? 231 ARG A CG    1 
ATOM   1815 C  CD    . ARG A 1 231 ? 10.063  1.008   -14.596 1.00   37.92 ? 231 ARG A CD    1 
ATOM   1816 N  NE    . ARG A 1 231 ? 8.856   1.701   -14.105 1.00   36.63 ? 231 ARG A NE    1 
ATOM   1817 C  CZ    . ARG A 1 231 ? 8.875   2.660   -13.189 1.00   35.75 ? 231 ARG A CZ    1 
ATOM   1818 N  NH1   . ARG A 1 231 ? 10.042  3.072   -12.662 1.00   38.20 ? 231 ARG A NH1   1 
ATOM   1819 N  NH2   . ARG A 1 231 ? 7.738   3.212   -12.808 1.00   34.40 ? 231 ARG A NH2   1 
ATOM   1820 N  N     . GLY A 1 232 ? 6.188   -3.440  -15.219 1.00   38.54 ? 232 GLY A N     1 
ATOM   1821 C  CA    . GLY A 1 232 ? 5.502   -4.583  -14.632 1.00   37.86 ? 232 GLY A CA    1 
ATOM   1822 C  C     . GLY A 1 232 ? 3.992   -4.425  -14.721 1.00   34.94 ? 232 GLY A C     1 
ATOM   1823 O  O     . GLY A 1 232 ? 3.499   -3.490  -15.375 1.00   36.57 ? 232 GLY A O     1 
ATOM   1824 N  N     . PRO A 1 233 ? 3.259   -5.328  -14.042 1.00   34.11 ? 233 PRO A N     1 
ATOM   1825 C  CA    . PRO A 1 233 ? 1.818   -5.527  -14.188 1.00   33.67 ? 233 PRO A CA    1 
ATOM   1826 C  C     . PRO A 1 233 ? 0.977   -4.509  -13.415 1.00   30.72 ? 233 PRO A C     1 
ATOM   1827 O  O     . PRO A 1 233 ? 0.167   -4.896  -12.600 1.00   28.89 ? 233 PRO A O     1 
ATOM   1828 C  CB    . PRO A 1 233 ? 1.630   -6.942  -13.639 1.00   34.56 ? 233 PRO A CB    1 
ATOM   1829 C  CG    . PRO A 1 233 ? 2.668   -7.037  -12.563 1.00   35.13 ? 233 PRO A CG    1 
ATOM   1830 C  CD    . PRO A 1 233 ? 3.876   -6.369  -13.190 1.00   34.55 ? 233 PRO A CD    1 
ATOM   1831 N  N     . TRP A 1 234 ? 1.177   -3.220  -13.714 1.00   31.59 ? 234 TRP A N     1 
ATOM   1832 C  CA    . TRP A 1 234 ? 0.516   -2.078  -13.038 1.00   29.50 ? 234 TRP A CA    1 
ATOM   1833 C  C     . TRP A 1 234 ? -0.087  -1.029  -14.041 1.00   29.01 ? 234 TRP A C     1 
ATOM   1834 O  O     . TRP A 1 234 ? 0.478   -0.726  -15.108 1.00   28.77 ? 234 TRP A O     1 
ATOM   1835 C  CB    . TRP A 1 234 ? 1.491   -1.410  -12.033 1.00   28.19 ? 234 TRP A CB    1 
ATOM   1836 C  CG    . TRP A 1 234 ? 2.431   -2.424  -11.310 1.00   28.54 ? 234 TRP A CG    1 
ATOM   1837 C  CD1   . TRP A 1 234 ? 2.044   -3.443  -10.469 1.00   28.54 ? 234 TRP A CD1   1 
ATOM   1838 C  CD2   . TRP A 1 234 ? 3.871   -2.523  -11.417 1.00   30.36 ? 234 TRP A CD2   1 
ATOM   1839 N  NE1   . TRP A 1 234 ? 3.160   -4.170  -10.072 1.00   30.02 ? 234 TRP A NE1   1 
ATOM   1840 C  CE2   . TRP A 1 234 ? 4.284   -3.618  -10.623 1.00   30.85 ? 234 TRP A CE2   1 
ATOM   1841 C  CE3   . TRP A 1 234 ? 4.857   -1.795  -12.119 1.00   31.32 ? 234 TRP A CE3   1 
ATOM   1842 C  CZ2   . TRP A 1 234 ? 5.672   -3.999  -10.493 1.00   33.05 ? 234 TRP A CZ2   1 
ATOM   1843 C  CZ3   . TRP A 1 234 ? 6.186   -2.187  -12.012 1.00   30.79 ? 234 TRP A CZ3   1 
ATOM   1844 C  CH2   . TRP A 1 234 ? 6.579   -3.275  -11.209 1.00   32.42 ? 234 TRP A CH2   1 
ATOM   1845 N  N     . LEU A 1 235 ? -1.245  -0.480  -13.684 1.00   27.43 ? 235 LEU A N     1 
ATOM   1846 C  CA    . LEU A 1 235 ? -1.998  0.369   -14.579 1.00   25.38 ? 235 LEU A CA    1 
ATOM   1847 C  C     . LEU A 1 235 ? -2.161  1.713   -13.934 1.00   25.69 ? 235 LEU A C     1 
ATOM   1848 O  O     . LEU A 1 235 ? -2.188  1.828   -12.688 1.00   25.92 ? 235 LEU A O     1 
ATOM   1849 C  CB    . LEU A 1 235 ? -3.416  -0.204  -14.822 1.00   25.08 ? 235 LEU A CB    1 
ATOM   1850 C  CG    . LEU A 1 235 ? -3.368  -1.588  -15.412 1.00   27.69 ? 235 LEU A CG    1 
ATOM   1851 C  CD1   . LEU A 1 235 ? -4.786  -1.994  -15.769 1.00   29.16 ? 235 LEU A CD1   1 
ATOM   1852 C  CD2   . LEU A 1 235 ? -2.426  -1.668  -16.617 1.00   29.02 ? 235 LEU A CD2   1 
ATOM   1853 N  N     . TYR A 1 236 ? -2.279  2.723   -14.780 1.00   26.32 ? 236 TYR A N     1 
ATOM   1854 C  CA    . TYR A 1 236 ? -2.691  4.073   -14.334 1.00   25.43 ? 236 TYR A CA    1 
ATOM   1855 C  C     . TYR A 1 236 ? -3.952  4.470   -15.032 1.00   25.91 ? 236 TYR A C     1 
ATOM   1856 O  O     . TYR A 1 236 ? -4.086  4.315   -16.266 1.00   28.30 ? 236 TYR A O     1 
ATOM   1857 C  CB    . TYR A 1 236 ? -1.626  5.106   -14.661 1.00   24.17 ? 236 TYR A CB    1 
ATOM   1858 C  CG    . TYR A 1 236 ? -0.282  4.677   -14.143 1.00   27.59 ? 236 TYR A CG    1 
ATOM   1859 C  CD1   . TYR A 1 236 ? 0.060   4.908   -12.805 1.00   29.61 ? 236 TYR A CD1   1 
ATOM   1860 C  CD2   . TYR A 1 236 ? 0.634   4.030   -14.963 1.00   27.93 ? 236 TYR A CD2   1 
ATOM   1861 C  CE1   . TYR A 1 236 ? 1.285   4.506   -12.317 1.00   29.49 ? 236 TYR A CE1   1 
ATOM   1862 C  CE2   . TYR A 1 236 ? 1.875   3.654   -14.493 1.00   27.81 ? 236 TYR A CE2   1 
ATOM   1863 C  CZ    . TYR A 1 236 ? 2.186   3.894   -13.164 1.00   28.29 ? 236 TYR A CZ    1 
ATOM   1864 O  OH    . TYR A 1 236 ? 3.355   3.490   -12.615 1.00   29.13 ? 236 TYR A OH    1 
ATOM   1865 N  N     . TYR A 1 237 ? -4.866  5.001   -14.248 1.00   24.57 ? 237 TYR A N     1 
ATOM   1866 C  CA    . TYR A 1 237 ? -5.984  5.740   -14.821 1.00   23.68 ? 237 TYR A CA    1 
ATOM   1867 C  C     . TYR A 1 237 ? -5.487  7.159   -14.730 1.00   24.44 ? 237 TYR A C     1 
ATOM   1868 O  O     . TYR A 1 237 ? -5.073  7.589   -13.636 1.00   24.33 ? 237 TYR A O     1 
ATOM   1869 C  CB    . TYR A 1 237 ? -7.214  5.587   -13.977 1.00   23.17 ? 237 TYR A CB    1 
ATOM   1870 C  CG    . TYR A 1 237 ? -8.257  6.673   -14.294 1.00   21.48 ? 237 TYR A CG    1 
ATOM   1871 C  CD1   . TYR A 1 237 ? -9.031  6.609   -15.453 1.00   23.97 ? 237 TYR A CD1   1 
ATOM   1872 C  CD2   . TYR A 1 237 ? -8.422  7.759   -13.462 1.00   20.70 ? 237 TYR A CD2   1 
ATOM   1873 C  CE1   . TYR A 1 237 ? -9.977  7.606   -15.756 1.00   22.71 ? 237 TYR A CE1   1 
ATOM   1874 C  CE2   . TYR A 1 237 ? -9.369  8.782   -13.760 1.00   21.56 ? 237 TYR A CE2   1 
ATOM   1875 C  CZ    . TYR A 1 237 ? -10.152 8.672   -14.906 1.00   21.94 ? 237 TYR A CZ    1 
ATOM   1876 O  OH    . TYR A 1 237 ? -11.073 9.655   -15.222 1.00   21.67 ? 237 TYR A OH    1 
ATOM   1877 N  N     . THR A 1 238 ? -5.498  7.881   -15.850 1.00   23.85 ? 238 THR A N     1 
ATOM   1878 C  CA    . THR A 1 238 ? -4.885  9.202   -15.916 1.00   24.86 ? 238 THR A CA    1 
ATOM   1879 C  C     . THR A 1 238 ? -5.826  10.241  -16.539 1.00   25.72 ? 238 THR A C     1 
ATOM   1880 O  O     . THR A 1 238 ? -6.482  9.945   -17.524 1.00   27.15 ? 238 THR A O     1 
ATOM   1881 C  CB    . THR A 1 238 ? -3.623  9.154   -16.793 1.00   27.29 ? 238 THR A CB    1 
ATOM   1882 O  OG1   . THR A 1 238 ? -2.780  8.064   -16.371 1.00   31.46 ? 238 THR A OG1   1 
ATOM   1883 C  CG2   . THR A 1 238 ? -2.882  10.445  -16.686 1.00   28.16 ? 238 THR A CG2   1 
ATOM   1884 N  N     . VAL A 1 239 ? -5.857  11.461  -15.986 1.00   26.85 ? 239 VAL A N     1 
ATOM   1885 C  CA    . VAL A 1 239 ? -6.516  12.614  -16.621 1.00   25.89 ? 239 VAL A CA    1 
ATOM   1886 C  C     . VAL A 1 239 ? -5.484  13.740  -16.714 1.00   27.01 ? 239 VAL A C     1 
ATOM   1887 O  O     . VAL A 1 239 ? -4.949  14.194  -15.696 1.00   24.38 ? 239 VAL A O     1 
ATOM   1888 C  CB    . VAL A 1 239 ? -7.728  13.132  -15.819 1.00   23.71 ? 239 VAL A CB    1 
ATOM   1889 C  CG1   . VAL A 1 239 ? -8.389  14.267  -16.573 1.00   24.42 ? 239 VAL A CG1   1 
ATOM   1890 C  CG2   . VAL A 1 239 ? -8.737  12.002  -15.546 1.00   23.94 ? 239 VAL A CG2   1 
ATOM   1891 N  N     . THR A 1 240 ? -5.193  14.179  -17.937 1.00   32.25 ? 240 THR A N     1 
ATOM   1892 C  CA    . THR A 1 240 ? -4.236  15.287  -18.169 1.00   34.77 ? 240 THR A CA    1 
ATOM   1893 C  C     . THR A 1 240 ? -4.916  16.506  -18.825 1.00   37.62 ? 240 THR A C     1 
ATOM   1894 O  O     . THR A 1 240 ? -4.474  17.681  -18.663 1.00   41.68 ? 240 THR A O     1 
ATOM   1895 C  CB    . THR A 1 240 ? -3.045  14.793  -19.000 1.00   41.25 ? 240 THR A CB    1 
ATOM   1896 O  OG1   . THR A 1 240 ? -2.218  15.929  -19.368 1.00   54.16 ? 240 THR A OG1   1 
ATOM   1897 C  CG2   . THR A 1 240 ? -3.552  13.967  -20.257 1.00   29.41 ? 240 THR A CG2   1 
ATOM   1898 N  N     . ASN A 1 241 ? -6.005  16.218  -19.539 1.00   32.24 ? 241 ASN A N     1 
ATOM   1899 C  CA    . ASN A 1 241 ? -6.812  17.248  -20.179 1.00   30.69 ? 241 ASN A CA    1 
ATOM   1900 C  C     . ASN A 1 241 ? -7.314  18.291  -19.153 1.00   30.97 ? 241 ASN A C     1 
ATOM   1901 O  O     . ASN A 1 241 ? -8.125  17.982  -18.282 1.00   31.90 ? 241 ASN A O     1 
ATOM   1902 C  CB    . ASN A 1 241 ? -7.974  16.602  -20.956 1.00   31.81 ? 241 ASN A CB    1 
ATOM   1903 C  CG    . ASN A 1 241 ? -8.719  17.609  -21.820 1.00   33.21 ? 241 ASN A CG    1 
ATOM   1904 O  OD1   . ASN A 1 241 ? -9.469  18.436  -21.314 1.00   34.40 ? 241 ASN A OD1   1 
ATOM   1905 N  ND2   . ASN A 1 241 ? -8.488  17.561  -23.122 1.00   34.50 ? 241 ASN A ND2   1 
ATOM   1906 N  N     . PHE A 1 242 ? -6.821  19.527  -19.263 1.00   28.58 ? 242 PHE A N     1 
ATOM   1907 C  CA    . PHE A 1 242 ? -7.098  20.528  -18.273 1.00   28.47 ? 242 PHE A CA    1 
ATOM   1908 C  C     . PHE A 1 242 ? -8.594  20.865  -18.213 1.00   27.72 ? 242 PHE A C     1 
ATOM   1909 O  O     . PHE A 1 242 ? -9.101  21.141  -17.128 1.00   25.89 ? 242 PHE A O     1 
ATOM   1910 C  CB    . PHE A 1 242 ? -6.264  21.793  -18.505 1.00   30.92 ? 242 PHE A CB    1 
ATOM   1911 C  CG    . PHE A 1 242 ? -6.476  22.884  -17.452 1.00   31.88 ? 242 PHE A CG    1 
ATOM   1912 C  CD1   . PHE A 1 242 ? -5.992  22.720  -16.137 1.00   35.33 ? 242 PHE A CD1   1 
ATOM   1913 C  CD2   . PHE A 1 242 ? -7.136  24.081  -17.770 1.00   31.34 ? 242 PHE A CD2   1 
ATOM   1914 C  CE1   . PHE A 1 242 ? -6.156  23.721  -15.156 1.00   27.43 ? 242 PHE A CE1   1 
ATOM   1915 C  CE2   . PHE A 1 242 ? -7.294  25.071  -16.790 1.00   34.91 ? 242 PHE A CE2   1 
ATOM   1916 C  CZ    . PHE A 1 242 ? -6.809  24.888  -15.487 1.00   31.11 ? 242 PHE A CZ    1 
ATOM   1917 N  N     . SER A 1 243 ? -9.307  20.866  -19.331 1.00   25.18 ? 243 SER A N     1 
ATOM   1918 C  CA    . SER A 1 243 ? -10.711 21.218  -19.202 1.00   28.54 ? 243 SER A CA    1 
ATOM   1919 C  C     . SER A 1 243 ? -11.514 20.101  -18.481 1.00   28.70 ? 243 SER A C     1 
ATOM   1920 O  O     . SER A 1 243 ? -12.489 20.416  -17.815 1.00   28.50 ? 243 SER A O     1 
ATOM   1921 C  CB    . SER A 1 243 ? -11.328 21.569  -20.539 1.00   32.34 ? 243 SER A CB    1 
ATOM   1922 O  OG    . SER A 1 243 ? -11.421 20.406  -21.295 1.00   36.41 ? 243 SER A OG    1 
ATOM   1923 N  N     . ASP A 1 244 ? -11.077 18.829  -18.593 1.00   25.91 ? 244 ASP A N     1 
ATOM   1924 C  CA    . ASP A 1 244 ? -11.627 17.724  -17.804 1.00   28.70 ? 244 ASP A CA    1 
ATOM   1925 C  C     . ASP A 1 244 ? -11.219 17.838  -16.314 1.00   27.02 ? 244 ASP A C     1 
ATOM   1926 O  O     . ASP A 1 244 ? -12.011 17.594  -15.407 1.00   24.74 ? 244 ASP A O     1 
ATOM   1927 C  CB    . ASP A 1 244 ? -11.124 16.379  -18.354 1.00   30.06 ? 244 ASP A CB    1 
ATOM   1928 C  CG    . ASP A 1 244 ? -11.802 16.001  -19.670 1.00   31.57 ? 244 ASP A CG    1 
ATOM   1929 O  OD1   . ASP A 1 244 ? -12.931 16.433  -19.927 1.00   31.98 ? 244 ASP A OD1   1 
ATOM   1930 O  OD2   . ASP A 1 244 ? -11.222 15.244  -20.454 1.00   33.66 ? 244 ASP A OD2   1 
ATOM   1931 N  N     . ILE A 1 245 ? -9.971  18.208  -16.077 1.00   25.17 ? 245 ILE A N     1 
ATOM   1932 C  CA    . ILE A 1 245 ? -9.524  18.454  -14.711 1.00   25.18 ? 245 ILE A CA    1 
ATOM   1933 C  C     . ILE A 1 245 ? -10.408 19.546  -14.113 1.00   27.89 ? 245 ILE A C     1 
ATOM   1934 O  O     . ILE A 1 245 ? -11.008 19.349  -13.068 1.00   31.37 ? 245 ILE A O     1 
ATOM   1935 C  CB    . ILE A 1 245 ? -8.011  18.758  -14.625 1.00   24.87 ? 245 ILE A CB    1 
ATOM   1936 C  CG1   . ILE A 1 245 ? -7.224  17.412  -14.672 1.00   26.35 ? 245 ILE A CG1   1 
ATOM   1937 C  CG2   . ILE A 1 245 ? -7.695  19.462  -13.307 1.00   24.80 ? 245 ILE A CG2   1 
ATOM   1938 C  CD1   . ILE A 1 245 ? -5.755  17.589  -14.857 1.00   27.56 ? 245 ILE A CD1   1 
ATOM   1939 N  N     . GLN A 1 246 ? -10.571 20.663  -14.807 1.00   28.04 ? 246 GLN A N     1 
ATOM   1940 C  CA    . GLN A 1 246 ? -11.421 21.763  -14.256 1.00   30.08 ? 246 GLN A CA    1 
ATOM   1941 C  C     . GLN A 1 246 ? -12.894 21.388  -14.092 1.00   28.98 ? 246 GLN A C     1 
ATOM   1942 O  O     . GLN A 1 246 ? -13.538 21.742  -13.107 1.00   30.02 ? 246 GLN A O     1 
ATOM   1943 C  CB    . GLN A 1 246 ? -11.327 23.030  -15.121 1.00   33.64 ? 246 GLN A CB    1 
ATOM   1944 C  CG    . GLN A 1 246 ? -10.106 23.913  -14.847 1.00   35.29 ? 246 GLN A CG    1 
ATOM   1945 C  CD    . GLN A 1 246 ? -10.416 25.410  -15.011 1.00   42.78 ? 246 GLN A CD    1 
ATOM   1946 O  OE1   . GLN A 1 246 ? -10.854 25.878  -16.081 1.00   55.00 ? 246 GLN A OE1   1 
ATOM   1947 N  NE2   . GLN A 1 246 ? -10.192 26.164  -13.949 1.00   42.27 ? 246 GLN A NE2   1 
ATOM   1948 N  N     . GLY A 1 247 ? -13.451 20.714  -15.070 1.00   28.42 ? 247 GLY A N     1 
ATOM   1949 C  CA    . GLY A 1 247 ? -14.905 20.588  -15.099 1.00   27.95 ? 247 GLY A CA    1 
ATOM   1950 C  C     . GLY A 1 247 ? -15.391 19.278  -14.522 1.00   29.24 ? 247 GLY A C     1 
ATOM   1951 O  O     . GLY A 1 247 ? -16.585 19.145  -14.274 1.00   28.57 ? 247 GLY A O     1 
ATOM   1952 N  N     . LYS A 1 248 ? -14.491 18.290  -14.353 1.00   28.37 ? 248 LYS A N     1 
ATOM   1953 C  CA    . LYS A 1 248 ? -14.940 16.962  -13.873 1.00   29.22 ? 248 LYS A CA    1 
ATOM   1954 C  C     . LYS A 1 248 ? -14.227 16.463  -12.623 1.00   27.27 ? 248 LYS A C     1 
ATOM   1955 O  O     . LYS A 1 248 ? -14.878 16.037  -11.712 1.00   29.85 ? 248 LYS A O     1 
ATOM   1956 C  CB    . LYS A 1 248 ? -14.878 15.899  -14.980 1.00   29.39 ? 248 LYS A CB    1 
ATOM   1957 C  CG    . LYS A 1 248 ? -15.779 16.248  -16.196 1.00   35.97 ? 248 LYS A CG    1 
ATOM   1958 C  CD    . LYS A 1 248 ? -15.108 15.734  -17.472 1.00   40.55 ? 248 LYS A CD    1 
ATOM   1959 C  CE    . LYS A 1 248 ? -15.708 16.275  -18.770 1.00   34.40 ? 248 LYS A CE    1 
ATOM   1960 N  NZ    . LYS A 1 248 ? -16.796 15.337  -19.123 1.00   41.84 ? 248 LYS A NZ    1 
ATOM   1961 N  N     . ILE A 1 249 ? -12.901 16.518  -12.574 1.00   26.39 ? 249 ILE A N     1 
ATOM   1962 C  CA    . ILE A 1 249 ? -12.175 15.963  -11.440 1.00   25.49 ? 249 ILE A CA    1 
ATOM   1963 C  C     . ILE A 1 249 ? -12.263 16.864  -10.197 1.00   26.38 ? 249 ILE A C     1 
ATOM   1964 O  O     . ILE A 1 249 ? -12.623 16.401  -9.073  1.00   25.06 ? 249 ILE A O     1 
ATOM   1965 C  CB    . ILE A 1 249 ? -10.683 15.765  -11.813 1.00   22.76 ? 249 ILE A CB    1 
ATOM   1966 C  CG1   . ILE A 1 249 ? -10.569 14.799  -12.994 1.00   22.78 ? 249 ILE A CG1   1 
ATOM   1967 C  CG2   . ILE A 1 249 ? -9.843  15.250  -10.617 1.00   24.76 ? 249 ILE A CG2   1 
ATOM   1968 C  CD1   . ILE A 1 249 ? -11.381 13.496  -12.903 1.00   23.27 ? 249 ILE A CD1   1 
ATOM   1969 N  N     . ILE A 1 250 ? -11.917 18.142  -10.400 1.00   24.08 ? 250 ILE A N     1 
ATOM   1970 C  CA    . ILE A 1 250 ? -11.951 19.095  -9.320  1.00   25.91 ? 250 ILE A CA    1 
ATOM   1971 C  C     . ILE A 1 250 ? -13.336 19.200  -8.647  1.00   26.60 ? 250 ILE A C     1 
ATOM   1972 O  O     . ILE A 1 250 ? -13.406 19.114  -7.417  1.00   26.02 ? 250 ILE A O     1 
ATOM   1973 C  CB    . ILE A 1 250 ? -11.337 20.451  -9.737  1.00   24.83 ? 250 ILE A CB    1 
ATOM   1974 C  CG1   . ILE A 1 250 ? -9.798  20.273  -9.757  1.00   25.07 ? 250 ILE A CG1   1 
ATOM   1975 C  CG2   . ILE A 1 250 ? -11.881 21.596  -8.857  1.00   24.69 ? 250 ILE A CG2   1 
ATOM   1976 C  CD1   . ILE A 1 250 ? -9.039  21.462  -10.283 1.00   27.02 ? 250 ILE A CD1   1 
ATOM   1977 N  N     . PRO A 1 251 ? -14.428 19.334  -9.423  1.00   27.15 ? 251 PRO A N     1 
ATOM   1978 C  CA    . PRO A 1 251 ? -15.725 19.409  -8.710  1.00   27.84 ? 251 PRO A CA    1 
ATOM   1979 C  C     . PRO A 1 251 ? -16.140 18.081  -8.064  1.00   29.14 ? 251 PRO A C     1 
ATOM   1980 O  O     . PRO A 1 251 ? -16.813 18.080  -7.012  1.00   29.43 ? 251 PRO A O     1 
ATOM   1981 C  CB    . PRO A 1 251 ? -16.734 19.781  -9.821  1.00   29.44 ? 251 PRO A CB    1 
ATOM   1982 C  CG    . PRO A 1 251 ? -15.895 20.454  -10.841 1.00   26.92 ? 251 PRO A CG    1 
ATOM   1983 C  CD    . PRO A 1 251 ? -14.590 19.692  -10.846 1.00   27.11 ? 251 PRO A CD    1 
ATOM   1984 N  N     . PHE A 1 252 ? -15.751 16.959  -8.647  1.00   27.57 ? 252 PHE A N     1 
ATOM   1985 C  CA    . PHE A 1 252 ? -16.034 15.683  -7.950  1.00   27.30 ? 252 PHE A CA    1 
ATOM   1986 C  C     . PHE A 1 252 ? -15.446 15.631  -6.526  1.00   26.02 ? 252 PHE A C     1 
ATOM   1987 O  O     . PHE A 1 252 ? -16.164 15.339  -5.544  1.00   26.10 ? 252 PHE A O     1 
ATOM   1988 C  CB    . PHE A 1 252 ? -15.492 14.473  -8.724  1.00   25.03 ? 252 PHE A CB    1 
ATOM   1989 C  CG    . PHE A 1 252 ? -15.896 13.155  -8.108  1.00   25.71 ? 252 PHE A CG    1 
ATOM   1990 C  CD1   . PHE A 1 252 ? -17.198 12.632  -8.335  1.00   26.49 ? 252 PHE A CD1   1 
ATOM   1991 C  CD2   . PHE A 1 252 ? -15.016 12.445  -7.282  1.00   26.33 ? 252 PHE A CD2   1 
ATOM   1992 C  CE1   . PHE A 1 252 ? -17.602 11.429  -7.759  1.00   27.30 ? 252 PHE A CE1   1 
ATOM   1993 C  CE2   . PHE A 1 252 ? -15.418 11.231  -6.710  1.00   28.08 ? 252 PHE A CE2   1 
ATOM   1994 C  CZ    . PHE A 1 252 ? -16.719 10.720  -6.951  1.00   25.52 ? 252 PHE A CZ    1 
ATOM   1995 N  N     . PHE A 1 253 ? -14.129 15.837  -6.426  1.00   25.19 ? 253 PHE A N     1 
ATOM   1996 C  CA    . PHE A 1 253 ? -13.435 15.702  -5.139  1.00   25.99 ? 253 PHE A CA    1 
ATOM   1997 C  C     . PHE A 1 253 ? -13.645 16.928  -4.239  1.00   27.05 ? 253 PHE A C     1 
ATOM   1998 O  O     . PHE A 1 253 ? -13.317 16.909  -3.064  1.00   26.78 ? 253 PHE A O     1 
ATOM   1999 C  CB    . PHE A 1 253 ? -11.960 15.330  -5.306  1.00   24.61 ? 253 PHE A CB    1 
ATOM   2000 C  CG    . PHE A 1 253 ? -11.760 13.976  -5.953  1.00   24.82 ? 253 PHE A CG    1 
ATOM   2001 C  CD1   . PHE A 1 253 ? -11.984 12.799  -5.229  1.00   24.42 ? 253 PHE A CD1   1 
ATOM   2002 C  CD2   . PHE A 1 253 ? -11.407 13.871  -7.300  1.00   23.41 ? 253 PHE A CD2   1 
ATOM   2003 C  CE1   . PHE A 1 253 ? -11.838 11.546  -5.812  1.00   24.00 ? 253 PHE A CE1   1 
ATOM   2004 C  CE2   . PHE A 1 253 ? -11.262 12.618  -7.901  1.00   25.09 ? 253 PHE A CE2   1 
ATOM   2005 C  CZ    . PHE A 1 253 ? -11.484 11.458  -7.156  1.00   25.93 ? 253 PHE A CZ    1 
ATOM   2006 N  N     . HIS A 1 254 ? -14.199 17.999  -4.779  1.00   25.93 ? 254 HIS A N     1 
ATOM   2007 C  CA    . HIS A 1 254 ? -14.646 19.080  -3.908  1.00   28.93 ? 254 HIS A CA    1 
ATOM   2008 C  C     . HIS A 1 254 ? -15.788 18.587  -3.016  1.00   31.08 ? 254 HIS A C     1 
ATOM   2009 O  O     . HIS A 1 254 ? -15.868 18.929  -1.815  1.00   31.75 ? 254 HIS A O     1 
ATOM   2010 C  CB    . HIS A 1 254 ? -15.106 20.301  -4.708  1.00   32.61 ? 254 HIS A CB    1 
ATOM   2011 C  CG    . HIS A 1 254 ? -15.571 21.412  -3.834  1.00   33.88 ? 254 HIS A CG    1 
ATOM   2012 N  ND1   . HIS A 1 254 ? -14.718 22.090  -2.998  1.00   33.76 ? 254 HIS A ND1   1 
ATOM   2013 C  CD2   . HIS A 1 254 ? -16.804 21.918  -3.608  1.00   36.21 ? 254 HIS A CD2   1 
ATOM   2014 C  CE1   . HIS A 1 254 ? -15.397 22.996  -2.319  1.00   38.44 ? 254 HIS A CE1   1 
ATOM   2015 N  NE2   . HIS A 1 254 ? -16.665 22.917  -2.678  1.00   34.96 ? 254 HIS A NE2   1 
ATOM   2016 N  N     . GLN A 1 255 ? -16.671 17.787  -3.614  1.00   31.21 ? 255 GLN A N     1 
ATOM   2017 C  CA    . GLN A 1 255 ? -17.863 17.265  -2.933  1.00   31.34 ? 255 GLN A CA    1 
ATOM   2018 C  C     . GLN A 1 255 ? -17.609 15.928  -2.214  1.00   31.39 ? 255 GLN A C     1 
ATOM   2019 O  O     . GLN A 1 255 ? -18.115 15.714  -1.100  1.00   32.45 ? 255 GLN A O     1 
ATOM   2020 C  CB    . GLN A 1 255 ? -18.997 17.106  -3.940  1.00   30.22 ? 255 GLN A CB    1 
ATOM   2021 C  CG    . GLN A 1 255 ? -20.230 16.537  -3.298  1.00   33.49 ? 255 GLN A CG    1 
ATOM   2022 C  CD    . GLN A 1 255 ? -21.442 16.621  -4.187  1.00   34.31 ? 255 GLN A CD    1 
ATOM   2023 O  OE1   . GLN A 1 255 ? -21.321 16.603  -5.396  1.00   37.67 ? 255 GLN A OE1   1 
ATOM   2024 N  NE2   . GLN A 1 255 ? -22.621 16.693  -3.589  1.00   35.22 ? 255 GLN A NE2   1 
ATOM   2025 N  N     . TYR A 1 256 ? -16.830 15.034  -2.831  1.00   26.07 ? 256 TYR A N     1 
ATOM   2026 C  CA    . TYR A 1 256 ? -16.551 13.735  -2.249  1.00   25.40 ? 256 TYR A CA    1 
ATOM   2027 C  C     . TYR A 1 256 ? -15.121 13.855  -1.878  1.00   25.45 ? 256 TYR A C     1 
ATOM   2028 O  O     . TYR A 1 256 ? -14.280 13.666  -2.718  1.00   25.95 ? 256 TYR A O     1 
ATOM   2029 C  CB    . TYR A 1 256 ? -16.830 12.601  -3.235  1.00   24.47 ? 256 TYR A CB    1 
ATOM   2030 C  CG    . TYR A 1 256 ? -18.296 12.657  -3.592  1.00   26.87 ? 256 TYR A CG    1 
ATOM   2031 C  CD1   . TYR A 1 256 ? -19.249 12.239  -2.679  1.00   28.94 ? 256 TYR A CD1   1 
ATOM   2032 C  CD2   . TYR A 1 256 ? -18.740 13.222  -4.795  1.00   27.86 ? 256 TYR A CD2   1 
ATOM   2033 C  CE1   . TYR A 1 256 ? -20.616 12.323  -2.960  1.00   31.12 ? 256 TYR A CE1   1 
ATOM   2034 C  CE2   . TYR A 1 256 ? -20.114 13.305  -5.094  1.00   28.64 ? 256 TYR A CE2   1 
ATOM   2035 C  CZ    . TYR A 1 256 ? -21.028 12.869  -4.165  1.00   30.86 ? 256 TYR A CZ    1 
ATOM   2036 O  OH    . TYR A 1 256 ? -22.359 12.945  -4.417  1.00   31.80 ? 256 TYR A OH    1 
ATOM   2037 N  N     . LYS A 1 257 ? -14.873 14.238  -0.617  1.00   26.71 ? 257 LYS A N     1 
ATOM   2038 C  CA    . LYS A 1 257 ? -13.585 14.768  -0.195  1.00   24.03 ? 257 LYS A CA    1 
ATOM   2039 C  C     . LYS A 1 257 ? -12.534 13.714  0.028   1.00   22.75 ? 257 LYS A C     1 
ATOM   2040 O  O     . LYS A 1 257 ? -12.800 12.633  0.537   1.00   25.49 ? 257 LYS A O     1 
ATOM   2041 C  CB    . LYS A 1 257 ? -13.738 15.677  1.035   1.00   27.44 ? 257 LYS A CB    1 
ATOM   2042 C  CG    . LYS A 1 257 ? -14.068 17.126  0.616   1.00   30.63 ? 257 LYS A CG    1 
ATOM   2043 C  CD    . LYS A 1 257 ? -14.448 18.061  1.745   1.00   34.14 ? 257 LYS A CD    1 
ATOM   2044 C  CE    . LYS A 1 257 ? -15.044 19.355  1.202   1.00   37.71 ? 257 LYS A CE    1 
ATOM   2045 N  NZ    . LYS A 1 257 ? -16.537 19.242  1.005   1.00   46.21 ? 257 LYS A NZ    1 
ATOM   2046 N  N     . ILE A 1 258 ? -11.320 14.046  -0.358  1.00   21.56 ? 258 ILE A N     1 
ATOM   2047 C  CA    . ILE A 1 258 ? -10.177 13.165  -0.068  1.00   22.58 ? 258 ILE A CA    1 
ATOM   2048 C  C     . ILE A 1 258 ? -9.962  13.183  1.441   1.00   24.12 ? 258 ILE A C     1 
ATOM   2049 O  O     . ILE A 1 258 ? -10.168 14.208  2.072   1.00   25.59 ? 258 ILE A O     1 
ATOM   2050 C  CB    . ILE A 1 258 ? -8.945  13.709  -0.789  1.00   21.38 ? 258 ILE A CB    1 
ATOM   2051 C  CG1   . ILE A 1 258 ? -9.178  13.584  -2.287  1.00   20.40 ? 258 ILE A CG1   1 
ATOM   2052 C  CG2   . ILE A 1 258 ? -7.670  13.032  -0.318  1.00   20.23 ? 258 ILE A CG2   1 
ATOM   2053 C  CD1   . ILE A 1 258 ? -9.248  12.157  -2.828  1.00   20.21 ? 258 ILE A CD1   1 
ATOM   2054 N  N     . ILE A 1 259 ? -9.573  12.048  2.011   1.00   25.28 ? 259 ILE A N     1 
ATOM   2055 C  CA    . ILE A 1 259 ? -9.242  11.968  3.436   1.00   27.53 ? 259 ILE A CA    1 
ATOM   2056 C  C     . ILE A 1 259 ? -7.750  11.771  3.704   1.00   28.71 ? 259 ILE A C     1 
ATOM   2057 O  O     . ILE A 1 259 ? -7.012  11.147  2.892   1.00   27.42 ? 259 ILE A O     1 
ATOM   2058 C  CB    . ILE A 1 259 ? -9.996  10.798  4.120   1.00   27.64 ? 259 ILE A CB    1 
ATOM   2059 C  CG1   . ILE A 1 259 ? -9.556  9.462   3.531   1.00   23.13 ? 259 ILE A CG1   1 
ATOM   2060 C  CG2   . ILE A 1 259 ? -11.496 10.999  3.986   1.00   23.64 ? 259 ILE A CG2   1 
ATOM   2061 C  CD1   . ILE A 1 259 ? -10.403 8.283   4.000   1.00   20.46 ? 259 ILE A CD1   1 
ATOM   2062 N  N     . GLY A 1 260 ? -7.336  12.246  4.886   1.00   26.68 ? 260 GLY A N     1 
ATOM   2063 C  CA    . GLY A 1 260 ? -5.964  12.218  5.302   1.00   26.46 ? 260 GLY A CA    1 
ATOM   2064 C  C     . GLY A 1 260 ? -5.320  13.475  4.766   1.00   27.35 ? 260 GLY A C     1 
ATOM   2065 O  O     . GLY A 1 260 ? -6.014  14.322  4.188   1.00   26.54 ? 260 GLY A O     1 
ATOM   2066 N  N     . SER A 1 261 ? -4.006  13.603  4.943   1.00   26.27 ? 261 SER A N     1 
ATOM   2067 C  CA    . SER A 1 261 ? -3.296  14.848  4.572   1.00   28.29 ? 261 SER A CA    1 
ATOM   2068 C  C     . SER A 1 261 ? -3.318  15.105  3.070   1.00   26.58 ? 261 SER A C     1 
ATOM   2069 O  O     . SER A 1 261 ? -3.173  16.238  2.636   1.00   28.37 ? 261 SER A O     1 
ATOM   2070 C  CB    . SER A 1 261 ? -1.846  14.852  5.098   1.00   31.78 ? 261 SER A CB    1 
ATOM   2071 O  OG    . SER A 1 261 ? -1.161  13.734  4.598   1.00   38.12 ? 261 SER A OG    1 
ATOM   2072 N  N     . LYS A 1 262 ? -3.523  14.064  2.267   1.00   26.20 ? 262 LYS A N     1 
ATOM   2073 C  CA    . LYS A 1 262 ? -3.685  14.226  0.811   1.00   25.07 ? 262 LYS A CA    1 
ATOM   2074 C  C     . LYS A 1 262 ? -4.775  15.271  0.470   1.00   26.03 ? 262 LYS A C     1 
ATOM   2075 O  O     . LYS A 1 262 ? -4.756  15.853  -0.610  1.00   31.04 ? 262 LYS A O     1 
ATOM   2076 C  CB    . LYS A 1 262 ? -3.986  12.868  0.143   1.00   21.98 ? 262 LYS A CB    1 
ATOM   2077 C  CG    . LYS A 1 262 ? -3.906  12.884  -1.392  1.00   24.72 ? 262 LYS A CG    1 
ATOM   2078 C  CD    . LYS A 1 262 ? -4.212  11.539  -2.077  1.00   23.82 ? 262 LYS A CD    1 
ATOM   2079 C  CE    . LYS A 1 262 ? -3.132  10.508  -1.804  1.00   25.04 ? 262 LYS A CE    1 
ATOM   2080 N  NZ    . LYS A 1 262 ? -1.877  10.758  -2.549  1.00   27.60 ? 262 LYS A NZ    1 
ATOM   2081 N  N     . TYR A 1 263 ? -5.725  15.500  1.379   1.00   26.10 ? 263 TYR A N     1 
ATOM   2082 C  CA    . TYR A 1 263 ? -6.713  16.550  1.189   1.00   23.68 ? 263 TYR A CA    1 
ATOM   2083 C  C     . TYR A 1 263 ? -6.081  17.942  1.005   1.00   26.53 ? 263 TYR A C     1 
ATOM   2084 O  O     . TYR A 1 263 ? -6.545  18.740  0.140   1.00   23.67 ? 263 TYR A O     1 
ATOM   2085 C  CB    . TYR A 1 263 ? -7.679  16.613  2.368   1.00   24.48 ? 263 TYR A CB    1 
ATOM   2086 C  CG    . TYR A 1 263 ? -8.751  17.640  2.142   1.00   25.99 ? 263 TYR A CG    1 
ATOM   2087 C  CD1   . TYR A 1 263 ? -9.661  17.513  1.089   1.00   24.72 ? 263 TYR A CD1   1 
ATOM   2088 C  CD2   . TYR A 1 263 ? -8.850  18.773  2.972   1.00   30.37 ? 263 TYR A CD2   1 
ATOM   2089 C  CE1   . TYR A 1 263 ? -10.654 18.465  0.890   1.00   28.71 ? 263 TYR A CE1   1 
ATOM   2090 C  CE2   . TYR A 1 263 ? -9.835  19.740  2.777   1.00   32.51 ? 263 TYR A CE2   1 
ATOM   2091 C  CZ    . TYR A 1 263 ? -10.729 19.586  1.733   1.00   33.22 ? 263 TYR A CZ    1 
ATOM   2092 O  OH    . TYR A 1 263 ? -11.711 20.560  1.554   1.00   39.25 ? 263 TYR A OH    1 
ATOM   2093 N  N     . GLY A 1 264 ? -5.041  18.223  1.814   1.00   27.23 ? 264 GLY A N     1 
ATOM   2094 C  CA    . GLY A 1 264 ? -4.205  19.444  1.650   1.00   26.93 ? 264 GLY A CA    1 
ATOM   2095 C  C     . GLY A 1 264 ? -3.585  19.524  0.255   1.00   26.99 ? 264 GLY A C     1 
ATOM   2096 O  O     . GLY A 1 264 ? -3.525  20.601  -0.349  1.00   27.78 ? 264 GLY A O     1 
ATOM   2097 N  N     . ASP A 1 265 ? -3.101  18.390  -0.257  1.00   25.50 ? 265 ASP A N     1 
ATOM   2098 C  CA    . ASP A 1 265 ? -2.473  18.351  -1.576  1.00   24.15 ? 265 ASP A CA    1 
ATOM   2099 C  C     . ASP A 1 265 ? -3.517  18.631  -2.640  1.00   22.69 ? 265 ASP A C     1 
ATOM   2100 O  O     . ASP A 1 265 ? -3.240  19.363  -3.592  1.00   23.41 ? 265 ASP A O     1 
ATOM   2101 C  CB    . ASP A 1 265 ? -1.788  17.006  -1.835  1.00   22.44 ? 265 ASP A CB    1 
ATOM   2102 C  CG    . ASP A 1 265 ? -0.656  16.720  -0.829  1.00   25.67 ? 265 ASP A CG    1 
ATOM   2103 O  OD1   . ASP A 1 265 ? 0.084   17.677  -0.496  1.00   27.40 ? 265 ASP A OD1   1 
ATOM   2104 O  OD2   . ASP A 1 265 ? -0.513  15.542  -0.384  1.00   27.85 ? 265 ASP A OD2   1 
ATOM   2105 N  N     . TYR A 1 266 ? -4.706  18.046  -2.511  1.00   22.38 ? 266 TYR A N     1 
ATOM   2106 C  CA    . TYR A 1 266 ? -5.813  18.405  -3.402  1.00   23.05 ? 266 TYR A CA    1 
ATOM   2107 C  C     . TYR A 1 266 ? -6.147  19.935  -3.394  1.00   24.00 ? 266 TYR A C     1 
ATOM   2108 O  O     . TYR A 1 266 ? -6.325  20.524  -4.468  1.00   24.25 ? 266 TYR A O     1 
ATOM   2109 C  CB    . TYR A 1 266 ? -7.065  17.555  -3.125  1.00   21.18 ? 266 TYR A CB    1 
ATOM   2110 C  CG    . TYR A 1 266 ? -8.347  18.140  -3.735  1.00   23.39 ? 266 TYR A CG    1 
ATOM   2111 C  CD1   . TYR A 1 266 ? -8.753  17.807  -5.024  1.00   22.18 ? 266 TYR A CD1   1 
ATOM   2112 C  CD2   . TYR A 1 266 ? -9.138  19.044  -3.009  1.00   25.59 ? 266 TYR A CD2   1 
ATOM   2113 C  CE1   . TYR A 1 266 ? -9.908  18.355  -5.544  1.00   24.13 ? 266 TYR A CE1   1 
ATOM   2114 C  CE2   . TYR A 1 266 ? -10.317 19.584  -3.522  1.00   26.04 ? 266 TYR A CE2   1 
ATOM   2115 C  CZ    . TYR A 1 266 ? -10.690 19.231  -4.803  1.00   25.67 ? 266 TYR A CZ    1 
ATOM   2116 O  OH    . TYR A 1 266 ? -11.827 19.784  -5.361  1.00   25.11 ? 266 TYR A OH    1 
ATOM   2117 N  N     . MET A 1 267 ? -6.280  20.559  -2.213  1.00   25.87 ? 267 MET A N     1 
ATOM   2118 C  CA    . MET A 1 267 ? -6.521  22.026  -2.131  1.00   27.03 ? 267 MET A CA    1 
ATOM   2119 C  C     . MET A 1 267 ? -5.429  22.826  -2.852  1.00   25.09 ? 267 MET A C     1 
ATOM   2120 O  O     . MET A 1 267 ? -5.700  23.819  -3.497  1.00   25.30 ? 267 MET A O     1 
ATOM   2121 C  CB    . MET A 1 267 ? -6.611  22.530  -0.660  1.00   30.48 ? 267 MET A CB    1 
ATOM   2122 C  CG    . MET A 1 267 ? -7.830  21.998  0.104   1.00   33.63 ? 267 MET A CG    1 
ATOM   2123 S  SD    . MET A 1 267 ? -7.946  22.509  1.851   1.00   51.07 ? 267 MET A SD    1 
ATOM   2124 C  CE    . MET A 1 267 ? -6.221  22.451  2.373   1.00   49.54 ? 267 MET A CE    1 
ATOM   2125 N  N     . ASP A 1 268 ? -4.187  22.413  -2.691  1.00   27.20 ? 268 ASP A N     1 
ATOM   2126 C  CA    . ASP A 1 268 ? -3.061  23.103  -3.344  1.00   26.80 ? 268 ASP A CA    1 
ATOM   2127 C  C     . ASP A 1 268 ? -3.059  22.903  -4.855  1.00   24.72 ? 268 ASP A C     1 
ATOM   2128 O  O     . ASP A 1 268 ? -2.752  23.821  -5.615  1.00   24.93 ? 268 ASP A O     1 
ATOM   2129 C  CB    . ASP A 1 268 ? -1.712  22.683  -2.703  1.00   27.29 ? 268 ASP A CB    1 
ATOM   2130 C  CG    . ASP A 1 268 ? -1.516  23.345  -1.337  1.00   30.32 ? 268 ASP A CG    1 
ATOM   2131 O  OD1   . ASP A 1 268 ? -2.256  24.328  -0.998  1.00   29.90 ? 268 ASP A OD1   1 
ATOM   2132 O  OD2   . ASP A 1 268 ? -0.645  22.878  -0.599  1.00   28.86 ? 268 ASP A OD2   1 
ATOM   2133 N  N     . TRP A 1 269 ? -3.464  21.713  -5.267  1.00   24.15 ? 269 TRP A N     1 
ATOM   2134 C  CA    . TRP A 1 269 ? -3.604  21.387  -6.683  1.00   25.28 ? 269 TRP A CA    1 
ATOM   2135 C  C     . TRP A 1 269 ? -4.678  22.269  -7.296  1.00   25.58 ? 269 TRP A C     1 
ATOM   2136 O  O     . TRP A 1 269 ? -4.457  22.817  -8.380  1.00   26.15 ? 269 TRP A O     1 
ATOM   2137 C  CB    . TRP A 1 269 ? -4.058  19.975  -6.756  1.00   23.84 ? 269 TRP A CB    1 
ATOM   2138 C  CG    . TRP A 1 269 ? -3.911  19.224  -8.038  1.00   22.85 ? 269 TRP A CG    1 
ATOM   2139 C  CD1   . TRP A 1 269 ? -2.733  18.819  -8.654  1.00   21.61 ? 269 TRP A CD1   1 
ATOM   2140 C  CD2   . TRP A 1 269 ? -4.976  18.607  -8.750  1.00   21.72 ? 269 TRP A CD2   1 
ATOM   2141 N  NE1   . TRP A 1 269 ? -3.038  18.023  -9.762  1.00   23.03 ? 269 TRP A NE1   1 
ATOM   2142 C  CE2   . TRP A 1 269 ? -4.410  17.872  -9.817  1.00   22.66 ? 269 TRP A CE2   1 
ATOM   2143 C  CE3   . TRP A 1 269 ? -6.384  18.628  -8.612  1.00   24.24 ? 269 TRP A CE3   1 
ATOM   2144 C  CZ2   . TRP A 1 269 ? -5.206  17.198  -10.762 1.00   23.74 ? 269 TRP A CZ2   1 
ATOM   2145 C  CZ3   . TRP A 1 269 ? -7.170  17.913  -9.543  1.00   21.88 ? 269 TRP A CZ3   1 
ATOM   2146 C  CH2   . TRP A 1 269 ? -6.574  17.214  -10.589 1.00   23.06 ? 269 TRP A CH2   1 
ATOM   2147 N  N     . CYS A 1 270 ? -5.824  22.401  -6.610  1.00   24.85 ? 270 CYS A N     1 
ATOM   2148 C  CA    . CYS A 1 270 ? -6.889  23.352  -7.035  1.00   24.44 ? 270 CYS A CA    1 
ATOM   2149 C  C     . CYS A 1 270 ? -6.391  24.826  -7.145  1.00   26.23 ? 270 CYS A C     1 
ATOM   2150 O  O     . CYS A 1 270 ? -6.862  25.604  -8.001  1.00   26.47 ? 270 CYS A O     1 
ATOM   2151 C  CB    . CYS A 1 270 ? -8.064  23.304  -6.069  1.00   26.49 ? 270 CYS A CB    1 
ATOM   2152 S  SG    . CYS A 1 270 ? -8.851  21.674  -6.058  1.00   31.05 ? 270 CYS A SG    1 
ATOM   2153 N  N     . LYS A 1 271 ? -5.468  25.247  -6.273  1.00   26.76 ? 271 LYS A N     1 
ATOM   2154 C  CA    . LYS A 1 271 ? -4.954  26.640  -6.390  1.00   27.22 ? 271 LYS A CA    1 
ATOM   2155 C  C     . LYS A 1 271 ? -4.130  26.807  -7.656  1.00   26.22 ? 271 LYS A C     1 
ATOM   2156 O  O     . LYS A 1 271 ? -4.119  27.886  -8.276  1.00   25.64 ? 271 LYS A O     1 
ATOM   2157 C  CB    . LYS A 1 271 ? -4.115  27.035  -5.204  1.00   30.14 ? 271 LYS A CB    1 
ATOM   2158 C  CG    . LYS A 1 271 ? -4.898  27.101  -3.899  1.00   36.91 ? 271 LYS A CG    1 
ATOM   2159 C  CD    . LYS A 1 271 ? -3.951  27.583  -2.815  1.00   38.67 ? 271 LYS A CD    1 
ATOM   2160 C  CE    . LYS A 1 271 ? -4.208  26.861  -1.544  1.00   41.75 ? 271 LYS A CE    1 
ATOM   2161 N  NZ    . LYS A 1 271 ? -5.472  27.420  -1.017  1.00   46.95 ? 271 LYS A NZ    1 
ATOM   2162 N  N     . ILE A 1 272 ? -3.415  25.742  -8.028  1.00   25.59 ? 272 ILE A N     1 
ATOM   2163 C  CA    . ILE A 1 272 ? -2.630  25.769  -9.265  1.00   24.66 ? 272 ILE A CA    1 
ATOM   2164 C  C     . ILE A 1 272 ? -3.599  25.878  -10.427 1.00   24.46 ? 272 ILE A C     1 
ATOM   2165 O  O     . ILE A 1 272 ? -3.429  26.702  -11.337 1.00   23.43 ? 272 ILE A O     1 
ATOM   2166 C  CB    . ILE A 1 272 ? -1.726  24.528  -9.385  1.00   23.51 ? 272 ILE A CB    1 
ATOM   2167 C  CG1   . ILE A 1 272 ? -0.575  24.606  -8.341  1.00   22.60 ? 272 ILE A CG1   1 
ATOM   2168 C  CG2   . ILE A 1 272 ? -1.137  24.441  -10.793 1.00   24.21 ? 272 ILE A CG2   1 
ATOM   2169 C  CD1   . ILE A 1 272 ? 0.209   23.295  -8.164  1.00   19.42 ? 272 ILE A CD1   1 
ATOM   2170 N  N     . ALA A 1 273 ? -4.658  25.075  -10.367 1.00   24.97 ? 273 ALA A N     1 
ATOM   2171 C  CA    . ALA A 1 273 ? -5.636  25.060  -11.434 1.00   25.30 ? 273 ALA A CA    1 
ATOM   2172 C  C     . ALA A 1 273 ? -6.227  26.436  -11.657 1.00   26.21 ? 273 ALA A C     1 
ATOM   2173 O  O     . ALA A 1 273 ? -6.516  26.816  -12.792 1.00   29.38 ? 273 ALA A O     1 
ATOM   2174 C  CB    . ALA A 1 273 ? -6.745  24.063  -11.114 1.00   27.55 ? 273 ALA A CB    1 
ATOM   2175 N  N     . LEU A 1 274 ? -6.417  27.179  -10.569 1.00   27.95 ? 274 LEU A N     1 
ATOM   2176 C  CA    . LEU A 1 274 ? -7.022  28.535  -10.635 1.00   29.64 ? 274 LEU A CA    1 
ATOM   2177 C  C     . LEU A 1 274 ? -6.019  29.440  -11.332 1.00   28.64 ? 274 LEU A C     1 
ATOM   2178 O  O     . LEU A 1 274 ? -6.355  30.262  -12.165 1.00   27.45 ? 274 LEU A O     1 
ATOM   2179 C  CB    . LEU A 1 274 ? -7.276  29.064  -9.224  1.00   31.35 ? 274 LEU A CB    1 
ATOM   2180 C  CG    . LEU A 1 274 ? -8.257  30.227  -9.160  1.00   35.53 ? 274 LEU A CG    1 
ATOM   2181 C  CD1   . LEU A 1 274 ? -9.632  29.777  -9.678  1.00   40.43 ? 274 LEU A CD1   1 
ATOM   2182 C  CD2   . LEU A 1 274 ? -8.351  30.809  -7.757  1.00   38.57 ? 274 LEU A CD2   1 
ATOM   2183 N  N     . ILE A 1 275 ? -4.755  29.272  -10.984 1.00   30.97 ? 275 ILE A N     1 
ATOM   2184 C  CA    . ILE A 1 275 ? -3.734  30.111  -11.596 1.00   30.01 ? 275 ILE A CA    1 
ATOM   2185 C  C     . ILE A 1 275 ? -3.742  29.860  -13.097 1.00   28.66 ? 275 ILE A C     1 
ATOM   2186 O  O     . ILE A 1 275 ? -3.722  30.809  -13.887 1.00   30.29 ? 275 ILE A O     1 
ATOM   2187 C  CB    . ILE A 1 275 ? -2.368  29.874  -10.958 1.00   30.51 ? 275 ILE A CB    1 
ATOM   2188 C  CG1   . ILE A 1 275 ? -2.387  30.476  -9.540  1.00   32.51 ? 275 ILE A CG1   1 
ATOM   2189 C  CG2   . ILE A 1 275 ? -1.264  30.482  -11.826 1.00   32.07 ? 275 ILE A CG2   1 
ATOM   2190 C  CD1   . ILE A 1 275 ? -1.267  29.956  -8.649  1.00   33.05 ? 275 ILE A CD1   1 
ATOM   2191 N  N     . MET A 1 276 ? -3.870  28.589  -13.475 1.00   27.81 ? 276 MET A N     1 
ATOM   2192 C  CA    . MET A 1 276 ? -3.879  28.185  -14.880 1.00   27.71 ? 276 MET A CA    1 
ATOM   2193 C  C     . MET A 1 276 ? -5.149  28.669  -15.564 1.00   27.87 ? 276 MET A C     1 
ATOM   2194 O  O     . MET A 1 276 ? -5.100  29.049  -16.696 1.00   30.83 ? 276 MET A O     1 
ATOM   2195 C  CB    . MET A 1 276 ? -3.734  26.670  -15.009 1.00   25.41 ? 276 MET A CB    1 
ATOM   2196 C  CG    . MET A 1 276 ? -2.338  26.241  -14.586 1.00   25.11 ? 276 MET A CG    1 
ATOM   2197 S  SD    . MET A 1 276 ? -1.986  24.476  -14.572 1.00   27.77 ? 276 MET A SD    1 
ATOM   2198 C  CE    . MET A 1 276 ? -2.294  24.081  -16.314 1.00   27.53 ? 276 MET A CE    1 
ATOM   2199 N  N     . GLN A 1 277 ? -6.261  28.703  -14.846 1.00   28.59 ? 277 GLN A N     1 
ATOM   2200 C  CA    . GLN A 1 277 ? -7.547  29.057  -15.451 1.00   32.29 ? 277 GLN A CA    1 
ATOM   2201 C  C     . GLN A 1 277 ? -7.508  30.535  -15.823 1.00   34.78 ? 277 GLN A C     1 
ATOM   2202 O  O     . GLN A 1 277 ? -8.048  30.947  -16.861 1.00   37.42 ? 277 GLN A O     1 
ATOM   2203 C  CB    . GLN A 1 277 ? -8.662  28.791  -14.446 1.00   35.45 ? 277 GLN A CB    1 
ATOM   2204 C  CG    . GLN A 1 277 ? -10.018 29.321  -14.867 1.00   37.57 ? 277 GLN A CG    1 
ATOM   2205 C  CD    . GLN A 1 277 ? -10.889 29.546  -13.666 1.00   43.06 ? 277 GLN A CD    1 
ATOM   2206 O  OE1   . GLN A 1 277 ? -11.506 28.612  -13.160 1.00   51.10 ? 277 GLN A OE1   1 
ATOM   2207 N  NE2   . GLN A 1 277 ? -10.924 30.799  -13.171 1.00   49.55 ? 277 GLN A NE2   1 
ATOM   2208 N  N     . ASN A 1 278 ? -6.823  31.308  -14.979 1.00   34.72 ? 278 ASN A N     1 
ATOM   2209 C  CA    . ASN A 1 278 ? -6.615  32.749  -15.173 1.00   36.41 ? 278 ASN A CA    1 
ATOM   2210 C  C     . ASN A 1 278 ? -5.479  33.053  -16.156 1.00   35.30 ? 278 ASN A C     1 
ATOM   2211 O  O     . ASN A 1 278 ? -5.200  34.204  -16.428 1.00   37.78 ? 278 ASN A O     1 
ATOM   2212 C  CB    . ASN A 1 278 ? -6.371  33.443  -13.817 1.00   38.12 ? 278 ASN A CB    1 
ATOM   2213 C  CG    . ASN A 1 278 ? -7.563  33.285  -12.868 1.00   44.14 ? 278 ASN A CG    1 
ATOM   2214 O  OD1   . ASN A 1 278 ? -8.691  33.069  -13.305 1.00   53.05 ? 278 ASN A OD1   1 
ATOM   2215 N  ND2   . ASN A 1 278 ? -7.308  33.352  -11.571 1.00   45.96 ? 278 ASN A ND2   1 
ATOM   2216 N  N     . LYS A 1 279 ? -4.844  32.007  -16.680 1.00   33.03 ? 279 LYS A N     1 
ATOM   2217 C  CA    . LYS A 1 279 ? -3.778  32.110  -17.661 1.00   31.58 ? 279 LYS A CA    1 
ATOM   2218 C  C     . LYS A 1 279 ? -2.481  32.702  -17.083 1.00   31.66 ? 279 LYS A C     1 
ATOM   2219 O  O     . LYS A 1 279 ? -1.502  33.019  -17.808 1.00   31.27 ? 279 LYS A O     1 
ATOM   2220 C  CB    . LYS A 1 279 ? -4.273  32.861  -18.882 1.00   34.30 ? 279 LYS A CB    1 
ATOM   2221 C  CG    . LYS A 1 279 ? -5.601  32.316  -19.454 1.00   37.11 ? 279 LYS A CG    1 
ATOM   2222 C  CD    . LYS A 1 279 ? -5.473  30.858  -19.894 1.00   36.65 ? 279 LYS A CD    1 
ATOM   2223 C  CE    . LYS A 1 279 ? -6.730  30.365  -20.600 1.00   40.82 ? 279 LYS A CE    1 
ATOM   2224 N  NZ    . LYS A 1 279 ? -6.433  29.069  -21.262 1.00   40.47 ? 279 LYS A NZ    1 
ATOM   2225 N  N     . ASN A 1 280 ? -2.433  32.807  -15.759 1.00   32.54 ? 280 ASN A N     1 
ATOM   2226 C  CA    . ASN A 1 280 ? -1.269  33.444  -15.138 1.00   32.01 ? 280 ASN A CA    1 
ATOM   2227 C  C     . ASN A 1 280 ? -0.044  32.561  -15.086 1.00   29.11 ? 280 ASN A C     1 
ATOM   2228 O  O     . ASN A 1 280 ? 1.040   33.062  -14.825 1.00   30.71 ? 280 ASN A O     1 
ATOM   2229 C  CB    . ASN A 1 280 ? -1.613  34.020  -13.770 1.00   33.15 ? 280 ASN A CB    1 
ATOM   2230 C  CG    . ASN A 1 280 ? -2.588  35.157  -13.884 1.00   36.93 ? 280 ASN A CG    1 
ATOM   2231 O  OD1   . ASN A 1 280 ? -3.576  35.220  -13.155 1.00   41.20 ? 280 ASN A OD1   1 
ATOM   2232 N  ND2   . ASN A 1 280 ? -2.335  36.055  -14.846 1.00   38.22 ? 280 ASN A ND2   1 
ATOM   2233 N  N     . HIS A 1 281 ? -0.234  31.270  -15.378 1.00   28.91 ? 281 HIS A N     1 
ATOM   2234 C  CA    . HIS A 1 281 ? 0.849   30.283  -15.487 1.00   27.64 ? 281 HIS A CA    1 
ATOM   2235 C  C     . HIS A 1 281 ? 1.788   30.591  -16.645 1.00   28.74 ? 281 HIS A C     1 
ATOM   2236 O  O     . HIS A 1 281 ? 2.935   30.088  -16.688 1.00   29.96 ? 281 HIS A O     1 
ATOM   2237 C  CB    . HIS A 1 281 ? 0.302   28.836  -15.631 1.00   25.99 ? 281 HIS A CB    1 
ATOM   2238 C  CG    . HIS A 1 281 ? -0.547  28.603  -16.855 1.00   27.54 ? 281 HIS A CG    1 
ATOM   2239 N  ND1   . HIS A 1 281 ? -1.660  29.368  -17.153 1.00   28.45 ? 281 HIS A ND1   1 
ATOM   2240 C  CD2   . HIS A 1 281 ? -0.455  27.672  -17.840 1.00   25.46 ? 281 HIS A CD2   1 
ATOM   2241 C  CE1   . HIS A 1 281 ? -2.227  28.908  -18.257 1.00   28.38 ? 281 HIS A CE1   1 
ATOM   2242 N  NE2   . HIS A 1 281 ? -1.505  27.890  -18.702 1.00   27.75 ? 281 HIS A NE2   1 
ATOM   2243 N  N     . LEU A 1 282 ? 1.332   31.400  -17.594 1.00   29.05 ? 282 LEU A N     1 
ATOM   2244 C  CA    . LEU A 1 282 ? 2.239   31.784  -18.702 1.00   29.78 ? 282 LEU A CA    1 
ATOM   2245 C  C     . LEU A 1 282 ? 3.001   33.072  -18.422 1.00   31.60 ? 282 LEU A C     1 
ATOM   2246 O  O     . LEU A 1 282 ? 3.628   33.611  -19.331 1.00   37.68 ? 282 LEU A O     1 
ATOM   2247 C  CB    . LEU A 1 282 ? 1.481   31.872  -20.034 1.00   30.90 ? 282 LEU A CB    1 
ATOM   2248 C  CG    . LEU A 1 282 ? 0.371   30.825  -20.230 1.00   29.72 ? 282 LEU A CG    1 
ATOM   2249 C  CD1   . LEU A 1 282 ? -0.665  31.238  -21.280 1.00   28.00 ? 282 LEU A CD1   1 
ATOM   2250 C  CD2   . LEU A 1 282 ? 1.035   29.527  -20.621 1.00   30.16 ? 282 LEU A CD2   1 
ATOM   2251 N  N     . THR A 1 283 ? 2.943   33.579  -17.191 1.00   32.76 ? 283 THR A N     1 
ATOM   2252 C  CA    . THR A 1 283 ? 3.786   34.735  -16.768 1.00   33.94 ? 283 THR A CA    1 
ATOM   2253 C  C     . THR A 1 283 ? 4.859   34.248  -15.783 1.00   33.84 ? 283 THR A C     1 
ATOM   2254 O  O     . THR A 1 283 ? 4.672   33.226  -15.115 1.00   34.97 ? 283 THR A O     1 
ATOM   2255 C  CB    . THR A 1 283 ? 2.950   35.828  -16.063 1.00   35.27 ? 283 THR A CB    1 
ATOM   2256 O  OG1   . THR A 1 283 ? 2.533   35.315  -14.800 1.00   35.61 ? 283 THR A OG1   1 
ATOM   2257 C  CG2   . THR A 1 283 ? 1.688   36.249  -16.892 1.00   34.46 ? 283 THR A CG2   1 
ATOM   2258 N  N     . PRO A 1 284 ? 5.987   34.977  -15.650 1.00   34.68 ? 284 PRO A N     1 
ATOM   2259 C  CA    . PRO A 1 284 ? 7.013   34.460  -14.715 1.00   35.80 ? 284 PRO A CA    1 
ATOM   2260 C  C     . PRO A 1 284 ? 6.492   34.429  -13.275 1.00   34.51 ? 284 PRO A C     1 
ATOM   2261 O  O     . PRO A 1 284 ? 6.753   33.482  -12.537 1.00   40.12 ? 284 PRO A O     1 
ATOM   2262 C  CB    . PRO A 1 284 ? 8.179   35.474  -14.843 1.00   35.75 ? 284 PRO A CB    1 
ATOM   2263 C  CG    . PRO A 1 284 ? 7.870   36.303  -16.040 1.00   36.80 ? 284 PRO A CG    1 
ATOM   2264 C  CD    . PRO A 1 284 ? 6.373   36.253  -16.274 1.00   35.28 ? 284 PRO A CD    1 
ATOM   2265 N  N     . GLU A 1 285 ? 5.756   35.455  -12.894 1.00   35.43 ? 285 GLU A N     1 
ATOM   2266 C  CA    . GLU A 1 285 ? 5.108   35.556  -11.593 1.00   38.73 ? 285 GLU A CA    1 
ATOM   2267 C  C     . GLU A 1 285 ? 4.204   34.363  -11.314 1.00   33.60 ? 285 GLU A C     1 
ATOM   2268 O  O     . GLU A 1 285 ? 4.359   33.689  -10.282 1.00   32.68 ? 285 GLU A O     1 
ATOM   2269 C  CB    . GLU A 1 285 ? 4.224   36.823  -11.525 1.00   44.31 ? 285 GLU A CB    1 
ATOM   2270 C  CG    . GLU A 1 285 ? 4.983   38.147  -11.482 1.00   48.38 ? 285 GLU A CG    1 
ATOM   2271 C  CD    . GLU A 1 285 ? 5.430   38.645  -12.851 1.00   49.00 ? 285 GLU A CD    1 
ATOM   2272 O  OE1   . GLU A 1 285 ? 4.776   38.280  -13.889 1.00   48.70 ? 285 GLU A OE1   1 
ATOM   2273 O  OE2   . GLU A 1 285 ? 6.446   39.401  -12.860 1.00   50.84 ? 285 GLU A OE2   1 
ATOM   2274 N  N     . GLY A 1 286 ? 3.236   34.134  -12.211 1.00   31.16 ? 286 GLY A N     1 
ATOM   2275 C  CA    . GLY A 1 286 ? 2.376   32.947  -12.089 1.00   30.02 ? 286 GLY A CA    1 
ATOM   2276 C  C     . GLY A 1 286 ? 3.179   31.629  -12.020 1.00   28.83 ? 286 GLY A C     1 
ATOM   2277 O  O     . GLY A 1 286 ? 2.893   30.750  -11.210 1.00   26.30 ? 286 GLY A O     1 
ATOM   2278 N  N     . LEU A 1 287 ? 4.168   31.477  -12.891 1.00   28.78 ? 287 LEU A N     1 
ATOM   2279 C  CA    . LEU A 1 287 ? 4.969   30.259  -12.909 1.00   28.44 ? 287 LEU A CA    1 
ATOM   2280 C  C     . LEU A 1 287 ? 5.602   30.071  -11.504 1.00   29.96 ? 287 LEU A C     1 
ATOM   2281 O  O     . LEU A 1 287 ? 5.581   28.968  -10.952 1.00   29.67 ? 287 LEU A O     1 
ATOM   2282 C  CB    . LEU A 1 287 ? 6.068   30.351  -13.982 1.00   30.56 ? 287 LEU A CB    1 
ATOM   2283 C  CG    . LEU A 1 287 ? 7.010   29.123  -14.094 1.00   32.83 ? 287 LEU A CG    1 
ATOM   2284 C  CD1   . LEU A 1 287 ? 6.158   27.874  -14.359 1.00   32.04 ? 287 LEU A CD1   1 
ATOM   2285 C  CD2   . LEU A 1 287 ? 8.036   29.314  -15.190 1.00   34.68 ? 287 LEU A CD2   1 
ATOM   2286 N  N     . ASN A 1 288 ? 6.174   31.147  -10.953 1.00   31.24 ? 288 ASN A N     1 
ATOM   2287 C  CA    . ASN A 1 288 ? 6.774   31.097  -9.644  1.00   32.43 ? 288 ASN A CA    1 
ATOM   2288 C  C     . ASN A 1 288 ? 5.790   30.840  -8.507  1.00   31.59 ? 288 ASN A C     1 
ATOM   2289 O  O     . ASN A 1 288 ? 6.129   30.080  -7.596  1.00   32.06 ? 288 ASN A O     1 
ATOM   2290 C  CB    . ASN A 1 288 ? 7.634   32.317  -9.391  1.00   34.92 ? 288 ASN A CB    1 
ATOM   2291 C  CG    . ASN A 1 288 ? 9.033   32.148  -9.942  1.00   35.94 ? 288 ASN A CG    1 
ATOM   2292 O  OD1   . ASN A 1 288 ? 9.646   31.097  -9.788  1.00   36.75 ? 288 ASN A OD1   1 
ATOM   2293 N  ND2   . ASN A 1 288 ? 9.544   33.176  -10.577 1.00   37.02 ? 288 ASN A ND2   1 
ATOM   2294 N  N     . GLU A 1 289 ? 4.571   31.398  -8.562  1.00   30.94 ? 289 GLU A N     1 
ATOM   2295 C  CA    . GLU A 1 289 ? 3.561   30.953  -7.570  1.00   32.09 ? 289 GLU A CA    1 
ATOM   2296 C  C     . GLU A 1 289 ? 3.342   29.439  -7.643  1.00   28.96 ? 289 GLU A C     1 
ATOM   2297 O  O     . GLU A 1 289 ? 3.147   28.797  -6.625  1.00   27.93 ? 289 GLU A O     1 
ATOM   2298 C  CB    . GLU A 1 289 ? 2.194   31.612  -7.742  1.00   34.45 ? 289 GLU A CB    1 
ATOM   2299 C  CG    . GLU A 1 289 ? 2.118   33.110  -7.519  1.00   38.75 ? 289 GLU A CG    1 
ATOM   2300 C  CD    . GLU A 1 289 ? 0.738   33.643  -7.925  1.00   40.77 ? 289 GLU A CD    1 
ATOM   2301 O  OE1   . GLU A 1 289 ? 0.631   34.743  -8.481  1.00   46.91 ? 289 GLU A OE1   1 
ATOM   2302 O  OE2   . GLU A 1 289 ? -0.247  32.925  -7.739  1.00   43.86 ? 289 GLU A OE2   1 
ATOM   2303 N  N     . ILE A 1 290 ? 3.322   28.889  -8.852  1.00   27.83 ? 290 ILE A N     1 
ATOM   2304 C  CA    . ILE A 1 290 ? 3.065   27.444  -9.042  1.00   27.76 ? 290 ILE A CA    1 
ATOM   2305 C  C     . ILE A 1 290 ? 4.261   26.634  -8.506  1.00   28.13 ? 290 ILE A C     1 
ATOM   2306 O  O     . ILE A 1 290 ? 4.028   25.615  -7.800  1.00   28.32 ? 290 ILE A O     1 
ATOM   2307 C  CB    . ILE A 1 290 ? 2.738   27.046  -10.519 1.00   27.71 ? 290 ILE A CB    1 
ATOM   2308 C  CG1   . ILE A 1 290 ? 1.376   27.656  -10.989 1.00   28.11 ? 290 ILE A CG1   1 
ATOM   2309 C  CG2   . ILE A 1 290 ? 2.706   25.516  -10.673 1.00   25.73 ? 290 ILE A CG2   1 
ATOM   2310 C  CD1   . ILE A 1 290 ? 1.096   27.581  -12.497 1.00   25.12 ? 290 ILE A CD1   1 
ATOM   2311 N  N     . ARG A 1 291 ? 5.514   27.088  -8.769  1.00   27.73 ? 291 ARG A N     1 
ATOM   2312 C  CA    . ARG A 1 291 ? 6.665   26.381  -8.220  1.00   28.87 ? 291 ARG A CA    1 
ATOM   2313 C  C     . ARG A 1 291 ? 6.525   26.378  -6.687  1.00   29.24 ? 291 ARG A C     1 
ATOM   2314 O  O     . ARG A 1 291 ? 6.815   25.383  -6.038  1.00   30.75 ? 291 ARG A O     1 
ATOM   2315 C  CB    . ARG A 1 291 ? 8.065   26.996  -8.655  1.00   29.38 ? 291 ARG A CB    1 
ATOM   2316 C  CG    . ARG A 1 291 ? 8.408   26.871  -10.152 1.00   31.68 ? 291 ARG A CG    1 
ATOM   2317 C  CD    . ARG A 1 291 ? 9.904   27.024  -10.570 1.00   39.04 ? 291 ARG A CD    1 
ATOM   2318 N  NE    . ARG A 1 291 ? 10.140  28.327  -11.177 1.00   41.93 ? 291 ARG A NE    1 
ATOM   2319 C  CZ    . ARG A 1 291 ? 10.552  28.593  -12.422 1.00   40.74 ? 291 ARG A CZ    1 
ATOM   2320 N  NH1   . ARG A 1 291 ? 10.836  27.643  -13.305 1.00   39.64 ? 291 ARG A NH1   1 
ATOM   2321 N  NH2   . ARG A 1 291 ? 10.728  29.855  -12.765 1.00   47.03 ? 291 ARG A NH2   1 
ATOM   2322 N  N     . ALA A 1 292 ? 6.062   27.481  -6.099  1.00   29.99 ? 292 ALA A N     1 
ATOM   2323 C  CA    . ALA A 1 292 ? 6.008   27.533  -4.628  1.00   32.34 ? 292 ALA A CA    1 
ATOM   2324 C  C     . ALA A 1 292 ? 4.885   26.640  -4.103  1.00   30.78 ? 292 ALA A C     1 
ATOM   2325 O  O     . ALA A 1 292 ? 5.070   25.967  -3.105  1.00   33.42 ? 292 ALA A O     1 
ATOM   2326 C  CB    . ALA A 1 292 ? 5.883   28.965  -4.118  1.00   30.92 ? 292 ALA A CB    1 
ATOM   2327 N  N     . LEU A 1 293 ? 3.735   26.603  -4.759  1.00   29.54 ? 293 LEU A N     1 
ATOM   2328 C  CA    . LEU A 1 293 ? 2.673   25.668  -4.334  1.00   28.98 ? 293 LEU A CA    1 
ATOM   2329 C  C     . LEU A 1 293 ? 3.142   24.224  -4.422  1.00   28.83 ? 293 LEU A C     1 
ATOM   2330 O  O     . LEU A 1 293 ? 2.916   23.453  -3.499  1.00   30.39 ? 293 LEU A O     1 
ATOM   2331 C  CB    . LEU A 1 293 ? 1.377   25.838  -5.139  1.00   26.76 ? 293 LEU A CB    1 
ATOM   2332 C  CG    . LEU A 1 293 ? 0.561   27.077  -4.708  1.00   29.55 ? 293 LEU A CG    1 
ATOM   2333 C  CD1   . LEU A 1 293 ? -0.342  27.574  -5.834  1.00   30.11 ? 293 LEU A CD1   1 
ATOM   2334 C  CD2   . LEU A 1 293 ? -0.253  26.832  -3.411  1.00   28.07 ? 293 LEU A CD2   1 
ATOM   2335 N  N     . LYS A 1 294 ? 3.748   23.857  -5.550  1.00   29.81 ? 294 LYS A N     1 
ATOM   2336 C  CA    . LYS A 1 294 ? 4.270   22.501  -5.784  1.00   32.63 ? 294 LYS A CA    1 
ATOM   2337 C  C     . LYS A 1 294 ? 5.217   22.059  -4.687  1.00   30.85 ? 294 LYS A C     1 
ATOM   2338 O  O     . LYS A 1 294 ? 5.143   20.935  -4.173  1.00   32.67 ? 294 LYS A O     1 
ATOM   2339 C  CB    . LYS A 1 294 ? 5.121   22.479  -7.061  1.00   35.61 ? 294 LYS A CB    1 
ATOM   2340 C  CG    . LYS A 1 294 ? 4.415   22.039  -8.309  1.00   38.18 ? 294 LYS A CG    1 
ATOM   2341 C  CD    . LYS A 1 294 ? 5.368   22.102  -9.514  1.00   36.35 ? 294 LYS A CD    1 
ATOM   2342 C  CE    . LYS A 1 294 ? 6.616   21.250  -9.380  1.00   34.10 ? 294 LYS A CE    1 
ATOM   2343 N  NZ    . LYS A 1 294 ? 6.284   19.790  -9.487  1.00   45.35 ? 294 LYS A NZ    1 
ATOM   2344 N  N     . GLY A 1 295 ? 6.131   22.955  -4.387  1.00   31.50 ? 295 GLY A N     1 
ATOM   2345 C  CA    . GLY A 1 295 ? 7.149   22.733  -3.385  1.00   34.29 ? 295 GLY A CA    1 
ATOM   2346 C  C     . GLY A 1 295 ? 6.511   22.231  -2.126  1.00   35.78 ? 295 GLY A C     1 
ATOM   2347 O  O     . GLY A 1 295 ? 6.921   21.229  -1.618  1.00   41.29 ? 295 GLY A O     1 
ATOM   2348 N  N     . GLY A 1 296 ? 5.464   22.900  -1.644  1.00   36.16 ? 296 GLY A N     1 
ATOM   2349 C  CA    . GLY A 1 296 ? 4.875   22.498  -0.374  1.00   36.51 ? 296 GLY A CA    1 
ATOM   2350 C  C     . GLY A 1 296 ? 3.826   21.398  -0.456  1.00   36.90 ? 296 GLY A C     1 
ATOM   2351 O  O     . GLY A 1 296 ? 3.236   21.035  0.544   1.00   40.30 ? 296 GLY A O     1 
ATOM   2352 N  N     . MET A 1 297 ? 3.557   20.862  -1.632  1.00   36.39 ? 297 MET A N     1 
ATOM   2353 C  CA    . MET A 1 297 ? 2.552   19.813  -1.656  1.00   34.00 ? 297 MET A CA    1 
ATOM   2354 C  C     . MET A 1 297 ? 3.209   18.459  -1.793  1.00   32.93 ? 297 MET A C     1 
ATOM   2355 O  O     . MET A 1 297 ? 4.440   18.358  -1.979  1.00   33.37 ? 297 MET A O     1 
ATOM   2356 C  CB    . MET A 1 297 ? 1.429   20.067  -2.690  1.00   34.67 ? 297 MET A CB    1 
ATOM   2357 C  CG    . MET A 1 297 ? 1.876   19.902  -4.122  1.00   38.43 ? 297 MET A CG    1 
ATOM   2358 S  SD    . MET A 1 297 ? 0.756   20.695  -5.286  1.00   39.27 ? 297 MET A SD    1 
ATOM   2359 C  CE    . MET A 1 297 ? -0.236  19.280  -5.741  1.00   31.12 ? 297 MET A CE    1 
ATOM   2360 N  N     . ASN A 1 298 ? 2.391   17.421  -1.619  1.00   36.89 ? 298 ASN A N     1 
ATOM   2361 C  CA    . ASN A 1 298 ? 2.861   16.044  -1.687  1.00   35.13 ? 298 ASN A CA    1 
ATOM   2362 C  C     . ASN A 1 298 ? 4.160   15.934  -0.873  1.00   38.49 ? 298 ASN A C     1 
ATOM   2363 O  O     . ASN A 1 298 ? 4.203   16.295  0.319   1.00   41.08 ? 298 ASN A O     1 
ATOM   2364 C  CB    . ASN A 1 298 ? 3.016   15.580  -3.174  1.00   35.88 ? 298 ASN A CB    1 
ATOM   2365 C  CG    . ASN A 1 298 ? 1.684   15.598  -3.951  1.00   36.00 ? 298 ASN A CG    1 
ATOM   2366 O  OD1   . ASN A 1 298 ? 0.587   15.508  -3.358  1.00   32.05 ? 298 ASN A OD1   1 
ATOM   2367 N  ND2   . ASN A 1 298 ? 1.770   15.730  -5.301  1.00   35.87 ? 298 ASN A ND2   1 
ATOM   2368 N  N     . LYS A 1 299 ? 5.225   15.474  -1.514  1.00   39.39 ? 299 LYS A N     1 
ATOM   2369 C  CA    . LYS A 1 299 ? 6.488   15.172  -0.785  1.00   38.71 ? 299 LYS A CA    1 
ATOM   2370 C  C     . LYS A 1 299 ? 7.133   16.418  -0.147  1.00   37.06 ? 299 LYS A C     1 
ATOM   2371 O  O     . LYS A 1 299 ? 7.978   16.311  0.743   1.00   46.85 ? 299 LYS A O     1 
ATOM   2372 C  CB    . LYS A 1 299 ? 7.478   14.425  -1.696  1.00   45.35 ? 299 LYS A CB    1 
ATOM   2373 C  CG    . LYS A 1 299 ? 7.178   12.928  -1.858  1.00   49.68 ? 299 LYS A CG    1 
ATOM   2374 C  CD    . LYS A 1 299 ? 7.347   12.435  -3.301  1.00   56.05 ? 299 LYS A CD    1 
ATOM   2375 C  CE    . LYS A 1 299 ? 8.547   13.044  -4.102  1.00   67.06 ? 299 LYS A CE    1 
ATOM   2376 N  NZ    . LYS A 1 299 ? 9.929   12.825  -3.594  1.00   59.65 ? 299 LYS A NZ    1 
ATOM   2377 N  N     . GLY A 1 300 ? 6.706   17.604  -0.563  1.00   37.91 ? 300 GLY A N     1 
ATOM   2378 C  CA    . GLY A 1 300 ? 7.195   18.826  0.072   1.00   40.25 ? 300 GLY A CA    1 
ATOM   2379 C  C     . GLY A 1 300 ? 6.432   19.235  1.336   1.00   39.81 ? 300 GLY A C     1 
ATOM   2380 O  O     . GLY A 1 300 ? 6.871   20.139  2.036   1.00   35.88 ? 300 GLY A O     1 
ATOM   2381 N  N     . ARG A 1 301 ? 5.295   18.587  1.620   1.00   39.23 ? 301 ARG A N     1 
ATOM   2382 C  CA    . ARG A 1 301 ? 4.424   19.027  2.741   1.00   40.31 ? 301 ARG A CA    1 
ATOM   2383 C  C     . ARG A 1 301 ? 4.964   18.718  4.164   1.00   38.18 ? 301 ARG A C     1 
ATOM   2384 O  O     . ARG A 1 301 ? 5.271   17.569  4.473   1.00   41.79 ? 301 ARG A O     1 
ATOM   2385 C  CB    . ARG A 1 301 ? 2.968   18.495  2.568   1.00   40.62 ? 301 ARG A CB    1 
ATOM   2386 C  CG    . ARG A 1 301 ? 2.013   18.929  3.686   1.00   41.73 ? 301 ARG A CG    1 
ATOM   2387 C  CD    . ARG A 1 301 ? 0.619   18.313  3.488   1.00   36.22 ? 301 ARG A CD    1 
ATOM   2388 N  NE    . ARG A 1 301 ? 0.191   18.714  2.159   1.00   35.47 ? 301 ARG A NE    1 
ATOM   2389 C  CZ    . ARG A 1 301 ? -0.255  19.924  1.856   1.00   34.16 ? 301 ARG A CZ    1 
ATOM   2390 N  NH1   . ARG A 1 301 ? -0.423  20.826  2.819   1.00   35.87 ? 301 ARG A NH1   1 
ATOM   2391 N  NH2   . ARG A 1 301 ? -0.532  20.214  0.594   1.00   34.74 ? 301 ARG A NH2   1 
ATOM   2392 N  N     . LEU A 1 302 ? 5.050   19.748  5.025   1.00   46.61 ? 302 LEU A N     1 
ATOM   2393 C  CA    . LEU A 1 302 ? 5.543   19.601  6.438   1.00   47.31 ? 302 LEU A CA    1 
ATOM   2394 C  C     . LEU A 1 302 ? 4.523   18.967  7.411   1.00   47.66 ? 302 LEU A C     1 
ATOM   2395 O  O     . LEU A 1 302 ? 4.827   18.050  8.218   1.00   49.33 ? 302 LEU A O     1 
ATOM   2396 C  CB    . LEU A 1 302 ? 6.046   20.947  7.004   1.00   49.17 ? 302 LEU A CB    1 
ATOM   2397 C  CG    . LEU A 1 302 ? 7.403   20.952  7.728   1.00   50.98 ? 302 LEU A CG    1 
ATOM   2398 C  CD1   . LEU A 1 302 ? 7.391   21.846  8.973   1.00   55.37 ? 302 LEU A CD1   1 
ATOM   2399 C  CD2   . LEU A 1 302 ? 7.895   19.534  8.066   1.00   53.04 ? 302 LEU A CD2   1 
ATOM   2400 O  OXT   . LEU A 1 302 ? 3.356   19.388  7.413   1.00   52.89 ? 302 LEU A OXT   1 
ATOM   2401 O  "O5'" . DC  B 2 1   ? 5.783   32.672  -28.312 1.00   39.15 ? 1   DC  B "O5'" 1 
ATOM   2402 C  "C5'" . DC  B 2 1   ? 4.978   31.695  -28.948 1.00   35.27 ? 1   DC  B "C5'" 1 
ATOM   2403 C  "C4'" . DC  B 2 1   ? 3.631   31.633  -28.266 1.00   34.65 ? 1   DC  B "C4'" 1 
ATOM   2404 O  "O4'" . DC  B 2 1   ? 2.748   30.806  -29.065 1.00   36.18 ? 1   DC  B "O4'" 1 
ATOM   2405 C  "C3'" . DC  B 2 1   ? 3.654   30.986  -26.881 1.00   35.37 ? 1   DC  B "C3'" 1 
ATOM   2406 O  "O3'" . DC  B 2 1   ? 2.634   31.568  -26.049 1.00   32.94 ? 1   DC  B "O3'" 1 
ATOM   2407 C  "C2'" . DC  B 2 1   ? 3.438   29.515  -27.195 1.00   33.53 ? 1   DC  B "C2'" 1 
ATOM   2408 C  "C1'" . DC  B 2 1   ? 2.546   29.531  -28.441 1.00   35.02 ? 1   DC  B "C1'" 1 
ATOM   2409 N  N1    . DC  B 2 1   ? 2.856   28.480  -29.436 1.00   33.37 ? 1   DC  B N1    1 
ATOM   2410 C  C2    . DC  B 2 1   ? 1.831   27.620  -29.858 1.00   35.91 ? 1   DC  B C2    1 
ATOM   2411 O  O2    . DC  B 2 1   ? 0.690   27.754  -29.370 1.00   36.30 ? 1   DC  B O2    1 
ATOM   2412 N  N3    . DC  B 2 1   ? 2.103   26.674  -30.793 1.00   34.07 ? 1   DC  B N3    1 
ATOM   2413 C  C4    . DC  B 2 1   ? 3.347   26.541  -31.267 1.00   34.00 ? 1   DC  B C4    1 
ATOM   2414 N  N4    . DC  B 2 1   ? 3.569   25.592  -32.180 1.00   35.73 ? 1   DC  B N4    1 
ATOM   2415 C  C5    . DC  B 2 1   ? 4.407   27.408  -30.860 1.00   34.54 ? 1   DC  B C5    1 
ATOM   2416 C  C6    . DC  B 2 1   ? 4.123   28.344  -29.941 1.00   34.79 ? 1   DC  B C6    1 
ATOM   2417 P  P     . DG  B 2 2   ? 2.591   31.287  -24.475 1.00   35.40 ? 2   DG  B P     1 
ATOM   2418 O  OP1   . DG  B 2 2   ? 1.751   32.342  -23.857 1.00   36.00 ? 2   DG  B OP1   1 
ATOM   2419 O  OP2   . DG  B 2 2   ? 3.995   31.114  -23.984 1.00   34.64 ? 2   DG  B OP2   1 
ATOM   2420 O  "O5'" . DG  B 2 2   ? 1.854   29.876  -24.374 1.00   30.78 ? 2   DG  B "O5'" 1 
ATOM   2421 C  "C5'" . DG  B 2 2   ? 0.466   29.707  -24.741 1.00   31.72 ? 2   DG  B "C5'" 1 
ATOM   2422 C  "C4'" . DG  B 2 2   ? 0.134   28.240  -24.923 1.00   30.22 ? 2   DG  B "C4'" 1 
ATOM   2423 O  "O4'" . DG  B 2 2   ? 0.809   27.663  -26.066 1.00   30.79 ? 2   DG  B "O4'" 1 
ATOM   2424 C  "C3'" . DG  B 2 2   ? 0.464   27.326  -23.742 1.00   30.17 ? 2   DG  B "C3'" 1 
ATOM   2425 O  "O3'" . DG  B 2 2   ? -0.807  27.017  -23.146 1.00   33.69 ? 2   DG  B "O3'" 1 
ATOM   2426 C  "C2'" . DG  B 2 2   ? 1.166   26.131  -24.376 1.00   28.95 ? 2   DG  B "C2'" 1 
ATOM   2427 C  "C1'" . DG  B 2 2   ? 0.830   26.267  -25.844 1.00   28.53 ? 2   DG  B "C1'" 1 
ATOM   2428 N  N9    . DG  B 2 2   ? 1.801   25.666  -26.755 1.00   28.49 ? 2   DG  B N9    1 
ATOM   2429 C  C8    . DG  B 2 2   ? 3.147   25.932  -26.837 1.00   27.80 ? 2   DG  B C8    1 
ATOM   2430 N  N7    . DG  B 2 2   ? 3.752   25.234  -27.758 1.00   27.91 ? 2   DG  B N7    1 
ATOM   2431 C  C5    . DG  B 2 2   ? 2.752   24.436  -28.298 1.00   28.83 ? 2   DG  B C5    1 
ATOM   2432 C  C6    . DG  B 2 2   ? 2.809   23.462  -29.328 1.00   28.70 ? 2   DG  B C6    1 
ATOM   2433 O  O6    . DG  B 2 2   ? 3.785   23.100  -29.989 1.00   30.13 ? 2   DG  B O6    1 
ATOM   2434 N  N1    . DG  B 2 2   ? 1.563   22.894  -29.566 1.00   29.01 ? 2   DG  B N1    1 
ATOM   2435 C  C2    . DG  B 2 2   ? 0.407   23.221  -28.900 1.00   31.31 ? 2   DG  B C2    1 
ATOM   2436 N  N2    . DG  B 2 2   ? -0.705  22.581  -29.292 1.00   31.85 ? 2   DG  B N2    1 
ATOM   2437 N  N3    . DG  B 2 2   ? 0.339   24.135  -27.942 1.00   30.99 ? 2   DG  B N3    1 
ATOM   2438 C  C4    . DG  B 2 2   ? 1.543   24.683  -27.682 1.00   29.07 ? 2   DG  B C4    1 
ATOM   2439 P  P     . DT  B 2 3   ? -0.982  25.994  -21.935 1.00   32.56 ? 3   DT  B P     1 
ATOM   2440 O  OP1   . DT  B 2 3   ? -2.075  26.504  -21.043 1.00   28.13 ? 3   DT  B OP1   1 
ATOM   2441 O  OP2   . DT  B 2 3   ? 0.338   25.647  -21.369 1.00   31.32 ? 3   DT  B OP2   1 
ATOM   2442 O  "O5'" . DT  B 2 3   ? -1.515  24.695  -22.690 1.00   31.15 ? 3   DT  B "O5'" 1 
ATOM   2443 C  "C5'" . DT  B 2 3   ? -2.649  24.760  -23.579 1.00   32.48 ? 3   DT  B "C5'" 1 
ATOM   2444 C  "C4'" . DT  B 2 3   ? -3.003  23.374  -24.071 1.00   29.54 ? 3   DT  B "C4'" 1 
ATOM   2445 O  "O4'" . DT  B 2 3   ? -2.057  22.925  -25.071 1.00   28.59 ? 3   DT  B "O4'" 1 
ATOM   2446 C  "C3'" . DT  B 2 3   ? -3.042  22.284  -22.996 1.00   28.27 ? 3   DT  B "C3'" 1 
ATOM   2447 O  "O3'" . DT  B 2 3   ? -4.252  21.575  -23.235 1.00   28.60 ? 3   DT  B "O3'" 1 
ATOM   2448 C  "C2'" . DT  B 2 3   ? -1.803  21.440  -23.276 1.00   26.77 ? 3   DT  B "C2'" 1 
ATOM   2449 C  "C1'" . DT  B 2 3   ? -1.595  21.611  -24.773 1.00   28.21 ? 3   DT  B "C1'" 1 
ATOM   2450 N  N1    . DT  B 2 3   ? -0.195  21.508  -25.277 1.00   28.03 ? 3   DT  B N1    1 
ATOM   2451 C  C2    . DT  B 2 3   ? 0.064   20.700  -26.366 1.00   28.35 ? 3   DT  B C2    1 
ATOM   2452 O  O2    . DT  B 2 3   ? -0.778  19.979  -26.881 1.00   28.77 ? 3   DT  B O2    1 
ATOM   2453 N  N3    . DT  B 2 3   ? 1.371   20.720  -26.794 1.00   28.58 ? 3   DT  B N3    1 
ATOM   2454 C  C4    . DT  B 2 3   ? 2.409   21.475  -26.278 1.00   28.31 ? 3   DT  B C4    1 
ATOM   2455 O  O4    . DT  B 2 3   ? 3.533   21.401  -26.780 1.00   30.49 ? 3   DT  B O4    1 
ATOM   2456 C  C5    . DT  B 2 3   ? 2.063   22.305  -25.146 1.00   27.13 ? 3   DT  B C5    1 
ATOM   2457 C  C7    . DT  B 2 3   ? 3.121   23.166  -24.531 1.00   28.56 ? 3   DT  B C7    1 
ATOM   2458 C  C6    . DT  B 2 3   ? 0.792   22.295  -24.721 1.00   29.08 ? 3   DT  B C6    1 
ATOM   2459 P  P     . DA  B 2 4   ? -4.734  20.406  -22.251 1.00   31.65 ? 4   DA  B P     1 
ATOM   2460 O  OP1   . DA  B 2 4   ? -6.183  20.325  -22.330 1.00   31.96 ? 4   DA  B OP1   1 
ATOM   2461 O  OP2   . DA  B 2 4   ? -4.013  20.565  -20.931 1.00   28.64 ? 4   DA  B OP2   1 
ATOM   2462 O  "O5'" . DA  B 2 4   ? -4.188  19.092  -22.972 1.00   31.96 ? 4   DA  B "O5'" 1 
ATOM   2463 C  "C5'" . DA  B 2 4   ? -4.761  18.656  -24.229 1.00   33.18 ? 4   DA  B "C5'" 1 
ATOM   2464 C  "C4'" . DA  B 2 4   ? -4.105  17.364  -24.644 1.00   31.59 ? 4   DA  B "C4'" 1 
ATOM   2465 O  "O4'" . DA  B 2 4   ? -2.709  17.580  -24.971 1.00   30.88 ? 4   DA  B "O4'" 1 
ATOM   2466 C  "C3'" . DA  B 2 4   ? -4.100  16.315  -23.541 1.00   30.12 ? 4   DA  B "C3'" 1 
ATOM   2467 O  "O3'" . DA  B 2 4   ? -4.345  15.064  -24.175 1.00   32.06 ? 4   DA  B "O3'" 1 
ATOM   2468 C  "C2'" . DA  B 2 4   ? -2.703  16.416  -22.957 1.00   27.83 ? 4   DA  B "C2'" 1 
ATOM   2469 C  "C1'" . DA  B 2 4   ? -1.903  16.691  -24.209 1.00   28.60 ? 4   DA  B "C1'" 1 
ATOM   2470 N  N9    . DA  B 2 4   ? -0.642  17.363  -23.959 1.00   26.98 ? 4   DA  B N9    1 
ATOM   2471 C  C8    . DA  B 2 4   ? -0.391  18.249  -22.943 1.00   27.36 ? 4   DA  B C8    1 
ATOM   2472 N  N7    . DA  B 2 4   ? 0.805   18.783  -22.990 1.00   29.47 ? 4   DA  B N7    1 
ATOM   2473 C  C5    . DA  B 2 4   ? 1.384   18.205  -24.114 1.00   26.47 ? 4   DA  B C5    1 
ATOM   2474 C  C6    . DA  B 2 4   ? 2.649   18.353  -24.705 1.00   27.64 ? 4   DA  B C6    1 
ATOM   2475 N  N6    . DA  B 2 4   ? 3.601   19.152  -24.212 1.00   28.93 ? 4   DA  B N6    1 
ATOM   2476 N  N1    . DA  B 2 4   ? 2.906   17.649  -25.834 1.00   27.82 ? 4   DA  B N1    1 
ATOM   2477 C  C2    . DA  B 2 4   ? 1.946   16.853  -26.323 1.00   25.78 ? 4   DA  B C2    1 
ATOM   2478 N  N3    . DA  B 2 4   ? 0.723   16.617  -25.844 1.00   26.02 ? 4   DA  B N3    1 
ATOM   2479 C  C4    . DA  B 2 4   ? 0.498   17.342  -24.731 1.00   26.19 ? 4   DA  B C4    1 
ATOM   2480 P  P     . DC  B 2 5   ? -5.652  14.261  -23.780 1.00   33.63 ? 5   DC  B P     1 
ATOM   2481 O  OP1   . DC  B 2 5   ? -6.814  14.836  -24.510 1.00   37.54 ? 5   DC  B OP1   1 
ATOM   2482 O  OP2   . DC  B 2 5   ? -5.716  14.258  -22.317 1.00   32.41 ? 5   DC  B OP2   1 
ATOM   2483 O  "O5'" . DC  B 2 5   ? -5.260  12.728  -23.998 1.00   38.97 ? 5   DC  B "O5'" 1 
ATOM   2484 C  "C5'" . DC  B 2 5   ? -5.055  12.108  -25.251 1.00   39.47 ? 5   DC  B "C5'" 1 
ATOM   2485 C  "C4'" . DC  B 2 5   ? -3.623  11.634  -25.357 1.00   39.95 ? 5   DC  B "C4'" 1 
ATOM   2486 O  "O4'" . DC  B 2 5   ? -2.716  12.563  -24.750 1.00   35.29 ? 5   DC  B "O4'" 1 
ATOM   2487 C  "C3'" . DC  B 2 5   ? -3.238  10.278  -24.762 1.00   38.05 ? 5   DC  B "C3'" 1 
ATOM   2488 O  "O3'" . DC  B 2 5   ? -3.374  9.387   -25.880 1.00   43.02 ? 5   DC  B "O3'" 1 
ATOM   2489 C  "C2'" . DC  B 2 5   ? -1.779  10.485  -24.334 1.00   34.54 ? 5   DC  B "C2'" 1 
ATOM   2490 C  "C1'" . DC  B 2 5   ? -1.472  11.911  -24.799 1.00   33.18 ? 5   DC  B "C1'" 1 
ATOM   2491 N  N1    . DC  B 2 5   ? -0.528  12.744  -24.048 1.00   32.06 ? 5   DC  B N1    1 
ATOM   2492 C  C2    . DC  B 2 5   ? 0.684   13.094  -24.641 1.00   32.53 ? 5   DC  B C2    1 
ATOM   2493 O  O2    . DC  B 2 5   ? 0.977   12.601  -25.738 1.00   38.33 ? 5   DC  B O2    1 
ATOM   2494 N  N3    . DC  B 2 5   ? 1.531   13.916  -23.981 1.00   31.32 ? 5   DC  B N3    1 
ATOM   2495 C  C4    . DC  B 2 5   ? 1.188   14.410  -22.792 1.00   28.13 ? 5   DC  B C4    1 
ATOM   2496 N  N4    . DC  B 2 5   ? 2.048   15.229  -22.187 1.00   31.54 ? 5   DC  B N4    1 
ATOM   2497 C  C5    . DC  B 2 5   ? -0.063  14.108  -22.184 1.00   28.42 ? 5   DC  B C5    1 
ATOM   2498 C  C6    . DC  B 2 5   ? -0.889  13.288  -22.846 1.00   33.39 ? 5   DC  B C6    1 
ATOM   2499 P  P     . DA  B 2 6   ? -2.994  7.825   -25.786 1.00   45.85 ? 6   DA  B P     1 
ATOM   2500 O  OP1   . DA  B 2 6   ? -3.588  7.161   -26.982 1.00   48.30 ? 6   DA  B OP1   1 
ATOM   2501 O  OP2   . DA  B 2 6   ? -3.383  7.340   -24.439 1.00   44.57 ? 6   DA  B OP2   1 
ATOM   2502 O  "O5'" . DA  B 2 6   ? -1.389  7.832   -25.865 1.00   45.94 ? 6   DA  B "O5'" 1 
ATOM   2503 C  "C5'" . DA  B 2 6   ? -0.674  7.743   -27.117 1.00   44.17 ? 6   DA  B "C5'" 1 
ATOM   2504 C  "C4'" . DA  B 2 6   ? 0.819   7.683   -26.879 1.00   41.17 ? 6   DA  B "C4'" 1 
ATOM   2505 O  "O4'" . DA  B 2 6   ? 1.233   8.793   -26.050 1.00   38.42 ? 6   DA  B "O4'" 1 
ATOM   2506 C  "C3'" . DA  B 2 6   ? 1.349   6.414   -26.199 1.00   42.38 ? 6   DA  B "C3'" 1 
ATOM   2507 O  "O3'" . DA  B 2 6   ? 2.481   5.937   -26.936 1.00   44.46 ? 6   DA  B "O3'" 1 
ATOM   2508 C  "C2'" . DA  B 2 6   ? 1.824   6.892   -24.837 1.00   40.05 ? 6   DA  B "C2'" 1 
ATOM   2509 C  "C1'" . DA  B 2 6   ? 2.182   8.342   -25.108 1.00   39.05 ? 6   DA  B "C1'" 1 
ATOM   2510 N  N9    . DA  B 2 6   ? 2.074   9.203   -23.937 1.00   36.48 ? 6   DA  B N9    1 
ATOM   2511 C  C8    . DA  B 2 6   ? 1.056   9.262   -23.015 1.00   35.59 ? 6   DA  B C8    1 
ATOM   2512 N  N7    . DA  B 2 6   ? 1.241   10.164  -22.081 1.00   32.42 ? 6   DA  B N7    1 
ATOM   2513 C  C5    . DA  B 2 6   ? 2.464   10.735  -22.408 1.00   32.37 ? 6   DA  B C5    1 
ATOM   2514 C  C6    . DA  B 2 6   ? 3.236   11.744  -21.794 1.00   30.35 ? 6   DA  B C6    1 
ATOM   2515 N  N6    . DA  B 2 6   ? 2.867   12.396  -20.690 1.00   28.55 ? 6   DA  B N6    1 
ATOM   2516 N  N1    . DA  B 2 6   ? 4.410   12.073  -22.373 1.00   29.59 ? 6   DA  B N1    1 
ATOM   2517 C  C2    . DA  B 2 6   ? 4.775   11.432  -23.492 1.00   31.09 ? 6   DA  B C2    1 
ATOM   2518 N  N3    . DA  B 2 6   ? 4.143   10.466  -24.156 1.00   31.93 ? 6   DA  B N3    1 
ATOM   2519 C  C4    . DA  B 2 6   ? 2.984   10.157  -23.552 1.00   32.59 ? 6   DA  B C4    1 
ATOM   2520 P  P     . DC  B 2 7   ? 3.237   4.590   -26.498 1.00   46.11 ? 7   DC  B P     1 
ATOM   2521 O  OP1   . DC  B 2 7   ? 3.831   4.006   -27.699 1.00   50.01 ? 7   DC  B OP1   1 
ATOM   2522 O  OP2   . DC  B 2 7   ? 2.321   3.774   -25.661 1.00   47.21 ? 7   DC  B OP2   1 
ATOM   2523 O  "O5'" . DC  B 2 7   ? 4.378   5.110   -25.525 1.00   46.34 ? 7   DC  B "O5'" 1 
ATOM   2524 C  "C5'" . DC  B 2 7   ? 5.451   5.895   -26.064 1.00   48.41 ? 7   DC  B "C5'" 1 
ATOM   2525 C  "C4'" . DC  B 2 7   ? 6.330   6.405   -24.948 1.00   45.92 ? 7   DC  B "C4'" 1 
ATOM   2526 O  "O4'" . DC  B 2 7   ? 5.546   7.259   -24.100 1.00   39.56 ? 7   DC  B "O4'" 1 
ATOM   2527 C  "C3'" . DC  B 2 7   ? 6.923   5.344   -24.013 1.00   47.35 ? 7   DC  B "C3'" 1 
ATOM   2528 O  "O3'" . DC  B 2 7   ? 8.307   5.159   -24.317 1.00   53.09 ? 7   DC  B "O3'" 1 
ATOM   2529 C  "C2'" . DC  B 2 7   ? 6.807   5.976   -22.634 1.00   43.14 ? 7   DC  B "C2'" 1 
ATOM   2530 C  "C1'" . DC  B 2 7   ? 6.302   7.384   -22.925 1.00   39.94 ? 7   DC  B "C1'" 1 
ATOM   2531 N  N1    . DC  B 2 7   ? 5.444   7.966   -21.882 1.00   35.25 ? 7   DC  B N1    1 
ATOM   2532 C  C2    . DC  B 2 7   ? 5.902   9.094   -21.186 1.00   31.96 ? 7   DC  B C2    1 
ATOM   2533 O  O2    . DC  B 2 7   ? 6.994   9.594   -21.506 1.00   33.48 ? 7   DC  B O2    1 
ATOM   2534 N  N3    . DC  B 2 7   ? 5.148   9.605   -20.186 1.00   28.46 ? 7   DC  B N3    1 
ATOM   2535 C  C4    . DC  B 2 7   ? 3.976   9.039   -19.881 1.00   29.77 ? 7   DC  B C4    1 
ATOM   2536 N  N4    . DC  B 2 7   ? 3.251   9.589   -18.905 1.00   32.05 ? 7   DC  B N4    1 
ATOM   2537 C  C5    . DC  B 2 7   ? 3.486   7.894   -20.578 1.00   31.37 ? 7   DC  B C5    1 
ATOM   2538 C  C6    . DC  B 2 7   ? 4.255   7.383   -21.545 1.00   33.54 ? 7   DC  B C6    1 
ATOM   2539 P  P     . DC  B 2 8   ? 9.249   4.289   -23.346 1.00   60.31 ? 8   DC  B P     1 
ATOM   2540 O  OP1   . DC  B 2 8   ? 10.481  3.923   -24.119 1.00   62.84 ? 8   DC  B OP1   1 
ATOM   2541 O  OP2   . DC  B 2 8   ? 8.416   3.205   -22.737 1.00   61.24 ? 8   DC  B OP2   1 
ATOM   2542 O  "O5'" . DC  B 2 8   ? 9.634   5.320   -22.185 1.00   53.05 ? 8   DC  B "O5'" 1 
ATOM   2543 C  "C5'" . DC  B 2 8   ? 10.573  6.397   -22.424 1.00   50.49 ? 8   DC  B "C5'" 1 
ATOM   2544 C  "C4'" . DC  B 2 8   ? 10.981  7.079   -21.137 1.00   46.30 ? 8   DC  B "C4'" 1 
ATOM   2545 O  "O4'" . DC  B 2 8   ? 9.812   7.644   -20.505 1.00   41.52 ? 8   DC  B "O4'" 1 
ATOM   2546 C  "C3'" . DC  B 2 8   ? 11.634  6.182   -20.082 1.00   48.17 ? 8   DC  B "C3'" 1 
ATOM   2547 O  "O3'" . DC  B 2 8   ? 13.015  6.500   -19.903 1.00   55.00 ? 8   DC  B "O3'" 1 
ATOM   2548 C  "C2'" . DC  B 2 8   ? 10.933  6.538   -18.778 1.00   43.42 ? 8   DC  B "C2'" 1 
ATOM   2549 C  "C1'" . DC  B 2 8   ? 10.064  7.736   -19.119 1.00   40.03 ? 8   DC  B "C1'" 1 
ATOM   2550 N  N1    . DC  B 2 8   ? 8.766   7.769   -18.435 1.00   37.61 ? 8   DC  B N1    1 
ATOM   2551 C  C2    . DC  B 2 8   ? 8.624   8.571   -17.293 1.00   35.90 ? 8   DC  B C2    1 
ATOM   2552 O  O2    . DC  B 2 8   ? 9.610   9.202   -16.878 1.00   36.99 ? 8   DC  B O2    1 
ATOM   2553 N  N3    . DC  B 2 8   ? 7.430   8.610   -16.657 1.00   34.87 ? 8   DC  B N3    1 
ATOM   2554 C  C4    . DC  B 2 8   ? 6.396   7.909   -17.135 1.00   32.93 ? 8   DC  B C4    1 
ATOM   2555 N  N4    . DC  B 2 8   ? 5.235   7.973   -16.474 1.00   30.15 ? 8   DC  B N4    1 
ATOM   2556 C  C5    . DC  B 2 8   ? 6.519   7.074   -18.288 1.00   33.50 ? 8   DC  B C5    1 
ATOM   2557 C  C6    . DC  B 2 8   ? 7.704   7.049   -18.910 1.00   35.28 ? 8   DC  B C6    1 
ATOM   2558 P  P     . DT  B 2 9   ? 13.935  5.577   -18.974 1.00   59.18 ? 9   DT  B P     1 
ATOM   2559 O  OP1   . DT  B 2 9   ? 15.351  5.804   -19.359 1.00   64.60 ? 9   DT  B OP1   1 
ATOM   2560 O  OP2   . DT  B 2 9   ? 13.378  4.201   -18.998 1.00   63.35 ? 9   DT  B OP2   1 
ATOM   2561 O  "O5'" . DT  B 2 9   ? 13.706  6.189   -17.521 1.00   57.83 ? 9   DT  B "O5'" 1 
ATOM   2562 C  "C5'" . DT  B 2 9   ? 13.846  7.603   -17.284 1.00   56.25 ? 9   DT  B "C5'" 1 
ATOM   2563 C  "C4'" . DT  B 2 9   ? 14.100  7.862   -15.817 1.00   52.52 ? 9   DT  B "C4'" 1 
ATOM   2564 O  "O4'" . DT  B 2 9   ? 12.846  8.162   -15.158 1.00   48.22 ? 9   DT  B "O4'" 1 
ATOM   2565 C  "C3'" . DT  B 2 9   ? 14.700  6.682   -15.054 1.00   55.52 ? 9   DT  B "C3'" 1 
ATOM   2566 O  "O3'" . DT  B 2 9   ? 15.587  7.151   -14.034 1.00   60.25 ? 9   DT  B "O3'" 1 
ATOM   2567 C  "C2'" . DT  B 2 9   ? 13.484  6.015   -14.439 1.00   51.28 ? 9   DT  B "C2'" 1 
ATOM   2568 C  "C1'" . DT  B 2 9   ? 12.576  7.199   -14.149 1.00   45.81 ? 9   DT  B "C1'" 1 
ATOM   2569 N  N1    . DT  B 2 9   ? 11.138  6.884   -14.200 1.00   40.75 ? 9   DT  B N1    1 
ATOM   2570 C  C2    . DT  B 2 9   ? 10.300  7.522   -13.316 1.00   37.91 ? 9   DT  B C2    1 
ATOM   2571 O  O2    . DT  B 2 9   ? 10.691  8.335   -12.494 1.00   38.45 ? 9   DT  B O2    1 
ATOM   2572 N  N3    . DT  B 2 9   ? 8.977   7.173   -13.430 1.00   33.91 ? 9   DT  B N3    1 
ATOM   2573 C  C4    . DT  B 2 9   ? 8.424   6.270   -14.318 1.00   35.00 ? 9   DT  B C4    1 
ATOM   2574 O  O4    . DT  B 2 9   ? 7.215   6.057   -14.303 1.00   33.94 ? 9   DT  B O4    1 
ATOM   2575 C  C5    . DT  B 2 9   ? 9.363   5.637   -15.217 1.00   37.64 ? 9   DT  B C5    1 
ATOM   2576 C  C7    . DT  B 2 9   ? 8.857   4.645   -16.215 1.00   38.56 ? 9   DT  B C7    1 
ATOM   2577 C  C6    . DT  B 2 9   ? 10.656  5.972   -15.113 1.00   40.27 ? 9   DT  B C6    1 
ATOM   2578 P  P     . DG  B 2 10  ? 16.150  6.135   -12.935 1.00   63.35 ? 10  DG  B P     1 
ATOM   2579 O  OP1   . DG  B 2 10  ? 17.627  6.282   -12.886 1.00   67.80 ? 10  DG  B OP1   1 
ATOM   2580 O  OP2   . DG  B 2 10  ? 15.553  4.800   -13.193 1.00   70.24 ? 10  DG  B OP2   1 
ATOM   2581 O  "O5'" . DG  B 2 10  ? 15.545  6.706   -11.576 1.00   59.96 ? 10  DG  B "O5'" 1 
ATOM   2582 C  "C5'" . DG  B 2 10  ? 15.130  8.081   -11.474 1.00   54.61 ? 10  DG  B "C5'" 1 
ATOM   2583 C  "C4'" . DG  B 2 10  ? 14.692  8.391   -10.061 1.00   50.92 ? 10  DG  B "C4'" 1 
ATOM   2584 O  "O4'" . DG  B 2 10  ? 13.254  8.258   -9.964  1.00   46.18 ? 10  DG  B "O4'" 1 
ATOM   2585 C  "C3'" . DG  B 2 10  ? 15.269  7.462   -8.995  1.00   53.58 ? 10  DG  B "C3'" 1 
ATOM   2586 O  "O3'" . DG  B 2 10  ? 15.491  8.181   -7.778  1.00   56.68 ? 10  DG  B "O3'" 1 
ATOM   2587 C  "C2'" . DG  B 2 10  ? 14.179  6.423   -8.816  1.00   50.05 ? 10  DG  B "C2'" 1 
ATOM   2588 C  "C1'" . DG  B 2 10  ? 12.912  7.233   -9.042  1.00   45.73 ? 10  DG  B "C1'" 1 
ATOM   2589 N  N9    . DG  B 2 10  ? 11.809  6.468   -9.614  1.00   43.41 ? 10  DG  B N9    1 
ATOM   2590 C  C8    . DG  B 2 10  ? 11.884  5.531   -10.616 1.00   43.44 ? 10  DG  B C8    1 
ATOM   2591 N  N7    . DG  B 2 10  ? 10.726  5.012   -10.920 1.00   40.69 ? 10  DG  B N7    1 
ATOM   2592 C  C5    . DG  B 2 10  ? 9.832   5.644   -10.067 1.00   37.43 ? 10  DG  B C5    1 
ATOM   2593 C  C6    . DG  B 2 10  ? 8.427   5.493   -9.931  1.00   33.17 ? 10  DG  B C6    1 
ATOM   2594 O  O6    . DG  B 2 10  ? 7.667   4.745   -10.559 1.00   31.09 ? 10  DG  B O6    1 
ATOM   2595 N  N1    . DG  B 2 10  ? 7.917   6.329   -8.944  1.00   32.68 ? 10  DG  B N1    1 
ATOM   2596 C  C2    . DG  B 2 10  ? 8.659   7.199   -8.184  1.00   34.61 ? 10  DG  B C2    1 
ATOM   2597 N  N2    . DG  B 2 10  ? 7.981   7.922   -7.281  1.00   33.11 ? 10  DG  B N2    1 
ATOM   2598 N  N3    . DG  B 2 10  ? 9.968   7.349   -8.300  1.00   38.52 ? 10  DG  B N3    1 
ATOM   2599 C  C4    . DG  B 2 10  ? 10.485  6.546   -9.254  1.00   39.88 ? 10  DG  B C4    1 
ATOM   2600 P  P     . DA  B 2 11  ? 16.118  7.434   -6.510  1.00   57.41 ? 11  DA  B P     1 
ATOM   2601 O  OP1   . DA  B 2 11  ? 17.384  8.122   -6.150  1.00   63.96 ? 11  DA  B OP1   1 
ATOM   2602 O  OP2   . DA  B 2 11  ? 16.128  5.976   -6.794  1.00   60.58 ? 11  DA  B OP2   1 
ATOM   2603 O  "O5'" . DA  B 2 11  ? 15.050  7.718   -5.363  1.00   55.86 ? 11  DA  B "O5'" 1 
ATOM   2604 C  "C5'" . DA  B 2 11  ? 14.105  8.798   -5.484  1.00   53.89 ? 11  DA  B "C5'" 1 
ATOM   2605 C  "C4'" . DA  B 2 11  ? 13.059  8.702   -4.398  1.00   50.87 ? 11  DA  B "C4'" 1 
ATOM   2606 O  "O4'" . DA  B 2 11  ? 11.891  8.021   -4.914  1.00   48.06 ? 11  DA  B "O4'" 1 
ATOM   2607 C  "C3'" . DA  B 2 11  ? 13.491  7.913   -3.162  1.00   51.86 ? 11  DA  B "C3'" 1 
ATOM   2608 O  "O3'" . DA  B 2 11  ? 12.913  8.479   -1.982  1.00   51.70 ? 11  DA  B "O3'" 1 
ATOM   2609 C  "C2'" . DA  B 2 11  ? 12.935  6.527   -3.426  1.00   50.23 ? 11  DA  B "C2'" 1 
ATOM   2610 C  "C1'" . DA  B 2 11  ? 11.651  6.827   -4.182  1.00   47.94 ? 11  DA  B "C1'" 1 
ATOM   2611 N  N9    . DA  B 2 11  ? 11.261  5.789   -5.136  1.00   46.48 ? 11  DA  B N9    1 
ATOM   2612 C  C8    . DA  B 2 11  ? 12.072  5.082   -5.988  1.00   46.29 ? 11  DA  B C8    1 
ATOM   2613 N  N7    . DA  B 2 11  ? 11.430  4.213   -6.730  1.00   43.82 ? 11  DA  B N7    1 
ATOM   2614 C  C5    . DA  B 2 11  ? 10.106  4.358   -6.341  1.00   41.38 ? 11  DA  B C5    1 
ATOM   2615 C  C6    . DA  B 2 11  ? 8.923   3.719   -6.754  1.00   38.29 ? 11  DA  B C6    1 
ATOM   2616 N  N6    . DA  B 2 11  ? 8.882   2.768   -7.689  1.00   37.63 ? 11  DA  B N6    1 
ATOM   2617 N  N1    . DA  B 2 11  ? 7.767   4.097   -6.165  1.00   37.20 ? 11  DA  B N1    1 
ATOM   2618 C  C2    . DA  B 2 11  ? 7.809   5.052   -5.227  1.00   39.05 ? 11  DA  B C2    1 
ATOM   2619 N  N3    . DA  B 2 11  ? 8.855   5.725   -4.754  1.00   41.18 ? 11  DA  B N3    1 
ATOM   2620 C  C4    . DA  B 2 11  ? 9.987   5.326   -5.360  1.00   42.78 ? 11  DA  B C4    1 
ATOM   2621 P  P     . DT  B 2 12  ? 13.168  7.793   -0.560  1.00   59.71 ? 12  DT  B P     1 
ATOM   2622 O  OP1   . DT  B 2 12  ? 13.010  8.834   0.487   1.00   64.72 ? 12  DT  B OP1   1 
ATOM   2623 O  OP2   . DT  B 2 12  ? 14.433  7.020   -0.643  1.00   61.72 ? 12  DT  B OP2   1 
ATOM   2624 O  "O5'" . DT  B 2 12  ? 11.957  6.767   -0.436  1.00   57.53 ? 12  DT  B "O5'" 1 
ATOM   2625 C  "C5'" . DT  B 2 12  ? 10.593  7.227   -0.471  1.00   53.15 ? 12  DT  B "C5'" 1 
ATOM   2626 C  "C4'" . DT  B 2 12  ? 9.691   6.246   0.242   1.00   51.75 ? 12  DT  B "C4'" 1 
ATOM   2627 O  "O4'" . DT  B 2 12  ? 9.088   5.356   -0.727  1.00   49.34 ? 12  DT  B "O4'" 1 
ATOM   2628 C  "C3'" . DT  B 2 12  ? 10.397  5.347   1.256   1.00   55.66 ? 12  DT  B "C3'" 1 
ATOM   2629 O  "O3'" . DT  B 2 12  ? 9.543   5.090   2.374   1.00   59.78 ? 12  DT  B "O3'" 1 
ATOM   2630 C  "C2'" . DT  B 2 12  ? 10.654  4.074   0.472   1.00   54.52 ? 12  DT  B "C2'" 1 
ATOM   2631 C  "C1'" . DT  B 2 12  ? 9.448   4.009   -0.451  1.00   49.11 ? 12  DT  B "C1'" 1 
ATOM   2632 N  N1    . DT  B 2 12  ? 9.698   3.337   -1.740  1.00   47.67 ? 12  DT  B N1    1 
ATOM   2633 C  C2    . DT  B 2 12  ? 8.616   2.843   -2.433  1.00   43.86 ? 12  DT  B C2    1 
ATOM   2634 O  O2    . DT  B 2 12  ? 7.468   2.936   -2.031  1.00   42.20 ? 12  DT  B O2    1 
ATOM   2635 N  N3    . DT  B 2 12  ? 8.931   2.232   -3.622  1.00   43.11 ? 12  DT  B N3    1 
ATOM   2636 C  C4    . DT  B 2 12  ? 10.188  2.071   -4.172  1.00   46.75 ? 12  DT  B C4    1 
ATOM   2637 O  O4    . DT  B 2 12  ? 10.316  1.499   -5.251  1.00   47.86 ? 12  DT  B O4    1 
ATOM   2638 C  C5    . DT  B 2 12  ? 11.276  2.614   -3.391  1.00   50.49 ? 12  DT  B C5    1 
ATOM   2639 C  C7    . DT  B 2 12  ? 12.674  2.487   -3.906  1.00   51.61 ? 12  DT  B C7    1 
ATOM   2640 C  C6    . DT  B 2 12  ? 10.979  3.212   -2.230  1.00   50.96 ? 12  DT  B C6    1 
ATOM   2641 P  P     . DA  B 2 13  ? 10.105  5.250   3.864   0.50   61.07 ? 13  DA  B P     1 
ATOM   2642 O  OP1   . DA  B 2 13  ? 10.650  6.623   4.005   0.50   65.03 ? 13  DA  B OP1   1 
ATOM   2643 O  OP2   . DA  B 2 13  ? 10.972  4.080   4.156   0.50   62.87 ? 13  DA  B OP2   1 
ATOM   2644 O  "O5'" . DA  B 2 13  ? 8.790   5.139   4.756   0.50   60.41 ? 13  DA  B "O5'" 1 
ATOM   2645 C  "C5'" . DA  B 2 13  ? 7.879   6.248   4.869   0.50   56.25 ? 13  DA  B "C5'" 1 
ATOM   2646 C  "C4'" . DA  B 2 13  ? 6.693   6.046   3.954   0.50   54.01 ? 13  DA  B "C4'" 1 
ATOM   2647 O  "O4'" . DA  B 2 13  ? 7.105   5.296   2.786   0.50   52.74 ? 13  DA  B "O4'" 1 
ATOM   2648 C  "C3'" . DA  B 2 13  ? 5.535   5.262   4.573   0.50   55.31 ? 13  DA  B "C3'" 1 
ATOM   2649 O  "O3'" . DA  B 2 13  ? 4.283   5.816   4.155   0.50   53.30 ? 13  DA  B "O3'" 1 
ATOM   2650 C  "C2'" . DA  B 2 13  ? 5.717   3.863   4.013   0.50   56.21 ? 13  DA  B "C2'" 1 
ATOM   2651 C  "C1'" . DA  B 2 13  ? 6.291   4.144   2.637   0.50   52.87 ? 13  DA  B "C1'" 1 
ATOM   2652 N  N9    . DA  B 2 13  ? 7.128   3.070   2.103   0.50   52.80 ? 13  DA  B N9    1 
ATOM   2653 C  C8    . DA  B 2 13  ? 8.362   2.664   2.547   0.50   54.35 ? 13  DA  B C8    1 
ATOM   2654 N  N7    . DA  B 2 13  ? 8.869   1.668   1.862   0.50   55.11 ? 13  DA  B N7    1 
ATOM   2655 C  C5    . DA  B 2 13  ? 7.903   1.399   0.902   0.50   52.59 ? 13  DA  B C5    1 
ATOM   2656 C  C6    . DA  B 2 13  ? 7.838   0.451   -0.135  0.50   51.05 ? 13  DA  B C6    1 
ATOM   2657 N  N6    . DA  B 2 13  ? 8.801   -0.438  -0.387  0.50   52.79 ? 13  DA  B N6    1 
ATOM   2658 N  N1    . DA  B 2 13  ? 6.734   0.448   -0.914  0.50   48.24 ? 13  DA  B N1    1 
ATOM   2659 C  C2    . DA  B 2 13  ? 5.769   1.340   -0.660  0.50   48.53 ? 13  DA  B C2    1 
ATOM   2660 N  N3    . DA  B 2 13  ? 5.715   2.279   0.283   0.50   49.38 ? 13  DA  B N3    1 
ATOM   2661 C  C4    . DA  B 2 13  ? 6.826   2.255   1.039   0.50   51.35 ? 13  DA  B C4    1 
ATOM   2662 P  P     . DA  B 2 14  ? 2.970   4.903   4.135   0.0000 20.00 ? 14  DA  B P     1 
ATOM   2663 O  OP1   . DA  B 2 14  ? 1.789   5.797   4.039   0.0000 20.00 ? 14  DA  B OP1   1 
ATOM   2664 O  OP2   . DA  B 2 14  ? 3.069   3.931   5.254   0.0000 20.00 ? 14  DA  B OP2   1 
ATOM   2665 O  "O5'" . DA  B 2 14  ? 3.111   4.103   2.764   0.0000 20.00 ? 14  DA  B "O5'" 1 
ATOM   2666 C  "C5'" . DA  B 2 14  ? 2.245   4.387   1.650   0.50   50.35 ? 14  DA  B "C5'" 1 
ATOM   2667 C  "C4'" . DA  B 2 14  ? 1.440   3.161   1.290   0.50   48.90 ? 14  DA  B "C4'" 1 
ATOM   2668 O  "O4'" . DA  B 2 14  ? 2.336   2.044   1.080   0.50   48.11 ? 14  DA  B "O4'" 1 
ATOM   2669 C  "C3'" . DA  B 2 14  ? 0.455   2.706   2.365   0.50   50.47 ? 14  DA  B "C3'" 1 
ATOM   2670 O  "O3'" . DA  B 2 14  ? -0.706  2.127   1.763   0.50   47.78 ? 14  DA  B "O3'" 1 
ATOM   2671 C  "C2'" . DA  B 2 14  ? 1.241   1.656   3.128   0.50   52.80 ? 14  DA  B "C2'" 1 
ATOM   2672 C  "C1'" . DA  B 2 14  ? 2.084   1.021   2.034   0.50   51.15 ? 14  DA  B "C1'" 1 
ATOM   2673 N  N9    . DA  B 2 14  ? 3.374   0.510   2.494   0.50   54.03 ? 14  DA  B N9    1 
ATOM   2674 C  C8    . DA  B 2 14  ? 4.059   0.856   3.633   0.50   55.53 ? 14  DA  B C8    1 
ATOM   2675 N  N7    . DA  B 2 14  ? 5.199   0.226   3.777   0.50   56.54 ? 14  DA  B N7    1 
ATOM   2676 C  C5    . DA  B 2 14  ? 5.271   -0.591  2.657   0.50   54.52 ? 14  DA  B C5    1 
ATOM   2677 C  C6    . DA  B 2 14  ? 6.238   -1.513  2.219   0.50   55.36 ? 14  DA  B C6    1 
ATOM   2678 N  N6    . DA  B 2 14  ? 7.365   -1.776  2.885   0.50   58.59 ? 14  DA  B N6    1 
ATOM   2679 N  N1    . DA  B 2 14  ? 6.006   -2.163  1.058   0.50   53.52 ? 14  DA  B N1    1 
ATOM   2680 C  C2    . DA  B 2 14  ? 4.875   -1.898  0.391   0.50   51.94 ? 14  DA  B C2    1 
ATOM   2681 N  N3    . DA  B 2 14  ? 3.892   -1.056  0.700   0.50   52.03 ? 14  DA  B N3    1 
ATOM   2682 C  C4    . DA  B 2 14  ? 4.154   -0.426  1.858   0.50   53.25 ? 14  DA  B C4    1 
ATOM   2683 O  OP3   . DT  C 3 1   ? 0.633   -0.893  -1.701  1.00   39.32 ? 15  DT  C OP3   1 
ATOM   2684 P  P     . DT  C 3 1   ? -0.398  -0.000  -1.083  1.00   41.27 ? 15  DT  C P     1 
ATOM   2685 O  OP1   . DT  C 3 1   ? -1.678  0.104   -1.881  1.00   40.99 ? 15  DT  C OP1   1 
ATOM   2686 O  OP2   . DT  C 3 1   ? 0.312   1.262   -0.750  1.00   45.86 ? 15  DT  C OP2   1 
ATOM   2687 O  "O5'" . DT  C 3 1   ? -0.632  -0.601  0.378   1.00   37.37 ? 15  DT  C "O5'" 1 
ATOM   2688 C  "C5'" . DT  C 3 1   ? -1.493  -1.719  0.644   1.00   37.42 ? 15  DT  C "C5'" 1 
ATOM   2689 C  "C4'" . DT  C 3 1   ? -0.710  -2.994  0.444   1.00   35.04 ? 15  DT  C "C4'" 1 
ATOM   2690 O  "O4'" . DT  C 3 1   ? 0.644   -2.850  0.934   1.00   34.93 ? 15  DT  C "O4'" 1 
ATOM   2691 C  "C3'" . DT  C 3 1   ? -1.287  -4.239  1.115   1.00   35.13 ? 15  DT  C "C3'" 1 
ATOM   2692 O  "O3'" . DT  C 3 1   ? -1.393  -5.170  0.046   1.00   37.01 ? 15  DT  C "O3'" 1 
ATOM   2693 C  "C2'" . DT  C 3 1   ? -0.211  -4.676  2.099   1.00   33.80 ? 15  DT  C "C2'" 1 
ATOM   2694 C  "C1'" . DT  C 3 1   ? 1.062   -4.077  1.522   1.00   33.99 ? 15  DT  C "C1'" 1 
ATOM   2695 N  N1    . DT  C 3 1   ? 2.078   -3.760  2.551   1.00   32.48 ? 15  DT  C N1    1 
ATOM   2696 C  C2    . DT  C 3 1   ? 3.336   -4.334  2.487   1.00   31.53 ? 15  DT  C C2    1 
ATOM   2697 O  O2    . DT  C 3 1   ? 3.669   -5.126  1.619   1.00   35.56 ? 15  DT  C O2    1 
ATOM   2698 N  N3    . DT  C 3 1   ? 4.199   -3.934  3.482   1.00   30.89 ? 15  DT  C N3    1 
ATOM   2699 C  C4    . DT  C 3 1   ? 3.926   -3.057  4.519   1.00   34.08 ? 15  DT  C C4    1 
ATOM   2700 O  O4    . DT  C 3 1   ? 4.800   -2.792  5.346   1.00   35.64 ? 15  DT  C O4    1 
ATOM   2701 C  C5    . DT  C 3 1   ? 2.587   -2.496  4.520   1.00   34.44 ? 15  DT  C C5    1 
ATOM   2702 C  C7    . DT  C 3 1   ? 2.208   -1.524  5.591   1.00   36.65 ? 15  DT  C C7    1 
ATOM   2703 C  C6    . DT  C 3 1   ? 1.745   -2.872  3.551   1.00   32.16 ? 15  DT  C C6    1 
ATOM   2704 P  P     . DG  C 3 2   ? -2.208  -6.547  0.203   1.00   37.04 ? 16  DG  C P     1 
ATOM   2705 O  OP1   . DG  C 3 2   ? -2.456  -7.048  -1.173  1.00   38.40 ? 16  DG  C OP1   1 
ATOM   2706 O  OP2   . DG  C 3 2   ? -3.363  -6.378  1.139   1.00   36.25 ? 16  DG  C OP2   1 
ATOM   2707 O  "O5'" . DG  C 3 2   ? -1.186  -7.463  1.016   1.00   37.88 ? 16  DG  C "O5'" 1 
ATOM   2708 C  "C5'" . DG  C 3 2   ? 0.059   -7.922  0.458   1.00   38.10 ? 16  DG  C "C5'" 1 
ATOM   2709 C  "C4'" . DG  C 3 2   ? 0.888   -8.568  1.547   1.00   34.90 ? 16  DG  C "C4'" 1 
ATOM   2710 O  "O4'" . DG  C 3 2   ? 1.486   -7.537  2.373   1.00   33.19 ? 16  DG  C "O4'" 1 
ATOM   2711 C  "C3'" . DG  C 3 2   ? 0.129   -9.502  2.511   1.00   34.72 ? 16  DG  C "C3'" 1 
ATOM   2712 O  "O3'" . DG  C 3 2   ? 0.565   -10.872 2.290   1.00   37.28 ? 16  DG  C "O3'" 1 
ATOM   2713 C  "C2'" . DG  C 3 2   ? 0.474   -8.951  3.887   1.00   35.04 ? 16  DG  C "C2'" 1 
ATOM   2714 C  "C1'" . DG  C 3 2   ? 1.724   -8.127  3.625   1.00   33.83 ? 16  DG  C "C1'" 1 
ATOM   2715 N  N9    . DG  C 3 2   ? 1.945   -7.076  4.615   1.00   31.15 ? 16  DG  C N9    1 
ATOM   2716 C  C8    . DG  C 3 2   ? 0.974   -6.323  5.234   1.00   32.02 ? 16  DG  C C8    1 
ATOM   2717 N  N7    . DG  C 3 2   ? 1.453   -5.527  6.153   1.00   30.49 ? 16  DG  C N7    1 
ATOM   2718 C  C5    . DG  C 3 2   ? 2.812   -5.812  6.184   1.00   29.96 ? 16  DG  C C5    1 
ATOM   2719 C  C6    . DG  C 3 2   ? 3.850   -5.270  6.992   1.00   29.88 ? 16  DG  C C6    1 
ATOM   2720 O  O6    . DG  C 3 2   ? 3.771   -4.402  7.866   1.00   33.69 ? 16  DG  C O6    1 
ATOM   2721 N  N1    . DG  C 3 2   ? 5.083   -5.842  6.695   1.00   30.40 ? 16  DG  C N1    1 
ATOM   2722 C  C2    . DG  C 3 2   ? 5.298   -6.795  5.732   1.00   30.27 ? 16  DG  C C2    1 
ATOM   2723 N  N2    . DG  C 3 2   ? 6.569   -7.219  5.594   1.00   30.70 ? 16  DG  C N2    1 
ATOM   2724 N  N3    . DG  C 3 2   ? 4.342   -7.305  4.969   1.00   31.05 ? 16  DG  C N3    1 
ATOM   2725 C  C4    . DG  C 3 2   ? 3.131   -6.781  5.255   1.00   29.84 ? 16  DG  C C4    1 
ATOM   2726 P  P     . DG  C 3 3   ? 0.365   -12.069 3.368   1.00   37.36 ? 17  DG  C P     1 
ATOM   2727 O  OP1   . DG  C 3 3   ? 0.521   -13.358 2.648   1.00   38.46 ? 17  DG  C OP1   1 
ATOM   2728 O  OP2   . DG  C 3 3   ? -0.907  -11.833 4.124   1.00   35.93 ? 17  DG  C OP2   1 
ATOM   2729 O  "O5'" . DG  C 3 3   ? 1.580   -11.884 4.386   1.00   37.56 ? 17  DG  C "O5'" 1 
ATOM   2730 C  "C5'" . DG  C 3 3   ? 2.931   -12.124 3.965   1.00   35.97 ? 17  DG  C "C5'" 1 
ATOM   2731 C  "C4'" . DG  C 3 3   ? 3.907   -11.860 5.086   1.00   37.02 ? 17  DG  C "C4'" 1 
ATOM   2732 O  "O4'" . DG  C 3 3   ? 3.787   -10.519 5.598   1.00   34.85 ? 17  DG  C "O4'" 1 
ATOM   2733 C  "C3'" . DG  C 3 3   ? 3.788   -12.740 6.328   1.00   38.51 ? 17  DG  C "C3'" 1 
ATOM   2734 O  "O3'" . DG  C 3 3   ? 4.584   -13.926 6.226   1.00   43.47 ? 17  DG  C "O3'" 1 
ATOM   2735 C  "C2'" . DG  C 3 3   ? 4.463   -11.888 7.386   1.00   35.46 ? 17  DG  C "C2'" 1 
ATOM   2736 C  "C1'" . DG  C 3 3   ? 4.571   -10.492 6.772   1.00   34.24 ? 17  DG  C "C1'" 1 
ATOM   2737 N  N9    . DG  C 3 3   ? 4.033   -9.477  7.670   1.00   32.23 ? 17  DG  C N9    1 
ATOM   2738 C  C8    . DG  C 3 3   ? 2.721   -9.093  7.816   1.00   29.14 ? 17  DG  C C8    1 
ATOM   2739 N  N7    . DG  C 3 3   ? 2.546   -8.225  8.777   1.00   29.42 ? 17  DG  C N7    1 
ATOM   2740 C  C5    . DG  C 3 3   ? 3.819   -8.028  9.300   1.00   30.20 ? 17  DG  C C5    1 
ATOM   2741 C  C6    . DG  C 3 3   ? 4.262   -7.196  10.368  1.00   31.41 ? 17  DG  C C6    1 
ATOM   2742 O  O6    . DG  C 3 3   ? 3.602   -6.415  11.064  1.00   33.23 ? 17  DG  C O6    1 
ATOM   2743 N  N1    . DG  C 3 3   ? 5.632   -7.323  10.582  1.00   32.79 ? 17  DG  C N1    1 
ATOM   2744 C  C2    . DG  C 3 3   ? 6.473   -8.133  9.860   1.00   32.64 ? 17  DG  C C2    1 
ATOM   2745 N  N2    . DG  C 3 3   ? 7.776   -8.090  10.204  1.00   33.78 ? 17  DG  C N2    1 
ATOM   2746 N  N3    . DG  C 3 3   ? 6.077   -8.907  8.863   1.00   31.32 ? 17  DG  C N3    1 
ATOM   2747 C  C4    . DG  C 3 3   ? 4.745   -8.810  8.643   1.00   31.42 ? 17  DG  C C4    1 
ATOM   2748 P  P     . DA  C 3 4   ? 4.531   -15.044 7.400   1.00   44.63 ? 18  DA  C P     1 
ATOM   2749 O  OP1   . DA  C 3 4   ? 4.857   -16.344 6.805   1.00   50.96 ? 18  DA  C OP1   1 
ATOM   2750 O  OP2   . DA  C 3 4   ? 3.227   -14.866 8.134   1.00   46.76 ? 18  DA  C OP2   1 
ATOM   2751 O  "O5'" . DA  C 3 4   ? 5.709   -14.623 8.392   1.00   44.87 ? 18  DA  C "O5'" 1 
ATOM   2752 C  "C5'" . DA  C 3 4   ? 7.052   -14.291 7.970   1.00   40.23 ? 18  DA  C "C5'" 1 
ATOM   2753 C  "C4'" . DA  C 3 4   ? 7.799   -13.718 9.155   1.00   41.28 ? 18  DA  C "C4'" 1 
ATOM   2754 O  "O4'" . DA  C 3 4   ? 7.228   -12.432 9.491   1.00   38.32 ? 18  DA  C "O4'" 1 
ATOM   2755 C  "C3'" . DA  C 3 4   ? 7.681   -14.555 10.434  1.00   42.48 ? 18  DA  C "C3'" 1 
ATOM   2756 O  "O3'" . DA  C 3 4   ? 8.895   -15.197 10.798  1.00   45.96 ? 18  DA  C "O3'" 1 
ATOM   2757 C  "C2'" . DA  C 3 4   ? 7.475   -13.544 11.547  1.00   39.66 ? 18  DA  C "C2'" 1 
ATOM   2758 C  "C1'" . DA  C 3 4   ? 7.409   -12.190 10.870  1.00   37.47 ? 18  DA  C "C1'" 1 
ATOM   2759 N  N9    . DA  C 3 4   ? 6.245   -11.461 11.355  1.00   35.55 ? 18  DA  C N9    1 
ATOM   2760 C  C8    . DA  C 3 4   ? 4.928   -11.609 10.984  1.00   34.93 ? 18  DA  C C8    1 
ATOM   2761 N  N7    . DA  C 3 4   ? 4.102   -10.830 11.641  1.00   30.65 ? 18  DA  C N7    1 
ATOM   2762 C  C5    . DA  C 3 4   ? 4.931   -10.113 12.495  1.00   31.19 ? 18  DA  C C5    1 
ATOM   2763 C  C6    . DA  C 3 4   ? 4.664   -9.142  13.471  1.00   30.34 ? 18  DA  C C6    1 
ATOM   2764 N  N6    . DA  C 3 4   ? 3.437   -8.685  13.744  1.00   27.67 ? 18  DA  C N6    1 
ATOM   2765 N  N1    . DA  C 3 4   ? 5.713   -8.645  14.166  1.00   33.97 ? 18  DA  C N1    1 
ATOM   2766 C  C2    . DA  C 3 4   ? 6.939   -9.118  13.905  1.00   34.60 ? 18  DA  C C2    1 
ATOM   2767 N  N3    . DA  C 3 4   ? 7.314   -10.041 13.021  1.00   33.67 ? 18  DA  C N3    1 
ATOM   2768 C  C4    . DA  C 3 4   ? 6.250   -10.513 12.350  1.00   34.15 ? 18  DA  C C4    1 
ATOM   2769 P  P     . DG  C 3 5   ? 8.884   -16.289 11.953  1.00   50.44 ? 19  DG  C P     1 
ATOM   2770 O  OP1   . DG  C 3 5   ? 9.790   -17.406 11.553  1.00   58.37 ? 19  DG  C OP1   1 
ATOM   2771 O  OP2   . DG  C 3 5   ? 7.458   -16.534 12.339  1.00   49.65 ? 19  DG  C OP2   1 
ATOM   2772 O  "O5'" . DG  C 3 5   ? 9.565   -15.551 13.185  1.00   49.30 ? 19  DG  C "O5'" 1 
ATOM   2773 C  "C5'" . DG  C 3 5   ? 10.723  -14.716 13.047  1.00   49.37 ? 19  DG  C "C5'" 1 
ATOM   2774 C  "C4'" . DG  C 3 5   ? 11.061  -14.160 14.410  1.00   49.58 ? 19  DG  C "C4'" 1 
ATOM   2775 O  "O4'" . DG  C 3 5   ? 10.096  -13.144 14.790  1.00   45.37 ? 19  DG  C "O4'" 1 
ATOM   2776 C  "C3'" . DG  C 3 5   ? 11.018  -15.207 15.519  1.00   49.83 ? 19  DG  C "C3'" 1 
ATOM   2777 O  "O3'" . DG  C 3 5   ? 12.119  -14.876 16.356  1.00   56.18 ? 19  DG  C "O3'" 1 
ATOM   2778 C  "C2'" . DG  C 3 5   ? 9.651   -14.998 16.153  1.00   44.92 ? 19  DG  C "C2'" 1 
ATOM   2779 C  "C1'" . DG  C 3 5   ? 9.428   -13.503 15.986  1.00   43.53 ? 19  DG  C "C1'" 1 
ATOM   2780 N  N9    . DG  C 3 5   ? 8.036   -13.086 15.849  1.00   40.65 ? 19  DG  C N9    1 
ATOM   2781 C  C8    . DG  C 3 5   ? 7.077   -13.667 15.055  1.00   37.63 ? 19  DG  C C8    1 
ATOM   2782 N  N7    . DG  C 3 5   ? 5.932   -13.043 15.094  1.00   35.15 ? 19  DG  C N7    1 
ATOM   2783 C  C5    . DG  C 3 5   ? 6.142   -11.992 15.978  1.00   35.62 ? 19  DG  C C5    1 
ATOM   2784 C  C6    . DG  C 3 5   ? 5.259   -10.966 16.417  1.00   34.03 ? 19  DG  C C6    1 
ATOM   2785 O  O6    . DG  C 3 5   ? 4.064   -10.800 16.133  1.00   33.06 ? 19  DG  C O6    1 
ATOM   2786 N  N1    . DG  C 3 5   ? 5.887   -10.095 17.303  1.00   35.45 ? 19  DG  C N1    1 
ATOM   2787 C  C2    . DG  C 3 5   ? 7.201   -10.180 17.696  1.00   41.25 ? 19  DG  C C2    1 
ATOM   2788 N  N2    . DG  C 3 5   ? 7.632   -9.226  18.545  1.00   44.83 ? 19  DG  C N2    1 
ATOM   2789 N  N3    . DG  C 3 5   ? 8.037   -11.124 17.284  1.00   42.73 ? 19  DG  C N3    1 
ATOM   2790 C  C4    . DG  C 3 5   ? 7.443   -11.990 16.434  1.00   38.70 ? 19  DG  C C4    1 
ATOM   2791 P  P     . DG  C 3 6   ? 12.450  -15.736 17.666  1.00   62.74 ? 20  DG  C P     1 
ATOM   2792 O  OP1   . DG  C 3 6   ? 13.919  -15.637 17.912  1.00   67.17 ? 20  DG  C OP1   1 
ATOM   2793 O  OP2   . DG  C 3 6   ? 11.811  -17.073 17.523  1.00   63.04 ? 20  DG  C OP2   1 
ATOM   2794 O  "O5'" . DG  C 3 6   ? 11.713  -14.906 18.812  1.00   59.53 ? 20  DG  C "O5'" 1 
ATOM   2795 C  "C5'" . DG  C 3 6   ? 12.269  -13.645 19.244  1.00   56.89 ? 20  DG  C "C5'" 1 
ATOM   2796 C  "C4'" . DG  C 3 6   ? 11.486  -13.074 20.404  1.00   52.86 ? 20  DG  C "C4'" 1 
ATOM   2797 O  "O4'" . DG  C 3 6   ? 10.151  -12.715 19.983  1.00   47.83 ? 20  DG  C "O4'" 1 
ATOM   2798 C  "C3'" . DG  C 3 6   ? 11.319  -13.993 21.613  1.00   55.08 ? 20  DG  C "C3'" 1 
ATOM   2799 O  "O3'" . DG  C 3 6   ? 11.568  -13.129 22.721  1.00   59.08 ? 20  DG  C "O3'" 1 
ATOM   2800 C  "C2'" . DG  C 3 6   ? 9.868   -14.428 21.527  1.00   50.25 ? 20  DG  C "C2'" 1 
ATOM   2801 C  "C1'" . DG  C 3 6   ? 9.230   -13.185 20.943  1.00   47.32 ? 20  DG  C "C1'" 1 
ATOM   2802 N  N9    . DG  C 3 6   ? 7.949   -13.393 20.277  1.00   44.25 ? 20  DG  C N9    1 
ATOM   2803 C  C8    . DG  C 3 6   ? 7.612   -14.415 19.421  1.00   42.12 ? 20  DG  C C8    1 
ATOM   2804 N  N7    . DG  C 3 6   ? 6.374   -14.352 19.008  1.00   38.02 ? 20  DG  C N7    1 
ATOM   2805 C  C5    . DG  C 3 6   ? 5.864   -13.212 19.618  1.00   38.43 ? 20  DG  C C5    1 
ATOM   2806 C  C6    . DG  C 3 6   ? 4.564   -12.629 19.549  1.00   35.09 ? 20  DG  C C6    1 
ATOM   2807 O  O6    . DG  C 3 6   ? 3.580   -13.020 18.917  1.00   33.35 ? 20  DG  C O6    1 
ATOM   2808 N  N1    . DG  C 3 6   ? 4.466   -11.498 20.352  1.00   35.15 ? 20  DG  C N1    1 
ATOM   2809 C  C2    . DG  C 3 6   ? 5.491   -10.980 21.118  1.00   37.91 ? 20  DG  C C2    1 
ATOM   2810 N  N2    . DG  C 3 6   ? 5.205   -9.880  21.832  1.00   38.10 ? 20  DG  C N2    1 
ATOM   2811 N  N3    . DG  C 3 6   ? 6.705   -11.506 21.184  1.00   40.28 ? 20  DG  C N3    1 
ATOM   2812 C  C4    . DG  C 3 6   ? 6.819   -12.615 20.417  1.00   42.16 ? 20  DG  C C4    1 
ATOM   2813 P  P     . DA  C 3 7   ? 11.488  -13.646 24.235  1.00   62.23 ? 21  DA  C P     1 
ATOM   2814 O  OP1   . DA  C 3 7   ? 12.567  -12.969 24.996  1.00   65.73 ? 21  DA  C OP1   1 
ATOM   2815 O  OP2   . DA  C 3 7   ? 11.410  -15.130 24.236  1.00   62.65 ? 21  DA  C OP2   1 
ATOM   2816 O  "O5'" . DA  C 3 7   ? 10.108  -13.015 24.715  1.00   58.76 ? 21  DA  C "O5'" 1 
ATOM   2817 C  "C5'" . DA  C 3 7   ? 9.921   -11.593 24.611  1.00   57.27 ? 21  DA  C "C5'" 1 
ATOM   2818 C  "C4'" . DA  C 3 7   ? 8.573   -11.201 25.164  1.00   56.46 ? 21  DA  C "C4'" 1 
ATOM   2819 O  "O4'" . DA  C 3 7   ? 7.526   -11.599 24.244  1.00   54.97 ? 21  DA  C "O4'" 1 
ATOM   2820 C  "C3'" . DA  C 3 7   ? 8.219   -11.833 26.513  1.00   58.47 ? 21  DA  C "C3'" 1 
ATOM   2821 O  "O3'" . DA  C 3 7   ? 7.746   -10.789 27.371  1.00   58.85 ? 21  DA  C "O3'" 1 
ATOM   2822 C  "C2'" . DA  C 3 7   ? 7.125   -12.836 26.174  1.00   55.78 ? 21  DA  C "C2'" 1 
ATOM   2823 C  "C1'" . DA  C 3 7   ? 6.468   -12.191 24.977  1.00   51.62 ? 21  DA  C "C1'" 1 
ATOM   2824 N  N9    . DA  C 3 7   ? 5.782   -13.123 24.088  1.00   46.78 ? 21  DA  C N9    1 
ATOM   2825 C  C8    . DA  C 3 7   ? 6.271   -14.271 23.515  1.00   47.33 ? 21  DA  C C8    1 
ATOM   2826 N  N7    . DA  C 3 7   ? 5.404   -14.890 22.751  1.00   45.09 ? 21  DA  C N7    1 
ATOM   2827 C  C5    . DA  C 3 7   ? 4.267   -14.096 22.825  1.00   42.13 ? 21  DA  C C5    1 
ATOM   2828 C  C6    . DA  C 3 7   ? 2.988   -14.213 22.244  1.00   37.97 ? 21  DA  C C6    1 
ATOM   2829 N  N6    . DA  C 3 7   ? 2.630   -15.211 21.433  1.00   36.34 ? 21  DA  C N6    1 
ATOM   2830 N  N1    . DA  C 3 7   ? 2.076   -13.261 22.537  1.00   36.79 ? 21  DA  C N1    1 
ATOM   2831 C  C2    . DA  C 3 7   ? 2.431   -12.267 23.360  1.00   39.59 ? 21  DA  C C2    1 
ATOM   2832 N  N3    . DA  C 3 7   ? 3.602   -12.042 23.959  1.00   42.73 ? 21  DA  C N3    1 
ATOM   2833 C  C4    . DA  C 3 7   ? 4.486   -13.006 23.647  1.00   43.46 ? 21  DA  C C4    1 
ATOM   2834 P  P     . DT  C 3 8   ? 7.491   -11.053 28.924  1.00   62.59 ? 22  DT  C P     1 
ATOM   2835 O  OP1   . DT  C 3 8   ? 8.052   -9.909  29.684  1.00   66.10 ? 22  DT  C OP1   1 
ATOM   2836 O  OP2   . DT  C 3 8   ? 7.901   -12.451 29.261  1.00   64.40 ? 22  DT  C OP2   1 
ATOM   2837 O  "O5'" . DT  C 3 8   ? 5.912   -10.938 29.033  1.00   60.12 ? 22  DT  C "O5'" 1 
ATOM   2838 C  "C5'" . DT  C 3 8   ? 5.210   -9.878  28.382  1.00   57.23 ? 22  DT  C "C5'" 1 
ATOM   2839 C  "C4'" . DT  C 3 8   ? 3.741   -10.224 28.372  1.00   55.29 ? 22  DT  C "C4'" 1 
ATOM   2840 O  "O4'" . DT  C 3 8   ? 3.436   -11.160 27.305  1.00   52.51 ? 22  DT  C "O4'" 1 
ATOM   2841 C  "C3'" . DT  C 3 8   ? 3.234   -10.877 29.665  1.00   57.98 ? 22  DT  C "C3'" 1 
ATOM   2842 O  "O3'" . DT  C 3 8   ? 1.895   -10.407 29.814  1.00   61.96 ? 22  DT  C "O3'" 1 
ATOM   2843 C  "C2'" . DT  C 3 8   ? 3.119   -12.344 29.288  1.00   56.08 ? 22  DT  C "C2'" 1 
ATOM   2844 C  "C1'" . DT  C 3 8   ? 2.610   -12.178 27.866  1.00   52.61 ? 22  DT  C "C1'" 1 
ATOM   2845 N  N1    . DT  C 3 8   ? 2.663   -13.375 26.998  1.00   48.64 ? 22  DT  C N1    1 
ATOM   2846 C  C2    . DT  C 3 8   ? 1.575   -13.629 26.185  1.00   44.85 ? 22  DT  C C2    1 
ATOM   2847 O  O2    . DT  C 3 8   ? 0.607   -12.882 26.104  1.00   43.80 ? 22  DT  C O2    1 
ATOM   2848 N  N3    . DT  C 3 8   ? 1.683   -14.769 25.430  1.00   42.08 ? 22  DT  C N3    1 
ATOM   2849 C  C4    . DT  C 3 8   ? 2.737   -15.664 25.410  1.00   44.20 ? 22  DT  C C4    1 
ATOM   2850 O  O4    . DT  C 3 8   ? 2.692   -16.643 24.669  1.00   43.28 ? 22  DT  C O4    1 
ATOM   2851 C  C5    . DT  C 3 8   ? 3.820   -15.364 26.323  1.00   47.77 ? 22  DT  C C5    1 
ATOM   2852 C  C7    . DT  C 3 8   ? 4.994   -16.290 26.387  1.00   50.60 ? 22  DT  C C7    1 
ATOM   2853 C  C6    . DT  C 3 8   ? 3.731   -14.247 27.058  1.00   49.66 ? 22  DT  C C6    1 
ATOM   2854 P  P     . DA  C 3 9   ? 1.256   -10.098 31.236  1.00   64.08 ? 23  DA  C P     1 
ATOM   2855 O  OP1   . DA  C 3 9   ? 1.767   -8.775  31.691  1.00   69.81 ? 23  DA  C OP1   1 
ATOM   2856 O  OP2   . DA  C 3 9   ? 1.429   -11.285 32.103  1.00   62.59 ? 23  DA  C OP2   1 
ATOM   2857 O  "O5'" . DA  C 3 9   ? -0.281  -9.956  30.844  1.00   62.01 ? 23  DA  C "O5'" 1 
ATOM   2858 C  "C5'" . DA  C 3 9   ? -0.650  -9.661  29.483  1.00   56.22 ? 23  DA  C "C5'" 1 
ATOM   2859 C  "C4'" . DA  C 3 9   ? -2.034  -10.180 29.174  1.00   55.03 ? 23  DA  C "C4'" 1 
ATOM   2860 O  "O4'" . DA  C 3 9   ? -1.956  -11.394 28.395  1.00   51.46 ? 23  DA  C "O4'" 1 
ATOM   2861 C  "C3'" . DA  C 3 9   ? -2.915  -10.513 30.372  1.00   58.57 ? 23  DA  C "C3'" 1 
ATOM   2862 O  "O3'" . DA  C 3 9   ? -4.219  -10.108 29.941  1.00   62.25 ? 23  DA  C "O3'" 1 
ATOM   2863 C  "C2'" . DA  C 3 9   ? -2.718  -12.011 30.544  1.00   57.16 ? 23  DA  C "C2'" 1 
ATOM   2864 C  "C1'" . DA  C 3 9   ? -2.509  -12.496 29.114  1.00   53.46 ? 23  DA  C "C1'" 1 
ATOM   2865 N  N9    . DA  C 3 9   ? -1.596  -13.629 28.939  1.00   53.46 ? 23  DA  C N9    1 
ATOM   2866 C  C8    . DA  C 3 9   ? -0.328  -13.758 29.455  1.00   54.51 ? 23  DA  C C8    1 
ATOM   2867 N  N7    . DA  C 3 9   ? 0.287   -14.854 29.082  1.00   52.51 ? 23  DA  C N7    1 
ATOM   2868 C  C5    . DA  C 3 9   ? -0.632  -15.489 28.258  1.00   50.87 ? 23  DA  C C5    1 
ATOM   2869 C  C6    . DA  C 3 9   ? -0.580  -16.694 27.532  1.00   48.44 ? 23  DA  C C6    1 
ATOM   2870 N  N6    . DA  C 3 9   ? 0.472   -17.513 27.533  1.00   48.06 ? 23  DA  C N6    1 
ATOM   2871 N  N1    . DA  C 3 9   ? -1.665  -17.036 26.802  1.00   48.36 ? 23  DA  C N1    1 
ATOM   2872 C  C2    . DA  C 3 9   ? -2.714  -16.199 26.781  1.00   48.56 ? 23  DA  C C2    1 
ATOM   2873 N  N3    . DA  C 3 9   ? -2.883  -15.043 27.423  1.00   48.51 ? 23  DA  C N3    1 
ATOM   2874 C  C4    . DA  C 3 9   ? -1.791  -14.736 28.147  1.00   51.47 ? 23  DA  C C4    1 
ATOM   2875 P  P     . DC  C 3 10  ? -5.524  -10.423 30.816  1.00   67.40 ? 24  DC  C P     1 
ATOM   2876 O  OP1   . DC  C 3 10  ? -6.582  -9.452  30.419  1.00   69.93 ? 24  DC  C OP1   1 
ATOM   2877 O  OP2   . DC  C 3 10  ? -5.124  -10.559 32.252  1.00   71.52 ? 24  DC  C OP2   1 
ATOM   2878 O  "O5'" . DC  C 3 10  ? -5.986  -11.834 30.253  1.00   64.72 ? 24  DC  C "O5'" 1 
ATOM   2879 C  "C5'" . DC  C 3 10  ? -6.206  -12.023 28.846  1.00   58.91 ? 24  DC  C "C5'" 1 
ATOM   2880 C  "C4'" . DC  C 3 10  ? -6.924  -13.335 28.648  1.00   58.99 ? 24  DC  C "C4'" 1 
ATOM   2881 O  "O4'" . DC  C 3 10  ? -5.950  -14.401 28.514  1.00   57.29 ? 24  DC  C "O4'" 1 
ATOM   2882 C  "C3'" . DC  C 3 10  ? -7.825  -13.719 29.826  1.00   63.01 ? 24  DC  C "C3'" 1 
ATOM   2883 O  "O3'" . DC  C 3 10  ? -9.070  -14.181 29.293  1.00   67.06 ? 24  DC  C "O3'" 1 
ATOM   2884 C  "C2'" . DC  C 3 10  ? -7.026  -14.782 30.566  1.00   62.64 ? 24  DC  C "C2'" 1 
ATOM   2885 C  "C1'" . DC  C 3 10  ? -6.246  -15.440 29.440  1.00   58.75 ? 24  DC  C "C1'" 1 
ATOM   2886 N  N1    . DC  C 3 10  ? -4.973  -16.085 29.817  1.00   58.62 ? 24  DC  C N1    1 
ATOM   2887 C  C2    . DC  C 3 10  ? -4.693  -17.366 29.314  1.00   59.06 ? 24  DC  C C2    1 
ATOM   2888 O  O2    . DC  C 3 10  ? -5.533  -17.927 28.593  1.00   59.17 ? 24  DC  C O2    1 
ATOM   2889 N  N3    . DC  C 3 10  ? -3.532  -17.972 29.654  1.00   57.30 ? 24  DC  C N3    1 
ATOM   2890 C  C4    . DC  C 3 10  ? -2.650  -17.334 30.426  1.00   57.00 ? 24  DC  C C4    1 
ATOM   2891 N  N4    . DC  C 3 10  ? -1.504  -17.960 30.709  1.00   57.19 ? 24  DC  C N4    1 
ATOM   2892 C  C5    . DC  C 3 10  ? -2.911  -16.034 30.958  1.00   58.02 ? 24  DC  C C5    1 
ATOM   2893 C  C6    . DC  C 3 10  ? -4.071  -15.449 30.624  1.00   58.18 ? 24  DC  C C6    1 
ATOM   2894 P  P     . DC  C 3 11  ? -10.294 -14.566 30.265  1.00   75.58 ? 25  DC  C P     1 
ATOM   2895 O  OP1   . DC  C 3 11  ? -11.331 -13.506 30.134  1.00   81.61 ? 25  DC  C OP1   1 
ATOM   2896 O  OP2   . DC  C 3 11  ? -9.750  -14.904 31.617  1.00   78.05 ? 25  DC  C OP2   1 
ATOM   2897 O  "O5'" . DC  C 3 11  ? -10.874 -15.894 29.595  1.00   76.89 ? 25  DC  C "O5'" 1 
ATOM   2898 C  "C5'" . DC  C 3 11  ? -10.081 -16.676 28.669  1.00   69.89 ? 25  DC  C "C5'" 1 
ATOM   2899 C  "C4'" . DC  C 3 11  ? -10.014 -18.125 29.099  1.00   70.25 ? 25  DC  C "C4'" 1 
ATOM   2900 O  "O4'" . DC  C 3 11  ? -8.651  -18.460 29.454  1.00   69.92 ? 25  DC  C "O4'" 1 
ATOM   2901 C  "C3'" . DC  C 3 11  ? -10.879 -18.504 30.306  1.00   74.93 ? 25  DC  C "C3'" 1 
ATOM   2902 O  "O3'" . DC  C 3 11  ? -11.807 -19.542 29.958  1.00   79.48 ? 25  DC  C "O3'" 1 
ATOM   2903 C  "C2'" . DC  C 3 11  ? -9.879  -18.953 31.363  1.00   74.34 ? 25  DC  C "C2'" 1 
ATOM   2904 C  "C1'" . DC  C 3 11  ? -8.678  -19.367 30.538  1.00   71.27 ? 25  DC  C "C1'" 1 
ATOM   2905 N  N1    . DC  C 3 11  ? -7.365  -19.307 31.218  1.00   71.99 ? 25  DC  C N1    1 
ATOM   2906 C  C2    . DC  C 3 11  ? -6.592  -20.474 31.292  1.00   71.37 ? 25  DC  C C2    1 
ATOM   2907 O  O2    . DC  C 3 11  ? -7.040  -21.523 30.803  1.00   71.85 ? 25  DC  C O2    1 
ATOM   2908 N  N3    . DC  C 3 11  ? -5.383  -20.430 31.901  1.00   67.86 ? 25  DC  C N3    1 
ATOM   2909 C  C4    . DC  C 3 11  ? -4.939  -19.284 32.420  1.00   67.29 ? 25  DC  C C4    1 
ATOM   2910 N  N4    . DC  C 3 11  ? -3.742  -19.290 33.009  1.00   64.66 ? 25  DC  C N4    1 
ATOM   2911 C  C5    . DC  C 3 11  ? -5.702  -18.080 32.356  1.00   70.25 ? 25  DC  C C5    1 
ATOM   2912 C  C6    . DC  C 3 11  ? -6.896  -18.135 31.746  1.00   71.97 ? 25  DC  C C6    1 
ATOM   2913 O  "O5'" . DG  D 4 1   ? 2.747   -27.123 29.883  1.00   60.72 ? 1   DG  D "O5'" 1 
ATOM   2914 C  "C5'" . DG  D 4 1   ? 2.165   -28.417 30.142  1.00   54.33 ? 1   DG  D "C5'" 1 
ATOM   2915 C  "C4'" . DG  D 4 1   ? 0.673   -28.335 29.933  1.00   52.07 ? 1   DG  D "C4'" 1 
ATOM   2916 O  "O4'" . DG  D 4 1   ? 0.164   -27.341 30.849  1.00   49.47 ? 1   DG  D "O4'" 1 
ATOM   2917 C  "C3'" . DG  D 4 1   ? 0.317   -27.854 28.523  1.00   52.85 ? 1   DG  D "C3'" 1 
ATOM   2918 O  "O3'" . DG  D 4 1   ? -0.113  -28.840 27.554  1.00   58.26 ? 1   DG  D "O3'" 1 
ATOM   2919 C  "C2'" . DG  D 4 1   ? -0.591  -26.653 28.718  1.00   49.95 ? 1   DG  D "C2'" 1 
ATOM   2920 C  "C1'" . DG  D 4 1   ? -0.824  -26.545 30.209  1.00   50.03 ? 1   DG  D "C1'" 1 
ATOM   2921 N  N9    . DG  D 4 1   ? -0.717  -25.176 30.709  1.00   48.39 ? 1   DG  D N9    1 
ATOM   2922 C  C8    . DG  D 4 1   ? 0.414   -24.506 31.116  1.00   48.20 ? 1   DG  D C8    1 
ATOM   2923 N  N7    . DG  D 4 1   ? 0.172   -23.284 31.512  1.00   46.97 ? 1   DG  D N7    1 
ATOM   2924 C  C5    . DG  D 4 1   ? -1.197  -23.129 31.332  1.00   47.42 ? 1   DG  D C5    1 
ATOM   2925 C  C6    . DG  D 4 1   ? -2.046  -22.020 31.606  1.00   46.92 ? 1   DG  D C6    1 
ATOM   2926 O  O6    . DG  D 4 1   ? -1.742  -20.902 32.047  1.00   50.14 ? 1   DG  D O6    1 
ATOM   2927 N  N1    . DG  D 4 1   ? -3.373  -22.303 31.293  1.00   48.07 ? 1   DG  D N1    1 
ATOM   2928 C  C2    . DG  D 4 1   ? -3.830  -23.499 30.790  1.00   47.43 ? 1   DG  D C2    1 
ATOM   2929 N  N2    . DG  D 4 1   ? -5.146  -23.576 30.551  1.00   48.36 ? 1   DG  D N2    1 
ATOM   2930 N  N3    . DG  D 4 1   ? -3.053  -24.537 30.532  1.00   47.38 ? 1   DG  D N3    1 
ATOM   2931 C  C4    . DG  D 4 1   ? -1.760  -24.288 30.833  1.00   47.84 ? 1   DG  D C4    1 
ATOM   2932 P  P     . DG  D 4 2   ? -1.455  -29.720 27.731  1.00   53.04 ? 2   DG  D P     1 
ATOM   2933 O  OP1   . DG  D 4 2   ? -1.761  -29.773 29.167  1.00   57.71 ? 2   DG  D OP1   1 
ATOM   2934 O  OP2   . DG  D 4 2   ? -1.271  -30.956 26.961  1.00   57.39 ? 2   DG  D OP2   1 
ATOM   2935 O  "O5'" . DG  D 4 2   ? -2.570  -28.845 27.001  1.00   49.12 ? 2   DG  D "O5'" 1 
ATOM   2936 C  "C5'" . DG  D 4 2   ? -2.321  -28.136 25.791  1.00   48.72 ? 2   DG  D "C5'" 1 
ATOM   2937 C  "C4'" . DG  D 4 2   ? -3.507  -27.243 25.517  1.00   47.95 ? 2   DG  D "C4'" 1 
ATOM   2938 O  "O4'" . DG  D 4 2   ? -3.535  -26.151 26.470  1.00   47.31 ? 2   DG  D "O4'" 1 
ATOM   2939 C  "C3'" . DG  D 4 2   ? -3.533  -26.598 24.131  1.00   47.36 ? 2   DG  D "C3'" 1 
ATOM   2940 O  "O3'" . DG  D 4 2   ? -4.891  -26.577 23.688  1.00   47.64 ? 2   DG  D "O3'" 1 
ATOM   2941 C  "C2'" . DG  D 4 2   ? -3.007  -25.196 24.386  1.00   45.77 ? 2   DG  D "C2'" 1 
ATOM   2942 C  "C1'" . DG  D 4 2   ? -3.514  -24.899 25.791  1.00   45.85 ? 2   DG  D "C1'" 1 
ATOM   2943 N  N9    . DG  D 4 2   ? -2.644  -23.990 26.533  1.00   42.93 ? 2   DG  D N9    1 
ATOM   2944 C  C8    . DG  D 4 2   ? -1.290  -24.125 26.735  1.00   42.28 ? 2   DG  D C8    1 
ATOM   2945 N  N7    . DG  D 4 2   ? -0.771  -23.137 27.412  1.00   41.18 ? 2   DG  D N7    1 
ATOM   2946 C  C5    . DG  D 4 2   ? -1.846  -22.301 27.680  1.00   42.28 ? 2   DG  D C5    1 
ATOM   2947 C  C6    . DG  D 4 2   ? -1.899  -21.064 28.384  1.00   40.86 ? 2   DG  D C6    1 
ATOM   2948 O  O6    . DG  D 4 2   ? -0.974  -20.435 28.908  1.00   40.01 ? 2   DG  D O6    1 
ATOM   2949 N  N1    . DG  D 4 2   ? -3.190  -20.548 28.413  1.00   41.77 ? 2   DG  D N1    1 
ATOM   2950 C  C2    . DG  D 4 2   ? -4.291  -21.140 27.840  1.00   43.51 ? 2   DG  D C2    1 
ATOM   2951 N  N2    . DG  D 4 2   ? -5.454  -20.485 27.984  1.00   44.20 ? 2   DG  D N2    1 
ATOM   2952 N  N3    . DG  D 4 2   ? -4.256  -22.292 27.182  1.00   43.22 ? 2   DG  D N3    1 
ATOM   2953 C  C4    . DG  D 4 2   ? -3.008  -22.806 27.131  1.00   42.63 ? 2   DG  D C4    1 
ATOM   2954 P  P     . DT  D 4 3   ? -5.265  -26.093 22.215  1.00   48.07 ? 3   DT  D P     1 
ATOM   2955 O  OP1   . DT  D 4 3   ? -6.517  -26.782 21.822  1.00   50.09 ? 3   DT  D OP1   1 
ATOM   2956 O  OP2   . DT  D 4 3   ? -4.046  -26.217 21.354  1.00   45.99 ? 3   DT  D OP2   1 
ATOM   2957 O  "O5'" . DT  D 4 3   ? -5.577  -24.545 22.421  1.00   45.69 ? 3   DT  D "O5'" 1 
ATOM   2958 C  "C5'" . DT  D 4 3   ? -6.582  -24.128 23.378  1.00   45.98 ? 3   DT  D "C5'" 1 
ATOM   2959 C  "C4'" . DT  D 4 3   ? -6.649  -22.620 23.470  1.00   42.74 ? 3   DT  D "C4'" 1 
ATOM   2960 O  "O4'" . DT  D 4 3   ? -5.541  -22.119 24.243  1.00   39.42 ? 3   DT  D "O4'" 1 
ATOM   2961 C  "C3'" . DT  D 4 3   ? -6.629  -21.860 22.140  1.00   41.88 ? 3   DT  D "C3'" 1 
ATOM   2962 O  "O3'" . DT  D 4 3   ? -7.839  -21.101 22.174  1.00   44.28 ? 3   DT  D "O3'" 1 
ATOM   2963 C  "C2'" . DT  D 4 3   ? -5.425  -20.936 22.241  1.00   39.19 ? 3   DT  D "C2'" 1 
ATOM   2964 C  "C1'" . DT  D 4 3   ? -5.164  -20.867 23.740  1.00   39.44 ? 3   DT  D "C1'" 1 
ATOM   2965 N  N1    . DT  D 4 3   ? -3.770  -20.623 24.151  1.00   38.13 ? 3   DT  D N1    1 
ATOM   2966 C  C2    . DT  D 4 3   ? -3.515  -19.463 24.845  1.00   38.36 ? 3   DT  D C2    1 
ATOM   2967 O  O2    . DT  D 4 3   ? -4.377  -18.639 25.103  1.00   40.59 ? 3   DT  D O2    1 
ATOM   2968 N  N3    . DT  D 4 3   ? -2.208  -19.298 25.224  1.00   37.89 ? 3   DT  D N3    1 
ATOM   2969 C  C4    . DT  D 4 3   ? -1.148  -20.142 24.954  1.00   37.84 ? 3   DT  D C4    1 
ATOM   2970 O  O4    . DT  D 4 3   ? -0.023  -19.852 25.351  1.00   38.99 ? 3   DT  D O4    1 
ATOM   2971 C  C5    . DT  D 4 3   ? -1.487  -21.345 24.224  1.00   37.80 ? 3   DT  D C5    1 
ATOM   2972 C  C7    . DT  D 4 3   ? -0.407  -22.332 23.908  1.00   38.00 ? 3   DT  D C7    1 
ATOM   2973 C  C6    . DT  D 4 3   ? -2.766  -21.524 23.869  1.00   37.63 ? 3   DT  D C6    1 
ATOM   2974 P  P     . DA  D 4 4   ? -8.301  -20.215 20.927  1.00   46.84 ? 4   DA  D P     1 
ATOM   2975 O  OP1   . DA  D 4 4   ? -9.794  -20.284 20.874  1.00   48.42 ? 4   DA  D OP1   1 
ATOM   2976 O  OP2   . DA  D 4 4   ? -7.507  -20.606 19.730  1.00   44.06 ? 4   DA  D OP2   1 
ATOM   2977 O  "O5'" . DA  D 4 4   ? -7.810  -18.755 21.365  1.00   45.89 ? 4   DA  D "O5'" 1 
ATOM   2978 C  "C5'" . DA  D 4 4   ? -8.367  -18.125 22.550  1.00   43.86 ? 4   DA  D "C5'" 1 
ATOM   2979 C  "C4'" . DA  D 4 4   ? -7.826  -16.721 22.711  1.00   40.79 ? 4   DA  D "C4'" 1 
ATOM   2980 O  "O4'" . DA  D 4 4   ? -6.436  -16.801 23.108  1.00   36.28 ? 4   DA  D "O4'" 1 
ATOM   2981 C  "C3'" . DA  D 4 4   ? -7.868  -15.834 21.456  1.00   41.32 ? 4   DA  D "C3'" 1 
ATOM   2982 O  "O3'" . DA  D 4 4   ? -8.452  -14.561 21.813  1.00   43.92 ? 4   DA  D "O3'" 1 
ATOM   2983 C  "C2'" . DA  D 4 4   ? -6.408  -15.788 21.020  1.00   38.06 ? 4   DA  D "C2'" 1 
ATOM   2984 C  "C1'" . DA  D 4 4   ? -5.666  -15.916 22.342  1.00   36.89 ? 4   DA  D "C1'" 1 
ATOM   2985 N  N9    . DA  D 4 4   ? -4.314  -16.464 22.286  1.00   36.07 ? 4   DA  D N9    1 
ATOM   2986 C  C8    . DA  D 4 4   ? -3.903  -17.629 21.687  1.00   35.55 ? 4   DA  D C8    1 
ATOM   2987 N  N7    . DA  D 4 4   ? -2.633  -17.902 21.877  1.00   35.17 ? 4   DA  D N7    1 
ATOM   2988 C  C5    . DA  D 4 4   ? -2.179  -16.850 22.659  1.00   34.78 ? 4   DA  D C5    1 
ATOM   2989 C  C6    . DA  D 4 4   ? -0.911  -16.538 23.182  1.00   36.22 ? 4   DA  D C6    1 
ATOM   2990 N  N6    . DA  D 4 4   ? 0.174   -17.295 22.994  1.00   38.04 ? 4   DA  D N6    1 
ATOM   2991 N  N1    . DA  D 4 4   ? -0.798  -15.422 23.936  1.00   36.11 ? 4   DA  D N1    1 
ATOM   2992 C  C2    . DA  D 4 4   ? -1.889  -14.667 24.129  1.00   36.92 ? 4   DA  D C2    1 
ATOM   2993 N  N3    . DA  D 4 4   ? -3.135  -14.856 23.691  1.00   36.48 ? 4   DA  D N3    1 
ATOM   2994 C  C4    . DA  D 4 4   ? -3.213  -15.976 22.950  1.00   36.01 ? 4   DA  D C4    1 
ATOM   2995 P  P     . DT  D 4 5   ? -8.653  -13.357 20.739  1.00   46.95 ? 5   DT  D P     1 
ATOM   2996 O  OP1   . DT  D 4 5   ? -9.977  -12.717 21.020  1.00   53.29 ? 5   DT  D OP1   1 
ATOM   2997 O  OP2   . DT  D 4 5   ? -8.389  -13.874 19.342  1.00   41.18 ? 5   DT  D OP2   1 
ATOM   2998 O  "O5'" . DT  D 4 5   ? -7.539  -12.297 21.183  1.00   44.03 ? 5   DT  D "O5'" 1 
ATOM   2999 C  "C5'" . DT  D 4 5   ? -7.155  -12.132 22.581  1.00   40.93 ? 5   DT  D "C5'" 1 
ATOM   3000 C  "C4'" . DT  D 4 5   ? -5.883  -11.317 22.712  1.00   41.09 ? 5   DT  D "C4'" 1 
ATOM   3001 O  "O4'" . DT  D 4 5   ? -4.684  -12.137 22.661  1.00   39.44 ? 5   DT  D "O4'" 1 
ATOM   3002 C  "C3'" . DT  D 4 5   ? -5.671  -10.183 21.704  1.00   40.91 ? 5   DT  D "C3'" 1 
ATOM   3003 O  "O3'" . DT  D 4 5   ? -5.665  -9.000  22.514  1.00   42.82 ? 5   DT  D "O3'" 1 
ATOM   3004 C  "C2'" . DT  D 4 5   ? -4.323  -10.491 21.062  1.00   38.07 ? 5   DT  D "C2'" 1 
ATOM   3005 C  "C1'" . DT  D 4 5   ? -3.637  -11.383 22.079  1.00   38.13 ? 5   DT  D "C1'" 1 
ATOM   3006 N  N1    . DT  D 4 5   ? -2.675  -12.337 21.493  1.00   35.55 ? 5   DT  D N1    1 
ATOM   3007 C  C2    . DT  D 4 5   ? -1.376  -12.352 21.952  1.00   36.81 ? 5   DT  D C2    1 
ATOM   3008 O  O2    . DT  D 4 5   ? -0.961  -11.587 22.808  1.00   39.39 ? 5   DT  D O2    1 
ATOM   3009 N  N3    . DT  D 4 5   ? -0.570  -13.294 21.355  1.00   35.31 ? 5   DT  D N3    1 
ATOM   3010 C  C4    . DT  D 4 5   ? -0.935  -14.207 20.380  1.00   34.63 ? 5   DT  D C4    1 
ATOM   3011 O  O4    . DT  D 4 5   ? -0.103  -14.986 19.925  1.00   33.31 ? 5   DT  D O4    1 
ATOM   3012 C  C5    . DT  D 4 5   ? -2.311  -14.138 19.955  1.00   33.59 ? 5   DT  D C5    1 
ATOM   3013 C  C7    . DT  D 4 5   ? -2.796  -15.100 18.918  1.00   32.85 ? 5   DT  D C7    1 
ATOM   3014 C  C6    . DT  D 4 5   ? -3.099  -13.216 20.520  1.00   33.59 ? 5   DT  D C6    1 
ATOM   3015 P  P     . DC  D 4 6   ? -5.059  -7.588  21.994  1.00   45.03 ? 6   DC  D P     1 
ATOM   3016 O  OP1   . DC  D 4 6   ? -5.621  -6.529  22.870  1.00   49.26 ? 6   DC  D OP1   1 
ATOM   3017 O  OP2   . DC  D 4 6   ? -5.266  -7.507  20.533  1.00   44.94 ? 6   DC  D OP2   1 
ATOM   3018 O  "O5'" . DC  D 4 6   ? -3.510  -7.668  22.396  1.00   43.60 ? 6   DC  D "O5'" 1 
ATOM   3019 C  "C5'" . DC  D 4 6   ? -3.142  -7.648  23.794  1.00   43.58 ? 6   DC  D "C5'" 1 
ATOM   3020 C  "C4'" . DC  D 4 6   ? -1.664  -7.384  23.978  1.00   43.49 ? 6   DC  D "C4'" 1 
ATOM   3021 O  "O4'" . DC  D 4 6   ? -0.857  -8.458  23.427  1.00   40.15 ? 6   DC  D "O4'" 1 
ATOM   3022 C  "C3'" . DC  D 4 6   ? -1.158  -6.100  23.329  1.00   45.34 ? 6   DC  D "C3'" 1 
ATOM   3023 O  "O3'" . DC  D 4 6   ? -0.275  -5.524  24.286  1.00   50.29 ? 6   DC  D "O3'" 1 
ATOM   3024 C  "C2'" . DC  D 4 6   ? -0.433  -6.594  22.090  1.00   42.79 ? 6   DC  D "C2'" 1 
ATOM   3025 C  "C1'" . DC  D 4 6   ? 0.114   -7.937  22.542  1.00   39.76 ? 6   DC  D "C1'" 1 
ATOM   3026 N  N1    . DC  D 4 6   ? 0.314   -8.921  21.463  1.00   37.06 ? 6   DC  D N1    1 
ATOM   3027 C  C2    . DC  D 4 6   ? 1.573   -9.522  21.306  1.00   36.41 ? 6   DC  D C2    1 
ATOM   3028 O  O2    . DC  D 4 6   ? 2.496   -9.186  22.055  1.00   37.08 ? 6   DC  D O2    1 
ATOM   3029 N  N3    . DC  D 4 6   ? 1.762   -10.414 20.306  1.00   35.40 ? 6   DC  D N3    1 
ATOM   3030 C  C4    . DC  D 4 6   ? 0.744   -10.744 19.507  1.00   34.90 ? 6   DC  D C4    1 
ATOM   3031 N  N4    . DC  D 4 6   ? 0.965   -11.657 18.560  1.00   32.28 ? 6   DC  D N4    1 
ATOM   3032 C  C5    . DC  D 4 6   ? -0.553  -10.160 19.655  1.00   37.50 ? 6   DC  D C5    1 
ATOM   3033 C  C6    . DC  D 4 6   ? -0.720  -9.262  20.637  1.00   37.30 ? 6   DC  D C6    1 
ATOM   3034 P  P     . DC  D 4 7   ? 0.162   -3.980  24.187  1.00   55.83 ? 7   DC  D P     1 
ATOM   3035 O  OP1   . DC  D 4 7   ? 0.297   -3.483  25.565  1.00   57.94 ? 7   DC  D OP1   1 
ATOM   3036 O  OP2   . DC  D 4 7   ? -0.733  -3.288  23.212  1.00   56.78 ? 7   DC  D OP2   1 
ATOM   3037 O  "O5'" . DC  D 4 7   ? 1.610   -4.080  23.541  1.00   53.80 ? 7   DC  D "O5'" 1 
ATOM   3038 C  "C5'" . DC  D 4 7   ? 2.660   -4.762  24.240  1.00   51.45 ? 7   DC  D "C5'" 1 
ATOM   3039 C  "C4'" . DC  D 4 7   ? 3.839   -4.945  23.319  1.00   50.98 ? 7   DC  D "C4'" 1 
ATOM   3040 O  "O4'" . DC  D 4 7   ? 3.516   -5.996  22.382  1.00   49.54 ? 7   DC  D "O4'" 1 
ATOM   3041 C  "C3'" . DC  D 4 7   ? 4.200   -3.719  22.468  1.00   49.95 ? 7   DC  D "C3'" 1 
ATOM   3042 O  "O3'" . DC  D 4 7   ? 5.494   -3.217  22.839  1.00   51.40 ? 7   DC  D "O3'" 1 
ATOM   3043 C  "C2'" . DC  D 4 7   ? 4.153   -4.228  21.032  1.00   47.84 ? 7   DC  D "C2'" 1 
ATOM   3044 C  "C1'" . DC  D 4 7   ? 4.250   -5.733  21.204  1.00   47.39 ? 7   DC  D "C1'" 1 
ATOM   3045 N  N1    . DC  D 4 7   ? 3.700   -6.575  20.125  1.00   42.22 ? 7   DC  D N1    1 
ATOM   3046 C  C2    . DC  D 4 7   ? 4.567   -7.425  19.427  1.00   40.74 ? 7   DC  D C2    1 
ATOM   3047 O  O2    . DC  D 4 7   ? 5.772   -7.417  19.711  1.00   41.29 ? 7   DC  D O2    1 
ATOM   3048 N  N3    . DC  D 4 7   ? 4.074   -8.207  18.438  1.00   38.89 ? 7   DC  D N3    1 
ATOM   3049 C  C4    . DC  D 4 7   ? 2.771   -8.173  18.151  1.00   37.37 ? 7   DC  D C4    1 
ATOM   3050 N  N4    . DC  D 4 7   ? 2.326   -8.971  17.181  1.00   35.44 ? 7   DC  D N4    1 
ATOM   3051 C  C5    . DC  D 4 7   ? 1.865   -7.312  18.844  1.00   37.24 ? 7   DC  D C5    1 
ATOM   3052 C  C6    . DC  D 4 7   ? 2.363   -6.561  19.833  1.00   39.43 ? 7   DC  D C6    1 
ATOM   3053 P  P     . DT  D 4 8   ? 6.088   -1.900  22.151  1.00   54.18 ? 8   DT  D P     1 
ATOM   3054 O  OP1   . DT  D 4 8   ? 6.935   -1.209  23.134  1.00   57.44 ? 8   DT  D OP1   1 
ATOM   3055 O  OP2   . DT  D 4 8   ? 4.970   -1.175  21.474  1.00   52.11 ? 8   DT  D OP2   1 
ATOM   3056 O  "O5'" . DT  D 4 8   ? 7.070   -2.462  21.024  1.00   53.17 ? 8   DT  D "O5'" 1 
ATOM   3057 C  "C5'" . DT  D 4 8   ? 8.153   -3.361  21.353  1.00   53.77 ? 8   DT  D "C5'" 1 
ATOM   3058 C  "C4'" . DT  D 4 8   ? 8.771   -3.907  20.086  1.00   52.37 ? 8   DT  D "C4'" 1 
ATOM   3059 O  "O4'" . DT  D 4 8   ? 7.840   -4.780  19.414  1.00   46.98 ? 8   DT  D "O4'" 1 
ATOM   3060 C  "C3'" . DT  D 4 8   ? 9.176   -2.844  19.064  1.00   53.62 ? 8   DT  D "C3'" 1 
ATOM   3061 O  "O3'" . DT  D 4 8   ? 10.602  -2.835  18.998  1.00   56.65 ? 8   DT  D "O3'" 1 
ATOM   3062 C  "C2'" . DT  D 4 8   ? 8.553   -3.302  17.756  1.00   49.39 ? 8   DT  D "C2'" 1 
ATOM   3063 C  "C1'" . DT  D 4 8   ? 8.084   -4.718  18.031  1.00   47.33 ? 8   DT  D "C1'" 1 
ATOM   3064 N  N1    . DT  D 4 8   ? 6.837   -5.108  17.350  1.00   44.27 ? 8   DT  D N1    1 
ATOM   3065 C  C2    . DT  D 4 8   ? 6.855   -6.234  16.555  1.00   42.13 ? 8   DT  D C2    1 
ATOM   3066 O  O2    . DT  D 4 8   ? 7.860   -6.892  16.351  1.00   42.65 ? 8   DT  D O2    1 
ATOM   3067 N  N3    . DT  D 4 8   ? 5.649   -6.549  15.985  1.00   39.14 ? 8   DT  D N3    1 
ATOM   3068 C  C4    . DT  D 4 8   ? 4.448   -5.887  16.150  1.00   37.96 ? 8   DT  D C4    1 
ATOM   3069 O  O4    . DT  D 4 8   ? 3.441   -6.310  15.598  1.00   35.20 ? 8   DT  D O4    1 
ATOM   3070 C  C5    . DT  D 4 8   ? 4.498   -4.720  17.002  1.00   40.41 ? 8   DT  D C5    1 
ATOM   3071 C  C7    . DT  D 4 8   ? 3.244   -3.937  17.235  1.00   40.40 ? 8   DT  D C7    1 
ATOM   3072 C  C6    . DT  D 4 8   ? 5.671   -4.405  17.569  1.00   42.34 ? 8   DT  D C6    1 
ATOM   3073 P  P     . DC  D 4 9   ? 11.373  -1.867  17.991  1.00   60.75 ? 9   DC  D P     1 
ATOM   3074 O  OP1   . DC  D 4 9   ? 12.761  -1.690  18.502  1.00   64.58 ? 9   DC  D OP1   1 
ATOM   3075 O  OP2   . DC  D 4 9   ? 10.528  -0.665  17.743  1.00   60.23 ? 9   DC  D OP2   1 
ATOM   3076 O  "O5'" . DC  D 4 9   ? 11.372  -2.692  16.623  1.00   56.52 ? 9   DC  D "O5'" 1 
ATOM   3077 C  "C5'" . DC  D 4 9   ? 12.034  -3.969  16.527  1.00   57.69 ? 9   DC  D "C5'" 1 
ATOM   3078 C  "C4'" . DC  D 4 9   ? 11.856  -4.583  15.156  1.00   55.84 ? 9   DC  D "C4'" 1 
ATOM   3079 O  "O4'" . DC  D 4 9   ? 10.490  -5.009  14.970  1.00   51.07 ? 9   DC  D "O4'" 1 
ATOM   3080 C  "C3'" . DC  D 4 9   ? 12.202  -3.705  13.946  1.00   56.75 ? 9   DC  D "C3'" 1 
ATOM   3081 O  "O3'" . DC  D 4 9   ? 13.304  -4.347  13.298  1.00   60.26 ? 9   DC  D "O3'" 1 
ATOM   3082 C  "C2'" . DC  D 4 9   ? 10.940  -3.726  13.096  1.00   51.80 ? 9   DC  D "C2'" 1 
ATOM   3083 C  "C1'" . DC  D 4 9   ? 10.199  -4.943  13.599  1.00   49.33 ? 9   DC  D "C1'" 1 
ATOM   3084 N  N1    . DC  D 4 9   ? 8.737   -4.865  13.451  1.00   45.29 ? 9   DC  D N1    1 
ATOM   3085 C  C2    . DC  D 4 9   ? 8.092   -5.850  12.697  1.00   42.62 ? 9   DC  D C2    1 
ATOM   3086 O  O2    . DC  D 4 9   ? 8.769   -6.761  12.194  1.00   42.69 ? 9   DC  D O2    1 
ATOM   3087 N  N3    . DC  D 4 9   ? 6.752   -5.782  12.527  1.00   38.74 ? 9   DC  D N3    1 
ATOM   3088 C  C4    . DC  D 4 9   ? 6.060   -4.775  13.065  1.00   37.69 ? 9   DC  D C4    1 
ATOM   3089 N  N4    . DC  D 4 9   ? 4.746   -4.736  12.842  1.00   34.66 ? 9   DC  D N4    1 
ATOM   3090 C  C5    . DC  D 4 9   ? 6.693   -3.745  13.824  1.00   39.91 ? 9   DC  D C5    1 
ATOM   3091 C  C6    . DC  D 4 9   ? 8.021   -3.833  13.996  1.00   43.91 ? 9   DC  D C6    1 
ATOM   3092 P  P     . DC  D 4 10  ? 13.944  -3.759  11.953  1.00   64.79 ? 10  DC  D P     1 
ATOM   3093 O  OP1   . DC  D 4 10  ? 15.395  -4.074  11.965  1.00   69.38 ? 10  DC  D OP1   1 
ATOM   3094 O  OP2   . DC  D 4 10  ? 13.494  -2.347  11.770  1.00   64.41 ? 10  DC  D OP2   1 
ATOM   3095 O  "O5'" . DC  D 4 10  ? 13.217  -4.620  10.828  1.00   60.03 ? 10  DC  D "O5'" 1 
ATOM   3096 C  "C5'" . DC  D 4 10  ? 13.229  -6.058  10.865  1.00   57.71 ? 10  DC  D "C5'" 1 
ATOM   3097 C  "C4'" . DC  D 4 10  ? 12.802  -6.592  9.517   1.00   56.58 ? 10  DC  D "C4'" 1 
ATOM   3098 O  "O4'" . DC  D 4 10  ? 11.358  -6.629  9.427   1.00   51.62 ? 10  DC  D "O4'" 1 
ATOM   3099 C  "C3'" . DC  D 4 10  ? 13.278  -5.763  8.329   1.00   58.64 ? 10  DC  D "C3'" 1 
ATOM   3100 O  "O3'" . DC  D 4 10  ? 13.743  -6.680  7.341   1.00   63.69 ? 10  DC  D "O3'" 1 
ATOM   3101 C  "C2'" . DC  D 4 10  ? 12.038  -4.991  7.909   1.00   55.32 ? 10  DC  D "C2'" 1 
ATOM   3102 C  "C1'" . DC  D 4 10  ? 10.917  -5.945  8.271   1.00   49.97 ? 10  DC  D "C1'" 1 
ATOM   3103 N  N1    . DC  D 4 10  ? 9.635   -5.317  8.599   1.00   46.36 ? 10  DC  D N1    1 
ATOM   3104 C  C2    . DC  D 4 10  ? 8.475   -5.738  7.931   1.00   43.73 ? 10  DC  D C2    1 
ATOM   3105 O  O2    . DC  D 4 10  ? 8.572   -6.594  7.042   1.00   49.11 ? 10  DC  D O2    1 
ATOM   3106 N  N3    . DC  D 4 10  ? 7.288   -5.172  8.248   1.00   39.66 ? 10  DC  D N3    1 
ATOM   3107 C  C4    . DC  D 4 10  ? 7.223   -4.263  9.224   1.00   41.20 ? 10  DC  D C4    1 
ATOM   3108 N  N4    . DC  D 4 10  ? 6.027   -3.744  9.517   1.00   37.70 ? 10  DC  D N4    1 
ATOM   3109 C  C5    . DC  D 4 10  ? 8.386   -3.828  9.930   1.00   43.93 ? 10  DC  D C5    1 
ATOM   3110 C  C6    . DC  D 4 10  ? 9.557   -4.386  9.598   1.00   45.63 ? 10  DC  D C6    1 
ATOM   3111 P  P     . DA  D 4 11  ? 14.776  -6.201  6.225   1.00   66.90 ? 11  DA  D P     1 
ATOM   3112 O  OP1   . DA  D 4 11  ? 16.094  -6.848  6.505   1.00   72.75 ? 11  DA  D OP1   1 
ATOM   3113 O  OP2   . DA  D 4 11  ? 14.696  -4.720  6.103   1.00   66.73 ? 11  DA  D OP2   1 
ATOM   3114 O  "O5'" . DA  D 4 11  ? 14.150  -6.787  4.882   1.00   63.55 ? 11  DA  D "O5'" 1 
ATOM   3115 C  "C5'" . DA  D 4 11  ? 13.844  -8.189  4.738   1.00   62.29 ? 11  DA  D "C5'" 1 
ATOM   3116 C  "C4'" . DA  D 4 11  ? 13.148  -8.457  3.421   1.00   59.88 ? 11  DA  D "C4'" 1 
ATOM   3117 O  "O4'" . DA  D 4 11  ? 11.762  -8.045  3.477   1.00   56.03 ? 11  DA  D "O4'" 1 
ATOM   3118 C  "C3'" . DA  D 4 11  ? 13.732  -7.774  2.190   1.00   62.12 ? 11  DA  D "C3'" 1 
ATOM   3119 O  "O3'" . DA  D 4 11  ? 13.582  -8.720  1.125   1.00   63.90 ? 11  DA  D "O3'" 1 
ATOM   3120 C  "C2'" . DA  D 4 11  ? 12.868  -6.530  2.027   1.00   58.37 ? 11  DA  D "C2'" 1 
ATOM   3121 C  "C1'" . DA  D 4 11  ? 11.511  -6.959  2.580   1.00   53.88 ? 11  DA  D "C1'" 1 
ATOM   3122 N  N9    . DA  D 4 11  ? 10.780  -5.942  3.331   1.00   49.48 ? 11  DA  D N9    1 
ATOM   3123 C  C8    . DA  D 4 11  ? 11.266  -5.092  4.295   1.00   51.22 ? 11  DA  D C8    1 
ATOM   3124 N  N7    . DA  D 4 11  ? 10.346  -4.342  4.851   1.00   48.76 ? 11  DA  D N7    1 
ATOM   3125 C  C5    . DA  D 4 11  ? 9.170   -4.741  4.230   1.00   46.53 ? 11  DA  D C5    1 
ATOM   3126 C  C6    . DA  D 4 11  ? 7.832   -4.319  4.367   1.00   43.05 ? 11  DA  D C6    1 
ATOM   3127 N  N6    . DA  D 4 11  ? 7.440   -3.356  5.207   1.00   43.41 ? 11  DA  D N6    1 
ATOM   3128 N  N1    . DA  D 4 11  ? 6.899   -4.928  3.602   1.00   40.47 ? 11  DA  D N1    1 
ATOM   3129 C  C2    . DA  D 4 11  ? 7.297   -5.870  2.737   1.00   41.27 ? 11  DA  D C2    1 
ATOM   3130 N  N3    . DA  D 4 11  ? 8.520   -6.351  2.517   1.00   43.64 ? 11  DA  D N3    1 
ATOM   3131 C  C4    . DA  D 4 11  ? 9.420   -5.741  3.307   1.00   46.10 ? 11  DA  D C4    1 
ATOM   3132 P  P     . DT  D 4 12  ? 13.947  -8.340  -0.385  1.00   65.06 ? 12  DT  D P     1 
ATOM   3133 O  OP1   . DT  D 4 12  ? 14.363  -9.574  -1.076  1.00   71.92 ? 12  DT  D OP1   1 
ATOM   3134 O  OP2   . DT  D 4 12  ? 14.845  -7.155  -0.384  1.00   68.17 ? 12  DT  D OP2   1 
ATOM   3135 O  "O5'" . DT  D 4 12  ? 12.542  -7.976  -1.028  1.00   61.44 ? 12  DT  D "O5'" 1 
ATOM   3136 C  "C5'" . DT  D 4 12  ? 11.361  -8.693  -0.626  1.00   57.77 ? 12  DT  D "C5'" 1 
ATOM   3137 C  "C4'" . DT  D 4 12  ? 10.187  -8.227  -1.451  1.00   55.81 ? 12  DT  D "C4'" 1 
ATOM   3138 O  "O4'" . DT  D 4 12  ? 9.498   -7.162  -0.764  1.00   54.26 ? 12  DT  D "O4'" 1 
ATOM   3139 C  "C3'" . DT  D 4 12  ? 10.537  -7.665  -2.825  1.00   59.96 ? 12  DT  D "C3'" 1 
ATOM   3140 O  "O3'" . DT  D 4 12  ? 9.424   -8.024  -3.649  1.00   59.98 ? 12  DT  D "O3'" 1 
ATOM   3141 C  "C2'" . DT  D 4 12  ? 10.599  -6.162  -2.582  1.00   58.29 ? 12  DT  D "C2'" 1 
ATOM   3142 C  "C1'" . DT  D 4 12  ? 9.502   -5.972  -1.546  1.00   53.73 ? 12  DT  D "C1'" 1 
ATOM   3143 N  N1    . DT  D 4 12  ? 9.659   -4.838  -0.613  1.00   51.98 ? 12  DT  D N1    1 
ATOM   3144 C  C2    . DT  D 4 12  ? 8.513   -4.234  -0.132  1.00   48.21 ? 12  DT  D C2    1 
ATOM   3145 O  O2    . DT  D 4 12  ? 7.391   -4.541  -0.498  1.00   44.38 ? 12  DT  D O2    1 
ATOM   3146 N  N3    . DT  D 4 12  ? 8.737   -3.228  0.777   1.00   49.00 ? 12  DT  D N3    1 
ATOM   3147 C  C4    . DT  D 4 12  ? 9.958   -2.806  1.273   1.00   51.75 ? 12  DT  D C4    1 
ATOM   3148 O  O4    . DT  D 4 12  ? 9.999   -1.893  2.094   1.00   56.91 ? 12  DT  D O4    1 
ATOM   3149 C  C5    . DT  D 4 12  ? 11.114  -3.508  0.752   1.00   53.77 ? 12  DT  D C5    1 
ATOM   3150 C  C7    . DT  D 4 12  ? 12.480  -3.106  1.218   1.00   53.10 ? 12  DT  D C7    1 
ATOM   3151 C  C6    . DT  D 4 12  ? 10.907  -4.485  -0.142  1.00   54.17 ? 12  DT  D C6    1 
ATOM   3152 P  P     . DT  D 4 13  ? 9.508   -7.861  -5.219  1.00   59.74 ? 13  DT  D P     1 
ATOM   3153 O  OP1   . DT  D 4 13  ? 9.493   -9.214  -5.817  1.00   65.92 ? 13  DT  D OP1   1 
ATOM   3154 O  OP2   . DT  D 4 13  ? 10.618  -6.915  -5.536  1.00   65.66 ? 13  DT  D OP2   1 
ATOM   3155 O  "O5'" . DT  D 4 13  ? 8.104   -7.214  -5.586  1.00   53.92 ? 13  DT  D "O5'" 1 
ATOM   3156 C  "C5'" . DT  D 4 13  ? 6.907   -7.648  -4.933  1.00   50.64 ? 13  DT  D "C5'" 1 
ATOM   3157 C  "C4'" . DT  D 4 13  ? 5.893   -6.533  -5.027  1.00   49.02 ? 13  DT  D "C4'" 1 
ATOM   3158 O  "O4'" . DT  D 4 13  ? 6.243   -5.462  -4.107  1.00   51.68 ? 13  DT  D "O4'" 1 
ATOM   3159 C  "C3'" . DT  D 4 13  ? 5.831   -5.888  -6.413  1.00   49.45 ? 13  DT  D "C3'" 1 
ATOM   3160 O  "O3'" . DT  D 4 13  ? 4.520   -5.384  -6.627  1.00   47.85 ? 13  DT  D "O3'" 1 
ATOM   3161 C  "C2'" . DT  D 4 13  ? 6.681   -4.634  -6.252  1.00   52.20 ? 13  DT  D "C2'" 1 
ATOM   3162 C  "C1'" . DT  D 4 13  ? 6.307   -4.231  -4.830  1.00   52.29 ? 13  DT  D "C1'" 1 
ATOM   3163 N  N1    . DT  D 4 13  ? 7.221   -3.287  -4.100  1.00   52.08 ? 13  DT  D N1    1 
ATOM   3164 C  C2    . DT  D 4 13  ? 6.680   -2.513  -3.088  1.00   50.81 ? 13  DT  D C2    1 
ATOM   3165 O  O2    . DT  D 4 13  ? 5.508   -2.585  -2.740  1.00   52.03 ? 13  DT  D O2    1 
ATOM   3166 N  N3    . DT  D 4 13  ? 7.572   -1.664  -2.476  1.00   50.02 ? 13  DT  D N3    1 
ATOM   3167 C  C4    . DT  D 4 13  ? 8.910   -1.497  -2.779  1.00   52.72 ? 13  DT  D C4    1 
ATOM   3168 O  O4    . DT  D 4 13  ? 9.588   -0.695  -2.134  1.00   55.94 ? 13  DT  D O4    1 
ATOM   3169 C  C5    . DT  D 4 13  ? 9.408   -2.332  -3.859  1.00   54.53 ? 13  DT  D C5    1 
ATOM   3170 C  C7    . DT  D 4 13  ? 10.852  -2.241  -4.241  1.00   57.00 ? 13  DT  D C7    1 
ATOM   3171 C  C6    . DT  D 4 13  ? 8.547   -3.167  -4.459  1.00   52.85 ? 13  DT  D C6    1 
ATOM   3172 P  P     . DA  D 4 14  ? 3.266   -6.340  -7.014  1.00   42.62 ? 14  DA  D P     1 
ATOM   3173 O  OP1   . DA  D 4 14  ? 3.268   -7.505  -6.108  1.00   42.85 ? 14  DA  D OP1   1 
ATOM   3174 O  OP2   . DA  D 4 14  ? 3.289   -6.562  -8.486  1.00   43.58 ? 14  DA  D OP2   1 
ATOM   3175 O  "O5'" . DA  D 4 14  ? 2.056   -5.363  -6.661  1.00   37.65 ? 14  DA  D "O5'" 1 
ATOM   3176 C  "C5'" . DA  D 4 14  ? 1.712   -5.112  -5.276  1.00   35.27 ? 14  DA  D "C5'" 1 
ATOM   3177 C  "C4'" . DA  D 4 14  ? 1.361   -3.659  -5.036  1.00   33.08 ? 14  DA  D "C4'" 1 
ATOM   3178 O  "O4'" . DA  D 4 14  ? 2.552   -2.845  -4.933  1.00   33.54 ? 14  DA  D "O4'" 1 
ATOM   3179 C  "C3'" . DA  D 4 14  ? 0.470   -2.961  -6.066  1.00   31.90 ? 14  DA  D "C3'" 1 
ATOM   3180 O  "O3'" . DA  D 4 14  ? -0.361  -2.108  -5.276  1.00   30.89 ? 14  DA  D "O3'" 1 
ATOM   3181 C  "C2'" . DA  D 4 14  ? 1.454   -2.118  -6.861  1.00   32.37 ? 14  DA  D "C2'" 1 
ATOM   3182 C  "C1'" . DA  D 4 14  ? 2.473   -1.727  -5.805  1.00   33.11 ? 14  DA  D "C1'" 1 
ATOM   3183 N  N9    . DA  D 4 14  ? 3.829   -1.452  -6.288  1.00   35.17 ? 14  DA  D N9    1 
ATOM   3184 C  C8    . DA  D 4 14  ? 4.427   -1.933  -7.427  1.00   36.30 ? 14  DA  D C8    1 
ATOM   3185 N  N7    . DA  D 4 14  ? 5.672   -1.547  -7.574  1.00   38.21 ? 14  DA  D N7    1 
ATOM   3186 C  C5    . DA  D 4 14  ? 5.911   -0.752  -6.462  1.00   37.96 ? 14  DA  D C5    1 
ATOM   3187 C  C6    . DA  D 4 14  ? 7.045   -0.029  -6.034  1.00   39.69 ? 14  DA  D C6    1 
ATOM   3188 N  N6    . DA  D 4 14  ? 8.195   0.011   -6.699  1.00   42.08 ? 14  DA  D N6    1 
ATOM   3189 N  N1    . DA  D 4 14  ? 6.946   0.672   -4.887  1.00   38.99 ? 14  DA  D N1    1 
ATOM   3190 C  C2    . DA  D 4 14  ? 5.790   0.631   -4.210  1.00   37.43 ? 14  DA  D C2    1 
ATOM   3191 N  N3    . DA  D 4 14  ? 4.660   -0.010  -4.506  1.00   35.37 ? 14  DA  D N3    1 
ATOM   3192 C  C4    . DA  D 4 14  ? 4.783   -0.682  -5.663  1.00   36.48 ? 14  DA  D C4    1 
ATOM   3193 P  P     . DT  D 4 15  ? -1.701  -1.460  -5.845  1.00   30.59 ? 15  DT  D P     1 
ATOM   3194 O  OP1   . DT  D 4 15  ? -2.446  -0.935  -4.660  1.00   29.23 ? 15  DT  D OP1   1 
ATOM   3195 O  OP2   . DT  D 4 15  ? -2.369  -2.471  -6.733  1.00   29.49 ? 15  DT  D OP2   1 
ATOM   3196 O  "O5'" . DT  D 4 15  ? -1.156  -0.278  -6.763  1.00   30.07 ? 15  DT  D "O5'" 1 
ATOM   3197 C  "C5'" . DT  D 4 15  ? -1.139  1.100   -6.339  1.00   31.36 ? 15  DT  D "C5'" 1 
ATOM   3198 C  "C4'" . DT  D 4 15  ? -0.095  1.384   -5.280  1.00   31.88 ? 15  DT  D "C4'" 1 
ATOM   3199 O  "O4'" . DT  D 4 15  ? 1.265   1.149   -5.753  1.00   31.26 ? 15  DT  D "O4'" 1 
ATOM   3200 C  "C3'" . DT  D 4 15  ? -0.122  2.842   -4.818  1.00   32.09 ? 15  DT  D "C3'" 1 
ATOM   3201 O  "O3'" . DT  D 4 15  ? 0.103   2.864   -3.402  1.00   31.86 ? 15  DT  D "O3'" 1 
ATOM   3202 C  "C2'" . DT  D 4 15  ? 1.027   3.470   -5.587  1.00   33.30 ? 15  DT  D "C2'" 1 
ATOM   3203 C  "C1'" . DT  D 4 15  ? 2.036   2.332   -5.524  1.00   33.37 ? 15  DT  D "C1'" 1 
ATOM   3204 N  N1    . DT  D 4 15  ? 3.174   2.349   -6.470  1.00   34.36 ? 15  DT  D N1    1 
ATOM   3205 C  C2    . DT  D 4 15  ? 4.321   3.021   -6.108  1.00   36.60 ? 15  DT  D C2    1 
ATOM   3206 O  O2    . DT  D 4 15  ? 4.423   3.667   -5.076  1.00   38.50 ? 15  DT  D O2    1 
ATOM   3207 N  N3    . DT  D 4 15  ? 5.348   2.930   -7.017  1.00   38.52 ? 15  DT  D N3    1 
ATOM   3208 C  C4    . DT  D 4 15  ? 5.337   2.258   -8.227  1.00   38.08 ? 15  DT  D C4    1 
ATOM   3209 O  O4    . DT  D 4 15  ? 6.335   2.268   -8.942  1.00   41.25 ? 15  DT  D O4    1 
ATOM   3210 C  C5    . DT  D 4 15  ? 4.105   1.570   -8.538  1.00   35.49 ? 15  DT  D C5    1 
ATOM   3211 C  C7    . DT  D 4 15  ? 4.005   0.807   -9.821  1.00   35.04 ? 15  DT  D C7    1 
ATOM   3212 C  C6    . DT  D 4 15  ? 3.101   1.647   -7.657  1.00   34.05 ? 15  DT  D C6    1 
ATOM   3213 O  OP3   . DC  E 5 1   ? -0.120  4.621   -0.660  1.00   61.93 ? 16  DC  E OP3   1 
ATOM   3214 P  P     . DC  E 5 1   ? 0.421   5.855   -1.254  1.00   61.04 ? 16  DC  E P     1 
ATOM   3215 O  OP1   . DC  E 5 1   ? 1.915   5.775   -1.161  1.00   69.02 ? 16  DC  E OP1   1 
ATOM   3216 O  OP2   . DC  E 5 1   ? -0.256  7.050   -0.695  1.00   59.26 ? 16  DC  E OP2   1 
ATOM   3217 O  "O5'" . DC  E 5 1   ? -0.061  5.656   -2.769  1.00   55.50 ? 16  DC  E "O5'" 1 
ATOM   3218 C  "C5'" . DC  E 5 1   ? -0.165  6.731   -3.724  1.00   50.37 ? 16  DC  E "C5'" 1 
ATOM   3219 C  "C4'" . DC  E 5 1   ? 1.182   7.402   -3.888  1.00   51.87 ? 16  DC  E "C4'" 1 
ATOM   3220 O  "O4'" . DC  E 5 1   ? 2.067   6.602   -4.701  1.00   51.37 ? 16  DC  E "O4'" 1 
ATOM   3221 C  "C3'" . DC  E 5 1   ? 1.132   8.778   -4.542  1.00   48.15 ? 16  DC  E "C3'" 1 
ATOM   3222 O  "O3'" . DC  E 5 1   ? 1.688   9.708   -3.615  1.00   51.04 ? 16  DC  E "O3'" 1 
ATOM   3223 C  "C2'" . DC  E 5 1   ? 2.047   8.658   -5.751  1.00   47.32 ? 16  DC  E "C2'" 1 
ATOM   3224 C  "C1'" . DC  E 5 1   ? 2.922   7.456   -5.427  1.00   51.28 ? 16  DC  E "C1'" 1 
ATOM   3225 N  N1    . DC  E 5 1   ? 3.361   6.739   -6.638  1.00   48.02 ? 16  DC  E N1    1 
ATOM   3226 C  C2    . DC  E 5 1   ? 4.720   6.739   -6.988  1.00   51.09 ? 16  DC  E C2    1 
ATOM   3227 O  O2    . DC  E 5 1   ? 5.539   7.293   -6.237  1.00   56.52 ? 16  DC  E O2    1 
ATOM   3228 N  N3    . DC  E 5 1   ? 5.106   6.126   -8.128  1.00   50.25 ? 16  DC  E N3    1 
ATOM   3229 C  C4    . DC  E 5 1   ? 4.202   5.518   -8.900  1.00   45.62 ? 16  DC  E C4    1 
ATOM   3230 N  N4    . DC  E 5 1   ? 4.635   4.927   -10.014 1.00   45.19 ? 16  DC  E N4    1 
ATOM   3231 C  C5    . DC  E 5 1   ? 2.808   5.526   -8.583  1.00   41.47 ? 16  DC  E C5    1 
ATOM   3232 C  C6    . DC  E 5 1   ? 2.436   6.143   -7.455  1.00   42.85 ? 16  DC  E C6    1 
ATOM   3233 P  P     . DA  E 5 2   ? 1.552   11.275  -3.876  1.00   51.30 ? 17  DA  E P     1 
ATOM   3234 O  OP1   . DA  E 5 2   ? 1.847   11.968  -2.584  1.00   57.07 ? 17  DA  E OP1   1 
ATOM   3235 O  OP2   . DA  E 5 2   ? 0.261   11.512  -4.599  1.00   44.95 ? 17  DA  E OP2   1 
ATOM   3236 O  "O5'" . DA  E 5 2   ? 2.719   11.591  -4.894  1.00   51.54 ? 17  DA  E "O5'" 1 
ATOM   3237 C  "C5'" . DA  E 5 2   ? 4.069   11.504  -4.454  1.00   58.52 ? 17  DA  E "C5'" 1 
ATOM   3238 C  "C4'" . DA  E 5 2   ? 4.947   11.691  -5.661  1.00   58.54 ? 17  DA  E "C4'" 1 
ATOM   3239 O  "O4'" . DA  E 5 2   ? 4.812   10.578  -6.564  1.00   52.96 ? 17  DA  E "O4'" 1 
ATOM   3240 C  "C3'" . DA  E 5 2   ? 4.600   12.932  -6.481  1.00   58.80 ? 17  DA  E "C3'" 1 
ATOM   3241 O  "O3'" . DA  E 5 2   ? 5.769   13.727  -6.411  1.00   69.60 ? 17  DA  E "O3'" 1 
ATOM   3242 C  "C2'" . DA  E 5 2   ? 4.471   12.415  -7.905  1.00   53.40 ? 17  DA  E "C2'" 1 
ATOM   3243 C  "C1'" . DA  E 5 2   ? 5.202   11.094  -7.811  1.00   52.83 ? 17  DA  E "C1'" 1 
ATOM   3244 N  N9    . DA  E 5 2   ? 4.872   10.122  -8.850  1.00   47.84 ? 17  DA  E N9    1 
ATOM   3245 C  C8    . DA  E 5 2   ? 3.645   9.627   -9.211  1.00   42.68 ? 17  DA  E C8    1 
ATOM   3246 N  N7    . DA  E 5 2   ? 3.685   8.809   -10.234 1.00   40.16 ? 17  DA  E N7    1 
ATOM   3247 C  C5    . DA  E 5 2   ? 5.026   8.783   -10.588 1.00   44.75 ? 17  DA  E C5    1 
ATOM   3248 C  C6    . DA  E 5 2   ? 5.724   8.112   -11.611 1.00   45.28 ? 17  DA  E C6    1 
ATOM   3249 N  N6    . DA  E 5 2   ? 5.141   7.299   -12.495 1.00   40.99 ? 17  DA  E N6    1 
ATOM   3250 N  N1    . DA  E 5 2   ? 7.056   8.320   -11.702 1.00   49.45 ? 17  DA  E N1    1 
ATOM   3251 C  C2    . DA  E 5 2   ? 7.639   9.139   -10.816 1.00   53.18 ? 17  DA  E C2    1 
ATOM   3252 N  N3    . DA  E 5 2   ? 7.094   9.814   -9.806  1.00   52.65 ? 17  DA  E N3    1 
ATOM   3253 C  C4    . DA  E 5 2   ? 5.768   9.598   -9.752  1.00   48.70 ? 17  DA  E C4    1 
ATOM   3254 P  P     . DG  E 5 3   ? 5.700   15.326  -6.358  1.00   78.29 ? 18  DG  E P     1 
ATOM   3255 O  OP1   . DG  E 5 3   ? 6.197   15.753  -5.005  1.00   82.13 ? 18  DG  E OP1   1 
ATOM   3256 O  OP2   . DG  E 5 3   ? 4.353   15.766  -6.831  1.00   68.84 ? 18  DG  E OP2   1 
ATOM   3257 O  "O5'" . DG  E 5 3   ? 6.686   15.764  -7.539  1.00   77.97 ? 18  DG  E "O5'" 1 
ATOM   3258 C  "C5'" . DG  E 5 3   ? 8.084   15.387  -7.591  1.00   77.41 ? 18  DG  E "C5'" 1 
ATOM   3259 C  "C4'" . DG  E 5 3   ? 8.508   15.083  -9.015  1.00   72.88 ? 18  DG  E "C4'" 1 
ATOM   3260 O  "O4'" . DG  E 5 3   ? 7.806   13.899  -9.479  1.00   64.75 ? 18  DG  E "O4'" 1 
ATOM   3261 C  "C3'" . DG  E 5 3   ? 8.229   16.172  -10.067 1.00   69.58 ? 18  DG  E "C3'" 1 
ATOM   3262 O  "O3'" . DG  E 5 3   ? 9.407   16.701  -10.703 1.00   74.15 ? 18  DG  E "O3'" 1 
ATOM   3263 C  "C2'" . DG  E 5 3   ? 7.461   15.430  -11.145 1.00   63.58 ? 18  DG  E "C2'" 1 
ATOM   3264 C  "C1'" . DG  E 5 3   ? 7.833   13.989  -10.865 1.00   59.39 ? 18  DG  E "C1'" 1 
ATOM   3265 N  N9    . DG  E 5 3   ? 6.901   13.027  -11.436 1.00   52.16 ? 18  DG  E N9    1 
ATOM   3266 C  C8    . DG  E 5 3   ? 5.546   12.916  -11.219 1.00   44.47 ? 18  DG  E C8    1 
ATOM   3267 N  N7    . DG  E 5 3   ? 4.978   12.016  -11.978 1.00   39.70 ? 18  DG  E N7    1 
ATOM   3268 C  C5    . DG  E 5 3   ? 6.013   11.535  -12.770 1.00   43.74 ? 18  DG  E C5    1 
ATOM   3269 C  C6    . DG  E 5 3   ? 6.012   10.541  -13.788 1.00   41.55 ? 18  DG  E C6    1 
ATOM   3270 O  O6    . DG  E 5 3   ? 5.053   9.900   -14.238 1.00   37.43 ? 18  DG  E O6    1 
ATOM   3271 N  N1    . DG  E 5 3   ? 7.290   10.348  -14.315 1.00   45.27 ? 18  DG  E N1    1 
ATOM   3272 C  C2    . DG  E 5 3   ? 8.419   11.023  -13.917 1.00   49.73 ? 18  DG  E C2    1 
ATOM   3273 N  N2    . DG  E 5 3   ? 9.564   10.715  -14.556 1.00   54.53 ? 18  DG  E N2    1 
ATOM   3274 N  N3    . DG  E 5 3   ? 8.430   11.946  -12.970 1.00   52.46 ? 18  DG  E N3    1 
ATOM   3275 C  C4    . DG  E 5 3   ? 7.202   12.161  -12.456 1.00   48.74 ? 18  DG  E C4    1 
ATOM   3276 P  P     . DG  E 5 4   ? 9.298   17.841  -11.868 1.00   69.85 ? 19  DG  E P     1 
ATOM   3277 O  OP1   . DG  E 5 4   ? 10.294  18.894  -11.602 1.00   76.39 ? 19  DG  E OP1   1 
ATOM   3278 O  OP2   . DG  E 5 4   ? 7.853   18.184  -12.075 1.00   65.63 ? 19  DG  E OP2   1 
ATOM   3279 O  "O5'" . DG  E 5 4   ? 9.736   17.079  -13.199 1.00   68.67 ? 19  DG  E "O5'" 1 
ATOM   3280 C  "C5'" . DG  E 5 4   ? 11.064  16.523  -13.365 1.00   74.40 ? 19  DG  E "C5'" 1 
ATOM   3281 C  "C4'" . DG  E 5 4   ? 11.132  15.668  -14.611 1.00   69.19 ? 19  DG  E "C4'" 1 
ATOM   3282 O  "O4'" . DG  E 5 4   ? 10.110  14.644  -14.572 1.00   61.77 ? 19  DG  E "O4'" 1 
ATOM   3283 C  "C3'" . DG  E 5 4   ? 10.921  16.419  -15.929 1.00   66.80 ? 19  DG  E "C3'" 1 
ATOM   3284 O  "O3'" . DG  E 5 4   ? 12.125  16.483  -16.708 1.00   73.97 ? 19  DG  E "O3'" 1 
ATOM   3285 C  "C2'" . DG  E 5 4   ? 9.867   15.604  -16.659 1.00   58.19 ? 19  DG  E "C2'" 1 
ATOM   3286 C  "C1'" . DG  E 5 4   ? 9.813   14.301  -15.896 1.00   56.68 ? 19  DG  E "C1'" 1 
ATOM   3287 N  N9    . DG  E 5 4   ? 8.467   13.747  -15.939 1.00   50.05 ? 19  DG  E N9    1 
ATOM   3288 C  C8    . DG  E 5 4   ? 7.402   14.064  -15.131 1.00   47.31 ? 19  DG  E C8    1 
ATOM   3289 N  N7    . DG  E 5 4   ? 6.303   13.447  -15.471 1.00   43.66 ? 19  DG  E N7    1 
ATOM   3290 C  C5    . DG  E 5 4   ? 6.646   12.741  -16.616 1.00   42.48 ? 19  DG  E C5    1 
ATOM   3291 C  C6    . DG  E 5 4   ? 5.863   11.908  -17.449 1.00   38.42 ? 19  DG  E C6    1 
ATOM   3292 O  O6    . DG  E 5 4   ? 4.668   11.629  -17.348 1.00   34.37 ? 19  DG  E O6    1 
ATOM   3293 N  N1    . DG  E 5 4   ? 6.609   11.389  -18.500 1.00   39.86 ? 19  DG  E N1    1 
ATOM   3294 C  C2    . DG  E 5 4   ? 7.943   11.633  -18.719 1.00   44.85 ? 19  DG  E C2    1 
ATOM   3295 N  N2    . DG  E 5 4   ? 8.491   11.031  -19.783 1.00   46.19 ? 19  DG  E N2    1 
ATOM   3296 N  N3    . DG  E 5 4   ? 8.686   12.405  -17.948 1.00   47.65 ? 19  DG  E N3    1 
ATOM   3297 C  C4    . DG  E 5 4   ? 7.976   12.929  -16.926 1.00   46.70 ? 19  DG  E C4    1 
ATOM   3298 P  P     . DT  E 5 5   ? 12.122  17.181  -18.151 1.00   76.99 ? 20  DT  E P     1 
ATOM   3299 O  OP1   . DT  E 5 5   ? 13.501  17.607  -18.475 1.00   84.49 ? 20  DT  E OP1   1 
ATOM   3300 O  OP2   . DT  E 5 5   ? 11.003  18.161  -18.211 1.00   73.60 ? 20  DT  E OP2   1 
ATOM   3301 O  "O5'" . DT  E 5 5   ? 11.683  15.999  -19.121 1.00   72.21 ? 20  DT  E "O5'" 1 
ATOM   3302 C  "C5'" . DT  E 5 5   ? 12.497  14.832  -19.315 1.00   71.84 ? 20  DT  E "C5'" 1 
ATOM   3303 C  "C4'" . DT  E 5 5   ? 12.099  14.218  -20.634 1.00   66.50 ? 20  DT  E "C4'" 1 
ATOM   3304 O  "O4'" . DT  E 5 5   ? 10.737  13.738  -20.538 1.00   56.80 ? 20  DT  E "O4'" 1 
ATOM   3305 C  "C3'" . DT  E 5 5   ? 12.111  15.206  -21.798 1.00   66.31 ? 20  DT  E "C3'" 1 
ATOM   3306 O  "O3'" . DT  E 5 5   ? 12.642  14.526  -22.938 1.00   71.49 ? 20  DT  E "O3'" 1 
ATOM   3307 C  "C2'" . DT  E 5 5   ? 10.649  15.582  -21.958 1.00   58.54 ? 20  DT  E "C2'" 1 
ATOM   3308 C  "C1'" . DT  E 5 5   ? 9.980   14.276  -21.601 1.00   54.70 ? 20  DT  E "C1'" 1 
ATOM   3309 N  N1    . DT  E 5 5   ? 8.594   14.349  -21.151 1.00   48.58 ? 20  DT  E N1    1 
ATOM   3310 C  C2    . DT  E 5 5   ? 7.660   13.616  -21.847 1.00   45.31 ? 20  DT  E C2    1 
ATOM   3311 O  O2    . DT  E 5 5   ? 7.920   12.990  -22.859 1.00   45.40 ? 20  DT  E O2    1 
ATOM   3312 N  N3    . DT  E 5 5   ? 6.393   13.671  -21.332 1.00   41.34 ? 20  DT  E N3    1 
ATOM   3313 C  C4    . DT  E 5 5   ? 5.975   14.353  -20.206 1.00   39.55 ? 20  DT  E C4    1 
ATOM   3314 O  O4    . DT  E 5 5   ? 4.799   14.293  -19.858 1.00   36.89 ? 20  DT  E O4    1 
ATOM   3315 C  C5    . DT  E 5 5   ? 7.011   15.072  -19.503 1.00   42.88 ? 20  DT  E C5    1 
ATOM   3316 C  C7    . DT  E 5 5   ? 6.651   15.835  -18.268 1.00   41.84 ? 20  DT  E C7    1 
ATOM   3317 C  C6    . DT  E 5 5   ? 8.256   15.036  -20.004 1.00   47.18 ? 20  DT  E C6    1 
ATOM   3318 P  P     . DG  E 5 6   ? 13.169  15.336  -24.203 1.00   72.81 ? 21  DG  E P     1 
ATOM   3319 O  OP1   . DG  E 5 6   ? 14.509  14.811  -24.539 1.00   79.41 ? 21  DG  E OP1   1 
ATOM   3320 O  OP2   . DG  E 5 6   ? 12.999  16.782  -23.941 1.00   71.88 ? 21  DG  E OP2   1 
ATOM   3321 O  "O5'" . DG  E 5 6   ? 12.156  14.854  -25.333 1.00   67.29 ? 21  DG  E "O5'" 1 
ATOM   3322 C  "C5'" . DG  E 5 6   ? 11.402  13.638  -25.138 1.00   62.91 ? 21  DG  E "C5'" 1 
ATOM   3323 C  "C4'" . DG  E 5 6   ? 10.861  13.108  -26.447 1.00   63.54 ? 21  DG  E "C4'" 1 
ATOM   3324 O  "O4'" . DG  E 5 6   ? 9.423   12.988  -26.361 1.00   58.08 ? 21  DG  E "O4'" 1 
ATOM   3325 C  "C3'" . DG  E 5 6   ? 11.097  13.980  -27.671 1.00   65.98 ? 21  DG  E "C3'" 1 
ATOM   3326 O  "O3'" . DG  E 5 6   ? 10.949  13.125  -28.810 1.00   68.05 ? 21  DG  E "O3'" 1 
ATOM   3327 C  "C2'" . DG  E 5 6   ? 9.929   14.947  -27.607 1.00   60.01 ? 21  DG  E "C2'" 1 
ATOM   3328 C  "C1'" . DG  E 5 6   ? 8.804   14.081  -27.048 1.00   55.55 ? 21  DG  E "C1'" 1 
ATOM   3329 N  N9    . DG  E 5 6   ? 7.965   14.761  -26.079 1.00   49.47 ? 21  DG  E N9    1 
ATOM   3330 C  C8    . DG  E 5 6   ? 8.364   15.668  -25.127 1.00   50.32 ? 21  DG  E C8    1 
ATOM   3331 N  N7    . DG  E 5 6   ? 7.392   16.047  -24.344 1.00   47.42 ? 21  DG  E N7    1 
ATOM   3332 C  C5    . DG  E 5 6   ? 6.290   15.331  -24.792 1.00   43.80 ? 21  DG  E C5    1 
ATOM   3333 C  C6    . DG  E 5 6   ? 4.949   15.312  -24.321 1.00   41.14 ? 21  DG  E C6    1 
ATOM   3334 O  O6    . DG  E 5 6   ? 4.452   15.942  -23.375 1.00   41.56 ? 21  DG  E O6    1 
ATOM   3335 N  N1    . DG  E 5 6   ? 4.163   14.429  -25.057 1.00   39.62 ? 21  DG  E N1    1 
ATOM   3336 C  C2    . DG  E 5 6   ? 4.609   13.657  -26.103 1.00   41.78 ? 21  DG  E C2    1 
ATOM   3337 N  N2    . DG  E 5 6   ? 3.693   12.885  -26.704 1.00   41.84 ? 21  DG  E N2    1 
ATOM   3338 N  N3    . DG  E 5 6   ? 5.852   13.672  -26.553 1.00   43.93 ? 21  DG  E N3    1 
ATOM   3339 C  C4    . DG  E 5 6   ? 6.630   14.531  -25.862 1.00   44.88 ? 21  DG  E C4    1 
ATOM   3340 P  P     . DT  E 5 7   ? 11.119  13.684  -30.308 1.00   72.76 ? 22  DT  E P     1 
ATOM   3341 O  OP1   . DT  E 5 7   ? 11.595  12.576  -31.160 1.00   78.69 ? 22  DT  E OP1   1 
ATOM   3342 O  OP2   . DT  E 5 7   ? 11.894  14.952  -30.268 1.00   74.00 ? 22  DT  E OP2   1 
ATOM   3343 O  "O5'" . DT  E 5 7   ? 9.627   13.999  -30.761 1.00   66.88 ? 22  DT  E "O5'" 1 
ATOM   3344 C  "C5'" . DT  E 5 7   ? 8.547   13.063  -30.578 1.00   62.88 ? 22  DT  E "C5'" 1 
ATOM   3345 C  "C4'" . DT  E 5 7   ? 7.249   13.728  -30.972 1.00   59.85 ? 22  DT  E "C4'" 1 
ATOM   3346 O  "O4'" . DT  E 5 7   ? 6.716   14.440  -29.828 1.00   53.35 ? 22  DT  E "O4'" 1 
ATOM   3347 C  "C3'" . DT  E 5 7   ? 7.390   14.779  -32.076 1.00   62.29 ? 22  DT  E "C3'" 1 
ATOM   3348 O  "O3'" . DT  E 5 7   ? 6.208   14.782  -32.877 1.00   62.53 ? 22  DT  E "O3'" 1 
ATOM   3349 C  "C2'" . DT  E 5 7   ? 7.411   16.087  -31.305 1.00   58.53 ? 22  DT  E "C2'" 1 
ATOM   3350 C  "C1'" . DT  E 5 7   ? 6.403   15.762  -30.229 1.00   52.93 ? 22  DT  E "C1'" 1 
ATOM   3351 N  N1    . DT  E 5 7   ? 6.387   16.612  -29.030 1.00   48.97 ? 22  DT  E N1    1 
ATOM   3352 C  C2    . DT  E 5 7   ? 5.207   16.669  -28.316 1.00   44.54 ? 22  DT  E C2    1 
ATOM   3353 O  O2    . DT  E 5 7   ? 4.194   16.089  -28.660 1.00   42.57 ? 22  DT  E O2    1 
ATOM   3354 N  N3    . DT  E 5 7   ? 5.250   17.464  -27.199 1.00   42.67 ? 22  DT  E N3    1 
ATOM   3355 C  C4    . DT  E 5 7   ? 6.321   18.218  -26.755 1.00   46.86 ? 22  DT  E C4    1 
ATOM   3356 O  O4    . DT  E 5 7   ? 6.212   18.885  -25.732 1.00   48.07 ? 22  DT  E O4    1 
ATOM   3357 C  C5    . DT  E 5 7   ? 7.536   18.093  -27.541 1.00   50.21 ? 22  DT  E C5    1 
ATOM   3358 C  C7    . DT  E 5 7   ? 8.759   18.840  -27.115 1.00   53.30 ? 22  DT  E C7    1 
ATOM   3359 C  C6    . DT  E 5 7   ? 7.504   17.311  -28.627 1.00   50.74 ? 22  DT  E C6    1 
ATOM   3360 P  P     . DA  E 5 8   ? 6.253   14.311  -34.399 1.00   69.84 ? 23  DA  E P     1 
ATOM   3361 O  OP1   . DA  E 5 8   ? 6.918   12.984  -34.427 1.00   73.62 ? 23  DA  E OP1   1 
ATOM   3362 O  OP2   . DA  E 5 8   ? 6.807   15.424  -35.218 1.00   71.03 ? 23  DA  E OP2   1 
ATOM   3363 O  "O5'" . DA  E 5 8   ? 4.705   14.138  -34.734 1.00   66.72 ? 23  DA  E "O5'" 1 
ATOM   3364 C  "C5'" . DA  E 5 8   ? 3.888   13.260  -33.939 1.00   63.79 ? 23  DA  E "C5'" 1 
ATOM   3365 C  "C4'" . DA  E 5 8   ? 2.496   13.824  -33.769 1.00   60.50 ? 23  DA  E "C4'" 1 
ATOM   3366 O  "O4'" . DA  E 5 8   ? 2.453   14.771  -32.677 1.00   54.13 ? 23  DA  E "O4'" 1 
ATOM   3367 C  "C3'" . DA  E 5 8   ? 1.921   14.563  -34.972 1.00   64.16 ? 23  DA  E "C3'" 1 
ATOM   3368 O  "O3'" . DA  E 5 8   ? 0.531   14.243  -34.948 1.00   63.08 ? 23  DA  E "O3'" 1 
ATOM   3369 C  "C2'" . DA  E 5 8   ? 2.173   16.025  -34.636 1.00   61.77 ? 23  DA  E "C2'" 1 
ATOM   3370 C  "C1'" . DA  E 5 8   ? 1.978   16.031  -33.130 1.00   55.89 ? 23  DA  E "C1'" 1 
ATOM   3371 N  N9    . DA  E 5 8   ? 2.707   17.058  -32.391 1.00   52.61 ? 23  DA  E N9    1 
ATOM   3372 C  C8    . DA  E 5 8   ? 3.950   17.578  -32.651 1.00   55.34 ? 23  DA  E C8    1 
ATOM   3373 N  N7    . DA  E 5 8   ? 4.353   18.453  -31.762 1.00   53.19 ? 23  DA  E N7    1 
ATOM   3374 C  C5    . DA  E 5 8   ? 3.308   18.507  -30.850 1.00   49.54 ? 23  DA  E C5    1 
ATOM   3375 C  C6    . DA  E 5 8   ? 3.122   19.241  -29.663 1.00   47.27 ? 23  DA  E C6    1 
ATOM   3376 N  N6    . DA  E 5 8   ? 4.012   20.105  -29.179 1.00   47.88 ? 23  DA  E N6    1 
ATOM   3377 N  N1    . DA  E 5 8   ? 1.969   19.054  -28.983 1.00   44.89 ? 23  DA  E N1    1 
ATOM   3378 C  C2    . DA  E 5 8   ? 1.070   18.188  -29.471 1.00   44.22 ? 23  DA  E C2    1 
ATOM   3379 N  N3    . DA  E 5 8   ? 1.133   17.437  -30.569 1.00   46.73 ? 23  DA  E N3    1 
ATOM   3380 C  C4    . DA  E 5 8   ? 2.287   17.653  -31.226 1.00   49.33 ? 23  DA  E C4    1 
ATOM   3381 P  P     . DC  E 5 9   ? -0.424  14.711  -36.133 1.00   68.78 ? 24  DC  E P     1 
ATOM   3382 O  OP1   . DC  E 5 9   ? -1.484  13.680  -36.310 1.00   71.18 ? 24  DC  E OP1   1 
ATOM   3383 O  OP2   . DC  E 5 9   ? 0.426   15.119  -37.279 1.00   73.10 ? 24  DC  E OP2   1 
ATOM   3384 O  "O5'" . DC  E 5 9   ? -1.134  15.988  -35.505 1.00   65.64 ? 24  DC  E "O5'" 1 
ATOM   3385 C  "C5'" . DC  E 5 9   ? -1.914  15.865  -34.304 1.00   60.24 ? 24  DC  E "C5'" 1 
ATOM   3386 C  "C4'" . DC  E 5 9   ? -2.365  17.234  -33.862 1.00   59.47 ? 24  DC  E "C4'" 1 
ATOM   3387 O  "O4'" . DC  E 5 9   ? -1.283  17.914  -33.187 1.00   56.53 ? 24  DC  E "O4'" 1 
ATOM   3388 C  "C3'" . DC  E 5 9   ? -2.782  18.148  -35.017 1.00   64.99 ? 24  DC  E "C3'" 1 
ATOM   3389 O  "O3'" . DC  E 5 9   ? -4.000  18.764  -34.639 1.00   67.23 ? 24  DC  E "O3'" 1 
ATOM   3390 C  "C2'" . DC  E 5 9   ? -1.725  19.236  -35.029 1.00   64.53 ? 24  DC  E "C2'" 1 
ATOM   3391 C  "C1'" . DC  E 5 9   ? -1.327  19.265  -33.572 1.00   59.02 ? 24  DC  E "C1'" 1 
ATOM   3392 N  N1    . DC  E 5 9   ? -0.014  19.860  -33.301 1.00   57.17 ? 24  DC  E N1    1 
ATOM   3393 C  C2    . DC  E 5 9   ? 0.186   20.525  -32.088 1.00   54.02 ? 24  DC  E C2    1 
ATOM   3394 O  O2    . DC  E 5 9   ? -0.743  20.578  -31.274 1.00   49.59 ? 24  DC  E O2    1 
ATOM   3395 N  N3    . DC  E 5 9   ? 1.380   21.112  -31.845 1.00   53.92 ? 24  DC  E N3    1 
ATOM   3396 C  C4    . DC  E 5 9   ? 2.356   21.039  -32.751 1.00   57.70 ? 24  DC  E C4    1 
ATOM   3397 N  N4    . DC  E 5 9   ? 3.521   21.620  -32.460 1.00   58.08 ? 24  DC  E N4    1 
ATOM   3398 C  C5    . DC  E 5 9   ? 2.177   20.374  -33.999 1.00   60.84 ? 24  DC  E C5    1 
ATOM   3399 C  C6    . DC  E 5 9   ? 0.990   19.795  -34.226 1.00   60.03 ? 24  DC  E C6    1 
ATOM   3400 P  P     . DG  E 5 10  ? -5.067  19.109  -35.737 1.00   75.12 ? 25  DG  E P     1 
ATOM   3401 O  OP1   . DG  E 5 10  ? -5.936  17.921  -35.899 1.00   77.17 ? 25  DG  E OP1   1 
ATOM   3402 O  OP2   . DG  E 5 10  ? -4.367  19.709  -36.917 1.00   77.40 ? 25  DG  E OP2   1 
ATOM   3403 O  "O5'" . DG  E 5 10  ? -5.894  20.280  -35.053 1.00   74.73 ? 25  DG  E "O5'" 1 
ATOM   3404 C  "C5'" . DG  E 5 10  ? -6.218  20.255  -33.651 1.00   70.20 ? 25  DG  E "C5'" 1 
ATOM   3405 C  "C4'" . DG  E 5 10  ? -6.218  21.676  -33.139 1.00   72.77 ? 25  DG  E "C4'" 1 
ATOM   3406 O  "O4'" . DG  E 5 10  ? -4.850  22.014  -32.824 1.00   68.32 ? 25  DG  E "O4'" 1 
ATOM   3407 C  "C3'" . DG  E 5 10  ? -6.703  22.723  -34.153 1.00   79.50 ? 25  DG  E "C3'" 1 
ATOM   3408 O  "O3'" . DG  E 5 10  ? -7.742  23.574  -33.644 1.00   85.06 ? 25  DG  E "O3'" 1 
ATOM   3409 C  "C2'" . DG  E 5 10  ? -5.447  23.500  -34.516 1.00   79.59 ? 25  DG  E "C2'" 1 
ATOM   3410 C  "C1'" . DG  E 5 10  ? -4.570  23.311  -33.291 1.00   73.23 ? 25  DG  E "C1'" 1 
ATOM   3411 N  N9    . DG  E 5 10  ? -3.137  23.386  -33.536 1.00   72.04 ? 25  DG  E N9    1 
ATOM   3412 C  C8    . DG  E 5 10  ? -2.436  22.785  -34.552 1.00   71.29 ? 25  DG  E C8    1 
ATOM   3413 N  N7    . DG  E 5 10  ? -1.155  23.028  -34.505 1.00   71.12 ? 25  DG  E N7    1 
ATOM   3414 C  C5    . DG  E 5 10  ? -0.998  23.822  -33.377 1.00   70.01 ? 25  DG  E C5    1 
ATOM   3415 C  C6    . DG  E 5 10  ? 0.169   24.410  -32.819 1.00   68.79 ? 25  DG  E C6    1 
ATOM   3416 O  O6    . DG  E 5 10  ? 1.339   24.316  -33.205 1.00   67.93 ? 25  DG  E O6    1 
ATOM   3417 N  N1    . DG  E 5 10  ? -0.129  25.164  -31.689 1.00   66.52 ? 25  DG  E N1    1 
ATOM   3418 C  C2    . DG  E 5 10  ? -1.382  25.331  -31.158 1.00   67.68 ? 25  DG  E C2    1 
ATOM   3419 N  N2    . DG  E 5 10  ? -1.462  26.096  -30.062 1.00   65.90 ? 25  DG  E N2    1 
ATOM   3420 N  N3    . DG  E 5 10  ? -2.475  24.779  -31.660 1.00   69.89 ? 25  DG  E N3    1 
ATOM   3421 C  C4    . DG  E 5 10  ? -2.212  24.048  -32.765 1.00   70.63 ? 25  DG  E C4    1 
HETATM 3422 MG MG    . MG  F 6 .   ? -3.444  -0.307  -2.833  1.00   18.75 ? 401 MG  A MG    1 
HETATM 3423 MG MG    . MG  G 6 .   ? -1.503  2.898   -1.607  1.00   23.30 ? 402 MG  A MG    1 
HETATM 3424 O  O     . HOH H 7 .   ? -5.249  -1.625  -3.523  1.00   23.13 ? 501 HOH A O     1 
HETATM 3425 O  O     . HOH H 7 .   ? -2.252  -3.145  4.613   1.00   31.79 ? 502 HOH A O     1 
HETATM 3426 O  O     . HOH H 7 .   ? -4.104  33.782  -10.668 1.00   27.42 ? 503 HOH A O     1 
HETATM 3427 O  O     . HOH H 7 .   ? -4.062  2.194   20.006  1.00   36.95 ? 504 HOH A O     1 
HETATM 3428 O  O     . HOH H 7 .   ? 6.137   -1.298  16.987  1.00   35.54 ? 505 HOH A O     1 
HETATM 3429 O  O     . HOH H 7 .   ? -8.724  -17.200 18.040  1.00   41.07 ? 506 HOH A O     1 
HETATM 3430 O  O     . HOH H 7 .   ? -3.859  -4.346  -2.553  1.00   37.21 ? 507 HOH A O     1 
HETATM 3431 O  O     . HOH H 7 .   ? -5.414  -8.375  1.804   1.00   26.19 ? 508 HOH A O     1 
HETATM 3432 O  O     . HOH H 7 .   ? -7.463  -13.956 15.234  1.00   35.15 ? 509 HOH A O     1 
HETATM 3433 O  O     . HOH H 7 .   ? 2.309   -16.352 5.350   1.00   43.11 ? 510 HOH A O     1 
HETATM 3434 O  O     . HOH H 7 .   ? -6.023  -4.515  -6.801  1.00   26.80 ? 511 HOH A O     1 
HETATM 3435 O  O     . HOH H 7 .   ? -10.194 -6.798  -13.687 1.00   32.61 ? 512 HOH A O     1 
HETATM 3436 O  O     . HOH H 7 .   ? -11.449 -5.035  -11.668 1.00   33.68 ? 513 HOH A O     1 
HETATM 3437 O  O     . HOH H 7 .   ? 3.041   -2.227  13.827  1.00   36.15 ? 514 HOH A O     1 
HETATM 3438 O  O     . HOH H 7 .   ? -1.370  -1.856  14.994  1.00   31.54 ? 515 HOH A O     1 
HETATM 3439 O  O     . HOH H 7 .   ? -1.713  0.098   4.181   1.00   36.17 ? 516 HOH A O     1 
HETATM 3440 O  O     . HOH H 7 .   ? 6.554   5.653   12.387  1.00   39.51 ? 517 HOH A O     1 
HETATM 3441 O  O     . HOH H 7 .   ? -0.562  11.611  1.082   1.00   32.08 ? 518 HOH A O     1 
HETATM 3442 O  O     . HOH H 7 .   ? -11.078 16.526  -1.843  1.00   31.21 ? 519 HOH A O     1 
HETATM 3443 O  O     . HOH H 7 .   ? -14.486 8.278   13.219  1.00   41.34 ? 520 HOH A O     1 
HETATM 3444 O  O     . HOH H 7 .   ? -16.282 -7.067  1.330   1.00   32.93 ? 521 HOH A O     1 
HETATM 3445 O  O     . HOH H 7 .   ? -22.544 -6.108  -0.091  1.00   30.28 ? 522 HOH A O     1 
HETATM 3446 O  O     . HOH H 7 .   ? -21.829 -3.670  -1.171  1.00   33.31 ? 523 HOH A O     1 
HETATM 3447 O  O     . HOH H 7 .   ? -3.427  -28.966 4.158   1.00   53.86 ? 524 HOH A O     1 
HETATM 3448 O  O     . HOH H 7 .   ? -4.480  -10.848 -3.178  1.00   30.90 ? 525 HOH A O     1 
HETATM 3449 O  O     . HOH H 7 .   ? 11.360  31.342  -25.014 1.00   57.60 ? 526 HOH A O     1 
HETATM 3450 O  O     . HOH H 7 .   ? 1.990   26.068  -19.138 1.00   29.20 ? 527 HOH A O     1 
HETATM 3451 O  O     . HOH H 7 .   ? 3.501   27.885  -18.429 1.00   33.32 ? 528 HOH A O     1 
HETATM 3452 O  O     . HOH H 7 .   ? 1.815   23.954  -1.118  1.00   34.95 ? 529 HOH A O     1 
HETATM 3453 O  O     . HOH H 7 .   ? 5.363   4.314   -15.652 1.00   35.96 ? 530 HOH A O     1 
HETATM 3454 O  O     . HOH H 7 .   ? -20.480 11.615  4.596   1.00   37.08 ? 531 HOH A O     1 
HETATM 3455 O  O     . HOH H 7 .   ? 0.190   -13.343 7.363   1.00   44.98 ? 532 HOH A O     1 
HETATM 3456 O  O     . HOH H 7 .   ? 3.551   -15.748 11.121  1.00   46.24 ? 533 HOH A O     1 
HETATM 3457 O  O     . HOH H 7 .   ? 1.487   -17.606 8.337   1.00   35.96 ? 534 HOH A O     1 
HETATM 3458 O  O     . HOH H 7 .   ? 7.581   -24.725 18.512  1.00   43.50 ? 535 HOH A O     1 
HETATM 3459 O  O     . HOH H 7 .   ? -7.970  -6.863  18.280  1.00   36.22 ? 536 HOH A O     1 
HETATM 3460 O  O     . HOH H 7 .   ? -4.958  -12.515 17.983  1.00   37.15 ? 537 HOH A O     1 
HETATM 3461 O  O     . HOH H 7 .   ? 1.120   12.872  12.755  1.00   39.57 ? 538 HOH A O     1 
HETATM 3462 O  O     . HOH H 7 .   ? -1.631  13.235  12.582  1.00   49.24 ? 539 HOH A O     1 
HETATM 3463 O  O     . HOH H 7 .   ? -2.719  11.473  3.033   1.00   35.84 ? 540 HOH A O     1 
HETATM 3464 O  O     . HOH H 7 .   ? -4.741  9.977   2.406   1.00   28.32 ? 541 HOH A O     1 
HETATM 3465 O  O     . HOH H 7 .   ? -19.950 -3.479  12.400  1.00   31.62 ? 542 HOH A O     1 
HETATM 3466 O  O     . HOH H 7 .   ? 9.420   -0.121  13.195  1.00   37.79 ? 543 HOH A O     1 
HETATM 3467 O  O     . HOH H 7 .   ? -24.800 -1.692  0.906   1.00   32.71 ? 544 HOH A O     1 
HETATM 3468 O  O     . HOH H 7 .   ? -23.532 -2.097  -2.311  1.00   44.86 ? 545 HOH A O     1 
HETATM 3469 O  O     . HOH H 7 .   ? -19.491 -3.671  -2.973  1.00   33.57 ? 546 HOH A O     1 
HETATM 3470 O  O     . HOH H 7 .   ? -26.687 1.268   4.420   1.00   42.97 ? 547 HOH A O     1 
HETATM 3471 O  O     . HOH H 7 .   ? -6.604  -4.702  -4.296  1.00   36.00 ? 548 HOH A O     1 
HETATM 3472 O  O     . HOH H 7 .   ? -12.559 -30.485 12.624  1.00   50.82 ? 549 HOH A O     1 
HETATM 3473 O  O     . HOH H 7 .   ? 0.127   -20.477 -1.758  1.00   34.11 ? 550 HOH A O     1 
HETATM 3474 O  O     . HOH H 7 .   ? 2.182   -30.318 11.347  1.00   53.43 ? 551 HOH A O     1 
HETATM 3475 O  O     . HOH H 7 .   ? -11.645 -7.294  -8.869  1.00   52.07 ? 552 HOH A O     1 
HETATM 3476 O  O     . HOH H 7 .   ? 12.786  28.491  -23.173 1.00   67.75 ? 553 HOH A O     1 
HETATM 3477 O  O     . HOH H 7 .   ? -0.295  23.096  -19.919 1.00   30.06 ? 554 HOH A O     1 
HETATM 3478 O  O     . HOH H 7 .   ? -2.703  20.480  -17.344 1.00   32.20 ? 555 HOH A O     1 
HETATM 3479 O  O     . HOH H 7 .   ? -9.857  13.066  -20.551 1.00   30.05 ? 556 HOH A O     1 
HETATM 3480 O  O     . HOH H 7 .   ? -11.918 9.728   -21.735 1.00   38.85 ? 557 HOH A O     1 
HETATM 3481 O  O     . HOH H 7 .   ? 4.158   -6.712  -16.961 1.00   41.97 ? 558 HOH A O     1 
HETATM 3482 O  O     . HOH H 7 .   ? -9.385  25.263  -8.973  1.00   37.09 ? 559 HOH A O     1 
HETATM 3483 O  O     . HOH H 7 .   ? 6.182   21.032  -22.884 1.00   37.30 ? 560 HOH A O     1 
HETATM 3484 O  O     . HOH H 7 .   ? -4.807  -21.650 17.182  1.00   44.85 ? 561 HOH A O     1 
HETATM 3485 O  O     . HOH H 7 .   ? -18.473 -17.569 4.020   1.00   38.67 ? 562 HOH A O     1 
HETATM 3486 O  O     . HOH H 7 .   ? -16.734 -15.861 2.424   1.00   38.96 ? 563 HOH A O     1 
HETATM 3487 O  O     . HOH H 7 .   ? -23.864 -6.972  7.602   1.00   32.58 ? 564 HOH A O     1 
HETATM 3488 O  O     . HOH H 7 .   ? -18.642 -1.308  13.456  1.00   41.62 ? 565 HOH A O     1 
HETATM 3489 O  O     . HOH H 7 .   ? -18.656 1.072   11.982  1.00   35.52 ? 566 HOH A O     1 
HETATM 3490 O  O     . HOH H 7 .   ? -2.445  -6.761  19.112  1.00   43.85 ? 567 HOH A O     1 
HETATM 3491 O  O     . HOH H 7 .   ? -0.003  -8.649  15.948  1.00   45.48 ? 568 HOH A O     1 
HETATM 3492 O  O     . HOH H 7 .   ? 2.005   -2.638  9.122   1.00   45.73 ? 569 HOH A O     1 
HETATM 3493 O  O     . HOH H 7 .   ? -0.878  -3.105  6.888   1.00   40.54 ? 570 HOH A O     1 
HETATM 3494 O  O     . HOH H 7 .   ? -11.193 5.288   19.613  1.00   44.62 ? 571 HOH A O     1 
HETATM 3495 O  O     . HOH H 7 .   ? -18.444 -19.759 12.533  1.00   39.03 ? 572 HOH A O     1 
HETATM 3496 O  O     . HOH H 7 .   ? -22.046 -8.101  -1.366  1.00   41.38 ? 573 HOH A O     1 
HETATM 3497 O  O     . HOH H 7 .   ? -19.441 -8.578  -2.636  1.00   38.04 ? 574 HOH A O     1 
HETATM 3498 O  O     . HOH H 7 .   ? -25.301 -1.217  7.907   1.00   38.61 ? 575 HOH A O     1 
HETATM 3499 O  O     . HOH H 7 .   ? -23.169 -2.953  8.983   1.00   33.08 ? 576 HOH A O     1 
HETATM 3500 O  O     . HOH H 7 .   ? 0.781   8.269   -9.927  1.00   33.98 ? 577 HOH A O     1 
HETATM 3501 O  O     . HOH H 7 .   ? -1.134  7.300   -8.647  1.00   38.55 ? 578 HOH A O     1 
HETATM 3502 O  O     . HOH H 7 .   ? -10.730 -12.901 -6.082  1.00   50.71 ? 579 HOH A O     1 
HETATM 3503 O  O     . HOH H 7 .   ? -23.665 8.871   -0.979  1.00   35.29 ? 580 HOH A O     1 
HETATM 3504 O  O     . HOH H 7 .   ? -24.434 0.875   -3.396  1.00   32.48 ? 581 HOH A O     1 
HETATM 3505 O  O     . HOH H 7 .   ? -17.080 14.904  1.332   1.00   32.34 ? 582 HOH A O     1 
HETATM 3506 O  O     . HOH H 7 .   ? -16.997 8.130   12.669  1.00   37.40 ? 583 HOH A O     1 
HETATM 3507 O  O     . HOH H 7 .   ? -16.046 11.306  10.654  1.00   44.54 ? 584 HOH A O     1 
HETATM 3508 O  O     . HOH H 7 .   ? -9.210  6.699   18.185  1.00   30.05 ? 585 HOH A O     1 
HETATM 3509 O  O     . HOH H 7 .   ? -11.570 10.299  16.307  1.00   44.21 ? 586 HOH A O     1 
HETATM 3510 O  O     . HOH H 7 .   ? 2.321   -15.252 2.786   1.00   31.66 ? 587 HOH A O     1 
HETATM 3511 O  O     . HOH H 7 .   ? -4.331  -26.647 18.571  1.00   40.84 ? 588 HOH A O     1 
HETATM 3512 O  O     . HOH H 7 .   ? -1.398  13.684  -4.286  1.00   28.44 ? 589 HOH A O     1 
HETATM 3513 O  O     . HOH I 7 .   ? -2.927  22.387  -19.278 1.00   26.89 ? 101 HOH B O     1 
HETATM 3514 O  O     . HOH I 7 .   ? -3.983  24.993  -19.992 1.00   27.34 ? 102 HOH B O     1 
HETATM 3515 O  O     . HOH I 7 .   ? -3.410  23.064  -28.385 1.00   51.93 ? 103 HOH B O     1 
HETATM 3516 O  O     . HOH I 7 .   ? -5.980  25.664  -24.458 1.00   53.57 ? 104 HOH B O     1 
HETATM 3517 O  O     . HOH I 7 .   ? -1.166  6.591   -22.708 1.00   41.88 ? 105 HOH B O     1 
HETATM 3518 O  O     . HOH J 7 .   ? -1.415  -15.440 3.112   1.00   30.97 ? 101 HOH C O     1 
HETATM 3519 O  O     . HOH J 7 .   ? 2.880   0.368   -2.509  1.00   38.83 ? 102 HOH C O     1 
HETATM 3520 O  O     . HOH J 7 .   ? 8.019   -9.837  7.195   1.00   44.78 ? 103 HOH C O     1 
HETATM 3521 O  O     . HOH J 7 .   ? 9.780   -10.831 13.103  1.00   44.99 ? 104 HOH C O     1 
HETATM 3522 O  O     . HOH J 7 .   ? 10.595  -10.473 17.175  1.00   46.23 ? 105 HOH C O     1 
HETATM 3523 O  O     . HOH J 7 .   ? -2.281  -13.683 4.957   1.00   37.20 ? 106 HOH C O     1 
HETATM 3524 O  O     . HOH J 7 .   ? 1.520   -9.997  11.304  1.00   40.97 ? 107 HOH C O     1 
HETATM 3525 O  O     . HOH J 7 .   ? -14.011 -19.678 30.718  1.00   50.71 ? 108 HOH C O     1 
HETATM 3526 O  O     . HOH J 7 .   ? 6.366   -14.445 28.950  1.00   62.23 ? 109 HOH C O     1 
HETATM 3527 O  O     . HOH J 7 .   ? 2.296   2.904   -1.450  1.00   43.83 ? 110 HOH C O     1 
HETATM 3528 O  O     . HOH K 7 .   ? -2.667  -2.155  -2.084  1.00   28.92 ? 101 HOH D O     1 
HETATM 3529 O  O     . HOH K 7 .   ? -6.440  -14.792 17.796  1.00   28.81 ? 102 HOH D O     1 
HETATM 3530 O  O     . HOH K 7 .   ? 8.350   -0.182  16.217  1.00   45.59 ? 103 HOH D O     1 
HETATM 3531 O  O     . HOH K 7 .   ? -2.667  -33.169 27.328  1.00   45.88 ? 104 HOH D O     1 
HETATM 3532 O  O     . HOH K 7 .   ? -5.194  -19.539 19.299  1.00   34.37 ? 105 HOH D O     1 
HETATM 3533 O  O     . HOH K 7 .   ? 5.956   0.186   19.281  1.00   36.35 ? 106 HOH D O     1 
HETATM 3534 O  O     . HOH K 7 .   ? 10.872  -8.437  11.235  1.00   47.98 ? 107 HOH D O     1 
HETATM 3535 O  O     . HOH K 7 .   ? 10.232  -7.736  16.540  1.00   44.27 ? 108 HOH D O     1 
HETATM 3536 O  O     . HOH L 7 .   ? -0.296  12.811  -1.150  1.00   26.97 ? 101 HOH E O     1 
HETATM 3537 O  O     . HOH L 7 .   ? -3.557  26.687  -26.785 1.00   42.15 ? 102 HOH E O     1 
HETATM 3538 O  O     . HOH L 7 .   ? 3.714   15.542  -8.805  1.00   40.28 ? 103 HOH E O     1 
HETATM 3539 O  O     . HOH L 7 .   ? 3.528   13.219  -15.204 1.00   34.22 ? 104 HOH E O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . GLY A 3   ? 0.4390 0.5590 0.7623 -0.0064 -0.2164 -0.0778 3   GLY A N     
2    C  CA    . GLY A 3   ? 0.4411 0.5181 0.7438 0.0103  0.0513  0.0064  3   GLY A CA    
3    C  C     . GLY A 3   ? 0.3517 0.5154 0.7079 -0.0538 0.0775  -0.0016 3   GLY A C     
4    O  O     . GLY A 3   ? 0.6119 1.0436 0.5034 0.0858  0.1857  -0.1521 3   GLY A O     
5    N  N     . GLU A 4   ? 0.9849 0.6133 0.8405 -0.1068 0.0754  0.1648  4   GLU A N     
6    C  CA    . GLU A 4   ? 0.5961 0.6148 0.7908 -0.0325 -0.0255 0.1475  4   GLU A CA    
7    C  C     . GLU A 4   ? 0.6623 0.5738 0.8997 -0.1257 0.0583  -0.0498 4   GLU A C     
8    O  O     . GLU A 4   ? 1.0284 0.6898 0.8800 0.0778  0.1504  -0.0658 4   GLU A O     
9    C  CB    . GLU A 4   ? 0.4670 0.7861 0.8671 0.0153  -0.0158 0.2099  4   GLU A CB    
10   C  CG    . GLU A 4   ? 0.5126 0.7044 1.1491 -0.0058 -0.0555 0.1286  4   GLU A CG    
11   C  CD    . GLU A 4   ? 0.5171 0.5602 1.1263 -0.0454 0.0199  0.0890  4   GLU A CD    
12   O  OE1   . GLU A 4   ? 0.6348 0.4615 1.2639 0.0581  0.0452  0.0263  4   GLU A OE1   
13   O  OE2   . GLU A 4   ? 0.5982 1.0656 0.8819 -0.1880 0.0772  0.0216  4   GLU A OE2   
14   N  N     . ASN A 5   ? 0.5228 0.5434 0.8155 -0.1379 -0.0133 0.0561  5   ASN A N     
15   C  CA    . ASN A 5   ? 0.4386 0.5141 0.5328 -0.0611 -0.0396 0.0116  5   ASN A CA    
16   C  C     . ASN A 5   ? 0.3392 0.4728 0.5440 0.0509  0.0915  -0.0236 5   ASN A C     
17   O  O     . ASN A 5   ? 0.3626 0.4943 0.5991 0.0137  0.0644  -0.1527 5   ASN A O     
18   C  CB    . ASN A 5   ? 0.3163 0.6349 0.4518 -0.0116 0.1210  0.0889  5   ASN A CB    
19   C  CG    . ASN A 5   ? 0.3061 0.7008 0.4929 0.0049  0.0103  -0.1078 5   ASN A CG    
20   O  OD1   . ASN A 5   ? 0.5240 0.6620 0.5134 0.0802  0.1276  -0.0609 5   ASN A OD1   
21   N  ND2   . ASN A 5   ? 0.2766 0.6921 0.3912 0.1178  0.0896  -0.0842 5   ASN A ND2   
22   N  N     . GLY A 6   ? 0.4095 0.4809 0.5571 0.0829  0.1311  0.0375  6   GLY A N     
23   C  CA    . GLY A 6   ? 0.3937 0.4665 0.8926 -0.0155 0.1770  0.0419  6   GLY A CA    
24   C  C     . GLY A 6   ? 0.3629 0.5526 0.7683 -0.0118 0.0953  0.0103  6   GLY A C     
25   O  O     . GLY A 6   ? 0.5367 0.5866 0.9029 -0.2170 -0.1374 0.0512  6   GLY A O     
26   N  N     . LYS A 7   ? 0.4416 0.5897 0.6822 0.0446  0.0944  0.0048  7   LYS A N     
27   C  CA    . LYS A 7   ? 0.4600 0.4313 0.5580 0.0427  0.1074  -0.0509 7   LYS A CA    
28   C  C     . LYS A 7   ? 0.5520 0.4852 0.4367 -0.0544 0.0772  -0.0163 7   LYS A C     
29   O  O     . LYS A 7   ? 0.3451 0.7012 0.5258 0.1009  0.1345  -0.1426 7   LYS A O     
30   C  CB    . LYS A 7   ? 0.4889 0.5216 0.5671 0.0956  0.1500  -0.0113 7   LYS A CB    
31   C  CG    . LYS A 7   ? 0.6655 0.5594 0.6880 0.0608  0.1347  -0.1414 7   LYS A CG    
32   C  CD    . LYS A 7   ? 0.6532 0.4141 0.6791 0.0855  0.1483  -0.0774 7   LYS A CD    
33   C  CE    . LYS A 7   ? 0.4407 0.5244 0.5988 0.1433  0.1633  -0.0409 7   LYS A CE    
34   N  NZ    . LYS A 7   ? 0.5556 0.6807 0.4421 0.1097  0.1744  0.1413  7   LYS A NZ    
35   N  N     . LEU A 8   ? 0.4176 0.5025 0.5355 -0.0821 0.0121  -0.0289 8   LEU A N     
36   C  CA    . LEU A 8   ? 0.2712 0.4691 0.4770 0.0571  0.0386  -0.0214 8   LEU A CA    
37   C  C     . LEU A 8   ? 0.2629 0.4953 0.4392 0.0177  0.1300  -0.0590 8   LEU A C     
38   O  O     . LEU A 8   ? 0.3550 0.6532 0.4089 0.0681  0.1808  0.0771  8   LEU A O     
39   C  CB    . LEU A 8   ? 0.3309 0.4410 0.4292 0.0506  0.0389  -0.0391 8   LEU A CB    
40   C  CG    . LEU A 8   ? 0.3296 0.4179 0.4013 0.0495  0.0262  -0.0296 8   LEU A CG    
41   C  CD1   . LEU A 8   ? 0.4768 0.4207 0.4493 -0.0042 -0.0118 0.0131  8   LEU A CD1   
42   C  CD2   . LEU A 8   ? 0.3264 0.4502 0.3802 0.0112  0.0050  -0.0222 8   LEU A CD2   
43   N  N     . ASN A 9   ? 0.2552 0.4875 0.4899 0.0443  0.0414  -0.0834 9   ASN A N     
44   C  CA    . ASN A 9   ? 0.2034 0.4396 0.5309 0.0820  0.0699  -0.0356 9   ASN A CA    
45   C  C     . ASN A 9   ? 0.2323 0.3997 0.4657 0.0237  0.0181  0.0059  9   ASN A C     
46   O  O     . ASN A 9   ? 0.2154 0.4046 0.4433 0.0326  -0.0452 -0.0480 9   ASN A O     
47   C  CB    . ASN A 9   ? 0.2410 0.5313 0.5771 0.0918  0.0249  0.0223  9   ASN A CB    
48   C  CG    . ASN A 9   ? 0.3831 0.5011 0.4925 0.1612  -0.0019 -0.0246 9   ASN A CG    
49   O  OD1   . ASN A 9   ? 0.5468 0.5134 0.4901 0.3557  0.1239  0.0647  9   ASN A OD1   
50   N  ND2   . ASN A 9   ? 0.3247 0.6616 0.5502 0.1689  -0.0010 -0.1057 9   ASN A ND2   
51   N  N     . PRO A 10  ? 0.1950 0.4220 0.4113 0.0559  0.0689  0.0163  10  PRO A N     
52   C  CA    . PRO A 10  ? 0.2175 0.4006 0.4158 0.0167  0.0630  0.0482  10  PRO A CA    
53   C  C     . PRO A 10  ? 0.2025 0.3768 0.4132 0.0297  0.0353  -0.0006 10  PRO A C     
54   O  O     . PRO A 10  ? 0.1933 0.3062 0.3679 -0.0034 0.0513  -0.0107 10  PRO A O     
55   C  CB    . PRO A 10  ? 0.1997 0.4372 0.4419 0.0222  0.0433  0.0608  10  PRO A CB    
56   C  CG    . PRO A 10  ? 0.2673 0.4374 0.5028 0.0338  0.0738  0.0400  10  PRO A CG    
57   C  CD    . PRO A 10  ? 0.1917 0.4483 0.4227 0.0322  0.0816  0.0346  10  PRO A CD    
58   N  N     . TRP A 11  ? 0.2097 0.3985 0.4128 -0.0128 0.0537  0.0319  11  TRP A N     
59   C  CA    . TRP A 11  ? 0.1640 0.3692 0.3757 -0.0311 0.0119  0.0525  11  TRP A CA    
60   C  C     . TRP A 11  ? 0.1685 0.3617 0.3986 -0.0259 0.0307  0.0273  11  TRP A C     
61   O  O     . TRP A 11  ? 0.1979 0.2622 0.4000 -0.0219 0.0004  0.0296  11  TRP A O     
62   C  CB    . TRP A 11  ? 0.1851 0.3377 0.4068 0.0174  0.0294  0.0760  11  TRP A CB    
63   C  CG    . TRP A 11  ? 0.1779 0.3799 0.3964 0.0182  0.0057  0.1076  11  TRP A CG    
64   C  CD1   . TRP A 11  ? 0.1994 0.4040 0.4059 0.0207  0.0118  0.1032  11  TRP A CD1   
65   C  CD2   . TRP A 11  ? 0.2122 0.3837 0.4049 0.0035  0.0013  0.1122  11  TRP A CD2   
66   N  NE1   . TRP A 11  ? 0.2285 0.4184 0.4769 -0.0150 0.0177  0.1641  11  TRP A NE1   
67   C  CE2   . TRP A 11  ? 0.2181 0.4462 0.4250 0.0006  -0.0203 0.1337  11  TRP A CE2   
68   C  CE3   . TRP A 11  ? 0.2132 0.3962 0.4172 0.0136  -0.0194 0.0998  11  TRP A CE3   
69   C  CZ2   . TRP A 11  ? 0.2965 0.4369 0.4359 0.0195  -0.0488 0.1437  11  TRP A CZ2   
70   C  CZ3   . TRP A 11  ? 0.2347 0.4110 0.4023 -0.0067 -0.0700 0.1145  11  TRP A CZ3   
71   C  CH2   . TRP A 11  ? 0.2282 0.4519 0.4105 -0.0125 -0.0290 0.1472  11  TRP A CH2   
72   N  N     . ALA A 12  ? 0.1748 0.3243 0.4061 -0.0198 0.0371  0.0519  12  ALA A N     
73   C  CA    . ALA A 12  ? 0.1787 0.3370 0.4169 -0.0249 -0.0116 -0.0025 12  ALA A CA    
74   C  C     . ALA A 12  ? 0.2013 0.3407 0.4079 -0.0111 0.0054  0.0066  12  ALA A C     
75   O  O     . ALA A 12  ? 0.2109 0.2754 0.4452 -0.0199 0.0094  -0.0053 12  ALA A O     
76   C  CB    . ALA A 12  ? 0.2210 0.3609 0.4089 -0.0364 -0.0296 -0.0235 12  ALA A CB    
77   N  N     . VAL A 13  ? 0.2010 0.3446 0.3939 -0.0126 -0.0013 0.0007  13  VAL A N     
78   C  CA    . VAL A 13  ? 0.2406 0.3186 0.3764 -0.0014 0.0188  -0.0002 13  VAL A CA    
79   C  C     . VAL A 13  ? 0.1921 0.3447 0.3843 -0.0157 0.0109  -0.0174 13  VAL A C     
80   O  O     . VAL A 13  ? 0.2161 0.2849 0.3714 0.0167  -0.0885 -0.0336 13  VAL A O     
81   C  CB    . VAL A 13  ? 0.2612 0.3139 0.3926 0.0193  0.0532  0.0005  13  VAL A CB    
82   C  CG1   . VAL A 13  ? 0.2992 0.3303 0.3811 0.0239  0.0386  0.0054  13  VAL A CG1   
83   C  CG2   . VAL A 13  ? 0.3252 0.3615 0.3888 0.0719  0.1496  -0.0264 13  VAL A CG2   
84   N  N     . VAL A 14  ? 0.2421 0.3614 0.3576 -0.0214 -0.0308 0.0086  14  VAL A N     
85   C  CA    . VAL A 14  ? 0.2109 0.3633 0.3890 -0.0458 0.0258  -0.0068 14  VAL A CA    
86   C  C     . VAL A 14  ? 0.1925 0.3449 0.3848 -0.0151 0.0152  0.0031  14  VAL A C     
87   O  O     . VAL A 14  ? 0.2559 0.2940 0.3518 -0.0133 0.0183  -0.0096 14  VAL A O     
88   C  CB    . VAL A 14  ? 0.1860 0.3791 0.3412 -0.0040 0.0238  -0.0112 14  VAL A CB    
89   C  CG1   . VAL A 14  ? 0.2022 0.3622 0.3171 0.0326  0.0216  0.0162  14  VAL A CG1   
90   C  CG2   . VAL A 14  ? 0.1741 0.3487 0.3848 -0.0540 0.0220  -0.0095 14  VAL A CG2   
91   N  N     . GLY A 15  ? 0.2253 0.3396 0.3423 -0.0282 0.0092  -0.0041 15  GLY A N     
92   C  CA    . GLY A 15  ? 0.1426 0.3261 0.3973 -0.0493 -0.0049 -0.0150 15  GLY A CA    
93   C  C     . GLY A 15  ? 0.1617 0.3069 0.3473 0.0060  -0.0156 -0.0137 15  GLY A C     
94   O  O     . GLY A 15  ? 0.1531 0.2751 0.3880 -0.0260 0.0119  -0.0219 15  GLY A O     
95   N  N     . PHE A 16  ? 0.1710 0.3139 0.3359 0.0039  -0.0215 -0.0161 16  PHE A N     
96   C  CA    . PHE A 16  ? 0.1789 0.3075 0.3283 0.0039  -0.0224 -0.0274 16  PHE A CA    
97   C  C     . PHE A 16  ? 0.1963 0.3108 0.3581 0.0096  -0.0037 -0.0174 16  PHE A C     
98   O  O     . PHE A 16  ? 0.2006 0.3431 0.2946 -0.0035 -0.0250 -0.0311 16  PHE A O     
99   C  CB    . PHE A 16  ? 0.1809 0.3484 0.2926 -0.0024 0.0005  -0.0154 16  PHE A CB    
100  C  CG    . PHE A 16  ? 0.1742 0.3259 0.3220 0.0217  -0.0094 -0.0287 16  PHE A CG    
101  C  CD1   . PHE A 16  ? 0.1983 0.3623 0.3121 0.0081  0.0128  -0.0301 16  PHE A CD1   
102  C  CD2   . PHE A 16  ? 0.2070 0.3806 0.3098 -0.0169 -0.0263 -0.0192 16  PHE A CD2   
103  C  CE1   . PHE A 16  ? 0.1844 0.3554 0.3355 0.0599  -0.0158 -0.0333 16  PHE A CE1   
104  C  CE2   . PHE A 16  ? 0.1728 0.3969 0.2922 0.0395  -0.0384 -0.0052 16  PHE A CE2   
105  C  CZ    . PHE A 16  ? 0.1893 0.3565 0.3162 0.0154  -0.0348 -0.0574 16  PHE A CZ    
106  N  N     . ILE A 17  ? 0.2259 0.3213 0.3221 0.0119  -0.0028 0.0257  17  ILE A N     
107  C  CA    . ILE A 17  ? 0.2198 0.3202 0.3391 0.0344  0.0320  0.0032  17  ILE A CA    
108  C  C     . ILE A 17  ? 0.2263 0.3111 0.3321 0.0239  -0.0134 -0.0009 17  ILE A C     
109  O  O     . ILE A 17  ? 0.2273 0.2903 0.3787 0.0192  0.0380  -0.0055 17  ILE A O     
110  C  CB    . ILE A 17  ? 0.2225 0.3399 0.3615 0.0136  0.0125  0.0275  17  ILE A CB    
111  C  CG1   . ILE A 17  ? 0.2299 0.3209 0.3832 -0.0075 -0.0144 -0.0007 17  ILE A CG1   
112  C  CG2   . ILE A 17  ? 0.2013 0.3346 0.3412 0.0134  0.0569  0.0201  17  ILE A CG2   
113  C  CD1   . ILE A 17  ? 0.2277 0.3636 0.3257 -0.0003 -0.0168 0.0390  17  ILE A CD1   
114  N  N     . ASP A 18  ? 0.1700 0.2789 0.3600 -0.0474 -0.0236 -0.0120 18  ASP A N     
115  C  CA    . ASP A 18  ? 0.1888 0.3373 0.3301 -0.0094 -0.0016 0.0250  18  ASP A CA    
116  C  C     . ASP A 18  ? 0.1916 0.3269 0.3506 -0.0068 0.0050  -0.0019 18  ASP A C     
117  O  O     . ASP A 18  ? 0.1972 0.2670 0.3547 -0.0068 -0.0332 0.0223  18  ASP A O     
118  C  CB    . ASP A 18  ? 0.1946 0.3771 0.2800 -0.0228 0.0131  0.0288  18  ASP A CB    
119  C  CG    . ASP A 18  ? 0.2152 0.3700 0.3022 -0.0032 -0.0049 0.0128  18  ASP A CG    
120  O  OD1   . ASP A 18  ? 0.2602 0.3654 0.2647 0.0014  -0.0222 -0.0207 18  ASP A OD1   
121  O  OD2   . ASP A 18  ? 0.2071 0.4237 0.2896 -0.0071 0.0051  0.0386  18  ASP A OD2   
122  N  N     . ALA A 19  ? 0.1931 0.3335 0.3030 -0.0042 -0.0038 -0.0039 19  ALA A N     
123  C  CA    . ALA A 19  ? 0.1740 0.3251 0.3219 0.0052  -0.0059 -0.0173 19  ALA A CA    
124  C  C     . ALA A 19  ? 0.1996 0.3393 0.3322 0.0175  -0.0108 -0.0087 19  ALA A C     
125  O  O     . ALA A 19  ? 0.2108 0.3025 0.3125 -0.0263 0.0268  0.0037  19  ALA A O     
126  C  CB    . ALA A 19  ? 0.1165 0.3206 0.3221 -0.0133 -0.0073 -0.0216 19  ALA A CB    
127  N  N     . GLU A 20  ? 0.1970 0.3399 0.3318 0.0118  0.0131  0.0282  20  GLU A N     
128  C  CA    . GLU A 20  ? 0.2893 0.3870 0.3238 0.0453  -0.0360 0.0002  20  GLU A CA    
129  C  C     . GLU A 20  ? 0.2559 0.3855 0.4045 0.0595  -0.0569 0.0269  20  GLU A C     
130  O  O     . GLU A 20  ? 0.2219 0.4253 0.4624 0.1574  -0.0302 -0.0232 20  GLU A O     
131  C  CB    . GLU A 20  ? 0.2337 0.3582 0.4059 -0.0197 0.0422  0.0092  20  GLU A CB    
132  C  CG    . GLU A 20  ? 0.3137 0.3774 0.3499 -0.0073 0.0272  0.0034  20  GLU A CG    
133  C  CD    . GLU A 20  ? 0.2022 0.5222 0.4249 -0.0023 -0.0252 0.0077  20  GLU A CD    
134  O  OE1   . GLU A 20  ? 0.2158 0.5881 0.5381 -0.0779 -0.1392 -0.1625 20  GLU A OE1   
135  O  OE2   . GLU A 20  ? 0.3490 0.5577 0.4545 -0.0004 -0.0489 0.0408  20  GLU A OE2   
136  N  N     . GLY A 21  ? 0.2400 0.3960 0.3495 0.0700  0.0128  0.0092  21  GLY A N     
137  C  CA    . GLY A 21  ? 0.3158 0.3620 0.3110 0.0484  -0.0064 -0.0279 21  GLY A CA    
138  C  C     . GLY A 21  ? 0.3059 0.4159 0.3389 0.1141  -0.0009 -0.0154 21  GLY A C     
139  O  O     . GLY A 21  ? 0.2511 0.5147 0.3342 0.1156  0.0235  0.0111  21  GLY A O     
140  N  N     . SER A 22  ? 0.3225 0.3745 0.3645 0.0222  -0.0476 -0.0144 22  SER A N     
141  C  CA    . SER A 22  ? 0.2377 0.3689 0.2869 0.0299  -0.0173 -0.0088 22  SER A CA    
142  C  C     . SER A 22  ? 0.2187 0.3362 0.3308 0.0376  -0.0134 -0.0082 22  SER A C     
143  O  O     . SER A 22  ? 0.2705 0.2669 0.3321 -0.0216 -0.0125 -0.0148 22  SER A O     
144  C  CB    . SER A 22  ? 0.2358 0.4449 0.3209 0.0059  -0.0041 -0.0210 22  SER A CB    
145  O  OG    . SER A 22  ? 0.2694 0.4860 0.3747 -0.0087 0.0404  -0.0316 22  SER A OG    
146  N  N     . PHE A 23  ? 0.2026 0.3109 0.3061 0.0752  -0.0202 0.0001  23  PHE A N     
147  C  CA    . PHE A 23  ? 0.2016 0.3507 0.3028 0.0676  0.0009  0.0087  23  PHE A CA    
148  C  C     . PHE A 23  ? 0.2520 0.3270 0.3271 0.0712  0.0006  -0.0130 23  PHE A C     
149  O  O     . PHE A 23  ? 0.2351 0.3577 0.3678 0.1137  0.0088  -0.0414 23  PHE A O     
150  C  CB    . PHE A 23  ? 0.2212 0.3300 0.2746 0.0538  0.0044  0.0001  23  PHE A CB    
151  C  CG    . PHE A 23  ? 0.1983 0.3535 0.3245 0.0552  -0.0160 0.0071  23  PHE A CG    
152  C  CD1   . PHE A 23  ? 0.1600 0.3786 0.3367 0.0310  -0.0221 -0.0123 23  PHE A CD1   
153  C  CD2   . PHE A 23  ? 0.2294 0.3143 0.3675 0.0414  0.0014  0.0201  23  PHE A CD2   
154  C  CE1   . PHE A 23  ? 0.2050 0.3356 0.3714 0.0140  -0.0106 0.0190  23  PHE A CE1   
155  C  CE2   . PHE A 23  ? 0.1576 0.3180 0.3989 0.0144  0.0209  0.0336  23  PHE A CE2   
156  C  CZ    . PHE A 23  ? 0.1731 0.3087 0.3477 0.0018  -0.0204 -0.0062 23  PHE A CZ    
157  N  N     . MET A 24  ? 0.2258 0.3296 0.3458 0.0427  0.0089  0.0564  24  MET A N     
158  C  CA    . MET A 24  ? 0.2455 0.3514 0.3847 0.0648  0.0397  0.0090  24  MET A CA    
159  C  C     . MET A 24  ? 0.2734 0.3554 0.3941 0.0625  0.0140  0.0210  24  MET A C     
160  O  O     . MET A 24  ? 0.1997 0.3918 0.4475 0.1015  -0.0057 0.0219  24  MET A O     
161  C  CB    . MET A 24  ? 0.2579 0.3802 0.3828 0.0496  0.0377  0.0013  24  MET A CB    
162  C  CG    . MET A 24  ? 0.2712 0.3792 0.3872 0.0372  0.0772  -0.0215 24  MET A CG    
163  S  SD    . MET A 24  ? 0.3671 0.4582 0.4533 -0.0688 0.0424  0.0519  24  MET A SD    
164  C  CE    . MET A 24  ? 0.2816 0.4433 0.5290 -0.0450 0.0620  0.0453  24  MET A CE    
165  N  N     . VAL A 25  ? 0.2797 0.4013 0.4270 0.1051  0.0248  0.0314  25  VAL A N     
166  C  CA    . VAL A 25  ? 0.2620 0.4259 0.4782 0.0831  0.0035  0.0547  25  VAL A CA    
167  C  C     . VAL A 25  ? 0.2590 0.4436 0.4623 0.1031  0.0322  0.0100  25  VAL A C     
168  O  O     . VAL A 25  ? 0.3040 0.4514 0.4549 0.0021  0.0507  -0.0413 25  VAL A O     
169  C  CB    . VAL A 25  ? 0.2850 0.4348 0.4645 0.0933  -0.0313 0.0443  25  VAL A CB    
170  C  CG1   . VAL A 25  ? 0.3273 0.4226 0.5050 0.1542  -0.0373 0.0399  25  VAL A CG1   
171  C  CG2   . VAL A 25  ? 0.2448 0.3421 0.3999 0.0486  0.0400  0.0759  25  VAL A CG2   
172  N  N     . ARG A 26  ? 0.2353 0.3798 0.4367 0.0853  0.0635  0.0322  26  ARG A N     
173  C  CA    . ARG A 26  ? 0.2541 0.4137 0.4982 0.0694  0.0202  0.0515  26  ARG A CA    
174  C  C     . ARG A 26  ? 0.3023 0.4037 0.5017 0.0642  0.0372  0.0344  26  ARG A C     
175  O  O     . ARG A 26  ? 0.3263 0.3944 0.4969 0.0783  0.0670  0.0023  26  ARG A O     
176  C  CB    . ARG A 26  ? 0.3503 0.4350 0.5054 0.0432  0.0096  0.0454  26  ARG A CB    
177  C  CG    . ARG A 26  ? 0.3016 0.4454 0.5138 0.0581  -0.0121 0.0898  26  ARG A CG    
178  C  CD    . ARG A 26  ? 0.2519 0.5495 0.5827 0.0605  -0.0416 0.0625  26  ARG A CD    
179  N  NE    . ARG A 26  ? 0.3054 0.4955 0.6094 0.1149  -0.0594 0.1456  26  ARG A NE    
180  C  CZ    . ARG A 26  ? 0.3172 0.5301 0.5874 0.0632  -0.0387 0.1475  26  ARG A CZ    
181  N  NH1   . ARG A 26  ? 0.3584 0.4987 0.6310 0.0571  -0.0395 0.1583  26  ARG A NH1   
182  N  NH2   . ARG A 26  ? 0.3495 0.5785 0.6487 0.0963  0.0058  0.2044  26  ARG A NH2   
183  N  N     . VAL A 27  ? 0.2457 0.4125 0.5119 0.0562  0.0417  0.0468  27  VAL A N     
184  C  CA    . VAL A 27  ? 0.3201 0.4469 0.4947 0.1064  0.0202  0.0834  27  VAL A CA    
185  C  C     . VAL A 27  ? 0.3245 0.4493 0.5213 0.1327  0.0380  0.0635  27  VAL A C     
186  O  O     . VAL A 27  ? 0.2535 0.4312 0.5999 0.1114  0.0539  0.1001  27  VAL A O     
187  C  CB    . VAL A 27  ? 0.4260 0.3977 0.4670 0.1080  0.0168  0.0785  27  VAL A CB    
188  C  CG1   . VAL A 27  ? 0.4481 0.4671 0.4395 0.0490  0.0434  0.1068  27  VAL A CG1   
189  C  CG2   . VAL A 27  ? 0.4034 0.4270 0.4846 0.1680  0.0458  0.0165  27  VAL A CG2   
190  N  N     . ARG A 28  ? 0.3384 0.4108 0.5285 0.1488  0.0005  0.1293  28  ARG A N     
191  C  CA    . ARG A 28  ? 0.3224 0.4649 0.5370 0.1319  0.0220  0.1208  28  ARG A CA    
192  C  C     . ARG A 28  ? 0.3385 0.4914 0.5065 0.1472  0.0063  0.1271  28  ARG A C     
193  O  O     . ARG A 28  ? 0.3709 0.4764 0.5168 0.1018  -0.0071 0.1240  28  ARG A O     
194  C  CB    . ARG A 28  ? 0.3603 0.4707 0.5667 0.1226  0.0361  0.1071  28  ARG A CB    
195  C  CG    . ARG A 28  ? 0.3538 0.4821 0.5335 0.1234  0.0396  0.1127  28  ARG A CG    
196  C  CD    . ARG A 28  ? 0.3391 0.4496 0.5828 0.0632  0.0200  0.1019  28  ARG A CD    
197  N  NE    . ARG A 28  ? 0.4029 0.5324 0.5259 0.0863  -0.0174 0.1256  28  ARG A NE    
198  C  CZ    . ARG A 28  ? 0.3254 0.5093 0.5411 0.1128  -0.0434 0.1328  28  ARG A CZ    
199  N  NH1   . ARG A 28  ? 0.2933 0.5416 0.5433 0.1264  -0.0401 0.1473  28  ARG A NH1   
200  N  NH2   . ARG A 28  ? 0.3067 0.4855 0.5385 0.1086  -0.0279 0.1663  28  ARG A NH2   
201  N  N     . LYS A 29  ? 0.3602 0.5098 0.5220 0.1677  0.0404  0.1546  29  LYS A N     
202  C  CA    . LYS A 29  ? 0.3329 0.5286 0.5987 0.2126  0.0441  0.1545  29  LYS A CA    
203  C  C     . LYS A 29  ? 0.3585 0.5159 0.6077 0.1567  0.0207  0.1691  29  LYS A C     
204  O  O     . LYS A 29  ? 0.3450 0.4652 0.6621 0.1738  0.0270  0.1700  29  LYS A O     
205  C  CB    . LYS A 29  ? 0.3466 0.5132 0.5989 0.2369  0.0543  0.1800  29  LYS A CB    
206  C  CG    . LYS A 29  ? 0.4012 0.5644 0.5870 0.2823  0.0573  0.2216  29  LYS A CG    
207  C  CD    . LYS A 29  ? 0.3906 0.6828 0.7782 0.2698  0.1303  0.1764  29  LYS A CD    
208  C  CE    . LYS A 29  ? 0.4309 0.4972 0.7793 0.2626  0.1487  0.1671  29  LYS A CE    
209  N  NZ    . LYS A 29  ? 0.4269 0.5786 0.7100 0.3100  0.0627  0.1588  29  LYS A NZ    
210  N  N     . ASN A 30  ? 0.3683 0.5363 0.6294 0.1289  0.0438  0.1577  30  ASN A N     
211  C  CA    . ASN A 30  ? 0.4092 0.5395 0.6261 0.1097  0.0282  0.1657  30  ASN A CA    
212  C  C     . ASN A 30  ? 0.4153 0.5006 0.6119 0.1408  0.0097  0.1629  30  ASN A C     
213  O  O     . ASN A 30  ? 0.4091 0.4751 0.5994 0.1544  0.0255  0.1260  30  ASN A O     
214  C  CB    . ASN A 30  ? 0.4631 0.4980 0.5844 0.0993  0.0064  0.1644  30  ASN A CB    
215  C  CG    . ASN A 30  ? 0.5567 0.5479 0.5910 0.0761  -0.0220 0.1680  30  ASN A CG    
216  O  OD1   . ASN A 30  ? 0.5656 0.5773 0.5434 0.0239  0.0047  0.1755  30  ASN A OD1   
217  N  ND2   . ASN A 30  ? 0.6704 0.5706 0.6332 0.0448  -0.0366 0.1235  30  ASN A ND2   
218  N  N     . SER A 31  ? 0.3669 0.5579 0.6177 0.1381  0.0243  0.1742  31  SER A N     
219  C  CA    . SER A 31  ? 0.4107 0.5595 0.6449 0.1532  0.0013  0.2048  31  SER A CA    
220  C  C     . SER A 31  ? 0.4088 0.5387 0.6262 0.1256  -0.0107 0.2185  31  SER A C     
221  O  O     . SER A 31  ? 0.3765 0.5078 0.6480 0.1425  -0.0030 0.2019  31  SER A O     
222  C  CB    . SER A 31  ? 0.4024 0.6150 0.6861 0.1508  -0.0058 0.2343  31  SER A CB    
223  O  OG    . SER A 31  ? 0.4290 0.7007 0.6721 0.1436  -0.0371 0.2340  31  SER A OG    
224  N  N     . LYS A 32  ? 0.4416 0.5343 0.5998 0.0735  -0.0198 0.2003  32  LYS A N     
225  C  CA    . LYS A 32  ? 0.4203 0.5783 0.6071 0.0715  -0.0308 0.1732  32  LYS A CA    
226  C  C     . LYS A 32  ? 0.4307 0.5186 0.5612 0.0543  -0.0522 0.1672  32  LYS A C     
227  O  O     . LYS A 32  ? 0.4260 0.4365 0.5293 0.0494  -0.0670 0.1812  32  LYS A O     
228  C  CB    . LYS A 32  ? 0.4248 0.6017 0.5604 0.0485  -0.0651 0.1857  32  LYS A CB    
229  C  CG    . LYS A 32  ? 0.4347 0.6372 0.6056 0.0634  -0.0805 0.2240  32  LYS A CG    
230  C  CD    . LYS A 32  ? 0.4491 0.6671 0.6726 0.0152  -0.0614 0.2335  32  LYS A CD    
231  C  CE    . LYS A 32  ? 0.4593 0.6807 0.6763 0.0449  -0.0746 0.2663  32  LYS A CE    
232  N  NZ    . LYS A 32  ? 0.3904 0.7999 0.7882 0.0623  -0.0053 0.2902  32  LYS A NZ    
233  N  N     . TYR A 33  ? 0.4577 0.5263 0.5512 0.0587  -0.0413 0.1450  33  TYR A N     
234  C  CA    . TYR A 33  ? 0.4491 0.4908 0.5293 0.0909  -0.0349 0.1426  33  TYR A CA    
235  C  C     . TYR A 33  ? 0.4567 0.4947 0.5445 0.0977  -0.0159 0.1285  33  TYR A C     
236  O  O     . TYR A 33  ? 0.5107 0.4469 0.6578 0.1374  -0.0261 0.0693  33  TYR A O     
237  C  CB    . TYR A 33  ? 0.4556 0.4863 0.4737 0.0954  -0.0080 0.1199  33  TYR A CB    
238  C  CG    . TYR A 33  ? 0.4546 0.4812 0.4702 0.0702  -0.0106 0.1371  33  TYR A CG    
239  C  CD1   . TYR A 33  ? 0.4453 0.5159 0.4455 0.0716  -0.0199 0.1602  33  TYR A CD1   
240  C  CD2   . TYR A 33  ? 0.4142 0.4847 0.4368 0.0489  -0.0226 0.1473  33  TYR A CD2   
241  C  CE1   . TYR A 33  ? 0.4274 0.5227 0.4098 0.0653  -0.0351 0.1616  33  TYR A CE1   
242  C  CE2   . TYR A 33  ? 0.4148 0.4907 0.4072 0.0479  -0.0171 0.1405  33  TYR A CE2   
243  C  CZ    . TYR A 33  ? 0.4082 0.5028 0.3954 0.0583  -0.0560 0.1679  33  TYR A CZ    
244  O  OH    . TYR A 33  ? 0.3702 0.5180 0.3809 0.0359  -0.0589 0.1635  33  TYR A OH    
245  N  N     . LYS A 34  ? 0.5065 0.4778 0.4945 0.0737  0.0152  0.1805  34  LYS A N     
246  C  CA    . LYS A 34  ? 0.5184 0.4954 0.5414 0.0627  0.0063  0.1584  34  LYS A CA    
247  C  C     . LYS A 34  ? 0.5319 0.4652 0.5669 0.1091  0.0262  0.1491  34  LYS A C     
248  O  O     . LYS A 34  ? 0.5884 0.4334 0.5810 0.1242  0.0001  0.1987  34  LYS A O     
249  C  CB    . LYS A 34  ? 0.5265 0.5716 0.5656 0.0156  0.0094  0.0885  34  LYS A CB    
250  C  CG    . LYS A 34  ? 0.6026 0.5821 0.5749 0.0126  0.0524  0.0894  34  LYS A CG    
251  C  CD    . LYS A 34  ? 0.5496 0.5931 0.7161 -0.0041 0.0124  0.0622  34  LYS A CD    
252  C  CE    . LYS A 34  ? 0.5535 0.5902 0.6559 0.0058  0.0256  0.0799  34  LYS A CE    
253  N  NZ    . LYS A 34  ? 0.4295 0.6711 0.6845 0.0906  -0.0458 0.0343  34  LYS A NZ    
254  N  N     . THR A 35  ? 0.5261 0.4642 0.5480 0.0786  0.0361  0.1589  35  THR A N     
255  C  CA    . THR A 35  ? 0.5369 0.4256 0.5632 0.0906  0.0296  0.1184  35  THR A CA    
256  C  C     . THR A 35  ? 0.5142 0.4633 0.5941 0.1276  0.0267  0.1058  35  THR A C     
257  O  O     . THR A 35  ? 0.6018 0.5068 0.6416 0.1274  0.0535  0.0604  35  THR A O     
258  C  CB    . THR A 35  ? 0.5237 0.4714 0.5110 0.0714  0.0124  0.1086  35  THR A CB    
259  O  OG1   . THR A 35  ? 0.5390 0.5072 0.5661 0.0231  -0.0165 0.1293  35  THR A OG1   
260  C  CG2   . THR A 35  ? 0.5111 0.4737 0.4797 0.0557  -0.0109 0.1068  35  THR A CG2   
261  N  N     . GLY A 36  ? 0.4761 0.4518 0.5656 0.1540  0.0274  0.1198  36  GLY A N     
262  C  CA    . GLY A 36  ? 0.4717 0.4632 0.5439 0.1412  0.0094  0.1053  36  GLY A CA    
263  C  C     . GLY A 36  ? 0.4164 0.4644 0.5345 0.1448  0.0032  0.0927  36  GLY A C     
264  O  O     . GLY A 36  ? 0.3545 0.4595 0.5726 0.1826  -0.0229 0.0825  36  GLY A O     
265  N  N     . TRP A 37  ? 0.4031 0.4541 0.5094 0.1258  -0.0274 0.0693  37  TRP A N     
266  C  CA    . TRP A 37  ? 0.4002 0.4711 0.5209 0.1351  -0.0119 0.0824  37  TRP A CA    
267  C  C     . TRP A 37  ? 0.4095 0.4751 0.4571 0.1071  -0.0002 0.0667  37  TRP A C     
268  O  O     . TRP A 37  ? 0.4224 0.5074 0.4440 0.1026  0.0238  0.0449  37  TRP A O     
269  C  CB    . TRP A 37  ? 0.4477 0.4746 0.5174 0.1418  0.0030  0.0596  37  TRP A CB    
270  C  CG    . TRP A 37  ? 0.4570 0.4828 0.5249 0.1280  0.0413  0.0692  37  TRP A CG    
271  C  CD1   . TRP A 37  ? 0.4777 0.4757 0.5358 0.1343  0.0489  0.0987  37  TRP A CD1   
272  C  CD2   . TRP A 37  ? 0.4934 0.4917 0.5171 0.1101  0.0537  0.0861  37  TRP A CD2   
273  N  NE1   . TRP A 37  ? 0.5174 0.5426 0.5275 0.1294  0.0996  0.1266  37  TRP A NE1   
274  C  CE2   . TRP A 37  ? 0.5069 0.4998 0.5612 0.1419  0.0760  0.1149  37  TRP A CE2   
275  C  CE3   . TRP A 37  ? 0.4929 0.5016 0.5265 0.1012  0.0512  0.0882  37  TRP A CE3   
276  C  CZ2   . TRP A 37  ? 0.5523 0.5342 0.5646 0.1216  0.1043  0.1334  37  TRP A CZ2   
277  C  CZ3   . TRP A 37  ? 0.4630 0.5050 0.5507 0.1292  0.0407  0.0926  37  TRP A CZ3   
278  C  CH2   . TRP A 37  ? 0.5689 0.5078 0.5751 0.1200  0.1141  0.0715  37  TRP A CH2   
279  N  N     . LEU A 38  ? 0.4228 0.4759 0.4840 0.1001  -0.0037 0.0793  38  LEU A N     
280  C  CA    . LEU A 38  ? 0.4210 0.4414 0.4578 0.0768  -0.0055 0.0806  38  LEU A CA    
281  C  C     . LEU A 38  ? 0.3496 0.4290 0.4529 0.0539  -0.0008 0.0740  38  LEU A C     
282  O  O     . LEU A 38  ? 0.3581 0.3958 0.4302 0.0677  0.0040  0.0545  38  LEU A O     
283  C  CB    . LEU A 38  ? 0.3835 0.4969 0.4723 0.0492  -0.0231 0.0925  38  LEU A CB    
284  C  CG    . LEU A 38  ? 0.3555 0.4847 0.4462 0.0164  -0.0172 0.0990  38  LEU A CG    
285  C  CD1   . LEU A 38  ? 0.3226 0.4480 0.4763 -0.0093 -0.0434 0.0722  38  LEU A CD1   
286  C  CD2   . LEU A 38  ? 0.3863 0.5055 0.4362 -0.0117 -0.0038 0.0874  38  LEU A CD2   
287  N  N     . VAL A 39  ? 0.3246 0.3530 0.4299 0.0070  0.0107  0.0677  39  VAL A N     
288  C  CA    . VAL A 39  ? 0.3008 0.3982 0.4358 0.0242  0.0003  0.0462  39  VAL A CA    
289  C  C     . VAL A 39  ? 0.2685 0.3994 0.4430 0.0357  -0.0167 0.0601  39  VAL A C     
290  O  O     . VAL A 39  ? 0.3617 0.4055 0.3950 0.0270  -0.0173 0.0808  39  VAL A O     
291  C  CB    . VAL A 39  ? 0.3174 0.3994 0.4687 0.0128  -0.0086 0.0585  39  VAL A CB    
292  C  CG1   . VAL A 39  ? 0.3295 0.4174 0.4025 -0.0440 -0.0323 0.0352  39  VAL A CG1   
293  C  CG2   . VAL A 39  ? 0.3874 0.4123 0.5049 0.0031  -0.0344 0.0034  39  VAL A CG2   
294  N  N     . VAL A 40  ? 0.2763 0.4100 0.4674 0.0180  -0.0038 0.0652  40  VAL A N     
295  C  CA    . VAL A 40  ? 0.3051 0.4227 0.4508 0.0561  -0.0506 0.0558  40  VAL A CA    
296  C  C     . VAL A 40  ? 0.2687 0.4493 0.4009 0.0904  -0.0018 0.0322  40  VAL A C     
297  O  O     . VAL A 40  ? 0.2583 0.4488 0.3801 0.0731  -0.0040 0.0523  40  VAL A O     
298  C  CB    . VAL A 40  ? 0.2901 0.3550 0.4589 0.0548  -0.0128 0.0868  40  VAL A CB    
299  C  CG1   . VAL A 40  ? 0.3133 0.3531 0.4199 -0.0033 0.0074  0.0661  40  VAL A CG1   
300  C  CG2   . VAL A 40  ? 0.1844 0.4603 0.5172 0.0667  -0.0327 0.0583  40  VAL A CG2   
301  N  N     . ALA A 41  ? 0.2382 0.3645 0.4194 0.0639  -0.0642 0.0144  41  ALA A N     
302  C  CA    . ALA A 41  ? 0.2428 0.3773 0.4200 0.0156  -0.0563 0.0511  41  ALA A CA    
303  C  C     . ALA A 41  ? 0.2513 0.3770 0.3785 0.0126  -0.0440 0.0459  41  ALA A C     
304  O  O     . ALA A 41  ? 0.2643 0.3741 0.3735 0.0149  -0.0193 0.0765  41  ALA A O     
305  C  CB    . ALA A 41  ? 0.2183 0.3129 0.3962 0.0499  -0.0377 0.0668  41  ALA A CB    
306  N  N     . ILE A 42  ? 0.1835 0.3806 0.3279 0.0193  -0.0256 0.0046  42  ILE A N     
307  C  CA    . ILE A 42  ? 0.2264 0.3651 0.3595 0.0314  -0.0019 0.0350  42  ILE A CA    
308  C  C     . ILE A 42  ? 0.2141 0.3646 0.3474 0.0212  0.0092  0.0385  42  ILE A C     
309  O  O     . ILE A 42  ? 0.2402 0.3835 0.3440 0.0429  0.0371  0.0787  42  ILE A O     
310  C  CB    . ILE A 42  ? 0.2411 0.3824 0.3470 0.0124  -0.0358 0.0284  42  ILE A CB    
311  C  CG1   . ILE A 42  ? 0.2805 0.3918 0.3738 0.0646  0.0003  0.0603  42  ILE A CG1   
312  C  CG2   . ILE A 42  ? 0.3045 0.3751 0.3053 -0.0187 -0.0551 0.0829  42  ILE A CG2   
313  C  CD1   . ILE A 42  ? 0.3768 0.4440 0.4673 0.0905  0.0045  -0.0147 42  ILE A CD1   
314  N  N     . PHE A 43  ? 0.1857 0.3136 0.3348 -0.0142 -0.0061 0.0348  43  PHE A N     
315  C  CA    . PHE A 43  ? 0.1839 0.3112 0.3385 0.0222  -0.0150 0.0148  43  PHE A CA    
316  C  C     . PHE A 43  ? 0.1747 0.3278 0.3264 0.0192  -0.0225 0.0145  43  PHE A C     
317  O  O     . PHE A 43  ? 0.1791 0.3145 0.3505 -0.0316 -0.0351 0.0026  43  PHE A O     
318  C  CB    . PHE A 43  ? 0.1858 0.3696 0.3619 0.0344  -0.0127 0.0302  43  PHE A CB    
319  C  CG    . PHE A 43  ? 0.2462 0.3416 0.3684 0.0275  0.0037  0.0170  43  PHE A CG    
320  C  CD1   . PHE A 43  ? 0.2066 0.3295 0.3792 -0.0038 -0.0088 0.0614  43  PHE A CD1   
321  C  CD2   . PHE A 43  ? 0.3098 0.3528 0.3880 0.0857  -0.0189 0.0282  43  PHE A CD2   
322  C  CE1   . PHE A 43  ? 0.2867 0.3299 0.4355 0.1171  -0.0283 0.0076  43  PHE A CE1   
323  C  CE2   . PHE A 43  ? 0.3123 0.3590 0.3690 0.1297  0.0158  0.0119  43  PHE A CE2   
324  C  CZ    . PHE A 43  ? 0.3692 0.3861 0.3716 0.1624  -0.0136 0.0122  43  PHE A CZ    
325  N  N     . SER A 44  ? 0.1652 0.3596 0.2792 0.0218  -0.0305 -0.0138 44  SER A N     
326  C  CA    . SER A 44  ? 0.2037 0.3712 0.3014 -0.0019 -0.0433 0.0105  44  SER A CA    
327  C  C     . SER A 44  ? 0.2256 0.3602 0.3292 -0.0009 -0.0445 0.0160  44  SER A C     
328  O  O     . SER A 44  ? 0.2971 0.3463 0.3330 -0.0116 -0.0463 -0.0135 44  SER A O     
329  C  CB    . SER A 44  ? 0.1844 0.4116 0.2962 0.0100  -0.0496 0.0363  44  SER A CB    
330  O  OG    . SER A 44  ? 0.2887 0.3877 0.3364 -0.0303 -0.0311 -0.0234 44  SER A OG    
331  N  N     . VAL A 45  ? 0.1656 0.3661 0.3241 0.0074  -0.0527 0.0172  45  VAL A N     
332  C  CA    . VAL A 45  ? 0.1945 0.3718 0.3403 -0.0177 -0.0684 0.0277  45  VAL A CA    
333  C  C     . VAL A 45  ? 0.1959 0.3816 0.3696 -0.0450 -0.0329 0.0211  45  VAL A C     
334  O  O     . VAL A 45  ? 0.2502 0.4300 0.3757 -0.0668 -0.0311 0.0188  45  VAL A O     
335  C  CB    . VAL A 45  ? 0.2713 0.3156 0.3436 0.0426  -0.0145 0.0236  45  VAL A CB    
336  C  CG1   . VAL A 45  ? 0.3246 0.3738 0.3641 0.0130  0.0377  0.0618  45  VAL A CG1   
337  C  CG2   . VAL A 45  ? 0.3220 0.3894 0.4425 -0.1318 0.0022  0.0794  45  VAL A CG2   
338  N  N     . THR A 46  ? 0.2123 0.3841 0.3327 -0.0546 -0.0202 -0.0208 46  THR A N     
339  C  CA    . THR A 46  ? 0.2143 0.4233 0.3572 -0.0370 -0.0954 0.0011  46  THR A CA    
340  C  C     . THR A 46  ? 0.2718 0.4300 0.3906 -0.0861 -0.0733 0.0184  46  THR A C     
341  O  O     . THR A 46  ? 0.3629 0.4510 0.3906 -0.1565 -0.0539 0.1272  46  THR A O     
342  C  CB    . THR A 46  ? 0.2292 0.4064 0.3339 -0.0262 -0.1167 -0.0004 46  THR A CB    
343  O  OG1   . THR A 46  ? 0.2865 0.3492 0.3853 -0.0071 -0.0501 -0.0307 46  THR A OG1   
344  C  CG2   . THR A 46  ? 0.2147 0.4965 0.5202 -0.0775 -0.0862 0.0416  46  THR A CG2   
345  N  N     . VAL A 47  ? 0.2710 0.4182 0.3398 -0.0601 -0.0779 0.0377  47  VAL A N     
346  C  CA    . VAL A 47  ? 0.2056 0.3798 0.3765 -0.0438 -0.0751 0.0082  47  VAL A CA    
347  C  C     . VAL A 47  ? 0.2321 0.3933 0.3884 -0.0659 -0.0824 0.0083  47  VAL A C     
348  O  O     . VAL A 47  ? 0.2253 0.3900 0.4185 -0.0951 -0.1017 0.0298  47  VAL A O     
349  C  CB    . VAL A 47  ? 0.2335 0.3564 0.3787 -0.0418 -0.0903 0.0060  47  VAL A CB    
350  C  CG1   . VAL A 47  ? 0.2044 0.4006 0.4615 -0.0287 -0.1060 0.0311  47  VAL A CG1   
351  C  CG2   . VAL A 47  ? 0.3147 0.3649 0.3728 -0.0188 -0.0627 0.0174  47  VAL A CG2   
352  N  N     . ASP A 48  ? 0.2408 0.4424 0.4229 -0.0816 -0.0595 0.0302  48  ASP A N     
353  C  CA    . ASP A 48  ? 0.2676 0.4663 0.4435 -0.1114 -0.0316 -0.0062 48  ASP A CA    
354  C  C     . ASP A 48  ? 0.2244 0.4892 0.3856 -0.0907 -0.0754 0.0191  48  ASP A C     
355  O  O     . ASP A 48  ? 0.2061 0.4529 0.3554 -0.1125 -0.0787 0.0106  48  ASP A O     
356  C  CB    . ASP A 48  ? 0.3257 0.4716 0.5353 -0.1384 -0.0267 0.0321  48  ASP A CB    
357  C  CG    . ASP A 48  ? 0.2987 0.5244 0.6458 -0.1577 -0.0014 0.0474  48  ASP A CG    
358  O  OD1   . ASP A 48  ? 0.3862 0.5578 0.6772 -0.0666 -0.0677 -0.0079 48  ASP A OD1   
359  O  OD2   . ASP A 48  ? 0.3082 0.5575 0.7269 -0.1063 0.1590  0.0378  48  ASP A OD2   
360  N  N     . LYS A 49  ? 0.1972 0.5406 0.4153 -0.0636 -0.0891 0.0189  49  LYS A N     
361  C  CA    . LYS A 49  ? 0.2621 0.5156 0.4124 -0.0588 -0.1065 0.0139  49  LYS A CA    
362  C  C     . LYS A 49  ? 0.3335 0.4674 0.4216 -0.0802 -0.0550 -0.0258 49  LYS A C     
363  O  O     . LYS A 49  ? 0.3548 0.5468 0.4335 -0.1112 0.0095  0.0088  49  LYS A O     
364  C  CB    . LYS A 49  ? 0.3067 0.5197 0.4275 -0.1547 -0.1343 0.0382  49  LYS A CB    
365  C  CG    . LYS A 49  ? 0.3319 0.5819 0.3659 -0.1159 -0.1011 0.0700  49  LYS A CG    
366  C  CD    . LYS A 49  ? 0.3098 0.6253 0.5223 -0.1425 -0.1507 0.0384  49  LYS A CD    
367  C  CE    . LYS A 49  ? 0.4681 0.5668 0.4945 -0.1522 -0.1077 0.0825  49  LYS A CE    
368  N  NZ    . LYS A 49  ? 0.3781 0.5955 0.5485 -0.1386 -0.0471 0.0985  49  LYS A NZ    
369  N  N     . LYS A 50  ? 0.3089 0.5103 0.4402 -0.0688 -0.0539 0.0001  50  LYS A N     
370  C  CA    . LYS A 50  ? 0.3133 0.5088 0.4681 -0.0852 -0.0973 -0.0246 50  LYS A CA    
371  C  C     . LYS A 50  ? 0.2942 0.4472 0.4807 -0.0544 -0.0442 -0.0272 50  LYS A C     
372  O  O     . LYS A 50  ? 0.2251 0.4877 0.5065 -0.0562 -0.0580 -0.0332 50  LYS A O     
373  C  CB    . LYS A 50  ? 0.4355 0.6126 0.4315 -0.0460 -0.0713 0.0011  50  LYS A CB    
374  C  CG    . LYS A 50  ? 0.4532 0.6959 0.4076 0.0435  -0.0486 -0.0035 50  LYS A CG    
375  C  CD    . LYS A 50  ? 0.5511 0.8239 0.4788 0.0118  0.0111  0.0001  50  LYS A CD    
376  C  CE    . LYS A 50  ? 0.3831 0.6538 0.6556 0.1080  -0.0606 -0.0670 50  LYS A CE    
377  N  NZ    . LYS A 50  ? 0.3762 0.5988 0.8109 0.0045  -0.0436 0.1575  50  LYS A NZ    
378  N  N     . ASP A 51  ? 0.2804 0.4643 0.4720 -0.0817 -0.0328 -0.0152 51  ASP A N     
379  C  CA    . ASP A 51  ? 0.2671 0.4140 0.3921 -0.0573 -0.0231 -0.0342 51  ASP A CA    
380  C  C     . ASP A 51  ? 0.3261 0.4494 0.3719 -0.0615 -0.0227 -0.0406 51  ASP A C     
381  O  O     . ASP A 51  ? 0.3343 0.4094 0.4167 -0.0542 0.0167  -0.0659 51  ASP A O     
382  C  CB    . ASP A 51  ? 0.2382 0.3979 0.3659 0.0244  0.0039  -0.0365 51  ASP A CB    
383  C  CG    . ASP A 51  ? 0.3315 0.4322 0.3904 0.0309  -0.0271 -0.0303 51  ASP A CG    
384  O  OD1   . ASP A 51  ? 0.4109 0.4489 0.5397 0.0581  0.0064  -0.0537 51  ASP A OD1   
385  O  OD2   . ASP A 51  ? 0.2956 0.4116 0.4310 -0.0311 -0.0407 -0.0941 51  ASP A OD2   
386  N  N     . LEU A 52  ? 0.3385 0.4347 0.3875 -0.0654 -0.0407 -0.0360 52  LEU A N     
387  C  CA    . LEU A 52  ? 0.3461 0.4552 0.4056 -0.0646 -0.0243 -0.0211 52  LEU A CA    
388  C  C     . LEU A 52  ? 0.3548 0.4216 0.4307 -0.0503 -0.0215 -0.0103 52  LEU A C     
389  O  O     . LEU A 52  ? 0.3783 0.4598 0.4262 -0.0330 0.0212  0.0427  52  LEU A O     
390  C  CB    . LEU A 52  ? 0.3389 0.4407 0.4462 -0.0747 -0.0612 0.0005  52  LEU A CB    
391  C  CG    . LEU A 52  ? 0.3973 0.4710 0.4894 -0.0363 -0.0798 -0.0214 52  LEU A CG    
392  C  CD1   . LEU A 52  ? 0.3492 0.5620 0.4705 0.0069  -0.0802 -0.0177 52  LEU A CD1   
393  C  CD2   . LEU A 52  ? 0.4941 0.5025 0.4798 -0.0265 -0.0216 0.0255  52  LEU A CD2   
394  N  N     . PHE A 53  ? 0.4118 0.4233 0.3861 -0.0273 -0.0179 -0.0312 53  PHE A N     
395  C  CA    . PHE A 53  ? 0.4093 0.4260 0.3408 -0.0449 -0.0028 -0.0347 53  PHE A CA    
396  C  C     . PHE A 53  ? 0.3382 0.4278 0.3341 -0.0231 0.0376  -0.0441 53  PHE A C     
397  O  O     . PHE A 53  ? 0.3443 0.3933 0.2902 -0.0050 0.0534  -0.0496 53  PHE A O     
398  C  CB    . PHE A 53  ? 0.5019 0.4478 0.3687 0.0296  0.0318  -0.0403 53  PHE A CB    
399  C  CG    . PHE A 53  ? 0.4552 0.5583 0.3708 0.0371  -0.0160 -0.0370 53  PHE A CG    
400  C  CD1   . PHE A 53  ? 0.5318 0.5496 0.3832 0.0506  0.0576  0.0113  53  PHE A CD1   
401  C  CD2   . PHE A 53  ? 0.4257 0.5207 0.4504 0.1414  0.0205  0.0268  53  PHE A CD2   
402  C  CE1   . PHE A 53  ? 0.4633 0.7359 0.3701 0.0730  -0.0053 0.0039  53  PHE A CE1   
403  C  CE2   . PHE A 53  ? 0.4121 0.5449 0.4101 0.1986  0.0900  -0.0494 53  PHE A CE2   
404  C  CZ    . PHE A 53  ? 0.3645 0.7873 0.4857 0.0609  0.0425  -0.0400 53  PHE A CZ    
405  N  N     . LEU A 54  ? 0.3148 0.4090 0.3060 0.0078  0.0176  -0.0156 54  LEU A N     
406  C  CA    . LEU A 54  ? 0.2862 0.4072 0.3577 0.0267  0.0169  -0.0423 54  LEU A CA    
407  C  C     . LEU A 54  ? 0.2675 0.4241 0.3475 0.0089  -0.0025 -0.0505 54  LEU A C     
408  O  O     . LEU A 54  ? 0.2445 0.4473 0.3567 0.0103  0.0189  -0.0626 54  LEU A O     
409  C  CB    . LEU A 54  ? 0.2954 0.4690 0.3481 0.0228  0.0109  0.0000  54  LEU A CB    
410  C  CG    . LEU A 54  ? 0.2777 0.4940 0.3860 -0.0149 0.0472  -0.0008 54  LEU A CG    
411  C  CD1   . LEU A 54  ? 0.2852 0.4757 0.3957 0.0142  0.1135  0.0701  54  LEU A CD1   
412  C  CD2   . LEU A 54  ? 0.2899 0.4108 0.3899 -0.0167 0.0640  0.0857  54  LEU A CD2   
413  N  N     . LEU A 55  ? 0.2840 0.4522 0.3406 0.0197  -0.0307 -0.0754 55  LEU A N     
414  C  CA    . LEU A 55  ? 0.2895 0.4449 0.3891 0.0341  -0.0302 -0.0518 55  LEU A CA    
415  C  C     . LEU A 55  ? 0.3038 0.4494 0.3693 0.0610  -0.0388 -0.0310 55  LEU A C     
416  O  O     . LEU A 55  ? 0.3715 0.4522 0.3644 0.0490  -0.0274 0.0320  55  LEU A O     
417  C  CB    . LEU A 55  ? 0.2690 0.5227 0.3630 0.0014  -0.0947 -0.0881 55  LEU A CB    
418  C  CG    . LEU A 55  ? 0.2468 0.4814 0.3671 0.0064  -0.1116 -0.0625 55  LEU A CG    
419  C  CD1   . LEU A 55  ? 0.2402 0.4323 0.3614 0.0171  -0.0655 -0.0340 55  LEU A CD1   
420  C  CD2   . LEU A 55  ? 0.1996 0.4748 0.3116 -0.0312 -0.0863 0.0018  55  LEU A CD2   
421  N  N     . GLU A 56  ? 0.3083 0.4271 0.3715 0.0654  -0.0214 -0.0283 56  GLU A N     
422  C  CA    . GLU A 56  ? 0.3739 0.4492 0.3860 0.0102  0.0110  -0.0181 56  GLU A CA    
423  C  C     . GLU A 56  ? 0.3582 0.4503 0.3815 0.0087  0.0292  0.0057  56  GLU A C     
424  O  O     . GLU A 56  ? 0.3022 0.4263 0.4087 0.0342  0.0304  -0.0072 56  GLU A O     
425  C  CB    . GLU A 56  ? 0.4798 0.4682 0.3473 -0.0509 0.0222  -0.0191 56  GLU A CB    
426  C  CG    . GLU A 56  ? 0.4780 0.5722 0.4639 -0.0375 0.0412  -0.0119 56  GLU A CG    
427  C  CD    . GLU A 56  ? 0.6389 0.6507 0.4704 -0.0997 -0.0236 -0.0291 56  GLU A CD    
428  O  OE1   . GLU A 56  ? 0.8760 0.5492 0.4936 -0.0517 0.1020  -0.0804 56  GLU A OE1   
429  O  OE2   . GLU A 56  ? 0.7362 0.7305 0.6574 -0.1791 -0.0045 -0.2111 56  GLU A OE2   
430  N  N     . SER A 57  ? 0.3255 0.4235 0.3441 -0.0029 0.0160  -0.0427 57  SER A N     
431  C  CA    . SER A 57  ? 0.3396 0.4062 0.3468 0.0478  0.0035  -0.0307 57  SER A CA    
432  C  C     . SER A 57  ? 0.3146 0.4051 0.3135 0.0592  0.0109  -0.0444 57  SER A C     
433  O  O     . SER A 57  ? 0.3260 0.4367 0.3321 0.0541  0.0226  -0.0813 57  SER A O     
434  C  CB    . SER A 57  ? 0.3989 0.4244 0.3586 0.0265  0.0413  -0.0033 57  SER A CB    
435  O  OG    . SER A 57  ? 0.4980 0.4038 0.3625 0.1372  0.0582  -0.0151 57  SER A OG    
436  N  N     . LEU A 58  ? 0.2629 0.4142 0.3256 0.0458  -0.0202 -0.0782 58  LEU A N     
437  C  CA    . LEU A 58  ? 0.2706 0.4095 0.3578 0.0228  0.0364  -0.0461 58  LEU A CA    
438  C  C     . LEU A 58  ? 0.2703 0.4349 0.3227 0.0263  0.0279  -0.0523 58  LEU A C     
439  O  O     . LEU A 58  ? 0.3125 0.3884 0.3397 0.0084  -0.0089 -0.0497 58  LEU A O     
440  C  CB    . LEU A 58  ? 0.2560 0.4766 0.4256 0.0787  0.0220  -0.0551 58  LEU A CB    
441  C  CG    . LEU A 58  ? 0.2534 0.6194 0.4139 0.1728  0.0393  -0.0302 58  LEU A CG    
442  C  CD1   . LEU A 58  ? 0.3184 0.5552 0.4719 0.1644  0.0666  0.0686  58  LEU A CD1   
443  C  CD2   . LEU A 58  ? 0.2221 0.7587 0.5685 0.1646  0.0475  -0.0697 58  LEU A CD2   
444  N  N     . LYS A 59  ? 0.2512 0.4176 0.3384 0.0295  0.0237  -0.0338 59  LYS A N     
445  C  CA    . LYS A 59  ? 0.2843 0.4015 0.3377 0.0296  0.0462  -0.0340 59  LYS A CA    
446  C  C     . LYS A 59  ? 0.2925 0.3912 0.3353 0.0484  0.0403  -0.0358 59  LYS A C     
447  O  O     . LYS A 59  ? 0.2802 0.3980 0.3436 0.0782  0.0625  -0.0003 59  LYS A O     
448  C  CB    . LYS A 59  ? 0.3442 0.3805 0.2938 0.0342  0.0264  -0.0079 59  LYS A CB    
449  C  CG    . LYS A 59  ? 0.3781 0.3856 0.3200 0.0417  0.0599  0.0169  59  LYS A CG    
450  C  CD    . LYS A 59  ? 0.3997 0.4384 0.3220 0.0195  0.0411  0.0556  59  LYS A CD    
451  C  CE    . LYS A 59  ? 0.4942 0.4981 0.3171 0.0277  0.0133  0.0803  59  LYS A CE    
452  N  NZ    . LYS A 59  ? 0.5126 0.5242 0.3663 0.0643  0.0876  0.1284  59  LYS A NZ    
453  N  N     . THR A 60  ? 0.3110 0.3853 0.3762 0.0249  0.0267  -0.0712 60  THR A N     
454  C  CA    . THR A 60  ? 0.3912 0.3990 0.3716 0.0427  0.0953  -0.0904 60  THR A CA    
455  C  C     . THR A 60  ? 0.3476 0.4147 0.3748 0.0502  0.1001  -0.0528 60  THR A C     
456  O  O     . THR A 60  ? 0.3615 0.4385 0.3021 0.0810  0.1164  -0.0575 60  THR A O     
457  C  CB    . THR A 60  ? 0.4418 0.3943 0.4257 0.0319  0.1230  -0.1263 60  THR A CB    
458  O  OG1   . THR A 60  ? 0.4149 0.4600 0.5150 -0.0075 0.1438  -0.1569 60  THR A OG1   
459  C  CG2   . THR A 60  ? 0.3820 0.4173 0.4505 -0.0126 0.1233  -0.0814 60  THR A CG2   
460  N  N     . PHE A 61  ? 0.3310 0.3974 0.3657 0.0701  0.0793  -0.0684 61  PHE A N     
461  C  CA    . PHE A 61  ? 0.3237 0.3904 0.3561 0.0600  0.0757  -0.0240 61  PHE A CA    
462  C  C     . PHE A 61  ? 0.2898 0.4019 0.3376 0.0528  0.0600  -0.0081 61  PHE A C     
463  O  O     . PHE A 61  ? 0.2591 0.4272 0.3387 0.0829  0.0611  0.0047  61  PHE A O     
464  C  CB    . PHE A 61  ? 0.3210 0.3865 0.3636 0.0156  0.0755  0.0060  61  PHE A CB    
465  C  CG    . PHE A 61  ? 0.2903 0.4082 0.3653 0.0275  0.0780  0.0313  61  PHE A CG    
466  C  CD1   . PHE A 61  ? 0.2501 0.4214 0.3880 0.0129  0.1054  0.0515  61  PHE A CD1   
467  C  CD2   . PHE A 61  ? 0.2450 0.3990 0.3471 -0.0050 0.0824  0.0368  61  PHE A CD2   
468  C  CE1   . PHE A 61  ? 0.2356 0.4038 0.4533 0.0563  0.0646  0.0432  61  PHE A CE1   
469  C  CE2   . PHE A 61  ? 0.2847 0.4154 0.4123 0.0281  0.0280  0.0192  61  PHE A CE2   
470  C  CZ    . PHE A 61  ? 0.2518 0.4277 0.3576 0.0296  0.0646  0.0269  61  PHE A CZ    
471  N  N     . PHE A 62  ? 0.3071 0.4029 0.3570 0.0565  0.0281  -0.0165 62  PHE A N     
472  C  CA    . PHE A 62  ? 0.2951 0.3966 0.3671 0.0320  0.0370  -0.0255 62  PHE A CA    
473  C  C     . PHE A 62  ? 0.3006 0.4176 0.3697 0.0129  0.0451  -0.0254 62  PHE A C     
474  O  O     . PHE A 62  ? 0.2945 0.4085 0.3534 0.0040  0.0238  -0.0355 62  PHE A O     
475  C  CB    . PHE A 62  ? 0.3243 0.3750 0.3715 0.0178  0.0340  -0.0649 62  PHE A CB    
476  C  CG    . PHE A 62  ? 0.3003 0.4116 0.3666 0.0126  0.0371  -0.0369 62  PHE A CG    
477  C  CD1   . PHE A 62  ? 0.3094 0.3748 0.3923 0.0179  0.0084  -0.0082 62  PHE A CD1   
478  C  CD2   . PHE A 62  ? 0.2595 0.3423 0.3684 0.0117  0.0240  -0.0624 62  PHE A CD2   
479  C  CE1   . PHE A 62  ? 0.2720 0.3791 0.3677 0.0493  0.0255  0.0607  62  PHE A CE1   
480  C  CE2   . PHE A 62  ? 0.2868 0.4173 0.3823 0.0173  -0.0414 -0.0364 62  PHE A CE2   
481  C  CZ    . PHE A 62  ? 0.1746 0.3162 0.3953 0.0771  0.0035  0.0253  62  PHE A CZ    
482  N  N     . GLY A 63  ? 0.3168 0.4454 0.3792 0.0154  0.0649  -0.0270 63  GLY A N     
483  C  CA    . GLY A 63  ? 0.3415 0.4683 0.4043 0.0284  0.1301  -0.0356 63  GLY A CA    
484  C  C     . GLY A 63  ? 0.4229 0.4785 0.3645 0.0078  0.1068  0.0014  63  GLY A C     
485  O  O     . GLY A 63  ? 0.4776 0.5097 0.3819 0.0089  0.1050  0.0397  63  GLY A O     
486  N  N     . GLY A 64  ? 0.3814 0.4810 0.3992 0.0426  0.0911  -0.0396 64  GLY A N     
487  C  CA    . GLY A 64  ? 0.4048 0.4310 0.4075 0.0215  0.0702  -0.0323 64  GLY A CA    
488  C  C     . GLY A 64  ? 0.3843 0.4559 0.3732 0.0296  0.0723  -0.0047 64  GLY A C     
489  O  O     . GLY A 64  ? 0.4664 0.5412 0.3102 0.0454  0.0665  0.0160  64  GLY A O     
490  N  N     . LEU A 65  ? 0.3650 0.4513 0.4130 0.0202  0.0395  0.0064  65  LEU A N     
491  C  CA    . LEU A 65  ? 0.3312 0.4340 0.4431 -0.0092 0.0615  0.0117  65  LEU A CA    
492  C  C     . LEU A 65  ? 0.3374 0.4145 0.3591 -0.0090 0.0520  0.0237  65  LEU A C     
493  O  O     . LEU A 65  ? 0.2826 0.3951 0.3862 -0.0238 0.0209  0.0330  65  LEU A O     
494  C  CB    . LEU A 65  ? 0.3822 0.4604 0.4472 0.0020  0.0082  0.0167  65  LEU A CB    
495  C  CG    . LEU A 65  ? 0.3094 0.5225 0.5706 -0.0033 0.0389  -0.0191 65  LEU A CG    
496  C  CD1   . LEU A 65  ? 0.4341 0.5017 0.5737 0.0032  0.0923  -0.0570 65  LEU A CD1   
497  C  CD2   . LEU A 65  ? 0.5881 0.4595 0.5937 0.0345  -0.0394 -0.0228 65  LEU A CD2   
498  N  N     . GLY A 66  ? 0.3103 0.4232 0.3716 -0.0134 0.0333  0.0049  66  GLY A N     
499  C  CA    . GLY A 66  ? 0.3281 0.4545 0.3521 -0.0322 0.0351  -0.0521 66  GLY A CA    
500  C  C     . GLY A 66  ? 0.3459 0.4863 0.3290 -0.0372 0.0153  -0.0610 66  GLY A C     
501  O  O     . GLY A 66  ? 0.3609 0.4796 0.3372 -0.0526 0.0054  -0.0725 66  GLY A O     
502  N  N     . SER A 67  ? 0.3254 0.4673 0.2822 -0.0117 -0.0141 -0.0237 67  SER A N     
503  C  CA    . SER A 67  ? 0.3358 0.4455 0.3084 -0.0122 -0.0387 0.0268  67  SER A CA    
504  C  C     . SER A 67  ? 0.3283 0.4151 0.3093 -0.0012 -0.0304 0.0146  67  SER A C     
505  O  O     . SER A 67  ? 0.3032 0.4203 0.3000 -0.0026 -0.0045 0.0240  67  SER A O     
506  C  CB    . SER A 67  ? 0.4174 0.4496 0.3432 -0.0106 -0.0836 0.0616  67  SER A CB    
507  O  OG    . SER A 67  ? 0.3484 0.6470 0.4623 -0.0828 -0.0944 0.1083  67  SER A OG    
508  N  N     . ILE A 68  ? 0.3230 0.4190 0.3346 0.0036  -0.0180 -0.0140 68  ILE A N     
509  C  CA    . ILE A 68  ? 0.3306 0.4139 0.3175 -0.0189 -0.0543 -0.0042 68  ILE A CA    
510  C  C     . ILE A 68  ? 0.3469 0.4392 0.3411 0.0068  -0.0694 0.0154  68  ILE A C     
511  O  O     . ILE A 68  ? 0.4106 0.4540 0.3397 0.0346  -0.0988 0.0217  68  ILE A O     
512  C  CB    . ILE A 68  ? 0.3378 0.4193 0.2917 -0.0099 -0.0572 -0.0247 68  ILE A CB    
513  C  CG1   . ILE A 68  ? 0.3238 0.4231 0.2954 -0.0078 -0.0442 -0.0529 68  ILE A CG1   
514  C  CG2   . ILE A 68  ? 0.3638 0.4017 0.2813 -0.0041 -0.0364 -0.0385 68  ILE A CG2   
515  C  CD1   . ILE A 68  ? 0.2947 0.4167 0.2642 -0.0178 -0.0465 -0.0488 68  ILE A CD1   
516  N  N     . LYS A 69  ? 0.3374 0.4404 0.3215 0.0039  -0.0658 0.0421  69  LYS A N     
517  C  CA    . LYS A 69  ? 0.3411 0.4807 0.3584 -0.0015 -0.0824 0.0604  69  LYS A CA    
518  C  C     . LYS A 69  ? 0.3022 0.4217 0.4150 -0.0055 -0.0767 0.0773  69  LYS A C     
519  O  O     . LYS A 69  ? 0.2702 0.4158 0.4080 -0.0128 -0.0232 0.0711  69  LYS A O     
520  C  CB    . LYS A 69  ? 0.3341 0.4680 0.4199 -0.0238 -0.0685 0.0514  69  LYS A CB    
521  C  CG    . LYS A 69  ? 0.3945 0.5340 0.4027 -0.0394 -0.0652 0.0549  69  LYS A CG    
522  C  CD    . LYS A 69  ? 0.4870 0.5102 0.3847 -0.0441 -0.0470 0.0052  69  LYS A CD    
523  C  CE    . LYS A 69  ? 0.4877 0.5529 0.5215 -0.1525 -0.0238 0.0037  69  LYS A CE    
524  N  NZ    . LYS A 69  ? 0.4949 0.5355 0.6124 -0.1970 -0.0500 -0.0224 69  LYS A NZ    
525  N  N     . LYS A 70  ? 0.3558 0.4276 0.4063 -0.0451 -0.0815 0.0613  70  LYS A N     
526  C  CA    . LYS A 70  ? 0.2805 0.5318 0.4424 -0.0429 -0.0902 0.0423  70  LYS A CA    
527  C  C     . LYS A 70  ? 0.2902 0.5291 0.4520 -0.0423 -0.0919 0.0434  70  LYS A C     
528  O  O     . LYS A 70  ? 0.3394 0.5264 0.4274 0.0016  -0.0745 0.0219  70  LYS A O     
529  C  CB    . LYS A 70  ? 0.3505 0.5724 0.4276 -0.1094 -0.1183 0.0261  70  LYS A CB    
530  C  CG    . LYS A 70  ? 0.2788 0.5802 0.4479 -0.0700 -0.1393 0.0367  70  LYS A CG    
531  C  CD    . LYS A 70  ? 0.2928 0.6734 0.4635 -0.1569 -0.1428 0.0196  70  LYS A CD    
532  C  CE    . LYS A 70  ? 0.2743 0.6705 0.5253 -0.1693 -0.1517 0.0451  70  LYS A CE    
533  N  NZ    . LYS A 70  ? 0.2875 0.7813 0.6163 -0.1964 -0.2037 0.0671  70  LYS A NZ    
534  N  N     . SER A 71  ? 0.2464 0.5560 0.4625 -0.0069 -0.1031 0.0385  71  SER A N     
535  C  CA    . SER A 71  ? 0.2808 0.5099 0.5067 -0.0032 -0.0664 0.0604  71  SER A CA    
536  C  C     . SER A 71  ? 0.3183 0.5669 0.5731 -0.0088 -0.0069 0.0872  71  SER A C     
537  O  O     . SER A 71  ? 0.3404 0.5816 0.7446 -0.0050 0.0791  0.1286  71  SER A O     
538  C  CB    . SER A 71  ? 0.3169 0.5138 0.4743 -0.0389 -0.0665 0.0202  71  SER A CB    
539  O  OG    . SER A 71  ? 0.4154 0.5514 0.5328 -0.0339 0.0215  -0.0163 71  SER A OG    
540  N  N     . GLY A 72  ? 0.2904 0.5743 0.6383 -0.0410 0.0237  0.0445  72  GLY A N     
541  C  CA    . GLY A 72  ? 0.2055 0.6344 0.6699 -0.0801 -0.0642 0.0320  72  GLY A CA    
542  C  C     . GLY A 72  ? 0.2909 0.5820 0.6538 -0.0482 -0.0426 0.0857  72  GLY A C     
543  O  O     . GLY A 72  ? 0.3258 0.7092 0.5788 0.0103  -0.0557 0.0990  72  GLY A O     
544  N  N     . ASN A 73  ? 0.1607 0.6016 0.6725 -0.0424 -0.1543 0.0486  73  ASN A N     
545  C  CA    . ASN A 73  ? 0.3306 0.5794 0.7176 -0.0753 -0.1071 0.0634  73  ASN A CA    
546  C  C     . ASN A 73  ? 0.3304 0.6234 0.6234 -0.0489 -0.1016 0.0353  73  ASN A C     
547  O  O     . ASN A 73  ? 0.4690 0.6191 0.7019 -0.0558 -0.0680 -0.0085 73  ASN A O     
548  C  CB    . ASN A 73  ? 0.3305 0.5540 0.7548 -0.1224 -0.1177 0.0350  73  ASN A CB    
549  C  CG    . ASN A 73  ? 0.3810 0.7239 0.8852 -0.0909 -0.1662 0.0964  73  ASN A CG    
550  O  OD1   . ASN A 73  ? 0.7608 0.6609 1.0165 -0.1533 -0.1749 0.1339  73  ASN A OD1   
551  N  ND2   . ASN A 73  ? 0.5845 0.5982 0.9755 -0.1747 -0.0804 0.2081  73  ASN A ND2   
552  N  N     . SER A 74  ? 0.3281 0.6131 0.5357 -0.0482 -0.0344 0.1163  74  SER A N     
553  C  CA    . SER A 74  ? 0.2532 0.6146 0.5056 -0.0676 -0.0593 0.0724  74  SER A CA    
554  C  C     . SER A 74  ? 0.2645 0.5194 0.4756 -0.0703 -0.0850 0.0641  74  SER A C     
555  O  O     . SER A 74  ? 0.2615 0.5494 0.4956 -0.0105 -0.0708 0.0296  74  SER A O     
556  C  CB    . SER A 74  ? 0.4021 0.7114 0.4546 -0.0997 -0.0773 0.0943  74  SER A CB    
557  O  OG    . SER A 74  ? 0.5377 0.7858 0.5856 -0.0311 0.1995  0.0252  74  SER A OG    
558  N  N     . THR A 75  ? 0.2264 0.5116 0.4716 -0.0567 -0.0656 0.0625  75  THR A N     
559  C  CA    . THR A 75  ? 0.2457 0.4994 0.4368 -0.0745 -0.0496 0.0155  75  THR A CA    
560  C  C     . THR A 75  ? 0.2363 0.4634 0.4216 -0.0487 -0.0594 0.0165  75  THR A C     
561  O  O     . THR A 75  ? 0.2253 0.4614 0.3954 -0.0457 -0.0481 0.0041  75  THR A O     
562  C  CB    . THR A 75  ? 0.3287 0.4866 0.4595 -0.0610 -0.0677 0.0176  75  THR A CB    
563  O  OG1   . THR A 75  ? 0.2982 0.4401 0.6044 -0.0742 -0.0173 0.0220  75  THR A OG1   
564  C  CG2   . THR A 75  ? 0.3513 0.5861 0.4369 0.0005  -0.0645 0.0225  75  THR A CG2   
565  N  N     . PHE A 76  ? 0.2494 0.3859 0.3595 -0.0734 -0.0277 -0.0217 76  PHE A N     
566  C  CA    . PHE A 76  ? 0.2737 0.4011 0.3564 -0.0586 -0.0353 0.0088  76  PHE A CA    
567  C  C     . PHE A 76  ? 0.2502 0.3921 0.3435 -0.0476 0.0029  -0.0275 76  PHE A C     
568  O  O     . PHE A 76  ? 0.2104 0.3791 0.3534 -0.0924 -0.0041 -0.0320 76  PHE A O     
569  C  CB    . PHE A 76  ? 0.2937 0.3899 0.3151 -0.0493 -0.0307 0.0374  76  PHE A CB    
570  C  CG    . PHE A 76  ? 0.3182 0.4560 0.3697 -0.0574 -0.0618 0.0234  76  PHE A CG    
571  C  CD1   . PHE A 76  ? 0.3208 0.4648 0.4273 -0.0806 -0.0735 0.0218  76  PHE A CD1   
572  C  CD2   . PHE A 76  ? 0.3191 0.4614 0.3745 -0.0185 -0.1047 0.0270  76  PHE A CD2   
573  C  CE1   . PHE A 76  ? 0.4782 0.5255 0.4072 -0.0873 -0.1199 -0.0170 76  PHE A CE1   
574  C  CE2   . PHE A 76  ? 0.4187 0.4847 0.3668 -0.0518 -0.0965 -0.0057 76  PHE A CE2   
575  C  CZ    . PHE A 76  ? 0.4661 0.4683 0.4317 -0.0446 -0.1052 0.0391  76  PHE A CZ    
576  N  N     . SER A 77  ? 0.3171 0.4031 0.3682 -0.0327 0.0247  -0.0117 77  SER A N     
577  C  CA    . SER A 77  ? 0.2806 0.4321 0.3649 -0.0257 -0.0114 -0.0205 77  SER A CA    
578  C  C     . SER A 77  ? 0.2440 0.4149 0.3653 -0.0133 -0.0440 -0.0211 77  SER A C     
579  O  O     . SER A 77  ? 0.3353 0.4124 0.3500 -0.0166 -0.0223 0.0051  77  SER A O     
580  C  CB    . SER A 77  ? 0.3283 0.4294 0.5284 -0.0126 0.0219  0.0006  77  SER A CB    
581  O  OG    . SER A 77  ? 0.6728 0.5875 0.5518 0.1105  -0.1020 -0.0562 77  SER A OG    
582  N  N     . TYR A 78  ? 0.2290 0.3108 0.3287 -0.0243 -0.0268 -0.0118 78  TYR A N     
583  C  CA    . TYR A 78  ? 0.2468 0.3776 0.2967 0.0113  -0.0125 -0.0098 78  TYR A CA    
584  C  C     . TYR A 78  ? 0.2264 0.3784 0.3266 0.0073  -0.0174 0.0025  78  TYR A C     
585  O  O     . TYR A 78  ? 0.2204 0.4018 0.3303 -0.0160 -0.0289 0.0101  78  TYR A O     
586  C  CB    . TYR A 78  ? 0.2623 0.3565 0.2854 0.0088  -0.0152 -0.0054 78  TYR A CB    
587  C  CG    . TYR A 78  ? 0.2795 0.4051 0.3175 0.0114  0.0079  -0.0072 78  TYR A CG    
588  C  CD1   . TYR A 78  ? 0.3283 0.3486 0.3089 -0.0030 0.0003  -0.0258 78  TYR A CD1   
589  C  CD2   . TYR A 78  ? 0.2943 0.4487 0.2897 -0.0168 0.0079  0.0101  78  TYR A CD2   
590  C  CE1   . TYR A 78  ? 0.3237 0.3877 0.3403 0.0040  -0.0043 -0.0025 78  TYR A CE1   
591  C  CE2   . TYR A 78  ? 0.2970 0.4641 0.3431 -0.0051 0.0160  0.0066  78  TYR A CE2   
592  C  CZ    . TYR A 78  ? 0.3049 0.4133 0.3427 -0.0039 0.0186  -0.0066 78  TYR A CZ    
593  O  OH    . TYR A 78  ? 0.2608 0.4111 0.3749 0.0965  0.0266  -0.0181 78  TYR A OH    
594  N  N     . ARG A 79  ? 0.2071 0.3864 0.3290 0.0444  -0.0602 0.0137  79  ARG A N     
595  C  CA    . ARG A 79  ? 0.2107 0.3819 0.3221 0.0356  -0.0342 0.0291  79  ARG A CA    
596  C  C     . ARG A 79  ? 0.2371 0.3712 0.3195 0.0570  -0.0080 0.0253  79  ARG A C     
597  O  O     . ARG A 79  ? 0.3260 0.4042 0.3105 0.0560  -0.0130 0.0289  79  ARG A O     
598  C  CB    . ARG A 79  ? 0.2044 0.3929 0.3502 0.0407  -0.0269 0.0160  79  ARG A CB    
599  C  CG    . ARG A 79  ? 0.1958 0.4007 0.3646 0.0552  -0.0251 0.0243  79  ARG A CG    
600  C  CD    . ARG A 79  ? 0.2263 0.4740 0.3819 0.0988  -0.0359 0.0376  79  ARG A CD    
601  N  NE    . ARG A 79  ? 0.1967 0.4533 0.4210 0.0359  -0.0063 -0.0277 79  ARG A NE    
602  C  CZ    . ARG A 79  ? 0.2376 0.4904 0.4125 0.1038  -0.0380 0.0229  79  ARG A CZ    
603  N  NH1   . ARG A 79  ? 0.2590 0.5142 0.3346 0.0359  -0.0899 -0.0226 79  ARG A NH1   
604  N  NH2   . ARG A 79  ? 0.2766 0.5083 0.4644 0.0859  0.0400  -0.0512 79  ARG A NH2   
605  N  N     . ILE A 80  ? 0.2447 0.3347 0.3360 0.0611  0.0214  0.0175  80  ILE A N     
606  C  CA    . ILE A 80  ? 0.2884 0.3768 0.3708 0.0291  0.0247  0.0349  80  ILE A CA    
607  C  C     . ILE A 80  ? 0.3906 0.3962 0.3556 0.0734  0.0040  0.0305  80  ILE A C     
608  O  O     . ILE A 80  ? 0.2688 0.3887 0.3966 0.1190  -0.0072 -0.0150 80  ILE A O     
609  C  CB    . ILE A 80  ? 0.2717 0.3969 0.3764 -0.0001 0.0254  0.0397  80  ILE A CB    
610  C  CG1   . ILE A 80  ? 0.2891 0.4164 0.3422 0.0107  0.0214  -0.0069 80  ILE A CG1   
611  C  CG2   . ILE A 80  ? 0.2976 0.4158 0.2608 0.0125  -0.0048 0.0371  80  ILE A CG2   
612  C  CD1   . ILE A 80  ? 0.2827 0.4377 0.2759 -0.0188 0.0500  0.0507  80  ILE A CD1   
613  N  N     . GLU A 81  ? 0.4279 0.4387 0.3490 0.0473  -0.0053 0.0468  81  GLU A N     
614  C  CA    . GLU A 81  ? 0.3216 0.4505 0.3726 0.0554  -0.0151 0.0175  81  GLU A CA    
615  C  C     . GLU A 81  ? 0.3809 0.4740 0.4413 0.0596  0.0157  0.0604  81  GLU A C     
616  O  O     . GLU A 81  ? 0.4272 0.4803 0.3865 0.0854  -0.0554 0.0163  81  GLU A O     
617  C  CB    . GLU A 81  ? 0.3157 0.4962 0.3884 0.0302  0.0027  0.0298  81  GLU A CB    
618  C  CG    . GLU A 81  ? 0.3497 0.5407 0.4041 -0.0156 -0.0448 0.0503  81  GLU A CG    
619  C  CD    . GLU A 81  ? 0.3769 0.5725 0.5664 0.0189  -0.0241 0.0897  81  GLU A CD    
620  O  OE1   . GLU A 81  ? 0.5170 0.6671 0.7112 -0.0789 -0.0760 0.2728  81  GLU A OE1   
621  O  OE2   . GLU A 81  ? 0.4603 0.5495 0.6508 0.0036  0.0021  0.0678  81  GLU A OE2   
622  N  N     . SER A 82  ? 0.4506 0.5456 0.4057 0.0329  0.0725  0.0631  82  SER A N     
623  C  CA    . SER A 82  ? 0.2868 0.4443 0.4088 0.0558  -0.0060 0.0422  82  SER A CA    
624  C  C     . SER A 82  ? 0.3242 0.4399 0.4704 0.0437  -0.0250 0.0273  82  SER A C     
625  O  O     . SER A 82  ? 0.3330 0.4961 0.4156 0.0335  -0.0253 0.0743  82  SER A O     
626  C  CB    . SER A 82  ? 0.2842 0.4685 0.4260 0.0317  0.0463  0.0517  82  SER A CB    
627  O  OG    . SER A 82  ? 0.3815 0.4805 0.5074 -0.0407 0.1786  -0.0292 82  SER A OG    
628  N  N     . SER A 83  ? 0.3915 0.4325 0.5149 0.0231  -0.0740 0.0105  83  SER A N     
629  C  CA    . SER A 83  ? 0.3397 0.4663 0.5067 0.0093  -0.0318 0.0272  83  SER A CA    
630  C  C     . SER A 83  ? 0.3834 0.4590 0.4021 0.0546  0.0081  0.0187  83  SER A C     
631  O  O     . SER A 83  ? 0.4179 0.3866 0.3400 0.0370  0.0334  0.0329  83  SER A O     
632  C  CB    . SER A 83  ? 0.4065 0.4307 0.5139 0.0100  -0.0615 -0.0017 83  SER A CB    
633  O  OG    . SER A 83  ? 0.6041 0.4941 0.6257 0.0048  -0.1299 -0.0783 83  SER A OG    
634  N  N     . GLU A 84  ? 0.3602 0.3989 0.3678 0.0424  0.0228  0.1077  84  GLU A N     
635  C  CA    . GLU A 84  ? 0.3822 0.4734 0.3731 0.0288  0.0441  0.0558  84  GLU A CA    
636  C  C     . GLU A 84  ? 0.3483 0.4562 0.3512 -0.0063 0.0242  0.0530  84  GLU A C     
637  O  O     . GLU A 84  ? 0.3261 0.5655 0.3501 0.0463  0.0802  0.0095  84  GLU A O     
638  C  CB    . GLU A 84  ? 0.4149 0.6105 0.3715 0.0183  0.0624  0.0607  84  GLU A CB    
639  C  CG    . GLU A 84  ? 0.4445 0.7491 0.4460 -0.0368 0.1088  0.0592  84  GLU A CG    
640  C  CD    . GLU A 84  ? 0.4783 0.9082 0.4420 0.0181  0.0985  0.0913  84  GLU A CD    
641  O  OE1   . GLU A 84  ? 0.5137 1.0259 0.5462 0.0575  0.0630  0.1528  84  GLU A OE1   
642  O  OE2   . GLU A 84  ? 0.5072 1.0623 0.5416 -0.0949 0.2580  0.1781  84  GLU A OE2   
643  N  N     A GLN A 85  ? 0.3714 0.4162 0.3091 0.0096  0.0072  0.0280  85  GLN A N     
644  N  N     B GLN A 85  ? 0.3738 0.4189 0.3160 0.0075  0.0101  0.0251  85  GLN A N     
645  C  CA    A GLN A 85  ? 0.3402 0.4164 0.3811 0.0183  -0.0078 0.0261  85  GLN A CA    
646  C  CA    B GLN A 85  ? 0.3434 0.4161 0.3884 0.0204  -0.0172 0.0229  85  GLN A CA    
647  C  C     A GLN A 85  ? 0.2149 0.3360 0.3811 0.0536  -0.0009 0.0210  85  GLN A C     
648  C  C     B GLN A 85  ? 0.2166 0.3372 0.3876 0.0560  -0.0023 0.0170  85  GLN A C     
649  O  O     A GLN A 85  ? 0.2178 0.3412 0.3970 0.0381  0.0070  0.0416  85  GLN A O     
650  O  O     B GLN A 85  ? 0.2135 0.3301 0.4102 0.0305  0.0003  0.0388  85  GLN A O     
651  C  CB    A GLN A 85  ? 0.3914 0.4346 0.3558 0.0131  -0.0401 0.0179  85  GLN A CB    
652  C  CB    B GLN A 85  ? 0.3207 0.4453 0.3599 0.0190  -0.0106 0.0324  85  GLN A CB    
653  C  CG    A GLN A 85  ? 0.4100 0.4495 0.3554 0.0119  0.0117  0.0215  85  GLN A CG    
654  C  CG    B GLN A 85  ? 0.3933 0.4815 0.3650 0.0385  -0.0135 0.0228  85  GLN A CG    
655  C  CD    A GLN A 85  ? 0.4162 0.4593 0.3883 0.0063  0.0282  0.0479  85  GLN A CD    
656  C  CD    B GLN A 85  ? 0.3854 0.4675 0.3674 0.0398  -0.0048 0.0430  85  GLN A CD    
657  O  OE1   A GLN A 85  ? 0.4960 0.5208 0.3968 0.0280  0.0882  0.0566  85  GLN A OE1   
658  O  OE1   B GLN A 85  ? 0.4451 0.4534 0.3538 0.0398  -0.0015 0.1011  85  GLN A OE1   
659  N  NE2   A GLN A 85  ? 0.4582 0.4212 0.3974 0.0121  0.0201  0.0502  85  GLN A NE2   
660  N  NE2   B GLN A 85  ? 0.4201 0.5545 0.4037 0.0270  -0.0063 -0.0305 85  GLN A NE2   
661  N  N     . LEU A 86  ? 0.2155 0.3826 0.3796 0.0209  0.0300  0.0053  86  LEU A N     
662  C  CA    . LEU A 86  ? 0.2261 0.3649 0.3733 -0.0114 0.0368  0.0122  86  LEU A CA    
663  C  C     . LEU A 86  ? 0.2450 0.4091 0.4109 -0.0263 0.0100  0.0315  86  LEU A C     
664  O  O     . LEU A 86  ? 0.3140 0.4093 0.4129 -0.0327 0.0234  0.0642  86  LEU A O     
665  C  CB    . LEU A 86  ? 0.2179 0.3261 0.3604 -0.0166 0.0364  0.0306  86  LEU A CB    
666  C  CG    . LEU A 86  ? 0.2168 0.3422 0.3723 -0.0031 0.0137  0.0271  86  LEU A CG    
667  C  CD1   . LEU A 86  ? 0.1807 0.3694 0.3752 -0.0069 0.0235  0.0227  86  LEU A CD1   
668  C  CD2   . LEU A 86  ? 0.2334 0.3072 0.3901 -0.0452 0.0714  -0.0031 86  LEU A CD2   
669  N  N     . THR A 87  ? 0.2724 0.4159 0.3913 -0.0360 -0.0018 0.0370  87  THR A N     
670  C  CA    . THR A 87  ? 0.2307 0.4417 0.3997 -0.0209 0.0237  0.0625  87  THR A CA    
671  C  C     . THR A 87  ? 0.3069 0.4478 0.4579 0.0224  0.0272  0.0354  87  THR A C     
672  O  O     . THR A 87  ? 0.3144 0.4633 0.5579 -0.0305 -0.0103 0.0568  87  THR A O     
673  C  CB    . THR A 87  ? 0.2673 0.4565 0.4223 -0.0483 0.0142  0.0774  87  THR A CB    
674  O  OG1   . THR A 87  ? 0.4206 0.4454 0.5502 0.1169  -0.0672 0.1402  87  THR A OG1   
675  C  CG2   . THR A 87  ? 0.2584 0.4424 0.3946 -0.0661 0.0622  0.1082  87  THR A CG2   
676  N  N     . LYS A 88  ? 0.3714 0.5011 0.4367 0.0634  0.0429  0.0296  88  LYS A N     
677  C  CA    . LYS A 88  ? 0.2956 0.5459 0.4363 0.0075  0.0970  0.0391  88  LYS A CA    
678  C  C     . LYS A 88  ? 0.2836 0.5110 0.4568 0.0070  0.1114  0.0009  88  LYS A C     
679  O  O     . LYS A 88  ? 0.2373 0.6175 0.5611 0.0445  0.2094  -0.0057 88  LYS A O     
680  C  CB    . LYS A 88  ? 0.3906 0.6212 0.4487 0.0453  0.1023  -0.0226 88  LYS A CB    
681  C  CG    . LYS A 88  ? 0.3312 0.6536 0.5074 0.0564  0.0654  -0.0439 88  LYS A CG    
682  C  CD    . LYS A 88  ? 0.6399 0.6405 0.5004 0.0341  0.0671  -0.1105 88  LYS A CD    
683  C  CE    . LYS A 88  ? 0.7022 0.5463 0.5267 0.0163  0.0929  -0.0140 88  LYS A CE    
684  N  NZ    . LYS A 88  ? 0.8245 0.6313 0.4938 -0.0281 0.1308  0.0653  88  LYS A NZ    
685  N  N     . ILE A 89  ? 0.3584 0.4584 0.3962 -0.0299 0.1285  -0.0043 89  ILE A N     
686  C  CA    . ILE A 89  ? 0.4284 0.4431 0.4413 0.0309  0.0926  -0.0096 89  ILE A CA    
687  C  C     . ILE A 89  ? 0.3221 0.4402 0.4217 0.0590  0.0359  0.0077  89  ILE A C     
688  O  O     . ILE A 89  ? 0.3570 0.4526 0.4307 0.0881  0.0317  0.0210  89  ILE A O     
689  C  CB    . ILE A 89  ? 0.4361 0.4542 0.4608 0.0482  0.0586  -0.0036 89  ILE A CB    
690  C  CG1   . ILE A 89  ? 0.3947 0.6199 0.4732 0.0256  0.0618  -0.0009 89  ILE A CG1   
691  C  CG2   . ILE A 89  ? 0.4929 0.4678 0.4113 -0.0464 0.0601  -0.0528 89  ILE A CG2   
692  C  CD1   . ILE A 89  ? 0.4306 0.5855 0.6691 0.1212  0.2200  -0.1748 89  ILE A CD1   
693  N  N     . ILE A 90  ? 0.2320 0.3970 0.3743 -0.0253 -0.0020 -0.0217 90  ILE A N     
694  C  CA    . ILE A 90  ? 0.2287 0.3706 0.3960 -0.0035 0.0147  0.0273  90  ILE A CA    
695  C  C     . ILE A 90  ? 0.2706 0.3796 0.3624 0.0065  0.0224  0.0261  90  ILE A C     
696  O  O     . ILE A 90  ? 0.3136 0.3735 0.3720 0.0662  0.0525  0.0387  90  ILE A O     
697  C  CB    . ILE A 90  ? 0.2244 0.3401 0.3960 -0.0344 0.0012  0.0396  90  ILE A CB    
698  C  CG1   . ILE A 90  ? 0.3274 0.3721 0.4473 -0.0480 -0.0946 0.0536  90  ILE A CG1   
699  C  CG2   . ILE A 90  ? 0.1311 0.3057 0.3903 -0.0230 0.0022  0.0528  90  ILE A CG2   
700  C  CD1   . ILE A 90  ? 0.3215 0.3693 0.4496 -0.0438 -0.1242 0.0590  90  ILE A CD1   
701  N  N     . LEU A 91  ? 0.2345 0.3886 0.3542 -0.0163 0.0820  0.0167  91  LEU A N     
702  C  CA    . LEU A 91  ? 0.2419 0.3811 0.3548 -0.0152 0.0627  0.0319  91  LEU A CA    
703  C  C     . LEU A 91  ? 0.2247 0.3913 0.4111 -0.0243 0.0630  0.0311  91  LEU A C     
704  O  O     . LEU A 91  ? 0.1538 0.3518 0.4186 0.0019  0.0490  -0.0055 91  LEU A O     
705  C  CB    . LEU A 91  ? 0.3308 0.3885 0.3284 -0.0023 0.0759  0.0418  91  LEU A CB    
706  C  CG    . LEU A 91  ? 0.3452 0.3925 0.3626 -0.0110 0.0495  0.0817  91  LEU A CG    
707  C  CD1   . LEU A 91  ? 0.4224 0.4115 0.3852 -0.0506 -0.0274 0.1270  91  LEU A CD1   
708  C  CD2   . LEU A 91  ? 0.3778 0.4246 0.4021 -0.0080 0.1037  0.0166  91  LEU A CD2   
709  N  N     . PRO A 92  ? 0.2351 0.4184 0.4240 -0.0065 0.0739  0.0348  92  PRO A N     
710  C  CA    . PRO A 92  ? 0.2248 0.4267 0.4085 -0.0176 0.0595  0.0516  92  PRO A CA    
711  C  C     . PRO A 92  ? 0.1770 0.4059 0.4479 -0.0252 0.0471  0.0426  92  PRO A C     
712  O  O     . PRO A 92  ? 0.1307 0.4677 0.5234 -0.0321 0.0331  0.0758  92  PRO A O     
713  C  CB    . PRO A 92  ? 0.2509 0.4042 0.4336 0.0117  0.0930  0.0706  92  PRO A CB    
714  C  CG    . PRO A 92  ? 0.2408 0.4250 0.3809 0.0258  0.0997  0.0583  92  PRO A CG    
715  C  CD    . PRO A 92  ? 0.2222 0.4263 0.4175 -0.0155 0.0869  0.0398  92  PRO A CD    
716  N  N     . PHE A 93  ? 0.1567 0.4289 0.4327 -0.0237 0.0543  0.0538  93  PHE A N     
717  C  CA    . PHE A 93  ? 0.1747 0.3904 0.4318 -0.0144 0.0231  0.0418  93  PHE A CA    
718  C  C     . PHE A 93  ? 0.1966 0.3621 0.4332 0.0028  -0.0005 0.0258  93  PHE A C     
719  O  O     . PHE A 93  ? 0.2249 0.3287 0.3991 -0.0214 -0.0019 0.0168  93  PHE A O     
720  C  CB    . PHE A 93  ? 0.1931 0.3630 0.3776 0.0040  0.0145  0.0370  93  PHE A CB    
721  C  CG    . PHE A 93  ? 0.1898 0.3436 0.3993 0.0024  0.0078  0.0302  93  PHE A CG    
722  C  CD1   . PHE A 93  ? 0.1972 0.3551 0.4037 0.0147  0.0019  0.0173  93  PHE A CD1   
723  C  CD2   . PHE A 93  ? 0.2098 0.3087 0.3936 0.0175  0.0270  0.0057  93  PHE A CD2   
724  C  CE1   . PHE A 93  ? 0.1612 0.3614 0.4076 -0.0154 0.0374  0.0168  93  PHE A CE1   
725  C  CE2   . PHE A 93  ? 0.2006 0.3489 0.4045 0.0469  0.0147  0.0511  93  PHE A CE2   
726  C  CZ    . PHE A 93  ? 0.1779 0.3584 0.3928 0.0450  0.0568  -0.0094 93  PHE A CZ    
727  N  N     . PHE A 94  ? 0.2082 0.3683 0.4222 -0.0009 0.0162  0.0115  94  PHE A N     
728  C  CA    . PHE A 94  ? 0.1786 0.3446 0.4348 0.0111  0.0140  0.0098  94  PHE A CA    
729  C  C     . PHE A 94  ? 0.2002 0.3516 0.4252 0.0075  -0.0211 0.0356  94  PHE A C     
730  O  O     . PHE A 94  ? 0.3180 0.3319 0.4254 0.0045  -0.0279 0.0232  94  PHE A O     
731  C  CB    . PHE A 94  ? 0.1619 0.3785 0.4776 -0.0006 -0.0197 -0.0095 94  PHE A CB    
732  C  CG    . PHE A 94  ? 0.1092 0.4321 0.4759 -0.0239 0.0209  0.0152  94  PHE A CG    
733  C  CD1   . PHE A 94  ? 0.1509 0.4173 0.4805 -0.0029 -0.0100 0.0033  94  PHE A CD1   
734  C  CD2   . PHE A 94  ? 0.1498 0.4356 0.4356 -0.0247 0.0315  -0.0160 94  PHE A CD2   
735  C  CE1   . PHE A 94  ? 0.1802 0.4405 0.4360 -0.0328 0.0370  -0.0321 94  PHE A CE1   
736  C  CE2   . PHE A 94  ? 0.1975 0.3993 0.4398 -0.0277 0.0291  -0.0155 94  PHE A CE2   
737  C  CZ    . PHE A 94  ? 0.1532 0.4235 0.4524 -0.0203 0.0231  0.0167  94  PHE A CZ    
738  N  N     . ASP A 95  ? 0.1634 0.3987 0.4309 0.0061  0.0072  0.0106  95  ASP A N     
739  C  CA    . ASP A 95  ? 0.1707 0.3963 0.4566 -0.0017 -0.0168 0.0337  95  ASP A CA    
740  C  C     . ASP A 95  ? 0.2301 0.4163 0.4605 0.0109  -0.0530 0.0562  95  ASP A C     
741  O  O     . ASP A 95  ? 0.2313 0.3853 0.5095 0.0410  -0.0890 0.0326  95  ASP A O     
742  C  CB    . ASP A 95  ? 0.2003 0.3957 0.4400 -0.0122 -0.0184 0.0354  95  ASP A CB    
743  C  CG    . ASP A 95  ? 0.2223 0.3838 0.4663 -0.0154 -0.0122 0.0311  95  ASP A CG    
744  O  OD1   . ASP A 95  ? 0.2586 0.3708 0.4214 0.0007  0.0046  0.0242  95  ASP A OD1   
745  O  OD2   . ASP A 95  ? 0.2784 0.3771 0.5032 -0.0254 -0.0540 0.0633  95  ASP A OD2   
746  N  N     . LYS A 96  ? 0.2365 0.4120 0.4583 0.0129  -0.0481 0.0637  96  LYS A N     
747  C  CA    . LYS A 96  ? 0.2326 0.4081 0.4991 0.0211  -0.0336 0.0601  96  LYS A CA    
748  C  C     . LYS A 96  ? 0.2044 0.3828 0.5302 -0.0174 -0.0058 0.0329  96  LYS A C     
749  O  O     . LYS A 96  ? 0.2552 0.3940 0.5053 -0.0732 -0.0135 0.0244  96  LYS A O     
750  C  CB    . LYS A 96  ? 0.1680 0.4768 0.5028 0.0215  -0.0058 0.0804  96  LYS A CB    
751  C  CG    . LYS A 96  ? 0.1685 0.4654 0.5340 0.0097  -0.0236 0.0864  96  LYS A CG    
752  C  CD    . LYS A 96  ? 0.1510 0.5524 0.5977 -0.0162 -0.0187 0.0918  96  LYS A CD    
753  C  CE    . LYS A 96  ? 0.2487 0.5551 0.7217 0.0583  0.0117  0.0664  96  LYS A CE    
754  N  NZ    . LYS A 96  ? 0.2600 0.7309 0.8361 0.1948  0.0595  0.0947  96  LYS A NZ    
755  N  N     . TYR A 97  ? 0.1526 0.3616 0.4731 0.0294  0.0182  0.0395  97  TYR A N     
756  C  CA    . TYR A 97  ? 0.2239 0.3546 0.4814 0.0265  0.0415  0.0297  97  TYR A CA    
757  C  C     . TYR A 97  ? 0.1634 0.3881 0.4564 -0.0004 0.0215  0.0333  97  TYR A C     
758  O  O     . TYR A 97  ? 0.2124 0.4119 0.4005 -0.0569 -0.0018 0.0142  97  TYR A O     
759  C  CB    . TYR A 97  ? 0.1554 0.3632 0.4609 0.0027  0.0194  0.0505  97  TYR A CB    
760  C  CG    . TYR A 97  ? 0.1765 0.3737 0.4735 0.0307  0.0247  0.0547  97  TYR A CG    
761  C  CD1   . TYR A 97  ? 0.1755 0.3759 0.4485 0.0102  -0.0001 0.0539  97  TYR A CD1   
762  C  CD2   . TYR A 97  ? 0.1825 0.3990 0.4514 0.0285  0.0024  0.0315  97  TYR A CD2   
763  C  CE1   . TYR A 97  ? 0.1824 0.3812 0.5063 0.0281  0.0026  0.0725  97  TYR A CE1   
764  C  CE2   . TYR A 97  ? 0.2094 0.3909 0.4587 0.0326  0.0187  0.0289  97  TYR A CE2   
765  C  CZ    . TYR A 97  ? 0.1858 0.4083 0.4991 0.0242  0.0196  0.0487  97  TYR A CZ    
766  O  OH    . TYR A 97  ? 0.2303 0.4560 0.5108 0.0545  0.0394  0.0428  97  TYR A OH    
767  N  N     . SER A 98  ? 0.2318 0.4044 0.4276 0.0097  0.0160  0.0546  98  SER A N     
768  C  CA    . SER A 98  ? 0.2223 0.3881 0.4679 -0.0229 0.0101  0.0054  98  SER A CA    
769  C  C     . SER A 98  ? 0.1836 0.3585 0.4075 -0.0063 -0.0215 -0.0114 98  SER A C     
770  O  O     . SER A 98  ? 0.1548 0.4294 0.3964 -0.0024 -0.0144 0.0162  98  SER A O     
771  C  CB    . SER A 98  ? 0.3246 0.4186 0.5154 -0.0616 -0.0131 -0.0143 98  SER A CB    
772  O  OG    . SER A 98  ? 0.2588 0.5204 0.5690 -0.0547 -0.0057 -0.0013 98  SER A OG    
773  N  N     . LEU A 99  ? 0.1941 0.3105 0.3359 -0.0187 -0.0639 0.0052  99  LEU A N     
774  C  CA    . LEU A 99  ? 0.1893 0.3441 0.3658 -0.0100 -0.0664 0.0088  99  LEU A CA    
775  C  C     . LEU A 99  ? 0.2455 0.3335 0.3655 -0.0276 -0.0381 -0.0081 99  LEU A C     
776  O  O     . LEU A 99  ? 0.2284 0.3916 0.3913 -0.0641 -0.0614 0.0063  99  LEU A O     
777  C  CB    . LEU A 99  ? 0.1781 0.3294 0.3799 -0.0265 -0.0815 0.0105  99  LEU A CB    
778  C  CG    . LEU A 99  ? 0.2153 0.3413 0.3713 0.0143  -0.0908 0.0223  99  LEU A CG    
779  C  CD1   . LEU A 99  ? 0.2586 0.3735 0.4197 0.0292  -0.1002 0.0533  99  LEU A CD1   
780  C  CD2   . LEU A 99  ? 0.2450 0.3506 0.3256 -0.0010 -0.1236 0.0051  99  LEU A CD2   
781  N  N     . ILE A 100 ? 0.2181 0.3667 0.3820 -0.0092 0.0395  -0.0375 100 ILE A N     
782  C  CA    . ILE A 100 ? 0.2326 0.3912 0.3708 -0.0270 -0.0308 0.0011  100 ILE A CA    
783  C  C     . ILE A 100 ? 0.2591 0.2949 0.3449 -0.0324 -0.0281 -0.0359 100 ILE A C     
784  O  O     . ILE A 100 ? 0.2805 0.2999 0.3543 -0.0739 -0.0182 -0.0517 100 ILE A O     
785  C  CB    . ILE A 100 ? 0.2229 0.3644 0.4241 -0.0384 -0.0575 -0.0076 100 ILE A CB    
786  C  CG1   . ILE A 100 ? 0.2766 0.3748 0.4314 -0.0468 -0.0685 0.0285  100 ILE A CG1   
787  C  CG2   . ILE A 100 ? 0.2690 0.3910 0.4093 -0.0582 -0.0025 0.0176  100 ILE A CG2   
788  C  CD1   . ILE A 100 ? 0.2410 0.3897 0.5016 -0.0710 -0.0802 0.0703  100 ILE A CD1   
789  N  N     . THR A 101 ? 0.2406 0.3144 0.3426 -0.0032 -0.0214 -0.0352 101 THR A N     
790  C  CA    . THR A 101 ? 0.2663 0.3530 0.3480 0.0037  -0.0072 -0.0362 101 THR A CA    
791  C  C     . THR A 101 ? 0.3040 0.3647 0.3915 0.0001  -0.0098 -0.0197 101 THR A C     
792  O  O     . THR A 101 ? 0.1866 0.4551 0.4382 -0.0149 -0.0351 -0.0518 101 THR A O     
793  C  CB    . THR A 101 ? 0.2385 0.3327 0.3442 0.0062  0.0006  0.0392  101 THR A CB    
794  O  OG1   . THR A 101 ? 0.3361 0.3479 0.3480 0.0366  -0.0523 0.0207  101 THR A OG1   
795  C  CG2   . THR A 101 ? 0.2083 0.3234 0.4104 0.0038  0.0141  -0.0187 101 THR A CG2   
796  N  N     . GLU A 102 ? 0.3181 0.4002 0.3796 -0.0127 0.0432  0.0002  102 GLU A N     
797  C  CA    . GLU A 102 ? 0.3369 0.4211 0.4305 0.0235  0.0210  0.0096  102 GLU A CA    
798  C  C     . GLU A 102 ? 0.3324 0.3786 0.4188 0.0208  0.0340  -0.0203 102 GLU A C     
799  O  O     . GLU A 102 ? 0.3575 0.3430 0.5352 0.0414  0.1123  -0.0490 102 GLU A O     
800  C  CB    . GLU A 102 ? 0.3487 0.4447 0.3344 -0.0023 0.0140  0.0200  102 GLU A CB    
801  C  CG    . GLU A 102 ? 0.4129 0.3483 0.4425 -0.0072 -0.0085 -0.0760 102 GLU A CG    
802  C  CD    . GLU A 102 ? 0.4071 0.4110 0.5110 -0.0663 -0.0127 -0.0197 102 GLU A CD    
803  O  OE1   . GLU A 102 ? 0.5418 0.4762 0.6322 0.0035  -0.1341 -0.0560 102 GLU A OE1   
804  O  OE2   . GLU A 102 ? 0.4901 0.4648 0.4823 -0.1375 -0.0613 -0.0409 102 GLU A OE2   
805  N  N     . LYS A 103 ? 0.3371 0.3988 0.4025 0.0026  -0.0041 -0.0097 103 LYS A N     
806  C  CA    . LYS A 103 ? 0.2945 0.3628 0.3984 -0.0132 0.0108  -0.0017 103 LYS A CA    
807  C  C     . LYS A 103 ? 0.2585 0.3511 0.3697 -0.0092 -0.0364 0.0162  103 LYS A C     
808  O  O     . LYS A 103 ? 0.3073 0.4339 0.4166 0.0175  0.0163  0.0861  103 LYS A O     
809  C  CB    . LYS A 103 ? 0.3405 0.3103 0.3837 0.0166  -0.0074 0.0114  103 LYS A CB    
810  C  CG    . LYS A 103 ? 0.3479 0.3356 0.3633 -0.0419 0.0419  -0.0099 103 LYS A CG    
811  C  CD    . LYS A 103 ? 0.3897 0.3276 0.3898 -0.0513 0.0057  0.0044  103 LYS A CD    
812  C  CE    . LYS A 103 ? 0.2406 0.3740 0.3257 0.0864  0.0398  0.0012  103 LYS A CE    
813  N  NZ    . LYS A 103 ? 0.1903 0.4311 0.4487 0.0296  -0.0419 -0.0722 103 LYS A NZ    
814  N  N     . LEU A 104 ? 0.2440 0.3321 0.3790 -0.0157 -0.0405 0.0050  104 LEU A N     
815  C  CA    . LEU A 104 ? 0.2589 0.3485 0.3079 -0.0161 -0.0191 0.0049  104 LEU A CA    
816  C  C     . LEU A 104 ? 0.2756 0.3641 0.3417 0.0294  -0.0133 0.0122  104 LEU A C     
817  O  O     . LEU A 104 ? 0.2054 0.3297 0.3845 -0.0017 -0.0066 -0.0157 104 LEU A O     
818  C  CB    . LEU A 104 ? 0.2426 0.3431 0.3363 -0.0289 -0.0370 -0.0162 104 LEU A CB    
819  C  CG    . LEU A 104 ? 0.2735 0.4477 0.3368 -0.0732 -0.0267 0.0148  104 LEU A CG    
820  C  CD1   . LEU A 104 ? 0.2944 0.4057 0.3990 -0.0704 0.0398  0.0075  104 LEU A CD1   
821  C  CD2   . LEU A 104 ? 0.2966 0.3835 0.3798 -0.0719 -0.0666 -0.0031 104 LEU A CD2   
822  N  N     . GLY A 105 ? 0.3421 0.3551 0.3432 0.0314  -0.0258 -0.0323 105 GLY A N     
823  C  CA    . GLY A 105 ? 0.3161 0.3512 0.3542 0.0394  0.0000  -0.0289 105 GLY A CA    
824  C  C     . GLY A 105 ? 0.2524 0.3220 0.3528 0.0382  0.0227  -0.0420 105 GLY A C     
825  O  O     . GLY A 105 ? 0.2734 0.3450 0.3675 0.0190  0.0510  -0.0283 105 GLY A O     
826  N  N     . ASP A 106 ? 0.3101 0.3279 0.3370 0.0122  0.0159  -0.0614 106 ASP A N     
827  C  CA    . ASP A 106 ? 0.3116 0.3189 0.3773 0.0227  0.0136  0.0077  106 ASP A CA    
828  C  C     . ASP A 106 ? 0.2994 0.3185 0.3805 0.0306  0.0139  0.0304  106 ASP A C     
829  O  O     . ASP A 106 ? 0.2954 0.3494 0.3346 0.0642  0.0033  0.0164  106 ASP A O     
830  C  CB    . ASP A 106 ? 0.3075 0.3639 0.3758 0.0118  -0.0113 0.0217  106 ASP A CB    
831  C  CG    . ASP A 106 ? 0.3553 0.3683 0.4366 0.0426  0.0278  0.0135  106 ASP A CG    
832  O  OD1   . ASP A 106 ? 0.3903 0.3539 0.4374 0.0374  -0.0551 -0.0091 106 ASP A OD1   
833  O  OD2   . ASP A 106 ? 0.5073 0.4180 0.5458 -0.0272 0.0703  0.0494  106 ASP A OD2   
834  N  N     . TYR A 107 ? 0.2238 0.3331 0.3819 0.0126  0.0228  0.0123  107 TYR A N     
835  C  CA    . TYR A 107 ? 0.2245 0.3168 0.3671 0.0244  0.0124  0.0245  107 TYR A CA    
836  C  C     . TYR A 107 ? 0.2157 0.3315 0.3787 0.0073  -0.0220 0.0053  107 TYR A C     
837  O  O     . TYR A 107 ? 0.3116 0.3372 0.3806 -0.0280 0.0115  -0.0180 107 TYR A O     
838  C  CB    . TYR A 107 ? 0.2380 0.3082 0.3696 0.0259  0.0028  0.0105  107 TYR A CB    
839  C  CG    . TYR A 107 ? 0.2404 0.3146 0.3749 -0.0048 0.0061  0.0189  107 TYR A CG    
840  C  CD1   . TYR A 107 ? 0.2599 0.3108 0.3870 -0.0194 0.0273  -0.0081 107 TYR A CD1   
841  C  CD2   . TYR A 107 ? 0.2608 0.3558 0.3784 -0.0108 -0.0174 0.0232  107 TYR A CD2   
842  C  CE1   . TYR A 107 ? 0.2449 0.2775 0.3757 -0.0411 0.0122  -0.0301 107 TYR A CE1   
843  C  CE2   . TYR A 107 ? 0.2605 0.2941 0.3987 -0.0220 -0.0030 0.0104  107 TYR A CE2   
844  C  CZ    . TYR A 107 ? 0.2070 0.3592 0.3820 -0.0033 0.0007  0.0261  107 TYR A CZ    
845  O  OH    . TYR A 107 ? 0.2654 0.4599 0.3546 -0.0475 0.0291  0.0329  107 TYR A OH    
846  N  N     . LEU A 108 ? 0.2534 0.3095 0.3673 0.0262  -0.0064 0.0014  108 LEU A N     
847  C  CA    . LEU A 108 ? 0.2751 0.3401 0.4288 -0.0043 -0.0415 0.0008  108 LEU A CA    
848  C  C     . LEU A 108 ? 0.3054 0.3595 0.3667 -0.0173 -0.0423 0.0314  108 LEU A C     
849  O  O     . LEU A 108 ? 0.3264 0.3497 0.3948 -0.0485 -0.0360 0.0129  108 LEU A O     
850  C  CB    . LEU A 108 ? 0.2840 0.4343 0.4147 0.0016  -0.0401 0.0353  108 LEU A CB    
851  C  CG    . LEU A 108 ? 0.3713 0.4410 0.4441 0.0672  -0.0883 0.0477  108 LEU A CG    
852  C  CD1   . LEU A 108 ? 0.3458 0.4901 0.4449 0.0112  -0.0706 -0.0063 108 LEU A CD1   
853  C  CD2   . LEU A 108 ? 0.2700 0.4230 0.4798 -0.0166 0.0090  0.1016  108 LEU A CD2   
854  N  N     . LEU A 109 ? 0.3292 0.3549 0.3814 0.0287  -0.0167 0.0099  109 LEU A N     
855  C  CA    . LEU A 109 ? 0.3328 0.3318 0.3913 0.0138  -0.0111 0.0057  109 LEU A CA    
856  C  C     . LEU A 109 ? 0.3273 0.3431 0.3936 0.0077  0.0029  0.0147  109 LEU A C     
857  O  O     . LEU A 109 ? 0.3191 0.3632 0.4175 -0.0282 0.0197  0.0331  109 LEU A O     
858  C  CB    . LEU A 109 ? 0.3659 0.3400 0.4241 0.0141  0.0265  -0.0138 109 LEU A CB    
859  C  CG    . LEU A 109 ? 0.4482 0.4796 0.3840 -0.0657 0.0001  -0.0338 109 LEU A CG    
860  C  CD1   . LEU A 109 ? 0.3463 0.4999 0.3856 0.0669  -0.0257 -0.0221 109 LEU A CD1   
861  C  CD2   . LEU A 109 ? 0.5822 0.4438 0.3914 -0.0351 -0.0317 0.0967  109 LEU A CD2   
862  N  N     . PHE A 110 ? 0.3384 0.3569 0.4181 -0.0071 0.0298  -0.0139 110 PHE A N     
863  C  CA    . PHE A 110 ? 0.2808 0.3538 0.4149 0.0301  0.0154  0.0089  110 PHE A CA    
864  C  C     . PHE A 110 ? 0.2673 0.3404 0.4064 -0.0023 -0.0049 0.0258  110 PHE A C     
865  O  O     . PHE A 110 ? 0.3617 0.2867 0.4092 -0.0075 -0.0276 0.0101  110 PHE A O     
866  C  CB    . PHE A 110 ? 0.2391 0.3370 0.4393 0.0599  0.0200  -0.0050 110 PHE A CB    
867  C  CG    . PHE A 110 ? 0.2664 0.3694 0.3540 0.0458  0.0626  0.0475  110 PHE A CG    
868  C  CD1   . PHE A 110 ? 0.3341 0.3147 0.3765 0.0113  0.0313  0.0227  110 PHE A CD1   
869  C  CD2   . PHE A 110 ? 0.3092 0.3397 0.3598 0.0613  0.0732  0.0578  110 PHE A CD2   
870  C  CE1   . PHE A 110 ? 0.3270 0.3618 0.3472 0.0102  0.0765  0.0237  110 PHE A CE1   
871  C  CE2   . PHE A 110 ? 0.2730 0.3640 0.3678 -0.0039 0.0321  0.0429  110 PHE A CE2   
872  C  CZ    . PHE A 110 ? 0.2687 0.3518 0.3903 0.0048  0.0168  0.0552  110 PHE A CZ    
873  N  N     . LYS A 111 ? 0.2589 0.3305 0.3759 -0.0358 -0.0219 0.0202  111 LYS A N     
874  C  CA    . LYS A 111 ? 0.2651 0.3525 0.3911 -0.0192 -0.0018 0.0112  111 LYS A CA    
875  C  C     . LYS A 111 ? 0.2765 0.3604 0.4164 -0.0480 -0.0141 0.0189  111 LYS A C     
876  O  O     . LYS A 111 ? 0.2415 0.3798 0.4233 -0.0280 -0.0305 0.0404  111 LYS A O     
877  C  CB    . LYS A 111 ? 0.2563 0.3879 0.4175 -0.0392 -0.0258 0.0022  111 LYS A CB    
878  C  CG    . LYS A 111 ? 0.2384 0.4344 0.4336 -0.0255 -0.0309 -0.0166 111 LYS A CG    
879  C  CD    . LYS A 111 ? 0.2748 0.4162 0.4511 -0.0204 -0.0274 0.0051  111 LYS A CD    
880  C  CE    . LYS A 111 ? 0.2785 0.4196 0.5283 -0.0163 0.0027  0.0112  111 LYS A CE    
881  N  NZ    . LYS A 111 ? 0.2218 0.3895 0.5848 -0.0574 -0.0046 0.0139  111 LYS A NZ    
882  N  N     . LYS A 112 ? 0.2741 0.3434 0.4296 -0.0268 -0.0030 0.0292  112 LYS A N     
883  C  CA    . LYS A 112 ? 0.3059 0.3548 0.4222 -0.0764 -0.0436 0.0174  112 LYS A CA    
884  C  C     . LYS A 112 ? 0.2989 0.3428 0.4194 -0.0298 -0.0016 0.0329  112 LYS A C     
885  O  O     . LYS A 112 ? 0.2594 0.3154 0.4572 -0.0445 -0.0039 0.0278  112 LYS A O     
886  C  CB    . LYS A 112 ? 0.3273 0.3970 0.4038 -0.0882 -0.0043 0.0386  112 LYS A CB    
887  C  CG    . LYS A 112 ? 0.4580 0.4596 0.3566 -0.1511 -0.0711 0.0472  112 LYS A CG    
888  C  CD    . LYS A 112 ? 0.5258 0.5478 0.4307 -0.0588 -0.0503 -0.0187 112 LYS A CD    
889  C  CE    . LYS A 112 ? 0.6183 0.6425 0.4317 -0.0387 -0.0872 -0.0219 112 LYS A CE    
890  N  NZ    . LYS A 112 ? 0.6183 0.5676 0.5114 0.0394  -0.1713 -0.1102 112 LYS A NZ    
891  N  N     . VAL A 113 ? 0.3119 0.3091 0.3936 -0.0437 0.0112  0.0042  113 VAL A N     
892  C  CA    . VAL A 113 ? 0.3192 0.3212 0.4323 0.0153  0.0172  0.0327  113 VAL A CA    
893  C  C     . VAL A 113 ? 0.3268 0.3489 0.4382 0.0015  0.0271  0.0241  113 VAL A C     
894  O  O     . VAL A 113 ? 0.3840 0.3512 0.5001 0.0993  0.0163  0.0575  113 VAL A O     
895  C  CB    . VAL A 113 ? 0.3249 0.3848 0.4292 -0.0409 0.0092  0.0263  113 VAL A CB    
896  C  CG1   . VAL A 113 ? 0.3278 0.3708 0.4273 -0.0201 -0.0183 0.0852  113 VAL A CG1   
897  C  CG2   . VAL A 113 ? 0.3220 0.2893 0.4526 -0.0150 0.0391  -0.0029 113 VAL A CG2   
898  N  N     . LEU A 114 ? 0.2145 0.3474 0.4380 -0.0252 0.0344  0.0101  114 LEU A N     
899  C  CA    . LEU A 114 ? 0.2449 0.3715 0.4203 -0.0346 0.0258  0.0109  114 LEU A CA    
900  C  C     . LEU A 114 ? 0.2885 0.3653 0.4357 -0.0648 0.0158  0.0284  114 LEU A C     
901  O  O     . LEU A 114 ? 0.3268 0.3300 0.4212 -0.0627 -0.0116 0.0165  114 LEU A O     
902  C  CB    . LEU A 114 ? 0.2607 0.3704 0.4411 -0.0151 0.0629  0.0174  114 LEU A CB    
903  C  CG    . LEU A 114 ? 0.3376 0.4234 0.4966 -0.0535 -0.0247 0.0400  114 LEU A CG    
904  C  CD1   . LEU A 114 ? 0.2785 0.3971 0.5322 0.0249  0.0126  0.0879  114 LEU A CD1   
905  C  CD2   . LEU A 114 ? 0.2722 0.5214 0.4212 -0.1529 0.1029  -0.0319 114 LEU A CD2   
906  N  N     . GLU A 115 ? 0.2986 0.3511 0.4462 -0.0627 0.0016  0.0304  115 GLU A N     
907  C  CA    . GLU A 115 ? 0.3017 0.3923 0.4636 -0.0690 0.0037  0.0838  115 GLU A CA    
908  C  C     . GLU A 115 ? 0.3412 0.3847 0.4780 -0.0444 0.0202  0.0685  115 GLU A C     
909  O  O     . GLU A 115 ? 0.3622 0.3757 0.4365 -0.0297 0.0072  0.0708  115 GLU A O     
910  C  CB    . GLU A 115 ? 0.3467 0.4538 0.4943 -0.1196 -0.0245 0.0878  115 GLU A CB    
911  C  CG    . GLU A 115 ? 0.3405 0.4965 0.5600 -0.0574 -0.0030 0.0535  115 GLU A CG    
912  C  CD    . GLU A 115 ? 0.4713 0.6120 0.5984 -0.0380 -0.0672 0.1060  115 GLU A CD    
913  O  OE1   . GLU A 115 ? 0.6380 0.8070 0.6995 -0.0843 0.0523  0.0110  115 GLU A OE1   
914  O  OE2   . GLU A 115 ? 0.4547 0.6375 0.7720 -0.0315 -0.0391 0.0524  115 GLU A OE2   
915  N  N     . LEU A 116 ? 0.3520 0.4167 0.4782 -0.0023 -0.0132 0.0779  116 LEU A N     
916  C  CA    . LEU A 116 ? 0.3471 0.4094 0.4504 0.0040  -0.0240 0.0584  116 LEU A CA    
917  C  C     . LEU A 116 ? 0.3841 0.3908 0.4373 0.0008  -0.0021 0.0449  116 LEU A C     
918  O  O     . LEU A 116 ? 0.4001 0.4196 0.4707 0.0514  -0.0292 0.0790  116 LEU A O     
919  C  CB    . LEU A 116 ? 0.3553 0.3787 0.4367 -0.0059 -0.0055 0.0785  116 LEU A CB    
920  C  CG    . LEU A 116 ? 0.4087 0.4805 0.4905 -0.0464 -0.0276 0.0395  116 LEU A CG    
921  C  CD1   . LEU A 116 ? 0.4111 0.5558 0.5424 -0.0566 -0.0240 0.0061  116 LEU A CD1   
922  C  CD2   . LEU A 116 ? 0.4844 0.4177 0.5039 -0.0575 -0.0024 0.0151  116 LEU A CD2   
923  N  N     . MET A 117 ? 0.3191 0.3842 0.4150 0.0098  0.0104  0.0581  117 MET A N     
924  C  CA    . MET A 117 ? 0.3490 0.3806 0.4260 -0.0080 0.0061  0.0596  117 MET A CA    
925  C  C     . MET A 117 ? 0.3533 0.3911 0.4454 -0.0520 0.0272  0.0847  117 MET A C     
926  O  O     . MET A 117 ? 0.4203 0.4308 0.4836 -0.0668 -0.0340 0.1224  117 MET A O     
927  C  CB    . MET A 117 ? 0.3279 0.3798 0.3744 -0.0021 -0.0061 0.0640  117 MET A CB    
928  C  CG    . MET A 117 ? 0.3603 0.3709 0.4090 0.0390  0.0152  0.0708  117 MET A CG    
929  S  SD    . MET A 117 ? 0.3392 0.3954 0.4562 0.0357  -0.0023 0.0765  117 MET A SD    
930  C  CE    . MET A 117 ? 0.3363 0.4292 0.4167 0.0290  0.0336  0.0762  117 MET A CE    
931  N  N     . GLY A 118 ? 0.3338 0.4047 0.5041 -0.0639 0.0402  0.1153  118 GLY A N     
932  C  CA    . GLY A 118 ? 0.3627 0.4138 0.4732 -0.0350 0.0516  0.0961  118 GLY A CA    
933  C  C     . GLY A 118 ? 0.3828 0.4380 0.4523 -0.0595 0.0464  0.0982  118 GLY A C     
934  O  O     . GLY A 118 ? 0.4080 0.5294 0.4459 -0.0438 0.0493  0.1553  118 GLY A O     
935  N  N     . THR A 119 ? 0.4605 0.4240 0.5233 -0.0414 -0.0208 0.0847  119 THR A N     
936  C  CA    . THR A 119 ? 0.4533 0.4516 0.5634 -0.0473 -0.0254 0.1069  119 THR A CA    
937  C  C     . THR A 119 ? 0.4321 0.4235 0.6100 -0.0531 0.0025  0.1204  119 THR A C     
938  O  O     . THR A 119 ? 0.4356 0.4174 0.6021 -0.1148 0.0497  0.0921  119 THR A O     
939  C  CB    . THR A 119 ? 0.4549 0.4146 0.6245 -0.0191 -0.0356 0.0772  119 THR A CB    
940  O  OG1   . THR A 119 ? 0.6290 0.4440 0.6552 0.0410  0.0631  0.1433  119 THR A OG1   
941  C  CG2   . THR A 119 ? 0.3071 0.3778 0.7477 -0.0703 -0.0386 -0.0197 119 THR A CG2   
942  N  N     . LYS A 120 ? 0.3980 0.5193 0.5350 -0.0452 -0.0321 0.0525  120 LYS A N     
943  C  CA    . LYS A 120 ? 0.4551 0.4743 0.4699 -0.0069 -0.0136 0.0964  120 LYS A CA    
944  C  C     . LYS A 120 ? 0.4100 0.4624 0.4680 0.0025  -0.0244 0.1045  120 LYS A C     
945  O  O     . LYS A 120 ? 0.4581 0.3803 0.5464 -0.0317 -0.0202 0.1757  120 LYS A O     
946  C  CB    . LYS A 120 ? 0.5585 0.5550 0.4841 -0.0228 0.0415  0.1064  120 LYS A CB    
947  C  CG    . LYS A 120 ? 0.4756 0.6343 0.4760 0.0475  0.0199  0.1062  120 LYS A CG    
948  C  CD    . LYS A 120 ? 0.6105 0.6943 0.4991 -0.0468 0.0520  0.0265  120 LYS A CD    
949  C  CE    . LYS A 120 ? 0.5333 0.7358 0.5628 0.0035  0.1354  0.0636  120 LYS A CE    
950  N  NZ    . LYS A 120 ? 0.7128 0.6306 0.8326 -0.0016 0.0936  0.0983  120 LYS A NZ    
951  N  N     . GLU A 121 ? 0.4317 0.5023 0.4694 -0.0129 -0.0223 0.0806  121 GLU A N     
952  C  CA    . GLU A 121 ? 0.4454 0.4904 0.5173 0.0016  -0.0365 0.0644  121 GLU A CA    
953  C  C     . GLU A 121 ? 0.4546 0.4102 0.5252 0.0156  -0.0269 0.0457  121 GLU A C     
954  O  O     . GLU A 121 ? 0.4114 0.5103 0.5716 0.0642  -0.0129 0.0072  121 GLU A O     
955  C  CB    . GLU A 121 ? 0.5230 0.5929 0.5508 -0.0048 -0.0853 0.0919  121 GLU A CB    
956  C  CG    . GLU A 121 ? 0.4931 0.7520 0.6278 -0.0129 -0.0894 0.0744  121 GLU A CG    
957  C  CD    . GLU A 121 ? 0.6280 0.8471 0.6235 -0.0105 -0.0997 0.0562  121 GLU A CD    
958  O  OE1   . GLU A 121 ? 0.6141 0.8654 0.9074 -0.0097 -0.0900 0.0853  121 GLU A OE1   
959  O  OE2   . GLU A 121 ? 0.5882 0.8559 0.5940 -0.0704 0.0209  0.1434  121 GLU A OE2   
960  N  N     . HIS A 122 ? 0.4594 0.4274 0.4806 -0.0276 0.0315  0.0988  122 HIS A N     
961  C  CA    . HIS A 122 ? 0.4366 0.4225 0.4817 0.0353  0.0320  0.0748  122 HIS A CA    
962  C  C     . HIS A 122 ? 0.4478 0.4677 0.5039 0.0484  0.0299  0.0903  122 HIS A C     
963  O  O     . HIS A 122 ? 0.5089 0.4891 0.5159 0.0816  0.1394  0.0739  122 HIS A O     
964  C  CB    . HIS A 122 ? 0.3833 0.4347 0.4687 0.0150  0.0229  0.0320  122 HIS A CB    
965  C  CG    . HIS A 122 ? 0.3779 0.4527 0.4440 0.0203  0.0331  0.0581  122 HIS A CG    
966  N  ND1   . HIS A 122 ? 0.3831 0.4289 0.4926 0.0437  0.0347  -0.0010 122 HIS A ND1   
967  C  CD2   . HIS A 122 ? 0.3630 0.4501 0.4256 0.0275  0.0288  0.0875  122 HIS A CD2   
968  C  CE1   . HIS A 122 ? 0.3853 0.4976 0.4591 0.0782  0.0239  0.0207  122 HIS A CE1   
969  N  NE2   . HIS A 122 ? 0.3998 0.4708 0.4337 0.0895  -0.0104 0.0393  122 HIS A NE2   
970  N  N     . LEU A 123 ? 0.5504 0.4761 0.4645 0.0733  0.0298  0.0818  123 LEU A N     
971  C  CA    . LEU A 123 ? 0.5345 0.4344 0.4942 0.0602  0.0110  0.0824  123 LEU A CA    
972  C  C     . LEU A 123 ? 0.5074 0.4341 0.5129 0.0871  0.0089  0.0752  123 LEU A C     
973  O  O     . LEU A 123 ? 0.6003 0.4938 0.5669 0.1231  -0.0440 0.1001  123 LEU A O     
974  C  CB    . LEU A 123 ? 0.4907 0.4501 0.4797 0.0929  -0.0190 0.0615  123 LEU A CB    
975  C  CG    . LEU A 123 ? 0.4747 0.4831 0.4507 0.0318  -0.0012 0.0344  123 LEU A CG    
976  C  CD1   . LEU A 123 ? 0.4484 0.5850 0.4801 0.0559  0.0296  0.0748  123 LEU A CD1   
977  C  CD2   . LEU A 123 ? 0.4598 0.5487 0.4388 0.0463  0.0409  -0.0220 123 LEU A CD2   
978  N  N     . THR A 124 ? 0.4823 0.4059 0.4918 0.0563  0.0389  0.0903  124 THR A N     
979  C  CA    . THR A 124 ? 0.4985 0.4127 0.5116 0.0279  0.0221  0.0797  124 THR A CA    
980  C  C     . THR A 124 ? 0.5334 0.4053 0.5159 0.0459  0.0317  0.0773  124 THR A C     
981  O  O     . THR A 124 ? 0.5352 0.3564 0.5312 0.0348  0.0201  0.0525  124 THR A O     
982  C  CB    . THR A 124 ? 0.5165 0.4278 0.5232 0.0026  0.0187  0.0731  124 THR A CB    
983  O  OG1   . THR A 124 ? 0.4907 0.5311 0.5361 0.0225  0.0045  0.0855  124 THR A OG1   
984  C  CG2   . THR A 124 ? 0.4181 0.4518 0.5287 -0.0372 -0.0017 0.0856  124 THR A CG2   
985  N  N     . GLN A 125 ? 0.5949 0.3874 0.5324 0.0453  0.0355  0.1285  125 GLN A N     
986  C  CA    . GLN A 125 ? 0.6074 0.4072 0.5737 0.0883  0.0412  0.0854  125 GLN A CA    
987  C  C     . GLN A 125 ? 0.5764 0.4241 0.5597 0.0501  0.0422  0.0624  125 GLN A C     
988  O  O     . GLN A 125 ? 0.6085 0.3559 0.5929 0.0728  0.0726  0.0588  125 GLN A O     
989  C  CB    . GLN A 125 ? 0.6373 0.4196 0.6115 0.1090  0.0237  0.0796  125 GLN A CB    
990  C  CG    . GLN A 125 ? 0.6726 0.5141 0.6082 0.1262  0.0389  0.0855  125 GLN A CG    
991  C  CD    . GLN A 125 ? 0.7124 0.5155 0.6108 0.1101  0.0529  0.1205  125 GLN A CD    
992  O  OE1   . GLN A 125 ? 0.7997 0.5486 0.6643 0.1038  0.0387  0.0643  125 GLN A OE1   
993  N  NE2   . GLN A 125 ? 0.6518 0.5825 0.5856 0.1736  0.0204  0.1420  125 GLN A NE2   
994  N  N     . ARG A 126 ? 0.6159 0.4005 0.5645 -0.0207 0.0148  0.0819  126 ARG A N     
995  C  CA    . ARG A 126 ? 0.6121 0.4000 0.5795 -0.0224 -0.0074 0.0644  126 ARG A CA    
996  C  C     . ARG A 126 ? 0.5433 0.3956 0.5256 -0.0692 0.0126  0.0782  126 ARG A C     
997  O  O     . ARG A 126 ? 0.6060 0.4610 0.5137 -0.0896 -0.0379 0.0835  126 ARG A O     
998  C  CB    . ARG A 126 ? 0.6244 0.4626 0.6261 -0.0511 -0.0212 0.0447  126 ARG A CB    
999  C  CG    . ARG A 126 ? 0.6950 0.4387 0.6148 -0.0362 -0.0286 0.0128  126 ARG A CG    
1000 C  CD    . ARG A 126 ? 0.8033 0.3789 0.7867 -0.0886 -0.0643 -0.0476 126 ARG A CD    
1001 N  NE    . ARG A 126 ? 0.9796 0.4402 0.7526 0.0346  -0.1108 -0.0221 126 ARG A NE    
1002 C  CZ    . ARG A 126 ? 0.9448 0.3867 0.6922 0.0520  -0.1214 0.0333  126 ARG A CZ    
1003 N  NH1   . ARG A 126 ? 1.0473 0.6877 0.6125 -0.0076 -0.1686 -0.0072 126 ARG A NH1   
1004 N  NH2   . ARG A 126 ? 0.9457 0.4094 0.6873 0.0970  -0.1928 0.0387  126 ARG A NH2   
1005 N  N     . GLY A 127 ? 0.5449 0.3856 0.5588 -0.0580 0.0380  0.0817  127 GLY A N     
1006 C  CA    . GLY A 127 ? 0.4831 0.4056 0.4952 -0.0173 0.0090  0.1055  127 GLY A CA    
1007 C  C     . GLY A 127 ? 0.4696 0.3937 0.4972 0.0059  0.0298  0.0829  127 GLY A C     
1008 O  O     . GLY A 127 ? 0.4364 0.3805 0.4573 0.0557  0.0489  0.0517  127 GLY A O     
1009 N  N     . LEU A 128 ? 0.4850 0.4179 0.4891 0.0367  0.0316  0.0783  128 LEU A N     
1010 C  CA    . LEU A 128 ? 0.4474 0.4140 0.4779 0.0822  0.0335  0.0630  128 LEU A CA    
1011 C  C     . LEU A 128 ? 0.4346 0.3861 0.4847 0.0910  0.0363  0.0567  128 LEU A C     
1012 O  O     . LEU A 128 ? 0.4112 0.3695 0.4954 0.1064  0.0375  0.0464  128 LEU A O     
1013 C  CB    . LEU A 128 ? 0.4629 0.4078 0.4415 0.0975  0.0538  0.0780  128 LEU A CB    
1014 C  CG    . LEU A 128 ? 0.4840 0.3834 0.4491 0.0888  0.0796  0.1189  128 LEU A CG    
1015 C  CD1   . LEU A 128 ? 0.5033 0.4046 0.4206 0.0788  0.0962  0.0536  128 LEU A CD1   
1016 C  CD2   . LEU A 128 ? 0.4580 0.4206 0.4888 0.0849  0.0802  0.1445  128 LEU A CD2   
1017 N  N     . GLU A 129 ? 0.4455 0.3747 0.5020 0.0858  0.0154  0.0625  129 GLU A N     
1018 C  CA    . GLU A 129 ? 0.5114 0.3541 0.5215 0.0702  0.0411  0.0422  129 GLU A CA    
1019 C  C     . GLU A 129 ? 0.5150 0.3539 0.5194 0.0576  0.0275  0.0409  129 GLU A C     
1020 O  O     . GLU A 129 ? 0.4865 0.3705 0.4868 0.0795  0.0319  0.0232  129 GLU A O     
1021 C  CB    . GLU A 129 ? 0.6262 0.3511 0.5408 0.0843  0.0631  0.0345  129 GLU A CB    
1022 C  CG    . GLU A 129 ? 0.6504 0.4283 0.5327 0.1002  0.0564  0.0399  129 GLU A CG    
1023 C  CD    . GLU A 129 ? 0.7792 0.4460 0.5898 0.1032  0.1017  0.0139  129 GLU A CD    
1024 O  OE1   . GLU A 129 ? 0.7624 0.6081 0.5446 0.1214  0.1496  0.0646  129 GLU A OE1   
1025 O  OE2   . GLU A 129 ? 0.8073 0.5135 0.6040 0.0896  0.0893  -0.0058 129 GLU A OE2   
1026 N  N     . LYS A 130 ? 0.5161 0.3127 0.5130 0.0652  0.0290  0.0171  130 LYS A N     
1027 C  CA    . LYS A 130 ? 0.4807 0.3328 0.4961 0.0163  0.0109  0.0403  130 LYS A CA    
1028 C  C     . LYS A 130 ? 0.4088 0.3360 0.4576 0.0282  0.0151  0.0524  130 LYS A C     
1029 O  O     . LYS A 130 ? 0.3976 0.3487 0.4488 0.0024  -0.0112 0.0550  130 LYS A O     
1030 C  CB    . LYS A 130 ? 0.4797 0.3547 0.5021 -0.0257 0.0141  0.0245  130 LYS A CB    
1031 C  CG    . LYS A 130 ? 0.5882 0.3762 0.5190 -0.0618 -0.0034 -0.0140 130 LYS A CG    
1032 C  CD    . LYS A 130 ? 0.5809 0.4574 0.5985 -0.0801 0.0258  -0.0271 130 LYS A CD    
1033 C  CE    . LYS A 130 ? 0.5788 0.5020 0.6467 -0.1065 -0.0004 0.0342  130 LYS A CE    
1034 N  NZ    . LYS A 130 ? 0.5681 0.6290 0.6551 -0.1404 0.0257  0.0713  130 LYS A NZ    
1035 N  N     . ILE A 131 ? 0.3922 0.3290 0.4370 0.0480  0.0353  0.0456  131 ILE A N     
1036 C  CA    . ILE A 131 ? 0.3864 0.3547 0.4264 0.0337  0.0338  0.0095  131 ILE A CA    
1037 C  C     . ILE A 131 ? 0.3848 0.3550 0.4531 0.0545  0.0443  0.0067  131 ILE A C     
1038 O  O     . ILE A 131 ? 0.3510 0.3649 0.4415 0.0503  0.0737  -0.0017 131 ILE A O     
1039 C  CB    . ILE A 131 ? 0.3597 0.3645 0.4217 0.0305  0.0251  0.0182  131 ILE A CB    
1040 C  CG1   . ILE A 131 ? 0.3440 0.3707 0.4222 0.0294  0.0027  -0.0044 131 ILE A CG1   
1041 C  CG2   . ILE A 131 ? 0.3149 0.3384 0.4156 0.0530  0.0514  0.0504  131 ILE A CG2   
1042 C  CD1   . ILE A 131 ? 0.3482 0.3627 0.4192 0.0764  0.0743  0.0373  131 ILE A CD1   
1043 N  N     . VAL A 132 ? 0.4224 0.3705 0.4741 0.0809  0.0369  0.0258  132 VAL A N     
1044 C  CA    . VAL A 132 ? 0.4535 0.3619 0.4752 0.1164  0.0513  0.0204  132 VAL A CA    
1045 C  C     . VAL A 132 ? 0.4560 0.3326 0.4871 0.0861  0.0319  0.0268  132 VAL A C     
1046 O  O     . VAL A 132 ? 0.4446 0.3373 0.4550 0.0814  0.0302  0.0210  132 VAL A O     
1047 C  CB    . VAL A 132 ? 0.4958 0.3753 0.4901 0.1418  0.0617  0.0271  132 VAL A CB    
1048 C  CG1   . VAL A 132 ? 0.5101 0.3662 0.4717 0.1490  0.0670  0.0183  132 VAL A CG1   
1049 C  CG2   . VAL A 132 ? 0.5096 0.4025 0.4708 0.1690  0.0739  0.0692  132 VAL A CG2   
1050 N  N     . SER A 133 ? 0.4909 0.3347 0.5216 0.0693  0.0171  0.0129  133 SER A N     
1051 C  CA    . SER A 133 ? 0.5489 0.3135 0.5048 0.0384  0.0217  0.0125  133 SER A CA    
1052 C  C     . SER A 133 ? 0.4871 0.3115 0.4551 0.0102  0.0174  0.0216  133 SER A C     
1053 O  O     . SER A 133 ? 0.4866 0.3111 0.4565 0.0319  0.0126  0.0320  133 SER A O     
1054 C  CB    . SER A 133 ? 0.5889 0.3609 0.5528 -0.0074 0.0157  0.0180  133 SER A CB    
1055 O  OG    . SER A 133 ? 0.7398 0.3443 0.6288 -0.0869 0.0362  -0.0329 133 SER A OG    
1056 N  N     . LEU A 134 ? 0.4651 0.3198 0.4435 -0.0013 0.0300  0.0374  134 LEU A N     
1057 C  CA    . LEU A 134 ? 0.4243 0.3479 0.4029 0.0248  0.0212  0.0182  134 LEU A CA    
1058 C  C     . LEU A 134 ? 0.4210 0.3550 0.4151 0.0235  0.0197  0.0069  134 LEU A C     
1059 O  O     . LEU A 134 ? 0.3932 0.3668 0.4228 0.0736  -0.0076 0.0164  134 LEU A O     
1060 C  CB    . LEU A 134 ? 0.3624 0.3460 0.4202 0.0170  0.0032  0.0061  134 LEU A CB    
1061 C  CG    . LEU A 134 ? 0.3789 0.3783 0.4204 -0.0041 -0.0097 0.0308  134 LEU A CG    
1062 C  CD1   . LEU A 134 ? 0.3273 0.3807 0.4183 -0.0373 -0.0265 0.0536  134 LEU A CD1   
1063 C  CD2   . LEU A 134 ? 0.3985 0.4624 0.3311 -0.0248 -0.0076 0.0021  134 LEU A CD2   
1064 N  N     . LYS A 135 ? 0.3842 0.3857 0.4321 0.0374  0.0387  0.0237  135 LYS A N     
1065 C  CA    . LYS A 135 ? 0.3571 0.3688 0.4197 0.0603  0.0437  0.0027  135 LYS A CA    
1066 C  C     . LYS A 135 ? 0.4241 0.3757 0.4151 0.0726  0.0569  0.0091  135 LYS A C     
1067 O  O     . LYS A 135 ? 0.4271 0.3805 0.4206 0.0790  0.0520  0.0225  135 LYS A O     
1068 C  CB    . LYS A 135 ? 0.3417 0.3846 0.4300 0.0746  0.0559  0.0222  135 LYS A CB    
1069 C  CG    . LYS A 135 ? 0.3023 0.3609 0.4532 0.1091  0.0549  0.0172  135 LYS A CG    
1070 C  CD    . LYS A 135 ? 0.3259 0.4636 0.4604 0.0688  0.0449  0.0415  135 LYS A CD    
1071 C  CE    . LYS A 135 ? 0.3389 0.4040 0.5187 0.0688  0.0271  0.0599  135 LYS A CE    
1072 N  NZ    . LYS A 135 ? 0.2732 0.4052 0.4943 0.0462  -0.0252 0.0193  135 LYS A NZ    
1073 N  N     . ALA A 136 ? 0.4654 0.3556 0.4333 0.1148  0.0624  0.0263  136 ALA A N     
1074 C  CA    . ALA A 136 ? 0.5257 0.3334 0.4489 0.0956  0.0849  -0.0013 136 ALA A CA    
1075 C  C     . ALA A 136 ? 0.5270 0.3199 0.4354 0.0766  0.0774  -0.0131 136 ALA A C     
1076 O  O     . ALA A 136 ? 0.5932 0.4122 0.4075 0.0541  0.0854  -0.0143 136 ALA A O     
1077 C  CB    . ALA A 136 ? 0.5669 0.3061 0.4584 0.1527  0.0863  0.0400  136 ALA A CB    
1078 N  N     . SER A 137 ? 0.4718 0.3430 0.4634 0.0142  0.0389  -0.0039 137 SER A N     
1079 C  CA    . SER A 137 ? 0.4741 0.3500 0.4787 0.0316  0.0288  -0.0112 137 SER A CA    
1080 C  C     . SER A 137 ? 0.4314 0.3529 0.4327 0.0212  0.0591  0.0056  137 SER A C     
1081 O  O     . SER A 137 ? 0.5228 0.3963 0.4970 0.0510  0.0972  0.0930  137 SER A O     
1082 C  CB    . SER A 137 ? 0.4933 0.3367 0.4666 -0.0126 0.0663  -0.0282 137 SER A CB    
1083 O  OG    . SER A 137 ? 0.5017 0.3184 0.5286 -0.0269 0.0864  -0.0367 137 SER A OG    
1084 N  N     . ILE A 138 ? 0.3183 0.3615 0.4304 0.0014  0.0624  0.0096  138 ILE A N     
1085 C  CA    . ILE A 138 ? 0.3625 0.3773 0.4022 0.0412  0.0553  0.0036  138 ILE A CA    
1086 C  C     . ILE A 138 ? 0.3498 0.3460 0.4330 0.0387  0.0202  -0.0195 138 ILE A C     
1087 O  O     . ILE A 138 ? 0.3742 0.3582 0.4726 0.0676  0.0378  -0.0325 138 ILE A O     
1088 C  CB    . ILE A 138 ? 0.3684 0.3975 0.4012 0.0216  0.0544  -0.0084 138 ILE A CB    
1089 C  CG1   . ILE A 138 ? 0.3735 0.4163 0.3924 0.0184  0.0707  0.0285  138 ILE A CG1   
1090 C  CG2   . ILE A 138 ? 0.3460 0.4235 0.2859 0.0027  -0.0047 -0.0033 138 ILE A CG2   
1091 C  CD1   . ILE A 138 ? 0.3547 0.5445 0.3836 0.0613  0.0492  0.0513  138 ILE A CD1   
1092 N  N     . ASN A 139 ? 0.3209 0.3765 0.3954 0.0558  -0.0119 -0.0082 139 ASN A N     
1093 C  CA    . ASN A 139 ? 0.2959 0.4155 0.4336 0.0696  0.0560  0.0094  139 ASN A CA    
1094 C  C     . ASN A 139 ? 0.3476 0.4113 0.4610 0.1090  0.0598  -0.0082 139 ASN A C     
1095 O  O     . ASN A 139 ? 0.3319 0.4654 0.4815 0.1270  0.1352  -0.0440 139 ASN A O     
1096 C  CB    . ASN A 139 ? 0.3010 0.4469 0.4794 0.0734  0.0177  -0.0203 139 ASN A CB    
1097 C  CG    . ASN A 139 ? 0.3640 0.4361 0.4387 0.0637  0.0414  -0.0564 139 ASN A CG    
1098 O  OD1   . ASN A 139 ? 0.4744 0.4206 0.5249 -0.0011 -0.0328 -0.0001 139 ASN A OD1   
1099 N  ND2   . ASN A 139 ? 0.4212 0.4575 0.4238 0.0309  -0.0023 -0.0094 139 ASN A ND2   
1100 N  N     . LYS A 140 ? 0.3798 0.4256 0.4006 0.1513  0.0566  0.0178  140 LYS A N     
1101 C  CA    . LYS A 140 ? 0.3561 0.4230 0.4878 0.1322  0.0670  0.0495  140 LYS A CA    
1102 C  C     . LYS A 140 ? 0.3920 0.4088 0.4715 0.1145  0.0763  0.0113  140 LYS A C     
1103 O  O     . LYS A 140 ? 0.3456 0.4073 0.4773 0.0912  0.0925  0.0489  140 LYS A O     
1104 C  CB    . LYS A 140 ? 0.4158 0.4211 0.4951 0.0678  0.0475  0.0835  140 LYS A CB    
1105 C  CG    . LYS A 140 ? 0.4696 0.4347 0.5081 0.0821  0.0799  0.1270  140 LYS A CG    
1106 C  CD    . LYS A 140 ? 0.6566 0.6395 0.5146 0.0755  0.0795  0.0464  140 LYS A CD    
1107 C  CE    . LYS A 140 ? 0.6961 0.6743 0.5258 0.1572  0.0268  0.0079  140 LYS A CE    
1108 N  NZ    . LYS A 140 ? 0.8598 0.7502 0.4126 0.1819  0.0594  0.1023  140 LYS A NZ    
1109 N  N     . GLY A 141 ? 0.3573 0.3744 0.5286 0.1128  0.0459  0.0107  141 GLY A N     
1110 C  CA    . GLY A 141 ? 0.4905 0.3665 0.5067 0.0834  0.0393  -0.0402 141 GLY A CA    
1111 C  C     . GLY A 141 ? 0.5029 0.3676 0.5147 0.1300  0.0996  0.0188  141 GLY A C     
1112 O  O     . GLY A 141 ? 0.4775 0.4071 0.5054 0.0996  0.1362  0.0149  141 GLY A O     
1113 N  N     . LEU A 142 ? 0.5223 0.3922 0.4451 0.1433  0.1398  -0.0055 142 LEU A N     
1114 C  CA    . LEU A 142 ? 0.4585 0.4047 0.4994 0.1458  0.1239  0.0060  142 LEU A CA    
1115 C  C     . LEU A 142 ? 0.4689 0.4662 0.5403 0.1296  0.1347  0.0216  142 LEU A C     
1116 O  O     . LEU A 142 ? 0.4303 0.4483 0.6048 0.1434  0.1857  -0.0076 142 LEU A O     
1117 C  CB    . LEU A 142 ? 0.5134 0.4092 0.4776 0.1138  0.1007  0.0029  142 LEU A CB    
1118 C  CG    . LEU A 142 ? 0.5090 0.3941 0.4707 0.1159  0.1000  0.0161  142 LEU A CG    
1119 C  CD1   . LEU A 142 ? 0.4915 0.4000 0.5259 0.1163  0.0795  -0.0009 142 LEU A CD1   
1120 C  CD2   . LEU A 142 ? 0.4615 0.3422 0.4920 0.1403  0.0678  -0.0027 142 LEU A CD2   
1121 N  N     . SER A 143 ? 0.4556 0.4413 0.5783 0.1850  0.0732  0.0589  143 SER A N     
1122 C  CA    . SER A 143 ? 0.4668 0.4602 0.6078 0.1660  0.0930  0.0653  143 SER A CA    
1123 C  C     . SER A 143 ? 0.4711 0.5289 0.6197 0.1912  0.1740  0.0201  143 SER A C     
1124 O  O     . SER A 143 ? 0.4692 0.5240 0.6321 0.1715  0.2469  0.0265  143 SER A O     
1125 C  CB    . SER A 143 ? 0.5434 0.4835 0.5874 0.1401  0.1075  0.0817  143 SER A CB    
1126 O  OG    . SER A 143 ? 0.4557 0.4648 0.5171 0.1536  0.0544  0.0674  143 SER A OG    
1127 N  N     . GLU A 144 ? 0.4667 0.5241 0.6649 0.1851  0.1270  0.0418  144 GLU A N     
1128 C  CA    . GLU A 144 ? 0.4877 0.5302 0.6687 0.2201  0.1468  0.1103  144 GLU A CA    
1129 C  C     . GLU A 144 ? 0.5136 0.5171 0.6921 0.2255  0.1318  0.1261  144 GLU A C     
1130 O  O     . GLU A 144 ? 0.5701 0.5241 0.6265 0.2109  0.1425  0.1150  144 GLU A O     
1131 C  CB    . GLU A 144 ? 0.4807 0.5772 0.7251 0.2337  0.1527  0.1291  144 GLU A CB    
1132 C  CG    . GLU A 144 ? 0.5269 0.6152 0.7240 0.2399  0.1551  0.1308  144 GLU A CG    
1133 C  CD    . GLU A 144 ? 0.5277 0.6296 0.7512 0.2386  0.1317  0.1179  144 GLU A CD    
1134 O  OE1   . GLU A 144 ? 0.5602 0.7294 0.7775 0.2403  0.1576  0.0800  144 GLU A OE1   
1135 O  OE2   . GLU A 144 ? 0.5276 0.8312 0.7488 0.1994  0.1310  0.1486  144 GLU A OE2   
1136 N  N     . GLU A 145 ? 0.4759 0.5088 0.6891 0.2079  0.1340  0.1317  145 GLU A N     
1137 C  CA    . GLU A 145 ? 0.4785 0.5614 0.6781 0.2159  0.1382  0.1436  145 GLU A CA    
1138 C  C     . GLU A 145 ? 0.4826 0.4818 0.6476 0.2369  0.1071  0.1139  145 GLU A C     
1139 O  O     . GLU A 145 ? 0.5160 0.4668 0.6931 0.2537  0.1142  0.1144  145 GLU A O     
1140 C  CB    . GLU A 145 ? 0.4549 0.6084 0.6787 0.1768  0.1050  0.1460  145 GLU A CB    
1141 C  CG    . GLU A 145 ? 0.4812 0.6472 0.7001 0.1956  0.0676  0.1781  145 GLU A CG    
1142 C  CD    . GLU A 145 ? 0.4777 0.6260 0.7051 0.1871  0.1424  0.1759  145 GLU A CD    
1143 O  OE1   . GLU A 145 ? 0.5381 0.5860 0.5615 0.1679  0.1196  0.1462  145 GLU A OE1   
1144 O  OE2   . GLU A 145 ? 0.5771 0.7106 0.6901 0.0659  0.1290  0.2558  145 GLU A OE2   
1145 N  N     . LEU A 146 ? 0.4646 0.4682 0.6351 0.2278  0.0947  0.0806  146 LEU A N     
1146 C  CA    . LEU A 146 ? 0.4675 0.4280 0.6068 0.2199  0.1277  0.0933  146 LEU A CA    
1147 C  C     . LEU A 146 ? 0.5162 0.4298 0.6305 0.2219  0.1494  0.0782  146 LEU A C     
1148 O  O     . LEU A 146 ? 0.5778 0.4018 0.6714 0.2193  0.1310  0.0594  146 LEU A O     
1149 C  CB    . LEU A 146 ? 0.4400 0.3968 0.5646 0.1978  0.1420  0.0580  146 LEU A CB    
1150 C  CG    . LEU A 146 ? 0.4585 0.3936 0.5302 0.1842  0.1034  0.0667  146 LEU A CG    
1151 C  CD1   . LEU A 146 ? 0.3503 0.4553 0.5073 0.1944  0.0884  -0.0027 146 LEU A CD1   
1152 C  CD2   . LEU A 146 ? 0.4732 0.4194 0.4990 0.1637  0.0843  0.0810  146 LEU A CD2   
1153 N  N     . GLN A 147 ? 0.5221 0.4478 0.6280 0.2317  0.1495  0.0942  147 GLN A N     
1154 C  CA    . GLN A 147 ? 0.5900 0.4435 0.6373 0.2346  0.1597  0.0935  147 GLN A CA    
1155 C  C     . GLN A 147 ? 0.5965 0.4625 0.6257 0.2492  0.1703  0.1156  147 GLN A C     
1156 O  O     . GLN A 147 ? 0.6281 0.4359 0.6098 0.2876  0.1512  0.0985  147 GLN A O     
1157 C  CB    . GLN A 147 ? 0.6440 0.5435 0.6434 0.2114  0.1527  0.1565  147 GLN A CB    
1158 C  CG    . GLN A 147 ? 0.6948 0.5354 0.6751 0.2368  0.1311  0.1044  147 GLN A CG    
1159 C  CD    . GLN A 147 ? 0.6210 0.5773 0.6969 0.2454  0.1184  0.1140  147 GLN A CD    
1160 O  OE1   . GLN A 147 ? 0.6521 0.7407 0.7715 0.2593  0.2189  0.0163  147 GLN A OE1   
1161 N  NE2   . GLN A 147 ? 0.7236 0.6355 0.6053 0.2054  0.0868  0.1702  147 GLN A NE2   
1162 N  N     . ALA A 148 ? 0.5583 0.4455 0.6462 0.2547  0.1901  0.1245  148 ALA A N     
1163 C  CA    . ALA A 148 ? 0.6046 0.4761 0.6938 0.2718  0.1673  0.1575  148 ALA A CA    
1164 C  C     . ALA A 148 ? 0.5738 0.4679 0.6947 0.2596  0.1441  0.1493  148 ALA A C     
1165 O  O     . ALA A 148 ? 0.6082 0.4632 0.7375 0.2706  0.1327  0.1825  148 ALA A O     
1166 C  CB    . ALA A 148 ? 0.5806 0.4823 0.7303 0.2575  0.1920  0.1719  148 ALA A CB    
1167 N  N     . ALA A 149 ? 0.5351 0.4802 0.6846 0.2555  0.1184  0.1451  149 ALA A N     
1168 C  CA    . ALA A 149 ? 0.5545 0.4676 0.6742 0.2445  0.1212  0.1321  149 ALA A CA    
1169 C  C     . ALA A 149 ? 0.5851 0.4313 0.6605 0.2250  0.1237  0.1039  149 ALA A C     
1170 O  O     . ALA A 149 ? 0.5773 0.4539 0.6742 0.2118  0.1082  0.1258  149 ALA A O     
1171 C  CB    . ALA A 149 ? 0.4687 0.4367 0.6741 0.2440  0.0985  0.1369  149 ALA A CB    
1172 N  N     . PHE A 150 ? 0.5794 0.3913 0.6492 0.2715  0.1243  0.0557  150 PHE A N     
1173 C  CA    . PHE A 150 ? 0.6308 0.3900 0.6487 0.2226  0.1225  0.0369  150 PHE A CA    
1174 C  C     . PHE A 150 ? 0.6567 0.3863 0.6455 0.2143  0.1091  0.0348  150 PHE A C     
1175 O  O     . PHE A 150 ? 0.6516 0.3338 0.5863 0.1821  0.1221  0.0075  150 PHE A O     
1176 C  CB    . PHE A 150 ? 0.5580 0.4436 0.6196 0.2022  0.1180  0.0392  150 PHE A CB    
1177 C  CG    . PHE A 150 ? 0.6160 0.4386 0.5839 0.1763  0.0633  0.0792  150 PHE A CG    
1178 C  CD1   . PHE A 150 ? 0.6564 0.4970 0.5865 0.1449  0.0725  0.0879  150 PHE A CD1   
1179 C  CD2   . PHE A 150 ? 0.6335 0.3684 0.5938 0.2010  0.0675  0.0970  150 PHE A CD2   
1180 C  CE1   . PHE A 150 ? 0.6423 0.4065 0.6021 0.1970  0.0913  0.0512  150 PHE A CE1   
1181 C  CE2   . PHE A 150 ? 0.6556 0.4336 0.6047 0.1572  0.1173  0.0894  150 PHE A CE2   
1182 C  CZ    . PHE A 150 ? 0.5810 0.4583 0.6238 0.1427  0.0794  0.0802  150 PHE A CZ    
1183 N  N     . PRO A 151 ? 0.6981 0.4277 0.6610 0.2258  0.1601  0.0114  151 PRO A N     
1184 C  CA    . PRO A 151 ? 0.7506 0.4745 0.6724 0.2431  0.1934  0.0233  151 PRO A CA    
1185 C  C     . PRO A 151 ? 0.7699 0.4447 0.6623 0.2405  0.1855  0.0298  151 PRO A C     
1186 O  O     . PRO A 151 ? 0.7857 0.4686 0.6865 0.2751  0.1282  0.0466  151 PRO A O     
1187 C  CB    . PRO A 151 ? 0.8073 0.4263 0.6994 0.2595  0.2243  0.0267  151 PRO A CB    
1188 C  CG    . PRO A 151 ? 0.7678 0.4270 0.7224 0.2450  0.1940  0.0482  151 PRO A CG    
1189 C  CD    . PRO A 151 ? 0.7115 0.4221 0.6958 0.2215  0.1696  0.0476  151 PRO A CD    
1190 N  N     . GLN A 152 ? 0.8188 0.3802 0.7406 0.1900  0.1572  0.0478  152 GLN A N     
1191 C  CA    . GLN A 152 ? 0.8765 0.4161 0.7189 0.1600  0.1350  0.0381  152 GLN A CA    
1192 C  C     . GLN A 152 ? 0.8426 0.3680 0.6855 0.1241  0.1383  0.0178  152 GLN A C     
1193 O  O     . GLN A 152 ? 0.8760 0.3932 0.7363 0.0914  0.1186  -0.0192 152 GLN A O     
1194 C  CB    . GLN A 152 ? 0.9916 0.4604 0.7239 0.0837  0.1473  0.0346  152 GLN A CB    
1195 C  CG    . GLN A 152 ? 0.9637 0.5504 0.7356 0.0604  0.1536  0.0655  152 GLN A CG    
1196 C  CD    . GLN A 152 ? 0.9313 0.6021 0.7295 0.0803  0.1109  0.0931  152 GLN A CD    
1197 O  OE1   . GLN A 152 ? 0.9184 0.5413 0.9321 0.1090  0.1195  0.0939  152 GLN A OE1   
1198 N  NE2   . GLN A 152 ? 0.9924 0.5565 0.7441 0.1479  0.1467  0.0922  152 GLN A NE2   
1199 N  N     . CYS A 153 ? 0.7646 0.3747 0.7184 0.1394  0.1340  -0.0016 153 CYS A N     
1200 C  CA    . CYS A 153 ? 0.7168 0.4013 0.6602 0.1238  0.1014  0.0164  153 CYS A CA    
1201 C  C     . CYS A 153 ? 0.7431 0.4133 0.6268 0.0932  0.1277  -0.0031 153 CYS A C     
1202 O  O     . CYS A 153 ? 0.7228 0.4336 0.6909 0.0728  0.1594  -0.0268 153 CYS A O     
1203 C  CB    . CYS A 153 ? 0.7189 0.4921 0.7195 0.1014  0.0708  -0.0459 153 CYS A CB    
1204 S  SG    . CYS A 153 ? 0.7510 0.5933 0.8787 0.0128  -0.0138 0.1149  153 CYS A SG    
1205 N  N     . VAL A 154 ? 0.7589 0.3595 0.5950 0.0852  0.1046  -0.0321 154 VAL A N     
1206 C  CA    . VAL A 154 ? 0.7757 0.3654 0.5749 0.0721  0.0985  -0.0435 154 VAL A CA    
1207 C  C     . VAL A 154 ? 0.7175 0.3667 0.5050 0.0527  0.1040  -0.0498 154 VAL A C     
1208 O  O     . VAL A 154 ? 0.6378 0.4192 0.4997 -0.0043 0.0699  -0.0862 154 VAL A O     
1209 C  CB    . VAL A 154 ? 0.8296 0.3713 0.5513 0.0532  0.1026  -0.0616 154 VAL A CB    
1210 C  CG1   . VAL A 154 ? 0.8938 0.3295 0.5712 0.0266  0.0890  -0.0389 154 VAL A CG1   
1211 C  CG2   . VAL A 154 ? 0.8179 0.4593 0.4982 -0.0293 0.0673  -0.0507 154 VAL A CG2   
1212 N  N     . PRO A 155 ? 0.6883 0.3609 0.4885 0.0724  0.0818  -0.0364 155 PRO A N     
1213 C  CA    . PRO A 155 ? 0.6382 0.3653 0.4394 0.0788  0.0711  -0.0180 155 PRO A CA    
1214 C  C     . PRO A 155 ? 0.6359 0.3862 0.4438 0.0629  0.0677  -0.0326 155 PRO A C     
1215 O  O     . PRO A 155 ? 0.6180 0.3694 0.4491 0.0634  0.0905  -0.0559 155 PRO A O     
1216 C  CB    . PRO A 155 ? 0.6157 0.3600 0.4758 0.0692  0.0816  -0.0381 155 PRO A CB    
1217 C  CG    . PRO A 155 ? 0.6695 0.3424 0.4695 0.0961  0.1067  -0.0105 155 PRO A CG    
1218 C  CD    . PRO A 155 ? 0.7401 0.3435 0.4466 0.0901  0.0905  -0.0351 155 PRO A CD    
1219 N  N     . THR A 156 ? 0.6209 0.3745 0.4692 0.0820  0.0483  -0.0335 156 THR A N     
1220 C  CA    . THR A 156 ? 0.6177 0.3752 0.5147 0.0138  0.0209  -0.0242 156 THR A CA    
1221 C  C     . THR A 156 ? 0.5636 0.3392 0.4912 0.0431  0.0182  -0.0521 156 THR A C     
1222 O  O     . THR A 156 ? 0.4822 0.3758 0.5180 0.0482  0.0583  -0.0584 156 THR A O     
1223 C  CB    . THR A 156 ? 0.6491 0.3818 0.5018 0.0108  0.0115  -0.0288 156 THR A CB    
1224 O  OG1   . THR A 156 ? 0.7257 0.3696 0.6943 -0.0874 0.0633  -0.0694 156 THR A OG1   
1225 C  CG2   . THR A 156 ? 0.5959 0.4432 0.4768 -0.0150 0.0171  -0.0384 156 THR A CG2   
1226 N  N     . PRO A 157 ? 0.6186 0.3053 0.4994 -0.0102 0.0072  -0.0402 157 PRO A N     
1227 C  CA    . PRO A 157 ? 0.6469 0.3345 0.4788 -0.0226 0.0126  -0.0360 157 PRO A CA    
1228 C  C     . PRO A 157 ? 0.5886 0.3666 0.4500 0.0348  0.0194  -0.0315 157 PRO A C     
1229 O  O     . PRO A 157 ? 0.5720 0.4443 0.4651 0.0816  0.0085  -0.0318 157 PRO A O     
1230 C  CB    . PRO A 157 ? 0.7367 0.3434 0.4946 -0.0532 -0.0449 -0.0201 157 PRO A CB    
1231 C  CG    . PRO A 157 ? 0.7650 0.3260 0.4863 -0.0772 -0.0186 -0.0351 157 PRO A CG    
1232 C  CD    . PRO A 157 ? 0.6904 0.3351 0.4997 -0.0524 -0.0251 -0.0550 157 PRO A CD    
1233 N  N     . ARG A 158 ? 0.5385 0.3501 0.4034 0.0607  0.0181  -0.0402 158 ARG A N     
1234 C  CA    . ARG A 158 ? 0.5305 0.3566 0.4257 0.0471  0.0086  -0.0404 158 ARG A CA    
1235 C  C     . ARG A 158 ? 0.5670 0.4130 0.4104 0.0566  -0.0307 -0.0295 158 ARG A C     
1236 O  O     . ARG A 158 ? 0.6371 0.4442 0.3913 0.1077  -0.0468 -0.0087 158 ARG A O     
1237 C  CB    . ARG A 158 ? 0.5465 0.3632 0.4522 0.0375  0.0215  -0.0206 158 ARG A CB    
1238 C  CG    . ARG A 158 ? 0.4857 0.3632 0.5174 0.0467  -0.0165 -0.0161 158 ARG A CG    
1239 C  CD    . ARG A 158 ? 0.5356 0.3181 0.5436 0.0104  0.0786  0.0431  158 ARG A CD    
1240 N  NE    . ARG A 158 ? 0.6045 0.3865 0.4409 0.1284  0.0531  -0.0523 158 ARG A NE    
1241 C  CZ    . ARG A 158 ? 0.5762 0.3813 0.4125 0.0854  0.0373  -0.0191 158 ARG A CZ    
1242 N  NH1   . ARG A 158 ? 0.6107 0.3731 0.4341 0.1413  0.1303  0.0104  158 ARG A NH1   
1243 N  NH2   . ARG A 158 ? 0.4226 0.3955 0.3161 0.1329  0.1080  0.0082  158 ARG A NH2   
1244 N  N     . PRO A 159 ? 0.5351 0.4362 0.4441 0.0570  -0.0293 -0.0356 159 PRO A N     
1245 C  CA    . PRO A 159 ? 0.5272 0.4582 0.4600 0.0338  -0.0347 -0.0065 159 PRO A CA    
1246 C  C     . PRO A 159 ? 0.6368 0.5570 0.4281 -0.0249 -0.0659 -0.0186 159 PRO A C     
1247 O  O     . PRO A 159 ? 0.7735 0.4410 0.6996 0.0238  0.0244  0.0963  159 PRO A O     
1248 C  CB    . PRO A 159 ? 0.4890 0.4834 0.4118 0.0000  -0.0408 -0.0023 159 PRO A CB    
1249 C  CG    . PRO A 159 ? 0.4568 0.5367 0.4193 0.0349  -0.0178 -0.0105 159 PRO A CG    
1250 C  CD    . PRO A 159 ? 0.4842 0.4345 0.4109 0.0941  -0.0199 0.0125  159 PRO A CD    
1251 N  N     . GLU A 160 ? 0.7053 0.7075 0.4754 0.0280  -0.1817 0.0495  160 GLU A N     
1252 C  CA    . GLU A 160 ? 0.7246 0.6136 0.4915 0.0436  -0.1870 0.0398  160 GLU A CA    
1253 C  C     . GLU A 160 ? 0.7128 0.4740 0.7495 -0.0394 -0.1638 -0.0341 160 GLU A C     
1254 O  O     . GLU A 160 ? 0.6711 0.9885 0.8941 -0.0893 -0.1288 0.0325  160 GLU A O     
1255 C  CB    . GLU A 160 ? 0.7235 0.5718 0.4763 0.0269  -0.1628 0.0476  160 GLU A CB    
1256 C  CG    . GLU A 160 ? 0.6736 0.6616 0.4355 -0.0908 -0.1322 0.0247  160 GLU A CG    
1257 C  CD    . GLU A 160 ? 0.6694 0.6435 0.4498 -0.1348 -0.1297 0.0582  160 GLU A CD    
1258 O  OE1   . GLU A 160 ? 0.6287 0.7100 0.5044 -0.1465 -0.1003 0.0026  160 GLU A OE1   
1259 O  OE2   . GLU A 160 ? 0.5867 0.6353 0.4462 -0.1703 -0.1183 0.0638  160 GLU A OE2   
1260 N  N     . ILE A 161 ? 0.6254 0.5264 0.7501 -0.0879 -0.2622 -0.0330 161 ILE A N     
1261 C  CA    . ILE A 161 ? 0.6594 0.5789 0.5857 -0.0584 -0.1637 -0.0099 161 ILE A CA    
1262 C  C     . ILE A 161 ? 0.6479 0.6603 0.6527 -0.1223 -0.1874 0.0695  161 ILE A C     
1263 O  O     . ILE A 161 ? 0.6415 0.6954 0.9137 -0.0982 -0.1722 0.1692  161 ILE A O     
1264 C  CB    . ILE A 161 ? 0.4777 0.6602 0.5393 -0.0187 -0.1126 -0.0195 161 ILE A CB    
1265 C  CG1   . ILE A 161 ? 0.4322 0.5354 0.5931 0.0105  -0.1259 -0.1046 161 ILE A CG1   
1266 C  CG2   . ILE A 161 ? 0.3980 0.7103 0.4762 -0.1501 -0.1738 -0.0595 161 ILE A CG2   
1267 C  CD1   . ILE A 161 ? 0.4816 0.4180 0.4512 -0.0062 -0.1015 -0.1819 161 ILE A CD1   
1268 N  N     . ASN A 162 ? 0.5957 0.5629 0.6520 -0.1266 -0.1561 0.1096  162 ASN A N     
1269 C  CA    . ASN A 162 ? 0.7159 0.5396 0.6004 -0.1067 -0.0760 0.0534  162 ASN A CA    
1270 C  C     . ASN A 162 ? 0.7486 0.6170 0.5873 -0.0207 -0.0556 0.0534  162 ASN A C     
1271 O  O     . ASN A 162 ? 0.8386 0.6435 0.6144 0.0332  -0.0139 0.0687  162 ASN A O     
1272 C  CB    . ASN A 162 ? 0.6300 0.5739 0.8197 -0.2733 -0.0740 0.0205  162 ASN A CB    
1273 C  CG    . ASN A 162 ? 0.6609 0.4888 0.9114 -0.2400 -0.1206 0.0712  162 ASN A CG    
1274 O  OD1   . ASN A 162 ? 0.7177 0.5609 0.8980 -0.1809 -0.1038 0.1072  162 ASN A OD1   
1275 N  ND2   . ASN A 162 ? 0.6281 0.7316 0.8950 -0.3535 -0.1455 -0.1119 162 ASN A ND2   
1276 N  N     . ASN A 163 ? 0.7071 0.6580 0.6479 -0.0071 -0.1315 0.0962  163 ASN A N     
1277 C  CA    . ASN A 163 ? 0.5796 0.6193 0.6863 -0.0690 -0.1824 -0.0356 163 ASN A CA    
1278 C  C     . ASN A 163 ? 0.4501 0.8377 0.6705 -0.0851 -0.1296 -0.0689 163 ASN A C     
1279 O  O     . ASN A 163 ? 0.4423 0.9242 0.9224 0.0531  -0.0923 -0.1866 163 ASN A O     
1280 C  CB    . ASN A 163 ? 0.6334 0.7352 0.5541 -0.0957 -0.2199 0.0182  163 ASN A CB    
1281 C  CG    . ASN A 163 ? 0.8843 0.5971 0.6118 -0.1506 -0.1001 0.0185  163 ASN A CG    
1282 O  OD1   . ASN A 163 ? 1.0651 0.7484 0.6553 0.0079  -0.1536 0.2563  163 ASN A OD1   
1283 N  ND2   . ASN A 163 ? 0.8387 0.6956 0.6618 -0.2786 0.0094  -0.0483 163 ASN A ND2   
1284 N  N     . LYS A 164 ? 0.5394 0.6308 0.6785 -0.0652 -0.2152 -0.0557 164 LYS A N     
1285 C  CA    . LYS A 164 ? 0.6060 0.5323 0.6559 -0.0704 -0.2005 -0.0091 164 LYS A CA    
1286 C  C     . LYS A 164 ? 0.4368 0.5605 0.6955 -0.0407 -0.0999 0.0386  164 LYS A C     
1287 O  O     . LYS A 164 ? 0.5672 0.9964 0.6914 -0.2254 0.0171  0.0413  164 LYS A O     
1288 C  CB    . LYS A 164 ? 0.5733 0.5175 0.7996 0.0034  -0.1312 0.0521  164 LYS A CB    
1289 C  CG    . LYS A 164 ? 0.6307 0.4322 0.8593 0.0494  -0.1297 0.0116  164 LYS A CG    
1290 C  CD    . LYS A 164 ? 0.4062 0.6633 0.7048 -0.0420 -0.1559 -0.0245 164 LYS A CD    
1291 C  CE    . LYS A 164 ? 0.3702 0.5793 0.6145 -0.0017 -0.0839 0.0868  164 LYS A CE    
1292 N  NZ    . LYS A 164 ? 0.3139 0.6201 0.7695 -0.1430 -0.0061 -0.1322 164 LYS A NZ    
1293 N  N     . LEU A 165 ? 0.4394 0.5077 0.5927 -0.0310 -0.1514 0.0452  165 LEU A N     
1294 C  CA    . LEU A 165 ? 0.4059 0.4581 0.4694 -0.1425 -0.0588 0.0552  165 LEU A CA    
1295 C  C     . LEU A 165 ? 0.4716 0.4368 0.4697 -0.0630 -0.0398 0.0350  165 LEU A C     
1296 O  O     . LEU A 165 ? 0.5479 0.3068 0.5111 0.0067  -0.0746 0.0755  165 LEU A O     
1297 C  CB    . LEU A 165 ? 0.4969 0.5013 0.5378 -0.0557 -0.1909 0.0357  165 LEU A CB    
1298 C  CG    . LEU A 165 ? 0.4888 0.5949 0.5891 -0.0975 -0.2182 -0.0227 165 LEU A CG    
1299 C  CD1   . LEU A 165 ? 0.6645 0.4380 0.6868 -0.1742 -0.1629 0.1157  165 LEU A CD1   
1300 C  CD2   . LEU A 165 ? 0.4095 0.6615 0.6777 -0.2481 -0.2111 0.0384  165 LEU A CD2   
1301 N  N     . ILE A 166 ? 0.4536 0.4466 0.4098 -0.0518 -0.0653 0.0270  166 ILE A N     
1302 C  CA    . ILE A 166 ? 0.2589 0.4213 0.4723 -0.0515 -0.0533 0.0069  166 ILE A CA    
1303 C  C     . ILE A 166 ? 0.2421 0.4749 0.4660 -0.0152 -0.0754 0.0060  166 ILE A C     
1304 O  O     . ILE A 166 ? 0.3346 0.4789 0.4188 0.0267  -0.1138 -0.0117 166 ILE A O     
1305 C  CB    . ILE A 166 ? 0.2348 0.3993 0.4820 -0.0036 -0.0761 0.0569  166 ILE A CB    
1306 C  CG1   . ILE A 166 ? 0.2323 0.4306 0.5064 -0.0591 -0.0554 0.0330  166 ILE A CG1   
1307 C  CG2   . ILE A 166 ? 0.1967 0.4272 0.4273 0.0712  -0.0349 0.0759  166 ILE A CG2   
1308 C  CD1   . ILE A 166 ? 0.0980 0.5054 0.5215 -0.0440 -0.0989 0.0910  166 ILE A CD1   
1309 N  N     . PRO A 167 ? 0.2164 0.4684 0.4907 -0.0312 -0.0577 0.0355  167 PRO A N     
1310 C  CA    . PRO A 167 ? 0.2295 0.4580 0.5005 -0.0405 -0.0478 0.0277  167 PRO A CA    
1311 C  C     . PRO A 167 ? 0.2259 0.4731 0.5257 -0.0273 -0.0293 0.0194  167 PRO A C     
1312 O  O     . PRO A 167 ? 0.2254 0.4687 0.5598 -0.0213 -0.0477 -0.0198 167 PRO A O     
1313 C  CB    . PRO A 167 ? 0.1864 0.4012 0.5045 -0.0562 -0.0197 0.0279  167 PRO A CB    
1314 C  CG    . PRO A 167 ? 0.1864 0.4639 0.4962 -0.0582 -0.0106 0.0210  167 PRO A CG    
1315 C  CD    . PRO A 167 ? 0.2143 0.4206 0.4332 -0.0426 -0.0597 -0.0077 167 PRO A CD    
1316 N  N     . ASP A 168 ? 0.3540 0.4314 0.4361 -0.0426 0.0172  0.0424  168 ASP A N     
1317 C  CA    . ASP A 168 ? 0.2914 0.3738 0.4734 -0.0412 0.0200  0.1033  168 ASP A CA    
1318 C  C     . ASP A 168 ? 0.1879 0.3942 0.4586 -0.0021 -0.0004 0.0713  168 ASP A C     
1319 O  O     . ASP A 168 ? 0.2077 0.3491 0.4151 0.0244  0.0061  0.0750  168 ASP A O     
1320 C  CB    . ASP A 168 ? 0.2148 0.4713 0.4504 -0.0165 -0.0169 0.0618  168 ASP A CB    
1321 C  CG    . ASP A 168 ? 0.2156 0.4862 0.4540 -0.0033 0.0402  0.0985  168 ASP A CG    
1322 O  OD1   . ASP A 168 ? 0.2745 0.5108 0.4452 -0.0527 0.0810  0.0940  168 ASP A OD1   
1323 O  OD2   . ASP A 168 ? 0.2203 0.4972 0.5005 -0.0376 0.0620  0.1751  168 ASP A OD2   
1324 N  N     . PRO A 169 ? 0.1771 0.3934 0.4774 -0.0133 0.0228  0.1107  169 PRO A N     
1325 C  CA    . PRO A 169 ? 0.1449 0.3756 0.4708 0.0102  -0.0051 0.1024  169 PRO A CA    
1326 C  C     . PRO A 169 ? 0.1281 0.3558 0.4625 0.0196  0.0117  0.0571  169 PRO A C     
1327 O  O     . PRO A 169 ? 0.1241 0.3825 0.4543 0.0091  0.0077  0.0491  169 PRO A O     
1328 C  CB    . PRO A 169 ? 0.1742 0.3519 0.5557 0.0189  0.0527  0.0421  169 PRO A CB    
1329 C  CG    . PRO A 169 ? 0.1939 0.4210 0.5606 0.0057  0.0727  0.0902  169 PRO A CG    
1330 C  CD    . PRO A 169 ? 0.1646 0.4309 0.5614 -0.0392 -0.0102 0.1228  169 PRO A CD    
1331 N  N     . PHE A 170 ? 0.1357 0.3225 0.4594 0.0629  0.0319  0.0513  170 PHE A N     
1332 C  CA    . PHE A 170 ? 0.2049 0.3479 0.4202 0.0723  0.0360  0.0242  170 PHE A CA    
1333 C  C     . PHE A 170 ? 0.1917 0.3377 0.4270 0.0564  0.0114  0.0288  170 PHE A C     
1334 O  O     . PHE A 170 ? 0.2191 0.3020 0.3721 -0.0171 0.0233  0.0455  170 PHE A O     
1335 C  CB    . PHE A 170 ? 0.1642 0.3836 0.4417 0.0536  0.0466  0.0564  170 PHE A CB    
1336 C  CG    . PHE A 170 ? 0.1717 0.3929 0.4356 0.0616  0.0817  0.0647  170 PHE A CG    
1337 C  CD1   . PHE A 170 ? 0.2589 0.3677 0.4145 0.0660  0.0599  0.0433  170 PHE A CD1   
1338 C  CD2   . PHE A 170 ? 0.1839 0.4387 0.4395 0.0876  0.0796  0.0728  170 PHE A CD2   
1339 C  CE1   . PHE A 170 ? 0.2610 0.3760 0.4572 0.0777  0.0836  0.0547  170 PHE A CE1   
1340 C  CE2   . PHE A 170 ? 0.1972 0.3983 0.4999 0.0466  0.1279  0.0915  170 PHE A CE2   
1341 C  CZ    . PHE A 170 ? 0.2381 0.4199 0.5154 0.0313  0.0920  0.0784  170 PHE A CZ    
1342 N  N     . TRP A 171 ? 0.1885 0.3031 0.4256 0.0037  0.0423  0.0860  171 TRP A N     
1343 C  CA    . TRP A 171 ? 0.1953 0.3093 0.3532 0.0019  0.0320  0.0333  171 TRP A CA    
1344 C  C     . TRP A 171 ? 0.1785 0.3228 0.3784 -0.0151 0.0119  0.0283  171 TRP A C     
1345 O  O     . TRP A 171 ? 0.2163 0.3145 0.3700 0.0028  0.0053  0.0246  171 TRP A O     
1346 C  CB    . TRP A 171 ? 0.1585 0.3207 0.3689 0.0156  0.0147  0.0242  171 TRP A CB    
1347 C  CG    . TRP A 171 ? 0.1425 0.3246 0.3804 0.0150  -0.0270 0.0043  171 TRP A CG    
1348 C  CD1   . TRP A 171 ? 0.1815 0.3246 0.3813 -0.0033 -0.0173 0.0106  171 TRP A CD1   
1349 C  CD2   . TRP A 171 ? 0.1773 0.3050 0.3619 -0.0309 -0.0152 0.0107  171 TRP A CD2   
1350 N  NE1   . TRP A 171 ? 0.1505 0.3709 0.3992 -0.0179 -0.0171 0.0257  171 TRP A NE1   
1351 C  CE2   . TRP A 171 ? 0.2183 0.3298 0.3537 -0.0041 -0.0205 0.0037  171 TRP A CE2   
1352 C  CE3   . TRP A 171 ? 0.2575 0.3186 0.3471 0.0010  -0.0105 0.0061  171 TRP A CE3   
1353 C  CZ2   . TRP A 171 ? 0.2410 0.2902 0.3539 -0.0093 -0.0101 0.0175  171 TRP A CZ2   
1354 C  CZ3   . TRP A 171 ? 0.2386 0.3333 0.3220 -0.0199 -0.0029 0.0431  171 TRP A CZ3   
1355 C  CH2   . TRP A 171 ? 0.3127 0.3120 0.3098 0.0112  0.0213  -0.0111 171 TRP A CH2   
1356 N  N     . LEU A 172 ? 0.2326 0.4021 0.3338 -0.0419 0.0152  0.0420  172 LEU A N     
1357 C  CA    . LEU A 172 ? 0.1929 0.3394 0.3852 -0.0325 0.0034  0.0435  172 LEU A CA    
1358 C  C     . LEU A 172 ? 0.1746 0.3873 0.3329 -0.0011 -0.0017 0.0290  172 LEU A C     
1359 O  O     . LEU A 172 ? 0.1552 0.4102 0.2864 -0.0054 -0.0070 0.0415  172 LEU A O     
1360 C  CB    . LEU A 172 ? 0.1994 0.4017 0.3588 -0.0047 0.0124  0.0238  172 LEU A CB    
1361 C  CG    . LEU A 172 ? 0.2615 0.4745 0.3830 0.0510  0.0411  0.0408  172 LEU A CG    
1362 C  CD1   . LEU A 172 ? 0.2571 0.3412 0.5069 -0.0976 0.1182  0.0323  172 LEU A CD1   
1363 C  CD2   . LEU A 172 ? 0.1770 0.5434 0.2552 -0.0574 -0.0104 0.0139  172 LEU A CD2   
1364 N  N     . ALA A 173 ? 0.1886 0.3333 0.4023 0.0035  0.0350  0.0315  173 ALA A N     
1365 C  CA    . ALA A 173 ? 0.1833 0.3914 0.3949 0.0383  0.0094  -0.0027 173 ALA A CA    
1366 C  C     . ALA A 173 ? 0.1966 0.3441 0.3318 -0.0020 0.0326  0.0258  173 ALA A C     
1367 O  O     . ALA A 173 ? 0.2128 0.3285 0.3419 -0.0420 0.0647  0.0474  173 ALA A O     
1368 C  CB    . ALA A 173 ? 0.1644 0.3085 0.4116 -0.0105 0.0171  0.0035  173 ALA A CB    
1369 N  N     . GLY A 174 ? 0.1880 0.3238 0.3136 -0.0083 0.0446  -0.0060 174 GLY A N     
1370 C  CA    . GLY A 174 ? 0.2087 0.2597 0.3351 0.0036  0.0749  0.0167  174 GLY A CA    
1371 C  C     . GLY A 174 ? 0.1207 0.3109 0.3025 -0.0146 0.0309  0.0106  174 GLY A C     
1372 O  O     . GLY A 174 ? 0.1457 0.3172 0.3263 -0.0797 -0.0085 -0.0174 174 GLY A O     
1373 N  N     . PHE A 175 ? 0.1516 0.2674 0.3223 -0.0413 0.0413  -0.0008 175 PHE A N     
1374 C  CA    . PHE A 175 ? 0.1709 0.3029 0.3052 -0.0183 0.0082  -0.0226 175 PHE A CA    
1375 C  C     . PHE A 175 ? 0.1532 0.3075 0.3253 -0.0086 -0.0046 -0.0128 175 PHE A C     
1376 O  O     . PHE A 175 ? 0.1690 0.2898 0.3121 0.0158  -0.0421 -0.0224 175 PHE A O     
1377 C  CB    . PHE A 175 ? 0.1844 0.2820 0.3321 -0.0367 0.0081  -0.0376 175 PHE A CB    
1378 C  CG    . PHE A 175 ? 0.1812 0.3321 0.3389 -0.0006 -0.0059 -0.0456 175 PHE A CG    
1379 C  CD1   . PHE A 175 ? 0.1907 0.3442 0.2862 0.0067  -0.0337 -0.0636 175 PHE A CD1   
1380 C  CD2   . PHE A 175 ? 0.1577 0.3404 0.3421 -0.0052 0.0120  -0.0553 175 PHE A CD2   
1381 C  CE1   . PHE A 175 ? 0.2109 0.3713 0.3397 0.0259  -0.0013 -0.0643 175 PHE A CE1   
1382 C  CE2   . PHE A 175 ? 0.2718 0.3414 0.4171 0.0546  0.0401  -0.0497 175 PHE A CE2   
1383 C  CZ    . PHE A 175 ? 0.3243 0.3421 0.3087 0.0360  -0.0317 -0.0710 175 PHE A CZ    
1384 N  N     . VAL A 176 ? 0.1612 0.3096 0.2805 -0.0145 -0.0273 -0.0065 176 VAL A N     
1385 C  CA    . VAL A 176 ? 0.1793 0.2776 0.3283 -0.0035 -0.0276 0.0052  176 VAL A CA    
1386 C  C     . VAL A 176 ? 0.1270 0.3315 0.3401 0.0180  -0.0284 0.0077  176 VAL A C     
1387 O  O     . VAL A 176 ? 0.1501 0.3147 0.3331 0.0161  0.0170  -0.0071 176 VAL A O     
1388 C  CB    . VAL A 176 ? 0.1332 0.3115 0.3585 -0.0115 -0.0466 0.0293  176 VAL A CB    
1389 C  CG1   . VAL A 176 ? 0.1378 0.2687 0.3701 0.0049  -0.0468 0.0154  176 VAL A CG1   
1390 C  CG2   . VAL A 176 ? 0.1637 0.2966 0.3489 -0.0050 -0.0407 0.0213  176 VAL A CG2   
1391 N  N     . SER A 177 ? 0.1548 0.3284 0.3358 0.0273  -0.0227 0.0148  177 SER A N     
1392 C  CA    . SER A 177 ? 0.1828 0.3337 0.2967 0.0447  0.0101  -0.0054 177 SER A CA    
1393 C  C     . SER A 177 ? 0.1482 0.3513 0.2903 0.0154  -0.0126 0.0249  177 SER A C     
1394 O  O     . SER A 177 ? 0.1676 0.3457 0.3647 -0.0458 -0.0047 0.0213  177 SER A O     
1395 C  CB    . SER A 177 ? 0.1672 0.3581 0.3184 0.0311  0.0223  0.0045  177 SER A CB    
1396 O  OG    . SER A 177 ? 0.2353 0.3941 0.3574 0.0873  0.0083  -0.0585 177 SER A OG    
1397 N  N     . GLY A 178 ? 0.1626 0.3531 0.2592 0.0328  -0.0021 0.0101  178 GLY A N     
1398 C  CA    . GLY A 178 ? 0.1746 0.3871 0.2967 0.0509  -0.0003 0.0097  178 GLY A CA    
1399 C  C     . GLY A 178 ? 0.1609 0.4060 0.3392 0.0323  0.0217  0.0059  178 GLY A C     
1400 O  O     . GLY A 178 ? 0.1540 0.4905 0.4643 0.0284  0.0858  0.0538  178 GLY A O     
1401 N  N     . ASP A 179 ? 0.2426 0.3312 0.3038 0.0377  0.0235  0.0086  179 ASP A N     
1402 C  CA    . ASP A 179 ? 0.2632 0.3305 0.3237 0.0224  0.0312  -0.0165 179 ASP A CA    
1403 C  C     . ASP A 179 ? 0.3068 0.3238 0.3455 0.0619  0.0175  -0.0072 179 ASP A C     
1404 O  O     . ASP A 179 ? 0.1997 0.3841 0.3335 0.0735  0.0047  0.0172  179 ASP A O     
1405 C  CB    . ASP A 179 ? 0.1778 0.3202 0.3695 0.0281  0.0064  0.0015  179 ASP A CB    
1406 C  CG    . ASP A 179 ? 0.1704 0.3287 0.3486 0.0284  0.0287  0.0050  179 ASP A CG    
1407 O  OD1   . ASP A 179 ? 0.1915 0.4068 0.3926 0.0806  -0.0139 0.0477  179 ASP A OD1   
1408 O  OD2   . ASP A 179 ? 0.2230 0.2787 0.3839 0.0622  0.0682  -0.0254 179 ASP A OD2   
1409 N  N     . GLY A 180 ? 0.2337 0.3585 0.3883 0.1140  -0.0102 0.0231  180 GLY A N     
1410 C  CA    . GLY A 180 ? 0.1564 0.2689 0.4048 0.0253  0.0027  -0.0061 180 GLY A CA    
1411 C  C     . GLY A 180 ? 0.1469 0.3425 0.3584 -0.0051 -0.0168 0.0197  180 GLY A C     
1412 O  O     . GLY A 180 ? 0.1242 0.3271 0.3329 -0.0355 0.0104  0.0124  180 GLY A O     
1413 N  N     . SER A 181 ? 0.1817 0.3264 0.3545 -0.0100 0.0249  0.0082  181 SER A N     
1414 C  CA    . SER A 181 ? 0.1313 0.3350 0.3181 0.0148  0.0005  0.0020  181 SER A CA    
1415 C  C     . SER A 181 ? 0.1957 0.3361 0.3505 0.0128  -0.0105 0.0170  181 SER A C     
1416 O  O     . SER A 181 ? 0.1553 0.2826 0.3684 0.0559  -0.0209 0.0300  181 SER A O     
1417 C  CB    . SER A 181 ? 0.1756 0.3288 0.3372 0.0147  0.0290  -0.0405 181 SER A CB    
1418 O  OG    . SER A 181 ? 0.1315 0.4856 0.3000 0.0361  -0.0597 -0.0336 181 SER A OG    
1419 N  N     . PHE A 182 ? 0.1974 0.3469 0.3501 0.0541  -0.0110 0.0055  182 PHE A N     
1420 C  CA    . PHE A 182 ? 0.1608 0.3411 0.3811 0.0283  0.0415  0.0245  182 PHE A CA    
1421 C  C     . PHE A 182 ? 0.1980 0.3435 0.3840 -0.0265 0.0156  0.0150  182 PHE A C     
1422 O  O     . PHE A 182 ? 0.1284 0.3696 0.4314 -0.0344 0.0079  0.0425  182 PHE A O     
1423 C  CB    . PHE A 182 ? 0.1720 0.3034 0.3127 0.0012  -0.0094 0.0019  182 PHE A CB    
1424 C  CG    . PHE A 182 ? 0.1425 0.3741 0.3391 0.0400  0.0264  0.0080  182 PHE A CG    
1425 C  CD1   . PHE A 182 ? 0.1765 0.2889 0.3177 -0.0072 -0.0060 -0.0448 182 PHE A CD1   
1426 C  CD2   . PHE A 182 ? 0.1653 0.3022 0.3518 0.0111  0.0027  0.0015  182 PHE A CD2   
1427 C  CE1   . PHE A 182 ? 0.1944 0.3039 0.3455 -0.0084 0.0078  -0.0107 182 PHE A CE1   
1428 C  CE2   . PHE A 182 ? 0.1695 0.2999 0.3126 0.0083  0.0153  -0.0051 182 PHE A CE2   
1429 C  CZ    . PHE A 182 ? 0.1970 0.2434 0.3093 0.0203  0.0019  -0.0513 182 PHE A CZ    
1430 N  N     . LYS A 183 ? 0.1897 0.3213 0.3719 -0.0243 0.0280  0.0473  183 LYS A N     
1431 C  CA    . LYS A 183 ? 0.1628 0.3691 0.4370 -0.0310 -0.0100 0.0257  183 LYS A CA    
1432 C  C     . LYS A 183 ? 0.1701 0.3999 0.4168 -0.0192 -0.0589 0.0570  183 LYS A C     
1433 O  O     . LYS A 183 ? 0.1113 0.3256 0.4025 0.0322  0.0046  0.0533  183 LYS A O     
1434 C  CB    . LYS A 183 ? 0.1810 0.4144 0.4496 0.0093  0.0237  0.0240  183 LYS A CB    
1435 C  CG    . LYS A 183 ? 0.2068 0.4209 0.4379 0.0553  0.0705  0.0399  183 LYS A CG    
1436 C  CD    . LYS A 183 ? 0.2443 0.4973 0.3709 0.0673  0.0292  -0.0376 183 LYS A CD    
1437 C  CE    . LYS A 183 ? 0.1274 0.4267 0.3918 0.0080  0.0383  -0.0773 183 LYS A CE    
1438 N  NZ    . LYS A 183 ? 0.2260 0.4790 0.4274 0.1282  0.0057  -0.1181 183 LYS A NZ    
1439 N  N     . SER A 184 ? 0.1942 0.3995 0.3650 -0.0434 -0.0368 0.0389  184 SER A N     
1440 C  CA    . SER A 184 ? 0.2302 0.3867 0.3929 -0.0287 0.0375  0.0183  184 SER A CA    
1441 C  C     . SER A 184 ? 0.2002 0.4261 0.4188 -0.0104 0.0069  0.0283  184 SER A C     
1442 O  O     . SER A 184 ? 0.2480 0.4911 0.4121 -0.0062 -0.0205 0.0383  184 SER A O     
1443 C  CB    . SER A 184 ? 0.2382 0.4324 0.3688 -0.0039 0.0344  -0.0001 184 SER A CB    
1444 O  OG    . SER A 184 ? 0.3436 0.4390 0.3742 0.0388  0.0544  0.0363  184 SER A OG    
1445 N  N     . ILE A 185 ? 0.2132 0.3954 0.4460 -0.0099 0.0446  0.0633  185 ILE A N     
1446 C  CA    . ILE A 185 ? 0.2263 0.4043 0.3972 0.0088  0.0356  0.0674  185 ILE A CA    
1447 C  C     . ILE A 185 ? 0.1989 0.4085 0.4644 -0.0373 0.0093  0.0577  185 ILE A C     
1448 O  O     . ILE A 185 ? 0.1935 0.3540 0.4132 -0.0326 0.0502  0.0336  185 ILE A O     
1449 C  CB    . ILE A 185 ? 0.2353 0.3924 0.4243 0.0255  0.0391  0.0591  185 ILE A CB    
1450 C  CG1   . ILE A 185 ? 0.2738 0.3603 0.4103 0.0394  0.0188  0.0482  185 ILE A CG1   
1451 C  CG2   . ILE A 185 ? 0.2589 0.4017 0.4859 0.0480  0.0655  0.0531  185 ILE A CG2   
1452 C  CD1   . ILE A 185 ? 0.2797 0.3461 0.4053 0.0464  0.0037  0.0146  185 ILE A CD1   
1453 N  N     . LEU A 186 ? 0.1987 0.4592 0.4392 -0.0273 -0.0024 0.0388  186 LEU A N     
1454 C  CA    . LEU A 186 ? 0.2863 0.4748 0.4181 -0.0539 0.0232  0.0288  186 LEU A CA    
1455 C  C     . LEU A 186 ? 0.2916 0.4733 0.4740 0.0136  -0.0084 -0.0055 186 LEU A C     
1456 O  O     . LEU A 186 ? 0.1999 0.5859 0.5327 -0.0343 -0.0499 -0.0544 186 LEU A O     
1457 C  CB    . LEU A 186 ? 0.3698 0.5209 0.4089 -0.0479 -0.0200 0.0061  186 LEU A CB    
1458 C  CG    . LEU A 186 ? 0.2918 0.5133 0.4753 -0.0266 -0.0727 0.0043  186 LEU A CG    
1459 C  CD1   . LEU A 186 ? 0.2834 0.6286 0.5669 -0.1167 -0.0982 -0.0300 186 LEU A CD1   
1460 C  CD2   . LEU A 186 ? 0.3048 0.4617 0.4973 -0.0228 -0.0869 -0.0295 186 LEU A CD2   
1461 N  N     . LYS A 187 ? 0.3164 0.4600 0.4677 -0.0274 -0.0070 -0.0021 187 LYS A N     
1462 C  CA    . LYS A 187 ? 0.3332 0.4785 0.4442 -0.0400 0.0158  0.0337  187 LYS A CA    
1463 C  C     . LYS A 187 ? 0.2653 0.4934 0.4421 -0.0461 0.0002  0.0362  187 LYS A C     
1464 O  O     . LYS A 187 ? 0.2611 0.4922 0.4393 -0.0432 -0.0156 0.0316  187 LYS A O     
1465 C  CB    . LYS A 187 ? 0.2527 0.4604 0.4674 -0.0190 0.0430  0.0256  187 LYS A CB    
1466 C  CG    . LYS A 187 ? 0.3161 0.4721 0.4442 -0.0127 0.0579  0.0469  187 LYS A CG    
1467 C  CD    . LYS A 187 ? 0.3014 0.5120 0.4518 0.0074  0.0660  0.0101  187 LYS A CD    
1468 C  CE    . LYS A 187 ? 0.3857 0.5639 0.4310 0.0448  0.1089  0.0526  187 LYS A CE    
1469 N  NZ    . LYS A 187 ? 0.3747 0.5402 0.4525 0.0396  0.2169  0.0081  187 LYS A NZ    
1470 N  N     . LYS A 188 ? 0.2713 0.4881 0.4686 -0.0198 -0.0048 0.0739  188 LYS A N     
1471 C  CA    . LYS A 188 ? 0.3158 0.5649 0.5071 -0.0445 0.0367  0.0968  188 LYS A CA    
1472 C  C     . LYS A 188 ? 0.2931 0.5285 0.5179 -0.0470 0.0331  0.0943  188 LYS A C     
1473 O  O     . LYS A 188 ? 0.3615 0.5039 0.4621 -0.0638 0.0536  0.1231  188 LYS A O     
1474 C  CB    . LYS A 188 ? 0.3118 0.6088 0.6193 -0.0522 0.0307  0.0802  188 LYS A CB    
1475 C  CG    . LYS A 188 ? 0.5753 0.6574 0.7352 -0.1174 0.1043  0.1455  188 LYS A CG    
1476 C  CD    . LYS A 188 ? 0.7143 0.6815 0.8026 -0.1341 0.0510  0.1207  188 LYS A CD    
1477 C  CE    . LYS A 188 ? 0.5953 0.5757 0.8973 -0.0914 0.0784  0.1005  188 LYS A CE    
1478 N  NZ    . LYS A 188 ? 0.1967 0.6127 0.8537 -0.1201 -0.0002 0.0623  188 LYS A NZ    
1479 N  N     . SER A 189 ? 0.2924 0.5510 0.5209 -0.0691 0.0560  0.1247  189 SER A N     
1480 C  CA    . SER A 189 ? 0.3183 0.5564 0.4915 -0.0449 0.0758  0.0909  189 SER A CA    
1481 C  C     . SER A 189 ? 0.3508 0.5637 0.5256 -0.0542 0.0816  0.1074  189 SER A C     
1482 O  O     . SER A 189 ? 0.3920 0.5884 0.5060 -0.0474 0.1094  0.0673  189 SER A O     
1483 C  CB    . SER A 189 ? 0.3296 0.5246 0.4678 -0.0102 0.0571  0.0627  189 SER A CB    
1484 O  OG    . SER A 189 ? 0.2900 0.4652 0.4812 0.0276  0.0500  0.0089  189 SER A OG    
1485 N  N     . GLU A 190 ? 0.3638 0.6298 0.5488 -0.0800 0.0953  0.0674  190 GLU A N     
1486 C  CA    . GLU A 190 ? 0.3941 0.6308 0.5359 -0.0318 0.1002  0.1185  190 GLU A CA    
1487 C  C     . GLU A 190 ? 0.3482 0.5971 0.4937 -0.0577 0.0976  0.0897  190 GLU A C     
1488 O  O     . GLU A 190 ? 0.4490 0.5676 0.5708 -0.0549 0.0490  0.1048  190 GLU A O     
1489 C  CB    . GLU A 190 ? 0.3518 0.7523 0.6491 -0.0029 0.1587  0.0917  190 GLU A CB    
1490 C  CG    . GLU A 190 ? 0.3713 0.8995 0.6942 0.0843  0.0459  0.0778  190 GLU A CG    
1491 C  CD    . GLU A 190 ? 0.5105 0.9135 0.7365 0.0957  0.1413  0.1286  190 GLU A CD    
1492 O  OE1   . GLU A 190 ? 0.5433 1.0939 0.9214 0.0601  0.2960  -0.0552 190 GLU A OE1   
1493 O  OE2   . GLU A 190 ? 0.5592 1.0921 0.8764 0.0731  0.3157  0.0241  190 GLU A OE2   
1494 N  N     . SER A 191 ? 0.3598 0.5068 0.4533 -0.0887 0.0765  0.0900  191 SER A N     
1495 C  CA    . SER A 191 ? 0.3931 0.5323 0.4922 -0.0702 0.0671  0.1029  191 SER A CA    
1496 C  C     . SER A 191 ? 0.4202 0.5307 0.4723 -0.0842 0.0502  0.0859  191 SER A C     
1497 O  O     . SER A 191 ? 0.4332 0.5459 0.5469 -0.0561 0.0565  0.0962  191 SER A O     
1498 C  CB    . SER A 191 ? 0.4412 0.5075 0.4968 -0.0807 0.0698  0.0880  191 SER A CB    
1499 O  OG    . SER A 191 ? 0.3891 0.5572 0.4874 -0.1084 0.0289  0.1006  191 SER A OG    
1500 N  N     . ILE A 192 ? 0.3074 0.4751 0.4940 -0.1428 0.0798  0.0885  192 ILE A N     
1501 C  CA    . ILE A 192 ? 0.2713 0.4753 0.4888 -0.1017 0.0487  0.0984  192 ILE A CA    
1502 C  C     . ILE A 192 ? 0.2704 0.4634 0.4941 -0.0909 0.0293  0.1118  192 ILE A C     
1503 O  O     . ILE A 192 ? 0.2570 0.4204 0.4879 -0.0965 0.0403  0.1304  192 ILE A O     
1504 C  CB    . ILE A 192 ? 0.2576 0.4463 0.4918 -0.1044 0.0579  0.0772  192 ILE A CB    
1505 C  CG1   . ILE A 192 ? 0.2346 0.4628 0.4674 -0.0829 0.0156  0.0788  192 ILE A CG1   
1506 C  CG2   . ILE A 192 ? 0.2431 0.4666 0.4928 -0.1018 0.0559  0.0677  192 ILE A CG2   
1507 C  CD1   . ILE A 192 ? 0.2585 0.4916 0.4895 -0.1370 0.0411  0.0450  192 ILE A CD1   
1508 N  N     . LYS A 193 ? 0.2783 0.4813 0.4617 -0.0643 0.0326  0.1177  193 LYS A N     
1509 C  CA    . LYS A 193 ? 0.3784 0.4678 0.5067 -0.0832 0.0110  0.1360  193 LYS A CA    
1510 C  C     . LYS A 193 ? 0.3128 0.4995 0.5306 -0.0995 0.0085  0.1308  193 LYS A C     
1511 O  O     . LYS A 193 ? 0.3236 0.4983 0.5387 -0.1265 -0.0067 0.1609  193 LYS A O     
1512 C  CB    . LYS A 193 ? 0.4465 0.5288 0.5504 -0.0148 -0.0173 0.1295  193 LYS A CB    
1513 C  CG    . LYS A 193 ? 0.4590 0.5091 0.5403 -0.0149 0.0256  0.1638  193 LYS A CG    
1514 C  CD    . LYS A 193 ? 0.3684 0.5165 0.6073 0.0011  0.0058  0.1106  193 LYS A CD    
1515 C  CE    . LYS A 193 ? 0.3741 0.5226 0.5585 -0.0180 -0.0045 0.0797  193 LYS A CE    
1516 N  NZ    . LYS A 193 ? 0.4234 0.4565 0.6304 -0.0157 -0.0330 0.1119  193 LYS A NZ    
1517 N  N     . VAL A 194 ? 0.2842 0.4936 0.5166 -0.0912 0.0195  0.0990  194 VAL A N     
1518 C  CA    . VAL A 194 ? 0.3069 0.5078 0.5052 -0.0928 0.0219  0.0714  194 VAL A CA    
1519 C  C     . VAL A 194 ? 0.3325 0.5115 0.5365 -0.0819 0.0183  0.0706  194 VAL A C     
1520 O  O     . VAL A 194 ? 0.3256 0.4812 0.5831 -0.1052 -0.0404 0.0091  194 VAL A O     
1521 C  CB    . VAL A 194 ? 0.2771 0.4742 0.5115 -0.1112 0.0200  0.0705  194 VAL A CB    
1522 C  CG1   . VAL A 194 ? 0.3234 0.4361 0.4567 -0.1426 0.0455  0.0514  194 VAL A CG1   
1523 C  CG2   . VAL A 194 ? 0.3523 0.4249 0.4126 -0.1187 0.0191  0.0318  194 VAL A CG2   
1524 N  N     . GLY A 195 ? 0.3485 0.5344 0.4961 -0.0772 0.0410  0.0836  195 GLY A N     
1525 C  CA    . GLY A 195 ? 0.3606 0.5481 0.4928 -0.0661 0.0602  0.0840  195 GLY A CA    
1526 C  C     . GLY A 195 ? 0.2628 0.5341 0.4700 -0.0509 0.0444  0.0736  195 GLY A C     
1527 O  O     . GLY A 195 ? 0.1634 0.5866 0.5040 -0.0533 0.0175  0.0547  195 GLY A O     
1528 N  N     . PHE A 196 ? 0.2392 0.5125 0.4231 -0.0710 0.0146  0.0928  196 PHE A N     
1529 C  CA    . PHE A 196 ? 0.2372 0.4756 0.4552 -0.0625 0.0030  0.0788  196 PHE A CA    
1530 C  C     . PHE A 196 ? 0.2368 0.4588 0.4271 -0.0654 0.0170  0.0656  196 PHE A C     
1531 O  O     . PHE A 196 ? 0.2724 0.4167 0.4263 -0.0890 -0.0021 0.0423  196 PHE A O     
1532 C  CB    . PHE A 196 ? 0.2597 0.4972 0.4499 -0.0807 0.0184  0.0669  196 PHE A CB    
1533 C  CG    . PHE A 196 ? 0.2586 0.5534 0.4281 -0.0515 0.0184  0.0555  196 PHE A CG    
1534 C  CD1   . PHE A 196 ? 0.2761 0.5787 0.4464 -0.0861 0.0311  0.0692  196 PHE A CD1   
1535 C  CD2   . PHE A 196 ? 0.2592 0.5873 0.4561 -0.0162 0.0087  0.0301  196 PHE A CD2   
1536 C  CE1   . PHE A 196 ? 0.2862 0.6114 0.4917 -0.0305 0.0015  0.0564  196 PHE A CE1   
1537 C  CE2   . PHE A 196 ? 0.2291 0.6294 0.5229 -0.0448 0.0353  0.0441  196 PHE A CE2   
1538 C  CZ    . PHE A 196 ? 0.2545 0.6133 0.5303 -0.0372 0.0566  0.0574  196 PHE A CZ    
1539 N  N     . GLN A 197 ? 0.2271 0.4389 0.3944 -0.0497 0.0452  0.0656  197 GLN A N     
1540 C  CA    . GLN A 197 ? 0.2339 0.4359 0.4220 -0.0575 0.0181  0.0515  197 GLN A CA    
1541 C  C     . GLN A 197 ? 0.2483 0.4353 0.4258 -0.0649 0.0297  0.0379  197 GLN A C     
1542 O  O     . GLN A 197 ? 0.3173 0.4354 0.4304 -0.0998 -0.0098 0.0560  197 GLN A O     
1543 C  CB    . GLN A 197 ? 0.2760 0.4073 0.4336 -0.0293 0.0527  0.0384  197 GLN A CB    
1544 C  CG    . GLN A 197 ? 0.3065 0.3685 0.4143 -0.0419 -0.0007 0.0429  197 GLN A CG    
1545 C  CD    . GLN A 197 ? 0.3073 0.3609 0.3765 -0.0045 0.0333  0.0433  197 GLN A CD    
1546 O  OE1   . GLN A 197 ? 0.3195 0.3353 0.3588 -0.0246 0.0631  0.0460  197 GLN A OE1   
1547 N  NE2   . GLN A 197 ? 0.3179 0.3398 0.3096 0.0032  0.0054  0.0498  197 GLN A NE2   
1548 N  N     . SER A 198 ? 0.2281 0.3343 0.3902 -0.0810 0.0004  0.0268  198 SER A N     
1549 C  CA    . SER A 198 ? 0.2175 0.3441 0.3948 -0.0530 0.0064  0.0400  198 SER A CA    
1550 C  C     . SER A 198 ? 0.2110 0.3601 0.3813 -0.0549 0.0161  0.0280  198 SER A C     
1551 O  O     . SER A 198 ? 0.2312 0.3812 0.3660 0.0401  0.0524  0.0560  198 SER A O     
1552 C  CB    . SER A 198 ? 0.2247 0.3273 0.3987 -0.0702 -0.0029 0.0307  198 SER A CB    
1553 O  OG    . SER A 198 ? 0.1955 0.3246 0.4142 -0.0476 -0.0113 0.0614  198 SER A OG    
1554 N  N     . ILE A 199 ? 0.1995 0.3477 0.3889 -0.0490 0.0138  0.0172  199 ILE A N     
1555 C  CA    . ILE A 199 ? 0.1758 0.3579 0.3523 -0.0426 0.0217  0.0044  199 ILE A CA    
1556 C  C     . ILE A 199 ? 0.1649 0.3608 0.3748 -0.0631 0.0434  -0.0063 199 ILE A C     
1557 O  O     . ILE A 199 ? 0.1839 0.3516 0.3493 -0.0519 0.0640  0.0136  199 ILE A O     
1558 C  CB    . ILE A 199 ? 0.2038 0.3707 0.3771 -0.0559 0.0475  -0.0178 199 ILE A CB    
1559 C  CG1   . ILE A 199 ? 0.2076 0.3576 0.3901 -0.0096 0.0573  0.0016  199 ILE A CG1   
1560 C  CG2   . ILE A 199 ? 0.1870 0.3787 0.3362 -0.0575 0.0441  -0.0082 199 ILE A CG2   
1561 C  CD1   . ILE A 199 ? 0.1987 0.3992 0.4054 -0.0155 0.0959  0.0085  199 ILE A CD1   
1562 N  N     . LEU A 200 ? 0.1389 0.3842 0.3932 0.0135  0.0601  -0.0023 200 LEU A N     
1563 C  CA    . LEU A 200 ? 0.1708 0.3483 0.3991 -0.0064 0.0551  -0.0052 200 LEU A CA    
1564 C  C     . LEU A 200 ? 0.2262 0.3708 0.3589 -0.0203 -0.0088 0.0048  200 LEU A C     
1565 O  O     . LEU A 200 ? 0.1906 0.3494 0.3737 -0.0845 -0.0219 0.0128  200 LEU A O     
1566 C  CB    . LEU A 200 ? 0.1627 0.3707 0.4050 0.0052  0.0339  -0.0120 200 LEU A CB    
1567 C  CG    . LEU A 200 ? 0.1786 0.3279 0.4112 0.0214  0.0171  0.0156  200 LEU A CG    
1568 C  CD1   . LEU A 200 ? 0.2077 0.3232 0.4289 0.0449  0.0213  -0.0067 200 LEU A CD1   
1569 C  CD2   . LEU A 200 ? 0.1926 0.3308 0.4384 -0.0708 -0.0163 -0.0313 200 LEU A CD2   
1570 N  N     . VAL A 201 ? 0.2001 0.3892 0.3461 -0.0024 0.0063  0.0113  201 VAL A N     
1571 C  CA    . VAL A 201 ? 0.1591 0.3820 0.3896 0.0076  0.0145  0.0056  201 VAL A CA    
1572 C  C     . VAL A 201 ? 0.1944 0.3556 0.3787 -0.0090 -0.0186 0.0183  201 VAL A C     
1573 O  O     . VAL A 201 ? 0.2855 0.4002 0.3426 0.0429  -0.0216 0.0887  201 VAL A O     
1574 C  CB    . VAL A 201 ? 0.2278 0.3568 0.4062 0.0413  0.0374  0.0233  201 VAL A CB    
1575 C  CG1   . VAL A 201 ? 0.1350 0.4016 0.4561 0.0010  -0.0410 -0.0109 201 VAL A CG1   
1576 C  CG2   . VAL A 201 ? 0.2690 0.4101 0.4410 0.0026  0.0721  0.0176  201 VAL A CG2   
1577 N  N     . PHE A 202 ? 0.1522 0.3415 0.3864 -0.0019 0.0508  -0.0130 202 PHE A N     
1578 C  CA    . PHE A 202 ? 0.1655 0.3650 0.3304 0.0076  0.0094  0.0095  202 PHE A CA    
1579 C  C     . PHE A 202 ? 0.1884 0.3598 0.3343 -0.0208 0.0089  0.0130  202 PHE A C     
1580 O  O     . PHE A 202 ? 0.2353 0.4410 0.2887 -0.0355 0.0789  0.0364  202 PHE A O     
1581 C  CB    . PHE A 202 ? 0.1494 0.3228 0.3625 -0.0258 0.0332  -0.0072 202 PHE A CB    
1582 C  CG    . PHE A 202 ? 0.2127 0.3165 0.3516 -0.0415 0.0166  0.0018  202 PHE A CG    
1583 C  CD1   . PHE A 202 ? 0.1920 0.3311 0.3551 -0.0266 0.0219  -0.0114 202 PHE A CD1   
1584 C  CD2   . PHE A 202 ? 0.2140 0.3426 0.3560 -0.0577 0.0269  -0.0176 202 PHE A CD2   
1585 C  CE1   . PHE A 202 ? 0.1478 0.3418 0.4280 -0.0238 0.0558  -0.0144 202 PHE A CE1   
1586 C  CE2   . PHE A 202 ? 0.2330 0.3440 0.3447 -0.0349 0.0398  -0.0188 202 PHE A CE2   
1587 C  CZ    . PHE A 202 ? 0.1309 0.3510 0.3384 -0.0293 0.0798  -0.0074 202 PHE A CZ    
1588 N  N     . GLN A 203 ? 0.1873 0.3668 0.2969 -0.0061 0.0272  0.0055  203 GLN A N     
1589 C  CA    . GLN A 203 ? 0.2108 0.3694 0.3580 0.0049  0.0101  -0.0038 203 GLN A CA    
1590 C  C     . GLN A 203 ? 0.2599 0.3022 0.3740 0.0305  -0.0177 -0.0055 203 GLN A C     
1591 O  O     . GLN A 203 ? 0.2334 0.2985 0.3576 0.0146  -0.0397 0.0610  203 GLN A O     
1592 C  CB    . GLN A 203 ? 0.2381 0.4388 0.4053 0.0318  0.0711  -0.0121 203 GLN A CB    
1593 C  CG    . GLN A 203 ? 0.2904 0.4519 0.4664 0.0348  0.0970  -0.0377 203 GLN A CG    
1594 C  CD    . GLN A 203 ? 0.2531 0.5460 0.4001 -0.0032 0.0277  -0.0126 203 GLN A CD    
1595 O  OE1   . GLN A 203 ? 0.4427 0.5346 0.4581 0.0559  0.2435  -0.0276 203 GLN A OE1   
1596 N  NE2   . GLN A 203 ? 0.2212 0.4258 0.3872 0.0048  0.0559  -0.0561 203 GLN A NE2   
1597 N  N     . ILE A 204 ? 0.1814 0.3321 0.3578 0.0371  -0.0039 -0.0215 204 ILE A N     
1598 C  CA    . ILE A 204 ? 0.1640 0.3134 0.3511 0.0271  -0.0049 -0.0293 204 ILE A CA    
1599 C  C     . ILE A 204 ? 0.2156 0.3288 0.3479 0.0464  -0.0016 -0.0395 204 ILE A C     
1600 O  O     . ILE A 204 ? 0.1544 0.3292 0.3555 0.0352  -0.0250 -0.0472 204 ILE A O     
1601 C  CB    . ILE A 204 ? 0.1628 0.3260 0.3343 0.0327  0.0033  -0.0146 204 ILE A CB    
1602 C  CG1   . ILE A 204 ? 0.1644 0.2715 0.3467 -0.0238 0.0174  -0.0480 204 ILE A CG1   
1603 C  CG2   . ILE A 204 ? 0.2385 0.3170 0.3281 0.0569  0.0081  -0.0213 204 ILE A CG2   
1604 C  CD1   . ILE A 204 ? 0.1504 0.3447 0.2378 0.0149  -0.0277 -0.0387 204 ILE A CD1   
1605 N  N     . THR A 205 ? 0.2143 0.3058 0.3428 0.0262  0.0131  -0.0085 205 THR A N     
1606 C  CA    . THR A 205 ? 0.1986 0.3429 0.3923 0.0367  0.0380  -0.0069 205 THR A CA    
1607 C  C     . THR A 205 ? 0.2561 0.3369 0.3499 0.0316  0.0331  -0.0080 205 THR A C     
1608 O  O     . THR A 205 ? 0.2087 0.3515 0.3363 -0.0341 0.0134  0.0028  205 THR A O     
1609 C  CB    . THR A 205 ? 0.2014 0.3781 0.4308 0.0413  0.0300  -0.0208 205 THR A CB    
1610 O  OG1   . THR A 205 ? 0.2044 0.4407 0.4240 -0.0257 0.0412  -0.0326 205 THR A OG1   
1611 C  CG2   . THR A 205 ? 0.2497 0.3923 0.3839 0.0762  0.0284  0.0061  205 THR A CG2   
1612 N  N     . GLN A 206 ? 0.3035 0.3474 0.2990 0.0478  0.0533  0.0038  206 GLN A N     
1613 C  CA    . GLN A 206 ? 0.2216 0.3465 0.3664 0.0423  0.0487  -0.0033 206 GLN A CA    
1614 C  C     . GLN A 206 ? 0.2951 0.3580 0.3746 0.0515  0.0477  -0.0167 206 GLN A C     
1615 O  O     . GLN A 206 ? 0.3552 0.3759 0.3874 0.0621  0.0495  0.0453  206 GLN A O     
1616 C  CB    . GLN A 206 ? 0.2166 0.3312 0.3762 0.0248  -0.0188 -0.0132 206 GLN A CB    
1617 C  CG    . GLN A 206 ? 0.1969 0.3623 0.3577 0.0173  0.0035  -0.0232 206 GLN A CG    
1618 C  CD    . GLN A 206 ? 0.2031 0.3415 0.3539 0.0086  -0.0004 0.0097  206 GLN A CD    
1619 O  OE1   . GLN A 206 ? 0.2666 0.3391 0.3958 0.0101  0.0160  0.0344  206 GLN A OE1   
1620 N  NE2   . GLN A 206 ? 0.1047 0.3265 0.3806 0.0137  0.0026  0.0287  206 GLN A NE2   
1621 N  N     . HIS A 207 ? 0.3036 0.3271 0.3696 0.0419  0.0809  -0.0302 207 HIS A N     
1622 C  CA    . HIS A 207 ? 0.3115 0.3206 0.3671 0.0804  0.0458  -0.0138 207 HIS A CA    
1623 C  C     . HIS A 207 ? 0.3661 0.3228 0.3210 0.0617  0.0498  -0.0093 207 HIS A C     
1624 O  O     . HIS A 207 ? 0.3519 0.2903 0.3255 0.0395  0.0161  -0.0092 207 HIS A O     
1625 C  CB    . HIS A 207 ? 0.2896 0.3311 0.3322 0.0951  0.0705  -0.0249 207 HIS A CB    
1626 C  CG    . HIS A 207 ? 0.3370 0.3227 0.3643 0.1081  0.0832  -0.0190 207 HIS A CG    
1627 N  ND1   . HIS A 207 ? 0.3371 0.3832 0.4348 0.1330  0.1031  -0.0424 207 HIS A ND1   
1628 C  CD2   . HIS A 207 ? 0.3509 0.3198 0.3985 0.0879  0.1058  -0.0351 207 HIS A CD2   
1629 C  CE1   . HIS A 207 ? 0.3454 0.3546 0.4853 0.1404  0.0937  -0.0331 207 HIS A CE1   
1630 N  NE2   . HIS A 207 ? 0.4152 0.2669 0.4797 0.1135  0.0825  -0.0479 207 HIS A NE2   
1631 N  N     . ALA A 208 ? 0.4033 0.2962 0.3618 0.0838  0.0396  -0.0576 208 ALA A N     
1632 C  CA    . ALA A 208 ? 0.4446 0.3849 0.3442 0.0475  0.0491  -0.0658 208 ALA A CA    
1633 C  C     . ALA A 208 ? 0.4597 0.3968 0.3517 0.0368  0.0344  -0.0491 208 ALA A C     
1634 O  O     . ALA A 208 ? 0.5464 0.4675 0.3220 0.0099  0.0226  -0.0976 208 ALA A O     
1635 C  CB    . ALA A 208 ? 0.4444 0.3806 0.3372 0.0394  0.0251  -0.1094 208 ALA A CB    
1636 N  N     . ARG A 209 ? 0.4177 0.3706 0.3778 0.0582  0.0344  -0.0277 209 ARG A N     
1637 C  CA    . ARG A 209 ? 0.4601 0.3726 0.3409 0.0345  0.0289  -0.0407 209 ARG A CA    
1638 C  C     . ARG A 209 ? 0.4349 0.3750 0.3159 0.0095  -0.0261 -0.0463 209 ARG A C     
1639 O  O     . ARG A 209 ? 0.4722 0.3334 0.3549 -0.0268 -0.0017 -0.0288 209 ARG A O     
1640 C  CB    . ARG A 209 ? 0.4942 0.3591 0.3434 0.0290  0.0326  -0.0366 209 ARG A CB    
1641 C  CG    . ARG A 209 ? 0.5120 0.3994 0.3381 0.0044  0.0006  -0.0561 209 ARG A CG    
1642 C  CD    . ARG A 209 ? 0.5919 0.4442 0.3936 0.0855  0.0214  -0.0157 209 ARG A CD    
1643 N  NE    . ARG A 209 ? 0.5475 0.5387 0.3266 -0.0431 -0.0249 -0.0317 209 ARG A NE    
1644 C  CZ    . ARG A 209 ? 0.4929 0.4155 0.3590 -0.0039 -0.1099 -0.0371 209 ARG A CZ    
1645 N  NH1   . ARG A 209 ? 0.5109 0.4223 0.3453 0.0235  -0.0870 -0.0491 209 ARG A NH1   
1646 N  NH2   . ARG A 209 ? 0.3610 0.5384 0.3109 -0.0453 -0.0811 -0.0165 209 ARG A NH2   
1647 N  N     . ASP A 210 ? 0.4146 0.3697 0.2979 0.0405  -0.0465 -0.0143 210 ASP A N     
1648 C  CA    . ASP A 210 ? 0.4171 0.3643 0.3129 0.0349  -0.0122 -0.0422 210 ASP A CA    
1649 C  C     . ASP A 210 ? 0.4231 0.3623 0.3092 0.0069  -0.0243 -0.0419 210 ASP A C     
1650 O  O     . ASP A 210 ? 0.3716 0.4111 0.3044 0.0182  0.0187  -0.0733 210 ASP A O     
1651 C  CB    . ASP A 210 ? 0.3334 0.3620 0.3190 0.0214  -0.0085 -0.0447 210 ASP A CB    
1652 C  CG    . ASP A 210 ? 0.3525 0.3685 0.3679 0.0215  -0.0269 0.0014  210 ASP A CG    
1653 O  OD1   . ASP A 210 ? 0.4158 0.3278 0.4231 -0.0829 0.0267  0.0194  210 ASP A OD1   
1654 O  OD2   . ASP A 210 ? 0.4507 0.3848 0.3604 0.0807  -0.0384 -0.0041 210 ASP A OD2   
1655 N  N     . VAL A 211 ? 0.4224 0.3862 0.3092 0.0068  0.0237  -0.0014 211 VAL A N     
1656 C  CA    . VAL A 211 ? 0.4355 0.3878 0.3083 0.0105  0.0038  -0.0127 211 VAL A CA    
1657 C  C     . VAL A 211 ? 0.4220 0.3795 0.2790 -0.0197 -0.0121 -0.0430 211 VAL A C     
1658 O  O     . VAL A 211 ? 0.4427 0.4061 0.3019 -0.0222 -0.0145 -0.0202 211 VAL A O     
1659 C  CB    . VAL A 211 ? 0.4313 0.3838 0.3204 -0.0067 -0.0010 -0.0278 211 VAL A CB    
1660 C  CG1   . VAL A 211 ? 0.4352 0.4061 0.3428 -0.0386 -0.0108 -0.0214 211 VAL A CG1   
1661 C  CG2   . VAL A 211 ? 0.3948 0.3956 0.3305 -0.0219 0.0097  -0.0116 211 VAL A CG2   
1662 N  N     . LYS A 212 ? 0.4525 0.3550 0.2920 -0.0257 -0.0154 -0.0332 212 LYS A N     
1663 C  CA    . LYS A 212 ? 0.4602 0.4014 0.3270 -0.0396 -0.0436 -0.0244 212 LYS A CA    
1664 C  C     . LYS A 212 ? 0.4540 0.3680 0.3568 -0.0354 -0.0693 -0.0133 212 LYS A C     
1665 O  O     . LYS A 212 ? 0.3926 0.4534 0.2673 0.0036  -0.0934 -0.0609 212 LYS A O     
1666 C  CB    . LYS A 212 ? 0.5504 0.4374 0.3926 -0.0935 -0.0447 -0.0251 212 LYS A CB    
1667 C  CG    . LYS A 212 ? 0.6711 0.5035 0.4403 -0.1249 -0.0499 -0.0663 212 LYS A CG    
1668 C  CD    . LYS A 212 ? 0.7761 0.5355 0.5562 -0.1067 -0.0643 -0.0387 212 LYS A CD    
1669 C  CE    . LYS A 212 ? 0.8636 0.6949 0.5404 -0.2977 -0.1020 -0.0517 212 LYS A CE    
1670 N  NZ    . LYS A 212 ? 0.8660 0.8366 0.5261 -0.3447 0.0119  -0.0306 212 LYS A NZ    
1671 N  N     . LEU A 213 ? 0.4600 0.3860 0.3406 -0.0468 -0.0373 -0.0405 213 LEU A N     
1672 C  CA    . LEU A 213 ? 0.4164 0.3671 0.3625 -0.0241 -0.0587 -0.0286 213 LEU A CA    
1673 C  C     . LEU A 213 ? 0.3099 0.3837 0.3555 0.0010  -0.0287 -0.0108 213 LEU A C     
1674 O  O     . LEU A 213 ? 0.2284 0.3747 0.3190 -0.0288 -0.0736 -0.0034 213 LEU A O     
1675 C  CB    . LEU A 213 ? 0.3680 0.4087 0.3785 0.0425  -0.0144 0.0559  213 LEU A CB    
1676 C  CG    . LEU A 213 ? 0.2466 0.4676 0.4038 0.0163  -0.0547 0.0147  213 LEU A CG    
1677 C  CD1   . LEU A 213 ? 0.2455 0.4519 0.4717 0.0188  -0.0208 0.0676  213 LEU A CD1   
1678 C  CD2   . LEU A 213 ? 0.3125 0.4827 0.4048 -0.0006 -0.0363 0.0505  213 LEU A CD2   
1679 N  N     . MET A 214 ? 0.3061 0.4031 0.3584 -0.0169 -0.0231 -0.0103 214 MET A N     
1680 C  CA    . MET A 214 ? 0.2857 0.3850 0.3285 0.0040  0.0016  -0.0193 214 MET A CA    
1681 C  C     . MET A 214 ? 0.2992 0.3710 0.3530 -0.0042 -0.0121 -0.0193 214 MET A C     
1682 O  O     . MET A 214 ? 0.4112 0.3459 0.3713 -0.0624 0.0021  0.0042  214 MET A O     
1683 C  CB    . MET A 214 ? 0.2970 0.3546 0.3509 0.0386  -0.0272 -0.0187 214 MET A CB    
1684 C  CG    . MET A 214 ? 0.2766 0.4331 0.3842 0.0566  -0.0376 -0.0012 214 MET A CG    
1685 S  SD    . MET A 214 ? 0.3350 0.5026 0.4160 0.0286  -0.1229 -0.0066 214 MET A SD    
1686 C  CE    . MET A 214 ? 0.3699 0.3454 0.4059 0.0250  -0.0831 0.0360  214 MET A CE    
1687 N  N     . GLU A 215 ? 0.3314 0.3904 0.3466 -0.0245 -0.0064 -0.0325 215 GLU A N     
1688 C  CA    . GLU A 215 ? 0.4015 0.4369 0.3839 -0.0332 -0.0358 0.0006  215 GLU A CA    
1689 C  C     . GLU A 215 ? 0.3830 0.4343 0.3925 -0.0483 -0.0367 0.0274  215 GLU A C     
1690 O  O     . GLU A 215 ? 0.4295 0.4491 0.3406 0.0194  -0.0966 -0.0201 215 GLU A O     
1691 C  CB    . GLU A 215 ? 0.4551 0.5230 0.3235 -0.1174 -0.0716 -0.0041 215 GLU A CB    
1692 C  CG    . GLU A 215 ? 0.4617 0.6376 0.4487 0.0146  -0.1062 0.0107  215 GLU A CG    
1693 C  CD    . GLU A 215 ? 0.5649 0.7794 0.4853 0.0052  -0.1113 0.0662  215 GLU A CD    
1694 O  OE1   . GLU A 215 ? 0.6231 1.0885 0.8826 -0.1570 -0.0374 -0.1486 215 GLU A OE1   
1695 O  OE2   . GLU A 215 ? 0.5657 1.0619 0.5108 -0.0401 -0.2088 0.0570  215 GLU A OE2   
1696 N  N     . SER A 216 ? 0.3711 0.4492 0.3984 -0.0832 -0.0182 -0.0122 216 SER A N     
1697 C  CA    . SER A 216 ? 0.3618 0.4349 0.4507 -0.0640 -0.0486 0.0059  216 SER A CA    
1698 C  C     . SER A 216 ? 0.2801 0.4313 0.4987 -0.0528 -0.0718 0.0001  216 SER A C     
1699 O  O     . SER A 216 ? 0.2350 0.5091 0.5564 -0.0542 -0.1232 0.0201  216 SER A O     
1700 C  CB    . SER A 216 ? 0.3134 0.4642 0.3983 -0.0379 -0.0669 0.0177  216 SER A CB    
1701 O  OG    . SER A 216 ? 0.2831 0.5885 0.3569 -0.0350 0.0068  -0.0246 216 SER A OG    
1702 N  N     . LEU A 217 ? 0.2612 0.4177 0.3745 -0.0208 -0.0534 0.0047  217 LEU A N     
1703 C  CA    . LEU A 217 ? 0.2397 0.4333 0.3773 -0.0397 -0.0016 -0.0065 217 LEU A CA    
1704 C  C     . LEU A 217 ? 0.2988 0.4460 0.3929 -0.0072 -0.0503 -0.0052 217 LEU A C     
1705 O  O     . LEU A 217 ? 0.2702 0.4517 0.4155 -0.0501 -0.0451 -0.0682 217 LEU A O     
1706 C  CB    . LEU A 217 ? 0.2850 0.3728 0.2827 -0.0209 -0.0293 -0.0349 217 LEU A CB    
1707 C  CG    . LEU A 217 ? 0.2859 0.3732 0.3493 0.0363  -0.0045 0.0142  217 LEU A CG    
1708 C  CD1   . LEU A 217 ? 0.2656 0.4320 0.3447 -0.0870 0.0142  0.0471  217 LEU A CD1   
1709 C  CD2   . LEU A 217 ? 0.2834 0.4054 0.2957 -0.0234 0.0265  0.0537  217 LEU A CD2   
1710 N  N     . ILE A 218 ? 0.2911 0.4628 0.3611 -0.0715 -0.0662 -0.0009 218 ILE A N     
1711 C  CA    . ILE A 218 ? 0.3480 0.4931 0.3823 0.0022  -0.1037 0.0026  218 ILE A CA    
1712 C  C     . ILE A 218 ? 0.3283 0.4710 0.5020 -0.0461 -0.0776 0.0131  218 ILE A C     
1713 O  O     . ILE A 218 ? 0.3505 0.4640 0.3840 -0.0364 -0.0591 -0.0197 218 ILE A O     
1714 C  CB    . ILE A 218 ? 0.3682 0.5187 0.3812 -0.0131 -0.0504 0.0311  218 ILE A CB    
1715 C  CG1   . ILE A 218 ? 0.3456 0.4150 0.3787 -0.0656 -0.0525 -0.0205 218 ILE A CG1   
1716 C  CG2   . ILE A 218 ? 0.3863 0.5445 0.4193 -0.0302 -0.1653 0.0267  218 ILE A CG2   
1717 C  CD1   . ILE A 218 ? 0.3851 0.4345 0.3882 -0.0883 -0.0011 -0.0165 218 ILE A CD1   
1718 N  N     . SER A 219 ? 0.3403 0.4858 0.4870 -0.0606 -0.0978 0.0007  219 SER A N     
1719 C  CA    . SER A 219 ? 0.3338 0.5147 0.5305 -0.0833 -0.0790 0.0150  219 SER A CA    
1720 C  C     . SER A 219 ? 0.3306 0.4705 0.4693 -0.0341 -0.1184 0.0673  219 SER A C     
1721 O  O     . SER A 219 ? 0.2513 0.4610 0.5798 -0.0744 -0.1115 0.1139  219 SER A O     
1722 C  CB    . SER A 219 ? 0.3579 0.4864 0.6132 -0.0590 -0.1314 0.0113  219 SER A CB    
1723 O  OG    . SER A 219 ? 0.3114 0.8122 0.7334 -0.2126 -0.2165 0.0072  219 SER A OG    
1724 N  N     . TYR A 220 ? 0.2968 0.4323 0.4455 -0.0047 -0.0982 0.0419  220 TYR A N     
1725 C  CA    . TYR A 220 ? 0.3036 0.4085 0.4444 -0.0278 -0.0649 0.0659  220 TYR A CA    
1726 C  C     . TYR A 220 ? 0.2145 0.4158 0.4394 -0.0249 -0.0612 0.0337  220 TYR A C     
1727 O  O     . TYR A 220 ? 0.1801 0.4452 0.4252 -0.0127 -0.0738 0.0563  220 TYR A O     
1728 C  CB    . TYR A 220 ? 0.2439 0.4157 0.4368 -0.0230 -0.0397 0.0611  220 TYR A CB    
1729 C  CG    . TYR A 220 ? 0.2876 0.4389 0.3991 -0.0553 -0.0534 0.0837  220 TYR A CG    
1730 C  CD1   . TYR A 220 ? 0.2097 0.5556 0.4718 -0.0184 -0.0566 0.0798  220 TYR A CD1   
1731 C  CD2   . TYR A 220 ? 0.1954 0.4752 0.3930 -0.0217 -0.0777 0.0773  220 TYR A CD2   
1732 C  CE1   . TYR A 220 ? 0.2780 0.5476 0.4438 -0.0489 -0.0694 0.0563  220 TYR A CE1   
1733 C  CE2   . TYR A 220 ? 0.2466 0.4700 0.4261 -0.0658 -0.0282 0.0667  220 TYR A CE2   
1734 C  CZ    . TYR A 220 ? 0.1267 0.5355 0.4496 0.0043  -0.0453 0.0403  220 TYR A CZ    
1735 O  OH    . TYR A 220 ? 0.1745 0.4939 0.4517 -0.0719 -0.0052 0.0537  220 TYR A OH    
1736 N  N     . LEU A 221 ? 0.2158 0.4186 0.4206 -0.0556 -0.0886 0.0520  221 LEU A N     
1737 C  CA    . LEU A 221 ? 0.2007 0.4003 0.4600 -0.0209 -0.0698 0.0693  221 LEU A CA    
1738 C  C     . LEU A 221 ? 0.2805 0.3989 0.4568 -0.0471 -0.0813 0.0692  221 LEU A C     
1739 O  O     . LEU A 221 ? 0.2268 0.3848 0.5266 0.0687  -0.0295 0.0725  221 LEU A O     
1740 C  CB    . LEU A 221 ? 0.2085 0.3989 0.3750 -0.0244 -0.0653 0.0248  221 LEU A CB    
1741 C  CG    . LEU A 221 ? 0.1980 0.4774 0.3639 0.0153  -0.0478 0.0165  221 LEU A CG    
1742 C  CD1   . LEU A 221 ? 0.1966 0.4873 0.2724 -0.0214 -0.0480 0.0472  221 LEU A CD1   
1743 C  CD2   . LEU A 221 ? 0.2775 0.4575 0.3656 0.0219  -0.0024 0.0374  221 LEU A CD2   
1744 N  N     . GLY A 222 ? 0.3005 0.3897 0.4267 -0.0940 -0.0509 0.0859  222 GLY A N     
1745 C  CA    . GLY A 222 ? 0.2058 0.3938 0.4854 -0.0178 -0.1192 0.1020  222 GLY A CA    
1746 C  C     . GLY A 222 ? 0.2671 0.3924 0.4681 -0.0489 -0.0911 0.0769  222 GLY A C     
1747 O  O     . GLY A 222 ? 0.2940 0.4363 0.4970 -0.0763 -0.0876 0.1181  222 GLY A O     
1748 N  N     . CYS A 223 ? 0.2645 0.4344 0.4368 -0.0599 -0.1305 0.0803  223 CYS A N     
1749 C  CA    . CYS A 223 ? 0.2879 0.4086 0.4534 -0.0302 -0.0924 0.0552  223 CYS A CA    
1750 C  C     . CYS A 223 ? 0.2784 0.4114 0.4328 -0.0259 -0.0722 0.0519  223 CYS A C     
1751 O  O     . CYS A 223 ? 0.3297 0.3836 0.3929 0.0476  -0.1150 0.0565  223 CYS A O     
1752 C  CB    . CYS A 223 ? 0.3509 0.3718 0.4010 0.0348  -0.0835 0.0598  223 CYS A CB    
1753 S  SG    . CYS A 223 ? 0.2969 0.3953 0.3839 0.0257  -0.0056 0.0149  223 CYS A SG    
1754 N  N     . GLY A 224 ? 0.3164 0.4079 0.3968 0.0045  -0.0177 0.0687  224 GLY A N     
1755 C  CA    . GLY A 224 ? 0.2873 0.3896 0.3794 0.0210  0.0286  0.0095  224 GLY A CA    
1756 C  C     . GLY A 224 ? 0.3223 0.3966 0.3493 0.0013  -0.0330 -0.0045 224 GLY A C     
1757 O  O     . GLY A 224 ? 0.3322 0.3847 0.3305 0.0111  -0.0265 -0.0288 224 GLY A O     
1758 N  N     . PHE A 225 ? 0.3399 0.3991 0.2871 0.0238  0.0056  0.0132  225 PHE A N     
1759 C  CA    . PHE A 225 ? 0.3655 0.3723 0.2923 -0.0094 -0.0156 0.0081  225 PHE A CA    
1760 C  C     . PHE A 225 ? 0.3449 0.3807 0.2863 -0.0249 -0.0147 0.0127  225 PHE A C     
1761 O  O     . PHE A 225 ? 0.2997 0.3978 0.3009 0.0000  -0.0600 0.0388  225 PHE A O     
1762 C  CB    . PHE A 225 ? 0.3909 0.3529 0.3155 -0.0265 -0.0044 0.0293  225 PHE A CB    
1763 C  CG    . PHE A 225 ? 0.3755 0.3979 0.3188 -0.0429 0.0196  0.0235  225 PHE A CG    
1764 C  CD1   . PHE A 225 ? 0.3726 0.4068 0.3244 -0.0498 0.0083  0.0105  225 PHE A CD1   
1765 C  CD2   . PHE A 225 ? 0.4033 0.4024 0.3794 -0.0290 0.0012  0.0241  225 PHE A CD2   
1766 C  CE1   . PHE A 225 ? 0.3548 0.3761 0.3660 -0.0490 0.0613  0.0150  225 PHE A CE1   
1767 C  CE2   . PHE A 225 ? 0.3992 0.4043 0.3828 -0.0430 0.0230  0.0593  225 PHE A CE2   
1768 C  CZ    . PHE A 225 ? 0.3342 0.4065 0.3788 -0.0712 0.0289  0.0216  225 PHE A CZ    
1769 N  N     . ILE A 226 ? 0.3735 0.3975 0.2828 -0.0102 -0.0030 -0.0164 226 ILE A N     
1770 C  CA    . ILE A 226 ? 0.3958 0.4290 0.3307 0.0120  0.0298  0.0256  226 ILE A CA    
1771 C  C     . ILE A 226 ? 0.4183 0.4261 0.3554 0.0496  0.0468  0.0100  226 ILE A C     
1772 O  O     . ILE A 226 ? 0.4353 0.4183 0.3642 0.0241  0.0710  0.0618  226 ILE A O     
1773 C  CB    . ILE A 226 ? 0.4835 0.3919 0.3750 0.0116  0.0399  0.0500  226 ILE A CB    
1774 C  CG1   . ILE A 226 ? 0.4538 0.5283 0.4296 0.0679  0.0676  0.0361  226 ILE A CG1   
1775 C  CG2   . ILE A 226 ? 0.4407 0.4836 0.4302 0.0588  0.0783  0.0342  226 ILE A CG2   
1776 C  CD1   . ILE A 226 ? 0.4236 0.3492 0.5282 0.0037  -0.1023 0.0767  226 ILE A CD1   
1777 N  N     . GLU A 227 ? 0.4118 0.4470 0.3436 0.0370  0.0526  0.0084  227 GLU A N     
1778 C  CA    . GLU A 227 ? 0.4534 0.4398 0.3461 0.0563  0.0872  0.0198  227 GLU A CA    
1779 C  C     . GLU A 227 ? 0.4750 0.4703 0.3410 0.0818  0.0674  0.0035  227 GLU A C     
1780 O  O     . GLU A 227 ? 0.5618 0.4387 0.3500 0.0183  0.0244  0.1140  227 GLU A O     
1781 C  CB    . GLU A 227 ? 0.4004 0.4354 0.3606 0.0695  0.0602  -0.0002 227 GLU A CB    
1782 C  CG    . GLU A 227 ? 0.5075 0.4689 0.2731 0.0193  0.0699  -0.0111 227 GLU A CG    
1783 C  CD    . GLU A 227 ? 0.4706 0.5615 0.4106 -0.0151 0.1109  0.0189  227 GLU A CD    
1784 O  OE1   . GLU A 227 ? 0.6407 0.5870 0.3631 0.0872  0.1266  0.0675  227 GLU A OE1   
1785 O  OE2   . GLU A 227 ? 0.8033 0.6866 0.5086 -0.0941 0.0606  -0.0595 227 GLU A OE2   
1786 N  N     . LYS A 228 ? 0.4944 0.4396 0.2678 0.0674  0.0333  -0.0377 228 LYS A N     
1787 C  CA    . LYS A 228 ? 0.4673 0.4328 0.3650 0.0668  0.0356  -0.0180 228 LYS A CA    
1788 C  C     . LYS A 228 ? 0.4214 0.4323 0.4119 0.0858  0.1079  0.0017  228 LYS A C     
1789 O  O     . LYS A 228 ? 0.3876 0.4759 0.4049 0.0838  0.0980  0.0066  228 LYS A O     
1790 C  CB    . LYS A 228 ? 0.5836 0.4636 0.4127 0.0815  0.0113  -0.0449 228 LYS A CB    
1791 C  CG    . LYS A 228 ? 0.5651 0.4264 0.4850 0.0706  0.0458  -0.0268 228 LYS A CG    
1792 C  CD    . LYS A 228 ? 0.6575 0.4876 0.5441 0.0826  0.1015  -0.0734 228 LYS A CD    
1793 C  CE    . LYS A 228 ? 0.5929 0.5775 0.4874 0.0424  0.0964  -0.0423 228 LYS A CE    
1794 N  NZ    . LYS A 228 ? 0.5311 0.5418 0.4719 0.0982  0.1319  -0.0214 228 LYS A NZ    
1795 N  N     . ASP A 229 ? 0.3851 0.3824 0.4440 0.0912  0.0686  -0.0269 229 ASP A N     
1796 C  CA    . ASP A 229 ? 0.3906 0.4422 0.4445 0.0966  0.0637  -0.0220 229 ASP A CA    
1797 C  C     . ASP A 229 ? 0.3820 0.4542 0.4632 0.1155  0.0934  -0.0035 229 ASP A C     
1798 O  O     . ASP A 229 ? 0.4425 0.4795 0.5097 0.0542  0.1241  -0.0007 229 ASP A O     
1799 C  CB    . ASP A 229 ? 0.3734 0.4196 0.4409 0.0978  0.0507  -0.0176 229 ASP A CB    
1800 C  CG    . ASP A 229 ? 0.3339 0.4611 0.4533 0.0858  0.1039  -0.0095 229 ASP A CG    
1801 O  OD1   . ASP A 229 ? 0.3318 0.5314 0.4374 0.1222  0.0726  -0.0307 229 ASP A OD1   
1802 O  OD2   . ASP A 229 ? 0.3047 0.4513 0.4244 0.0175  0.0538  0.0069  229 ASP A OD2   
1803 N  N     . SER A 230 ? 0.4338 0.5046 0.4450 0.0920  0.1038  0.0241  230 SER A N     
1804 C  CA    . SER A 230 ? 0.4749 0.5805 0.5206 0.1100  0.1731  0.0273  230 SER A CA    
1805 C  C     . SER A 230 ? 0.5699 0.5396 0.5323 0.0983  0.1799  0.0350  230 SER A C     
1806 O  O     . SER A 230 ? 0.4183 0.5783 0.6949 0.0973  0.2421  0.0775  230 SER A O     
1807 C  CB    . SER A 230 ? 0.5050 0.6486 0.5307 0.1030  0.2588  0.0890  230 SER A CB    
1808 O  OG    . SER A 230 ? 0.5845 0.8439 0.5246 0.1990  0.1771  0.0749  230 SER A OG    
1809 N  N     . ARG A 231 ? 0.4812 0.5460 0.5176 0.1065  0.1266  0.0605  231 ARG A N     
1810 C  CA    . ARG A 231 ? 0.4692 0.5057 0.5632 0.1218  0.1494  0.0668  231 ARG A CA    
1811 C  C     . ARG A 231 ? 0.4324 0.4492 0.5454 0.1407  0.1382  0.0335  231 ARG A C     
1812 O  O     . ARG A 231 ? 0.3805 0.4691 0.5509 0.1856  0.1377  -0.0208 231 ARG A O     
1813 C  CB    . ARG A 231 ? 0.4153 0.5321 0.5577 0.0858  0.0968  0.1259  231 ARG A CB    
1814 C  CG    . ARG A 231 ? 0.4344 0.5404 0.5978 0.0823  0.1719  0.0856  231 ARG A CG    
1815 C  CD    . ARG A 231 ? 0.3886 0.4896 0.5626 0.0924  0.2174  0.1133  231 ARG A CD    
1816 N  NE    . ARG A 231 ? 0.3728 0.4796 0.5391 0.0877  0.1422  0.0840  231 ARG A NE    
1817 C  CZ    . ARG A 231 ? 0.2908 0.4794 0.5881 0.1116  0.1553  0.0618  231 ARG A CZ    
1818 N  NH1   . ARG A 231 ? 0.2755 0.5228 0.6532 0.0737  0.1500  0.1238  231 ARG A NH1   
1819 N  NH2   . ARG A 231 ? 0.2137 0.4488 0.6444 0.0511  0.1334  0.0672  231 ARG A NH2   
1820 N  N     . GLY A 232 ? 0.4390 0.5003 0.5250 0.1189  0.1243  0.0275  232 GLY A N     
1821 C  CA    . GLY A 232 ? 0.4325 0.4765 0.5292 0.1219  0.1456  -0.0081 232 GLY A CA    
1822 C  C     . GLY A 232 ? 0.4424 0.4219 0.4630 0.1126  0.1166  -0.0135 232 GLY A C     
1823 O  O     . GLY A 232 ? 0.4816 0.4054 0.5022 0.1628  0.0917  -0.0505 232 GLY A O     
1824 N  N     . PRO A 233 ? 0.4475 0.4205 0.4279 0.1177  0.1346  -0.0147 233 PRO A N     
1825 C  CA    . PRO A 233 ? 0.4553 0.4057 0.4182 0.1040  0.1260  -0.0171 233 PRO A CA    
1826 C  C     . PRO A 233 ? 0.3747 0.3972 0.3951 0.0941  0.1015  0.0017  233 PRO A C     
1827 O  O     . PRO A 233 ? 0.3791 0.3609 0.3577 0.1019  0.0934  -0.0137 233 PRO A O     
1828 C  CB    . PRO A 233 ? 0.4402 0.4435 0.4293 0.0650  0.1360  0.0167  233 PRO A CB    
1829 C  CG    . PRO A 233 ? 0.4222 0.4604 0.4522 0.1098  0.1379  0.0316  233 PRO A CG    
1830 C  CD    . PRO A 233 ? 0.4618 0.4111 0.4398 0.0916  0.1469  0.0206  233 PRO A CD    
1831 N  N     . TRP A 234 ? 0.3866 0.3865 0.4269 0.0959  0.0786  -0.0106 234 TRP A N     
1832 C  CA    . TRP A 234 ? 0.3549 0.3999 0.3658 0.0849  0.0667  -0.0157 234 TRP A CA    
1833 C  C     . TRP A 234 ? 0.3177 0.4189 0.3654 0.0788  0.0719  -0.0120 234 TRP A C     
1834 O  O     . TRP A 234 ? 0.3298 0.4219 0.3414 0.0844  0.0739  -0.0410 234 TRP A O     
1835 C  CB    . TRP A 234 ? 0.3485 0.3464 0.3759 0.0817  0.0682  -0.0055 234 TRP A CB    
1836 C  CG    . TRP A 234 ? 0.3344 0.3993 0.3503 0.1093  0.0851  -0.0060 234 TRP A CG    
1837 C  CD1   . TRP A 234 ? 0.3482 0.3739 0.3620 0.1036  0.0535  -0.0065 234 TRP A CD1   
1838 C  CD2   . TRP A 234 ? 0.3349 0.4569 0.3617 0.0937  0.1171  0.0013  234 TRP A CD2   
1839 N  NE1   . TRP A 234 ? 0.3170 0.4327 0.3908 0.0951  0.0550  0.0072  234 TRP A NE1   
1840 C  CE2   . TRP A 234 ? 0.3343 0.4487 0.3891 0.1355  0.1308  -0.0129 234 TRP A CE2   
1841 C  CE3   . TRP A 234 ? 0.3199 0.4760 0.3941 0.0748  0.1202  -0.0195 234 TRP A CE3   
1842 C  CZ2   . TRP A 234 ? 0.2952 0.5081 0.4523 0.0691  0.1362  -0.0009 234 TRP A CZ2   
1843 C  CZ3   . TRP A 234 ? 0.3052 0.4792 0.3853 0.0712  0.1411  -0.0237 234 TRP A CZ3   
1844 C  CH2   . TRP A 234 ? 0.3058 0.4939 0.4319 0.0832  0.1472  -0.0085 234 TRP A CH2   
1845 N  N     . LEU A 235 ? 0.3000 0.3752 0.3670 0.0677  0.0419  -0.0200 235 LEU A N     
1846 C  CA    . LEU A 235 ? 0.2968 0.3458 0.3214 0.0198  0.0505  -0.0057 235 LEU A CA    
1847 C  C     . LEU A 235 ? 0.2861 0.3481 0.3417 0.0154  0.0295  -0.0165 235 LEU A C     
1848 O  O     . LEU A 235 ? 0.2442 0.4030 0.3373 -0.0056 0.0567  0.0229  235 LEU A O     
1849 C  CB    . LEU A 235 ? 0.3377 0.3097 0.3052 -0.0004 -0.0021 0.0077  235 LEU A CB    
1850 C  CG    . LEU A 235 ? 0.3917 0.3574 0.3029 -0.0111 0.0301  -0.0458 235 LEU A CG    
1851 C  CD1   . LEU A 235 ? 0.3781 0.3616 0.3682 0.0331  0.0040  -0.0627 235 LEU A CD1   
1852 C  CD2   . LEU A 235 ? 0.3941 0.3858 0.3224 0.0130  0.0477  0.0150  235 LEU A CD2   
1853 N  N     . TYR A 236 ? 0.3389 0.3486 0.3124 0.0404  0.0327  -0.0288 236 TYR A N     
1854 C  CA    . TYR A 236 ? 0.2529 0.3563 0.3568 0.0517  0.0141  -0.0279 236 TYR A CA    
1855 C  C     . TYR A 236 ? 0.2503 0.3798 0.3544 0.0582  0.0204  -0.0191 236 TYR A C     
1856 O  O     . TYR A 236 ? 0.2783 0.4352 0.3617 -0.0146 -0.0161 0.0006  236 TYR A O     
1857 C  CB    . TYR A 236 ? 0.2597 0.3307 0.3278 0.0644  0.0377  -0.0011 236 TYR A CB    
1858 C  CG    . TYR A 236 ? 0.2341 0.4543 0.3596 0.0446  0.0470  0.0147  236 TYR A CG    
1859 C  CD1   . TYR A 236 ? 0.2536 0.5104 0.3610 0.0209  0.0372  0.0347  236 TYR A CD1   
1860 C  CD2   . TYR A 236 ? 0.3155 0.4017 0.3438 0.0804  0.0508  0.0180  236 TYR A CD2   
1861 C  CE1   . TYR A 236 ? 0.2668 0.4717 0.3819 0.0324  0.0335  -0.0074 236 TYR A CE1   
1862 C  CE2   . TYR A 236 ? 0.2464 0.4361 0.3739 0.0396  0.1030  0.0389  236 TYR A CE2   
1863 C  CZ    . TYR A 236 ? 0.1876 0.4671 0.4199 0.0120  0.0516  0.0151  236 TYR A CZ    
1864 O  OH    . TYR A 236 ? 0.2083 0.4467 0.4518 -0.0194 0.0071  0.0443  236 TYR A OH    
1865 N  N     . TYR A 237 ? 0.2521 0.3674 0.3139 0.0498  0.0203  -0.0028 237 TYR A N     
1866 C  CA    . TYR A 237 ? 0.2402 0.3455 0.3137 0.0414  0.0198  -0.0124 237 TYR A CA    
1867 C  C     . TYR A 237 ? 0.2463 0.3372 0.3448 0.0572  0.0258  -0.0043 237 TYR A C     
1868 O  O     . TYR A 237 ? 0.2221 0.3253 0.3768 0.0569  0.0109  -0.0078 237 TYR A O     
1869 C  CB    . TYR A 237 ? 0.1942 0.3387 0.3472 0.0345  -0.0007 -0.0030 237 TYR A CB    
1870 C  CG    . TYR A 237 ? 0.1849 0.3248 0.3062 0.0080  -0.0071 0.0356  237 TYR A CG    
1871 C  CD1   . TYR A 237 ? 0.1937 0.3947 0.3221 0.0148  -0.0226 0.0192  237 TYR A CD1   
1872 C  CD2   . TYR A 237 ? 0.1436 0.3570 0.2856 0.0103  0.0124  0.0220  237 TYR A CD2   
1873 C  CE1   . TYR A 237 ? 0.2377 0.3487 0.2764 -0.0065 -0.0375 0.0501  237 TYR A CE1   
1874 C  CE2   . TYR A 237 ? 0.1390 0.3803 0.2998 -0.0060 -0.0183 0.0701  237 TYR A CE2   
1875 C  CZ    . TYR A 237 ? 0.1734 0.3570 0.3029 -0.0130 -0.0285 0.0398  237 TYR A CZ    
1876 O  OH    . TYR A 237 ? 0.1517 0.3896 0.2819 -0.0290 -0.0568 0.0644  237 TYR A OH    
1877 N  N     . THR A 238 ? 0.2386 0.3331 0.3343 0.0706  0.0148  -0.0122 238 THR A N     
1878 C  CA    . THR A 238 ? 0.2322 0.3622 0.3500 0.0396  0.0158  0.0022  238 THR A CA    
1879 C  C     . THR A 238 ? 0.2419 0.3711 0.3642 0.0357  0.0232  0.0303  238 THR A C     
1880 O  O     . THR A 238 ? 0.2447 0.3627 0.4240 0.0761  -0.0146 0.0287  238 THR A O     
1881 C  CB    . THR A 238 ? 0.2344 0.3897 0.4125 0.0300  0.0343  -0.0160 238 THR A CB    
1882 O  OG1   . THR A 238 ? 0.2938 0.4742 0.4270 0.0804  0.0196  0.0077  238 THR A OG1   
1883 C  CG2   . THR A 238 ? 0.1872 0.4374 0.4451 0.0076  -0.0224 -0.0006 238 THR A CG2   
1884 N  N     . VAL A 239 ? 0.2712 0.3784 0.3704 0.0202  0.0262  0.0406  239 VAL A N     
1885 C  CA    . VAL A 239 ? 0.2588 0.3479 0.3770 -0.0017 0.0328  0.0350  239 VAL A CA    
1886 C  C     . VAL A 239 ? 0.2386 0.3841 0.4032 -0.0106 0.0139  0.0255  239 VAL A C     
1887 O  O     . VAL A 239 ? 0.2013 0.3374 0.3875 0.0484  0.0194  0.0211  239 VAL A O     
1888 C  CB    . VAL A 239 ? 0.1730 0.3490 0.3788 -0.0274 -0.0124 0.0366  239 VAL A CB    
1889 C  CG1   . VAL A 239 ? 0.2752 0.3441 0.3083 -0.0364 -0.0261 0.0393  239 VAL A CG1   
1890 C  CG2   . VAL A 239 ? 0.2498 0.3330 0.3266 -0.0330 0.0210  0.0725  239 VAL A CG2   
1891 N  N     . THR A 240 ? 0.3466 0.4497 0.4288 -0.0396 -0.0135 0.0783  240 THR A N     
1892 C  CA    . THR A 240 ? 0.3022 0.4884 0.5302 -0.0171 0.0455  0.1292  240 THR A CA    
1893 C  C     . THR A 240 ? 0.3192 0.5450 0.5649 0.0120  -0.0386 0.1243  240 THR A C     
1894 O  O     . THR A 240 ? 0.2955 0.5346 0.7535 0.0541  -0.0265 0.2827  240 THR A O     
1895 C  CB    . THR A 240 ? 0.3867 0.6788 0.5017 0.0262  0.0595  0.0432  240 THR A CB    
1896 O  OG1   . THR A 240 ? 0.4882 0.6902 0.8791 0.0791  0.0499  0.1377  240 THR A OG1   
1897 C  CG2   . THR A 240 ? 0.3180 0.4203 0.3790 0.0787  0.1227  0.1437  240 THR A CG2   
1898 N  N     . ASN A 241 ? 0.3015 0.4183 0.5049 -0.0141 -0.0031 0.0868  241 ASN A N     
1899 C  CA    . ASN A 241 ? 0.2882 0.4571 0.4208 -0.0002 -0.0048 0.0710  241 ASN A CA    
1900 C  C     . ASN A 241 ? 0.2822 0.4367 0.4575 -0.0040 -0.0011 0.0693  241 ASN A C     
1901 O  O     . ASN A 241 ? 0.3285 0.4879 0.3954 0.0434  0.0246  0.0279  241 ASN A O     
1902 C  CB    . ASN A 241 ? 0.3084 0.4433 0.4566 -0.0236 -0.0278 0.1054  241 ASN A CB    
1903 C  CG    . ASN A 241 ? 0.3403 0.5123 0.4089 0.0317  -0.0250 0.0867  241 ASN A CG    
1904 O  OD1   . ASN A 241 ? 0.3825 0.4709 0.4534 0.0780  -0.0482 0.1275  241 ASN A OD1   
1905 N  ND2   . ASN A 241 ? 0.3948 0.5137 0.4021 0.0004  -0.0155 0.1334  241 ASN A ND2   
1906 N  N     . PHE A 242 ? 0.2297 0.4180 0.4380 0.0314  -0.0135 0.0283  242 PHE A N     
1907 C  CA    . PHE A 242 ? 0.2384 0.3866 0.4566 0.0280  0.0020  0.0314  242 PHE A CA    
1908 C  C     . PHE A 242 ? 0.2112 0.4131 0.4289 -0.0188 -0.0208 0.0524  242 PHE A C     
1909 O  O     . PHE A 242 ? 0.1852 0.3401 0.4585 -0.0267 0.0217  0.1144  242 PHE A O     
1910 C  CB    . PHE A 242 ? 0.3198 0.4177 0.4373 -0.0055 0.0190  0.0381  242 PHE A CB    
1911 C  CG    . PHE A 242 ? 0.3437 0.4245 0.4429 -0.0344 -0.0626 0.0052  242 PHE A CG    
1912 C  CD1   . PHE A 242 ? 0.4264 0.5192 0.3966 -0.0203 -0.0099 0.0132  242 PHE A CD1   
1913 C  CD2   . PHE A 242 ? 0.2494 0.4240 0.5174 -0.0304 -0.0140 -0.0252 242 PHE A CD2   
1914 C  CE1   . PHE A 242 ? 0.2193 0.3585 0.4641 -0.0679 0.0125  0.0520  242 PHE A CE1   
1915 C  CE2   . PHE A 242 ? 0.3888 0.4412 0.4961 0.0154  0.0006  0.0001  242 PHE A CE2   
1916 C  CZ    . PHE A 242 ? 0.2561 0.4177 0.5082 0.0063  0.0066  0.0079  242 PHE A CZ    
1917 N  N     . SER A 243 ? 0.2269 0.3648 0.3651 -0.0344 0.0175  0.0775  243 SER A N     
1918 C  CA    . SER A 243 ? 0.2314 0.3959 0.4570 -0.0199 -0.0551 0.0987  243 SER A CA    
1919 C  C     . SER A 243 ? 0.2418 0.4164 0.4322 -0.0097 -0.0180 0.0891  243 SER A C     
1920 O  O     . SER A 243 ? 0.2187 0.4142 0.4497 -0.0024 -0.0197 0.1168  243 SER A O     
1921 C  CB    . SER A 243 ? 0.3813 0.4228 0.4244 -0.0305 -0.0682 0.0785  243 SER A CB    
1922 O  OG    . SER A 243 ? 0.4238 0.4536 0.5060 -0.1179 -0.1369 0.0489  243 SER A OG    
1923 N  N     . ASP A 244 ? 0.2778 0.4022 0.3043 -0.0152 -0.0642 0.0390  244 ASP A N     
1924 C  CA    . ASP A 244 ? 0.2887 0.3986 0.4030 -0.0536 -0.0710 0.0384  244 ASP A CA    
1925 C  C     . ASP A 244 ? 0.2147 0.4188 0.3931 -0.0408 -0.0432 0.0343  244 ASP A C     
1926 O  O     . ASP A 244 ? 0.1568 0.3392 0.4437 -0.0800 -0.0630 0.0642  244 ASP A O     
1927 C  CB    . ASP A 244 ? 0.2627 0.4692 0.4101 -0.0265 -0.0411 -0.0113 244 ASP A CB    
1928 C  CG    . ASP A 244 ? 0.2803 0.4881 0.4311 0.0043  -0.0716 -0.0015 244 ASP A CG    
1929 O  OD1   . ASP A 244 ? 0.2927 0.3990 0.5233 -0.0021 -0.0871 0.0904  244 ASP A OD1   
1930 O  OD2   . ASP A 244 ? 0.3406 0.6052 0.3332 0.0149  -0.0230 0.0171  244 ASP A OD2   
1931 N  N     . ILE A 245 ? 0.2006 0.3313 0.4243 -0.0207 -0.0350 0.0152  245 ILE A N     
1932 C  CA    . ILE A 245 ? 0.2179 0.3382 0.4006 0.0243  -0.0020 0.0252  245 ILE A CA    
1933 C  C     . ILE A 245 ? 0.2662 0.3283 0.4651 0.0297  0.0198  0.0143  245 ILE A C     
1934 O  O     . ILE A 245 ? 0.3761 0.3276 0.4881 -0.0118 0.0552  -0.0188 245 ILE A O     
1935 C  CB    . ILE A 245 ? 0.2266 0.3059 0.4122 0.0059  -0.0018 0.0046  245 ILE A CB    
1936 C  CG1   . ILE A 245 ? 0.1722 0.4077 0.4212 0.0636  0.0422  -0.0558 245 ILE A CG1   
1937 C  CG2   . ILE A 245 ? 0.2211 0.3152 0.4059 0.0607  0.0554  -0.0191 245 ILE A CG2   
1938 C  CD1   . ILE A 245 ? 0.1887 0.3294 0.5291 -0.0667 -0.0025 -0.0300 245 ILE A CD1   
1939 N  N     . GLN A 246 ? 0.2143 0.3562 0.4948 0.0384  -0.0166 0.0380  246 GLN A N     
1940 C  CA    . GLN A 246 ? 0.1992 0.3870 0.5565 0.0378  0.0272  0.0387  246 GLN A CA    
1941 C  C     . GLN A 246 ? 0.2179 0.4144 0.4689 -0.0027 0.0231  0.0494  246 GLN A C     
1942 O  O     . GLN A 246 ? 0.2500 0.4292 0.4612 0.0433  0.0290  0.0813  246 GLN A O     
1943 C  CB    . GLN A 246 ? 0.3004 0.3868 0.5908 0.0215  0.0129  0.0544  246 GLN A CB    
1944 C  CG    . GLN A 246 ? 0.2862 0.4130 0.6415 0.0357  -0.0611 0.1050  246 GLN A CG    
1945 C  CD    . GLN A 246 ? 0.6634 0.3872 0.5746 0.0635  -0.0367 -0.0211 246 GLN A CD    
1946 O  OE1   . GLN A 246 ? 0.6300 0.7488 0.7108 0.1859  -0.0698 0.1011  246 GLN A OE1   
1947 N  NE2   . GLN A 246 ? 0.3610 0.6885 0.5565 -0.0919 0.0392  -0.1038 246 GLN A NE2   
1948 N  N     . GLY A 247 ? 0.1984 0.4258 0.4557 -0.0021 0.0308  0.0511  247 GLY A N     
1949 C  CA    . GLY A 247 ? 0.1913 0.3895 0.4810 0.0044  0.0059  0.0569  247 GLY A CA    
1950 C  C     . GLY A 247 ? 0.1646 0.4381 0.5083 0.0297  0.0260  0.1196  247 GLY A C     
1951 O  O     . GLY A 247 ? 0.1435 0.4160 0.5258 0.0199  -0.0099 0.0808  247 GLY A O     
1952 N  N     . LYS A 248 ? 0.1955 0.4070 0.4752 0.0284  -0.0426 0.0827  248 LYS A N     
1953 C  CA    . LYS A 248 ? 0.2151 0.4201 0.4748 -0.0266 -0.0642 0.0347  248 LYS A CA    
1954 C  C     . LYS A 248 ? 0.1587 0.4048 0.4723 0.0149  -0.0023 0.0585  248 LYS A C     
1955 O  O     . LYS A 248 ? 0.1190 0.4511 0.5640 -0.0149 0.0488  0.0407  248 LYS A O     
1956 C  CB    . LYS A 248 ? 0.1937 0.4709 0.4518 -0.0366 -0.1043 0.0137  248 LYS A CB    
1957 C  CG    . LYS A 248 ? 0.3254 0.5754 0.4660 0.0279  -0.1382 0.0474  248 LYS A CG    
1958 C  CD    . LYS A 248 ? 0.4382 0.6495 0.4528 0.0443  -0.1610 0.0061  248 LYS A CD    
1959 C  CE    . LYS A 248 ? 0.2390 0.5125 0.5555 0.0465  -0.2343 -0.0500 248 LYS A CE    
1960 N  NZ    . LYS A 248 ? 0.3466 0.6317 0.6110 -0.0563 -0.2713 -0.0617 248 LYS A NZ    
1961 N  N     . ILE A 249 ? 0.1480 0.3860 0.4687 0.0677  -0.0487 0.0148  249 ILE A N     
1962 C  CA    . ILE A 249 ? 0.1580 0.4073 0.4030 0.0496  0.0108  0.0428  249 ILE A CA    
1963 C  C     . ILE A 249 ? 0.2024 0.3706 0.4293 0.0278  0.0221  0.0455  249 ILE A C     
1964 O  O     . ILE A 249 ? 0.1454 0.3558 0.4510 0.0308  -0.0127 0.0997  249 ILE A O     
1965 C  CB    . ILE A 249 ? 0.1345 0.3683 0.3620 0.0289  -0.0164 0.0320  249 ILE A CB    
1966 C  CG1   . ILE A 249 ? 0.1473 0.3661 0.3519 -0.0259 -0.0083 0.0328  249 ILE A CG1   
1967 C  CG2   . ILE A 249 ? 0.2114 0.3981 0.3311 -0.0009 0.0040  0.0980  249 ILE A CG2   
1968 C  CD1   . ILE A 249 ? 0.1955 0.3409 0.3477 -0.0186 0.0584  0.0477  249 ILE A CD1   
1969 N  N     . ILE A 250 ? 0.1407 0.3457 0.4282 0.0563  -0.0264 0.0487  250 ILE A N     
1970 C  CA    . ILE A 250 ? 0.1817 0.3427 0.4598 0.0356  0.0347  0.0325  250 ILE A CA    
1971 C  C     . ILE A 250 ? 0.1678 0.3687 0.4742 0.0417  0.0242  0.0475  250 ILE A C     
1972 O  O     . ILE A 250 ? 0.1903 0.3098 0.4883 0.0378  0.0989  0.0522  250 ILE A O     
1973 C  CB    . ILE A 250 ? 0.1594 0.3574 0.4263 0.0208  0.0262  0.0179  250 ILE A CB    
1974 C  CG1   . ILE A 250 ? 0.1556 0.3611 0.4357 0.0088  0.0217  0.0383  250 ILE A CG1   
1975 C  CG2   . ILE A 250 ? 0.2237 0.2788 0.4353 0.0157  0.0070  0.0407  250 ILE A CG2   
1976 C  CD1   . ILE A 250 ? 0.1397 0.3960 0.4908 -0.0210 0.0218  0.0414  250 ILE A CD1   
1977 N  N     . PRO A 251 ? 0.1904 0.3706 0.4703 0.0103  0.0068  0.0681  251 PRO A N     
1978 C  CA    . PRO A 251 ? 0.2031 0.3975 0.4573 0.0443  0.0184  0.0812  251 PRO A CA    
1979 C  C     . PRO A 251 ? 0.2594 0.3547 0.4929 0.0588  0.0440  0.0560  251 PRO A C     
1980 O  O     . PRO A 251 ? 0.1936 0.3922 0.5321 0.0410  0.0545  0.0034  251 PRO A O     
1981 C  CB    . PRO A 251 ? 0.2408 0.3951 0.4827 0.0462  -0.0029 0.1209  251 PRO A CB    
1982 C  CG    . PRO A 251 ? 0.1992 0.3735 0.4499 0.0176  -0.0304 0.0895  251 PRO A CG    
1983 C  CD    . PRO A 251 ? 0.1848 0.3836 0.4614 0.0027  -0.0154 0.0545  251 PRO A CD    
1984 N  N     . PHE A 252 ? 0.2517 0.3481 0.4475 0.0634  0.0000  0.0581  252 PHE A N     
1985 C  CA    . PHE A 252 ? 0.2512 0.3332 0.4526 0.0354  0.0388  0.0290  252 PHE A CA    
1986 C  C     . PHE A 252 ? 0.2017 0.3344 0.4525 0.0641  0.0428  0.0303  252 PHE A C     
1987 O  O     . PHE A 252 ? 0.1615 0.3588 0.4713 0.1048  0.0652  0.0123  252 PHE A O     
1988 C  CB    . PHE A 252 ? 0.1351 0.3394 0.4763 0.0192  0.0489  0.0240  252 PHE A CB    
1989 C  CG    . PHE A 252 ? 0.1551 0.3334 0.4883 0.0121  0.0369  0.0172  252 PHE A CG    
1990 C  CD1   . PHE A 252 ? 0.1378 0.3316 0.5368 0.0195  0.0465  0.0376  252 PHE A CD1   
1991 C  CD2   . PHE A 252 ? 0.1959 0.3284 0.4762 -0.0072 0.0295  0.0266  252 PHE A CD2   
1992 C  CE1   . PHE A 252 ? 0.1620 0.3837 0.4916 -0.0142 0.0225  0.0678  252 PHE A CE1   
1993 C  CE2   . PHE A 252 ? 0.2031 0.3975 0.4661 -0.0516 0.0641  0.0541  252 PHE A CE2   
1994 C  CZ    . PHE A 252 ? 0.1561 0.3323 0.4809 -0.0050 0.0481  0.0856  252 PHE A CZ    
1995 N  N     . PHE A 253 ? 0.2403 0.3299 0.3869 -0.0187 0.0211  0.0096  253 PHE A N     
1996 C  CA    . PHE A 253 ? 0.2178 0.3549 0.4146 0.0339  0.0070  0.0049  253 PHE A CA    
1997 C  C     . PHE A 253 ? 0.2394 0.3286 0.4595 0.0365  0.0269  0.0044  253 PHE A C     
1998 O  O     . PHE A 253 ? 0.2542 0.3205 0.4425 0.0397  0.0798  0.0172  253 PHE A O     
1999 C  CB    . PHE A 253 ? 0.2189 0.3219 0.3941 0.0390  0.0323  0.0193  253 PHE A CB    
2000 C  CG    . PHE A 253 ? 0.2094 0.3568 0.3765 0.0232  0.0050  -0.0139 253 PHE A CG    
2001 C  CD1   . PHE A 253 ? 0.2173 0.3632 0.3473 0.0753  -0.0273 0.0048  253 PHE A CD1   
2002 C  CD2   . PHE A 253 ? 0.1493 0.3684 0.3717 0.0677  -0.0055 0.0074  253 PHE A CD2   
2003 C  CE1   . PHE A 253 ? 0.1714 0.3784 0.3618 0.0725  -0.0074 -0.0099 253 PHE A CE1   
2004 C  CE2   . PHE A 253 ? 0.1877 0.3648 0.4007 0.1284  -0.0197 0.0164  253 PHE A CE2   
2005 C  CZ    . PHE A 253 ? 0.2058 0.3823 0.3971 0.1096  0.0586  -0.0038 253 PHE A CZ    
2006 N  N     . HIS A 254 ? 0.1908 0.3603 0.4339 0.0487  -0.0251 -0.0280 254 HIS A N     
2007 C  CA    . HIS A 254 ? 0.2364 0.3874 0.4754 0.1145  0.0515  0.0004  254 HIS A CA    
2008 C  C     . HIS A 254 ? 0.2751 0.4093 0.4961 0.0658  0.0504  0.0244  254 HIS A C     
2009 O  O     . HIS A 254 ? 0.2929 0.4100 0.5035 0.1101  0.0905  0.0160  254 HIS A O     
2010 C  CB    . HIS A 254 ? 0.3180 0.3815 0.5393 0.1020  0.0832  0.0323  254 HIS A CB    
2011 C  CG    . HIS A 254 ? 0.2926 0.3612 0.6332 0.1126  0.0538  0.0038  254 HIS A CG    
2012 N  ND1   . HIS A 254 ? 0.2819 0.3974 0.6033 0.1429  0.0398  0.0075  254 HIS A ND1   
2013 C  CD2   . HIS A 254 ? 0.3228 0.4516 0.6012 0.1314  0.0886  -0.0063 254 HIS A CD2   
2014 C  CE1   . HIS A 254 ? 0.3321 0.4626 0.6658 0.1559  0.1104  -0.0079 254 HIS A CE1   
2015 N  NE2   . HIS A 254 ? 0.3420 0.3793 0.6070 0.1635  0.1139  0.0215  254 HIS A NE2   
2016 N  N     . GLN A 255 ? 0.2406 0.4309 0.5143 0.0397  0.0642  0.0462  255 GLN A N     
2017 C  CA    . GLN A 255 ? 0.2170 0.4695 0.5042 0.0870  0.0890  0.0520  255 GLN A CA    
2018 C  C     . GLN A 255 ? 0.2591 0.4369 0.4966 0.0884  0.1193  0.0217  255 GLN A C     
2019 O  O     . GLN A 255 ? 0.2095 0.4647 0.5584 0.1206  0.1689  0.0467  255 GLN A O     
2020 C  CB    . GLN A 255 ? 0.1645 0.4804 0.5033 0.0827  0.1173  -0.0046 255 GLN A CB    
2021 C  CG    . GLN A 255 ? 0.2318 0.4784 0.5622 0.0187  0.0950  0.0673  255 GLN A CG    
2022 C  CD    . GLN A 255 ? 0.2397 0.4793 0.5843 0.0425  0.0866  0.0851  255 GLN A CD    
2023 O  OE1   . GLN A 255 ? 0.3204 0.5173 0.5932 0.0173  0.1435  0.1399  255 GLN A OE1   
2024 N  NE2   . GLN A 255 ? 0.2844 0.4374 0.6163 0.0711  0.1347  0.0531  255 GLN A NE2   
2025 N  N     . TYR A 256 ? 0.1498 0.4100 0.4306 0.0742  0.0549  0.0433  256 TYR A N     
2026 C  CA    . TYR A 256 ? 0.1597 0.3947 0.4107 0.0359  0.0422  0.0388  256 TYR A CA    
2027 C  C     . TYR A 256 ? 0.1591 0.3793 0.4284 0.0561  0.0397  0.0307  256 TYR A C     
2028 O  O     . TYR A 256 ? 0.1766 0.4070 0.4021 0.0573  0.0275  0.0106  256 TYR A O     
2029 C  CB    . TYR A 256 ? 0.1329 0.3709 0.4258 0.0409  0.0282  0.0431  256 TYR A CB    
2030 C  CG    . TYR A 256 ? 0.1416 0.4065 0.4726 0.0434  0.0164  0.0293  256 TYR A CG    
2031 C  CD1   . TYR A 256 ? 0.1491 0.4327 0.5176 0.0312  0.0350  0.0380  256 TYR A CD1   
2032 C  CD2   . TYR A 256 ? 0.1716 0.3823 0.5044 0.0589  -0.0232 0.0274  256 TYR A CD2   
2033 C  CE1   . TYR A 256 ? 0.1612 0.4780 0.5431 0.0394  -0.0016 0.0377  256 TYR A CE1   
2034 C  CE2   . TYR A 256 ? 0.1475 0.4069 0.5337 0.0549  0.0260  0.0325  256 TYR A CE2   
2035 C  CZ    . TYR A 256 ? 0.1572 0.4435 0.5717 0.0284  0.0131  0.0810  256 TYR A CZ    
2036 O  OH    . TYR A 256 ? 0.1786 0.4464 0.5831 0.0720  -0.0098 0.1078  256 TYR A OH    
2037 N  N     . LYS A 257 ? 0.2157 0.3618 0.4372 0.0335  0.0395  0.0204  257 LYS A N     
2038 C  CA    . LYS A 257 ? 0.2021 0.3107 0.4000 0.0632  0.0461  -0.0083 257 LYS A CA    
2039 C  C     . LYS A 257 ? 0.1791 0.2983 0.3870 0.0418  0.0597  -0.0046 257 LYS A C     
2040 O  O     . LYS A 257 ? 0.2214 0.3342 0.4128 0.0339  0.1193  0.0280  257 LYS A O     
2041 C  CB    . LYS A 257 ? 0.2958 0.3335 0.4132 0.0927  0.0265  -0.0269 257 LYS A CB    
2042 C  CG    . LYS A 257 ? 0.3832 0.3545 0.4261 0.1288  0.0341  -0.0188 257 LYS A CG    
2043 C  CD    . LYS A 257 ? 0.4457 0.3288 0.5226 0.1321  0.0282  -0.0697 257 LYS A CD    
2044 C  CE    . LYS A 257 ? 0.3379 0.3863 0.7085 0.2183  0.0066  -0.1025 257 LYS A CE    
2045 N  NZ    . LYS A 257 ? 0.3533 0.6722 0.7300 -0.0829 0.1468  -0.1494 257 LYS A NZ    
2046 N  N     . ILE A 258 ? 0.1686 0.3207 0.3297 0.0544  0.0692  -0.0466 258 ILE A N     
2047 C  CA    . ILE A 258 ? 0.1624 0.3305 0.3651 0.0262  0.0405  0.0042  258 ILE A CA    
2048 C  C     . ILE A 258 ? 0.2076 0.3539 0.3546 0.0288  0.0628  -0.0282 258 ILE A C     
2049 O  O     . ILE A 258 ? 0.2396 0.3702 0.3625 0.0215  0.0788  -0.0455 258 ILE A O     
2050 C  CB    . ILE A 258 ? 0.1586 0.3158 0.3377 0.0487  0.0584  -0.0132 258 ILE A CB    
2051 C  CG1   . ILE A 258 ? 0.1475 0.2890 0.3386 0.0326  0.0594  -0.0185 258 ILE A CG1   
2052 C  CG2   . ILE A 258 ? 0.1346 0.3224 0.3115 -0.0219 0.0097  0.0110  258 ILE A CG2   
2053 C  CD1   . ILE A 258 ? 0.2011 0.2949 0.2716 0.0172  0.0632  -0.0152 258 ILE A CD1   
2054 N  N     . ILE A 259 ? 0.2303 0.3708 0.3594 0.0349  0.0637  -0.0195 259 ILE A N     
2055 C  CA    . ILE A 259 ? 0.2254 0.4585 0.3620 -0.0344 0.0707  0.0067  259 ILE A CA    
2056 C  C     . ILE A 259 ? 0.2434 0.4925 0.3548 -0.0329 0.0403  -0.0589 259 ILE A C     
2057 O  O     . ILE A 259 ? 0.1759 0.4453 0.4205 -0.0575 0.0573  -0.0522 259 ILE A O     
2058 C  CB    . ILE A 259 ? 0.2607 0.3414 0.4478 -0.0115 0.0520  -0.0146 259 ILE A CB    
2059 C  CG1   . ILE A 259 ? 0.1985 0.3472 0.3330 -0.0001 0.0396  0.0083  259 ILE A CG1   
2060 C  CG2   . ILE A 259 ? 0.2343 0.2920 0.3718 -0.0535 0.0711  -0.0391 259 ILE A CG2   
2061 C  CD1   . ILE A 259 ? 0.1223 0.3520 0.3030 -0.0143 -0.0094 -0.0247 259 ILE A CD1   
2062 N  N     . GLY A 260 ? 0.2563 0.4306 0.3269 -0.0236 0.0916  -0.0731 260 GLY A N     
2063 C  CA    . GLY A 260 ? 0.2932 0.4153 0.2967 0.0037  0.0365  -0.0138 260 GLY A CA    
2064 C  C     . GLY A 260 ? 0.2801 0.4067 0.3522 -0.0071 -0.0106 0.0043  260 GLY A C     
2065 O  O     . GLY A 260 ? 0.3032 0.3643 0.3406 0.0537  0.0194  -0.0646 260 GLY A O     
2066 N  N     . SER A 261 ? 0.2718 0.3902 0.3359 -0.0093 0.0077  0.0437  261 SER A N     
2067 C  CA    . SER A 261 ? 0.2963 0.3812 0.3971 -0.0614 -0.0531 -0.0125 261 SER A CA    
2068 C  C     . SER A 261 ? 0.2299 0.3944 0.3853 -0.0432 -0.0127 -0.0383 261 SER A C     
2069 O  O     . SER A 261 ? 0.2935 0.3840 0.4004 -0.0678 -0.0639 -0.0769 261 SER A O     
2070 C  CB    . SER A 261 ? 0.2798 0.4510 0.4765 -0.0174 -0.0362 0.0327  261 SER A CB    
2071 O  OG    . SER A 261 ? 0.3438 0.5249 0.5797 0.0335  0.0213  0.0542  261 SER A OG    
2072 N  N     . LYS A 262 ? 0.2471 0.3954 0.3528 -0.0169 -0.0157 -0.0292 262 LYS A N     
2073 C  CA    . LYS A 262 ? 0.2172 0.3925 0.3426 0.0092  0.0098  -0.0436 262 LYS A CA    
2074 C  C     . LYS A 262 ? 0.2475 0.3820 0.3593 0.0135  0.0417  -0.0200 262 LYS A C     
2075 O  O     . LYS A 262 ? 0.3428 0.4563 0.3800 0.0484  0.0452  0.0156  262 LYS A O     
2076 C  CB    . LYS A 262 ? 0.1745 0.3248 0.3355 0.0115  -0.0064 0.0146  262 LYS A CB    
2077 C  CG    . LYS A 262 ? 0.2400 0.3588 0.3403 0.0179  -0.0177 -0.0078 262 LYS A CG    
2078 C  CD    . LYS A 262 ? 0.2135 0.3775 0.3140 0.0087  -0.0425 -0.0042 262 LYS A CD    
2079 C  CE    . LYS A 262 ? 0.2180 0.4091 0.3243 0.0443  0.0523  -0.0013 262 LYS A CE    
2080 N  NZ    . LYS A 262 ? 0.1843 0.4740 0.3903 0.0218  0.0284  0.0208  262 LYS A NZ    
2081 N  N     . TYR A 263 ? 0.2321 0.3650 0.3943 0.0183  0.0496  -0.0623 263 TYR A N     
2082 C  CA    . TYR A 263 ? 0.2261 0.3227 0.3507 -0.0223 0.0276  -0.0105 263 TYR A CA    
2083 C  C     . TYR A 263 ? 0.2671 0.3388 0.4019 -0.0475 0.0086  -0.0053 263 TYR A C     
2084 O  O     . TYR A 263 ? 0.2961 0.2458 0.3573 -0.0434 0.0242  -0.0530 263 TYR A O     
2085 C  CB    . TYR A 263 ? 0.2494 0.3228 0.3578 0.0027  0.0440  -0.0335 263 TYR A CB    
2086 C  CG    . TYR A 263 ? 0.2657 0.3381 0.3834 0.0139  0.0539  -0.0260 263 TYR A CG    
2087 C  CD1   . TYR A 263 ? 0.2686 0.3111 0.3593 -0.0127 0.0637  -0.0339 263 TYR A CD1   
2088 C  CD2   . TYR A 263 ? 0.3586 0.3824 0.4126 0.0204  0.0294  -0.0650 263 TYR A CD2   
2089 C  CE1   . TYR A 263 ? 0.2892 0.3647 0.4367 0.0125  0.0546  -0.0024 263 TYR A CE1   
2090 C  CE2   . TYR A 263 ? 0.3645 0.4149 0.4557 0.0510  0.0487  -0.0539 263 TYR A CE2   
2091 C  CZ    . TYR A 263 ? 0.3810 0.4360 0.4450 0.0372  0.0557  -0.0419 263 TYR A CZ    
2092 O  OH    . TYR A 263 ? 0.4364 0.5116 0.5433 0.0772  0.1222  0.0366  263 TYR A OH    
2093 N  N     . GLY A 264 ? 0.3111 0.3645 0.3588 -0.0779 0.0055  -0.0141 264 GLY A N     
2094 C  CA    . GLY A 264 ? 0.2922 0.3318 0.3990 -0.0431 0.0186  0.0015  264 GLY A CA    
2095 C  C     . GLY A 264 ? 0.2652 0.3568 0.4033 -0.0172 0.0181  -0.0249 264 GLY A C     
2096 O  O     . GLY A 264 ? 0.2553 0.4065 0.3934 -0.0287 0.0125  0.0065  264 GLY A O     
2097 N  N     . ASP A 265 ? 0.2475 0.3440 0.3771 -0.0181 0.0049  -0.0116 265 ASP A N     
2098 C  CA    . ASP A 265 ? 0.2211 0.3296 0.3667 -0.0222 -0.0017 0.0150  265 ASP A CA    
2099 C  C     . ASP A 265 ? 0.1723 0.3067 0.3830 -0.0023 0.0194  0.0043  265 ASP A C     
2100 O  O     . ASP A 265 ? 0.1788 0.3048 0.4056 -0.0305 0.0348  0.0025  265 ASP A O     
2101 C  CB    . ASP A 265 ? 0.1621 0.3503 0.3403 -0.0127 -0.0040 0.0259  265 ASP A CB    
2102 C  CG    . ASP A 265 ? 0.2405 0.3707 0.3641 -0.0335 -0.0619 0.0243  265 ASP A CG    
2103 O  OD1   . ASP A 265 ? 0.2451 0.3959 0.3997 -0.0720 -0.1196 0.0896  265 ASP A OD1   
2104 O  OD2   . ASP A 265 ? 0.2992 0.4263 0.3324 -0.0057 -0.0466 0.0871  265 ASP A OD2   
2105 N  N     . TYR A 266 ? 0.1829 0.3048 0.3625 -0.0086 0.0378  0.0326  266 TYR A N     
2106 C  CA    . TYR A 266 ? 0.1889 0.3234 0.3633 -0.0298 0.0163  0.0233  266 TYR A CA    
2107 C  C     . TYR A 266 ? 0.2135 0.3235 0.3746 -0.0349 0.0349  -0.0239 266 TYR A C     
2108 O  O     . TYR A 266 ? 0.2312 0.2945 0.3954 -0.0759 0.0492  0.0035  266 TYR A O     
2109 C  CB    . TYR A 266 ? 0.1726 0.3278 0.3041 -0.0163 0.0283  0.0113  266 TYR A CB    
2110 C  CG    . TYR A 266 ? 0.1778 0.3779 0.3326 0.0054  0.0379  0.0206  266 TYR A CG    
2111 C  CD1   . TYR A 266 ? 0.1490 0.3346 0.3589 -0.0126 0.0049  0.0143  266 TYR A CD1   
2112 C  CD2   . TYR A 266 ? 0.2530 0.3230 0.3960 0.0402  -0.0057 0.0048  266 TYR A CD2   
2113 C  CE1   . TYR A 266 ? 0.2045 0.3692 0.3431 0.0413  0.0022  0.0065  266 TYR A CE1   
2114 C  CE2   . TYR A 266 ? 0.2269 0.3573 0.4050 0.0213  -0.0041 0.0247  266 TYR A CE2   
2115 C  CZ    . TYR A 266 ? 0.2088 0.3359 0.4305 0.0412  -0.0093 -0.0218 266 TYR A CZ    
2116 O  OH    . TYR A 266 ? 0.2424 0.2893 0.4221 0.0444  -0.0249 -0.0093 266 TYR A OH    
2117 N  N     . MET A 267 ? 0.2680 0.3315 0.3831 -0.0846 0.0336  -0.0429 267 MET A N     
2118 C  CA    . MET A 267 ? 0.2877 0.3590 0.3802 0.0115  0.0805  -0.0264 267 MET A CA    
2119 C  C     . MET A 267 ? 0.2453 0.3394 0.3686 -0.0109 0.0122  -0.0256 267 MET A C     
2120 O  O     . MET A 267 ? 0.2291 0.3564 0.3756 0.0019  0.0332  -0.0083 267 MET A O     
2121 C  CB    . MET A 267 ? 0.3567 0.3902 0.4113 0.0168  0.1036  -0.0725 267 MET A CB    
2122 C  CG    . MET A 267 ? 0.3705 0.3726 0.5346 0.0401  0.1455  -0.0262 267 MET A CG    
2123 S  SD    . MET A 267 ? 0.7670 0.6059 0.5673 -0.1035 0.0809  -0.0400 267 MET A SD    
2124 C  CE    . MET A 267 ? 0.6878 0.6531 0.5412 0.0736  0.1715  0.0257  267 MET A CE    
2125 N  N     . ASP A 268 ? 0.2384 0.3826 0.4124 0.0113  0.0600  -0.0222 268 ASP A N     
2126 C  CA    . ASP A 268 ? 0.2429 0.3852 0.3900 -0.0495 -0.0184 -0.0137 268 ASP A CA    
2127 C  C     . ASP A 268 ? 0.1868 0.3633 0.3890 -0.0118 -0.0161 -0.0115 268 ASP A C     
2128 O  O     . ASP A 268 ? 0.1912 0.3493 0.4064 -0.0188 -0.0301 -0.0091 268 ASP A O     
2129 C  CB    . ASP A 268 ? 0.2274 0.4607 0.3487 -0.0334 -0.0058 -0.0520 268 ASP A CB    
2130 C  CG    . ASP A 268 ? 0.3160 0.4412 0.3946 -0.0398 -0.0740 -0.0713 268 ASP A CG    
2131 O  OD1   . ASP A 268 ? 0.3050 0.4666 0.3642 -0.1026 0.0221  -0.1553 268 ASP A OD1   
2132 O  OD2   . ASP A 268 ? 0.3331 0.4601 0.3032 -0.0417 -0.0506 -0.0685 268 ASP A OD2   
2133 N  N     . TRP A 269 ? 0.1873 0.3396 0.3907 0.0181  -0.0330 -0.0081 269 TRP A N     
2134 C  CA    . TRP A 269 ? 0.2365 0.3238 0.4001 0.0034  -0.0460 -0.0047 269 TRP A CA    
2135 C  C     . TRP A 269 ? 0.2283 0.3321 0.4116 0.0287  0.0144  0.0257  269 TRP A C     
2136 O  O     . TRP A 269 ? 0.3204 0.3072 0.3660 0.0431  -0.0159 0.0068  269 TRP A O     
2137 C  CB    . TRP A 269 ? 0.2384 0.3010 0.3663 0.0229  -0.0083 0.0079  269 TRP A CB    
2138 C  CG    . TRP A 269 ? 0.2030 0.2844 0.3808 0.0253  0.0012  0.0041  269 TRP A CG    
2139 C  CD1   . TRP A 269 ? 0.1627 0.2761 0.3823 -0.0351 0.0187  0.0331  269 TRP A CD1   
2140 C  CD2   . TRP A 269 ? 0.1652 0.2934 0.3667 0.0249  -0.0054 0.0362  269 TRP A CD2   
2141 N  NE1   . TRP A 269 ? 0.1554 0.3431 0.3762 -0.0077 -0.0358 0.0299  269 TRP A NE1   
2142 C  CE2   . TRP A 269 ? 0.1535 0.3426 0.3649 0.0061  -0.0089 0.0205  269 TRP A CE2   
2143 C  CE3   . TRP A 269 ? 0.1767 0.3569 0.3874 0.0003  -0.0025 0.0108  269 TRP A CE3   
2144 C  CZ2   . TRP A 269 ? 0.1491 0.3352 0.4174 -0.0062 -0.0024 -0.0061 269 TRP A CZ2   
2145 C  CZ3   . TRP A 269 ? 0.1078 0.3601 0.3632 0.0213  -0.0146 0.0483  269 TRP A CZ3   
2146 C  CH2   . TRP A 269 ? 0.1461 0.3533 0.3765 0.0312  -0.0335 0.0223  269 TRP A CH2   
2147 N  N     . CYS A 270 ? 0.2779 0.2630 0.4030 0.0273  0.0631  0.0095  270 CYS A N     
2148 C  CA    . CYS A 270 ? 0.1978 0.3318 0.3989 0.0053  0.0296  0.0018  270 CYS A CA    
2149 C  C     . CYS A 270 ? 0.2384 0.3328 0.4252 0.0009  0.0574  -0.0012 270 CYS A C     
2150 O  O     . CYS A 270 ? 0.1715 0.3693 0.4647 0.0289  0.0512  0.0035  270 CYS A O     
2151 C  CB    . CYS A 270 ? 0.2262 0.3333 0.4468 -0.0011 0.0660  0.0359  270 CYS A CB    
2152 S  SG    . CYS A 270 ? 0.2275 0.3737 0.5784 -0.0236 0.0415  -0.0140 270 CYS A SG    
2153 N  N     . LYS A 271 ? 0.2428 0.3183 0.4554 0.0059  0.0486  -0.0022 271 LYS A N     
2154 C  CA    . LYS A 271 ? 0.2643 0.3373 0.4325 -0.0343 0.0528  -0.0399 271 LYS A CA    
2155 C  C     . LYS A 271 ? 0.2207 0.3454 0.4299 -0.0250 0.0370  -0.0387 271 LYS A C     
2156 O  O     . LYS A 271 ? 0.2354 0.3114 0.4271 -0.0205 0.0632  -0.0688 271 LYS A O     
2157 C  CB    . LYS A 271 ? 0.3273 0.3834 0.4344 -0.0306 0.0284  -0.0493 271 LYS A CB    
2158 C  CG    . LYS A 271 ? 0.4092 0.5317 0.4615 -0.0233 0.0626  -0.0649 271 LYS A CG    
2159 C  CD    . LYS A 271 ? 0.4705 0.5595 0.4390 -0.0565 0.0859  -0.1154 271 LYS A CD    
2160 C  CE    . LYS A 271 ? 0.4922 0.6212 0.4729 -0.0254 0.0519  -0.0558 271 LYS A CE    
2161 N  NZ    . LYS A 271 ? 0.5555 0.6229 0.6053 0.1164  0.0138  -0.0416 271 LYS A NZ    
2162 N  N     . ILE A 272 ? 0.2201 0.3246 0.4273 -0.0474 0.0401  -0.0505 272 ILE A N     
2163 C  CA    . ILE A 272 ? 0.1891 0.3363 0.4114 -0.0250 0.0187  -0.0354 272 ILE A CA    
2164 C  C     . ILE A 272 ? 0.2026 0.3205 0.4062 -0.0219 0.0215  -0.0261 272 ILE A C     
2165 O  O     . ILE A 272 ? 0.1451 0.3179 0.4272 -0.0143 0.0273  -0.0175 272 ILE A O     
2166 C  CB    . ILE A 272 ? 0.1870 0.3268 0.3794 -0.0303 -0.0024 -0.0355 272 ILE A CB    
2167 C  CG1   . ILE A 272 ? 0.1655 0.3197 0.3733 -0.0255 0.0073  -0.0233 272 ILE A CG1   
2168 C  CG2   . ILE A 272 ? 0.1557 0.3712 0.3930 -0.0393 0.0093  -0.0433 272 ILE A CG2   
2169 C  CD1   . ILE A 272 ? 0.1250 0.2993 0.3136 -0.0539 0.0008  -0.0278 272 ILE A CD1   
2170 N  N     . ALA A 273 ? 0.1862 0.3333 0.4290 -0.0153 0.0154  -0.0148 273 ALA A N     
2171 C  CA    . ALA A 273 ? 0.2011 0.3371 0.4231 -0.0276 0.0147  0.0029  273 ALA A CA    
2172 C  C     . ALA A 273 ? 0.2380 0.3227 0.4349 -0.0291 0.0399  0.0153  273 ALA A C     
2173 O  O     . ALA A 273 ? 0.3018 0.3461 0.4683 0.0261  -0.0148 0.0197  273 ALA A O     
2174 C  CB    . ALA A 273 ? 0.1962 0.3974 0.4528 -0.0443 0.0468  0.0196  273 ALA A CB    
2175 N  N     . LEU A 274 ? 0.2723 0.3326 0.4568 -0.0038 0.0493  0.0069  274 LEU A N     
2176 C  CA    . LEU A 274 ? 0.3020 0.3292 0.4950 0.0009  0.0430  0.0173  274 LEU A CA    
2177 C  C     . LEU A 274 ? 0.2768 0.3310 0.4801 0.0022  0.0164  0.0238  274 LEU A C     
2178 O  O     . LEU A 274 ? 0.2049 0.3333 0.5045 0.0094  0.0128  0.0259  274 LEU A O     
2179 C  CB    . LEU A 274 ? 0.3176 0.3649 0.5087 0.0055  0.0624  -0.0008 274 LEU A CB    
2180 C  CG    . LEU A 274 ? 0.3529 0.4422 0.5546 0.0470  0.0393  -0.0530 274 LEU A CG    
2181 C  CD1   . LEU A 274 ? 0.2602 0.5786 0.6971 0.0867  0.0555  -0.0077 274 LEU A CD1   
2182 C  CD2   . LEU A 274 ? 0.4021 0.5216 0.5416 -0.0068 0.0607  -0.0585 274 LEU A CD2   
2183 N  N     . ILE A 275 ? 0.2680 0.3646 0.5440 -0.0365 0.0013  0.0108  275 ILE A N     
2184 C  CA    . ILE A 275 ? 0.2752 0.3921 0.4729 -0.0270 -0.0035 0.0250  275 ILE A CA    
2185 C  C     . ILE A 275 ? 0.2323 0.3768 0.4796 -0.0126 -0.0471 0.0113  275 ILE A C     
2186 O  O     . ILE A 275 ? 0.3097 0.3400 0.5010 -0.0602 -0.0553 -0.0096 275 ILE A O     
2187 C  CB    . ILE A 275 ? 0.2923 0.4131 0.4536 -0.0868 -0.0475 0.0028  275 ILE A CB    
2188 C  CG1   . ILE A 275 ? 0.3594 0.4317 0.4440 -0.0844 -0.0097 0.0132  275 ILE A CG1   
2189 C  CG2   . ILE A 275 ? 0.3100 0.4557 0.4528 0.0113  0.0108  0.0313  275 ILE A CG2   
2190 C  CD1   . ILE A 275 ? 0.3976 0.4462 0.4116 -0.0983 -0.0730 -0.0743 275 ILE A CD1   
2191 N  N     . MET A 276 ? 0.2163 0.3633 0.4771 0.0475  -0.0544 0.0091  276 MET A N     
2192 C  CA    . MET A 276 ? 0.2380 0.3537 0.4610 0.0472  -0.0304 0.0412  276 MET A CA    
2193 C  C     . MET A 276 ? 0.2454 0.3639 0.4496 0.0508  -0.0182 0.0768  276 MET A C     
2194 O  O     . MET A 276 ? 0.3100 0.4496 0.4117 0.1308  -0.0516 0.0405  276 MET A O     
2195 C  CB    . MET A 276 ? 0.2108 0.3537 0.4009 0.0176  0.0000  -0.0111 276 MET A CB    
2196 C  CG    . MET A 276 ? 0.2322 0.3370 0.3846 0.0111  -0.0173 0.0250  276 MET A CG    
2197 S  SD    . MET A 276 ? 0.2866 0.3354 0.4331 0.0110  0.0043  0.0309  276 MET A SD    
2198 C  CE    . MET A 276 ? 0.2569 0.3934 0.3956 -0.0496 0.0719  0.0552  276 MET A CE    
2199 N  N     . GLN A 277 ? 0.2479 0.3050 0.5332 0.0561  0.0157  0.0910  277 GLN A N     
2200 C  CA    . GLN A 277 ? 0.2634 0.4149 0.5485 0.0230  -0.0234 0.0829  277 GLN A CA    
2201 C  C     . GLN A 277 ? 0.3635 0.3780 0.5799 0.0444  -0.0256 0.0317  277 GLN A C     
2202 O  O     . GLN A 277 ? 0.4593 0.4155 0.5469 -0.0309 -0.0399 0.0214  277 GLN A O     
2203 C  CB    . GLN A 277 ? 0.2384 0.4736 0.6348 -0.0395 0.0022  0.0558  277 GLN A CB    
2204 C  CG    . GLN A 277 ? 0.3575 0.4285 0.6413 0.0898  -0.0147 0.0399  277 GLN A CG    
2205 C  CD    . GLN A 277 ? 0.4949 0.4758 0.6654 0.0569  0.0403  0.0667  277 GLN A CD    
2206 O  OE1   . GLN A 277 ? 0.6553 0.4630 0.8231 -0.0110 0.0037  0.0920  277 GLN A OE1   
2207 N  NE2   . GLN A 277 ? 0.6342 0.5464 0.7021 0.0870  -0.0985 -0.0100 277 GLN A NE2   
2208 N  N     . ASN A 278 ? 0.3879 0.3837 0.5475 0.0150  0.0021  0.0277  278 ASN A N     
2209 C  CA    . ASN A 278 ? 0.4591 0.3991 0.5251 0.0002  0.0426  0.0535  278 ASN A CA    
2210 C  C     . ASN A 278 ? 0.3768 0.3598 0.6045 -0.0179 0.0221  0.0574  278 ASN A C     
2211 O  O     . ASN A 278 ? 0.4175 0.4178 0.6000 -0.0652 -0.0028 0.1402  278 ASN A O     
2212 C  CB    . ASN A 278 ? 0.4527 0.4629 0.5326 -0.0069 0.0541  0.0180  278 ASN A CB    
2213 C  CG    . ASN A 278 ? 0.4052 0.6851 0.5869 0.1182  0.0727  -0.0929 278 ASN A CG    
2214 O  OD1   . ASN A 278 ? 0.4723 0.8267 0.7164 0.1142  -0.0182 -0.1248 278 ASN A OD1   
2215 N  ND2   . ASN A 278 ? 0.4717 0.6829 0.5917 0.1723  0.0932  -0.1717 278 ASN A ND2   
2216 N  N     . LYS A 279 ? 0.3321 0.3986 0.5244 -0.0265 -0.0009 0.0129  279 LYS A N     
2217 C  CA    . LYS A 279 ? 0.3314 0.3615 0.5067 -0.0524 -0.0021 0.0387  279 LYS A CA    
2218 C  C     . LYS A 279 ? 0.3669 0.3621 0.4739 -0.0816 0.0155  0.0235  279 LYS A C     
2219 O  O     . LYS A 279 ? 0.3929 0.3490 0.4459 -0.0646 0.0277  0.0371  279 LYS A O     
2220 C  CB    . LYS A 279 ? 0.3514 0.3863 0.5655 -0.0233 -0.0414 0.0378  279 LYS A CB    
2221 C  CG    . LYS A 279 ? 0.3439 0.3918 0.6741 -0.0623 -0.0220 0.0484  279 LYS A CG    
2222 C  CD    . LYS A 279 ? 0.3473 0.4291 0.6158 -0.0736 -0.0323 -0.0060 279 LYS A CD    
2223 C  CE    . LYS A 279 ? 0.3681 0.4912 0.6916 -0.1234 -0.0456 0.0144  279 LYS A CE    
2224 N  NZ    . LYS A 279 ? 0.4147 0.5457 0.5770 -0.1815 -0.1258 -0.0363 279 LYS A NZ    
2225 N  N     . ASN A 280 ? 0.3964 0.3627 0.4770 -0.0611 0.0069  0.0061  280 ASN A N     
2226 C  CA    . ASN A 280 ? 0.3565 0.3854 0.4740 -0.0477 0.0119  0.0319  280 ASN A CA    
2227 C  C     . ASN A 280 ? 0.3054 0.3773 0.4233 -0.0827 0.0093  0.0190  280 ASN A C     
2228 O  O     . ASN A 280 ? 0.3420 0.3848 0.4398 -0.1034 -0.0236 -0.0128 280 ASN A O     
2229 C  CB    . ASN A 280 ? 0.4379 0.3317 0.4900 -0.0422 0.0303  0.0300  280 ASN A CB    
2230 C  CG    . ASN A 280 ? 0.4552 0.4012 0.5464 -0.0019 0.0564  0.0619  280 ASN A CG    
2231 O  OD1   . ASN A 280 ? 0.4453 0.5030 0.6168 0.0570  0.0694  0.0414  280 ASN A OD1   
2232 N  ND2   . ASN A 280 ? 0.5470 0.3862 0.5189 -0.0497 0.0579  0.0357  280 ASN A ND2   
2233 N  N     . HIS A 281 ? 0.3097 0.3599 0.4289 -0.0751 0.0075  0.0449  281 HIS A N     
2234 C  CA    . HIS A 281 ? 0.2698 0.3732 0.4070 -0.0903 -0.0085 0.0319  281 HIS A CA    
2235 C  C     . HIS A 281 ? 0.2999 0.3703 0.4216 -0.1026 0.0024  0.0428  281 HIS A C     
2236 O  O     . HIS A 281 ? 0.2933 0.3686 0.4765 -0.1169 -0.0719 0.0456  281 HIS A O     
2237 C  CB    . HIS A 281 ? 0.2511 0.3531 0.3831 -0.0641 -0.0008 0.0501  281 HIS A CB    
2238 C  CG    . HIS A 281 ? 0.2271 0.3936 0.4256 -0.0466 -0.0181 0.0232  281 HIS A CG    
2239 N  ND1   . HIS A 281 ? 0.2978 0.3788 0.4041 -0.0100 -0.0221 0.0668  281 HIS A ND1   
2240 C  CD2   . HIS A 281 ? 0.2041 0.3218 0.4413 -0.0893 -0.0101 0.0439  281 HIS A CD2   
2241 C  CE1   . HIS A 281 ? 0.2877 0.3659 0.4247 -0.0215 -0.0130 0.0388  281 HIS A CE1   
2242 N  NE2   . HIS A 281 ? 0.3029 0.3423 0.4091 -0.0231 -0.0387 0.0432  281 HIS A NE2   
2243 N  N     . LEU A 282 ? 0.2917 0.3727 0.4392 -0.0868 -0.0210 0.0334  282 LEU A N     
2244 C  CA    . LEU A 282 ? 0.2842 0.3868 0.4605 -0.0956 -0.0276 0.0715  282 LEU A CA    
2245 C  C     . LEU A 282 ? 0.3089 0.4041 0.4876 -0.1128 -0.0331 0.0587  282 LEU A C     
2246 O  O     . LEU A 282 ? 0.4357 0.4781 0.5178 -0.2130 0.0098  0.0212  282 LEU A O     
2247 C  CB    . LEU A 282 ? 0.2899 0.4103 0.4734 -0.1162 -0.0397 0.0763  282 LEU A CB    
2248 C  CG    . LEU A 282 ? 0.2713 0.3900 0.4678 -0.1001 -0.0427 0.0887  282 LEU A CG    
2249 C  CD1   . LEU A 282 ? 0.2432 0.3846 0.4358 -0.1190 -0.0253 0.0828  282 LEU A CD1   
2250 C  CD2   . LEU A 282 ? 0.2872 0.4080 0.4505 -0.0735 -0.0878 0.0872  282 LEU A CD2   
2251 N  N     . THR A 283 ? 0.3573 0.4037 0.4837 -0.1147 -0.0261 0.0613  283 THR A N     
2252 C  CA    . THR A 283 ? 0.3757 0.4164 0.4974 -0.1192 -0.0270 0.0433  283 THR A CA    
2253 C  C     . THR A 283 ? 0.3379 0.4339 0.5137 -0.1590 -0.0369 0.0302  283 THR A C     
2254 O  O     . THR A 283 ? 0.4352 0.3718 0.5217 -0.1441 -0.0150 -0.0205 283 THR A O     
2255 C  CB    . THR A 283 ? 0.4136 0.4639 0.4623 -0.1070 -0.0117 0.0257  283 THR A CB    
2256 O  OG1   . THR A 283 ? 0.4581 0.4048 0.4901 -0.0980 -0.0346 0.0781  283 THR A OG1   
2257 C  CG2   . THR A 283 ? 0.4176 0.4638 0.4278 -0.0475 0.0347  0.0430  283 THR A CG2   
2258 N  N     . PRO A 284 ? 0.3490 0.4303 0.5382 -0.1711 -0.0306 0.0503  284 PRO A N     
2259 C  CA    . PRO A 284 ? 0.3527 0.4524 0.5552 -0.1976 -0.0578 0.0597  284 PRO A CA    
2260 C  C     . PRO A 284 ? 0.3224 0.4174 0.5712 -0.2062 -0.0491 0.0515  284 PRO A C     
2261 O  O     . PRO A 284 ? 0.4699 0.4954 0.5590 -0.1616 -0.1091 0.0618  284 PRO A O     
2262 C  CB    . PRO A 284 ? 0.3189 0.4807 0.5584 -0.1865 -0.0450 0.0840  284 PRO A CB    
2263 C  CG    . PRO A 284 ? 0.3672 0.4683 0.5625 -0.1968 -0.0334 0.0944  284 PRO A CG    
2264 C  CD    . PRO A 284 ? 0.3681 0.4575 0.5146 -0.1968 -0.0316 0.0659  284 PRO A CD    
2265 N  N     . GLU A 285 ? 0.3739 0.3753 0.5967 -0.2041 -0.0407 0.0536  285 GLU A N     
2266 C  CA    . GLU A 285 ? 0.4735 0.3929 0.6052 -0.1700 -0.0210 0.0488  285 GLU A CA    
2267 C  C     . GLU A 285 ? 0.4022 0.3657 0.5085 -0.1386 -0.0640 0.0255  285 GLU A C     
2268 O  O     . GLU A 285 ? 0.3948 0.3896 0.4571 -0.0980 -0.1144 -0.0149 285 GLU A O     
2269 C  CB    . GLU A 285 ? 0.4964 0.4481 0.7389 -0.1172 -0.0299 0.0637  285 GLU A CB    
2270 C  CG    . GLU A 285 ? 0.7007 0.4628 0.6746 -0.1672 -0.0163 0.0488  285 GLU A CG    
2271 C  CD    . GLU A 285 ? 0.6385 0.5471 0.6762 -0.1996 -0.0731 0.0877  285 GLU A CD    
2272 O  OE1   . GLU A 285 ? 0.6864 0.5788 0.5849 -0.0578 -0.1555 0.1800  285 GLU A OE1   
2273 O  OE2   . GLU A 285 ? 0.5065 0.5482 0.8769 -0.1395 -0.0152 0.0426  285 GLU A OE2   
2274 N  N     . GLY A 286 ? 0.3876 0.3414 0.4546 -0.0820 -0.0443 0.0018  286 GLY A N     
2275 C  CA    . GLY A 286 ? 0.3237 0.3690 0.4477 -0.0752 -0.0189 -0.0027 286 GLY A CA    
2276 C  C     . GLY A 286 ? 0.2872 0.3788 0.4291 -0.0768 -0.0263 0.0074  286 GLY A C     
2277 O  O     . GLY A 286 ? 0.2525 0.3480 0.3984 -0.0414 -0.0363 -0.0086 286 GLY A O     
2278 N  N     . LEU A 287 ? 0.2221 0.4054 0.4658 -0.0847 -0.0442 0.0162  287 LEU A N     
2279 C  CA    . LEU A 287 ? 0.2126 0.3973 0.4707 -0.0945 -0.0332 0.0031  287 LEU A CA    
2280 C  C     . LEU A 287 ? 0.2554 0.4363 0.4465 -0.0949 -0.0092 0.0076  287 LEU A C     
2281 O  O     . LEU A 287 ? 0.2649 0.4434 0.4190 -0.0681 -0.0201 -0.0082 287 LEU A O     
2282 C  CB    . LEU A 287 ? 0.2928 0.4339 0.4343 -0.0668 -0.0119 0.0055  287 LEU A CB    
2283 C  CG    . LEU A 287 ? 0.2797 0.4668 0.5006 -0.0576 0.0071  -0.0063 287 LEU A CG    
2284 C  CD1   . LEU A 287 ? 0.3089 0.4433 0.4650 -0.0419 0.0195  -0.0182 287 LEU A CD1   
2285 C  CD2   . LEU A 287 ? 0.2714 0.5094 0.5370 -0.0170 0.0235  0.0032  287 LEU A CD2   
2286 N  N     . ASN A 288 ? 0.2784 0.4453 0.4633 -0.1022 -0.0230 -0.0008 288 ASN A N     
2287 C  CA    . ASN A 288 ? 0.3253 0.4238 0.4830 -0.1320 -0.0509 0.0051  288 ASN A CA    
2288 C  C     . ASN A 288 ? 0.3505 0.4029 0.4467 -0.1195 -0.0541 -0.0095 288 ASN A C     
2289 O  O     . ASN A 288 ? 0.3779 0.3866 0.4534 -0.1045 -0.0855 -0.0256 288 ASN A O     
2290 C  CB    . ASN A 288 ? 0.3506 0.4720 0.5039 -0.1688 -0.0790 0.0023  288 ASN A CB    
2291 C  CG    . ASN A 288 ? 0.3634 0.4993 0.5025 -0.1607 -0.0656 0.0306  288 ASN A CG    
2292 O  OD1   . ASN A 288 ? 0.3730 0.5325 0.4909 -0.1252 -0.0840 0.0007  288 ASN A OD1   
2293 N  ND2   . ASN A 288 ? 0.3409 0.5575 0.5080 -0.2293 -0.0823 0.0311  288 ASN A ND2   
2294 N  N     . GLU A 289 ? 0.3496 0.3847 0.4410 -0.1198 -0.0387 -0.0122 289 GLU A N     
2295 C  CA    . GLU A 289 ? 0.3539 0.3810 0.4844 -0.1175 -0.0261 0.0031  289 GLU A CA    
2296 C  C     . GLU A 289 ? 0.3038 0.3721 0.4244 -0.0965 -0.0388 -0.0084 289 GLU A C     
2297 O  O     . GLU A 289 ? 0.3033 0.3697 0.3879 -0.1209 -0.0404 -0.0430 289 GLU A O     
2298 C  CB    . GLU A 289 ? 0.3868 0.3925 0.5294 -0.0653 0.0150  0.0207  289 GLU A CB    
2299 C  CG    . GLU A 289 ? 0.4716 0.4152 0.5854 -0.0386 -0.0093 -0.0301 289 GLU A CG    
2300 C  CD    . GLU A 289 ? 0.4371 0.4197 0.6920 -0.0505 0.0333  -0.0015 289 GLU A CD    
2301 O  OE1   . GLU A 289 ? 0.5156 0.4978 0.7689 0.0928  -0.0941 0.0514  289 GLU A OE1   
2302 O  OE2   . GLU A 289 ? 0.3397 0.5539 0.7727 -0.0325 0.0837  -0.0735 289 GLU A OE2   
2303 N  N     . ILE A 290 ? 0.2745 0.3844 0.3985 -0.0745 -0.0260 0.0143  290 ILE A N     
2304 C  CA    . ILE A 290 ? 0.2633 0.3926 0.3987 -0.0845 -0.0365 0.0088  290 ILE A CA    
2305 C  C     . ILE A 290 ? 0.2248 0.4161 0.4278 -0.0879 -0.0131 0.0040  290 ILE A C     
2306 O  O     . ILE A 290 ? 0.1824 0.4125 0.4811 -0.1079 -0.0353 0.0095  290 ILE A O     
2307 C  CB    . ILE A 290 ? 0.2603 0.3734 0.4189 -0.0592 -0.0546 -0.0119 290 ILE A CB    
2308 C  CG1   . ILE A 290 ? 0.2699 0.3652 0.4326 -0.0413 -0.0474 -0.0136 290 ILE A CG1   
2309 C  CG2   . ILE A 290 ? 0.2417 0.3679 0.3680 -0.0383 -0.0135 0.0016  290 ILE A CG2   
2310 C  CD1   . ILE A 290 ? 0.2208 0.2813 0.4521 -0.0362 -0.0980 0.0020  290 ILE A CD1   
2311 N  N     . ARG A 291 ? 0.2212 0.4320 0.4002 -0.1017 -0.0209 -0.0100 291 ARG A N     
2312 C  CA    . ARG A 291 ? 0.1969 0.4512 0.4485 -0.1186 -0.0083 0.0284  291 ARG A CA    
2313 C  C     . ARG A 291 ? 0.2273 0.4292 0.4545 -0.1307 0.0063  0.0463  291 ARG A C     
2314 O  O     . ARG A 291 ? 0.2528 0.4233 0.4922 -0.0736 0.0010  0.0308  291 ARG A O     
2315 C  CB    . ARG A 291 ? 0.2100 0.3951 0.5108 -0.1486 -0.0361 0.0320  291 ARG A CB    
2316 C  CG    . ARG A 291 ? 0.2165 0.4783 0.5089 -0.1376 -0.0455 0.0452  291 ARG A CG    
2317 C  CD    . ARG A 291 ? 0.2712 0.5571 0.6551 -0.2610 0.0017  0.0422  291 ARG A CD    
2318 N  NE    . ARG A 291 ? 0.2909 0.6232 0.6787 -0.1691 -0.0376 0.1170  291 ARG A NE    
2319 C  CZ    . ARG A 291 ? 0.3916 0.5819 0.5744 -0.1608 -0.1540 0.1194  291 ARG A CZ    
2320 N  NH1   . ARG A 291 ? 0.3240 0.4641 0.7178 -0.1798 -0.1954 0.1105  291 ARG A NH1   
2321 N  NH2   . ARG A 291 ? 0.5445 0.5411 0.7010 -0.0314 -0.2694 0.1336  291 ARG A NH2   
2322 N  N     . ALA A 292 ? 0.2547 0.4267 0.4581 -0.1404 0.0012  0.0331  292 ALA A N     
2323 C  CA    . ALA A 292 ? 0.3242 0.4462 0.4581 -0.1368 -0.0259 0.0230  292 ALA A CA    
2324 C  C     . ALA A 292 ? 0.2818 0.4637 0.4236 -0.1274 -0.0527 0.0223  292 ALA A C     
2325 O  O     . ALA A 292 ? 0.2581 0.5013 0.5102 -0.0972 -0.1265 0.0650  292 ALA A O     
2326 C  CB    . ALA A 292 ? 0.3457 0.4517 0.3773 -0.1717 -0.0569 0.0198  292 ALA A CB    
2327 N  N     . LEU A 293 ? 0.2841 0.4379 0.4003 -0.0845 -0.0551 0.0157  293 LEU A N     
2328 C  CA    . LEU A 293 ? 0.2847 0.4202 0.3962 -0.0637 -0.0532 0.0415  293 LEU A CA    
2329 C  C     . LEU A 293 ? 0.2503 0.4426 0.4024 -0.0509 -0.0579 0.0200  293 LEU A C     
2330 O  O     . LEU A 293 ? 0.2709 0.4184 0.4654 -0.0266 -0.1035 0.0697  293 LEU A O     
2331 C  CB    . LEU A 293 ? 0.2030 0.4303 0.3831 -0.0811 0.0065  0.0095  293 LEU A CB    
2332 C  CG    . LEU A 293 ? 0.2918 0.4350 0.3957 -0.0509 0.0005  0.0075  293 LEU A CG    
2333 C  CD1   . LEU A 293 ? 0.2314 0.4858 0.4268 -0.0044 0.0184  -0.0006 293 LEU A CD1   
2334 C  CD2   . LEU A 293 ? 0.2427 0.4022 0.4214 -0.0970 0.0021  -0.0101 293 LEU A CD2   
2335 N  N     . LYS A 294 ? 0.1700 0.5093 0.4531 -0.0128 -0.0222 0.0348  294 LYS A N     
2336 C  CA    . LYS A 294 ? 0.3132 0.4634 0.4629 -0.0335 -0.0278 0.0771  294 LYS A CA    
2337 C  C     . LYS A 294 ? 0.2114 0.4564 0.5041 -0.0649 -0.0512 0.0269  294 LYS A C     
2338 O  O     . LYS A 294 ? 0.2285 0.4556 0.5572 -0.0292 -0.0295 0.0316  294 LYS A O     
2339 C  CB    . LYS A 294 ? 0.3546 0.5274 0.4708 0.0017  -0.0051 0.0537  294 LYS A CB    
2340 C  CG    . LYS A 294 ? 0.4048 0.5996 0.4462 -0.0503 -0.0151 0.0995  294 LYS A CG    
2341 C  CD    . LYS A 294 ? 0.3064 0.5116 0.5630 -0.0487 0.0216  0.2417  294 LYS A CD    
2342 C  CE    . LYS A 294 ? 0.2524 0.4773 0.5657 -0.1102 -0.0610 0.2174  294 LYS A CE    
2343 N  NZ    . LYS A 294 ? 0.5113 0.4805 0.7310 -0.1165 -0.1430 0.1273  294 LYS A NZ    
2344 N  N     . GLY A 295 ? 0.2322 0.4152 0.5492 -0.0743 -0.0404 0.0373  295 GLY A N     
2345 C  CA    . GLY A 295 ? 0.2983 0.4684 0.5362 -0.0613 -0.0568 0.0467  295 GLY A CA    
2346 C  C     . GLY A 295 ? 0.3327 0.4706 0.5560 -0.0557 -0.0380 0.0498  295 GLY A C     
2347 O  O     . GLY A 295 ? 0.4625 0.4731 0.6329 0.0140  -0.0137 0.0498  295 GLY A O     
2348 N  N     . GLY A 296 ? 0.3006 0.5155 0.5574 -0.1191 -0.0208 -0.0400 296 GLY A N     
2349 C  CA    . GLY A 296 ? 0.2703 0.5784 0.5383 -0.0906 -0.0663 0.0180  296 GLY A CA    
2350 C  C     . GLY A 296 ? 0.4330 0.5205 0.4484 -0.1388 -0.0252 -0.0068 296 GLY A C     
2351 O  O     . GLY A 296 ? 0.4861 0.6137 0.4314 -0.2148 -0.0107 -0.0456 296 GLY A O     
2352 N  N     . MET A 297 ? 0.3576 0.5391 0.4859 -0.1291 -0.0840 -0.0161 297 MET A N     
2353 C  CA    . MET A 297 ? 0.3161 0.4684 0.5072 -0.0682 -0.0634 0.0084  297 MET A CA    
2354 C  C     . MET A 297 ? 0.2191 0.5223 0.5095 -0.0517 -0.0386 -0.0483 297 MET A C     
2355 O  O     . MET A 297 ? 0.2315 0.5736 0.4627 -0.0528 0.0281  -0.0257 297 MET A O     
2356 C  CB    . MET A 297 ? 0.3586 0.5316 0.4270 -0.0242 -0.0416 0.0088  297 MET A CB    
2357 C  CG    . MET A 297 ? 0.4580 0.5794 0.4227 -0.0330 0.0003  0.0930  297 MET A CG    
2358 S  SD    . MET A 297 ? 0.3544 0.5475 0.5900 -0.0693 -0.0380 0.0911  297 MET A SD    
2359 C  CE    . MET A 297 ? 0.3936 0.4937 0.2951 -0.0183 -0.0914 0.0111  297 MET A CE    
2360 N  N     . ASN A 298 ? 0.3834 0.4619 0.5562 -0.0476 -0.0132 -0.0018 298 ASN A N     
2361 C  CA    . ASN A 298 ? 0.3159 0.5183 0.5004 0.0290  -0.0526 0.0058  298 ASN A CA    
2362 C  C     . ASN A 298 ? 0.2654 0.6329 0.5638 -0.0008 -0.0403 -0.0070 298 ASN A C     
2363 O  O     . ASN A 298 ? 0.3091 0.6612 0.5905 -0.0665 0.0428  -0.0281 298 ASN A O     
2364 C  CB    . ASN A 298 ? 0.2937 0.6157 0.4539 0.0409  -0.0433 0.0521  298 ASN A CB    
2365 C  CG    . ASN A 298 ? 0.2057 0.7427 0.4194 -0.0337 0.0442  0.0227  298 ASN A CG    
2366 O  OD1   . ASN A 298 ? 0.1865 0.4692 0.5621 0.0285  0.0773  0.0255  298 ASN A OD1   
2367 N  ND2   . ASN A 298 ? 0.3571 0.5934 0.4123 -0.0660 0.0348  -0.0195 298 ASN A ND2   
2368 N  N     . LYS A 299 ? 0.2278 0.5600 0.7085 0.0382  -0.0666 0.0003  299 LYS A N     
2369 C  CA    . LYS A 299 ? 0.3304 0.6344 0.5058 -0.0200 -0.1563 -0.1162 299 LYS A CA    
2370 C  C     . LYS A 299 ? 0.2862 0.5278 0.5939 -0.0784 -0.1315 0.0192  299 LYS A C     
2371 O  O     . LYS A 299 ? 0.5059 0.7443 0.5298 0.0275  -0.1818 0.0963  299 LYS A O     
2372 C  CB    . LYS A 299 ? 0.4403 0.6412 0.6414 0.1049  -0.0785 -0.0390 299 LYS A CB    
2373 C  CG    . LYS A 299 ? 0.6106 0.6500 0.6268 0.0611  0.0909  -0.0428 299 LYS A CG    
2374 C  CD    . LYS A 299 ? 0.5087 1.0785 0.5422 -0.1379 0.1269  0.0368  299 LYS A CD    
2375 C  CE    . LYS A 299 ? 0.0914 1.2951 1.1612 -0.0769 0.0808  0.1126  299 LYS A CE    
2376 N  NZ    . LYS A 299 ? 0.3074 1.0376 0.9213 0.0325  -0.1114 0.0744  299 LYS A NZ    
2377 N  N     . GLY A 300 ? 0.4331 0.5548 0.4523 -0.0653 -0.1051 0.0430  300 GLY A N     
2378 C  CA    . GLY A 300 ? 0.4615 0.5531 0.5146 -0.0567 -0.0308 -0.0105 300 GLY A CA    
2379 C  C     . GLY A 300 ? 0.3957 0.6374 0.4793 -0.0868 -0.0647 -0.0269 300 GLY A C     
2380 O  O     . GLY A 300 ? 0.2363 0.6507 0.4762 -0.0547 -0.1446 0.0075  300 GLY A O     
2381 N  N     . ARG A 301 ? 0.3540 0.6738 0.4627 -0.0295 -0.0045 -0.0101 301 ARG A N     
2382 C  CA    . ARG A 301 ? 0.2733 0.7844 0.4736 -0.0458 0.0035  0.0307  301 ARG A CA    
2383 C  C     . ARG A 301 ? 0.3365 0.6139 0.5000 -0.0252 -0.0506 0.0177  301 ARG A C     
2384 O  O     . ARG A 301 ? 0.4705 0.5640 0.5533 -0.0393 -0.0265 -0.0148 301 ARG A O     
2385 C  CB    . ARG A 301 ? 0.3209 0.6813 0.5410 -0.1124 0.0184  0.0434  301 ARG A CB    
2386 C  CG    . ARG A 301 ? 0.3290 0.7301 0.5265 -0.0656 0.0067  0.0380  301 ARG A CG    
2387 C  CD    . ARG A 301 ? 0.3130 0.6136 0.4495 0.0155  -0.0143 -0.0003 301 ARG A CD    
2388 N  NE    . ARG A 301 ? 0.4057 0.5126 0.4292 0.0600  0.0114  -0.0142 301 ARG A NE    
2389 C  CZ    . ARG A 301 ? 0.3895 0.4862 0.4221 0.0332  -0.0627 -0.0295 301 ARG A CZ    
2390 N  NH1   . ARG A 301 ? 0.4410 0.4325 0.4891 0.0509  -0.0072 -0.0213 301 ARG A NH1   
2391 N  NH2   . ARG A 301 ? 0.3703 0.5090 0.4404 0.0032  -0.0503 0.0345  301 ARG A NH2   
2392 N  N     . LEU A 302 ? 0.4686 0.7037 0.5984 -0.0283 -0.1174 -0.0337 302 LEU A N     
2393 C  CA    . LEU A 302 ? 0.5700 0.6887 0.5389 -0.0789 -0.0593 -0.0651 302 LEU A CA    
2394 C  C     . LEU A 302 ? 0.5395 0.6776 0.5936 -0.0888 -0.0953 0.0010  302 LEU A C     
2395 O  O     . LEU A 302 ? 0.4910 0.6881 0.6952 -0.0040 -0.2573 -0.0277 302 LEU A O     
2396 C  CB    . LEU A 302 ? 0.5616 0.6009 0.7056 -0.0777 -0.0783 -0.0125 302 LEU A CB    
2397 C  CG    . LEU A 302 ? 0.6574 0.5987 0.6805 -0.0571 -0.1425 0.0699  302 LEU A CG    
2398 C  CD1   . LEU A 302 ? 0.7701 0.6010 0.7324 0.0398  -0.0964 0.0432  302 LEU A CD1   
2399 C  CD2   . LEU A 302 ? 0.7703 0.5733 0.6715 -0.1153 -0.0716 0.1589  302 LEU A CD2   
2400 O  OXT   . LEU A 302 ? 0.4842 0.8108 0.7143 -0.1460 -0.0891 -0.0184 302 LEU A OXT   
2401 O  "O5'" . DC  B 1   ? 0.5083 0.5059 0.4730 -0.2926 -0.0169 0.0035  1   DC  B "O5'" 
2402 C  "C5'" . DC  B 1   ? 0.5341 0.4930 0.3129 -0.3139 0.0371  0.0629  1   DC  B "C5'" 
2403 C  "C4'" . DC  B 1   ? 0.5092 0.4684 0.3389 -0.2287 0.0328  0.0438  1   DC  B "C4'" 
2404 O  "O4'" . DC  B 1   ? 0.5088 0.4898 0.3759 -0.2236 0.0003  0.0448  1   DC  B "O4'" 
2405 C  "C3'" . DC  B 1   ? 0.5230 0.4531 0.3676 -0.2327 0.0281  0.0695  1   DC  B "C3'" 
2406 O  "O3'" . DC  B 1   ? 0.5045 0.3715 0.3753 -0.2242 -0.0027 0.0767  1   DC  B "O3'" 
2407 C  "C2'" . DC  B 1   ? 0.4762 0.4549 0.3428 -0.1978 0.0223  0.0527  1   DC  B "C2'" 
2408 C  "C1'" . DC  B 1   ? 0.5027 0.5047 0.3232 -0.1787 0.0228  0.0756  1   DC  B "C1'" 
2409 N  N1    . DC  B 1   ? 0.4827 0.4631 0.3219 -0.1912 0.0000  0.0992  1   DC  B N1    
2410 C  C2    . DC  B 1   ? 0.4998 0.4766 0.3878 -0.2012 -0.0056 0.0878  1   DC  B C2    
2411 O  O2    . DC  B 1   ? 0.5640 0.4662 0.3488 -0.2127 0.0380  0.1016  1   DC  B O2    
2412 N  N3    . DC  B 1   ? 0.4886 0.4748 0.3308 -0.2294 0.0283  0.1207  1   DC  B N3    
2413 C  C4    . DC  B 1   ? 0.4969 0.4937 0.3010 -0.1584 -0.0063 0.0933  1   DC  B C4    
2414 N  N4    . DC  B 1   ? 0.5851 0.4295 0.3428 -0.1745 -0.0885 0.0787  1   DC  B N4    
2415 C  C5    . DC  B 1   ? 0.4857 0.5038 0.3227 -0.1901 0.0177  0.1230  1   DC  B C5    
2416 C  C6    . DC  B 1   ? 0.4838 0.5019 0.3359 -0.2141 0.0201  0.1120  1   DC  B C6    
2417 P  P     . DG  B 2   ? 0.5234 0.4530 0.3683 -0.1724 0.0142  0.0220  2   DG  B P     
2418 O  OP1   . DG  B 2   ? 0.5835 0.3940 0.3902 -0.1314 -0.0124 0.0646  2   DG  B OP1   
2419 O  OP2   . DG  B 2   ? 0.5362 0.5090 0.2709 -0.2083 -0.0201 0.0425  2   DG  B OP2   
2420 O  "O5'" . DG  B 2   ? 0.4729 0.4368 0.2598 -0.1599 -0.0547 0.0286  2   DG  B "O5'" 
2421 C  "C5'" . DG  B 2   ? 0.4442 0.4221 0.3386 -0.1401 -0.0168 0.0069  2   DG  B "C5'" 
2422 C  "C4'" . DG  B 2   ? 0.3956 0.4091 0.3434 -0.1307 -0.0241 0.0456  2   DG  B "C4'" 
2423 O  "O4'" . DG  B 2   ? 0.4013 0.4288 0.3397 -0.1015 -0.0351 0.0607  2   DG  B "O4'" 
2424 C  "C3'" . DG  B 2   ? 0.3791 0.4252 0.3418 -0.1021 -0.0152 0.0386  2   DG  B "C3'" 
2425 O  "O3'" . DG  B 2   ? 0.3661 0.4233 0.4906 -0.0641 0.0181  0.0479  2   DG  B "O3'" 
2426 C  "C2'" . DG  B 2   ? 0.3622 0.4208 0.3167 -0.1206 0.0142  0.0568  2   DG  B "C2'" 
2427 C  "C1'" . DG  B 2   ? 0.3338 0.4252 0.3249 -0.1306 -0.0010 0.0628  2   DG  B "C1'" 
2428 N  N9    . DG  B 2   ? 0.3753 0.4532 0.2538 -0.1424 -0.0032 0.0655  2   DG  B N9    
2429 C  C8    . DG  B 2   ? 0.3655 0.4473 0.2432 -0.1372 -0.0140 0.0916  2   DG  B C8    
2430 N  N7    . DG  B 2   ? 0.3289 0.4132 0.3180 -0.1171 0.0013  0.0904  2   DG  B N7    
2431 C  C5    . DG  B 2   ? 0.3828 0.4146 0.2978 -0.1054 -0.0097 0.0533  2   DG  B C5    
2432 C  C6    . DG  B 2   ? 0.4029 0.4430 0.2444 -0.0955 0.0149  0.0647  2   DG  B C6    
2433 O  O6    . DG  B 2   ? 0.3827 0.4528 0.3091 -0.0730 0.0085  0.0458  2   DG  B O6    
2434 N  N1    . DG  B 2   ? 0.4122 0.4632 0.2269 -0.0989 -0.0055 0.0693  2   DG  B N1    
2435 C  C2    . DG  B 2   ? 0.4245 0.4628 0.3020 -0.0944 -0.0015 0.0212  2   DG  B C2    
2436 N  N2    . DG  B 2   ? 0.4840 0.4054 0.3205 -0.1274 -0.0235 0.0115  2   DG  B N2    
2437 N  N3    . DG  B 2   ? 0.4281 0.4661 0.2832 -0.1357 -0.0527 0.0218  2   DG  B N3    
2438 C  C4    . DG  B 2   ? 0.3908 0.4143 0.2995 -0.1333 0.0115  0.0598  2   DG  B C4    
2439 P  P     . DT  B 3   ? 0.3884 0.4480 0.4005 -0.1013 0.0094  -0.0088 3   DT  B P     
2440 O  OP1   . DT  B 3   ? 0.3761 0.3603 0.3322 -0.0928 -0.0222 0.0167  3   DT  B OP1   
2441 O  OP2   . DT  B 3   ? 0.3721 0.4587 0.3593 -0.1564 -0.0157 0.0082  3   DT  B OP2   
2442 O  "O5'" . DT  B 3   ? 0.4163 0.4484 0.3188 -0.1374 0.0044  0.0290  3   DT  B "O5'" 
2443 C  "C5'" . DT  B 3   ? 0.4098 0.4158 0.4083 -0.0674 -0.0250 0.0619  3   DT  B "C5'" 
2444 C  "C4'" . DT  B 3   ? 0.3489 0.4161 0.3571 -0.0356 -0.0056 0.0501  3   DT  B "C4'" 
2445 O  "O4'" . DT  B 3   ? 0.3455 0.4002 0.3404 -0.0606 0.0204  0.0781  3   DT  B "O4'" 
2446 C  "C3'" . DT  B 3   ? 0.3039 0.4040 0.3660 -0.0609 0.0326  0.0479  3   DT  B "C3'" 
2447 O  "O3'" . DT  B 3   ? 0.3083 0.4212 0.3569 -0.0327 -0.0486 0.0424  3   DT  B "O3'" 
2448 C  "C2'" . DT  B 3   ? 0.2879 0.3909 0.3383 -0.0543 -0.0179 0.0408  3   DT  B "C2'" 
2449 C  "C1'" . DT  B 3   ? 0.3165 0.4031 0.3520 -0.0654 0.0127  0.1003  3   DT  B "C1'" 
2450 N  N1    . DT  B 3   ? 0.3191 0.3921 0.3538 -0.0961 0.0077  0.0911  3   DT  B N1    
2451 C  C2    . DT  B 3   ? 0.3190 0.4349 0.3230 -0.0960 -0.0196 0.0732  3   DT  B C2    
2452 O  O2    . DT  B 3   ? 0.3218 0.4432 0.3280 -0.1261 -0.0244 0.0952  3   DT  B O2    
2453 N  N3    . DT  B 3   ? 0.3499 0.4306 0.3052 -0.1104 0.0186  0.0995  3   DT  B N3    
2454 C  C4    . DT  B 3   ? 0.3230 0.4289 0.3237 -0.0691 0.0108  0.0804  3   DT  B C4    
2455 O  O4    . DT  B 3   ? 0.3907 0.4731 0.2947 -0.0857 0.0916  0.0583  3   DT  B O4    
2456 C  C5    . DT  B 3   ? 0.3306 0.4217 0.2785 -0.0800 0.0083  0.1093  3   DT  B C5    
2457 C  C7    . DT  B 3   ? 0.3527 0.4663 0.2660 -0.1183 -0.0014 0.1207  3   DT  B C7    
2458 C  C6    . DT  B 3   ? 0.3241 0.4450 0.3358 -0.1051 -0.0066 0.1004  3   DT  B C6    
2459 P  P     . DA  B 4   ? 0.3757 0.4241 0.4026 -0.0405 0.0044  0.0380  4   DA  B P     
2460 O  OP1   . DA  B 4   ? 0.3182 0.4745 0.4215 -0.0422 -0.0179 0.0226  4   DA  B OP1   
2461 O  OP2   . DA  B 4   ? 0.3728 0.3430 0.3723 -0.0213 0.0557  -0.0213 4   DA  B OP2   
2462 O  "O5'" . DA  B 4   ? 0.3834 0.4492 0.3817 -0.0840 0.0132  -0.0145 4   DA  B "O5'" 
2463 C  "C5'" . DA  B 4   ? 0.4470 0.4377 0.3757 -0.0693 -0.0354 0.0486  4   DA  B "C5'" 
2464 C  "C4'" . DA  B 4   ? 0.3768 0.4337 0.3897 -0.1144 0.0029  0.0269  4   DA  B "C4'" 
2465 O  "O4'" . DA  B 4   ? 0.3586 0.4505 0.3639 -0.0930 -0.0216 0.0326  4   DA  B "O4'" 
2466 C  "C3'" . DA  B 4   ? 0.3258 0.4109 0.4075 -0.1196 0.0090  0.0264  4   DA  B "C3'" 
2467 O  "O3'" . DA  B 4   ? 0.3849 0.4554 0.3778 -0.1254 0.0175  -0.0204 4   DA  B "O3'" 
2468 C  "C2'" . DA  B 4   ? 0.3358 0.4024 0.3190 -0.0779 0.0000  0.0089  4   DA  B "C2'" 
2469 C  "C1'" . DA  B 4   ? 0.3131 0.3983 0.3750 -0.0841 0.0246  0.0237  4   DA  B "C1'" 
2470 N  N9    . DA  B 4   ? 0.3050 0.3893 0.3306 -0.0559 -0.0207 0.0219  4   DA  B N9    
2471 C  C8    . DA  B 4   ? 0.2738 0.4222 0.3436 -0.0264 0.0142  -0.0148 4   DA  B C8    
2472 N  N7    . DA  B 4   ? 0.3016 0.4710 0.3468 -0.0788 -0.0080 0.0009  4   DA  B N7    
2473 C  C5    . DA  B 4   ? 0.2857 0.3962 0.3238 -0.0500 -0.0106 0.0368  4   DA  B C5    
2474 C  C6    . DA  B 4   ? 0.2736 0.4275 0.3490 -0.0283 -0.0069 0.0182  4   DA  B C6    
2475 N  N6    . DA  B 4   ? 0.2877 0.4082 0.4033 -0.0283 -0.0132 0.0195  4   DA  B N6    
2476 N  N1    . DA  B 4   ? 0.2709 0.4359 0.3501 -0.0355 -0.0133 0.0046  4   DA  B N1    
2477 C  C2    . DA  B 4   ? 0.3361 0.3488 0.2943 -0.0253 -0.0128 -0.0020 4   DA  B C2    
2478 N  N3    . DA  B 4   ? 0.3134 0.3753 0.2999 -0.0346 -0.0548 -0.0037 4   DA  B N3    
2479 C  C4    . DA  B 4   ? 0.3136 0.3845 0.2968 -0.0246 -0.0243 0.0108  4   DA  B C4    
2480 P  P     . DC  B 5   ? 0.3652 0.4670 0.4454 -0.1519 -0.0847 0.1021  5   DC  B P     
2481 O  OP1   . DC  B 5   ? 0.4654 0.5654 0.3955 -0.0950 -0.0945 0.1554  5   DC  B OP1   
2482 O  OP2   . DC  B 5   ? 0.3450 0.4384 0.4480 -0.0735 0.0293  0.0495  5   DC  B OP2   
2483 O  "O5'" . DC  B 5   ? 0.4916 0.5032 0.4858 -0.1562 -0.0225 0.0027  5   DC  B "O5'" 
2484 C  "C5'" . DC  B 5   ? 0.4623 0.5560 0.4813 -0.1667 -0.0799 -0.0206 5   DC  B "C5'" 
2485 C  "C4'" . DC  B 5   ? 0.4867 0.4566 0.5745 -0.1157 -0.1418 0.0040  5   DC  B "C4'" 
2486 O  "O4'" . DC  B 5   ? 0.4309 0.4186 0.4911 -0.0533 -0.1365 0.0075  5   DC  B "O4'" 
2487 C  "C3'" . DC  B 5   ? 0.4717 0.4847 0.4893 -0.1312 -0.1164 0.0357  5   DC  B "C3'" 
2488 O  "O3'" . DC  B 5   ? 0.5456 0.5153 0.5735 -0.1282 -0.1343 -0.0032 5   DC  B "O3'" 
2489 C  "C2'" . DC  B 5   ? 0.4615 0.4405 0.4101 -0.0703 -0.1079 -0.0276 5   DC  B "C2'" 
2490 C  "C1'" . DC  B 5   ? 0.4279 0.4491 0.3836 -0.0522 -0.0987 0.0018  5   DC  B "C1'" 
2491 N  N1    . DC  B 5   ? 0.3696 0.4422 0.4060 -0.0318 -0.0411 -0.0358 5   DC  B N1    
2492 C  C2    . DC  B 5   ? 0.4447 0.4290 0.3621 -0.0574 -0.0053 -0.0044 5   DC  B C2    
2493 O  O2    . DC  B 5   ? 0.5726 0.5340 0.3496 -0.0096 0.0152  -0.0016 5   DC  B O2    
2494 N  N3    . DC  B 5   ? 0.3516 0.4717 0.3666 -0.0085 -0.0355 -0.0037 5   DC  B N3    
2495 C  C4    . DC  B 5   ? 0.3038 0.4133 0.3515 -0.0338 -0.0514 0.0058  5   DC  B C4    
2496 N  N4    . DC  B 5   ? 0.2820 0.5249 0.3913 -0.0902 -0.0396 -0.0047 5   DC  B N4    
2497 C  C5    . DC  B 5   ? 0.3135 0.4319 0.3341 -0.0259 -0.0451 -0.0012 5   DC  B C5    
2498 C  C6    . DC  B 5   ? 0.4215 0.4541 0.3931 -0.0498 -0.0626 -0.0477 5   DC  B C6    
2499 P  P     . DA  B 6   ? 0.5841 0.5484 0.6095 -0.0871 -0.0878 -0.0072 6   DA  B P     
2500 O  OP1   . DA  B 6   ? 0.7417 0.5491 0.5444 -0.0435 -0.0548 -0.0423 6   DA  B OP1   
2501 O  OP2   . DA  B 6   ? 0.5025 0.5843 0.6064 -0.0659 -0.0504 -0.0017 6   DA  B OP2   
2502 O  "O5'" . DA  B 6   ? 0.5884 0.6252 0.5319 -0.0229 -0.0465 0.0140  6   DA  B "O5'" 
2503 C  "C5'" . DA  B 6   ? 0.6799 0.5053 0.4931 -0.0329 -0.0594 -0.0560 6   DA  B "C5'" 
2504 C  "C4'" . DA  B 6   ? 0.6757 0.4319 0.4567 -0.0244 -0.0282 -0.0450 6   DA  B "C4'" 
2505 O  "O4'" . DA  B 6   ? 0.6381 0.3989 0.4227 -0.0257 -0.0085 -0.0136 6   DA  B "O4'" 
2506 C  "C3'" . DA  B 6   ? 0.7256 0.4085 0.4760 -0.0147 -0.0177 -0.0516 6   DA  B "C3'" 
2507 O  "O3'" . DA  B 6   ? 0.7819 0.4133 0.4941 0.0150  0.0181  -0.0269 6   DA  B "O3'" 
2508 C  "C2'" . DA  B 6   ? 0.6513 0.4098 0.4606 -0.0052 -0.0037 -0.0318 6   DA  B "C2'" 
2509 C  "C1'" . DA  B 6   ? 0.6356 0.4180 0.4299 -0.0145 -0.0115 -0.0326 6   DA  B "C1'" 
2510 N  N9    . DA  B 6   ? 0.5433 0.4307 0.4120 -0.0045 0.0105  -0.0200 6   DA  B N9    
2511 C  C8    . DA  B 6   ? 0.4847 0.4362 0.4310 0.0080  -0.0076 -0.0135 6   DA  B C8    
2512 N  N7    . DA  B 6   ? 0.3881 0.4520 0.3914 -0.0052 0.0207  -0.0086 6   DA  B N7    
2513 C  C5    . DA  B 6   ? 0.3886 0.4349 0.4064 -0.0097 0.0245  -0.0140 6   DA  B C5    
2514 C  C6    . DA  B 6   ? 0.3122 0.4615 0.3794 -0.0122 0.0615  -0.0138 6   DA  B C6    
2515 N  N6    . DA  B 6   ? 0.2081 0.5450 0.3316 -0.0414 0.0763  0.0031  6   DA  B N6    
2516 N  N1    . DA  B 6   ? 0.2842 0.4691 0.3707 0.0235  0.0483  0.0268  6   DA  B N1    
2517 C  C2    . DA  B 6   ? 0.3705 0.4153 0.3955 0.0662  0.0390  0.0217  6   DA  B C2    
2518 N  N3    . DA  B 6   ? 0.4146 0.4585 0.3398 0.0552  0.0183  0.0202  6   DA  B N3    
2519 C  C4    . DA  B 6   ? 0.4230 0.4487 0.3664 0.0170  0.0115  0.0185  6   DA  B C4    
2520 P  P     . DC  B 7   ? 0.7926 0.4326 0.5266 0.0624  0.0338  -0.0558 7   DC  B P     
2521 O  OP1   . DC  B 7   ? 0.8651 0.4905 0.5445 0.0704  0.0786  -0.0467 7   DC  B OP1   
2522 O  OP2   . DC  B 7   ? 0.7989 0.4489 0.5458 0.0323  -0.0066 -0.0261 7   DC  B OP2   
2523 O  "O5'" . DC  B 7   ? 0.7190 0.4815 0.5601 0.0578  0.0627  -0.0527 7   DC  B "O5'" 
2524 C  "C5'" . DC  B 7   ? 0.7533 0.5363 0.5495 0.0542  0.1141  -0.0620 7   DC  B "C5'" 
2525 C  "C4'" . DC  B 7   ? 0.7031 0.5217 0.5197 0.1088  0.1169  -0.0429 7   DC  B "C4'" 
2526 O  "O4'" . DC  B 7   ? 0.5980 0.4612 0.4437 0.0578  0.0860  -0.0190 7   DC  B "O4'" 
2527 C  "C3'" . DC  B 7   ? 0.6913 0.5640 0.5437 0.1346  0.1169  -0.0268 7   DC  B "C3'" 
2528 O  "O3'" . DC  B 7   ? 0.7376 0.6507 0.6288 0.1752  0.2032  -0.0610 7   DC  B "O3'" 
2529 C  "C2'" . DC  B 7   ? 0.5863 0.5345 0.5181 0.1119  0.1078  0.0034  7   DC  B "C2'" 
2530 C  "C1'" . DC  B 7   ? 0.5447 0.5182 0.4546 0.0829  0.0980  -0.0021 7   DC  B "C1'" 
2531 N  N1    . DC  B 7   ? 0.4447 0.4482 0.4463 0.0646  0.0578  0.0007  7   DC  B N1    
2532 C  C2    . DC  B 7   ? 0.3659 0.4136 0.4347 0.0639  0.0807  0.0343  7   DC  B C2    
2533 O  O2    . DC  B 7   ? 0.3673 0.4455 0.4589 0.0564  0.0769  0.0787  7   DC  B O2    
2534 N  N3    . DC  B 7   ? 0.3174 0.3661 0.3978 0.0510  0.0524  0.0450  7   DC  B N3    
2535 C  C4    . DC  B 7   ? 0.3396 0.3746 0.4169 0.0249  0.0383  0.0404  7   DC  B C4    
2536 N  N4    . DC  B 7   ? 0.3081 0.4462 0.4634 0.0048  0.0669  0.0240  7   DC  B N4    
2537 C  C5    . DC  B 7   ? 0.3990 0.3667 0.4261 0.0387  0.0412  0.0257  7   DC  B C5    
2538 C  C6    . DC  B 7   ? 0.4691 0.3947 0.4103 0.0433  0.0462  0.0006  7   DC  B C6    
2539 P  P     . DC  B 8   ? 0.7796 0.7860 0.7256 0.1645  0.1299  -0.0493 8   DC  B P     
2540 O  OP1   . DC  B 8   ? 0.7794 0.8293 0.7789 0.2797  0.0875  -0.1186 8   DC  B OP1   
2541 O  OP2   . DC  B 8   ? 0.8974 0.6627 0.7666 0.1776  0.0654  -0.0039 8   DC  B OP2   
2542 O  "O5'" . DC  B 8   ? 0.6015 0.6815 0.7325 0.1769  0.1801  -0.0264 8   DC  B "O5'" 
2543 C  "C5'" . DC  B 8   ? 0.5788 0.6919 0.6476 0.1831  0.2019  -0.0381 8   DC  B "C5'" 
2544 C  "C4'" . DC  B 8   ? 0.4848 0.6690 0.6053 0.1687  0.1655  0.0348  8   DC  B "C4'" 
2545 O  "O4'" . DC  B 8   ? 0.4048 0.6137 0.5590 0.1402  0.0979  0.0519  8   DC  B "O4'" 
2546 C  "C3'" . DC  B 8   ? 0.4912 0.6559 0.6828 0.2169  0.1541  0.0383  8   DC  B "C3'" 
2547 O  "O3'" . DC  B 8   ? 0.5106 0.7929 0.7860 0.1843  0.1661  0.0553  8   DC  B "O3'" 
2548 C  "C2'" . DC  B 8   ? 0.4312 0.6268 0.5917 0.1447  0.1077  0.0996  8   DC  B "C2'" 
2549 C  "C1'" . DC  B 8   ? 0.4056 0.5645 0.5509 0.1069  0.1176  0.0670  8   DC  B "C1'" 
2550 N  N1    . DC  B 8   ? 0.3917 0.5307 0.5065 0.0808  0.0824  0.0669  8   DC  B N1    
2551 C  C2    . DC  B 8   ? 0.3401 0.5142 0.5095 0.0295  0.0575  0.0595  8   DC  B C2    
2552 O  O2    . DC  B 8   ? 0.3397 0.5749 0.4908 0.0034  0.0288  0.1129  8   DC  B O2    
2553 N  N3    . DC  B 8   ? 0.3071 0.4901 0.5276 0.0271  0.0377  0.0641  8   DC  B N3    
2554 C  C4    . DC  B 8   ? 0.3519 0.4431 0.4559 0.0370  0.0380  0.0440  8   DC  B C4    
2555 N  N4    . DC  B 8   ? 0.3338 0.3758 0.4360 0.0859  0.0239  0.0301  8   DC  B N4    
2556 C  C5    . DC  B 8   ? 0.3997 0.4295 0.4436 0.1006  0.0484  0.0650  8   DC  B C5    
2557 C  C6    . DC  B 8   ? 0.4043 0.4684 0.4676 0.1090  0.0609  0.0555  8   DC  B C6    
2558 P  P     . DT  B 9   ? 0.5910 0.8367 0.8206 0.2322  0.1369  0.0388  9   DT  B P     
2559 O  OP1   . DT  B 9   ? 0.6071 0.9871 0.8601 0.2434  0.1669  0.0602  9   DT  B OP1   
2560 O  OP2   . DT  B 9   ? 0.7334 0.7982 0.8753 0.2307  0.0978  0.1097  9   DT  B OP2   
2561 O  "O5'" . DT  B 9   ? 0.5574 0.8489 0.7908 0.1362  0.1480  0.0694  9   DT  B "O5'" 
2562 C  "C5'" . DT  B 9   ? 0.5105 0.8674 0.7592 0.1074  0.1527  0.0897  9   DT  B "C5'" 
2563 C  "C4'" . DT  B 9   ? 0.3946 0.8634 0.7372 0.0850  0.1136  0.1302  9   DT  B "C4'" 
2564 O  "O4'" . DT  B 9   ? 0.3904 0.7800 0.6615 0.0849  0.0702  0.1152  9   DT  B "O4'" 
2565 C  "C3'" . DT  B 9   ? 0.4245 0.8738 0.8110 0.1467  0.1109  0.1253  9   DT  B "C3'" 
2566 O  "O3'" . DT  B 9   ? 0.4583 0.9470 0.8839 0.1371  0.0823  0.1096  9   DT  B "O3'" 
2567 C  "C2'" . DT  B 9   ? 0.4106 0.7424 0.7952 0.1158  0.0682  0.1234  9   DT  B "C2'" 
2568 C  "C1'" . DT  B 9   ? 0.3639 0.7153 0.6612 0.0805  0.0801  0.1020  9   DT  B "C1'" 
2569 N  N1    . DT  B 9   ? 0.3776 0.6287 0.5419 0.0736  0.0496  0.1124  9   DT  B N1    
2570 C  C2    . DT  B 9   ? 0.3240 0.5539 0.5625 0.0560  0.0283  0.1158  9   DT  B C2    
2571 O  O2    . DT  B 9   ? 0.3412 0.5457 0.5739 0.0491  0.1003  0.0790  9   DT  B O2    
2572 N  N3    . DT  B 9   ? 0.3111 0.4924 0.4848 0.0531  0.0598  0.1242  9   DT  B N3    
2573 C  C4    . DT  B 9   ? 0.3378 0.4985 0.4933 0.0427  0.0580  0.1176  9   DT  B C4    
2574 O  O4    . DT  B 9   ? 0.3222 0.4941 0.4732 0.0681  0.0122  0.1244  9   DT  B O4    
2575 C  C5    . DT  B 9   ? 0.3882 0.5134 0.5286 0.0846  0.0581  0.0952  9   DT  B C5    
2576 C  C7    . DT  B 9   ? 0.4288 0.4731 0.5628 0.0684  0.0905  0.0814  9   DT  B C7    
2577 C  C6    . DT  B 9   ? 0.3852 0.5790 0.5657 0.0823  0.0744  0.1047  9   DT  B C6    
2578 P  P     . DG  B 10  ? 0.4759 0.9459 0.9853 0.1639  0.0028  0.1025  10  DG  B P     
2579 O  OP1   . DG  B 10  ? 0.4853 1.0620 1.0286 0.1336  0.0126  0.1649  10  DG  B OP1   
2580 O  OP2   . DG  B 10  ? 0.7276 0.8865 1.0545 0.2512  -0.0130 0.1007  10  DG  B OP2   
2581 O  "O5'" . DG  B 10  ? 0.4964 0.8724 0.9091 0.1433  -0.0479 0.1140  10  DG  B "O5'" 
2582 C  "C5'" . DG  B 10  ? 0.4381 0.8463 0.7904 0.0434  -0.0634 0.1307  10  DG  B "C5'" 
2583 C  "C4'" . DG  B 10  ? 0.3474 0.8271 0.7600 -0.0116 -0.0969 0.1800  10  DG  B "C4'" 
2584 O  "O4'" . DG  B 10  ? 0.3289 0.7592 0.6662 0.0348  -0.0855 0.1741  10  DG  B "O4'" 
2585 C  "C3'" . DG  B 10  ? 0.3826 0.8392 0.8137 0.0067  -0.0978 0.2141  10  DG  B "C3'" 
2586 O  "O3'" . DG  B 10  ? 0.4692 0.8222 0.8620 -0.0545 -0.1154 0.2025  10  DG  B "O3'" 
2587 C  "C2'" . DG  B 10  ? 0.3843 0.7629 0.7542 0.0376  -0.0881 0.1860  10  DG  B "C2'" 
2588 C  "C1'" . DG  B 10  ? 0.3377 0.7277 0.6718 0.0094  -0.0753 0.1537  10  DG  B "C1'" 
2589 N  N9    . DG  B 10  ? 0.3674 0.6366 0.6453 -0.0007 -0.0395 0.1346  10  DG  B N9    
2590 C  C8    . DG  B 10  ? 0.3885 0.6166 0.6453 0.0389  -0.0225 0.1443  10  DG  B C8    
2591 N  N7    . DG  B 10  ? 0.4156 0.5473 0.5829 0.0255  -0.0216 0.1329  10  DG  B N7    
2592 C  C5    . DG  B 10  ? 0.3426 0.5127 0.5669 0.0119  -0.0540 0.1329  10  DG  B C5    
2593 C  C6    . DG  B 10  ? 0.3382 0.4345 0.4872 -0.0169 -0.0833 0.1000  10  DG  B C6    
2594 O  O6    . DG  B 10  ? 0.3314 0.4107 0.4391 -0.0088 -0.0509 0.1103  10  DG  B O6    
2595 N  N1    . DG  B 10  ? 0.3230 0.4413 0.4774 -0.0027 -0.0839 0.1117  10  DG  B N1    
2596 C  C2    . DG  B 10  ? 0.3277 0.4957 0.4914 -0.0113 -0.0917 0.0924  10  DG  B C2    
2597 N  N2    . DG  B 10  ? 0.3644 0.4501 0.4434 -0.0187 -0.1312 0.0909  10  DG  B N2    
2598 N  N3    . DG  B 10  ? 0.3330 0.5421 0.5884 -0.0479 -0.0775 0.1047  10  DG  B N3    
2599 C  C4    . DG  B 10  ? 0.3580 0.5646 0.5926 -0.0079 -0.0625 0.1150  10  DG  B C4    
2600 P  P     . DA  B 11  ? 0.4215 0.8748 0.8850 -0.0838 -0.1335 0.2064  11  DA  B P     
2601 O  OP1   . DA  B 11  ? 0.4871 0.9392 1.0037 -0.1317 -0.1321 0.1517  11  DA  B OP1   
2602 O  OP2   . DA  B 11  ? 0.4096 0.9317 0.9603 0.0174  -0.1350 0.2285  11  DA  B OP2   
2603 O  "O5'" . DA  B 11  ? 0.3503 0.8789 0.8932 -0.0729 -0.1688 0.1796  11  DA  B "O5'" 
2604 C  "C5'" . DA  B 11  ? 0.4415 0.7733 0.8325 -0.0974 -0.1188 0.1504  11  DA  B "C5'" 
2605 C  "C4'" . DA  B 11  ? 0.4724 0.7094 0.7509 -0.0983 -0.1481 0.1581  11  DA  B "C4'" 
2606 O  "O4'" . DA  B 11  ? 0.4597 0.6127 0.7534 -0.0448 -0.1363 0.1113  11  DA  B "O4'" 
2607 C  "C3'" . DA  B 11  ? 0.4490 0.7371 0.7842 -0.1069 -0.2030 0.1872  11  DA  B "C3'" 
2608 O  "O3'" . DA  B 11  ? 0.4999 0.6765 0.7877 -0.1674 -0.2054 0.1671  11  DA  B "O3'" 
2609 C  "C2'" . DA  B 11  ? 0.4435 0.7223 0.7426 -0.0924 -0.1564 0.1820  11  DA  B "C2'" 
2610 C  "C1'" . DA  B 11  ? 0.4811 0.6758 0.6647 -0.0684 -0.1539 0.1620  11  DA  B "C1'" 
2611 N  N9    . DA  B 11  ? 0.4543 0.6471 0.6643 -0.0395 -0.1224 0.1549  11  DA  B N9    
2612 C  C8    . DA  B 11  ? 0.4298 0.6186 0.7101 -0.0070 -0.1063 0.1817  11  DA  B C8    
2613 N  N7    . DA  B 11  ? 0.4075 0.5898 0.6676 0.0384  -0.0882 0.1756  11  DA  B N7    
2614 C  C5    . DA  B 11  ? 0.4144 0.5507 0.6070 0.0138  -0.0850 0.1630  11  DA  B C5    
2615 C  C6    . DA  B 11  ? 0.4128 0.4900 0.5517 0.0249  -0.0580 0.1459  11  DA  B C6    
2616 N  N6    . DA  B 11  ? 0.3655 0.4716 0.5923 0.0404  -0.0234 0.1231  11  DA  B N6    
2617 N  N1    . DA  B 11  ? 0.4070 0.4826 0.5237 -0.0012 -0.0569 0.1512  11  DA  B N1    
2618 C  C2    . DA  B 11  ? 0.4249 0.5298 0.5289 -0.0336 -0.0562 0.1316  11  DA  B C2    
2619 N  N3    . DA  B 11  ? 0.4521 0.5644 0.5480 -0.0423 -0.0887 0.1342  11  DA  B N3    
2620 C  C4    . DA  B 11  ? 0.4389 0.5797 0.6066 -0.0212 -0.0906 0.1510  11  DA  B C4    
2621 P  P     . DT  B 12  ? 0.6379 0.7824 0.8481 -0.1824 -0.2376 0.1543  12  DT  B P     
2622 O  OP1   . DT  B 12  ? 0.7990 0.8168 0.8430 -0.2246 -0.2482 0.1263  12  DT  B OP1   
2623 O  OP2   . DT  B 12  ? 0.6187 0.7585 0.9676 -0.1947 -0.2332 0.2124  12  DT  B OP2   
2624 O  "O5'" . DT  B 12  ? 0.6455 0.7973 0.7430 -0.1442 -0.1930 0.1784  12  DT  B "O5'" 
2625 C  "C5'" . DT  B 12  ? 0.6397 0.7465 0.6329 -0.1614 -0.2095 0.1402  12  DT  B "C5'" 
2626 C  "C4'" . DT  B 12  ? 0.6872 0.7065 0.5722 -0.1287 -0.1919 0.1827  12  DT  B "C4'" 
2627 O  "O4'" . DT  B 12  ? 0.6035 0.6481 0.6229 -0.1020 -0.1801 0.1555  12  DT  B "O4'" 
2628 C  "C3'" . DT  B 12  ? 0.7347 0.7363 0.6436 -0.1034 -0.2249 0.1946  12  DT  B "C3'" 
2629 O  "O3'" . DT  B 12  ? 0.8079 0.8095 0.6538 -0.1372 -0.1784 0.1636  12  DT  B "O3'" 
2630 C  "C2'" . DT  B 12  ? 0.6793 0.7737 0.6184 -0.0526 -0.2382 0.1813  12  DT  B "C2'" 
2631 C  "C1'" . DT  B 12  ? 0.6006 0.6593 0.6060 -0.0575 -0.1940 0.1819  12  DT  B "C1'" 
2632 N  N1    . DT  B 12  ? 0.5643 0.6274 0.6193 -0.0342 -0.1763 0.1923  12  DT  B N1    
2633 C  C2    . DT  B 12  ? 0.5394 0.5493 0.5776 -0.0201 -0.1365 0.1801  12  DT  B C2    
2634 O  O2    . DT  B 12  ? 0.5189 0.5715 0.5128 -0.0702 -0.1465 0.1256  12  DT  B O2    
2635 N  N3    . DT  B 12  ? 0.5135 0.5257 0.5984 -0.0084 -0.1258 0.1825  12  DT  B N3    
2636 C  C4    . DT  B 12  ? 0.5217 0.5801 0.6745 -0.0154 -0.0910 0.1751  12  DT  B C4    
2637 O  O4    . DT  B 12  ? 0.4936 0.5514 0.7732 -0.0093 -0.0047 0.1260  12  DT  B O4    
2638 C  C5    . DT  B 12  ? 0.5312 0.6587 0.7282 0.0028  -0.1411 0.1875  12  DT  B C5    
2639 C  C7    . DT  B 12  ? 0.5119 0.6338 0.8150 0.0270  -0.1647 0.2170  12  DT  B C7    
2640 C  C6    . DT  B 12  ? 0.5757 0.6855 0.6748 -0.0275 -0.1499 0.2008  12  DT  B C6    
2641 P  P     . DA  B 13  ? 0.8948 0.7783 0.6469 -0.1284 -0.1855 0.1972  13  DA  B P     
2642 O  OP1   . DA  B 13  ? 0.8961 0.8535 0.7210 -0.1513 -0.2228 0.1993  13  DA  B OP1   
2643 O  OP2   . DA  B 13  ? 0.9360 0.7765 0.6760 -0.0855 -0.1850 0.2096  13  DA  B OP2   
2644 O  "O5'" . DA  B 13  ? 0.9234 0.7571 0.6147 -0.1077 -0.1929 0.2065  13  DA  B "O5'" 
2645 C  "C5'" . DA  B 13  ? 0.8550 0.7092 0.5730 -0.1055 -0.1701 0.1663  13  DA  B "C5'" 
2646 C  "C4'" . DA  B 13  ? 0.8150 0.6876 0.5495 -0.0879 -0.1151 0.1680  13  DA  B "C4'" 
2647 O  "O4'" . DA  B 13  ? 0.7765 0.6364 0.5908 -0.0571 -0.1103 0.1820  13  DA  B "O4'" 
2648 C  "C3'" . DA  B 13  ? 0.8888 0.6869 0.5258 -0.0677 -0.0908 0.1792  13  DA  B "C3'" 
2649 O  "O3'" . DA  B 13  ? 0.8508 0.7029 0.4715 -0.0390 -0.0047 0.1634  13  DA  B "O3'" 
2650 C  "C2'" . DA  B 13  ? 0.9017 0.6849 0.5491 -0.0726 -0.1021 0.2122  13  DA  B "C2'" 
2651 C  "C1'" . DA  B 13  ? 0.7940 0.6539 0.5606 -0.0685 -0.1062 0.1898  13  DA  B "C1'" 
2652 N  N9    . DA  B 13  ? 0.7532 0.6411 0.6117 -0.0776 -0.1452 0.2025  13  DA  B N9    
2653 C  C8    . DA  B 13  ? 0.8135 0.6433 0.6081 -0.0760 -0.2002 0.2519  13  DA  B C8    
2654 N  N7    . DA  B 13  ? 0.7740 0.6787 0.6410 -0.0514 -0.2201 0.2446  13  DA  B N7    
2655 C  C5    . DA  B 13  ? 0.7337 0.6397 0.6247 -0.0478 -0.1805 0.2283  13  DA  B C5    
2656 C  C6    . DA  B 13  ? 0.7076 0.6044 0.6275 -0.0226 -0.1713 0.2495  13  DA  B C6    
2657 N  N6    . DA  B 13  ? 0.7236 0.6019 0.6801 -0.0095 -0.1959 0.2629  13  DA  B N6    
2658 N  N1    . DA  B 13  ? 0.6753 0.5698 0.5877 -0.0368 -0.1305 0.2438  13  DA  B N1    
2659 C  C2    . DA  B 13  ? 0.6549 0.6180 0.5710 -0.0375 -0.0981 0.2041  13  DA  B C2    
2660 N  N3    . DA  B 13  ? 0.6695 0.6418 0.5646 -0.0594 -0.1002 0.1845  13  DA  B N3    
2661 C  C4    . DA  B 13  ? 0.7128 0.6340 0.6040 -0.0618 -0.1448 0.2066  13  DA  B C4    
2662 P  P     . DA  B 14  ? 0.2533 0.2533 0.2533 0.0000  0.0000  0.0000  14  DA  B P     
2663 O  OP1   . DA  B 14  ? 0.2533 0.2533 0.2533 0.0000  0.0000  0.0000  14  DA  B OP1   
2664 O  OP2   . DA  B 14  ? 0.2533 0.2533 0.2533 0.0000  0.0000  0.0000  14  DA  B OP2   
2665 O  "O5'" . DA  B 14  ? 0.2533 0.2533 0.2533 0.0000  0.0000  0.0000  14  DA  B "O5'" 
2666 C  "C5'" . DA  B 14  ? 0.6939 0.6191 0.5997 -0.0882 -0.0261 0.1218  14  DA  B "C5'" 
2667 C  "C4'" . DA  B 14  ? 0.7049 0.6054 0.5473 -0.1009 -0.0205 0.1791  14  DA  B "C4'" 
2668 O  "O4'" . DA  B 14  ? 0.6521 0.5887 0.5870 -0.1231 -0.0312 0.1837  14  DA  B "O4'" 
2669 C  "C3'" . DA  B 14  ? 0.7473 0.6330 0.5372 -0.0933 -0.0045 0.1765  14  DA  B "C3'" 
2670 O  "O3'" . DA  B 14  ? 0.7276 0.6057 0.4821 -0.1180 0.0098  0.1662  14  DA  B "O3'" 
2671 C  "C2'" . DA  B 14  ? 0.7962 0.6426 0.5671 -0.1055 -0.0239 0.2155  14  DA  B "C2'" 
2672 C  "C1'" . DA  B 14  ? 0.7449 0.6182 0.5804 -0.0772 -0.0521 0.2336  14  DA  B "C1'" 
2673 N  N9    . DA  B 14  ? 0.7762 0.6609 0.6155 -0.0685 -0.0956 0.2374  14  DA  B N9    
2674 C  C8    . DA  B 14  ? 0.8510 0.6809 0.5778 -0.0656 -0.1117 0.2649  14  DA  B C8    
2675 N  N7    . DA  B 14  ? 0.8739 0.6796 0.5946 -0.0600 -0.1642 0.2794  14  DA  B N7    
2676 C  C5    . DA  B 14  ? 0.8222 0.6223 0.6268 -0.0432 -0.1401 0.2845  14  DA  B C5    
2677 C  C6    . DA  B 14  ? 0.8126 0.6344 0.6564 -0.0320 -0.1595 0.2774  14  DA  B C6    
2678 N  N6    . DA  B 14  ? 0.8382 0.6614 0.7262 -0.0277 -0.2056 0.2541  14  DA  B N6    
2679 N  N1    . DA  B 14  ? 0.7732 0.5978 0.6625 -0.0243 -0.1422 0.2760  14  DA  B N1    
2680 C  C2    . DA  B 14  ? 0.7422 0.5713 0.6600 -0.0473 -0.1256 0.2526  14  DA  B C2    
2681 N  N3    . DA  B 14  ? 0.7416 0.5771 0.6582 -0.0571 -0.1091 0.2290  14  DA  B N3    
2682 C  C4    . DA  B 14  ? 0.7817 0.6276 0.6139 -0.0654 -0.1149 0.2515  14  DA  B C4    
2683 O  OP3   . DT  C 1   ? 0.4587 0.4376 0.5974 0.0369  0.0784  0.0878  15  DT  C OP3   
2684 P  P     . DT  C 1   ? 0.4530 0.4955 0.6195 0.0488  0.0991  0.1211  15  DT  C P     
2685 O  OP1   . DT  C 1   ? 0.4767 0.5742 0.5063 0.0520  0.0924  0.1223  15  DT  C OP1   
2686 O  OP2   . DT  C 1   ? 0.5051 0.5262 0.7109 0.0286  0.0333  0.1001  15  DT  C OP2   
2687 O  "O5'" . DT  C 1   ? 0.4200 0.4195 0.5803 0.0811  0.0424  0.1026  15  DT  C "O5'" 
2688 C  "C5'" . DT  C 1   ? 0.3861 0.4573 0.5782 0.0561  0.0324  0.1168  15  DT  C "C5'" 
2689 C  "C4'" . DT  C 1   ? 0.3513 0.4412 0.5386 0.0373  -0.0152 0.1395  15  DT  C "C4'" 
2690 O  "O4'" . DT  C 1   ? 0.3374 0.4210 0.5687 -0.0081 0.0111  0.1239  15  DT  C "O4'" 
2691 C  "C3'" . DT  C 1   ? 0.3837 0.4028 0.5479 -0.0033 -0.0624 0.0917  15  DT  C "C3'" 
2692 O  "O3'" . DT  C 1   ? 0.4144 0.4669 0.5249 0.0644  -0.0817 0.0678  15  DT  C "O3'" 
2693 C  "C2'" . DT  C 1   ? 0.3112 0.4035 0.5693 0.0021  -0.0275 0.0993  15  DT  C "C2'" 
2694 C  "C1'" . DT  C 1   ? 0.3565 0.3946 0.5401 -0.0143 -0.0010 0.0994  15  DT  C "C1'" 
2695 N  N1    . DT  C 1   ? 0.3028 0.3975 0.5337 -0.0173 0.0363  0.0749  15  DT  C N1    
2696 C  C2    . DT  C 1   ? 0.3698 0.3438 0.4843 0.0324  0.0545  0.0488  15  DT  C C2    
2697 O  O2    . DT  C 1   ? 0.4868 0.3473 0.5167 -0.0127 0.1354  0.0303  15  DT  C O2    
2698 N  N3    . DT  C 1   ? 0.3081 0.3497 0.5159 0.0129  0.0541  0.0604  15  DT  C N3    
2699 C  C4    . DT  C 1   ? 0.3503 0.4094 0.5352 0.0339  0.0514  0.0413  15  DT  C C4    
2700 O  O4    . DT  C 1   ? 0.3576 0.4729 0.5237 0.0058  0.0656  0.0623  15  DT  C O4    
2701 C  C5    . DT  C 1   ? 0.3503 0.4413 0.5169 0.0388  0.0305  0.0219  15  DT  C C5    
2702 C  C7    . DT  C 1   ? 0.3571 0.4445 0.5906 0.1655  0.0541  0.0338  15  DT  C C7    
2703 C  C6    . DT  C 1   ? 0.2710 0.3863 0.5646 0.0192  0.0222  0.0725  15  DT  C C6    
2704 P  P     . DG  C 2   ? 0.4063 0.4572 0.5436 0.0505  -0.0868 0.0131  16  DG  C P     
2705 O  OP1   . DG  C 2   ? 0.3618 0.5827 0.5144 -0.0145 -0.0984 0.0426  16  DG  C OP1   
2706 O  OP2   . DG  C 2   ? 0.3598 0.5551 0.4623 0.0312  -0.1326 0.0720  16  DG  C OP2   
2707 O  "O5'" . DG  C 2   ? 0.4038 0.4906 0.5449 0.0278  -0.1078 0.0327  16  DG  C "O5'" 
2708 C  "C5'" . DG  C 2   ? 0.4529 0.4623 0.5323 0.0088  -0.0296 0.0468  16  DG  C "C5'" 
2709 C  "C4'" . DG  C 2   ? 0.4721 0.3878 0.4660 -0.0238 -0.0067 0.0294  16  DG  C "C4'" 
2710 O  "O4'" . DG  C 2   ? 0.4065 0.4098 0.4446 -0.0465 0.0686  0.0143  16  DG  C "O4'" 
2711 C  "C3'" . DG  C 2   ? 0.4700 0.3875 0.4617 -0.0278 -0.0005 0.0222  16  DG  C "C3'" 
2712 O  "O3'" . DG  C 2   ? 0.4996 0.4185 0.4982 -0.0026 0.0687  -0.0152 16  DG  C "O3'" 
2713 C  "C2'" . DG  C 2   ? 0.4445 0.4214 0.4653 -0.0370 0.0301  0.0069  16  DG  C "C2'" 
2714 C  "C1'" . DG  C 2   ? 0.4488 0.3710 0.4656 -0.0264 0.0187  0.0256  16  DG  C "C1'" 
2715 N  N9    . DG  C 2   ? 0.4234 0.3291 0.4309 0.0180  0.0106  0.0592  16  DG  C N9    
2716 C  C8    . DG  C 2   ? 0.4200 0.3478 0.4486 0.0431  0.0115  0.0786  16  DG  C C8    
2717 N  N7    . DG  C 2   ? 0.3787 0.2998 0.4797 0.0409  0.0543  0.0670  16  DG  C N7    
2718 C  C5    . DG  C 2   ? 0.3499 0.3245 0.4636 -0.0131 0.0305  0.0533  16  DG  C C5    
2719 C  C6    . DG  C 2   ? 0.3262 0.3340 0.4749 0.0002  0.0454  0.0386  16  DG  C C6    
2720 O  O6    . DG  C 2   ? 0.4103 0.3575 0.5120 0.0552  0.0431  0.0119  16  DG  C O6    
2721 N  N1    . DG  C 2   ? 0.3291 0.3499 0.4761 0.0176  0.0583  0.0496  16  DG  C N1    
2722 C  C2    . DG  C 2   ? 0.3142 0.3408 0.4951 0.0080  0.0291  0.0403  16  DG  C C2    
2723 N  N2    . DG  C 2   ? 0.3052 0.3846 0.4765 0.0143  0.0477  0.0659  16  DG  C N2    
2724 N  N3    . DG  C 2   ? 0.3370 0.3775 0.4650 0.0231  -0.0042 0.0483  16  DG  C N3    
2725 C  C4    . DG  C 2   ? 0.3567 0.3107 0.4662 0.0183  0.0383  0.0629  16  DG  C C4    
2726 P  P     . DG  C 3   ? 0.5142 0.4003 0.5048 0.0123  -0.0167 -0.0152 17  DG  C P     
2727 O  OP1   . DG  C 3   ? 0.5608 0.3622 0.5382 0.0282  0.0051  0.0164  17  DG  C OP1   
2728 O  OP2   . DG  C 3   ? 0.4957 0.4169 0.4523 -0.0386 -0.0239 0.0131  17  DG  C OP2   
2729 O  "O5'" . DG  C 3   ? 0.4598 0.3971 0.5699 0.0105  0.0003  -0.0348 17  DG  C "O5'" 
2730 C  "C5'" . DG  C 3   ? 0.4991 0.3708 0.4967 0.1096  -0.0029 -0.0189 17  DG  C "C5'" 
2731 C  "C4'" . DG  C 3   ? 0.5228 0.4003 0.4835 0.1114  -0.0097 0.0085  17  DG  C "C4'" 
2732 O  "O4'" . DG  C 3   ? 0.4609 0.3832 0.4799 0.0423  -0.0395 0.0290  17  DG  C "O4'" 
2733 C  "C3'" . DG  C 3   ? 0.5669 0.4428 0.4534 0.0531  -0.0292 -0.0016 17  DG  C "C3'" 
2734 O  "O3'" . DG  C 3   ? 0.7147 0.4668 0.4699 0.0866  -0.0830 0.0227  17  DG  C "O3'" 
2735 C  "C2'" . DG  C 3   ? 0.4647 0.4372 0.4452 0.0884  -0.0472 0.0197  17  DG  C "C2'" 
2736 C  "C1'" . DG  C 3   ? 0.4018 0.4333 0.4658 0.0371  -0.0180 0.0211  17  DG  C "C1'" 
2737 N  N9    . DG  C 3   ? 0.3425 0.4112 0.4708 0.0171  -0.0018 0.0434  17  DG  C N9    
2738 C  C8    . DG  C 3   ? 0.3279 0.3268 0.4522 0.0133  -0.0539 0.0835  17  DG  C C8    
2739 N  N7    . DG  C 3   ? 0.3393 0.3032 0.4753 0.0245  -0.0553 0.0773  17  DG  C N7    
2740 C  C5    . DG  C 3   ? 0.3230 0.3518 0.4727 0.0128  -0.0256 0.0376  17  DG  C C5    
2741 C  C6    . DG  C 3   ? 0.2947 0.4188 0.4797 0.0056  0.0018  -0.0019 17  DG  C C6    
2742 O  O6    . DG  C 3   ? 0.3166 0.4759 0.4700 0.0536  0.0260  0.0179  17  DG  C O6    
2743 N  N1    . DG  C 3   ? 0.3053 0.4648 0.4756 0.0282  -0.0236 0.0194  17  DG  C N1    
2744 C  C2    . DG  C 3   ? 0.3076 0.4567 0.4757 0.0264  -0.0090 0.0382  17  DG  C C2    
2745 N  N2    . DG  C 3   ? 0.2882 0.5172 0.4778 0.0604  0.0289  0.0824  17  DG  C N2    
2746 N  N3    . DG  C 3   ? 0.3122 0.4271 0.4506 0.0288  -0.0058 0.0569  17  DG  C N3    
2747 C  C4    . DG  C 3   ? 0.3135 0.4340 0.4464 0.0271  -0.0023 0.0491  17  DG  C C4    
2748 P  P     . DA  C 4   ? 0.6395 0.5374 0.5188 0.0382  -0.0765 0.0677  18  DA  C P     
2749 O  OP1   . DA  C 4   ? 0.8337 0.6005 0.5019 0.1985  -0.0874 0.0796  18  DA  C OP1   
2750 O  OP2   . DA  C 4   ? 0.7211 0.5833 0.4722 0.0736  -0.0145 0.0623  18  DA  C OP2   
2751 O  "O5'" . DA  C 4   ? 0.5358 0.6004 0.5685 0.1259  -0.0996 0.1231  18  DA  C "O5'" 
2752 C  "C5'" . DA  C 4   ? 0.5527 0.4847 0.4912 0.2239  0.0235  0.0768  18  DA  C "C5'" 
2753 C  "C4'" . DA  C 4   ? 0.5217 0.4881 0.5585 0.1792  0.0150  0.0672  18  DA  C "C4'" 
2754 O  "O4'" . DA  C 4   ? 0.4531 0.4819 0.5206 0.1511  0.0520  0.0677  18  DA  C "O4'" 
2755 C  "C3'" . DA  C 4   ? 0.5572 0.5219 0.5347 0.1698  0.0007  0.0564  18  DA  C "C3'" 
2756 O  "O3'" . DA  C 4   ? 0.5504 0.6163 0.5792 0.2134  0.0606  0.0698  18  DA  C "O3'" 
2757 C  "C2'" . DA  C 4   ? 0.4520 0.5335 0.5213 0.1499  -0.0039 0.0499  18  DA  C "C2'" 
2758 C  "C1'" . DA  C 4   ? 0.3798 0.5006 0.5431 0.1354  -0.0176 0.0290  18  DA  C "C1'" 
2759 N  N9    . DA  C 4   ? 0.3289 0.4884 0.5333 0.0714  -0.0015 0.0104  18  DA  C N9    
2760 C  C8    . DA  C 4   ? 0.3574 0.4348 0.5348 0.0393  -0.0347 -0.0102 18  DA  C C8    
2761 N  N7    . DA  C 4   ? 0.2943 0.3871 0.4831 0.0303  -0.0678 0.0256  18  DA  C N7    
2762 C  C5    . DA  C 4   ? 0.3259 0.3948 0.4643 0.0216  -0.0403 0.0043  18  DA  C C5    
2763 C  C6    . DA  C 4   ? 0.3114 0.3741 0.4673 -0.0024 -0.0224 0.0112  18  DA  C C6    
2764 N  N6    . DA  C 4   ? 0.2575 0.3307 0.4631 -0.0653 -0.0241 0.0500  18  DA  C N6    
2765 N  N1    . DA  C 4   ? 0.3084 0.4850 0.4970 -0.0119 -0.0239 -0.0049 18  DA  C N1    
2766 C  C2    . DA  C 4   ? 0.2904 0.5164 0.5074 -0.0081 -0.0481 0.0221  18  DA  C C2    
2767 N  N3    . DA  C 4   ? 0.2980 0.5189 0.4621 0.0342  -0.0508 0.0588  18  DA  C N3    
2768 C  C4    . DA  C 4   ? 0.3049 0.5014 0.4910 0.0058  -0.0292 0.0209  18  DA  C C4    
2769 P  P     . DG  C 5   ? 0.6603 0.6705 0.5854 0.1827  0.0282  0.0912  19  DG  C P     
2770 O  OP1   . DG  C 5   ? 0.8125 0.7511 0.6540 0.2826  0.1258  0.1242  19  DG  C OP1   
2771 O  OP2   . DG  C 5   ? 0.6578 0.6231 0.6055 0.1611  0.0159  0.1000  19  DG  C OP2   
2772 O  "O5'" . DG  C 5   ? 0.5923 0.6792 0.6016 0.1681  0.0192  0.1052  19  DG  C "O5'" 
2773 C  "C5'" . DG  C 5   ? 0.5033 0.7791 0.5934 0.1948  0.0230  0.1171  19  DG  C "C5'" 
2774 C  "C4'" . DG  C 5   ? 0.4780 0.7939 0.6120 0.1751  -0.0290 0.1264  19  DG  C "C4'" 
2775 O  "O4'" . DG  C 5   ? 0.4138 0.7426 0.5675 0.1063  -0.0424 0.0920  19  DG  C "O4'" 
2776 C  "C3'" . DG  C 5   ? 0.4845 0.8013 0.6075 0.2083  -0.0290 0.1321  19  DG  C "C3'" 
2777 O  "O3'" . DG  C 5   ? 0.4996 0.9450 0.6899 0.1829  -0.0543 0.1139  19  DG  C "O3'" 
2778 C  "C2'" . DG  C 5   ? 0.4589 0.7082 0.5394 0.1278  -0.0542 0.0769  19  DG  C "C2'" 
2779 C  "C1'" . DG  C 5   ? 0.4199 0.7061 0.5280 0.1076  -0.0692 0.0888  19  DG  C "C1'" 
2780 N  N9    . DG  C 5   ? 0.4033 0.6224 0.5186 0.0643  -0.0450 0.0612  19  DG  C N9    
2781 C  C8    . DG  C 5   ? 0.3895 0.5333 0.5069 0.0570  -0.0102 0.0638  19  DG  C C8    
2782 N  N7    . DG  C 5   ? 0.3620 0.4621 0.5113 0.0156  0.0060  0.0670  19  DG  C N7    
2783 C  C5    . DG  C 5   ? 0.3772 0.5077 0.4685 -0.0127 -0.0130 0.0653  19  DG  C C5    
2784 C  C6    . DG  C 5   ? 0.3639 0.4791 0.4499 -0.0409 -0.0436 0.0451  19  DG  C C6    
2785 O  O6    . DG  C 5   ? 0.3571 0.4619 0.4371 -0.0659 -0.0641 0.0289  19  DG  C O6    
2786 N  N1    . DG  C 5   ? 0.3900 0.5140 0.4427 -0.1027 -0.0452 0.0648  19  DG  C N1    
2787 C  C2    . DG  C 5   ? 0.4285 0.6269 0.5119 -0.0342 -0.0791 0.0316  19  DG  C C2    
2788 N  N2    . DG  C 5   ? 0.5032 0.6566 0.5432 -0.0927 -0.1139 0.0278  19  DG  C N2    
2789 N  N3    . DG  C 5   ? 0.4943 0.6161 0.5128 -0.0075 -0.0562 0.0498  19  DG  C N3    
2790 C  C4    . DG  C 5   ? 0.4073 0.5827 0.4804 0.0226  -0.0460 0.0675  19  DG  C C4    
2791 P  P     . DG  C 6   ? 0.6361 0.9929 0.7546 0.2115  -0.0680 0.1547  20  DG  C P     
2792 O  OP1   . DG  C 6   ? 0.5727 1.1372 0.8422 0.3462  0.0153  0.1591  20  DG  C OP1   
2793 O  OP2   . DG  C 6   ? 0.7289 0.8997 0.7664 0.2702  -0.0354 0.1935  20  DG  C OP2   
2794 O  "O5'" . DG  C 6   ? 0.5617 0.9630 0.7371 0.1508  -0.0808 0.1278  20  DG  C "O5'" 
2795 C  "C5'" . DG  C 6   ? 0.4562 0.9971 0.7080 0.1313  -0.0809 0.1364  20  DG  C "C5'" 
2796 C  "C4'" . DG  C 6   ? 0.4618 0.9496 0.5969 0.0593  -0.1346 0.1366  20  DG  C "C4'" 
2797 O  "O4'" . DG  C 6   ? 0.4277 0.8388 0.5507 0.0697  -0.0827 0.0845  20  DG  C "O4'" 
2798 C  "C3'" . DG  C 6   ? 0.5119 0.9847 0.5959 0.0597  -0.1284 0.1518  20  DG  C "C3'" 
2799 O  "O3'" . DG  C 6   ? 0.5816 1.0458 0.6174 -0.0167 -0.1385 0.1350  20  DG  C "O3'" 
2800 C  "C2'" . DG  C 6   ? 0.5059 0.8522 0.5512 0.0805  -0.1032 0.1285  20  DG  C "C2'" 
2801 C  "C1'" . DG  C 6   ? 0.4713 0.8027 0.5238 0.0343  -0.1117 0.1052  20  DG  C "C1'" 
2802 N  N9    . DG  C 6   ? 0.4673 0.7267 0.4872 0.0429  -0.0933 0.0660  20  DG  C N9    
2803 C  C8    . DG  C 6   ? 0.4700 0.6642 0.4660 0.0833  -0.0675 0.0884  20  DG  C C8    
2804 N  N7    . DG  C 6   ? 0.4609 0.5764 0.4070 0.0502  -0.0544 0.0855  20  DG  C N7    
2805 C  C5    . DG  C 6   ? 0.4347 0.5958 0.4295 0.0317  -0.0607 0.0482  20  DG  C C5    
2806 C  C6    . DG  C 6   ? 0.4305 0.5135 0.3889 0.0149  -0.0652 0.0515  20  DG  C C6    
2807 O  O6    . DG  C 6   ? 0.3824 0.4843 0.4004 0.0721  -0.0480 0.0302  20  DG  C O6    
2808 N  N1    . DG  C 6   ? 0.4217 0.5230 0.3905 -0.0167 -0.0467 0.0409  20  DG  C N1    
2809 C  C2    . DG  C 6   ? 0.4749 0.5670 0.3984 -0.0378 -0.0697 0.0311  20  DG  C C2    
2810 N  N2    . DG  C 6   ? 0.5213 0.5583 0.3680 -0.1024 -0.0780 0.0127  20  DG  C N2    
2811 N  N3    . DG  C 6   ? 0.4670 0.6461 0.4170 -0.0304 -0.1010 0.0631  20  DG  C N3    
2812 C  C4    . DG  C 6   ? 0.4692 0.6654 0.4670 0.0205  -0.1042 0.0436  20  DG  C C4    
2813 P  P     . DA  C 7   ? 0.6514 1.0908 0.6223 -0.0045 -0.1467 0.1529  21  DA  C P     
2814 O  OP1   . DA  C 7   ? 0.6091 1.2356 0.6524 -0.0128 -0.1996 0.1861  21  DA  C OP1   
2815 O  OP2   . DA  C 7   ? 0.6739 1.0797 0.6266 0.0759  -0.1299 0.1917  21  DA  C OP2   
2816 O  "O5'" . DA  C 7   ? 0.6294 1.0154 0.5879 -0.0263 -0.1725 0.1250  21  DA  C "O5'" 
2817 C  "C5'" . DA  C 7   ? 0.6072 0.9941 0.5744 -0.0872 -0.1914 0.0930  21  DA  C "C5'" 
2818 C  "C4'" . DA  C 7   ? 0.6421 0.9643 0.5387 -0.1094 -0.1602 0.0529  21  DA  C "C4'" 
2819 O  "O4'" . DA  C 7   ? 0.6297 0.9156 0.5429 -0.1257 -0.1499 0.0761  21  DA  C "O4'" 
2820 C  "C3'" . DA  C 7   ? 0.7250 0.9617 0.5350 -0.0926 -0.1739 0.0631  21  DA  C "C3'" 
2821 O  "O3'" . DA  C 7   ? 0.7711 0.9614 0.5033 -0.1356 -0.1825 0.0378  21  DA  C "O3'" 
2822 C  "C2'" . DA  C 7   ? 0.6921 0.9023 0.5247 -0.0613 -0.1452 0.0743  21  DA  C "C2'" 
2823 C  "C1'" . DA  C 7   ? 0.6215 0.8336 0.5062 -0.0839 -0.1301 0.0477  21  DA  C "C1'" 
2824 N  N9    . DA  C 7   ? 0.5667 0.7184 0.4921 -0.0552 -0.0821 0.0745  21  DA  C N9    
2825 C  C8    . DA  C 7   ? 0.5781 0.7212 0.4988 -0.0112 -0.0826 0.1027  21  DA  C C8    
2826 N  N7    . DA  C 7   ? 0.5446 0.6449 0.5237 0.0069  -0.0798 0.1226  21  DA  C N7    
2827 C  C5    . DA  C 7   ? 0.5323 0.5991 0.4692 -0.0145 -0.0741 0.0936  21  DA  C C5    
2828 C  C6    . DA  C 7   ? 0.5203 0.4935 0.4286 0.0039  -0.0587 0.0988  21  DA  C C6    
2829 N  N6    . DA  C 7   ? 0.4975 0.4741 0.4088 0.0040  -0.0771 0.1208  21  DA  C N6    
2830 N  N1    . DA  C 7   ? 0.4914 0.4615 0.4448 -0.0170 -0.0530 0.1107  21  DA  C N1    
2831 C  C2    . DA  C 7   ? 0.5617 0.5058 0.4367 -0.0151 -0.0678 0.0918  21  DA  C C2    
2832 N  N3    . DA  C 7   ? 0.5584 0.5925 0.4727 -0.0356 -0.0669 0.0986  21  DA  C N3    
2833 C  C4    . DA  C 7   ? 0.5646 0.6176 0.4690 -0.0252 -0.0705 0.0849  21  DA  C C4    
2834 P  P     . DT  C 8   ? 0.8402 1.0080 0.5298 -0.1410 -0.0953 0.0275  22  DT  C P     
2835 O  OP1   . DT  C 8   ? 0.9205 1.0952 0.4956 -0.2011 -0.1292 0.0085  22  DT  C OP1   
2836 O  OP2   . DT  C 8   ? 0.8670 1.0681 0.5117 -0.0680 -0.1233 0.0679  22  DT  C OP2   
2837 O  "O5'" . DT  C 8   ? 0.8441 0.9459 0.4939 -0.0971 -0.0950 0.0142  22  DT  C "O5'" 
2838 C  "C5'" . DT  C 8   ? 0.8398 0.8846 0.4498 -0.1222 -0.0709 0.0027  22  DT  C "C5'" 
2839 C  "C4'" . DT  C 8   ? 0.8318 0.7929 0.4759 -0.0876 -0.0224 -0.0111 22  DT  C "C4'" 
2840 O  "O4'" . DT  C 8   ? 0.8060 0.7331 0.4558 -0.0640 -0.0103 0.0106  22  DT  C "O4'" 
2841 C  "C3'" . DT  C 8   ? 0.9084 0.8313 0.4629 -0.0744 -0.0311 0.0068  22  DT  C "C3'" 
2842 O  "O3'" . DT  C 8   ? 0.9527 0.8785 0.5228 -0.0263 0.0223  -0.0073 22  DT  C "O3'" 
2843 C  "C2'" . DT  C 8   ? 0.8692 0.8073 0.4540 -0.0446 -0.0233 0.0391  22  DT  C "C2'" 
2844 C  "C1'" . DT  C 8   ? 0.7995 0.7450 0.4542 -0.0583 -0.0104 0.0175  22  DT  C "C1'" 
2845 N  N1    . DT  C 8   ? 0.7078 0.6969 0.4435 -0.0271 -0.0437 0.0546  22  DT  C N1    
2846 C  C2    . DT  C 8   ? 0.6466 0.6381 0.4194 -0.0267 0.0021  0.0703  22  DT  C C2    
2847 O  O2    . DT  C 8   ? 0.6087 0.6449 0.4104 -0.0446 0.0340  0.0924  22  DT  C O2    
2848 N  N3    . DT  C 8   ? 0.5913 0.5784 0.4290 -0.0174 -0.0235 0.1041  22  DT  C N3    
2849 C  C4    . DT  C 8   ? 0.6281 0.6046 0.4467 0.0127  -0.0383 0.0957  22  DT  C C4    
2850 O  O4    . DT  C 8   ? 0.6044 0.5834 0.4564 0.0597  -0.0162 0.0997  22  DT  C O4    
2851 C  C5    . DT  C 8   ? 0.6387 0.6950 0.4812 0.0089  -0.0568 0.0876  22  DT  C C5    
2852 C  C7    . DT  C 8   ? 0.6750 0.7524 0.4951 0.0465  -0.1274 0.1413  22  DT  C C7    
2853 C  C6    . DT  C 8   ? 0.6903 0.7429 0.4534 -0.0202 -0.0574 0.0560  22  DT  C C6    
2854 P  P     . DA  C 9   ? 1.0025 0.8551 0.5769 -0.0142 0.0761  -0.0248 23  DA  C P     
2855 O  OP1   . DA  C 9   ? 1.1071 0.9007 0.6447 -0.0309 0.0169  -0.0886 23  DA  C OP1   
2856 O  OP2   . DA  C 9   ? 0.9594 0.9069 0.5116 -0.0054 0.0294  -0.0144 23  DA  C OP2   
2857 O  "O5'" . DA  C 9   ? 0.9968 0.8375 0.5217 0.0117  0.0996  -0.0023 23  DA  C "O5'" 
2858 C  "C5'" . DA  C 9   ? 0.8937 0.7208 0.5215 -0.0049 0.0923  -0.0303 23  DA  C "C5'" 
2859 C  "C4'" . DA  C 9   ? 0.8673 0.7008 0.5227 0.0174  0.0994  0.0101  23  DA  C "C4'" 
2860 O  "O4'" . DA  C 9   ? 0.7795 0.6694 0.5062 0.0165  0.0642  0.0406  23  DA  C "O4'" 
2861 C  "C3'" . DA  C 9   ? 0.9441 0.7396 0.5414 0.0273  0.1394  0.0165  23  DA  C "C3'" 
2862 O  "O3'" . DA  C 9   ? 0.9575 0.7818 0.6257 0.0961  0.1738  0.0302  23  DA  C "O3'" 
2863 C  "C2'" . DA  C 9   ? 0.9024 0.7535 0.5158 0.0404  0.0929  0.0681  23  DA  C "C2'" 
2864 C  "C1'" . DA  C 9   ? 0.8117 0.7061 0.5134 0.0224  0.0810  0.0786  23  DA  C "C1'" 
2865 N  N9    . DA  C 9   ? 0.8062 0.6972 0.5276 0.0202  0.0340  0.0854  23  DA  C N9    
2866 C  C8    . DA  C 9   ? 0.8162 0.7173 0.5376 0.0092  0.0167  0.0875  23  DA  C C8    
2867 N  N7    . DA  C 9   ? 0.7787 0.7130 0.5032 0.0280  -0.0233 0.1233  23  DA  C N7    
2868 C  C5    . DA  C 9   ? 0.7510 0.6728 0.5089 0.0126  0.0040  0.1334  23  DA  C C5    
2869 C  C6    . DA  C 9   ? 0.7144 0.6347 0.4912 0.0289  0.0156  0.1687  23  DA  C C6    
2870 N  N6    . DA  C 9   ? 0.6949 0.6716 0.4593 0.0324  0.0013  0.1910  23  DA  C N6    
2871 N  N1    . DA  C 9   ? 0.7019 0.6528 0.4827 0.0044  0.0416  0.1577  23  DA  C N1    
2872 C  C2    . DA  C 9   ? 0.6974 0.6234 0.5242 -0.0090 0.0608  0.1516  23  DA  C C2    
2873 N  N3    . DA  C 9   ? 0.6785 0.5950 0.5697 0.0242  0.0582  0.1726  23  DA  C N3    
2874 C  C4    . DA  C 9   ? 0.7527 0.6590 0.5439 0.0144  0.0311  0.1114  23  DA  C C4    
2875 P  P     . DC  C 10  ? 1.0534 0.8211 0.6861 0.0753  0.2246  0.0700  24  DC  C P     
2876 O  OP1   . DC  C 10  ? 1.0358 0.8266 0.7944 0.1067  0.2752  0.0608  24  DC  C OP1   
2877 O  OP2   . DC  C 10  ? 1.1664 0.8923 0.6588 0.0956  0.2370  0.0464  24  DC  C OP2   
2878 O  "O5'" . DC  C 10  ? 1.0034 0.8169 0.6384 0.0839  0.2068  0.0863  24  DC  C "O5'" 
2879 C  "C5'" . DC  C 10  ? 0.8713 0.7423 0.6246 0.0519  0.2202  0.1294  24  DC  C "C5'" 
2880 C  "C4'" . DC  C 10  ? 0.8046 0.7645 0.6719 0.0278  0.2257  0.1871  24  DC  C "C4'" 
2881 O  "O4'" . DC  C 10  ? 0.7833 0.7364 0.6567 0.0057  0.2083  0.1729  24  DC  C "O4'" 
2882 C  "C3'" . DC  C 10  ? 0.8387 0.8396 0.7156 0.0473  0.2770  0.1925  24  DC  C "C3'" 
2883 O  "O3'" . DC  C 10  ? 0.8382 0.8747 0.8349 0.0244  0.2665  0.2108  24  DC  C "O3'" 
2884 C  "C2'" . DC  C 10  ? 0.8660 0.8368 0.6772 0.0097  0.2325  0.2031  24  DC  C "C2'" 
2885 C  "C1'" . DC  C 10  ? 0.8257 0.7473 0.6593 0.0168  0.1777  0.1978  24  DC  C "C1'" 
2886 N  N1    . DC  C 10  ? 0.8150 0.7701 0.6421 -0.0063 0.1307  0.1570  24  DC  C N1    
2887 C  C2    . DC  C 10  ? 0.8092 0.7767 0.6580 0.0062  0.0963  0.1453  24  DC  C C2    
2888 O  O2    . DC  C 10  ? 0.7944 0.7841 0.6696 0.0471  0.0939  0.1003  24  DC  C O2    
2889 N  N3    . DC  C 10  ? 0.8488 0.7594 0.5689 0.0026  0.0519  0.1655  24  DC  C N3    
2890 C  C4    . DC  C 10  ? 0.8929 0.7403 0.5324 0.0075  0.0322  0.1774  24  DC  C C4    
2891 N  N4    . DC  C 10  ? 0.8676 0.7519 0.5534 -0.0100 0.0001  0.1112  24  DC  C N4    
2892 C  C5    . DC  C 10  ? 0.9028 0.7755 0.5258 0.0090  0.0589  0.1394  24  DC  C C5    
2893 C  C6    . DC  C 10  ? 0.8538 0.7808 0.5757 0.0090  0.1359  0.1333  24  DC  C C6    
2894 P  P     . DC  C 11  ? 0.9014 0.9984 0.9719 0.0179  0.3389  0.2393  25  DC  C P     
2895 O  OP1   . DC  C 11  ? 0.9033 1.0883 1.1093 0.0595  0.3337  0.2819  25  DC  C OP1   
2896 O  OP2   . DC  C 11  ? 1.0109 1.0280 0.9265 0.0429  0.3160  0.1952  25  DC  C OP2   
2897 O  "O5'" . DC  C 11  ? 0.9145 1.0096 0.9973 -0.0010 0.2638  0.2668  25  DC  C "O5'" 
2898 C  "C5'" . DC  C 11  ? 0.8593 0.9197 0.8763 -0.0537 0.1875  0.2748  25  DC  C "C5'" 
2899 C  "C4'" . DC  C 11  ? 0.8697 0.9233 0.8760 -0.0397 0.1733  0.2750  25  DC  C "C4'" 
2900 O  "O4'" . DC  C 11  ? 0.9193 0.8688 0.8684 -0.0058 0.1126  0.2573  25  DC  C "O4'" 
2901 C  "C3'" . DC  C 11  ? 0.9368 0.9813 0.9286 -0.0805 0.2152  0.3441  25  DC  C "C3'" 
2902 O  "O3'" . DC  C 11  ? 0.9689 1.0318 1.0189 -0.1068 0.1550  0.3436  25  DC  C "O3'" 
2903 C  "C2'" . DC  C 11  ? 0.9548 0.9553 0.9144 -0.0567 0.2114  0.3123  25  DC  C "C2'" 
2904 C  "C1'" . DC  C 11  ? 0.9489 0.8967 0.8624 -0.0519 0.1717  0.2818  25  DC  C "C1'" 
2905 N  N1    . DC  C 11  ? 0.9862 0.8719 0.8770 -0.0366 0.1336  0.2621  25  DC  C N1    
2906 C  C2    . DC  C 11  ? 1.0004 0.8504 0.8608 -0.0460 0.1234  0.2547  25  DC  C C2    
2907 O  O2    . DC  C 11  ? 0.9865 0.8312 0.9122 -0.0584 0.0972  0.2857  25  DC  C O2    
2908 N  N3    . DC  C 11  ? 1.0129 0.8084 0.7571 -0.0105 0.1340  0.2547  25  DC  C N3    
2909 C  C4    . DC  C 11  ? 0.9898 0.8339 0.7330 -0.0168 0.1285  0.2420  25  DC  C C4    
2910 N  N4    . DC  C 11  ? 1.0207 0.7911 0.6449 0.0232  0.1181  0.2286  25  DC  C N4    
2911 C  C5    . DC  C 11  ? 0.9866 0.8568 0.8257 0.0024  0.1445  0.2020  25  DC  C C5    
2912 C  C6    . DC  C 11  ? 0.9808 0.8891 0.8645 -0.0108 0.1432  0.2205  25  DC  C C6    
2913 O  "O5'" . DG  D 1   ? 0.9276 0.7372 0.6421 0.0787  -0.0050 0.1889  1   DG  D "O5'" 
2914 C  "C5'" . DG  D 1   ? 0.8474 0.6911 0.5255 0.1475  -0.0817 0.2152  1   DG  D "C5'" 
2915 C  "C4'" . DG  D 1   ? 0.8403 0.6242 0.5139 0.1483  -0.0597 0.1859  1   DG  D "C4'" 
2916 O  "O4'" . DG  D 1   ? 0.7963 0.6279 0.4555 0.1156  -0.0544 0.1941  1   DG  D "O4'" 
2917 C  "C3'" . DG  D 1   ? 0.8236 0.6724 0.5119 0.1650  -0.0853 0.1634  1   DG  D "C3'" 
2918 O  "O3'" . DG  D 1   ? 0.8318 0.6677 0.7140 0.1401  -0.1543 0.1220  1   DG  D "O3'" 
2919 C  "C2'" . DG  D 1   ? 0.7566 0.6508 0.4904 0.1198  -0.0661 0.1554  1   DG  D "C2'" 
2920 C  "C1'" . DG  D 1   ? 0.7628 0.6585 0.4793 0.1000  -0.0966 0.1575  1   DG  D "C1'" 
2921 N  N9    . DG  D 1   ? 0.7137 0.6565 0.4684 0.0959  -0.0718 0.1536  1   DG  D N9    
2922 C  C8    . DG  D 1   ? 0.6720 0.6872 0.4721 0.0914  -0.0286 0.1524  1   DG  D C8    
2923 N  N7    . DG  D 1   ? 0.6533 0.6907 0.4407 0.0570  -0.0260 0.1324  1   DG  D N7    
2924 C  C5    . DG  D 1   ? 0.6549 0.6756 0.4710 0.0676  -0.0088 0.1446  1   DG  D C5    
2925 C  C6    . DG  D 1   ? 0.6504 0.6655 0.4667 0.0444  0.0011  0.1265  1   DG  D C6    
2926 O  O6    . DG  D 1   ? 0.7375 0.7046 0.4628 0.0398  0.0660  0.0505  1   DG  D O6    
2927 N  N1    . DG  D 1   ? 0.6463 0.6946 0.4852 0.0382  0.0014  0.1544  1   DG  D N1    
2928 C  C2    . DG  D 1   ? 0.6265 0.6945 0.4811 0.0352  -0.0323 0.1734  1   DG  D C2    
2929 N  N2    . DG  D 1   ? 0.6505 0.7447 0.4421 -0.0149 -0.0791 0.1609  1   DG  D N2    
2930 N  N3    . DG  D 1   ? 0.6772 0.6607 0.4621 0.0466  -0.0613 0.1868  1   DG  D N3    
2931 C  C4    . DG  D 1   ? 0.6593 0.6860 0.4722 0.0698  -0.0427 0.1452  1   DG  D C4    
2932 P  P     . DG  D 2   ? 0.8960 0.5355 0.5836 0.1342  -0.1867 0.1932  2   DG  D P     
2933 O  OP1   . DG  D 2   ? 0.9141 0.6528 0.6255 0.1509  -0.1180 0.2396  2   DG  D OP1   
2934 O  OP2   . DG  D 2   ? 0.9907 0.5930 0.5967 0.1037  -0.2820 0.1204  2   DG  D OP2   
2935 O  "O5'" . DG  D 2   ? 0.7670 0.5673 0.5320 0.0619  -0.2058 0.1495  2   DG  D "O5'" 
2936 C  "C5'" . DG  D 2   ? 0.7972 0.5463 0.5077 0.0728  -0.1852 0.1341  2   DG  D "C5'" 
2937 C  "C4'" . DG  D 2   ? 0.7633 0.5529 0.5055 0.0516  -0.1554 0.1615  2   DG  D "C4'" 
2938 O  "O4'" . DG  D 2   ? 0.7481 0.6085 0.4407 0.0278  -0.1204 0.1602  2   DG  D "O4'" 
2939 C  "C3'" . DG  D 2   ? 0.7721 0.5397 0.4877 0.0526  -0.1308 0.1416  2   DG  D "C3'" 
2940 O  "O3'" . DG  D 2   ? 0.7670 0.5293 0.5137 0.0061  -0.1301 0.1699  2   DG  D "O3'" 
2941 C  "C2'" . DG  D 2   ? 0.7070 0.5546 0.4771 0.0480  -0.0986 0.1363  2   DG  D "C2'" 
2942 C  "C1'" . DG  D 2   ? 0.6873 0.5834 0.4712 0.0397  -0.0953 0.1499  2   DG  D "C1'" 
2943 N  N9    . DG  D 2   ? 0.6342 0.5740 0.4229 0.0496  -0.0502 0.1522  2   DG  D N9    
2944 C  C8    . DG  D 2   ? 0.6351 0.5736 0.3976 0.0781  -0.0486 0.1466  2   DG  D C8    
2945 N  N7    . DG  D 2   ? 0.5845 0.5972 0.3829 0.0818  -0.0527 0.1445  2   DG  D N7    
2946 C  C5    . DG  D 2   ? 0.5818 0.5945 0.4302 0.0665  -0.0356 0.1267  2   DG  D C5    
2947 C  C6    . DG  D 2   ? 0.5517 0.6227 0.3780 0.0498  -0.0398 0.1146  2   DG  D C6    
2948 O  O6    . DG  D 2   ? 0.5346 0.6404 0.3451 0.0537  -0.0282 0.1083  2   DG  D O6    
2949 N  N1    . DG  D 2   ? 0.5474 0.6241 0.4155 0.0399  -0.0068 0.1420  2   DG  D N1    
2950 C  C2    . DG  D 2   ? 0.5479 0.6205 0.4849 0.0408  -0.0263 0.1496  2   DG  D C2    
2951 N  N2    . DG  D 2   ? 0.5204 0.6076 0.5512 0.0230  -0.0283 0.1745  2   DG  D N2    
2952 N  N3    . DG  D 2   ? 0.5712 0.5937 0.4773 0.0291  -0.0429 0.1711  2   DG  D N3    
2953 C  C4    . DG  D 2   ? 0.5941 0.5769 0.4488 0.0517  -0.0436 0.1501  2   DG  D C4    
2954 P  P     . DT  D 3   ? 0.7564 0.5531 0.5167 0.0083  -0.1539 0.1448  3   DT  D P     
2955 O  OP1   . DT  D 3   ? 0.8036 0.5477 0.5517 -0.0494 -0.1515 0.1626  3   DT  D OP1   
2956 O  OP2   . DT  D 3   ? 0.7814 0.5018 0.4641 0.0306  -0.1555 0.1657  3   DT  D OP2   
2957 O  "O5'" . DT  D 3   ? 0.6369 0.5569 0.5422 0.0048  -0.1328 0.1353  3   DT  D "O5'" 
2958 C  "C5'" . DT  D 3   ? 0.6383 0.5698 0.5388 -0.0236 -0.1093 0.1608  3   DT  D "C5'" 
2959 C  "C4'" . DT  D 3   ? 0.5393 0.5712 0.5131 0.0293  -0.0861 0.1737  3   DT  D "C4'" 
2960 O  "O4'" . DT  D 3   ? 0.5207 0.5458 0.4313 0.0586  -0.0515 0.1508  3   DT  D "O4'" 
2961 C  "C3'" . DT  D 3   ? 0.5319 0.5559 0.5033 0.0147  -0.0973 0.1579  3   DT  D "C3'" 
2962 O  "O3'" . DT  D 3   ? 0.5406 0.5570 0.5848 0.0219  -0.0828 0.1446  3   DT  D "O3'" 
2963 C  "C2'" . DT  D 3   ? 0.4741 0.5364 0.4784 0.0577  -0.0557 0.1324  3   DT  D "C2'" 
2964 C  "C1'" . DT  D 3   ? 0.4932 0.5410 0.4642 0.0668  -0.0221 0.1385  3   DT  D "C1'" 
2965 N  N1    . DT  D 3   ? 0.5039 0.5300 0.4147 0.0677  -0.0222 0.1284  3   DT  D N1    
2966 C  C2    . DT  D 3   ? 0.4844 0.5374 0.4355 0.0769  0.0159  0.1088  3   DT  D C2    
2967 O  O2    . DT  D 3   ? 0.4923 0.5512 0.4987 0.0985  0.0220  0.1263  3   DT  D O2    
2968 N  N3    . DT  D 3   ? 0.4852 0.5359 0.4182 0.0849  0.0052  0.1290  3   DT  D N3    
2969 C  C4    . DT  D 3   ? 0.5003 0.5239 0.4133 0.0960  -0.0292 0.1297  3   DT  D C4    
2970 O  O4    . DT  D 3   ? 0.4589 0.5748 0.4474 0.1300  -0.0158 0.1729  3   DT  D O4    
2971 C  C5    . DT  D 3   ? 0.5330 0.5314 0.3719 0.1002  -0.0443 0.1324  3   DT  D C5    
2972 C  C7    . DT  D 3   ? 0.5568 0.5214 0.3654 0.1137  -0.0689 0.1250  3   DT  D C7    
2973 C  C6    . DT  D 3   ? 0.5341 0.5041 0.3914 0.0783  -0.0411 0.1346  3   DT  D C6    
2974 P  P     . DA  D 4   ? 0.5617 0.6203 0.5975 0.0606  -0.1172 0.1130  4   DA  D P     
2975 O  OP1   . DA  D 4   ? 0.5521 0.6971 0.5903 0.0507  -0.1467 0.1622  4   DA  D OP1   
2976 O  OP2   . DA  D 4   ? 0.5290 0.6319 0.5129 0.0498  -0.1649 0.1534  4   DA  D OP2   
2977 O  "O5'" . DA  D 4   ? 0.5442 0.5802 0.6190 0.0702  -0.0599 0.1320  4   DA  D "O5'" 
2978 C  "C5'" . DA  D 4   ? 0.5234 0.5769 0.5661 0.0292  -0.0208 0.1949  4   DA  D "C5'" 
2979 C  "C4'" . DA  D 4   ? 0.4618 0.5644 0.5234 0.0650  0.0145  0.1597  4   DA  D "C4'" 
2980 O  "O4'" . DA  D 4   ? 0.4679 0.4760 0.4345 0.0875  0.0222  0.1334  4   DA  D "O4'" 
2981 C  "C3'" . DA  D 4   ? 0.4380 0.5838 0.5479 0.0277  0.0470  0.1836  4   DA  D "C3'" 
2982 O  "O3'" . DA  D 4   ? 0.4247 0.6377 0.6061 0.0772  0.0895  0.2098  4   DA  D "O3'" 
2983 C  "C2'" . DA  D 4   ? 0.4284 0.5380 0.4796 0.0640  0.0278  0.1393  4   DA  D "C2'" 
2984 C  "C1'" . DA  D 4   ? 0.4368 0.5173 0.4474 0.0793  0.0467  0.1132  4   DA  D "C1'" 
2985 N  N9    . DA  D 4   ? 0.4414 0.5214 0.4077 0.0857  0.0145  0.1087  4   DA  D N9    
2986 C  C8    . DA  D 4   ? 0.4517 0.5069 0.3919 0.0724  0.0181  0.1161  4   DA  D C8    
2987 N  N7    . DA  D 4   ? 0.4612 0.5151 0.3600 0.0777  -0.0046 0.1134  4   DA  D N7    
2988 C  C5    . DA  D 4   ? 0.4424 0.5162 0.3627 0.0877  0.0114  0.0997  4   DA  D C5    
2989 C  C6    . DA  D 4   ? 0.4358 0.5441 0.3962 0.0811  0.0255  0.0663  4   DA  D C6    
2990 N  N6    . DA  D 4   ? 0.4377 0.5817 0.4257 0.1025  -0.0116 0.0517  4   DA  D N6    
2991 N  N1    . DA  D 4   ? 0.4236 0.5527 0.3957 0.0658  0.0440  0.0611  4   DA  D N1    
2992 C  C2    . DA  D 4   ? 0.4577 0.5386 0.4063 0.0812  0.0680  0.0592  4   DA  D C2    
2993 N  N3    . DA  D 4   ? 0.4404 0.5379 0.4076 0.1314  0.0717  0.0503  4   DA  D N3    
2994 C  C4    . DA  D 4   ? 0.4421 0.5183 0.4078 0.0708  0.0404  0.0775  4   DA  D C4    
2995 P  P     . DT  D 5   ? 0.4849 0.5591 0.7399 0.0963  0.1031  0.2013  5   DT  D P     
2996 O  OP1   . DT  D 5   ? 0.4579 0.7231 0.8436 0.0458  0.2769  0.2272  5   DT  D OP1   
2997 O  OP2   . DT  D 5   ? 0.3885 0.5187 0.6574 0.0526  0.1235  0.2755  5   DT  D OP2   
2998 O  "O5'" . DT  D 5   ? 0.4603 0.5831 0.6295 0.1591  0.0194  0.1455  5   DT  D "O5'" 
2999 C  "C5'" . DT  D 5   ? 0.4395 0.5382 0.5772 0.1718  0.1180  0.0977  5   DT  D "C5'" 
3000 C  "C4'" . DT  D 5   ? 0.4853 0.5148 0.5610 0.1376  0.0994  0.0935  5   DT  D "C4'" 
3001 O  "O4'" . DT  D 5   ? 0.4457 0.5224 0.5304 0.1099  0.1199  0.0970  5   DT  D "O4'" 
3002 C  "C3'" . DT  D 5   ? 0.4537 0.5361 0.5643 0.1181  0.1139  0.1015  5   DT  D "C3'" 
3003 O  "O3'" . DT  D 5   ? 0.5002 0.5455 0.5811 0.1139  0.1450  0.0964  5   DT  D "O3'" 
3004 C  "C2'" . DT  D 5   ? 0.4533 0.4748 0.5184 0.0794  0.1123  0.0861  5   DT  D "C2'" 
3005 C  "C1'" . DT  D 5   ? 0.4276 0.5172 0.5040 0.0839  0.0850  0.0675  5   DT  D "C1'" 
3006 N  N1    . DT  D 5   ? 0.4116 0.4778 0.4611 0.0590  0.0538  0.0526  5   DT  D N1    
3007 C  C2    . DT  D 5   ? 0.4479 0.5162 0.4344 0.0701  0.0135  0.0266  5   DT  D C2    
3008 O  O2    . DT  D 5   ? 0.5384 0.5487 0.4095 0.0827  -0.0132 0.0230  5   DT  D O2    
3009 N  N3    . DT  D 5   ? 0.4272 0.5310 0.3833 0.0673  0.0089  0.0393  5   DT  D N3    
3010 C  C4    . DT  D 5   ? 0.3838 0.5339 0.3980 0.0661  -0.0048 0.0386  5   DT  D C4    
3011 O  O4    . DT  D 5   ? 0.3963 0.5267 0.3425 0.0666  -0.0360 0.0260  5   DT  D O4    
3012 C  C5    . DT  D 5   ? 0.3711 0.5294 0.3757 0.0532  0.0156  0.0590  5   DT  D C5    
3013 C  C7    . DT  D 5   ? 0.3099 0.5391 0.3989 0.0256  -0.0071 0.0741  5   DT  D C7    
3014 C  C6    . DT  D 5   ? 0.3559 0.5077 0.4123 0.0597  0.0238  0.0846  5   DT  D C6    
3015 P  P     . DC  D 6   ? 0.5842 0.5603 0.5662 0.0894  0.1519  0.0956  6   DC  D P     
3016 O  OP1   . DC  D 6   ? 0.6595 0.5217 0.6901 0.1358  0.1758  0.0857  6   DC  D OP1   
3017 O  OP2   . DC  D 6   ? 0.6048 0.5076 0.5948 0.0604  0.0662  0.1289  6   DC  D OP2   
3018 O  "O5'" . DC  D 6   ? 0.6105 0.5409 0.5051 0.0383  0.0844  0.1216  6   DC  D "O5'" 
3019 C  "C5'" . DC  D 6   ? 0.6276 0.5617 0.4662 0.0687  0.1439  0.0717  6   DC  D "C5'" 
3020 C  "C4'" . DC  D 6   ? 0.6516 0.5267 0.4738 0.0404  0.1096  0.0281  6   DC  D "C4'" 
3021 O  "O4'" . DC  D 6   ? 0.5787 0.5085 0.4381 0.0320  0.0718  0.0465  6   DC  D "O4'" 
3022 C  "C3'" . DC  D 6   ? 0.6990 0.5315 0.4922 0.0128  0.1150  0.0186  6   DC  D "C3'" 
3023 O  "O3'" . DC  D 6   ? 0.8032 0.5724 0.5349 -0.0300 0.0661  0.0254  6   DC  D "O3'" 
3024 C  "C2'" . DC  D 6   ? 0.6270 0.5315 0.4670 0.0252  0.0784  0.0252  6   DC  D "C2'" 
3025 C  "C1'" . DC  D 6   ? 0.5635 0.5214 0.4258 0.0147  0.0736  0.0031  6   DC  D "C1'" 
3026 N  N1    . DC  D 6   ? 0.5007 0.4977 0.4097 0.0258  0.0459  0.0179  6   DC  D N1    
3027 C  C2    . DC  D 6   ? 0.4832 0.5139 0.3862 0.0206  0.0108  0.0161  6   DC  D C2    
3028 O  O2    . DC  D 6   ? 0.5134 0.5371 0.3581 0.0126  0.0074  0.0054  6   DC  D O2    
3029 N  N3    . DC  D 6   ? 0.4252 0.4887 0.4308 0.0591  0.0165  0.0144  6   DC  D N3    
3030 C  C4    . DC  D 6   ? 0.4275 0.5001 0.3984 0.0827  0.0252  -0.0039 6   DC  D C4    
3031 N  N4    . DC  D 6   ? 0.3757 0.4299 0.4207 0.0752  0.0287  0.0170  6   DC  D N4    
3032 C  C5    . DC  D 6   ? 0.4352 0.5219 0.4676 0.0992  0.0295  -0.0035 6   DC  D C5    
3033 C  C6    . DC  D 6   ? 0.4676 0.5135 0.4359 0.0688  0.0392  0.0117  6   DC  D C6    
3034 P  P     . DC  D 7   ? 0.9017 0.5897 0.6296 -0.0819 0.0825  -0.0311 7   DC  D P     
3035 O  OP1   . DC  D 7   ? 1.0322 0.5451 0.6239 -0.1454 0.0335  -0.0143 7   DC  D OP1   
3036 O  OP2   . DC  D 7   ? 0.9253 0.4964 0.7356 -0.0690 0.0975  0.0584  7   DC  D OP2   
3037 O  "O5'" . DC  D 7   ? 0.8125 0.6259 0.6057 -0.1399 0.0004  -0.0189 7   DC  D "O5'" 
3038 C  "C5'" . DC  D 7   ? 0.8460 0.6160 0.4927 -0.1140 0.0194  -0.0290 7   DC  D "C5'" 
3039 C  "C4'" . DC  D 7   ? 0.7957 0.6666 0.4744 -0.0948 -0.0147 0.0064  7   DC  D "C4'" 
3040 O  "O4'" . DC  D 7   ? 0.7116 0.6790 0.4915 -0.0933 -0.0055 0.0014  7   DC  D "O4'" 
3041 C  "C3'" . DC  D 7   ? 0.7870 0.6368 0.4741 -0.1135 -0.0290 -0.0167 7   DC  D "C3'" 
3042 O  "O3'" . DC  D 7   ? 0.8134 0.6909 0.4485 -0.1374 -0.0585 -0.0022 7   DC  D "O3'" 
3043 C  "C2'" . DC  D 7   ? 0.7310 0.6516 0.4350 -0.1005 -0.0213 0.0330  7   DC  D "C2'" 
3044 C  "C1'" . DC  D 7   ? 0.6969 0.6525 0.4509 -0.0845 -0.0386 0.0199  7   DC  D "C1'" 
3045 N  N1    . DC  D 7   ? 0.5684 0.5928 0.4427 -0.0533 -0.0026 0.0304  7   DC  D N1    
3046 C  C2    . DC  D 7   ? 0.5004 0.5947 0.4529 -0.0431 -0.0240 0.0542  7   DC  D C2    
3047 O  O2    . DC  D 7   ? 0.4949 0.6151 0.4589 -0.0743 -0.0198 0.0664  7   DC  D O2    
3048 N  N3    . DC  D 7   ? 0.4603 0.5546 0.4628 -0.0202 0.0033  0.0491  7   DC  D N3    
3049 C  C4    . DC  D 7   ? 0.4511 0.5304 0.4380 -0.0101 0.0207  0.0373  7   DC  D C4    
3050 N  N4    . DC  D 7   ? 0.4428 0.4720 0.4315 0.0196  0.0491  0.0407  7   DC  D N4    
3051 C  C5    . DC  D 7   ? 0.4840 0.4724 0.4584 -0.0276 0.0244  0.0236  7   DC  D C5    
3052 C  C6    . DC  D 7   ? 0.5595 0.4896 0.4487 -0.0169 0.0164  0.0107  7   DC  D C6    
3053 P  P     . DT  D 8   ? 0.8559 0.6994 0.5031 -0.1999 -0.0775 -0.0175 8   DT  D P     
3054 O  OP1   . DT  D 8   ? 0.9230 0.7406 0.5187 -0.2495 -0.1040 -0.0048 8   DT  D OP1   
3055 O  OP2   . DT  D 8   ? 0.8649 0.6372 0.4778 -0.1814 -0.0426 -0.0294 8   DT  D OP2   
3056 O  "O5'" . DT  D 8   ? 0.7636 0.7499 0.5064 -0.2148 -0.0875 0.0091  8   DT  D "O5'" 
3057 C  "C5'" . DT  D 8   ? 0.7065 0.8364 0.5000 -0.2369 -0.1171 0.0514  8   DT  D "C5'" 
3058 C  "C4'" . DT  D 8   ? 0.6202 0.8525 0.5169 -0.2263 -0.1084 0.0708  8   DT  D "C4'" 
3059 O  "O4'" . DT  D 8   ? 0.5216 0.7944 0.4690 -0.1429 -0.0970 0.0708  8   DT  D "O4'" 
3060 C  "C3'" . DT  D 8   ? 0.6572 0.8876 0.4925 -0.2438 -0.1234 0.0827  8   DT  D "C3'" 
3061 O  "O3'" . DT  D 8   ? 0.6570 1.0003 0.4951 -0.2799 -0.1527 0.0866  8   DT  D "O3'" 
3062 C  "C2'" . DT  D 8   ? 0.5374 0.8346 0.5045 -0.2179 -0.0943 0.0650  8   DT  D "C2'" 
3063 C  "C1'" . DT  D 8   ? 0.5134 0.8028 0.4821 -0.1457 -0.0820 0.0814  8   DT  D "C1'" 
3064 N  N1    . DT  D 8   ? 0.4923 0.7120 0.4776 -0.1384 -0.0518 0.0623  8   DT  D N1    
3065 C  C2    . DT  D 8   ? 0.4326 0.7060 0.4621 -0.0848 -0.0401 0.0736  8   DT  D C2    
3066 O  O2    . DT  D 8   ? 0.4022 0.7672 0.4512 -0.0859 -0.0288 0.0868  8   DT  D O2    
3067 N  N3    . DT  D 8   ? 0.4184 0.6087 0.4598 -0.0645 -0.0266 0.0561  8   DT  D N3    
3068 C  C4    . DT  D 8   ? 0.4403 0.5806 0.4213 -0.0549 -0.0124 0.0496  8   DT  D C4    
3069 O  O4    . DT  D 8   ? 0.3608 0.5415 0.4349 0.0118  0.0084  0.0584  8   DT  D O4    
3070 C  C5    . DT  D 8   ? 0.5026 0.5738 0.4589 -0.0924 -0.0068 0.0448  8   DT  D C5    
3071 C  C7    . DT  D 8   ? 0.5630 0.4966 0.4755 -0.0733 -0.0005 0.0255  8   DT  D C7    
3072 C  C6    . DT  D 8   ? 0.5377 0.6190 0.4519 -0.1298 -0.0382 0.0692  8   DT  D C6    
3073 P  P     . DC  D 9   ? 0.6772 1.0597 0.5712 -0.3316 -0.1536 0.1138  9   DC  D P     
3074 O  OP1   . DC  D 9   ? 0.7148 1.1707 0.5682 -0.3826 -0.1877 0.1348  9   DC  D OP1   
3075 O  OP2   . DC  D 9   ? 0.7406 0.9992 0.5484 -0.3362 -0.1577 0.0473  9   DC  D OP2   
3076 O  "O5'" . DC  D 9   ? 0.5346 1.0544 0.5582 -0.3096 -0.1212 0.1270  9   DC  D "O5'" 
3077 C  "C5'" . DC  D 9   ? 0.4917 1.1071 0.5931 -0.2689 -0.1285 0.1484  9   DC  D "C5'" 
3078 C  "C4'" . DC  D 9   ? 0.4539 1.0914 0.5761 -0.2347 -0.1009 0.1603  9   DC  D "C4'" 
3079 O  "O4'" . DC  D 9   ? 0.4156 0.9892 0.5353 -0.1532 -0.1033 0.1214  9   DC  D "O4'" 
3080 C  "C3'" . DC  D 9   ? 0.4713 1.1153 0.5694 -0.2483 -0.1150 0.1656  9   DC  D "C3'" 
3081 O  "O3'" . DC  D 9   ? 0.4773 1.1962 0.6157 -0.2225 -0.0987 0.1726  9   DC  D "O3'" 
3082 C  "C2'" . DC  D 9   ? 0.4504 1.0142 0.5035 -0.1922 -0.0786 0.1370  9   DC  D "C2'" 
3083 C  "C1'" . DC  D 9   ? 0.4040 0.9500 0.5203 -0.1469 -0.0810 0.1131  9   DC  D "C1'" 
3084 N  N1    . DC  D 9   ? 0.4033 0.8397 0.4776 -0.1058 -0.0537 0.0978  9   DC  D N1    
3085 C  C2    . DC  D 9   ? 0.3616 0.7826 0.4748 -0.0675 -0.0342 0.1001  9   DC  D C2    
3086 O  O2    . DC  D 9   ? 0.2759 0.8216 0.5245 -0.0272 -0.0569 0.1354  9   DC  D O2    
3087 N  N3    . DC  D 9   ? 0.3582 0.6683 0.4451 -0.0579 -0.0112 0.0699  9   DC  D N3    
3088 C  C4    . DC  D 9   ? 0.3845 0.6439 0.4033 -0.0847 0.0043  0.0672  9   DC  D C4    
3089 N  N4    . DC  D 9   ? 0.3786 0.5279 0.4103 -0.0481 0.0247  0.0515  9   DC  D N4    
3090 C  C5    . DC  D 9   ? 0.4507 0.6693 0.3964 -0.1182 -0.0127 0.0728  9   DC  D C5    
3091 C  C6    . DC  D 9   ? 0.4535 0.7820 0.4327 -0.1535 -0.0451 0.0827  9   DC  D C6    
3092 P  P     . DC  D 10  ? 0.5186 1.3076 0.6353 -0.1851 -0.0414 0.1566  10  DC  D P     
3093 O  OP1   . DC  D 10  ? 0.4723 1.4534 0.7103 -0.2623 -0.1389 0.1965  10  DC  D OP1   
3094 O  OP2   . DC  D 10  ? 0.6378 1.2394 0.5701 -0.2822 -0.1006 0.1691  10  DC  D OP2   
3095 O  "O5'" . DC  D 10  ? 0.4183 1.2255 0.6368 -0.1536 0.0027  0.1547  10  DC  D "O5'" 
3096 C  "C5'" . DC  D 10  ? 0.3396 1.2267 0.6264 -0.0842 0.0112  0.1691  10  DC  D "C5'" 
3097 C  "C4'" . DC  D 10  ? 0.3507 1.1970 0.6018 -0.0230 0.0149  0.1805  10  DC  D "C4'" 
3098 O  "O4'" . DC  D 10  ? 0.3544 1.0876 0.5194 0.0241  -0.0300 0.1277  10  DC  D "O4'" 
3099 C  "C3'" . DC  D 10  ? 0.3749 1.2470 0.6058 -0.0373 -0.0100 0.2091  10  DC  D "C3'" 
3100 O  "O3'" . DC  D 10  ? 0.4789 1.2946 0.6462 -0.0107 0.0331  0.1886  10  DC  D "O3'" 
3101 C  "C2'" . DC  D 10  ? 0.3974 1.1160 0.5882 -0.0549 -0.0328 0.1540  10  DC  D "C2'" 
3102 C  "C1'" . DC  D 10  ? 0.3601 1.0217 0.5167 0.0038  -0.0065 0.1306  10  DC  D "C1'" 
3103 N  N1    . DC  D 10  ? 0.3449 0.9230 0.4934 -0.0318 -0.0294 0.1158  10  DC  D N1    
3104 C  C2    . DC  D 10  ? 0.3362 0.8278 0.4972 -0.0366 0.0108  0.0694  10  DC  D C2    
3105 O  O2    . DC  D 10  ? 0.4758 0.8368 0.5533 -0.0299 0.0308  0.0410  10  DC  D O2    
3106 N  N3    . DC  D 10  ? 0.3157 0.7061 0.4848 -0.0675 -0.0170 0.0617  10  DC  D N3    
3107 C  C4    . DC  D 10  ? 0.3623 0.7413 0.4617 -0.0770 -0.0221 0.0588  10  DC  D C4    
3108 N  N4    . DC  D 10  ? 0.4140 0.6461 0.3723 -0.0698 -0.0021 0.0353  10  DC  D N4    
3109 C  C5    . DC  D 10  ? 0.4023 0.8143 0.4524 -0.0977 -0.0432 0.0542  10  DC  D C5    
3110 C  C6    . DC  D 10  ? 0.3335 0.9066 0.4935 -0.1044 -0.0690 0.1145  10  DC  D C6    
3111 P  P     . DA  D 11  ? 0.4489 1.4159 0.6768 0.0458  0.0630  0.1929  11  DA  D P     
3112 O  OP1   . DA  D 11  ? 0.5307 1.5193 0.7141 0.0786  -0.0160 0.2717  11  DA  D OP1   
3113 O  OP2   . DA  D 11  ? 0.5233 1.4096 0.6023 -0.0127 0.0009  0.2113  11  DA  D OP2   
3114 O  "O5'" . DA  D 11  ? 0.4037 1.3351 0.6758 0.0740  0.0568  0.2190  11  DA  D "O5'" 
3115 C  "C5'" . DA  D 11  ? 0.4192 1.2948 0.6525 0.1584  0.0814  0.2248  11  DA  D "C5'" 
3116 C  "C4'" . DA  D 11  ? 0.4432 1.2221 0.6097 0.1825  0.1025  0.2371  11  DA  D "C4'" 
3117 O  "O4'" . DA  D 11  ? 0.4428 1.0966 0.5892 0.1413  0.0795  0.2028  11  DA  D "O4'" 
3118 C  "C3'" . DA  D 11  ? 0.4260 1.3005 0.6336 0.1867  0.1340  0.2528  11  DA  D "C3'" 
3119 O  "O3'" . DA  D 11  ? 0.4744 1.3133 0.6401 0.2157  0.1603  0.2351  11  DA  D "O3'" 
3120 C  "C2'" . DA  D 11  ? 0.4100 1.2135 0.5943 0.1223  0.1076  0.2392  11  DA  D "C2'" 
3121 C  "C1'" . DA  D 11  ? 0.3912 1.0720 0.5837 0.1387  0.0876  0.1886  11  DA  D "C1'" 
3122 N  N9    . DA  D 11  ? 0.3505 0.9855 0.5439 0.0945  0.0465  0.1965  11  DA  D N9    
3123 C  C8    . DA  D 11  ? 0.3377 1.0122 0.5962 0.0359  0.0155  0.2063  11  DA  D C8    
3124 N  N7    . DA  D 11  ? 0.3619 0.9170 0.5737 -0.0229 0.0060  0.1558  11  DA  D N7    
3125 C  C5    . DA  D 11  ? 0.3531 0.8604 0.5541 0.0207  0.0074  0.1243  11  DA  D C5    
3126 C  C6    . DA  D 11  ? 0.3427 0.7796 0.5132 -0.0226 0.0231  0.0883  11  DA  D C6    
3127 N  N6    . DA  D 11  ? 0.3582 0.7058 0.5852 -0.0747 0.0169  0.0726  11  DA  D N6    
3128 N  N1    . DA  D 11  ? 0.3560 0.6896 0.4919 0.0385  -0.0017 0.0847  11  DA  D N1    
3129 C  C2    . DA  D 11  ? 0.3734 0.6961 0.4984 0.0600  0.0212  0.0930  11  DA  D C2    
3130 N  N3    . DA  D 11  ? 0.3759 0.7744 0.5077 0.0676  0.0547  0.1097  11  DA  D N3    
3131 C  C4    . DA  D 11  ? 0.3455 0.8843 0.5215 0.0593  0.0261  0.1395  11  DA  D C4    
3132 P  P     . DT  D 12  ? 0.5213 1.3292 0.6214 0.2896  0.1343  0.2548  12  DT  D P     
3133 O  OP1   . DT  D 12  ? 0.6767 1.3713 0.6845 0.4022  0.1831  0.2655  12  DT  D OP1   
3134 O  OP2   . DT  D 12  ? 0.4999 1.4604 0.6295 0.2092  0.1304  0.2814  12  DT  D OP2   
3135 O  "O5'" . DT  D 12  ? 0.4530 1.2007 0.6807 0.2745  0.1584  0.1689  12  DT  D "O5'" 
3136 C  "C5'" . DT  D 12  ? 0.5023 1.0808 0.6117 0.2541  0.1210  0.1544  12  DT  D "C5'" 
3137 C  "C4'" . DT  D 12  ? 0.5165 1.0091 0.5947 0.2372  0.1103  0.1389  12  DT  D "C4'" 
3138 O  "O4'" . DT  D 12  ? 0.5889 0.9061 0.5665 0.1879  0.0525  0.1201  12  DT  D "O4'" 
3139 C  "C3'" . DT  D 12  ? 0.6179 1.0560 0.6042 0.2388  0.1110  0.1463  12  DT  D "C3'" 
3140 O  "O3'" . DT  D 12  ? 0.6812 0.9810 0.6164 0.2771  0.0849  0.0563  12  DT  D "O3'" 
3141 C  "C2'" . DT  D 12  ? 0.4934 1.0663 0.6548 0.1723  0.0961  0.1282  12  DT  D "C2'" 
3142 C  "C1'" . DT  D 12  ? 0.5469 0.9520 0.5424 0.1282  0.0888  0.1431  12  DT  D "C1'" 
3143 N  N1    . DT  D 12  ? 0.4496 0.9533 0.5719 0.0660  0.0219  0.1530  12  DT  D N1    
3144 C  C2    . DT  D 12  ? 0.4139 0.8662 0.5514 0.0437  -0.0247 0.1659  12  DT  D C2    
3145 O  O2    . DT  D 12  ? 0.4246 0.7550 0.5064 0.0530  -0.0322 0.1873  12  DT  D O2    
3146 N  N3    . DT  D 12  ? 0.4533 0.8791 0.5292 0.0076  -0.0573 0.1863  12  DT  D N3    
3147 C  C4    . DT  D 12  ? 0.4058 0.9657 0.5947 -0.0396 0.0121  0.1572  12  DT  D C4    
3148 O  O4    . DT  D 12  ? 0.5612 0.9803 0.6205 -0.0598 -0.0034 0.1391  12  DT  D O4    
3149 C  C5    . DT  D 12  ? 0.3770 1.0755 0.5904 -0.0054 0.0174  0.2069  12  DT  D C5    
3150 C  C7    . DT  D 12  ? 0.3434 1.1234 0.5505 -0.0075 0.0395  0.2639  12  DT  D C7    
3151 C  C6    . DT  D 12  ? 0.4069 1.0492 0.6018 0.0412  0.0571  0.1968  12  DT  D C6    
3152 P  P     . DT  D 13  ? 0.6480 1.0044 0.6172 0.3156  0.1083  0.0773  13  DT  D P     
3153 O  OP1   . DT  D 13  ? 0.8100 0.9429 0.7517 0.4015  0.0455  0.1169  13  DT  D OP1   
3154 O  OP2   . DT  D 13  ? 0.7374 1.0429 0.7141 0.2708  0.1537  0.1070  13  DT  D OP2   
3155 O  "O5'" . DT  D 13  ? 0.6218 0.8448 0.5818 0.2706  0.1028  0.0619  13  DT  D "O5'" 
3156 C  "C5'" . DT  D 13  ? 0.6134 0.7867 0.5238 0.2366  0.0714  0.0571  13  DT  D "C5'" 
3157 C  "C4'" . DT  D 13  ? 0.6142 0.6986 0.5495 0.1781  0.0633  0.0744  13  DT  D "C4'" 
3158 O  "O4'" . DT  D 13  ? 0.6018 0.7294 0.6323 0.0784  0.0615  0.0645  13  DT  D "O4'" 
3159 C  "C3'" . DT  D 13  ? 0.5762 0.7519 0.5507 0.1745  0.0037  0.0746  13  DT  D "C3'" 
3160 O  "O3'" . DT  D 13  ? 0.5326 0.6817 0.6035 0.1247  0.0230  0.0475  13  DT  D "O3'" 
3161 C  "C2'" . DT  D 13  ? 0.6401 0.7872 0.5559 0.1233  0.0195  0.0935  13  DT  D "C2'" 
3162 C  "C1'" . DT  D 13  ? 0.6413 0.7675 0.5778 0.0648  0.0484  0.0706  13  DT  D "C1'" 
3163 N  N1    . DT  D 13  ? 0.4646 0.8689 0.6451 0.0156  0.0713  0.1183  13  DT  D N1    
3164 C  C2    . DT  D 13  ? 0.4326 0.8107 0.6872 0.0180  0.0014  0.0749  13  DT  D C2    
3165 O  O2    . DT  D 13  ? 0.3941 0.8553 0.7274 0.0828  -0.0290 0.0546  13  DT  D O2    
3166 N  N3    . DT  D 13  ? 0.3656 0.7903 0.7444 -0.0282 0.0052  0.1808  13  DT  D N3    
3167 C  C4    . DT  D 13  ? 0.3731 0.8791 0.7509 0.0163  0.0352  0.1879  13  DT  D C4    
3168 O  O4    . DT  D 13  ? 0.4986 0.8610 0.7656 -0.0423 -0.0450 0.2670  13  DT  D O4    
3169 C  C5    . DT  D 13  ? 0.4105 0.9356 0.7256 0.0232  0.0773  0.1950  13  DT  D C5    
3170 C  C7    . DT  D 13  ? 0.4308 0.9753 0.7596 0.1103  0.1566  0.2789  13  DT  D C7    
3171 C  C6    . DT  D 13  ? 0.4163 0.8924 0.6992 0.1035  0.0373  0.1487  13  DT  D C6    
3172 P  P     . DA  D 14  ? 0.5484 0.5526 0.5182 0.1593  0.0588  0.0347  14  DA  D P     
3173 O  OP1   . DA  D 14  ? 0.6609 0.5186 0.4484 0.1885  0.1222  0.0000  14  DA  D OP1   
3174 O  OP2   . DA  D 14  ? 0.6253 0.5216 0.5090 0.2086  0.0738  -0.0008 14  DA  D OP2   
3175 O  "O5'" . DA  D 14  ? 0.4607 0.5323 0.4374 0.0994  0.0266  -0.0096 14  DA  D "O5'" 
3176 C  "C5'" . DA  D 14  ? 0.4319 0.4813 0.4268 0.0792  0.0093  -0.0040 14  DA  D "C5'" 
3177 C  "C4'" . DA  D 14  ? 0.3920 0.4666 0.3982 0.0696  0.0125  0.0170  14  DA  D "C4'" 
3178 O  "O4'" . DA  D 14  ? 0.3733 0.4774 0.4238 0.0817  0.0173  0.0459  14  DA  D "O4'" 
3179 C  "C3'" . DA  D 14  ? 0.4012 0.4164 0.3943 0.0411  0.0044  0.0155  14  DA  D "C3'" 
3180 O  "O3'" . DA  D 14  ? 0.3648 0.4079 0.4009 0.0221  0.0031  0.0148  14  DA  D "O3'" 
3181 C  "C2'" . DA  D 14  ? 0.4058 0.4204 0.4038 0.0500  0.0208  0.0332  14  DA  D "C2'" 
3182 C  "C1'" . DA  D 14  ? 0.3766 0.4689 0.4125 0.0382  0.0269  0.0454  14  DA  D "C1'" 
3183 N  N9    . DA  D 14  ? 0.3879 0.5089 0.4392 0.0389  0.0401  0.0676  14  DA  D N9    
3184 C  C8    . DA  D 14  ? 0.4300 0.5267 0.4225 0.0623  0.0532  0.0970  14  DA  D C8    
3185 N  N7    . DA  D 14  ? 0.4203 0.6015 0.4301 0.0667  0.0578  0.1142  14  DA  D N7    
3186 C  C5    . DA  D 14  ? 0.3931 0.6053 0.4438 0.0254  0.0449  0.1169  14  DA  D C5    
3187 C  C6    . DA  D 14  ? 0.3749 0.6816 0.4514 0.0084  0.0380  0.1375  14  DA  D C6    
3188 N  N6    . DA  D 14  ? 0.3917 0.7647 0.4422 0.0225  0.0464  0.1536  14  DA  D N6    
3189 N  N1    . DA  D 14  ? 0.3588 0.6586 0.4638 -0.0416 0.0059  0.1263  14  DA  D N1    
3190 C  C2    . DA  D 14  ? 0.3435 0.5927 0.4858 -0.0453 0.0019  0.1131  14  DA  D C2    
3191 N  N3    . DA  D 14  ? 0.3482 0.5157 0.4797 -0.0275 0.0176  0.0849  14  DA  D N3    
3192 C  C4    . DA  D 14  ? 0.3705 0.5559 0.4593 0.0076  0.0376  0.0945  14  DA  D C4    
3193 P  P     . DT  D 15  ? 0.3317 0.3865 0.4437 -0.0134 0.0032  0.0182  15  DT  D P     
3194 O  OP1   . DT  D 15  ? 0.2979 0.3239 0.4884 -0.0179 -0.0029 -0.0101 15  DT  D OP1   
3195 O  OP2   . DT  D 15  ? 0.3505 0.3313 0.4384 0.0052  0.0023  0.0367  15  DT  D OP2   
3196 O  "O5'" . DT  D 15  ? 0.3113 0.3774 0.4536 -0.0236 0.0151  0.0056  15  DT  D "O5'" 
3197 C  "C5'" . DT  D 15  ? 0.3282 0.3683 0.4948 -0.0244 -0.0040 0.0216  15  DT  D "C5'" 
3198 C  "C4'" . DT  D 15  ? 0.3520 0.4053 0.4539 -0.0397 0.0078  0.0193  15  DT  D "C4'" 
3199 O  "O4'" . DT  D 15  ? 0.3551 0.3952 0.4374 -0.0090 -0.0001 0.0475  15  DT  D "O4'" 
3200 C  "C3'" . DT  D 15  ? 0.3396 0.3950 0.4845 -0.0558 0.0005  0.0273  15  DT  D "C3'" 
3201 O  "O3'" . DT  D 15  ? 0.3467 0.3806 0.4831 -0.1143 0.0151  0.0402  15  DT  D "O3'" 
3202 C  "C2'" . DT  D 15  ? 0.4081 0.3951 0.4618 -0.0714 0.0103  0.0509  15  DT  D "C2'" 
3203 C  "C1'" . DT  D 15  ? 0.3847 0.4454 0.4375 -0.0536 0.0005  0.0524  15  DT  D "C1'" 
3204 N  N1    . DT  D 15  ? 0.3817 0.4660 0.4576 -0.0460 0.0116  0.0873  15  DT  D N1    
3205 C  C2    . DT  D 15  ? 0.3846 0.5420 0.4640 -0.0611 0.0052  0.1132  15  DT  D C2    
3206 O  O2    . DT  D 15  ? 0.4051 0.5950 0.4626 -0.0331 0.0320  0.0987  15  DT  D O2    
3207 N  N3    . DT  D 15  ? 0.4082 0.5837 0.4713 -0.0712 0.0270  0.1229  15  DT  D N3    
3208 C  C4    . DT  D 15  ? 0.3919 0.5751 0.4797 -0.0583 0.0361  0.1173  15  DT  D C4    
3209 O  O4    . DT  D 15  ? 0.4247 0.6409 0.5017 -0.0779 0.0668  0.1214  15  DT  D O4    
3210 C  C5    . DT  D 15  ? 0.3862 0.5114 0.4506 -0.0291 0.0268  0.0962  15  DT  D C5    
3211 C  C7    . DT  D 15  ? 0.3598 0.5239 0.4477 -0.0002 0.0382  0.0892  15  DT  D C7    
3212 C  C6    . DT  D 15  ? 0.3714 0.4702 0.4520 -0.0330 0.0171  0.0906  15  DT  D C6    
3213 O  OP3   . DC  E 1   ? 0.4729 1.3301 0.5500 -0.3063 -0.0679 0.3682  16  DC  E OP3   
3214 P  P     . DC  E 1   ? 0.4465 1.2903 0.5823 -0.3416 -0.1161 0.2995  16  DC  E P     
3215 O  OP1   . DC  E 1   ? 0.4469 1.4127 0.7628 -0.3749 -0.1204 0.3580  16  DC  E OP1   
3216 O  OP2   . DC  E 1   ? 0.4919 1.3030 0.4568 -0.4273 -0.0835 0.2110  16  DC  E OP2   
3217 O  "O5'" . DC  E 1   ? 0.4315 1.1236 0.5536 -0.2565 -0.0635 0.2794  16  DC  E "O5'" 
3218 C  "C5'" . DC  E 1   ? 0.4210 0.9476 0.5452 -0.3104 -0.0514 0.2013  16  DC  E "C5'" 
3219 C  "C4'" . DC  E 1   ? 0.4142 1.0234 0.5332 -0.3245 -0.0821 0.2734  16  DC  E "C4'" 
3220 O  "O4'" . DC  E 1   ? 0.3922 0.9967 0.5629 -0.2660 -0.0867 0.3454  16  DC  E "O4'" 
3221 C  "C3'" . DC  E 1   ? 0.4197 0.9609 0.4486 -0.3694 -0.0685 0.2033  16  DC  E "C3'" 
3222 O  "O3'" . DC  E 1   ? 0.4710 1.0615 0.4065 -0.4367 -0.0821 0.2125  16  DC  E "O3'" 
3223 C  "C2'" . DC  E 1   ? 0.4022 0.9200 0.4757 -0.3032 -0.0637 0.2272  16  DC  E "C2'" 
3224 C  "C1'" . DC  E 1   ? 0.4117 0.9888 0.5477 -0.3032 -0.1129 0.3382  16  DC  E "C1'" 
3225 N  N1    . DC  E 1   ? 0.3215 0.8958 0.6071 -0.1989 -0.0856 0.3807  16  DC  E N1    
3226 C  C2    . DC  E 1   ? 0.2945 0.9955 0.6511 -0.1979 -0.1310 0.4477  16  DC  E C2    
3227 O  O2    . DC  E 1   ? 0.2830 1.1486 0.7159 -0.2744 -0.1519 0.4792  16  DC  E O2    
3228 N  N3    . DC  E 1   ? 0.2654 0.9525 0.6913 -0.1017 -0.0886 0.4841  16  DC  E N3    
3229 C  C4    . DC  E 1   ? 0.2663 0.8140 0.6529 -0.0290 -0.0576 0.4305  16  DC  E C4    
3230 N  N4    . DC  E 1   ? 0.2178 0.7909 0.7081 0.0399  -0.0257 0.4386  16  DC  E N4    
3231 C  C5    . DC  E 1   ? 0.2733 0.7068 0.5954 -0.0519 -0.0558 0.3642  16  DC  E C5    
3232 C  C6    . DC  E 1   ? 0.3093 0.7586 0.5599 -0.1131 -0.0711 0.3492  16  DC  E C6    
3233 P  P     . DA  E 2   ? 0.5610 1.0142 0.3739 -0.5092 -0.0591 0.1309  17  DA  E P     
3234 O  OP1   . DA  E 2   ? 0.6571 1.1395 0.3716 -0.6171 -0.0908 0.1329  17  DA  E OP1   
3235 O  OP2   . DA  E 2   ? 0.5675 0.8220 0.3183 -0.4277 -0.0288 0.0654  17  DA  E OP2   
3236 O  "O5'" . DA  E 2   ? 0.5469 1.0208 0.3904 -0.4884 -0.0659 0.1710  17  DA  E "O5'" 
3237 C  "C5'" . DA  E 2   ? 0.5716 1.1835 0.4682 -0.5742 -0.1312 0.2525  17  DA  E "C5'" 
3238 C  "C4'" . DA  E 2   ? 0.5251 1.2050 0.4940 -0.5309 -0.1346 0.2969  17  DA  E "C4'" 
3239 O  "O4'" . DA  E 2   ? 0.4121 1.0917 0.5082 -0.4070 -0.1080 0.3432  17  DA  E "O4'" 
3240 C  "C3'" . DA  E 2   ? 0.6262 1.0903 0.5174 -0.5170 -0.1073 0.2215  17  DA  E "C3'" 
3241 O  "O3'" . DA  E 2   ? 0.6641 1.2374 0.7427 -0.5865 -0.1166 0.2296  17  DA  E "O3'" 
3242 C  "C2'" . DA  E 2   ? 0.5487 0.9734 0.5067 -0.4123 -0.0710 0.2421  17  DA  E "C2'" 
3243 C  "C1'" . DA  E 2   ? 0.4439 1.0576 0.5057 -0.3775 -0.1014 0.3321  17  DA  E "C1'" 
3244 N  N9    . DA  E 2   ? 0.3609 0.9367 0.5200 -0.2748 -0.0973 0.3441  17  DA  E N9    
3245 C  C8    . DA  E 2   ? 0.3473 0.7859 0.4885 -0.2193 -0.0819 0.2765  17  DA  E C8    
3246 N  N7    . DA  E 2   ? 0.2851 0.7295 0.5113 -0.1392 -0.0801 0.2866  17  DA  E N7    
3247 C  C5    . DA  E 2   ? 0.2999 0.8263 0.5739 -0.1318 -0.0543 0.3403  17  DA  E C5    
3248 C  C6    . DA  E 2   ? 0.2771 0.8054 0.6380 -0.0553 -0.0356 0.3745  17  DA  E C6    
3249 N  N6    . DA  E 2   ? 0.2124 0.7114 0.6333 0.0251  0.0059  0.3482  17  DA  E N6    
3250 N  N1    . DA  E 2   ? 0.2762 0.9225 0.6803 -0.0607 -0.0345 0.4603  17  DA  E N1    
3251 C  C2    . DA  E 2   ? 0.3009 1.0417 0.6779 -0.1530 -0.0868 0.4974  17  DA  E C2    
3252 N  N3    . DA  E 2   ? 0.3380 1.0530 0.6094 -0.2468 -0.1209 0.4575  17  DA  E N3    
3253 C  C4    . DA  E 2   ? 0.3402 0.9441 0.5659 -0.2201 -0.0926 0.3838  17  DA  E C4    
3254 P  P     . DG  E 3   ? 0.9106 1.2330 0.8308 -0.6594 -0.0874 0.1349  18  DG  E P     
3255 O  OP1   . DG  E 3   ? 0.9324 1.3732 0.8147 -0.7858 -0.1957 0.2199  18  DG  E OP1   
3256 O  OP2   . DG  E 3   ? 0.8596 0.9790 0.7767 -0.6936 -0.0588 0.0755  18  DG  E OP2   
3257 O  "O5'" . DG  E 3   ? 0.8582 1.2885 0.8156 -0.6612 -0.0756 0.1178  18  DG  E "O5'" 
3258 C  "C5'" . DG  E 3   ? 0.8225 1.4724 0.6463 -0.6796 -0.1754 0.2451  18  DG  E "C5'" 
3259 C  "C4'" . DG  E 3   ? 0.7532 1.3719 0.6439 -0.6122 -0.1358 0.3404  18  DG  E "C4'" 
3260 O  "O4'" . DG  E 3   ? 0.6049 1.2801 0.5749 -0.4814 -0.0942 0.3100  18  DG  E "O4'" 
3261 C  "C3'" . DG  E 3   ? 0.7771 1.2570 0.6094 -0.6192 -0.1267 0.2686  18  DG  E "C3'" 
3262 O  "O3'" . DG  E 3   ? 0.8193 1.3544 0.6434 -0.6666 -0.1394 0.3306  18  DG  E "O3'" 
3263 C  "C2'" . DG  E 3   ? 0.7225 1.0872 0.6060 -0.4832 -0.1110 0.2422  18  DG  E "C2'" 
3264 C  "C1'" . DG  E 3   ? 0.5446 1.1389 0.5728 -0.4703 -0.1212 0.3300  18  DG  E "C1'" 
3265 N  N9    . DG  E 3   ? 0.4744 0.9492 0.5582 -0.3756 -0.0642 0.3246  18  DG  E N9    
3266 C  C8    . DG  E 3   ? 0.4733 0.8042 0.4120 -0.3807 -0.0811 0.2394  18  DG  E C8    
3267 N  N7    . DG  E 3   ? 0.3831 0.7160 0.4092 -0.2833 -0.0476 0.2349  18  DG  E N7    
3268 C  C5    . DG  E 3   ? 0.3574 0.7819 0.5224 -0.2076 -0.0313 0.2926  18  DG  E C5    
3269 C  C6    . DG  E 3   ? 0.2994 0.7106 0.5684 -0.1251 0.0145  0.3038  18  DG  E C6    
3270 O  O6    . DG  E 3   ? 0.2484 0.5897 0.5839 -0.0566 0.0426  0.2692  18  DG  E O6    
3271 N  N1    . DG  E 3   ? 0.2965 0.8040 0.6196 -0.0982 0.0377  0.4033  18  DG  E N1    
3272 C  C2    . DG  E 3   ? 0.3124 0.9437 0.6334 -0.1489 0.0022  0.4591  18  DG  E C2    
3273 N  N2    . DG  E 3   ? 0.2759 1.0530 0.7429 -0.1417 0.0264  0.5224  18  DG  E N2    
3274 N  N3    . DG  E 3   ? 0.3987 0.9965 0.5979 -0.2380 -0.0451 0.4536  18  DG  E N3    
3275 C  C4    . DG  E 3   ? 0.3937 0.9069 0.5513 -0.2986 -0.0454 0.3768  18  DG  E C4    
3276 P  P     . DG  E 4   ? 0.7788 1.2006 0.6744 -0.7465 -0.0928 0.2820  19  DG  E P     
3277 O  OP1   . DG  E 4   ? 0.8519 1.3525 0.6978 -0.8366 -0.1884 0.2506  19  DG  E OP1   
3278 O  OP2   . DG  E 4   ? 0.8015 1.0209 0.6712 -0.6655 -0.0590 0.1484  19  DG  E OP2   
3279 O  "O5'" . DG  E 4   ? 0.7087 1.2004 0.7001 -0.5963 -0.0711 0.3329  19  DG  E "O5'" 
3280 C  "C5'" . DG  E 4   ? 0.6586 1.3950 0.7733 -0.5890 -0.1182 0.4100  19  DG  E "C5'" 
3281 C  "C4'" . DG  E 4   ? 0.5567 1.3383 0.7337 -0.4638 -0.0801 0.4651  19  DG  E "C4'" 
3282 O  "O4'" . DG  E 4   ? 0.4703 1.2135 0.6632 -0.3647 -0.0757 0.3933  19  DG  E "O4'" 
3283 C  "C3'" . DG  E 4   ? 0.5711 1.2502 0.7166 -0.4378 -0.1059 0.4030  19  DG  E "C3'" 
3284 O  "O3'" . DG  E 4   ? 0.5367 1.4233 0.8504 -0.4165 -0.0923 0.4265  19  DG  E "O3'" 
3285 C  "C2'" . DG  E 4   ? 0.4680 1.0720 0.6708 -0.3484 -0.0274 0.3862  19  DG  E "C2'" 
3286 C  "C1'" . DG  E 4   ? 0.4190 1.1006 0.6339 -0.2755 -0.0304 0.4099  19  DG  E "C1'" 
3287 N  N9    . DG  E 4   ? 0.4171 0.9139 0.5706 -0.2297 -0.0128 0.3735  19  DG  E N9    
3288 C  C8    . DG  E 4   ? 0.4404 0.8353 0.5219 -0.2297 -0.0366 0.3232  19  DG  E C8    
3289 N  N7    . DG  E 4   ? 0.4279 0.7243 0.5067 -0.1676 0.0002  0.2593  19  DG  E N7    
3290 C  C5    . DG  E 4   ? 0.3845 0.6944 0.5350 -0.1122 0.0235  0.2747  19  DG  E C5    
3291 C  C6    . DG  E 4   ? 0.3631 0.5841 0.5125 -0.0446 0.0636  0.2401  19  DG  E C6    
3292 O  O6    . DG  E 4   ? 0.3680 0.4760 0.4619 -0.0171 0.1177  0.1936  19  DG  E O6    
3293 N  N1    . DG  E 4   ? 0.3397 0.6264 0.5484 -0.0031 0.0863  0.2659  19  DG  E N1    
3294 C  C2    . DG  E 4   ? 0.3541 0.7485 0.6012 -0.0371 0.0940  0.3331  19  DG  E C2    
3295 N  N2    . DG  E 4   ? 0.2925 0.7892 0.6731 0.0162  0.1441  0.3435  19  DG  E N2    
3296 N  N3    . DG  E 4   ? 0.3592 0.8402 0.6107 -0.0998 0.0529  0.3832  19  DG  E N3    
3297 C  C4    . DG  E 4   ? 0.3914 0.8125 0.5703 -0.1429 0.0275  0.3522  19  DG  E C4    
3298 P  P     . DT  E 5   ? 0.6430 1.4056 0.8765 -0.3955 -0.0264 0.3810  20  DT  E P     
3299 O  OP1   . DT  E 5   ? 0.6636 1.6111 0.9354 -0.4676 -0.0353 0.4237  20  DT  E OP1   
3300 O  OP2   . DT  E 5   ? 0.7734 1.2124 0.8103 -0.4017 -0.0158 0.2774  20  DT  E OP2   
3301 O  "O5'" . DT  E 5   ? 0.5707 1.2771 0.8956 -0.3087 0.0510  0.3906  20  DT  E "O5'" 
3302 C  "C5'" . DT  E 5   ? 0.5284 1.3487 0.8523 -0.2549 0.0577  0.4606  20  DT  E "C5'" 
3303 C  "C4'" . DT  E 5   ? 0.4828 1.2330 0.8106 -0.1460 0.1058  0.4691  20  DT  E "C4'" 
3304 O  "O4'" . DT  E 5   ? 0.4407 1.0343 0.6830 -0.0724 0.0906  0.3922  20  DT  E "O4'" 
3305 C  "C3'" . DT  E 5   ? 0.5043 1.2306 0.7844 -0.1593 0.0801  0.4528  20  DT  E "C3'" 
3306 O  "O3'" . DT  E 5   ? 0.5571 1.3137 0.8452 -0.0667 0.1461  0.4628  20  DT  E "O3'" 
3307 C  "C2'" . DT  E 5   ? 0.5154 1.0392 0.6696 -0.1502 0.0686  0.3524  20  DT  E "C2'" 
3308 C  "C1'" . DT  E 5   ? 0.4781 0.9645 0.6358 -0.0729 0.0839  0.3473  20  DT  E "C1'" 
3309 N  N1    . DT  E 5   ? 0.4804 0.8129 0.5523 -0.0621 0.0614  0.3239  20  DT  E N1    
3310 C  C2    . DT  E 5   ? 0.4654 0.7146 0.5416 -0.0070 0.0753  0.2883  20  DT  E C2    
3311 O  O2    . DT  E 5   ? 0.4397 0.7240 0.5610 0.0128  0.1013  0.2880  20  DT  E O2    
3312 N  N3    . DT  E 5   ? 0.4696 0.6179 0.4833 0.0005  0.0570  0.2328  20  DT  E N3    
3313 C  C4    . DT  E 5   ? 0.4553 0.5725 0.4750 -0.0378 0.0255  0.2227  20  DT  E C4    
3314 O  O4    . DT  E 5   ? 0.4676 0.5058 0.4282 0.0028  0.0533  0.1591  20  DT  E O4    
3315 C  C5    . DT  E 5   ? 0.4791 0.6424 0.5077 -0.1174 0.0167  0.2701  20  DT  E C5    
3316 C  C7    . DT  E 5   ? 0.4699 0.6221 0.4976 -0.2032 0.0122  0.2549  20  DT  E C7    
3317 C  C6    . DT  E 5   ? 0.4856 0.7692 0.5377 -0.0998 0.0235  0.3209  20  DT  E C6    
3318 P  P     . DG  E 6   ? 0.5601 1.3644 0.8419 -0.0839 0.1723  0.4655  21  DG  E P     
3319 O  OP1   . DG  E 6   ? 0.5078 1.5520 0.9571 -0.0932 0.1959  0.5527  21  DG  E OP1   
3320 O  OP2   . DG  E 6   ? 0.5912 1.3369 0.8030 -0.1763 0.1403  0.4821  21  DG  E OP2   
3321 O  "O5'" . DG  E 6   ? 0.5151 1.2255 0.8159 0.0042  0.1900  0.4349  21  DG  E "O5'" 
3322 C  "C5'" . DG  E 6   ? 0.5034 1.1389 0.7478 0.0693  0.2236  0.4003  21  DG  E "C5'" 
3323 C  "C4'" . DG  E 6   ? 0.5994 1.0767 0.7379 0.1029  0.2591  0.3541  21  DG  E "C4'" 
3324 O  "O4'" . DG  E 6   ? 0.6099 0.9367 0.6601 0.0748  0.2196  0.2775  21  DG  E "O4'" 
3325 C  "C3'" . DG  E 6   ? 0.6297 1.1632 0.7137 0.0459  0.2659  0.3577  21  DG  E "C3'" 
3326 O  "O3'" . DG  E 6   ? 0.6866 1.1488 0.7500 0.1187  0.3420  0.3162  21  DG  E "O3'" 
3327 C  "C2'" . DG  E 6   ? 0.6277 1.0306 0.6218 -0.0102 0.2081  0.3214  21  DG  E "C2'" 
3328 C  "C1'" . DG  E 6   ? 0.6212 0.9076 0.5815 0.0192  0.1962  0.2737  21  DG  E "C1'" 
3329 N  N9    . DG  E 6   ? 0.5812 0.7808 0.5173 -0.0128 0.1428  0.2921  21  DG  E N9    
3330 C  C8    . DG  E 6   ? 0.5672 0.8112 0.5335 -0.0610 0.0997  0.3101  21  DG  E C8    
3331 N  N7    . DG  E 6   ? 0.5615 0.7005 0.5397 -0.0558 0.0574  0.2429  21  DG  E N7    
3332 C  C5    . DG  E 6   ? 0.5548 0.6108 0.4983 -0.0122 0.0624  0.2174  21  DG  E C5    
3333 C  C6    . DG  E 6   ? 0.5444 0.5312 0.4873 -0.0047 0.0395  0.1557  21  DG  E C6    
3334 O  O6    . DG  E 6   ? 0.5689 0.5429 0.4672 0.0102  0.0230  0.1552  21  DG  E O6    
3335 N  N1    . DG  E 6   ? 0.5638 0.5128 0.4285 0.0318  0.0514  0.1283  21  DG  E N1    
3336 C  C2    . DG  E 6   ? 0.5851 0.5320 0.4703 0.0310  0.0953  0.1183  21  DG  E C2    
3337 N  N2    . DG  E 6   ? 0.6136 0.4768 0.4992 0.0277  0.1311  0.0769  21  DG  E N2    
3338 N  N3    . DG  E 6   ? 0.5994 0.6131 0.4566 0.0500  0.1199  0.1749  21  DG  E N3    
3339 C  C4    . DG  E 6   ? 0.5667 0.6547 0.4837 0.0056  0.0952  0.2309  21  DG  E C4    
3340 P  P     . DT  E 7   ? 0.7946 1.2566 0.7131 0.0974  0.3283  0.2930  22  DT  E P     
3341 O  OP1   . DT  E 7   ? 0.9016 1.3207 0.7675 0.1620  0.4036  0.2869  22  DT  E OP1   
3342 O  OP2   . DT  E 7   ? 0.7911 1.3380 0.6825 0.0263  0.3122  0.3629  22  DT  E OP2   
3343 O  "O5'" . DT  E 7   ? 0.7933 1.1316 0.6159 0.0441  0.3023  0.2132  22  DT  E "O5'" 
3344 C  "C5'" . DT  E 7   ? 0.8080 1.0301 0.5510 0.0758  0.3307  0.1844  22  DT  E "C5'" 
3345 C  "C4'" . DT  E 7   ? 0.7910 0.9720 0.5109 0.0086  0.2680  0.1770  22  DT  E "C4'" 
3346 O  "O4'" . DT  E 7   ? 0.6805 0.8526 0.4937 0.0000  0.2007  0.1933  22  DT  E "O4'" 
3347 C  "C3'" . DT  E 7   ? 0.8238 1.0304 0.5124 -0.0314 0.2458  0.2022  22  DT  E "C3'" 
3348 O  "O3'" . DT  E 7   ? 0.8736 1.0152 0.4868 -0.0490 0.2185  0.1419  22  DT  E "O3'" 
3349 C  "C2'" . DT  E 7   ? 0.7349 0.9804 0.5082 -0.0732 0.1833  0.2489  22  DT  E "C2'" 
3350 C  "C1'" . DT  E 7   ? 0.6889 0.8444 0.4779 -0.0593 0.1545  0.2187  22  DT  E "C1'" 
3351 N  N1    . DT  E 7   ? 0.6376 0.7402 0.4828 -0.0762 0.1148  0.2500  22  DT  E N1    
3352 C  C2    . DT  E 7   ? 0.6107 0.6149 0.4665 -0.0787 0.0864  0.2213  22  DT  E C2    
3353 O  O2    . DT  E 7   ? 0.6033 0.5772 0.4369 -0.0659 0.1141  0.1874  22  DT  E O2    
3354 N  N3    . DT  E 7   ? 0.5681 0.5995 0.4536 -0.0834 0.0593  0.2383  22  DT  E N3    
3355 C  C4    . DT  E 7   ? 0.5903 0.6879 0.5020 -0.1202 0.0411  0.2476  22  DT  E C4    
3356 O  O4    . DT  E 7   ? 0.6014 0.6825 0.5423 -0.1163 0.0249  0.2176  22  DT  E O4    
3357 C  C5    . DT  E 7   ? 0.6152 0.7867 0.5058 -0.1443 0.0750  0.3055  22  DT  E C5    
3358 C  C7    . DT  E 7   ? 0.5942 0.8944 0.5363 -0.1825 0.0835  0.3403  22  DT  E C7    
3359 C  C6    . DT  E 7   ? 0.6056 0.8160 0.5062 -0.0997 0.1286  0.2915  22  DT  E C6    
3360 P  P     . DA  E 8   ? 1.0398 1.1049 0.5086 -0.0897 0.2178  0.0945  23  DA  E P     
3361 O  OP1   . DA  E 8   ? 1.0869 1.1671 0.5429 -0.0202 0.2933  0.0396  23  DA  E OP1   
3362 O  OP2   . DA  E 8   ? 1.0145 1.2484 0.4360 -0.0990 0.2285  0.1665  23  DA  E OP2   
3363 O  "O5'" . DA  E 8   ? 1.0603 1.0558 0.4186 -0.1123 0.1900  0.0791  23  DA  E "O5'" 
3364 C  "C5'" . DA  E 8   ? 1.0410 0.9608 0.4217 -0.0998 0.1788  0.0491  23  DA  E "C5'" 
3365 C  "C4'" . DA  E 8   ? 1.0005 0.8931 0.4051 -0.1369 0.1030  0.0830  23  DA  E "C4'" 
3366 O  "O4'" . DA  E 8   ? 0.8669 0.8201 0.3695 -0.1224 0.0434  0.1336  23  DA  E "O4'" 
3367 C  "C3'" . DA  E 8   ? 1.0515 0.9812 0.4049 -0.1911 0.0593  0.1095  23  DA  E "C3'" 
3368 O  "O3'" . DA  E 8   ? 1.0656 0.9125 0.4183 -0.2177 0.0354  0.0867  23  DA  E "O3'" 
3369 C  "C2'" . DA  E 8   ? 0.9708 0.9528 0.4232 -0.1913 0.0265  0.1850  23  DA  E "C2'" 
3370 C  "C1'" . DA  E 8   ? 0.8697 0.8349 0.4189 -0.1488 0.0086  0.1834  23  DA  E "C1'" 
3371 N  N9    . DA  E 8   ? 0.8081 0.7660 0.4247 -0.1308 -0.0030 0.2434  23  DA  E N9    
3372 C  C8    . DA  E 8   ? 0.8203 0.8189 0.4634 -0.1409 0.0212  0.2662  23  DA  E C8    
3373 N  N7    . DA  E 8   ? 0.7823 0.7692 0.4694 -0.1364 0.0100  0.2944  23  DA  E N7    
3374 C  C5    . DA  E 8   ? 0.7374 0.6593 0.4853 -0.1341 -0.0089 0.2777  23  DA  E C5    
3375 C  C6    . DA  E 8   ? 0.6995 0.5774 0.5190 -0.1367 -0.0260 0.2699  23  DA  E C6    
3376 N  N6    . DA  E 8   ? 0.6596 0.6158 0.5438 -0.1509 -0.0163 0.2815  23  DA  E N6    
3377 N  N1    . DA  E 8   ? 0.6878 0.4972 0.5207 -0.1100 -0.0275 0.2387  23  DA  E N1    
3378 C  C2    . DA  E 8   ? 0.6786 0.5133 0.4882 -0.0879 -0.0440 0.2192  23  DA  E C2    
3379 N  N3    . DA  E 8   ? 0.7201 0.5794 0.4758 -0.1109 -0.0509 0.2033  23  DA  E N3    
3380 C  C4    . DA  E 8   ? 0.7610 0.6595 0.4535 -0.1219 -0.0271 0.2369  23  DA  E C4    
3381 P  P     . DC  E 9   ? 1.1467 1.0345 0.4319 -0.2890 -0.0182 0.1390  24  DC  E P     
3382 O  OP1   . DC  E 9   ? 1.2170 1.0312 0.4559 -0.3131 -0.0306 0.0817  24  DC  E OP1   
3383 O  OP2   . DC  E 9   ? 1.1956 1.1373 0.4443 -0.3139 0.0020  0.1430  24  DC  E OP2   
3384 O  "O5'" . DC  E 9   ? 1.0391 0.9855 0.4693 -0.2719 -0.0645 0.2097  24  DC  E "O5'" 
3385 C  "C5'" . DC  E 9   ? 0.9566 0.8948 0.4371 -0.2385 -0.1117 0.2143  24  DC  E "C5'" 
3386 C  "C4'" . DC  E 9   ? 0.8906 0.8660 0.5029 -0.2283 -0.1541 0.2572  24  DC  E "C4'" 
3387 O  "O4'" . DC  E 9   ? 0.8328 0.7851 0.5299 -0.1948 -0.1235 0.2497  24  DC  E "O4'" 
3388 C  "C3'" . DC  E 9   ? 0.9489 0.9599 0.5605 -0.2663 -0.1857 0.3318  24  DC  E "C3'" 
3389 O  "O3'" . DC  E 9   ? 0.9296 0.9676 0.6570 -0.2470 -0.2199 0.3505  24  DC  E "O3'" 
3390 C  "C2'" . DC  E 9   ? 0.9243 0.9585 0.5689 -0.2559 -0.1652 0.3556  24  DC  E "C2'" 
3391 C  "C1'" . DC  E 9   ? 0.8561 0.8267 0.5597 -0.2161 -0.1454 0.3341  24  DC  E "C1'" 
3392 N  N1    . DC  E 9   ? 0.8546 0.7788 0.5385 -0.2125 -0.1235 0.3393  24  DC  E N1    
3393 C  C2    . DC  E 9   ? 0.8144 0.6848 0.5531 -0.1913 -0.1158 0.3439  24  DC  E C2    
3394 O  O2    . DC  E 9   ? 0.7706 0.5747 0.5388 -0.1950 -0.1436 0.3353  24  DC  E O2    
3395 N  N3    . DC  E 9   ? 0.8251 0.6879 0.5355 -0.2018 -0.1112 0.3495  24  DC  E N3    
3396 C  C4    . DC  E 9   ? 0.8499 0.7847 0.5575 -0.2158 -0.0868 0.3545  24  DC  E C4    
3397 N  N4    . DC  E 9   ? 0.8561 0.7991 0.5515 -0.2340 -0.0779 0.3745  24  DC  E N4    
3398 C  C5    . DC  E 9   ? 0.8901 0.8898 0.5317 -0.2196 -0.0969 0.3531  24  DC  E C5    
3399 C  C6    . DC  E 9   ? 0.9099 0.8750 0.4958 -0.2291 -0.1098 0.3401  24  DC  E C6    
3400 P  P     . DG  E 10  ? 0.9480 1.1571 0.7488 -0.2787 -0.2692 0.4028  25  DG  E P     
3401 O  OP1   . DG  E 10  ? 1.0106 1.1491 0.7724 -0.2882 -0.2776 0.3593  25  DG  E OP1   
3402 O  OP2   . DG  E 10  ? 0.9860 1.2242 0.7303 -0.2989 -0.3138 0.4531  25  DG  E OP2   
3403 O  "O5'" . DG  E 10  ? 0.9138 1.1023 0.8231 -0.2448 -0.2921 0.4687  25  DG  E "O5'" 
3404 C  "C5'" . DG  E 10  ? 0.8637 0.9788 0.8247 -0.2015 -0.2855 0.4177  25  DG  E "C5'" 
3405 C  "C4'" . DG  E 10  ? 0.9041 0.9327 0.9281 -0.1813 -0.2583 0.4613  25  DG  E "C4'" 
3406 O  "O4'" . DG  E 10  ? 0.8879 0.8383 0.8696 -0.1451 -0.2324 0.4182  25  DG  E "O4'" 
3407 C  "C3'" . DG  E 10  ? 0.9528 1.0371 1.0308 -0.1933 -0.2998 0.5568  25  DG  E "C3'" 
3408 O  "O3'" . DG  E 10  ? 1.0027 1.0333 1.1956 -0.1417 -0.2827 0.5765  25  DG  E "O3'" 
3409 C  "C2'" . DG  E 10  ? 0.9993 1.0092 1.0155 -0.2039 -0.2662 0.5701  25  DG  E "C2'" 
3410 C  "C1'" . DG  E 10  ? 0.9414 0.8809 0.9600 -0.1773 -0.2208 0.4841  25  DG  E "C1'" 
3411 N  N9    . DG  E 10  ? 0.9504 0.8643 0.9225 -0.1892 -0.2010 0.4676  25  DG  E N9    
3412 C  C8    . DG  E 10  ? 0.9532 0.9217 0.8339 -0.2389 -0.2251 0.4624  25  DG  E C8    
3413 N  N7    . DG  E 10  ? 0.9633 0.8970 0.8416 -0.2704 -0.1866 0.4574  25  DG  E N7    
3414 C  C5    . DG  E 10  ? 0.9460 0.8469 0.8669 -0.2382 -0.1630 0.4492  25  DG  E C5    
3415 C  C6    . DG  E 10  ? 0.9737 0.8008 0.8389 -0.2587 -0.1566 0.4549  25  DG  E C6    
3416 O  O6    . DG  E 10  ? 0.9771 0.8069 0.7970 -0.3215 -0.1469 0.4250  25  DG  E O6    
3417 N  N1    . DG  E 10  ? 0.9506 0.6966 0.8799 -0.2542 -0.1584 0.4613  25  DG  E N1    
3418 C  C2    . DG  E 10  ? 0.9689 0.6824 0.9202 -0.2022 -0.1419 0.4760  25  DG  E C2    
3419 N  N2    . DG  E 10  ? 0.9600 0.5574 0.9866 -0.2115 -0.1185 0.4732  25  DG  E N2    
3420 N  N3    . DG  E 10  ? 0.9288 0.7826 0.9438 -0.1736 -0.1626 0.4765  25  DG  E N3    
3421 C  C4    . DG  E 10  ? 0.9342 0.8207 0.9286 -0.1991 -0.1699 0.4668  25  DG  E C4    
3422 MG MG    . MG  F .   ? 0.1173 0.2619 0.3332 0.0570  0.0648  -0.0322 401 MG  A MG    
3423 MG MG    . MG  G .   ? 0.1181 0.4535 0.3137 0.0138  0.0513  0.0022  402 MG  A MG    
3424 O  O     . HOH H .   ? 0.2112 0.3325 0.3349 0.0010  0.0305  -0.0374 501 HOH A O     
3425 O  O     . HOH H .   ? 0.2216 0.3816 0.6044 -0.0269 0.1217  -0.0407 502 HOH A O     
3426 O  O     . HOH H .   ? 0.2665 0.3534 0.4219 0.0226  -0.0371 0.0387  503 HOH A O     
3427 O  O     . HOH H .   ? 0.5099 0.5953 0.2985 -0.0075 0.0010  -0.0132 504 HOH A O     
3428 O  O     . HOH H .   ? 0.3909 0.4050 0.5541 -0.0528 -0.0604 0.0709  505 HOH A O     
3429 O  O     . HOH H .   ? 0.2890 0.5561 0.7152 0.0507  0.1091  0.0743  506 HOH A O     
3430 O  O     . HOH H .   ? 0.5570 0.4941 0.3627 0.1208  -0.0446 0.0049  507 HOH A O     
3431 O  O     . HOH H .   ? 0.1873 0.4551 0.3527 0.0277  -0.0061 0.0635  508 HOH A O     
3432 O  O     . HOH H .   ? 0.3460 0.5068 0.4825 -0.0847 -0.0744 0.1837  509 HOH A O     
3433 O  O     . HOH H .   ? 0.2934 0.8269 0.5176 -0.0904 -0.0558 0.1244  510 HOH A O     
3434 O  O     . HOH H .   ? 0.2600 0.3510 0.4070 0.0519  -0.0504 -0.0563 511 HOH A O     
3435 O  O     . HOH H .   ? 0.4095 0.4312 0.3983 -0.0630 0.0089  -0.0721 512 HOH A O     
3436 O  O     . HOH H .   ? 0.3225 0.5102 0.4467 -0.0109 0.0159  0.0165  513 HOH A O     
3437 O  O     . HOH H .   ? 0.3828 0.5788 0.4119 0.1453  0.0346  0.1404  514 HOH A O     
3438 O  O     . HOH H .   ? 0.3186 0.4314 0.4484 -0.0521 -0.0534 0.1191  515 HOH A O     
3439 O  O     . HOH H .   ? 0.2591 0.6070 0.5081 0.1002  -0.1029 0.0866  516 HOH A O     
3440 O  O     . HOH H .   ? 0.3494 0.4305 0.7213 -0.0232 0.0330  0.0614  517 HOH A O     
3441 O  O     . HOH H .   ? 0.4352 0.4516 0.3317 0.1025  0.0090  -0.0139 518 HOH A O     
3442 O  O     . HOH H .   ? 0.3500 0.3692 0.4663 0.0084  0.0307  -0.0402 519 HOH A O     
3443 O  O     . HOH H .   ? 0.5137 0.4555 0.6014 0.0133  -0.0157 -0.1005 520 HOH A O     
3444 O  O     . HOH H .   ? 0.3445 0.3777 0.5291 -0.0277 -0.0491 0.0117  521 HOH A O     
3445 O  O     . HOH H .   ? 0.1794 0.5521 0.4189 -0.0425 0.0014  -0.0386 522 HOH A O     
3446 O  O     . HOH H .   ? 0.1858 0.6411 0.4387 -0.0575 0.0309  -0.0451 523 HOH A O     
3447 O  O     . HOH H .   ? 0.4582 1.0146 0.5733 -0.0857 -0.0339 -0.1427 524 HOH A O     
3448 O  O     . HOH H .   ? 0.2849 0.4153 0.4738 0.0221  -0.0231 0.0187  525 HOH A O     
3449 O  O     . HOH H .   ? 0.3340 0.9350 0.9195 -0.1301 -0.0417 0.4499  526 HOH A O     
3450 O  O     . HOH H .   ? 0.1891 0.4589 0.4611 -0.0724 -0.0707 0.1198  527 HOH A O     
3451 O  O     . HOH H .   ? 0.3107 0.4657 0.4893 -0.0894 -0.0559 0.0613  528 HOH A O     
3452 O  O     . HOH H .   ? 0.5732 0.3652 0.3893 -0.1406 -0.0265 0.0133  529 HOH A O     
3453 O  O     . HOH H .   ? 0.4316 0.4316 0.5029 0.1619  0.1561  0.0929  530 HOH A O     
3454 O  O     . HOH H .   ? 0.4098 0.4280 0.5709 -0.0062 0.1235  -0.0208 531 HOH A O     
3455 O  O     . HOH H .   ? 0.5082 0.7064 0.4943 -0.0152 0.1337  -0.0537 532 HOH A O     
3456 O  O     . HOH H .   ? 0.3915 0.8878 0.4776 -0.2710 0.0193  -0.0139 533 HOH A O     
3457 O  O     . HOH H .   ? 0.3230 0.4966 0.5466 0.1600  0.0787  0.0420  534 HOH A O     
3458 O  O     . HOH H .   ? 0.4817 0.5038 0.6673 0.0836  0.0081  0.0762  535 HOH A O     
3459 O  O     . HOH H .   ? 0.4640 0.5621 0.3498 0.0528  0.0201  0.1015  536 HOH A O     
3460 O  O     . HOH H .   ? 0.3639 0.4203 0.6273 -0.0432 -0.0482 -0.0408 537 HOH A O     
3461 O  O     . HOH H .   ? 0.4961 0.4289 0.5781 -0.1332 0.0766  0.0048  538 HOH A O     
3462 O  O     . HOH H .   ? 0.6565 0.4225 0.7916 0.0369  0.1480  -0.0562 539 HOH A O     
3463 O  O     . HOH H .   ? 0.4664 0.5023 0.3929 0.1136  -0.0599 0.0212  540 HOH A O     
3464 O  O     . HOH H .   ? 0.2055 0.4913 0.3790 0.0838  -0.0113 0.0486  541 HOH A O     
3465 O  O     . HOH H .   ? 0.3307 0.3481 0.5226 0.0465  0.0022  -0.0372 542 HOH A O     
3466 O  O     . HOH H .   ? 0.2555 0.7055 0.4747 -0.1258 -0.0875 0.0279  543 HOH A O     
3467 O  O     . HOH H .   ? 0.3120 0.3297 0.6009 -0.0517 0.1151  0.0008  544 HOH A O     
3468 O  O     . HOH H .   ? 0.3628 0.5608 0.7808 -0.1382 -0.0729 -0.1525 545 HOH A O     
3469 O  O     . HOH H .   ? 0.2941 0.4299 0.5515 0.0219  -0.0299 -0.1009 546 HOH A O     
3470 O  O     . HOH H .   ? 0.3743 0.5171 0.7413 0.1745  -0.0761 -0.1680 547 HOH A O     
3471 O  O     . HOH H .   ? 0.4077 0.4187 0.5414 -0.0353 0.1740  -0.0189 548 HOH A O     
3472 O  O     . HOH H .   ? 0.5325 0.6394 0.7587 0.0293  -0.1828 -0.0291 549 HOH A O     
3473 O  O     . HOH H .   ? 0.4672 0.3293 0.4994 0.1067  0.1662  -0.0072 550 HOH A O     
3474 O  O     . HOH H .   ? 0.5634 0.7417 0.7247 0.2895  0.2041  0.1703  551 HOH A O     
3475 O  O     . HOH H .   ? 0.8894 0.6512 0.4377 -0.1394 -0.2500 -0.0122 552 HOH A O     
3476 O  O     . HOH H .   ? 0.2777 1.4920 0.8043 0.1078  0.0632  0.0675  553 HOH A O     
3477 O  O     . HOH H .   ? 0.1735 0.4632 0.5053 0.0018  0.0203  0.1625  554 HOH A O     
3478 O  O     . HOH H .   ? 0.4233 0.4212 0.3787 0.0395  -0.0738 0.0689  555 HOH A O     
3479 O  O     . HOH H .   ? 0.2334 0.4924 0.4160 -0.0242 0.0458  0.0246  556 HOH A O     
3480 O  O     . HOH H .   ? 0.5136 0.5987 0.3635 -0.0130 -0.0354 -0.0302 557 HOH A O     
3481 O  O     . HOH H .   ? 0.4538 0.6911 0.4496 0.3078  0.0757  -0.1291 558 HOH A O     
3482 O  O     . HOH H .   ? 0.2775 0.4812 0.6504 0.0954  0.0313  -0.0265 559 HOH A O     
3483 O  O     . HOH H .   ? 0.1790 0.7514 0.4865 0.0246  0.0488  0.0593  560 HOH A O     
3484 O  O     . HOH H .   ? 0.3446 0.7578 0.6016 -0.1431 0.0466  0.1126  561 HOH A O     
3485 O  O     . HOH H .   ? 0.2734 0.5743 0.6215 -0.0753 -0.0924 0.0437  562 HOH A O     
3486 O  O     . HOH H .   ? 0.6348 0.4760 0.3693 0.1134  -0.0981 -0.0309 563 HOH A O     
3487 O  O     . HOH H .   ? 0.2598 0.5280 0.4499 0.0343  0.0415  0.1236  564 HOH A O     
3488 O  O     . HOH H .   ? 0.5010 0.6467 0.4334 0.1104  0.1785  -0.1008 565 HOH A O     
3489 O  O     . HOH H .   ? 0.3456 0.6026 0.4014 -0.1123 -0.0048 0.1041  566 HOH A O     
3490 O  O     . HOH H .   ? 0.5958 0.5302 0.5400 -0.0964 0.1318  0.0018  567 HOH A O     
3491 O  O     . HOH H .   ? 0.5350 0.6723 0.5207 0.0801  -0.0797 -0.1990 568 HOH A O     
3492 O  O     . HOH H .   ? 0.5998 0.5061 0.6315 0.1723  -0.2423 -0.1191 569 HOH A O     
3493 O  O     . HOH H .   ? 0.5564 0.6089 0.3748 -0.0937 0.1051  0.0102  570 HOH A O     
3494 O  O     . HOH H .   ? 0.6888 0.5147 0.4917 -0.0878 -0.0672 -0.0898 571 HOH A O     
3495 O  O     . HOH H .   ? 0.3240 0.4166 0.7423 -0.0951 0.1068  0.0083  572 HOH A O     
3496 O  O     . HOH H .   ? 0.4200 0.5784 0.5736 -0.0814 -0.1909 0.1820  573 HOH A O     
3497 O  O     . HOH H .   ? 0.4109 0.3188 0.7156 -0.0860 -0.0174 0.0349  574 HOH A O     
3498 O  O     . HOH H .   ? 0.4803 0.5003 0.4863 0.0604  0.1700  -0.0108 575 HOH A O     
3499 O  O     . HOH H .   ? 0.3034 0.5153 0.4380 0.1083  0.1377  0.0655  576 HOH A O     
3500 O  O     . HOH H .   ? 0.2439 0.4682 0.5790 0.0028  -0.1182 0.0649  577 HOH A O     
3501 O  O     . HOH H .   ? 0.3247 0.5146 0.6253 -0.0516 0.0990  -0.0282 578 HOH A O     
3502 O  O     . HOH H .   ? 0.6797 0.8470 0.4000 0.0523  -0.1321 0.0017  579 HOH A O     
3503 O  O     . HOH H .   ? 0.3234 0.5875 0.4296 0.1063  -0.0745 -0.0069 580 HOH A O     
3504 O  O     . HOH H .   ? 0.4069 0.4299 0.3971 -0.0986 -0.0750 -0.0806 581 HOH A O     
3505 O  O     . HOH H .   ? 0.4037 0.4366 0.3883 -0.0456 0.1720  -0.0335 582 HOH A O     
3506 O  O     . HOH H .   ? 0.3633 0.5035 0.5541 0.0707  -0.1177 -0.0133 583 HOH A O     
3507 O  O     . HOH H .   ? 0.7171 0.5160 0.4590 -0.1158 -0.0086 -0.0454 584 HOH A O     
3508 O  O     . HOH H .   ? 0.3106 0.3773 0.4537 0.0253  -0.0180 -0.0898 585 HOH A O     
3509 O  O     . HOH H .   ? 0.5223 0.6131 0.5442 -0.0372 -0.1421 -0.1054 586 HOH A O     
3510 O  O     . HOH H .   ? 0.2991 0.4908 0.4130 0.1245  0.0725  0.0473  587 HOH A O     
3511 O  O     . HOH H .   ? 0.3808 0.5520 0.6188 0.0170  -0.0267 0.2687  588 HOH A O     
3512 O  O     . HOH H .   ? 0.3123 0.3917 0.3765 -0.0326 0.0714  -0.0520 589 HOH A O     
3513 O  O     . HOH I .   ? 0.1601 0.5056 0.3557 0.0249  0.0136  0.0151  101 HOH B O     
3514 O  O     . HOH I .   ? 0.1868 0.4424 0.4093 -0.0005 -0.0803 0.0136  102 HOH B O     
3515 O  O     . HOH I .   ? 0.4196 0.9003 0.6532 -0.0084 0.0620  0.3188  103 HOH B O     
3516 O  O     . HOH I .   ? 0.6077 0.8514 0.5759 0.2655  -0.1548 -0.0603 104 HOH B O     
3517 O  O     . HOH I .   ? 0.6464 0.4359 0.5087 0.1016  0.1281  -0.0195 105 HOH B O     
3518 O  O     . HOH J .   ? 0.3827 0.3774 0.4165 0.0440  0.0923  -0.0023 101 HOH C O     
3519 O  O     . HOH J .   ? 0.3814 0.5228 0.5710 0.0699  -0.0871 0.0585  102 HOH C O     
3520 O  O     . HOH J .   ? 0.2789 0.7246 0.6977 -0.1190 0.0239  0.0489  103 HOH C O     
3521 O  O     . HOH J .   ? 0.4415 0.7094 0.5584 0.1391  -0.0671 -0.0011 104 HOH C O     
3522 O  O     . HOH J .   ? 0.2941 0.8080 0.6542 0.1042  -0.1728 -0.0728 105 HOH C O     
3523 O  O     . HOH J .   ? 0.4869 0.3657 0.5607 0.0562  0.2126  0.0442  106 HOH C O     
3524 O  O     . HOH J .   ? 0.3153 0.4057 0.8355 -0.0068 -0.1886 -0.0419 107 HOH C O     
3525 O  O     . HOH J .   ? 0.7430 0.7041 0.4795 -0.1292 0.0146  0.0916  108 HOH C O     
3526 O  O     . HOH J .   ? 0.9345 0.8385 0.5912 -0.1478 -0.4403 0.1286  109 HOH C O     
3527 O  O     . HOH J .   ? 0.2100 0.6232 0.8320 0.1765  0.0388  0.1967  110 HOH C O     
3528 O  O     . HOH K .   ? 0.3613 0.3401 0.3972 0.1280  0.0244  -0.0051 101 HOH D O     
3529 O  O     . HOH K .   ? 0.3328 0.3911 0.3708 -0.0578 -0.0459 0.0685  102 HOH D O     
3530 O  O     . HOH K .   ? 0.3046 0.6984 0.7291 0.0289  -0.1328 0.0754  103 HOH D O     
3531 O  O     . HOH K .   ? 0.5155 0.7328 0.4949 -0.2404 -0.0700 0.0671  104 HOH D O     
3532 O  O     . HOH K .   ? 0.3542 0.4031 0.5486 0.0263  -0.1129 0.0833  105 HOH D O     
3533 O  O     . HOH K .   ? 0.3481 0.4540 0.5790 -0.1040 -0.0672 -0.0015 106 HOH D O     
3534 O  O     . HOH K .   ? 0.1990 0.8601 0.7638 0.0414  -0.0989 0.0097  107 HOH D O     
3535 O  O     . HOH K .   ? 0.3535 0.8027 0.5256 -0.0631 -0.1112 0.0109  108 HOH D O     
3536 O  O     . HOH L .   ? 0.1949 0.4142 0.4153 0.0377  0.0539  0.0318  101 HOH E O     
3537 O  O     . HOH L .   ? 0.4655 0.5259 0.6101 0.1026  -0.0225 0.1740  102 HOH E O     
3538 O  O     . HOH L .   ? 0.2653 0.4030 0.8620 0.0129  0.1600  0.1555  103 HOH E O     
3539 O  O     . HOH L .   ? 0.3212 0.5106 0.4684 0.1991  0.0753  0.0605  104 HOH E O     
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   ?   ?   ?   A . n 
A 1 2   LYS 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   3   GLY GLY A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASN 5   5   5   ASN ASN A . n 
A 1 6   GLY 6   6   6   GLY GLY A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  PRO 10  10  10  PRO PRO A . n 
A 1 11  TRP 11  11  11  TRP TRP A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  PHE 16  16  16  PHE PHE A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  PHE 23  23  23  PHE PHE A . n 
A 1 24  MET 24  24  24  MET MET A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  ASN 30  30  30  ASN ASN A . n 
A 1 31  SER 31  31  31  SER SER A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  TRP 37  37  37  TRP TRP A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  LYS 50  50  50  LYS LYS A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  TYR 78  78  78  TYR TYR A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  PHE 94  94  94  PHE PHE A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 ASP 106 106 106 ASP ASP A . n 
A 1 107 TYR 107 107 107 TYR TYR A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 PHE 110 110 110 PHE PHE A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 MET 117 117 117 MET MET A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 HIS 122 122 122 HIS HIS A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 GLN 125 125 125 GLN GLN A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 SER 133 133 133 SER SER A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 LYS 135 135 135 LYS LYS A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 ASN 139 139 139 ASN ASN A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 GLU 145 145 145 GLU GLU A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 GLN 147 147 147 GLN GLN A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 PHE 150 150 150 PHE PHE A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 GLN 152 152 152 GLN GLN A . n 
A 1 153 CYS 153 153 153 CYS CYS A . n 
A 1 154 VAL 154 154 154 VAL VAL A . n 
A 1 155 PRO 155 155 155 PRO PRO A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 ARG 158 158 158 ARG ARG A . n 
A 1 159 PRO 159 159 159 PRO PRO A . n 
A 1 160 GLU 160 160 160 GLU GLU A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 ASN 162 162 162 ASN ASN A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 LYS 164 164 164 LYS LYS A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 PRO 167 167 167 PRO PRO A . n 
A 1 168 ASP 168 168 168 ASP ASP A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 PHE 170 170 170 PHE PHE A . n 
A 1 171 TRP 171 171 171 TRP TRP A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 ALA 173 173 173 ALA ALA A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 PHE 175 175 175 PHE PHE A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 ASP 179 179 179 ASP ASP A . n 
A 1 180 GLY 180 180 180 GLY GLY A . n 
A 1 181 SER 181 181 181 SER SER A . n 
A 1 182 PHE 182 182 182 PHE PHE A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 LYS 187 187 187 LYS LYS A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 GLU 190 190 190 GLU GLU A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 LYS 193 193 193 LYS LYS A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 PHE 196 196 196 PHE PHE A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 PHE 202 202 202 PHE PHE A . n 
A 1 203 GLN 203 203 203 GLN GLN A . n 
A 1 204 ILE 204 204 204 ILE ILE A . n 
A 1 205 THR 205 205 205 THR THR A . n 
A 1 206 GLN 206 206 206 GLN GLN A . n 
A 1 207 HIS 207 207 207 HIS HIS A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 LYS 212 212 212 LYS LYS A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 MET 214 214 214 MET MET A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 SER 216 216 216 SER SER A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 TYR 220 220 220 TYR TYR A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 GLY 222 222 222 GLY GLY A . n 
A 1 223 CYS 223 223 223 CYS CYS A . n 
A 1 224 GLY 224 224 224 GLY GLY A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 ILE 226 226 226 ILE ILE A . n 
A 1 227 GLU 227 227 227 GLU GLU A . n 
A 1 228 LYS 228 228 228 LYS LYS A . n 
A 1 229 ASP 229 229 229 ASP ASP A . n 
A 1 230 SER 230 230 230 SER SER A . n 
A 1 231 ARG 231 231 231 ARG ARG A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 PRO 233 233 233 PRO PRO A . n 
A 1 234 TRP 234 234 234 TRP TRP A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 TYR 236 236 236 TYR TYR A . n 
A 1 237 TYR 237 237 237 TYR TYR A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 ASN 241 241 241 ASN ASN A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 ASP 244 244 244 ASP ASP A . n 
A 1 245 ILE 245 245 245 ILE ILE A . n 
A 1 246 GLN 246 246 246 GLN GLN A . n 
A 1 247 GLY 247 247 247 GLY GLY A . n 
A 1 248 LYS 248 248 248 LYS LYS A . n 
A 1 249 ILE 249 249 249 ILE ILE A . n 
A 1 250 ILE 250 250 250 ILE ILE A . n 
A 1 251 PRO 251 251 251 PRO PRO A . n 
A 1 252 PHE 252 252 252 PHE PHE A . n 
A 1 253 PHE 253 253 253 PHE PHE A . n 
A 1 254 HIS 254 254 254 HIS HIS A . n 
A 1 255 GLN 255 255 255 GLN GLN A . n 
A 1 256 TYR 256 256 256 TYR TYR A . n 
A 1 257 LYS 257 257 257 LYS LYS A . n 
A 1 258 ILE 258 258 258 ILE ILE A . n 
A 1 259 ILE 259 259 259 ILE ILE A . n 
A 1 260 GLY 260 260 260 GLY GLY A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 LYS 262 262 262 LYS LYS A . n 
A 1 263 TYR 263 263 263 TYR TYR A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 ASP 265 265 265 ASP ASP A . n 
A 1 266 TYR 266 266 266 TYR TYR A . n 
A 1 267 MET 267 267 267 MET MET A . n 
A 1 268 ASP 268 268 268 ASP ASP A . n 
A 1 269 TRP 269 269 269 TRP TRP A . n 
A 1 270 CYS 270 270 270 CYS CYS A . n 
A 1 271 LYS 271 271 271 LYS LYS A . n 
A 1 272 ILE 272 272 272 ILE ILE A . n 
A 1 273 ALA 273 273 273 ALA ALA A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 MET 276 276 276 MET MET A . n 
A 1 277 GLN 277 277 277 GLN GLN A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 HIS 281 281 281 HIS HIS A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 THR 283 283 283 THR THR A . n 
A 1 284 PRO 284 284 284 PRO PRO A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 GLY 286 286 286 GLY GLY A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 ASN 288 288 288 ASN ASN A . n 
A 1 289 GLU 289 289 289 GLU GLU A . n 
A 1 290 ILE 290 290 290 ILE ILE A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 ALA 292 292 292 ALA ALA A . n 
A 1 293 LEU 293 293 293 LEU LEU A . n 
A 1 294 LYS 294 294 294 LYS LYS A . n 
A 1 295 GLY 295 295 295 GLY GLY A . n 
A 1 296 GLY 296 296 296 GLY GLY A . n 
A 1 297 MET 297 297 297 MET MET A . n 
A 1 298 ASN 298 298 298 ASN ASN A . n 
A 1 299 LYS 299 299 299 LYS LYS A . n 
A 1 300 GLY 300 300 300 GLY GLY A . n 
A 1 301 ARG 301 301 301 ARG ARG A . n 
A 1 302 LEU 302 302 302 LEU LEU A . n 
B 2 1   DC  1   1   1   DC  DC  B . n 
B 2 2   DG  2   2   2   DG  DG  B . n 
B 2 3   DT  3   3   3   DT  DT  B . n 
B 2 4   DA  4   4   4   DA  DA  B . n 
B 2 5   DC  5   5   5   DC  DC  B . n 
B 2 6   DA  6   6   6   DA  DA  B . n 
B 2 7   DC  7   7   7   DC  DC  B . n 
B 2 8   DC  8   8   8   DC  DC  B . n 
B 2 9   DT  9   9   9   DT  DT  B . n 
B 2 10  DG  10  10  10  DG  DG  B . n 
B 2 11  DA  11  11  11  DA  DA  B . n 
B 2 12  DT  12  12  12  DT  DT  B . n 
B 2 13  DA  13  13  13  DA  DA  B . n 
B 2 14  DA  14  14  14  DA  DA  B . n 
C 3 1   DT  1   15  15  DT  DT  C . n 
C 3 2   DG  2   16  16  DG  DG  C . n 
C 3 3   DG  3   17  17  DG  DG  C . n 
C 3 4   DA  4   18  18  DA  DA  C . n 
C 3 5   DG  5   19  19  DG  DG  C . n 
C 3 6   DG  6   20  20  DG  DG  C . n 
C 3 7   DA  7   21  21  DA  DA  C . n 
C 3 8   DT  8   22  22  DT  DT  C . n 
C 3 9   DA  9   23  23  DA  DA  C . n 
C 3 10  DC  10  24  24  DC  DC  C . n 
C 3 11  DC  11  25  25  DC  DC  C . n 
D 4 1   DG  1   1   1   DG  DG  D . n 
D 4 2   DG  2   2   2   DG  DG  D . n 
D 4 3   DT  3   3   3   DT  DT  D . n 
D 4 4   DA  4   4   4   DA  DA  D . n 
D 4 5   DT  5   5   5   DT  DT  D . n 
D 4 6   DC  6   6   6   DC  DC  D . n 
D 4 7   DC  7   7   7   DC  DC  D . n 
D 4 8   DT  8   8   8   DT  DT  D . n 
D 4 9   DC  9   9   9   DC  DC  D . n 
D 4 10  DC  10  10  10  DC  DC  D . n 
D 4 11  DA  11  11  11  DA  DA  D . n 
D 4 12  DT  12  12  12  DT  DT  D . n 
D 4 13  DT  13  13  13  DT  DT  D . n 
D 4 14  DA  14  14  14  DA  DA  D . n 
D 4 15  DT  15  15  15  DT  DT  D . n 
E 5 1   DC  1   16  16  DC  DC  E . n 
E 5 2   DA  2   17  17  DA  DA  E . n 
E 5 3   DG  3   18  18  DG  DG  E . n 
E 5 4   DG  4   19  19  DG  DG  E . n 
E 5 5   DT  5   20  20  DT  DT  E . n 
E 5 6   DG  6   21  21  DG  DG  E . n 
E 5 7   DT  7   22  22  DT  DT  E . n 
E 5 8   DA  8   23  23  DA  DA  E . n 
E 5 9   DC  9   24  24  DC  DC  E . n 
E 5 10  DG  10  25  25  DG  DG  E . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   pentameric 
_pdbx_struct_assembly.oligomeric_count     5 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9170  ? 
1 MORE         -71   ? 
1 'SSA (A^2)'  18190 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OP1   ? C DT  1   ? C DT  15  ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 O     ? A ALA 19  ? A ALA 19  ? 1_555 92.1  ? 
2  OP1   ? C DT  1   ? C DT  15  ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 OP1   ? D DT  15  ? D DT  15  ? 1_555 93.0  ? 
3  O     ? A ALA 19  ? A ALA 19  ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 OP1   ? D DT  15  ? D DT  15  ? 1_555 168.3 ? 
4  OP1   ? C DT  1   ? C DT  15  ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 OD2   ? A ASP 179 ? A ASP 179 ? 1_555 120.7 ? 
5  O     ? A ALA 19  ? A ALA 19  ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 OD2   ? A ASP 179 ? A ASP 179 ? 1_555 97.6  ? 
6  OP1   ? D DT  15  ? D DT  15  ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 OD2   ? A ASP 179 ? A ASP 179 ? 1_555 88.8  ? 
7  OP1   ? C DT  1   ? C DT  15  ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 OD1   ? A ASP 179 ? A ASP 179 ? 1_555 73.8  ? 
8  O     ? A ALA 19  ? A ALA 19  ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 OD1   ? A ASP 179 ? A ASP 179 ? 1_555 96.1  ? 
9  OP1   ? D DT  15  ? D DT  15  ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 OD1   ? A ASP 179 ? A ASP 179 ? 1_555 95.5  ? 
10 OD2   ? A ASP 179 ? A ASP 179 ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 OD1   ? A ASP 179 ? A ASP 179 ? 1_555 47.2  ? 
11 OP1   ? C DT  1   ? C DT  15  ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 O     ? K HOH .   ? D HOH 101 ? 1_555 72.4  ? 
12 O     ? A ALA 19  ? A ALA 19  ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 O     ? K HOH .   ? D HOH 101 ? 1_555 88.6  ? 
13 OP1   ? D DT  15  ? D DT  15  ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 O     ? K HOH .   ? D HOH 101 ? 1_555 83.0  ? 
14 OD2   ? A ASP 179 ? A ASP 179 ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 O     ? K HOH .   ? D HOH 101 ? 1_555 165.0 ? 
15 OD1   ? A ASP 179 ? A ASP 179 ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 O     ? K HOH .   ? D HOH 101 ? 1_555 146.0 ? 
16 OP1   ? C DT  1   ? C DT  15  ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 O     ? H HOH .   ? A HOH 501 ? 1_555 156.3 ? 
17 O     ? A ALA 19  ? A ALA 19  ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 O     ? H HOH .   ? A HOH 501 ? 1_555 84.3  ? 
18 OP1   ? D DT  15  ? D DT  15  ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 O     ? H HOH .   ? A HOH 501 ? 1_555 86.8  ? 
19 OD2   ? A ASP 179 ? A ASP 179 ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 O     ? H HOH .   ? A HOH 501 ? 1_555 83.0  ? 
20 OD1   ? A ASP 179 ? A ASP 179 ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 O     ? H HOH .   ? A HOH 501 ? 1_555 129.9 ? 
21 O     ? K HOH .   ? D HOH 101 ? 1_555 MG ? F MG . ? A MG 401 ? 1_555 O     ? H HOH .   ? A HOH 501 ? 1_555 84.1  ? 
22 OE2   ? A GLU 20  ? A GLU 20  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 OD1   ? A ASP 179 ? A ASP 179 ? 1_555 83.3  ? 
23 OE2   ? A GLU 20  ? A GLU 20  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 OP3   ? E DC  1   ? E DC  16  ? 1_555 105.2 ? 
24 OD1   ? A ASP 179 ? A ASP 179 ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 OP3   ? E DC  1   ? E DC  16  ? 1_555 140.6 ? 
25 OE2   ? A GLU 20  ? A GLU 20  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 "O3'" ? D DT  15  ? D DT  15  ? 1_555 166.9 ? 
26 OD1   ? A ASP 179 ? A ASP 179 ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 "O3'" ? D DT  15  ? D DT  15  ? 1_555 83.6  ? 
27 OP3   ? E DC  1   ? E DC  16  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 "O3'" ? D DT  15  ? D DT  15  ? 1_555 85.4  ? 
28 OE2   ? A GLU 20  ? A GLU 20  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 OP2   ? C DT  1   ? C DT  15  ? 1_555 111.1 ? 
29 OD1   ? A ASP 179 ? A ASP 179 ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 OP2   ? C DT  1   ? C DT  15  ? 1_555 128.1 ? 
30 OP3   ? E DC  1   ? E DC  16  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 OP2   ? C DT  1   ? C DT  15  ? 1_555 85.4  ? 
31 "O3'" ? D DT  15  ? D DT  15  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 OP2   ? C DT  1   ? C DT  15  ? 1_555 76.7  ? 
32 OE2   ? A GLU 20  ? A GLU 20  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 OP1   ? C DT  1   ? C DT  15  ? 1_555 88.6  ? 
33 OD1   ? A ASP 179 ? A ASP 179 ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 OP1   ? C DT  1   ? C DT  15  ? 1_555 75.2  ? 
34 OP3   ? E DC  1   ? E DC  16  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 OP1   ? C DT  1   ? C DT  15  ? 1_555 141.8 ? 
35 "O3'" ? D DT  15  ? D DT  15  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 OP1   ? C DT  1   ? C DT  15  ? 1_555 87.4  ? 
36 OP2   ? C DT  1   ? C DT  15  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 OP1   ? C DT  1   ? C DT  15  ? 1_555 56.5  ? 
37 OE2   ? A GLU 20  ? A GLU 20  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 O     ? A GLY 178 ? A GLY 178 ? 1_555 71.5  ? 
38 OD1   ? A ASP 179 ? A ASP 179 ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 O     ? A GLY 178 ? A GLY 178 ? 1_555 76.3  ? 
39 OP3   ? E DC  1   ? E DC  16  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 O     ? A GLY 178 ? A GLY 178 ? 1_555 70.7  ? 
40 "O3'" ? D DT  15  ? D DT  15  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 O     ? A GLY 178 ? A GLY 178 ? 1_555 106.0 ? 
41 OP2   ? C DT  1   ? C DT  15  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 O     ? A GLY 178 ? A GLY 178 ? 1_555 155.4 ? 
42 OP1   ? C DT  1   ? C DT  15  ? 1_555 MG ? G MG . ? A MG 402 ? 1_555 O     ? A GLY 178 ? A GLY 178 ? 1_555 146.8 ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2014-09-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -6.1130 1.5290   -0.8350  0.0161 0.2030 0.1948 0.0255  0.0044  -0.0201 0.6119 2.4008 1.7517  
0.4005  -0.2337 -1.4801 0.0001  -0.0379 -0.0185 -0.0422 -0.0165 -0.0172 0.1122  0.0878 0.0164  
'X-RAY DIFFRACTION' 2 ? refined 5.4030  12.4030  -17.8370 0.1096 0.3053 0.2504 -0.0293 0.0372  0.0277  1.7533 6.4343 5.8953  
-0.1635 1.0790  -3.4916 0.0898  0.0664  -0.3026 -0.2558 -0.2133 -0.4058 0.3871  0.6077 0.1235  
'X-RAY DIFFRACTION' 3 ? refined 2.4780  -11.7460 17.8570  0.2552 0.2972 0.3142 -0.0143 -0.0264 0.0222  2.8531 5.8122 11.0114 
-0.1107 -1.4492 -4.5546 0.1481  -0.5088 -0.0451 0.5080  -0.0535 0.0109  0.3005  0.5248 -0.0946 
'X-RAY DIFFRACTION' 4 ? refined 3.1120  -9.8490  13.0150  0.2134 0.4215 0.2929 0.0485  0.0121  0.0256  0.7771 4.0552 8.6525  
-0.1455 0.8748  -4.8350 0.1561  -0.1381 0.0467  0.1498  -0.2554 -0.0736 0.0254  1.0569 0.0993  
'X-RAY DIFFRACTION' 5 ? refined 4.8150  14.8390  -21.4570 0.3300 0.4095 0.3422 -0.0825 0.0304  0.1561  9.3226 7.3005 12.0874 
4.9309  -3.2450 -7.1364 -0.0481 0.0610  0.0140  -0.3632 -0.9264 -0.5922 -0.6056 2.0027 0.9745  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 3  ? ? A 302 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 1  ? ? B 14  ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 C 15 ? ? C 25  ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 D 1  ? ? D 15  ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 E 16 ? ? E 25  ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC     'data collection' Quantum  ? 1 
PHASER   phasing           MR       ? 2 
REFMAC   refinement        5.7.0025 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 A GLU 20 ? ? "O3'" B DA  14  ? ? 1.46 
2 1 N6  B DA  13 ? ? O4    D DT  13  ? ? 1.93 
3 1 OP2 E DG  18 ? ? O     E HOH 103 ? ? 2.09 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 P C DT 15 ? ? OP3 C DT 15 ? ? 1.497 1.607 -0.110 0.012 N 
2 1 P E DC 16 ? ? OP3 E DC 16 ? ? 1.473 1.607 -0.134 0.012 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 O     A VAL 27 ? ? C A VAL 27 ? ? N   A ARG 28 ? ? 108.03 122.70 -14.67 1.60 Y 
2 1 "O5'" B DC  5  ? ? P B DC  5  ? ? OP1 B DC  5  ? ? 119.71 110.70 9.01   1.20 N 
3 1 "O5'" B DC  5  ? ? P B DC  5  ? ? OP2 B DC  5  ? ? 98.34  105.70 -7.36  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 30  ? ? -167.34 104.16  
2 1 PHE A 62  ? ? -88.46  34.18   
3 1 ASN A 139 ? ? 50.90   -126.01 
4 1 ASN A 163 ? ? 34.85   68.54   
5 1 ASP A 168 ? ? -170.62 146.88  
6 1 ASN A 298 ? ? 45.64   -123.53 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 0 B DA 14 ? P     ? B DA 14 P     
2 1 Y 0 B DA 14 ? OP1   ? B DA 14 OP1   
3 1 Y 0 B DA 14 ? OP2   ? B DA 14 OP2   
4 1 Y 0 B DA 14 ? "O5'" ? B DA 14 "O5'" 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 1 ? A SER 1 
2 1 Y 1 A LYS 2 ? A LYS 2 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4LOX 'double helix'        
4LOX 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1  1_555 E DG 10 1_555 0.257  -0.205 0.138  -13.910 -4.961  -1.946  1  B_DC1:DG25_E  B 1  ? E 25 ? 19 1 
1 B DG 2  1_555 E DC 9  1_555 -0.190 -0.106 -0.206 -14.740 -12.119 -0.458  2  B_DG2:DC24_E  B 2  ? E 24 ? 19 1 
1 B DT 3  1_555 E DA 8  1_555 -0.039 -0.175 0.031  -8.002  -10.064 -3.403  3  B_DT3:DA23_E  B 3  ? E 23 ? 20 1 
1 B DA 4  1_555 E DT 7  1_555 0.066  -0.175 -0.115 2.498   2.631   5.257   4  B_DA4:DT22_E  B 4  ? E 22 ? 20 1 
1 B DC 5  1_555 E DG 6  1_555 0.098  -0.147 0.021  11.976  -9.240  -3.304  5  B_DC5:DG21_E  B 5  ? E 21 ? 19 1 
1 B DA 6  1_555 E DT 5  1_555 0.311  -0.165 0.259  15.561  -7.169  -0.293  6  B_DA6:DT20_E  B 6  ? E 20 ? 20 1 
1 B DC 7  1_555 E DG 4  1_555 0.381  -0.172 -0.452 15.271  -9.730  2.059   7  B_DC7:DG19_E  B 7  ? E 19 ? 19 1 
1 B DC 8  1_555 E DG 3  1_555 0.237  -0.097 0.002  -8.428  -3.543  1.113   8  B_DC8:DG18_E  B 8  ? E 18 ? 19 1 
1 B DT 9  1_555 E DA 2  1_555 -0.258 -0.220 0.009  3.622   -1.772  2.381   9  B_DT9:DA17_E  B 9  ? E 17 ? 20 1 
1 B DG 10 1_555 E DC 1  1_555 -0.166 -0.193 -0.233 3.434   -10.005 1.108   10 B_DG10:DC16_E B 10 ? E 16 ? 19 1 
1 B DA 11 1_555 D DT 15 1_555 0.221  -0.354 0.266  7.647   -12.401 -2.534  11 B_DA11:DT15_D B 11 ? D 15 ? 20 1 
1 B DT 12 1_555 D DA 14 1_555 -0.168 -0.125 -0.359 12.221  -14.707 1.422   12 B_DT12:DA14_D B 12 ? D 14 ? 20 1 
1 B DA 13 1_555 D DT 13 1_555 0.369  -0.199 0.016  -6.580  -40.508 -22.567 13 B_DA13:DT13_D B 13 ? D 13 ? 20 1 
1 B DA 14 1_555 D DT 12 1_555 -1.079 -0.656 0.264  -11.657 -23.712 -14.587 14 B_DA14:DT12_D B 14 ? D 12 ? 20 1 
1 C DT 1  1_555 D DA 11 1_555 -0.264 -0.108 0.035  -9.366  -9.493  -6.823  15 C_DT15:DA11_D C 15 ? D 11 ? 20 1 
1 C DG 2  1_555 D DC 10 1_555 -0.114 -0.217 -0.261 -0.609  0.645   2.207   16 C_DG16:DC10_D C 16 ? D 10 ? 19 1 
1 C DG 3  1_555 D DC 9  1_555 -0.101 -0.278 -0.418 -14.079 -7.895  0.299   17 C_DG17:DC9_D  C 17 ? D 9  ? 19 1 
1 C DA 4  1_555 D DT 8  1_555 0.059  -0.133 -0.110 -9.232  -5.876  3.528   18 C_DA18:DT8_D  C 18 ? D 8  ? 20 1 
1 C DG 5  1_555 D DC 7  1_555 -0.242 -0.198 0.186  12.439  0.398   -2.977  19 C_DG19:DC7_D  C 19 ? D 7  ? 19 1 
1 C DG 6  1_555 D DC 6  1_555 -0.460 -0.151 0.198  8.252   -10.416 0.677   20 C_DG20:DC6_D  C 20 ? D 6  ? 19 1 
1 C DA 7  1_555 D DT 5  1_555 -0.174 -0.059 0.232  2.572   -8.730  2.605   21 C_DA21:DT5_D  C 21 ? D 5  ? 20 1 
1 C DT 8  1_555 D DA 4  1_555 0.079  0.030  -0.183 12.645  -5.798  0.886   22 C_DT22:DA4_D  C 22 ? D 4  ? 20 1 
1 C DA 9  1_555 D DT 3  1_555 0.142  -0.054 0.266  5.458   -11.362 7.452   23 C_DA23:DT3_D  C 23 ? D 3  ? 20 1 
1 C DC 10 1_555 D DG 2  1_555 0.315  -0.103 0.224  -7.936  -13.663 4.697   24 C_DC24:DG2_D  C 24 ? D 2  ? 19 1 
1 C DC 11 1_555 D DG 1  1_555 -0.185 -0.260 0.922  -15.812 -7.599  -4.650  25 C_DC25:DG1_D  C 25 ? D 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1  1_555 E DG 10 1_555 B DG 2  1_555 E DC 9  1_555 0.728  -0.034 3.409 3.571  7.314   29.140 -1.630 -0.632 3.365 14.190  
-6.929  30.231 1  BB_DC1DG2:DC24DG25_EE   B 1  ? E 25 ? B 2  ? E 24 ? 
1 B DG 2  1_555 E DC 9  1_555 B DT 3  1_555 E DA 8  1_555 -0.826 -0.368 3.107 -2.383 3.971   32.899 -1.277 1.065  3.093 6.969   
4.182   33.214 2  BB_DG2DT3:DA23DC24_EE   B 2  ? E 24 ? B 3  ? E 23 ? 
1 B DT 3  1_555 E DA 8  1_555 B DA 4  1_555 E DT 7  1_555 0.996  0.975  3.207 1.144  -1.265  39.682 1.579  -1.335 3.202 -1.862  
-1.684  39.717 3  BB_DT3DA4:DT22DA23_EE   B 3  ? E 23 ? B 4  ? E 22 ? 
1 B DA 4  1_555 E DT 7  1_555 B DC 5  1_555 E DG 6  1_555 -1.120 0.759  3.170 0.456  -0.268  28.547 1.598  2.371  3.145 -0.543  
-0.924  28.552 4  BB_DA4DC5:DG21DT22_EE   B 4  ? E 22 ? B 5  ? E 21 ? 
1 B DC 5  1_555 E DG 6  1_555 B DA 6  1_555 E DT 5  1_555 0.780  0.118  3.302 0.766  0.821   41.328 0.078  -1.022 3.317 1.163   
-1.085  41.343 5  BB_DC5DA6:DT20DG21_EE   B 5  ? E 21 ? B 6  ? E 20 ? 
1 B DA 6  1_555 E DT 5  1_555 B DC 7  1_555 E DG 4  1_555 0.931  -1.360 3.342 4.374  1.734   31.764 -2.780 -0.875 3.360 3.147   
-7.938  32.101 6  BB_DA6DC7:DG19DT20_EE   B 6  ? E 20 ? B 7  ? E 19 ? 
1 B DC 7  1_555 E DG 4  1_555 B DC 8  1_555 E DG 3  1_555 0.056  -1.951 3.841 -1.339 7.563   31.980 -4.881 -0.353 3.301 13.484  
2.388   32.866 7  BB_DC7DC8:DG18DG19_EE   B 7  ? E 19 ? B 8  ? E 18 ? 
1 B DC 8  1_555 E DG 3  1_555 B DT 9  1_555 E DA 2  1_555 -0.127 -0.816 3.064 2.288  4.399   29.694 -2.397 0.673  2.898 8.508   
-4.426  30.096 8  BB_DC8DT9:DA17DG18_EE   B 8  ? E 18 ? B 9  ? E 17 ? 
1 B DT 9  1_555 E DA 2  1_555 B DG 10 1_555 E DC 1  1_555 -0.771 -0.862 3.398 -1.288 4.252   27.894 -2.781 1.274  3.265 8.750   
2.652   28.239 9  BB_DT9DG10:DC16DA17_EE  B 9  ? E 17 ? B 10 ? E 16 ? 
1 B DG 10 1_555 E DC 1  1_555 B DA 11 1_555 D DT 15 1_555 -0.595 -0.171 3.131 -7.056 2.028   39.811 -0.468 0.091  3.175 2.947   
10.256  40.456 10 BB_DG10DA11:DT15DC16_DE B 10 ? E 16 ? B 11 ? D 15 ? 
1 B DA 11 1_555 D DT 15 1_555 B DT 12 1_555 D DA 14 1_555 -0.257 -0.435 3.198 4.731  -2.160  24.656 -0.379 1.942  3.120 -4.987  
-10.925 25.190 11 BB_DA11DT12:DA14DT15_DD B 11 ? D 15 ? B 12 ? D 14 ? 
1 B DT 12 1_555 D DA 14 1_555 B DA 13 1_555 D DT 13 1_555 -1.214 2.517  3.713 -5.086 -18.536 49.750 4.038  1.022  2.780 -21.145 
5.802   53.113 12 BB_DT12DA13:DT13DA14_DD B 12 ? D 14 ? B 13 ? D 13 ? 
1 B DA 13 1_555 D DT 13 1_555 B DA 14 1_555 D DT 12 1_555 0.208  0.053  3.094 -3.906 -9.080  36.950 1.160  -0.781 2.964 -14.020 
6.032   38.205 13 BB_DA13DA14:DT12DT13_DD B 13 ? D 13 ? B 14 ? D 12 ? 
1 B DA 14 1_555 D DT 12 1_555 C DT 1  1_555 D DA 11 1_555 0.440  -0.215 3.272 4.489  -0.990  40.388 -0.198 -0.131 3.305 -1.429  
-6.477  40.638 14 BC_DA14DT15:DA11DT12_DD B 14 ? D 12 ? C 15 ? D 11 ? 
1 C DT 1  1_555 D DA 11 1_555 C DG 2  1_555 D DC 10 1_555 2.126  0.331  3.156 4.639  1.257   34.168 0.361  -2.858 3.416 2.126   
-7.848  34.495 15 CC_DT15DG16:DC10DA11_DD C 15 ? D 11 ? C 16 ? D 10 ? 
1 C DG 2  1_555 D DC 10 1_555 C DG 3  1_555 D DC 9  1_555 0.730  -1.518 3.821 3.843  4.187   29.818 -3.870 -0.505 3.642 8.045   
-7.385  30.343 16 CC_DG16DG17:DC9DC10_DD  C 16 ? D 10 ? C 17 ? D 9  ? 
1 C DG 3  1_555 D DC 9  1_555 C DA 4  1_555 D DT 8  1_555 -0.026 -1.075 3.304 -0.362 1.024   30.361 -2.259 -0.023 3.267 1.954   
0.690   30.380 17 CC_DG17DA18:DT8DC9_DD   C 17 ? D 9  ? C 18 ? D 8  ? 
1 C DA 4  1_555 D DT 8  1_555 C DG 5  1_555 D DC 7  1_555 -0.598 -0.500 2.865 -0.573 3.350   32.259 -1.408 0.983  2.810 6.009   
1.027   32.432 18 CC_DA18DG19:DC7DT8_DD   C 18 ? D 8  ? C 19 ? D 7  ? 
1 C DG 5  1_555 D DC 7  1_555 C DG 6  1_555 D DC 6  1_555 0.103  -0.677 3.482 1.862  2.697   30.713 -1.824 0.188  3.411 5.073   
-3.502  30.883 19 CC_DG19DG20:DC6DC7_DD   C 19 ? D 7  ? C 20 ? D 6  ? 
1 C DG 6  1_555 D DC 6  1_555 C DA 7  1_555 D DT 5  1_555 0.419  -0.882 3.417 1.188  -3.968  36.874 -0.824 -0.490 3.501 -6.249  
-1.870  37.098 20 CC_DG20DA21:DT5DC6_DD   C 20 ? D 6  ? C 21 ? D 5  ? 
1 C DA 7  1_555 D DT 5  1_555 C DT 8  1_555 D DA 4  1_555 0.100  -0.791 3.133 1.527  -5.165  31.970 -0.527 0.084  3.219 -9.296  
-2.748  32.409 21 CC_DA21DT22:DA4DT5_DD   C 21 ? D 5  ? C 22 ? D 4  ? 
1 C DT 8  1_555 D DA 4  1_555 C DA 9  1_555 D DT 3  1_555 -0.033 -0.231 3.462 -4.793 0.735   41.113 -0.410 -0.496 3.440 1.042   
6.796   41.386 22 CC_DT22DA23:DT3DA4_DD   C 22 ? D 4  ? C 23 ? D 3  ? 
1 C DA 9  1_555 D DT 3  1_555 C DC 10 1_555 D DG 2  1_555 -0.407 -0.841 3.614 -1.745 -1.484  33.335 -1.189 0.386  3.663 -2.583  
3.037   33.412 23 CC_DA23DC24:DG2DT3_DD   C 23 ? D 3  ? C 24 ? D 2  ? 
1 C DC 10 1_555 D DG 2  1_555 C DC 11 1_555 D DG 1  1_555 -0.143 -0.439 3.512 -8.554 6.644   33.328 -1.801 -1.139 3.303 11.221  
14.447  34.997 24 CC_DC24DC25:DG1DG2_DD   C 24 ? D 2  ? C 25 ? D 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
6 'MAGNESIUM ION' MG  
7 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 6 MG  1  401 401 MG  MG  A . 
G 6 MG  1  402 402 MG  MG  A . 
H 7 HOH 1  501 2   HOH HOH A . 
H 7 HOH 2  502 3   HOH HOH A . 
H 7 HOH 3  503 5   HOH HOH A . 
H 7 HOH 4  504 8   HOH HOH A . 
H 7 HOH 5  505 9   HOH HOH A . 
H 7 HOH 6  506 11  HOH HOH A . 
H 7 HOH 7  507 12  HOH HOH A . 
H 7 HOH 8  508 13  HOH HOH A . 
H 7 HOH 9  509 14  HOH HOH A . 
H 7 HOH 10 510 17  HOH HOH A . 
H 7 HOH 11 511 19  HOH HOH A . 
H 7 HOH 12 512 20  HOH HOH A . 
H 7 HOH 13 513 21  HOH HOH A . 
H 7 HOH 14 514 23  HOH HOH A . 
H 7 HOH 15 515 27  HOH HOH A . 
H 7 HOH 16 516 28  HOH HOH A . 
H 7 HOH 17 517 29  HOH HOH A . 
H 7 HOH 18 518 33  HOH HOH A . 
H 7 HOH 19 519 34  HOH HOH A . 
H 7 HOH 20 520 35  HOH HOH A . 
H 7 HOH 21 521 36  HOH HOH A . 
H 7 HOH 22 522 37  HOH HOH A . 
H 7 HOH 23 523 38  HOH HOH A . 
H 7 HOH 24 524 39  HOH HOH A . 
H 7 HOH 25 525 40  HOH HOH A . 
H 7 HOH 26 526 41  HOH HOH A . 
H 7 HOH 27 527 42  HOH HOH A . 
H 7 HOH 28 528 43  HOH HOH A . 
H 7 HOH 29 529 51  HOH HOH A . 
H 7 HOH 30 530 52  HOH HOH A . 
H 7 HOH 31 531 59  HOH HOH A . 
H 7 HOH 32 532 61  HOH HOH A . 
H 7 HOH 33 533 62  HOH HOH A . 
H 7 HOH 34 534 64  HOH HOH A . 
H 7 HOH 35 535 65  HOH HOH A . 
H 7 HOH 36 536 70  HOH HOH A . 
H 7 HOH 37 537 72  HOH HOH A . 
H 7 HOH 38 538 76  HOH HOH A . 
H 7 HOH 39 539 77  HOH HOH A . 
H 7 HOH 40 540 78  HOH HOH A . 
H 7 HOH 41 541 79  HOH HOH A . 
H 7 HOH 42 542 81  HOH HOH A . 
H 7 HOH 43 543 83  HOH HOH A . 
H 7 HOH 44 544 84  HOH HOH A . 
H 7 HOH 45 545 85  HOH HOH A . 
H 7 HOH 46 546 86  HOH HOH A . 
H 7 HOH 47 547 87  HOH HOH A . 
H 7 HOH 48 548 88  HOH HOH A . 
H 7 HOH 49 549 89  HOH HOH A . 
H 7 HOH 50 550 90  HOH HOH A . 
H 7 HOH 51 551 91  HOH HOH A . 
H 7 HOH 52 552 92  HOH HOH A . 
H 7 HOH 53 553 94  HOH HOH A . 
H 7 HOH 54 554 95  HOH HOH A . 
H 7 HOH 55 555 96  HOH HOH A . 
H 7 HOH 56 556 97  HOH HOH A . 
H 7 HOH 57 557 98  HOH HOH A . 
H 7 HOH 58 558 99  HOH HOH A . 
H 7 HOH 59 559 100 HOH HOH A . 
H 7 HOH 60 560 104 HOH HOH A . 
H 7 HOH 61 561 108 HOH HOH A . 
H 7 HOH 62 562 109 HOH HOH A . 
H 7 HOH 63 563 110 HOH HOH A . 
H 7 HOH 64 564 111 HOH HOH A . 
H 7 HOH 65 565 112 HOH HOH A . 
H 7 HOH 66 566 113 HOH HOH A . 
H 7 HOH 67 567 114 HOH HOH A . 
H 7 HOH 68 568 115 HOH HOH A . 
H 7 HOH 69 569 116 HOH HOH A . 
H 7 HOH 70 570 117 HOH HOH A . 
H 7 HOH 71 571 119 HOH HOH A . 
H 7 HOH 72 572 120 HOH HOH A . 
H 7 HOH 73 573 121 HOH HOH A . 
H 7 HOH 74 574 122 HOH HOH A . 
H 7 HOH 75 575 123 HOH HOH A . 
H 7 HOH 76 576 124 HOH HOH A . 
H 7 HOH 77 577 127 HOH HOH A . 
H 7 HOH 78 578 128 HOH HOH A . 
H 7 HOH 79 579 130 HOH HOH A . 
H 7 HOH 80 580 132 HOH HOH A . 
H 7 HOH 81 581 133 HOH HOH A . 
H 7 HOH 82 582 134 HOH HOH A . 
H 7 HOH 83 583 135 HOH HOH A . 
H 7 HOH 84 584 136 HOH HOH A . 
H 7 HOH 85 585 137 HOH HOH A . 
H 7 HOH 86 586 138 HOH HOH A . 
H 7 HOH 87 587 16  HOH HOH A . 
H 7 HOH 88 588 66  HOH HOH A . 
H 7 HOH 89 589 7   HOH HOH A . 
I 7 HOH 1  101 44  HOH HOH B . 
I 7 HOH 2  102 45  HOH HOH B . 
I 7 HOH 3  103 47  HOH HOH B . 
I 7 HOH 4  104 48  HOH HOH B . 
I 7 HOH 5  105 49  HOH HOH B . 
J 7 HOH 1  101 15  HOH HOH C . 
J 7 HOH 2  102 25  HOH HOH C . 
J 7 HOH 3  103 54  HOH HOH C . 
J 7 HOH 4  104 55  HOH HOH C . 
J 7 HOH 5  105 56  HOH HOH C . 
J 7 HOH 6  106 60  HOH HOH C . 
J 7 HOH 7  107 75  HOH HOH C . 
J 7 HOH 8  108 101 HOH HOH C . 
J 7 HOH 9  109 105 HOH HOH C . 
J 7 HOH 10 110 126 HOH HOH C . 
K 7 HOH 1  101 1   HOH HOH D . 
K 7 HOH 2  102 10  HOH HOH D . 
K 7 HOH 3  103 22  HOH HOH D . 
K 7 HOH 4  104 67  HOH HOH D . 
K 7 HOH 5  105 68  HOH HOH D . 
K 7 HOH 6  106 82  HOH HOH D . 
K 7 HOH 7  107 102 HOH HOH D . 
K 7 HOH 8  108 106 HOH HOH D . 
L 7 HOH 1  101 6   HOH HOH E . 
L 7 HOH 2  102 46  HOH HOH E . 
L 7 HOH 3  103 93  HOH HOH E . 
L 7 HOH 4  104 129 HOH HOH E . 
#