data_4LXZ
# 
_entry.id   4LXZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4LXZ         
RCSB  RCSB081226   
WWPDB D_1000081226 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4LY1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4LXZ 
_pdbx_database_status.recvd_initial_deposition_date   2013-07-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fong, R.'       1 
'Lupardus, P.J.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Histone Deacetylase (HDAC) Inhibitor Kinetic Rate Constants Correlate with Cellular Histone Acetylation but Not Transcription and Cell Viability.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            288 
_citation.page_first                26926 
_citation.page_last                 26943 
_citation.year                      2013 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23897821 
_citation.pdbx_database_id_DOI      10.1074/jbc.M113.490706 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lauffer, B.E.'  1  
primary 'Mintzer, R.'    2  
primary 'Fong, R.'       3  
primary 'Mukund, S.'     4  
primary 'Tam, C.'        5  
primary 'Zilberleyb, I.' 6  
primary 'Flicke, B.'     7  
primary 'Ritscher, A.'   8  
primary 'Fedorowicz, G.' 9  
primary 'Vallero, R.'    10 
primary 'Ortwine, D.F.'  11 
primary 'Gunzner, J.'    12 
primary 'Modrusan, Z.'   13 
primary 'Neumann, L.'    14 
primary 'Koth, C.M.'     15 
primary 'Lupardus, P.J.' 16 
primary 'Kaminker, J.S.' 17 
primary 'Heise, C.E.'    18 
primary 'Steiner, P.'    19 
# 
_cell.entry_id           4LXZ 
_cell.length_a           91.967 
_cell.length_b           97.603 
_cell.length_c           138.833 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4LXZ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone deacetylase 2'                     42367.234 3   3.5.1.98 ? 'core domain (UNP residues 8-376)' ? 
2 non-polymer syn 'ZINC ION'                                  65.409    3   ?        ? ?                                  ? 
3 non-polymer syn 'CALCIUM ION'                               40.078    3   ?        ? ?                                  ? 
4 non-polymer syn 'SODIUM ION'                                22.990    3   ?        ? ?                                  ? 
5 non-polymer syn 'TETRAETHYLENE GLYCOL'                      194.226   8   ?        ? ?                                  ? 
6 non-polymer syn 'OCTANEDIOIC ACID HYDROXYAMIDE PHENYLAMIDE' 264.320   3   ?        ? ?                                  ? 
7 non-polymer syn '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID' 207.290   1   ?        ? ?                                  ? 
8 water       nat water                                       18.015    923 ?        ? ?                                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        HD2 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSE
YSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY
HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIIS
KVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPN
ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSE
YSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY
HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIIS
KVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPN
ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPH
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   LYS n 
1 3   LYS n 
1 4   LYS n 
1 5   VAL n 
1 6   CYS n 
1 7   TYR n 
1 8   TYR n 
1 9   TYR n 
1 10  ASP n 
1 11  GLY n 
1 12  ASP n 
1 13  ILE n 
1 14  GLY n 
1 15  ASN n 
1 16  TYR n 
1 17  TYR n 
1 18  TYR n 
1 19  GLY n 
1 20  GLN n 
1 21  GLY n 
1 22  HIS n 
1 23  PRO n 
1 24  MET n 
1 25  LYS n 
1 26  PRO n 
1 27  HIS n 
1 28  ARG n 
1 29  ILE n 
1 30  ARG n 
1 31  MET n 
1 32  THR n 
1 33  HIS n 
1 34  ASN n 
1 35  LEU n 
1 36  LEU n 
1 37  LEU n 
1 38  ASN n 
1 39  TYR n 
1 40  GLY n 
1 41  LEU n 
1 42  TYR n 
1 43  ARG n 
1 44  LYS n 
1 45  MET n 
1 46  GLU n 
1 47  ILE n 
1 48  TYR n 
1 49  ARG n 
1 50  PRO n 
1 51  HIS n 
1 52  LYS n 
1 53  ALA n 
1 54  THR n 
1 55  ALA n 
1 56  GLU n 
1 57  GLU n 
1 58  MET n 
1 59  THR n 
1 60  LYS n 
1 61  TYR n 
1 62  HIS n 
1 63  SER n 
1 64  ASP n 
1 65  GLU n 
1 66  TYR n 
1 67  ILE n 
1 68  LYS n 
1 69  PHE n 
1 70  LEU n 
1 71  ARG n 
1 72  SER n 
1 73  ILE n 
1 74  ARG n 
1 75  PRO n 
1 76  ASP n 
1 77  ASN n 
1 78  MET n 
1 79  SER n 
1 80  GLU n 
1 81  TYR n 
1 82  SER n 
1 83  LYS n 
1 84  GLN n 
1 85  MET n 
1 86  GLN n 
1 87  ARG n 
1 88  PHE n 
1 89  ASN n 
1 90  VAL n 
1 91  GLY n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  PRO n 
1 96  VAL n 
1 97  PHE n 
1 98  ASP n 
1 99  GLY n 
1 100 LEU n 
1 101 PHE n 
1 102 GLU n 
1 103 PHE n 
1 104 CYS n 
1 105 GLN n 
1 106 LEU n 
1 107 SER n 
1 108 THR n 
1 109 GLY n 
1 110 GLY n 
1 111 SER n 
1 112 VAL n 
1 113 ALA n 
1 114 GLY n 
1 115 ALA n 
1 116 VAL n 
1 117 LYS n 
1 118 LEU n 
1 119 ASN n 
1 120 ARG n 
1 121 GLN n 
1 122 GLN n 
1 123 THR n 
1 124 ASP n 
1 125 MET n 
1 126 ALA n 
1 127 VAL n 
1 128 ASN n 
1 129 TRP n 
1 130 ALA n 
1 131 GLY n 
1 132 GLY n 
1 133 LEU n 
1 134 HIS n 
1 135 HIS n 
1 136 ALA n 
1 137 LYS n 
1 138 LYS n 
1 139 SER n 
1 140 GLU n 
1 141 ALA n 
1 142 SER n 
1 143 GLY n 
1 144 PHE n 
1 145 CYS n 
1 146 TYR n 
1 147 VAL n 
1 148 ASN n 
1 149 ASP n 
1 150 ILE n 
1 151 VAL n 
1 152 LEU n 
1 153 ALA n 
1 154 ILE n 
1 155 LEU n 
1 156 GLU n 
1 157 LEU n 
1 158 LEU n 
1 159 LYS n 
1 160 TYR n 
1 161 HIS n 
1 162 GLN n 
1 163 ARG n 
1 164 VAL n 
1 165 LEU n 
1 166 TYR n 
1 167 ILE n 
1 168 ASP n 
1 169 ILE n 
1 170 ASP n 
1 171 ILE n 
1 172 HIS n 
1 173 HIS n 
1 174 GLY n 
1 175 ASP n 
1 176 GLY n 
1 177 VAL n 
1 178 GLU n 
1 179 GLU n 
1 180 ALA n 
1 181 PHE n 
1 182 TYR n 
1 183 THR n 
1 184 THR n 
1 185 ASP n 
1 186 ARG n 
1 187 VAL n 
1 188 MET n 
1 189 THR n 
1 190 VAL n 
1 191 SER n 
1 192 PHE n 
1 193 HIS n 
1 194 LYS n 
1 195 TYR n 
1 196 GLY n 
1 197 GLU n 
1 198 TYR n 
1 199 PHE n 
1 200 PRO n 
1 201 GLY n 
1 202 THR n 
1 203 GLY n 
1 204 ASP n 
1 205 LEU n 
1 206 ARG n 
1 207 ASP n 
1 208 ILE n 
1 209 GLY n 
1 210 ALA n 
1 211 GLY n 
1 212 LYS n 
1 213 GLY n 
1 214 LYS n 
1 215 TYR n 
1 216 TYR n 
1 217 ALA n 
1 218 VAL n 
1 219 ASN n 
1 220 PHE n 
1 221 PRO n 
1 222 MET n 
1 223 ARG n 
1 224 ASP n 
1 225 GLY n 
1 226 ILE n 
1 227 ASP n 
1 228 ASP n 
1 229 GLU n 
1 230 SER n 
1 231 TYR n 
1 232 GLY n 
1 233 GLN n 
1 234 ILE n 
1 235 PHE n 
1 236 LYS n 
1 237 PRO n 
1 238 ILE n 
1 239 ILE n 
1 240 SER n 
1 241 LYS n 
1 242 VAL n 
1 243 MET n 
1 244 GLU n 
1 245 MET n 
1 246 TYR n 
1 247 GLN n 
1 248 PRO n 
1 249 SER n 
1 250 ALA n 
1 251 VAL n 
1 252 VAL n 
1 253 LEU n 
1 254 GLN n 
1 255 CYS n 
1 256 GLY n 
1 257 ALA n 
1 258 ASP n 
1 259 SER n 
1 260 LEU n 
1 261 SER n 
1 262 GLY n 
1 263 ASP n 
1 264 ARG n 
1 265 LEU n 
1 266 GLY n 
1 267 CYS n 
1 268 PHE n 
1 269 ASN n 
1 270 LEU n 
1 271 THR n 
1 272 VAL n 
1 273 LYS n 
1 274 GLY n 
1 275 HIS n 
1 276 ALA n 
1 277 LYS n 
1 278 CYS n 
1 279 VAL n 
1 280 GLU n 
1 281 VAL n 
1 282 VAL n 
1 283 LYS n 
1 284 THR n 
1 285 PHE n 
1 286 ASN n 
1 287 LEU n 
1 288 PRO n 
1 289 LEU n 
1 290 LEU n 
1 291 MET n 
1 292 LEU n 
1 293 GLY n 
1 294 GLY n 
1 295 GLY n 
1 296 GLY n 
1 297 TYR n 
1 298 THR n 
1 299 ILE n 
1 300 ARG n 
1 301 ASN n 
1 302 VAL n 
1 303 ALA n 
1 304 ARG n 
1 305 CYS n 
1 306 TRP n 
1 307 THR n 
1 308 TYR n 
1 309 GLU n 
1 310 THR n 
1 311 ALA n 
1 312 VAL n 
1 313 ALA n 
1 314 LEU n 
1 315 ASP n 
1 316 CYS n 
1 317 GLU n 
1 318 ILE n 
1 319 PRO n 
1 320 ASN n 
1 321 GLU n 
1 322 LEU n 
1 323 PRO n 
1 324 TYR n 
1 325 ASN n 
1 326 ASP n 
1 327 TYR n 
1 328 PHE n 
1 329 GLU n 
1 330 TYR n 
1 331 PHE n 
1 332 GLY n 
1 333 PRO n 
1 334 ASP n 
1 335 PHE n 
1 336 LYS n 
1 337 LEU n 
1 338 HIS n 
1 339 ILE n 
1 340 SER n 
1 341 PRO n 
1 342 SER n 
1 343 ASN n 
1 344 MET n 
1 345 THR n 
1 346 ASN n 
1 347 GLN n 
1 348 ASN n 
1 349 THR n 
1 350 PRO n 
1 351 GLU n 
1 352 TYR n 
1 353 MET n 
1 354 GLU n 
1 355 LYS n 
1 356 ILE n 
1 357 LYS n 
1 358 GLN n 
1 359 ARG n 
1 360 LEU n 
1 361 PHE n 
1 362 GLU n 
1 363 ASN n 
1 364 LEU n 
1 365 ARG n 
1 366 MET n 
1 367 LEU n 
1 368 PRO n 
1 369 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 HDAC2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HDAC2_HUMAN 
_struct_ref.pdbx_db_accession          Q92769 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSE
YSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKY
HQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIIS
KVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPN
ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPH
;
_struct_ref.pdbx_align_begin           8 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4LXZ A 1 ? 369 ? Q92769 8 ? 376 ? 12 380 
2 1 4LXZ B 1 ? 369 ? Q92769 8 ? 376 ? 12 380 
3 1 4LXZ C 1 ? 369 ? Q92769 8 ? 376 ? 12 380 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                     ?                           'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                    ?                           'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ?                           'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ?                           'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                               ?                           'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                                    ?                           'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                   ?                           'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ?                           'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                     ?                           'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ?                           'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                       ?                           'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ?                           'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                     ?                           'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                      ?                           'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                  ?                           'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'                                ?                           'Na 1'           22.990  
NHE non-polymer         . '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID' 'N-CYCLOHEXYLTAURINE; CHES' 'C8 H17 N O3 S'  207.290 
PG4 non-polymer         . 'TETRAETHYLENE GLYCOL'                      ?                           'C8 H18 O5'      194.226 
PHE 'L-peptide linking' y PHENYLALANINE                               ?                           'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                     ?                           'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                      ?                           'C3 H7 N O3'     105.093 
SHH non-polymer         . 'OCTANEDIOIC ACID HYDROXYAMIDE PHENYLAMIDE' SAHA                        'C14 H20 N2 O3'  264.320 
THR 'L-peptide linking' y THREONINE                                   ?                           'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                  ?                           'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                    ?                           'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                      ?                           'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'                                  ?                           'Zn 2'           65.409  
# 
_exptl.entry_id          4LXZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.82 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.5 
_exptl_crystal_grow.pdbx_details    '0.1M CHES, pH 9.5, 40% PEG-600, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2011-07-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.pdbx_wavelength             0.979 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     4LXZ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.85 
_reflns.number_obs                   105047 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.1 
_reflns.pdbx_Rmerge_I_obs            0.085 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.6 
_reflns.B_iso_Wilson_estimate        18.25 
_reflns.pdbx_redundancy              3.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.85 
_reflns_shell.d_res_low              1.88 
_reflns_shell.percent_possible_all   95.9 
_reflns_shell.Rmerge_I_obs           0.532 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.9 
_reflns_shell.pdbx_redundancy        2.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4LXZ 
_refine.ls_number_reflns_obs                     105047 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.09 
_refine.ls_d_res_high                            1.85 
_refine.ls_percent_reflns_obs                    98.16 
_refine.ls_R_factor_obs                          0.1607 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1590 
_refine.ls_R_factor_R_free                       0.1916 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  5254 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9544 
_refine.correlation_coeff_Fo_to_Fc_free          0.9412 
_refine.B_iso_mean                               20.14 
_refine.aniso_B[1][1]                            2.5434 
_refine.aniso_B[2][2]                            -3.2583 
_refine.aniso_B[3][3]                            0.7149 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 3MAX' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.116 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        4LXZ 
_refine_analyze.Luzzati_coordinate_error_obs    0.171 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8886 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         183 
_refine_hist.number_atoms_solvent             923 
_refine_hist.number_atoms_total               9992 
_refine_hist.d_res_high                       1.85 
_refine_hist.d_res_low                        27.09 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_bond_d                  0.010 ? 2.00  9364  HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               0.98  ? 2.00  12604 HARMONIC     'X-RAY DIFFRACTION' 
t_dihedral_angle_d        ?     ? 2.00  3320  SINUSOIDAL   'X-RAY DIFFRACTION' 
t_incorr_chiral_ct        ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_pseud_angle             ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_trig_c_planes           ?     ? 2.00  225   HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              ?     ? 5.00  1361  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      ?     ? 20.00 9364  HARMONIC     'X-RAY DIFFRACTION' 
t_nbd                     ?     ? 5.00  0     SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_omega_torsion           3.47  ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_other_torsion           16.15 ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_improper_torsion        ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion ?     ? 5.00  1116  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_sum_occupancies         ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_utility_distance        ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_utility_angle           ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_utility_torsion         ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_ideal_dist_contact      ?     ? 4.00  12028 SEMIHARMONIC 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.85 
_refine_ls_shell.d_res_low                        1.90 
_refine_ls_shell.number_reflns_R_work             7131 
_refine_ls_shell.R_factor_R_work                  0.2102 
_refine_ls_shell.percent_reflns_obs               98.16 
_refine_ls_shell.R_factor_R_free                  0.2527 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.81 
_refine_ls_shell.number_reflns_R_free             360 
_refine_ls_shell.number_reflns_all                7491 
_refine_ls_shell.R_factor_all                     0.2123 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4LXZ 
_struct.title                     'Structure of Human HDAC2 in complex with SAHA (vorinostat)' 
_struct.pdbx_descriptor           'Histone deacetylase 2 (E.C.3.5.1.98)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4LXZ 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            'deacetylase, Histone, HYDROLASE-HYDROLASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 3 ? 
F  N N 4 ? 
G  N N 5 ? 
H  N N 5 ? 
I  N N 5 ? 
J  N N 6 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 4 ? 
N  N N 7 ? 
O  N N 5 ? 
P  N N 5 ? 
Q  N N 5 ? 
R  N N 6 ? 
S  N N 2 ? 
T  N N 3 ? 
U  N N 4 ? 
V  N N 5 ? 
W  N N 5 ? 
X  N N 6 ? 
Y  N N 8 ? 
Z  N N 8 ? 
AA N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 12  ? TYR A 16  ? ASP A 23  TYR A 27  5 ? 5  
HELX_P HELX_P2  2  PRO A 26  ? TYR A 39  ? PRO A 37  TYR A 50  1 ? 14 
HELX_P HELX_P3  3  GLY A 40  ? LYS A 44  ? GLY A 51  LYS A 55  5 ? 5  
HELX_P HELX_P4  4  THR A 54  ? THR A 59  ? THR A 65  THR A 70  1 ? 6  
HELX_P HELX_P5  5  SER A 63  ? ILE A 73  ? SER A 74  ILE A 84  1 ? 11 
HELX_P HELX_P6  6  ASN A 77  ? GLU A 80  ? ASN A 88  GLU A 91  5 ? 4  
HELX_P HELX_P7  7  TYR A 81  ? ASN A 89  ? TYR A 92  ASN A 100 1 ? 9  
HELX_P HELX_P8  8  GLY A 99  ? ARG A 120 ? GLY A 110 ARG A 131 1 ? 22 
HELX_P HELX_P9  9  ASN A 148 ? LEU A 158 ? ASN A 159 LEU A 169 1 ? 11 
HELX_P HELX_P10 10 GLY A 174 ? PHE A 181 ? GLY A 185 PHE A 192 1 ? 8  
HELX_P HELX_P11 11 ALA A 210 ? LYS A 214 ? ALA A 221 LYS A 225 5 ? 5  
HELX_P HELX_P12 12 ASP A 227 ? GLN A 247 ? ASP A 238 GLN A 258 1 ? 21 
HELX_P HELX_P13 13 GLY A 256 ? LEU A 260 ? GLY A 267 LEU A 271 5 ? 5  
HELX_P HELX_P14 14 THR A 271 ? THR A 284 ? THR A 282 THR A 295 1 ? 14 
HELX_P HELX_P15 15 THR A 298 ? LEU A 314 ? THR A 309 LEU A 325 1 ? 17 
HELX_P HELX_P16 16 TYR A 327 ? GLY A 332 ? TYR A 338 GLY A 343 5 ? 6  
HELX_P HELX_P17 17 THR A 349 ? ARG A 365 ? THR A 360 ARG A 376 1 ? 17 
HELX_P HELX_P18 18 ASP B 12  ? TYR B 16  ? ASP B 23  TYR B 27  5 ? 5  
HELX_P HELX_P19 19 PRO B 26  ? TYR B 39  ? PRO B 37  TYR B 50  1 ? 14 
HELX_P HELX_P20 20 GLY B 40  ? MET B 45  ? GLY B 51  MET B 56  5 ? 6  
HELX_P HELX_P21 21 THR B 54  ? THR B 59  ? THR B 65  THR B 70  1 ? 6  
HELX_P HELX_P22 22 SER B 63  ? ILE B 73  ? SER B 74  ILE B 84  1 ? 11 
HELX_P HELX_P23 23 ARG B 74  ? MET B 78  ? ARG B 85  MET B 89  5 ? 5  
HELX_P HELX_P24 24 TYR B 81  ? PHE B 88  ? TYR B 92  PHE B 99  1 ? 8  
HELX_P HELX_P25 25 GLY B 99  ? ARG B 120 ? GLY B 110 ARG B 131 1 ? 22 
HELX_P HELX_P26 26 ASN B 148 ? LEU B 158 ? ASN B 159 LEU B 169 1 ? 11 
HELX_P HELX_P27 27 GLY B 174 ? PHE B 181 ? GLY B 185 PHE B 192 1 ? 8  
HELX_P HELX_P28 28 ALA B 210 ? LYS B 214 ? ALA B 221 LYS B 225 5 ? 5  
HELX_P HELX_P29 29 ASP B 227 ? GLN B 247 ? ASP B 238 GLN B 258 1 ? 21 
HELX_P HELX_P30 30 GLY B 256 ? LEU B 260 ? GLY B 267 LEU B 271 5 ? 5  
HELX_P HELX_P31 31 THR B 271 ? THR B 284 ? THR B 282 THR B 295 1 ? 14 
HELX_P HELX_P32 32 THR B 298 ? LEU B 314 ? THR B 309 LEU B 325 1 ? 17 
HELX_P HELX_P33 33 TYR B 327 ? GLY B 332 ? TYR B 338 GLY B 343 5 ? 6  
HELX_P HELX_P34 34 THR B 349 ? MET B 366 ? THR B 360 MET B 377 1 ? 18 
HELX_P HELX_P35 35 ASP C 12  ? TYR C 16  ? ASP C 23  TYR C 27  5 ? 5  
HELX_P HELX_P36 36 PRO C 26  ? TYR C 39  ? PRO C 37  TYR C 50  1 ? 14 
HELX_P HELX_P37 37 GLY C 40  ? LYS C 44  ? GLY C 51  LYS C 55  5 ? 5  
HELX_P HELX_P38 38 THR C 54  ? THR C 59  ? THR C 65  THR C 70  1 ? 6  
HELX_P HELX_P39 39 SER C 63  ? ILE C 73  ? SER C 74  ILE C 84  1 ? 11 
HELX_P HELX_P40 40 ASN C 77  ? GLU C 80  ? ASN C 88  GLU C 91  5 ? 4  
HELX_P HELX_P41 41 TYR C 81  ? ASN C 89  ? TYR C 92  ASN C 100 1 ? 9  
HELX_P HELX_P42 42 GLY C 99  ? ARG C 120 ? GLY C 110 ARG C 131 1 ? 22 
HELX_P HELX_P43 43 ASN C 148 ? LEU C 158 ? ASN C 159 LEU C 169 1 ? 11 
HELX_P HELX_P44 44 GLY C 174 ? PHE C 181 ? GLY C 185 PHE C 192 1 ? 8  
HELX_P HELX_P45 45 ALA C 210 ? LYS C 214 ? ALA C 221 LYS C 225 5 ? 5  
HELX_P HELX_P46 46 ASP C 227 ? GLN C 247 ? ASP C 238 GLN C 258 1 ? 21 
HELX_P HELX_P47 47 GLY C 256 ? LEU C 260 ? GLY C 267 LEU C 271 5 ? 5  
HELX_P HELX_P48 48 THR C 271 ? THR C 284 ? THR C 282 THR C 295 1 ? 14 
HELX_P HELX_P49 49 THR C 298 ? LEU C 314 ? THR C 309 LEU C 325 1 ? 17 
HELX_P HELX_P50 50 TYR C 327 ? GLY C 332 ? TYR C 338 GLY C 343 5 ? 6  
HELX_P HELX_P51 51 THR C 349 ? ARG C 365 ? THR C 360 ARG C 376 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 258 OD2 ? ? ? 1_555 D  ZN  . ZN ? ? A ASP 269 A ZN  401 1_555 ? ? ? ? ? ? ? 1.900 ? 
metalc2  metalc ? ? B ASP 258 OD1 ? ? ? 1_555 K  ZN  . ZN ? ? B ASP 269 B ZN  401 1_555 ? ? ? ? ? ? ? 1.902 ? 
metalc3  metalc ? ? C ASP 258 OD2 ? ? ? 1_555 S  ZN  . ZN ? ? C ASP 269 C ZN  401 1_555 ? ? ? ? ? ? ? 1.961 ? 
metalc4  metalc ? ? C HIS 172 ND1 ? ? ? 1_555 S  ZN  . ZN ? ? C HIS 183 C ZN  401 1_555 ? ? ? ? ? ? ? 1.980 ? 
metalc5  metalc ? ? A ASP 170 OD2 ? ? ? 1_555 D  ZN  . ZN ? ? A ASP 181 A ZN  401 1_555 ? ? ? ? ? ? ? 1.995 ? 
metalc6  metalc ? ? B ASP 170 OD2 ? ? ? 1_555 K  ZN  . ZN ? ? B ASP 181 B ZN  401 1_555 ? ? ? ? ? ? ? 1.998 ? 
metalc7  metalc ? ? C ASP 170 OD2 ? ? ? 1_555 S  ZN  . ZN ? ? C ASP 181 C ZN  401 1_555 ? ? ? ? ? ? ? 2.062 ? 
metalc8  metalc ? ? A HIS 172 ND1 ? ? ? 1_555 D  ZN  . ZN ? ? A HIS 183 A ZN  401 1_555 ? ? ? ? ? ? ? 2.067 ? 
metalc9  metalc ? ? B HIS 172 ND1 ? ? ? 1_555 K  ZN  . ZN ? ? B HIS 183 B ZN  401 1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc10 metalc ? ? C PHE 181 O   ? ? ? 1_555 U  NA  . NA ? ? C PHE 192 C NA  403 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc11 metalc ? ? C VAL 187 O   ? ? ? 1_555 U  NA  . NA ? ? C VAL 198 C NA  403 1_555 ? ? ? ? ? ? ? 2.400 ? 
metalc12 metalc ? ? A PHE 181 O   ? ? ? 1_555 F  NA  . NA ? ? A PHE 192 A NA  403 1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc13 metalc ? ? B VAL 187 O   ? ? ? 1_555 M  NA  . NA ? ? B VAL 198 B NA  403 1_555 ? ? ? ? ? ? ? 2.455 ? 
metalc14 metalc ? ? B PHE 181 O   ? ? ? 1_555 M  NA  . NA ? ? B PHE 192 B NA  403 1_555 ? ? ? ? ? ? ? 2.458 ? 
metalc15 metalc ? ? A VAL 187 O   ? ? ? 1_555 F  NA  . NA ? ? A VAL 198 A NA  403 1_555 ? ? ? ? ? ? ? 2.495 ? 
metalc16 metalc ? ? C ASP 170 O   ? ? ? 1_555 T  CA  . CA ? ? C ASP 181 C CA  402 1_555 ? ? ? ? ? ? ? 2.554 ? 
metalc17 metalc ? ? A ASP 168 OD1 ? ? ? 1_555 E  CA  . CA ? ? A ASP 179 A CA  402 1_555 ? ? ? ? ? ? ? 2.556 ? 
metalc18 metalc ? ? C ASP 168 OD1 ? ? ? 1_555 T  CA  . CA ? ? C ASP 179 C CA  402 1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc19 metalc ? ? B PHE 192 O   ? ? ? 1_555 L  CA  . CA ? ? B PHE 203 B CA  402 1_555 ? ? ? ? ? ? ? 2.565 ? 
metalc20 metalc ? ? B ASP 170 O   ? ? ? 1_555 L  CA  . CA ? ? B ASP 181 B CA  402 1_555 ? ? ? ? ? ? ? 2.572 ? 
metalc21 metalc ? ? A ASP 170 O   ? ? ? 1_555 E  CA  . CA ? ? A ASP 181 A CA  402 1_555 ? ? ? ? ? ? ? 2.573 ? 
metalc22 metalc ? ? A PHE 192 O   ? ? ? 1_555 E  CA  . CA ? ? A PHE 203 A CA  402 1_555 ? ? ? ? ? ? ? 2.623 ? 
metalc23 metalc ? ? C THR 184 O   ? ? ? 1_555 U  NA  . NA ? ? C THR 195 C NA  403 1_555 ? ? ? ? ? ? ? 2.646 ? 
metalc24 metalc ? ? B ASP 168 OD1 ? ? ? 1_555 L  CA  . CA ? ? B ASP 179 B CA  402 1_555 ? ? ? ? ? ? ? 2.648 ? 
metalc25 metalc ? ? C PHE 192 O   ? ? ? 1_555 T  CA  . CA ? ? C PHE 203 C CA  402 1_555 ? ? ? ? ? ? ? 2.670 ? 
metalc26 metalc ? ? B THR 184 O   ? ? ? 1_555 M  NA  . NA ? ? B THR 195 B NA  403 1_555 ? ? ? ? ? ? ? 2.686 ? 
metalc27 metalc ? ? A ASP 168 O   ? ? ? 1_555 E  CA  . CA ? ? A ASP 179 A CA  402 1_555 ? ? ? ? ? ? ? 2.712 ? 
metalc28 metalc ? ? B HIS 172 O   ? ? ? 1_555 L  CA  . CA ? ? B HIS 183 B CA  402 1_555 ? ? ? ? ? ? ? 2.746 ? 
metalc29 metalc ? ? A THR 184 O   ? ? ? 1_555 F  NA  . NA ? ? A THR 195 A NA  403 1_555 ? ? ? ? ? ? ? 2.755 ? 
metalc30 metalc ? ? C HIS 172 O   ? ? ? 1_555 T  CA  . CA ? ? C HIS 183 C CA  402 1_555 ? ? ? ? ? ? ? 2.772 ? 
metalc31 metalc ? ? A HIS 172 O   ? ? ? 1_555 E  CA  . CA ? ? A HIS 183 A CA  402 1_555 ? ? ? ? ? ? ? 2.811 ? 
metalc32 metalc ? ? B SER 191 OG  ? ? ? 1_555 L  CA  . CA ? ? B SER 202 B CA  402 1_555 ? ? ? ? ? ? ? 2.874 ? 
metalc33 metalc ? ? C ASP 168 O   ? ? ? 1_555 T  CA  . CA ? ? C ASP 179 C CA  402 1_555 ? ? ? ? ? ? ? 2.893 ? 
metalc34 metalc ? ? C SER 191 OG  ? ? ? 1_555 T  CA  . CA ? ? C SER 202 C CA  402 1_555 ? ? ? ? ? ? ? 2.894 ? 
metalc35 metalc ? ? B ASP 168 O   ? ? ? 1_555 L  CA  . CA ? ? B ASP 179 B CA  402 1_555 ? ? ? ? ? ? ? 2.900 ? 
metalc36 metalc ? ? A SER 191 OG  ? ? ? 1_555 E  CA  . CA ? ? A SER 202 A CA  402 1_555 ? ? ? ? ? ? ? 2.999 ? 
metalc37 metalc ? ? B TYR 216 O   ? ? ? 1_555 M  NA  . NA ? ? B TYR 227 B NA  403 1_555 ? ? ? ? ? ? ? 3.103 ? 
metalc38 metalc ? ? A TYR 216 O   ? ? ? 1_555 F  NA  . NA ? ? A TYR 227 A NA  403 1_555 ? ? ? ? ? ? ? 3.179 ? 
metalc39 metalc ? ? U NA  .   NA  ? ? ? 1_555 AA HOH . O  ? ? C NA  403 C HOH 505 1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc40 metalc ? ? M NA  .   NA  ? ? ? 1_555 Z  HOH . O  ? ? B NA  403 B HOH 533 1_555 ? ? ? ? ? ? ? 2.447 ? 
metalc41 metalc ? ? F NA  .   NA  ? ? ? 1_555 Y  HOH . O  ? ? A NA  403 A HOH 522 1_555 ? ? ? ? ? ? ? 2.542 ? 
metalc42 metalc ? ? U NA  .   NA  ? ? ? 1_555 AA HOH . O  ? ? C NA  403 C HOH 520 1_555 ? ? ? ? ? ? ? 2.672 ? 
metalc43 metalc ? ? M NA  .   NA  ? ? ? 1_555 Z  HOH . O  ? ? B NA  403 B HOH 549 1_555 ? ? ? ? ? ? ? 2.766 ? 
metalc44 metalc ? ? F NA  .   NA  ? ? ? 1_555 Y  HOH . O  ? ? A NA  403 A HOH 528 1_555 ? ? ? ? ? ? ? 2.878 ? 
metalc45 metalc ? ? D ZN  .   ZN  ? ? ? 1_555 J  SHH . O1 ? ? A ZN  401 A SHH 407 1_555 ? ? ? ? ? ? ? 1.957 ? 
metalc46 metalc ? ? K ZN  .   ZN  ? ? ? 1_555 R  SHH . O1 ? ? B ZN  401 B SHH 408 1_555 ? ? ? ? ? ? ? 1.983 ? 
metalc47 metalc ? ? S ZN  .   ZN  ? ? ? 1_555 X  SHH . O1 ? ? C ZN  401 C SHH 406 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc48 metalc ? ? D ZN  .   ZN  ? ? ? 1_555 J  SHH . O2 ? ? A ZN  401 A SHH 407 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc49 metalc ? ? S ZN  .   ZN  ? ? ? 1_555 X  SHH . O2 ? ? C ZN  401 C SHH 406 1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc50 metalc ? ? K ZN  .   ZN  ? ? ? 1_555 R  SHH . O2 ? ? B ZN  401 B SHH 408 1_555 ? ? ? ? ? ? ? 2.421 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 199 A . ? PHE 210 A PRO 200 A ? PRO 211 A 1 -2.59 
2 GLY 332 A . ? GLY 343 A PRO 333 A ? PRO 344 A 1 0.60  
3 PHE 199 B . ? PHE 210 B PRO 200 B ? PRO 211 B 1 -4.14 
4 GLY 332 B . ? GLY 343 B PRO 333 B ? PRO 344 B 1 6.58  
5 PHE 199 C . ? PHE 210 C PRO 200 C ? PRO 211 C 1 -3.28 
6 GLY 332 C . ? GLY 343 C PRO 333 C ? PRO 344 C 1 3.28  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 8 ? 
C ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
A 5 6 ? parallel 
A 6 7 ? parallel 
A 7 8 ? parallel 
B 1 2 ? parallel 
B 2 3 ? parallel 
B 3 4 ? parallel 
B 4 5 ? parallel 
B 5 6 ? parallel 
B 6 7 ? parallel 
B 7 8 ? parallel 
C 1 2 ? parallel 
C 2 3 ? parallel 
C 3 4 ? parallel 
C 4 5 ? parallel 
C 5 6 ? parallel 
C 6 7 ? parallel 
C 7 8 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 46  ? TYR A 48  ? GLU A 57  TYR A 59  
A 2 VAL A 5   ? TYR A 8   ? VAL A 16  TYR A 19  
A 3 MET A 125 ? ASN A 128 ? MET A 136 ASN A 139 
A 4 LEU A 289 ? LEU A 292 ? LEU A 300 LEU A 303 
A 5 ALA A 250 ? GLN A 254 ? ALA A 261 GLN A 265 
A 6 VAL A 164 ? ASP A 168 ? VAL A 175 ASP A 179 
A 7 VAL A 187 ? LYS A 194 ? VAL A 198 LYS A 205 
A 8 ALA A 217 ? MET A 222 ? ALA A 228 MET A 233 
B 1 GLU B 46  ? TYR B 48  ? GLU B 57  TYR B 59  
B 2 VAL B 5   ? TYR B 8   ? VAL B 16  TYR B 19  
B 3 MET B 125 ? ASN B 128 ? MET B 136 ASN B 139 
B 4 LEU B 289 ? LEU B 292 ? LEU B 300 LEU B 303 
B 5 ALA B 250 ? GLN B 254 ? ALA B 261 GLN B 265 
B 6 VAL B 164 ? ASP B 168 ? VAL B 175 ASP B 179 
B 7 VAL B 187 ? LYS B 194 ? VAL B 198 LYS B 205 
B 8 ALA B 217 ? MET B 222 ? ALA B 228 MET B 233 
C 1 GLU C 46  ? TYR C 48  ? GLU C 57  TYR C 59  
C 2 VAL C 5   ? TYR C 8   ? VAL C 16  TYR C 19  
C 3 MET C 125 ? ASN C 128 ? MET C 136 ASN C 139 
C 4 LEU C 289 ? LEU C 292 ? LEU C 300 LEU C 303 
C 5 ALA C 250 ? GLN C 254 ? ALA C 261 GLN C 265 
C 6 VAL C 164 ? ASP C 168 ? VAL C 175 ASP C 179 
C 7 VAL C 187 ? LYS C 194 ? VAL C 198 LYS C 205 
C 8 ALA C 217 ? MET C 222 ? ALA C 228 MET C 233 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 48  ? O TYR A 59  N TYR A 7   ? N TYR A 18  
A 2 3 N TYR A 8   ? N TYR A 19  O VAL A 127 ? O VAL A 138 
A 3 4 N ALA A 126 ? N ALA A 137 O MET A 291 ? O MET A 302 
A 4 5 O LEU A 290 ? O LEU A 301 N LEU A 253 ? N LEU A 264 
A 5 6 O GLN A 254 ? O GLN A 265 N ILE A 167 ? N ILE A 178 
A 6 7 N TYR A 166 ? N TYR A 177 O MET A 188 ? O MET A 199 
A 7 8 N THR A 189 ? N THR A 200 O VAL A 218 ? O VAL A 229 
B 1 2 O TYR B 48  ? O TYR B 59  N TYR B 7   ? N TYR B 18  
B 2 3 N TYR B 8   ? N TYR B 19  O VAL B 127 ? O VAL B 138 
B 3 4 N ALA B 126 ? N ALA B 137 O MET B 291 ? O MET B 302 
B 4 5 O LEU B 290 ? O LEU B 301 N LEU B 253 ? N LEU B 264 
B 5 6 O GLN B 254 ? O GLN B 265 N ILE B 167 ? N ILE B 178 
B 6 7 N TYR B 166 ? N TYR B 177 O MET B 188 ? O MET B 199 
B 7 8 N SER B 191 ? N SER B 202 O PHE B 220 ? O PHE B 231 
C 1 2 O TYR C 48  ? O TYR C 59  N TYR C 7   ? N TYR C 18  
C 2 3 N TYR C 8   ? N TYR C 19  O VAL C 127 ? O VAL C 138 
C 3 4 N ALA C 126 ? N ALA C 137 O MET C 291 ? O MET C 302 
C 4 5 O LEU C 290 ? O LEU C 301 N LEU C 253 ? N LEU C 264 
C 5 6 O GLN C 254 ? O GLN C 265 N ILE C 167 ? N ILE C 178 
C 6 7 N TYR C 166 ? N TYR C 177 O MET C 188 ? O MET C 199 
C 7 8 N THR C 189 ? N THR C 200 O VAL C 218 ? O VAL C 229 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 401'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 402'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 403'  
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PG4 A 404' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE PG4 A 405' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE PG4 A 406' 
AC7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE SHH A 407' 
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 401'  
AC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA B 402'  
BC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA B 403'  
BC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NHE B 404' 
BC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE PG4 B 405' 
BC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE PG4 B 406' 
BC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE PG4 B 407' 
BC6 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE SHH B 408' 
BC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 401'  
BC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA C 402'  
BC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA C 403'  
CC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE PG4 C 404' 
CC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE PG4 C 405' 
CC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE SHH C 406' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  ASP A  170 ? ASP A 181 . ? 1_555 ? 
2   AC1 4  HIS A  172 ? HIS A 183 . ? 1_555 ? 
3   AC1 4  ASP A  258 ? ASP A 269 . ? 1_555 ? 
4   AC1 4  SHH J  .   ? SHH A 407 . ? 1_555 ? 
5   AC2 5  ASP A  168 ? ASP A 179 . ? 1_555 ? 
6   AC2 5  ASP A  170 ? ASP A 181 . ? 1_555 ? 
7   AC2 5  HIS A  172 ? HIS A 183 . ? 1_555 ? 
8   AC2 5  SER A  191 ? SER A 202 . ? 1_555 ? 
9   AC2 5  PHE A  192 ? PHE A 203 . ? 1_555 ? 
10  AC3 6  PHE A  181 ? PHE A 192 . ? 1_555 ? 
11  AC3 6  THR A  184 ? THR A 195 . ? 1_555 ? 
12  AC3 6  VAL A  187 ? VAL A 198 . ? 1_555 ? 
13  AC3 6  TYR A  216 ? TYR A 227 . ? 1_555 ? 
14  AC3 6  HOH Y  .   ? HOH A 522 . ? 1_555 ? 
15  AC3 6  HOH Y  .   ? HOH A 528 . ? 1_555 ? 
16  AC4 2  LYS A  60  ? LYS A 71  . ? 1_555 ? 
17  AC4 2  ALA A  180 ? ALA A 191 . ? 1_555 ? 
18  AC5 4  ARG A  300 ? ARG A 311 . ? 1_555 ? 
19  AC5 4  GLU A  329 ? GLU A 340 . ? 1_555 ? 
20  AC5 4  TYR A  330 ? TYR A 341 . ? 1_555 ? 
21  AC5 4  GLY A  332 ? GLY A 343 . ? 1_555 ? 
22  AC6 5  ASP A  12  ? ASP A 23  . ? 1_555 ? 
23  AC6 5  ASN A  15  ? ASN A 26  . ? 1_555 ? 
24  AC6 5  TYR A  16  ? TYR A 27  . ? 1_555 ? 
25  AC6 5  ASP A  98  ? ASP A 109 . ? 1_555 ? 
26  AC6 5  HOH Y  .   ? HOH A 802 . ? 1_555 ? 
27  AC7 13 PRO A  23  ? PRO A 34  . ? 1_555 ? 
28  AC7 13 ASP A  93  ? ASP A 104 . ? 1_555 ? 
29  AC7 13 HIS A  134 ? HIS A 145 . ? 1_555 ? 
30  AC7 13 HIS A  135 ? HIS A 146 . ? 1_555 ? 
31  AC7 13 GLY A  143 ? GLY A 154 . ? 1_555 ? 
32  AC7 13 PHE A  144 ? PHE A 155 . ? 1_555 ? 
33  AC7 13 ASP A  170 ? ASP A 181 . ? 1_555 ? 
34  AC7 13 HIS A  172 ? HIS A 183 . ? 1_555 ? 
35  AC7 13 ASP A  258 ? ASP A 269 . ? 1_555 ? 
36  AC7 13 TYR A  297 ? TYR A 308 . ? 1_555 ? 
37  AC7 13 ZN  D  .   ? ZN  A 401 . ? 1_555 ? 
38  AC7 13 HOH Y  .   ? HOH A 606 . ? 1_555 ? 
39  AC7 13 HOH Y  .   ? HOH A 791 . ? 1_555 ? 
40  AC8 4  ASP B  170 ? ASP B 181 . ? 1_555 ? 
41  AC8 4  HIS B  172 ? HIS B 183 . ? 1_555 ? 
42  AC8 4  ASP B  258 ? ASP B 269 . ? 1_555 ? 
43  AC8 4  SHH R  .   ? SHH B 408 . ? 1_555 ? 
44  AC9 5  ASP B  168 ? ASP B 179 . ? 1_555 ? 
45  AC9 5  ASP B  170 ? ASP B 181 . ? 1_555 ? 
46  AC9 5  HIS B  172 ? HIS B 183 . ? 1_555 ? 
47  AC9 5  SER B  191 ? SER B 202 . ? 1_555 ? 
48  AC9 5  PHE B  192 ? PHE B 203 . ? 1_555 ? 
49  BC1 6  PHE B  181 ? PHE B 192 . ? 1_555 ? 
50  BC1 6  THR B  184 ? THR B 195 . ? 1_555 ? 
51  BC1 6  VAL B  187 ? VAL B 198 . ? 1_555 ? 
52  BC1 6  TYR B  216 ? TYR B 227 . ? 1_555 ? 
53  BC1 6  HOH Z  .   ? HOH B 533 . ? 1_555 ? 
54  BC1 6  HOH Z  .   ? HOH B 549 . ? 1_555 ? 
55  BC2 7  TYR A  48  ? TYR A 59  . ? 4_545 ? 
56  BC2 7  LYS A  117 ? LYS A 128 . ? 4_545 ? 
57  BC2 7  ASP B  10  ? ASP B 21  . ? 1_555 ? 
58  BC2 7  ASP B  12  ? ASP B 23  . ? 1_555 ? 
59  BC2 7  ARG B  49  ? ARG B 60  . ? 1_555 ? 
60  BC2 7  LYS B  52  ? LYS B 63  . ? 1_555 ? 
61  BC2 7  GLU B  102 ? GLU B 113 . ? 1_555 ? 
62  BC3 5  ARG B  300 ? ARG B 311 . ? 1_555 ? 
63  BC3 5  GLU B  329 ? GLU B 340 . ? 1_555 ? 
64  BC3 5  TYR B  330 ? TYR B 341 . ? 1_555 ? 
65  BC3 5  GLY B  332 ? GLY B 343 . ? 1_555 ? 
66  BC3 5  HOH Z  .   ? HOH B 835 . ? 1_555 ? 
67  BC4 5  LYS B  273 ? LYS B 284 . ? 1_555 ? 
68  BC4 5  ASN B  320 ? ASN B 331 . ? 1_555 ? 
69  BC4 5  HIS B  338 ? HIS B 349 . ? 1_555 ? 
70  BC4 5  GLU C  56  ? GLU C 67  . ? 1_555 ? 
71  BC4 5  THR C  59  ? THR C 70  . ? 1_555 ? 
72  BC5 6  ARG A  120 ? ARG A 131 . ? 4_545 ? 
73  BC5 6  ASP B  12  ? ASP B 23  . ? 1_555 ? 
74  BC5 6  ASN B  15  ? ASN B 26  . ? 1_555 ? 
75  BC5 6  TYR B  16  ? TYR B 27  . ? 1_555 ? 
76  BC5 6  ASP B  98  ? ASP B 109 . ? 1_555 ? 
77  BC5 6  GLU B  102 ? GLU B 113 . ? 1_555 ? 
78  BC6 11 PRO B  23  ? PRO B 34  . ? 1_555 ? 
79  BC6 11 ASP B  93  ? ASP B 104 . ? 1_555 ? 
80  BC6 11 HIS B  134 ? HIS B 145 . ? 1_555 ? 
81  BC6 11 HIS B  135 ? HIS B 146 . ? 1_555 ? 
82  BC6 11 GLY B  143 ? GLY B 154 . ? 1_555 ? 
83  BC6 11 ASP B  170 ? ASP B 181 . ? 1_555 ? 
84  BC6 11 HIS B  172 ? HIS B 183 . ? 1_555 ? 
85  BC6 11 ASP B  258 ? ASP B 269 . ? 1_555 ? 
86  BC6 11 TYR B  297 ? TYR B 308 . ? 1_555 ? 
87  BC6 11 ZN  K  .   ? ZN  B 401 . ? 1_555 ? 
88  BC6 11 HOH Z  .   ? HOH B 671 . ? 1_555 ? 
89  BC7 4  ASP C  170 ? ASP C 181 . ? 1_555 ? 
90  BC7 4  HIS C  172 ? HIS C 183 . ? 1_555 ? 
91  BC7 4  ASP C  258 ? ASP C 269 . ? 1_555 ? 
92  BC7 4  SHH X  .   ? SHH C 406 . ? 1_555 ? 
93  BC8 5  ASP C  168 ? ASP C 179 . ? 1_555 ? 
94  BC8 5  ASP C  170 ? ASP C 181 . ? 1_555 ? 
95  BC8 5  HIS C  172 ? HIS C 183 . ? 1_555 ? 
96  BC8 5  SER C  191 ? SER C 202 . ? 1_555 ? 
97  BC8 5  PHE C  192 ? PHE C 203 . ? 1_555 ? 
98  BC9 6  PHE C  181 ? PHE C 192 . ? 1_555 ? 
99  BC9 6  THR C  184 ? THR C 195 . ? 1_555 ? 
100 BC9 6  VAL C  187 ? VAL C 198 . ? 1_555 ? 
101 BC9 6  TYR C  216 ? TYR C 227 . ? 1_555 ? 
102 BC9 6  HOH AA .   ? HOH C 505 . ? 1_555 ? 
103 BC9 6  HOH AA .   ? HOH C 520 . ? 1_555 ? 
104 CC1 6  PRO B  333 ? PRO B 344 . ? 1_555 ? 
105 CC1 6  ASP B  334 ? ASP B 345 . ? 1_555 ? 
106 CC1 6  ALA C  180 ? ALA C 191 . ? 1_555 ? 
107 CC1 6  ARG C  186 ? ARG C 197 . ? 1_555 ? 
108 CC1 6  HOH AA .   ? HOH C 540 . ? 1_555 ? 
109 CC1 6  HOH AA .   ? HOH C 627 . ? 1_555 ? 
110 CC2 5  ASN B  343 ? ASN B 354 . ? 1_555 ? 
111 CC2 5  LEU C  158 ? LEU C 169 . ? 1_555 ? 
112 CC2 5  TYR C  160 ? TYR C 171 . ? 1_555 ? 
113 CC2 5  GLN C  162 ? GLN C 173 . ? 1_555 ? 
114 CC2 5  ARG C  186 ? ARG C 197 . ? 1_555 ? 
115 CC3 13 PRO C  23  ? PRO C 34  . ? 1_555 ? 
116 CC3 13 ASP C  93  ? ASP C 104 . ? 1_555 ? 
117 CC3 13 HIS C  134 ? HIS C 145 . ? 1_555 ? 
118 CC3 13 HIS C  135 ? HIS C 146 . ? 1_555 ? 
119 CC3 13 GLY C  143 ? GLY C 154 . ? 1_555 ? 
120 CC3 13 ASP C  170 ? ASP C 181 . ? 1_555 ? 
121 CC3 13 HIS C  172 ? HIS C 183 . ? 1_555 ? 
122 CC3 13 ASP C  258 ? ASP C 269 . ? 1_555 ? 
123 CC3 13 TYR C  297 ? TYR C 308 . ? 1_555 ? 
124 CC3 13 HIS C  369 ? HIS C 380 . ? 3_544 ? 
125 CC3 13 ZN  S  .   ? ZN  C 401 . ? 1_555 ? 
126 CC3 13 HOH AA .   ? HOH C 641 . ? 1_555 ? 
127 CC3 13 HOH AA .   ? HOH C 755 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4LXZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4LXZ 
_atom_sites.fract_transf_matrix[1][1]   0.010873 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010246 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007203 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
NA 
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A  1 1   ? -10.393 -26.860 -7.953  1.00 33.70 ? 12  GLY A N     1 
ATOM   2     C  CA    . GLY A  1 1   ? -11.161 -26.080 -6.979  1.00 32.90 ? 12  GLY A CA    1 
ATOM   3     C  C     . GLY A  1 1   ? -10.234 -25.377 -5.957  1.00 32.58 ? 12  GLY A C     1 
ATOM   4     O  O     . GLY A  1 1   ? -9.014  -25.419 -6.130  1.00 31.29 ? 12  GLY A O     1 
ATOM   5     N  N     . LYS A  1 2   ? -10.803 -24.771 -4.870  1.00 26.06 ? 13  LYS A N     1 
ATOM   6     C  CA    . LYS A  1 2   ? -10.001 -24.155 -3.800  1.00 24.98 ? 13  LYS A CA    1 
ATOM   7     C  C     . LYS A  1 2   ? -9.439  -25.281 -2.954  1.00 29.46 ? 13  LYS A C     1 
ATOM   8     O  O     . LYS A  1 2   ? -10.083 -26.327 -2.821  1.00 28.77 ? 13  LYS A O     1 
ATOM   9     C  CB    . LYS A  1 2   ? -10.810 -23.166 -2.949  1.00 26.83 ? 13  LYS A CB    1 
ATOM   10    C  CG    . LYS A  1 2   ? -11.153 -21.890 -3.722  1.00 30.45 ? 13  LYS A CG    1 
ATOM   11    C  CD    . LYS A  1 2   ? -11.590 -20.761 -2.824  1.00 36.34 ? 13  LYS A CD    1 
ATOM   12    C  CE    . LYS A  1 2   ? -11.741 -19.506 -3.638  1.00 41.74 ? 13  LYS A CE    1 
ATOM   13    N  NZ    . LYS A  1 2   ? -12.060 -18.329 -2.793  1.00 51.57 ? 13  LYS A NZ    1 
ATOM   14    N  N     . LYS A  1 3   ? -8.229  -25.096 -2.406  1.00 24.38 ? 14  LYS A N     1 
ATOM   15    C  CA    . LYS A  1 3   ? -7.588  -26.199 -1.699  1.00 23.58 ? 14  LYS A CA    1 
ATOM   16    C  C     . LYS A  1 3   ? -7.378  -26.010 -0.202  1.00 23.99 ? 14  LYS A C     1 
ATOM   17    O  O     . LYS A  1 3   ? -7.395  -24.878 0.297   1.00 22.53 ? 14  LYS A O     1 
ATOM   18    C  CB    . LYS A  1 3   ? -6.260  -26.544 -2.399  1.00 26.67 ? 14  LYS A CB    1 
ATOM   19    C  CG    . LYS A  1 3   ? -6.357  -26.901 -3.897  1.00 40.37 ? 14  LYS A CG    1 
ATOM   20    C  CD    . LYS A  1 3   ? -7.210  -28.158 -4.182  1.00 48.89 ? 14  LYS A CD    1 
ATOM   21    C  CE    . LYS A  1 3   ? -7.053  -28.711 -5.583  1.00 53.79 ? 14  LYS A CE    1 
ATOM   22    N  NZ    . LYS A  1 3   ? -7.422  -27.726 -6.635  1.00 63.69 ? 14  LYS A NZ    1 
ATOM   23    N  N     . LYS A  1 4   ? -7.200  -27.141 0.512   1.00 17.57 ? 15  LYS A N     1 
ATOM   24    C  CA    . LYS A  1 4   ? -6.907  -27.146 1.939   1.00 15.67 ? 15  LYS A CA    1 
ATOM   25    C  C     . LYS A  1 4   ? -5.404  -26.900 2.054   1.00 17.29 ? 15  LYS A C     1 
ATOM   26    O  O     . LYS A  1 4   ? -4.592  -27.644 1.482   1.00 16.08 ? 15  LYS A O     1 
ATOM   27    C  CB    . LYS A  1 4   ? -7.266  -28.489 2.588   1.00 16.84 ? 15  LYS A CB    1 
ATOM   28    C  CG    . LYS A  1 4   ? -6.901  -28.543 4.075   1.00 21.72 ? 15  LYS A CG    1 
ATOM   29    C  CD    . LYS A  1 4   ? -7.706  -29.583 4.844   1.00 29.12 ? 15  LYS A CD    1 
ATOM   30    C  CE    . LYS A  1 4   ? -7.332  -29.583 6.304   1.00 37.63 ? 15  LYS A CE    1 
ATOM   31    N  NZ    . LYS A  1 4   ? -7.621  -30.897 6.944   1.00 42.76 ? 15  LYS A NZ    1 
ATOM   32    N  N     . VAL A  1 5   ? -5.055  -25.886 2.828   1.00 12.25 ? 16  VAL A N     1 
ATOM   33    C  CA    . VAL A  1 5   ? -3.676  -25.445 3.053   1.00 12.16 ? 16  VAL A CA    1 
ATOM   34    C  C     . VAL A  1 5   ? -3.372  -25.548 4.543   1.00 14.47 ? 16  VAL A C     1 
ATOM   35    O  O     . VAL A  1 5   ? -4.115  -24.995 5.366   1.00 14.82 ? 16  VAL A O     1 
ATOM   36    C  CB    . VAL A  1 5   ? -3.496  -23.961 2.574   1.00 15.64 ? 16  VAL A CB    1 
ATOM   37    C  CG1   . VAL A  1 5   ? -2.094  -23.426 2.886   1.00 15.54 ? 16  VAL A CG1   1 
ATOM   38    C  CG2   . VAL A  1 5   ? -3.811  -23.789 1.081   1.00 16.59 ? 16  VAL A CG2   1 
ATOM   39    N  N     . CYS A  1 6   ? -2.266  -26.214 4.884   1.00 11.06 ? 17  CYS A N     1 
ATOM   40    C  CA    . CYS A  1 6   ? -1.757  -26.318 6.251   1.00 11.02 ? 17  CYS A CA    1 
ATOM   41    C  C     . CYS A  1 6   ? -0.441  -25.580 6.244   1.00 14.06 ? 17  CYS A C     1 
ATOM   42    O  O     . CYS A  1 6   ? 0.395   -25.774 5.344   1.00 13.61 ? 17  CYS A O     1 
ATOM   43    C  CB    . CYS A  1 6   ? -1.601  -27.772 6.680   1.00 12.20 ? 17  CYS A CB    1 
ATOM   44    S  SG    . CYS A  1 6   ? -3.185  -28.604 6.933   1.00 15.73 ? 17  CYS A SG    1 
ATOM   45    N  N     . TYR A  1 7   ? -0.300  -24.668 7.194   1.00 10.32 ? 18  TYR A N     1 
ATOM   46    C  CA    . TYR A  1 7   ? 0.817   -23.740 7.271   1.00 9.45  ? 18  TYR A CA    1 
ATOM   47    C  C     . TYR A  1 7   ? 1.581   -23.937 8.572   1.00 12.75 ? 18  TYR A C     1 
ATOM   48    O  O     . TYR A  1 7   ? 0.969   -24.038 9.646   1.00 13.57 ? 18  TYR A O     1 
ATOM   49    C  CB    . TYR A  1 7   ? 0.231   -22.320 7.088   1.00 10.04 ? 18  TYR A CB    1 
ATOM   50    C  CG    . TYR A  1 7   ? 1.117   -21.161 7.482   1.00 11.69 ? 18  TYR A CG    1 
ATOM   51    C  CD1   . TYR A  1 7   ? 1.210   -20.752 8.813   1.00 13.32 ? 18  TYR A CD1   1 
ATOM   52    C  CD2   . TYR A  1 7   ? 1.746   -20.379 6.514   1.00 12.86 ? 18  TYR A CD2   1 
ATOM   53    C  CE1   . TYR A  1 7   ? 1.953   -19.630 9.176   1.00 11.39 ? 18  TYR A CE1   1 
ATOM   54    C  CE2   . TYR A  1 7   ? 2.484   -19.241 6.867   1.00 13.62 ? 18  TYR A CE2   1 
ATOM   55    C  CZ    . TYR A  1 7   ? 2.581   -18.874 8.199   1.00 15.34 ? 18  TYR A CZ    1 
ATOM   56    O  OH    . TYR A  1 7   ? 3.297   -17.768 8.569   1.00 12.11 ? 18  TYR A OH    1 
ATOM   57    N  N     . TYR A  1 8   ? 2.922   -23.979 8.476   1.00 8.81  ? 19  TYR A N     1 
ATOM   58    C  CA    . TYR A  1 8   ? 3.781   -24.269 9.617   1.00 8.93  ? 19  TYR A CA    1 
ATOM   59    C  C     . TYR A  1 8   ? 4.607   -23.081 10.049  1.00 12.93 ? 19  TYR A C     1 
ATOM   60    O  O     . TYR A  1 8   ? 5.331   -22.481 9.245   1.00 12.57 ? 19  TYR A O     1 
ATOM   61    C  CB    . TYR A  1 8   ? 4.686   -25.489 9.322   1.00 11.05 ? 19  TYR A CB    1 
ATOM   62    C  CG    . TYR A  1 8   ? 3.879   -26.744 9.121   1.00 10.81 ? 19  TYR A CG    1 
ATOM   63    C  CD1   . TYR A  1 8   ? 3.319   -27.045 7.881   1.00 11.47 ? 19  TYR A CD1   1 
ATOM   64    C  CD2   . TYR A  1 8   ? 3.618   -27.603 10.183  1.00 11.69 ? 19  TYR A CD2   1 
ATOM   65    C  CE1   . TYR A  1 8   ? 2.487   -28.148 7.716   1.00 12.79 ? 19  TYR A CE1   1 
ATOM   66    C  CE2   . TYR A  1 8   ? 2.819   -28.736 10.016  1.00 12.01 ? 19  TYR A CE2   1 
ATOM   67    C  CZ    . TYR A  1 8   ? 2.244   -28.991 8.785   1.00 16.32 ? 19  TYR A CZ    1 
ATOM   68    O  OH    . TYR A  1 8   ? 1.412   -30.062 8.616   1.00 14.87 ? 19  TYR A OH    1 
ATOM   69    N  N     . TYR A  1 9   ? 4.534   -22.772 11.340  1.00 8.37  ? 20  TYR A N     1 
ATOM   70    C  CA    . TYR A  1 9   ? 5.272   -21.639 11.873  1.00 8.50  ? 20  TYR A CA    1 
ATOM   71    C  C     . TYR A  1 9   ? 5.491   -21.789 13.359  1.00 14.15 ? 20  TYR A C     1 
ATOM   72    O  O     . TYR A  1 9   ? 4.570   -22.173 14.094  1.00 12.72 ? 20  TYR A O     1 
ATOM   73    C  CB    . TYR A  1 9   ? 4.482   -20.346 11.600  1.00 8.97  ? 20  TYR A CB    1 
ATOM   74    C  CG    . TYR A  1 9   ? 5.065   -19.092 12.205  1.00 10.11 ? 20  TYR A CG    1 
ATOM   75    C  CD1   . TYR A  1 9   ? 4.531   -18.544 13.370  1.00 12.45 ? 20  TYR A CD1   1 
ATOM   76    C  CD2   . TYR A  1 9   ? 6.156   -18.450 11.618  1.00 9.65  ? 20  TYR A CD2   1 
ATOM   77    C  CE1   . TYR A  1 9   ? 5.057   -17.383 13.933  1.00 11.96 ? 20  TYR A CE1   1 
ATOM   78    C  CE2   . TYR A  1 9   ? 6.710   -17.295 12.188  1.00 10.22 ? 20  TYR A CE2   1 
ATOM   79    C  CZ    . TYR A  1 9   ? 6.146   -16.764 13.342  1.00 13.62 ? 20  TYR A CZ    1 
ATOM   80    O  OH    . TYR A  1 9   ? 6.631   -15.608 13.899  1.00 12.29 ? 20  TYR A OH    1 
ATOM   81    N  N     . ASP A  1 10  ? 6.712   -21.445 13.803  1.00 10.88 ? 21  ASP A N     1 
ATOM   82    C  CA    . ASP A  1 10  ? 7.029   -21.418 15.222  1.00 10.32 ? 21  ASP A CA    1 
ATOM   83    C  C     . ASP A  1 10  ? 7.366   -19.981 15.567  1.00 15.08 ? 21  ASP A C     1 
ATOM   84    O  O     . ASP A  1 10  ? 8.284   -19.445 14.965  1.00 15.12 ? 21  ASP A O     1 
ATOM   85    C  CB    . ASP A  1 10  ? 8.219   -22.349 15.531  1.00 11.85 ? 21  ASP A CB    1 
ATOM   86    C  CG    . ASP A  1 10  ? 8.455   -22.501 17.028  1.00 16.97 ? 21  ASP A CG    1 
ATOM   87    O  OD1   . ASP A  1 10  ? 8.303   -23.614 17.530  1.00 14.45 ? 21  ASP A OD1   1 
ATOM   88    O  OD2   . ASP A  1 10  ? 8.637   -21.464 17.715  1.00 16.30 ? 21  ASP A OD2   1 
ATOM   89    N  N     . GLY A  1 11  ? 6.656   -19.383 16.541  1.00 12.56 ? 22  GLY A N     1 
ATOM   90    C  CA    . GLY A  1 11  ? 6.878   -18.007 16.994  1.00 13.67 ? 22  GLY A CA    1 
ATOM   91    C  C     . GLY A  1 11  ? 8.290   -17.686 17.485  1.00 18.11 ? 22  GLY A C     1 
ATOM   92    O  O     . GLY A  1 11  ? 8.646   -16.515 17.620  1.00 19.74 ? 22  GLY A O     1 
ATOM   93    N  N     . ASP A  1 12  ? 9.108   -18.710 17.779  1.00 13.17 ? 23  ASP A N     1 
ATOM   94    C  CA    . ASP A  1 12  ? 10.490  -18.500 18.231  1.00 13.90 ? 23  ASP A CA    1 
ATOM   95    C  C     . ASP A  1 12  ? 11.425  -18.240 17.056  1.00 16.21 ? 23  ASP A C     1 
ATOM   96    O  O     . ASP A  1 12  ? 12.510  -17.707 17.264  1.00 14.78 ? 23  ASP A O     1 
ATOM   97    C  CB    . ASP A  1 12  ? 11.022  -19.751 18.945  1.00 16.60 ? 23  ASP A CB    1 
ATOM   98    C  CG    . ASP A  1 12  ? 10.363  -20.090 20.266  1.00 24.36 ? 23  ASP A CG    1 
ATOM   99    O  OD1   . ASP A  1 12  ? 10.590  -21.219 20.766  1.00 24.81 ? 23  ASP A OD1   1 
ATOM   100   O  OD2   . ASP A  1 12  ? 9.633   -19.217 20.816  1.00 21.17 ? 23  ASP A OD2   1 
ATOM   101   N  N     . ILE A  1 13  ? 11.030  -18.662 15.835  1.00 13.70 ? 24  ILE A N     1 
ATOM   102   C  CA    . ILE A  1 13  ? 11.883  -18.602 14.626  1.00 13.04 ? 24  ILE A CA    1 
ATOM   103   C  C     . ILE A  1 13  ? 12.587  -17.274 14.364  1.00 15.31 ? 24  ILE A C     1 
ATOM   104   O  O     . ILE A  1 13  ? 13.771  -17.274 14.036  1.00 13.98 ? 24  ILE A O     1 
ATOM   105   C  CB    . ILE A  1 13  ? 11.185  -19.197 13.352  1.00 16.01 ? 24  ILE A CB    1 
ATOM   106   C  CG1   . ILE A  1 13  ? 12.206  -19.757 12.314  1.00 17.80 ? 24  ILE A CG1   1 
ATOM   107   C  CG2   . ILE A  1 13  ? 10.173  -18.231 12.715  1.00 14.36 ? 24  ILE A CG2   1 
ATOM   108   C  CD1   . ILE A  1 13  ? 12.748  -21.148 12.675  1.00 19.58 ? 24  ILE A CD1   1 
ATOM   109   N  N     . GLY A  1 14  ? 11.860  -16.176 14.527  1.00 13.55 ? 25  GLY A N     1 
ATOM   110   C  CA    . GLY A  1 14  ? 12.352  -14.825 14.262  1.00 14.46 ? 25  GLY A CA    1 
ATOM   111   C  C     . GLY A  1 14  ? 13.462  -14.357 15.178  1.00 17.49 ? 25  GLY A C     1 
ATOM   112   O  O     . GLY A  1 14  ? 14.118  -13.365 14.874  1.00 16.77 ? 25  GLY A O     1 
ATOM   113   N  N     . ASN A  1 15  ? 13.691  -15.083 16.290  1.00 13.89 ? 26  ASN A N     1 
ATOM   114   C  CA    . ASN A  1 15  ? 14.716  -14.733 17.282  1.00 14.72 ? 26  ASN A CA    1 
ATOM   115   C  C     . ASN A  1 15  ? 16.088  -15.298 16.994  1.00 17.86 ? 26  ASN A C     1 
ATOM   116   O  O     . ASN A  1 15  ? 17.059  -14.847 17.608  1.00 16.56 ? 26  ASN A O     1 
ATOM   117   C  CB    . ASN A  1 15  ? 14.265  -15.134 18.685  1.00 15.59 ? 26  ASN A CB    1 
ATOM   118   C  CG    . ASN A  1 15  ? 13.001  -14.419 19.097  1.00 29.82 ? 26  ASN A CG    1 
ATOM   119   O  OD1   . ASN A  1 15  ? 12.801  -13.229 18.813  1.00 22.23 ? 26  ASN A OD1   1 
ATOM   120   N  ND2   . ASN A  1 15  ? 12.086  -15.158 19.683  1.00 23.21 ? 26  ASN A ND2   1 
ATOM   121   N  N     . TYR A  1 16  ? 16.188  -16.293 16.094  1.00 13.81 ? 27  TYR A N     1 
ATOM   122   C  CA    . TYR A  1 16  ? 17.497  -16.874 15.737  1.00 13.21 ? 27  TYR A CA    1 
ATOM   123   C  C     . TYR A  1 16  ? 18.270  -15.857 14.919  1.00 16.55 ? 27  TYR A C     1 
ATOM   124   O  O     . TYR A  1 16  ? 17.732  -15.255 13.975  1.00 15.64 ? 27  TYR A O     1 
ATOM   125   C  CB    . TYR A  1 16  ? 17.334  -18.222 15.015  1.00 14.07 ? 27  TYR A CB    1 
ATOM   126   C  CG    . TYR A  1 16  ? 16.740  -19.262 15.930  1.00 14.71 ? 27  TYR A CG    1 
ATOM   127   C  CD1   . TYR A  1 16  ? 15.381  -19.559 15.889  1.00 16.07 ? 27  TYR A CD1   1 
ATOM   128   C  CD2   . TYR A  1 16  ? 17.516  -19.886 16.903  1.00 15.31 ? 27  TYR A CD2   1 
ATOM   129   C  CE1   . TYR A  1 16  ? 14.807  -20.444 16.801  1.00 17.54 ? 27  TYR A CE1   1 
ATOM   130   C  CE2   . TYR A  1 16  ? 16.955  -20.784 17.809  1.00 16.44 ? 27  TYR A CE2   1 
ATOM   131   C  CZ    . TYR A  1 16  ? 15.602  -21.061 17.753  1.00 20.25 ? 27  TYR A CZ    1 
ATOM   132   O  OH    . TYR A  1 16  ? 15.060  -21.962 18.629  1.00 21.92 ? 27  TYR A OH    1 
ATOM   133   N  N     . TYR A  1 17  ? 19.508  -15.601 15.332  1.00 14.05 ? 28  TYR A N     1 
ATOM   134   C  CA    . TYR A  1 17  ? 20.335  -14.540 14.754  1.00 14.39 ? 28  TYR A CA    1 
ATOM   135   C  C     . TYR A  1 17  ? 21.663  -15.065 14.263  1.00 17.14 ? 28  TYR A C     1 
ATOM   136   O  O     . TYR A  1 17  ? 22.457  -15.565 15.050  1.00 15.50 ? 28  TYR A O     1 
ATOM   137   C  CB    . TYR A  1 17  ? 20.506  -13.410 15.806  1.00 16.61 ? 28  TYR A CB    1 
ATOM   138   C  CG    . TYR A  1 17  ? 21.189  -12.151 15.314  1.00 19.64 ? 28  TYR A CG    1 
ATOM   139   C  CD1   . TYR A  1 17  ? 20.584  -11.329 14.366  1.00 22.40 ? 28  TYR A CD1   1 
ATOM   140   C  CD2   . TYR A  1 17  ? 22.395  -11.728 15.867  1.00 21.04 ? 28  TYR A CD2   1 
ATOM   141   C  CE1   . TYR A  1 17  ? 21.202  -10.159 13.919  1.00 23.65 ? 28  TYR A CE1   1 
ATOM   142   C  CE2   . TYR A  1 17  ? 23.011  -10.548 15.447  1.00 22.33 ? 28  TYR A CE2   1 
ATOM   143   C  CZ    . TYR A  1 17  ? 22.419  -9.776  14.460  1.00 31.97 ? 28  TYR A CZ    1 
ATOM   144   O  OH    . TYR A  1 17  ? 23.015  -8.603  14.051  1.00 33.88 ? 28  TYR A OH    1 
ATOM   145   N  N     . TYR A  1 18  ? 21.897  -14.971 12.948  1.00 14.42 ? 29  TYR A N     1 
ATOM   146   C  CA    . TYR A  1 18  ? 23.135  -15.439 12.300  1.00 14.30 ? 29  TYR A CA    1 
ATOM   147   C  C     . TYR A  1 18  ? 24.374  -14.600 12.673  1.00 21.07 ? 29  TYR A C     1 
ATOM   148   O  O     . TYR A  1 18  ? 25.495  -15.064 12.456  1.00 22.20 ? 29  TYR A O     1 
ATOM   149   C  CB    . TYR A  1 18  ? 22.965  -15.426 10.773  1.00 13.45 ? 29  TYR A CB    1 
ATOM   150   C  CG    . TYR A  1 18  ? 22.325  -16.665 10.180  1.00 13.64 ? 29  TYR A CG    1 
ATOM   151   C  CD1   . TYR A  1 18  ? 23.026  -17.476 9.290   1.00 14.54 ? 29  TYR A CD1   1 
ATOM   152   C  CD2   . TYR A  1 18  ? 21.001  -17.004 10.472  1.00 13.88 ? 29  TYR A CD2   1 
ATOM   153   C  CE1   . TYR A  1 18  ? 22.426  -18.591 8.699   1.00 14.19 ? 29  TYR A CE1   1 
ATOM   154   C  CE2   . TYR A  1 18  ? 20.416  -18.158 9.942   1.00 13.60 ? 29  TYR A CE2   1 
ATOM   155   C  CZ    . TYR A  1 18  ? 21.121  -18.926 9.026   1.00 13.46 ? 29  TYR A CZ    1 
ATOM   156   O  OH    . TYR A  1 18  ? 20.538  -20.028 8.450   1.00 11.76 ? 29  TYR A OH    1 
ATOM   157   N  N     . GLY A  1 19  ? 24.183  -13.386 13.173  1.00 18.66 ? 30  GLY A N     1 
ATOM   158   C  CA    . GLY A  1 19  ? 25.311  -12.527 13.546  1.00 19.04 ? 30  GLY A CA    1 
ATOM   159   C  C     . GLY A  1 19  ? 25.349  -11.201 12.823  1.00 23.19 ? 30  GLY A C     1 
ATOM   160   O  O     . GLY A  1 19  ? 24.684  -11.017 11.801  1.00 20.80 ? 30  GLY A O     1 
ATOM   161   N  N     . GLN A  1 20  ? 26.111  -10.237 13.380  1.00 21.96 ? 31  GLN A N     1 
ATOM   162   C  CA    . GLN A  1 20  ? 26.224  -8.889  12.815  1.00 22.47 ? 31  GLN A CA    1 
ATOM   163   C  C     . GLN A  1 20  ? 26.743  -8.941  11.374  1.00 24.91 ? 31  GLN A C     1 
ATOM   164   O  O     . GLN A  1 20  ? 27.721  -9.635  11.082  1.00 26.09 ? 31  GLN A O     1 
ATOM   165   C  CB    . GLN A  1 20  ? 27.141  -8.010  13.694  1.00 24.28 ? 31  GLN A CB    1 
ATOM   166   C  CG    . GLN A  1 20  ? 27.159  -6.531  13.309  1.00 38.43 ? 31  GLN A CG    1 
ATOM   167   C  CD    . GLN A  1 20  ? 28.225  -5.726  14.034  1.00 63.67 ? 31  GLN A CD    1 
ATOM   168   O  OE1   . GLN A  1 20  ? 29.199  -6.257  14.591  1.00 60.93 ? 31  GLN A OE1   1 
ATOM   169   N  NE2   . GLN A  1 20  ? 28.088  -4.411  13.996  1.00 54.62 ? 31  GLN A NE2   1 
ATOM   170   N  N     . GLY A  1 21  ? 26.049  -8.247  10.492  1.00 20.19 ? 32  GLY A N     1 
ATOM   171   C  CA    . GLY A  1 21  ? 26.419  -8.194  9.084   1.00 19.82 ? 32  GLY A CA    1 
ATOM   172   C  C     . GLY A  1 21  ? 25.966  -9.369  8.236   1.00 21.07 ? 32  GLY A C     1 
ATOM   173   O  O     . GLY A  1 21  ? 26.039  -9.273  7.009   1.00 20.30 ? 32  GLY A O     1 
ATOM   174   N  N     . HIS A  1 22  ? 25.487  -10.486 8.860   1.00 14.81 ? 33  HIS A N     1 
ATOM   175   C  CA    . HIS A  1 22  ? 25.049  -11.657 8.084   1.00 13.05 ? 33  HIS A CA    1 
ATOM   176   C  C     . HIS A  1 22  ? 23.691  -11.400 7.394   1.00 16.97 ? 33  HIS A C     1 
ATOM   177   O  O     . HIS A  1 22  ? 22.705  -11.055 8.061   1.00 15.13 ? 33  HIS A O     1 
ATOM   178   C  CB    . HIS A  1 22  ? 25.039  -12.952 8.922   1.00 12.50 ? 33  HIS A CB    1 
ATOM   179   C  CG    . HIS A  1 22  ? 25.038  -14.183 8.070   1.00 14.62 ? 33  HIS A CG    1 
ATOM   180   N  ND1   . HIS A  1 22  ? 23.970  -14.482 7.241   1.00 14.65 ? 33  HIS A ND1   1 
ATOM   181   C  CD2   . HIS A  1 22  ? 25.994  -15.132 7.915   1.00 14.78 ? 33  HIS A CD2   1 
ATOM   182   C  CE1   . HIS A  1 22  ? 24.309  -15.595 6.613   1.00 13.92 ? 33  HIS A CE1   1 
ATOM   183   N  NE2   . HIS A  1 22  ? 25.527  -16.011 6.972   1.00 14.63 ? 33  HIS A NE2   1 
ATOM   184   N  N     . PRO A  1 23  ? 23.621  -11.556 6.050   1.00 15.12 ? 34  PRO A N     1 
ATOM   185   C  CA    . PRO A  1 23  ? 22.369  -11.253 5.344   1.00 14.05 ? 34  PRO A CA    1 
ATOM   186   C  C     . PRO A  1 23  ? 21.180  -12.171 5.632   1.00 14.22 ? 34  PRO A C     1 
ATOM   187   O  O     . PRO A  1 23  ? 20.055  -11.734 5.422   1.00 12.80 ? 34  PRO A O     1 
ATOM   188   C  CB    . PRO A  1 23  ? 22.775  -11.279 3.867   1.00 16.50 ? 34  PRO A CB    1 
ATOM   189   C  CG    . PRO A  1 23  ? 23.926  -12.199 3.823   1.00 20.46 ? 34  PRO A CG    1 
ATOM   190   C  CD    . PRO A  1 23  ? 24.684  -11.933 5.098   1.00 16.68 ? 34  PRO A CD    1 
ATOM   191   N  N     . MET A  1 24  ? 21.410  -13.410 6.081   1.00 11.71 ? 35  MET A N     1 
ATOM   192   C  CA    . MET A  1 24  ? 20.294  -14.338 6.366   1.00 9.53  ? 35  MET A CA    1 
ATOM   193   C  C     . MET A  1 24  ? 19.622  -13.917 7.682   1.00 14.41 ? 35  MET A C     1 
ATOM   194   O  O     . MET A  1 24  ? 20.248  -13.946 8.752   1.00 13.44 ? 35  MET A O     1 
ATOM   195   C  CB    . MET A  1 24  ? 20.774  -15.799 6.392   1.00 11.13 ? 35  MET A CB    1 
ATOM   196   C  CG    . MET A  1 24  ? 19.675  -16.778 6.779   1.00 13.52 ? 35  MET A CG    1 
ATOM   197   S  SD    . MET A  1 24  ? 18.227  -16.708 5.716   1.00 15.88 ? 35  MET A SD    1 
ATOM   198   C  CE    . MET A  1 24  ? 18.674  -17.971 4.499   1.00 12.90 ? 35  MET A CE    1 
ATOM   199   N  N     . LYS A  1 25  ? 18.347  -13.493 7.586   1.00 12.16 ? 36  LYS A N     1 
ATOM   200   C  CA    . LYS A  1 25  ? 17.597  -12.978 8.734   1.00 12.16 ? 36  LYS A CA    1 
ATOM   201   C  C     . LYS A  1 25  ? 16.322  -13.779 9.019   1.00 14.45 ? 36  LYS A C     1 
ATOM   202   O  O     . LYS A  1 25  ? 15.288  -13.491 8.444   1.00 13.07 ? 36  LYS A O     1 
ATOM   203   C  CB    . LYS A  1 25  ? 17.344  -11.464 8.552   1.00 12.47 ? 36  LYS A CB    1 
ATOM   204   C  CG    . LYS A  1 25  ? 18.664  -10.709 8.824   1.00 22.67 ? 36  LYS A CG    1 
ATOM   205   C  CD    . LYS A  1 25  ? 18.682  -9.264  8.454   1.00 30.25 ? 36  LYS A CD    1 
ATOM   206   C  CE    A LYS A  1 25  ? 20.125  -8.786  8.326   1.00 35.09 ? 36  LYS A CE    1 
ATOM   207   N  NZ    A LYS A  1 25  ? 20.867  -8.768  9.634   1.00 33.82 ? 36  LYS A NZ    1 
ATOM   208   N  N     . PRO A  1 26  ? 16.359  -14.749 9.953   1.00 11.29 ? 37  PRO A N     1 
ATOM   209   C  CA    . PRO A  1 26  ? 15.143  -15.523 10.272  1.00 10.94 ? 37  PRO A CA    1 
ATOM   210   C  C     . PRO A  1 26  ? 13.945  -14.659 10.676  1.00 15.98 ? 37  PRO A C     1 
ATOM   211   O  O     . PRO A  1 26  ? 12.811  -15.079 10.506  1.00 15.72 ? 37  PRO A O     1 
ATOM   212   C  CB    . PRO A  1 26  ? 15.622  -16.464 11.387  1.00 12.18 ? 37  PRO A CB    1 
ATOM   213   C  CG    . PRO A  1 26  ? 17.094  -16.672 11.040  1.00 14.90 ? 37  PRO A CG    1 
ATOM   214   C  CD    . PRO A  1 26  ? 17.522  -15.265 10.703  1.00 11.67 ? 37  PRO A CD    1 
ATOM   215   N  N     . HIS A  1 27  ? 14.202  -13.403 11.094  1.00 13.37 ? 38  HIS A N     1 
ATOM   216   C  CA    . HIS A  1 27  ? 13.196  -12.400 11.431  1.00 12.27 ? 38  HIS A CA    1 
ATOM   217   C  C     . HIS A  1 27  ? 12.240  -12.167 10.253  1.00 14.17 ? 38  HIS A C     1 
ATOM   218   O  O     . HIS A  1 27  ? 11.056  -11.913 10.487  1.00 12.92 ? 38  HIS A O     1 
ATOM   219   C  CB    . HIS A  1 27  ? 13.890  -11.087 11.862  1.00 12.73 ? 38  HIS A CB    1 
ATOM   220   C  CG    . HIS A  1 27  ? 12.944  -9.973  12.185  1.00 16.45 ? 38  HIS A CG    1 
ATOM   221   N  ND1   . HIS A  1 27  ? 12.023  -10.087 13.211  1.00 18.70 ? 38  HIS A ND1   1 
ATOM   222   C  CD2   . HIS A  1 27  ? 12.841  -8.737  11.630  1.00 18.30 ? 38  HIS A CD2   1 
ATOM   223   C  CE1   . HIS A  1 27  ? 11.379  -8.924  13.249  1.00 18.10 ? 38  HIS A CE1   1 
ATOM   224   N  NE2   . HIS A  1 27  ? 11.831  -8.081  12.310  1.00 18.36 ? 38  HIS A NE2   1 
ATOM   225   N  N     . ARG A  1 28  ? 12.719  -12.316 8.975   1.00 9.99  ? 39  ARG A N     1 
ATOM   226   C  CA    . ARG A  1 28  ? 11.831  -12.166 7.798   1.00 9.98  ? 39  ARG A CA    1 
ATOM   227   C  C     . ARG A  1 28  ? 10.634  -13.169 7.807   1.00 12.57 ? 39  ARG A C     1 
ATOM   228   O  O     . ARG A  1 28  ? 9.595   -12.892 7.200   1.00 11.43 ? 39  ARG A O     1 
ATOM   229   C  CB    . ARG A  1 28  ? 12.629  -12.326 6.475   1.00 10.08 ? 39  ARG A CB    1 
ATOM   230   C  CG    . ARG A  1 28  ? 13.057  -13.781 6.193   1.00 8.68  ? 39  ARG A CG    1 
ATOM   231   C  CD    . ARG A  1 28  ? 14.403  -13.949 5.443   1.00 8.31  ? 39  ARG A CD    1 
ATOM   232   N  NE    . ARG A  1 28  ? 14.750  -15.364 5.525   1.00 9.69  ? 39  ARG A NE    1 
ATOM   233   C  CZ    . ARG A  1 28  ? 14.840  -16.202 4.494   1.00 13.70 ? 39  ARG A CZ    1 
ATOM   234   N  NH1   . ARG A  1 28  ? 14.904  -15.737 3.255   1.00 7.95  ? 39  ARG A NH1   1 
ATOM   235   N  NH2   . ARG A  1 28  ? 14.974  -17.504 4.702   1.00 9.19  ? 39  ARG A NH2   1 
ATOM   236   N  N     . ILE A  1 29  ? 10.809  -14.339 8.459   1.00 9.42  ? 40  ILE A N     1 
ATOM   237   C  CA    . ILE A  1 29  ? 9.758   -15.357 8.568   1.00 9.57  ? 40  ILE A CA    1 
ATOM   238   C  C     . ILE A  1 29  ? 8.666   -14.838 9.511   1.00 12.37 ? 40  ILE A C     1 
ATOM   239   O  O     . ILE A  1 29  ? 7.483   -15.000 9.217   1.00 10.22 ? 40  ILE A O     1 
ATOM   240   C  CB    . ILE A  1 29  ? 10.297  -16.753 8.983   1.00 12.54 ? 40  ILE A CB    1 
ATOM   241   C  CG1   . ILE A  1 29  ? 11.399  -17.239 8.001   1.00 12.76 ? 40  ILE A CG1   1 
ATOM   242   C  CG2   . ILE A  1 29  ? 9.133   -17.795 9.067   1.00 13.09 ? 40  ILE A CG2   1 
ATOM   243   C  CD1   . ILE A  1 29  ? 12.430  -18.223 8.665   1.00 16.14 ? 40  ILE A CD1   1 
ATOM   244   N  N     . ARG A  1 30  ? 9.068   -14.186 10.614  1.00 9.82  ? 41  ARG A N     1 
ATOM   245   C  CA    . ARG A  1 30  ? 8.132   -13.541 11.557  1.00 9.65  ? 41  ARG A CA    1 
ATOM   246   C  C     . ARG A  1 30  ? 7.412   -12.382 10.877  1.00 12.67 ? 41  ARG A C     1 
ATOM   247   O  O     . ARG A  1 30  ? 6.207   -12.204 11.081  1.00 11.86 ? 41  ARG A O     1 
ATOM   248   C  CB    . ARG A  1 30  ? 8.887   -13.033 12.798  1.00 12.05 ? 41  ARG A CB    1 
ATOM   249   C  CG    . ARG A  1 30  ? 7.982   -12.310 13.794  1.00 17.84 ? 41  ARG A CG    1 
ATOM   250   C  CD    . ARG A  1 30  ? 8.605   -12.166 15.159  1.00 14.34 ? 41  ARG A CD    1 
ATOM   251   N  NE    . ARG A  1 30  ? 9.958   -11.627 15.102  1.00 17.38 ? 41  ARG A NE    1 
ATOM   252   C  CZ    . ARG A  1 30  ? 10.858  -11.816 16.053  1.00 33.05 ? 41  ARG A CZ    1 
ATOM   253   N  NH1   . ARG A  1 30  ? 10.547  -12.516 17.140  1.00 22.20 ? 41  ARG A NH1   1 
ATOM   254   N  NH2   . ARG A  1 30  ? 12.079  -11.307 15.929  1.00 20.76 ? 41  ARG A NH2   1 
ATOM   255   N  N     . MET A  1 31  ? 8.151   -11.562 10.081  1.00 9.34  ? 42  MET A N     1 
ATOM   256   C  CA    . MET A  1 31  ? 7.525   -10.458 9.341   1.00 8.98  ? 42  MET A CA    1 
ATOM   257   C  C     . MET A  1 31  ? 6.461   -11.001 8.390   1.00 11.36 ? 42  MET A C     1 
ATOM   258   O  O     . MET A  1 31  ? 5.378   -10.420 8.281   1.00 10.74 ? 42  MET A O     1 
ATOM   259   C  CB    . MET A  1 31  ? 8.557   -9.694  8.512   1.00 10.06 ? 42  MET A CB    1 
ATOM   260   C  CG    . MET A  1 31  ? 9.494   -8.842  9.346   1.00 13.15 ? 42  MET A CG    1 
ATOM   261   S  SD    . MET A  1 31  ? 10.814  -8.244  8.281   1.00 16.57 ? 42  MET A SD    1 
ATOM   262   C  CE    . MET A  1 31  ? 9.835   -7.222  7.151   1.00 13.47 ? 42  MET A CE    1 
ATOM   263   N  N     . THR A  1 32  ? 6.785   -12.100 7.681   1.00 8.52  ? 43  THR A N     1 
ATOM   264   C  CA    . THR A  1 32  ? 5.862   -12.766 6.750   1.00 6.95  ? 43  THR A CA    1 
ATOM   265   C  C     . THR A  1 32  ? 4.605   -13.182 7.534   1.00 10.46 ? 43  THR A C     1 
ATOM   266   O  O     . THR A  1 32  ? 3.496   -12.882 7.125   1.00 10.50 ? 43  THR A O     1 
ATOM   267   C  CB    . THR A  1 32  ? 6.544   -14.010 6.149   1.00 10.72 ? 43  THR A CB    1 
ATOM   268   O  OG1   . THR A  1 32  ? 7.655   -13.610 5.345   1.00 11.77 ? 43  THR A OG1   1 
ATOM   269   C  CG2   . THR A  1 32  ? 5.567   -14.856 5.321   1.00 10.52 ? 43  THR A CG2   1 
ATOM   270   N  N     . HIS A  1 33  ? 4.794   -13.899 8.657   1.00 9.66  ? 44  HIS A N     1 
ATOM   271   C  CA    . HIS A  1 33  ? 3.684   -14.377 9.484   1.00 9.72  ? 44  HIS A CA    1 
ATOM   272   C  C     . HIS A  1 33  ? 2.782   -13.231 9.926   1.00 13.08 ? 44  HIS A C     1 
ATOM   273   O  O     . HIS A  1 33  ? 1.577   -13.287 9.734   1.00 12.07 ? 44  HIS A O     1 
ATOM   274   C  CB    . HIS A  1 33  ? 4.231   -15.110 10.712  1.00 10.46 ? 44  HIS A CB    1 
ATOM   275   C  CG    . HIS A  1 33  ? 3.153   -15.775 11.510  1.00 13.76 ? 44  HIS A CG    1 
ATOM   276   N  ND1   . HIS A  1 33  ? 2.509   -16.911 11.047  1.00 14.58 ? 44  HIS A ND1   1 
ATOM   277   C  CD2   . HIS A  1 33  ? 2.655   -15.455 12.723  1.00 15.42 ? 44  HIS A CD2   1 
ATOM   278   C  CE1   . HIS A  1 33  ? 1.640   -17.233 11.984  1.00 14.17 ? 44  HIS A CE1   1 
ATOM   279   N  NE2   . HIS A  1 33  ? 1.697   -16.394 13.011  1.00 14.72 ? 44  HIS A NE2   1 
ATOM   280   N  N     . ASN A  1 34  ? 3.368   -12.206 10.524  1.00 11.99 ? 45  ASN A N     1 
ATOM   281   C  CA    . ASN A  1 34  ? 2.609   -11.063 11.039  1.00 11.20 ? 45  ASN A CA    1 
ATOM   282   C  C     . ASN A  1 34  ? 1.840   -10.340 9.934   1.00 13.44 ? 45  ASN A C     1 
ATOM   283   O  O     . ASN A  1 34  ? 0.693   -9.923  10.149  1.00 11.69 ? 45  ASN A O     1 
ATOM   284   C  CB    . ASN A  1 34  ? 3.524   -10.142 11.842  1.00 12.77 ? 45  ASN A CB    1 
ATOM   285   C  CG    . ASN A  1 34  ? 2.765   -9.063  12.544  1.00 19.42 ? 45  ASN A CG    1 
ATOM   286   O  OD1   . ASN A  1 34  ? 2.754   -7.917  12.103  1.00 14.86 ? 45  ASN A OD1   1 
ATOM   287   N  ND2   . ASN A  1 34  ? 2.050   -9.424  13.593  1.00 14.08 ? 45  ASN A ND2   1 
ATOM   288   N  N     . LEU A  1 35  ? 2.436   -10.247 8.729   1.00 10.48 ? 46  LEU A N     1 
ATOM   289   C  CA    . LEU A  1 35  ? 1.751   -9.618  7.616   1.00 10.00 ? 46  LEU A CA    1 
ATOM   290   C  C     . LEU A  1 35  ? 0.578   -10.474 7.160   1.00 13.15 ? 46  LEU A C     1 
ATOM   291   O  O     . LEU A  1 35  ? -0.527  -9.964  7.012   1.00 11.21 ? 46  LEU A O     1 
ATOM   292   C  CB    . LEU A  1 35  ? 2.706   -9.298  6.464   1.00 10.42 ? 46  LEU A CB    1 
ATOM   293   C  CG    . LEU A  1 35  ? 2.106   -8.523  5.297   1.00 14.79 ? 46  LEU A CG    1 
ATOM   294   C  CD1   . LEU A  1 35  ? 1.493   -7.202  5.769   1.00 14.24 ? 46  LEU A CD1   1 
ATOM   295   C  CD2   . LEU A  1 35  ? 3.160   -8.269  4.206   1.00 14.64 ? 46  LEU A CD2   1 
ATOM   296   N  N     . LEU A  1 36  ? 0.792   -11.776 6.967   1.00 12.73 ? 47  LEU A N     1 
ATOM   297   C  CA    . LEU A  1 36  ? -0.338  -12.597 6.544   1.00 13.14 ? 47  LEU A CA    1 
ATOM   298   C  C     . LEU A  1 36  ? -1.455  -12.690 7.599   1.00 16.32 ? 47  LEU A C     1 
ATOM   299   O  O     . LEU A  1 36  ? -2.644  -12.730 7.222   1.00 14.53 ? 47  LEU A O     1 
ATOM   300   C  CB    . LEU A  1 36  ? 0.093   -13.936 5.903   1.00 13.89 ? 47  LEU A CB    1 
ATOM   301   C  CG    . LEU A  1 36  ? 0.792   -14.929 6.790   1.00 18.32 ? 47  LEU A CG    1 
ATOM   302   C  CD1   . LEU A  1 36  ? -0.221  -15.771 7.545   1.00 20.07 ? 47  LEU A CD1   1 
ATOM   303   C  CD2   . LEU A  1 36  ? 1.728   -15.840 5.956   1.00 14.94 ? 47  LEU A CD2   1 
ATOM   304   N  N     . LEU A  1 37  ? -1.090  -12.645 8.924   1.00 11.75 ? 48  LEU A N     1 
ATOM   305   C  CA    . LEU A  1 37  ? -2.102  -12.617 9.988   1.00 11.77 ? 48  LEU A CA    1 
ATOM   306   C  C     . LEU A  1 37  ? -2.938  -11.349 9.844   1.00 15.96 ? 48  LEU A C     1 
ATOM   307   O  O     . LEU A  1 37  ? -4.160  -11.413 9.939   1.00 14.73 ? 48  LEU A O     1 
ATOM   308   C  CB    . LEU A  1 37  ? -1.468  -12.609 11.396  1.00 12.04 ? 48  LEU A CB    1 
ATOM   309   C  CG    . LEU A  1 37  ? -0.942  -13.933 11.940  1.00 16.34 ? 48  LEU A CG    1 
ATOM   310   C  CD1   . LEU A  1 37  ? -0.489  -13.752 13.399  1.00 15.78 ? 48  LEU A CD1   1 
ATOM   311   C  CD2   . LEU A  1 37  ? -1.978  -15.042 11.825  1.00 17.56 ? 48  LEU A CD2   1 
ATOM   312   N  N     . ASN A  1 38  ? -2.265  -10.196 9.587   1.00 13.25 ? 49  ASN A N     1 
ATOM   313   C  CA    . ASN A  1 38  ? -2.946  -8.912  9.433   1.00 13.39 ? 49  ASN A CA    1 
ATOM   314   C  C     . ASN A  1 38  ? -3.817  -8.807  8.213   1.00 16.58 ? 49  ASN A C     1 
ATOM   315   O  O     . ASN A  1 38  ? -4.748  -8.006  8.213   1.00 16.35 ? 49  ASN A O     1 
ATOM   316   C  CB    . ASN A  1 38  ? -1.996  -7.749  9.575   1.00 11.53 ? 49  ASN A CB    1 
ATOM   317   C  CG    . ASN A  1 38  ? -1.779  -7.472  11.042  1.00 17.81 ? 49  ASN A CG    1 
ATOM   318   O  OD1   . ASN A  1 38  ? -2.700  -7.052  11.759  1.00 13.92 ? 49  ASN A OD1   1 
ATOM   319   N  ND2   . ASN A  1 38  ? -0.608  -7.798  11.543  1.00 8.03  ? 49  ASN A ND2   1 
ATOM   320   N  N     . TYR A  1 39  ? -3.575  -9.662  7.201   1.00 11.59 ? 50  TYR A N     1 
ATOM   321   C  CA    . TYR A  1 39  ? -4.440  -9.713  6.020   1.00 10.28 ? 50  TYR A CA    1 
ATOM   322   C  C     . TYR A  1 39  ? -5.657  -10.627 6.302   1.00 16.29 ? 50  TYR A C     1 
ATOM   323   O  O     . TYR A  1 39  ? -6.547  -10.762 5.444   1.00 17.73 ? 50  TYR A O     1 
ATOM   324   C  CB    . TYR A  1 39  ? -3.652  -10.257 4.822   1.00 10.06 ? 50  TYR A CB    1 
ATOM   325   C  CG    . TYR A  1 39  ? -3.065  -9.196  3.927   1.00 11.85 ? 50  TYR A CG    1 
ATOM   326   C  CD1   . TYR A  1 39  ? -3.884  -8.368  3.165   1.00 12.92 ? 50  TYR A CD1   1 
ATOM   327   C  CD2   . TYR A  1 39  ? -1.683  -9.056  3.791   1.00 11.48 ? 50  TYR A CD2   1 
ATOM   328   C  CE1   . TYR A  1 39  ? -3.350  -7.441  2.282   1.00 14.39 ? 50  TYR A CE1   1 
ATOM   329   C  CE2   . TYR A  1 39  ? -1.137  -8.148  2.884   1.00 11.06 ? 50  TYR A CE2   1 
ATOM   330   C  CZ    . TYR A  1 39  ? -1.978  -7.337  2.142   1.00 13.38 ? 50  TYR A CZ    1 
ATOM   331   O  OH    . TYR A  1 39  ? -1.482  -6.438  1.253   1.00 14.67 ? 50  TYR A OH    1 
ATOM   332   N  N     . GLY A  1 40  ? -5.650  -11.303 7.454   1.00 13.85 ? 51  GLY A N     1 
ATOM   333   C  CA    . GLY A  1 40  ? -6.730  -12.205 7.847   1.00 13.68 ? 51  GLY A CA    1 
ATOM   334   C  C     . GLY A  1 40  ? -6.650  -13.593 7.232   1.00 18.51 ? 51  GLY A C     1 
ATOM   335   O  O     . GLY A  1 40  ? -7.624  -14.346 7.298   1.00 18.97 ? 51  GLY A O     1 
ATOM   336   N  N     . LEU A  1 41  ? -5.488  -13.964 6.647   1.00 15.44 ? 52  LEU A N     1 
ATOM   337   C  CA    . LEU A  1 41  ? -5.293  -15.270 6.003   1.00 14.92 ? 52  LEU A CA    1 
ATOM   338   C  C     . LEU A  1 41  ? -5.396  -16.484 6.940   1.00 18.64 ? 52  LEU A C     1 
ATOM   339   O  O     . LEU A  1 41  ? -5.647  -17.596 6.468   1.00 17.78 ? 52  LEU A O     1 
ATOM   340   C  CB    . LEU A  1 41  ? -4.022  -15.304 5.133   1.00 15.20 ? 52  LEU A CB    1 
ATOM   341   C  CG    . LEU A  1 41  ? -4.001  -14.314 3.948   1.00 20.69 ? 52  LEU A CG    1 
ATOM   342   C  CD1   . LEU A  1 41  ? -2.686  -14.395 3.206   1.00 21.98 ? 52  LEU A CD1   1 
ATOM   343   C  CD2   . LEU A  1 41  ? -5.127  -14.588 2.945   1.00 21.70 ? 52  LEU A CD2   1 
ATOM   344   N  N     . TYR A  1 42  ? -5.261  -16.271 8.265   1.00 15.13 ? 53  TYR A N     1 
ATOM   345   C  CA    . TYR A  1 42  ? -5.421  -17.349 9.252   1.00 16.36 ? 53  TYR A CA    1 
ATOM   346   C  C     . TYR A  1 42  ? -6.863  -17.890 9.252   1.00 21.78 ? 53  TYR A C     1 
ATOM   347   O  O     . TYR A  1 42  ? -7.089  -18.996 9.725   1.00 22.43 ? 53  TYR A O     1 
ATOM   348   C  CB    . TYR A  1 42  ? -5.060  -16.869 10.669  1.00 18.42 ? 53  TYR A CB    1 
ATOM   349   C  CG    . TYR A  1 42  ? -5.956  -15.768 11.198  1.00 20.65 ? 53  TYR A CG    1 
ATOM   350   C  CD1   . TYR A  1 42  ? -7.100  -16.066 11.935  1.00 23.03 ? 53  TYR A CD1   1 
ATOM   351   C  CD2   . TYR A  1 42  ? -5.664  -14.428 10.956  1.00 20.84 ? 53  TYR A CD2   1 
ATOM   352   C  CE1   . TYR A  1 42  ? -7.946  -15.055 12.396  1.00 24.82 ? 53  TYR A CE1   1 
ATOM   353   C  CE2   . TYR A  1 42  ? -6.501  -13.410 11.415  1.00 21.79 ? 53  TYR A CE2   1 
ATOM   354   C  CZ    . TYR A  1 42  ? -7.632  -13.730 12.147  1.00 29.81 ? 53  TYR A CZ    1 
ATOM   355   O  OH    . TYR A  1 42  ? -8.447  -12.735 12.616  1.00 32.75 ? 53  TYR A OH    1 
ATOM   356   N  N     . ARG A  1 43  ? -7.844  -17.102 8.759   1.00 19.33 ? 54  ARG A N     1 
ATOM   357   C  CA    . ARG A  1 43  ? -9.248  -17.547 8.753   1.00 19.30 ? 54  ARG A CA    1 
ATOM   358   C  C     . ARG A  1 43  ? -9.489  -18.633 7.714   1.00 24.41 ? 54  ARG A C     1 
ATOM   359   O  O     . ARG A  1 43  ? -10.512 -19.300 7.772   1.00 25.57 ? 54  ARG A O     1 
ATOM   360   C  CB    . ARG A  1 43  ? -10.207 -16.366 8.469   1.00 20.35 ? 54  ARG A CB    1 
ATOM   361   C  CG    A ARG A  1 43  ? -10.103 -15.198 9.464   0.73 25.70 ? 54  ARG A CG    1 
ATOM   362   C  CD    A ARG A  1 43  ? -11.035 -14.049 9.105   0.73 40.93 ? 54  ARG A CD    1 
ATOM   363   N  NE    A ARG A  1 43  ? -10.656 -13.390 7.852   0.73 53.87 ? 54  ARG A NE    1 
ATOM   364   C  CZ    A ARG A  1 43  ? -11.275 -13.565 6.686   0.73 68.73 ? 54  ARG A CZ    1 
ATOM   365   N  NH1   A ARG A  1 43  ? -12.318 -14.383 6.593   0.73 58.64 ? 54  ARG A NH1   1 
ATOM   366   N  NH2   A ARG A  1 43  ? -10.849 -12.931 5.602   0.73 48.41 ? 54  ARG A NH2   1 
ATOM   367   N  N     . LYS A  1 44  ? -8.572  -18.785 6.745   1.00 20.52 ? 55  LYS A N     1 
ATOM   368   C  CA    . LYS A  1 44  ? -8.717  -19.682 5.602   1.00 20.34 ? 55  LYS A CA    1 
ATOM   369   C  C     . LYS A  1 44  ? -7.791  -20.901 5.626   1.00 21.68 ? 55  LYS A C     1 
ATOM   370   O  O     . LYS A  1 44  ? -7.886  -21.743 4.740   1.00 20.89 ? 55  LYS A O     1 
ATOM   371   C  CB    . LYS A  1 44  ? -8.492  -18.874 4.306   1.00 24.18 ? 55  LYS A CB    1 
ATOM   372   C  CG    . LYS A  1 44  ? -9.514  -17.754 4.125   1.00 42.10 ? 55  LYS A CG    1 
ATOM   373   C  CD    . LYS A  1 44  ? -9.429  -17.124 2.771   1.00 52.78 ? 55  LYS A CD    1 
ATOM   374   C  CE    . LYS A  1 44  ? -10.758 -16.531 2.381   1.00 67.61 ? 55  LYS A CE    1 
ATOM   375   N  NZ    . LYS A  1 44  ? -10.775 -16.104 0.958   1.00 77.38 ? 55  LYS A NZ    1 
ATOM   376   N  N     . MET A  1 45  ? -6.887  -20.991 6.611   1.00 18.12 ? 56  MET A N     1 
ATOM   377   C  CA    . MET A  1 45  ? -5.959  -22.120 6.665   1.00 16.89 ? 56  MET A CA    1 
ATOM   378   C  C     . MET A  1 45  ? -5.698  -22.603 8.045   1.00 20.76 ? 56  MET A C     1 
ATOM   379   O  O     . MET A  1 45  ? -5.915  -21.857 8.999   1.00 21.17 ? 56  MET A O     1 
ATOM   380   C  CB    . MET A  1 45  ? -4.633  -21.797 5.937   1.00 18.84 ? 56  MET A CB    1 
ATOM   381   C  CG    . MET A  1 45  ? -3.900  -20.650 6.507   1.00 20.38 ? 56  MET A CG    1 
ATOM   382   S  SD    . MET A  1 45  ? -2.363  -20.303 5.622   1.00 21.65 ? 56  MET A SD    1 
ATOM   383   C  CE    . MET A  1 45  ? -1.816  -18.945 6.669   1.00 17.33 ? 56  MET A CE    1 
ATOM   384   N  N     . GLU A  1 46  ? -5.199  -23.859 8.171   1.00 15.78 ? 57  GLU A N     1 
ATOM   385   C  CA    . GLU A  1 46  ? -4.852  -24.379 9.483   1.00 15.42 ? 57  GLU A CA    1 
ATOM   386   C  C     . GLU A  1 46  ? -3.424  -23.998 9.760   1.00 16.79 ? 57  GLU A C     1 
ATOM   387   O  O     . GLU A  1 46  ? -2.567  -24.165 8.890   1.00 14.52 ? 57  GLU A O     1 
ATOM   388   C  CB    . GLU A  1 46  ? -5.061  -25.899 9.553   1.00 17.55 ? 57  GLU A CB    1 
ATOM   389   C  CG    . GLU A  1 46  ? -6.526  -26.270 9.716   1.00 27.14 ? 57  GLU A CG    1 
ATOM   390   C  CD    . GLU A  1 46  ? -6.907  -27.698 9.389   1.00 50.53 ? 57  GLU A CD    1 
ATOM   391   O  OE1   . GLU A  1 46  ? -6.045  -28.604 9.490   1.00 38.40 ? 57  GLU A OE1   1 
ATOM   392   O  OE2   . GLU A  1 46  ? -8.097  -27.913 9.068   1.00 52.56 ? 57  GLU A OE2   1 
ATOM   393   N  N     . ILE A  1 47  ? -3.170  -23.428 10.947  1.00 14.45 ? 58  ILE A N     1 
ATOM   394   C  CA    . ILE A  1 47  ? -1.833  -22.994 11.358  1.00 13.47 ? 58  ILE A CA    1 
ATOM   395   C  C     . ILE A  1 47  ? -1.314  -23.980 12.400  1.00 16.87 ? 58  ILE A C     1 
ATOM   396   O  O     . ILE A  1 47  ? -1.979  -24.209 13.408  1.00 15.71 ? 58  ILE A O     1 
ATOM   397   C  CB    . ILE A  1 47  ? -1.816  -21.516 11.855  1.00 16.11 ? 58  ILE A CB    1 
ATOM   398   C  CG1   . ILE A  1 47  ? -2.235  -20.566 10.697  1.00 16.71 ? 58  ILE A CG1   1 
ATOM   399   C  CG2   . ILE A  1 47  ? -0.425  -21.140 12.442  1.00 14.30 ? 58  ILE A CG2   1 
ATOM   400   C  CD1   . ILE A  1 47  ? -2.149  -18.978 10.989  1.00 18.38 ? 58  ILE A CD1   1 
ATOM   401   N  N     . TYR A  1 48  ? -0.163  -24.600 12.115  1.00 11.47 ? 59  TYR A N     1 
ATOM   402   C  CA    . TYR A  1 48  ? 0.462   -25.589 12.974  1.00 11.45 ? 59  TYR A CA    1 
ATOM   403   C  C     . TYR A  1 48  ? 1.804   -25.118 13.435  1.00 15.01 ? 59  TYR A C     1 
ATOM   404   O  O     . TYR A  1 48  ? 2.501   -24.426 12.699  1.00 12.94 ? 59  TYR A O     1 
ATOM   405   C  CB    . TYR A  1 48  ? 0.668   -26.888 12.195  1.00 13.34 ? 59  TYR A CB    1 
ATOM   406   C  CG    . TYR A  1 48  ? -0.608  -27.624 11.865  1.00 19.26 ? 59  TYR A CG    1 
ATOM   407   C  CD1   . TYR A  1 48  ? -1.235  -28.433 12.812  1.00 22.54 ? 59  TYR A CD1   1 
ATOM   408   C  CD2   . TYR A  1 48  ? -1.177  -27.539 10.602  1.00 21.86 ? 59  TYR A CD2   1 
ATOM   409   C  CE1   . TYR A  1 48  ? -2.378  -29.166 12.495  1.00 22.97 ? 59  TYR A CE1   1 
ATOM   410   C  CE2   . TYR A  1 48  ? -2.334  -28.248 10.281  1.00 23.77 ? 59  TYR A CE2   1 
ATOM   411   C  CZ    . TYR A  1 48  ? -2.915  -29.082 11.223  1.00 28.51 ? 59  TYR A CZ    1 
ATOM   412   O  OH    . TYR A  1 48  ? -4.072  -29.762 10.918  1.00 29.81 ? 59  TYR A OH    1 
ATOM   413   N  N     . ARG A  1 49  ? 2.191   -25.513 14.649  1.00 11.22 ? 60  ARG A N     1 
ATOM   414   C  CA    . ARG A  1 49  ? 3.520   -25.222 15.132  1.00 11.60 ? 60  ARG A CA    1 
ATOM   415   C  C     . ARG A  1 49  ? 4.273   -26.515 14.897  1.00 16.48 ? 60  ARG A C     1 
ATOM   416   O  O     . ARG A  1 49  ? 3.850   -27.551 15.385  1.00 16.73 ? 60  ARG A O     1 
ATOM   417   C  CB    . ARG A  1 49  ? 3.509   -24.840 16.619  1.00 12.53 ? 60  ARG A CB    1 
ATOM   418   C  CG    . ARG A  1 49  ? 4.877   -24.343 17.120  1.00 12.77 ? 60  ARG A CG    1 
ATOM   419   C  CD    . ARG A  1 49  ? 4.779   -23.951 18.593  1.00 10.24 ? 60  ARG A CD    1 
ATOM   420   N  NE    . ARG A  1 49  ? 5.881   -23.067 18.969  1.00 12.22 ? 60  ARG A NE    1 
ATOM   421   C  CZ    . ARG A  1 49  ? 5.847   -22.223 19.983  1.00 17.60 ? 60  ARG A CZ    1 
ATOM   422   N  NH1   . ARG A  1 49  ? 4.811   -22.212 20.812  1.00 12.28 ? 60  ARG A NH1   1 
ATOM   423   N  NH2   . ARG A  1 49  ? 6.867   -21.409 20.207  1.00 14.21 ? 60  ARG A NH2   1 
ATOM   424   N  N     . PRO A  1 50  ? 5.341   -26.518 14.097  1.00 13.23 ? 61  PRO A N     1 
ATOM   425   C  CA    . PRO A  1 50  ? 6.041   -27.782 13.843  1.00 11.78 ? 61  PRO A CA    1 
ATOM   426   C  C     . PRO A  1 50  ? 6.750   -28.284 15.099  1.00 12.64 ? 61  PRO A C     1 
ATOM   427   O  O     . PRO A  1 50  ? 7.035   -27.479 15.994  1.00 11.67 ? 61  PRO A O     1 
ATOM   428   C  CB    . PRO A  1 50  ? 7.093   -27.374 12.813  1.00 14.42 ? 61  PRO A CB    1 
ATOM   429   C  CG    . PRO A  1 50  ? 7.402   -25.914 13.152  1.00 18.15 ? 61  PRO A CG    1 
ATOM   430   C  CD    . PRO A  1 50  ? 6.010   -25.381 13.424  1.00 14.51 ? 61  PRO A CD    1 
ATOM   431   N  N     . HIS A  1 51  ? 7.026   -29.601 15.156  1.00 10.21 ? 62  HIS A N     1 
ATOM   432   C  CA    . HIS A  1 51  ? 7.833   -30.186 16.225  1.00 9.25  ? 62  HIS A CA    1 
ATOM   433   C  C     . HIS A  1 51  ? 9.303   -29.841 15.885  1.00 13.22 ? 62  HIS A C     1 
ATOM   434   O  O     . HIS A  1 51  ? 9.623   -29.497 14.742  1.00 11.95 ? 62  HIS A O     1 
ATOM   435   C  CB    . HIS A  1 51  ? 7.683   -31.733 16.231  1.00 9.96  ? 62  HIS A CB    1 
ATOM   436   C  CG    . HIS A  1 51  ? 8.182   -32.410 14.985  1.00 12.56 ? 62  HIS A CG    1 
ATOM   437   N  ND1   . HIS A  1 51  ? 7.465   -32.362 13.800  1.00 14.31 ? 62  HIS A ND1   1 
ATOM   438   C  CD2   . HIS A  1 51  ? 9.316   -33.126 14.779  1.00 14.39 ? 62  HIS A CD2   1 
ATOM   439   C  CE1   . HIS A  1 51  ? 8.163   -33.073 12.924  1.00 14.21 ? 62  HIS A CE1   1 
ATOM   440   N  NE2   . HIS A  1 51  ? 9.294   -33.538 13.459  1.00 14.06 ? 62  HIS A NE2   1 
ATOM   441   N  N     . LYS A  1 52  ? 10.194  -30.032 16.846  1.00 9.77  ? 63  LYS A N     1 
ATOM   442   C  CA    . LYS A  1 52  ? 11.628  -29.904 16.619  1.00 9.17  ? 63  LYS A CA    1 
ATOM   443   C  C     . LYS A  1 52  ? 12.095  -31.284 16.110  1.00 13.48 ? 63  LYS A C     1 
ATOM   444   O  O     . LYS A  1 52  ? 12.112  -32.250 16.882  1.00 13.02 ? 63  LYS A O     1 
ATOM   445   C  CB    . LYS A  1 52  ? 12.324  -29.576 17.946  1.00 9.71  ? 63  LYS A CB    1 
ATOM   446   C  CG    . LYS A  1 52  ? 12.282  -28.099 18.265  1.00 16.52 ? 63  LYS A CG    1 
ATOM   447   C  CD    . LYS A  1 52  ? 12.842  -27.856 19.653  1.00 27.90 ? 63  LYS A CD    1 
ATOM   448   C  CE    . LYS A  1 52  ? 12.848  -26.382 19.984  1.00 44.51 ? 63  LYS A CE    1 
ATOM   449   N  NZ    . LYS A  1 52  ? 11.479  -25.820 20.051  1.00 55.98 ? 63  LYS A NZ    1 
ATOM   450   N  N     . ALA A  1 53  ? 12.451  -31.373 14.810  1.00 11.42 ? 64  ALA A N     1 
ATOM   451   C  CA    . ALA A  1 53  ? 12.933  -32.606 14.181  1.00 10.75 ? 64  ALA A CA    1 
ATOM   452   C  C     . ALA A  1 53  ? 14.097  -33.184 14.980  1.00 13.78 ? 64  ALA A C     1 
ATOM   453   O  O     . ALA A  1 53  ? 14.975  -32.445 15.407  1.00 13.05 ? 64  ALA A O     1 
ATOM   454   C  CB    . ALA A  1 53  ? 13.372  -32.337 12.742  1.00 10.81 ? 64  ALA A CB    1 
ATOM   455   N  N     . THR A  1 54  ? 14.080  -34.494 15.217  1.00 12.01 ? 65  THR A N     1 
ATOM   456   C  CA    . THR A  1 54  ? 15.112  -35.149 16.034  1.00 13.24 ? 65  THR A CA    1 
ATOM   457   C  C     . THR A  1 54  ? 16.308  -35.569 15.179  1.00 19.17 ? 65  THR A C     1 
ATOM   458   O  O     . THR A  1 54  ? 16.251  -35.489 13.956  1.00 14.87 ? 65  THR A O     1 
ATOM   459   C  CB    . THR A  1 54  ? 14.512  -36.409 16.684  1.00 14.60 ? 65  THR A CB    1 
ATOM   460   O  OG1   . THR A  1 54  ? 14.287  -37.394 15.662  1.00 11.00 ? 65  THR A OG1   1 
ATOM   461   C  CG2   . THR A  1 54  ? 13.178  -36.129 17.406  1.00 14.05 ? 65  THR A CG2   1 
ATOM   462   N  N     . ALA A  1 55  ? 17.353  -36.124 15.818  1.00 20.53 ? 66  ALA A N     1 
ATOM   463   C  CA    . ALA A  1 55  ? 18.514  -36.654 15.102  1.00 19.73 ? 66  ALA A CA    1 
ATOM   464   C  C     . ALA A  1 55  ? 18.133  -37.883 14.264  1.00 24.88 ? 66  ALA A C     1 
ATOM   465   O  O     . ALA A  1 55  ? 18.661  -38.060 13.168  1.00 27.29 ? 66  ALA A O     1 
ATOM   466   C  CB    . ALA A  1 55  ? 19.616  -36.986 16.084  1.00 20.83 ? 66  ALA A CB    1 
ATOM   467   N  N     . GLU A  1 56  ? 17.189  -38.703 14.731  1.00 19.58 ? 67  GLU A N     1 
ATOM   468   C  CA    . GLU A  1 56  ? 16.705  -39.844 13.961  1.00 19.73 ? 67  GLU A CA    1 
ATOM   469   C  C     . GLU A  1 56  ? 16.084  -39.343 12.653  1.00 21.56 ? 67  GLU A C     1 
ATOM   470   O  O     . GLU A  1 56  ? 16.255  -39.972 11.598  1.00 20.57 ? 67  GLU A O     1 
ATOM   471   C  CB    . GLU A  1 56  ? 15.632  -40.614 14.745  1.00 21.16 ? 67  GLU A CB    1 
ATOM   472   C  CG    . GLU A  1 56  ? 16.185  -41.756 15.578  1.00 29.16 ? 67  GLU A CG    1 
ATOM   473   C  CD    . GLU A  1 56  ? 15.119  -42.506 16.347  1.00 34.53 ? 67  GLU A CD    1 
ATOM   474   O  OE1   . GLU A  1 56  ? 13.924  -42.177 16.181  1.00 30.08 ? 67  GLU A OE1   1 
ATOM   475   O  OE2   . GLU A  1 56  ? 15.479  -43.372 17.174  1.00 29.95 ? 67  GLU A OE2   1 
ATOM   476   N  N     . GLU A  1 57  ? 15.339  -38.221 12.727  1.00 14.81 ? 68  GLU A N     1 
ATOM   477   C  CA    . GLU A  1 57  ? 14.699  -37.669 11.538  1.00 12.82 ? 68  GLU A CA    1 
ATOM   478   C  C     . GLU A  1 57  ? 15.751  -37.137 10.569  1.00 15.77 ? 68  GLU A C     1 
ATOM   479   O  O     . GLU A  1 57  ? 15.694  -37.439 9.382   1.00 14.56 ? 68  GLU A O     1 
ATOM   480   C  CB    . GLU A  1 57  ? 13.703  -36.575 11.905  1.00 13.65 ? 68  GLU A CB    1 
ATOM   481   C  CG    . GLU A  1 57  ? 12.399  -37.136 12.467  1.00 17.71 ? 68  GLU A CG    1 
ATOM   482   C  CD    . GLU A  1 57  ? 11.440  -36.049 12.905  1.00 20.39 ? 68  GLU A CD    1 
ATOM   483   O  OE1   . GLU A  1 57  ? 10.627  -35.585 12.074  1.00 20.71 ? 68  GLU A OE1   1 
ATOM   484   O  OE2   . GLU A  1 57  ? 11.572  -35.592 14.058  1.00 14.64 ? 68  GLU A OE2   1 
ATOM   485   N  N     . MET A  1 58  ? 16.699  -36.353 11.088  1.00 11.89 ? 69  MET A N     1 
ATOM   486   C  CA    . MET A  1 58  ? 17.741  -35.727 10.265  1.00 10.12 ? 69  MET A CA    1 
ATOM   487   C  C     . MET A  1 58  ? 18.727  -36.719 9.608   1.00 15.09 ? 69  MET A C     1 
ATOM   488   O  O     . MET A  1 58  ? 19.234  -36.434 8.508   1.00 14.95 ? 69  MET A O     1 
ATOM   489   C  CB    . MET A  1 58  ? 18.510  -34.711 11.099  1.00 11.25 ? 69  MET A CB    1 
ATOM   490   C  CG    . MET A  1 58  ? 17.691  -33.470 11.425  1.00 12.54 ? 69  MET A CG    1 
ATOM   491   S  SD    . MET A  1 58  ? 18.690  -32.391 12.446  1.00 15.88 ? 69  MET A SD    1 
ATOM   492   C  CE    . MET A  1 58  ? 17.494  -31.153 12.860  1.00 12.31 ? 69  MET A CE    1 
ATOM   493   N  N     . THR A  1 59  ? 19.043  -37.831 10.310  1.00 12.04 ? 70  THR A N     1 
ATOM   494   C  CA    . THR A  1 59  ? 19.965  -38.868 9.827   1.00 12.69 ? 70  THR A CA    1 
ATOM   495   C  C     . THR A  1 59  ? 19.344  -39.809 8.806   1.00 17.73 ? 70  THR A C     1 
ATOM   496   O  O     . THR A  1 59  ? 20.012  -40.735 8.327   1.00 17.37 ? 70  THR A O     1 
ATOM   497   C  CB    . THR A  1 59  ? 20.704  -39.585 10.965  1.00 17.30 ? 70  THR A CB    1 
ATOM   498   O  OG1   . THR A  1 59  ? 19.759  -40.263 11.788  1.00 16.92 ? 70  THR A OG1   1 
ATOM   499   C  CG2   . THR A  1 59  ? 21.599  -38.659 11.751  1.00 10.57 ? 70  THR A CG2   1 
ATOM   500   N  N     . LYS A  1 60  ? 18.097  -39.519 8.379   1.00 14.77 ? 71  LYS A N     1 
ATOM   501   C  CA    . LYS A  1 60  ? 17.481  -40.256 7.271   1.00 14.33 ? 71  LYS A CA    1 
ATOM   502   C  C     . LYS A  1 60  ? 18.243  -39.847 5.975   1.00 19.13 ? 71  LYS A C     1 
ATOM   503   O  O     . LYS A  1 60  ? 18.186  -40.539 4.953   1.00 19.42 ? 71  LYS A O     1 
ATOM   504   C  CB    . LYS A  1 60  ? 15.982  -39.929 7.156   1.00 14.98 ? 71  LYS A CB    1 
ATOM   505   C  CG    . LYS A  1 60  ? 15.110  -40.560 8.271   1.00 19.39 ? 71  LYS A CG    1 
ATOM   506   C  CD    . LYS A  1 60  ? 15.357  -42.065 8.434   1.00 22.15 ? 71  LYS A CD    1 
ATOM   507   C  CE    . LYS A  1 60  ? 14.480  -42.697 9.478   1.00 34.95 ? 71  LYS A CE    1 
ATOM   508   N  NZ    . LYS A  1 60  ? 14.624  -44.177 9.480   1.00 36.07 ? 71  LYS A NZ    1 
ATOM   509   N  N     . TYR A  1 61  ? 18.968  -38.723 6.056   1.00 15.84 ? 72  TYR A N     1 
ATOM   510   C  CA    . TYR A  1 61  ? 19.809  -38.188 4.977   1.00 15.24 ? 72  TYR A CA    1 
ATOM   511   C  C     . TYR A  1 61  ? 21.214  -37.853 5.473   1.00 17.09 ? 72  TYR A C     1 
ATOM   512   O  O     . TYR A  1 61  ? 22.199  -38.361 4.939   1.00 16.66 ? 72  TYR A O     1 
ATOM   513   C  CB    . TYR A  1 61  ? 19.171  -36.950 4.305   1.00 16.34 ? 72  TYR A CB    1 
ATOM   514   C  CG    . TYR A  1 61  ? 20.073  -36.339 3.250   1.00 18.33 ? 72  TYR A CG    1 
ATOM   515   C  CD1   . TYR A  1 61  ? 20.491  -35.014 3.344   1.00 21.59 ? 72  TYR A CD1   1 
ATOM   516   C  CD2   . TYR A  1 61  ? 20.507  -37.086 2.156   1.00 18.92 ? 72  TYR A CD2   1 
ATOM   517   C  CE1   . TYR A  1 61  ? 21.321  -34.449 2.376   1.00 24.78 ? 72  TYR A CE1   1 
ATOM   518   C  CE2   . TYR A  1 61  ? 21.371  -36.546 1.210   1.00 19.53 ? 72  TYR A CE2   1 
ATOM   519   C  CZ    . TYR A  1 61  ? 21.769  -35.226 1.317   1.00 30.09 ? 72  TYR A CZ    1 
ATOM   520   O  OH    . TYR A  1 61  ? 22.595  -34.700 0.352   1.00 37.89 ? 72  TYR A OH    1 
ATOM   521   N  N     . HIS A  1 62  ? 21.319  -36.968 6.474   1.00 12.71 ? 73  HIS A N     1 
ATOM   522   C  CA    . HIS A  1 62  ? 22.615  -36.529 6.964   1.00 11.65 ? 73  HIS A CA    1 
ATOM   523   C  C     . HIS A  1 62  ? 23.378  -37.596 7.733   1.00 17.42 ? 73  HIS A C     1 
ATOM   524   O  O     . HIS A  1 62  ? 22.761  -38.493 8.300   1.00 18.07 ? 73  HIS A O     1 
ATOM   525   C  CB    . HIS A  1 62  ? 22.473  -35.242 7.764   1.00 11.35 ? 73  HIS A CB    1 
ATOM   526   C  CG    . HIS A  1 62  ? 21.952  -34.082 6.961   1.00 13.92 ? 73  HIS A CG    1 
ATOM   527   N  ND1   . HIS A  1 62  ? 22.797  -33.316 6.169   1.00 14.81 ? 73  HIS A ND1   1 
ATOM   528   C  CD2   . HIS A  1 62  ? 20.703  -33.559 6.905   1.00 14.76 ? 73  HIS A CD2   1 
ATOM   529   C  CE1   . HIS A  1 62  ? 22.033  -32.369 5.644   1.00 14.32 ? 73  HIS A CE1   1 
ATOM   530   N  NE2   . HIS A  1 62  ? 20.759  -32.493 6.025   1.00 14.77 ? 73  HIS A NE2   1 
ATOM   531   N  N     . SER A  1 63  ? 24.715  -37.519 7.739   1.00 16.64 ? 74  SER A N     1 
ATOM   532   C  CA    . SER A  1 63  ? 25.520  -38.528 8.437   1.00 17.27 ? 74  SER A CA    1 
ATOM   533   C  C     . SER A  1 63  ? 25.382  -38.344 9.936   1.00 21.19 ? 74  SER A C     1 
ATOM   534   O  O     . SER A  1 63  ? 25.155  -37.226 10.396  1.00 18.78 ? 74  SER A O     1 
ATOM   535   C  CB    . SER A  1 63  ? 26.992  -38.414 8.057   1.00 18.34 ? 74  SER A CB    1 
ATOM   536   O  OG    . SER A  1 63  ? 27.568  -37.199 8.513   1.00 19.52 ? 74  SER A OG    1 
ATOM   537   N  N     . ASP A  1 64  ? 25.547  -39.436 10.690  1.00 19.65 ? 75  ASP A N     1 
ATOM   538   C  CA    . ASP A  1 64  ? 25.518  -39.403 12.151  1.00 19.26 ? 75  ASP A CA    1 
ATOM   539   C  C     . ASP A  1 64  ? 26.535  -38.416 12.692  1.00 20.34 ? 75  ASP A C     1 
ATOM   540   O  O     . ASP A  1 64  ? 26.196  -37.698 13.602  1.00 18.83 ? 75  ASP A O     1 
ATOM   541   C  CB    . ASP A  1 64  ? 25.783  -40.794 12.740  1.00 21.62 ? 75  ASP A CB    1 
ATOM   542   C  CG    . ASP A  1 64  ? 24.648  -41.790 12.621  1.00 35.87 ? 75  ASP A CG    1 
ATOM   543   O  OD1   . ASP A  1 64  ? 24.907  -43.002 12.779  1.00 40.73 ? 75  ASP A OD1   1 
ATOM   544   O  OD2   . ASP A  1 64  ? 23.498  -41.361 12.398  1.00 36.97 ? 75  ASP A OD2   1 
ATOM   545   N  N     . GLU A  1 65  ? 27.755  -38.337 12.108  1.00 19.05 ? 76  GLU A N     1 
ATOM   546   C  CA    . GLU A  1 65  ? 28.840  -37.447 12.565  1.00 19.41 ? 76  GLU A CA    1 
ATOM   547   C  C     . GLU A  1 65  ? 28.503  -35.970 12.429  1.00 20.15 ? 76  GLU A C     1 
ATOM   548   O  O     . GLU A  1 65  ? 28.814  -35.177 13.322  1.00 18.08 ? 76  GLU A O     1 
ATOM   549   C  CB    . GLU A  1 65  ? 30.175  -37.741 11.833  1.00 21.99 ? 76  GLU A CB    1 
ATOM   550   C  CG    . GLU A  1 65  ? 30.463  -39.215 11.555  1.00 36.80 ? 76  GLU A CG    1 
ATOM   551   C  CD    . GLU A  1 65  ? 29.803  -39.780 10.306  1.00 58.61 ? 76  GLU A CD    1 
ATOM   552   O  OE1   . GLU A  1 65  ? 30.357  -39.586 9.198   1.00 58.20 ? 76  GLU A OE1   1 
ATOM   553   O  OE2   . GLU A  1 65  ? 28.726  -40.410 10.436  1.00 38.37 ? 76  GLU A OE2   1 
ATOM   554   N  N     . TYR A  1 66  ? 27.908  -35.588 11.288  1.00 16.68 ? 77  TYR A N     1 
ATOM   555   C  CA    . TYR A  1 66  ? 27.558  -34.184 11.017  1.00 15.47 ? 77  TYR A CA    1 
ATOM   556   C  C     . TYR A  1 66  ? 26.443  -33.684 11.955  1.00 17.21 ? 77  TYR A C     1 
ATOM   557   O  O     . TYR A  1 66  ? 26.555  -32.585 12.491  1.00 17.94 ? 77  TYR A O     1 
ATOM   558   C  CB    . TYR A  1 66  ? 27.192  -34.014 9.525   1.00 15.38 ? 77  TYR A CB    1 
ATOM   559   C  CG    . TYR A  1 66  ? 26.691  -32.639 9.146   1.00 14.38 ? 77  TYR A CG    1 
ATOM   560   C  CD1   . TYR A  1 66  ? 27.456  -31.503 9.395   1.00 14.93 ? 77  TYR A CD1   1 
ATOM   561   C  CD2   . TYR A  1 66  ? 25.475  -32.478 8.479   1.00 13.82 ? 77  TYR A CD2   1 
ATOM   562   C  CE1   . TYR A  1 66  ? 27.004  -30.237 9.050   1.00 15.43 ? 77  TYR A CE1   1 
ATOM   563   C  CE2   . TYR A  1 66  ? 25.010  -31.213 8.131   1.00 14.30 ? 77  TYR A CE2   1 
ATOM   564   C  CZ    . TYR A  1 66  ? 25.784  -30.094 8.412   1.00 18.08 ? 77  TYR A CZ    1 
ATOM   565   O  OH    . TYR A  1 66  ? 25.357  -28.825 8.097   1.00 13.92 ? 77  TYR A OH    1 
ATOM   566   N  N     . ILE A  1 67  ? 25.395  -34.486 12.146  1.00 13.33 ? 78  ILE A N     1 
ATOM   567   C  CA    . ILE A  1 67  ? 24.269  -34.170 13.042  1.00 12.29 ? 78  ILE A CA    1 
ATOM   568   C  C     . ILE A  1 67  ? 24.765  -34.069 14.496  1.00 17.19 ? 78  ILE A C     1 
ATOM   569   O  O     . ILE A  1 67  ? 24.400  -33.123 15.198  1.00 16.89 ? 78  ILE A O     1 
ATOM   570   C  CB    . ILE A  1 67  ? 23.087  -35.167 12.838  1.00 15.13 ? 78  ILE A CB    1 
ATOM   571   C  CG1   . ILE A  1 67  ? 22.516  -35.062 11.386  1.00 14.88 ? 78  ILE A CG1   1 
ATOM   572   C  CG2   . ILE A  1 67  ? 21.949  -34.974 13.897  1.00 16.24 ? 78  ILE A CG2   1 
ATOM   573   C  CD1   . ILE A  1 67  ? 22.181  -33.588 10.876  1.00 13.49 ? 78  ILE A CD1   1 
ATOM   574   N  N     . LYS A  1 68  ? 25.662  -34.984 14.913  1.00 15.46 ? 79  LYS A N     1 
ATOM   575   C  CA    . LYS A  1 68  ? 26.241  -34.940 16.274  1.00 16.15 ? 79  LYS A CA    1 
ATOM   576   C  C     . LYS A  1 68  ? 27.000  -33.636 16.485  1.00 19.79 ? 79  LYS A C     1 
ATOM   577   O  O     . LYS A  1 68  ? 26.850  -32.998 17.532  1.00 19.67 ? 79  LYS A O     1 
ATOM   578   C  CB    . LYS A  1 68  ? 27.152  -36.152 16.530  1.00 18.15 ? 79  LYS A CB    1 
ATOM   579   C  CG    . LYS A  1 68  ? 26.394  -37.437 16.842  1.00 37.19 ? 79  LYS A CG    1 
ATOM   580   C  CD    . LYS A  1 68  ? 27.341  -38.632 16.864  1.00 52.15 ? 79  LYS A CD    1 
ATOM   581   C  CE    . LYS A  1 68  ? 26.611  -39.954 16.875  1.00 66.07 ? 79  LYS A CE    1 
ATOM   582   N  NZ    . LYS A  1 68  ? 27.535  -41.089 16.593  1.00 74.09 ? 79  LYS A NZ    1 
ATOM   583   N  N     . PHE A  1 69  ? 27.765  -33.198 15.466  1.00 16.25 ? 80  PHE A N     1 
ATOM   584   C  CA    . PHE A  1 69  ? 28.495  -31.933 15.511  1.00 16.28 ? 80  PHE A CA    1 
ATOM   585   C  C     . PHE A  1 69  ? 27.501  -30.758 15.617  1.00 20.04 ? 80  PHE A C     1 
ATOM   586   O  O     . PHE A  1 69  ? 27.679  -29.891 16.472  1.00 21.06 ? 80  PHE A O     1 
ATOM   587   C  CB    . PHE A  1 69  ? 29.415  -31.786 14.272  1.00 18.55 ? 80  PHE A CB    1 
ATOM   588   C  CG    . PHE A  1 69  ? 29.906  -30.379 14.025  1.00 19.61 ? 80  PHE A CG    1 
ATOM   589   C  CD1   . PHE A  1 69  ? 29.286  -29.564 13.084  1.00 21.54 ? 80  PHE A CD1   1 
ATOM   590   C  CD2   . PHE A  1 69  ? 30.962  -29.854 14.760  1.00 21.22 ? 80  PHE A CD2   1 
ATOM   591   C  CE1   . PHE A  1 69  ? 29.732  -28.262 12.864  1.00 20.91 ? 80  PHE A CE1   1 
ATOM   592   C  CE2   . PHE A  1 69  ? 31.393  -28.541 14.553  1.00 22.91 ? 80  PHE A CE2   1 
ATOM   593   C  CZ    . PHE A  1 69  ? 30.772  -27.753 13.601  1.00 20.96 ? 80  PHE A CZ    1 
ATOM   594   N  N     . LEU A  1 70  ? 26.459  -30.722 14.763  1.00 16.43 ? 81  LEU A N     1 
ATOM   595   C  CA    . LEU A  1 70  ? 25.461  -29.639 14.837  1.00 15.38 ? 81  LEU A CA    1 
ATOM   596   C  C     . LEU A  1 70  ? 24.762  -29.560 16.214  1.00 17.89 ? 81  LEU A C     1 
ATOM   597   O  O     . LEU A  1 70  ? 24.537  -28.459 16.706  1.00 18.00 ? 81  LEU A O     1 
ATOM   598   C  CB    . LEU A  1 70  ? 24.407  -29.770 13.730  1.00 15.54 ? 81  LEU A CB    1 
ATOM   599   C  CG    . LEU A  1 70  ? 24.854  -29.494 12.313  1.00 19.43 ? 81  LEU A CG    1 
ATOM   600   C  CD1   . LEU A  1 70  ? 23.704  -29.737 11.364  1.00 19.66 ? 81  LEU A CD1   1 
ATOM   601   C  CD2   . LEU A  1 70  ? 25.420  -28.062 12.159  1.00 18.12 ? 81  LEU A CD2   1 
ATOM   602   N  N     . ARG A  1 71  ? 24.426  -30.724 16.808  1.00 15.43 ? 82  ARG A N     1 
ATOM   603   C  CA    . ARG A  1 71  ? 23.796  -30.891 18.139  1.00 17.12 ? 82  ARG A CA    1 
ATOM   604   C  C     . ARG A  1 71  ? 24.714  -30.375 19.268  1.00 24.40 ? 82  ARG A C     1 
ATOM   605   O  O     . ARG A  1 71  ? 24.218  -30.028 20.345  1.00 23.28 ? 82  ARG A O     1 
ATOM   606   C  CB    . ARG A  1 71  ? 23.633  -32.401 18.447  1.00 19.96 ? 82  ARG A CB    1 
ATOM   607   C  CG    . ARG A  1 71  ? 22.365  -33.095 18.007  1.00 33.00 ? 82  ARG A CG    1 
ATOM   608   C  CD    . ARG A  1 71  ? 21.908  -34.197 18.995  1.00 38.40 ? 82  ARG A CD    1 
ATOM   609   N  NE    . ARG A  1 71  ? 22.945  -35.173 19.375  1.00 41.19 ? 82  ARG A NE    1 
ATOM   610   C  CZ    . ARG A  1 71  ? 22.721  -36.476 19.569  1.00 49.71 ? 82  ARG A CZ    1 
ATOM   611   N  NH1   . ARG A  1 71  ? 23.711  -37.281 19.934  1.00 36.02 ? 82  ARG A NH1   1 
ATOM   612   N  NH2   . ARG A  1 71  ? 21.511  -36.985 19.380  1.00 21.56 ? 82  ARG A NH2   1 
ATOM   613   N  N     . SER A  1 72  ? 26.054  -30.457 19.065  1.00 22.20 ? 83  SER A N     1 
ATOM   614   C  CA    . SER A  1 72  ? 27.089  -30.124 20.075  1.00 21.46 ? 83  SER A CA    1 
ATOM   615   C  C     . SER A  1 72  ? 27.703  -28.749 19.971  1.00 24.45 ? 83  SER A C     1 
ATOM   616   O  O     . SER A  1 72  ? 28.070  -28.188 21.004  1.00 25.71 ? 83  SER A O     1 
ATOM   617   C  CB    . SER A  1 72  ? 28.224  -31.153 20.038  1.00 21.71 ? 83  SER A CB    1 
ATOM   618   O  OG    . SER A  1 72  ? 27.725  -32.479 20.010  1.00 29.06 ? 83  SER A OG    1 
ATOM   619   N  N     . ILE A  1 73  ? 27.895  -28.230 18.747  1.00 20.20 ? 84  ILE A N     1 
ATOM   620   C  CA    . ILE A  1 73  ? 28.571  -26.934 18.514  1.00 19.75 ? 84  ILE A CA    1 
ATOM   621   C  C     . ILE A  1 73  ? 27.843  -25.698 19.062  1.00 22.65 ? 84  ILE A C     1 
ATOM   622   O  O     . ILE A  1 73  ? 26.651  -25.512 18.804  1.00 21.35 ? 84  ILE A O     1 
ATOM   623   C  CB    . ILE A  1 73  ? 29.032  -26.774 17.025  1.00 23.38 ? 84  ILE A CB    1 
ATOM   624   C  CG1   . ILE A  1 73  ? 30.048  -25.626 16.843  1.00 24.07 ? 84  ILE A CG1   1 
ATOM   625   C  CG2   . ILE A  1 73  ? 27.847  -26.622 16.040  1.00 23.57 ? 84  ILE A CG2   1 
ATOM   626   C  CD1   . ILE A  1 73  ? 31.338  -25.858 17.341  1.00 31.21 ? 84  ILE A CD1   1 
ATOM   627   N  N     . ARG A  1 74  ? 28.570  -24.847 19.813  1.00 19.51 ? 85  ARG A N     1 
ATOM   628   C  CA    . ARG A  1 74  ? 28.010  -23.621 20.392  1.00 20.04 ? 85  ARG A CA    1 
ATOM   629   C  C     . ARG A  1 74  ? 29.047  -22.496 20.341  1.00 25.52 ? 85  ARG A C     1 
ATOM   630   O  O     . ARG A  1 74  ? 30.243  -22.791 20.290  1.00 27.29 ? 85  ARG A O     1 
ATOM   631   C  CB    . ARG A  1 74  ? 27.575  -23.837 21.867  1.00 21.24 ? 85  ARG A CB    1 
ATOM   632   C  CG    . ARG A  1 74  ? 26.553  -24.954 22.108  1.00 33.61 ? 85  ARG A CG    1 
ATOM   633   C  CD    . ARG A  1 74  ? 26.072  -25.049 23.555  1.00 42.44 ? 85  ARG A CD    1 
ATOM   634   N  NE    . ARG A  1 74  ? 27.148  -25.021 24.555  1.00 46.42 ? 85  ARG A NE    1 
ATOM   635   C  CZ    . ARG A  1 74  ? 27.867  -26.077 24.934  1.00 60.45 ? 85  ARG A CZ    1 
ATOM   636   N  NH1   . ARG A  1 74  ? 28.806  -25.949 25.862  1.00 48.63 ? 85  ARG A NH1   1 
ATOM   637   N  NH2   . ARG A  1 74  ? 27.665  -27.264 24.375  1.00 47.89 ? 85  ARG A NH2   1 
ATOM   638   N  N     . PRO A  1 75  ? 28.652  -21.205 20.418  1.00 22.92 ? 86  PRO A N     1 
ATOM   639   C  CA    . PRO A  1 75  ? 29.673  -20.140 20.439  1.00 23.63 ? 86  PRO A CA    1 
ATOM   640   C  C     . PRO A  1 75  ? 30.658  -20.249 21.627  1.00 32.26 ? 86  PRO A C     1 
ATOM   641   O  O     . PRO A  1 75  ? 31.819  -19.861 21.475  1.00 33.58 ? 86  PRO A O     1 
ATOM   642   C  CB    . PRO A  1 75  ? 28.850  -18.852 20.496  1.00 25.10 ? 86  PRO A CB    1 
ATOM   643   C  CG    . PRO A  1 75  ? 27.497  -19.225 20.016  1.00 29.13 ? 86  PRO A CG    1 
ATOM   644   C  CD    . PRO A  1 75  ? 27.286  -20.640 20.454  1.00 24.43 ? 86  PRO A CD    1 
ATOM   645   N  N     . ASP A  1 76  ? 30.222  -20.828 22.769  1.00 30.06 ? 87  ASP A N     1 
ATOM   646   C  CA    . ASP A  1 76  ? 31.059  -20.988 23.974  1.00 30.96 ? 87  ASP A CA    1 
ATOM   647   C  C     . ASP A  1 76  ? 32.123  -22.084 23.891  1.00 34.12 ? 87  ASP A C     1 
ATOM   648   O  O     . ASP A  1 76  ? 33.108  -21.995 24.614  1.00 34.05 ? 87  ASP A O     1 
ATOM   649   C  CB    . ASP A  1 76  ? 30.216  -21.118 25.266  1.00 32.56 ? 87  ASP A CB    1 
ATOM   650   C  CG    . ASP A  1 76  ? 29.358  -22.362 25.319  1.00 42.83 ? 87  ASP A CG    1 
ATOM   651   O  OD1   . ASP A  1 76  ? 28.162  -22.269 24.977  1.00 46.59 ? 87  ASP A OD1   1 
ATOM   652   O  OD2   . ASP A  1 76  ? 29.888  -23.435 25.678  1.00 42.68 ? 87  ASP A OD2   1 
ATOM   653   N  N     . ASN A  1 77  ? 31.923  -23.121 23.038  1.00 29.48 ? 88  ASN A N     1 
ATOM   654   C  CA    . ASN A  1 77  ? 32.865  -24.239 22.871  1.00 27.82 ? 88  ASN A CA    1 
ATOM   655   C  C     . ASN A  1 77  ? 33.518  -24.293 21.478  1.00 31.91 ? 88  ASN A C     1 
ATOM   656   O  O     . ASN A  1 77  ? 34.226  -25.257 21.186  1.00 31.43 ? 88  ASN A O     1 
ATOM   657   C  CB    . ASN A  1 77  ? 32.194  -25.583 23.231  1.00 25.83 ? 88  ASN A CB    1 
ATOM   658   C  CG    . ASN A  1 77  ? 31.067  -26.025 22.302  1.00 40.27 ? 88  ASN A CG    1 
ATOM   659   O  OD1   . ASN A  1 77  ? 30.954  -25.603 21.150  1.00 27.91 ? 88  ASN A OD1   1 
ATOM   660   N  ND2   . ASN A  1 77  ? 30.235  -26.936 22.762  1.00 31.45 ? 88  ASN A ND2   1 
ATOM   661   N  N     . MET A  1 78  ? 33.234  -23.286 20.613  1.00 29.68 ? 89  MET A N     1 
ATOM   662   C  CA    . MET A  1 78  ? 33.725  -23.135 19.229  1.00 30.80 ? 89  MET A CA    1 
ATOM   663   C  C     . MET A  1 78  ? 35.217  -23.397 19.104  1.00 37.13 ? 89  MET A C     1 
ATOM   664   O  O     . MET A  1 78  ? 35.648  -24.151 18.226  1.00 36.42 ? 89  MET A O     1 
ATOM   665   C  CB    . MET A  1 78  ? 33.480  -21.700 18.755  1.00 32.75 ? 89  MET A CB    1 
ATOM   666   C  CG    . MET A  1 78  ? 32.319  -21.552 17.877  1.00 35.90 ? 89  MET A CG    1 
ATOM   667   S  SD    . MET A  1 78  ? 32.184  -19.830 17.442  1.00 39.38 ? 89  MET A SD    1 
ATOM   668   C  CE    . MET A  1 78  ? 33.011  -19.835 15.929  1.00 36.42 ? 89  MET A CE    1 
ATOM   669   N  N     . SER A  1 79  ? 36.000  -22.746 19.995  1.00 36.41 ? 90  SER A N     1 
ATOM   670   C  CA    . SER A  1 79  ? 37.462  -22.817 20.083  1.00 36.84 ? 90  SER A CA    1 
ATOM   671   C  C     . SER A  1 79  ? 38.000  -24.239 20.195  1.00 39.51 ? 90  SER A C     1 
ATOM   672   O  O     . SER A  1 79  ? 39.126  -24.481 19.786  1.00 40.95 ? 90  SER A O     1 
ATOM   673   C  CB    . SER A  1 79  ? 37.964  -21.959 21.242  1.00 41.26 ? 90  SER A CB    1 
ATOM   674   O  OG    . SER A  1 79  ? 37.416  -22.402 22.474  1.00 49.79 ? 90  SER A OG    1 
ATOM   675   N  N     . GLU A  1 80  ? 37.195  -25.174 20.716  1.00 35.30 ? 91  GLU A N     1 
ATOM   676   C  CA    . GLU A  1 80  ? 37.551  -26.588 20.879  1.00 35.38 ? 91  GLU A CA    1 
ATOM   677   C  C     . GLU A  1 80  ? 37.118  -27.444 19.672  1.00 39.39 ? 91  GLU A C     1 
ATOM   678   O  O     . GLU A  1 80  ? 37.299  -28.663 19.698  1.00 39.64 ? 91  GLU A O     1 
ATOM   679   C  CB    . GLU A  1 80  ? 36.899  -27.155 22.164  1.00 36.77 ? 91  GLU A CB    1 
ATOM   680   C  CG    . GLU A  1 80  ? 37.391  -26.528 23.460  1.00 48.77 ? 91  GLU A CG    1 
ATOM   681   C  CD    . GLU A  1 80  ? 36.811  -27.120 24.732  1.00 75.22 ? 91  GLU A CD    1 
ATOM   682   O  OE1   . GLU A  1 80  ? 35.583  -27.360 24.780  1.00 66.25 ? 91  GLU A OE1   1 
ATOM   683   O  OE2   . GLU A  1 80  ? 37.584  -27.303 25.701  1.00 77.53 ? 91  GLU A OE2   1 
ATOM   684   N  N     . TYR A  1 81  ? 36.511  -26.821 18.637  1.00 34.75 ? 92  TYR A N     1 
ATOM   685   C  CA    . TYR A  1 81  ? 35.976  -27.531 17.464  1.00 33.31 ? 92  TYR A CA    1 
ATOM   686   C  C     . TYR A  1 81  ? 36.497  -27.001 16.117  1.00 35.52 ? 92  TYR A C     1 
ATOM   687   O  O     . TYR A  1 81  ? 35.915  -27.330 15.083  1.00 34.25 ? 92  TYR A O     1 
ATOM   688   C  CB    . TYR A  1 81  ? 34.436  -27.448 17.467  1.00 33.81 ? 92  TYR A CB    1 
ATOM   689   C  CG    . TYR A  1 81  ? 33.734  -28.394 18.418  1.00 35.24 ? 92  TYR A CG    1 
ATOM   690   C  CD1   . TYR A  1 81  ? 33.382  -29.679 18.018  1.00 36.76 ? 92  TYR A CD1   1 
ATOM   691   C  CD2   . TYR A  1 81  ? 33.339  -27.975 19.685  1.00 35.88 ? 92  TYR A CD2   1 
ATOM   692   C  CE1   . TYR A  1 81  ? 32.701  -30.544 18.876  1.00 37.33 ? 92  TYR A CE1   1 
ATOM   693   C  CE2   . TYR A  1 81  ? 32.661  -28.831 20.553  1.00 36.67 ? 92  TYR A CE2   1 
ATOM   694   C  CZ    . TYR A  1 81  ? 32.349  -30.116 20.146  1.00 43.06 ? 92  TYR A CZ    1 
ATOM   695   O  OH    . TYR A  1 81  ? 31.682  -30.963 20.999  1.00 45.29 ? 92  TYR A OH    1 
ATOM   696   N  N     . SER A  1 82  ? 37.575  -26.183 16.126  1.00 32.15 ? 93  SER A N     1 
ATOM   697   C  CA    . SER A  1 82  ? 38.186  -25.575 14.938  1.00 32.32 ? 93  SER A CA    1 
ATOM   698   C  C     . SER A  1 82  ? 38.322  -26.521 13.730  1.00 34.54 ? 93  SER A C     1 
ATOM   699   O  O     . SER A  1 82  ? 37.962  -26.141 12.616  1.00 34.54 ? 93  SER A O     1 
ATOM   700   C  CB    . SER A  1 82  ? 39.535  -24.953 15.282  1.00 37.71 ? 93  SER A CB    1 
ATOM   701   O  OG    . SER A  1 82  ? 40.468  -25.965 15.625  1.00 50.83 ? 93  SER A OG    1 
ATOM   702   N  N     . LYS A  1 83  ? 38.795  -27.747 13.957  1.00 29.80 ? 94  LYS A N     1 
ATOM   703   C  CA    . LYS A  1 83  ? 38.987  -28.735 12.890  1.00 29.23 ? 94  LYS A CA    1 
ATOM   704   C  C     . LYS A  1 83  ? 37.650  -29.251 12.370  1.00 31.86 ? 94  LYS A C     1 
ATOM   705   O  O     . LYS A  1 83  ? 37.458  -29.348 11.155  1.00 31.29 ? 94  LYS A O     1 
ATOM   706   C  CB    . LYS A  1 83  ? 39.879  -29.901 13.371  1.00 31.30 ? 94  LYS A CB    1 
ATOM   707   C  CG    . LYS A  1 83  ? 40.037  -31.024 12.340  1.00 43.26 ? 94  LYS A CG    1 
ATOM   708   C  CD    . LYS A  1 83  ? 40.776  -32.247 12.879  1.00 54.18 ? 94  LYS A CD    1 
ATOM   709   C  CE    . LYS A  1 83  ? 41.033  -33.240 11.771  1.00 63.08 ? 94  LYS A CE    1 
ATOM   710   N  NZ    . LYS A  1 83  ? 42.168  -34.147 12.084  1.00 73.27 ? 94  LYS A NZ    1 
ATOM   711   N  N     . GLN A  1 84  ? 36.740  -29.598 13.295  1.00 27.72 ? 95  GLN A N     1 
ATOM   712   C  CA    . GLN A  1 84  ? 35.406  -30.124 12.997  1.00 26.38 ? 95  GLN A CA    1 
ATOM   713   C  C     . GLN A  1 84  ? 34.595  -29.088 12.187  1.00 25.38 ? 95  GLN A C     1 
ATOM   714   O  O     . GLN A  1 84  ? 33.931  -29.447 11.221  1.00 25.29 ? 95  GLN A O     1 
ATOM   715   C  CB    . GLN A  1 84  ? 34.698  -30.543 14.304  1.00 27.70 ? 95  GLN A CB    1 
ATOM   716   C  CG    A GLN A  1 84  ? 35.350  -31.745 15.023  0.82 40.59 ? 95  GLN A CG    1 
ATOM   717   C  CD    A GLN A  1 84  ? 36.683  -31.478 15.718  0.82 60.61 ? 95  GLN A CD    1 
ATOM   718   O  OE1   A GLN A  1 84  ? 37.096  -30.332 15.962  0.82 52.75 ? 95  GLN A OE1   1 
ATOM   719   N  NE2   A GLN A  1 84  ? 37.400  -32.546 16.049  0.82 55.30 ? 95  GLN A NE2   1 
ATOM   720   N  N     . MET A  1 85  ? 34.728  -27.806 12.540  1.00 19.83 ? 96  MET A N     1 
ATOM   721   C  CA    . MET A  1 85  ? 34.098  -26.679 11.856  1.00 19.56 ? 96  MET A CA    1 
ATOM   722   C  C     . MET A  1 85  ? 34.542  -26.614 10.371  1.00 22.65 ? 96  MET A C     1 
ATOM   723   O  O     . MET A  1 85  ? 33.700  -26.523 9.490   1.00 20.33 ? 96  MET A O     1 
ATOM   724   C  CB    . MET A  1 85  ? 34.423  -25.361 12.584  1.00 21.70 ? 96  MET A CB    1 
ATOM   725   C  CG    . MET A  1 85  ? 33.573  -25.142 13.850  1.00 25.70 ? 96  MET A CG    1 
ATOM   726   S  SD    . MET A  1 85  ? 33.940  -23.600 14.716  1.00 31.17 ? 96  MET A SD    1 
ATOM   727   C  CE    . MET A  1 85  ? 33.460  -22.406 13.520  1.00 28.83 ? 96  MET A CE    1 
ATOM   728   N  N     . GLN A  1 86  ? 35.853  -26.722 10.107  1.00 19.99 ? 97  GLN A N     1 
ATOM   729   C  CA    . GLN A  1 86  ? 36.400  -26.702 8.737   1.00 20.77 ? 97  GLN A CA    1 
ATOM   730   C  C     . GLN A  1 86  ? 35.908  -27.917 7.952   1.00 23.81 ? 97  GLN A C     1 
ATOM   731   O  O     . GLN A  1 86  ? 35.400  -27.749 6.845   1.00 23.93 ? 97  GLN A O     1 
ATOM   732   C  CB    . GLN A  1 86  ? 37.943  -26.612 8.759   1.00 22.65 ? 97  GLN A CB    1 
ATOM   733   C  CG    . GLN A  1 86  ? 38.460  -25.339 9.407   1.00 33.34 ? 97  GLN A CG    1 
ATOM   734   C  CD    . GLN A  1 86  ? 39.913  -25.463 9.780   1.00 48.53 ? 97  GLN A CD    1 
ATOM   735   O  OE1   . GLN A  1 86  ? 40.798  -25.278 8.950   1.00 43.17 ? 97  GLN A OE1   1 
ATOM   736   N  NE2   . GLN A  1 86  ? 40.192  -25.778 11.044  1.00 32.54 ? 97  GLN A NE2   1 
ATOM   737   N  N     . ARG A  1 87  ? 35.938  -29.112 8.567   1.00 20.55 ? 98  ARG A N     1 
ATOM   738   C  CA    . ARG A  1 87  ? 35.448  -30.362 7.957   1.00 20.77 ? 98  ARG A CA    1 
ATOM   739   C  C     . ARG A  1 87  ? 33.961  -30.276 7.470   1.00 24.61 ? 98  ARG A C     1 
ATOM   740   O  O     . ARG A  1 87  ? 33.637  -30.779 6.394   1.00 23.74 ? 98  ARG A O     1 
ATOM   741   C  CB    . ARG A  1 87  ? 35.584  -31.518 8.968   1.00 24.13 ? 98  ARG A CB    1 
ATOM   742   C  CG    . ARG A  1 87  ? 35.504  -32.896 8.324   1.00 39.03 ? 98  ARG A CG    1 
ATOM   743   C  CD    . ARG A  1 87  ? 34.715  -33.925 9.115   1.00 51.99 ? 98  ARG A CD    1 
ATOM   744   N  NE    . ARG A  1 87  ? 35.354  -34.300 10.376  1.00 62.80 ? 98  ARG A NE    1 
ATOM   745   C  CZ    . ARG A  1 87  ? 34.996  -35.345 11.120  1.00 78.20 ? 98  ARG A CZ    1 
ATOM   746   N  NH1   . ARG A  1 87  ? 35.622  -35.599 12.260  1.00 70.98 ? 98  ARG A NH1   1 
ATOM   747   N  NH2   . ARG A  1 87  ? 34.015  -36.148 10.722  1.00 55.66 ? 98  ARG A NH2   1 
ATOM   748   N  N     . PHE A  1 88  ? 33.074  -29.662 8.277   1.00 21.15 ? 99  PHE A N     1 
ATOM   749   C  CA    . PHE A  1 88  ? 31.637  -29.556 7.976   1.00 18.88 ? 99  PHE A CA    1 
ATOM   750   C  C     . PHE A  1 88  ? 31.211  -28.205 7.370   1.00 21.24 ? 99  PHE A C     1 
ATOM   751   O  O     . PHE A  1 88  ? 30.018  -27.979 7.180   1.00 18.33 ? 99  PHE A O     1 
ATOM   752   C  CB    . PHE A  1 88  ? 30.817  -29.898 9.243   1.00 19.98 ? 99  PHE A CB    1 
ATOM   753   C  CG    . PHE A  1 88  ? 31.090  -31.278 9.809   1.00 21.03 ? 99  PHE A CG    1 
ATOM   754   C  CD1   . PHE A  1 88  ? 30.851  -32.419 9.051   1.00 22.68 ? 99  PHE A CD1   1 
ATOM   755   C  CD2   . PHE A  1 88  ? 31.556  -31.436 11.114  1.00 23.75 ? 99  PHE A CD2   1 
ATOM   756   C  CE1   . PHE A  1 88  ? 31.108  -33.693 9.570   1.00 23.57 ? 99  PHE A CE1   1 
ATOM   757   C  CE2   . PHE A  1 88  ? 31.803  -32.710 11.637  1.00 25.71 ? 99  PHE A CE2   1 
ATOM   758   C  CZ    . PHE A  1 88  ? 31.553  -33.830 10.873  1.00 23.71 ? 99  PHE A CZ    1 
ATOM   759   N  N     . ASN A  1 89  ? 32.196  -27.329 7.031   1.00 17.07 ? 100 ASN A N     1 
ATOM   760   C  CA    . ASN A  1 89  ? 31.985  -26.018 6.415   1.00 17.45 ? 100 ASN A CA    1 
ATOM   761   C  C     . ASN A  1 89  ? 31.155  -25.057 7.267   1.00 20.87 ? 100 ASN A C     1 
ATOM   762   O  O     . ASN A  1 89  ? 30.299  -24.323 6.756   1.00 18.85 ? 100 ASN A O     1 
ATOM   763   C  CB    . ASN A  1 89  ? 31.446  -26.120 4.981   1.00 15.09 ? 100 ASN A CB    1 
ATOM   764   C  CG    . ASN A  1 89  ? 31.519  -24.826 4.216   1.00 25.21 ? 100 ASN A CG    1 
ATOM   765   O  OD1   . ASN A  1 89  ? 32.484  -24.075 4.313   1.00 22.81 ? 100 ASN A OD1   1 
ATOM   766   N  ND2   . ASN A  1 89  ? 30.467  -24.514 3.476   1.00 22.42 ? 100 ASN A ND2   1 
ATOM   767   N  N     . VAL A  1 90  ? 31.435  -25.055 8.566   1.00 18.99 ? 101 VAL A N     1 
ATOM   768   C  CA    . VAL A  1 90  ? 30.796  -24.135 9.493   1.00 20.84 ? 101 VAL A CA    1 
ATOM   769   C  C     . VAL A  1 90  ? 31.841  -23.070 9.895   1.00 28.34 ? 101 VAL A C     1 
ATOM   770   O  O     . VAL A  1 90  ? 32.976  -23.430 10.213  1.00 27.78 ? 101 VAL A O     1 
ATOM   771   C  CB    . VAL A  1 90  ? 30.202  -24.937 10.692  1.00 24.40 ? 101 VAL A CB    1 
ATOM   772   C  CG1   . VAL A  1 90  ? 29.764  -24.025 11.819  1.00 24.48 ? 101 VAL A CG1   1 
ATOM   773   C  CG2   . VAL A  1 90  ? 29.028  -25.802 10.236  1.00 23.69 ? 101 VAL A CG2   1 
ATOM   774   N  N     . GLY A  1 91  ? 31.474  -21.785 9.831   1.00 27.68 ? 102 GLY A N     1 
ATOM   775   C  CA    . GLY A  1 91  ? 32.375  -20.720 10.277  1.00 29.15 ? 102 GLY A CA    1 
ATOM   776   C  C     . GLY A  1 91  ? 32.399  -19.372 9.588   1.00 35.24 ? 102 GLY A C     1 
ATOM   777   O  O     . GLY A  1 91  ? 32.964  -18.421 10.144  1.00 37.24 ? 102 GLY A O     1 
ATOM   778   N  N     . GLU A  1 92  ? 31.837  -19.264 8.386   1.00 29.90 ? 103 GLU A N     1 
ATOM   779   C  CA    . GLU A  1 92  ? 31.825  -17.993 7.653   1.00 29.04 ? 103 GLU A CA    1 
ATOM   780   C  C     . GLU A  1 92  ? 30.412  -17.755 7.097   1.00 26.90 ? 103 GLU A C     1 
ATOM   781   O  O     . GLU A  1 92  ? 29.642  -17.004 7.694   1.00 25.81 ? 103 GLU A O     1 
ATOM   782   C  CB    . GLU A  1 92  ? 32.916  -18.006 6.549   1.00 31.46 ? 103 GLU A CB    1 
ATOM   783   C  CG    . GLU A  1 92  ? 32.959  -16.784 5.642   1.00 46.65 ? 103 GLU A CG    1 
ATOM   784   C  CD    . GLU A  1 92  ? 33.371  -15.456 6.249   1.00 79.36 ? 103 GLU A CD    1 
ATOM   785   O  OE1   . GLU A  1 92  ? 32.957  -14.410 5.699   1.00 67.76 ? 103 GLU A OE1   1 
ATOM   786   O  OE2   . GLU A  1 92  ? 34.134  -15.453 7.244   1.00 84.24 ? 103 GLU A OE2   1 
ATOM   787   N  N     . ASP A  1 93  ? 30.055  -18.431 5.991   1.00 20.63 ? 104 ASP A N     1 
ATOM   788   C  CA    . ASP A  1 93  ? 28.710  -18.352 5.400   1.00 18.83 ? 104 ASP A CA    1 
ATOM   789   C  C     . ASP A  1 93  ? 27.702  -18.998 6.345   1.00 19.60 ? 104 ASP A C     1 
ATOM   790   O  O     . ASP A  1 93  ? 26.557  -18.572 6.418   1.00 18.48 ? 104 ASP A O     1 
ATOM   791   C  CB    . ASP A  1 93  ? 28.679  -19.117 4.061   1.00 20.58 ? 104 ASP A CB    1 
ATOM   792   C  CG    . ASP A  1 93  ? 29.354  -18.403 2.905   1.00 26.51 ? 104 ASP A CG    1 
ATOM   793   O  OD1   . ASP A  1 93  ? 29.515  -17.176 2.980   1.00 26.36 ? 104 ASP A OD1   1 
ATOM   794   O  OD2   . ASP A  1 93  ? 29.664  -19.069 1.901   1.00 31.37 ? 104 ASP A OD2   1 
ATOM   795   N  N     . CYS A  1 94  ? 28.141  -20.061 7.040   1.00 16.28 ? 105 CYS A N     1 
ATOM   796   C  CA    . CYS A  1 94  ? 27.339  -20.898 7.923   1.00 15.66 ? 105 CYS A CA    1 
ATOM   797   C  C     . CYS A  1 94  ? 27.872  -20.789 9.347   1.00 17.64 ? 105 CYS A C     1 
ATOM   798   O  O     . CYS A  1 94  ? 28.560  -21.680 9.831   1.00 16.34 ? 105 CYS A O     1 
ATOM   799   C  CB    . CYS A  1 94  ? 27.347  -22.327 7.390   1.00 15.65 ? 105 CYS A CB    1 
ATOM   800   S  SG    . CYS A  1 94  ? 26.736  -22.441 5.684   1.00 18.76 ? 105 CYS A SG    1 
ATOM   801   N  N     . PRO A  1 95  ? 27.619  -19.645 10.009  1.00 15.53 ? 106 PRO A N     1 
ATOM   802   C  CA    . PRO A  1 95  ? 28.227  -19.432 11.317  1.00 16.00 ? 106 PRO A CA    1 
ATOM   803   C  C     . PRO A  1 95  ? 27.619  -20.246 12.431  1.00 19.85 ? 106 PRO A C     1 
ATOM   804   O  O     . PRO A  1 95  ? 26.525  -20.815 12.297  1.00 15.64 ? 106 PRO A O     1 
ATOM   805   C  CB    . PRO A  1 95  ? 28.047  -17.929 11.531  1.00 17.61 ? 106 PRO A CB    1 
ATOM   806   C  CG    . PRO A  1 95  ? 26.808  -17.592 10.815  1.00 21.05 ? 106 PRO A CG    1 
ATOM   807   C  CD    . PRO A  1 95  ? 26.861  -18.447 9.581   1.00 17.16 ? 106 PRO A CD    1 
ATOM   808   N  N     . VAL A  1 96  ? 28.360  -20.308 13.545  1.00 17.64 ? 107 VAL A N     1 
ATOM   809   C  CA    . VAL A  1 96  ? 27.861  -20.920 14.766  1.00 17.44 ? 107 VAL A CA    1 
ATOM   810   C  C     . VAL A  1 96  ? 27.127  -19.751 15.462  1.00 20.54 ? 107 VAL A C     1 
ATOM   811   O  O     . VAL A  1 96  ? 27.674  -18.644 15.566  1.00 18.84 ? 107 VAL A O     1 
ATOM   812   C  CB    . VAL A  1 96  ? 28.995  -21.499 15.663  1.00 21.15 ? 107 VAL A CB    1 
ATOM   813   C  CG1   . VAL A  1 96  ? 28.420  -22.124 16.934  1.00 21.54 ? 107 VAL A CG1   1 
ATOM   814   C  CG2   . VAL A  1 96  ? 29.826  -22.527 14.913  1.00 20.54 ? 107 VAL A CG2   1 
ATOM   815   N  N     . PHE A  1 97  ? 25.863  -19.970 15.844  1.00 15.95 ? 108 PHE A N     1 
ATOM   816   C  CA    . PHE A  1 97  ? 25.089  -18.959 16.565  1.00 14.67 ? 108 PHE A CA    1 
ATOM   817   C  C     . PHE A  1 97  ? 24.266  -19.651 17.646  1.00 18.29 ? 108 PHE A C     1 
ATOM   818   O  O     . PHE A  1 97  ? 24.036  -20.868 17.556  1.00 16.40 ? 108 PHE A O     1 
ATOM   819   C  CB    . PHE A  1 97  ? 24.224  -18.108 15.613  1.00 15.35 ? 108 PHE A CB    1 
ATOM   820   C  CG    . PHE A  1 97  ? 23.239  -18.826 14.715  1.00 15.43 ? 108 PHE A CG    1 
ATOM   821   C  CD1   . PHE A  1 97  ? 23.540  -19.070 13.380  1.00 16.58 ? 108 PHE A CD1   1 
ATOM   822   C  CD2   . PHE A  1 97  ? 21.971  -19.186 15.185  1.00 16.17 ? 108 PHE A CD2   1 
ATOM   823   C  CE1   . PHE A  1 97  ? 22.610  -19.687 12.533  1.00 16.83 ? 108 PHE A CE1   1 
ATOM   824   C  CE2   . PHE A  1 97  ? 21.041  -19.809 14.342  1.00 17.03 ? 108 PHE A CE2   1 
ATOM   825   C  CZ    . PHE A  1 97  ? 21.361  -20.042 13.017  1.00 16.07 ? 108 PHE A CZ    1 
ATOM   826   N  N     . ASP A  1 98  ? 23.880  -18.911 18.698  1.00 16.90 ? 109 ASP A N     1 
ATOM   827   C  CA    . ASP A  1 98  ? 23.074  -19.480 19.789  1.00 16.83 ? 109 ASP A CA    1 
ATOM   828   C  C     . ASP A  1 98  ? 21.764  -20.034 19.229  1.00 18.22 ? 109 ASP A C     1 
ATOM   829   O  O     . ASP A  1 98  ? 21.038  -19.323 18.509  1.00 17.49 ? 109 ASP A O     1 
ATOM   830   C  CB    . ASP A  1 98  ? 22.717  -18.409 20.836  1.00 18.88 ? 109 ASP A CB    1 
ATOM   831   C  CG    . ASP A  1 98  ? 23.880  -17.840 21.615  1.00 30.05 ? 109 ASP A CG    1 
ATOM   832   O  OD1   . ASP A  1 98  ? 24.826  -18.598 21.909  1.00 30.99 ? 109 ASP A OD1   1 
ATOM   833   O  OD2   . ASP A  1 98  ? 23.810  -16.657 21.994  1.00 36.00 ? 109 ASP A OD2   1 
ATOM   834   N  N     . GLY A  1 99  ? 21.468  -21.273 19.596  1.00 14.24 ? 110 GLY A N     1 
ATOM   835   C  CA    . GLY A  1 99  ? 20.251  -21.943 19.157  1.00 14.64 ? 110 GLY A CA    1 
ATOM   836   C  C     . GLY A  1 99  ? 20.318  -22.480 17.734  1.00 16.66 ? 110 GLY A C     1 
ATOM   837   O  O     . GLY A  1 99  ? 19.292  -22.902 17.203  1.00 13.94 ? 110 GLY A O     1 
ATOM   838   N  N     . LEU A  1 100 ? 21.535  -22.539 17.123  1.00 13.43 ? 111 LEU A N     1 
ATOM   839   C  CA    . LEU A  1 100 ? 21.694  -23.085 15.760  1.00 13.22 ? 111 LEU A CA    1 
ATOM   840   C  C     . LEU A  1 100 ? 20.970  -24.426 15.561  1.00 15.09 ? 111 LEU A C     1 
ATOM   841   O  O     . LEU A  1 100 ? 20.194  -24.533 14.611  1.00 15.06 ? 111 LEU A O     1 
ATOM   842   C  CB    . LEU A  1 100 ? 23.183  -23.191 15.343  1.00 13.35 ? 111 LEU A CB    1 
ATOM   843   C  CG    . LEU A  1 100 ? 23.471  -24.033 14.078  1.00 18.06 ? 111 LEU A CG    1 
ATOM   844   C  CD1   . LEU A  1 100 ? 22.824  -23.417 12.862  1.00 17.84 ? 111 LEU A CD1   1 
ATOM   845   C  CD2   . LEU A  1 100 ? 24.946  -24.229 13.875  1.00 19.60 ? 111 LEU A CD2   1 
ATOM   846   N  N     . PHE A  1 101 ? 21.231  -25.453 16.415  1.00 11.07 ? 112 PHE A N     1 
ATOM   847   C  CA    . PHE A  1 101 ? 20.551  -26.741 16.224  1.00 10.09 ? 112 PHE A CA    1 
ATOM   848   C  C     . PHE A  1 101 ? 19.030  -26.623 16.283  1.00 13.55 ? 112 PHE A C     1 
ATOM   849   O  O     . PHE A  1 101 ? 18.360  -27.197 15.432  1.00 13.95 ? 112 PHE A O     1 
ATOM   850   C  CB    . PHE A  1 101 ? 21.073  -27.850 17.146  1.00 11.13 ? 112 PHE A CB    1 
ATOM   851   C  CG    . PHE A  1 101 ? 20.586  -29.229 16.764  1.00 12.31 ? 112 PHE A CG    1 
ATOM   852   C  CD1   . PHE A  1 101 ? 20.991  -29.825 15.577  1.00 14.01 ? 112 PHE A CD1   1 
ATOM   853   C  CD2   . PHE A  1 101 ? 19.713  -29.929 17.588  1.00 14.35 ? 112 PHE A CD2   1 
ATOM   854   C  CE1   . PHE A  1 101 ? 20.530  -31.099 15.219  1.00 15.34 ? 112 PHE A CE1   1 
ATOM   855   C  CE2   . PHE A  1 101 ? 19.284  -31.221 17.245  1.00 16.51 ? 112 PHE A CE2   1 
ATOM   856   C  CZ    . PHE A  1 101 ? 19.672  -31.787 16.048  1.00 14.40 ? 112 PHE A CZ    1 
ATOM   857   N  N     . GLU A  1 102 ? 18.494  -25.842 17.245  1.00 12.13 ? 113 GLU A N     1 
ATOM   858   C  CA    . GLU A  1 102 ? 17.054  -25.626 17.391  1.00 12.19 ? 113 GLU A CA    1 
ATOM   859   C  C     . GLU A  1 102 ? 16.463  -24.937 16.158  1.00 14.67 ? 113 GLU A C     1 
ATOM   860   O  O     . GLU A  1 102 ? 15.377  -25.316 15.729  1.00 14.14 ? 113 GLU A O     1 
ATOM   861   C  CB    . GLU A  1 102 ? 16.730  -24.859 18.687  1.00 14.09 ? 113 GLU A CB    1 
ATOM   862   C  CG    . GLU A  1 102 ? 16.958  -25.700 19.936  1.00 25.83 ? 113 GLU A CG    1 
ATOM   863   C  CD    . GLU A  1 102 ? 16.551  -25.054 21.249  1.00 61.33 ? 113 GLU A CD    1 
ATOM   864   O  OE1   . GLU A  1 102 ? 15.382  -25.226 21.663  1.00 64.23 ? 113 GLU A OE1   1 
ATOM   865   O  OE2   . GLU A  1 102 ? 17.406  -24.382 21.871  1.00 57.86 ? 113 GLU A OE2   1 
ATOM   866   N  N     . PHE A  1 103 ? 17.198  -23.976 15.554  1.00 11.62 ? 114 PHE A N     1 
ATOM   867   C  CA    . PHE A  1 103 ? 16.748  -23.320 14.311  1.00 11.55 ? 114 PHE A CA    1 
ATOM   868   C  C     . PHE A  1 103 ? 16.621  -24.392 13.215  1.00 14.47 ? 114 PHE A C     1 
ATOM   869   O  O     . PHE A  1 103 ? 15.601  -24.450 12.521  1.00 12.17 ? 114 PHE A O     1 
ATOM   870   C  CB    . PHE A  1 103 ? 17.729  -22.213 13.884  1.00 13.33 ? 114 PHE A CB    1 
ATOM   871   C  CG    . PHE A  1 103 ? 17.485  -21.700 12.479  1.00 13.32 ? 114 PHE A CG    1 
ATOM   872   C  CD1   . PHE A  1 103 ? 18.263  -22.145 11.412  1.00 15.67 ? 114 PHE A CD1   1 
ATOM   873   C  CD2   . PHE A  1 103 ? 16.475  -20.784 12.223  1.00 14.20 ? 114 PHE A CD2   1 
ATOM   874   C  CE1   . PHE A  1 103 ? 18.021  -21.681 10.104  1.00 15.92 ? 114 PHE A CE1   1 
ATOM   875   C  CE2   . PHE A  1 103 ? 16.204  -20.358 10.912  1.00 16.65 ? 114 PHE A CE2   1 
ATOM   876   C  CZ    . PHE A  1 103 ? 16.987  -20.796 9.865   1.00 14.84 ? 114 PHE A CZ    1 
ATOM   877   N  N     . CYS A  1 104 ? 17.631  -25.285 13.107  1.00 10.69 ? 115 CYS A N     1 
ATOM   878   C  CA    . CYS A  1 104 ? 17.593  -26.395 12.151  1.00 9.35  ? 115 CYS A CA    1 
ATOM   879   C  C     . CYS A  1 104 ? 16.425  -27.314 12.416  1.00 12.23 ? 115 CYS A C     1 
ATOM   880   O  O     . CYS A  1 104 ? 15.818  -27.788 11.482  1.00 9.92  ? 115 CYS A O     1 
ATOM   881   C  CB    . CYS A  1 104 ? 18.901  -27.174 12.172  1.00 9.10  ? 115 CYS A CB    1 
ATOM   882   S  SG    . CYS A  1 104 ? 20.332  -26.208 11.651  1.00 12.63 ? 115 CYS A SG    1 
ATOM   883   N  N     . GLN A  1 105 ? 16.166  -27.632 13.697  1.00 10.64 ? 116 GLN A N     1 
ATOM   884   C  CA    . GLN A  1 105 ? 15.092  -28.550 14.077  1.00 10.11 ? 116 GLN A CA    1 
ATOM   885   C  C     . GLN A  1 105 ? 13.711  -28.025 13.687  1.00 13.46 ? 116 GLN A C     1 
ATOM   886   O  O     . GLN A  1 105 ? 12.874  -28.825 13.303  1.00 11.90 ? 116 GLN A O     1 
ATOM   887   C  CB    . GLN A  1 105 ? 15.119  -28.820 15.572  1.00 10.80 ? 116 GLN A CB    1 
ATOM   888   C  CG    . GLN A  1 105 ? 16.342  -29.582 16.064  1.00 11.39 ? 116 GLN A CG    1 
ATOM   889   C  CD    . GLN A  1 105 ? 16.171  -29.850 17.541  1.00 16.26 ? 116 GLN A CD    1 
ATOM   890   O  OE1   . GLN A  1 105 ? 16.313  -28.951 18.359  1.00 14.22 ? 116 GLN A OE1   1 
ATOM   891   N  NE2   . GLN A  1 105 ? 15.773  -31.064 17.893  1.00 14.59 ? 116 GLN A NE2   1 
ATOM   892   N  N     . LEU A  1 106 ? 13.482  -26.702 13.796  1.00 11.43 ? 117 LEU A N     1 
ATOM   893   C  CA    . LEU A  1 106 ? 12.184  -26.052 13.492  1.00 11.03 ? 117 LEU A CA    1 
ATOM   894   C  C     . LEU A  1 106 ? 12.006  -25.882 11.994  1.00 13.94 ? 117 LEU A C     1 
ATOM   895   O  O     . LEU A  1 106 ? 10.910  -26.106 11.481  1.00 12.17 ? 117 LEU A O     1 
ATOM   896   C  CB    . LEU A  1 106 ? 12.084  -24.685 14.192  1.00 10.91 ? 117 LEU A CB    1 
ATOM   897   C  CG    . LEU A  1 106 ? 11.970  -24.750 15.730  1.00 15.62 ? 117 LEU A CG    1 
ATOM   898   C  CD1   . LEU A  1 106 ? 12.080  -23.355 16.342  1.00 16.54 ? 117 LEU A CD1   1 
ATOM   899   C  CD2   . LEU A  1 106 ? 10.686  -25.467 16.165  1.00 15.93 ? 117 LEU A CD2   1 
ATOM   900   N  N     . SER A  1 107 ? 13.093  -25.490 11.292  1.00 10.89 ? 118 SER A N     1 
ATOM   901   C  CA    . SER A  1 107 ? 13.094  -25.370 9.825   1.00 10.72 ? 118 SER A CA    1 
ATOM   902   C  C     . SER A  1 107 ? 12.738  -26.754 9.249   1.00 12.90 ? 118 SER A C     1 
ATOM   903   O  O     . SER A  1 107 ? 11.842  -26.856 8.425   1.00 13.14 ? 118 SER A O     1 
ATOM   904   C  CB    . SER A  1 107 ? 14.487  -24.964 9.333   1.00 12.01 ? 118 SER A CB    1 
ATOM   905   O  OG    . SER A  1 107 ? 14.566  -25.080 7.916   1.00 12.48 ? 118 SER A OG    1 
ATOM   906   N  N     . THR A  1 108 ? 13.425  -27.808 9.705   1.00 10.23 ? 119 THR A N     1 
ATOM   907   C  CA    . THR A  1 108 ? 13.191  -29.190 9.260   1.00 10.17 ? 119 THR A CA    1 
ATOM   908   C  C     . THR A  1 108 ? 11.821  -29.724 9.659   1.00 13.05 ? 119 THR A C     1 
ATOM   909   O  O     . THR A  1 108 ? 11.154  -30.321 8.823   1.00 12.32 ? 119 THR A O     1 
ATOM   910   C  CB    . THR A  1 108 ? 14.317  -30.112 9.734   1.00 13.31 ? 119 THR A CB    1 
ATOM   911   O  OG1   . THR A  1 108 ? 15.530  -29.605 9.188   1.00 12.54 ? 119 THR A OG1   1 
ATOM   912   C  CG2   . THR A  1 108 ? 14.130  -31.574 9.297   1.00 12.72 ? 119 THR A CG2   1 
ATOM   913   N  N     . GLY A  1 109 ? 11.430  -29.506 10.914  1.00 10.85 ? 120 GLY A N     1 
ATOM   914   C  CA    . GLY A  1 109 ? 10.147  -29.982 11.442  1.00 8.51  ? 120 GLY A CA    1 
ATOM   915   C  C     . GLY A  1 109 ? 8.957   -29.538 10.623  1.00 12.03 ? 120 GLY A C     1 
ATOM   916   O  O     . GLY A  1 109 ? 8.044   -30.321 10.424  1.00 12.00 ? 120 GLY A O     1 
ATOM   917   N  N     . GLY A  1 110 ? 8.945   -28.286 10.144  1.00 8.47  ? 121 GLY A N     1 
ATOM   918   C  CA    . GLY A  1 110 ? 7.843   -27.822 9.314   1.00 8.73  ? 121 GLY A CA    1 
ATOM   919   C  C     . GLY A  1 110 ? 7.765   -28.550 7.981   1.00 12.30 ? 121 GLY A C     1 
ATOM   920   O  O     . GLY A  1 110 ? 6.678   -28.936 7.549   1.00 11.46 ? 121 GLY A O     1 
ATOM   921   N  N     . SER A  1 111 ? 8.934   -28.805 7.351   1.00 8.88  ? 122 SER A N     1 
ATOM   922   C  CA    . SER A  1 111 ? 8.970   -29.472 6.043   1.00 8.72  ? 122 SER A CA    1 
ATOM   923   C  C     . SER A  1 111 ? 8.554   -30.936 6.151   1.00 11.98 ? 122 SER A C     1 
ATOM   924   O  O     . SER A  1 111 ? 7.705   -31.408 5.376   1.00 11.08 ? 122 SER A O     1 
ATOM   925   C  CB    . SER A  1 111 ? 10.350  -29.342 5.397   1.00 10.21 ? 122 SER A CB    1 
ATOM   926   O  OG    . SER A  1 111 ? 10.662  -27.968 5.237   1.00 12.26 ? 122 SER A OG    1 
ATOM   927   N  N     . VAL A  1 112 ? 9.079   -31.619 7.161   1.00 10.29 ? 123 VAL A N     1 
ATOM   928   C  CA    . VAL A  1 112 ? 8.780   -33.035 7.378   1.00 10.36 ? 123 VAL A CA    1 
ATOM   929   C  C     . VAL A  1 112 ? 7.329   -33.216 7.804   1.00 12.45 ? 123 VAL A C     1 
ATOM   930   O  O     . VAL A  1 112 ? 6.676   -34.106 7.276   1.00 11.42 ? 123 VAL A O     1 
ATOM   931   C  CB    . VAL A  1 112 ? 9.819   -33.739 8.295   1.00 14.48 ? 123 VAL A CB    1 
ATOM   932   C  CG1   . VAL A  1 112 ? 9.326   -35.123 8.702   1.00 16.16 ? 123 VAL A CG1   1 
ATOM   933   C  CG2   . VAL A  1 112 ? 11.151  -33.883 7.561   1.00 13.46 ? 123 VAL A CG2   1 
ATOM   934   N  N     . ALA A  1 113 ? 6.821   -32.369 8.730   1.00 10.53 ? 124 ALA A N     1 
ATOM   935   C  CA    . ALA A  1 113 ? 5.418   -32.429 9.177   1.00 10.41 ? 124 ALA A CA    1 
ATOM   936   C  C     . ALA A  1 113 ? 4.457   -32.143 7.987   1.00 14.19 ? 124 ALA A C     1 
ATOM   937   O  O     . ALA A  1 113 ? 3.402   -32.772 7.851   1.00 12.63 ? 124 ALA A O     1 
ATOM   938   C  CB    . ALA A  1 113 ? 5.189   -31.444 10.298  1.00 10.92 ? 124 ALA A CB    1 
ATOM   939   N  N     . GLY A  1 114 ? 4.850   -31.216 7.137   1.00 10.83 ? 125 GLY A N     1 
ATOM   940   C  CA    . GLY A  1 114 ? 4.054   -30.891 5.951   1.00 10.67 ? 125 GLY A CA    1 
ATOM   941   C  C     . GLY A  1 114 ? 3.974   -32.058 4.991   1.00 12.99 ? 125 GLY A C     1 
ATOM   942   O  O     . GLY A  1 114 ? 2.902   -32.374 4.473   1.00 12.15 ? 125 GLY A O     1 
ATOM   943   N  N     . ALA A  1 115 ? 5.102   -32.737 4.782   1.00 12.06 ? 126 ALA A N     1 
ATOM   944   C  CA    . ALA A  1 115 ? 5.174   -33.928 3.932   1.00 11.55 ? 126 ALA A CA    1 
ATOM   945   C  C     . ALA A  1 115 ? 4.273   -35.048 4.520   1.00 14.40 ? 126 ALA A C     1 
ATOM   946   O  O     . ALA A  1 115 ? 3.552   -35.718 3.775   1.00 12.76 ? 126 ALA A O     1 
ATOM   947   C  CB    . ALA A  1 115 ? 6.617   -34.408 3.845   1.00 11.66 ? 126 ALA A CB    1 
ATOM   948   N  N     . VAL A  1 116 ? 4.349   -35.274 5.855   1.00 10.21 ? 127 VAL A N     1 
ATOM   949   C  CA    . VAL A  1 116 ? 3.512   -36.309 6.518   1.00 9.86  ? 127 VAL A CA    1 
ATOM   950   C  C     . VAL A  1 116 ? 2.027   -35.993 6.280   1.00 12.75 ? 127 VAL A C     1 
ATOM   951   O  O     . VAL A  1 116 ? 1.251   -36.882 5.930   1.00 12.60 ? 127 VAL A O     1 
ATOM   952   C  CB    . VAL A  1 116 ? 3.847   -36.464 8.036   1.00 13.54 ? 127 VAL A CB    1 
ATOM   953   C  CG1   . VAL A  1 116 ? 2.840   -37.392 8.756   1.00 13.74 ? 127 VAL A CG1   1 
ATOM   954   C  CG2   . VAL A  1 116 ? 5.273   -36.974 8.230   1.00 13.03 ? 127 VAL A CG2   1 
ATOM   955   N  N     . LYS A  1 117 ? 1.648   -34.724 6.455   1.00 9.88  ? 128 LYS A N     1 
ATOM   956   C  CA    . LYS A  1 117 ? 0.270   -34.246 6.287   1.00 10.03 ? 128 LYS A CA    1 
ATOM   957   C  C     . LYS A  1 117 ? -0.252  -34.519 4.853   1.00 13.32 ? 128 LYS A C     1 
ATOM   958   O  O     . LYS A  1 117 ? -1.387  -34.993 4.679   1.00 12.97 ? 128 LYS A O     1 
ATOM   959   C  CB    . LYS A  1 117 ? 0.204   -32.737 6.636   1.00 12.33 ? 128 LYS A CB    1 
ATOM   960   C  CG    . LYS A  1 117 ? -1.198  -32.232 6.957   1.00 18.62 ? 128 LYS A CG    1 
ATOM   961   C  CD    . LYS A  1 117 ? -1.688  -32.628 8.333   1.00 13.84 ? 128 LYS A CD    1 
ATOM   962   C  CE    . LYS A  1 117 ? -3.064  -32.038 8.551   1.00 22.73 ? 128 LYS A CE    1 
ATOM   963   N  NZ    . LYS A  1 117 ? -3.759  -32.674 9.715   1.00 26.31 ? 128 LYS A NZ    1 
ATOM   964   N  N     . LEU A  1 118 ? 0.603   -34.290 3.842   1.00 8.89  ? 129 LEU A N     1 
ATOM   965   C  CA    . LEU A  1 118 ? 0.285   -34.552 2.426   1.00 8.13  ? 129 LEU A CA    1 
ATOM   966   C  C     . LEU A  1 118 ? 0.141   -36.046 2.147   1.00 13.62 ? 129 LEU A C     1 
ATOM   967   O  O     . LEU A  1 118 ? -0.778  -36.445 1.432   1.00 14.05 ? 129 LEU A O     1 
ATOM   968   C  CB    . LEU A  1 118 ? 1.382   -33.956 1.524   1.00 8.12  ? 129 LEU A CB    1 
ATOM   969   C  CG    . LEU A  1 118 ? 1.404   -32.428 1.468   1.00 10.40 ? 129 LEU A CG    1 
ATOM   970   C  CD1   . LEU A  1 118 ? 2.775   -31.935 0.983   1.00 11.08 ? 129 LEU A CD1   1 
ATOM   971   C  CD2   . LEU A  1 118 ? 0.279   -31.919 0.592   1.00 12.77 ? 129 LEU A CD2   1 
ATOM   972   N  N     . ASN A  1 119 ? 1.048   -36.861 2.709   1.00 11.97 ? 130 ASN A N     1 
ATOM   973   C  CA    . ASN A  1 119 ? 1.054   -38.332 2.594   1.00 12.71 ? 130 ASN A CA    1 
ATOM   974   C  C     . ASN A  1 119 ? -0.223  -38.939 3.163   1.00 17.51 ? 130 ASN A C     1 
ATOM   975   O  O     . ASN A  1 119 ? -0.763  -39.889 2.591   1.00 14.78 ? 130 ASN A O     1 
ATOM   976   C  CB    . ASN A  1 119 ? 2.275   -38.927 3.323   1.00 13.04 ? 130 ASN A CB    1 
ATOM   977   C  CG    . ASN A  1 119 ? 3.555   -38.926 2.517   1.00 20.27 ? 130 ASN A CG    1 
ATOM   978   O  OD1   . ASN A  1 119 ? 3.542   -38.757 1.296   1.00 17.54 ? 130 ASN A OD1   1 
ATOM   979   N  ND2   . ASN A  1 119 ? 4.683   -39.161 3.189   1.00 10.76 ? 130 ASN A ND2   1 
ATOM   980   N  N     . ARG A  1 120 ? -0.713  -38.372 4.281   1.00 14.67 ? 131 ARG A N     1 
ATOM   981   C  CA    . ARG A  1 120 ? -1.934  -38.828 4.956   1.00 14.22 ? 131 ARG A CA    1 
ATOM   982   C  C     . ARG A  1 120 ? -3.182  -38.378 4.235   1.00 19.01 ? 131 ARG A C     1 
ATOM   983   O  O     . ARG A  1 120 ? -4.283  -38.790 4.592   1.00 18.95 ? 131 ARG A O     1 
ATOM   984   C  CB    . ARG A  1 120 ? -1.946  -38.351 6.417   1.00 13.01 ? 131 ARG A CB    1 
ATOM   985   C  CG    . ARG A  1 120 ? -0.880  -39.063 7.244   1.00 18.67 ? 131 ARG A CG    1 
ATOM   986   C  CD    . ARG A  1 120 ? -0.819  -38.514 8.645   1.00 21.08 ? 131 ARG A CD    1 
ATOM   987   N  NE    . ARG A  1 120 ? -1.934  -38.984 9.465   1.00 23.08 ? 131 ARG A NE    1 
ATOM   988   C  CZ    . ARG A  1 120 ? -2.262  -38.466 10.647  1.00 39.40 ? 131 ARG A CZ    1 
ATOM   989   N  NH1   . ARG A  1 120 ? -3.271  -38.976 11.344  1.00 25.12 ? 131 ARG A NH1   1 
ATOM   990   N  NH2   . ARG A  1 120 ? -1.576  -37.438 11.144  1.00 20.47 ? 131 ARG A NH2   1 
ATOM   991   N  N     . GLN A  1 121 ? -3.011  -37.549 3.200   1.00 14.10 ? 132 GLN A N     1 
ATOM   992   C  CA    . GLN A  1 121 ? -4.084  -36.971 2.389   1.00 14.74 ? 132 GLN A CA    1 
ATOM   993   C  C     . GLN A  1 121 ? -4.955  -36.092 3.280   1.00 20.44 ? 132 GLN A C     1 
ATOM   994   O  O     . GLN A  1 121 ? -6.162  -36.054 3.121   1.00 20.01 ? 132 GLN A O     1 
ATOM   995   C  CB    . GLN A  1 121 ? -4.876  -38.054 1.600   1.00 16.25 ? 132 GLN A CB    1 
ATOM   996   C  CG    . GLN A  1 121 ? -3.956  -38.944 0.731   1.00 21.57 ? 132 GLN A CG    1 
ATOM   997   C  CD    . GLN A  1 121 ? -4.662  -40.029 -0.071  1.00 39.62 ? 132 GLN A CD    1 
ATOM   998   O  OE1   . GLN A  1 121 ? -5.881  -40.116 -0.130  1.00 35.12 ? 132 GLN A OE1   1 
ATOM   999   N  NE2   . GLN A  1 121 ? -3.898  -40.858 -0.748  1.00 36.45 ? 132 GLN A NE2   1 
ATOM   1000  N  N     . GLN A  1 122 ? -4.322  -35.399 4.253   1.00 16.82 ? 133 GLN A N     1 
ATOM   1001  C  CA    . GLN A  1 122 ? -5.050  -34.510 5.151   1.00 16.56 ? 133 GLN A CA    1 
ATOM   1002  C  C     . GLN A  1 122 ? -4.972  -33.047 4.752   1.00 17.64 ? 133 GLN A C     1 
ATOM   1003  O  O     . GLN A  1 122 ? -5.573  -32.206 5.399   1.00 16.77 ? 133 GLN A O     1 
ATOM   1004  C  CB    . GLN A  1 122 ? -4.664  -34.727 6.612   1.00 17.25 ? 133 GLN A CB    1 
ATOM   1005  C  CG    . GLN A  1 122 ? -5.298  -35.970 7.217   1.00 25.04 ? 133 GLN A CG    1 
ATOM   1006  C  CD    . GLN A  1 122 ? -4.682  -36.324 8.545   1.00 34.72 ? 133 GLN A CD    1 
ATOM   1007  O  OE1   . GLN A  1 122 ? -3.911  -35.563 9.139   1.00 30.53 ? 133 GLN A OE1   1 
ATOM   1008  N  NE2   . GLN A  1 122 ? -5.046  -37.474 9.057   1.00 28.93 ? 133 GLN A NE2   1 
ATOM   1009  N  N     . THR A  1 123 ? -4.248  -32.748 3.682   1.00 13.74 ? 134 THR A N     1 
ATOM   1010  C  CA    . THR A  1 123 ? -4.152  -31.399 3.136   1.00 13.46 ? 134 THR A CA    1 
ATOM   1011  C  C     . THR A  1 123 ? -3.822  -31.525 1.641   1.00 16.57 ? 134 THR A C     1 
ATOM   1012  O  O     . THR A  1 123 ? -3.289  -32.556 1.214   1.00 15.98 ? 134 THR A O     1 
ATOM   1013  C  CB    . THR A  1 123 ? -3.101  -30.541 3.904   1.00 13.65 ? 134 THR A CB    1 
ATOM   1014  O  OG1   . THR A  1 123 ? -3.269  -29.166 3.528   1.00 13.45 ? 134 THR A OG1   1 
ATOM   1015  C  CG2   . THR A  1 123 ? -1.625  -31.009 3.665   1.00 10.14 ? 134 THR A CG2   1 
ATOM   1016  N  N     . ASP A  1 124 ? -4.122  -30.481 0.869   1.00 12.40 ? 135 ASP A N     1 
ATOM   1017  C  CA    . ASP A  1 124 ? -3.750  -30.432 -0.546  1.00 12.99 ? 135 ASP A CA    1 
ATOM   1018  C  C     . ASP A  1 124 ? -2.402  -29.758 -0.660  1.00 17.35 ? 135 ASP A C     1 
ATOM   1019  O  O     . ASP A  1 124 ? -1.595  -30.106 -1.529  1.00 17.94 ? 135 ASP A O     1 
ATOM   1020  C  CB    . ASP A  1 124 ? -4.782  -29.626 -1.330  1.00 14.88 ? 135 ASP A CB    1 
ATOM   1021  C  CG    . ASP A  1 124 ? -6.128  -30.298 -1.349  1.00 21.25 ? 135 ASP A CG    1 
ATOM   1022  O  OD1   . ASP A  1 124 ? -7.097  -29.685 -0.869  1.00 20.28 ? 135 ASP A OD1   1 
ATOM   1023  O  OD2   . ASP A  1 124 ? -6.193  -31.475 -1.761  1.00 22.55 ? 135 ASP A OD2   1 
ATOM   1024  N  N     . MET A  1 125 ? -2.180  -28.756 0.202   1.00 12.40 ? 136 MET A N     1 
ATOM   1025  C  CA    . MET A  1 125 ? -0.954  -27.995 0.237   1.00 12.80 ? 136 MET A CA    1 
ATOM   1026  C  C     . MET A  1 125 ? -0.388  -27.862 1.651   1.00 13.50 ? 136 MET A C     1 
ATOM   1027  O  O     . MET A  1 125 ? -1.148  -27.775 2.612   1.00 11.86 ? 136 MET A O     1 
ATOM   1028  C  CB    . MET A  1 125 ? -1.187  -26.608 -0.345  1.00 16.18 ? 136 MET A CB    1 
ATOM   1029  C  CG    . MET A  1 125 ? -1.029  -26.600 -1.859  1.00 21.77 ? 136 MET A CG    1 
ATOM   1030  S  SD    . MET A  1 125 ? -1.551  -25.030 -2.539  1.00 27.05 ? 136 MET A SD    1 
ATOM   1031  C  CE    . MET A  1 125 ? -3.198  -25.249 -2.458  1.00 23.79 ? 136 MET A CE    1 
ATOM   1032  N  N     . ALA A  1 126 ? 0.938   -27.903 1.773   1.00 9.06  ? 137 ALA A N     1 
ATOM   1033  C  CA    . ALA A  1 126 ? 1.596   -27.653 3.069   1.00 8.90  ? 137 ALA A CA    1 
ATOM   1034  C  C     . ALA A  1 126 ? 2.597   -26.523 2.822   1.00 11.37 ? 137 ALA A C     1 
ATOM   1035  O  O     . ALA A  1 126 ? 3.253   -26.500 1.760   1.00 11.22 ? 137 ALA A O     1 
ATOM   1036  C  CB    . ALA A  1 126 ? 2.290   -28.893 3.569   1.00 9.74  ? 137 ALA A CB    1 
ATOM   1037  N  N     . VAL A  1 127 ? 2.661   -25.550 3.732   1.00 8.60  ? 138 VAL A N     1 
ATOM   1038  C  CA    . VAL A  1 127 ? 3.525   -24.372 3.558   1.00 7.68  ? 138 VAL A CA    1 
ATOM   1039  C  C     . VAL A  1 127 ? 4.494   -24.272 4.749   1.00 11.85 ? 138 VAL A C     1 
ATOM   1040  O  O     . VAL A  1 127 ? 4.044   -24.305 5.909   1.00 11.85 ? 138 VAL A O     1 
ATOM   1041  C  CB    . VAL A  1 127 ? 2.702   -23.061 3.411   1.00 10.80 ? 138 VAL A CB    1 
ATOM   1042  C  CG1   . VAL A  1 127 ? 3.627   -21.864 3.194   1.00 8.83  ? 138 VAL A CG1   1 
ATOM   1043  C  CG2   . VAL A  1 127 ? 1.674   -23.145 2.277   1.00 10.96 ? 138 VAL A CG2   1 
ATOM   1044  N  N     . ASN A  1 128 ? 5.804   -24.141 4.463   1.00 8.49  ? 139 ASN A N     1 
ATOM   1045  C  CA    . ASN A  1 128 ? 6.824   -23.966 5.494   1.00 8.25  ? 139 ASN A CA    1 
ATOM   1046  C  C     . ASN A  1 128 ? 7.844   -22.928 5.033   1.00 10.77 ? 139 ASN A C     1 
ATOM   1047  O  O     . ASN A  1 128 ? 8.861   -23.301 4.463   1.00 9.57  ? 139 ASN A O     1 
ATOM   1048  C  CB    . ASN A  1 128 ? 7.549   -25.274 5.893   1.00 8.28  ? 139 ASN A CB    1 
ATOM   1049  C  CG    . ASN A  1 128 ? 8.649   -25.046 6.917   1.00 9.75  ? 139 ASN A CG    1 
ATOM   1050  O  OD1   . ASN A  1 128 ? 8.542   -24.181 7.790   1.00 9.55  ? 139 ASN A OD1   1 
ATOM   1051  N  ND2   . ASN A  1 128 ? 9.730   -25.829 6.866   1.00 7.54  ? 139 ASN A ND2   1 
ATOM   1052  N  N     . TRP A  1 129 ? 7.584   -21.644 5.303   1.00 8.38  ? 140 TRP A N     1 
ATOM   1053  C  CA    . TRP A  1 129 ? 8.493   -20.560 4.909   1.00 8.40  ? 140 TRP A CA    1 
ATOM   1054  C  C     . TRP A  1 129 ? 9.864   -20.602 5.611   1.00 11.56 ? 140 TRP A C     1 
ATOM   1055  O  O     . TRP A  1 129 ? 10.826  -20.046 5.075   1.00 10.86 ? 140 TRP A O     1 
ATOM   1056  C  CB    . TRP A  1 129 ? 7.820   -19.183 5.065   1.00 8.11  ? 140 TRP A CB    1 
ATOM   1057  C  CG    . TRP A  1 129 ? 6.594   -18.993 4.216   1.00 9.40  ? 140 TRP A CG    1 
ATOM   1058  C  CD1   . TRP A  1 129 ? 5.380   -18.540 4.636   1.00 11.82 ? 140 TRP A CD1   1 
ATOM   1059  C  CD2   . TRP A  1 129 ? 6.464   -19.250 2.805   1.00 9.57  ? 140 TRP A CD2   1 
ATOM   1060  N  NE1   . TRP A  1 129 ? 4.514   -18.449 3.569   1.00 11.15 ? 140 TRP A NE1   1 
ATOM   1061  C  CE2   . TRP A  1 129 ? 5.146   -18.896 2.436   1.00 12.92 ? 140 TRP A CE2   1 
ATOM   1062  C  CE3   . TRP A  1 129 ? 7.349   -19.715 1.805   1.00 11.31 ? 140 TRP A CE3   1 
ATOM   1063  C  CZ2   . TRP A  1 129 ? 4.671   -19.028 1.122   1.00 12.47 ? 140 TRP A CZ2   1 
ATOM   1064  C  CZ3   . TRP A  1 129 ? 6.882   -19.843 0.502   1.00 12.98 ? 140 TRP A CZ3   1 
ATOM   1065  C  CH2   . TRP A  1 129 ? 5.566   -19.475 0.161   1.00 13.59 ? 140 TRP A CH2   1 
ATOM   1066  N  N     . ALA A  1 130 ? 9.975   -21.307 6.764   1.00 7.61  ? 141 ALA A N     1 
ATOM   1067  C  CA    . ALA A  1 130 ? 11.266  -21.481 7.456   1.00 8.31  ? 141 ALA A CA    1 
ATOM   1068  C  C     . ALA A  1 130 ? 12.166  -22.557 6.774   1.00 13.55 ? 141 ALA A C     1 
ATOM   1069  O  O     . ALA A  1 130 ? 13.337  -22.697 7.131   1.00 13.48 ? 141 ALA A O     1 
ATOM   1070  C  CB    . ALA A  1 130 ? 11.044  -21.832 8.931   1.00 8.73  ? 141 ALA A CB    1 
ATOM   1071  N  N     . GLY A  1 131 ? 11.591  -23.328 5.847   1.00 11.03 ? 142 GLY A N     1 
ATOM   1072  C  CA    . GLY A  1 131 ? 12.301  -24.371 5.111   1.00 10.26 ? 142 GLY A CA    1 
ATOM   1073  C  C     . GLY A  1 131 ? 12.852  -23.896 3.771   1.00 12.31 ? 142 GLY A C     1 
ATOM   1074  O  O     . GLY A  1 131 ? 12.996  -22.694 3.545   1.00 11.31 ? 142 GLY A O     1 
ATOM   1075  N  N     . GLY A  1 132 ? 13.178  -24.847 2.898   1.00 9.81  ? 143 GLY A N     1 
ATOM   1076  C  CA    . GLY A  1 132 ? 13.734  -24.587 1.576   1.00 9.46  ? 143 GLY A CA    1 
ATOM   1077  C  C     . GLY A  1 132 ? 15.236  -24.352 1.558   1.00 13.02 ? 143 GLY A C     1 
ATOM   1078  O  O     . GLY A  1 132 ? 15.762  -23.765 0.609   1.00 12.13 ? 143 GLY A O     1 
ATOM   1079  N  N     . LEU A  1 133 ? 15.951  -24.874 2.557   1.00 9.36  ? 144 LEU A N     1 
ATOM   1080  C  CA    . LEU A  1 133 ? 17.389  -24.639 2.713   1.00 9.12  ? 144 LEU A CA    1 
ATOM   1081  C  C     . LEU A  1 133 ? 18.180  -25.647 1.863   1.00 12.96 ? 144 LEU A C     1 
ATOM   1082  O  O     . LEU A  1 133 ? 18.848  -26.548 2.363   1.00 11.44 ? 144 LEU A O     1 
ATOM   1083  C  CB    . LEU A  1 133 ? 17.734  -24.619 4.237   1.00 8.65  ? 144 LEU A CB    1 
ATOM   1084  C  CG    . LEU A  1 133 ? 16.957  -23.531 5.048   1.00 11.29 ? 144 LEU A CG    1 
ATOM   1085  C  CD1   . LEU A  1 133 ? 17.556  -23.349 6.488   1.00 11.18 ? 144 LEU A CD1   1 
ATOM   1086  C  CD2   . LEU A  1 133 ? 16.965  -22.152 4.326   1.00 12.99 ? 144 LEU A CD2   1 
ATOM   1087  N  N     . HIS A  1 134 ? 18.072  -25.438 0.535   1.00 9.38  ? 145 HIS A N     1 
ATOM   1088  C  CA    . HIS A  1 134 ? 18.495  -26.322 -0.558  1.00 8.19  ? 145 HIS A CA    1 
ATOM   1089  C  C     . HIS A  1 134 ? 19.956  -26.676 -0.714  1.00 12.70 ? 145 HIS A C     1 
ATOM   1090  O  O     . HIS A  1 134 ? 20.235  -27.619 -1.452  1.00 12.46 ? 145 HIS A O     1 
ATOM   1091  C  CB    . HIS A  1 134 ? 17.933  -25.814 -1.909  1.00 7.21  ? 145 HIS A CB    1 
ATOM   1092  C  CG    . HIS A  1 134 ? 18.320  -24.418 -2.313  1.00 9.21  ? 145 HIS A CG    1 
ATOM   1093  N  ND1   . HIS A  1 134 ? 17.975  -23.924 -3.560  1.00 10.22 ? 145 HIS A ND1   1 
ATOM   1094  C  CD2   . HIS A  1 134 ? 18.938  -23.433 -1.615  1.00 10.69 ? 145 HIS A CD2   1 
ATOM   1095  C  CE1   . HIS A  1 134 ? 18.431  -22.681 -3.596  1.00 10.14 ? 145 HIS A CE1   1 
ATOM   1096  N  NE2   . HIS A  1 134 ? 19.034  -22.349 -2.449  1.00 10.72 ? 145 HIS A NE2   1 
ATOM   1097  N  N     . HIS A  1 135 ? 20.882  -25.939 -0.067  1.00 9.94  ? 146 HIS A N     1 
ATOM   1098  C  CA    . HIS A  1 135 ? 22.327  -26.202 -0.242  1.00 10.09 ? 146 HIS A CA    1 
ATOM   1099  C  C     . HIS A  1 135 ? 22.935  -27.232 0.691   1.00 14.30 ? 146 HIS A C     1 
ATOM   1100  O  O     . HIS A  1 135 ? 24.024  -27.723 0.394   1.00 14.65 ? 146 HIS A O     1 
ATOM   1101  C  CB    . HIS A  1 135 ? 23.144  -24.909 -0.093  1.00 9.58  ? 146 HIS A CB    1 
ATOM   1102  C  CG    . HIS A  1 135 ? 22.780  -23.838 -1.058  1.00 12.12 ? 146 HIS A CG    1 
ATOM   1103  N  ND1   . HIS A  1 135 ? 22.873  -24.035 -2.426  1.00 12.87 ? 146 HIS A ND1   1 
ATOM   1104  C  CD2   . HIS A  1 135 ? 22.355  -22.573 -0.817  1.00 12.87 ? 146 HIS A CD2   1 
ATOM   1105  C  CE1   . HIS A  1 135 ? 22.487  -22.885 -2.974  1.00 12.39 ? 146 HIS A CE1   1 
ATOM   1106  N  NE2   . HIS A  1 135 ? 22.171  -21.978 -2.045  1.00 12.49 ? 146 HIS A NE2   1 
ATOM   1107  N  N     . ALA A  1 136 ? 22.310  -27.502 1.857   1.00 10.73 ? 147 ALA A N     1 
ATOM   1108  C  CA    . ALA A  1 136 ? 22.910  -28.445 2.809   1.00 11.26 ? 147 ALA A CA    1 
ATOM   1109  C  C     . ALA A  1 136 ? 23.117  -29.831 2.200   1.00 14.40 ? 147 ALA A C     1 
ATOM   1110  O  O     . ALA A  1 136 ? 22.254  -30.339 1.494   1.00 14.09 ? 147 ALA A O     1 
ATOM   1111  C  CB    . ALA A  1 136 ? 22.086  -28.522 4.091   1.00 12.65 ? 147 ALA A CB    1 
ATOM   1112  N  N     . LYS A  1 137 ? 24.299  -30.418 2.463   1.00 13.00 ? 148 LYS A N     1 
ATOM   1113  C  CA    . LYS A  1 137 ? 24.700  -31.719 1.938   1.00 13.05 ? 148 LYS A CA    1 
ATOM   1114  C  C     . LYS A  1 137 ? 24.718  -32.746 3.048   1.00 16.20 ? 148 LYS A C     1 
ATOM   1115  O  O     . LYS A  1 137 ? 24.663  -32.389 4.217   1.00 14.70 ? 148 LYS A O     1 
ATOM   1116  C  CB    . LYS A  1 137 ? 26.119  -31.619 1.335   1.00 16.97 ? 148 LYS A CB    1 
ATOM   1117  C  CG    . LYS A  1 137 ? 26.342  -30.429 0.399   1.00 25.44 ? 148 LYS A CG    1 
ATOM   1118  C  CD    A LYS A  1 137 ? 25.717  -30.632 -0.975  0.85 24.91 ? 148 LYS A CD    1 
ATOM   1119  C  CE    A LYS A  1 137 ? 26.262  -29.653 -2.001  0.85 22.16 ? 148 LYS A CE    1 
ATOM   1120  N  NZ    A LYS A  1 137 ? 25.989  -28.238 -1.620  0.85 25.04 ? 148 LYS A NZ    1 
ATOM   1121  N  N     . LYS A  1 138 ? 24.892  -34.021 2.687   1.00 13.49 ? 149 LYS A N     1 
ATOM   1122  C  CA    . LYS A  1 138 ? 24.925  -35.141 3.629   1.00 13.63 ? 149 LYS A CA    1 
ATOM   1123  C  C     . LYS A  1 138 ? 25.798  -34.837 4.841   1.00 17.39 ? 149 LYS A C     1 
ATOM   1124  O  O     . LYS A  1 138 ? 25.350  -34.995 5.971   1.00 15.05 ? 149 LYS A O     1 
ATOM   1125  C  CB    . LYS A  1 138 ? 25.393  -36.429 2.908   1.00 16.26 ? 149 LYS A CB    1 
ATOM   1126  C  CG    . LYS A  1 138 ? 25.293  -37.686 3.784   1.00 25.15 ? 149 LYS A CG    1 
ATOM   1127  C  CD    . LYS A  1 138 ? 25.498  -39.002 3.012   1.00 31.61 ? 149 LYS A CD    1 
ATOM   1128  C  CE    . LYS A  1 138 ? 24.351  -39.354 2.065   1.00 49.62 ? 149 LYS A CE    1 
ATOM   1129  N  NZ    . LYS A  1 138 ? 23.097  -39.784 2.764   1.00 49.59 ? 149 LYS A NZ    1 
ATOM   1130  N  N     . SER A  1 139 ? 27.026  -34.346 4.620   1.00 15.89 ? 150 SER A N     1 
ATOM   1131  C  CA    . SER A  1 139 ? 27.914  -34.059 5.750   1.00 15.80 ? 150 SER A CA    1 
ATOM   1132  C  C     . SER A  1 139 ? 28.542  -32.685 5.695   1.00 20.16 ? 150 SER A C     1 
ATOM   1133  O  O     . SER A  1 139 ? 29.679  -32.512 6.133   1.00 19.61 ? 150 SER A O     1 
ATOM   1134  C  CB    . SER A  1 139 ? 28.997  -35.129 5.847   1.00 16.75 ? 150 SER A CB    1 
ATOM   1135  O  OG    . SER A  1 139 ? 28.358  -36.369 6.065   1.00 24.68 ? 150 SER A OG    1 
ATOM   1136  N  N     . GLU A  1 140 ? 27.804  -31.694 5.187   1.00 16.81 ? 151 GLU A N     1 
ATOM   1137  C  CA    . GLU A  1 140 ? 28.385  -30.372 5.062   1.00 16.94 ? 151 GLU A CA    1 
ATOM   1138  C  C     . GLU A  1 140 ? 27.322  -29.275 5.050   1.00 17.51 ? 151 GLU A C     1 
ATOM   1139  O  O     . GLU A  1 140 ? 26.350  -29.398 4.302   1.00 15.91 ? 151 GLU A O     1 
ATOM   1140  C  CB    . GLU A  1 140 ? 29.143  -30.346 3.706   1.00 18.90 ? 151 GLU A CB    1 
ATOM   1141  C  CG    . GLU A  1 140 ? 30.003  -29.135 3.471   1.00 31.51 ? 151 GLU A CG    1 
ATOM   1142  C  CD    . GLU A  1 140 ? 30.479  -29.064 2.039   1.00 45.11 ? 151 GLU A CD    1 
ATOM   1143  O  OE1   . GLU A  1 140 ? 29.767  -28.481 1.191   1.00 44.00 ? 151 GLU A OE1   1 
ATOM   1144  O  OE2   . GLU A  1 140 ? 31.522  -29.682 1.749   1.00 34.68 ? 151 GLU A OE2   1 
ATOM   1145  N  N     . ALA A  1 141 ? 27.561  -28.167 5.786   1.00 14.33 ? 152 ALA A N     1 
ATOM   1146  C  CA    . ALA A  1 141 ? 26.717  -26.980 5.706   1.00 13.30 ? 152 ALA A CA    1 
ATOM   1147  C  C     . ALA A  1 141 ? 27.160  -26.235 4.429   1.00 17.25 ? 152 ALA A C     1 
ATOM   1148  O  O     . ALA A  1 141 ? 28.295  -26.404 3.983   1.00 15.53 ? 152 ALA A O     1 
ATOM   1149  C  CB    . ALA A  1 141 ? 26.937  -26.072 6.904   1.00 14.04 ? 152 ALA A CB    1 
ATOM   1150  N  N     . SER A  1 142 ? 26.286  -25.388 3.876   1.00 14.40 ? 153 SER A N     1 
ATOM   1151  C  CA    . SER A  1 142 ? 26.631  -24.581 2.702   1.00 13.58 ? 153 SER A CA    1 
ATOM   1152  C  C     . SER A  1 142 ? 25.600  -23.481 2.494   1.00 13.51 ? 153 SER A C     1 
ATOM   1153  O  O     . SER A  1 142 ? 24.414  -23.733 2.705   1.00 11.19 ? 153 SER A O     1 
ATOM   1154  C  CB    . SER A  1 142 ? 26.672  -25.464 1.448   1.00 16.05 ? 153 SER A CB    1 
ATOM   1155  O  OG    . SER A  1 142 ? 26.934  -24.659 0.316   1.00 24.02 ? 153 SER A OG    1 
ATOM   1156  N  N     . GLY A  1 143 ? 26.052  -22.300 2.043   1.00 10.24 ? 154 GLY A N     1 
ATOM   1157  C  CA    . GLY A  1 143 ? 25.182  -21.192 1.645   1.00 10.77 ? 154 GLY A CA    1 
ATOM   1158  C  C     . GLY A  1 143 ? 24.065  -20.834 2.606   1.00 13.85 ? 154 GLY A C     1 
ATOM   1159  O  O     . GLY A  1 143 ? 22.907  -20.668 2.195   1.00 13.10 ? 154 GLY A O     1 
ATOM   1160  N  N     . PHE A  1 144 ? 24.411  -20.759 3.908   1.00 11.81 ? 155 PHE A N     1 
ATOM   1161  C  CA    . PHE A  1 144 ? 23.510  -20.392 5.015   1.00 10.71 ? 155 PHE A CA    1 
ATOM   1162  C  C     . PHE A  1 144 ? 22.552  -21.534 5.432   1.00 14.31 ? 155 PHE A C     1 
ATOM   1163  O  O     . PHE A  1 144 ? 21.709  -21.342 6.320   1.00 13.47 ? 155 PHE A O     1 
ATOM   1164  C  CB    . PHE A  1 144 ? 22.721  -19.089 4.686   1.00 11.04 ? 155 PHE A CB    1 
ATOM   1165  C  CG    . PHE A  1 144 ? 23.449  -17.929 3.999   1.00 11.54 ? 155 PHE A CG    1 
ATOM   1166  C  CD1   . PHE A  1 144 ? 24.832  -17.761 4.137   1.00 13.32 ? 155 PHE A CD1   1 
ATOM   1167  C  CD2   . PHE A  1 144 ? 22.739  -16.967 3.287   1.00 10.64 ? 155 PHE A CD2   1 
ATOM   1168  C  CE1   . PHE A  1 144 ? 25.487  -16.666 3.552   1.00 14.26 ? 155 PHE A CE1   1 
ATOM   1169  C  CE2   . PHE A  1 144 ? 23.386  -15.854 2.733   1.00 13.54 ? 155 PHE A CE2   1 
ATOM   1170  C  CZ    . PHE A  1 144 ? 24.759  -15.712 2.868   1.00 12.51 ? 155 PHE A CZ    1 
ATOM   1171  N  N     . CYS A  1 145 ? 22.697  -22.715 4.810   1.00 11.31 ? 156 CYS A N     1 
ATOM   1172  C  CA    . CYS A  1 145 ? 21.863  -23.920 5.046   1.00 10.05 ? 156 CYS A CA    1 
ATOM   1173  C  C     . CYS A  1 145 ? 22.702  -24.928 5.810   1.00 15.86 ? 156 CYS A C     1 
ATOM   1174  O  O     . CYS A  1 145 ? 23.847  -25.182 5.419   1.00 16.30 ? 156 CYS A O     1 
ATOM   1175  C  CB    . CYS A  1 145 ? 21.409  -24.519 3.714   1.00 10.30 ? 156 CYS A CB    1 
ATOM   1176  S  SG    . CYS A  1 145 ? 20.657  -23.327 2.581   1.00 12.92 ? 156 CYS A SG    1 
ATOM   1177  N  N     . TYR A  1 146 ? 22.115  -25.576 6.837   1.00 10.40 ? 157 TYR A N     1 
ATOM   1178  C  CA    . TYR A  1 146 ? 22.841  -26.566 7.636   1.00 11.03 ? 157 TYR A CA    1 
ATOM   1179  C  C     . TYR A  1 146 ? 22.195  -27.931 7.526   1.00 15.31 ? 157 TYR A C     1 
ATOM   1180  O  O     . TYR A  1 146 ? 22.903  -28.930 7.375   1.00 15.73 ? 157 TYR A O     1 
ATOM   1181  C  CB    . TYR A  1 146 ? 22.908  -26.157 9.115   1.00 11.49 ? 157 TYR A CB    1 
ATOM   1182  C  CG    . TYR A  1 146 ? 23.459  -24.767 9.356   1.00 11.75 ? 157 TYR A CG    1 
ATOM   1183  C  CD1   . TYR A  1 146 ? 22.648  -23.641 9.216   1.00 12.42 ? 157 TYR A CD1   1 
ATOM   1184  C  CD2   . TYR A  1 146 ? 24.733  -24.585 9.891   1.00 11.26 ? 157 TYR A CD2   1 
ATOM   1185  C  CE1   . TYR A  1 146 ? 23.139  -22.361 9.457   1.00 12.92 ? 157 TYR A CE1   1 
ATOM   1186  C  CE2   . TYR A  1 146 ? 25.229  -23.309 10.160  1.00 10.41 ? 157 TYR A CE2   1 
ATOM   1187  C  CZ    . TYR A  1 146 ? 24.425  -22.200 9.939   1.00 15.22 ? 157 TYR A CZ    1 
ATOM   1188  O  OH    . TYR A  1 146 ? 24.863  -20.936 10.219  1.00 12.30 ? 157 TYR A OH    1 
ATOM   1189  N  N     . VAL A  1 147 ? 20.851  -27.980 7.566   1.00 10.51 ? 158 VAL A N     1 
ATOM   1190  C  CA    . VAL A  1 147 ? 20.127  -29.248 7.475   1.00 9.45  ? 158 VAL A CA    1 
ATOM   1191  C  C     . VAL A  1 147 ? 19.212  -29.119 6.275   1.00 11.80 ? 158 VAL A C     1 
ATOM   1192  O  O     . VAL A  1 147 ? 18.485  -28.122 6.156   1.00 11.55 ? 158 VAL A O     1 
ATOM   1193  C  CB    . VAL A  1 147 ? 19.369  -29.604 8.791   1.00 11.00 ? 158 VAL A CB    1 
ATOM   1194  C  CG1   . VAL A  1 147 ? 18.514  -30.847 8.620   1.00 10.81 ? 158 VAL A CG1   1 
ATOM   1195  C  CG2   . VAL A  1 147 ? 20.346  -29.814 9.943   1.00 11.31 ? 158 VAL A CG2   1 
ATOM   1196  N  N     . ASN A  1 148 ? 19.263  -30.114 5.372   1.00 8.87  ? 159 ASN A N     1 
ATOM   1197  C  CA    . ASN A  1 148 ? 18.497  -30.039 4.142   1.00 7.96  ? 159 ASN A CA    1 
ATOM   1198  C  C     . ASN A  1 148 ? 17.099  -30.520 4.386   1.00 10.81 ? 159 ASN A C     1 
ATOM   1199  O  O     . ASN A  1 148 ? 16.815  -31.684 4.193   1.00 11.11 ? 159 ASN A O     1 
ATOM   1200  C  CB    . ASN A  1 148 ? 19.191  -30.771 2.979   1.00 9.26  ? 159 ASN A CB    1 
ATOM   1201  C  CG    . ASN A  1 148 ? 18.683  -30.270 1.656   1.00 13.49 ? 159 ASN A CG    1 
ATOM   1202  O  OD1   . ASN A  1 148 ? 17.479  -30.102 1.463   1.00 8.35  ? 159 ASN A OD1   1 
ATOM   1203  N  ND2   . ASN A  1 148 ? 19.588  -29.920 0.741   1.00 8.65  ? 159 ASN A ND2   1 
ATOM   1204  N  N     . ASP A  1 149 ? 16.219  -29.615 4.865   1.00 11.05 ? 160 ASP A N     1 
ATOM   1205  C  CA    . ASP A  1 149 ? 14.811  -29.925 5.170   1.00 9.68  ? 160 ASP A CA    1 
ATOM   1206  C  C     . ASP A  1 149 ? 14.066  -30.412 3.934   1.00 12.55 ? 160 ASP A C     1 
ATOM   1207  O  O     . ASP A  1 149 ? 13.111  -31.176 4.063   1.00 11.37 ? 160 ASP A O     1 
ATOM   1208  C  CB    . ASP A  1 149 ? 14.108  -28.678 5.725   1.00 10.53 ? 160 ASP A CB    1 
ATOM   1209  C  CG    . ASP A  1 149 ? 14.036  -27.543 4.722   1.00 11.34 ? 160 ASP A CG    1 
ATOM   1210  O  OD1   . ASP A  1 149 ? 15.075  -26.896 4.480   1.00 10.70 ? 160 ASP A OD1   1 
ATOM   1211  O  OD2   . ASP A  1 149 ? 12.969  -27.357 4.126   1.00 10.79 ? 160 ASP A OD2   1 
ATOM   1212  N  N     . ILE A  1 150 ? 14.496  -29.971 2.734   1.00 8.15  ? 161 ILE A N     1 
ATOM   1213  C  CA    . ILE A  1 150 ? 13.835  -30.382 1.484   1.00 7.68  ? 161 ILE A CA    1 
ATOM   1214  C  C     . ILE A  1 150 ? 14.106  -31.845 1.206   1.00 10.75 ? 161 ILE A C     1 
ATOM   1215  O  O     . ILE A  1 150 ? 13.187  -32.586 0.885   1.00 11.85 ? 161 ILE A O     1 
ATOM   1216  C  CB    . ILE A  1 150 ? 14.338  -29.548 0.279   1.00 10.16 ? 161 ILE A CB    1 
ATOM   1217  C  CG1   . ILE A  1 150 ? 14.383  -28.057 0.610   1.00 10.31 ? 161 ILE A CG1   1 
ATOM   1218  C  CG2   . ILE A  1 150 ? 13.476  -29.856 -0.971  1.00 8.57  ? 161 ILE A CG2   1 
ATOM   1219  C  CD1   . ILE A  1 150 ? 14.973  -27.163 -0.581  1.00 10.70 ? 161 ILE A CD1   1 
ATOM   1220  N  N     . VAL A  1 151 ? 15.374  -32.250 1.271   1.00 8.46  ? 162 VAL A N     1 
ATOM   1221  C  CA    . VAL A  1 151 ? 15.709  -33.653 1.007   1.00 8.68  ? 162 VAL A CA    1 
ATOM   1222  C  C     . VAL A  1 151 ? 14.932  -34.572 1.987   1.00 12.44 ? 162 VAL A C     1 
ATOM   1223  O  O     . VAL A  1 151 ? 14.364  -35.593 1.579   1.00 11.56 ? 162 VAL A O     1 
ATOM   1224  C  CB    . VAL A  1 151 ? 17.229  -33.906 1.023   1.00 12.03 ? 162 VAL A CB    1 
ATOM   1225  C  CG1   . VAL A  1 151 ? 17.520  -35.417 0.945   1.00 11.82 ? 162 VAL A CG1   1 
ATOM   1226  C  CG2   . VAL A  1 151 ? 17.899  -33.177 -0.156  1.00 11.59 ? 162 VAL A CG2   1 
ATOM   1227  N  N     . LEU A  1 152 ? 14.885  -34.181 3.257   1.00 9.85  ? 163 LEU A N     1 
ATOM   1228  C  CA    . LEU A  1 152 ? 14.183  -34.958 4.293   1.00 9.34  ? 163 LEU A CA    1 
ATOM   1229  C  C     . LEU A  1 152 ? 12.687  -35.027 3.999   1.00 12.58 ? 163 LEU A C     1 
ATOM   1230  O  O     . LEU A  1 152 ? 12.081  -36.103 4.086   1.00 12.41 ? 163 LEU A O     1 
ATOM   1231  C  CB    . LEU A  1 152 ? 14.468  -34.319 5.665   1.00 9.62  ? 163 LEU A CB    1 
ATOM   1232  C  CG    . LEU A  1 152 ? 15.945  -34.497 6.109   1.00 12.93 ? 163 LEU A CG    1 
ATOM   1233  C  CD1   . LEU A  1 152 ? 16.302  -33.570 7.279   1.00 11.65 ? 163 LEU A CD1   1 
ATOM   1234  C  CD2   . LEU A  1 152 ? 16.273  -35.989 6.415   1.00 13.48 ? 163 LEU A CD2   1 
ATOM   1235  N  N     . ALA A  1 153 ? 12.104  -33.895 3.563   1.00 9.38  ? 164 ALA A N     1 
ATOM   1236  C  CA    . ALA A  1 153 ? 10.678  -33.871 3.209   1.00 10.02 ? 164 ALA A CA    1 
ATOM   1237  C  C     . ALA A  1 153 ? 10.420  -34.746 1.970   1.00 14.46 ? 164 ALA A C     1 
ATOM   1238  O  O     . ALA A  1 153 ? 9.415   -35.450 1.935   1.00 13.07 ? 164 ALA A O     1 
ATOM   1239  C  CB    . ALA A  1 153 ? 10.218  -32.442 2.961   1.00 10.29 ? 164 ALA A CB    1 
ATOM   1240  N  N     . ILE A  1 154 ? 11.345  -34.751 0.984   1.00 11.74 ? 165 ILE A N     1 
ATOM   1241  C  CA    . ILE A  1 154 ? 11.147  -35.589 -0.222  1.00 10.71 ? 165 ILE A CA    1 
ATOM   1242  C  C     . ILE A  1 154 ? 11.266  -37.074 0.141   1.00 13.83 ? 165 ILE A C     1 
ATOM   1243  O  O     . ILE A  1 154 ? 10.476  -37.888 -0.340  1.00 14.13 ? 165 ILE A O     1 
ATOM   1244  C  CB    . ILE A  1 154 ? 12.087  -35.183 -1.384  1.00 12.58 ? 165 ILE A CB    1 
ATOM   1245  C  CG1   . ILE A  1 154 ? 11.699  -33.777 -1.922  1.00 12.01 ? 165 ILE A CG1   1 
ATOM   1246  C  CG2   . ILE A  1 154 ? 11.994  -36.219 -2.530  1.00 11.59 ? 165 ILE A CG2   1 
ATOM   1247  C  CD1   . ILE A  1 154 ? 12.864  -33.119 -2.846  1.00 11.27 ? 165 ILE A CD1   1 
ATOM   1248  N  N     . LEU A  1 155 ? 12.220  -37.415 1.018   1.00 9.30  ? 166 LEU A N     1 
ATOM   1249  C  CA    . LEU A  1 155 ? 12.366  -38.807 1.463   1.00 9.59  ? 166 LEU A CA    1 
ATOM   1250  C  C     . LEU A  1 155 ? 11.085  -39.276 2.160   1.00 13.60 ? 166 LEU A C     1 
ATOM   1251  O  O     . LEU A  1 155 ? 10.677  -40.423 1.989   1.00 13.05 ? 166 LEU A O     1 
ATOM   1252  C  CB    . LEU A  1 155 ? 13.565  -38.943 2.394   1.00 10.44 ? 166 LEU A CB    1 
ATOM   1253  C  CG    . LEU A  1 155 ? 14.947  -38.872 1.744   1.00 14.64 ? 166 LEU A CG    1 
ATOM   1254  C  CD1   . LEU A  1 155 ? 16.021  -38.900 2.823   1.00 14.53 ? 166 LEU A CD1   1 
ATOM   1255  C  CD2   . LEU A  1 155 ? 15.153  -40.001 0.709   1.00 14.64 ? 166 LEU A CD2   1 
ATOM   1256  N  N     . GLU A  1 156 ? 10.406  -38.352 2.871   1.00 11.36 ? 167 GLU A N     1 
ATOM   1257  C  CA    . GLU A  1 156 ? 9.119   -38.630 3.519   1.00 12.74 ? 167 GLU A CA    1 
ATOM   1258  C  C     . GLU A  1 156 ? 8.063   -38.885 2.446   1.00 14.82 ? 167 GLU A C     1 
ATOM   1259  O  O     . GLU A  1 156 ? 7.365   -39.902 2.490   1.00 12.99 ? 167 GLU A O     1 
ATOM   1260  C  CB    . GLU A  1 156 ? 8.707   -37.453 4.416   1.00 13.69 ? 167 GLU A CB    1 
ATOM   1261  C  CG    . GLU A  1 156 ? 7.626   -37.807 5.406   1.00 22.76 ? 167 GLU A CG    1 
ATOM   1262  C  CD    . GLU A  1 156 ? 8.063   -38.849 6.425   1.00 23.97 ? 167 GLU A CD    1 
ATOM   1263  O  OE1   . GLU A  1 156 ? 9.229   -38.839 6.883   1.00 35.78 ? 167 GLU A OE1   1 
ATOM   1264  O  OE2   . GLU A  1 156 ? 7.229   -39.718 6.722   1.00 21.91 ? 167 GLU A OE2   1 
ATOM   1265  N  N     . LEU A  1 157 ? 7.976   -37.988 1.444   1.00 10.94 ? 168 LEU A N     1 
ATOM   1266  C  CA    . LEU A  1 157 ? 7.041   -38.157 0.343   1.00 11.22 ? 168 LEU A CA    1 
ATOM   1267  C  C     . LEU A  1 157 ? 7.248   -39.472 -0.425  1.00 12.94 ? 168 LEU A C     1 
ATOM   1268  O  O     . LEU A  1 157 ? 6.259   -40.121 -0.808  1.00 11.26 ? 168 LEU A O     1 
ATOM   1269  C  CB    . LEU A  1 157 ? 7.104   -36.970 -0.630  1.00 11.06 ? 168 LEU A CB    1 
ATOM   1270  C  CG    . LEU A  1 157 ? 6.556   -35.640 -0.109  1.00 14.43 ? 168 LEU A CG    1 
ATOM   1271  C  CD1   . LEU A  1 157 ? 6.892   -34.520 -1.080  1.00 14.19 ? 168 LEU A CD1   1 
ATOM   1272  C  CD2   . LEU A  1 157 ? 5.029   -35.717 0.117   1.00 14.91 ? 168 LEU A CD2   1 
ATOM   1273  N  N     . LEU A  1 158 ? 8.515   -39.870 -0.621  1.00 10.15 ? 169 LEU A N     1 
ATOM   1274  C  CA    . LEU A  1 158 ? 8.848   -41.103 -1.363  1.00 11.59 ? 169 LEU A CA    1 
ATOM   1275  C  C     . LEU A  1 158 ? 8.299   -42.393 -0.714  1.00 18.55 ? 169 LEU A C     1 
ATOM   1276  O  O     . LEU A  1 158 ? 8.233   -43.431 -1.379  1.00 18.49 ? 169 LEU A O     1 
ATOM   1277  C  CB    . LEU A  1 158 ? 10.355  -41.223 -1.627  1.00 11.37 ? 169 LEU A CB    1 
ATOM   1278  C  CG    . LEU A  1 158 ? 10.922  -40.252 -2.669  1.00 14.58 ? 169 LEU A CG    1 
ATOM   1279  C  CD1   . LEU A  1 158 ? 12.440  -40.168 -2.554  1.00 13.56 ? 169 LEU A CD1   1 
ATOM   1280  C  CD2   . LEU A  1 158 ? 10.473  -40.621 -4.083  1.00 16.72 ? 169 LEU A CD2   1 
ATOM   1281  N  N     . LYS A  1 159 ? 7.873   -42.317 0.572   1.00 15.15 ? 170 LYS A N     1 
ATOM   1282  C  CA    . LYS A  1 159 ? 7.237   -43.462 1.259   1.00 15.35 ? 170 LYS A CA    1 
ATOM   1283  C  C     . LYS A  1 159 ? 5.878   -43.785 0.598   1.00 21.46 ? 170 LYS A C     1 
ATOM   1284  O  O     . LYS A  1 159 ? 5.449   -44.949 0.613   1.00 22.98 ? 170 LYS A O     1 
ATOM   1285  C  CB    . LYS A  1 159 ? 6.982   -43.136 2.737   1.00 16.34 ? 170 LYS A CB    1 
ATOM   1286  C  CG    . LYS A  1 159 ? 8.247   -43.026 3.574   1.00 20.68 ? 170 LYS A CG    1 
ATOM   1287  C  CD    . LYS A  1 159 ? 7.917   -42.665 5.025   1.00 19.38 ? 170 LYS A CD    1 
ATOM   1288  C  CE    . LYS A  1 159 ? 9.183   -42.469 5.811   1.00 27.56 ? 170 LYS A CE    1 
ATOM   1289  N  NZ    . LYS A  1 159 ? 8.899   -42.053 7.213   1.00 33.85 ? 170 LYS A NZ    1 
ATOM   1290  N  N     . TYR A  1 160 ? 5.197   -42.770 0.030   1.00 18.20 ? 171 TYR A N     1 
ATOM   1291  C  CA    . TYR A  1 160 ? 3.867   -42.965 -0.588  1.00 19.20 ? 171 TYR A CA    1 
ATOM   1292  C  C     . TYR A  1 160 ? 3.782   -42.566 -2.049  1.00 23.57 ? 171 TYR A C     1 
ATOM   1293  O  O     . TYR A  1 160 ? 2.763   -42.835 -2.694  1.00 25.86 ? 171 TYR A O     1 
ATOM   1294  C  CB    . TYR A  1 160 ? 2.765   -42.259 0.227   1.00 22.13 ? 171 TYR A CB    1 
ATOM   1295  C  CG    . TYR A  1 160 ? 2.635   -42.816 1.628   1.00 27.19 ? 171 TYR A CG    1 
ATOM   1296  C  CD1   . TYR A  1 160 ? 1.835   -43.930 1.885   1.00 30.93 ? 171 TYR A CD1   1 
ATOM   1297  C  CD2   . TYR A  1 160 ? 3.404   -42.311 2.674   1.00 27.15 ? 171 TYR A CD2   1 
ATOM   1298  C  CE1   . TYR A  1 160 ? 1.793   -44.514 3.152   1.00 34.22 ? 171 TYR A CE1   1 
ATOM   1299  C  CE2   . TYR A  1 160 ? 3.368   -42.885 3.943   1.00 28.55 ? 171 TYR A CE2   1 
ATOM   1300  C  CZ    . TYR A  1 160 ? 2.552   -43.977 4.182   1.00 43.34 ? 171 TYR A CZ    1 
ATOM   1301  O  OH    . TYR A  1 160 ? 2.512   -44.535 5.442   1.00 49.16 ? 171 TYR A OH    1 
ATOM   1302  N  N     . HIS A  1 161 ? 4.832   -41.924 -2.578  1.00 17.30 ? 172 HIS A N     1 
ATOM   1303  C  CA    . HIS A  1 161 ? 4.831   -41.439 -3.958  1.00 15.40 ? 172 HIS A CA    1 
ATOM   1304  C  C     . HIS A  1 161 ? 5.974   -42.043 -4.747  1.00 18.40 ? 172 HIS A C     1 
ATOM   1305  O  O     . HIS A  1 161 ? 7.126   -41.888 -4.361  1.00 18.13 ? 172 HIS A O     1 
ATOM   1306  C  CB    . HIS A  1 161 ? 4.908   -39.890 -3.954  1.00 14.67 ? 172 HIS A CB    1 
ATOM   1307  C  CG    . HIS A  1 161 ? 3.713   -39.256 -3.309  1.00 16.79 ? 172 HIS A CG    1 
ATOM   1308  N  ND1   . HIS A  1 161 ? 2.552   -39.012 -4.024  1.00 17.97 ? 172 HIS A ND1   1 
ATOM   1309  C  CD2   . HIS A  1 161 ? 3.523   -38.875 -2.026  1.00 17.07 ? 172 HIS A CD2   1 
ATOM   1310  C  CE1   . HIS A  1 161 ? 1.715   -38.440 -3.171  1.00 17.27 ? 172 HIS A CE1   1 
ATOM   1311  N  NE2   . HIS A  1 161 ? 2.241   -38.351 -1.955  1.00 17.22 ? 172 HIS A NE2   1 
ATOM   1312  N  N     . GLN A  1 162 ? 5.661   -42.737 -5.862  1.00 15.26 ? 173 GLN A N     1 
ATOM   1313  C  CA    . GLN A  1 162 ? 6.683   -43.356 -6.708  1.00 14.64 ? 173 GLN A CA    1 
ATOM   1314  C  C     . GLN A  1 162 ? 7.596   -42.271 -7.328  1.00 17.17 ? 173 GLN A C     1 
ATOM   1315  O  O     . GLN A  1 162 ? 8.812   -42.442 -7.351  1.00 16.73 ? 173 GLN A O     1 
ATOM   1316  C  CB    . GLN A  1 162 ? 6.018   -44.220 -7.803  1.00 16.79 ? 173 GLN A CB    1 
ATOM   1317  C  CG    . GLN A  1 162 ? 7.000   -45.071 -8.642  1.00 28.43 ? 173 GLN A CG    1 
ATOM   1318  C  CD    . GLN A  1 162 ? 7.911   -45.986 -7.839  1.00 47.55 ? 173 GLN A CD    1 
ATOM   1319  O  OE1   . GLN A  1 162 ? 7.516   -46.623 -6.846  1.00 37.11 ? 173 GLN A OE1   1 
ATOM   1320  N  NE2   . GLN A  1 162 ? 9.157   -46.094 -8.281  1.00 42.68 ? 173 GLN A NE2   1 
ATOM   1321  N  N     . ARG A  1 163 ? 6.999   -41.147 -7.771  1.00 13.57 ? 174 ARG A N     1 
ATOM   1322  C  CA    . ARG A  1 163 ? 7.728   -40.025 -8.414  1.00 13.65 ? 174 ARG A CA    1 
ATOM   1323  C  C     . ARG A  1 163 ? 7.365   -38.699 -7.774  1.00 15.45 ? 174 ARG A C     1 
ATOM   1324  O  O     . ARG A  1 163 ? 6.186   -38.363 -7.669  1.00 15.16 ? 174 ARG A O     1 
ATOM   1325  C  CB    . ARG A  1 163 ? 7.431   -39.966 -9.926  1.00 12.42 ? 174 ARG A CB    1 
ATOM   1326  C  CG    . ARG A  1 163 ? 8.005   -41.158 -10.696 1.00 16.78 ? 174 ARG A CG    1 
ATOM   1327  C  CD    . ARG A  1 163 ? 7.582   -41.178 -12.151 1.00 18.64 ? 174 ARG A CD    1 
ATOM   1328  N  NE    . ARG A  1 163 ? 6.136   -41.052 -12.329 1.00 21.21 ? 174 ARG A NE    1 
ATOM   1329  C  CZ    . ARG A  1 163 ? 5.265   -42.054 -12.261 1.00 34.85 ? 174 ARG A CZ    1 
ATOM   1330  N  NH1   . ARG A  1 163 ? 3.972   -41.826 -12.427 1.00 25.21 ? 174 ARG A NH1   1 
ATOM   1331  N  NH2   . ARG A  1 163 ? 5.679   -43.287 -11.994 1.00 27.66 ? 174 ARG A NH2   1 
ATOM   1332  N  N     . VAL A  1 164 ? 8.403   -37.931 -7.372  1.00 11.15 ? 175 VAL A N     1 
ATOM   1333  C  CA    . VAL A  1 164 ? 8.276   -36.635 -6.712  1.00 9.07  ? 175 VAL A CA    1 
ATOM   1334  C  C     . VAL A  1 164 ? 8.997   -35.604 -7.557  1.00 11.62 ? 175 VAL A C     1 
ATOM   1335  O  O     . VAL A  1 164 ? 10.152  -35.799 -7.925  1.00 11.11 ? 175 VAL A O     1 
ATOM   1336  C  CB    . VAL A  1 164 ? 8.822   -36.681 -5.242  1.00 12.05 ? 175 VAL A CB    1 
ATOM   1337  C  CG1   . VAL A  1 164 ? 8.840   -35.285 -4.605  1.00 11.79 ? 175 VAL A CG1   1 
ATOM   1338  C  CG2   . VAL A  1 164 ? 8.000   -37.654 -4.381  1.00 11.59 ? 175 VAL A CG2   1 
ATOM   1339  N  N     . LEU A  1 165 ? 8.310   -34.517 -7.878  1.00 9.23  ? 176 LEU A N     1 
ATOM   1340  C  CA    . LEU A  1 165 ? 8.920   -33.440 -8.653  1.00 8.35  ? 176 LEU A CA    1 
ATOM   1341  C  C     . LEU A  1 165 ? 9.358   -32.317 -7.713  1.00 13.11 ? 176 LEU A C     1 
ATOM   1342  O  O     . LEU A  1 165 ? 8.556   -31.823 -6.930  1.00 11.71 ? 176 LEU A O     1 
ATOM   1343  C  CB    . LEU A  1 165 ? 7.918   -32.905 -9.685  1.00 7.37  ? 176 LEU A CB    1 
ATOM   1344  C  CG    . LEU A  1 165 ? 8.331   -31.638 -10.468 1.00 9.32  ? 176 LEU A CG    1 
ATOM   1345  C  CD1   . LEU A  1 165 ? 9.646   -31.838 -11.232 1.00 8.37  ? 176 LEU A CD1   1 
ATOM   1346  C  CD2   . LEU A  1 165 ? 7.206   -31.191 -11.379 1.00 9.68  ? 176 LEU A CD2   1 
ATOM   1347  N  N     . TYR A  1 166 ? 10.614  -31.880 -7.847  1.00 10.50 ? 177 TYR A N     1 
ATOM   1348  C  CA    . TYR A  1 166 ? 11.163  -30.770 -7.097  1.00 9.28  ? 177 TYR A CA    1 
ATOM   1349  C  C     . TYR A  1 166 ? 11.420  -29.580 -8.058  1.00 12.62 ? 177 TYR A C     1 
ATOM   1350  O  O     . TYR A  1 166 ? 12.070  -29.748 -9.094  1.00 10.27 ? 177 TYR A O     1 
ATOM   1351  C  CB    . TYR A  1 166 ? 12.449  -31.189 -6.357  1.00 10.56 ? 177 TYR A CB    1 
ATOM   1352  C  CG    . TYR A  1 166 ? 13.156  -30.021 -5.693  1.00 9.75  ? 177 TYR A CG    1 
ATOM   1353  C  CD1   . TYR A  1 166 ? 12.630  -29.418 -4.552  1.00 10.10 ? 177 TYR A CD1   1 
ATOM   1354  C  CD2   . TYR A  1 166 ? 14.347  -29.521 -6.206  1.00 9.52  ? 177 TYR A CD2   1 
ATOM   1355  C  CE1   . TYR A  1 166 ? 13.259  -28.324 -3.958  1.00 9.59  ? 177 TYR A CE1   1 
ATOM   1356  C  CE2   . TYR A  1 166 ? 14.992  -28.443 -5.610  1.00 9.67  ? 177 TYR A CE2   1 
ATOM   1357  C  CZ    . TYR A  1 166 ? 14.434  -27.833 -4.501  1.00 11.01 ? 177 TYR A CZ    1 
ATOM   1358  O  OH    . TYR A  1 166 ? 15.081  -26.780 -3.907  1.00 10.42 ? 177 TYR A OH    1 
ATOM   1359  N  N     . ILE A  1 167 ? 10.914  -28.391 -7.708  1.00 8.41  ? 178 ILE A N     1 
ATOM   1360  C  CA    . ILE A  1 167 ? 11.076  -27.167 -8.534  1.00 7.91  ? 178 ILE A CA    1 
ATOM   1361  C  C     . ILE A  1 167 ? 11.672  -26.080 -7.638  1.00 11.62 ? 178 ILE A C     1 
ATOM   1362  O  O     . ILE A  1 167 ? 11.193  -25.866 -6.523  1.00 12.49 ? 178 ILE A O     1 
ATOM   1363  C  CB    . ILE A  1 167 ? 9.734   -26.698 -9.176  1.00 9.44  ? 178 ILE A CB    1 
ATOM   1364  C  CG1   . ILE A  1 167 ? 9.036   -27.833 -9.974  1.00 8.18  ? 178 ILE A CG1   1 
ATOM   1365  C  CG2   . ILE A  1 167 ? 9.965   -25.420 -10.045 1.00 9.50  ? 178 ILE A CG2   1 
ATOM   1366  C  CD1   . ILE A  1 167 ? 7.542   -27.578 -10.228 1.00 12.66 ? 178 ILE A CD1   1 
ATOM   1367  N  N     . ASP A  1 168 ? 12.707  -25.401 -8.129  1.00 7.74  ? 179 ASP A N     1 
ATOM   1368  C  CA    . ASP A  1 168 ? 13.473  -24.454 -7.351  1.00 6.64  ? 179 ASP A CA    1 
ATOM   1369  C  C     . ASP A  1 168 ? 13.585  -23.097 -8.059  1.00 11.41 ? 179 ASP A C     1 
ATOM   1370  O  O     . ASP A  1 168 ? 14.376  -22.932 -9.004  1.00 10.95 ? 179 ASP A O     1 
ATOM   1371  C  CB    . ASP A  1 168 ? 14.843  -25.077 -7.076  1.00 7.78  ? 179 ASP A CB    1 
ATOM   1372  C  CG    . ASP A  1 168 ? 15.744  -24.352 -6.088  1.00 11.13 ? 179 ASP A CG    1 
ATOM   1373  O  OD1   . ASP A  1 168 ? 15.805  -23.111 -6.140  1.00 9.76  ? 179 ASP A OD1   1 
ATOM   1374  O  OD2   . ASP A  1 168 ? 16.400  -25.035 -5.271  1.00 11.01 ? 179 ASP A OD2   1 
ATOM   1375  N  N     . ILE A  1 169 ? 12.805  -22.120 -7.582  1.00 8.87  ? 180 ILE A N     1 
ATOM   1376  C  CA    . ILE A  1 169 ? 12.785  -20.755 -8.156  1.00 7.09  ? 180 ILE A CA    1 
ATOM   1377  C  C     . ILE A  1 169 ? 13.631  -19.727 -7.429  1.00 11.45 ? 180 ILE A C     1 
ATOM   1378  O  O     . ILE A  1 169 ? 13.604  -18.543 -7.776  1.00 10.16 ? 180 ILE A O     1 
ATOM   1379  C  CB    . ILE A  1 169 ? 11.379  -20.256 -8.480  1.00 9.30  ? 180 ILE A CB    1 
ATOM   1380  C  CG1   . ILE A  1 169 ? 10.553  -20.002 -7.186  1.00 7.72  ? 180 ILE A CG1   1 
ATOM   1381  C  CG2   . ILE A  1 169 ? 10.695  -21.191 -9.512  1.00 9.19  ? 180 ILE A CG2   1 
ATOM   1382  C  CD1   . ILE A  1 169 ? 9.237   -19.234 -7.437  1.00 7.29  ? 180 ILE A CD1   1 
ATOM   1383  N  N     . ASP A  1 170 ? 14.389  -20.177 -6.428  1.00 9.37  ? 181 ASP A N     1 
ATOM   1384  C  CA    . ASP A  1 170 ? 15.379  -19.345 -5.733  1.00 9.68  ? 181 ASP A CA    1 
ATOM   1385  C  C     . ASP A  1 170 ? 16.387  -18.895 -6.826  1.00 12.20 ? 181 ASP A C     1 
ATOM   1386  O  O     . ASP A  1 170 ? 16.554  -19.610 -7.816  1.00 11.31 ? 181 ASP A O     1 
ATOM   1387  C  CB    . ASP A  1 170 ? 16.114  -20.228 -4.703  1.00 11.64 ? 181 ASP A CB    1 
ATOM   1388  C  CG    . ASP A  1 170 ? 17.040  -19.488 -3.756  1.00 11.90 ? 181 ASP A CG    1 
ATOM   1389  O  OD1   . ASP A  1 170 ? 16.728  -19.423 -2.551  1.00 11.95 ? 181 ASP A OD1   1 
ATOM   1390  O  OD2   . ASP A  1 170 ? 18.114  -19.051 -4.200  1.00 11.90 ? 181 ASP A OD2   1 
ATOM   1391  N  N     . ILE A  1 171 ? 17.039  -17.719 -6.682  1.00 8.55  ? 182 ILE A N     1 
ATOM   1392  C  CA    . ILE A  1 171 ? 18.035  -17.299 -7.670  1.00 7.24  ? 182 ILE A CA    1 
ATOM   1393  C  C     . ILE A  1 171 ? 19.235  -18.271 -7.748  1.00 11.27 ? 182 ILE A C     1 
ATOM   1394  O  O     . ILE A  1 171 ? 19.901  -18.330 -8.779  1.00 11.08 ? 182 ILE A O     1 
ATOM   1395  C  CB    . ILE A  1 171 ? 18.468  -15.816 -7.458  1.00 9.34  ? 182 ILE A CB    1 
ATOM   1396  C  CG1   . ILE A  1 171 ? 19.177  -15.229 -8.723  1.00 10.23 ? 182 ILE A CG1   1 
ATOM   1397  C  CG2   . ILE A  1 171 ? 19.312  -15.618 -6.172  1.00 10.36 ? 182 ILE A CG2   1 
ATOM   1398  C  CD1   . ILE A  1 171 ? 19.496  -13.699 -8.594  1.00 12.34 ? 182 ILE A CD1   1 
ATOM   1399  N  N     . HIS A  1 172 ? 19.542  -18.992 -6.641  1.00 9.50  ? 183 HIS A N     1 
ATOM   1400  C  CA    . HIS A  1 172 ? 20.695  -19.885 -6.586  1.00 8.91  ? 183 HIS A CA    1 
ATOM   1401  C  C     . HIS A  1 172 ? 20.299  -21.296 -6.966  1.00 11.76 ? 183 HIS A C     1 
ATOM   1402  O  O     . HIS A  1 172 ? 19.164  -21.715 -6.704  1.00 11.25 ? 183 HIS A O     1 
ATOM   1403  C  CB    . HIS A  1 172 ? 21.350  -19.870 -5.177  1.00 9.46  ? 183 HIS A CB    1 
ATOM   1404  C  CG    . HIS A  1 172 ? 21.802  -18.500 -4.743  1.00 11.38 ? 183 HIS A CG    1 
ATOM   1405  N  ND1   . HIS A  1 172 ? 21.009  -17.703 -3.932  1.00 11.44 ? 183 HIS A ND1   1 
ATOM   1406  C  CD2   . HIS A  1 172 ? 22.935  -17.819 -5.063  1.00 11.99 ? 183 HIS A CD2   1 
ATOM   1407  C  CE1   . HIS A  1 172 ? 21.674  -16.564 -3.785  1.00 11.52 ? 183 HIS A CE1   1 
ATOM   1408  N  NE2   . HIS A  1 172 ? 22.845  -16.590 -4.442  1.00 12.07 ? 183 HIS A NE2   1 
ATOM   1409  N  N     . HIS A  1 173 ? 21.233  -22.030 -7.597  1.00 9.57  ? 184 HIS A N     1 
ATOM   1410  C  CA    . HIS A  1 173 ? 21.038  -23.430 -7.994  1.00 7.97  ? 184 HIS A CA    1 
ATOM   1411  C  C     . HIS A  1 173 ? 20.739  -24.314 -6.744  1.00 12.50 ? 184 HIS A C     1 
ATOM   1412  O  O     . HIS A  1 173 ? 21.413  -24.184 -5.724  1.00 12.09 ? 184 HIS A O     1 
ATOM   1413  C  CB    . HIS A  1 173 ? 22.302  -23.958 -8.693  1.00 7.80  ? 184 HIS A CB    1 
ATOM   1414  C  CG    . HIS A  1 173 ? 22.220  -25.411 -9.058  1.00 11.19 ? 184 HIS A CG    1 
ATOM   1415  N  ND1   . HIS A  1 173 ? 23.186  -26.310 -8.652  1.00 12.90 ? 184 HIS A ND1   1 
ATOM   1416  C  CD2   . HIS A  1 173 ? 21.252  -26.084 -9.729  1.00 11.88 ? 184 HIS A CD2   1 
ATOM   1417  C  CE1   . HIS A  1 173 ? 22.820  -27.485 -9.145  1.00 11.46 ? 184 HIS A CE1   1 
ATOM   1418  N  NE2   . HIS A  1 173 ? 21.659  -27.406 -9.790  1.00 11.22 ? 184 HIS A NE2   1 
ATOM   1419  N  N     . GLY A  1 174 ? 19.747  -25.206 -6.859  1.00 11.20 ? 185 GLY A N     1 
ATOM   1420  C  CA    . GLY A  1 174 ? 19.368  -26.152 -5.811  1.00 9.36  ? 185 GLY A CA    1 
ATOM   1421  C  C     . GLY A  1 174 ? 20.284  -27.364 -5.821  1.00 12.58 ? 185 GLY A C     1 
ATOM   1422  O  O     . GLY A  1 174 ? 19.841  -28.501 -6.040  1.00 12.24 ? 185 GLY A O     1 
ATOM   1423  N  N     . ASP A  1 175 ? 21.570  -27.121 -5.552  1.00 10.78 ? 186 ASP A N     1 
ATOM   1424  C  CA    . ASP A  1 175 ? 22.635  -28.133 -5.607  1.00 10.83 ? 186 ASP A CA    1 
ATOM   1425  C  C     . ASP A  1 175 ? 22.476  -29.284 -4.626  1.00 14.57 ? 186 ASP A C     1 
ATOM   1426  O  O     . ASP A  1 175 ? 22.653  -30.433 -5.025  1.00 12.27 ? 186 ASP A O     1 
ATOM   1427  C  CB    . ASP A  1 175 ? 24.040  -27.491 -5.520  1.00 10.87 ? 186 ASP A CB    1 
ATOM   1428  C  CG    . ASP A  1 175 ? 24.386  -26.805 -4.193  1.00 16.14 ? 186 ASP A CG    1 
ATOM   1429  O  OD1   . ASP A  1 175 ? 25.576  -26.689 -3.884  1.00 11.82 ? 186 ASP A OD1   1 
ATOM   1430  O  OD2   . ASP A  1 175 ? 23.452  -26.381 -3.471  1.00 13.98 ? 186 ASP A OD2   1 
ATOM   1431  N  N     . GLY A  1 176 ? 22.176  -28.983 -3.357  1.00 12.38 ? 187 GLY A N     1 
ATOM   1432  C  CA    . GLY A  1 176 ? 22.042  -30.030 -2.344  1.00 11.40 ? 187 GLY A CA    1 
ATOM   1433  C  C     . GLY A  1 176 ? 20.968  -31.050 -2.664  1.00 11.18 ? 187 GLY A C     1 
ATOM   1434  O  O     . GLY A  1 176 ? 21.175  -32.258 -2.495  1.00 11.40 ? 187 GLY A O     1 
ATOM   1435  N  N     . VAL A  1 177 ? 19.807  -30.568 -3.125  1.00 9.38  ? 188 VAL A N     1 
ATOM   1436  C  CA    . VAL A  1 177 ? 18.658  -31.393 -3.499  1.00 9.10  ? 188 VAL A CA    1 
ATOM   1437  C  C     . VAL A  1 177 ? 18.981  -32.195 -4.766  1.00 12.30 ? 188 VAL A C     1 
ATOM   1438  O  O     . VAL A  1 177 ? 18.759  -33.407 -4.807  1.00 9.30  ? 188 VAL A O     1 
ATOM   1439  C  CB    . VAL A  1 177 ? 17.351  -30.569 -3.625  1.00 12.13 ? 188 VAL A CB    1 
ATOM   1440  C  CG1   . VAL A  1 177 ? 16.134  -31.498 -3.728  1.00 12.14 ? 188 VAL A CG1   1 
ATOM   1441  C  CG2   . VAL A  1 177 ? 17.196  -29.635 -2.424  1.00 11.27 ? 188 VAL A CG2   1 
ATOM   1442  N  N     . GLU A  1 178 ? 19.563  -31.519 -5.782  1.00 9.63  ? 189 GLU A N     1 
ATOM   1443  C  CA    . GLU A  1 178 ? 19.963  -32.173 -7.028  1.00 9.59  ? 189 GLU A CA    1 
ATOM   1444  C  C     . GLU A  1 178 ? 20.985  -33.283 -6.721  1.00 13.21 ? 189 GLU A C     1 
ATOM   1445  O  O     . GLU A  1 178 ? 20.832  -34.400 -7.214  1.00 12.20 ? 189 GLU A O     1 
ATOM   1446  C  CB    . GLU A  1 178 ? 20.541  -31.132 -8.014  1.00 11.01 ? 189 GLU A CB    1 
ATOM   1447  C  CG    . GLU A  1 178 ? 21.097  -31.744 -9.287  1.00 14.62 ? 189 GLU A CG    1 
ATOM   1448  C  CD    . GLU A  1 178 ? 21.776  -30.726 -10.179 1.00 16.76 ? 189 GLU A CD    1 
ATOM   1449  O  OE1   . GLU A  1 178 ? 21.055  -29.965 -10.855 1.00 14.27 ? 189 GLU A OE1   1 
ATOM   1450  O  OE2   . GLU A  1 178 ? 23.018  -30.612 -10.106 1.00 14.35 ? 189 GLU A OE2   1 
ATOM   1451  N  N     . GLU A  1 179 ? 21.984  -32.991 -5.863  1.00 11.41 ? 190 GLU A N     1 
ATOM   1452  C  CA    . GLU A  1 179 ? 23.009  -33.969 -5.471  1.00 11.81 ? 190 GLU A CA    1 
ATOM   1453  C  C     . GLU A  1 179 ? 22.419  -35.208 -4.794  1.00 15.31 ? 190 GLU A C     1 
ATOM   1454  O  O     . GLU A  1 179 ? 22.732  -36.316 -5.213  1.00 15.70 ? 190 GLU A O     1 
ATOM   1455  C  CB    . GLU A  1 179 ? 24.073  -33.333 -4.573  1.00 13.07 ? 190 GLU A CB    1 
ATOM   1456  C  CG    . GLU A  1 179 ? 25.162  -34.302 -4.132  1.00 17.95 ? 190 GLU A CG    1 
ATOM   1457  C  CD    . GLU A  1 179 ? 26.221  -33.639 -3.281  1.00 36.39 ? 190 GLU A CD    1 
ATOM   1458  O  OE1   . GLU A  1 179 ? 26.276  -33.938 -2.068  1.00 24.86 ? 190 GLU A OE1   1 
ATOM   1459  O  OE2   . GLU A  1 179 ? 26.949  -32.769 -3.809  1.00 31.89 ? 190 GLU A OE2   1 
ATOM   1460  N  N     . ALA A  1 180 ? 21.582  -35.029 -3.757  1.00 11.62 ? 191 ALA A N     1 
ATOM   1461  C  CA    . ALA A  1 180 ? 20.970  -36.162 -3.043  1.00 11.67 ? 191 ALA A CA    1 
ATOM   1462  C  C     . ALA A  1 180 ? 20.236  -37.127 -3.962  1.00 15.22 ? 191 ALA A C     1 
ATOM   1463  O  O     . ALA A  1 180 ? 20.284  -38.329 -3.725  1.00 15.24 ? 191 ALA A O     1 
ATOM   1464  C  CB    . ALA A  1 180 ? 20.025  -35.658 -1.969  1.00 12.71 ? 191 ALA A CB    1 
ATOM   1465  N  N     . PHE A  1 181 ? 19.556  -36.609 -5.012  1.00 11.11 ? 192 PHE A N     1 
ATOM   1466  C  CA    . PHE A  1 181 ? 18.754  -37.440 -5.905  1.00 10.46 ? 192 PHE A CA    1 
ATOM   1467  C  C     . PHE A  1 181 ? 19.297  -37.573 -7.344  1.00 14.64 ? 192 PHE A C     1 
ATOM   1468  O  O     . PHE A  1 181 ? 18.550  -37.946 -8.242  1.00 14.38 ? 192 PHE A O     1 
ATOM   1469  C  CB    . PHE A  1 181 ? 17.324  -36.888 -5.922  1.00 11.44 ? 192 PHE A CB    1 
ATOM   1470  C  CG    . PHE A  1 181 ? 16.683  -36.869 -4.546  1.00 12.32 ? 192 PHE A CG    1 
ATOM   1471  C  CD1   . PHE A  1 181 ? 16.379  -35.663 -3.919  1.00 13.48 ? 192 PHE A CD1   1 
ATOM   1472  C  CD2   . PHE A  1 181 ? 16.459  -38.056 -3.846  1.00 14.42 ? 192 PHE A CD2   1 
ATOM   1473  C  CE1   . PHE A  1 181 ? 15.794  -35.645 -2.650  1.00 14.41 ? 192 PHE A CE1   1 
ATOM   1474  C  CE2   . PHE A  1 181 ? 15.876  -38.039 -2.576  1.00 16.53 ? 192 PHE A CE2   1 
ATOM   1475  C  CZ    . PHE A  1 181 ? 15.551  -36.832 -1.984  1.00 14.02 ? 192 PHE A CZ    1 
ATOM   1476  N  N     . TYR A  1 182 ? 20.576  -37.265 -7.548  1.00 12.68 ? 193 TYR A N     1 
ATOM   1477  C  CA    . TYR A  1 182 ? 21.226  -37.227 -8.864  1.00 12.52 ? 193 TYR A CA    1 
ATOM   1478  C  C     . TYR A  1 182 ? 21.204  -38.540 -9.616  1.00 17.93 ? 193 TYR A C     1 
ATOM   1479  O  O     . TYR A  1 182 ? 21.098  -38.544 -10.843 1.00 19.25 ? 193 TYR A O     1 
ATOM   1480  C  CB    . TYR A  1 182 ? 22.656  -36.678 -8.737  1.00 12.33 ? 193 TYR A CB    1 
ATOM   1481  C  CG    . TYR A  1 182 ? 23.161  -35.982 -9.983  1.00 14.68 ? 193 TYR A CG    1 
ATOM   1482  C  CD1   . TYR A  1 182 ? 24.271  -36.466 -10.678 1.00 16.46 ? 193 TYR A CD1   1 
ATOM   1483  C  CD2   . TYR A  1 182 ? 22.521  -34.849 -10.480 1.00 15.16 ? 193 TYR A CD2   1 
ATOM   1484  C  CE1   . TYR A  1 182 ? 24.734  -35.830 -11.832 1.00 16.02 ? 193 TYR A CE1   1 
ATOM   1485  C  CE2   . TYR A  1 182 ? 23.003  -34.180 -11.600 1.00 15.51 ? 193 TYR A CE2   1 
ATOM   1486  C  CZ    . TYR A  1 182 ? 24.115  -34.669 -12.271 1.00 19.95 ? 193 TYR A CZ    1 
ATOM   1487  O  OH    . TYR A  1 182 ? 24.527  -34.029 -13.417 1.00 15.72 ? 193 TYR A OH    1 
ATOM   1488  N  N     . THR A  1 183 ? 21.253  -39.656 -8.885  1.00 15.44 ? 194 THR A N     1 
ATOM   1489  C  CA    . THR A  1 183 ? 21.307  -40.976 -9.517  1.00 15.45 ? 194 THR A CA    1 
ATOM   1490  C  C     . THR A  1 183 ? 19.984  -41.742 -9.461  1.00 20.17 ? 194 THR A C     1 
ATOM   1491  O  O     . THR A  1 183 ? 19.959  -42.960 -9.705  1.00 19.94 ? 194 THR A O     1 
ATOM   1492  C  CB    . THR A  1 183 ? 22.484  -41.784 -8.935  1.00 21.54 ? 194 THR A CB    1 
ATOM   1493  O  OG1   . THR A  1 183 ? 22.212  -42.049 -7.567  1.00 21.31 ? 194 THR A OG1   1 
ATOM   1494  C  CG2   . THR A  1 183 ? 23.813  -41.081 -9.075  1.00 20.51 ? 194 THR A CG2   1 
ATOM   1495  N  N     . THR A  1 184 ? 18.884  -41.051 -9.122  1.00 14.77 ? 195 THR A N     1 
ATOM   1496  C  CA    . THR A  1 184 ? 17.580  -41.713 -9.074  1.00 13.26 ? 195 THR A CA    1 
ATOM   1497  C  C     . THR A  1 184 ? 16.571  -41.054 -9.993  1.00 17.35 ? 195 THR A C     1 
ATOM   1498  O  O     . THR A  1 184 ? 16.598  -39.822 -10.181 1.00 16.68 ? 195 THR A O     1 
ATOM   1499  C  CB    . THR A  1 184 ? 17.082  -41.956 -7.628  1.00 18.77 ? 195 THR A CB    1 
ATOM   1500  O  OG1   . THR A  1 184 ? 15.827  -42.657 -7.693  1.00 14.56 ? 195 THR A OG1   1 
ATOM   1501  C  CG2   . THR A  1 184 ? 16.894  -40.648 -6.835  1.00 15.66 ? 195 THR A CG2   1 
ATOM   1502  N  N     . ASP A  1 185 ? 15.654  -41.877 -10.539 1.00 13.56 ? 196 ASP A N     1 
ATOM   1503  C  CA    . ASP A  1 185 ? 14.571  -41.388 -11.389 1.00 13.34 ? 196 ASP A CA    1 
ATOM   1504  C  C     . ASP A  1 185 ? 13.327  -41.121 -10.557 1.00 17.25 ? 196 ASP A C     1 
ATOM   1505  O  O     . ASP A  1 185 ? 12.329  -40.633 -11.075 1.00 17.01 ? 196 ASP A O     1 
ATOM   1506  C  CB    . ASP A  1 185 ? 14.264  -42.368 -12.534 1.00 14.33 ? 196 ASP A CB    1 
ATOM   1507  C  CG    . ASP A  1 185 ? 13.885  -43.776 -12.114 1.00 21.07 ? 196 ASP A CG    1 
ATOM   1508  O  OD1   . ASP A  1 185 ? 14.017  -44.090 -10.930 1.00 17.85 ? 196 ASP A OD1   1 
ATOM   1509  O  OD2   . ASP A  1 185 ? 13.516  -44.577 -12.994 1.00 26.02 ? 196 ASP A OD2   1 
ATOM   1510  N  N     . ARG A  1 186 ? 13.387  -41.466 -9.257  1.00 14.31 ? 197 ARG A N     1 
ATOM   1511  C  CA    . ARG A  1 186 ? 12.272  -41.310 -8.316  1.00 13.10 ? 197 ARG A CA    1 
ATOM   1512  C  C     . ARG A  1 186 ? 12.072  -39.868 -7.905  1.00 15.06 ? 197 ARG A C     1 
ATOM   1513  O  O     . ARG A  1 186 ? 11.014  -39.514 -7.393  1.00 14.72 ? 197 ARG A O     1 
ATOM   1514  C  CB    . ARG A  1 186 ? 12.432  -42.242 -7.113  1.00 12.45 ? 197 ARG A CB    1 
ATOM   1515  C  CG    . ARG A  1 186 ? 12.231  -43.723 -7.492  1.00 20.36 ? 197 ARG A CG    1 
ATOM   1516  C  CD    . ARG A  1 186 ? 11.874  -44.557 -6.288  1.00 19.20 ? 197 ARG A CD    1 
ATOM   1517  N  NE    . ARG A  1 186 ? 10.608  -44.115 -5.695  1.00 19.49 ? 197 ARG A NE    1 
ATOM   1518  C  CZ    . ARG A  1 186 ? 10.252  -44.337 -4.437  1.00 24.90 ? 197 ARG A CZ    1 
ATOM   1519  N  NH1   . ARG A  1 186 ? 9.105   -43.869 -3.979  1.00 14.40 ? 197 ARG A NH1   1 
ATOM   1520  N  NH2   . ARG A  1 186 ? 11.046  -45.030 -3.625  1.00 16.92 ? 197 ARG A NH2   1 
ATOM   1521  N  N     . VAL A  1 187 ? 13.073  -39.012 -8.135  1.00 12.02 ? 198 VAL A N     1 
ATOM   1522  C  CA    . VAL A  1 187 ? 12.885  -37.576 -7.886  1.00 11.28 ? 198 VAL A CA    1 
ATOM   1523  C  C     . VAL A  1 187 ? 13.436  -36.829 -9.097  1.00 15.21 ? 198 VAL A C     1 
ATOM   1524  O  O     . VAL A  1 187 ? 14.605  -37.033 -9.442  1.00 15.19 ? 198 VAL A O     1 
ATOM   1525  C  CB    . VAL A  1 187 ? 13.559  -37.094 -6.589  1.00 13.92 ? 198 VAL A CB    1 
ATOM   1526  C  CG1   . VAL A  1 187 ? 13.318  -35.591 -6.352  1.00 13.26 ? 198 VAL A CG1   1 
ATOM   1527  C  CG2   . VAL A  1 187 ? 13.093  -37.917 -5.384  1.00 13.08 ? 198 VAL A CG2   1 
ATOM   1528  N  N     . MET A  1 188 ? 12.628  -35.956 -9.714  1.00 12.59 ? 199 MET A N     1 
ATOM   1529  C  CA    . MET A  1 188 ? 13.155  -35.119 -10.790 1.00 13.18 ? 199 MET A CA    1 
ATOM   1530  C  C     . MET A  1 188 ? 13.381  -33.735 -10.179 1.00 15.89 ? 199 MET A C     1 
ATOM   1531  O  O     . MET A  1 188 ? 12.474  -33.194 -9.522  1.00 15.61 ? 199 MET A O     1 
ATOM   1532  C  CB    . MET A  1 188 ? 12.229  -35.051 -12.024 1.00 16.48 ? 199 MET A CB    1 
ATOM   1533  C  CG    . MET A  1 188 ? 12.695  -34.021 -13.031 1.00 22.45 ? 199 MET A CG    1 
ATOM   1534  S  SD    . MET A  1 188 ? 11.704  -33.966 -14.523 1.00 29.60 ? 199 MET A SD    1 
ATOM   1535  C  CE    . MET A  1 188 ? 12.446  -35.251 -15.441 1.00 25.78 ? 199 MET A CE    1 
ATOM   1536  N  N     . THR A  1 189 ? 14.597  -33.194 -10.342 1.00 12.08 ? 200 THR A N     1 
ATOM   1537  C  CA    . THR A  1 189 ? 14.943  -31.873 -9.796  1.00 12.44 ? 200 THR A CA    1 
ATOM   1538  C  C     . THR A  1 189 ? 15.002  -30.842 -10.933 1.00 15.38 ? 200 THR A C     1 
ATOM   1539  O  O     . THR A  1 189 ? 15.614  -31.100 -11.973 1.00 13.94 ? 200 THR A O     1 
ATOM   1540  C  CB    . THR A  1 189 ? 16.201  -31.916 -8.920  1.00 14.50 ? 200 THR A CB    1 
ATOM   1541  O  OG1   . THR A  1 189 ? 17.336  -32.312 -9.704  1.00 12.43 ? 200 THR A OG1   1 
ATOM   1542  C  CG2   . THR A  1 189 ? 16.030  -32.831 -7.681  1.00 10.73 ? 200 THR A CG2   1 
ATOM   1543  N  N     . VAL A  1 190 ? 14.281  -29.723 -10.776 1.00 11.20 ? 201 VAL A N     1 
ATOM   1544  C  CA    . VAL A  1 190 ? 14.208  -28.668 -11.776 1.00 10.43 ? 201 VAL A CA    1 
ATOM   1545  C  C     . VAL A  1 190 ? 14.576  -27.337 -11.115 1.00 13.96 ? 201 VAL A C     1 
ATOM   1546  O  O     . VAL A  1 190 ? 13.822  -26.822 -10.281 1.00 13.67 ? 201 VAL A O     1 
ATOM   1547  C  CB    . VAL A  1 190 ? 12.823  -28.606 -12.483 1.00 13.38 ? 201 VAL A CB    1 
ATOM   1548  C  CG1   . VAL A  1 190 ? 12.809  -27.539 -13.586 1.00 11.95 ? 201 VAL A CG1   1 
ATOM   1549  C  CG2   . VAL A  1 190 ? 12.404  -29.968 -13.036 1.00 12.95 ? 201 VAL A CG2   1 
ATOM   1550  N  N     . SER A  1 191 ? 15.733  -26.785 -11.497 1.00 8.47  ? 202 SER A N     1 
ATOM   1551  C  CA    . SER A  1 191 ? 16.228  -25.539 -10.930 1.00 8.72  ? 202 SER A CA    1 
ATOM   1552  C  C     . SER A  1 191 ? 16.412  -24.470 -12.005 1.00 12.00 ? 202 SER A C     1 
ATOM   1553  O  O     . SER A  1 191 ? 17.010  -24.729 -13.052 1.00 11.34 ? 202 SER A O     1 
ATOM   1554  C  CB    . SER A  1 191 ? 17.539  -25.773 -10.179 1.00 10.20 ? 202 SER A CB    1 
ATOM   1555  O  OG    . SER A  1 191 ? 17.990  -24.566 -9.580  1.00 13.14 ? 202 SER A OG    1 
ATOM   1556  N  N     . PHE A  1 192 ? 15.912  -23.260 -11.724 1.00 9.95  ? 203 PHE A N     1 
ATOM   1557  C  CA    . PHE A  1 192 ? 16.060  -22.057 -12.584 1.00 8.62  ? 203 PHE A CA    1 
ATOM   1558  C  C     . PHE A  1 192 ? 16.964  -21.183 -11.735 1.00 12.59 ? 203 PHE A C     1 
ATOM   1559  O  O     . PHE A  1 192 ? 16.647  -20.935 -10.580 1.00 9.80  ? 203 PHE A O     1 
ATOM   1560  C  CB    . PHE A  1 192 ? 14.706  -21.359 -12.803 1.00 9.61  ? 203 PHE A CB    1 
ATOM   1561  C  CG    . PHE A  1 192 ? 13.668  -22.254 -13.442 1.00 11.32 ? 203 PHE A CG    1 
ATOM   1562  C  CD1   . PHE A  1 192 ? 12.867  -23.090 -12.662 1.00 13.55 ? 203 PHE A CD1   1 
ATOM   1563  C  CD2   . PHE A  1 192 ? 13.494  -22.268 -14.820 1.00 12.99 ? 203 PHE A CD2   1 
ATOM   1564  C  CE1   . PHE A  1 192 ? 11.908  -23.915 -13.254 1.00 13.96 ? 203 PHE A CE1   1 
ATOM   1565  C  CE2   . PHE A  1 192 ? 12.572  -23.140 -15.415 1.00 14.53 ? 203 PHE A CE2   1 
ATOM   1566  C  CZ    . PHE A  1 192 ? 11.776  -23.945 -14.631 1.00 11.90 ? 203 PHE A CZ    1 
ATOM   1567  N  N     . HIS A  1 193 ? 18.102  -20.738 -12.266 1.00 11.86 ? 204 HIS A N     1 
ATOM   1568  C  CA    . HIS A  1 193 ? 19.020  -19.973 -11.412 1.00 9.91  ? 204 HIS A CA    1 
ATOM   1569  C  C     . HIS A  1 193 ? 19.966  -19.112 -12.197 1.00 14.84 ? 204 HIS A C     1 
ATOM   1570  O  O     . HIS A  1 193 ? 20.296  -19.441 -13.336 1.00 12.72 ? 204 HIS A O     1 
ATOM   1571  C  CB    . HIS A  1 193 ? 19.870  -20.944 -10.555 1.00 9.71  ? 204 HIS A CB    1 
ATOM   1572  C  CG    . HIS A  1 193 ? 20.373  -22.124 -11.327 1.00 12.04 ? 204 HIS A CG    1 
ATOM   1573  N  ND1   . HIS A  1 193 ? 19.600  -23.263 -11.473 1.00 12.45 ? 204 HIS A ND1   1 
ATOM   1574  C  CD2   . HIS A  1 193 ? 21.495  -22.252 -12.076 1.00 13.05 ? 204 HIS A CD2   1 
ATOM   1575  C  CE1   . HIS A  1 193 ? 20.264  -24.046 -12.308 1.00 11.93 ? 204 HIS A CE1   1 
ATOM   1576  N  NE2   . HIS A  1 193 ? 21.430  -23.488 -12.679 1.00 12.79 ? 204 HIS A NE2   1 
ATOM   1577  N  N     . LYS A  1 194 ? 20.510  -18.086 -11.541 1.00 12.01 ? 205 LYS A N     1 
ATOM   1578  C  CA    . LYS A  1 194 ? 21.575  -17.278 -12.135 1.00 12.05 ? 205 LYS A CA    1 
ATOM   1579  C  C     . LYS A  1 194 ? 22.805  -18.207 -12.204 1.00 14.82 ? 205 LYS A C     1 
ATOM   1580  O  O     . LYS A  1 194 ? 23.077  -18.978 -11.273 1.00 12.88 ? 205 LYS A O     1 
ATOM   1581  C  CB    . LYS A  1 194 ? 21.836  -16.019 -11.278 1.00 13.44 ? 205 LYS A CB    1 
ATOM   1582  C  CG    . LYS A  1 194 ? 23.233  -15.395 -11.397 1.00 25.16 ? 205 LYS A CG    1 
ATOM   1583  C  CD    . LYS A  1 194 ? 23.514  -14.642 -12.651 1.00 28.70 ? 205 LYS A CD    1 
ATOM   1584  C  CE    . LYS A  1 194 ? 24.931  -14.115 -12.564 1.00 28.14 ? 205 LYS A CE    1 
ATOM   1585  N  NZ    . LYS A  1 194 ? 25.270  -13.323 -13.767 1.00 27.24 ? 205 LYS A NZ    1 
ATOM   1586  N  N     . TYR A  1 195 ? 23.483  -18.210 -13.340 1.00 12.36 ? 206 TYR A N     1 
ATOM   1587  C  CA    . TYR A  1 195 ? 24.628  -19.096 -13.542 1.00 12.21 ? 206 TYR A CA    1 
ATOM   1588  C  C     . TYR A  1 195 ? 25.753  -18.325 -14.240 1.00 17.67 ? 206 TYR A C     1 
ATOM   1589  O  O     . TYR A  1 195 ? 25.496  -17.640 -15.224 1.00 16.42 ? 206 TYR A O     1 
ATOM   1590  C  CB    . TYR A  1 195 ? 24.195  -20.316 -14.394 1.00 12.05 ? 206 TYR A CB    1 
ATOM   1591  C  CG    . TYR A  1 195 ? 25.301  -21.325 -14.612 1.00 13.22 ? 206 TYR A CG    1 
ATOM   1592  C  CD1   . TYR A  1 195 ? 26.057  -21.321 -15.786 1.00 15.86 ? 206 TYR A CD1   1 
ATOM   1593  C  CD2   . TYR A  1 195 ? 25.610  -22.268 -13.644 1.00 12.80 ? 206 TYR A CD2   1 
ATOM   1594  C  CE1   . TYR A  1 195 ? 27.106  -22.218 -15.969 1.00 16.98 ? 206 TYR A CE1   1 
ATOM   1595  C  CE2   . TYR A  1 195 ? 26.658  -23.165 -13.814 1.00 13.71 ? 206 TYR A CE2   1 
ATOM   1596  C  CZ    . TYR A  1 195 ? 27.404  -23.135 -14.979 1.00 20.55 ? 206 TYR A CZ    1 
ATOM   1597  O  OH    . TYR A  1 195 ? 28.452  -23.998 -15.142 1.00 17.85 ? 206 TYR A OH    1 
ATOM   1598  N  N     . GLY A  1 196 ? 26.976  -18.505 -13.745 1.00 17.06 ? 207 GLY A N     1 
ATOM   1599  C  CA    . GLY A  1 196 ? 28.190  -17.864 -14.254 1.00 18.35 ? 207 GLY A CA    1 
ATOM   1600  C  C     . GLY A  1 196 ? 28.805  -17.000 -13.175 1.00 24.74 ? 207 GLY A C     1 
ATOM   1601  O  O     . GLY A  1 196 ? 28.254  -15.951 -12.835 1.00 25.24 ? 207 GLY A O     1 
ATOM   1602  N  N     . GLU A  1 197 ? 29.930  -17.447 -12.614 1.00 23.67 ? 208 GLU A N     1 
ATOM   1603  C  CA    . GLU A  1 197 ? 30.638  -16.793 -11.495 1.00 24.80 ? 208 GLU A CA    1 
ATOM   1604  C  C     . GLU A  1 197 ? 29.692  -16.344 -10.375 1.00 27.05 ? 208 GLU A C     1 
ATOM   1605  O  O     . GLU A  1 197 ? 29.658  -15.177 -9.946  1.00 29.21 ? 208 GLU A O     1 
ATOM   1606  C  CB    A GLU A  1 197 ? 31.710  -15.759 -11.930 0.70 26.63 ? 208 GLU A CB    1 
ATOM   1607  C  CG    A GLU A  1 197 ? 31.243  -14.525 -12.686 0.70 38.71 ? 208 GLU A CG    1 
ATOM   1608  C  CD    A GLU A  1 197 ? 32.360  -13.569 -13.074 0.70 63.73 ? 208 GLU A CD    1 
ATOM   1609  O  OE1   A GLU A  1 197 ? 33.400  -14.038 -13.593 0.70 60.74 ? 208 GLU A OE1   1 
ATOM   1610  O  OE2   A GLU A  1 197 ? 32.186  -12.344 -12.879 0.70 56.90 ? 208 GLU A OE2   1 
ATOM   1611  N  N     . TYR A  1 198 ? 28.841  -17.288 -9.972  1.00 19.73 ? 209 TYR A N     1 
ATOM   1612  C  CA    . TYR A  1 198 ? 27.821  -17.043 -8.962  1.00 18.49 ? 209 TYR A CA    1 
ATOM   1613  C  C     . TYR A  1 198 ? 27.674  -18.252 -8.105  1.00 19.70 ? 209 TYR A C     1 
ATOM   1614  O  O     . TYR A  1 198 ? 27.777  -19.380 -8.593  1.00 19.35 ? 209 TYR A O     1 
ATOM   1615  C  CB    . TYR A  1 198 ? 26.478  -16.743 -9.656  1.00 19.49 ? 209 TYR A CB    1 
ATOM   1616  C  CG    . TYR A  1 198 ? 25.524  -15.893 -8.858  1.00 19.71 ? 209 TYR A CG    1 
ATOM   1617  C  CD1   . TYR A  1 198 ? 24.323  -16.417 -8.381  1.00 19.90 ? 209 TYR A CD1   1 
ATOM   1618  C  CD2   . TYR A  1 198 ? 25.786  -14.549 -8.628  1.00 20.98 ? 209 TYR A CD2   1 
ATOM   1619  C  CE1   . TYR A  1 198 ? 23.418  -15.624 -7.684  1.00 19.07 ? 209 TYR A CE1   1 
ATOM   1620  C  CE2   . TYR A  1 198 ? 24.910  -13.760 -7.891  1.00 21.85 ? 209 TYR A CE2   1 
ATOM   1621  C  CZ    . TYR A  1 198 ? 23.723  -14.297 -7.428  1.00 26.17 ? 209 TYR A CZ    1 
ATOM   1622  O  OH    . TYR A  1 198 ? 22.856  -13.515 -6.713  1.00 27.86 ? 209 TYR A OH    1 
ATOM   1623  N  N     . PHE A  1 199 ? 27.391  -18.027 -6.826  1.00 14.14 ? 210 PHE A N     1 
ATOM   1624  C  CA    . PHE A  1 199 ? 27.175  -19.106 -5.861  1.00 11.40 ? 210 PHE A CA    1 
ATOM   1625  C  C     . PHE A  1 199 ? 25.993  -20.015 -6.274  1.00 15.23 ? 210 PHE A C     1 
ATOM   1626  O  O     . PHE A  1 199 ? 24.959  -19.499 -6.695  1.00 14.02 ? 210 PHE A O     1 
ATOM   1627  C  CB    . PHE A  1 199 ? 26.902  -18.509 -4.456  1.00 11.42 ? 210 PHE A CB    1 
ATOM   1628  C  CG    . PHE A  1 199 ? 26.881  -19.564 -3.366  1.00 12.38 ? 210 PHE A CG    1 
ATOM   1629  C  CD1   . PHE A  1 199 ? 25.684  -20.186 -2.993  1.00 13.32 ? 210 PHE A CD1   1 
ATOM   1630  C  CD2   . PHE A  1 199 ? 28.051  -19.941 -2.719  1.00 12.86 ? 210 PHE A CD2   1 
ATOM   1631  C  CE1   . PHE A  1 199 ? 25.677  -21.194 -2.024  1.00 13.93 ? 210 PHE A CE1   1 
ATOM   1632  C  CE2   . PHE A  1 199 ? 28.039  -20.942 -1.742  1.00 15.74 ? 210 PHE A CE2   1 
ATOM   1633  C  CZ    . PHE A  1 199 ? 26.858  -21.587 -1.426  1.00 12.56 ? 210 PHE A CZ    1 
ATOM   1634  N  N     . PRO A  1 200 ? 26.101  -21.352 -6.126  1.00 13.36 ? 211 PRO A N     1 
ATOM   1635  C  CA    . PRO A  1 200 ? 27.266  -22.117 -5.647  1.00 14.03 ? 211 PRO A CA    1 
ATOM   1636  C  C     . PRO A  1 200 ? 28.257  -22.553 -6.736  1.00 18.88 ? 211 PRO A C     1 
ATOM   1637  O  O     . PRO A  1 200 ? 29.214  -23.261 -6.426  1.00 18.93 ? 211 PRO A O     1 
ATOM   1638  C  CB    . PRO A  1 200 ? 26.607  -23.308 -4.957  1.00 16.33 ? 211 PRO A CB    1 
ATOM   1639  C  CG    . PRO A  1 200 ? 25.382  -23.586 -5.818  1.00 19.20 ? 211 PRO A CG    1 
ATOM   1640  C  CD    . PRO A  1 200 ? 24.949  -22.246 -6.387  1.00 14.97 ? 211 PRO A CD    1 
ATOM   1641  N  N     . GLY A  1 201 ? 28.009  -22.175 -7.990  1.00 16.12 ? 212 GLY A N     1 
ATOM   1642  C  CA    . GLY A  1 201 ? 28.902  -22.543 -9.089  1.00 15.97 ? 212 GLY A CA    1 
ATOM   1643  C  C     . GLY A  1 201 ? 28.466  -23.723 -9.924  1.00 18.38 ? 212 GLY A C     1 
ATOM   1644  O  O     . GLY A  1 201 ? 29.117  -24.047 -10.916 1.00 18.32 ? 212 GLY A O     1 
ATOM   1645  N  N     . THR A  1 202 ? 27.365  -24.378 -9.537  1.00 13.55 ? 213 THR A N     1 
ATOM   1646  C  CA    . THR A  1 202 ? 26.828  -25.555 -10.213 1.00 12.19 ? 213 THR A CA    1 
ATOM   1647  C  C     . THR A  1 202 ? 25.528  -25.225 -10.978 1.00 15.33 ? 213 THR A C     1 
ATOM   1648  O  O     . THR A  1 202 ? 25.113  -24.068 -11.014 1.00 14.30 ? 213 THR A O     1 
ATOM   1649  C  CB    . THR A  1 202 ? 26.695  -26.707 -9.207  1.00 20.36 ? 213 THR A CB    1 
ATOM   1650  O  OG1   . THR A  1 202 ? 25.960  -26.227 -8.072  1.00 19.48 ? 213 THR A OG1   1 
ATOM   1651  C  CG2   . THR A  1 202 ? 28.072  -27.281 -8.791  1.00 20.61 ? 213 THR A CG2   1 
ATOM   1652  N  N     . GLY A  1 203 ? 24.889  -26.243 -11.551 1.00 11.89 ? 214 GLY A N     1 
ATOM   1653  C  CA    . GLY A  1 203 ? 23.648  -26.037 -12.293 1.00 12.08 ? 214 GLY A CA    1 
ATOM   1654  C  C     . GLY A  1 203 ? 23.829  -25.639 -13.751 1.00 14.10 ? 214 GLY A C     1 
ATOM   1655  O  O     . GLY A  1 203 ? 23.055  -24.842 -14.290 1.00 12.53 ? 214 GLY A O     1 
ATOM   1656  N  N     . ASP A  1 204 ? 24.855  -26.202 -14.402 1.00 10.71 ? 215 ASP A N     1 
ATOM   1657  C  CA    . ASP A  1 204 ? 25.048  -25.984 -15.847 1.00 11.99 ? 215 ASP A CA    1 
ATOM   1658  C  C     . ASP A  1 204 ? 23.887  -26.719 -16.545 1.00 17.07 ? 215 ASP A C     1 
ATOM   1659  O  O     . ASP A  1 204 ? 23.456  -27.772 -16.042 1.00 16.17 ? 215 ASP A O     1 
ATOM   1660  C  CB    . ASP A  1 204 ? 26.406  -26.615 -16.288 1.00 14.14 ? 215 ASP A CB    1 
ATOM   1661  C  CG    . ASP A  1 204 ? 26.817  -26.269 -17.722 1.00 18.56 ? 215 ASP A CG    1 
ATOM   1662  O  OD1   . ASP A  1 204 ? 26.133  -26.719 -18.664 1.00 16.22 ? 215 ASP A OD1   1 
ATOM   1663  O  OD2   . ASP A  1 204 ? 27.756  -25.483 -17.888 1.00 25.27 ? 215 ASP A OD2   1 
ATOM   1664  N  N     . LEU A  1 205 ? 23.397  -26.234 -17.712 1.00 15.36 ? 216 LEU A N     1 
ATOM   1665  C  CA    . LEU A  1 205 ? 22.307  -26.991 -18.373 1.00 17.17 ? 216 LEU A CA    1 
ATOM   1666  C  C     . LEU A  1 205 ? 22.746  -28.389 -18.811 1.00 16.24 ? 216 LEU A C     1 
ATOM   1667  O  O     . LEU A  1 205 ? 21.900  -29.235 -19.036 1.00 14.75 ? 216 LEU A O     1 
ATOM   1668  C  CB    . LEU A  1 205 ? 21.587  -26.249 -19.521 1.00 19.67 ? 216 LEU A CB    1 
ATOM   1669  C  CG    . LEU A  1 205 ? 22.147  -26.462 -20.923 1.00 25.41 ? 216 LEU A CG    1 
ATOM   1670  C  CD1   . LEU A  1 205 ? 21.165  -26.061 -21.974 1.00 26.34 ? 216 LEU A CD1   1 
ATOM   1671  C  CD2   . LEU A  1 205 ? 23.397  -25.727 -21.087 1.00 29.72 ? 216 LEU A CD2   1 
ATOM   1672  N  N     . ARG A  1 206 ? 24.069  -28.628 -18.905 1.00 15.01 ? 217 ARG A N     1 
ATOM   1673  C  CA    . ARG A  1 206 ? 24.608  -29.957 -19.268 1.00 14.70 ? 217 ARG A CA    1 
ATOM   1674  C  C     . ARG A  1 206 ? 24.622  -30.936 -18.077 1.00 15.78 ? 217 ARG A C     1 
ATOM   1675  O  O     . ARG A  1 206 ? 24.861  -32.123 -18.277 1.00 15.90 ? 217 ARG A O     1 
ATOM   1676  C  CB    . ARG A  1 206 ? 25.981  -29.839 -19.967 1.00 14.26 ? 217 ARG A CB    1 
ATOM   1677  C  CG    . ARG A  1 206 ? 25.862  -29.136 -21.331 1.00 15.84 ? 217 ARG A CG    1 
ATOM   1678  C  CD    . ARG A  1 206 ? 27.194  -28.578 -21.791 1.00 21.46 ? 217 ARG A CD    1 
ATOM   1679  N  NE    . ARG A  1 206 ? 27.629  -27.428 -20.979 1.00 17.56 ? 217 ARG A NE    1 
ATOM   1680  C  CZ    . ARG A  1 206 ? 28.645  -26.638 -21.298 1.00 24.95 ? 217 ARG A CZ    1 
ATOM   1681  N  NH1   . ARG A  1 206 ? 29.351  -26.863 -22.407 1.00 11.40 ? 217 ARG A NH1   1 
ATOM   1682  N  NH2   . ARG A  1 206 ? 28.982  -25.633 -20.503 1.00 13.77 ? 217 ARG A NH2   1 
ATOM   1683  N  N     . ASP A  1 207 ? 24.302  -30.462 -16.845 1.00 11.60 ? 218 ASP A N     1 
ATOM   1684  C  CA    . ASP A  1 207 ? 24.215  -31.357 -15.682 1.00 10.79 ? 218 ASP A CA    1 
ATOM   1685  C  C     . ASP A  1 207 ? 22.799  -31.914 -15.686 1.00 15.83 ? 218 ASP A C     1 
ATOM   1686  O  O     . ASP A  1 207 ? 21.845  -31.194 -15.382 1.00 15.29 ? 218 ASP A O     1 
ATOM   1687  C  CB    . ASP A  1 207 ? 24.548  -30.622 -14.369 1.00 12.17 ? 218 ASP A CB    1 
ATOM   1688  C  CG    . ASP A  1 207 ? 25.971  -30.121 -14.293 1.00 21.62 ? 218 ASP A CG    1 
ATOM   1689  O  OD1   . ASP A  1 207 ? 26.215  -29.167 -13.541 1.00 19.46 ? 218 ASP A OD1   1 
ATOM   1690  O  OD2   . ASP A  1 207 ? 26.841  -30.660 -15.033 1.00 23.33 ? 218 ASP A OD2   1 
ATOM   1691  N  N     . ILE A  1 208 ? 22.656  -33.170 -16.135 1.00 11.91 ? 219 ILE A N     1 
ATOM   1692  C  CA    . ILE A  1 208 ? 21.358  -33.788 -16.354 1.00 13.24 ? 219 ILE A CA    1 
ATOM   1693  C  C     . ILE A  1 208 ? 21.082  -35.050 -15.529 1.00 17.47 ? 219 ILE A C     1 
ATOM   1694  O  O     . ILE A  1 208 ? 20.089  -35.727 -15.774 1.00 16.27 ? 219 ILE A O     1 
ATOM   1695  C  CB    . ILE A  1 208 ? 21.146  -34.073 -17.882 1.00 17.35 ? 219 ILE A CB    1 
ATOM   1696  C  CG1   . ILE A  1 208 ? 22.200  -35.099 -18.407 1.00 19.04 ? 219 ILE A CG1   1 
ATOM   1697  C  CG2   . ILE A  1 208 ? 21.151  -32.772 -18.722 1.00 18.48 ? 219 ILE A CG2   1 
ATOM   1698  C  CD1   . ILE A  1 208 ? 21.841  -35.837 -19.733 1.00 20.34 ? 219 ILE A CD1   1 
ATOM   1699  N  N     . GLY A  1 209 ? 21.937  -35.365 -14.576 1.00 15.91 ? 220 GLY A N     1 
ATOM   1700  C  CA    . GLY A  1 209 ? 21.738  -36.576 -13.793 1.00 16.56 ? 220 GLY A CA    1 
ATOM   1701  C  C     . GLY A  1 209 ? 22.696  -37.640 -14.284 1.00 20.85 ? 220 GLY A C     1 
ATOM   1702  O  O     . GLY A  1 209 ? 23.340  -37.460 -15.330 1.00 18.29 ? 220 GLY A O     1 
ATOM   1703  N  N     . ALA A  1 210 ? 22.828  -38.732 -13.514 1.00 18.53 ? 221 ALA A N     1 
ATOM   1704  C  CA    . ALA A  1 210 ? 23.720  -39.843 -13.864 1.00 18.72 ? 221 ALA A CA    1 
ATOM   1705  C  C     . ALA A  1 210 ? 23.068  -41.183 -13.504 1.00 21.47 ? 221 ALA A C     1 
ATOM   1706  O  O     . ALA A  1 210 ? 22.196  -41.214 -12.642 1.00 17.61 ? 221 ALA A O     1 
ATOM   1707  C  CB    . ALA A  1 210 ? 25.061  -39.684 -13.158 1.00 19.37 ? 221 ALA A CB    1 
ATOM   1708  N  N     . GLY A  1 211 ? 23.457  -42.265 -14.206 1.00 19.72 ? 222 GLY A N     1 
ATOM   1709  C  CA    . GLY A  1 211 ? 22.927  -43.606 -13.969 1.00 18.27 ? 222 GLY A CA    1 
ATOM   1710  C  C     . GLY A  1 211 ? 21.437  -43.647 -14.184 1.00 22.21 ? 222 GLY A C     1 
ATOM   1711  O  O     . GLY A  1 211 ? 20.953  -43.066 -15.162 1.00 22.75 ? 222 GLY A O     1 
ATOM   1712  N  N     . LYS A  1 212 ? 20.675  -44.260 -13.241 1.00 18.92 ? 223 LYS A N     1 
ATOM   1713  C  CA    . LYS A  1 212 ? 19.205  -44.283 -13.356 1.00 19.14 ? 223 LYS A CA    1 
ATOM   1714  C  C     . LYS A  1 212 ? 18.593  -42.856 -13.375 1.00 20.78 ? 223 LYS A C     1 
ATOM   1715  O  O     . LYS A  1 212 ? 17.489  -42.673 -13.894 1.00 20.41 ? 223 LYS A O     1 
ATOM   1716  C  CB    . LYS A  1 212 ? 18.588  -45.075 -12.203 1.00 22.93 ? 223 LYS A CB    1 
ATOM   1717  C  CG    . LYS A  1 212 ? 18.307  -46.531 -12.555 1.00 44.32 ? 223 LYS A CG    1 
ATOM   1718  C  CD    . LYS A  1 212 ? 17.715  -47.309 -11.374 1.00 56.85 ? 223 LYS A CD    1 
ATOM   1719  C  CE    . LYS A  1 212 ? 16.219  -47.145 -11.205 1.00 69.95 ? 223 LYS A CE    1 
ATOM   1720  N  NZ    . LYS A  1 212 ? 15.449  -47.775 -12.313 1.00 78.31 ? 223 LYS A NZ    1 
ATOM   1721  N  N     . GLY A  1 213 ? 19.321  -41.884 -12.812 1.00 16.68 ? 224 GLY A N     1 
ATOM   1722  C  CA    . GLY A  1 213 ? 18.901  -40.479 -12.732 1.00 16.44 ? 224 GLY A CA    1 
ATOM   1723  C  C     . GLY A  1 213 ? 19.210  -39.643 -13.969 1.00 18.43 ? 224 GLY A C     1 
ATOM   1724  O  O     . GLY A  1 213 ? 18.881  -38.453 -14.005 1.00 17.27 ? 224 GLY A O     1 
ATOM   1725  N  N     . LYS A  1 214 ? 19.815  -40.239 -15.009 1.00 14.35 ? 225 LYS A N     1 
ATOM   1726  C  CA    . LYS A  1 214 ? 20.111  -39.470 -16.243 1.00 13.93 ? 225 LYS A CA    1 
ATOM   1727  C  C     . LYS A  1 214 ? 18.798  -38.978 -16.874 1.00 17.19 ? 225 LYS A C     1 
ATOM   1728  O  O     . LYS A  1 214 ? 17.872  -39.772 -17.037 1.00 17.77 ? 225 LYS A O     1 
ATOM   1729  C  CB    . LYS A  1 214 ? 20.942  -40.302 -17.233 1.00 17.09 ? 225 LYS A CB    1 
ATOM   1730  C  CG    . LYS A  1 214 ? 21.540  -39.452 -18.362 1.00 24.70 ? 225 LYS A CG    1 
ATOM   1731  C  CD    . LYS A  1 214 ? 22.219  -40.322 -19.435 1.00 26.55 ? 225 LYS A CD    1 
ATOM   1732  C  CE    . LYS A  1 214 ? 22.704  -39.478 -20.591 1.00 35.35 ? 225 LYS A CE    1 
ATOM   1733  N  NZ    . LYS A  1 214 ? 23.328  -40.298 -21.665 1.00 49.40 ? 225 LYS A NZ    1 
ATOM   1734  N  N     . TYR A  1 215 ? 18.709  -37.660 -17.172 1.00 13.17 ? 226 TYR A N     1 
ATOM   1735  C  CA    . TYR A  1 215 ? 17.526  -36.942 -17.694 1.00 12.86 ? 226 TYR A CA    1 
ATOM   1736  C  C     . TYR A  1 215 ? 16.519  -36.589 -16.599 1.00 15.70 ? 226 TYR A C     1 
ATOM   1737  O  O     . TYR A  1 215 ? 15.437  -36.073 -16.912 1.00 15.73 ? 226 TYR A O     1 
ATOM   1738  C  CB    . TYR A  1 215 ? 16.834  -37.672 -18.862 1.00 13.69 ? 226 TYR A CB    1 
ATOM   1739  C  CG    . TYR A  1 215 ? 17.772  -37.945 -20.016 1.00 17.11 ? 226 TYR A CG    1 
ATOM   1740  C  CD1   . TYR A  1 215 ? 18.311  -36.902 -20.763 1.00 18.67 ? 226 TYR A CD1   1 
ATOM   1741  C  CD2   . TYR A  1 215 ? 18.121  -39.250 -20.362 1.00 17.89 ? 226 TYR A CD2   1 
ATOM   1742  C  CE1   . TYR A  1 215 ? 19.169  -37.147 -21.833 1.00 19.89 ? 226 TYR A CE1   1 
ATOM   1743  C  CE2   . TYR A  1 215 ? 18.987  -39.508 -21.427 1.00 18.47 ? 226 TYR A CE2   1 
ATOM   1744  C  CZ    . TYR A  1 215 ? 19.495  -38.451 -22.168 1.00 26.30 ? 226 TYR A CZ    1 
ATOM   1745  O  OH    . TYR A  1 215 ? 20.358  -38.672 -23.213 1.00 26.21 ? 226 TYR A OH    1 
ATOM   1746  N  N     . TYR A  1 216 ? 16.877  -36.849 -15.324 1.00 13.65 ? 227 TYR A N     1 
ATOM   1747  C  CA    . TYR A  1 216 ? 16.000  -36.530 -14.189 1.00 13.31 ? 227 TYR A CA    1 
ATOM   1748  C  C     . TYR A  1 216 ? 16.512  -35.346 -13.341 1.00 16.88 ? 227 TYR A C     1 
ATOM   1749  O  O     . TYR A  1 216 ? 16.044  -35.118 -12.217 1.00 14.65 ? 227 TYR A O     1 
ATOM   1750  C  CB    . TYR A  1 216 ? 15.678  -37.791 -13.353 1.00 13.01 ? 227 TYR A CB    1 
ATOM   1751  C  CG    . TYR A  1 216 ? 14.898  -38.818 -14.141 1.00 13.51 ? 227 TYR A CG    1 
ATOM   1752  C  CD1   . TYR A  1 216 ? 15.551  -39.821 -14.859 1.00 15.28 ? 227 TYR A CD1   1 
ATOM   1753  C  CD2   . TYR A  1 216 ? 13.516  -38.749 -14.229 1.00 14.48 ? 227 TYR A CD2   1 
ATOM   1754  C  CE1   . TYR A  1 216 ? 14.836  -40.761 -15.608 1.00 13.82 ? 227 TYR A CE1   1 
ATOM   1755  C  CE2   . TYR A  1 216 ? 12.789  -39.684 -14.966 1.00 16.62 ? 227 TYR A CE2   1 
ATOM   1756  C  CZ    . TYR A  1 216 ? 13.455  -40.683 -15.658 1.00 20.53 ? 227 TYR A CZ    1 
ATOM   1757  O  OH    . TYR A  1 216 ? 12.720  -41.582 -16.376 1.00 19.43 ? 227 TYR A OH    1 
ATOM   1758  N  N     . ALA A  1 217 ? 17.486  -34.589 -13.889 1.00 12.80 ? 228 ALA A N     1 
ATOM   1759  C  CA    . ALA A  1 217 ? 17.962  -33.338 -13.295 1.00 12.28 ? 228 ALA A CA    1 
ATOM   1760  C  C     . ALA A  1 217 ? 17.901  -32.355 -14.445 1.00 16.47 ? 228 ALA A C     1 
ATOM   1761  O  O     . ALA A  1 217 ? 18.343  -32.661 -15.560 1.00 16.26 ? 228 ALA A O     1 
ATOM   1762  C  CB    . ALA A  1 217 ? 19.382  -33.450 -12.745 1.00 11.98 ? 228 ALA A CB    1 
ATOM   1763  N  N     . VAL A  1 218 ? 17.263  -31.228 -14.204 1.00 12.78 ? 229 VAL A N     1 
ATOM   1764  C  CA    . VAL A  1 218 ? 17.026  -30.180 -15.201 1.00 11.77 ? 229 VAL A CA    1 
ATOM   1765  C  C     . VAL A  1 218 ? 17.529  -28.879 -14.629 1.00 15.06 ? 229 VAL A C     1 
ATOM   1766  O  O     . VAL A  1 218 ? 17.144  -28.515 -13.516 1.00 14.32 ? 229 VAL A O     1 
ATOM   1767  C  CB    . VAL A  1 218 ? 15.514  -30.107 -15.550 1.00 15.24 ? 229 VAL A CB    1 
ATOM   1768  C  CG1   . VAL A  1 218 ? 15.187  -28.909 -16.452 1.00 15.16 ? 229 VAL A CG1   1 
ATOM   1769  C  CG2   . VAL A  1 218 ? 15.030  -31.408 -16.183 1.00 15.17 ? 229 VAL A CG2   1 
ATOM   1770  N  N     . ASN A  1 219 ? 18.392  -28.166 -15.391 1.00 9.86  ? 230 ASN A N     1 
ATOM   1771  C  CA    . ASN A  1 219 ? 18.931  -26.876 -14.964 1.00 9.75  ? 230 ASN A CA    1 
ATOM   1772  C  C     . ASN A  1 219 ? 18.688  -25.852 -16.035 1.00 14.41 ? 230 ASN A C     1 
ATOM   1773  O  O     . ASN A  1 219 ? 19.012  -26.112 -17.194 1.00 14.24 ? 230 ASN A O     1 
ATOM   1774  C  CB    . ASN A  1 219 ? 20.427  -27.022 -14.664 1.00 11.12 ? 230 ASN A CB    1 
ATOM   1775  C  CG    . ASN A  1 219 ? 20.632  -27.788 -13.385 1.00 20.61 ? 230 ASN A CG    1 
ATOM   1776  O  OD1   . ASN A  1 219 ? 20.240  -27.327 -12.311 1.00 14.80 ? 230 ASN A OD1   1 
ATOM   1777  N  ND2   . ASN A  1 219 ? 21.171  -28.993 -13.475 1.00 12.46 ? 230 ASN A ND2   1 
ATOM   1778  N  N     . PHE A  1 220 ? 18.130  -24.689 -15.664 1.00 10.70 ? 231 PHE A N     1 
ATOM   1779  C  CA    . PHE A  1 220 ? 17.915  -23.595 -16.598 1.00 9.41  ? 231 PHE A CA    1 
ATOM   1780  C  C     . PHE A  1 220 ? 18.822  -22.450 -16.153 1.00 12.80 ? 231 PHE A C     1 
ATOM   1781  O  O     . PHE A  1 220 ? 18.427  -21.666 -15.285 1.00 11.83 ? 231 PHE A O     1 
ATOM   1782  C  CB    . PHE A  1 220 ? 16.446  -23.165 -16.637 1.00 10.55 ? 231 PHE A CB    1 
ATOM   1783  C  CG    . PHE A  1 220 ? 16.094  -22.325 -17.846 1.00 11.31 ? 231 PHE A CG    1 
ATOM   1784  C  CD1   . PHE A  1 220 ? 15.072  -22.711 -18.703 1.00 12.27 ? 231 PHE A CD1   1 
ATOM   1785  C  CD2   . PHE A  1 220 ? 16.760  -21.123 -18.104 1.00 11.74 ? 231 PHE A CD2   1 
ATOM   1786  C  CE1   . PHE A  1 220 ? 14.748  -21.933 -19.812 1.00 13.80 ? 231 PHE A CE1   1 
ATOM   1787  C  CE2   . PHE A  1 220 ? 16.488  -20.393 -19.258 1.00 13.49 ? 231 PHE A CE2   1 
ATOM   1788  C  CZ    . PHE A  1 220 ? 15.491  -20.809 -20.110 1.00 12.36 ? 231 PHE A CZ    1 
ATOM   1789  N  N     . PRO A  1 221 ? 20.057  -22.364 -16.706 1.00 12.73 ? 232 PRO A N     1 
ATOM   1790  C  CA    . PRO A  1 221 ? 20.993  -21.296 -16.292 1.00 11.81 ? 232 PRO A CA    1 
ATOM   1791  C  C     . PRO A  1 221 ? 20.577  -19.935 -16.858 1.00 14.39 ? 232 PRO A C     1 
ATOM   1792  O  O     . PRO A  1 221 ? 20.184  -19.842 -18.023 1.00 14.48 ? 232 PRO A O     1 
ATOM   1793  C  CB    . PRO A  1 221 ? 22.323  -21.778 -16.879 1.00 13.75 ? 232 PRO A CB    1 
ATOM   1794  C  CG    . PRO A  1 221 ? 21.923  -22.533 -18.118 1.00 17.31 ? 232 PRO A CG    1 
ATOM   1795  C  CD    . PRO A  1 221 ? 20.673  -23.257 -17.715 1.00 13.43 ? 232 PRO A CD    1 
ATOM   1796  N  N     . MET A  1 222 ? 20.616  -18.879 -16.025 1.00 10.83 ? 233 MET A N     1 
ATOM   1797  C  CA    . MET A  1 222 ? 20.145  -17.547 -16.440 1.00 9.70  ? 233 MET A CA    1 
ATOM   1798  C  C     . MET A  1 222 ? 21.193  -16.476 -16.183 1.00 13.79 ? 233 MET A C     1 
ATOM   1799  O  O     . MET A  1 222 ? 22.131  -16.682 -15.412 1.00 13.86 ? 233 MET A O     1 
ATOM   1800  C  CB    . MET A  1 222 ? 18.847  -17.184 -15.678 1.00 11.58 ? 233 MET A CB    1 
ATOM   1801  C  CG    . MET A  1 222 ? 17.597  -17.957 -16.143 1.00 14.67 ? 233 MET A CG    1 
ATOM   1802  S  SD    . MET A  1 222 ? 16.302  -17.869 -14.862 1.00 17.82 ? 233 MET A SD    1 
ATOM   1803  C  CE    . MET A  1 222 ? 15.014  -18.773 -15.642 1.00 15.26 ? 233 MET A CE    1 
ATOM   1804  N  N     . ARG A  1 223 ? 21.020  -15.327 -16.829 1.00 10.88 ? 234 ARG A N     1 
ATOM   1805  C  CA    . ARG A  1 223 ? 21.924  -14.188 -16.677 1.00 11.30 ? 234 ARG A CA    1 
ATOM   1806  C  C     . ARG A  1 223 ? 21.278  -13.141 -15.800 1.00 15.18 ? 234 ARG A C     1 
ATOM   1807  O  O     . ARG A  1 223 ? 20.097  -13.265 -15.452 1.00 13.33 ? 234 ARG A O     1 
ATOM   1808  C  CB    . ARG A  1 223 ? 22.270  -13.590 -18.061 1.00 11.46 ? 234 ARG A CB    1 
ATOM   1809  C  CG    . ARG A  1 223 ? 22.855  -14.574 -19.072 1.00 11.28 ? 234 ARG A CG    1 
ATOM   1810  C  CD    . ARG A  1 223 ? 24.220  -15.114 -18.653 1.00 19.18 ? 234 ARG A CD    1 
ATOM   1811  N  NE    . ARG A  1 223 ? 24.795  -15.965 -19.700 1.00 15.65 ? 234 ARG A NE    1 
ATOM   1812  C  CZ    . ARG A  1 223 ? 25.262  -17.192 -19.511 1.00 17.80 ? 234 ARG A CZ    1 
ATOM   1813  N  NH1   . ARG A  1 223 ? 25.260  -17.731 -18.300 1.00 16.78 ? 234 ARG A NH1   1 
ATOM   1814  N  NH2   . ARG A  1 223 ? 25.786  -17.869 -20.520 1.00 9.86  ? 234 ARG A NH2   1 
ATOM   1815  N  N     . ASP A  1 224 ? 22.029  -12.079 -15.460 1.00 12.03 ? 235 ASP A N     1 
ATOM   1816  C  CA    . ASP A  1 224 ? 21.492  -10.971 -14.672 1.00 12.16 ? 235 ASP A CA    1 
ATOM   1817  C  C     . ASP A  1 224 ? 20.241  -10.361 -15.304 1.00 14.34 ? 235 ASP A C     1 
ATOM   1818  O  O     . ASP A  1 224 ? 20.093  -10.328 -16.532 1.00 13.30 ? 235 ASP A O     1 
ATOM   1819  C  CB    . ASP A  1 224 ? 22.532  -9.836  -14.596 1.00 14.27 ? 235 ASP A CB    1 
ATOM   1820  C  CG    . ASP A  1 224 ? 23.703  -10.057 -13.677 1.00 23.17 ? 235 ASP A CG    1 
ATOM   1821  O  OD1   . ASP A  1 224 ? 23.815  -11.148 -13.118 1.00 22.23 ? 235 ASP A OD1   1 
ATOM   1822  O  OD2   . ASP A  1 224 ? 24.506  -9.130  -13.517 1.00 30.41 ? 235 ASP A OD2   1 
ATOM   1823  N  N     . GLY A  1 225 ? 19.365  -9.854  -14.444 1.00 11.39 ? 236 GLY A N     1 
ATOM   1824  C  CA    . GLY A  1 225 ? 18.234  -9.017  -14.827 1.00 10.79 ? 236 GLY A CA    1 
ATOM   1825  C  C     . GLY A  1 225 ? 17.007  -9.617  -15.443 1.00 14.55 ? 236 GLY A C     1 
ATOM   1826  O  O     . GLY A  1 225 ? 16.200  -8.866  -16.013 1.00 13.44 ? 236 GLY A O     1 
ATOM   1827  N  N     . ILE A  1 226 ? 16.813  -10.956 -15.313 1.00 12.36 ? 237 ILE A N     1 
ATOM   1828  C  CA    . ILE A  1 226 ? 15.601  -11.578 -15.842 1.00 12.12 ? 237 ILE A CA    1 
ATOM   1829  C  C     . ILE A  1 226 ? 14.361  -10.885 -15.258 1.00 14.70 ? 237 ILE A C     1 
ATOM   1830  O  O     . ILE A  1 226 ? 14.361  -10.509 -14.075 1.00 13.93 ? 237 ILE A O     1 
ATOM   1831  C  CB    . ILE A  1 226 ? 15.567  -13.121 -15.666 1.00 15.42 ? 237 ILE A CB    1 
ATOM   1832  C  CG1   . ILE A  1 226 ? 14.563  -13.743 -16.664 1.00 16.76 ? 237 ILE A CG1   1 
ATOM   1833  C  CG2   . ILE A  1 226 ? 15.265  -13.526 -14.208 1.00 13.56 ? 237 ILE A CG2   1 
ATOM   1834  C  CD1   . ILE A  1 226 ? 14.622  -15.165 -16.805 1.00 26.72 ? 237 ILE A CD1   1 
ATOM   1835  N  N     . ASP A  1 227 ? 13.332  -10.701 -16.086 1.00 11.23 ? 238 ASP A N     1 
ATOM   1836  C  CA    . ASP A  1 227 ? 12.107  -10.020 -15.678 1.00 10.30 ? 238 ASP A CA    1 
ATOM   1837  C  C     . ASP A  1 227 ? 10.915  -10.943 -15.729 1.00 13.19 ? 238 ASP A C     1 
ATOM   1838  O  O     . ASP A  1 227 ? 11.074  -12.108 -16.095 1.00 12.08 ? 238 ASP A O     1 
ATOM   1839  C  CB    . ASP A  1 227 ? 11.911  -8.716  -16.493 1.00 12.42 ? 238 ASP A CB    1 
ATOM   1840  C  CG    . ASP A  1 227 ? 11.979  -8.910  -18.004 1.00 23.92 ? 238 ASP A CG    1 
ATOM   1841  O  OD1   . ASP A  1 227 ? 11.656  -10.018 -18.478 1.00 20.90 ? 238 ASP A OD1   1 
ATOM   1842  O  OD2   . ASP A  1 227 ? 12.353  -7.950  -18.709 1.00 28.17 ? 238 ASP A OD2   1 
ATOM   1843  N  N     . ASP A  1 228 ? 9.729   -10.448 -15.340 1.00 10.94 ? 239 ASP A N     1 
ATOM   1844  C  CA    . ASP A  1 228 ? 8.499   -11.236 -15.300 1.00 12.33 ? 239 ASP A CA    1 
ATOM   1845  C  C     . ASP A  1 228 ? 8.150   -11.844 -16.654 1.00 20.13 ? 239 ASP A C     1 
ATOM   1846  O  O     . ASP A  1 228 ? 7.818   -13.029 -16.726 1.00 18.15 ? 239 ASP A O     1 
ATOM   1847  C  CB    . ASP A  1 228 ? 7.327   -10.387 -14.813 1.00 12.95 ? 239 ASP A CB    1 
ATOM   1848  C  CG    . ASP A  1 228 ? 7.432   -9.930  -13.372 1.00 13.64 ? 239 ASP A CG    1 
ATOM   1849  O  OD1   . ASP A  1 228 ? 8.299   -10.461 -12.635 1.00 11.78 ? 239 ASP A OD1   1 
ATOM   1850  O  OD2   . ASP A  1 228 ? 6.565   -9.147  -12.941 1.00 18.77 ? 239 ASP A OD2   1 
ATOM   1851  N  N     . GLU A  1 229 ? 8.235   -11.023 -17.714 1.00 18.84 ? 240 GLU A N     1 
ATOM   1852  C  CA    . GLU A  1 229 ? 7.924   -11.444 -19.078 1.00 19.80 ? 240 GLU A CA    1 
ATOM   1853  C  C     . GLU A  1 229 ? 8.788   -12.600 -19.548 1.00 19.60 ? 240 GLU A C     1 
ATOM   1854  O  O     . GLU A  1 229 ? 8.235   -13.603 -19.997 1.00 19.62 ? 240 GLU A O     1 
ATOM   1855  C  CB    . GLU A  1 229 ? 7.998   -10.250 -20.043 1.00 22.05 ? 240 GLU A CB    1 
ATOM   1856  C  CG    . GLU A  1 229 ? 6.616   -9.872  -20.545 1.00 41.60 ? 240 GLU A CG    1 
ATOM   1857  C  CD    . GLU A  1 229 ? 6.554   -9.009  -21.792 1.00 76.43 ? 240 GLU A CD    1 
ATOM   1858  O  OE1   . GLU A  1 229 ? 5.841   -7.979  -21.760 1.00 79.62 ? 240 GLU A OE1   1 
ATOM   1859  O  OE2   . GLU A  1 229 ? 7.177   -9.381  -22.814 1.00 72.25 ? 240 GLU A OE2   1 
ATOM   1860  N  N     . SER A  1 230 ? 10.113  -12.501 -19.372 1.00 15.60 ? 241 SER A N     1 
ATOM   1861  C  CA    . SER A  1 230 ? 11.064  -13.552 -19.755 1.00 17.05 ? 241 SER A CA    1 
ATOM   1862  C  C     . SER A  1 230 ? 10.892  -14.821 -18.925 1.00 19.25 ? 241 SER A C     1 
ATOM   1863  O  O     . SER A  1 230 ? 10.895  -15.914 -19.487 1.00 17.47 ? 241 SER A O     1 
ATOM   1864  C  CB    . SER A  1 230 ? 12.497  -13.047 -19.647 1.00 22.65 ? 241 SER A CB    1 
ATOM   1865  O  OG    . SER A  1 230 ? 12.656  -11.934 -20.509 1.00 36.48 ? 241 SER A OG    1 
ATOM   1866  N  N     . TYR A  1 231 ? 10.708  -14.683 -17.592 1.00 14.80 ? 242 TYR A N     1 
ATOM   1867  C  CA    . TYR A  1 231 ? 10.532  -15.858 -16.724 1.00 13.75 ? 242 TYR A CA    1 
ATOM   1868  C  C     . TYR A  1 231 ? 9.254   -16.599 -17.114 1.00 18.20 ? 242 TYR A C     1 
ATOM   1869  O  O     . TYR A  1 231 ? 9.271   -17.815 -17.318 1.00 16.65 ? 242 TYR A O     1 
ATOM   1870  C  CB    . TYR A  1 231 ? 10.451  -15.427 -15.244 1.00 13.04 ? 242 TYR A CB    1 
ATOM   1871  C  CG    . TYR A  1 231 ? 11.058  -16.442 -14.304 1.00 12.26 ? 242 TYR A CG    1 
ATOM   1872  C  CD1   . TYR A  1 231 ? 12.364  -16.298 -13.842 1.00 12.13 ? 242 TYR A CD1   1 
ATOM   1873  C  CD2   . TYR A  1 231 ? 10.309  -17.518 -13.826 1.00 13.17 ? 242 TYR A CD2   1 
ATOM   1874  C  CE1   . TYR A  1 231 ? 12.910  -17.194 -12.926 1.00 13.07 ? 242 TYR A CE1   1 
ATOM   1875  C  CE2   . TYR A  1 231 ? 10.842  -18.415 -12.899 1.00 12.37 ? 242 TYR A CE2   1 
ATOM   1876  C  CZ    . TYR A  1 231 ? 12.144  -18.254 -12.459 1.00 12.99 ? 242 TYR A CZ    1 
ATOM   1877  O  OH    . TYR A  1 231 ? 12.692  -19.145 -11.570 1.00 10.18 ? 242 TYR A OH    1 
ATOM   1878  N  N     . GLY A  1 232 ? 8.179   -15.844 -17.277 1.00 18.61 ? 243 GLY A N     1 
ATOM   1879  C  CA    . GLY A  1 232 ? 6.869   -16.355 -17.678 1.00 20.47 ? 243 GLY A CA    1 
ATOM   1880  C  C     . GLY A  1 232 ? 6.865   -17.016 -19.046 1.00 26.05 ? 243 GLY A C     1 
ATOM   1881  O  O     . GLY A  1 232 ? 6.059   -17.914 -19.278 1.00 27.46 ? 243 GLY A O     1 
ATOM   1882  N  N     . GLN A  1 233 ? 7.797   -16.603 -19.933 1.00 23.49 ? 244 GLN A N     1 
ATOM   1883  C  CA    . GLN A  1 233 ? 8.039   -17.104 -21.304 1.00 23.24 ? 244 GLN A CA    1 
ATOM   1884  C  C     . GLN A  1 233 ? 8.462   -18.594 -21.220 1.00 23.73 ? 244 GLN A C     1 
ATOM   1885  O  O     . GLN A  1 233 ? 8.102   -19.394 -22.082 1.00 22.46 ? 244 GLN A O     1 
ATOM   1886  C  CB    A GLN A  1 233 ? 9.154   -16.221 -21.983 0.85 24.87 ? 244 GLN A CB    1 
ATOM   1887  C  CG    A GLN A  1 233 ? 9.681   -16.554 -23.422 0.85 38.26 ? 244 GLN A CG    1 
ATOM   1888  C  CD    A GLN A  1 233 ? 10.841  -15.664 -23.969 0.85 42.84 ? 244 GLN A CD    1 
ATOM   1889  O  OE1   A GLN A  1 233 ? 11.217  -14.609 -23.408 0.85 32.31 ? 244 GLN A OE1   1 
ATOM   1890  N  NE2   A GLN A  1 233 ? 11.448  -16.055 -25.117 0.85 16.22 ? 244 GLN A NE2   1 
ATOM   1891  N  N     . ILE A  1 234 ? 9.214   -18.966 -20.175 1.00 16.40 ? 245 ILE A N     1 
ATOM   1892  C  CA    . ILE A  1 234 ? 9.736   -20.318 -20.077 1.00 14.74 ? 245 ILE A CA    1 
ATOM   1893  C  C     . ILE A  1 234 ? 9.203   -21.201 -18.977 1.00 16.09 ? 245 ILE A C     1 
ATOM   1894  O  O     . ILE A  1 234 ? 9.308   -22.411 -19.102 1.00 14.14 ? 245 ILE A O     1 
ATOM   1895  C  CB    . ILE A  1 234 ? 11.290  -20.318 -20.091 1.00 18.26 ? 245 ILE A CB    1 
ATOM   1896  C  CG1   . ILE A  1 234 ? 11.876  -19.523 -18.892 1.00 18.77 ? 245 ILE A CG1   1 
ATOM   1897  C  CG2   . ILE A  1 234 ? 11.831  -19.813 -21.433 1.00 18.98 ? 245 ILE A CG2   1 
ATOM   1898  C  CD1   . ILE A  1 234 ? 12.099  -20.380 -17.584 1.00 26.37 ? 245 ILE A CD1   1 
ATOM   1899  N  N     . PHE A  1 235 ? 8.737   -20.628 -17.867 1.00 11.57 ? 246 PHE A N     1 
ATOM   1900  C  CA    . PHE A  1 235 ? 8.332   -21.432 -16.720 1.00 10.69 ? 246 PHE A CA    1 
ATOM   1901  C  C     . PHE A  1 235 ? 7.151   -22.358 -17.011 1.00 12.43 ? 246 PHE A C     1 
ATOM   1902  O  O     . PHE A  1 235 ? 7.284   -23.565 -16.839 1.00 13.77 ? 246 PHE A O     1 
ATOM   1903  C  CB    . PHE A  1 235 ? 8.100   -20.546 -15.480 1.00 11.46 ? 246 PHE A CB    1 
ATOM   1904  C  CG    . PHE A  1 235 ? 7.907   -21.357 -14.218 1.00 10.83 ? 246 PHE A CG    1 
ATOM   1905  C  CD1   . PHE A  1 235 ? 6.634   -21.746 -13.809 1.00 13.90 ? 246 PHE A CD1   1 
ATOM   1906  C  CD2   . PHE A  1 235 ? 8.999   -21.772 -13.464 1.00 10.24 ? 246 PHE A CD2   1 
ATOM   1907  C  CE1   . PHE A  1 235 ? 6.454   -22.507 -12.648 1.00 14.00 ? 246 PHE A CE1   1 
ATOM   1908  C  CE2   . PHE A  1 235 ? 8.823   -22.562 -12.328 1.00 12.72 ? 246 PHE A CE2   1 
ATOM   1909  C  CZ    . PHE A  1 235 ? 7.551   -22.922 -11.919 1.00 11.25 ? 246 PHE A CZ    1 
ATOM   1910  N  N     . LYS A  1 236 ? 6.017   -21.810 -17.463 1.00 9.99  ? 247 LYS A N     1 
ATOM   1911  C  CA    . LYS A  1 236 ? 4.839   -22.634 -17.788 1.00 10.83 ? 247 LYS A CA    1 
ATOM   1912  C  C     . LYS A  1 236 ? 5.185   -23.707 -18.860 1.00 15.90 ? 247 LYS A C     1 
ATOM   1913  O  O     . LYS A  1 236 ? 4.992   -24.895 -18.566 1.00 15.54 ? 247 LYS A O     1 
ATOM   1914  C  CB    . LYS A  1 236 ? 3.642   -21.775 -18.203 1.00 14.22 ? 247 LYS A CB    1 
ATOM   1915  C  CG    . LYS A  1 236 ? 2.351   -22.589 -18.286 1.00 27.07 ? 247 LYS A CG    1 
ATOM   1916  C  CD    . LYS A  1 236 ? 1.153   -21.741 -18.641 1.00 34.53 ? 247 LYS A CD    1 
ATOM   1917  C  CE    . LYS A  1 236 ? -0.156  -22.508 -18.557 1.00 49.42 ? 247 LYS A CE    1 
ATOM   1918  N  NZ    . LYS A  1 236 ? -0.126  -23.809 -19.287 1.00 64.96 ? 247 LYS A NZ    1 
ATOM   1919  N  N     . PRO A  1 237 ? 5.796   -23.359 -20.032 1.00 13.27 ? 248 PRO A N     1 
ATOM   1920  C  CA    . PRO A  1 237 ? 6.141   -24.421 -21.010 1.00 13.35 ? 248 PRO A CA    1 
ATOM   1921  C  C     . PRO A  1 237 ? 7.031   -25.535 -20.440 1.00 16.11 ? 248 PRO A C     1 
ATOM   1922  O  O     . PRO A  1 237 ? 6.778   -26.708 -20.733 1.00 15.55 ? 248 PRO A O     1 
ATOM   1923  C  CB    . PRO A  1 237 ? 6.861   -23.656 -22.135 1.00 15.63 ? 248 PRO A CB    1 
ATOM   1924  C  CG    . PRO A  1 237 ? 6.416   -22.256 -22.011 1.00 19.23 ? 248 PRO A CG    1 
ATOM   1925  C  CD    . PRO A  1 237 ? 6.094   -22.011 -20.574 1.00 14.19 ? 248 PRO A CD    1 
ATOM   1926  N  N     . ILE A  1 238 ? 8.067   -25.187 -19.631 1.00 11.73 ? 249 ILE A N     1 
ATOM   1927  C  CA    A ILE A  1 238 ? 8.978   -26.182 -19.044 0.48 11.65 ? 249 ILE A CA    1 
ATOM   1928  C  CA    B ILE A  1 238 ? 8.946   -26.213 -19.069 0.52 11.38 ? 249 ILE A CA    1 
ATOM   1929  C  C     . ILE A  1 238 ? 8.237   -27.074 -18.047 1.00 15.72 ? 249 ILE A C     1 
ATOM   1930  O  O     . ILE A  1 238 ? 8.337   -28.300 -18.125 1.00 14.78 ? 249 ILE A O     1 
ATOM   1931  C  CB    A ILE A  1 238 ? 10.275  -25.539 -18.445 0.48 14.35 ? 249 ILE A CB    1 
ATOM   1932  C  CB    B ILE A  1 238 ? 10.315  -25.670 -18.600 0.52 13.74 ? 249 ILE A CB    1 
ATOM   1933  C  CG1   A ILE A  1 238 ? 11.212  -24.955 -19.560 0.48 14.72 ? 249 ILE A CG1   1 
ATOM   1934  C  CG1   B ILE A  1 238 ? 11.117  -25.206 -19.835 0.52 13.51 ? 249 ILE A CG1   1 
ATOM   1935  C  CG2   A ILE A  1 238 ? 11.036  -26.509 -17.507 0.48 13.97 ? 249 ILE A CG2   1 
ATOM   1936  C  CG2   B ILE A  1 238 ? 11.106  -26.745 -17.806 0.52 12.75 ? 249 ILE A CG2   1 
ATOM   1937  C  CD1   A ILE A  1 238 ? 12.021  -25.972 -20.462 0.48 16.78 ? 249 ILE A CD1   1 
ATOM   1938  C  CD1   B ILE A  1 238 ? 12.099  -24.215 -19.559 0.52 12.78 ? 249 ILE A CD1   1 
ATOM   1939  N  N     . ILE A  1 239 ? 7.513   -26.452 -17.103 1.00 12.77 ? 250 ILE A N     1 
ATOM   1940  C  CA    . ILE A  1 239 ? 6.804   -27.239 -16.100 1.00 11.75 ? 250 ILE A CA    1 
ATOM   1941  C  C     . ILE A  1 239 ? 5.738   -28.108 -16.737 1.00 14.48 ? 250 ILE A C     1 
ATOM   1942  O  O     . ILE A  1 239 ? 5.637   -29.280 -16.375 1.00 12.52 ? 250 ILE A O     1 
ATOM   1943  C  CB    . ILE A  1 239 ? 6.317   -26.423 -14.868 1.00 13.87 ? 250 ILE A CB    1 
ATOM   1944  C  CG1   . ILE A  1 239 ? 7.532   -25.760 -14.137 1.00 11.96 ? 250 ILE A CG1   1 
ATOM   1945  C  CG2   . ILE A  1 239 ? 5.478   -27.318 -13.901 1.00 13.35 ? 250 ILE A CG2   1 
ATOM   1946  C  CD1   . ILE A  1 239 ? 8.697   -26.681 -13.748 1.00 10.26 ? 250 ILE A CD1   1 
ATOM   1947  N  N     . SER A  1 240 ? 5.011   -27.571 -17.733 1.00 12.36 ? 251 SER A N     1 
ATOM   1948  C  CA    . SER A  1 240 ? 4.007   -28.367 -18.436 1.00 13.66 ? 251 SER A CA    1 
ATOM   1949  C  C     . SER A  1 240 ? 4.630   -29.606 -19.085 1.00 16.06 ? 251 SER A C     1 
ATOM   1950  O  O     . SER A  1 240 ? 4.074   -30.706 -18.956 1.00 15.28 ? 251 SER A O     1 
ATOM   1951  C  CB    . SER A  1 240 ? 3.258   -27.528 -19.462 1.00 16.80 ? 251 SER A CB    1 
ATOM   1952  O  OG    . SER A  1 240 ? 2.536   -26.505 -18.803 1.00 21.96 ? 251 SER A OG    1 
ATOM   1953  N  N     . LYS A  1 241 ? 5.795   -29.447 -19.750 1.00 13.69 ? 252 LYS A N     1 
ATOM   1954  C  CA    . LYS A  1 241 ? 6.472   -30.594 -20.383 1.00 14.38 ? 252 LYS A CA    1 
ATOM   1955  C  C     . LYS A  1 241 ? 6.965   -31.600 -19.347 1.00 17.21 ? 252 LYS A C     1 
ATOM   1956  O  O     . LYS A  1 241 ? 6.845   -32.810 -19.525 1.00 13.81 ? 252 LYS A O     1 
ATOM   1957  C  CB    . LYS A  1 241 ? 7.614   -30.140 -21.306 1.00 15.82 ? 252 LYS A CB    1 
ATOM   1958  C  CG    . LYS A  1 241 ? 8.268   -31.260 -22.131 1.00 24.66 ? 252 LYS A CG    1 
ATOM   1959  C  CD    . LYS A  1 241 ? 7.330   -31.957 -23.135 1.00 30.47 ? 252 LYS A CD    1 
ATOM   1960  C  CE    . LYS A  1 241 ? 6.987   -31.147 -24.365 1.00 40.25 ? 252 LYS A CE    1 
ATOM   1961  N  NZ    . LYS A  1 241 ? 5.857   -31.762 -25.119 1.00 44.74 ? 252 LYS A NZ    1 
ATOM   1962  N  N     . VAL A  1 242 ? 7.485   -31.090 -18.246 1.00 15.05 ? 253 VAL A N     1 
ATOM   1963  C  CA    . VAL A  1 242 ? 7.942   -31.929 -17.143 1.00 13.21 ? 253 VAL A CA    1 
ATOM   1964  C  C     . VAL A  1 242 ? 6.765   -32.747 -16.599 1.00 15.86 ? 253 VAL A C     1 
ATOM   1965  O  O     . VAL A  1 242 ? 6.894   -33.958 -16.440 1.00 14.38 ? 253 VAL A O     1 
ATOM   1966  C  CB    . VAL A  1 242 ? 8.657   -31.081 -16.061 1.00 16.90 ? 253 VAL A CB    1 
ATOM   1967  C  CG1   . VAL A  1 242 ? 8.772   -31.851 -14.753 1.00 17.11 ? 253 VAL A CG1   1 
ATOM   1968  C  CG2   . VAL A  1 242 ? 10.039  -30.644 -16.542 1.00 16.85 ? 253 VAL A CG2   1 
ATOM   1969  N  N     . MET A  1 243 ? 5.609   -32.097 -16.375 1.00 12.31 ? 254 MET A N     1 
ATOM   1970  C  CA    . MET A  1 243 ? 4.420   -32.786 -15.862 1.00 11.46 ? 254 MET A CA    1 
ATOM   1971  C  C     . MET A  1 243 ? 3.973   -33.878 -16.820 1.00 17.92 ? 254 MET A C     1 
ATOM   1972  O  O     . MET A  1 243 ? 3.725   -35.015 -16.396 1.00 17.20 ? 254 MET A O     1 
ATOM   1973  C  CB    . MET A  1 243 ? 3.288   -31.794 -15.574 1.00 12.31 ? 254 MET A CB    1 
ATOM   1974  C  CG    . MET A  1 243 ? 3.607   -30.862 -14.428 1.00 14.29 ? 254 MET A CG    1 
ATOM   1975  S  SD    . MET A  1 243 ? 3.533   -31.701 -12.824 1.00 16.83 ? 254 MET A SD    1 
ATOM   1976  C  CE    . MET A  1 243 ? 3.583   -30.219 -11.725 1.00 13.18 ? 254 MET A CE    1 
ATOM   1977  N  N     . GLU A  1 244 ? 3.940   -33.549 -18.113 1.00 16.43 ? 255 GLU A N     1 
ATOM   1978  C  CA    . GLU A  1 244 ? 3.521   -34.462 -19.184 1.00 16.25 ? 255 GLU A CA    1 
ATOM   1979  C  C     . GLU A  1 244 ? 4.399   -35.700 -19.234 1.00 19.12 ? 255 GLU A C     1 
ATOM   1980  O  O     . GLU A  1 244 ? 3.885   -36.814 -19.244 1.00 19.78 ? 255 GLU A O     1 
ATOM   1981  C  CB    . GLU A  1 244 ? 3.585   -33.734 -20.543 1.00 18.07 ? 255 GLU A CB    1 
ATOM   1982  C  CG    . GLU A  1 244 ? 3.268   -34.639 -21.727 1.00 30.35 ? 255 GLU A CG    1 
ATOM   1983  C  CD    . GLU A  1 244 ? 3.561   -34.101 -23.116 1.00 51.97 ? 255 GLU A CD    1 
ATOM   1984  O  OE1   . GLU A  1 244 ? 3.757   -32.873 -23.268 1.00 40.97 ? 255 GLU A OE1   1 
ATOM   1985  O  OE2   . GLU A  1 244 ? 3.564   -34.918 -24.064 1.00 48.12 ? 255 GLU A OE2   1 
ATOM   1986  N  N     . MET A  1 245 ? 5.723   -35.499 -19.275 1.00 15.71 ? 256 MET A N     1 
ATOM   1987  C  CA    . MET A  1 245 ? 6.699   -36.563 -19.412 1.00 15.38 ? 256 MET A CA    1 
ATOM   1988  C  C     . MET A  1 245 ? 6.949   -37.331 -18.124 1.00 19.89 ? 256 MET A C     1 
ATOM   1989  O  O     . MET A  1 245 ? 7.141   -38.549 -18.163 1.00 18.98 ? 256 MET A O     1 
ATOM   1990  C  CB    . MET A  1 245 ? 8.030   -36.000 -19.941 1.00 17.51 ? 256 MET A CB    1 
ATOM   1991  C  CG    . MET A  1 245 ? 7.919   -35.304 -21.311 1.00 21.57 ? 256 MET A CG    1 
ATOM   1992  S  SD    . MET A  1 245 ? 7.240   -36.374 -22.606 1.00 25.75 ? 256 MET A SD    1 
ATOM   1993  C  CE    . MET A  1 245 ? 8.505   -37.635 -22.683 1.00 22.56 ? 256 MET A CE    1 
ATOM   1994  N  N     . TYR A  1 246 ? 7.081   -36.607 -17.006 1.00 14.70 ? 257 TYR A N     1 
ATOM   1995  C  CA    . TYR A  1 246 ? 7.433   -37.228 -15.731 1.00 13.63 ? 257 TYR A CA    1 
ATOM   1996  C  C     . TYR A  1 246 ? 6.251   -37.773 -14.938 1.00 14.51 ? 257 TYR A C     1 
ATOM   1997  O  O     . TYR A  1 246 ? 6.433   -38.747 -14.206 1.00 14.78 ? 257 TYR A O     1 
ATOM   1998  C  CB    . TYR A  1 246 ? 8.315   -36.301 -14.890 1.00 12.94 ? 257 TYR A CB    1 
ATOM   1999  C  CG    . TYR A  1 246 ? 8.909   -36.941 -13.652 1.00 13.20 ? 257 TYR A CG    1 
ATOM   2000  C  CD1   . TYR A  1 246 ? 8.673   -36.406 -12.386 1.00 14.20 ? 257 TYR A CD1   1 
ATOM   2001  C  CD2   . TYR A  1 246 ? 9.739   -38.058 -13.748 1.00 12.80 ? 257 TYR A CD2   1 
ATOM   2002  C  CE1   . TYR A  1 246 ? 9.273   -36.949 -11.253 1.00 14.38 ? 257 TYR A CE1   1 
ATOM   2003  C  CE2   . TYR A  1 246 ? 10.342  -38.611 -12.621 1.00 11.66 ? 257 TYR A CE2   1 
ATOM   2004  C  CZ    . TYR A  1 246 ? 10.099  -38.058 -11.375 1.00 17.72 ? 257 TYR A CZ    1 
ATOM   2005  O  OH    . TYR A  1 246 ? 10.680  -38.620 -10.266 1.00 14.79 ? 257 TYR A OH    1 
ATOM   2006  N  N     . GLN A  1 247 ? 5.060   -37.160 -15.055 1.00 13.86 ? 258 GLN A N     1 
ATOM   2007  C  CA    . GLN A  1 247 ? 3.840   -37.638 -14.355 1.00 14.17 ? 258 GLN A CA    1 
ATOM   2008  C  C     . GLN A  1 247 ? 4.088   -37.863 -12.832 1.00 17.44 ? 258 GLN A C     1 
ATOM   2009  O  O     . GLN A  1 247 ? 3.915   -38.974 -12.311 1.00 16.98 ? 258 GLN A O     1 
ATOM   2010  C  CB    . GLN A  1 247 ? 3.301   -38.917 -15.041 1.00 16.14 ? 258 GLN A CB    1 
ATOM   2011  C  CG    . GLN A  1 247 ? 2.747   -38.618 -16.433 1.00 27.33 ? 258 GLN A CG    1 
ATOM   2012  C  CD    . GLN A  1 247 ? 2.670   -39.835 -17.314 1.00 48.94 ? 258 GLN A CD    1 
ATOM   2013  O  OE1   . GLN A  1 247 ? 2.051   -40.844 -16.966 1.00 42.30 ? 258 GLN A OE1   1 
ATOM   2014  N  NE2   . GLN A  1 247 ? 3.246   -39.735 -18.511 1.00 44.26 ? 258 GLN A NE2   1 
ATOM   2015  N  N     . PRO A  1 248 ? 4.589   -36.831 -12.119 1.00 13.99 ? 259 PRO A N     1 
ATOM   2016  C  CA    . PRO A  1 248 ? 4.850   -37.013 -10.676 1.00 12.99 ? 259 PRO A CA    1 
ATOM   2017  C  C     . PRO A  1 248 ? 3.540   -37.115 -9.894  1.00 15.19 ? 259 PRO A C     1 
ATOM   2018  O  O     . PRO A  1 248 ? 2.505   -36.678 -10.399 1.00 14.45 ? 259 PRO A O     1 
ATOM   2019  C  CB    . PRO A  1 248 ? 5.624   -35.747 -10.316 1.00 14.63 ? 259 PRO A CB    1 
ATOM   2020  C  CG    . PRO A  1 248 ? 5.054   -34.682 -11.269 1.00 18.46 ? 259 PRO A CG    1 
ATOM   2021  C  CD    . PRO A  1 248 ? 4.845   -35.433 -12.551 1.00 13.87 ? 259 PRO A CD    1 
ATOM   2022  N  N     . SER A  1 249 ? 3.549   -37.718 -8.697  1.00 13.61 ? 260 SER A N     1 
ATOM   2023  C  CA    . SER A  1 249 ? 2.314   -37.718 -7.895  1.00 14.26 ? 260 SER A CA    1 
ATOM   2024  C  C     . SER A  1 249 ? 2.362   -36.686 -6.728  1.00 16.19 ? 260 SER A C     1 
ATOM   2025  O  O     . SER A  1 249 ? 1.355   -36.461 -6.051  1.00 13.26 ? 260 SER A O     1 
ATOM   2026  C  CB    . SER A  1 249 ? 1.933   -39.117 -7.413  1.00 15.81 ? 260 SER A CB    1 
ATOM   2027  O  OG    . SER A  1 249 ? 3.016   -39.723 -6.735  1.00 20.73 ? 260 SER A OG    1 
ATOM   2028  N  N     . ALA A  1 250 ? 3.526   -36.063 -6.500  1.00 12.76 ? 261 ALA A N     1 
ATOM   2029  C  CA    . ALA A  1 250 ? 3.652   -35.005 -5.487  1.00 12.33 ? 261 ALA A CA    1 
ATOM   2030  C  C     . ALA A  1 250 ? 4.685   -34.020 -5.933  1.00 13.96 ? 261 ALA A C     1 
ATOM   2031  O  O     . ALA A  1 250 ? 5.583   -34.360 -6.712  1.00 12.43 ? 261 ALA A O     1 
ATOM   2032  C  CB    . ALA A  1 250 ? 3.994   -35.549 -4.111  1.00 12.85 ? 261 ALA A CB    1 
ATOM   2033  N  N     . VAL A  1 251 ? 4.519   -32.772 -5.500  1.00 10.11 ? 262 VAL A N     1 
ATOM   2034  C  CA    . VAL A  1 251 ? 5.439   -31.697 -5.897  1.00 9.89  ? 262 VAL A CA    1 
ATOM   2035  C  C     . VAL A  1 251 ? 5.977   -30.959 -4.669  1.00 13.29 ? 262 VAL A C     1 
ATOM   2036  O  O     . VAL A  1 251 ? 5.237   -30.732 -3.712  1.00 12.82 ? 262 VAL A O     1 
ATOM   2037  C  CB    . VAL A  1 251 ? 4.753   -30.707 -6.882  1.00 13.59 ? 262 VAL A CB    1 
ATOM   2038  C  CG1   . VAL A  1 251 ? 5.731   -29.634 -7.395  1.00 12.86 ? 262 VAL A CG1   1 
ATOM   2039  C  CG2   . VAL A  1 251 ? 4.091   -31.443 -8.048  1.00 13.62 ? 262 VAL A CG2   1 
ATOM   2040  N  N     . VAL A  1 252 ? 7.252   -30.533 -4.735  1.00 9.54  ? 263 VAL A N     1 
ATOM   2041  C  CA    . VAL A  1 252 ? 7.869   -29.691 -3.698  1.00 9.14  ? 263 VAL A CA    1 
ATOM   2042  C  C     . VAL A  1 252 ? 8.342   -28.422 -4.414  1.00 12.13 ? 263 VAL A C     1 
ATOM   2043  O  O     . VAL A  1 252 ? 9.124   -28.505 -5.364  1.00 11.36 ? 263 VAL A O     1 
ATOM   2044  C  CB    . VAL A  1 252 ? 9.028   -30.373 -2.929  1.00 12.79 ? 263 VAL A CB    1 
ATOM   2045  C  CG1   . VAL A  1 252 ? 9.676   -29.392 -1.936  1.00 11.46 ? 263 VAL A CG1   1 
ATOM   2046  C  CG2   . VAL A  1 252 ? 8.542   -31.635 -2.208  1.00 12.72 ? 263 VAL A CG2   1 
ATOM   2047  N  N     . LEU A  1 253 ? 7.867   -27.261 -3.977  1.00 7.43  ? 264 LEU A N     1 
ATOM   2048  C  CA    . LEU A  1 253 ? 8.248   -26.022 -4.655  1.00 7.86  ? 264 LEU A CA    1 
ATOM   2049  C  C     . LEU A  1 253 ? 9.026   -25.124 -3.719  1.00 11.13 ? 264 LEU A C     1 
ATOM   2050  O  O     . LEU A  1 253 ? 8.487   -24.658 -2.703  1.00 10.45 ? 264 LEU A O     1 
ATOM   2051  C  CB    . LEU A  1 253 ? 6.991   -25.317 -5.227  1.00 7.36  ? 264 LEU A CB    1 
ATOM   2052  C  CG    . LEU A  1 253 ? 7.185   -23.929 -5.903  1.00 9.19  ? 264 LEU A CG    1 
ATOM   2053  C  CD1   . LEU A  1 253 ? 8.137   -23.979 -7.113  1.00 7.83  ? 264 LEU A CD1   1 
ATOM   2054  C  CD2   . LEU A  1 253 ? 5.851   -23.322 -6.287  1.00 9.72  ? 264 LEU A CD2   1 
ATOM   2055  N  N     . GLN A  1 254 ? 10.310  -24.907 -4.046  1.00 7.07  ? 265 GLN A N     1 
ATOM   2056  C  CA    . GLN A  1 254 ? 11.170  -24.022 -3.242  1.00 6.77  ? 265 GLN A CA    1 
ATOM   2057  C  C     . GLN A  1 254 ? 10.978  -22.604 -3.831  1.00 10.64 ? 265 GLN A C     1 
ATOM   2058  O  O     . GLN A  1 254 ? 11.160  -22.404 -5.036  1.00 10.15 ? 265 GLN A O     1 
ATOM   2059  C  CB    . GLN A  1 254 ? 12.621  -24.547 -3.245  1.00 6.90  ? 265 GLN A CB    1 
ATOM   2060  C  CG    . GLN A  1 254 ? 13.554  -23.985 -2.147  1.00 8.12  ? 265 GLN A CG    1 
ATOM   2061  C  CD    . GLN A  1 254 ? 14.215  -22.679 -2.542  1.00 11.63 ? 265 GLN A CD    1 
ATOM   2062  O  OE1   . GLN A  1 254 ? 13.749  -21.958 -3.426  1.00 11.00 ? 265 GLN A OE1   1 
ATOM   2063  N  NE2   . GLN A  1 254 ? 15.303  -22.341 -1.873  1.00 8.70  ? 265 GLN A NE2   1 
ATOM   2064  N  N     . CYS A  1 255 ? 10.519  -21.652 -2.980  1.00 8.56  ? 266 CYS A N     1 
ATOM   2065  C  CA    . CYS A  1 255 ? 10.128  -20.306 -3.349  1.00 9.20  ? 266 CYS A CA    1 
ATOM   2066  C  C     . CYS A  1 255 ? 11.109  -19.247 -2.874  1.00 11.95 ? 266 CYS A C     1 
ATOM   2067  O  O     . CYS A  1 255 ? 10.676  -18.153 -2.490  1.00 11.20 ? 266 CYS A O     1 
ATOM   2068  C  CB    . CYS A  1 255 ? 8.706   -20.007 -2.857  1.00 10.33 ? 266 CYS A CB    1 
ATOM   2069  S  SG    . CYS A  1 255 ? 7.436   -21.176 -3.435  1.00 13.39 ? 266 CYS A SG    1 
ATOM   2070  N  N     . GLY A  1 256 ? 12.405  -19.551 -2.909  1.00 7.89  ? 267 GLY A N     1 
ATOM   2071  C  CA    . GLY A  1 256 ? 13.431  -18.582 -2.503  1.00 7.87  ? 267 GLY A CA    1 
ATOM   2072  C  C     . GLY A  1 256 ? 13.139  -17.229 -3.135  1.00 10.02 ? 267 GLY A C     1 
ATOM   2073  O  O     . GLY A  1 256 ? 12.950  -17.149 -4.354  1.00 8.95  ? 267 GLY A O     1 
ATOM   2074  N  N     . ALA A  1 257 ? 12.972  -16.191 -2.289  1.00 8.85  ? 268 ALA A N     1 
ATOM   2075  C  CA    . ALA A  1 257 ? 12.598  -14.824 -2.687  1.00 7.83  ? 268 ALA A CA    1 
ATOM   2076  C  C     . ALA A  1 257 ? 13.768  -13.946 -3.131  1.00 11.44 ? 268 ALA A C     1 
ATOM   2077  O  O     . ALA A  1 257 ? 13.553  -12.776 -3.435  1.00 10.97 ? 268 ALA A O     1 
ATOM   2078  C  CB    . ALA A  1 257 ? 11.784  -14.141 -1.563  1.00 8.29  ? 268 ALA A CB    1 
ATOM   2079  N  N     . ASP A  1 258 ? 15.000  -14.510 -3.222  1.00 9.23  ? 269 ASP A N     1 
ATOM   2080  C  CA    . ASP A  1 258 ? 16.171  -13.740 -3.667  1.00 8.84  ? 269 ASP A CA    1 
ATOM   2081  C  C     . ASP A  1 258 ? 16.209  -13.585 -5.199  1.00 13.54 ? 269 ASP A C     1 
ATOM   2082  O  O     . ASP A  1 258 ? 17.130  -12.955 -5.731  1.00 14.19 ? 269 ASP A O     1 
ATOM   2083  C  CB    . ASP A  1 258 ? 17.494  -14.328 -3.120  1.00 9.32  ? 269 ASP A CB    1 
ATOM   2084  C  CG    . ASP A  1 258 ? 17.597  -15.824 -3.245  1.00 11.50 ? 269 ASP A CG    1 
ATOM   2085  O  OD1   . ASP A  1 258 ? 16.795  -16.410 -3.993  1.00 10.09 ? 269 ASP A OD1   1 
ATOM   2086  O  OD2   . ASP A  1 258 ? 18.510  -16.407 -2.638  1.00 9.54  ? 269 ASP A OD2   1 
ATOM   2087  N  N     . SER A  1 259 ? 15.194  -14.132 -5.897  1.00 10.09 ? 270 SER A N     1 
ATOM   2088  C  CA    . SER A  1 259 ? 15.048  -13.958 -7.355  1.00 9.66  ? 270 SER A CA    1 
ATOM   2089  C  C     . SER A  1 259 ? 14.208  -12.678 -7.656  1.00 12.69 ? 270 SER A C     1 
ATOM   2090  O  O     . SER A  1 259 ? 13.939  -12.377 -8.815  1.00 11.87 ? 270 SER A O     1 
ATOM   2091  C  CB    . SER A  1 259 ? 14.444  -15.201 -7.998  1.00 11.25 ? 270 SER A CB    1 
ATOM   2092  O  OG    . SER A  1 259 ? 13.430  -15.762 -7.176  1.00 12.11 ? 270 SER A OG    1 
ATOM   2093  N  N     . LEU A  1 260 ? 13.827  -11.913 -6.609  1.00 9.83  ? 271 LEU A N     1 
ATOM   2094  C  CA    . LEU A  1 260 ? 13.075  -10.658 -6.768  1.00 9.10  ? 271 LEU A CA    1 
ATOM   2095  C  C     . LEU A  1 260 ? 14.021  -9.524  -7.016  1.00 12.19 ? 271 LEU A C     1 
ATOM   2096  O  O     . LEU A  1 260 ? 15.124  -9.469  -6.437  1.00 12.20 ? 271 LEU A O     1 
ATOM   2097  C  CB    . LEU A  1 260 ? 12.273  -10.285 -5.486  1.00 8.85  ? 271 LEU A CB    1 
ATOM   2098  C  CG    . LEU A  1 260 ? 11.150  -11.256 -5.040  1.00 12.39 ? 271 LEU A CG    1 
ATOM   2099  C  CD1   . LEU A  1 260 ? 10.586  -10.852 -3.671  1.00 9.19  ? 271 LEU A CD1   1 
ATOM   2100  C  CD2   . LEU A  1 260 ? 10.011  -11.325 -6.082  1.00 13.57 ? 271 LEU A CD2   1 
ATOM   2101  N  N     . SER A  1 261 ? 13.508  -8.540  -7.753  1.00 10.00 ? 272 SER A N     1 
ATOM   2102  C  CA    . SER A  1 261 ? 14.129  -7.247  -8.020  1.00 10.09 ? 272 SER A CA    1 
ATOM   2103  C  C     . SER A  1 261 ? 14.484  -6.616  -6.679  1.00 15.24 ? 272 SER A C     1 
ATOM   2104  O  O     . SER A  1 261 ? 13.688  -6.690  -5.739  1.00 13.07 ? 272 SER A O     1 
ATOM   2105  C  CB    . SER A  1 261 ? 13.093  -6.344  -8.689  1.00 12.91 ? 272 SER A CB    1 
ATOM   2106  O  OG    . SER A  1 261 ? 13.620  -5.058  -8.968  1.00 20.91 ? 272 SER A OG    1 
ATOM   2107  N  N     . GLY A  1 262 ? 15.667  -6.020  -6.614  1.00 14.47 ? 273 GLY A N     1 
ATOM   2108  C  CA    . GLY A  1 262 ? 16.145  -5.293  -5.441  1.00 13.99 ? 273 GLY A CA    1 
ATOM   2109  C  C     . GLY A  1 262 ? 16.649  -6.144  -4.296  1.00 15.51 ? 273 GLY A C     1 
ATOM   2110  O  O     . GLY A  1 262 ? 16.887  -5.610  -3.209  1.00 14.55 ? 273 GLY A O     1 
ATOM   2111  N  N     . ASP A  1 263 ? 16.827  -7.466  -4.509  1.00 10.75 ? 274 ASP A N     1 
ATOM   2112  C  CA    . ASP A  1 263 ? 17.380  -8.335  -3.477  1.00 9.82  ? 274 ASP A CA    1 
ATOM   2113  C  C     . ASP A  1 263 ? 18.822  -7.914  -3.180  1.00 14.05 ? 274 ASP A C     1 
ATOM   2114  O  O     . ASP A  1 263 ? 19.580  -7.618  -4.102  1.00 14.52 ? 274 ASP A O     1 
ATOM   2115  C  CB    . ASP A  1 263 ? 17.356  -9.821  -3.883  1.00 10.52 ? 274 ASP A CB    1 
ATOM   2116  C  CG    . ASP A  1 263 ? 17.718  -10.702 -2.707  1.00 12.33 ? 274 ASP A CG    1 
ATOM   2117  O  OD1   . ASP A  1 263 ? 16.840  -10.929 -1.841  1.00 13.24 ? 274 ASP A OD1   1 
ATOM   2118  O  OD2   . ASP A  1 263 ? 18.889  -11.099 -2.613  1.00 13.82 ? 274 ASP A OD2   1 
ATOM   2119  N  N     . ARG A  1 264 ? 19.196  -7.911  -1.902  1.00 11.69 ? 275 ARG A N     1 
ATOM   2120  C  CA    . ARG A  1 264 ? 20.522  -7.501  -1.431  1.00 12.58 ? 275 ARG A CA    1 
ATOM   2121  C  C     . ARG A  1 264 ? 21.649  -8.340  -2.040  1.00 17.41 ? 275 ARG A C     1 
ATOM   2122  O  O     . ARG A  1 264 ? 22.723  -7.800  -2.293  1.00 14.80 ? 275 ARG A O     1 
ATOM   2123  C  CB    . ARG A  1 264 ? 20.542  -7.546  0.121   1.00 14.15 ? 275 ARG A CB    1 
ATOM   2124  C  CG    . ARG A  1 264 ? 21.826  -7.119  0.812   1.00 30.82 ? 275 ARG A CG    1 
ATOM   2125  C  CD    . ARG A  1 264 ? 21.673  -7.234  2.325   1.00 40.76 ? 275 ARG A CD    1 
ATOM   2126  N  NE    . ARG A  1 264 ? 22.960  -7.388  3.011   1.00 49.19 ? 275 ARG A NE    1 
ATOM   2127  C  CZ    . ARG A  1 264 ? 23.098  -7.454  4.333   1.00 59.45 ? 275 ARG A CZ    1 
ATOM   2128  N  NH1   . ARG A  1 264 ? 22.033  -7.391  5.124   1.00 37.43 ? 275 ARG A NH1   1 
ATOM   2129  N  NH2   . ARG A  1 264 ? 24.304  -7.578  4.875   1.00 45.10 ? 275 ARG A NH2   1 
ATOM   2130  N  N     . LEU A  1 265 ? 21.409  -9.651  -2.265  1.00 14.61 ? 276 LEU A N     1 
ATOM   2131  C  CA    . LEU A  1 265 ? 22.390  -10.576 -2.854  1.00 14.77 ? 276 LEU A CA    1 
ATOM   2132  C  C     . LEU A  1 265 ? 22.054  -10.941 -4.297  1.00 19.63 ? 276 LEU A C     1 
ATOM   2133  O  O     . LEU A  1 265 ? 22.954  -11.293 -5.054  1.00 22.11 ? 276 LEU A O     1 
ATOM   2134  C  CB    . LEU A  1 265 ? 22.513  -11.888 -2.049  1.00 14.82 ? 276 LEU A CB    1 
ATOM   2135  C  CG    . LEU A  1 265 ? 23.007  -11.848 -0.583  1.00 18.85 ? 276 LEU A CG    1 
ATOM   2136  C  CD1   . LEU A  1 265 ? 23.378  -13.237 -0.113  1.00 16.53 ? 276 LEU A CD1   1 
ATOM   2137  C  CD2   . LEU A  1 265 ? 24.188  -10.922 -0.392  1.00 22.86 ? 276 LEU A CD2   1 
ATOM   2138  N  N     . GLY A  1 266 ? 20.778  -10.891 -4.645  1.00 14.75 ? 277 GLY A N     1 
ATOM   2139  C  CA    . GLY A  1 266 ? 20.284  -11.265 -5.964  1.00 14.63 ? 277 GLY A CA    1 
ATOM   2140  C  C     . GLY A  1 266 ? 20.545  -10.258 -7.060  1.00 20.20 ? 277 GLY A C     1 
ATOM   2141  O  O     . GLY A  1 266 ? 20.823  -9.091  -6.792  1.00 20.05 ? 277 GLY A O     1 
ATOM   2142  N  N     . CYS A  1 267 ? 20.465  -10.715 -8.312  1.00 15.55 ? 278 CYS A N     1 
ATOM   2143  C  CA    . CYS A  1 267 ? 20.718  -9.886  -9.483  1.00 15.29 ? 278 CYS A CA    1 
ATOM   2144  C  C     . CYS A  1 267 ? 19.622  -10.109 -10.536 1.00 17.16 ? 278 CYS A C     1 
ATOM   2145  O  O     . CYS A  1 267 ? 19.843  -9.834  -11.722 1.00 16.48 ? 278 CYS A O     1 
ATOM   2146  C  CB    A CYS A  1 267 ? 22.114  -10.160 -10.044 0.82 15.76 ? 278 CYS A CB    1 
ATOM   2147  C  CB    B CYS A  1 267 ? 22.106  -10.178 -10.054 0.18 16.12 ? 278 CYS A CB    1 
ATOM   2148  S  SG    A CYS A  1 267 ? 22.410  -11.898 -10.425 0.82 19.62 ? 278 CYS A SG    1 
ATOM   2149  S  SG    B CYS A  1 267 ? 23.478  -9.686  -8.979  0.18 20.33 ? 278 CYS A SG    1 
ATOM   2150  N  N     . PHE A  1 268 ? 18.417  -10.573 -10.102 1.00 11.03 ? 279 PHE A N     1 
ATOM   2151  C  CA    . PHE A  1 268 ? 17.275  -10.758 -10.991 1.00 10.48 ? 279 PHE A CA    1 
ATOM   2152  C  C     . PHE A  1 268 ? 16.345  -9.564  -10.857 1.00 14.77 ? 279 PHE A C     1 
ATOM   2153  O  O     . PHE A  1 268 ? 16.582  -8.696  -10.008 1.00 15.41 ? 279 PHE A O     1 
ATOM   2154  C  CB    . PHE A  1 268 ? 16.518  -12.059 -10.649 1.00 11.99 ? 279 PHE A CB    1 
ATOM   2155  C  CG    . PHE A  1 268 ? 17.034  -13.356 -11.233 1.00 11.78 ? 279 PHE A CG    1 
ATOM   2156  C  CD1   . PHE A  1 268 ? 16.330  -14.543 -11.054 1.00 13.81 ? 279 PHE A CD1   1 
ATOM   2157  C  CD2   . PHE A  1 268 ? 18.215  -13.392 -11.970 1.00 12.11 ? 279 PHE A CD2   1 
ATOM   2158  C  CE1   . PHE A  1 268 ? 16.794  -15.743 -11.604 1.00 14.58 ? 279 PHE A CE1   1 
ATOM   2159  C  CE2   . PHE A  1 268 ? 18.682  -14.602 -12.525 1.00 14.22 ? 279 PHE A CE2   1 
ATOM   2160  C  CZ    . PHE A  1 268 ? 17.961  -15.765 -12.340 1.00 13.51 ? 279 PHE A CZ    1 
ATOM   2161  N  N     . ASN A  1 269 ? 15.279  -9.532  -11.656 1.00 11.03 ? 280 ASN A N     1 
ATOM   2162  C  CA    . ASN A  1 269 ? 14.368  -8.385  -11.693 1.00 11.11 ? 280 ASN A CA    1 
ATOM   2163  C  C     . ASN A  1 269 ? 12.892  -8.801  -11.708 1.00 15.33 ? 280 ASN A C     1 
ATOM   2164  O  O     . ASN A  1 269 ? 12.059  -8.163  -12.358 1.00 14.30 ? 280 ASN A O     1 
ATOM   2165  C  CB    . ASN A  1 269 ? 14.744  -7.478  -12.896 1.00 12.13 ? 280 ASN A CB    1 
ATOM   2166  C  CG    . ASN A  1 269 ? 14.244  -6.049  -12.758 1.00 19.54 ? 280 ASN A CG    1 
ATOM   2167  O  OD1   . ASN A  1 269 ? 13.962  -5.588  -11.659 1.00 14.58 ? 280 ASN A OD1   1 
ATOM   2168  N  ND2   . ASN A  1 269 ? 14.022  -5.356  -13.869 1.00 14.91 ? 280 ASN A ND2   1 
ATOM   2169  N  N     . LEU A  1 270 ? 12.561  -9.900  -10.986 1.00 10.95 ? 281 LEU A N     1 
ATOM   2170  C  CA    . LEU A  1 270 ? 11.162  -10.321 -10.886 1.00 10.55 ? 281 LEU A CA    1 
ATOM   2171  C  C     . LEU A  1 270 ? 10.403  -9.470  -9.883  1.00 13.82 ? 281 LEU A C     1 
ATOM   2172  O  O     . LEU A  1 270 ? 10.996  -8.980  -8.933  1.00 13.88 ? 281 LEU A O     1 
ATOM   2173  C  CB    . LEU A  1 270 ? 11.061  -11.794 -10.423 1.00 10.17 ? 281 LEU A CB    1 
ATOM   2174  C  CG    . LEU A  1 270 ? 11.757  -12.878 -11.278 1.00 13.37 ? 281 LEU A CG    1 
ATOM   2175  C  CD1   . LEU A  1 270 ? 11.488  -14.245 -10.686 1.00 11.48 ? 281 LEU A CD1   1 
ATOM   2176  C  CD2   . LEU A  1 270 ? 11.288  -12.823 -12.753 1.00 14.23 ? 281 LEU A CD2   1 
ATOM   2177  N  N     . THR A  1 271 ? 9.096   -9.309  -10.092 1.00 12.14 ? 282 THR A N     1 
ATOM   2178  C  CA    . THR A  1 271 ? 8.198   -8.667  -9.133  1.00 11.50 ? 282 THR A CA    1 
ATOM   2179  C  C     . THR A  1 271 ? 7.604   -9.815  -8.322  1.00 13.06 ? 282 THR A C     1 
ATOM   2180  O  O     . THR A  1 271 ? 7.853   -10.986 -8.626  1.00 11.46 ? 282 THR A O     1 
ATOM   2181  C  CB    . THR A  1 271 ? 7.087   -7.835  -9.823  1.00 14.48 ? 282 THR A CB    1 
ATOM   2182  O  OG1   . THR A  1 271 ? 6.139   -8.701  -10.460 1.00 15.00 ? 282 THR A OG1   1 
ATOM   2183  C  CG2   . THR A  1 271 ? 7.639   -6.800  -10.802 1.00 15.81 ? 282 THR A CG2   1 
ATOM   2184  N  N     . VAL A  1 272 ? 6.814   -9.497  -7.305  1.00 10.50 ? 283 VAL A N     1 
ATOM   2185  C  CA    . VAL A  1 272 ? 6.158   -10.515 -6.485  1.00 10.16 ? 283 VAL A CA    1 
ATOM   2186  C  C     . VAL A  1 272 ? 5.108   -11.247 -7.362  1.00 13.89 ? 283 VAL A C     1 
ATOM   2187  O  O     . VAL A  1 272 ? 4.957   -12.455 -7.243  1.00 13.00 ? 283 VAL A O     1 
ATOM   2188  C  CB    . VAL A  1 272 ? 5.545   -9.856  -5.228  1.00 13.24 ? 283 VAL A CB    1 
ATOM   2189  C  CG1   . VAL A  1 272 ? 4.496   -10.755 -4.587  1.00 12.37 ? 283 VAL A CG1   1 
ATOM   2190  C  CG2   . VAL A  1 272 ? 6.658   -9.515  -4.227  1.00 13.24 ? 283 VAL A CG2   1 
ATOM   2191  N  N     . LYS A  1 273 ? 4.442   -10.523 -8.270  1.00 12.62 ? 284 LYS A N     1 
ATOM   2192  C  CA    . LYS A  1 273 ? 3.466   -11.147 -9.183  1.00 13.35 ? 284 LYS A CA    1 
ATOM   2193  C  C     . LYS A  1 273 ? 4.161   -12.125 -10.111 1.00 16.17 ? 284 LYS A C     1 
ATOM   2194  O  O     . LYS A  1 273 ? 3.634   -13.205 -10.336 1.00 15.27 ? 284 LYS A O     1 
ATOM   2195  C  CB    . LYS A  1 273 ? 2.707   -10.080 -9.995  1.00 16.81 ? 284 LYS A CB    1 
ATOM   2196  C  CG    . LYS A  1 273 ? 1.519   -9.541  -9.230  1.00 27.20 ? 284 LYS A CG    1 
ATOM   2197  C  CD    . LYS A  1 273 ? 0.933   -8.292  -9.877  1.00 35.11 ? 284 LYS A CD    1 
ATOM   2198  C  CE    . LYS A  1 273 ? -0.377  -7.911  -9.229  1.00 42.69 ? 284 LYS A CE    1 
ATOM   2199  N  NZ    . LYS A  1 273 ? -0.907  -6.640  -9.786  1.00 55.32 ? 284 LYS A NZ    1 
ATOM   2200  N  N     . GLY A  1 274 ? 5.344   -11.759 -10.610 1.00 13.98 ? 285 GLY A N     1 
ATOM   2201  C  CA    . GLY A  1 274 ? 6.125   -12.614 -11.508 1.00 13.13 ? 285 GLY A CA    1 
ATOM   2202  C  C     . GLY A  1 274 ? 6.586   -13.871 -10.819 1.00 15.13 ? 285 GLY A C     1 
ATOM   2203  O  O     . GLY A  1 274 ? 6.513   -14.963 -11.394 1.00 14.99 ? 285 GLY A O     1 
ATOM   2204  N  N     . HIS A  1 275 ? 7.019   -13.725 -9.553  1.00 9.81  ? 286 HIS A N     1 
ATOM   2205  C  CA    . HIS A  1 275 ? 7.467   -14.835 -8.703  1.00 8.94  ? 286 HIS A CA    1 
ATOM   2206  C  C     . HIS A  1 275 ? 6.267   -15.734 -8.405  1.00 12.34 ? 286 HIS A C     1 
ATOM   2207  O  O     . HIS A  1 275 ? 6.340   -16.952 -8.622  1.00 9.79  ? 286 HIS A O     1 
ATOM   2208  C  CB    . HIS A  1 275 ? 8.074   -14.272 -7.384  1.00 9.06  ? 286 HIS A CB    1 
ATOM   2209  C  CG    . HIS A  1 275 ? 8.983   -15.209 -6.647  1.00 11.82 ? 286 HIS A CG    1 
ATOM   2210  N  ND1   . HIS A  1 275 ? 8.496   -16.101 -5.698  1.00 12.43 ? 286 HIS A ND1   1 
ATOM   2211  C  CD2   . HIS A  1 275 ? 10.330  -15.293 -6.671  1.00 11.70 ? 286 HIS A CD2   1 
ATOM   2212  C  CE1   . HIS A  1 275 ? 9.556   -16.715 -5.203  1.00 11.05 ? 286 HIS A CE1   1 
ATOM   2213  N  NE2   . HIS A  1 275 ? 10.683  -16.267 -5.762  1.00 11.12 ? 286 HIS A NE2   1 
ATOM   2214  N  N     . ALA A  1 276 ? 5.140   -15.131 -7.988  1.00 8.63  ? 287 ALA A N     1 
ATOM   2215  C  CA    . ALA A  1 276 ? 3.934   -15.880 -7.594  1.00 9.02  ? 287 ALA A CA    1 
ATOM   2216  C  C     . ALA A  1 276 ? 3.261   -16.603 -8.755  1.00 13.01 ? 287 ALA A C     1 
ATOM   2217  O  O     . ALA A  1 276 ? 2.583   -17.587 -8.529  1.00 12.51 ? 287 ALA A O     1 
ATOM   2218  C  CB    . ALA A  1 276 ? 2.946   -14.959 -6.898  1.00 9.74  ? 287 ALA A CB    1 
ATOM   2219  N  N     . LYS A  1 277 ? 3.461   -16.137 -9.997  1.00 10.94 ? 288 LYS A N     1 
ATOM   2220  C  CA    . LYS A  1 277 ? 2.910   -16.799 -11.189 1.00 10.97 ? 288 LYS A CA    1 
ATOM   2221  C  C     . LYS A  1 277 ? 3.417   -18.247 -11.204 1.00 14.38 ? 288 LYS A C     1 
ATOM   2222  O  O     . LYS A  1 277 ? 2.676   -19.121 -11.628 1.00 13.68 ? 288 LYS A O     1 
ATOM   2223  C  CB    . LYS A  1 277 ? 3.395   -16.075 -12.453 1.00 14.55 ? 288 LYS A CB    1 
ATOM   2224  C  CG    A LYS A  1 277 ? 2.683   -16.513 -13.738 0.70 24.31 ? 288 LYS A CG    1 
ATOM   2225  C  CD    A LYS A  1 277 ? 3.271   -15.772 -14.908 0.70 38.88 ? 288 LYS A CD    1 
ATOM   2226  C  CE    A LYS A  1 277 ? 2.774   -16.210 -16.260 0.70 54.44 ? 288 LYS A CE    1 
ATOM   2227  N  NZ    A LYS A  1 277 ? 3.443   -15.441 -17.349 0.70 56.78 ? 288 LYS A NZ    1 
ATOM   2228  N  N     . CYS A  1 278 ? 4.649   -18.503 -10.672 1.00 10.63 ? 289 CYS A N     1 
ATOM   2229  C  CA    . CYS A  1 278 ? 5.222   -19.853 -10.572 1.00 9.17  ? 289 CYS A CA    1 
ATOM   2230  C  C     . CYS A  1 278 ? 4.384   -20.755 -9.713  1.00 12.83 ? 289 CYS A C     1 
ATOM   2231  O  O     . CYS A  1 278 ? 4.136   -21.904 -10.073 1.00 12.48 ? 289 CYS A O     1 
ATOM   2232  C  CB    . CYS A  1 278 ? 6.659   -19.793 -10.077 1.00 9.08  ? 289 CYS A CB    1 
ATOM   2233  S  SG    . CYS A  1 278 ? 7.754   -18.943 -11.221 1.00 12.55 ? 289 CYS A SG    1 
ATOM   2234  N  N     . VAL A  1 279 ? 3.919   -20.225 -8.584  1.00 9.91  ? 290 VAL A N     1 
ATOM   2235  C  CA    . VAL A  1 279 ? 3.043   -20.953 -7.648  1.00 10.17 ? 290 VAL A CA    1 
ATOM   2236  C  C     . VAL A  1 279 ? 1.722   -21.213 -8.354  1.00 13.35 ? 290 VAL A C     1 
ATOM   2237  O  O     . VAL A  1 279 ? 1.219   -22.338 -8.304  1.00 12.67 ? 290 VAL A O     1 
ATOM   2238  C  CB    . VAL A  1 279 ? 2.841   -20.135 -6.343  1.00 13.71 ? 290 VAL A CB    1 
ATOM   2239  C  CG1   . VAL A  1 279 ? 1.894   -20.853 -5.397  1.00 13.94 ? 290 VAL A CG1   1 
ATOM   2240  C  CG2   . VAL A  1 279 ? 4.180   -19.854 -5.665  1.00 13.19 ? 290 VAL A CG2   1 
ATOM   2241  N  N     . GLU A  1 280 ? 1.156   -20.188 -9.014  1.00 12.22 ? 291 GLU A N     1 
ATOM   2242  C  CA    . GLU A  1 280 ? -0.123  -20.378 -9.746  1.00 13.40 ? 291 GLU A CA    1 
ATOM   2243  C  C     . GLU A  1 280 ? 0.037   -21.481 -10.799 1.00 17.33 ? 291 GLU A C     1 
ATOM   2244  O  O     . GLU A  1 280 ? -0.830  -22.350 -10.906 1.00 16.69 ? 291 GLU A O     1 
ATOM   2245  C  CB    . GLU A  1 280 ? -0.549  -19.089 -10.474 1.00 14.61 ? 291 GLU A CB    1 
ATOM   2246  C  CG    . GLU A  1 280 ? -0.647  -17.888 -9.550  1.00 23.95 ? 291 GLU A CG    1 
ATOM   2247  C  CD    . GLU A  1 280 ? -1.012  -16.566 -10.197 1.00 51.44 ? 291 GLU A CD    1 
ATOM   2248  O  OE1   . GLU A  1 280 ? -1.152  -16.530 -11.440 1.00 41.26 ? 291 GLU A OE1   1 
ATOM   2249  O  OE2   . GLU A  1 280 ? -1.162  -15.565 -9.458  1.00 50.75 ? 291 GLU A OE2   1 
ATOM   2250  N  N     . VAL A  1 281 ? 1.153   -21.452 -11.564 1.00 12.19 ? 292 VAL A N     1 
ATOM   2251  C  CA    . VAL A  1 281 ? 1.394   -22.482 -12.593 1.00 12.53 ? 292 VAL A CA    1 
ATOM   2252  C  C     . VAL A  1 281 ? 1.445   -23.883 -11.959 1.00 14.92 ? 292 VAL A C     1 
ATOM   2253  O  O     . VAL A  1 281 ? 0.787   -24.785 -12.452 1.00 12.88 ? 292 VAL A O     1 
ATOM   2254  C  CB    . VAL A  1 281 ? 2.642   -22.170 -13.451 1.00 15.01 ? 292 VAL A CB    1 
ATOM   2255  C  CG1   . VAL A  1 281 ? 3.052   -23.390 -14.301 1.00 16.43 ? 292 VAL A CG1   1 
ATOM   2256  C  CG2   . VAL A  1 281 ? 2.393   -20.942 -14.336 1.00 14.40 ? 292 VAL A CG2   1 
ATOM   2257  N  N     . VAL A  1 282 ? 2.225   -24.065 -10.884 1.00 12.34 ? 293 VAL A N     1 
ATOM   2258  C  CA    . VAL A  1 282 ? 2.318   -25.395 -10.229 1.00 12.44 ? 293 VAL A CA    1 
ATOM   2259  C  C     . VAL A  1 282 ? 0.958   -25.854 -9.631  1.00 17.32 ? 293 VAL A C     1 
ATOM   2260  O  O     . VAL A  1 282 ? 0.580   -27.029 -9.732  1.00 14.83 ? 293 VAL A O     1 
ATOM   2261  C  CB    . VAL A  1 282 ? 3.482   -25.448 -9.212  1.00 14.80 ? 293 VAL A CB    1 
ATOM   2262  C  CG1   . VAL A  1 282 ? 3.515   -26.788 -8.495  1.00 14.78 ? 293 VAL A CG1   1 
ATOM   2263  C  CG2   . VAL A  1 282 ? 4.822   -25.174 -9.910  1.00 14.01 ? 293 VAL A CG2   1 
ATOM   2264  N  N     . LYS A  1 283 ? 0.211   -24.901 -9.059  1.00 16.61 ? 294 LYS A N     1 
ATOM   2265  C  CA    . LYS A  1 283 ? -1.127  -25.116 -8.491  1.00 17.87 ? 294 LYS A CA    1 
ATOM   2266  C  C     . LYS A  1 283 ? -2.122  -25.728 -9.447  1.00 22.28 ? 294 LYS A C     1 
ATOM   2267  O  O     . LYS A  1 283 ? -2.950  -26.520 -9.004  1.00 22.81 ? 294 LYS A O     1 
ATOM   2268  C  CB    . LYS A  1 283 ? -1.709  -23.771 -8.025  1.00 20.71 ? 294 LYS A CB    1 
ATOM   2269  C  CG    . LYS A  1 283 ? -1.929  -23.670 -6.556  1.00 29.14 ? 294 LYS A CG    1 
ATOM   2270  C  CD    . LYS A  1 283 ? -2.725  -22.402 -6.274  1.00 34.02 ? 294 LYS A CD    1 
ATOM   2271  C  CE    . LYS A  1 283 ? -3.938  -22.685 -5.424  1.00 44.15 ? 294 LYS A CE    1 
ATOM   2272  N  NZ    . LYS A  1 283 ? -5.055  -23.290 -6.192  1.00 63.65 ? 294 LYS A NZ    1 
ATOM   2273  N  N     . THR A  1 284 ? -2.095  -25.339 -10.741 1.00 19.14 ? 295 THR A N     1 
ATOM   2274  C  CA    . THR A  1 284 ? -3.054  -25.818 -11.746 1.00 19.80 ? 295 THR A CA    1 
ATOM   2275  C  C     . THR A  1 284 ? -3.005  -27.320 -11.986 1.00 23.07 ? 295 THR A C     1 
ATOM   2276  O  O     . THR A  1 284 ? -3.990  -27.878 -12.455 1.00 24.08 ? 295 THR A O     1 
ATOM   2277  C  CB    . THR A  1 284 ? -2.932  -25.071 -13.095 1.00 29.03 ? 295 THR A CB    1 
ATOM   2278  O  OG1   . THR A  1 284 ? -1.692  -25.420 -13.711 1.00 32.96 ? 295 THR A OG1   1 
ATOM   2279  C  CG2   . THR A  1 284 ? -3.075  -23.560 -12.955 1.00 28.88 ? 295 THR A CG2   1 
ATOM   2280  N  N     . PHE A  1 285 ? -1.861  -27.967 -11.693 1.00 16.99 ? 296 PHE A N     1 
ATOM   2281  C  CA    . PHE A  1 285 ? -1.694  -29.412 -11.867 1.00 14.72 ? 296 PHE A CA    1 
ATOM   2282  C  C     . PHE A  1 285 ? -2.445  -30.248 -10.830 1.00 16.95 ? 296 PHE A C     1 
ATOM   2283  O  O     . PHE A  1 285 ? -2.568  -31.453 -11.014 1.00 16.28 ? 296 PHE A O     1 
ATOM   2284  C  CB    . PHE A  1 285 ? -0.209  -29.789 -12.014 1.00 15.48 ? 296 PHE A CB    1 
ATOM   2285  C  CG    . PHE A  1 285 ? 0.359   -29.220 -13.297 1.00 16.29 ? 296 PHE A CG    1 
ATOM   2286  C  CD1   . PHE A  1 285 ? 0.098   -29.831 -14.526 1.00 16.44 ? 296 PHE A CD1   1 
ATOM   2287  C  CD2   . PHE A  1 285 ? 1.082   -28.025 -13.290 1.00 15.62 ? 296 PHE A CD2   1 
ATOM   2288  C  CE1   . PHE A  1 285 ? 0.546   -29.258 -15.717 1.00 16.65 ? 296 PHE A CE1   1 
ATOM   2289  C  CE2   . PHE A  1 285 ? 1.521   -27.450 -14.483 1.00 17.63 ? 296 PHE A CE2   1 
ATOM   2290  C  CZ    . PHE A  1 285 ? 1.264   -28.080 -15.687 1.00 16.98 ? 296 PHE A CZ    1 
ATOM   2291  N  N     . ASN A  1 286 ? -2.988  -29.616 -9.762  1.00 14.94 ? 297 ASN A N     1 
ATOM   2292  C  CA    . ASN A  1 286 ? -3.788  -30.309 -8.735  1.00 15.43 ? 297 ASN A CA    1 
ATOM   2293  C  C     . ASN A  1 286 ? -3.112  -31.541 -8.127  1.00 17.73 ? 297 ASN A C     1 
ATOM   2294  O  O     . ASN A  1 286 ? -3.720  -32.608 -7.987  1.00 17.88 ? 297 ASN A O     1 
ATOM   2295  C  CB    . ASN A  1 286 ? -5.211  -30.650 -9.279  1.00 21.03 ? 297 ASN A CB    1 
ATOM   2296  C  CG    . ASN A  1 286 ? -6.030  -29.445 -9.703  1.00 48.17 ? 297 ASN A CG    1 
ATOM   2297  O  OD1   . ASN A  1 286 ? -6.032  -28.386 -9.050  1.00 40.18 ? 297 ASN A OD1   1 
ATOM   2298  N  ND2   . ASN A  1 286 ? -6.770  -29.591 -10.803 1.00 39.45 ? 297 ASN A ND2   1 
ATOM   2299  N  N     . LEU A  1 287 ? -1.845  -31.398 -7.794  1.00 13.04 ? 298 LEU A N     1 
ATOM   2300  C  CA    . LEU A  1 287 ? -1.079  -32.443 -7.141  1.00 12.98 ? 298 LEU A CA    1 
ATOM   2301  C  C     . LEU A  1 287 ? -0.747  -32.015 -5.706  1.00 17.15 ? 298 LEU A C     1 
ATOM   2302  O  O     . LEU A  1 287 ? -0.566  -30.813 -5.484  1.00 18.27 ? 298 LEU A O     1 
ATOM   2303  C  CB    . LEU A  1 287 ? 0.232   -32.668 -7.897  1.00 12.82 ? 298 LEU A CB    1 
ATOM   2304  C  CG    . LEU A  1 287 ? 0.112   -33.346 -9.282  1.00 16.28 ? 298 LEU A CG    1 
ATOM   2305  C  CD1   . LEU A  1 287 ? 1.456   -33.353 -9.960  1.00 16.03 ? 298 LEU A CD1   1 
ATOM   2306  C  CD2   . LEU A  1 287 ? -0.467  -34.797 -9.167  1.00 15.29 ? 298 LEU A CD2   1 
ATOM   2307  N  N     . PRO A  1 288 ? -0.598  -32.976 -4.755  1.00 13.74 ? 299 PRO A N     1 
ATOM   2308  C  CA    . PRO A  1 288 ? -0.149  -32.623 -3.391  1.00 13.07 ? 299 PRO A CA    1 
ATOM   2309  C  C     . PRO A  1 288 ? 1.108   -31.774 -3.501  1.00 15.06 ? 299 PRO A C     1 
ATOM   2310  O  O     . PRO A  1 288 ? 2.025   -32.132 -4.238  1.00 14.14 ? 299 PRO A O     1 
ATOM   2311  C  CB    . PRO A  1 288 ? 0.149   -33.982 -2.762  1.00 14.61 ? 299 PRO A CB    1 
ATOM   2312  C  CG    . PRO A  1 288 ? -0.768  -34.934 -3.495  1.00 19.19 ? 299 PRO A CG    1 
ATOM   2313  C  CD    . PRO A  1 288 ? -0.793  -34.443 -4.890  1.00 15.62 ? 299 PRO A CD    1 
ATOM   2314  N  N     . LEU A  1 289 ? 1.097   -30.601 -2.853  1.00 13.50 ? 300 LEU A N     1 
ATOM   2315  C  CA    . LEU A  1 289 ? 2.158   -29.620 -3.006  1.00 12.52 ? 300 LEU A CA    1 
ATOM   2316  C  C     . LEU A  1 289 ? 2.739   -29.104 -1.704  1.00 12.85 ? 300 LEU A C     1 
ATOM   2317  O  O     . LEU A  1 289 ? 2.016   -28.619 -0.840  1.00 12.39 ? 300 LEU A O     1 
ATOM   2318  C  CB    . LEU A  1 289 ? 1.619   -28.462 -3.882  1.00 12.32 ? 300 LEU A CB    1 
ATOM   2319  C  CG    . LEU A  1 289 ? 2.473   -27.176 -4.053  1.00 14.80 ? 300 LEU A CG    1 
ATOM   2320  C  CD1   . LEU A  1 289 ? 3.804   -27.460 -4.724  1.00 13.97 ? 300 LEU A CD1   1 
ATOM   2321  C  CD2   . LEU A  1 289 ? 1.705   -26.128 -4.870  1.00 14.25 ? 300 LEU A CD2   1 
ATOM   2322  N  N     . LEU A  1 290 ? 4.049   -29.169 -1.591  1.00 8.04  ? 301 LEU A N     1 
ATOM   2323  C  CA    . LEU A  1 290 ? 4.746   -28.649 -0.423  1.00 7.60  ? 301 LEU A CA    1 
ATOM   2324  C  C     . LEU A  1 290 ? 5.457   -27.396 -0.888  1.00 12.07 ? 301 LEU A C     1 
ATOM   2325  O  O     . LEU A  1 290 ? 6.311   -27.467 -1.782  1.00 11.34 ? 301 LEU A O     1 
ATOM   2326  C  CB    . LEU A  1 290 ? 5.758   -29.692 0.118   1.00 7.47  ? 301 LEU A CB    1 
ATOM   2327  C  CG    . LEU A  1 290 ? 6.621   -29.258 1.328   1.00 11.34 ? 301 LEU A CG    1 
ATOM   2328  C  CD1   . LEU A  1 290 ? 5.776   -28.913 2.554   1.00 11.51 ? 301 LEU A CD1   1 
ATOM   2329  C  CD2   . LEU A  1 290 ? 7.592   -30.362 1.706   1.00 11.09 ? 301 LEU A CD2   1 
ATOM   2330  N  N     . MET A  1 291 ? 5.067   -26.247 -0.328  1.00 7.26  ? 302 MET A N     1 
ATOM   2331  C  CA    . MET A  1 291 ? 5.672   -24.959 -0.648  1.00 6.82  ? 302 MET A CA    1 
ATOM   2332  C  C     . MET A  1 291 ? 6.654   -24.547 0.428   1.00 11.44 ? 302 MET A C     1 
ATOM   2333  O  O     . MET A  1 291 ? 6.300   -24.487 1.616   1.00 12.37 ? 302 MET A O     1 
ATOM   2334  C  CB    . MET A  1 291 ? 4.591   -23.896 -0.856  1.00 8.98  ? 302 MET A CB    1 
ATOM   2335  C  CG    . MET A  1 291 ? 3.825   -24.081 -2.153  1.00 13.22 ? 302 MET A CG    1 
ATOM   2336  S  SD    . MET A  1 291 ? 2.349   -23.038 -2.095  1.00 18.47 ? 302 MET A SD    1 
ATOM   2337  C  CE    . MET A  1 291 ? 3.156   -21.349 -1.889  1.00 14.25 ? 302 MET A CE    1 
ATOM   2338  N  N     . LEU A  1 292 ? 7.894   -24.251 0.014   1.00 9.03  ? 303 LEU A N     1 
ATOM   2339  C  CA    . LEU A  1 292 ? 8.971   -23.909 0.928   1.00 8.73  ? 303 LEU A CA    1 
ATOM   2340  C  C     . LEU A  1 292 ? 9.605   -22.557 0.664   1.00 12.30 ? 303 LEU A C     1 
ATOM   2341  O  O     . LEU A  1 292 ? 9.527   -22.042 -0.442  1.00 10.87 ? 303 LEU A O     1 
ATOM   2342  C  CB    . LEU A  1 292 ? 10.050  -25.021 0.958   1.00 8.26  ? 303 LEU A CB    1 
ATOM   2343  C  CG    . LEU A  1 292 ? 9.557   -26.444 1.245   1.00 11.15 ? 303 LEU A CG    1 
ATOM   2344  C  CD1   . LEU A  1 292 ? 10.702  -27.478 1.074   1.00 10.72 ? 303 LEU A CD1   1 
ATOM   2345  C  CD2   . LEU A  1 292 ? 8.989   -26.548 2.668   1.00 10.42 ? 303 LEU A CD2   1 
ATOM   2346  N  N     . GLY A  1 293 ? 10.266  -22.030 1.687   1.00 9.19  ? 304 GLY A N     1 
ATOM   2347  C  CA    . GLY A  1 293 ? 10.993  -20.770 1.623   1.00 7.67  ? 304 GLY A CA    1 
ATOM   2348  C  C     . GLY A  1 293 ? 12.343  -20.972 0.958   1.00 12.30 ? 304 GLY A C     1 
ATOM   2349  O  O     . GLY A  1 293 ? 12.465  -21.778 0.028   1.00 12.36 ? 304 GLY A O     1 
ATOM   2350  N  N     . GLY A  1 294 ? 13.359  -20.261 1.441   1.00 7.69  ? 305 GLY A N     1 
ATOM   2351  C  CA    . GLY A  1 294 ? 14.708  -20.332 0.871   1.00 8.12  ? 305 GLY A CA    1 
ATOM   2352  C  C     . GLY A  1 294 ? 15.438  -19.027 1.112   1.00 11.76 ? 305 GLY A C     1 
ATOM   2353  O  O     . GLY A  1 294 ? 15.263  -18.411 2.170   1.00 8.55  ? 305 GLY A O     1 
ATOM   2354  N  N     . GLY A  1 295 ? 16.178  -18.561 0.105   1.00 9.22  ? 306 GLY A N     1 
ATOM   2355  C  CA    . GLY A  1 295 ? 16.873  -17.279 0.166   1.00 10.10 ? 306 GLY A CA    1 
ATOM   2356  C  C     . GLY A  1 295 ? 15.903  -16.109 0.147   1.00 12.57 ? 306 GLY A C     1 
ATOM   2357  O  O     . GLY A  1 295 ? 14.684  -16.291 0.039   1.00 9.88  ? 306 GLY A O     1 
ATOM   2358  N  N     . GLY A  1 296 ? 16.441  -14.899 0.222   1.00 9.79  ? 307 GLY A N     1 
ATOM   2359  C  CA    . GLY A  1 296 ? 15.631  -13.682 0.261   1.00 8.69  ? 307 GLY A CA    1 
ATOM   2360  C  C     . GLY A  1 296 ? 16.268  -12.764 1.300   1.00 13.50 ? 307 GLY A C     1 
ATOM   2361  O  O     . GLY A  1 296 ? 16.274  -13.072 2.499   1.00 11.79 ? 307 GLY A O     1 
ATOM   2362  N  N     . TYR A  1 297 ? 16.868  -11.657 0.824   1.00 10.34 ? 308 TYR A N     1 
ATOM   2363  C  CA    . TYR A  1 297 ? 17.705  -10.778 1.650   1.00 9.38  ? 308 TYR A CA    1 
ATOM   2364  C  C     . TYR A  1 297 ? 17.283  -9.321  1.788   1.00 14.51 ? 308 TYR A C     1 
ATOM   2365  O  O     . TYR A  1 297 ? 17.905  -8.587  2.555   1.00 13.76 ? 308 TYR A O     1 
ATOM   2366  C  CB    . TYR A  1 297 ? 19.190  -10.958 1.231   1.00 9.57  ? 308 TYR A CB    1 
ATOM   2367  C  CG    . TYR A  1 297 ? 19.539  -12.427 1.242   1.00 10.49 ? 308 TYR A CG    1 
ATOM   2368  C  CD1   . TYR A  1 297 ? 19.547  -13.170 0.062   1.00 11.30 ? 308 TYR A CD1   1 
ATOM   2369  C  CD2   . TYR A  1 297 ? 19.667  -13.120 2.446   1.00 11.43 ? 308 TYR A CD2   1 
ATOM   2370  C  CE1   . TYR A  1 297 ? 19.745  -14.553 0.077   1.00 12.05 ? 308 TYR A CE1   1 
ATOM   2371  C  CE2   . TYR A  1 297 ? 19.848  -14.502 2.473   1.00 12.24 ? 308 TYR A CE2   1 
ATOM   2372  C  CZ    . TYR A  1 297 ? 19.906  -15.211 1.287   1.00 14.28 ? 308 TYR A CZ    1 
ATOM   2373  O  OH    . TYR A  1 297 ? 20.082  -16.569 1.348   1.00 11.28 ? 308 TYR A OH    1 
ATOM   2374  N  N     . THR A  1 298 ? 16.241  -8.898  1.050   1.00 12.83 ? 309 THR A N     1 
ATOM   2375  C  CA    . THR A  1 298 ? 15.634  -7.568  1.215   1.00 12.15 ? 309 THR A CA    1 
ATOM   2376  C  C     . THR A  1 298 ? 14.339  -7.977  1.905   1.00 14.45 ? 309 THR A C     1 
ATOM   2377  O  O     . THR A  1 298 ? 13.376  -8.388  1.259   1.00 12.28 ? 309 THR A O     1 
ATOM   2378  C  CB    . THR A  1 298 ? 15.447  -6.862  -0.116  1.00 15.46 ? 309 THR A CB    1 
ATOM   2379  O  OG1   . THR A  1 298 ? 16.751  -6.632  -0.657  1.00 15.16 ? 309 THR A OG1   1 
ATOM   2380  C  CG2   . THR A  1 298 ? 14.693  -5.544  0.040   1.00 12.21 ? 309 THR A CG2   1 
ATOM   2381  N  N     . ILE A  1 299 ? 14.379  -7.974  3.230   1.00 11.05 ? 310 ILE A N     1 
ATOM   2382  C  CA    . ILE A  1 299 ? 13.350  -8.590  4.069   1.00 10.07 ? 310 ILE A CA    1 
ATOM   2383  C  C     . ILE A  1 299 ? 11.931  -8.103  3.888   1.00 13.33 ? 310 ILE A C     1 
ATOM   2384  O  O     . ILE A  1 299 ? 10.998  -8.919  3.969   1.00 12.07 ? 310 ILE A O     1 
ATOM   2385  C  CB    . ILE A  1 299 ? 13.827  -8.831  5.510   1.00 13.26 ? 310 ILE A CB    1 
ATOM   2386  C  CG1   . ILE A  1 299 ? 14.043  -7.495  6.278   1.00 13.91 ? 310 ILE A CG1   1 
ATOM   2387  C  CG2   . ILE A  1 299 ? 15.152  -9.673  5.459   1.00 14.00 ? 310 ILE A CG2   1 
ATOM   2388  C  CD1   . ILE A  1 299 ? 14.352  -7.719  7.795   1.00 16.28 ? 310 ILE A CD1   1 
ATOM   2389  N  N     . ARG A  1 300 ? 11.755  -6.798  3.612   1.00 7.93  ? 311 ARG A N     1 
ATOM   2390  C  CA    . ARG A  1 300 ? 10.426  -6.265  3.313   1.00 7.79  ? 311 ARG A CA    1 
ATOM   2391  C  C     . ARG A  1 300 ? 9.842   -6.996  2.070   1.00 11.49 ? 311 ARG A C     1 
ATOM   2392  O  O     . ARG A  1 300 ? 8.671   -7.371  2.058   1.00 8.99  ? 311 ARG A O     1 
ATOM   2393  C  CB    . ARG A  1 300 ? 10.473  -4.730  3.148   1.00 10.05 ? 311 ARG A CB    1 
ATOM   2394  C  CG    . ARG A  1 300 ? 11.225  -4.219  1.909   1.00 15.02 ? 311 ARG A CG    1 
ATOM   2395  C  CD    . ARG A  1 300 ? 11.334  -2.701  1.865   1.00 16.02 ? 311 ARG A CD    1 
ATOM   2396  N  NE    . ARG A  1 300 ? 12.093  -2.242  0.694   1.00 17.11 ? 311 ARG A NE    1 
ATOM   2397  C  CZ    . ARG A  1 300 ? 13.419  -2.152  0.639   1.00 26.51 ? 311 ARG A CZ    1 
ATOM   2398  N  NH1   . ARG A  1 300 ? 14.016  -1.732  -0.468  1.00 23.57 ? 311 ARG A NH1   1 
ATOM   2399  N  NH2   . ARG A  1 300 ? 14.158  -2.463  1.695   1.00 19.23 ? 311 ARG A NH2   1 
ATOM   2400  N  N     . ASN A  1 301 ? 10.680  -7.272  1.055   1.00 9.01  ? 312 ASN A N     1 
ATOM   2401  C  CA    . ASN A  1 301 ? 10.198  -7.940  -0.167  1.00 9.73  ? 312 ASN A CA    1 
ATOM   2402  C  C     . ASN A  1 301 ? 9.961   -9.420  0.031   1.00 12.34 ? 312 ASN A C     1 
ATOM   2403  O  O     . ASN A  1 301 ? 9.073   -10.000 -0.601  1.00 11.20 ? 312 ASN A O     1 
ATOM   2404  C  CB    . ASN A  1 301 ? 11.120  -7.683  -1.334  1.00 10.67 ? 312 ASN A CB    1 
ATOM   2405  C  CG    . ASN A  1 301 ? 11.103  -6.228  -1.736  1.00 16.10 ? 312 ASN A CG    1 
ATOM   2406  O  OD1   . ASN A  1 301 ? 10.152  -5.498  -1.454  1.00 12.16 ? 312 ASN A OD1   1 
ATOM   2407  N  ND2   . ASN A  1 301 ? 12.086  -5.810  -2.502  1.00 13.53 ? 312 ASN A ND2   1 
ATOM   2408  N  N     . VAL A  1 302 ? 10.729  -10.022 0.922   1.00 10.35 ? 313 VAL A N     1 
ATOM   2409  C  CA    . VAL A  1 302 ? 10.528  -11.441 1.284   1.00 9.00  ? 313 VAL A CA    1 
ATOM   2410  C  C     . VAL A  1 302 ? 9.142   -11.578 1.954   1.00 12.79 ? 313 VAL A C     1 
ATOM   2411  O  O     . VAL A  1 302 ? 8.339   -12.435 1.567   1.00 12.52 ? 313 VAL A O     1 
ATOM   2412  C  CB    . VAL A  1 302 ? 11.637  -11.892 2.237   1.00 11.28 ? 313 VAL A CB    1 
ATOM   2413  C  CG1   . VAL A  1 302 ? 11.369  -13.305 2.747   1.00 11.42 ? 313 VAL A CG1   1 
ATOM   2414  C  CG2   . VAL A  1 302 ? 12.992  -11.806 1.543   1.00 10.88 ? 313 VAL A CG2   1 
ATOM   2415  N  N     . ALA A  1 303 ? 8.847   -10.686 2.919   1.00 9.28  ? 314 ALA A N     1 
ATOM   2416  C  CA    . ALA A  1 303 ? 7.556   -10.734 3.614   1.00 7.90  ? 314 ALA A CA    1 
ATOM   2417  C  C     . ALA A  1 303 ? 6.378   -10.546 2.625   1.00 11.55 ? 314 ALA A C     1 
ATOM   2418  O  O     . ALA A  1 303 ? 5.365   -11.260 2.723   1.00 11.18 ? 314 ALA A O     1 
ATOM   2419  C  CB    . ALA A  1 303 ? 7.528   -9.691  4.729   1.00 7.57  ? 314 ALA A CB    1 
ATOM   2420  N  N     . ARG A  1 304 ? 6.519   -9.606  1.670   1.00 9.38  ? 315 ARG A N     1 
ATOM   2421  C  CA    . ARG A  1 304 ? 5.494   -9.337  0.645   1.00 8.75  ? 315 ARG A CA    1 
ATOM   2422  C  C     . ARG A  1 304 ? 5.313   -10.592 -0.200  1.00 10.28 ? 315 ARG A C     1 
ATOM   2423  O  O     . ARG A  1 304 ? 4.193   -11.032 -0.406  1.00 10.13 ? 315 ARG A O     1 
ATOM   2424  C  CB    . ARG A  1 304 ? 5.941   -8.198  -0.294  1.00 10.93 ? 315 ARG A CB    1 
ATOM   2425  C  CG    . ARG A  1 304 ? 5.987   -6.806  0.341   1.00 12.48 ? 315 ARG A CG    1 
ATOM   2426  C  CD    . ARG A  1 304 ? 6.618   -5.792  -0.584  1.00 13.06 ? 315 ARG A CD    1 
ATOM   2427  N  NE    . ARG A  1 304 ? 6.137   -4.459  -0.249  1.00 12.04 ? 315 ARG A NE    1 
ATOM   2428  C  CZ    . ARG A  1 304 ? 6.914   -3.422  0.046   1.00 16.34 ? 315 ARG A CZ    1 
ATOM   2429  N  NH1   . ARG A  1 304 ? 6.375   -2.262  0.390   1.00 10.84 ? 315 ARG A NH1   1 
ATOM   2430  N  NH2   . ARG A  1 304 ? 8.238   -3.541  0.016   1.00 11.63 ? 315 ARG A NH2   1 
ATOM   2431  N  N     . CYS A  1 305 ? 6.421   -11.150 -0.698  1.00 9.50  ? 316 CYS A N     1 
ATOM   2432  C  CA    . CYS A  1 305 ? 6.425   -12.322 -1.596  1.00 9.53  ? 316 CYS A CA    1 
ATOM   2433  C  C     . CYS A  1 305 ? 5.698   -13.517 -0.991  1.00 11.86 ? 316 CYS A C     1 
ATOM   2434  O  O     . CYS A  1 305 ? 4.809   -14.086 -1.634  1.00 10.47 ? 316 CYS A O     1 
ATOM   2435  C  CB    . CYS A  1 305 ? 7.857   -12.687 -1.987  1.00 9.25  ? 316 CYS A CB    1 
ATOM   2436  S  SG    . CYS A  1 305 ? 7.969   -13.775 -3.440  1.00 12.53 ? 316 CYS A SG    1 
ATOM   2437  N  N     . TRP A  1 306 ? 6.116   -13.936 0.205   1.00 7.37  ? 317 TRP A N     1 
ATOM   2438  C  CA    . TRP A  1 306 ? 5.562   -15.115 0.868   1.00 7.68  ? 317 TRP A CA    1 
ATOM   2439  C  C     . TRP A  1 306 ? 4.140   -14.918 1.384   1.00 11.14 ? 317 TRP A C     1 
ATOM   2440  O  O     . TRP A  1 306 ? 3.354   -15.872 1.356   1.00 9.26  ? 317 TRP A O     1 
ATOM   2441  C  CB    . TRP A  1 306 ? 6.540   -15.663 1.911   1.00 6.81  ? 317 TRP A CB    1 
ATOM   2442  C  CG    . TRP A  1 306 ? 7.823   -16.177 1.299   1.00 8.05  ? 317 TRP A CG    1 
ATOM   2443  C  CD1   . TRP A  1 306 ? 8.034   -16.538 0.000   1.00 10.79 ? 317 TRP A CD1   1 
ATOM   2444  C  CD2   . TRP A  1 306 ? 9.046   -16.450 1.994   1.00 8.54  ? 317 TRP A CD2   1 
ATOM   2445  N  NE1   . TRP A  1 306 ? 9.337   -16.945 -0.174  1.00 10.37 ? 317 TRP A NE1   1 
ATOM   2446  C  CE2   . TRP A  1 306 ? 9.971   -16.935 1.040   1.00 11.68 ? 317 TRP A CE2   1 
ATOM   2447  C  CE3   . TRP A  1 306 ? 9.451   -16.338 3.343   1.00 9.08  ? 317 TRP A CE3   1 
ATOM   2448  C  CZ2   . TRP A  1 306 ? 11.278  -17.308 1.386   1.00 10.77 ? 317 TRP A CZ2   1 
ATOM   2449  C  CZ3   . TRP A  1 306 ? 10.734  -16.728 3.685   1.00 10.19 ? 317 TRP A CZ3   1 
ATOM   2450  C  CH2   . TRP A  1 306 ? 11.640  -17.190 2.708   1.00 10.57 ? 317 TRP A CH2   1 
ATOM   2451  N  N     . THR A  1 307 ? 3.771   -13.657 1.748   1.00 7.91  ? 318 THR A N     1 
ATOM   2452  C  CA    . THR A  1 307 ? 2.395   -13.347 2.141   1.00 8.03  ? 318 THR A CA    1 
ATOM   2453  C  C     . THR A  1 307 ? 1.529   -13.537 0.878   1.00 11.95 ? 318 THR A C     1 
ATOM   2454  O  O     . THR A  1 307 ? 0.500   -14.185 0.959   1.00 11.88 ? 318 THR A O     1 
ATOM   2455  C  CB    . THR A  1 307 ? 2.291   -11.882 2.654   1.00 12.01 ? 318 THR A CB    1 
ATOM   2456  O  OG1   . THR A  1 307 ? 2.986   -11.812 3.907   1.00 11.69 ? 318 THR A OG1   1 
ATOM   2457  C  CG2   . THR A  1 307 ? 0.847   -11.419 2.832   1.00 11.09 ? 318 THR A CG2   1 
ATOM   2458  N  N     . TYR A  1 308 ? 1.943   -12.954 -0.269  1.00 10.05 ? 319 TYR A N     1 
ATOM   2459  C  CA    . TYR A  1 308 ? 1.153   -13.061 -1.509  1.00 10.17 ? 319 TYR A CA    1 
ATOM   2460  C  C     . TYR A  1 308 ? 1.061   -14.505 -1.986  1.00 13.55 ? 319 TYR A C     1 
ATOM   2461  O  O     . TYR A  1 308 ? -0.019  -14.942 -2.383  1.00 13.11 ? 319 TYR A O     1 
ATOM   2462  C  CB    . TYR A  1 308 ? 1.691   -12.137 -2.622  1.00 11.16 ? 319 TYR A CB    1 
ATOM   2463  C  CG    . TYR A  1 308 ? 0.807   -12.093 -3.854  1.00 12.59 ? 319 TYR A CG    1 
ATOM   2464  C  CD1   . TYR A  1 308 ? -0.492  -11.590 -3.792  1.00 14.92 ? 319 TYR A CD1   1 
ATOM   2465  C  CD2   . TYR A  1 308 ? 1.264   -12.562 -5.081  1.00 12.15 ? 319 TYR A CD2   1 
ATOM   2466  C  CE1   . TYR A  1 308 ? -1.316  -11.568 -4.922  1.00 15.54 ? 319 TYR A CE1   1 
ATOM   2467  C  CE2   . TYR A  1 308 ? 0.456   -12.525 -6.221  1.00 11.84 ? 319 TYR A CE2   1 
ATOM   2468  C  CZ    . TYR A  1 308 ? -0.839  -12.051 -6.133  1.00 20.69 ? 319 TYR A CZ    1 
ATOM   2469  O  OH    . TYR A  1 308 ? -1.632  -12.021 -7.264  1.00 18.78 ? 319 TYR A OH    1 
ATOM   2470  N  N     . GLU A  1 309 ? 2.171   -15.263 -1.896  1.00 10.13 ? 320 GLU A N     1 
ATOM   2471  C  CA    . GLU A  1 309 ? 2.169   -16.675 -2.331  1.00 9.35  ? 320 GLU A CA    1 
ATOM   2472  C  C     . GLU A  1 309 ? 1.293   -17.564 -1.420  1.00 13.03 ? 320 GLU A C     1 
ATOM   2473  O  O     . GLU A  1 309 ? 0.693   -18.539 -1.901  1.00 10.89 ? 320 GLU A O     1 
ATOM   2474  C  CB    . GLU A  1 309 ? 3.584   -17.189 -2.510  1.00 10.72 ? 320 GLU A CB    1 
ATOM   2475  C  CG    . GLU A  1 309 ? 4.173   -16.542 -3.752  1.00 14.69 ? 320 GLU A CG    1 
ATOM   2476  C  CD    . GLU A  1 309 ? 5.643   -16.723 -4.039  1.00 15.30 ? 320 GLU A CD    1 
ATOM   2477  O  OE1   . GLU A  1 309 ? 6.406   -17.025 -3.097  1.00 9.39  ? 320 GLU A OE1   1 
ATOM   2478  O  OE2   . GLU A  1 309 ? 6.047   -16.441 -5.191  1.00 10.63 ? 320 GLU A OE2   1 
ATOM   2479  N  N     . THR A  1 310 ? 1.161   -17.182 -0.124  1.00 8.66  ? 321 THR A N     1 
ATOM   2480  C  CA    . THR A  1 310 ? 0.227   -17.889 0.771   1.00 8.79  ? 321 THR A CA    1 
ATOM   2481  C  C     . THR A  1 310 ? -1.211  -17.572 0.279   1.00 11.29 ? 321 THR A C     1 
ATOM   2482  O  O     . THR A  1 310 ? -2.040  -18.482 0.167   1.00 10.76 ? 321 THR A O     1 
ATOM   2483  C  CB    . THR A  1 310 ? 0.425   -17.485 2.240   1.00 13.87 ? 321 THR A CB    1 
ATOM   2484  O  OG1   . THR A  1 310 ? 1.805   -17.683 2.609   1.00 12.03 ? 321 THR A OG1   1 
ATOM   2485  C  CG2   . THR A  1 310 ? -0.519  -18.280 3.187   1.00 12.22 ? 321 THR A CG2   1 
ATOM   2486  N  N     . ALA A  1 311 ? -1.497  -16.294 -0.017  1.00 8.92  ? 322 ALA A N     1 
ATOM   2487  C  CA    . ALA A  1 311 ? -2.824  -15.870 -0.505  1.00 10.04 ? 322 ALA A CA    1 
ATOM   2488  C  C     . ALA A  1 311 ? -3.142  -16.582 -1.835  1.00 14.35 ? 322 ALA A C     1 
ATOM   2489  O  O     . ALA A  1 311 ? -4.279  -17.005 -2.050  1.00 14.85 ? 322 ALA A O     1 
ATOM   2490  C  CB    . ALA A  1 311 ? -2.858  -14.360 -0.703  1.00 11.11 ? 322 ALA A CB    1 
ATOM   2491  N  N     . VAL A  1 312 ? -2.127  -16.743 -2.698  1.00 10.61 ? 323 VAL A N     1 
ATOM   2492  C  CA    . VAL A  1 312 ? -2.247  -17.468 -3.973  1.00 10.85 ? 323 VAL A CA    1 
ATOM   2493  C  C     . VAL A  1 312 ? -2.577  -18.933 -3.696  1.00 14.83 ? 323 VAL A C     1 
ATOM   2494  O  O     . VAL A  1 312 ? -3.525  -19.457 -4.286  1.00 13.67 ? 323 VAL A O     1 
ATOM   2495  C  CB    . VAL A  1 312 ? -0.999  -17.258 -4.876  1.00 14.30 ? 323 VAL A CB    1 
ATOM   2496  C  CG1   . VAL A  1 312 ? -0.915  -18.309 -5.989  1.00 13.11 ? 323 VAL A CG1   1 
ATOM   2497  C  CG2   . VAL A  1 312 ? -1.017  -15.846 -5.468  1.00 13.54 ? 323 VAL A CG2   1 
ATOM   2498  N  N     . ALA A  1 313 ? -1.864  -19.579 -2.732  1.00 13.29 ? 324 ALA A N     1 
ATOM   2499  C  CA    . ALA A  1 313 ? -2.124  -20.983 -2.362  1.00 12.90 ? 324 ALA A CA    1 
ATOM   2500  C  C     . ALA A  1 313 ? -3.585  -21.154 -1.930  1.00 15.33 ? 324 ALA A C     1 
ATOM   2501  O  O     . ALA A  1 313 ? -4.209  -22.180 -2.217  1.00 13.94 ? 324 ALA A O     1 
ATOM   2502  C  CB    . ALA A  1 313 ? -1.209  -21.405 -1.216  1.00 13.86 ? 324 ALA A CB    1 
ATOM   2503  N  N     . LEU A  1 314 ? -4.123  -20.145 -1.250  1.00 11.70 ? 325 LEU A N     1 
ATOM   2504  C  CA    . LEU A  1 314 ? -5.496  -20.162 -0.736  1.00 11.70 ? 325 LEU A CA    1 
ATOM   2505  C  C     . LEU A  1 314 ? -6.553  -19.708 -1.746  1.00 15.68 ? 325 LEU A C     1 
ATOM   2506  O  O     . LEU A  1 314 ? -7.743  -19.758 -1.407  1.00 14.93 ? 325 LEU A O     1 
ATOM   2507  C  CB    . LEU A  1 314 ? -5.575  -19.226 0.480   1.00 11.92 ? 325 LEU A CB    1 
ATOM   2508  C  CG    . LEU A  1 314 ? -4.826  -19.678 1.755   1.00 15.71 ? 325 LEU A CG    1 
ATOM   2509  C  CD1   . LEU A  1 314 ? -4.628  -18.504 2.691   1.00 14.68 ? 325 LEU A CD1   1 
ATOM   2510  C  CD2   . LEU A  1 314 ? -5.599  -20.781 2.454   1.00 16.46 ? 325 LEU A CD2   1 
ATOM   2511  N  N     . ASP A  1 315 ? -6.140  -19.203 -2.940  1.00 13.06 ? 326 ASP A N     1 
ATOM   2512  C  CA    . ASP A  1 315 ? -7.058  -18.601 -3.930  1.00 14.37 ? 326 ASP A CA    1 
ATOM   2513  C  C     . ASP A  1 315 ? -7.841  -17.467 -3.257  1.00 21.86 ? 326 ASP A C     1 
ATOM   2514  O  O     . ASP A  1 315 ? -9.060  -17.357 -3.408  1.00 20.38 ? 326 ASP A O     1 
ATOM   2515  C  CB    . ASP A  1 315 ? -8.001  -19.662 -4.542  1.00 16.03 ? 326 ASP A CB    1 
ATOM   2516  C  CG    . ASP A  1 315 ? -7.239  -20.563 -5.476  1.00 21.05 ? 326 ASP A CG    1 
ATOM   2517  O  OD1   . ASP A  1 315 ? -7.053  -21.733 -5.134  1.00 22.36 ? 326 ASP A OD1   1 
ATOM   2518  O  OD2   . ASP A  1 315 ? -6.773  -20.071 -6.513  1.00 29.27 ? 326 ASP A OD2   1 
ATOM   2519  N  N     . CYS A  1 316 ? -7.129  -16.662 -2.454  1.00 20.40 ? 327 CYS A N     1 
ATOM   2520  C  CA    . CYS A  1 316 ? -7.719  -15.563 -1.702  1.00 22.06 ? 327 CYS A CA    1 
ATOM   2521  C  C     . CYS A  1 316 ? -7.118  -14.263 -2.192  1.00 24.88 ? 327 CYS A C     1 
ATOM   2522  O  O     . CYS A  1 316 ? -5.908  -14.072 -2.074  1.00 23.89 ? 327 CYS A O     1 
ATOM   2523  C  CB    . CYS A  1 316 ? -7.510  -15.759 -0.203  1.00 24.13 ? 327 CYS A CB    1 
ATOM   2524  S  SG    . CYS A  1 316 ? -8.156  -14.403 0.812   1.00 29.90 ? 327 CYS A SG    1 
ATOM   2525  N  N     . GLU A  1 317 ? -7.948  -13.405 -2.836  1.00 20.31 ? 328 GLU A N     1 
ATOM   2526  C  CA    . GLU A  1 317 ? -7.512  -12.110 -3.348  1.00 19.67 ? 328 GLU A CA    1 
ATOM   2527  C  C     . GLU A  1 317 ? -7.297  -11.170 -2.164  1.00 22.28 ? 328 GLU A C     1 
ATOM   2528  O  O     . GLU A  1 317 ? -8.110  -11.144 -1.242  1.00 20.29 ? 328 GLU A O     1 
ATOM   2529  C  CB    . GLU A  1 317 ? -8.547  -11.522 -4.313  1.00 21.20 ? 328 GLU A CB    1 
ATOM   2530  C  CG    . GLU A  1 317 ? -8.504  -12.187 -5.677  1.00 32.45 ? 328 GLU A CG    1 
ATOM   2531  C  CD    . GLU A  1 317 ? -9.471  -11.636 -6.705  1.00 57.92 ? 328 GLU A CD    1 
ATOM   2532  O  OE1   . GLU A  1 317 ? -9.295  -10.470 -7.129  1.00 55.71 ? 328 GLU A OE1   1 
ATOM   2533  O  OE2   . GLU A  1 317 ? -10.376 -12.391 -7.124  1.00 53.08 ? 328 GLU A OE2   1 
ATOM   2534  N  N     . ILE A  1 318 ? -6.173  -10.458 -2.151  1.00 18.86 ? 329 ILE A N     1 
ATOM   2535  C  CA    . ILE A  1 318 ? -5.887  -9.548  -1.031  1.00 17.63 ? 329 ILE A CA    1 
ATOM   2536  C  C     . ILE A  1 318 ? -5.546  -8.164  -1.587  1.00 19.43 ? 329 ILE A C     1 
ATOM   2537  O  O     . ILE A  1 318 ? -4.945  -8.074  -2.666  1.00 17.43 ? 329 ILE A O     1 
ATOM   2538  C  CB    . ILE A  1 318 ? -4.803  -10.101 -0.035  1.00 18.87 ? 329 ILE A CB    1 
ATOM   2539  C  CG1   . ILE A  1 318 ? -3.469  -10.444 -0.753  1.00 18.69 ? 329 ILE A CG1   1 
ATOM   2540  C  CG2   . ILE A  1 318 ? -5.349  -11.299 0.766   1.00 20.25 ? 329 ILE A CG2   1 
ATOM   2541  C  CD1   . ILE A  1 318 ? -2.253  -10.765 0.201   1.00 17.05 ? 329 ILE A CD1   1 
ATOM   2542  N  N     . PRO A  1 319 ? -5.915  -7.083  -0.866  1.00 16.92 ? 330 PRO A N     1 
ATOM   2543  C  CA    . PRO A  1 319 ? -5.636  -5.737  -1.383  1.00 16.48 ? 330 PRO A CA    1 
ATOM   2544  C  C     . PRO A  1 319 ? -4.154  -5.389  -1.453  1.00 19.06 ? 330 PRO A C     1 
ATOM   2545  O  O     . PRO A  1 319 ? -3.319  -5.909  -0.690  1.00 17.32 ? 330 PRO A O     1 
ATOM   2546  C  CB    . PRO A  1 319 ? -6.406  -4.806  -0.411  1.00 18.64 ? 330 PRO A CB    1 
ATOM   2547  C  CG    . PRO A  1 319 ? -6.656  -5.589  0.787   1.00 23.29 ? 330 PRO A CG    1 
ATOM   2548  C  CD    . PRO A  1 319 ? -6.690  -7.038  0.398   1.00 18.41 ? 330 PRO A CD    1 
ATOM   2549  N  N     . ASN A  1 320 ? -3.829  -4.506  -2.388  1.00 16.37 ? 331 ASN A N     1 
ATOM   2550  C  CA    . ASN A  1 320 ? -2.471  -4.026  -2.603  1.00 15.77 ? 331 ASN A CA    1 
ATOM   2551  C  C     . ASN A  1 320 ? -2.061  -3.099  -1.464  1.00 16.97 ? 331 ASN A C     1 
ATOM   2552  O  O     . ASN A  1 320 ? -0.894  -3.059  -1.097  1.00 15.88 ? 331 ASN A O     1 
ATOM   2553  C  CB    . ASN A  1 320 ? -2.342  -3.318  -3.945  1.00 15.35 ? 331 ASN A CB    1 
ATOM   2554  C  CG    . ASN A  1 320 ? -0.902  -3.076  -4.314  1.00 26.79 ? 331 ASN A CG    1 
ATOM   2555  O  OD1   . ASN A  1 320 ? -0.012  -3.883  -4.003  1.00 15.89 ? 331 ASN A OD1   1 
ATOM   2556  N  ND2   . ASN A  1 320 ? -0.634  -1.966  -4.970  1.00 17.73 ? 331 ASN A ND2   1 
ATOM   2557  N  N     . GLU A  1 321 ? -3.033  -2.401  -0.873  1.00 14.26 ? 332 GLU A N     1 
ATOM   2558  C  CA    . GLU A  1 321 ? -2.804  -1.500  0.262   1.00 13.09 ? 332 GLU A CA    1 
ATOM   2559  C  C     . GLU A  1 321 ? -2.463  -2.376  1.479   1.00 15.79 ? 332 GLU A C     1 
ATOM   2560  O  O     . GLU A  1 321 ? -3.281  -3.212  1.875   1.00 15.08 ? 332 GLU A O     1 
ATOM   2561  C  CB    . GLU A  1 321 ? -4.093  -0.674  0.516   1.00 14.62 ? 332 GLU A CB    1 
ATOM   2562  C  CG    . GLU A  1 321 ? -3.988  0.341   1.651   1.00 26.12 ? 332 GLU A CG    1 
ATOM   2563  C  CD    . GLU A  1 321 ? -3.054  1.526   1.477   1.00 42.37 ? 332 GLU A CD    1 
ATOM   2564  O  OE1   . GLU A  1 321 ? -2.583  1.789   0.345   1.00 35.57 ? 332 GLU A OE1   1 
ATOM   2565  O  OE2   . GLU A  1 321 ? -2.830  2.225   2.490   1.00 30.85 ? 332 GLU A OE2   1 
ATOM   2566  N  N     . LEU A  1 322 ? -1.237  -2.246  2.023   1.00 12.12 ? 333 LEU A N     1 
ATOM   2567  C  CA    . LEU A  1 322 ? -0.845  -3.092  3.156   1.00 11.96 ? 333 LEU A CA    1 
ATOM   2568  C  C     . LEU A  1 322 ? -1.653  -2.812  4.420   1.00 15.52 ? 333 LEU A C     1 
ATOM   2569  O  O     . LEU A  1 322 ? -1.802  -1.640  4.793   1.00 15.40 ? 333 LEU A O     1 
ATOM   2570  C  CB    . LEU A  1 322 ? 0.643   -2.962  3.497   1.00 12.31 ? 333 LEU A CB    1 
ATOM   2571  C  CG    . LEU A  1 322 ? 1.614   -3.569  2.512   1.00 17.15 ? 333 LEU A CG    1 
ATOM   2572  C  CD1   . LEU A  1 322 ? 3.013   -3.102  2.836   1.00 17.04 ? 333 LEU A CD1   1 
ATOM   2573  C  CD2   . LEU A  1 322 ? 1.568   -5.116  2.545   1.00 16.92 ? 333 LEU A CD2   1 
ATOM   2574  N  N     . PRO A  1 323 ? -2.142  -3.863  5.118   1.00 12.22 ? 334 PRO A N     1 
ATOM   2575  C  CA    . PRO A  1 323 ? -2.826  -3.621  6.391   1.00 12.17 ? 334 PRO A CA    1 
ATOM   2576  C  C     . PRO A  1 323 ? -1.779  -3.194  7.409   1.00 14.19 ? 334 PRO A C     1 
ATOM   2577  O  O     . PRO A  1 323 ? -0.605  -3.519  7.244   1.00 12.07 ? 334 PRO A O     1 
ATOM   2578  C  CB    . PRO A  1 323 ? -3.386  -4.998  6.756   1.00 13.77 ? 334 PRO A CB    1 
ATOM   2579  C  CG    . PRO A  1 323 ? -2.434  -5.952  6.156   1.00 18.20 ? 334 PRO A CG    1 
ATOM   2580  C  CD    . PRO A  1 323 ? -2.016  -5.307  4.853   1.00 14.26 ? 334 PRO A CD    1 
ATOM   2581  N  N     . TYR A  1 324 ? -2.196  -2.529  8.498   1.00 12.17 ? 335 TYR A N     1 
ATOM   2582  C  CA    . TYR A  1 324 ? -1.260  -2.208  9.567   1.00 10.97 ? 335 TYR A CA    1 
ATOM   2583  C  C     . TYR A  1 324 ? -0.703  -3.536  10.121  1.00 14.40 ? 335 TYR A C     1 
ATOM   2584  O  O     . TYR A  1 324 ? -1.386  -4.561  10.056  1.00 13.86 ? 335 TYR A O     1 
ATOM   2585  C  CB    . TYR A  1 324 ? -1.990  -1.453  10.699  1.00 12.45 ? 335 TYR A CB    1 
ATOM   2586  C  CG    . TYR A  1 324 ? -1.014  -1.023  11.767  1.00 13.15 ? 335 TYR A CG    1 
ATOM   2587  C  CD1   . TYR A  1 324 ? -0.952  -1.684  12.991  1.00 16.00 ? 335 TYR A CD1   1 
ATOM   2588  C  CD2   . TYR A  1 324 ? -0.061  -0.043  11.508  1.00 13.63 ? 335 TYR A CD2   1 
ATOM   2589  C  CE1   . TYR A  1 324 ? 0.029   -1.367  13.935  1.00 16.76 ? 335 TYR A CE1   1 
ATOM   2590  C  CE2   . TYR A  1 324 ? 0.916   0.285   12.445  1.00 13.92 ? 335 TYR A CE2   1 
ATOM   2591  C  CZ    . TYR A  1 324 ? 0.952   -0.371  13.657  1.00 22.65 ? 335 TYR A CZ    1 
ATOM   2592  O  OH    . TYR A  1 324 ? 1.948   -0.039  14.544  1.00 27.69 ? 335 TYR A OH    1 
ATOM   2593  N  N     . ASN A  1 325 ? 0.547   -3.531  10.598  1.00 11.38 ? 336 ASN A N     1 
ATOM   2594  C  CA    . ASN A  1 325 ? 1.204   -4.715  11.152  1.00 11.53 ? 336 ASN A CA    1 
ATOM   2595  C  C     . ASN A  1 325 ? 2.381   -4.267  12.018  1.00 14.00 ? 336 ASN A C     1 
ATOM   2596  O  O     . ASN A  1 325 ? 2.701   -3.077  12.037  1.00 14.09 ? 336 ASN A O     1 
ATOM   2597  C  CB    . ASN A  1 325 ? 1.643   -5.676  10.011  1.00 10.80 ? 336 ASN A CB    1 
ATOM   2598  C  CG    . ASN A  1 325 ? 2.666   -5.084  9.081   1.00 18.11 ? 336 ASN A CG    1 
ATOM   2599  O  OD1   . ASN A  1 325 ? 3.856   -5.123  9.366   1.00 13.56 ? 336 ASN A OD1   1 
ATOM   2600  N  ND2   . ASN A  1 325 ? 2.232   -4.489  7.970   1.00 13.48 ? 336 ASN A ND2   1 
ATOM   2601  N  N     . ASP A  1 326 ? 2.996   -5.201  12.772  1.00 11.28 ? 337 ASP A N     1 
ATOM   2602  C  CA    . ASP A  1 326 ? 4.098   -4.907  13.693  1.00 10.46 ? 337 ASP A CA    1 
ATOM   2603  C  C     . ASP A  1 326 ? 5.356   -4.331  13.029  1.00 14.77 ? 337 ASP A C     1 
ATOM   2604  O  O     . ASP A  1 326 ? 6.186   -3.729  13.707  1.00 13.82 ? 337 ASP A O     1 
ATOM   2605  C  CB    . ASP A  1 326 ? 4.487   -6.194  14.434  1.00 12.23 ? 337 ASP A CB    1 
ATOM   2606  C  CG    . ASP A  1 326 ? 3.505   -6.661  15.474  1.00 17.64 ? 337 ASP A CG    1 
ATOM   2607  O  OD1   . ASP A  1 326 ? 2.462   -5.967  15.679  1.00 16.45 ? 337 ASP A OD1   1 
ATOM   2608  O  OD2   . ASP A  1 326 ? 3.761   -7.704  16.084  1.00 25.58 ? 337 ASP A OD2   1 
ATOM   2609  N  N     . TYR A  1 327 ? 5.488   -4.522  11.709  1.00 11.43 ? 338 TYR A N     1 
ATOM   2610  C  CA    . TYR A  1 327 ? 6.638   -4.135  10.900  1.00 10.12 ? 338 TYR A CA    1 
ATOM   2611  C  C     . TYR A  1 327 ? 6.265   -3.161  9.804   1.00 13.13 ? 338 TYR A C     1 
ATOM   2612  O  O     . TYR A  1 327 ? 6.980   -3.052  8.814   1.00 12.00 ? 338 TYR A O     1 
ATOM   2613  C  CB    . TYR A  1 327 ? 7.303   -5.395  10.320  1.00 11.06 ? 338 TYR A CB    1 
ATOM   2614  C  CG    . TYR A  1 327 ? 7.551   -6.404  11.411  1.00 12.67 ? 338 TYR A CG    1 
ATOM   2615  C  CD1   . TYR A  1 327 ? 6.735   -7.528  11.543  1.00 13.51 ? 338 TYR A CD1   1 
ATOM   2616  C  CD2   . TYR A  1 327 ? 8.472   -6.146  12.423  1.00 13.75 ? 338 TYR A CD2   1 
ATOM   2617  C  CE1   . TYR A  1 327 ? 6.884   -8.407  12.606  1.00 13.14 ? 338 TYR A CE1   1 
ATOM   2618  C  CE2   . TYR A  1 327 ? 8.605   -7.001  13.511  1.00 15.76 ? 338 TYR A CE2   1 
ATOM   2619  C  CZ    . TYR A  1 327 ? 7.817   -8.137  13.591  1.00 17.46 ? 338 TYR A CZ    1 
ATOM   2620  O  OH    . TYR A  1 327 ? 7.994   -9.005  14.630  1.00 18.95 ? 338 TYR A OH    1 
ATOM   2621  N  N     . PHE A  1 328 ? 5.161   -2.429  9.994   1.00 10.77 ? 339 PHE A N     1 
ATOM   2622  C  CA    . PHE A  1 328 ? 4.601   -1.515  9.000   1.00 10.24 ? 339 PHE A CA    1 
ATOM   2623  C  C     . PHE A  1 328 ? 5.640   -0.538  8.403   1.00 15.48 ? 339 PHE A C     1 
ATOM   2624  O  O     . PHE A  1 328 ? 5.682   -0.338  7.177   1.00 13.78 ? 339 PHE A O     1 
ATOM   2625  C  CB    . PHE A  1 328 ? 3.360   -0.796  9.577   1.00 11.71 ? 339 PHE A CB    1 
ATOM   2626  C  CG    . PHE A  1 328 ? 2.496   -0.089  8.558   1.00 13.22 ? 339 PHE A CG    1 
ATOM   2627  C  CD1   . PHE A  1 328 ? 2.484   1.298   8.475   1.00 16.20 ? 339 PHE A CD1   1 
ATOM   2628  C  CD2   . PHE A  1 328 ? 1.657   -0.810  7.709   1.00 13.74 ? 339 PHE A CD2   1 
ATOM   2629  C  CE1   . PHE A  1 328 ? 1.673   1.955   7.541   1.00 17.58 ? 339 PHE A CE1   1 
ATOM   2630  C  CE2   . PHE A  1 328 ? 0.843   -0.151  6.773   1.00 17.58 ? 339 PHE A CE2   1 
ATOM   2631  C  CZ    . PHE A  1 328 ? 0.859   1.224   6.694   1.00 16.32 ? 339 PHE A CZ    1 
ATOM   2632  N  N     . GLU A  1 329 ? 6.530   -0.001  9.256   1.00 12.38 ? 340 GLU A N     1 
ATOM   2633  C  CA    . GLU A  1 329 ? 7.596   0.916   8.802   1.00 10.87 ? 340 GLU A CA    1 
ATOM   2634  C  C     . GLU A  1 329 ? 8.595   0.300   7.790   1.00 14.91 ? 340 GLU A C     1 
ATOM   2635  O  O     . GLU A  1 329 ? 9.215   1.041   7.030   1.00 13.86 ? 340 GLU A O     1 
ATOM   2636  C  CB    . GLU A  1 329 ? 8.356   1.535   9.991   1.00 11.06 ? 340 GLU A CB    1 
ATOM   2637  C  CG    . GLU A  1 329 ? 9.266   0.582   10.751  1.00 11.97 ? 340 GLU A CG    1 
ATOM   2638  C  CD    . GLU A  1 329 ? 8.676   -0.404  11.743  1.00 16.66 ? 340 GLU A CD    1 
ATOM   2639  O  OE1   . GLU A  1 329 ? 9.480   -1.004  12.489  1.00 13.14 ? 340 GLU A OE1   1 
ATOM   2640  O  OE2   . GLU A  1 329 ? 7.439   -0.610  11.764  1.00 16.95 ? 340 GLU A OE2   1 
ATOM   2641  N  N     . TYR A  1 330 ? 8.755   -1.032  7.780   1.00 13.76 ? 341 TYR A N     1 
ATOM   2642  C  CA    . TYR A  1 330 ? 9.698   -1.686  6.862   1.00 13.36 ? 341 TYR A CA    1 
ATOM   2643  C  C     . TYR A  1 330 ? 9.222   -1.570  5.395   1.00 14.82 ? 341 TYR A C     1 
ATOM   2644  O  O     . TYR A  1 330 ? 10.033  -1.663  4.487   1.00 14.82 ? 341 TYR A O     1 
ATOM   2645  C  CB    . TYR A  1 330 ? 9.825   -3.183  7.203   1.00 15.21 ? 341 TYR A CB    1 
ATOM   2646  C  CG    . TYR A  1 330 ? 10.595  -3.562  8.454   1.00 18.05 ? 341 TYR A CG    1 
ATOM   2647  C  CD1   . TYR A  1 330 ? 10.168  -3.146  9.715   1.00 20.44 ? 341 TYR A CD1   1 
ATOM   2648  C  CD2   . TYR A  1 330 ? 11.639  -4.487  8.398   1.00 19.98 ? 341 TYR A CD2   1 
ATOM   2649  C  CE1   . TYR A  1 330 ? 10.804  -3.584  10.880  1.00 19.51 ? 341 TYR A CE1   1 
ATOM   2650  C  CE2   . TYR A  1 330 ? 12.255  -4.958  9.559   1.00 20.84 ? 341 TYR A CE2   1 
ATOM   2651  C  CZ    . TYR A  1 330 ? 11.842  -4.492  10.793  1.00 25.08 ? 341 TYR A CZ    1 
ATOM   2652  O  OH    . TYR A  1 330 ? 12.455  -4.931  11.932  1.00 28.32 ? 341 TYR A OH    1 
ATOM   2653  N  N     . PHE A  1 331 ? 7.911   -1.389  5.188   1.00 12.82 ? 342 PHE A N     1 
ATOM   2654  C  CA    . PHE A  1 331 ? 7.228   -1.363  3.891   1.00 12.18 ? 342 PHE A CA    1 
ATOM   2655  C  C     . PHE A  1 331 ? 7.097   0.009   3.261   1.00 15.95 ? 342 PHE A C     1 
ATOM   2656  O  O     . PHE A  1 331 ? 6.505   0.154   2.190   1.00 14.68 ? 342 PHE A O     1 
ATOM   2657  C  CB    . PHE A  1 331 ? 5.868   -2.083  3.997   1.00 12.31 ? 342 PHE A CB    1 
ATOM   2658  C  CG    . PHE A  1 331 ? 6.024   -3.488  4.527   1.00 11.87 ? 342 PHE A CG    1 
ATOM   2659  C  CD1   . PHE A  1 331 ? 5.723   -3.784  5.850   1.00 13.61 ? 342 PHE A CD1   1 
ATOM   2660  C  CD2   . PHE A  1 331 ? 6.494   -4.512  3.707   1.00 11.02 ? 342 PHE A CD2   1 
ATOM   2661  C  CE1   . PHE A  1 331 ? 5.877   -5.094  6.348   1.00 13.61 ? 342 PHE A CE1   1 
ATOM   2662  C  CE2   . PHE A  1 331 ? 6.660   -5.813  4.204   1.00 13.82 ? 342 PHE A CE2   1 
ATOM   2663  C  CZ    . PHE A  1 331 ? 6.342   -6.100  5.528   1.00 12.17 ? 342 PHE A CZ    1 
ATOM   2664  N  N     . GLY A  1 332 ? 7.695   1.002   3.901   1.00 13.90 ? 343 GLY A N     1 
ATOM   2665  C  CA    . GLY A  1 332 ? 7.722   2.340   3.337   1.00 13.70 ? 343 GLY A CA    1 
ATOM   2666  C  C     . GLY A  1 332 ? 8.662   2.394   2.138   1.00 15.73 ? 343 GLY A C     1 
ATOM   2667  O  O     . GLY A  1 332 ? 9.444   1.472   1.934   1.00 14.14 ? 343 GLY A O     1 
ATOM   2668  N  N     . PRO A  1 333 ? 8.622   3.461   1.324   1.00 14.54 ? 344 PRO A N     1 
ATOM   2669  C  CA    . PRO A  1 333 ? 7.751   4.652   1.453   1.00 14.83 ? 344 PRO A CA    1 
ATOM   2670  C  C     . PRO A  1 333 ? 6.355   4.480   0.888   1.00 18.22 ? 344 PRO A C     1 
ATOM   2671  O  O     . PRO A  1 333 ? 5.523   5.372   1.055   1.00 17.99 ? 344 PRO A O     1 
ATOM   2672  C  CB    . PRO A  1 333 ? 8.513   5.716   0.658   1.00 16.28 ? 344 PRO A CB    1 
ATOM   2673  C  CG    . PRO A  1 333 ? 9.214   4.940   -0.434  1.00 20.41 ? 344 PRO A CG    1 
ATOM   2674  C  CD    . PRO A  1 333 ? 9.541   3.577   0.168   1.00 16.48 ? 344 PRO A CD    1 
ATOM   2675  N  N     . ASP A  1 334 ? 6.096   3.335   0.229   1.00 14.09 ? 345 ASP A N     1 
ATOM   2676  C  CA    . ASP A  1 334 ? 4.829   3.077   -0.462  1.00 14.15 ? 345 ASP A CA    1 
ATOM   2677  C  C     . ASP A  1 334 ? 3.744   2.394   0.352   1.00 16.06 ? 345 ASP A C     1 
ATOM   2678  O  O     . ASP A  1 334 ? 2.582   2.711   0.152   1.00 16.21 ? 345 ASP A O     1 
ATOM   2679  C  CB    . ASP A  1 334 ? 5.103   2.283   -1.749  1.00 16.34 ? 345 ASP A CB    1 
ATOM   2680  C  CG    . ASP A  1 334 ? 5.856   1.002   -1.455  1.00 15.56 ? 345 ASP A CG    1 
ATOM   2681  O  OD1   . ASP A  1 334 ? 7.068   1.083   -1.144  1.00 15.09 ? 345 ASP A OD1   1 
ATOM   2682  O  OD2   . ASP A  1 334 ? 5.205   -0.051  -1.373  1.00 15.28 ? 345 ASP A OD2   1 
ATOM   2683  N  N     . PHE A  1 335 ? 4.103   1.440   1.235   1.00 12.38 ? 346 PHE A N     1 
ATOM   2684  C  CA    . PHE A  1 335 ? 3.149   0.688   2.059   1.00 12.19 ? 346 PHE A CA    1 
ATOM   2685  C  C     . PHE A  1 335 ? 2.179   -0.096  1.198   1.00 15.64 ? 346 PHE A C     1 
ATOM   2686  O  O     . PHE A  1 335 ? 0.994   -0.227  1.546   1.00 14.53 ? 346 PHE A O     1 
ATOM   2687  C  CB    . PHE A  1 335 ? 2.419   1.578   3.075   1.00 12.47 ? 346 PHE A CB    1 
ATOM   2688  C  CG    . PHE A  1 335 ? 3.376   2.374   3.913   1.00 11.75 ? 346 PHE A CG    1 
ATOM   2689  C  CD1   . PHE A  1 335 ? 3.570   3.734   3.671   1.00 13.44 ? 346 PHE A CD1   1 
ATOM   2690  C  CD2   . PHE A  1 335 ? 4.140   1.755   4.905   1.00 11.93 ? 346 PHE A CD2   1 
ATOM   2691  C  CE1   . PHE A  1 335 ? 4.512   4.457   4.404   1.00 13.67 ? 346 PHE A CE1   1 
ATOM   2692  C  CE2   . PHE A  1 335 ? 5.052   2.490   5.669   1.00 14.84 ? 346 PHE A CE2   1 
ATOM   2693  C  CZ    . PHE A  1 335 ? 5.239   3.836   5.403   1.00 12.40 ? 346 PHE A CZ    1 
ATOM   2694  N  N     . LYS A  1 336 ? 2.710   -0.653  0.082   1.00 12.23 ? 347 LYS A N     1 
ATOM   2695  C  CA    . LYS A  1 336 ? 1.949   -1.490  -0.858  1.00 12.04 ? 347 LYS A CA    1 
ATOM   2696  C  C     . LYS A  1 336 ? 2.524   -2.911  -0.849  1.00 14.98 ? 347 LYS A C     1 
ATOM   2697  O  O     . LYS A  1 336 ? 3.688   -3.107  -0.526  1.00 15.05 ? 347 LYS A O     1 
ATOM   2698  C  CB    . LYS A  1 336 ? 1.991   -0.922  -2.316  1.00 13.81 ? 347 LYS A CB    1 
ATOM   2699  C  CG    . LYS A  1 336 ? 1.433   0.497   -2.511  1.00 22.56 ? 347 LYS A CG    1 
ATOM   2700  C  CD    . LYS A  1 336 ? -0.037  0.584   -2.191  1.00 31.93 ? 347 LYS A CD    1 
ATOM   2701  C  CE    . LYS A  1 336 ? -0.639  1.890   -2.649  1.00 36.37 ? 347 LYS A CE    1 
ATOM   2702  N  NZ    . LYS A  1 336 ? -2.112  1.897   -2.426  1.00 38.33 ? 347 LYS A NZ    1 
ATOM   2703  N  N     . LEU A  1 337 ? 1.708   -3.893  -1.215  1.00 11.14 ? 348 LEU A N     1 
ATOM   2704  C  CA    . LEU A  1 337 ? 2.126   -5.292  -1.226  1.00 11.09 ? 348 LEU A CA    1 
ATOM   2705  C  C     . LEU A  1 337 ? 3.024   -5.599  -2.423  1.00 15.70 ? 348 LEU A C     1 
ATOM   2706  O  O     . LEU A  1 337 ? 4.056   -6.259  -2.271  1.00 13.65 ? 348 LEU A O     1 
ATOM   2707  C  CB    . LEU A  1 337 ? 0.874   -6.194  -1.243  1.00 10.53 ? 348 LEU A CB    1 
ATOM   2708  C  CG    . LEU A  1 337 ? 1.081   -7.700  -1.377  1.00 13.68 ? 348 LEU A CG    1 
ATOM   2709  C  CD1   . LEU A  1 337 ? 1.742   -8.286  -0.109  1.00 14.50 ? 348 LEU A CD1   1 
ATOM   2710  C  CD2   . LEU A  1 337 ? -0.253  -8.370  -1.669  1.00 11.77 ? 348 LEU A CD2   1 
ATOM   2711  N  N     . HIS A  1 338 ? 2.618   -5.146  -3.614  1.00 13.11 ? 349 HIS A N     1 
ATOM   2712  C  CA    . HIS A  1 338 ? 3.356   -5.421  -4.840  1.00 12.76 ? 349 HIS A CA    1 
ATOM   2713  C  C     . HIS A  1 338 ? 4.492   -4.460  -5.077  1.00 18.47 ? 349 HIS A C     1 
ATOM   2714  O  O     . HIS A  1 338 ? 4.487   -3.354  -4.546  1.00 18.36 ? 349 HIS A O     1 
ATOM   2715  C  CB    . HIS A  1 338 ? 2.398   -5.565  -6.039  1.00 13.46 ? 349 HIS A CB    1 
ATOM   2716  C  CG    . HIS A  1 338 ? 1.502   -6.753  -5.861  1.00 15.83 ? 349 HIS A CG    1 
ATOM   2717  N  ND1   . HIS A  1 338 ? 1.978   -8.042  -6.045  1.00 17.09 ? 349 HIS A ND1   1 
ATOM   2718  C  CD2   . HIS A  1 338 ? 0.216   -6.816  -5.442  1.00 16.30 ? 349 HIS A CD2   1 
ATOM   2719  C  CE1   . HIS A  1 338 ? 0.975   -8.849  -5.730  1.00 15.77 ? 349 HIS A CE1   1 
ATOM   2720  N  NE2   . HIS A  1 338 ? -0.110  -8.161  -5.369  1.00 16.01 ? 349 HIS A NE2   1 
ATOM   2721  N  N     . ILE A  1 339 ? 5.509   -4.917  -5.819  1.00 15.06 ? 350 ILE A N     1 
ATOM   2722  C  CA    . ILE A  1 339 ? 6.721   -4.136  -6.057  1.00 13.85 ? 350 ILE A CA    1 
ATOM   2723  C  C     . ILE A  1 339 ? 6.896   -3.849  -7.546  1.00 19.56 ? 350 ILE A C     1 
ATOM   2724  O  O     . ILE A  1 339 ? 6.331   -4.537  -8.391  1.00 18.88 ? 350 ILE A O     1 
ATOM   2725  C  CB    . ILE A  1 339 ? 7.978   -4.840  -5.445  1.00 15.57 ? 350 ILE A CB    1 
ATOM   2726  C  CG1   . ILE A  1 339 ? 8.329   -6.168  -6.175  1.00 13.46 ? 350 ILE A CG1   1 
ATOM   2727  C  CG2   . ILE A  1 339 ? 7.818   -5.059  -3.919  1.00 17.44 ? 350 ILE A CG2   1 
ATOM   2728  C  CD1   . ILE A  1 339 ? 9.672   -6.866  -5.683  1.00 13.24 ? 350 ILE A CD1   1 
ATOM   2729  N  N     . SER A  1 340 ? 7.704   -2.843  -7.846  1.00 18.77 ? 351 SER A N     1 
ATOM   2730  C  CA    . SER A  1 340 ? 8.026   -2.423  -9.208  1.00 19.64 ? 351 SER A CA    1 
ATOM   2731  C  C     . SER A  1 340 ? 9.368   -3.019  -9.594  1.00 21.50 ? 351 SER A C     1 
ATOM   2732  O  O     . SER A  1 340 ? 10.264  -3.067  -8.744  1.00 21.17 ? 351 SER A O     1 
ATOM   2733  C  CB    . SER A  1 340 ? 8.124   -0.899  -9.276  1.00 24.08 ? 351 SER A CB    1 
ATOM   2734  O  OG    . SER A  1 340 ? 6.821   -0.338  -9.236  1.00 34.36 ? 351 SER A OG    1 
ATOM   2735  N  N     . PRO A  1 341 ? 9.552   -3.429  -10.870 1.00 17.20 ? 352 PRO A N     1 
ATOM   2736  C  CA    . PRO A  1 341 ? 10.883  -3.878  -11.294 1.00 18.08 ? 352 PRO A CA    1 
ATOM   2737  C  C     . PRO A  1 341 ? 11.807  -2.662  -11.417 1.00 22.44 ? 352 PRO A C     1 
ATOM   2738  O  O     . PRO A  1 341 ? 11.321  -1.538  -11.538 1.00 21.63 ? 352 PRO A O     1 
ATOM   2739  C  CB    . PRO A  1 341 ? 10.629  -4.493  -12.677 1.00 20.01 ? 352 PRO A CB    1 
ATOM   2740  C  CG    . PRO A  1 341 ? 9.432   -3.785  -13.205 1.00 23.63 ? 352 PRO A CG    1 
ATOM   2741  C  CD    . PRO A  1 341 ? 8.604   -3.374  -12.011 1.00 19.08 ? 352 PRO A CD    1 
ATOM   2742  N  N     . SER A  1 342 ? 13.119  -2.882  -11.361 1.00 20.07 ? 353 SER A N     1 
ATOM   2743  C  CA    . SER A  1 342 ? 14.100  -1.812  -11.522 1.00 20.42 ? 353 SER A CA    1 
ATOM   2744  C  C     . SER A  1 342 ? 14.326  -1.577  -13.041 1.00 23.59 ? 353 SER A C     1 
ATOM   2745  O  O     . SER A  1 342 ? 13.728  -2.282  -13.860 1.00 20.45 ? 353 SER A O     1 
ATOM   2746  C  CB    . SER A  1 342 ? 15.412  -2.210  -10.860 1.00 23.79 ? 353 SER A CB    1 
ATOM   2747  O  OG    . SER A  1 342 ? 16.122  -3.128  -11.674 1.00 25.39 ? 353 SER A OG    1 
ATOM   2748  N  N     . ASN A  1 343 ? 15.194  -0.594  -13.403 1.00 21.35 ? 354 ASN A N     1 
ATOM   2749  C  CA    . ASN A  1 343 ? 15.537  -0.292  -14.807 1.00 22.16 ? 354 ASN A CA    1 
ATOM   2750  C  C     . ASN A  1 343 ? 16.765  -1.136  -15.265 1.00 24.40 ? 354 ASN A C     1 
ATOM   2751  O  O     . ASN A  1 343 ? 17.361  -0.836  -16.308 1.00 23.39 ? 354 ASN A O     1 
ATOM   2752  C  CB    . ASN A  1 343 ? 15.828  1.230   -14.977 1.00 24.94 ? 354 ASN A CB    1 
ATOM   2753  C  CG    . ASN A  1 343 ? 17.132  1.725   -14.365 1.00 58.28 ? 354 ASN A CG    1 
ATOM   2754  O  OD1   . ASN A  1 343 ? 17.768  1.071   -13.515 1.00 53.13 ? 354 ASN A OD1   1 
ATOM   2755  N  ND2   . ASN A  1 343 ? 17.542  2.926   -14.761 1.00 52.89 ? 354 ASN A ND2   1 
ATOM   2756  N  N     . MET A  1 344 ? 17.174  -2.155  -14.463 1.00 19.04 ? 355 MET A N     1 
ATOM   2757  C  CA    . MET A  1 344 ? 18.341  -2.974  -14.816 1.00 16.77 ? 355 MET A CA    1 
ATOM   2758  C  C     . MET A  1 344 ? 18.151  -3.683  -16.145 1.00 19.04 ? 355 MET A C     1 
ATOM   2759  O  O     . MET A  1 344 ? 17.032  -4.071  -16.496 1.00 16.46 ? 355 MET A O     1 
ATOM   2760  C  CB    . MET A  1 344 ? 18.749  -3.942  -13.698 1.00 18.02 ? 355 MET A CB    1 
ATOM   2761  C  CG    . MET A  1 344 ? 17.897  -5.215  -13.642 1.00 19.89 ? 355 MET A CG    1 
ATOM   2762  S  SD    . MET A  1 344 ? 18.401  -6.293  -12.296 1.00 21.43 ? 355 MET A SD    1 
ATOM   2763  C  CE    . MET A  1 344 ? 20.089  -6.650  -12.750 1.00 18.45 ? 355 MET A CE    1 
ATOM   2764  N  N     . THR A  1 345 ? 19.246  -3.812  -16.898 1.00 16.53 ? 356 THR A N     1 
ATOM   2765  C  CA    . THR A  1 345 ? 19.202  -4.461  -18.202 1.00 16.53 ? 356 THR A CA    1 
ATOM   2766  C  C     . THR A  1 345 ? 18.953  -5.948  -18.001 1.00 18.01 ? 356 THR A C     1 
ATOM   2767  O  O     . THR A  1 345 ? 19.543  -6.570  -17.120 1.00 17.09 ? 356 THR A O     1 
ATOM   2768  C  CB    . THR A  1 345 ? 20.558  -4.231  -18.945 1.00 25.79 ? 356 THR A CB    1 
ATOM   2769  O  OG1   . THR A  1 345 ? 20.829  -2.832  -19.009 1.00 27.14 ? 356 THR A OG1   1 
ATOM   2770  C  CG2   . THR A  1 345 ? 20.574  -4.818  -20.349 1.00 21.78 ? 356 THR A CG2   1 
ATOM   2771  N  N     . ASN A  1 346 ? 18.087  -6.509  -18.825 1.00 16.30 ? 357 ASN A N     1 
ATOM   2772  C  CA    . ASN A  1 346 ? 17.856  -7.941  -18.811 1.00 15.80 ? 357 ASN A CA    1 
ATOM   2773  C  C     . ASN A  1 346 ? 18.873  -8.543  -19.788 1.00 19.76 ? 357 ASN A C     1 
ATOM   2774  O  O     . ASN A  1 346 ? 18.694  -8.437  -21.000 1.00 18.31 ? 357 ASN A O     1 
ATOM   2775  C  CB    . ASN A  1 346 ? 16.437  -8.259  -19.248 1.00 13.64 ? 357 ASN A CB    1 
ATOM   2776  C  CG    . ASN A  1 346 ? 16.118  -9.728  -19.224 1.00 21.64 ? 357 ASN A CG    1 
ATOM   2777  O  OD1   . ASN A  1 346 ? 16.945  -10.568 -18.854 1.00 19.42 ? 357 ASN A OD1   1 
ATOM   2778  N  ND2   . ASN A  1 346 ? 14.904  -10.074 -19.597 1.00 15.91 ? 357 ASN A ND2   1 
ATOM   2779  N  N     . GLN A  1 347 ? 19.899  -9.222  -19.260 1.00 16.38 ? 358 GLN A N     1 
ATOM   2780  C  CA    . GLN A  1 347 ? 20.939  -9.879  -20.061 1.00 15.98 ? 358 GLN A CA    1 
ATOM   2781  C  C     . GLN A  1 347 ? 20.439  -11.164 -20.738 1.00 17.80 ? 358 GLN A C     1 
ATOM   2782  O  O     . GLN A  1 347 ? 21.112  -11.710 -21.623 1.00 17.50 ? 358 GLN A O     1 
ATOM   2783  C  CB    . GLN A  1 347 ? 22.185  -10.137 -19.201 1.00 17.57 ? 358 GLN A CB    1 
ATOM   2784  C  CG    . GLN A  1 347 ? 22.691  -8.911  -18.434 1.00 35.34 ? 358 GLN A CG    1 
ATOM   2785  C  CD    . GLN A  1 347 ? 23.576  -7.973  -19.215 1.00 62.03 ? 358 GLN A CD    1 
ATOM   2786  O  OE1   . GLN A  1 347 ? 23.959  -8.222  -20.366 1.00 55.54 ? 358 GLN A OE1   1 
ATOM   2787  N  NE2   . GLN A  1 347 ? 23.934  -6.860  -18.585 1.00 58.36 ? 358 GLN A NE2   1 
ATOM   2788  N  N     . ASN A  1 348 ? 19.254  -11.637 -20.349 1.00 13.10 ? 359 ASN A N     1 
ATOM   2789  C  CA    . ASN A  1 348 ? 18.636  -12.829 -20.946 1.00 13.71 ? 359 ASN A CA    1 
ATOM   2790  C  C     . ASN A  1 348 ? 17.823  -12.401 -22.157 1.00 17.31 ? 359 ASN A C     1 
ATOM   2791  O  O     . ASN A  1 348 ? 16.646  -12.025 -22.027 1.00 17.02 ? 359 ASN A O     1 
ATOM   2792  C  CB    . ASN A  1 348 ? 17.719  -13.536 -19.956 1.00 11.66 ? 359 ASN A CB    1 
ATOM   2793  C  CG    . ASN A  1 348 ? 18.425  -13.944 -18.713 1.00 18.13 ? 359 ASN A CG    1 
ATOM   2794  O  OD1   . ASN A  1 348 ? 19.079  -14.983 -18.670 1.00 16.43 ? 359 ASN A OD1   1 
ATOM   2795  N  ND2   . ASN A  1 348 ? 18.371  -13.083 -17.708 1.00 9.47  ? 359 ASN A ND2   1 
ATOM   2796  N  N     . THR A  1 349 ? 18.414  -12.513 -23.347 1.00 11.20 ? 360 THR A N     1 
ATOM   2797  C  CA    . THR A  1 349 ? 17.665  -12.114 -24.535 1.00 10.29 ? 360 THR A CA    1 
ATOM   2798  C  C     . THR A  1 349 ? 16.502  -13.079 -24.780 1.00 12.70 ? 360 THR A C     1 
ATOM   2799  O  O     . THR A  1 349 ? 16.580  -14.239 -24.396 1.00 11.85 ? 360 THR A O     1 
ATOM   2800  C  CB    . THR A  1 349 ? 18.570  -12.063 -25.784 1.00 13.08 ? 360 THR A CB    1 
ATOM   2801  O  OG1   . THR A  1 349 ? 18.988  -13.393 -26.056 1.00 12.90 ? 360 THR A OG1   1 
ATOM   2802  C  CG2   . THR A  1 349 ? 19.794  -11.126 -25.619 1.00 11.59 ? 360 THR A CG2   1 
ATOM   2803  N  N     . PRO A  1 350 ? 15.440  -12.667 -25.476 1.00 10.58 ? 361 PRO A N     1 
ATOM   2804  C  CA    . PRO A  1 350 ? 14.358  -13.635 -25.784 1.00 10.73 ? 361 PRO A CA    1 
ATOM   2805  C  C     . PRO A  1 350 ? 14.895  -14.861 -26.566 1.00 14.00 ? 361 PRO A C     1 
ATOM   2806  O  O     . PRO A  1 350 ? 14.446  -15.985 -26.339 1.00 11.93 ? 361 PRO A O     1 
ATOM   2807  C  CB    . PRO A  1 350 ? 13.370  -12.793 -26.608 1.00 11.95 ? 361 PRO A CB    1 
ATOM   2808  C  CG    . PRO A  1 350 ? 13.611  -11.362 -26.103 1.00 16.31 ? 361 PRO A CG    1 
ATOM   2809  C  CD    . PRO A  1 350 ? 15.105  -11.300 -25.945 1.00 12.17 ? 361 PRO A CD    1 
ATOM   2810  N  N     . GLU A  1 351 ? 15.924  -14.656 -27.423 1.00 9.66  ? 362 GLU A N     1 
ATOM   2811  C  CA    . GLU A  1 351 ? 16.546  -15.756 -28.181 1.00 9.39  ? 362 GLU A CA    1 
ATOM   2812  C  C     . GLU A  1 351 ? 17.246  -16.709 -27.239 1.00 11.90 ? 362 GLU A C     1 
ATOM   2813  O  O     . GLU A  1 351 ? 17.154  -17.917 -27.430 1.00 11.63 ? 362 GLU A O     1 
ATOM   2814  C  CB    . GLU A  1 351 ? 17.557  -15.225 -29.237 1.00 9.67  ? 362 GLU A CB    1 
ATOM   2815  C  CG    . GLU A  1 351 ? 16.864  -14.515 -30.380 1.00 14.72 ? 362 GLU A CG    1 
ATOM   2816  C  CD    . GLU A  1 351 ? 16.358  -13.125 -30.059 1.00 27.08 ? 362 GLU A CD    1 
ATOM   2817  O  OE1   . GLU A  1 351 ? 16.943  -12.466 -29.171 1.00 15.99 ? 362 GLU A OE1   1 
ATOM   2818  O  OE2   . GLU A  1 351 ? 15.316  -12.733 -30.628 1.00 28.16 ? 362 GLU A OE2   1 
ATOM   2819  N  N     . TYR A  1 352 ? 17.959  -16.170 -26.227 1.00 10.41 ? 363 TYR A N     1 
ATOM   2820  C  CA    . TYR A  1 352 ? 18.660  -17.003 -25.247 1.00 10.22 ? 363 TYR A CA    1 
ATOM   2821  C  C     . TYR A  1 352 ? 17.622  -17.859 -24.517 1.00 13.90 ? 363 TYR A C     1 
ATOM   2822  O  O     . TYR A  1 352 ? 17.809  -19.071 -24.401 1.00 11.93 ? 363 TYR A O     1 
ATOM   2823  C  CB    . TYR A  1 352 ? 19.430  -16.134 -24.237 1.00 10.69 ? 363 TYR A CB    1 
ATOM   2824  C  CG    . TYR A  1 352 ? 20.060  -16.905 -23.088 1.00 11.17 ? 363 TYR A CG    1 
ATOM   2825  C  CD1   . TYR A  1 352 ? 19.394  -17.052 -21.872 1.00 11.38 ? 363 TYR A CD1   1 
ATOM   2826  C  CD2   . TYR A  1 352 ? 21.361  -17.397 -23.182 1.00 10.90 ? 363 TYR A CD2   1 
ATOM   2827  C  CE1   . TYR A  1 352 ? 19.970  -17.752 -20.809 1.00 11.97 ? 363 TYR A CE1   1 
ATOM   2828  C  CE2   . TYR A  1 352 ? 21.956  -18.075 -22.117 1.00 11.98 ? 363 TYR A CE2   1 
ATOM   2829  C  CZ    . TYR A  1 352 ? 21.258  -18.244 -20.928 1.00 15.29 ? 363 TYR A CZ    1 
ATOM   2830  O  OH    . TYR A  1 352 ? 21.858  -18.896 -19.872 1.00 16.98 ? 363 TYR A OH    1 
ATOM   2831  N  N     . MET A  1 353 ? 16.531  -17.224 -24.039 1.00 10.87 ? 364 MET A N     1 
ATOM   2832  C  CA    . MET A  1 353 ? 15.472  -17.930 -23.290 1.00 10.03 ? 364 MET A CA    1 
ATOM   2833  C  C     . MET A  1 353 ? 14.880  -19.079 -24.117 1.00 14.32 ? 364 MET A C     1 
ATOM   2834  O  O     . MET A  1 353 ? 14.768  -20.204 -23.627 1.00 13.58 ? 364 MET A O     1 
ATOM   2835  C  CB    . MET A  1 353 ? 14.386  -16.952 -22.841 1.00 11.82 ? 364 MET A CB    1 
ATOM   2836  C  CG    . MET A  1 353 ? 14.884  -15.869 -21.865 1.00 13.58 ? 364 MET A CG    1 
ATOM   2837  S  SD    . MET A  1 353 ? 15.736  -16.468 -20.377 1.00 18.61 ? 364 MET A SD    1 
ATOM   2838  C  CE    . MET A  1 353 ? 14.406  -17.365 -19.611 1.00 15.83 ? 364 MET A CE    1 
ATOM   2839  N  N     . GLU A  1 354 ? 14.540  -18.809 -25.379 1.00 12.40 ? 365 GLU A N     1 
ATOM   2840  C  CA    A GLU A  1 354 ? 13.958  -19.814 -26.255 0.45 12.48 ? 365 GLU A CA    1 
ATOM   2841  C  CA    B GLU A  1 354 ? 13.967  -19.826 -26.265 0.55 12.33 ? 365 GLU A CA    1 
ATOM   2842  C  C     . GLU A  1 354 ? 14.947  -20.948 -26.572 1.00 14.87 ? 365 GLU A C     1 
ATOM   2843  O  O     . GLU A  1 354 ? 14.548  -22.114 -26.624 1.00 12.15 ? 365 GLU A O     1 
ATOM   2844  C  CB    A GLU A  1 354 ? 13.411  -19.148 -27.524 0.45 14.07 ? 365 GLU A CB    1 
ATOM   2845  C  CB    B GLU A  1 354 ? 13.444  -19.211 -27.569 0.55 13.73 ? 365 GLU A CB    1 
ATOM   2846  C  CG    A GLU A  1 354 ? 12.736  -20.108 -28.485 0.45 21.35 ? 365 GLU A CG    1 
ATOM   2847  C  CG    B GLU A  1 354 ? 12.226  -18.328 -27.388 0.55 16.36 ? 365 GLU A CG    1 
ATOM   2848  C  CD    A GLU A  1 354 ? 11.418  -20.733 -28.071 0.45 18.54 ? 365 GLU A CD    1 
ATOM   2849  C  CD    B GLU A  1 354 ? 11.010  -18.969 -26.754 0.55 35.72 ? 365 GLU A CD    1 
ATOM   2850  O  OE1   A GLU A  1 354 ? 10.752  -20.198 -27.158 0.45 7.58  ? 365 GLU A OE1   1 
ATOM   2851  O  OE1   B GLU A  1 354 ? 10.611  -20.069 -27.200 0.55 34.49 ? 365 GLU A OE1   1 
ATOM   2852  O  OE2   A GLU A  1 354 ? 11.035  -21.746 -28.696 0.45 14.88 ? 365 GLU A OE2   1 
ATOM   2853  O  OE2   B GLU A  1 354 ? 10.450  -18.361 -25.815 0.55 26.60 ? 365 GLU A OE2   1 
ATOM   2854  N  N     . LYS A  1 355 ? 16.234  -20.609 -26.783 1.00 12.50 ? 366 LYS A N     1 
ATOM   2855  C  CA    . LYS A  1 355 ? 17.251  -21.609 -27.098 1.00 12.15 ? 366 LYS A CA    1 
ATOM   2856  C  C     . LYS A  1 355 ? 17.485  -22.609 -25.933 1.00 16.26 ? 366 LYS A C     1 
ATOM   2857  O  O     . LYS A  1 355 ? 17.503  -23.825 -26.171 1.00 15.26 ? 366 LYS A O     1 
ATOM   2858  C  CB    . LYS A  1 355 ? 18.558  -20.942 -27.546 1.00 13.32 ? 366 LYS A CB    1 
ATOM   2859  C  CG    . LYS A  1 355 ? 19.633  -21.944 -27.997 1.00 16.81 ? 366 LYS A CG    1 
ATOM   2860  C  CD    . LYS A  1 355 ? 19.295  -22.619 -29.336 1.00 19.47 ? 366 LYS A CD    1 
ATOM   2861  C  CE    . LYS A  1 355 ? 20.332  -23.677 -29.621 1.00 20.41 ? 366 LYS A CE    1 
ATOM   2862  N  NZ    . LYS A  1 355 ? 19.973  -24.490 -30.806 1.00 25.18 ? 366 LYS A NZ    1 
ATOM   2863  N  N     . ILE A  1 356 ? 17.642  -22.096 -24.693 1.00 12.91 ? 367 ILE A N     1 
ATOM   2864  C  CA    . ILE A  1 356 ? 17.827  -22.946 -23.497 1.00 12.28 ? 367 ILE A CA    1 
ATOM   2865  C  C     . ILE A  1 356 ? 16.590  -23.822 -23.317 1.00 16.89 ? 367 ILE A C     1 
ATOM   2866  O  O     . ILE A  1 356 ? 16.718  -25.023 -23.072 1.00 15.88 ? 367 ILE A O     1 
ATOM   2867  C  CB    . ILE A  1 356 ? 18.186  -22.120 -22.221 1.00 14.68 ? 367 ILE A CB    1 
ATOM   2868  C  CG1   . ILE A  1 356 ? 19.493  -21.275 -22.396 1.00 14.45 ? 367 ILE A CG1   1 
ATOM   2869  C  CG2   . ILE A  1 356 ? 18.233  -23.008 -20.951 1.00 14.67 ? 367 ILE A CG2   1 
ATOM   2870  C  CD1   . ILE A  1 356 ? 20.812  -22.070 -22.714 1.00 17.52 ? 367 ILE A CD1   1 
ATOM   2871  N  N     . LYS A  1 357 ? 15.393  -23.240 -23.508 1.00 12.81 ? 368 LYS A N     1 
ATOM   2872  C  CA    . LYS A  1 357 ? 14.145  -24.012 -23.409 1.00 11.57 ? 368 LYS A CA    1 
ATOM   2873  C  C     . LYS A  1 357 ? 14.117  -25.165 -24.430 1.00 17.42 ? 368 LYS A C     1 
ATOM   2874  O  O     . LYS A  1 357 ? 13.786  -26.296 -24.083 1.00 16.57 ? 368 LYS A O     1 
ATOM   2875  C  CB    . LYS A  1 357 ? 12.944  -23.099 -23.597 1.00 13.44 ? 368 LYS A CB    1 
ATOM   2876  C  CG    . LYS A  1 357 ? 11.622  -23.878 -23.604 1.00 22.20 ? 368 LYS A CG    1 
ATOM   2877  C  CD    . LYS A  1 357 ? 10.392  -22.986 -23.563 1.00 30.84 ? 368 LYS A CD    1 
ATOM   2878  C  CE    . LYS A  1 357 ? 10.224  -22.142 -24.794 1.00 33.51 ? 368 LYS A CE    1 
ATOM   2879  N  NZ    . LYS A  1 357 ? 9.823   -22.924 -25.988 1.00 42.65 ? 368 LYS A NZ    1 
ATOM   2880  N  N     . GLN A  1 358 ? 14.507  -24.882 -25.684 1.00 16.41 ? 369 GLN A N     1 
ATOM   2881  C  CA    . GLN A  1 358 ? 14.553  -25.916 -26.723 1.00 16.91 ? 369 GLN A CA    1 
ATOM   2882  C  C     . GLN A  1 358 ? 15.567  -27.012 -26.385 1.00 19.06 ? 369 GLN A C     1 
ATOM   2883  O  O     . GLN A  1 358 ? 15.266  -28.188 -26.604 1.00 18.50 ? 369 GLN A O     1 
ATOM   2884  C  CB    . GLN A  1 358 ? 14.834  -25.298 -28.104 1.00 18.54 ? 369 GLN A CB    1 
ATOM   2885  C  CG    . GLN A  1 358 ? 13.957  -25.888 -29.199 1.00 46.19 ? 369 GLN A CG    1 
ATOM   2886  C  CD    . GLN A  1 358 ? 12.468  -25.840 -28.900 1.00 63.63 ? 369 GLN A CD    1 
ATOM   2887  O  OE1   . GLN A  1 358 ? 11.907  -24.796 -28.535 1.00 60.52 ? 369 GLN A OE1   1 
ATOM   2888  N  NE2   . GLN A  1 358 ? 11.792  -26.974 -29.063 1.00 52.02 ? 369 GLN A NE2   1 
ATOM   2889  N  N     . ARG A  1 359 ? 16.721  -26.642 -25.779 1.00 16.00 ? 370 ARG A N     1 
ATOM   2890  C  CA    . ARG A  1 359 ? 17.710  -27.638 -25.363 1.00 15.69 ? 370 ARG A CA    1 
ATOM   2891  C  C     . ARG A  1 359 ? 17.145  -28.510 -24.242 1.00 19.79 ? 370 ARG A C     1 
ATOM   2892  O  O     . ARG A  1 359 ? 17.335  -29.737 -24.257 1.00 17.25 ? 370 ARG A O     1 
ATOM   2893  C  CB    . ARG A  1 359 ? 19.051  -27.018 -24.993 1.00 15.21 ? 370 ARG A CB    1 
ATOM   2894  C  CG    . ARG A  1 359 ? 19.741  -26.394 -26.211 1.00 24.83 ? 370 ARG A CG    1 
ATOM   2895  C  CD    . ARG A  1 359 ? 21.257  -26.396 -26.142 1.00 34.73 ? 370 ARG A CD    1 
ATOM   2896  N  NE    . ARG A  1 359 ? 21.823  -25.781 -27.347 1.00 40.74 ? 370 ARG A NE    1 
ATOM   2897  C  CZ    . ARG A  1 359 ? 23.079  -25.355 -27.464 1.00 46.16 ? 370 ARG A CZ    1 
ATOM   2898  N  NH1   . ARG A  1 359 ? 23.928  -25.481 -26.448 1.00 22.46 ? 370 ARG A NH1   1 
ATOM   2899  N  NH2   . ARG A  1 359 ? 23.488  -24.770 -28.590 1.00 22.92 ? 370 ARG A NH2   1 
ATOM   2900  N  N     . LEU A  1 360 ? 16.425  -27.892 -23.288 1.00 16.08 ? 371 LEU A N     1 
ATOM   2901  C  CA    . LEU A  1 360 ? 15.826  -28.675 -22.191 1.00 16.01 ? 371 LEU A CA    1 
ATOM   2902  C  C     . LEU A  1 360 ? 14.721  -29.590 -22.721 1.00 16.95 ? 371 LEU A C     1 
ATOM   2903  O  O     . LEU A  1 360 ? 14.622  -30.733 -22.269 1.00 15.76 ? 371 LEU A O     1 
ATOM   2904  C  CB    . LEU A  1 360 ? 15.312  -27.777 -21.039 1.00 16.05 ? 371 LEU A CB    1 
ATOM   2905  C  CG    . LEU A  1 360 ? 16.346  -26.901 -20.316 1.00 20.66 ? 371 LEU A CG    1 
ATOM   2906  C  CD1   . LEU A  1 360 ? 15.709  -26.182 -19.157 1.00 20.85 ? 371 LEU A CD1   1 
ATOM   2907  C  CD2   . LEU A  1 360 ? 17.526  -27.701 -19.825 1.00 22.81 ? 371 LEU A CD2   1 
ATOM   2908  N  N     . PHE A  1 361 ? 13.947  -29.129 -23.729 1.00 13.62 ? 372 PHE A N     1 
ATOM   2909  C  CA    . PHE A  1 361 ? 12.887  -29.949 -24.347 1.00 14.21 ? 372 PHE A CA    1 
ATOM   2910  C  C     . PHE A  1 361 ? 13.464  -31.212 -24.982 1.00 18.18 ? 372 PHE A C     1 
ATOM   2911  O  O     . PHE A  1 361 ? 12.852  -32.263 -24.858 1.00 16.92 ? 372 PHE A O     1 
ATOM   2912  C  CB    . PHE A  1 361 ? 12.062  -29.172 -25.396 1.00 16.84 ? 372 PHE A CB    1 
ATOM   2913  C  CG    . PHE A  1 361 ? 11.016  -28.200 -24.883 1.00 18.96 ? 372 PHE A CG    1 
ATOM   2914  C  CD1   . PHE A  1 361 ? 10.541  -28.282 -23.577 1.00 22.46 ? 372 PHE A CD1   1 
ATOM   2915  C  CD2   . PHE A  1 361 ? 10.489  -27.220 -25.717 1.00 22.69 ? 372 PHE A CD2   1 
ATOM   2916  C  CE1   . PHE A  1 361 ? 9.559   -27.397 -23.111 1.00 23.46 ? 372 PHE A CE1   1 
ATOM   2917  C  CE2   . PHE A  1 361 ? 9.514   -26.333 -25.250 1.00 26.46 ? 372 PHE A CE2   1 
ATOM   2918  C  CZ    . PHE A  1 361 ? 9.043   -26.441 -23.949 1.00 24.21 ? 372 PHE A CZ    1 
ATOM   2919  N  N     . GLU A  1 362 ? 14.644  -31.114 -25.633 1.00 17.30 ? 373 GLU A N     1 
ATOM   2920  C  CA    . GLU A  1 362 ? 15.342  -32.265 -26.230 1.00 17.84 ? 373 GLU A CA    1 
ATOM   2921  C  C     . GLU A  1 362 ? 15.656  -33.292 -25.155 1.00 20.36 ? 373 GLU A C     1 
ATOM   2922  O  O     . GLU A  1 362 ? 15.551  -34.487 -25.412 1.00 19.63 ? 373 GLU A O     1 
ATOM   2923  C  CB    . GLU A  1 362 ? 16.690  -31.850 -26.807 1.00 20.08 ? 373 GLU A CB    1 
ATOM   2924  C  CG    . GLU A  1 362 ? 16.636  -31.058 -28.084 1.00 32.14 ? 373 GLU A CG    1 
ATOM   2925  C  CD    . GLU A  1 362 ? 17.984  -31.052 -28.772 1.00 47.45 ? 373 GLU A CD    1 
ATOM   2926  O  OE1   . GLU A  1 362 ? 18.552  -32.145 -29.021 1.00 37.20 ? 373 GLU A OE1   1 
ATOM   2927  O  OE2   . GLU A  1 362 ? 18.464  -29.938 -29.076 1.00 35.00 ? 373 GLU A OE2   1 
ATOM   2928  N  N     . ASN A  1 363 ? 16.106  -32.821 -23.966 1.00 15.04 ? 374 ASN A N     1 
ATOM   2929  C  CA    . ASN A  1 363 ? 16.431  -33.702 -22.850 1.00 13.78 ? 374 ASN A CA    1 
ATOM   2930  C  C     . ASN A  1 363 ? 15.161  -34.380 -22.324 1.00 17.43 ? 374 ASN A C     1 
ATOM   2931  O  O     . ASN A  1 363 ? 15.183  -35.583 -22.092 1.00 17.98 ? 374 ASN A O     1 
ATOM   2932  C  CB    . ASN A  1 363 ? 17.158  -32.941 -21.748 1.00 14.06 ? 374 ASN A CB    1 
ATOM   2933  C  CG    . ASN A  1 363 ? 18.556  -32.540 -22.128 1.00 27.36 ? 374 ASN A CG    1 
ATOM   2934  O  OD1   . ASN A  1 363 ? 19.222  -33.186 -22.960 1.00 21.22 ? 374 ASN A OD1   1 
ATOM   2935  N  ND2   . ASN A  1 363 ? 19.043  -31.475 -21.506 1.00 15.07 ? 374 ASN A ND2   1 
ATOM   2936  N  N     . LEU A  1 364 ? 14.046  -33.637 -22.213 1.00 13.27 ? 375 LEU A N     1 
ATOM   2937  C  CA    . LEU A  1 364 ? 12.775  -34.190 -21.756 1.00 13.70 ? 375 LEU A CA    1 
ATOM   2938  C  C     . LEU A  1 364 ? 12.184  -35.258 -22.722 1.00 19.70 ? 375 LEU A C     1 
ATOM   2939  O  O     . LEU A  1 364 ? 11.489  -36.158 -22.264 1.00 18.94 ? 375 LEU A O     1 
ATOM   2940  C  CB    . LEU A  1 364 ? 11.771  -33.070 -21.410 1.00 13.81 ? 375 LEU A CB    1 
ATOM   2941  C  CG    . LEU A  1 364 ? 12.190  -32.186 -20.201 1.00 17.00 ? 375 LEU A CG    1 
ATOM   2942  C  CD1   . LEU A  1 364 ? 11.396  -30.899 -20.184 1.00 15.30 ? 375 LEU A CD1   1 
ATOM   2943  C  CD2   . LEU A  1 364 ? 11.999  -32.944 -18.862 1.00 17.08 ? 375 LEU A CD2   1 
ATOM   2944  N  N     . ARG A  1 365 ? 12.548  -35.216 -24.031 1.00 17.08 ? 376 ARG A N     1 
ATOM   2945  C  CA    . ARG A  1 365 ? 12.113  -36.220 -25.020 1.00 18.01 ? 376 ARG A CA    1 
ATOM   2946  C  C     . ARG A  1 365 ? 12.701  -37.605 -24.736 1.00 22.27 ? 376 ARG A C     1 
ATOM   2947  O  O     . ARG A  1 365 ? 12.150  -38.609 -25.186 1.00 23.49 ? 376 ARG A O     1 
ATOM   2948  C  CB    A ARG A  1 365 ? 12.432  -35.777 -26.453 0.50 17.59 ? 376 ARG A CB    1 
ATOM   2949  C  CB    B ARG A  1 365 ? 12.514  -35.782 -26.439 0.50 18.87 ? 376 ARG A CB    1 
ATOM   2950  C  CG    A ARG A  1 365 ? 11.562  -34.610 -26.909 0.50 20.45 ? 376 ARG A CG    1 
ATOM   2951  C  CG    B ARG A  1 365 ? 11.468  -34.909 -27.134 0.50 27.59 ? 376 ARG A CG    1 
ATOM   2952  C  CD    A ARG A  1 365 ? 11.508  -34.479 -28.422 0.50 23.99 ? 376 ARG A CD    1 
ATOM   2953  C  CD    B ARG A  1 365 ? 11.566  -35.009 -28.661 0.50 29.54 ? 376 ARG A CD    1 
ATOM   2954  N  NE    A ARG A  1 365 ? 12.803  -34.148 -29.019 0.50 16.79 ? 376 ARG A NE    1 
ATOM   2955  N  NE    B ARG A  1 365 ? 11.436  -36.394 -29.121 0.50 24.62 ? 376 ARG A NE    1 
ATOM   2956  C  CZ    A ARG A  1 365 ? 13.258  -32.912 -29.189 0.50 26.60 ? 376 ARG A CZ    1 
ATOM   2957  C  CZ    B ARG A  1 365 ? 10.285  -36.991 -29.415 0.50 35.68 ? 376 ARG A CZ    1 
ATOM   2958  N  NH1   A ARG A  1 365 ? 12.546  -31.870 -28.772 0.50 14.30 ? 376 ARG A NH1   1 
ATOM   2959  N  NH1   B ARG A  1 365 ? 9.145   -36.310 -29.372 0.50 19.36 ? 376 ARG A NH1   1 
ATOM   2960  N  NH2   A ARG A  1 365 ? 14.430  -32.707 -29.767 0.50 12.40 ? 376 ARG A NH2   1 
ATOM   2961  N  NH2   B ARG A  1 365 ? 10.267  -38.269 -29.773 0.50 17.46 ? 376 ARG A NH2   1 
ATOM   2962  N  N     . MET A  1 366 ? 13.813  -37.640 -23.985 1.00 18.00 ? 377 MET A N     1 
ATOM   2963  C  CA    . MET A  1 366 ? 14.552  -38.838 -23.575 1.00 18.12 ? 377 MET A CA    1 
ATOM   2964  C  C     . MET A  1 366 ? 13.930  -39.591 -22.395 1.00 26.02 ? 377 MET A C     1 
ATOM   2965  O  O     . MET A  1 366 ? 14.415  -40.668 -22.051 1.00 27.09 ? 377 MET A O     1 
ATOM   2966  C  CB    . MET A  1 366 ? 16.026  -38.503 -23.309 1.00 19.50 ? 377 MET A CB    1 
ATOM   2967  C  CG    . MET A  1 366 ? 16.756  -37.947 -24.515 1.00 22.77 ? 377 MET A CG    1 
ATOM   2968  S  SD    . MET A  1 366 ? 16.482  -38.903 -26.026 1.00 26.65 ? 377 MET A SD    1 
ATOM   2969  C  CE    . MET A  1 366 ? 17.527  -40.361 -25.691 1.00 23.81 ? 377 MET A CE    1 
ATOM   2970  N  N     . LEU A  1 367 ? 12.844  -39.068 -21.799 1.00 24.87 ? 378 LEU A N     1 
ATOM   2971  C  CA    . LEU A  1 367 ? 12.146  -39.766 -20.703 1.00 26.51 ? 378 LEU A CA    1 
ATOM   2972  C  C     . LEU A  1 367 ? 11.293  -40.932 -21.288 1.00 35.30 ? 378 LEU A C     1 
ATOM   2973  O  O     . LEU A  1 367 ? 10.866  -40.811 -22.437 1.00 34.35 ? 378 LEU A O     1 
ATOM   2974  C  CB    . LEU A  1 367 ? 11.213  -38.803 -19.946 1.00 26.15 ? 378 LEU A CB    1 
ATOM   2975  C  CG    . LEU A  1 367 ? 11.766  -37.759 -18.950 1.00 30.42 ? 378 LEU A CG    1 
ATOM   2976  C  CD1   . LEU A  1 367 ? 10.818  -37.623 -17.767 1.00 30.45 ? 378 LEU A CD1   1 
ATOM   2977  C  CD2   . LEU A  1 367 ? 13.156  -38.067 -18.457 1.00 29.18 ? 378 LEU A CD2   1 
ATOM   2978  N  N     . PRO A  1 368 ? 10.995  -42.030 -20.524 1.00 35.20 ? 379 PRO A N     1 
ATOM   2979  C  CA    . PRO A  1 368 ? 10.179  -43.131 -21.086 1.00 42.27 ? 379 PRO A CA    1 
ATOM   2980  C  C     . PRO A  1 368 ? 8.804   -42.700 -21.584 1.00 78.48 ? 379 PRO A C     1 
ATOM   2981  O  O     . PRO A  1 368 ? 8.192   -41.824 -20.984 1.00 50.06 ? 379 PRO A O     1 
ATOM   2982  C  CB    . PRO A  1 368 ? 10.029  -44.104 -19.908 1.00 43.38 ? 379 PRO A CB    1 
ATOM   2983  C  CG    . PRO A  1 368 ? 11.129  -43.774 -18.980 1.00 45.28 ? 379 PRO A CG    1 
ATOM   2984  C  CD    . PRO A  1 368 ? 11.392  -42.321 -19.130 1.00 39.04 ? 379 PRO A CD    1 
ATOM   2985  N  N     . LYS B  1 2   ? 49.390  -35.985 -35.838 1.00 41.30 ? 13  LYS B N     1 
ATOM   2986  C  CA    . LYS B  1 2   ? 49.110  -34.603 -36.231 1.00 40.58 ? 13  LYS B CA    1 
ATOM   2987  C  C     . LYS B  1 2   ? 50.162  -33.614 -35.714 1.00 42.58 ? 13  LYS B C     1 
ATOM   2988  O  O     . LYS B  1 2   ? 50.862  -33.896 -34.741 1.00 43.62 ? 13  LYS B O     1 
ATOM   2989  C  CB    . LYS B  1 2   ? 47.725  -34.189 -35.750 1.00 41.20 ? 13  LYS B CB    1 
ATOM   2990  N  N     . LYS B  1 3   ? 50.268  -32.453 -36.375 1.00 35.65 ? 14  LYS B N     1 
ATOM   2991  C  CA    . LYS B  1 3   ? 51.165  -31.360 -35.991 1.00 33.37 ? 14  LYS B CA    1 
ATOM   2992  C  C     . LYS B  1 3   ? 50.763  -30.848 -34.593 1.00 32.36 ? 14  LYS B C     1 
ATOM   2993  O  O     . LYS B  1 3   ? 49.582  -30.854 -34.249 1.00 33.39 ? 14  LYS B O     1 
ATOM   2994  C  CB    . LYS B  1 3   ? 51.053  -30.218 -37.003 1.00 34.63 ? 14  LYS B CB    1 
ATOM   2995  C  CG    . LYS B  1 3   ? 51.704  -30.494 -38.347 1.00 35.33 ? 14  LYS B CG    1 
ATOM   2996  C  CD    . LYS B  1 3   ? 51.213  -29.459 -39.357 1.00 44.59 ? 14  LYS B CD    1 
ATOM   2997  C  CE    . LYS B  1 3   ? 51.651  -29.733 -40.774 1.00 43.76 ? 14  LYS B CE    1 
ATOM   2998  N  NZ    . LYS B  1 3   ? 50.982  -28.804 -41.740 1.00 42.82 ? 14  LYS B NZ    1 
ATOM   2999  N  N     . LYS B  1 4   ? 51.743  -30.436 -33.796 1.00 23.51 ? 15  LYS B N     1 
ATOM   3000  C  CA    . LYS B  1 4   ? 51.535  -29.969 -32.431 1.00 21.68 ? 15  LYS B CA    1 
ATOM   3001  C  C     . LYS B  1 4   ? 51.164  -28.485 -32.411 1.00 21.23 ? 15  LYS B C     1 
ATOM   3002  O  O     . LYS B  1 4   ? 51.759  -27.687 -33.144 1.00 20.34 ? 15  LYS B O     1 
ATOM   3003  C  CB    . LYS B  1 4   ? 52.807  -30.187 -31.596 1.00 23.66 ? 15  LYS B CB    1 
ATOM   3004  C  CG    . LYS B  1 4   ? 52.998  -31.626 -31.139 1.00 42.81 ? 15  LYS B CG    1 
ATOM   3005  C  CD    . LYS B  1 4   ? 54.312  -31.864 -30.374 1.00 53.64 ? 15  LYS B CD    1 
ATOM   3006  C  CE    . LYS B  1 4   ? 54.625  -30.913 -29.225 1.00 68.08 ? 15  LYS B CE    1 
ATOM   3007  N  NZ    . LYS B  1 4   ? 53.503  -30.740 -28.256 1.00 77.38 ? 15  LYS B NZ    1 
ATOM   3008  N  N     . VAL B  1 5   ? 50.235  -28.126 -31.527 1.00 14.58 ? 16  VAL B N     1 
ATOM   3009  C  CA    . VAL B  1 5   ? 49.755  -26.755 -31.353 1.00 13.47 ? 16  VAL B CA    1 
ATOM   3010  C  C     . VAL B  1 5   ? 49.909  -26.308 -29.905 1.00 14.37 ? 16  VAL B C     1 
ATOM   3011  O  O     . VAL B  1 5   ? 49.416  -26.980 -29.018 1.00 13.89 ? 16  VAL B O     1 
ATOM   3012  C  CB    . VAL B  1 5   ? 48.270  -26.593 -31.796 1.00 16.99 ? 16  VAL B CB    1 
ATOM   3013  C  CG1   . VAL B  1 5   ? 47.837  -25.124 -31.751 1.00 17.46 ? 16  VAL B CG1   1 
ATOM   3014  C  CG2   . VAL B  1 5   ? 48.020  -27.180 -33.179 1.00 16.69 ? 16  VAL B CG2   1 
ATOM   3015  N  N     . CYS B  1 6   ? 50.508  -25.123 -29.678 1.00 10.83 ? 17  CYS B N     1 
ATOM   3016  C  CA    . CYS B  1 6   ? 50.552  -24.522 -28.349 1.00 10.46 ? 17  CYS B CA    1 
ATOM   3017  C  C     . CYS B  1 6   ? 49.809  -23.201 -28.445 1.00 14.88 ? 17  CYS B C     1 
ATOM   3018  O  O     . CYS B  1 6   ? 49.786  -22.563 -29.509 1.00 15.12 ? 17  CYS B O     1 
ATOM   3019  C  CB    A CYS B  1 6   ? 52.006  -24.253 -27.938 0.48 10.31 ? 17  CYS B CB    1 
ATOM   3020  C  CB    B CYS B  1 6   ? 51.936  -24.409 -27.738 0.52 10.10 ? 17  CYS B CB    1 
ATOM   3021  S  SG    A CYS B  1 6   ? 53.039  -25.732 -27.695 0.48 13.63 ? 17  CYS B SG    1 
ATOM   3022  S  SG    B CYS B  1 6   ? 52.946  -23.122 -28.455 0.52 13.07 ? 17  CYS B SG    1 
ATOM   3023  N  N     . TYR B  1 7   ? 49.162  -22.822 -27.355 1.00 9.43  ? 18  TYR B N     1 
ATOM   3024  C  CA    . TYR B  1 7   ? 48.265  -21.684 -27.351 1.00 8.07  ? 18  TYR B CA    1 
ATOM   3025  C  C     . TYR B  1 7   ? 48.483  -20.857 -26.089 1.00 10.74 ? 18  TYR B C     1 
ATOM   3026  O  O     . TYR B  1 7   ? 48.521  -21.412 -24.990 1.00 9.64  ? 18  TYR B O     1 
ATOM   3027  C  CB    . TYR B  1 7   ? 46.841  -22.284 -27.467 1.00 7.86  ? 18  TYR B CB    1 
ATOM   3028  C  CG    . TYR B  1 7   ? 45.673  -21.413 -27.065 1.00 8.62  ? 18  TYR B CG    1 
ATOM   3029  C  CD1   . TYR B  1 7   ? 45.358  -21.218 -25.723 1.00 9.93  ? 18  TYR B CD1   1 
ATOM   3030  C  CD2   . TYR B  1 7   ? 44.793  -20.902 -28.024 1.00 8.65  ? 18  TYR B CD2   1 
ATOM   3031  C  CE1   . TYR B  1 7   ? 44.232  -20.496 -25.341 1.00 9.98  ? 18  TYR B CE1   1 
ATOM   3032  C  CE2   . TYR B  1 7   ? 43.685  -20.139 -27.649 1.00 9.73  ? 18  TYR B CE2   1 
ATOM   3033  C  CZ    . TYR B  1 7   ? 43.417  -19.930 -26.303 1.00 15.19 ? 18  TYR B CZ    1 
ATOM   3034  O  OH    . TYR B  1 7   ? 42.315  -19.226 -25.875 1.00 11.36 ? 18  TYR B OH    1 
ATOM   3035  N  N     . TYR B  1 8   ? 48.535  -19.524 -26.242 1.00 6.92  ? 19  TYR B N     1 
ATOM   3036  C  CA    . TYR B  1 8   ? 48.799  -18.634 -25.112 1.00 8.49  ? 19  TYR B CA    1 
ATOM   3037  C  C     . TYR B  1 8   ? 47.595  -17.850 -24.704 1.00 11.83 ? 19  TYR B C     1 
ATOM   3038  O  O     . TYR B  1 8   ? 46.946  -17.218 -25.551 1.00 11.65 ? 19  TYR B O     1 
ATOM   3039  C  CB    . TYR B  1 8   ? 49.990  -17.693 -25.419 1.00 10.23 ? 19  TYR B CB    1 
ATOM   3040  C  CG    . TYR B  1 8   ? 51.291  -18.449 -25.467 1.00 13.45 ? 19  TYR B CG    1 
ATOM   3041  C  CD1   . TYR B  1 8   ? 51.671  -19.152 -26.610 1.00 16.14 ? 19  TYR B CD1   1 
ATOM   3042  C  CD2   . TYR B  1 8   ? 52.098  -18.552 -24.340 1.00 13.60 ? 19  TYR B CD2   1 
ATOM   3043  C  CE1   . TYR B  1 8   ? 52.836  -19.919 -26.632 1.00 17.39 ? 19  TYR B CE1   1 
ATOM   3044  C  CE2   . TYR B  1 8   ? 53.271  -19.300 -24.356 1.00 14.09 ? 19  TYR B CE2   1 
ATOM   3045  C  CZ    . TYR B  1 8   ? 53.637  -19.976 -25.504 1.00 20.26 ? 19  TYR B CZ    1 
ATOM   3046  O  OH    . TYR B  1 8   ? 54.754  -20.765 -25.485 1.00 20.67 ? 19  TYR B OH    1 
ATOM   3047  N  N     . TYR B  1 9   ? 47.314  -17.853 -23.394 1.00 9.94  ? 20  TYR B N     1 
ATOM   3048  C  CA    . TYR B  1 9   ? 46.189  -17.101 -22.822 1.00 9.52  ? 20  TYR B CA    1 
ATOM   3049  C  C     . TYR B  1 9   ? 46.419  -16.807 -21.356 1.00 12.78 ? 20  TYR B C     1 
ATOM   3050  O  O     . TYR B  1 9   ? 46.746  -17.711 -20.607 1.00 10.79 ? 20  TYR B O     1 
ATOM   3051  C  CB    . TYR B  1 9   ? 44.876  -17.902 -22.981 1.00 9.45  ? 20  TYR B CB    1 
ATOM   3052  C  CG    . TYR B  1 9   ? 43.657  -17.270 -22.341 1.00 10.50 ? 20  TYR B CG    1 
ATOM   3053  C  CD1   . TYR B  1 9   ? 43.159  -17.738 -21.126 1.00 10.39 ? 20  TYR B CD1   1 
ATOM   3054  C  CD2   . TYR B  1 9   ? 42.976  -16.228 -22.970 1.00 10.42 ? 20  TYR B CD2   1 
ATOM   3055  C  CE1   . TYR B  1 9   ? 42.061  -17.126 -20.508 1.00 9.59  ? 20  TYR B CE1   1 
ATOM   3056  C  CE2   . TYR B  1 9   ? 41.867  -15.633 -22.380 1.00 10.50 ? 20  TYR B CE2   1 
ATOM   3057  C  CZ    . TYR B  1 9   ? 41.406  -16.092 -21.156 1.00 13.44 ? 20  TYR B CZ    1 
ATOM   3058  O  OH    . TYR B  1 9   ? 40.299  -15.498 -20.611 1.00 12.79 ? 20  TYR B OH    1 
ATOM   3059  N  N     . ASP B  1 10  ? 46.184  -15.554 -20.934 1.00 9.28  ? 21  ASP B N     1 
ATOM   3060  C  CA    . ASP B  1 10  ? 46.244  -15.184 -19.516 1.00 9.70  ? 21  ASP B CA    1 
ATOM   3061  C  C     . ASP B  1 10  ? 44.812  -14.843 -19.137 1.00 15.04 ? 21  ASP B C     1 
ATOM   3062  O  O     . ASP B  1 10  ? 44.188  -14.000 -19.792 1.00 13.55 ? 21  ASP B O     1 
ATOM   3063  C  CB    . ASP B  1 10  ? 47.168  -13.972 -19.267 1.00 10.94 ? 21  ASP B CB    1 
ATOM   3064  C  CG    . ASP B  1 10  ? 47.298  -13.689 -17.773 1.00 16.66 ? 21  ASP B CG    1 
ATOM   3065  O  OD1   . ASP B  1 10  ? 48.305  -14.118 -17.175 1.00 13.05 ? 21  ASP B OD1   1 
ATOM   3066  O  OD2   . ASP B  1 10  ? 46.326  -13.168 -17.181 1.00 17.25 ? 21  ASP B OD2   1 
ATOM   3067  N  N     . GLY B  1 11  ? 44.323  -15.451 -18.057 1.00 11.57 ? 22  GLY B N     1 
ATOM   3068  C  CA    . GLY B  1 11  ? 42.973  -15.234 -17.545 1.00 11.46 ? 22  GLY B CA    1 
ATOM   3069  C  C     . GLY B  1 11  ? 42.587  -13.801 -17.233 1.00 14.09 ? 22  GLY B C     1 
ATOM   3070  O  O     . GLY B  1 11  ? 41.396  -13.516 -17.093 1.00 15.01 ? 22  GLY B O     1 
ATOM   3071  N  N     . ASP B  1 12  ? 43.567  -12.880 -17.088 1.00 10.02 ? 23  ASP B N     1 
ATOM   3072  C  CA    . ASP B  1 12  ? 43.216  -11.474 -16.851 1.00 10.19 ? 23  ASP B CA    1 
ATOM   3073  C  C     . ASP B  1 12  ? 43.083  -10.659 -18.124 1.00 13.49 ? 23  ASP B C     1 
ATOM   3074  O  O     . ASP B  1 12  ? 42.653  -9.513  -18.046 1.00 10.38 ? 23  ASP B O     1 
ATOM   3075  C  CB    . ASP B  1 12  ? 44.197  -10.779 -15.926 1.00 11.85 ? 23  ASP B CB    1 
ATOM   3076  C  CG    . ASP B  1 12  ? 43.850  -11.080 -14.483 1.00 22.91 ? 23  ASP B CG    1 
ATOM   3077  O  OD1   . ASP B  1 12  ? 44.655  -11.698 -13.822 1.00 20.52 ? 23  ASP B OD1   1 
ATOM   3078  O  OD2   . ASP B  1 12  ? 42.698  -10.790 -14.069 1.00 29.15 ? 23  ASP B OD2   1 
ATOM   3079  N  N     . ILE B  1 13  ? 43.489  -11.216 -19.276 1.00 10.56 ? 24  ILE B N     1 
ATOM   3080  C  CA    . ILE B  1 13  ? 43.455  -10.481 -20.551 1.00 9.39  ? 24  ILE B CA    1 
ATOM   3081  C  C     . ILE B  1 13  ? 42.134  -9.759  -20.870 1.00 12.54 ? 24  ILE B C     1 
ATOM   3082  O  O     . ILE B  1 13  ? 42.183  -8.604  -21.261 1.00 11.00 ? 24  ILE B O     1 
ATOM   3083  C  CB    . ILE B  1 13  ? 44.039  -11.289 -21.734 1.00 10.89 ? 24  ILE B CB    1 
ATOM   3084  C  CG1   . ILE B  1 13  ? 44.600  -10.336 -22.844 1.00 10.37 ? 24  ILE B CG1   1 
ATOM   3085  C  CG2   . ILE B  1 13  ? 43.023  -12.276 -22.312 1.00 9.21  ? 24  ILE B CG2   1 
ATOM   3086  C  CD1   . ILE B  1 13  ? 46.002  -9.624  -22.463 1.00 10.68 ? 24  ILE B CD1   1 
ATOM   3087  N  N     . GLY B  1 14  ? 41.000  -10.414 -20.608 1.00 9.62  ? 25  GLY B N     1 
ATOM   3088  C  CA    . GLY B  1 14  ? 39.675  -9.848  -20.838 1.00 10.09 ? 25  GLY B CA    1 
ATOM   3089  C  C     . GLY B  1 14  ? 39.287  -8.727  -19.878 1.00 14.00 ? 25  GLY B C     1 
ATOM   3090  O  O     . GLY B  1 14  ? 38.284  -8.059  -20.101 1.00 11.98 ? 25  GLY B O     1 
ATOM   3091  N  N     . ASN B  1 15  ? 40.067  -8.515  -18.788 1.00 11.57 ? 26  ASN B N     1 
ATOM   3092  C  CA    . ASN B  1 15  ? 39.758  -7.460  -17.816 1.00 12.18 ? 26  ASN B CA    1 
ATOM   3093  C  C     . ASN B  1 15  ? 40.329  -6.076  -18.150 1.00 16.13 ? 26  ASN B C     1 
ATOM   3094  O  O     . ASN B  1 15  ? 39.961  -5.097  -17.491 1.00 14.67 ? 26  ASN B O     1 
ATOM   3095  C  CB    . ASN B  1 15  ? 40.158  -7.894  -16.399 1.00 15.17 ? 26  ASN B CB    1 
ATOM   3096  C  CG    . ASN B  1 15  ? 39.405  -9.100  -15.936 1.00 19.20 ? 26  ASN B CG    1 
ATOM   3097  O  OD1   . ASN B  1 15  ? 38.245  -9.274  -16.262 1.00 14.63 ? 26  ASN B OD1   1 
ATOM   3098  N  ND2   . ASN B  1 15  ? 40.077  -10.005 -15.254 1.00 13.09 ? 26  ASN B ND2   1 
ATOM   3099  N  N     . TYR B  1 16  ? 41.234  -5.991  -19.148 1.00 10.94 ? 27  TYR B N     1 
ATOM   3100  C  CA    . TYR B  1 16  ? 41.799  -4.708  -19.532 1.00 11.04 ? 27  TYR B CA    1 
ATOM   3101  C  C     . TYR B  1 16  ? 40.780  -3.989  -20.368 1.00 13.86 ? 27  TYR B C     1 
ATOM   3102  O  O     . TYR B  1 16  ? 40.204  -4.572  -21.274 1.00 13.39 ? 27  TYR B O     1 
ATOM   3103  C  CB    . TYR B  1 16  ? 43.141  -4.865  -20.232 1.00 11.81 ? 27  TYR B CB    1 
ATOM   3104  C  CG    . TYR B  1 16  ? 44.144  -5.512  -19.306 1.00 11.63 ? 27  TYR B CG    1 
ATOM   3105  C  CD1   . TYR B  1 16  ? 44.326  -6.891  -19.300 1.00 13.09 ? 27  TYR B CD1   1 
ATOM   3106  C  CD2   . TYR B  1 16  ? 44.847  -4.754  -18.366 1.00 11.78 ? 27  TYR B CD2   1 
ATOM   3107  C  CE1   . TYR B  1 16  ? 45.201  -7.503  -18.401 1.00 12.46 ? 27  TYR B CE1   1 
ATOM   3108  C  CE2   . TYR B  1 16  ? 45.699  -5.359  -17.443 1.00 12.81 ? 27  TYR B CE2   1 
ATOM   3109  C  CZ    . TYR B  1 16  ? 45.885  -6.735  -17.479 1.00 16.62 ? 27  TYR B CZ    1 
ATOM   3110  O  OH    . TYR B  1 16  ? 46.731  -7.362  -16.598 1.00 13.56 ? 27  TYR B OH    1 
ATOM   3111  N  N     . TYR B  1 17  ? 40.518  -2.744  -20.027 1.00 9.72  ? 28  TYR B N     1 
ATOM   3112  C  CA    . TYR B  1 17  ? 39.435  -1.997  -20.630 1.00 9.96  ? 28  TYR B CA    1 
ATOM   3113  C  C     . TYR B  1 17  ? 39.875  -0.690  -21.222 1.00 12.61 ? 28  TYR B C     1 
ATOM   3114  O  O     . TYR B  1 17  ? 40.377  0.176   -20.507 1.00 11.74 ? 28  TYR B O     1 
ATOM   3115  C  CB    . TYR B  1 17  ? 38.345  -1.822  -19.541 1.00 11.64 ? 28  TYR B CB    1 
ATOM   3116  C  CG    . TYR B  1 17  ? 37.083  -1.147  -20.017 1.00 13.72 ? 28  TYR B CG    1 
ATOM   3117  C  CD1   . TYR B  1 17  ? 36.242  -1.767  -20.941 1.00 15.70 ? 28  TYR B CD1   1 
ATOM   3118  C  CD2   . TYR B  1 17  ? 36.676  0.072   -19.476 1.00 15.66 ? 28  TYR B CD2   1 
ATOM   3119  C  CE1   . TYR B  1 17  ? 35.052  -1.164  -21.356 1.00 18.40 ? 28  TYR B CE1   1 
ATOM   3120  C  CE2   . TYR B  1 17  ? 35.474  0.674   -19.869 1.00 17.12 ? 28  TYR B CE2   1 
ATOM   3121  C  CZ    . TYR B  1 17  ? 34.676  0.056   -20.815 1.00 23.81 ? 28  TYR B CZ    1 
ATOM   3122  O  OH    . TYR B  1 17  ? 33.502  0.648   -21.201 1.00 30.42 ? 28  TYR B OH    1 
ATOM   3123  N  N     . TYR B  1 18  ? 39.713  -0.550  -22.551 1.00 10.21 ? 29  TYR B N     1 
ATOM   3124  C  CA    . TYR B  1 18  ? 40.116  0.657   -23.277 1.00 10.27 ? 29  TYR B CA    1 
ATOM   3125  C  C     . TYR B  1 18  ? 39.329  1.925   -22.928 1.00 17.03 ? 29  TYR B C     1 
ATOM   3126  O  O     . TYR B  1 18  ? 39.796  3.023   -23.247 1.00 19.77 ? 29  TYR B O     1 
ATOM   3127  C  CB    . TYR B  1 18  ? 40.114  0.445   -24.800 1.00 9.47  ? 29  TYR B CB    1 
ATOM   3128  C  CG    . TYR B  1 18  ? 41.371  -0.202  -25.372 1.00 10.44 ? 29  TYR B CG    1 
ATOM   3129  C  CD1   . TYR B  1 18  ? 42.135  0.449   -26.345 1.00 11.53 ? 29  TYR B CD1   1 
ATOM   3130  C  CD2   . TYR B  1 18  ? 41.759  -1.487  -24.989 1.00 11.26 ? 29  TYR B CD2   1 
ATOM   3131  C  CE1   . TYR B  1 18  ? 43.219  -0.187  -26.961 1.00 10.54 ? 29  TYR B CE1   1 
ATOM   3132  C  CE2   . TYR B  1 18  ? 42.893  -2.102  -25.541 1.00 9.49  ? 29  TYR B CE2   1 
ATOM   3133  C  CZ    . TYR B  1 18  ? 43.609  -1.452  -26.537 1.00 13.14 ? 29  TYR B CZ    1 
ATOM   3134  O  OH    . TYR B  1 18  ? 44.679  -2.072  -27.137 1.00 11.00 ? 29  TYR B OH    1 
ATOM   3135  N  N     . GLY B  1 19  ? 38.146  1.775   -22.347 1.00 14.53 ? 30  GLY B N     1 
ATOM   3136  C  CA    . GLY B  1 19  ? 37.317  2.920   -21.974 1.00 15.16 ? 30  GLY B CA    1 
ATOM   3137  C  C     . GLY B  1 19  ? 35.967  2.907   -22.644 1.00 18.96 ? 30  GLY B C     1 
ATOM   3138  O  O     . GLY B  1 19  ? 35.795  2.250   -23.676 1.00 16.80 ? 30  GLY B O     1 
ATOM   3139  N  N     . GLN B  1 20  ? 34.990  3.645   -22.065 1.00 16.74 ? 31  GLN B N     1 
ATOM   3140  C  CA    . GLN B  1 20  ? 33.630  3.692   -22.627 1.00 17.67 ? 31  GLN B CA    1 
ATOM   3141  C  C     . GLN B  1 20  ? 33.631  4.201   -24.072 1.00 19.57 ? 31  GLN B C     1 
ATOM   3142  O  O     . GLN B  1 20  ? 34.270  5.201   -24.379 1.00 17.47 ? 31  GLN B O     1 
ATOM   3143  C  CB    . GLN B  1 20  ? 32.678  4.532   -21.732 1.00 19.70 ? 31  GLN B CB    1 
ATOM   3144  C  CG    . GLN B  1 20  ? 31.212  4.481   -22.171 1.00 38.36 ? 31  GLN B CG    1 
ATOM   3145  C  CD    . GLN B  1 20  ? 30.284  5.163   -21.191 1.00 67.04 ? 31  GLN B CD    1 
ATOM   3146  O  OE1   . GLN B  1 20  ? 30.450  6.339   -20.834 1.00 62.11 ? 31  GLN B OE1   1 
ATOM   3147  N  NE2   . GLN B  1 20  ? 29.255  4.447   -20.765 1.00 65.28 ? 31  GLN B NE2   1 
ATOM   3148  N  N     . GLY B  1 21  ? 32.948  3.466   -24.942 1.00 18.11 ? 32  GLY B N     1 
ATOM   3149  C  CA    . GLY B  1 21  ? 32.834  3.801   -26.361 1.00 17.59 ? 32  GLY B CA    1 
ATOM   3150  C  C     . GLY B  1 21  ? 33.979  3.323   -27.243 1.00 20.09 ? 32  GLY B C     1 
ATOM   3151  O  O     . GLY B  1 21  ? 33.865  3.394   -28.468 1.00 19.24 ? 32  GLY B O     1 
ATOM   3152  N  N     . HIS B  1 22  ? 35.117  2.888   -26.651 1.00 13.52 ? 33  HIS B N     1 
ATOM   3153  C  CA    . HIS B  1 22  ? 36.263  2.453   -27.458 1.00 10.87 ? 33  HIS B CA    1 
ATOM   3154  C  C     . HIS B  1 22  ? 35.956  1.069   -28.093 1.00 14.23 ? 33  HIS B C     1 
ATOM   3155  O  O     . HIS B  1 22  ? 35.552  0.144   -27.384 1.00 13.87 ? 33  HIS B O     1 
ATOM   3156  C  CB    . HIS B  1 22  ? 37.593  2.462   -26.648 1.00 10.20 ? 33  HIS B CB    1 
ATOM   3157  C  CG    . HIS B  1 22  ? 38.806  2.437   -27.544 1.00 11.99 ? 33  HIS B CG    1 
ATOM   3158  N  ND1   . HIS B  1 22  ? 39.098  1.329   -28.333 1.00 12.65 ? 33  HIS B ND1   1 
ATOM   3159  C  CD2   . HIS B  1 22  ? 39.725  3.406   -27.796 1.00 13.01 ? 33  HIS B CD2   1 
ATOM   3160  C  CE1   . HIS B  1 22  ? 40.182  1.647   -29.018 1.00 11.74 ? 33  HIS B CE1   1 
ATOM   3161  N  NE2   . HIS B  1 22  ? 40.605  2.885   -28.723 1.00 12.28 ? 33  HIS B NE2   1 
ATOM   3162  N  N     . PRO B  1 23  ? 36.101  0.914   -29.426 1.00 11.80 ? 34  PRO B N     1 
ATOM   3163  C  CA    . PRO B  1 23  ? 35.722  -0.370  -30.054 1.00 10.44 ? 34  PRO B CA    1 
ATOM   3164  C  C     . PRO B  1 23  ? 36.628  -1.546  -29.721 1.00 12.22 ? 34  PRO B C     1 
ATOM   3165  O  O     . PRO B  1 23  ? 36.187  -2.676  -29.890 1.00 11.68 ? 34  PRO B O     1 
ATOM   3166  C  CB    . PRO B  1 23  ? 35.732  -0.066  -31.558 1.00 12.73 ? 34  PRO B CB    1 
ATOM   3167  C  CG    . PRO B  1 23  ? 36.632  1.103   -31.700 1.00 16.88 ? 34  PRO B CG    1 
ATOM   3168  C  CD    . PRO B  1 23  ? 36.521  1.908   -30.436 1.00 12.27 ? 34  PRO B CD    1 
ATOM   3169  N  N     . MET B  1 24  ? 37.900  -1.292  -29.306 1.00 9.00  ? 35  MET B N     1 
ATOM   3170  C  CA    . MET B  1 24  ? 38.836  -2.383  -28.983 1.00 7.32  ? 35  MET B CA    1 
ATOM   3171  C  C     . MET B  1 24  ? 38.482  -2.987  -27.633 1.00 11.09 ? 35  MET B C     1 
ATOM   3172  O  O     . MET B  1 24  ? 38.512  -2.292  -26.621 1.00 12.98 ? 35  MET B O     1 
ATOM   3173  C  CB    . MET B  1 24  ? 40.305  -1.924  -29.034 1.00 8.11  ? 35  MET B CB    1 
ATOM   3174  C  CG    . MET B  1 24  ? 41.302  -3.034  -28.598 1.00 10.56 ? 35  MET B CG    1 
ATOM   3175  S  SD    . MET B  1 24  ? 41.200  -4.525  -29.621 1.00 12.50 ? 35  MET B SD    1 
ATOM   3176  C  CE    . MET B  1 24  ? 42.347  -4.082  -30.910 1.00 10.16 ? 35  MET B CE    1 
ATOM   3177  N  N     . LYS B  1 25  ? 38.093  -4.266  -27.634 1.00 7.87  ? 36  LYS B N     1 
ATOM   3178  C  CA    . LYS B  1 25  ? 37.608  -4.935  -26.419 1.00 7.53  ? 36  LYS B CA    1 
ATOM   3179  C  C     . LYS B  1 25  ? 38.381  -6.229  -26.120 1.00 9.07  ? 36  LYS B C     1 
ATOM   3180  O  O     . LYS B  1 25  ? 38.077  -7.253  -26.697 1.00 7.81  ? 36  LYS B O     1 
ATOM   3181  C  CB    . LYS B  1 25  ? 36.084  -5.170  -26.513 1.00 9.91  ? 36  LYS B CB    1 
ATOM   3182  C  CG    . LYS B  1 25  ? 35.334  -3.814  -26.421 1.00 18.79 ? 36  LYS B CG    1 
ATOM   3183  C  CD    . LYS B  1 25  ? 33.909  -3.821  -26.883 1.00 27.58 ? 36  LYS B CD    1 
ATOM   3184  C  CE    . LYS B  1 25  ? 33.304  -2.420  -26.792 1.00 27.56 ? 36  LYS B CE    1 
ATOM   3185  N  NZ    . LYS B  1 25  ? 33.387  -1.812  -25.414 1.00 31.34 ? 36  LYS B NZ    1 
ATOM   3186  N  N     . PRO B  1 26  ? 39.379  -6.191  -25.215 1.00 7.72  ? 37  PRO B N     1 
ATOM   3187  C  CA    . PRO B  1 26  ? 40.157  -7.401  -24.906 1.00 7.02  ? 37  PRO B CA    1 
ATOM   3188  C  C     . PRO B  1 26  ? 39.281  -8.558  -24.400 1.00 10.92 ? 37  PRO B C     1 
ATOM   3189  O  O     . PRO B  1 26  ? 39.667  -9.706  -24.556 1.00 9.89  ? 37  PRO B O     1 
ATOM   3190  C  CB    . PRO B  1 26  ? 41.155  -6.890  -23.858 1.00 8.71  ? 37  PRO B CB    1 
ATOM   3191  C  CG    . PRO B  1 26  ? 41.392  -5.452  -24.276 1.00 12.40 ? 37  PRO B CG    1 
ATOM   3192  C  CD    . PRO B  1 26  ? 39.969  -5.008  -24.547 1.00 10.38 ? 37  PRO B CD    1 
ATOM   3193  N  N     . HIS B  1 27  ? 38.066  -8.255  -23.865 1.00 8.82  ? 38  HIS B N     1 
ATOM   3194  C  CA    . HIS B  1 27  ? 37.060  -9.238  -23.446 1.00 8.68  ? 38  HIS B CA    1 
ATOM   3195  C  C     . HIS B  1 27  ? 36.760  -10.259 -24.591 1.00 12.01 ? 38  HIS B C     1 
ATOM   3196  O  O     . HIS B  1 27  ? 36.445  -11.414 -24.307 1.00 11.47 ? 38  HIS B O     1 
ATOM   3197  C  CB    . HIS B  1 27  ? 35.769  -8.507  -23.027 1.00 9.33  ? 38  HIS B CB    1 
ATOM   3198  C  CG    . HIS B  1 27  ? 34.657  -9.417  -22.606 1.00 13.12 ? 38  HIS B CG    1 
ATOM   3199  N  ND1   . HIS B  1 27  ? 34.786  -10.270 -21.522 1.00 15.48 ? 38  HIS B ND1   1 
ATOM   3200  C  CD2   . HIS B  1 27  ? 33.407  -9.536  -23.107 1.00 15.39 ? 38  HIS B CD2   1 
ATOM   3201  C  CE1   . HIS B  1 27  ? 33.632  -10.907 -21.430 1.00 14.84 ? 38  HIS B CE1   1 
ATOM   3202  N  NE2   . HIS B  1 27  ? 32.768  -10.492 -22.351 1.00 14.91 ? 38  HIS B NE2   1 
ATOM   3203  N  N     . ARG B  1 28  ? 36.880  -9.837  -25.871 1.00 8.73  ? 39  ARG B N     1 
ATOM   3204  C  CA    . ARG B  1 28  ? 36.686  -10.726 -27.021 1.00 8.92  ? 39  ARG B CA    1 
ATOM   3205  C  C     . ARG B  1 28  ? 37.652  -11.926 -26.984 1.00 10.14 ? 39  ARG B C     1 
ATOM   3206  O  O     . ARG B  1 28  ? 37.327  -12.975 -27.536 1.00 9.58  ? 39  ARG B O     1 
ATOM   3207  C  CB    . ARG B  1 28  ? 36.827  -9.966  -28.357 1.00 8.72  ? 39  ARG B CB    1 
ATOM   3208  C  CG    . ARG B  1 28  ? 38.266  -9.580  -28.764 1.00 9.60  ? 39  ARG B CG    1 
ATOM   3209  C  CD    . ARG B  1 28  ? 38.360  -8.278  -29.584 1.00 6.60  ? 39  ARG B CD    1 
ATOM   3210  N  NE    . ARG B  1 28  ? 39.778  -7.934  -29.602 1.00 10.15 ? 39  ARG B NE    1 
ATOM   3211  C  CZ    . ARG B  1 28  ? 40.562  -7.931  -30.666 1.00 15.68 ? 39  ARG B CZ    1 
ATOM   3212  N  NH1   . ARG B  1 28  ? 40.037  -7.969  -31.889 1.00 6.20  ? 39  ARG B NH1   1 
ATOM   3213  N  NH2   . ARG B  1 28  ? 41.869  -7.782  -30.526 1.00 7.52  ? 39  ARG B NH2   1 
ATOM   3214  N  N     . ILE B  1 29  ? 38.842  -11.739 -26.383 1.00 6.38  ? 40  ILE B N     1 
ATOM   3215  C  CA    . ILE B  1 29  ? 39.896  -12.786 -26.278 1.00 5.38  ? 40  ILE B CA    1 
ATOM   3216  C  C     . ILE B  1 29  ? 39.411  -13.808 -25.270 1.00 10.08 ? 40  ILE B C     1 
ATOM   3217  O  O     . ILE B  1 29  ? 39.615  -15.010 -25.476 1.00 8.56  ? 40  ILE B O     1 
ATOM   3218  C  CB    . ILE B  1 29  ? 41.285  -12.233 -25.848 1.00 8.19  ? 40  ILE B CB    1 
ATOM   3219  C  CG1   B ILE B  1 29  ? 41.728  -11.139 -26.861 0.98 8.87  ? 40  ILE B CG1   1 
ATOM   3220  C  CG1   C ILE B  1 29  ? 41.768  -10.950 -26.592 0.02 8.61  ? 40  ILE B CG1   1 
ATOM   3221  C  CG2   . ILE B  1 29  ? 42.347  -13.400 -25.787 1.00 10.31 ? 40  ILE B CG2   1 
ATOM   3222  C  CD1   B ILE B  1 29  ? 42.778  -10.155 -26.302 0.98 8.36  ? 40  ILE B CD1   1 
ATOM   3223  C  CD1   C ILE B  1 29  ? 41.847  -10.956 -28.073 0.02 15.63 ? 40  ILE B CD1   1 
ATOM   3224  N  N     . ARG B  1 30  ? 38.780  -13.325 -24.175 1.00 7.43  ? 41  ARG B N     1 
ATOM   3225  C  CA    . ARG B  1 30  ? 38.197  -14.207 -23.157 1.00 7.94  ? 41  ARG B CA    1 
ATOM   3226  C  C     . ARG B  1 30  ? 37.003  -14.973 -23.734 1.00 9.12  ? 41  ARG B C     1 
ATOM   3227  O  O     . ARG B  1 30  ? 36.847  -16.179 -23.475 1.00 8.33  ? 41  ARG B O     1 
ATOM   3228  C  CB    . ARG B  1 30  ? 37.777  -13.395 -21.917 1.00 8.86  ? 41  ARG B CB    1 
ATOM   3229  C  CG    . ARG B  1 30  ? 37.050  -14.254 -20.867 1.00 14.59 ? 41  ARG B CG    1 
ATOM   3230  C  CD    . ARG B  1 30  ? 37.036  -13.580 -19.512 1.00 8.38  ? 41  ARG B CD    1 
ATOM   3231  N  NE    . ARG B  1 30  ? 36.548  -12.210 -19.608 1.00 10.69 ? 41  ARG B NE    1 
ATOM   3232  C  CZ    . ARG B  1 30  ? 36.755  -11.285 -18.686 1.00 19.24 ? 41  ARG B CZ    1 
ATOM   3233  N  NH1   . ARG B  1 30  ? 37.433  -11.581 -17.577 1.00 16.09 ? 41  ARG B NH1   1 
ATOM   3234  N  NH2   . ARG B  1 30  ? 36.291  -10.058 -18.860 1.00 18.04 ? 41  ARG B NH2   1 
ATOM   3235  N  N     . MET B  1 31  ? 36.171  -14.288 -24.554 1.00 5.85  ? 42  MET B N     1 
ATOM   3236  C  CA    . MET B  1 31  ? 35.040  -14.968 -25.223 1.00 5.33  ? 42  MET B CA    1 
ATOM   3237  C  C     . MET B  1 31  ? 35.522  -16.115 -26.099 1.00 9.83  ? 42  MET B C     1 
ATOM   3238  O  O     . MET B  1 31  ? 34.964  -17.207 -26.049 1.00 8.46  ? 42  MET B O     1 
ATOM   3239  C  CB    . MET B  1 31  ? 34.235  -13.974 -26.071 1.00 7.70  ? 42  MET B CB    1 
ATOM   3240  C  CG    . MET B  1 31  ? 33.446  -12.942 -25.253 1.00 10.11 ? 42  MET B CG    1 
ATOM   3241  S  SD    . MET B  1 31  ? 32.764  -11.676 -26.369 1.00 12.29 ? 42  MET B SD    1 
ATOM   3242  C  CE    . MET B  1 31  ? 31.644  -12.751 -27.420 1.00 9.70  ? 42  MET B CE    1 
ATOM   3243  N  N     . THR B  1 32  ? 36.584  -15.874 -26.881 1.00 8.93  ? 43  THR B N     1 
ATOM   3244  C  CA    . THR B  1 32  ? 37.218  -16.864 -27.760 1.00 7.42  ? 43  THR B CA    1 
ATOM   3245  C  C     . THR B  1 32  ? 37.673  -18.044 -26.897 1.00 9.58  ? 43  THR B C     1 
ATOM   3246  O  O     . THR B  1 32  ? 37.341  -19.202 -27.198 1.00 8.32  ? 43  THR B O     1 
ATOM   3247  C  CB    . THR B  1 32  ? 38.461  -16.232 -28.438 1.00 10.55 ? 43  THR B CB    1 
ATOM   3248  O  OG1   . THR B  1 32  ? 38.078  -15.072 -29.205 1.00 9.36  ? 43  THR B OG1   1 
ATOM   3249  C  CG2   . THR B  1 32  ? 39.236  -17.249 -29.283 1.00 5.93  ? 43  THR B CG2   1 
ATOM   3250  N  N     . HIS B  1 33  ? 38.429  -17.750 -25.818 1.00 7.54  ? 44  HIS B N     1 
ATOM   3251  C  CA    . HIS B  1 33  ? 38.952  -18.795 -24.939 1.00 7.68  ? 44  HIS B CA    1 
ATOM   3252  C  C     . HIS B  1 33  ? 37.822  -19.647 -24.354 1.00 11.52 ? 44  HIS B C     1 
ATOM   3253  O  O     . HIS B  1 33  ? 37.882  -20.874 -24.389 1.00 10.89 ? 44  HIS B O     1 
ATOM   3254  C  CB    . HIS B  1 33  ? 39.762  -18.165 -23.785 1.00 7.76  ? 44  HIS B CB    1 
ATOM   3255  C  CG    . HIS B  1 33  ? 40.431  -19.190 -22.929 1.00 10.89 ? 44  HIS B CG    1 
ATOM   3256  N  ND1   . HIS B  1 33  ? 41.539  -19.873 -23.374 1.00 11.90 ? 44  HIS B ND1   1 
ATOM   3257  C  CD2   . HIS B  1 33  ? 40.135  -19.595 -21.664 1.00 12.70 ? 44  HIS B CD2   1 
ATOM   3258  C  CE1   . HIS B  1 33  ? 41.880  -20.686 -22.383 1.00 11.77 ? 44  HIS B CE1   1 
ATOM   3259  N  NE2   . HIS B  1 33  ? 41.073  -20.538 -21.329 1.00 12.44 ? 44  HIS B NE2   1 
ATOM   3260  N  N     . ASN B  1 34  ? 36.785  -19.000 -23.842 1.00 9.38  ? 45  ASN B N     1 
ATOM   3261  C  CA    . ASN B  1 34  ? 35.708  -19.763 -23.214 1.00 10.59 ? 45  ASN B CA    1 
ATOM   3262  C  C     . ASN B  1 34  ? 34.953  -20.615 -24.238 1.00 13.20 ? 45  ASN B C     1 
ATOM   3263  O  O     . ASN B  1 34  ? 34.552  -21.735 -23.933 1.00 10.71 ? 45  ASN B O     1 
ATOM   3264  C  CB    . ASN B  1 34  ? 34.764  -18.846 -22.447 1.00 12.70 ? 45  ASN B CB    1 
ATOM   3265  C  CG    . ASN B  1 34  ? 33.806  -19.610 -21.580 1.00 22.98 ? 45  ASN B CG    1 
ATOM   3266  O  OD1   . ASN B  1 34  ? 32.652  -19.762 -21.930 1.00 11.83 ? 45  ASN B OD1   1 
ATOM   3267  N  ND2   . ASN B  1 34  ? 34.305  -20.236 -20.514 1.00 14.41 ? 45  ASN B ND2   1 
ATOM   3268  N  N     . LEU B  1 35  ? 34.810  -20.107 -25.464 1.00 10.07 ? 46  LEU B N     1 
ATOM   3269  C  CA    . LEU B  1 35  ? 34.116  -20.854 -26.508 1.00 9.31  ? 46  LEU B CA    1 
ATOM   3270  C  C     . LEU B  1 35  ? 34.935  -22.083 -26.905 1.00 13.22 ? 46  LEU B C     1 
ATOM   3271  O  O     . LEU B  1 35  ? 34.418  -23.195 -26.912 1.00 12.95 ? 46  LEU B O     1 
ATOM   3272  C  CB    . LEU B  1 35  ? 33.814  -19.940 -27.716 1.00 9.21  ? 46  LEU B CB    1 
ATOM   3273  C  CG    . LEU B  1 35  ? 32.934  -20.558 -28.817 1.00 13.65 ? 46  LEU B CG    1 
ATOM   3274  C  CD1   . LEU B  1 35  ? 31.614  -21.129 -28.221 1.00 13.56 ? 46  LEU B CD1   1 
ATOM   3275  C  CD2   . LEU B  1 35  ? 32.708  -19.549 -29.991 1.00 11.99 ? 46  LEU B CD2   1 
ATOM   3276  N  N     . LEU B  1 36  ? 36.229  -21.908 -27.155 1.00 12.20 ? 47  LEU B N     1 
ATOM   3277  C  CA    . LEU B  1 36  ? 37.049  -23.067 -27.487 1.00 13.11 ? 47  LEU B CA    1 
ATOM   3278  C  C     . LEU B  1 36  ? 37.199  -24.098 -26.331 1.00 15.17 ? 47  LEU B C     1 
ATOM   3279  O  O     . LEU B  1 36  ? 37.261  -25.291 -26.615 1.00 12.75 ? 47  LEU B O     1 
ATOM   3280  C  CB    . LEU B  1 36  ? 38.356  -22.671 -28.205 1.00 14.56 ? 47  LEU B CB    1 
ATOM   3281  C  CG    . LEU B  1 36  ? 39.389  -21.948 -27.395 1.00 17.87 ? 47  LEU B CG    1 
ATOM   3282  C  CD1   . LEU B  1 36  ? 40.240  -22.946 -26.644 1.00 18.35 ? 47  LEU B CD1   1 
ATOM   3283  C  CD2   . LEU B  1 36  ? 40.255  -21.032 -28.314 1.00 13.40 ? 47  LEU B CD2   1 
ATOM   3284  N  N     . LEU B  1 37  ? 37.158  -23.656 -25.039 1.00 12.68 ? 48  LEU B N     1 
ATOM   3285  C  CA    . LEU B  1 37  ? 37.173  -24.611 -23.915 1.00 12.47 ? 48  LEU B CA    1 
ATOM   3286  C  C     . LEU B  1 37  ? 35.874  -25.420 -23.959 1.00 15.37 ? 48  LEU B C     1 
ATOM   3287  O  O     . LEU B  1 37  ? 35.907  -26.636 -23.758 1.00 13.97 ? 48  LEU B O     1 
ATOM   3288  C  CB    . LEU B  1 37  ? 37.246  -23.933 -22.532 1.00 12.60 ? 48  LEU B CB    1 
ATOM   3289  C  CG    . LEU B  1 37  ? 38.556  -23.246 -22.090 1.00 17.56 ? 48  LEU B CG    1 
ATOM   3290  C  CD1   . LEU B  1 37  ? 38.443  -22.794 -20.631 1.00 18.22 ? 48  LEU B CD1   1 
ATOM   3291  C  CD2   . LEU B  1 37  ? 39.755  -24.141 -22.243 1.00 19.97 ? 48  LEU B CD2   1 
ATOM   3292  N  N     . ASN B  1 38  ? 34.728  -24.746 -24.239 1.00 10.49 ? 49  ASN B N     1 
ATOM   3293  C  CA    . ASN B  1 38  ? 33.435  -25.428 -24.281 1.00 9.86  ? 49  ASN B CA    1 
ATOM   3294  C  C     . ASN B  1 38  ? 33.253  -26.365 -25.458 1.00 13.08 ? 49  ASN B C     1 
ATOM   3295  O  O     . ASN B  1 38  ? 32.482  -27.320 -25.362 1.00 14.06 ? 49  ASN B O     1 
ATOM   3296  C  CB    . ASN B  1 38  ? 32.282  -24.473 -24.097 1.00 10.03 ? 49  ASN B CB    1 
ATOM   3297  C  CG    . ASN B  1 38  ? 32.063  -24.157 -22.642 1.00 18.68 ? 49  ASN B CG    1 
ATOM   3298  O  OD1   . ASN B  1 38  ? 31.592  -24.986 -21.870 1.00 14.60 ? 49  ASN B OD1   1 
ATOM   3299  N  ND2   . ASN B  1 38  ? 32.452  -22.981 -22.225 1.00 9.39  ? 49  ASN B ND2   1 
ATOM   3300  N  N     . TYR B  1 39  ? 34.016  -26.141 -26.539 1.00 8.99  ? 50  TYR B N     1 
ATOM   3301  C  CA    . TYR B  1 39  ? 34.074  -27.054 -27.674 1.00 9.21  ? 50  TYR B CA    1 
ATOM   3302  C  C     . TYR B  1 39  ? 34.985  -28.284 -27.379 1.00 15.83 ? 50  TYR B C     1 
ATOM   3303  O  O     . TYR B  1 39  ? 34.998  -29.242 -28.159 1.00 16.09 ? 50  TYR B O     1 
ATOM   3304  C  CB    . TYR B  1 39  ? 34.589  -26.323 -28.917 1.00 9.18  ? 50  TYR B CB    1 
ATOM   3305  C  CG    . TYR B  1 39  ? 33.512  -25.749 -29.816 1.00 9.90  ? 50  TYR B CG    1 
ATOM   3306  C  CD1   . TYR B  1 39  ? 32.671  -26.581 -30.546 1.00 11.00 ? 50  TYR B CD1   1 
ATOM   3307  C  CD2   . TYR B  1 39  ? 33.415  -24.373 -30.030 1.00 10.57 ? 50  TYR B CD2   1 
ATOM   3308  C  CE1   . TYR B  1 39  ? 31.705  -26.058 -31.412 1.00 11.15 ? 50  TYR B CE1   1 
ATOM   3309  C  CE2   . TYR B  1 39  ? 32.470  -23.839 -30.907 1.00 10.59 ? 50  TYR B CE2   1 
ATOM   3310  C  CZ    . TYR B  1 39  ? 31.648  -24.690 -31.632 1.00 11.57 ? 50  TYR B CZ    1 
ATOM   3311  O  OH    . TYR B  1 39  ? 30.717  -24.192 -32.496 1.00 11.36 ? 50  TYR B OH    1 
ATOM   3312  N  N     . GLY B  1 40  ? 35.725  -28.250 -26.264 1.00 14.83 ? 51  GLY B N     1 
ATOM   3313  C  CA    . GLY B  1 40  ? 36.643  -29.322 -25.862 1.00 14.62 ? 51  GLY B CA    1 
ATOM   3314  C  C     . GLY B  1 40  ? 38.009  -29.278 -26.537 1.00 17.68 ? 51  GLY B C     1 
ATOM   3315  O  O     . GLY B  1 40  ? 38.773  -30.240 -26.444 1.00 16.78 ? 51  GLY B O     1 
ATOM   3316  N  N     . LEU B  1 41  ? 38.348  -28.159 -27.200 1.00 14.55 ? 52  LEU B N     1 
ATOM   3317  C  CA    . LEU B  1 41  ? 39.618  -28.014 -27.940 1.00 13.90 ? 52  LEU B CA    1 
ATOM   3318  C  C     . LEU B  1 41  ? 40.880  -28.009 -27.073 1.00 16.88 ? 52  LEU B C     1 
ATOM   3319  O  O     . LEU B  1 41  ? 41.963  -28.315 -27.587 1.00 15.36 ? 52  LEU B O     1 
ATOM   3320  C  CB    . LEU B  1 41  ? 39.619  -26.830 -28.930 1.00 14.58 ? 52  LEU B CB    1 
ATOM   3321  C  CG    . LEU B  1 41  ? 38.547  -26.844 -30.031 1.00 18.84 ? 52  LEU B CG    1 
ATOM   3322  C  CD1   . LEU B  1 41  ? 38.616  -25.572 -30.847 1.00 20.00 ? 52  LEU B CD1   1 
ATOM   3323  C  CD2   . LEU B  1 41  ? 38.685  -28.030 -30.928 1.00 18.60 ? 52  LEU B CD2   1 
ATOM   3324  N  N     . TYR B  1 42  ? 40.730  -27.750 -25.764 1.00 15.00 ? 53  TYR B N     1 
ATOM   3325  C  CA    . TYR B  1 42  ? 41.826  -27.811 -24.784 1.00 16.39 ? 53  TYR B CA    1 
ATOM   3326  C  C     . TYR B  1 42  ? 42.416  -29.236 -24.697 1.00 21.28 ? 53  TYR B C     1 
ATOM   3327  O  O     . TYR B  1 42  ? 43.574  -29.390 -24.331 1.00 21.85 ? 53  TYR B O     1 
ATOM   3328  C  CB    . TYR B  1 42  ? 41.354  -27.338 -23.387 1.00 17.18 ? 53  TYR B CB    1 
ATOM   3329  C  CG    . TYR B  1 42  ? 40.330  -28.243 -22.732 1.00 20.27 ? 53  TYR B CG    1 
ATOM   3330  C  CD1   . TYR B  1 42  ? 40.726  -29.316 -21.931 1.00 23.25 ? 53  TYR B CD1   1 
ATOM   3331  C  CD2   . TYR B  1 42  ? 38.962  -28.026 -22.909 1.00 20.11 ? 53  TYR B CD2   1 
ATOM   3332  C  CE1   . TYR B  1 42  ? 39.788  -30.161 -21.339 1.00 25.41 ? 53  TYR B CE1   1 
ATOM   3333  C  CE2   . TYR B  1 42  ? 38.018  -28.863 -22.322 1.00 20.53 ? 53  TYR B CE2   1 
ATOM   3334  C  CZ    . TYR B  1 42  ? 38.436  -29.936 -21.548 1.00 30.53 ? 53  TYR B CZ    1 
ATOM   3335  O  OH    . TYR B  1 42  ? 37.513  -30.765 -20.969 1.00 32.55 ? 53  TYR B OH    1 
ATOM   3336  N  N     . ARG B  1 43  ? 41.618  -30.278 -25.022 1.00 17.83 ? 54  ARG B N     1 
ATOM   3337  C  CA    . ARG B  1 43  ? 42.076  -31.680 -24.955 1.00 17.78 ? 54  ARG B CA    1 
ATOM   3338  C  C     . ARG B  1 43  ? 43.156  -31.984 -25.994 1.00 21.52 ? 54  ARG B C     1 
ATOM   3339  O  O     . ARG B  1 43  ? 43.917  -32.924 -25.814 1.00 22.69 ? 54  ARG B O     1 
ATOM   3340  C  CB    . ARG B  1 43  ? 40.880  -32.646 -25.148 1.00 17.62 ? 54  ARG B CB    1 
ATOM   3341  C  CG    . ARG B  1 43  ? 39.833  -32.478 -24.068 1.00 30.35 ? 54  ARG B CG    1 
ATOM   3342  C  CD    . ARG B  1 43  ? 38.766  -33.543 -24.053 1.00 52.92 ? 54  ARG B CD    1 
ATOM   3343  N  NE    . ARG B  1 43  ? 37.848  -33.302 -22.937 1.00 70.75 ? 54  ARG B NE    1 
ATOM   3344  C  CZ    . ARG B  1 43  ? 36.716  -33.965 -22.728 1.00 92.61 ? 54  ARG B CZ    1 
ATOM   3345  N  NH1   . ARG B  1 43  ? 36.338  -34.929 -23.560 1.00 84.42 ? 54  ARG B NH1   1 
ATOM   3346  N  NH2   . ARG B  1 43  ? 35.952  -33.669 -21.685 1.00 82.14 ? 54  ARG B NH2   1 
ATOM   3347  N  N     . LYS B  1 44  ? 43.213  -31.194 -27.078 1.00 15.08 ? 55  LYS B N     1 
ATOM   3348  C  CA    . LYS B  1 44  ? 44.087  -31.401 -28.228 1.00 15.23 ? 55  LYS B CA    1 
ATOM   3349  C  C     . LYS B  1 44  ? 45.300  -30.469 -28.291 1.00 17.43 ? 55  LYS B C     1 
ATOM   3350  O  O     . LYS B  1 44  ? 46.111  -30.595 -29.201 1.00 15.08 ? 55  LYS B O     1 
ATOM   3351  C  CB    . LYS B  1 44  ? 43.247  -31.208 -29.522 1.00 18.78 ? 55  LYS B CB    1 
ATOM   3352  C  CG    . LYS B  1 44  ? 42.130  -32.223 -29.719 1.00 32.62 ? 55  LYS B CG    1 
ATOM   3353  C  CD    . LYS B  1 44  ? 41.237  -31.833 -30.878 1.00 44.72 ? 55  LYS B CD    1 
ATOM   3354  C  CE    . LYS B  1 44  ? 39.941  -32.610 -30.854 1.00 62.63 ? 55  LYS B CE    1 
ATOM   3355  N  NZ    . LYS B  1 44  ? 39.045  -32.234 -31.979 1.00 74.54 ? 55  LYS B NZ    1 
ATOM   3356  N  N     . MET B  1 45  ? 45.412  -29.505 -27.368 1.00 15.30 ? 56  MET B N     1 
ATOM   3357  C  CA    . MET B  1 45  ? 46.518  -28.561 -27.449 1.00 14.95 ? 56  MET B CA    1 
ATOM   3358  C  C     . MET B  1 45  ? 47.117  -28.190 -26.114 1.00 17.06 ? 56  MET B C     1 
ATOM   3359  O  O     . MET B  1 45  ? 46.483  -28.356 -25.062 1.00 16.92 ? 56  MET B O     1 
ATOM   3360  C  CB    . MET B  1 45  ? 46.143  -27.313 -28.292 1.00 17.43 ? 56  MET B CB    1 
ATOM   3361  C  CG    . MET B  1 45  ? 45.263  -26.344 -27.603 1.00 19.73 ? 56  MET B CG    1 
ATOM   3362  S  SD    . MET B  1 45  ? 44.691  -24.941 -28.638 1.00 21.84 ? 56  MET B SD    1 
ATOM   3363  C  CE    . MET B  1 45  ? 43.479  -24.391 -27.561 1.00 16.56 ? 56  MET B CE    1 
ATOM   3364  N  N     . GLU B  1 46  ? 48.353  -27.670 -26.167 1.00 13.75 ? 57  GLU B N     1 
ATOM   3365  C  CA    . GLU B  1 46  ? 49.046  -27.228 -24.968 1.00 12.92 ? 57  GLU B CA    1 
ATOM   3366  C  C     . GLU B  1 46  ? 48.639  -25.801 -24.746 1.00 15.82 ? 57  GLU B C     1 
ATOM   3367  O  O     . GLU B  1 46  ? 48.824  -24.960 -25.633 1.00 13.85 ? 57  GLU B O     1 
ATOM   3368  C  CB    . GLU B  1 46  ? 50.566  -27.293 -25.148 1.00 15.05 ? 57  GLU B CB    1 
ATOM   3369  C  CG    . GLU B  1 46  ? 51.146  -28.690 -25.099 1.00 25.88 ? 57  GLU B CG    1 
ATOM   3370  C  CD    . GLU B  1 46  ? 51.211  -29.353 -23.736 1.00 40.18 ? 57  GLU B CD    1 
ATOM   3371  O  OE1   . GLU B  1 46  ? 51.681  -30.510 -23.681 1.00 40.03 ? 57  GLU B OE1   1 
ATOM   3372  O  OE2   . GLU B  1 46  ? 50.804  -28.731 -22.727 1.00 22.50 ? 57  GLU B OE2   1 
ATOM   3373  N  N     . ILE B  1 47  ? 48.118  -25.524 -23.573 1.00 11.79 ? 58  ILE B N     1 
ATOM   3374  C  CA    . ILE B  1 47  ? 47.727  -24.164 -23.236 1.00 11.86 ? 58  ILE B CA    1 
ATOM   3375  C  C     . ILE B  1 47  ? 48.715  -23.655 -22.221 1.00 15.17 ? 58  ILE B C     1 
ATOM   3376  O  O     . ILE B  1 47  ? 48.936  -24.320 -21.193 1.00 13.75 ? 58  ILE B O     1 
ATOM   3377  C  CB    . ILE B  1 47  ? 46.247  -24.093 -22.736 1.00 13.54 ? 58  ILE B CB    1 
ATOM   3378  C  CG1   . ILE B  1 47  ? 45.269  -24.548 -23.865 1.00 13.48 ? 58  ILE B CG1   1 
ATOM   3379  C  CG2   . ILE B  1 47  ? 45.907  -22.663 -22.237 1.00 12.64 ? 58  ILE B CG2   1 
ATOM   3380  C  CD1   . ILE B  1 47  ? 43.778  -24.704 -23.431 1.00 13.82 ? 58  ILE B CD1   1 
ATOM   3381  N  N     . TYR B  1 48  ? 49.320  -22.487 -22.511 1.00 11.19 ? 59  TYR B N     1 
ATOM   3382  C  CA    . TYR B  1 48  ? 50.261  -21.826 -21.606 1.00 10.12 ? 59  TYR B CA    1 
ATOM   3383  C  C     . TYR B  1 48  ? 49.773  -20.468 -21.251 1.00 14.28 ? 59  TYR B C     1 
ATOM   3384  O  O     . TYR B  1 48  ? 49.087  -19.813 -22.039 1.00 13.49 ? 59  TYR B O     1 
ATOM   3385  C  CB    . TYR B  1 48  ? 51.617  -21.616 -22.266 1.00 10.50 ? 59  TYR B CB    1 
ATOM   3386  C  CG    . TYR B  1 48  ? 52.286  -22.886 -22.709 1.00 13.57 ? 59  TYR B CG    1 
ATOM   3387  C  CD1   . TYR B  1 48  ? 52.978  -23.687 -21.803 1.00 15.10 ? 59  TYR B CD1   1 
ATOM   3388  C  CD2   . TYR B  1 48  ? 52.278  -23.266 -24.042 1.00 15.35 ? 59  TYR B CD2   1 
ATOM   3389  C  CE1   . TYR B  1 48  ? 53.592  -24.871 -22.212 1.00 15.56 ? 59  TYR B CE1   1 
ATOM   3390  C  CE2   . TYR B  1 48  ? 52.867  -24.452 -24.456 1.00 17.46 ? 59  TYR B CE2   1 
ATOM   3391  C  CZ    . TYR B  1 48  ? 53.549  -25.238 -23.548 1.00 24.67 ? 59  TYR B CZ    1 
ATOM   3392  O  OH    . TYR B  1 48  ? 54.167  -26.370 -24.011 1.00 24.40 ? 59  TYR B OH    1 
ATOM   3393  N  N     . ARG B  1 49  ? 50.184  -20.004 -20.078 1.00 10.14 ? 60  ARG B N     1 
ATOM   3394  C  CA    . ARG B  1 49  ? 49.922  -18.640 -19.689 1.00 9.85  ? 60  ARG B CA    1 
ATOM   3395  C  C     . ARG B  1 49  ? 51.176  -17.831 -20.146 1.00 13.67 ? 60  ARG B C     1 
ATOM   3396  O  O     . ARG B  1 49  ? 52.306  -18.253 -19.905 1.00 15.10 ? 60  ARG B O     1 
ATOM   3397  C  CB    . ARG B  1 49  ? 49.791  -18.588 -18.156 1.00 13.80 ? 60  ARG B CB    1 
ATOM   3398  C  CG    . ARG B  1 49  ? 49.118  -17.344 -17.678 1.00 25.53 ? 60  ARG B CG    1 
ATOM   3399  C  CD    . ARG B  1 49  ? 49.257  -17.214 -16.185 1.00 29.76 ? 60  ARG B CD    1 
ATOM   3400  N  NE    . ARG B  1 49  ? 48.536  -18.247 -15.450 1.00 32.35 ? 60  ARG B NE    1 
ATOM   3401  C  CZ    . ARG B  1 49  ? 48.363  -18.216 -14.132 1.00 53.29 ? 60  ARG B CZ    1 
ATOM   3402  N  NH1   . ARG B  1 49  ? 47.696  -19.182 -13.523 1.00 45.13 ? 60  ARG B NH1   1 
ATOM   3403  N  NH2   . ARG B  1 49  ? 48.841  -17.204 -13.415 1.00 34.32 ? 60  ARG B NH2   1 
ATOM   3404  N  N     . PRO B  1 50  ? 51.025  -16.689 -20.828 1.00 9.99  ? 61  PRO B N     1 
ATOM   3405  C  CA    . PRO B  1 50  ? 52.211  -15.913 -21.187 1.00 9.89  ? 61  PRO B CA    1 
ATOM   3406  C  C     . PRO B  1 50  ? 52.869  -15.309 -19.961 1.00 12.91 ? 61  PRO B C     1 
ATOM   3407  O  O     . PRO B  1 50  ? 52.202  -15.047 -18.960 1.00 13.94 ? 61  PRO B O     1 
ATOM   3408  C  CB    . PRO B  1 50  ? 51.626  -14.791 -22.045 1.00 10.68 ? 61  PRO B CB    1 
ATOM   3409  C  CG    . PRO B  1 50  ? 50.291  -14.527 -21.432 1.00 13.76 ? 61  PRO B CG    1 
ATOM   3410  C  CD    . PRO B  1 50  ? 49.790  -15.955 -21.182 1.00 11.10 ? 61  PRO B CD    1 
ATOM   3411  N  N     . HIS B  1 51  ? 54.158  -15.027 -20.070 1.00 10.82 ? 62  HIS B N     1 
ATOM   3412  C  CA    . HIS B  1 51  ? 54.849  -14.257 -19.050 1.00 9.06  ? 62  HIS B CA    1 
ATOM   3413  C  C     . HIS B  1 51  ? 54.531  -12.800 -19.382 1.00 12.74 ? 62  HIS B C     1 
ATOM   3414  O  O     . HIS B  1 51  ? 54.049  -12.503 -20.487 1.00 12.23 ? 62  HIS B O     1 
ATOM   3415  C  CB    . HIS B  1 51  ? 56.381  -14.481 -19.140 1.00 9.23  ? 62  HIS B CB    1 
ATOM   3416  C  CG    . HIS B  1 51  ? 57.015  -14.019 -20.426 1.00 10.88 ? 62  HIS B CG    1 
ATOM   3417  N  ND1   . HIS B  1 51  ? 56.850  -14.722 -21.605 1.00 12.26 ? 62  HIS B ND1   1 
ATOM   3418  C  CD2   . HIS B  1 51  ? 57.806  -12.947 -20.665 1.00 11.63 ? 62  HIS B CD2   1 
ATOM   3419  C  CE1   . HIS B  1 51  ? 57.576  -14.086 -22.513 1.00 11.42 ? 62  HIS B CE1   1 
ATOM   3420  N  NE2   . HIS B  1 51  ? 58.167  -13.007 -21.994 1.00 11.52 ? 62  HIS B NE2   1 
ATOM   3421  N  N     . LYS B  1 52  ? 54.796  -11.883 -18.439 1.00 8.41  ? 63  LYS B N     1 
ATOM   3422  C  CA    . LYS B  1 52  ? 54.695  -10.456 -18.733 1.00 8.37  ? 63  LYS B CA    1 
ATOM   3423  C  C     . LYS B  1 52  ? 56.021  -10.089 -19.407 1.00 12.45 ? 63  LYS B C     1 
ATOM   3424  O  O     . LYS B  1 52  ? 57.064  -10.120 -18.736 1.00 12.03 ? 63  LYS B O     1 
ATOM   3425  C  CB    . LYS B  1 52  ? 54.531  -9.663  -17.438 1.00 10.55 ? 63  LYS B CB    1 
ATOM   3426  C  CG    . LYS B  1 52  ? 53.081  -9.683  -16.929 1.00 15.29 ? 63  LYS B CG    1 
ATOM   3427  C  CD    . LYS B  1 52  ? 52.954  -9.294  -15.452 1.00 21.92 ? 63  LYS B CD    1 
ATOM   3428  C  CE    . LYS B  1 52  ? 53.139  -7.848  -15.110 1.00 43.87 ? 63  LYS B CE    1 
ATOM   3429  N  NZ    . LYS B  1 52  ? 52.905  -7.584  -13.660 1.00 56.99 ? 63  LYS B NZ    1 
ATOM   3430  N  N     . ALA B  1 53  ? 55.990  -9.737  -20.719 1.00 10.77 ? 64  ALA B N     1 
ATOM   3431  C  CA    . ALA B  1 53  ? 57.203  -9.367  -21.470 1.00 9.60  ? 64  ALA B CA    1 
ATOM   3432  C  C     . ALA B  1 53  ? 57.976  -8.243  -20.762 1.00 12.74 ? 64  ALA B C     1 
ATOM   3433  O  O     . ALA B  1 53  ? 57.380  -7.288  -20.296 1.00 11.46 ? 64  ALA B O     1 
ATOM   3434  C  CB    . ALA B  1 53  ? 56.854  -8.955  -22.898 1.00 9.76  ? 64  ALA B CB    1 
ATOM   3435  N  N     . THR B  1 54  ? 59.287  -8.399  -20.610 1.00 9.44  ? 65  THR B N     1 
ATOM   3436  C  CA    . THR B  1 54  ? 60.070  -7.388  -19.882 1.00 11.17 ? 65  THR B CA    1 
ATOM   3437  C  C     . THR B  1 54  ? 60.385  -6.192  -20.782 1.00 15.56 ? 65  THR B C     1 
ATOM   3438  O  O     . THR B  1 54  ? 60.301  -6.304  -22.001 1.00 11.52 ? 65  THR B O     1 
ATOM   3439  C  CB    . THR B  1 54  ? 61.356  -8.041  -19.363 1.00 15.60 ? 65  THR B CB    1 
ATOM   3440  O  OG1   . THR B  1 54  ? 62.103  -8.504  -20.483 1.00 14.94 ? 65  THR B OG1   1 
ATOM   3441  C  CG2   . THR B  1 54  ? 61.073  -9.233  -18.438 1.00 11.04 ? 65  THR B CG2   1 
ATOM   3442  N  N     . ALA B  1 55  ? 60.847  -5.068  -20.177 1.00 16.10 ? 66  ALA B N     1 
ATOM   3443  C  CA    . ALA B  1 55  ? 61.324  -3.899  -20.919 1.00 15.99 ? 66  ALA B CA    1 
ATOM   3444  C  C     . ALA B  1 55  ? 62.528  -4.334  -21.767 1.00 18.17 ? 66  ALA B C     1 
ATOM   3445  O  O     . ALA B  1 55  ? 62.662  -3.885  -22.909 1.00 18.39 ? 66  ALA B O     1 
ATOM   3446  C  CB    . ALA B  1 55  ? 61.729  -2.793  -19.950 1.00 16.81 ? 66  ALA B CB    1 
ATOM   3447  N  N     . GLU B  1 56  ? 63.355  -5.257  -21.254 1.00 14.33 ? 67  GLU B N     1 
ATOM   3448  C  CA    . GLU B  1 56  ? 64.483  -5.833  -22.007 1.00 14.50 ? 67  GLU B CA    1 
ATOM   3449  C  C     . GLU B  1 56  ? 64.000  -6.478  -23.350 1.00 16.97 ? 67  GLU B C     1 
ATOM   3450  O  O     . GLU B  1 56  ? 64.590  -6.244  -24.409 1.00 14.94 ? 67  GLU B O     1 
ATOM   3451  C  CB    . GLU B  1 56  ? 65.221  -6.870  -21.142 1.00 16.22 ? 67  GLU B CB    1 
ATOM   3452  C  CG    . GLU B  1 56  ? 66.394  -7.552  -21.827 1.00 26.18 ? 67  GLU B CG    1 
ATOM   3453  C  CD    . GLU B  1 56  ? 67.121  -8.606  -21.001 1.00 49.29 ? 67  GLU B CD    1 
ATOM   3454  O  OE1   . GLU B  1 56  ? 66.492  -9.236  -20.119 1.00 40.90 ? 67  GLU B OE1   1 
ATOM   3455  O  OE2   . GLU B  1 56  ? 68.326  -8.825  -21.262 1.00 35.68 ? 67  GLU B OE2   1 
ATOM   3456  N  N     . GLU B  1 57  ? 62.926  -7.273  -23.293 1.00 12.29 ? 68  GLU B N     1 
ATOM   3457  C  CA    . GLU B  1 57  ? 62.370  -7.908  -24.478 1.00 10.29 ? 68  GLU B CA    1 
ATOM   3458  C  C     . GLU B  1 57  ? 61.771  -6.866  -25.396 1.00 13.14 ? 68  GLU B C     1 
ATOM   3459  O  O     . GLU B  1 57  ? 62.036  -6.906  -26.590 1.00 14.15 ? 68  GLU B O     1 
ATOM   3460  C  CB    . GLU B  1 57  ? 61.290  -8.939  -24.109 1.00 11.51 ? 68  GLU B CB    1 
ATOM   3461  C  CG    . GLU B  1 57  ? 61.804  -10.190 -23.422 1.00 15.58 ? 68  GLU B CG    1 
ATOM   3462  C  CD    . GLU B  1 57  ? 60.654  -11.001 -22.846 1.00 18.94 ? 68  GLU B CD    1 
ATOM   3463  O  OE1   . GLU B  1 57  ? 60.038  -11.783 -23.598 1.00 31.20 ? 68  GLU B OE1   1 
ATOM   3464  O  OE2   . GLU B  1 57  ? 60.279  -10.742 -21.687 1.00 26.87 ? 68  GLU B OE2   1 
ATOM   3465  N  N     . MET B  1 58  ? 61.013  -5.911  -24.851 1.00 9.67  ? 69  MET B N     1 
ATOM   3466  C  CA    . MET B  1 58  ? 60.339  -4.880  -25.668 1.00 9.82  ? 69  MET B CA    1 
ATOM   3467  C  C     . MET B  1 58  ? 61.298  -3.963  -26.395 1.00 16.53 ? 69  MET B C     1 
ATOM   3468  O  O     . MET B  1 58  ? 61.005  -3.546  -27.523 1.00 14.53 ? 69  MET B O     1 
ATOM   3469  C  CB    . MET B  1 58  ? 59.344  -4.091  -24.817 1.00 11.06 ? 69  MET B CB    1 
ATOM   3470  C  CG    . MET B  1 58  ? 58.131  -4.928  -24.417 1.00 12.98 ? 69  MET B CG    1 
ATOM   3471  S  SD    . MET B  1 58  ? 57.036  -3.851  -23.504 1.00 17.58 ? 69  MET B SD    1 
ATOM   3472  C  CE    . MET B  1 58  ? 55.907  -5.001  -22.889 1.00 14.87 ? 69  MET B CE    1 
ATOM   3473  N  N     . THR B  1 59  ? 62.467  -3.669  -25.762 1.00 13.74 ? 70  THR B N     1 
ATOM   3474  C  CA    . THR B  1 59  ? 63.491  -2.797  -26.351 1.00 13.02 ? 70  THR B CA    1 
ATOM   3475  C  C     . THR B  1 59  ? 64.350  -3.459  -27.395 1.00 16.33 ? 70  THR B C     1 
ATOM   3476  O  O     . THR B  1 59  ? 65.229  -2.797  -27.949 1.00 16.36 ? 70  THR B O     1 
ATOM   3477  C  CB    . THR B  1 59  ? 64.292  -2.002  -25.302 1.00 15.28 ? 70  THR B CB    1 
ATOM   3478  O  OG1   . THR B  1 59  ? 64.997  -2.930  -24.479 1.00 17.57 ? 70  THR B OG1   1 
ATOM   3479  C  CG2   . THR B  1 59  ? 63.419  -1.081  -24.485 1.00 9.80  ? 70  THR B CG2   1 
ATOM   3480  N  N     . LYS B  1 60  ? 64.065  -4.735  -27.742 1.00 12.36 ? 71  LYS B N     1 
ATOM   3481  C  CA    . LYS B  1 60  ? 64.750  -5.383  -28.862 1.00 11.36 ? 71  LYS B CA    1 
ATOM   3482  C  C     . LYS B  1 60  ? 64.280  -4.662  -30.128 1.00 16.21 ? 71  LYS B C     1 
ATOM   3483  O  O     . LYS B  1 60  ? 64.941  -4.724  -31.162 1.00 15.80 ? 71  LYS B O     1 
ATOM   3484  C  CB    . LYS B  1 60  ? 64.436  -6.893  -28.929 1.00 12.64 ? 71  LYS B CB    1 
ATOM   3485  C  CG    A LYS B  1 60  ? 65.049  -7.723  -27.784 0.87 19.97 ? 71  LYS B CG    1 
ATOM   3486  C  CD    A LYS B  1 60  ? 66.590  -7.657  -27.720 0.87 26.24 ? 71  LYS B CD    1 
ATOM   3487  C  CE    A LYS B  1 60  ? 67.158  -8.425  -26.548 0.87 39.35 ? 71  LYS B CE    1 
ATOM   3488  N  NZ    A LYS B  1 60  ? 66.848  -7.796  -25.241 0.87 50.36 ? 71  LYS B NZ    1 
ATOM   3489  N  N     . TYR B  1 61  ? 63.118  -3.962  -30.036 1.00 12.41 ? 72  TYR B N     1 
ATOM   3490  C  CA    . TYR B  1 61  ? 62.642  -3.156  -31.162 1.00 11.94 ? 72  TYR B CA    1 
ATOM   3491  C  C     . TYR B  1 61  ? 62.359  -1.697  -30.768 1.00 15.01 ? 72  TYR B C     1 
ATOM   3492  O  O     . TYR B  1 61  ? 62.877  -0.778  -31.400 1.00 13.80 ? 72  TYR B O     1 
ATOM   3493  C  CB    . TYR B  1 61  ? 61.412  -3.781  -31.838 1.00 12.87 ? 72  TYR B CB    1 
ATOM   3494  C  CG    . TYR B  1 61  ? 60.924  -2.931  -32.988 1.00 15.25 ? 72  TYR B CG    1 
ATOM   3495  C  CD1   . TYR B  1 61  ? 59.659  -2.351  -32.965 1.00 18.50 ? 72  TYR B CD1   1 
ATOM   3496  C  CD2   . TYR B  1 61  ? 61.738  -2.683  -34.091 1.00 16.40 ? 72  TYR B CD2   1 
ATOM   3497  C  CE1   . TYR B  1 61  ? 59.207  -1.560  -34.030 1.00 19.80 ? 72  TYR B CE1   1 
ATOM   3498  C  CE2   . TYR B  1 61  ? 61.298  -1.904  -35.154 1.00 16.64 ? 72  TYR B CE2   1 
ATOM   3499  C  CZ    . TYR B  1 61  ? 60.043  -1.322  -35.106 1.00 23.51 ? 72  TYR B CZ    1 
ATOM   3500  O  OH    . TYR B  1 61  ? 59.648  -0.520  -36.145 1.00 24.16 ? 72  TYR B OH    1 
ATOM   3501  N  N     . HIS B  1 62  ? 61.490  -1.492  -29.775 1.00 10.43 ? 73  HIS B N     1 
ATOM   3502  C  CA    . HIS B  1 62  ? 61.062  -0.173  -29.353 1.00 10.31 ? 73  HIS B CA    1 
ATOM   3503  C  C     . HIS B  1 62  ? 62.163  0.603   -28.656 1.00 15.11 ? 73  HIS B C     1 
ATOM   3504  O  O     . HIS B  1 62  ? 63.058  0.014   -28.051 1.00 14.47 ? 73  HIS B O     1 
ATOM   3505  C  CB    . HIS B  1 62  ? 59.828  -0.277  -28.442 1.00 9.59  ? 73  HIS B CB    1 
ATOM   3506  C  CG    . HIS B  1 62  ? 58.619  -0.830  -29.145 1.00 11.92 ? 73  HIS B CG    1 
ATOM   3507  N  ND1   . HIS B  1 62  ? 57.862  -0.048  -30.002 1.00 12.43 ? 73  HIS B ND1   1 
ATOM   3508  C  CD2   . HIS B  1 62  ? 58.082  -2.077  -29.097 1.00 11.93 ? 73  HIS B CD2   1 
ATOM   3509  C  CE1   . HIS B  1 62  ? 56.896  -0.843  -30.454 1.00 11.91 ? 73  HIS B CE1   1 
ATOM   3510  N  NE2   . HIS B  1 62  ? 56.973  -2.061  -29.921 1.00 12.07 ? 73  HIS B NE2   1 
ATOM   3511  N  N     . SER B  1 63  ? 62.072  1.919   -28.702 1.00 12.58 ? 74  SER B N     1 
ATOM   3512  C  CA    . SER B  1 63  ? 63.057  2.726   -28.004 1.00 12.77 ? 74  SER B CA    1 
ATOM   3513  C  C     . SER B  1 63  ? 62.832  2.641   -26.497 1.00 15.88 ? 74  SER B C     1 
ATOM   3514  O  O     . SER B  1 63  ? 61.712  2.418   -26.030 1.00 15.15 ? 74  SER B O     1 
ATOM   3515  C  CB    . SER B  1 63  ? 63.010  4.171   -28.489 1.00 14.30 ? 74  SER B CB    1 
ATOM   3516  O  OG    . SER B  1 63  ? 61.809  4.791   -28.062 1.00 18.55 ? 74  SER B OG    1 
ATOM   3517  N  N     . ASP B  1 64  ? 63.914  2.821   -25.744 1.00 13.72 ? 75  ASP B N     1 
ATOM   3518  C  CA    . ASP B  1 64  ? 63.948  2.864   -24.295 1.00 13.80 ? 75  ASP B CA    1 
ATOM   3519  C  C     . ASP B  1 64  ? 63.022  3.938   -23.744 1.00 18.84 ? 75  ASP B C     1 
ATOM   3520  O  O     . ASP B  1 64  ? 62.283  3.652   -22.796 1.00 18.31 ? 75  ASP B O     1 
ATOM   3521  C  CB    . ASP B  1 64  ? 65.384  3.095   -23.823 1.00 15.95 ? 75  ASP B CB    1 
ATOM   3522  C  CG    . ASP B  1 64  ? 66.262  1.906   -24.175 1.00 29.43 ? 75  ASP B CG    1 
ATOM   3523  O  OD1   . ASP B  1 64  ? 66.689  1.806   -25.356 1.00 29.29 ? 75  ASP B OD1   1 
ATOM   3524  O  OD2   . ASP B  1 64  ? 66.443  1.033   -23.307 1.00 37.77 ? 75  ASP B OD2   1 
ATOM   3525  N  N     . GLU B  1 65  ? 63.013  5.140   -24.357 1.00 15.70 ? 76  GLU B N     1 
ATOM   3526  C  CA    . GLU B  1 65  ? 62.163  6.231   -23.887 1.00 16.45 ? 76  GLU B CA    1 
ATOM   3527  C  C     . GLU B  1 65  ? 60.681  5.881   -24.016 1.00 18.35 ? 76  GLU B C     1 
ATOM   3528  O  O     . GLU B  1 65  ? 59.896  6.165   -23.101 1.00 16.98 ? 76  GLU B O     1 
ATOM   3529  C  CB    . GLU B  1 65  ? 62.426  7.509   -24.686 1.00 19.45 ? 76  GLU B CB    1 
ATOM   3530  C  CG    . GLU B  1 65  ? 63.680  8.258   -24.285 1.00 35.91 ? 76  GLU B CG    1 
ATOM   3531  C  CD    . GLU B  1 65  ? 63.684  9.639   -24.905 1.00 56.66 ? 76  GLU B CD    1 
ATOM   3532  O  OE1   . GLU B  1 65  ? 63.291  10.593  -24.198 1.00 54.29 ? 76  GLU B OE1   1 
ATOM   3533  O  OE2   . GLU B  1 65  ? 63.982  9.753   -26.117 1.00 43.95 ? 76  GLU B OE2   1 
ATOM   3534  N  N     . TYR B  1 66  ? 60.297  5.289   -25.163 1.00 14.14 ? 77  TYR B N     1 
ATOM   3535  C  CA    . TYR B  1 66  ? 58.897  4.912   -25.401 1.00 13.14 ? 77  TYR B CA    1 
ATOM   3536  C  C     . TYR B  1 66  ? 58.406  3.845   -24.416 1.00 14.60 ? 77  TYR B C     1 
ATOM   3537  O  O     . TYR B  1 66  ? 57.314  3.983   -23.866 1.00 14.50 ? 77  TYR B O     1 
ATOM   3538  C  CB    . TYR B  1 66  ? 58.685  4.500   -26.860 1.00 12.91 ? 77  TYR B CB    1 
ATOM   3539  C  CG    . TYR B  1 66  ? 57.281  4.012   -27.162 1.00 12.70 ? 77  TYR B CG    1 
ATOM   3540  C  CD1   . TYR B  1 66  ? 56.174  4.831   -26.944 1.00 13.56 ? 77  TYR B CD1   1 
ATOM   3541  C  CD2   . TYR B  1 66  ? 57.065  2.758   -27.739 1.00 11.45 ? 77  TYR B CD2   1 
ATOM   3542  C  CE1   . TYR B  1 66  ? 54.876  4.383   -27.211 1.00 12.97 ? 77  TYR B CE1   1 
ATOM   3543  C  CE2   . TYR B  1 66  ? 55.776  2.302   -28.019 1.00 10.23 ? 77  TYR B CE2   1 
ATOM   3544  C  CZ    . TYR B  1 66  ? 54.683  3.116   -27.743 1.00 15.05 ? 77  TYR B CZ    1 
ATOM   3545  O  OH    . TYR B  1 66  ? 53.408  2.711   -28.060 1.00 12.88 ? 77  TYR B OH    1 
ATOM   3546  N  N     . ILE B  1 67  ? 59.206  2.806   -24.167 1.00 11.52 ? 78  ILE B N     1 
ATOM   3547  C  CA    . ILE B  1 67  ? 58.822  1.755   -23.204 1.00 11.07 ? 78  ILE B CA    1 
ATOM   3548  C  C     . ILE B  1 67  ? 58.786  2.313   -21.797 1.00 16.38 ? 78  ILE B C     1 
ATOM   3549  O  O     . ILE B  1 67  ? 57.865  1.976   -21.042 1.00 14.03 ? 78  ILE B O     1 
ATOM   3550  C  CB    . ILE B  1 67  ? 59.710  0.499   -23.340 1.00 13.68 ? 78  ILE B CB    1 
ATOM   3551  C  CG1   . ILE B  1 67  ? 59.584  -0.134  -24.766 1.00 13.09 ? 78  ILE B CG1   1 
ATOM   3552  C  CG2   . ILE B  1 67  ? 59.460  -0.542  -22.222 1.00 14.56 ? 78  ILE B CG2   1 
ATOM   3553  C  CD1   . ILE B  1 67  ? 58.065  -0.450  -25.252 1.00 13.50 ? 78  ILE B CD1   1 
ATOM   3554  N  N     . LYS B  1 68  ? 59.771  3.180   -21.442 1.00 15.14 ? 79  LYS B N     1 
ATOM   3555  C  CA    . LYS B  1 68  ? 59.788  3.808   -20.105 1.00 15.97 ? 79  LYS B CA    1 
ATOM   3556  C  C     . LYS B  1 68  ? 58.490  4.613   -19.933 1.00 16.94 ? 79  LYS B C     1 
ATOM   3557  O  O     . LYS B  1 68  ? 57.895  4.571   -18.857 1.00 16.57 ? 79  LYS B O     1 
ATOM   3558  C  CB    . LYS B  1 68  ? 61.019  4.723   -19.935 1.00 18.21 ? 79  LYS B CB    1 
ATOM   3559  C  CG    . LYS B  1 68  ? 61.108  5.383   -18.549 1.00 30.92 ? 79  LYS B CG    1 
ATOM   3560  C  CD    . LYS B  1 68  ? 62.191  6.457   -18.495 1.00 42.20 ? 79  LYS B CD    1 
ATOM   3561  C  CE    . LYS B  1 68  ? 62.395  6.990   -17.094 1.00 49.61 ? 79  LYS B CE    1 
ATOM   3562  N  NZ    . LYS B  1 68  ? 63.219  8.226   -17.099 1.00 57.74 ? 79  LYS B NZ    1 
ATOM   3563  N  N     . PHE B  1 69  ? 58.061  5.344   -20.994 1.00 13.18 ? 80  PHE B N     1 
ATOM   3564  C  CA    . PHE B  1 69  ? 56.806  6.110   -20.962 1.00 12.93 ? 80  PHE B CA    1 
ATOM   3565  C  C     . PHE B  1 69  ? 55.610  5.167   -20.736 1.00 16.08 ? 80  PHE B C     1 
ATOM   3566  O  O     . PHE B  1 69  ? 54.796  5.407   -19.847 1.00 15.82 ? 80  PHE B O     1 
ATOM   3567  C  CB    . PHE B  1 69  ? 56.618  6.930   -22.255 1.00 13.51 ? 80  PHE B CB    1 
ATOM   3568  C  CG    . PHE B  1 69  ? 55.211  7.449   -22.452 1.00 13.85 ? 80  PHE B CG    1 
ATOM   3569  C  CD1   . PHE B  1 69  ? 54.329  6.808   -23.323 1.00 15.65 ? 80  PHE B CD1   1 
ATOM   3570  C  CD2   . PHE B  1 69  ? 54.747  8.550   -21.730 1.00 16.56 ? 80  PHE B CD2   1 
ATOM   3571  C  CE1   . PHE B  1 69  ? 53.014  7.268   -23.483 1.00 16.54 ? 80  PHE B CE1   1 
ATOM   3572  C  CE2   . PHE B  1 69  ? 53.434  9.008   -21.889 1.00 18.02 ? 80  PHE B CE2   1 
ATOM   3573  C  CZ    . PHE B  1 69  ? 52.575  8.363   -22.761 1.00 15.44 ? 80  PHE B CZ    1 
ATOM   3574  N  N     . LEU B  1 70  ? 55.521  4.082   -21.516 1.00 11.37 ? 81  LEU B N     1 
ATOM   3575  C  CA    . LEU B  1 70  ? 54.408  3.140   -21.375 1.00 10.66 ? 81  LEU B CA    1 
ATOM   3576  C  C     . LEU B  1 70  ? 54.355  2.550   -19.990 1.00 16.68 ? 81  LEU B C     1 
ATOM   3577  O  O     . LEU B  1 70  ? 53.269  2.330   -19.477 1.00 17.17 ? 81  LEU B O     1 
ATOM   3578  C  CB    . LEU B  1 70  ? 54.494  2.005   -22.415 1.00 9.86  ? 81  LEU B CB    1 
ATOM   3579  C  CG    . LEU B  1 70  ? 54.237  2.376   -23.864 1.00 13.87 ? 81  LEU B CG    1 
ATOM   3580  C  CD1   . LEU B  1 70  ? 54.343  1.132   -24.743 1.00 13.30 ? 81  LEU B CD1   1 
ATOM   3581  C  CD2   . LEU B  1 70  ? 52.853  3.046   -24.071 1.00 11.96 ? 81  LEU B CD2   1 
ATOM   3582  N  N     . ARG B  1 71  ? 55.527  2.315   -19.381 1.00 15.10 ? 82  ARG B N     1 
ATOM   3583  C  CA    . ARG B  1 71  ? 55.614  1.724   -18.036 1.00 16.10 ? 82  ARG B CA    1 
ATOM   3584  C  C     . ARG B  1 71  ? 55.278  2.747   -16.922 1.00 19.56 ? 82  ARG B C     1 
ATOM   3585  O  O     . ARG B  1 71  ? 55.053  2.355   -15.773 1.00 18.24 ? 82  ARG B O     1 
ATOM   3586  C  CB    . ARG B  1 71  ? 57.017  1.121   -17.828 1.00 17.39 ? 82  ARG B CB    1 
ATOM   3587  C  CG    . ARG B  1 71  ? 57.023  0.060   -16.722 1.00 36.76 ? 82  ARG B CG    1 
ATOM   3588  C  CD    . ARG B  1 71  ? 58.379  -0.155  -16.094 1.00 48.40 ? 82  ARG B CD    1 
ATOM   3589  N  NE    . ARG B  1 71  ? 59.167  -1.183  -16.777 1.00 56.13 ? 82  ARG B NE    1 
ATOM   3590  C  CZ    . ARG B  1 71  ? 59.119  -2.487  -16.505 1.00 63.37 ? 82  ARG B CZ    1 
ATOM   3591  N  NH1   . ARG B  1 71  ? 59.892  -3.336  -17.166 1.00 41.80 ? 82  ARG B NH1   1 
ATOM   3592  N  NH2   . ARG B  1 71  ? 58.284  -2.951  -15.583 1.00 48.40 ? 82  ARG B NH2   1 
ATOM   3593  N  N     . SER B  1 72  ? 55.206  4.044   -17.276 1.00 17.31 ? 83  SER B N     1 
ATOM   3594  C  CA    . SER B  1 72  ? 54.962  5.133   -16.326 1.00 17.24 ? 83  SER B CA    1 
ATOM   3595  C  C     . SER B  1 72  ? 53.569  5.741   -16.343 1.00 20.83 ? 83  SER B C     1 
ATOM   3596  O  O     . SER B  1 72  ? 53.098  6.175   -15.293 1.00 20.65 ? 83  SER B O     1 
ATOM   3597  C  CB    . SER B  1 72  ? 55.990  6.242   -16.538 1.00 18.54 ? 83  SER B CB    1 
ATOM   3598  O  OG    . SER B  1 72  ? 57.299  5.710   -16.411 1.00 24.10 ? 83  SER B OG    1 
ATOM   3599  N  N     . ILE B  1 73  ? 52.968  5.873   -17.542 1.00 17.25 ? 84  ILE B N     1 
ATOM   3600  C  CA    . ILE B  1 73  ? 51.678  6.518   -17.787 1.00 16.08 ? 84  ILE B CA    1 
ATOM   3601  C  C     . ILE B  1 73  ? 50.504  5.807   -17.118 1.00 21.49 ? 84  ILE B C     1 
ATOM   3602  O  O     . ILE B  1 73  ? 50.343  4.592   -17.252 1.00 21.79 ? 84  ILE B O     1 
ATOM   3603  C  CB    . ILE B  1 73  ? 51.464  6.767   -19.311 1.00 18.11 ? 84  ILE B CB    1 
ATOM   3604  C  CG1   . ILE B  1 73  ? 50.351  7.809   -19.602 1.00 19.14 ? 84  ILE B CG1   1 
ATOM   3605  C  CG2   . ILE B  1 73  ? 51.178  5.457   -20.085 1.00 16.56 ? 84  ILE B CG2   1 
ATOM   3606  C  CD1   . ILE B  1 73  ? 50.611  9.212   -19.168 1.00 20.52 ? 84  ILE B CD1   1 
ATOM   3607  N  N     . ARG B  1 74  ? 49.690  6.572   -16.398 1.00 18.07 ? 85  ARG B N     1 
ATOM   3608  C  CA    . ARG B  1 74  ? 48.529  6.054   -15.691 1.00 17.50 ? 85  ARG B CA    1 
ATOM   3609  C  C     . ARG B  1 74  ? 47.433  7.111   -15.774 1.00 21.78 ? 85  ARG B C     1 
ATOM   3610  O  O     . ARG B  1 74  ? 47.756  8.289   -15.902 1.00 19.68 ? 85  ARG B O     1 
ATOM   3611  C  CB    . ARG B  1 74  ? 48.866  5.818   -14.200 1.00 19.05 ? 85  ARG B CB    1 
ATOM   3612  C  CG    . ARG B  1 74  ? 49.941  4.782   -13.881 1.00 23.79 ? 85  ARG B CG    1 
ATOM   3613  C  CD    . ARG B  1 74  ? 50.037  4.562   -12.378 1.00 33.54 ? 85  ARG B CD    1 
ATOM   3614  N  NE    . ARG B  1 74  ? 50.096  5.826   -11.640 1.00 36.88 ? 85  ARG B NE    1 
ATOM   3615  C  CZ    . ARG B  1 74  ? 51.206  6.353   -11.125 1.00 57.68 ? 85  ARG B CZ    1 
ATOM   3616  N  NH1   . ARG B  1 74  ? 51.159  7.512   -10.479 1.00 45.83 ? 85  ARG B NH1   1 
ATOM   3617  N  NH2   . ARG B  1 74  ? 52.368  5.720   -11.244 1.00 44.58 ? 85  ARG B NH2   1 
ATOM   3618  N  N     . PRO B  1 75  ? 46.138  6.742   -15.698 1.00 20.30 ? 86  PRO B N     1 
ATOM   3619  C  CA    . PRO B  1 75  ? 45.088  7.776   -15.707 1.00 21.11 ? 86  PRO B CA    1 
ATOM   3620  C  C     . PRO B  1 75  ? 45.300  8.844   -14.625 1.00 28.63 ? 86  PRO B C     1 
ATOM   3621  O  O     . PRO B  1 75  ? 45.017  10.005  -14.888 1.00 29.56 ? 86  PRO B O     1 
ATOM   3622  C  CB    . PRO B  1 75  ? 43.803  6.973   -15.470 1.00 21.98 ? 86  PRO B CB    1 
ATOM   3623  C  CG    . PRO B  1 75  ? 44.126  5.599   -15.967 1.00 25.12 ? 86  PRO B CG    1 
ATOM   3624  C  CD    . PRO B  1 75  ? 45.556  5.389   -15.571 1.00 20.58 ? 86  PRO B CD    1 
ATOM   3625  N  N     . ASP B  1 76  ? 45.853  8.473   -13.449 1.00 27.56 ? 87  ASP B N     1 
ATOM   3626  C  CA    . ASP B  1 76  ? 46.106  9.406   -12.335 1.00 28.78 ? 87  ASP B CA    1 
ATOM   3627  C  C     . ASP B  1 76  ? 47.272  10.420  -12.519 1.00 33.97 ? 87  ASP B C     1 
ATOM   3628  O  O     . ASP B  1 76  ? 47.362  11.377  -11.742 1.00 35.24 ? 87  ASP B O     1 
ATOM   3629  C  CB    . ASP B  1 76  ? 46.228  8.650   -10.996 1.00 31.42 ? 87  ASP B CB    1 
ATOM   3630  C  CG    . ASP B  1 76  ? 47.521  7.872   -10.830 1.00 45.35 ? 87  ASP B CG    1 
ATOM   3631  O  OD1   . ASP B  1 76  ? 48.557  8.498   -10.538 1.00 49.45 ? 87  ASP B OD1   1 
ATOM   3632  O  OD2   . ASP B  1 76  ? 47.492  6.642   -10.972 1.00 51.53 ? 87  ASP B OD2   1 
ATOM   3633  N  N     . ASN B  1 77  ? 48.176  10.204  -13.499 1.00 28.06 ? 88  ASN B N     1 
ATOM   3634  C  CA    . ASN B  1 77  ? 49.315  11.106  -13.713 1.00 26.91 ? 88  ASN B CA    1 
ATOM   3635  C  C     . ASN B  1 77  ? 49.417  11.673  -15.149 1.00 30.13 ? 88  ASN B C     1 
ATOM   3636  O  O     . ASN B  1 77  ? 50.464  12.202  -15.520 1.00 29.91 ? 88  ASN B O     1 
ATOM   3637  C  CB    . ASN B  1 77  ? 50.628  10.422  -13.270 1.00 27.22 ? 88  ASN B CB    1 
ATOM   3638  C  CG    . ASN B  1 77  ? 51.052  9.268   -14.148 1.00 29.87 ? 88  ASN B CG    1 
ATOM   3639  O  OD1   . ASN B  1 77  ? 50.625  9.145   -15.290 1.00 21.57 ? 88  ASN B OD1   1 
ATOM   3640  N  ND2   . ASN B  1 77  ? 51.956  8.435   -13.659 1.00 21.10 ? 88  ASN B ND2   1 
ATOM   3641  N  N     . MET B  1 78  ? 48.333  11.560  -15.944 1.00 25.50 ? 89  MET B N     1 
ATOM   3642  C  CA    . MET B  1 78  ? 48.231  12.024  -17.341 1.00 24.88 ? 89  MET B CA    1 
ATOM   3643  C  C     . MET B  1 78  ? 48.550  13.492  -17.528 1.00 30.82 ? 89  MET B C     1 
ATOM   3644  O  O     . MET B  1 78  ? 49.086  13.872  -18.565 1.00 29.53 ? 89  MET B O     1 
ATOM   3645  C  CB    . MET B  1 78  ? 46.815  11.791  -17.876 1.00 26.77 ? 89  MET B CB    1 
ATOM   3646  C  CG    . MET B  1 78  ? 46.517  10.372  -18.191 1.00 30.04 ? 89  MET B CG    1 
ATOM   3647  S  SD    . MET B  1 78  ? 44.812  10.238  -18.739 1.00 33.08 ? 89  MET B SD    1 
ATOM   3648  C  CE    . MET B  1 78  ? 44.941  10.850  -20.310 1.00 29.22 ? 89  MET B CE    1 
ATOM   3649  N  N     . SER B  1 79  ? 48.140  14.332  -16.562 1.00 29.94 ? 90  SER B N     1 
ATOM   3650  C  CA    . SER B  1 79  ? 48.380  15.779  -16.583 1.00 30.06 ? 90  SER B CA    1 
ATOM   3651  C  C     . SER B  1 79  ? 49.888  16.099  -16.554 1.00 34.01 ? 90  SER B C     1 
ATOM   3652  O  O     . SER B  1 79  ? 50.328  16.993  -17.277 1.00 35.06 ? 90  SER B O     1 
ATOM   3653  C  CB    . SER B  1 79  ? 47.648  16.448  -15.423 1.00 34.12 ? 90  SER B CB    1 
ATOM   3654  O  OG    . SER B  1 79  ? 47.689  15.626  -14.266 1.00 44.06 ? 90  SER B OG    1 
ATOM   3655  N  N     . GLU B  1 80  ? 50.679  15.307  -15.795 1.00 29.55 ? 91  GLU B N     1 
ATOM   3656  C  CA    . GLU B  1 80  ? 52.138  15.434  -15.674 1.00 28.77 ? 91  GLU B CA    1 
ATOM   3657  C  C     . GLU B  1 80  ? 52.869  14.988  -16.954 1.00 30.75 ? 91  GLU B C     1 
ATOM   3658  O  O     . GLU B  1 80  ? 54.028  15.352  -17.153 1.00 29.69 ? 91  GLU B O     1 
ATOM   3659  C  CB    . GLU B  1 80  ? 52.672  14.578  -14.497 1.00 30.52 ? 91  GLU B CB    1 
ATOM   3660  C  CG    . GLU B  1 80  ? 52.074  14.869  -13.127 1.00 42.37 ? 91  GLU B CG    1 
ATOM   3661  C  CD    . GLU B  1 80  ? 52.103  13.715  -12.140 1.00 70.05 ? 91  GLU B CD    1 
ATOM   3662  O  OE1   . GLU B  1 80  ? 53.149  13.030  -12.044 1.00 69.67 ? 91  GLU B OE1   1 
ATOM   3663  O  OE2   . GLU B  1 80  ? 51.083  13.509  -11.440 1.00 62.94 ? 91  GLU B OE2   1 
ATOM   3664  N  N     . TYR B  1 81  ? 52.211  14.169  -17.801 1.00 26.09 ? 92  TYR B N     1 
ATOM   3665  C  CA    . TYR B  1 81  ? 52.822  13.594  -19.000 1.00 25.01 ? 92  TYR B CA    1 
ATOM   3666  C  C     . TYR B  1 81  ? 52.188  14.053  -20.316 1.00 28.38 ? 92  TYR B C     1 
ATOM   3667  O  O     . TYR B  1 81  ? 52.346  13.348  -21.316 1.00 28.63 ? 92  TYR B O     1 
ATOM   3668  C  CB    . TYR B  1 81  ? 52.733  12.060  -18.914 1.00 25.78 ? 92  TYR B CB    1 
ATOM   3669  C  CG    . TYR B  1 81  ? 53.733  11.415  -17.985 1.00 25.71 ? 92  TYR B CG    1 
ATOM   3670  C  CD1   . TYR B  1 81  ? 53.398  11.116  -16.667 1.00 26.23 ? 92  TYR B CD1   1 
ATOM   3671  C  CD2   . TYR B  1 81  ? 54.987  11.029  -18.442 1.00 26.15 ? 92  TYR B CD2   1 
ATOM   3672  C  CE1   . TYR B  1 81  ? 54.306  10.482  -15.816 1.00 24.90 ? 92  TYR B CE1   1 
ATOM   3673  C  CE2   . TYR B  1 81  ? 55.910  10.422  -17.596 1.00 26.91 ? 92  TYR B CE2   1 
ATOM   3674  C  CZ    . TYR B  1 81  ? 55.562  10.142  -16.287 1.00 29.92 ? 92  TYR B CZ    1 
ATOM   3675  O  OH    . TYR B  1 81  ? 56.482  9.528   -15.477 1.00 28.69 ? 92  TYR B OH    1 
ATOM   3676  N  N     . SER B  1 82  ? 51.486  15.215  -20.345 1.00 23.16 ? 93  SER B N     1 
ATOM   3677  C  CA    . SER B  1 82  ? 50.820  15.673  -21.573 1.00 22.40 ? 93  SER B CA    1 
ATOM   3678  C  C     . SER B  1 82  ? 51.720  15.807  -22.818 1.00 23.41 ? 93  SER B C     1 
ATOM   3679  O  O     . SER B  1 82  ? 51.293  15.414  -23.893 1.00 21.68 ? 93  SER B O     1 
ATOM   3680  C  CB    . SER B  1 82  ? 49.940  16.904  -21.339 1.00 26.55 ? 93  SER B CB    1 
ATOM   3681  O  OG    . SER B  1 82  ? 50.725  18.028  -20.985 1.00 37.55 ? 93  SER B OG    1 
ATOM   3682  N  N     . LYS B  1 83  ? 52.972  16.291  -22.669 1.00 19.45 ? 94  LYS B N     1 
ATOM   3683  C  CA    . LYS B  1 83  ? 53.904  16.400  -23.798 1.00 19.44 ? 94  LYS B CA    1 
ATOM   3684  C  C     . LYS B  1 83  ? 54.354  15.035  -24.330 1.00 20.28 ? 94  LYS B C     1 
ATOM   3685  O  O     . LYS B  1 83  ? 54.377  14.826  -25.546 1.00 19.65 ? 94  LYS B O     1 
ATOM   3686  C  CB    . LYS B  1 83  ? 55.125  17.275  -23.453 1.00 23.83 ? 94  LYS B CB    1 
ATOM   3687  C  CG    . LYS B  1 83  ? 54.810  18.770  -23.447 1.00 37.65 ? 94  LYS B CG    1 
ATOM   3688  C  CD    . LYS B  1 83  ? 54.176  19.246  -24.749 1.00 40.45 ? 94  LYS B CD    1 
ATOM   3689  C  CE    . LYS B  1 83  ? 55.138  19.369  -25.915 1.00 32.39 ? 94  LYS B CE    1 
ATOM   3690  N  NZ    . LYS B  1 83  ? 54.438  20.003  -27.040 1.00 29.83 ? 94  LYS B NZ    1 
ATOM   3691  N  N     . GLN B  1 84  ? 54.684  14.110  -23.416 1.00 16.77 ? 95  GLN B N     1 
ATOM   3692  C  CA    . GLN B  1 84  ? 55.075  12.743  -23.778 1.00 16.55 ? 95  GLN B CA    1 
ATOM   3693  C  C     . GLN B  1 84  ? 53.900  12.003  -24.400 1.00 18.82 ? 95  GLN B C     1 
ATOM   3694  O  O     . GLN B  1 84  ? 54.109  11.262  -25.357 1.00 18.95 ? 95  GLN B O     1 
ATOM   3695  C  CB    . GLN B  1 84  ? 55.607  11.977  -22.574 1.00 17.96 ? 95  GLN B CB    1 
ATOM   3696  C  CG    . GLN B  1 84  ? 56.911  12.555  -22.008 1.00 32.90 ? 95  GLN B CG    1 
ATOM   3697  C  CD    . GLN B  1 84  ? 57.795  11.455  -21.489 1.00 50.15 ? 95  GLN B CD    1 
ATOM   3698  O  OE1   . GLN B  1 84  ? 57.411  10.668  -20.609 1.00 39.03 ? 95  GLN B OE1   1 
ATOM   3699  N  NE2   . GLN B  1 84  ? 58.985  11.345  -22.059 1.00 45.89 ? 95  GLN B NE2   1 
ATOM   3700  N  N     . MET B  1 85  ? 52.659  12.212  -23.892 1.00 14.77 ? 96  MET B N     1 
ATOM   3701  C  CA    . MET B  1 85  ? 51.472  11.570  -24.501 1.00 14.83 ? 96  MET B CA    1 
ATOM   3702  C  C     . MET B  1 85  ? 51.377  11.984  -25.989 1.00 19.93 ? 96  MET B C     1 
ATOM   3703  O  O     . MET B  1 85  ? 51.156  11.159  -26.885 1.00 16.89 ? 96  MET B O     1 
ATOM   3704  C  CB    . MET B  1 85  ? 50.195  11.988  -23.764 1.00 16.57 ? 96  MET B CB    1 
ATOM   3705  C  CG    . MET B  1 85  ? 49.979  11.236  -22.463 1.00 20.25 ? 96  MET B CG    1 
ATOM   3706  S  SD    . MET B  1 85  ? 48.537  11.820  -21.545 1.00 24.76 ? 96  MET B SD    1 
ATOM   3707  C  CE    . MET B  1 85  ? 47.292  11.678  -22.794 1.00 22.38 ? 96  MET B CE    1 
ATOM   3708  N  N     . GLN B  1 86  ? 51.605  13.273  -26.244 1.00 17.56 ? 97  GLN B N     1 
ATOM   3709  C  CA    . GLN B  1 86  ? 51.592  13.827  -27.586 1.00 16.34 ? 97  GLN B CA    1 
ATOM   3710  C  C     . GLN B  1 86  ? 52.699  13.190  -28.435 1.00 19.94 ? 97  GLN B C     1 
ATOM   3711  O  O     . GLN B  1 86  ? 52.437  12.747  -29.550 1.00 19.66 ? 97  GLN B O     1 
ATOM   3712  C  CB    . GLN B  1 86  ? 51.793  15.354  -27.496 1.00 17.20 ? 97  GLN B CB    1 
ATOM   3713  C  CG    . GLN B  1 86  ? 51.803  16.037  -28.845 1.00 21.83 ? 97  GLN B CG    1 
ATOM   3714  C  CD    . GLN B  1 86  ? 52.127  17.507  -28.702 1.00 31.30 ? 97  GLN B CD    1 
ATOM   3715  O  OE1   . GLN B  1 86  ? 53.277  17.886  -28.486 1.00 27.07 ? 97  GLN B OE1   1 
ATOM   3716  N  NE2   . GLN B  1 86  ? 51.113  18.353  -28.786 1.00 20.74 ? 97  GLN B NE2   1 
ATOM   3717  N  N     . ARG B  1 87  ? 53.944  13.198  -27.921 1.00 17.04 ? 98  ARG B N     1 
ATOM   3718  C  CA    . ARG B  1 87  ? 55.133  12.674  -28.588 1.00 16.52 ? 98  ARG B CA    1 
ATOM   3719  C  C     . ARG B  1 87  ? 54.959  11.198  -28.960 1.00 19.42 ? 98  ARG B C     1 
ATOM   3720  O  O     . ARG B  1 87  ? 55.282  10.804  -30.077 1.00 17.51 ? 98  ARG B O     1 
ATOM   3721  C  CB    . ARG B  1 87  ? 56.348  12.829  -27.655 1.00 15.98 ? 98  ARG B CB    1 
ATOM   3722  C  CG    . ARG B  1 87  ? 57.654  12.356  -28.277 1.00 24.11 ? 98  ARG B CG    1 
ATOM   3723  C  CD    . ARG B  1 87  ? 58.824  12.484  -27.320 1.00 28.01 ? 98  ARG B CD    1 
ATOM   3724  N  NE    . ARG B  1 87  ? 59.979  11.747  -27.841 1.00 41.27 ? 98  ARG B NE    1 
ATOM   3725  C  CZ    . ARG B  1 87  ? 61.044  11.404  -27.123 1.00 58.37 ? 98  ARG B CZ    1 
ATOM   3726  N  NH1   . ARG B  1 87  ? 62.030  10.712  -27.679 1.00 51.02 ? 98  ARG B NH1   1 
ATOM   3727  N  NH2   . ARG B  1 87  ? 61.130  11.746  -25.841 1.00 42.52 ? 98  ARG B NH2   1 
ATOM   3728  N  N     . PHE B  1 88  ? 54.416  10.401  -28.026 1.00 14.63 ? 99  PHE B N     1 
ATOM   3729  C  CA    . PHE B  1 88  ? 54.270  8.961   -28.236 1.00 13.82 ? 99  PHE B CA    1 
ATOM   3730  C  C     . PHE B  1 88  ? 52.908  8.530   -28.783 1.00 18.43 ? 99  PHE B C     1 
ATOM   3731  O  O     . PHE B  1 88  ? 52.636  7.338   -28.905 1.00 17.31 ? 99  PHE B O     1 
ATOM   3732  C  CB    . PHE B  1 88  ? 54.661  8.208   -26.951 1.00 14.28 ? 99  PHE B CB    1 
ATOM   3733  C  CG    . PHE B  1 88  ? 56.074  8.488   -26.476 1.00 15.76 ? 99  PHE B CG    1 
ATOM   3734  C  CD1   . PHE B  1 88  ? 57.171  8.214   -27.290 1.00 17.62 ? 99  PHE B CD1   1 
ATOM   3735  C  CD2   . PHE B  1 88  ? 56.308  9.018   -25.212 1.00 16.61 ? 99  PHE B CD2   1 
ATOM   3736  C  CE1   . PHE B  1 88  ? 58.474  8.450   -26.840 1.00 18.13 ? 99  PHE B CE1   1 
ATOM   3737  C  CE2   . PHE B  1 88  ? 57.609  9.265   -24.768 1.00 19.60 ? 99  PHE B CE2   1 
ATOM   3738  C  CZ    . PHE B  1 88  ? 58.685  8.975   -25.583 1.00 17.67 ? 99  PHE B CZ    1 
ATOM   3739  N  N     . ASN B  1 89  ? 52.071  9.499   -29.148 1.00 14.82 ? 100 ASN B N     1 
ATOM   3740  C  CA    . ASN B  1 89  ? 50.743  9.284   -29.741 1.00 14.71 ? 100 ASN B CA    1 
ATOM   3741  C  C     . ASN B  1 89  ? 49.774  8.481   -28.858 1.00 17.20 ? 100 ASN B C     1 
ATOM   3742  O  O     . ASN B  1 89  ? 49.027  7.616   -29.346 1.00 14.75 ? 100 ASN B O     1 
ATOM   3743  C  CB    . ASN B  1 89  ? 50.855  8.733   -31.177 1.00 16.43 ? 100 ASN B CB    1 
ATOM   3744  C  CG    . ASN B  1 89  ? 49.572  8.811   -31.957 1.00 31.76 ? 100 ASN B CG    1 
ATOM   3745  O  OD1   . ASN B  1 89  ? 48.894  9.831   -31.984 1.00 29.88 ? 100 ASN B OD1   1 
ATOM   3746  N  ND2   . ASN B  1 89  ? 49.192  7.714   -32.566 1.00 17.76 ? 100 ASN B ND2   1 
ATOM   3747  N  N     . VAL B  1 90  ? 49.816  8.749   -27.546 1.00 14.60 ? 101 VAL B N     1 
ATOM   3748  C  CA    . VAL B  1 90  ? 48.933  8.094   -26.588 1.00 16.07 ? 101 VAL B CA    1 
ATOM   3749  C  C     . VAL B  1 90  ? 47.916  9.126   -26.082 1.00 22.94 ? 101 VAL B C     1 
ATOM   3750  O  O     . VAL B  1 90  ? 48.294  10.258  -25.767 1.00 20.75 ? 101 VAL B O     1 
ATOM   3751  C  CB    . VAL B  1 90  ? 49.719  7.370   -25.444 1.00 20.41 ? 101 VAL B CB    1 
ATOM   3752  C  CG1   . VAL B  1 90  ? 48.814  6.975   -24.285 1.00 21.17 ? 101 VAL B CG1   1 
ATOM   3753  C  CG2   . VAL B  1 90  ? 50.443  6.126   -25.968 1.00 20.02 ? 101 VAL B CG2   1 
ATOM   3754  N  N     . GLY B  1 91  ? 46.648  8.730   -26.018 1.00 22.54 ? 102 GLY B N     1 
ATOM   3755  C  CA    . GLY B  1 91  ? 45.584  9.583   -25.491 1.00 23.94 ? 102 GLY B CA    1 
ATOM   3756  C  C     . GLY B  1 91  ? 44.296  9.636   -26.286 1.00 30.84 ? 102 GLY B C     1 
ATOM   3757  O  O     . GLY B  1 91  ? 43.246  9.943   -25.718 1.00 33.51 ? 102 GLY B O     1 
ATOM   3758  N  N     . GLU B  1 92  ? 44.355  9.383   -27.598 1.00 26.42 ? 103 GLU B N     1 
ATOM   3759  C  CA    . GLU B  1 92  ? 43.148  9.427   -28.437 1.00 26.01 ? 103 GLU B CA    1 
ATOM   3760  C  C     . GLU B  1 92  ? 42.695  8.040   -28.899 1.00 26.14 ? 103 GLU B C     1 
ATOM   3761  O  O     . GLU B  1 92  ? 41.912  7.411   -28.199 1.00 25.90 ? 103 GLU B O     1 
ATOM   3762  C  CB    . GLU B  1 92  ? 43.281  10.430  -29.588 1.00 28.00 ? 103 GLU B CB    1 
ATOM   3763  C  CG    . GLU B  1 92  ? 43.418  11.862  -29.101 1.00 40.58 ? 103 GLU B CG    1 
ATOM   3764  C  CD    . GLU B  1 92  ? 44.751  12.476  -29.470 1.00 73.68 ? 103 GLU B CD    1 
ATOM   3765  O  OE1   . GLU B  1 92  ? 45.773  12.097  -28.853 1.00 69.88 ? 103 GLU B OE1   1 
ATOM   3766  O  OE2   . GLU B  1 92  ? 44.779  13.302  -30.411 1.00 76.61 ? 103 GLU B OE2   1 
ATOM   3767  N  N     . ASP B  1 93  ? 43.203  7.547   -30.040 1.00 20.60 ? 104 ASP B N     1 
ATOM   3768  C  CA    . ASP B  1 93  ? 42.874  6.198   -30.518 1.00 18.86 ? 104 ASP B CA    1 
ATOM   3769  C  C     . ASP B  1 93  ? 43.511  5.188   -29.587 1.00 17.72 ? 104 ASP B C     1 
ATOM   3770  O  O     . ASP B  1 93  ? 43.007  4.088   -29.466 1.00 18.79 ? 104 ASP B O     1 
ATOM   3771  C  CB    . ASP B  1 93  ? 43.458  5.943   -31.923 1.00 20.23 ? 104 ASP B CB    1 
ATOM   3772  C  CG    . ASP B  1 93  ? 42.790  6.643   -33.081 1.00 25.76 ? 104 ASP B CG    1 
ATOM   3773  O  OD1   . ASP B  1 93  ? 41.580  6.954   -32.971 1.00 26.71 ? 104 ASP B OD1   1 
ATOM   3774  O  OD2   . ASP B  1 93  ? 43.439  6.774   -34.139 1.00 27.49 ? 104 ASP B OD2   1 
ATOM   3775  N  N     . CYS B  1 94  ? 44.662  5.533   -28.986 1.00 11.75 ? 105 CYS B N     1 
ATOM   3776  C  CA    . CYS B  1 94  ? 45.426  4.655   -28.095 1.00 11.31 ? 105 CYS B CA    1 
ATOM   3777  C  C     . CYS B  1 94  ? 45.370  5.309   -26.718 1.00 14.24 ? 105 CYS B C     1 
ATOM   3778  O  O     . CYS B  1 94  ? 46.306  6.016   -26.322 1.00 12.09 ? 105 CYS B O     1 
ATOM   3779  C  CB    . CYS B  1 94  ? 46.855  4.503   -28.606 1.00 11.18 ? 105 CYS B CB    1 
ATOM   3780  S  SG    . CYS B  1 94  ? 46.946  3.991   -30.346 1.00 15.38 ? 105 CYS B SG    1 
ATOM   3781  N  N     . PRO B  1 95  ? 44.238  5.103   -25.996 1.00 13.32 ? 106 PRO B N     1 
ATOM   3782  C  CA    . PRO B  1 95  ? 44.043  5.804   -24.719 1.00 13.43 ? 106 PRO B CA    1 
ATOM   3783  C  C     . PRO B  1 95  ? 44.919  5.316   -23.601 1.00 17.19 ? 106 PRO B C     1 
ATOM   3784  O  O     . PRO B  1 95  ? 45.523  4.244   -23.688 1.00 15.86 ? 106 PRO B O     1 
ATOM   3785  C  CB    . PRO B  1 95  ? 42.571  5.509   -24.389 1.00 14.79 ? 106 PRO B CB    1 
ATOM   3786  C  CG    . PRO B  1 95  ? 42.329  4.147   -25.018 1.00 18.12 ? 106 PRO B CG    1 
ATOM   3787  C  CD    . PRO B  1 95  ? 43.056  4.276   -26.329 1.00 14.08 ? 106 PRO B CD    1 
ATOM   3788  N  N     . VAL B  1 96  ? 44.936  6.094   -22.507 1.00 13.45 ? 107 VAL B N     1 
ATOM   3789  C  CA    . VAL B  1 96  ? 45.578  5.674   -21.272 1.00 12.33 ? 107 VAL B CA    1 
ATOM   3790  C  C     . VAL B  1 96  ? 44.479  4.936   -20.511 1.00 16.43 ? 107 VAL B C     1 
ATOM   3791  O  O     . VAL B  1 96  ? 43.371  5.462   -20.364 1.00 17.57 ? 107 VAL B O     1 
ATOM   3792  C  CB    . VAL B  1 96  ? 46.091  6.882   -20.431 1.00 16.71 ? 107 VAL B CB    1 
ATOM   3793  C  CG1   . VAL B  1 96  ? 46.774  6.402   -19.160 1.00 16.46 ? 107 VAL B CG1   1 
ATOM   3794  C  CG2   . VAL B  1 96  ? 47.041  7.749   -21.252 1.00 16.07 ? 107 VAL B CG2   1 
ATOM   3795  N  N     . PHE B  1 97  ? 44.774  3.740   -20.026 1.00 13.11 ? 108 PHE B N     1 
ATOM   3796  C  CA    . PHE B  1 97  ? 43.822  2.987   -19.205 1.00 12.22 ? 108 PHE B CA    1 
ATOM   3797  C  C     . PHE B  1 97  ? 44.537  2.258   -18.101 1.00 15.01 ? 108 PHE B C     1 
ATOM   3798  O  O     . PHE B  1 97  ? 45.735  2.050   -18.226 1.00 14.94 ? 108 PHE B O     1 
ATOM   3799  C  CB    . PHE B  1 97  ? 42.931  2.051   -20.044 1.00 12.89 ? 108 PHE B CB    1 
ATOM   3800  C  CG    . PHE B  1 97  ? 43.621  1.040   -20.939 1.00 12.30 ? 108 PHE B CG    1 
ATOM   3801  C  CD1   . PHE B  1 97  ? 43.842  1.314   -22.283 1.00 13.67 ? 108 PHE B CD1   1 
ATOM   3802  C  CD2   . PHE B  1 97  ? 43.993  -0.209  -20.449 1.00 12.01 ? 108 PHE B CD2   1 
ATOM   3803  C  CE1   . PHE B  1 97  ? 44.441  0.356   -23.121 1.00 13.89 ? 108 PHE B CE1   1 
ATOM   3804  C  CE2   . PHE B  1 97  ? 44.603  -1.158  -21.277 1.00 14.11 ? 108 PHE B CE2   1 
ATOM   3805  C  CZ    . PHE B  1 97  ? 44.793  -0.882  -22.616 1.00 12.95 ? 108 PHE B CZ    1 
ATOM   3806  N  N     . ASP B  1 98  ? 43.818  1.861   -17.013 1.00 12.66 ? 109 ASP B N     1 
ATOM   3807  C  CA    . ASP B  1 98  ? 44.438  1.137   -15.896 1.00 13.00 ? 109 ASP B CA    1 
ATOM   3808  C  C     . ASP B  1 98  ? 45.010  -0.191  -16.399 1.00 15.06 ? 109 ASP B C     1 
ATOM   3809  O  O     . ASP B  1 98  ? 44.317  -0.896  -17.124 1.00 15.63 ? 109 ASP B O     1 
ATOM   3810  C  CB    . ASP B  1 98  ? 43.411  0.872   -14.769 1.00 15.13 ? 109 ASP B CB    1 
ATOM   3811  C  CG    . ASP B  1 98  ? 42.996  2.118   -13.995 1.00 26.10 ? 109 ASP B CG    1 
ATOM   3812  O  OD1   . ASP B  1 98  ? 43.844  3.015   -13.808 1.00 25.03 ? 109 ASP B OD1   1 
ATOM   3813  O  OD2   . ASP B  1 98  ? 41.867  2.156   -13.514 1.00 33.37 ? 109 ASP B OD2   1 
ATOM   3814  N  N     . GLY B  1 99  ? 46.271  -0.474  -16.061 1.00 11.96 ? 110 GLY B N     1 
ATOM   3815  C  CA    . GLY B  1 99  ? 46.922  -1.721  -16.454 1.00 12.19 ? 110 GLY B CA    1 
ATOM   3816  C  C     . GLY B  1 99  ? 47.373  -1.775  -17.906 1.00 15.22 ? 110 GLY B C     1 
ATOM   3817  O  O     . GLY B  1 99  ? 47.685  -2.853  -18.431 1.00 13.99 ? 110 GLY B O     1 
ATOM   3818  N  N     . LEU B  1 100 ? 47.441  -0.610  -18.564 1.00 12.90 ? 111 LEU B N     1 
ATOM   3819  C  CA    . LEU B  1 100 ? 47.893  -0.500  -19.961 1.00 12.35 ? 111 LEU B CA    1 
ATOM   3820  C  C     . LEU B  1 100 ? 49.198  -1.265  -20.203 1.00 14.36 ? 111 LEU B C     1 
ATOM   3821  O  O     . LEU B  1 100 ? 49.254  -2.102  -21.104 1.00 12.85 ? 111 LEU B O     1 
ATOM   3822  C  CB    . LEU B  1 100 ? 48.049  0.997   -20.371 1.00 11.98 ? 111 LEU B CB    1 
ATOM   3823  C  CG    . LEU B  1 100 ? 48.815  1.282   -21.686 1.00 14.26 ? 111 LEU B CG    1 
ATOM   3824  C  CD1   . LEU B  1 100 ? 48.140  0.546   -22.890 1.00 14.20 ? 111 LEU B CD1   1 
ATOM   3825  C  CD2   . LEU B  1 100 ? 48.878  2.795   -21.946 1.00 15.30 ? 111 LEU B CD2   1 
ATOM   3826  N  N     . PHE B  1 101 ? 50.225  -1.009  -19.379 1.00 12.57 ? 112 PHE B N     1 
ATOM   3827  C  CA    . PHE B  1 101 ? 51.521  -1.669  -19.572 1.00 12.21 ? 112 PHE B CA    1 
ATOM   3828  C  C     . PHE B  1 101 ? 51.440  -3.181  -19.412 1.00 13.33 ? 112 PHE B C     1 
ATOM   3829  O  O     . PHE B  1 101 ? 51.948  -3.908  -20.259 1.00 10.65 ? 112 PHE B O     1 
ATOM   3830  C  CB    . PHE B  1 101 ? 52.604  -1.056  -18.672 1.00 14.15 ? 112 PHE B CB    1 
ATOM   3831  C  CG    . PHE B  1 101 ? 53.984  -1.508  -19.082 1.00 15.35 ? 112 PHE B CG    1 
ATOM   3832  C  CD1   . PHE B  1 101 ? 54.533  -1.107  -20.301 1.00 17.01 ? 112 PHE B CD1   1 
ATOM   3833  C  CD2   . PHE B  1 101 ? 54.721  -2.358  -18.273 1.00 16.16 ? 112 PHE B CD2   1 
ATOM   3834  C  CE1   . PHE B  1 101 ? 55.792  -1.557  -20.700 1.00 17.55 ? 112 PHE B CE1   1 
ATOM   3835  C  CE2   . PHE B  1 101 ? 55.986  -2.804  -18.672 1.00 18.22 ? 112 PHE B CE2   1 
ATOM   3836  C  CZ    . PHE B  1 101 ? 56.511  -2.397  -19.885 1.00 16.25 ? 112 PHE B CZ    1 
ATOM   3837  N  N     . GLU B  1 102 ? 50.688  -3.644  -18.410 1.00 11.75 ? 113 GLU B N     1 
ATOM   3838  C  CA    . GLU B  1 102 ? 50.485  -5.064  -18.149 1.00 11.30 ? 113 GLU B CA    1 
ATOM   3839  C  C     . GLU B  1 102 ? 49.769  -5.716  -19.342 1.00 12.95 ? 113 GLU B C     1 
ATOM   3840  O  O     . GLU B  1 102 ? 50.148  -6.813  -19.736 1.00 10.36 ? 113 GLU B O     1 
ATOM   3841  C  CB    . GLU B  1 102 ? 49.633  -5.191  -16.895 1.00 13.19 ? 113 GLU B CB    1 
ATOM   3842  C  CG    . GLU B  1 102 ? 49.878  -6.436  -16.092 1.00 25.18 ? 113 GLU B CG    1 
ATOM   3843  C  CD    . GLU B  1 102 ? 49.208  -6.316  -14.741 1.00 38.50 ? 113 GLU B CD    1 
ATOM   3844  O  OE1   . GLU B  1 102 ? 49.944  -6.194  -13.738 1.00 27.59 ? 113 GLU B OE1   1 
ATOM   3845  O  OE2   . GLU B  1 102 ? 47.956  -6.245  -14.691 1.00 21.54 ? 113 GLU B OE2   1 
ATOM   3846  N  N     . PHE B  1 103 ? 48.750  -5.047  -19.910 1.00 9.39  ? 114 PHE B N     1 
ATOM   3847  C  CA    . PHE B  1 103 ? 48.066  -5.544  -21.123 1.00 9.27  ? 114 PHE B CA    1 
ATOM   3848  C  C     . PHE B  1 103 ? 49.101  -5.741  -22.254 1.00 11.50 ? 114 PHE B C     1 
ATOM   3849  O  O     . PHE B  1 103 ? 49.137  -6.792  -22.892 1.00 10.22 ? 114 PHE B O     1 
ATOM   3850  C  CB    . PHE B  1 103 ? 46.960  -4.571  -21.560 1.00 9.41  ? 114 PHE B CB    1 
ATOM   3851  C  CG    . PHE B  1 103 ? 46.362  -4.919  -22.907 1.00 9.71  ? 114 PHE B CG    1 
ATOM   3852  C  CD1   . PHE B  1 103 ? 46.762  -4.244  -24.057 1.00 11.82 ? 114 PHE B CD1   1 
ATOM   3853  C  CD2   . PHE B  1 103 ? 45.508  -6.018  -23.045 1.00 11.05 ? 114 PHE B CD2   1 
ATOM   3854  C  CE1   . PHE B  1 103 ? 46.236  -4.591  -25.309 1.00 12.40 ? 114 PHE B CE1   1 
ATOM   3855  C  CE2   . PHE B  1 103 ? 44.986  -6.368  -24.297 1.00 12.64 ? 114 PHE B CE2   1 
ATOM   3856  C  CZ    . PHE B  1 103 ? 45.356  -5.652  -25.419 1.00 11.74 ? 114 PHE B CZ    1 
ATOM   3857  N  N     . CYS B  1 104 ? 49.970  -4.734  -22.467 1.00 8.56  ? 115 CYS B N     1 
ATOM   3858  C  CA    . CYS B  1 104 ? 51.046  -4.795  -23.453 1.00 8.81  ? 115 CYS B CA    1 
ATOM   3859  C  C     . CYS B  1 104 ? 51.979  -5.954  -23.158 1.00 10.63 ? 115 CYS B C     1 
ATOM   3860  O  O     . CYS B  1 104 ? 52.351  -6.682  -24.083 1.00 9.02  ? 115 CYS B O     1 
ATOM   3861  C  CB    . CYS B  1 104 ? 51.809  -3.472  -23.525 1.00 9.04  ? 115 CYS B CB    1 
ATOM   3862  S  SG    . CYS B  1 104 ? 50.796  -2.087  -24.102 1.00 12.05 ? 115 CYS B SG    1 
ATOM   3863  N  N     . GLN B  1 105 ? 52.359  -6.125  -21.886 1.00 7.56  ? 116 GLN B N     1 
ATOM   3864  C  CA    . GLN B  1 105 ? 53.279  -7.186  -21.468 1.00 7.72  ? 116 GLN B CA    1 
ATOM   3865  C  C     . GLN B  1 105 ? 52.723  -8.582  -21.782 1.00 9.63  ? 116 GLN B C     1 
ATOM   3866  O  O     . GLN B  1 105 ? 53.467  -9.446  -22.254 1.00 9.05  ? 116 GLN B O     1 
ATOM   3867  C  CB    . GLN B  1 105 ? 53.554  -7.073  -19.963 1.00 8.67  ? 116 GLN B CB    1 
ATOM   3868  C  CG    . GLN B  1 105 ? 54.409  -5.868  -19.604 1.00 12.18 ? 116 GLN B CG    1 
ATOM   3869  C  CD    . GLN B  1 105 ? 54.712  -5.868  -18.138 1.00 15.44 ? 116 GLN B CD    1 
ATOM   3870  O  OE1   . GLN B  1 105 ? 53.840  -5.654  -17.310 1.00 11.37 ? 116 GLN B OE1   1 
ATOM   3871  N  NE2   . GLN B  1 105 ? 55.938  -6.203  -17.790 1.00 9.85  ? 116 GLN B NE2   1 
ATOM   3872  N  N     . LEU B  1 106 ? 51.431  -8.801  -21.485 1.00 7.80  ? 117 LEU B N     1 
ATOM   3873  C  CA    . LEU B  1 106 ? 50.774  -10.080 -21.712 1.00 7.12  ? 117 LEU B CA    1 
ATOM   3874  C  C     . LEU B  1 106 ? 50.565  -10.349 -23.190 1.00 9.87  ? 117 LEU B C     1 
ATOM   3875  O  O     . LEU B  1 106 ? 50.772  -11.477 -23.636 1.00 10.94 ? 117 LEU B O     1 
ATOM   3876  C  CB    . LEU B  1 106 ? 49.442  -10.168 -20.958 1.00 7.54  ? 117 LEU B CB    1 
ATOM   3877  C  CG    . LEU B  1 106 ? 49.558  -10.120 -19.419 1.00 11.22 ? 117 LEU B CG    1 
ATOM   3878  C  CD1   . LEU B  1 106 ? 48.158  -9.939  -18.780 1.00 11.29 ? 117 LEU B CD1   1 
ATOM   3879  C  CD2   . LEU B  1 106 ? 50.275  -11.343 -18.878 1.00 12.20 ? 117 LEU B CD2   1 
ATOM   3880  N  N     . SER B  1 107 ? 50.098  -9.345  -23.937 1.00 7.22  ? 118 SER B N     1 
ATOM   3881  C  CA    . SER B  1 107 ? 49.937  -9.459  -25.395 1.00 7.01  ? 118 SER B CA    1 
ATOM   3882  C  C     . SER B  1 107 ? 51.302  -9.822  -26.041 1.00 10.60 ? 118 SER B C     1 
ATOM   3883  O  O     . SER B  1 107 ? 51.393  -10.741 -26.834 1.00 9.79  ? 118 SER B O     1 
ATOM   3884  C  CB    A SER B  1 107 ? 49.375  -8.168  -25.981 0.02 10.52 ? 118 SER B CB    1 
ATOM   3885  C  CB    B SER B  1 107 ? 49.430  -8.120  -25.951 0.98 9.15  ? 118 SER B CB    1 
ATOM   3886  O  OG    A SER B  1 107 ? 50.195  -7.058  -25.666 0.02 19.11 ? 118 SER B OG    1 
ATOM   3887  O  OG    B SER B  1 107 ? 49.501  -8.082  -27.372 0.98 13.52 ? 118 SER B OG    1 
ATOM   3888  N  N     . THR B  1 108 ? 52.370  -9.089  -25.690 1.00 9.20  ? 119 THR B N     1 
ATOM   3889  C  CA    . THR B  1 108 ? 53.702  -9.313  -26.256 1.00 7.26  ? 119 THR B CA    1 
ATOM   3890  C  C     . THR B  1 108 ? 54.284  -10.656 -25.783 1.00 10.30 ? 119 THR B C     1 
ATOM   3891  O  O     . THR B  1 108 ? 54.927  -11.346 -26.558 1.00 10.16 ? 119 THR B O     1 
ATOM   3892  C  CB    . THR B  1 108 ? 54.594  -8.120  -25.913 1.00 11.46 ? 119 THR B CB    1 
ATOM   3893  O  OG1   . THR B  1 108 ? 54.049  -6.993  -26.600 1.00 10.06 ? 119 THR B OG1   1 
ATOM   3894  C  CG2   . THR B  1 108 ? 56.046  -8.311  -26.352 1.00 10.16 ? 119 THR B CG2   1 
ATOM   3895  N  N     . GLY B  1 109 ? 54.078  -10.971 -24.513 1.00 9.45  ? 120 GLY B N     1 
ATOM   3896  C  CA    . GLY B  1 109 ? 54.557  -12.206 -23.904 1.00 9.08  ? 120 GLY B CA    1 
ATOM   3897  C  C     . GLY B  1 109 ? 54.146  -13.446 -24.668 1.00 11.43 ? 120 GLY B C     1 
ATOM   3898  O  O     . GLY B  1 109 ? 54.993  -14.292 -24.935 1.00 9.94  ? 120 GLY B O     1 
ATOM   3899  N  N     . GLY B  1 110 ? 52.868  -13.536 -25.050 1.00 9.68  ? 121 GLY B N     1 
ATOM   3900  C  CA    . GLY B  1 110 ? 52.363  -14.696 -25.806 1.00 8.50  ? 121 GLY B CA    1 
ATOM   3901  C  C     . GLY B  1 110 ? 53.043  -14.857 -27.165 1.00 10.45 ? 121 GLY B C     1 
ATOM   3902  O  O     . GLY B  1 110 ? 53.365  -15.972 -27.577 1.00 9.90  ? 121 GLY B O     1 
ATOM   3903  N  N     . SER B  1 111 ? 53.289  -13.746 -27.876 1.00 7.44  ? 122 SER B N     1 
ATOM   3904  C  CA    . SER B  1 111 ? 53.895  -13.784 -29.217 1.00 7.15  ? 122 SER B CA    1 
ATOM   3905  C  C     . SER B  1 111 ? 55.376  -14.169 -29.149 1.00 9.06  ? 122 SER B C     1 
ATOM   3906  O  O     . SER B  1 111 ? 55.823  -15.017 -29.911 1.00 8.20  ? 122 SER B O     1 
ATOM   3907  C  CB    . SER B  1 111 ? 53.730  -12.425 -29.902 1.00 7.93  ? 122 SER B CB    1 
ATOM   3908  O  OG    . SER B  1 111 ? 52.352  -12.158 -30.091 1.00 10.07 ? 122 SER B OG    1 
ATOM   3909  N  N     . VAL B  1 112 ? 56.134  -13.537 -28.240 1.00 8.37  ? 123 VAL B N     1 
ATOM   3910  C  CA    . VAL B  1 112 ? 57.570  -13.853 -28.093 1.00 10.16 ? 123 VAL B CA    1 
ATOM   3911  C  C     . VAL B  1 112 ? 57.729  -15.300 -27.583 1.00 12.97 ? 123 VAL B C     1 
ATOM   3912  O  O     . VAL B  1 112 ? 58.548  -16.055 -28.121 1.00 12.69 ? 123 VAL B O     1 
ATOM   3913  C  CB    . VAL B  1 112 ? 58.296  -12.823 -27.183 1.00 14.22 ? 123 VAL B CB    1 
ATOM   3914  C  CG1   . VAL B  1 112 ? 59.731  -13.279 -26.886 1.00 15.55 ? 123 VAL B CG1   1 
ATOM   3915  C  CG2   . VAL B  1 112 ? 58.302  -11.449 -27.853 1.00 13.58 ? 123 VAL B CG2   1 
ATOM   3916  N  N     . ALA B  1 113 ? 56.937  -15.683 -26.575 1.00 9.76  ? 124 ALA B N     1 
ATOM   3917  C  CA    . ALA B  1 113 ? 57.005  -17.059 -26.062 1.00 9.83  ? 124 ALA B CA    1 
ATOM   3918  C  C     . ALA B  1 113 ? 56.675  -18.113 -27.138 1.00 13.09 ? 124 ALA B C     1 
ATOM   3919  O  O     . ALA B  1 113 ? 57.357  -19.131 -27.202 1.00 10.87 ? 124 ALA B O     1 
ATOM   3920  C  CB    . ALA B  1 113 ? 56.099  -17.217 -24.844 1.00 10.32 ? 124 ALA B CB    1 
ATOM   3921  N  N     . GLY B  1 114 ? 55.676  -17.843 -27.998 1.00 8.97  ? 125 GLY B N     1 
ATOM   3922  C  CA    . GLY B  1 114 ? 55.305  -18.730 -29.092 1.00 8.97  ? 125 GLY B CA    1 
ATOM   3923  C  C     . GLY B  1 114 ? 56.411  -18.871 -30.129 1.00 14.27 ? 125 GLY B C     1 
ATOM   3924  O  O     . GLY B  1 114 ? 56.682  -19.971 -30.611 1.00 12.84 ? 125 GLY B O     1 
ATOM   3925  N  N     . ALA B  1 115 ? 57.072  -17.750 -30.468 1.00 11.04 ? 126 ALA B N     1 
ATOM   3926  C  CA    . ALA B  1 115 ? 58.222  -17.706 -31.402 1.00 9.68  ? 126 ALA B CA    1 
ATOM   3927  C  C     . ALA B  1 115 ? 59.382  -18.537 -30.792 1.00 13.85 ? 126 ALA B C     1 
ATOM   3928  O  O     . ALA B  1 115 ? 60.046  -19.272 -31.523 1.00 14.02 ? 126 ALA B O     1 
ATOM   3929  C  CB    . ALA B  1 115 ? 58.659  -16.255 -31.598 1.00 9.38  ? 126 ALA B CB    1 
ATOM   3930  N  N     . VAL B  1 116 ? 59.592  -18.452 -29.447 1.00 9.96  ? 127 VAL B N     1 
ATOM   3931  C  CA    . VAL B  1 116 ? 60.655  -19.250 -28.795 1.00 11.16 ? 127 VAL B CA    1 
ATOM   3932  C  C     . VAL B  1 116 ? 60.342  -20.761 -28.944 1.00 15.93 ? 127 VAL B C     1 
ATOM   3933  O  O     . VAL B  1 116 ? 61.229  -21.544 -29.291 1.00 15.65 ? 127 VAL B O     1 
ATOM   3934  C  CB    . VAL B  1 116 ? 60.922  -18.839 -27.315 1.00 14.04 ? 127 VAL B CB    1 
ATOM   3935  C  CG1   . VAL B  1 116 ? 61.886  -19.835 -26.629 1.00 13.79 ? 127 VAL B CG1   1 
ATOM   3936  C  CG2   . VAL B  1 116 ? 61.486  -17.426 -27.234 1.00 12.91 ? 127 VAL B CG2   1 
ATOM   3937  N  N     . LYS B  1 117 ? 59.072  -21.163 -28.696 1.00 14.13 ? 128 LYS B N     1 
ATOM   3938  C  CA    . LYS B  1 117 ? 58.618  -22.558 -28.816 1.00 13.04 ? 128 LYS B CA    1 
ATOM   3939  C  C     . LYS B  1 117 ? 58.863  -23.096 -30.213 1.00 15.81 ? 128 LYS B C     1 
ATOM   3940  O  O     . LYS B  1 117 ? 59.358  -24.218 -30.382 1.00 13.86 ? 128 LYS B O     1 
ATOM   3941  C  CB    . LYS B  1 117 ? 57.130  -22.650 -28.464 1.00 15.79 ? 128 LYS B CB    1 
ATOM   3942  C  CG    . LYS B  1 117 ? 56.886  -22.779 -26.971 1.00 34.51 ? 128 LYS B CG    1 
ATOM   3943  C  CD    . LYS B  1 117 ? 56.670  -24.231 -26.569 1.00 46.99 ? 128 LYS B CD    1 
ATOM   3944  C  CE    . LYS B  1 117 ? 57.087  -24.466 -25.146 1.00 60.75 ? 128 LYS B CE    1 
ATOM   3945  N  NZ    . LYS B  1 117 ? 56.992  -25.900 -24.769 1.00 70.22 ? 128 LYS B NZ    1 
ATOM   3946  N  N     . LEU B  1 118 ? 58.561  -22.266 -31.228 1.00 11.85 ? 129 LEU B N     1 
ATOM   3947  C  CA    . LEU B  1 118 ? 58.787  -22.615 -32.617 1.00 11.09 ? 129 LEU B CA    1 
ATOM   3948  C  C     . LEU B  1 118 ? 60.294  -22.794 -32.903 1.00 15.71 ? 129 LEU B C     1 
ATOM   3949  O  O     . LEU B  1 118 ? 60.666  -23.764 -33.564 1.00 15.47 ? 129 LEU B O     1 
ATOM   3950  C  CB    . LEU B  1 118 ? 58.180  -21.554 -33.541 1.00 10.83 ? 129 LEU B CB    1 
ATOM   3951  C  CG    . LEU B  1 118 ? 56.639  -21.561 -33.560 1.00 14.81 ? 129 LEU B CG    1 
ATOM   3952  C  CD1   . LEU B  1 118 ? 56.081  -20.246 -34.149 1.00 12.88 ? 129 LEU B CD1   1 
ATOM   3953  C  CD2   . LEU B  1 118 ? 56.095  -22.775 -34.346 1.00 12.20 ? 129 LEU B CD2   1 
ATOM   3954  N  N     . ASN B  1 119 ? 61.139  -21.862 -32.421 1.00 11.94 ? 130 ASN B N     1 
ATOM   3955  C  CA    . ASN B  1 119 ? 62.594  -21.891 -32.650 1.00 13.23 ? 130 ASN B CA    1 
ATOM   3956  C  C     . ASN B  1 119 ? 63.224  -23.160 -32.058 1.00 19.54 ? 130 ASN B C     1 
ATOM   3957  O  O     . ASN B  1 119 ? 64.089  -23.772 -32.676 1.00 19.80 ? 130 ASN B O     1 
ATOM   3958  C  CB    . ASN B  1 119 ? 63.252  -20.650 -32.011 1.00 11.65 ? 130 ASN B CB    1 
ATOM   3959  C  CG    . ASN B  1 119 ? 63.171  -19.416 -32.871 1.00 17.02 ? 130 ASN B CG    1 
ATOM   3960  O  OD1   . ASN B  1 119 ? 62.911  -19.477 -34.084 1.00 13.26 ? 130 ASN B OD1   1 
ATOM   3961  N  ND2   . ASN B  1 119 ? 63.515  -18.282 -32.279 1.00 10.57 ? 130 ASN B ND2   1 
ATOM   3962  N  N     . ARG B  1 120 ? 62.774  -23.541 -30.868 1.00 18.20 ? 131 ARG B N     1 
ATOM   3963  C  CA    . ARG B  1 120 ? 63.248  -24.730 -30.158 1.00 18.81 ? 131 ARG B CA    1 
ATOM   3964  C  C     . ARG B  1 120 ? 62.604  -26.000 -30.708 1.00 22.82 ? 131 ARG B C     1 
ATOM   3965  O  O     . ARG B  1 120 ? 62.869  -27.089 -30.197 1.00 23.19 ? 131 ARG B O     1 
ATOM   3966  C  CB    . ARG B  1 120 ? 63.013  -24.572 -28.657 1.00 18.36 ? 131 ARG B CB    1 
ATOM   3967  C  CG    . ARG B  1 120 ? 63.927  -23.489 -28.080 1.00 29.56 ? 131 ARG B CG    1 
ATOM   3968  C  CD    . ARG B  1 120 ? 63.701  -23.250 -26.610 1.00 37.13 ? 131 ARG B CD    1 
ATOM   3969  N  NE    . ARG B  1 120 ? 64.520  -22.136 -26.130 1.00 43.19 ? 131 ARG B NE    1 
ATOM   3970  C  CZ    . ARG B  1 120 ? 64.599  -21.764 -24.858 1.00 57.72 ? 131 ARG B CZ    1 
ATOM   3971  N  NH1   . ARG B  1 120 ? 65.367  -20.741 -24.507 1.00 44.90 ? 131 ARG B NH1   1 
ATOM   3972  N  NH2   . ARG B  1 120 ? 63.914  -22.414 -23.925 1.00 45.25 ? 131 ARG B NH2   1 
ATOM   3973  N  N     . GLN B  1 121 ? 61.772  -25.865 -31.763 1.00 17.59 ? 132 GLN B N     1 
ATOM   3974  C  CA    . GLN B  1 121 ? 61.080  -26.978 -32.427 1.00 17.12 ? 132 GLN B CA    1 
ATOM   3975  C  C     . GLN B  1 121 ? 60.265  -27.797 -31.427 1.00 20.96 ? 132 GLN B C     1 
ATOM   3976  O  O     . GLN B  1 121 ? 60.174  -29.011 -31.552 1.00 21.81 ? 132 GLN B O     1 
ATOM   3977  C  CB    . GLN B  1 121 ? 62.093  -27.845 -33.227 1.00 18.52 ? 132 GLN B CB    1 
ATOM   3978  C  CG    . GLN B  1 121 ? 62.833  -27.009 -34.268 1.00 18.16 ? 132 GLN B CG    1 
ATOM   3979  C  CD    . GLN B  1 121 ? 63.962  -27.712 -34.982 1.00 36.80 ? 132 GLN B CD    1 
ATOM   3980  O  OE1   . GLN B  1 121 ? 64.032  -28.940 -35.050 1.00 36.80 ? 132 GLN B OE1   1 
ATOM   3981  N  NE2   . GLN B  1 121 ? 64.848  -26.926 -35.577 1.00 27.97 ? 132 GLN B NE2   1 
ATOM   3982  N  N     . GLN B  1 122 ? 59.685  -27.133 -30.413 1.00 17.35 ? 133 GLN B N     1 
ATOM   3983  C  CA    . GLN B  1 122 ? 58.868  -27.822 -29.407 1.00 17.44 ? 133 GLN B CA    1 
ATOM   3984  C  C     . GLN B  1 122 ? 57.400  -27.839 -29.801 1.00 21.76 ? 133 GLN B C     1 
ATOM   3985  O  O     . GLN B  1 122 ? 56.600  -28.475 -29.127 1.00 23.48 ? 133 GLN B O     1 
ATOM   3986  C  CB    . GLN B  1 122 ? 59.061  -27.211 -28.011 1.00 19.15 ? 133 GLN B CB    1 
ATOM   3987  C  CG    . GLN B  1 122 ? 60.452  -27.482 -27.445 1.00 25.37 ? 133 GLN B CG    1 
ATOM   3988  C  CD    . GLN B  1 122 ? 60.732  -26.683 -26.210 1.00 47.56 ? 133 GLN B CD    1 
ATOM   3989  O  OE1   . GLN B  1 122 ? 60.314  -25.523 -26.064 1.00 45.01 ? 133 GLN B OE1   1 
ATOM   3990  N  NE2   . GLN B  1 122 ? 61.482  -27.281 -25.304 1.00 43.14 ? 133 GLN B NE2   1 
ATOM   3991  N  N     . THR B  1 123 ? 57.057  -27.161 -30.906 1.00 16.33 ? 134 THR B N     1 
ATOM   3992  C  CA    . THR B  1 123 ? 55.711  -27.059 -31.454 1.00 14.74 ? 134 THR B CA    1 
ATOM   3993  C  C     . THR B  1 123 ? 55.796  -26.779 -32.935 1.00 16.38 ? 134 THR B C     1 
ATOM   3994  O  O     . THR B  1 123 ? 56.787  -26.210 -33.405 1.00 14.55 ? 134 THR B O     1 
ATOM   3995  C  CB    . THR B  1 123 ? 54.901  -25.966 -30.700 1.00 15.11 ? 134 THR B CB    1 
ATOM   3996  O  OG1   . THR B  1 123 ? 53.523  -26.166 -30.956 1.00 16.21 ? 134 THR B OG1   1 
ATOM   3997  C  CG2   . THR B  1 123 ? 55.279  -24.537 -31.100 1.00 11.32 ? 134 THR B CG2   1 
ATOM   3998  N  N     . ASP B  1 124 ? 54.729  -27.105 -33.669 1.00 13.85 ? 135 ASP B N     1 
ATOM   3999  C  CA    . ASP B  1 124 ? 54.654  -26.794 -35.100 1.00 13.84 ? 135 ASP B CA    1 
ATOM   4000  C  C     . ASP B  1 124 ? 53.900  -25.473 -35.327 1.00 15.02 ? 135 ASP B C     1 
ATOM   4001  O  O     . ASP B  1 124 ? 54.128  -24.781 -36.319 1.00 14.12 ? 135 ASP B O     1 
ATOM   4002  C  CB    . ASP B  1 124 ? 53.938  -27.924 -35.842 1.00 16.20 ? 135 ASP B CB    1 
ATOM   4003  C  CG    . ASP B  1 124 ? 54.712  -29.225 -35.758 1.00 24.10 ? 135 ASP B CG    1 
ATOM   4004  O  OD1   . ASP B  1 124 ? 54.220  -30.151 -35.106 1.00 23.82 ? 135 ASP B OD1   1 
ATOM   4005  O  OD2   . ASP B  1 124 ? 55.876  -29.258 -36.230 1.00 26.32 ? 135 ASP B OD2   1 
ATOM   4006  N  N     . MET B  1 125 ? 52.943  -25.178 -34.443 1.00 11.46 ? 136 MET B N     1 
ATOM   4007  C  CA    . MET B  1 125 ? 52.122  -23.966 -34.484 1.00 11.12 ? 136 MET B CA    1 
ATOM   4008  C  C     . MET B  1 125 ? 52.018  -23.383 -33.104 1.00 13.45 ? 136 MET B C     1 
ATOM   4009  O  O     . MET B  1 125 ? 51.877  -24.117 -32.125 1.00 12.63 ? 136 MET B O     1 
ATOM   4010  C  CB    . MET B  1 125 ? 50.700  -24.280 -34.973 1.00 13.27 ? 136 MET B CB    1 
ATOM   4011  C  CG    . MET B  1 125 ? 50.583  -24.335 -36.479 1.00 16.48 ? 136 MET B CG    1 
ATOM   4012  S  SD    . MET B  1 125 ? 49.108  -25.222 -36.967 1.00 19.94 ? 136 MET B SD    1 
ATOM   4013  C  CE    . MET B  1 125 ? 49.687  -26.889 -36.819 1.00 17.32 ? 136 MET B CE    1 
ATOM   4014  N  N     . ALA B  1 126 ? 52.083  -22.055 -33.013 1.00 11.41 ? 137 ALA B N     1 
ATOM   4015  C  CA    . ALA B  1 126 ? 51.856  -21.385 -31.745 1.00 9.99  ? 137 ALA B CA    1 
ATOM   4016  C  C     . ALA B  1 126 ? 50.784  -20.333 -32.017 1.00 10.83 ? 137 ALA B C     1 
ATOM   4017  O  O     . ALA B  1 126 ? 50.770  -19.716 -33.085 1.00 10.62 ? 137 ALA B O     1 
ATOM   4018  C  CB    . ALA B  1 126 ? 53.139  -20.776 -31.193 1.00 10.63 ? 137 ALA B CB    1 
ATOM   4019  N  N     . VAL B  1 127 ? 49.851  -20.198 -31.087 1.00 7.95  ? 138 VAL B N     1 
ATOM   4020  C  CA    . VAL B  1 127 ? 48.704  -19.281 -31.213 1.00 7.58  ? 138 VAL B CA    1 
ATOM   4021  C  C     . VAL B  1 127 ? 48.714  -18.259 -30.088 1.00 10.57 ? 138 VAL B C     1 
ATOM   4022  O  O     . VAL B  1 127 ? 48.813  -18.636 -28.905 1.00 11.05 ? 138 VAL B O     1 
ATOM   4023  C  CB    . VAL B  1 127 ? 47.372  -20.089 -31.209 1.00 9.48  ? 138 VAL B CB    1 
ATOM   4024  C  CG1   . VAL B  1 127 ? 46.171  -19.190 -31.474 1.00 9.76  ? 138 VAL B CG1   1 
ATOM   4025  C  CG2   . VAL B  1 127 ? 47.403  -21.266 -32.205 1.00 8.90  ? 138 VAL B CG2   1 
ATOM   4026  N  N     . ASN B  1 128 ? 48.548  -16.963 -30.433 1.00 6.48  ? 139 ASN B N     1 
ATOM   4027  C  CA    . ASN B  1 128 ? 48.384  -15.920 -29.424 1.00 5.58  ? 139 ASN B CA    1 
ATOM   4028  C  C     . ASN B  1 128 ? 47.304  -14.935 -29.900 1.00 7.57  ? 139 ASN B C     1 
ATOM   4029  O  O     . ASN B  1 128 ? 47.623  -13.932 -30.569 1.00 6.64  ? 139 ASN B O     1 
ATOM   4030  C  CB    . ASN B  1 128 ? 49.702  -15.177 -29.081 1.00 5.74  ? 139 ASN B CB    1 
ATOM   4031  C  CG    . ASN B  1 128 ? 49.470  -14.035 -28.105 1.00 10.50 ? 139 ASN B CG    1 
ATOM   4032  O  OD1   . ASN B  1 128 ? 48.601  -14.100 -27.212 1.00 9.44  ? 139 ASN B OD1   1 
ATOM   4033  N  ND2   . ASN B  1 128 ? 50.265  -12.971 -28.217 1.00 7.47  ? 139 ASN B ND2   1 
ATOM   4034  N  N     . TRP B  1 129 ? 46.048  -15.172 -29.508 1.00 4.79  ? 140 TRP B N     1 
ATOM   4035  C  CA    . TRP B  1 129 ? 44.965  -14.273 -29.931 1.00 4.97  ? 140 TRP B CA    1 
ATOM   4036  C  C     . TRP B  1 129 ? 45.049  -12.894 -29.312 1.00 8.50  ? 140 TRP B C     1 
ATOM   4037  O  O     . TRP B  1 129 ? 44.435  -11.984 -29.852 1.00 9.23  ? 140 TRP B O     1 
ATOM   4038  C  CB    . TRP B  1 129 ? 43.567  -14.897 -29.754 1.00 4.52  ? 140 TRP B CB    1 
ATOM   4039  C  CG    . TRP B  1 129 ? 43.363  -16.178 -30.529 1.00 5.60  ? 140 TRP B CG    1 
ATOM   4040  C  CD1   . TRP B  1 129 ? 42.907  -17.371 -30.035 1.00 8.64  ? 140 TRP B CD1   1 
ATOM   4041  C  CD2   . TRP B  1 129 ? 43.646  -16.402 -31.927 1.00 4.81  ? 140 TRP B CD2   1 
ATOM   4042  N  NE1   . TRP B  1 129 ? 42.790  -18.292 -31.056 1.00 7.33  ? 140 TRP B NE1   1 
ATOM   4043  C  CE2   . TRP B  1 129 ? 43.237  -17.724 -32.228 1.00 9.49  ? 140 TRP B CE2   1 
ATOM   4044  C  CE3   . TRP B  1 129 ? 44.063  -15.566 -32.991 1.00 5.46  ? 140 TRP B CE3   1 
ATOM   4045  C  CZ2   . TRP B  1 129 ? 43.324  -18.262 -33.530 1.00 8.99  ? 140 TRP B CZ2   1 
ATOM   4046  C  CZ3   . TRP B  1 129 ? 44.156  -16.099 -34.276 1.00 7.70  ? 140 TRP B CZ3   1 
ATOM   4047  C  CH2   . TRP B  1 129 ? 43.796  -17.429 -34.538 1.00 8.32  ? 140 TRP B CH2   1 
ATOM   4048  N  N     . ALA B  1 130 ? 45.866  -12.704 -28.237 1.00 6.68  ? 141 ALA B N     1 
ATOM   4049  C  CA    . ALA B  1 130 ? 46.045  -11.380 -27.620 1.00 6.53  ? 141 ALA B CA    1 
ATOM   4050  C  C     . ALA B  1 130 ? 47.065  -10.540 -28.394 1.00 9.55  ? 141 ALA B C     1 
ATOM   4051  O  O     . ALA B  1 130 ? 47.218  -9.351  -28.104 1.00 8.72  ? 141 ALA B O     1 
ATOM   4052  C  CB    . ALA B  1 130 ? 46.478  -11.501 -26.154 1.00 6.93  ? 141 ALA B CB    1 
ATOM   4053  N  N     . GLY B  1 131 ? 47.753  -11.157 -29.345 1.00 7.12  ? 142 GLY B N     1 
ATOM   4054  C  CA    . GLY B  1 131 ? 48.770  -10.467 -30.149 1.00 6.09  ? 142 GLY B CA    1 
ATOM   4055  C  C     . GLY B  1 131 ? 48.262  -10.008 -31.502 1.00 8.49  ? 142 GLY B C     1 
ATOM   4056  O  O     . GLY B  1 131 ? 47.058  -9.852  -31.691 1.00 9.15  ? 142 GLY B O     1 
ATOM   4057  N  N     . GLY B  1 132 ? 49.185  -9.739  -32.427 1.00 5.46  ? 143 GLY B N     1 
ATOM   4058  C  CA    . GLY B  1 132 ? 48.858  -9.249  -33.767 1.00 5.08  ? 143 GLY B CA    1 
ATOM   4059  C  C     . GLY B  1 132 ? 48.617  -7.745  -33.849 1.00 8.06  ? 143 GLY B C     1 
ATOM   4060  O  O     . GLY B  1 132 ? 47.984  -7.277  -34.807 1.00 8.27  ? 143 GLY B O     1 
ATOM   4061  N  N     . LEU B  1 133 ? 49.189  -6.968  -32.897 1.00 6.10  ? 144 LEU B N     1 
ATOM   4062  C  CA    . LEU B  1 133 ? 48.999  -5.507  -32.808 1.00 6.58  ? 144 LEU B CA    1 
ATOM   4063  C  C     . LEU B  1 133 ? 49.953  -4.759  -33.748 1.00 10.72 ? 144 LEU B C     1 
ATOM   4064  O  O     . LEU B  1 133 ? 50.903  -4.046  -33.329 1.00 8.93  ? 144 LEU B O     1 
ATOM   4065  C  CB    . LEU B  1 133 ? 49.042  -5.038  -31.337 1.00 6.57  ? 144 LEU B CB    1 
ATOM   4066  C  CG    . LEU B  1 133 ? 47.994  -5.753  -30.418 1.00 9.98  ? 144 LEU B CG    1 
ATOM   4067  C  CD1   . LEU B  1 133 ? 47.953  -5.123  -29.035 1.00 9.57  ? 144 LEU B CD1   1 
ATOM   4068  C  CD2   . LEU B  1 133 ? 46.546  -5.700  -31.037 1.00 13.06 ? 144 LEU B CD2   1 
ATOM   4069  N  N     . HIS B  1 134 ? 49.642  -4.929  -35.053 1.00 7.43  ? 145 HIS B N     1 
ATOM   4070  C  CA    . HIS B  1 134 ? 50.437  -4.537  -36.217 1.00 7.26  ? 145 HIS B CA    1 
ATOM   4071  C  C     . HIS B  1 134 ? 50.827  -3.092  -36.435 1.00 11.88 ? 145 HIS B C     1 
ATOM   4072  O  O     . HIS B  1 134 ? 51.773  -2.844  -37.200 1.00 9.73  ? 145 HIS B O     1 
ATOM   4073  C  CB    . HIS B  1 134 ? 49.907  -5.177  -37.523 1.00 6.44  ? 145 HIS B CB    1 
ATOM   4074  C  CG    . HIS B  1 134 ? 48.505  -4.833  -37.931 1.00 7.97  ? 145 HIS B CG    1 
ATOM   4075  N  ND1   . HIS B  1 134 ? 48.014  -5.233  -39.165 1.00 8.82  ? 145 HIS B ND1   1 
ATOM   4076  C  CD2   . HIS B  1 134 ? 47.533  -4.165  -37.273 1.00 9.13  ? 145 HIS B CD2   1 
ATOM   4077  C  CE1   . HIS B  1 134 ? 46.769  -4.793  -39.225 1.00 7.59  ? 145 HIS B CE1   1 
ATOM   4078  N  NE2   . HIS B  1 134 ? 46.432  -4.138  -38.110 1.00 8.87  ? 145 HIS B NE2   1 
ATOM   4079  N  N     . HIS B  1 135 ? 50.089  -2.142  -35.833 1.00 8.95  ? 146 HIS B N     1 
ATOM   4080  C  CA    . HIS B  1 135 ? 50.378  -0.711  -36.063 1.00 8.67  ? 146 HIS B CA    1 
ATOM   4081  C  C     . HIS B  1 135 ? 51.472  -0.087  -35.220 1.00 12.20 ? 146 HIS B C     1 
ATOM   4082  O  O     . HIS B  1 135 ? 51.951  0.981   -35.585 1.00 10.78 ? 146 HIS B O     1 
ATOM   4083  C  CB    . HIS B  1 135 ? 49.103  0.134   -35.918 1.00 7.70  ? 146 HIS B CB    1 
ATOM   4084  C  CG    . HIS B  1 135 ? 47.999  -0.253  -36.859 1.00 10.26 ? 146 HIS B CG    1 
ATOM   4085  N  ND1   . HIS B  1 135 ? 48.208  -0.342  -38.226 1.00 10.82 ? 146 HIS B ND1   1 
ATOM   4086  C  CD2   . HIS B  1 135 ? 46.716  -0.580  -36.586 1.00 10.02 ? 146 HIS B CD2   1 
ATOM   4087  C  CE1   . HIS B  1 135 ? 47.046  -0.726  -38.740 1.00 10.40 ? 146 HIS B CE1   1 
ATOM   4088  N  NE2   . HIS B  1 135 ? 46.113  -0.863  -37.790 1.00 10.23 ? 146 HIS B NE2   1 
ATOM   4089  N  N     . ALA B  1 136 ? 51.788  -0.657  -34.046 1.00 9.84  ? 147 ALA B N     1 
ATOM   4090  C  CA    . ALA B  1 136 ? 52.758  -0.007  -33.148 1.00 10.33 ? 147 ALA B CA    1 
ATOM   4091  C  C     . ALA B  1 136 ? 54.099  0.199   -33.824 1.00 12.55 ? 147 ALA B C     1 
ATOM   4092  O  O     . ALA B  1 136 ? 54.591  -0.685  -34.523 1.00 11.10 ? 147 ALA B O     1 
ATOM   4093  C  CB    . ALA B  1 136 ? 52.928  -0.813  -31.875 1.00 12.13 ? 147 ALA B CB    1 
ATOM   4094  N  N     . LYS B  1 137 ? 54.668  1.379   -33.639 1.00 11.09 ? 148 LYS B N     1 
ATOM   4095  C  CA    . LYS B  1 137 ? 55.952  1.759   -34.253 1.00 10.76 ? 148 LYS B CA    1 
ATOM   4096  C  C     . LYS B  1 137 ? 57.055  1.772   -33.217 1.00 13.31 ? 148 LYS B C     1 
ATOM   4097  O  O     . LYS B  1 137 ? 56.787  1.683   -32.016 1.00 12.15 ? 148 LYS B O     1 
ATOM   4098  C  CB    . LYS B  1 137 ? 55.807  3.170   -34.877 1.00 14.15 ? 148 LYS B CB    1 
ATOM   4099  C  CG    . LYS B  1 137 ? 54.576  3.326   -35.798 1.00 17.96 ? 148 LYS B CG    1 
ATOM   4100  C  CD    . LYS B  1 137 ? 54.667  2.474   -37.045 1.00 24.57 ? 148 LYS B CD    1 
ATOM   4101  C  CE    . LYS B  1 137 ? 53.586  2.806   -38.046 1.00 25.15 ? 148 LYS B CE    1 
ATOM   4102  N  NZ    . LYS B  1 137 ? 53.822  4.121   -38.685 1.00 31.59 ? 148 LYS B NZ    1 
ATOM   4103  N  N     . LYS B  1 138 ? 58.310  1.943   -33.670 1.00 11.74 ? 149 LYS B N     1 
ATOM   4104  C  CA    . LYS B  1 138 ? 59.460  1.962   -32.769 1.00 11.46 ? 149 LYS B CA    1 
ATOM   4105  C  C     . LYS B  1 138 ? 59.256  2.877   -31.571 1.00 13.31 ? 149 LYS B C     1 
ATOM   4106  O  O     . LYS B  1 138 ? 59.488  2.439   -30.451 1.00 13.38 ? 149 LYS B O     1 
ATOM   4107  C  CB    . LYS B  1 138 ? 60.737  2.357   -33.526 1.00 13.39 ? 149 LYS B CB    1 
ATOM   4108  C  CG    . LYS B  1 138 ? 61.986  2.102   -32.706 1.00 16.59 ? 149 LYS B CG    1 
ATOM   4109  C  CD    . LYS B  1 138 ? 63.241  2.432   -33.475 1.00 23.30 ? 149 LYS B CD    1 
ATOM   4110  C  CE    . LYS B  1 138 ? 64.455  1.859   -32.781 1.00 30.22 ? 149 LYS B CE    1 
ATOM   4111  N  NZ    . LYS B  1 138 ? 64.604  0.398   -33.085 1.00 41.79 ? 149 LYS B NZ    1 
ATOM   4112  N  N     . SER B  1 139 ? 58.752  4.106   -31.787 1.00 10.45 ? 150 SER B N     1 
ATOM   4113  C  CA    . SER B  1 139 ? 58.581  5.074   -30.706 1.00 11.64 ? 150 SER B CA    1 
ATOM   4114  C  C     . SER B  1 139 ? 57.212  5.714   -30.647 1.00 17.61 ? 150 SER B C     1 
ATOM   4115  O  O     . SER B  1 139 ? 57.085  6.839   -30.163 1.00 16.57 ? 150 SER B O     1 
ATOM   4116  C  CB    . SER B  1 139 ? 59.660  6.156   -30.806 1.00 15.78 ? 150 SER B CB    1 
ATOM   4117  O  OG    . SER B  1 139 ? 60.918  5.533   -30.618 1.00 31.91 ? 150 SER B OG    1 
ATOM   4118  N  N     . GLU B  1 140 ? 56.178  5.007   -31.101 1.00 15.65 ? 151 GLU B N     1 
ATOM   4119  C  CA    . GLU B  1 140 ? 54.825  5.539   -30.987 1.00 16.15 ? 151 GLU B CA    1 
ATOM   4120  C  C     . GLU B  1 140 ? 53.725  4.500   -31.101 1.00 15.34 ? 151 GLU B C     1 
ATOM   4121  O  O     . GLU B  1 140 ? 53.857  3.533   -31.845 1.00 13.97 ? 151 GLU B O     1 
ATOM   4122  C  CB    . GLU B  1 140 ? 54.566  6.736   -31.917 1.00 18.33 ? 151 GLU B CB    1 
ATOM   4123  C  CG    . GLU B  1 140 ? 54.363  6.451   -33.381 1.00 29.88 ? 151 GLU B CG    1 
ATOM   4124  C  CD    . GLU B  1 140 ? 54.192  7.745   -34.156 1.00 53.32 ? 151 GLU B CD    1 
ATOM   4125  O  OE1   . GLU B  1 140 ? 53.128  7.914   -34.792 1.00 56.91 ? 151 GLU B OE1   1 
ATOM   4126  O  OE2   . GLU B  1 140 ? 55.094  8.611   -34.085 1.00 47.63 ? 151 GLU B OE2   1 
ATOM   4127  N  N     . ALA B  1 141 ? 52.622  4.769   -30.416 1.00 10.35 ? 152 ALA B N     1 
ATOM   4128  C  CA    . ALA B  1 141 ? 51.417  3.952   -30.459 1.00 10.07 ? 152 ALA B CA    1 
ATOM   4129  C  C     . ALA B  1 141 ? 50.649  4.388   -31.682 1.00 14.37 ? 152 ALA B C     1 
ATOM   4130  O  O     . ALA B  1 141 ? 50.803  5.528   -32.139 1.00 14.08 ? 152 ALA B O     1 
ATOM   4131  C  CB    . ALA B  1 141 ? 50.569  4.194   -29.212 1.00 10.07 ? 152 ALA B CB    1 
ATOM   4132  N  N     . SER B  1 142 ? 49.782  3.502   -32.191 1.00 10.09 ? 153 SER B N     1 
ATOM   4133  C  CA    . SER B  1 142 ? 48.944  3.805   -33.342 1.00 8.34  ? 153 SER B CA    1 
ATOM   4134  C  C     . SER B  1 142 ? 47.870  2.739   -33.468 1.00 12.83 ? 153 SER B C     1 
ATOM   4135  O  O     . SER B  1 142 ? 48.157  1.572   -33.238 1.00 12.09 ? 153 SER B O     1 
ATOM   4136  C  CB    . SER B  1 142 ? 49.795  3.798   -34.619 1.00 10.48 ? 153 SER B CB    1 
ATOM   4137  O  OG    . SER B  1 142 ? 48.928  3.894   -35.729 1.00 14.44 ? 153 SER B OG    1 
ATOM   4138  N  N     . GLY B  1 143 ? 46.670  3.132   -33.908 1.00 10.80 ? 154 GLY B N     1 
ATOM   4139  C  CA    . GLY B  1 143 ? 45.594  2.199   -34.256 1.00 10.14 ? 154 GLY B CA    1 
ATOM   4140  C  C     . GLY B  1 143 ? 45.274  1.157   -33.216 1.00 13.14 ? 154 GLY B C     1 
ATOM   4141  O  O     . GLY B  1 143 ? 45.126  -0.027  -33.550 1.00 12.30 ? 154 GLY B O     1 
ATOM   4142  N  N     . PHE B  1 144 ? 45.195  1.600   -31.939 1.00 9.18  ? 155 PHE B N     1 
ATOM   4143  C  CA    . PHE B  1 144 ? 44.858  0.774   -30.755 1.00 8.51  ? 155 PHE B CA    1 
ATOM   4144  C  C     . PHE B  1 144 ? 46.006  -0.152  -30.318 1.00 11.05 ? 155 PHE B C     1 
ATOM   4145  O  O     . PHE B  1 144 ? 45.810  -0.962  -29.410 1.00 12.03 ? 155 PHE B O     1 
ATOM   4146  C  CB    . PHE B  1 144 ? 43.576  -0.062  -31.004 1.00 8.58  ? 155 PHE B CB    1 
ATOM   4147  C  CG    . PHE B  1 144 ? 42.399  0.636   -31.672 1.00 8.63  ? 155 PHE B CG    1 
ATOM   4148  C  CD1   . PHE B  1 144 ? 42.237  2.027   -31.579 1.00 9.50  ? 155 PHE B CD1   1 
ATOM   4149  C  CD2   . PHE B  1 144 ? 41.422  -0.102  -32.336 1.00 9.03  ? 155 PHE B CD2   1 
ATOM   4150  C  CE1   . PHE B  1 144 ? 41.131  2.663   -32.157 1.00 10.57 ? 155 PHE B CE1   1 
ATOM   4151  C  CE2   . PHE B  1 144 ? 40.301  0.530   -32.899 1.00 12.25 ? 155 PHE B CE2   1 
ATOM   4152  C  CZ    . PHE B  1 144 ? 40.173  1.915   -32.817 1.00 10.92 ? 155 PHE B CZ    1 
ATOM   4153  N  N     . CYS B  1 145 ? 47.176  -0.027  -30.970 1.00 8.19  ? 156 CYS B N     1 
ATOM   4154  C  CA    . CYS B  1 145 ? 48.383  -0.835  -30.765 1.00 8.23  ? 156 CYS B CA    1 
ATOM   4155  C  C     . CYS B  1 145 ? 49.421  -0.022  -30.038 1.00 11.90 ? 156 CYS B C     1 
ATOM   4156  O  O     . CYS B  1 145 ? 49.699  1.090   -30.468 1.00 13.24 ? 156 CYS B O     1 
ATOM   4157  C  CB    . CYS B  1 145 ? 48.944  -1.357  -32.091 1.00 7.97  ? 156 CYS B CB    1 
ATOM   4158  S  SG    . CYS B  1 145 ? 47.743  -2.252  -33.133 1.00 10.41 ? 156 CYS B SG    1 
ATOM   4159  N  N     . TYR B  1 146 ? 50.088  -0.610  -29.016 1.00 8.28  ? 157 TYR B N     1 
ATOM   4160  C  CA    . TYR B  1 146 ? 51.134  0.129   -28.265 1.00 7.00  ? 157 TYR B CA    1 
ATOM   4161  C  C     . TYR B  1 146 ? 52.496  -0.513  -28.434 1.00 9.31  ? 157 TYR B C     1 
ATOM   4162  O  O     . TYR B  1 146 ? 53.474  0.186   -28.700 1.00 8.82  ? 157 TYR B O     1 
ATOM   4163  C  CB    . TYR B  1 146 ? 50.805  0.242   -26.762 1.00 7.65  ? 157 TYR B CB    1 
ATOM   4164  C  CG    . TYR B  1 146 ? 49.444  0.826   -26.484 1.00 8.68  ? 157 TYR B CG    1 
ATOM   4165  C  CD1   . TYR B  1 146 ? 48.295  0.043   -26.584 1.00 9.35  ? 157 TYR B CD1   1 
ATOM   4166  C  CD2   . TYR B  1 146 ? 49.300  2.157   -26.093 1.00 8.84  ? 157 TYR B CD2   1 
ATOM   4167  C  CE1   . TYR B  1 146 ? 47.037  0.568   -26.298 1.00 6.39  ? 157 TYR B CE1   1 
ATOM   4168  C  CE2   . TYR B  1 146 ? 48.043  2.694   -25.805 1.00 10.35 ? 157 TYR B CE2   1 
ATOM   4169  C  CZ    . TYR B  1 146 ? 46.913  1.900   -25.942 1.00 14.21 ? 157 TYR B CZ    1 
ATOM   4170  O  OH    . TYR B  1 146 ? 45.676  2.371   -25.618 1.00 11.01 ? 157 TYR B OH    1 
ATOM   4171  N  N     . VAL B  1 147 ? 52.569  -1.841  -28.255 1.00 6.06  ? 158 VAL B N     1 
ATOM   4172  C  CA    . VAL B  1 147 ? 53.818  -2.581  -28.396 1.00 7.97  ? 158 VAL B CA    1 
ATOM   4173  C  C     . VAL B  1 147 ? 53.643  -3.538  -29.555 1.00 9.78  ? 158 VAL B C     1 
ATOM   4174  O  O     . VAL B  1 147 ? 52.647  -4.252  -29.622 1.00 9.43  ? 158 VAL B O     1 
ATOM   4175  C  CB    . VAL B  1 147 ? 54.220  -3.276  -27.071 1.00 10.66 ? 158 VAL B CB    1 
ATOM   4176  C  CG1   . VAL B  1 147 ? 55.515  -4.096  -27.247 1.00 9.72  ? 158 VAL B CG1   1 
ATOM   4177  C  CG2   . VAL B  1 147 ? 54.375  -2.215  -25.958 1.00 9.80  ? 158 VAL B CG2   1 
ATOM   4178  N  N     . ASN B  1 148 ? 54.588  -3.531  -30.475 1.00 6.08  ? 159 ASN B N     1 
ATOM   4179  C  CA    . ASN B  1 148 ? 54.432  -4.379  -31.645 1.00 6.72  ? 159 ASN B CA    1 
ATOM   4180  C  C     . ASN B  1 148 ? 54.929  -5.786  -31.335 1.00 9.37  ? 159 ASN B C     1 
ATOM   4181  O  O     . ASN B  1 148 ? 56.076  -6.110  -31.605 1.00 7.80  ? 159 ASN B O     1 
ATOM   4182  C  CB    . ASN B  1 148 ? 55.093  -3.741  -32.892 1.00 8.13  ? 159 ASN B CB    1 
ATOM   4183  C  CG    . ASN B  1 148 ? 54.532  -4.296  -34.181 1.00 14.41 ? 159 ASN B CG    1 
ATOM   4184  O  OD1   . ASN B  1 148 ? 54.398  -5.512  -34.359 1.00 8.87  ? 159 ASN B OD1   1 
ATOM   4185  N  ND2   . ASN B  1 148 ? 54.226  -3.434  -35.127 1.00 6.58  ? 159 ASN B ND2   1 
ATOM   4186  N  N     . ASP B  1 149 ? 54.033  -6.631  -30.769 1.00 7.63  ? 160 ASP B N     1 
ATOM   4187  C  CA    . ASP B  1 149 ? 54.355  -8.015  -30.397 1.00 7.35  ? 160 ASP B CA    1 
ATOM   4188  C  C     . ASP B  1 149 ? 54.760  -8.805  -31.651 1.00 9.71  ? 160 ASP B C     1 
ATOM   4189  O  O     . ASP B  1 149 ? 55.470  -9.794  -31.531 1.00 8.39  ? 160 ASP B O     1 
ATOM   4190  C  CB    . ASP B  1 149 ? 53.108  -8.664  -29.780 1.00 8.94  ? 160 ASP B CB    1 
ATOM   4191  C  CG    . ASP B  1 149 ? 51.960  -8.765  -30.786 1.00 9.66  ? 160 ASP B CG    1 
ATOM   4192  O  OD1   . ASP B  1 149 ? 51.334  -7.730  -31.075 1.00 9.38  ? 160 ASP B OD1   1 
ATOM   4193  O  OD2   . ASP B  1 149 ? 51.748  -9.861  -31.325 1.00 8.85  ? 160 ASP B OD2   1 
ATOM   4194  N  N     . ILE B  1 150 ? 54.278  -8.388  -32.859 1.00 6.74  ? 161 ILE B N     1 
ATOM   4195  C  CA    . ILE B  1 150 ? 54.611  -9.100  -34.118 1.00 5.85  ? 161 ILE B CA    1 
ATOM   4196  C  C     . ILE B  1 150 ? 56.073  -8.875  -34.478 1.00 8.99  ? 161 ILE B C     1 
ATOM   4197  O  O     . ILE B  1 150 ? 56.786  -9.824  -34.802 1.00 7.88  ? 161 ILE B O     1 
ATOM   4198  C  CB    . ILE B  1 150 ? 53.733  -8.646  -35.303 1.00 8.12  ? 161 ILE B CB    1 
ATOM   4199  C  CG1   . ILE B  1 150 ? 52.225  -8.658  -34.924 1.00 8.50  ? 161 ILE B CG1   1 
ATOM   4200  C  CG2   . ILE B  1 150 ? 54.037  -9.543  -36.519 1.00 8.63  ? 161 ILE B CG2   1 
ATOM   4201  C  CD1   . ILE B  1 150 ? 51.345  -8.172  -36.076 1.00 7.74  ? 161 ILE B CD1   1 
ATOM   4202  N  N     . VAL B  1 151 ? 56.498  -7.600  -34.512 1.00 6.93  ? 162 VAL B N     1 
ATOM   4203  C  CA    . VAL B  1 151 ? 57.890  -7.271  -34.831 1.00 7.19  ? 162 VAL B CA    1 
ATOM   4204  C  C     . VAL B  1 151 ? 58.815  -8.030  -33.841 1.00 10.62 ? 162 VAL B C     1 
ATOM   4205  O  O     . VAL B  1 151 ? 59.792  -8.644  -34.265 1.00 8.81  ? 162 VAL B O     1 
ATOM   4206  C  CB    . VAL B  1 151 ? 58.147  -5.739  -34.820 1.00 10.20 ? 162 VAL B CB    1 
ATOM   4207  C  CG1   . VAL B  1 151 ? 59.638  -5.451  -34.983 1.00 10.89 ? 162 VAL B CG1   1 
ATOM   4208  C  CG2   . VAL B  1 151 ? 57.367  -5.058  -35.952 1.00 8.80  ? 162 VAL B CG2   1 
ATOM   4209  N  N     . LEU B  1 152 ? 58.476  -8.018  -32.543 1.00 6.07  ? 163 LEU B N     1 
ATOM   4210  C  CA    . LEU B  1 152 ? 59.312  -8.699  -31.530 1.00 7.11  ? 163 LEU B CA    1 
ATOM   4211  C  C     . LEU B  1 152 ? 59.337  -10.218 -31.732 1.00 10.98 ? 163 LEU B C     1 
ATOM   4212  O  O     . LEU B  1 152 ? 60.388  -10.838 -31.609 1.00 10.09 ? 163 LEU B O     1 
ATOM   4213  C  CB    . LEU B  1 152 ? 58.829  -8.320  -30.122 1.00 6.93  ? 163 LEU B CB    1 
ATOM   4214  C  CG    . LEU B  1 152 ? 59.001  -6.834  -29.798 1.00 10.61 ? 163 LEU B CG    1 
ATOM   4215  C  CD1   . LEU B  1 152 ? 58.073  -6.406  -28.651 1.00 10.33 ? 163 LEU B CD1   1 
ATOM   4216  C  CD2   . LEU B  1 152 ? 60.473  -6.502  -29.513 1.00 10.63 ? 163 LEU B CD2   1 
ATOM   4217  N  N     . ALA B  1 153 ? 58.190  -10.805 -32.116 1.00 7.29  ? 164 ALA B N     1 
ATOM   4218  C  CA    . ALA B  1 153 ? 58.115  -12.254 -32.418 1.00 6.89  ? 164 ALA B CA    1 
ATOM   4219  C  C     . ALA B  1 153 ? 58.978  -12.611 -33.651 1.00 10.98 ? 164 ALA B C     1 
ATOM   4220  O  O     . ALA B  1 153 ? 59.672  -13.642 -33.657 1.00 10.82 ? 164 ALA B O     1 
ATOM   4221  C  CB    . ALA B  1 153 ? 56.663  -12.655 -32.667 1.00 7.21  ? 164 ALA B CB    1 
ATOM   4222  N  N     . ILE B  1 154 ? 58.960  -11.744 -34.671 1.00 7.53  ? 165 ILE B N     1 
ATOM   4223  C  CA    . ILE B  1 154 ? 59.730  -11.942 -35.895 1.00 6.93  ? 165 ILE B CA    1 
ATOM   4224  C  C     . ILE B  1 154 ? 61.237  -11.808 -35.587 1.00 12.01 ? 165 ILE B C     1 
ATOM   4225  O  O     . ILE B  1 154 ? 62.026  -12.623 -36.043 1.00 12.67 ? 165 ILE B O     1 
ATOM   4226  C  CB    . ILE B  1 154 ? 59.227  -11.037 -37.044 1.00 7.31  ? 165 ILE B CB    1 
ATOM   4227  C  CG1   . ILE B  1 154 ? 57.795  -11.491 -37.522 1.00 5.69  ? 165 ILE B CG1   1 
ATOM   4228  C  CG2   . ILE B  1 154 ? 60.228  -11.105 -38.237 1.00 8.11  ? 165 ILE B CG2   1 
ATOM   4229  C  CD1   . ILE B  1 154 ? 57.094  -10.500 -38.463 1.00 12.28 ? 165 ILE B CD1   1 
ATOM   4230  N  N     . LEU B  1 155 ? 61.618  -10.831 -34.765 1.00 9.29  ? 166 LEU B N     1 
ATOM   4231  C  CA    . LEU B  1 155 ? 63.021  -10.700 -34.374 1.00 9.81  ? 166 LEU B CA    1 
ATOM   4232  C  C     . LEU B  1 155 ? 63.527  -11.976 -33.660 1.00 12.92 ? 166 LEU B C     1 
ATOM   4233  O  O     . LEU B  1 155 ? 64.657  -12.416 -33.923 1.00 10.88 ? 166 LEU B O     1 
ATOM   4234  C  CB    . LEU B  1 155 ? 63.230  -9.441  -33.529 1.00 9.57  ? 166 LEU B CB    1 
ATOM   4235  C  CG    . LEU B  1 155 ? 63.132  -8.117  -34.313 1.00 11.56 ? 166 LEU B CG    1 
ATOM   4236  C  CD1   . LEU B  1 155 ? 63.166  -6.927  -33.353 1.00 11.48 ? 166 LEU B CD1   1 
ATOM   4237  C  CD2   . LEU B  1 155 ? 64.292  -7.963  -35.285 1.00 13.49 ? 166 LEU B CD2   1 
ATOM   4238  N  N     . GLU B  1 156 ? 62.656  -12.609 -32.837 1.00 9.98  ? 167 GLU B N     1 
ATOM   4239  C  CA    . GLU B  1 156 ? 62.965  -13.863 -32.135 1.00 10.74 ? 167 GLU B CA    1 
ATOM   4240  C  C     . GLU B  1 156 ? 63.155  -14.979 -33.182 1.00 13.67 ? 167 GLU B C     1 
ATOM   4241  O  O     . GLU B  1 156 ? 64.161  -15.696 -33.143 1.00 12.95 ? 167 GLU B O     1 
ATOM   4242  C  CB    . GLU B  1 156 ? 61.845  -14.235 -31.133 1.00 12.05 ? 167 GLU B CB    1 
ATOM   4243  C  CG    . GLU B  1 156 ? 62.056  -15.598 -30.483 1.00 17.49 ? 167 GLU B CG    1 
ATOM   4244  C  CD    . GLU B  1 156 ? 63.329  -15.745 -29.673 1.00 30.32 ? 167 GLU B CD    1 
ATOM   4245  O  OE1   . GLU B  1 156 ? 63.700  -14.770 -28.984 1.00 17.09 ? 167 GLU B OE1   1 
ATOM   4246  O  OE2   . GLU B  1 156 ? 63.927  -16.846 -29.694 1.00 32.98 ? 167 GLU B OE2   1 
ATOM   4247  N  N     . LEU B  1 157 ? 62.215  -15.095 -34.141 1.00 9.21  ? 168 LEU B N     1 
ATOM   4248  C  CA    . LEU B  1 157 ? 62.312  -16.094 -35.209 1.00 10.01 ? 168 LEU B CA    1 
ATOM   4249  C  C     . LEU B  1 157 ? 63.571  -15.904 -36.063 1.00 13.52 ? 168 LEU B C     1 
ATOM   4250  O  O     . LEU B  1 157 ? 64.188  -16.894 -36.479 1.00 11.91 ? 168 LEU B O     1 
ATOM   4251  C  CB    . LEU B  1 157 ? 61.072  -16.033 -36.129 1.00 9.77  ? 168 LEU B CB    1 
ATOM   4252  C  CG    . LEU B  1 157 ? 59.768  -16.540 -35.505 1.00 11.81 ? 168 LEU B CG    1 
ATOM   4253  C  CD1   . LEU B  1 157 ? 58.597  -16.293 -36.439 1.00 10.73 ? 168 LEU B CD1   1 
ATOM   4254  C  CD2   . LEU B  1 157 ? 59.883  -18.024 -35.054 1.00 11.35 ? 168 LEU B CD2   1 
ATOM   4255  N  N     . LEU B  1 158 ? 63.967  -14.630 -36.294 1.00 11.18 ? 169 LEU B N     1 
ATOM   4256  C  CA    . LEU B  1 158 ? 65.154  -14.296 -37.099 1.00 10.17 ? 169 LEU B CA    1 
ATOM   4257  C  C     . LEU B  1 158 ? 66.460  -14.786 -36.473 1.00 13.60 ? 169 LEU B C     1 
ATOM   4258  O  O     . LEU B  1 158 ? 67.486  -14.840 -37.148 1.00 13.61 ? 169 LEU B O     1 
ATOM   4259  C  CB    . LEU B  1 158 ? 65.226  -12.802 -37.410 1.00 9.92  ? 169 LEU B CB    1 
ATOM   4260  C  CG    . LEU B  1 158 ? 64.208  -12.288 -38.458 1.00 13.94 ? 169 LEU B CG    1 
ATOM   4261  C  CD1   . LEU B  1 158 ? 64.221  -10.780 -38.508 1.00 15.01 ? 169 LEU B CD1   1 
ATOM   4262  C  CD2   . LEU B  1 158 ? 64.524  -12.835 -39.860 1.00 14.77 ? 169 LEU B CD2   1 
ATOM   4263  N  N     . LYS B  1 159 ? 66.418  -15.185 -35.211 1.00 11.80 ? 170 LYS B N     1 
ATOM   4264  C  CA    . LYS B  1 159 ? 67.615  -15.739 -34.567 1.00 11.40 ? 170 LYS B CA    1 
ATOM   4265  C  C     . LYS B  1 159 ? 67.961  -17.108 -35.186 1.00 16.34 ? 170 LYS B C     1 
ATOM   4266  O  O     . LYS B  1 159 ? 69.138  -17.436 -35.265 1.00 15.81 ? 170 LYS B O     1 
ATOM   4267  C  CB    . LYS B  1 159 ? 67.390  -15.920 -33.064 1.00 12.94 ? 170 LYS B CB    1 
ATOM   4268  C  CG    . LYS B  1 159 ? 67.294  -14.618 -32.282 1.00 12.82 ? 170 LYS B CG    1 
ATOM   4269  C  CD    . LYS B  1 159 ? 66.943  -14.923 -30.838 1.00 18.67 ? 170 LYS B CD    1 
ATOM   4270  C  CE    . LYS B  1 159 ? 66.897  -13.671 -30.004 1.00 19.17 ? 170 LYS B CE    1 
ATOM   4271  N  NZ    . LYS B  1 159 ? 66.427  -13.996 -28.619 1.00 16.90 ? 170 LYS B NZ    1 
ATOM   4272  N  N     . TYR B  1 160 ? 66.935  -17.899 -35.609 1.00 13.57 ? 171 TYR B N     1 
ATOM   4273  C  CA    . TYR B  1 160 ? 67.072  -19.263 -36.148 1.00 13.54 ? 171 TYR B CA    1 
ATOM   4274  C  C     . TYR B  1 160 ? 66.683  -19.403 -37.609 1.00 17.25 ? 171 TYR B C     1 
ATOM   4275  O  O     . TYR B  1 160 ? 67.042  -20.392 -38.242 1.00 15.93 ? 171 TYR B O     1 
ATOM   4276  C  CB    . TYR B  1 160 ? 66.186  -20.217 -35.314 1.00 15.89 ? 171 TYR B CB    1 
ATOM   4277  C  CG    . TYR B  1 160 ? 66.697  -20.460 -33.912 1.00 20.34 ? 171 TYR B CG    1 
ATOM   4278  C  CD1   . TYR B  1 160 ? 67.273  -21.677 -33.560 1.00 23.87 ? 171 TYR B CD1   1 
ATOM   4279  C  CD2   . TYR B  1 160 ? 66.591  -19.481 -32.931 1.00 21.38 ? 171 TYR B CD2   1 
ATOM   4280  C  CE1   . TYR B  1 160 ? 67.746  -21.904 -32.266 1.00 25.07 ? 171 TYR B CE1   1 
ATOM   4281  C  CE2   . TYR B  1 160 ? 67.092  -19.683 -31.650 1.00 22.61 ? 171 TYR B CE2   1 
ATOM   4282  C  CZ    . TYR B  1 160 ? 67.660  -20.901 -31.318 1.00 30.74 ? 171 TYR B CZ    1 
ATOM   4283  O  OH    . TYR B  1 160 ? 68.126  -21.101 -30.043 1.00 34.25 ? 171 TYR B OH    1 
ATOM   4284  N  N     . HIS B  1 161 ? 65.903  -18.445 -38.138 1.00 12.79 ? 172 HIS B N     1 
ATOM   4285  C  CA    . HIS B  1 161 ? 65.379  -18.519 -39.499 1.00 11.86 ? 172 HIS B CA    1 
ATOM   4286  C  C     . HIS B  1 161 ? 65.954  -17.438 -40.380 1.00 15.92 ? 172 HIS B C     1 
ATOM   4287  O  O     . HIS B  1 161 ? 65.850  -16.262 -40.048 1.00 13.65 ? 172 HIS B O     1 
ATOM   4288  C  CB    . HIS B  1 161 ? 63.833  -18.463 -39.453 1.00 10.95 ? 172 HIS B CB    1 
ATOM   4289  C  CG    . HIS B  1 161 ? 63.237  -19.648 -38.743 1.00 12.37 ? 172 HIS B CG    1 
ATOM   4290  N  ND1   . HIS B  1 161 ? 63.027  -20.849 -39.399 1.00 13.78 ? 172 HIS B ND1   1 
ATOM   4291  C  CD2   . HIS B  1 161 ? 62.853  -19.788 -37.449 1.00 12.77 ? 172 HIS B CD2   1 
ATOM   4292  C  CE1   . HIS B  1 161 ? 62.513  -21.671 -38.498 1.00 12.47 ? 172 HIS B CE1   1 
ATOM   4293  N  NE2   . HIS B  1 161 ? 62.409  -21.089 -37.303 1.00 11.89 ? 172 HIS B NE2   1 
ATOM   4294  N  N     . GLN B  1 162 ? 66.594  -17.837 -41.511 1.00 13.48 ? 173 GLN B N     1 
ATOM   4295  C  CA    . GLN B  1 162 ? 67.208  -16.890 -42.453 1.00 12.86 ? 173 GLN B CA    1 
ATOM   4296  C  C     . GLN B  1 162 ? 66.139  -15.996 -43.086 1.00 16.04 ? 173 GLN B C     1 
ATOM   4297  O  O     . GLN B  1 162 ? 66.347  -14.802 -43.241 1.00 13.83 ? 173 GLN B O     1 
ATOM   4298  C  CB    . GLN B  1 162 ? 67.965  -17.668 -43.555 1.00 14.50 ? 173 GLN B CB    1 
ATOM   4299  C  CG    . GLN B  1 162 ? 68.672  -16.786 -44.592 1.00 29.57 ? 173 GLN B CG    1 
ATOM   4300  C  CD    . GLN B  1 162 ? 69.587  -15.755 -43.981 1.00 43.22 ? 173 GLN B CD    1 
ATOM   4301  O  OE1   . GLN B  1 162 ? 70.280  -16.004 -42.983 1.00 31.37 ? 173 GLN B OE1   1 
ATOM   4302  N  NE2   . GLN B  1 162 ? 69.606  -14.570 -44.583 1.00 38.84 ? 173 GLN B NE2   1 
ATOM   4303  N  N     . ARG B  1 163 ? 64.984  -16.601 -43.433 1.00 13.21 ? 174 ARG B N     1 
ATOM   4304  C  CA    . ARG B  1 163 ? 63.876  -15.912 -44.072 1.00 11.99 ? 174 ARG B CA    1 
ATOM   4305  C  C     . ARG B  1 163 ? 62.570  -16.225 -43.339 1.00 14.98 ? 174 ARG B C     1 
ATOM   4306  O  O     . ARG B  1 163 ? 62.209  -17.385 -43.166 1.00 14.00 ? 174 ARG B O     1 
ATOM   4307  C  CB    . ARG B  1 163 ? 63.775  -16.347 -45.544 1.00 11.39 ? 174 ARG B CB    1 
ATOM   4308  C  CG    . ARG B  1 163 ? 64.945  -15.794 -46.400 1.00 16.51 ? 174 ARG B CG    1 
ATOM   4309  C  CD    . ARG B  1 163 ? 64.856  -16.213 -47.861 1.00 22.23 ? 174 ARG B CD    1 
ATOM   4310  N  NE    . ARG B  1 163 ? 64.815  -17.669 -47.985 1.00 19.39 ? 174 ARG B NE    1 
ATOM   4311  C  CZ    . ARG B  1 163 ? 65.874  -18.465 -47.871 1.00 40.86 ? 174 ARG B CZ    1 
ATOM   4312  N  NH1   . ARG B  1 163 ? 65.731  -19.782 -47.952 1.00 34.23 ? 174 ARG B NH1   1 
ATOM   4313  N  NH2   . ARG B  1 163 ? 67.085  -17.951 -47.669 1.00 22.16 ? 174 ARG B NH2   1 
ATOM   4314  N  N     . VAL B  1 164 ? 61.877  -15.172 -42.930 1.00 11.17 ? 175 VAL B N     1 
ATOM   4315  C  CA    . VAL B  1 164 ? 60.593  -15.236 -42.231 1.00 9.53  ? 175 VAL B CA    1 
ATOM   4316  C  C     . VAL B  1 164 ? 59.542  -14.594 -43.124 1.00 14.12 ? 175 VAL B C     1 
ATOM   4317  O  O     . VAL B  1 164 ? 59.744  -13.496 -43.620 1.00 15.09 ? 175 VAL B O     1 
ATOM   4318  C  CB    . VAL B  1 164 ? 60.649  -14.544 -40.853 1.00 11.23 ? 175 VAL B CB    1 
ATOM   4319  C  CG1   . VAL B  1 164 ? 59.266  -14.534 -40.190 1.00 10.26 ? 175 VAL B CG1   1 
ATOM   4320  C  CG2   . VAL B  1 164 ? 61.671  -15.223 -39.929 1.00 11.52 ? 175 VAL B CG2   1 
ATOM   4321  N  N     . LEU B  1 165 ? 58.404  -15.255 -43.287 1.00 9.83  ? 176 LEU B N     1 
ATOM   4322  C  CA    . LEU B  1 165 ? 57.299  -14.696 -44.064 1.00 7.58  ? 176 LEU B CA    1 
ATOM   4323  C  C     . LEU B  1 165 ? 56.259  -14.180 -43.086 1.00 10.39 ? 176 LEU B C     1 
ATOM   4324  O  O     . LEU B  1 165 ? 55.837  -14.914 -42.176 1.00 9.26  ? 176 LEU B O     1 
ATOM   4325  C  CB    . LEU B  1 165 ? 56.652  -15.788 -44.937 1.00 6.70  ? 176 LEU B CB    1 
ATOM   4326  C  CG    . LEU B  1 165 ? 55.359  -15.383 -45.689 1.00 9.89  ? 176 LEU B CG    1 
ATOM   4327  C  CD1   . LEU B  1 165 ? 55.581  -14.175 -46.599 1.00 10.24 ? 176 LEU B CD1   1 
ATOM   4328  C  CD2   . LEU B  1 165 ? 54.839  -16.555 -46.508 1.00 11.31 ? 176 LEU B CD2   1 
ATOM   4329  N  N     . TYR B  1 166 ? 55.778  -12.952 -43.337 1.00 9.16  ? 177 TYR B N     1 
ATOM   4330  C  CA    . TYR B  1 166 ? 54.692  -12.372 -42.550 1.00 8.86  ? 177 TYR B CA    1 
ATOM   4331  C  C     . TYR B  1 166 ? 53.489  -12.203 -43.475 1.00 12.78 ? 177 TYR B C     1 
ATOM   4332  O  O     . TYR B  1 166 ? 53.632  -11.600 -44.536 1.00 10.76 ? 177 TYR B O     1 
ATOM   4333  C  CB    . TYR B  1 166 ? 55.102  -11.002 -41.969 1.00 8.72  ? 177 TYR B CB    1 
ATOM   4334  C  CG    . TYR B  1 166 ? 53.953  -10.272 -41.303 1.00 8.21  ? 177 TYR B CG    1 
ATOM   4335  C  CD1   . TYR B  1 166 ? 53.397  -10.743 -40.115 1.00 9.50  ? 177 TYR B CD1   1 
ATOM   4336  C  CD2   . TYR B  1 166 ? 53.438  -9.093  -41.845 1.00 8.33  ? 177 TYR B CD2   1 
ATOM   4337  C  CE1   . TYR B  1 166 ? 52.338  -10.072 -39.490 1.00 9.32  ? 177 TYR B CE1   1 
ATOM   4338  C  CE2   . TYR B  1 166 ? 52.390  -8.405  -41.218 1.00 8.33  ? 177 TYR B CE2   1 
ATOM   4339  C  CZ    . TYR B  1 166 ? 51.846  -8.898  -40.041 1.00 9.27  ? 177 TYR B CZ    1 
ATOM   4340  O  OH    . TYR B  1 166 ? 50.822  -8.226  -39.391 1.00 8.34  ? 177 TYR B OH    1 
ATOM   4341  N  N     . ILE B  1 167 ? 52.300  -12.690 -43.053 1.00 9.28  ? 178 ILE B N     1 
ATOM   4342  C  CA    . ILE B  1 167 ? 51.036  -12.576 -43.805 1.00 9.10  ? 178 ILE B CA    1 
ATOM   4343  C  C     . ILE B  1 167 ? 50.000  -11.865 -42.901 1.00 11.17 ? 178 ILE B C     1 
ATOM   4344  O  O     . ILE B  1 167 ? 49.814  -12.248 -41.733 1.00 9.31  ? 178 ILE B O     1 
ATOM   4345  C  CB    . ILE B  1 167 ? 50.516  -13.938 -44.364 1.00 11.44 ? 178 ILE B CB    1 
ATOM   4346  C  CG1   . ILE B  1 167 ? 51.617  -14.690 -45.171 1.00 10.04 ? 178 ILE B CG1   1 
ATOM   4347  C  CG2   . ILE B  1 167 ? 49.209  -13.760 -45.203 1.00 11.17 ? 178 ILE B CG2   1 
ATOM   4348  C  CD1   . ILE B  1 167 ? 51.389  -16.198 -45.263 1.00 9.89  ? 178 ILE B CD1   1 
ATOM   4349  N  N     . ASP B  1 168 ? 49.322  -10.842 -43.459 1.00 7.53  ? 179 ASP B N     1 
ATOM   4350  C  CA    . ASP B  1 168 ? 48.404  -10.032 -42.671 1.00 6.98  ? 179 ASP B CA    1 
ATOM   4351  C  C     . ASP B  1 168 ? 47.047  -9.977  -43.360 1.00 10.70 ? 179 ASP B C     1 
ATOM   4352  O  O     . ASP B  1 168 ? 46.910  -9.332  -44.405 1.00 11.44 ? 179 ASP B O     1 
ATOM   4353  C  CB    . ASP B  1 168 ? 49.043  -8.635  -42.511 1.00 8.04  ? 179 ASP B CB    1 
ATOM   4354  C  CG    . ASP B  1 168 ? 48.382  -7.702  -41.546 1.00 8.90  ? 179 ASP B CG    1 
ATOM   4355  O  OD1   . ASP B  1 168 ? 47.138  -7.661  -41.521 1.00 7.92  ? 179 ASP B OD1   1 
ATOM   4356  O  OD2   . ASP B  1 168 ? 49.117  -6.988  -40.806 1.00 9.15  ? 179 ASP B OD2   1 
ATOM   4357  N  N     . ILE B  1 169 ? 46.032  -10.653 -42.757 1.00 8.38  ? 180 ILE B N     1 
ATOM   4358  C  CA    . ILE B  1 169 ? 44.657  -10.704 -43.309 1.00 6.24  ? 180 ILE B CA    1 
ATOM   4359  C  C     . ILE B  1 169 ? 43.669  -9.813  -42.563 1.00 9.37  ? 180 ILE B C     1 
ATOM   4360  O  O     . ILE B  1 169 ? 42.459  -9.823  -42.830 1.00 9.13  ? 180 ILE B O     1 
ATOM   4361  C  CB    . ILE B  1 169 ? 44.135  -12.145 -43.547 1.00 7.34  ? 180 ILE B CB    1 
ATOM   4362  C  CG1   . ILE B  1 169 ? 43.925  -12.877 -42.222 1.00 6.15  ? 180 ILE B CG1   1 
ATOM   4363  C  CG2   . ILE B  1 169 ? 45.072  -12.897 -44.515 1.00 7.17  ? 180 ILE B CG2   1 
ATOM   4364  C  CD1   . ILE B  1 169 ? 43.136  -14.270 -42.344 1.00 7.48  ? 180 ILE B CD1   1 
ATOM   4365  N  N     . ASP B  1 170 ? 44.209  -8.987  -41.668 1.00 6.86  ? 181 ASP B N     1 
ATOM   4366  C  CA    . ASP B  1 170 ? 43.413  -7.959  -41.002 1.00 5.95  ? 181 ASP B CA    1 
ATOM   4367  C  C     . ASP B  1 170 ? 42.897  -7.041  -42.121 1.00 8.94  ? 181 ASP B C     1 
ATOM   4368  O  O     . ASP B  1 170 ? 43.571  -6.935  -43.151 1.00 7.21  ? 181 ASP B O     1 
ATOM   4369  C  CB    . ASP B  1 170 ? 44.347  -7.144  -40.112 1.00 7.47  ? 181 ASP B CB    1 
ATOM   4370  C  CG    . ASP B  1 170 ? 43.638  -6.202  -39.155 1.00 6.43  ? 181 ASP B CG    1 
ATOM   4371  O  OD1   . ASP B  1 170 ? 43.654  -6.474  -37.947 1.00 8.61  ? 181 ASP B OD1   1 
ATOM   4372  O  OD2   . ASP B  1 170 ? 43.182  -5.140  -39.606 1.00 8.94  ? 181 ASP B OD2   1 
ATOM   4373  N  N     . ILE B  1 171 ? 41.733  -6.370  -41.948 1.00 5.80  ? 182 ILE B N     1 
ATOM   4374  C  CA    . ILE B  1 171 ? 41.264  -5.443  -43.006 1.00 6.24  ? 182 ILE B CA    1 
ATOM   4375  C  C     . ILE B  1 171 ? 42.229  -4.230  -43.183 1.00 10.15 ? 182 ILE B C     1 
ATOM   4376  O  O     . ILE B  1 171 ? 42.227  -3.594  -44.240 1.00 8.38  ? 182 ILE B O     1 
ATOM   4377  C  CB    . ILE B  1 171 ? 39.795  -4.953  -42.805 1.00 7.89  ? 182 ILE B CB    1 
ATOM   4378  C  CG1   . ILE B  1 171 ? 39.229  -4.333  -44.131 1.00 8.05  ? 182 ILE B CG1   1 
ATOM   4379  C  CG2   . ILE B  1 171 ? 39.658  -3.990  -41.608 1.00 7.19  ? 182 ILE B CG2   1 
ATOM   4380  C  CD1   . ILE B  1 171 ? 37.708  -4.039  -44.048 1.00 10.35 ? 182 ILE B CD1   1 
ATOM   4381  N  N     . HIS B  1 172 ? 43.006  -3.897  -42.148 1.00 7.53  ? 183 HIS B N     1 
ATOM   4382  C  CA    . HIS B  1 172 ? 43.928  -2.756  -42.212 1.00 7.56  ? 183 HIS B CA    1 
ATOM   4383  C  C     . HIS B  1 172 ? 45.346  -3.192  -42.614 1.00 10.91 ? 183 HIS B C     1 
ATOM   4384  O  O     . HIS B  1 172 ? 45.776  -4.308  -42.304 1.00 8.42  ? 183 HIS B O     1 
ATOM   4385  C  CB    . HIS B  1 172 ? 43.964  -2.015  -40.848 1.00 7.48  ? 183 HIS B CB    1 
ATOM   4386  C  CG    . HIS B  1 172 ? 42.616  -1.528  -40.406 1.00 10.03 ? 183 HIS B CG    1 
ATOM   4387  N  ND1   . HIS B  1 172 ? 41.860  -2.225  -39.465 1.00 10.94 ? 183 HIS B ND1   1 
ATOM   4388  C  CD2   . HIS B  1 172 ? 41.920  -0.436  -40.804 1.00 10.83 ? 183 HIS B CD2   1 
ATOM   4389  C  CE1   . HIS B  1 172 ? 40.729  -1.543  -39.331 1.00 10.06 ? 183 HIS B CE1   1 
ATOM   4390  N  NE2   . HIS B  1 172 ? 40.718  -0.451  -40.108 1.00 9.96  ? 183 HIS B NE2   1 
ATOM   4391  N  N     . HIS B  1 173 ? 46.074  -2.293  -43.293 1.00 8.47  ? 184 HIS B N     1 
ATOM   4392  C  CA    . HIS B  1 173 ? 47.464  -2.527  -43.694 1.00 8.55  ? 184 HIS B CA    1 
ATOM   4393  C  C     . HIS B  1 173 ? 48.371  -2.773  -42.452 1.00 10.88 ? 184 HIS B C     1 
ATOM   4394  O  O     . HIS B  1 173 ? 48.289  -2.029  -41.479 1.00 9.18  ? 184 HIS B O     1 
ATOM   4395  C  CB    . HIS B  1 173 ? 47.994  -1.272  -44.439 1.00 9.55  ? 184 HIS B CB    1 
ATOM   4396  C  CG    . HIS B  1 173 ? 49.433  -1.391  -44.863 1.00 12.05 ? 184 HIS B CG    1 
ATOM   4397  N  ND1   . HIS B  1 173 ? 50.356  -0.405  -44.567 1.00 13.56 ? 184 HIS B ND1   1 
ATOM   4398  C  CD2   . HIS B  1 173 ? 50.045  -2.373  -45.565 1.00 13.00 ? 184 HIS B CD2   1 
ATOM   4399  C  CE1   . HIS B  1 173 ? 51.498  -0.814  -45.097 1.00 13.22 ? 184 HIS B CE1   1 
ATOM   4400  N  NE2   . HIS B  1 173 ? 51.366  -2.000  -45.702 1.00 13.02 ? 184 HIS B NE2   1 
ATOM   4401  N  N     . GLY B  1 174 ? 49.250  -3.780  -42.522 1.00 10.16 ? 185 GLY B N     1 
ATOM   4402  C  CA    . GLY B  1 174 ? 50.223  -4.057  -41.462 1.00 9.36  ? 185 GLY B CA    1 
ATOM   4403  C  C     . GLY B  1 174 ? 51.422  -3.131  -41.584 1.00 11.81 ? 185 GLY B C     1 
ATOM   4404  O  O     . GLY B  1 174 ? 52.540  -3.589  -41.804 1.00 10.69 ? 185 GLY B O     1 
ATOM   4405  N  N     . ASP B  1 175 ? 51.201  -1.819  -41.431 1.00 8.49  ? 186 ASP B N     1 
ATOM   4406  C  CA    . ASP B  1 175 ? 52.241  -0.789  -41.580 1.00 7.99  ? 186 ASP B CA    1 
ATOM   4407  C  C     . ASP B  1 175 ? 53.431  -0.890  -40.616 1.00 11.66 ? 186 ASP B C     1 
ATOM   4408  O  O     . ASP B  1 175 ? 54.572  -0.724  -41.057 1.00 9.80  ? 186 ASP B O     1 
ATOM   4409  C  CB    . ASP B  1 175 ? 51.628  0.639   -41.539 1.00 8.97  ? 186 ASP B CB    1 
ATOM   4410  C  CG    . ASP B  1 175 ? 50.935  1.025   -40.239 1.00 15.39 ? 186 ASP B CG    1 
ATOM   4411  O  OD1   . ASP B  1 175 ? 50.829  2.237   -39.956 1.00 13.51 ? 186 ASP B OD1   1 
ATOM   4412  O  OD2   . ASP B  1 175 ? 50.591  0.134   -39.473 1.00 12.20 ? 186 ASP B OD2   1 
ATOM   4413  N  N     . GLY B  1 176 ? 53.171  -1.117  -39.324 1.00 7.04  ? 187 GLY B N     1 
ATOM   4414  C  CA    . GLY B  1 176 ? 54.253  -1.181  -38.339 1.00 7.52  ? 187 GLY B CA    1 
ATOM   4415  C  C     . GLY B  1 176 ? 55.204  -2.329  -38.616 1.00 11.64 ? 187 GLY B C     1 
ATOM   4416  O  O     . GLY B  1 176 ? 56.416  -2.185  -38.459 1.00 12.70 ? 187 GLY B O     1 
ATOM   4417  N  N     . VAL B  1 177 ? 54.664  -3.477  -39.058 1.00 8.11  ? 188 VAL B N     1 
ATOM   4418  C  CA    . VAL B  1 177 ? 55.485  -4.667  -39.362 1.00 6.60  ? 188 VAL B CA    1 
ATOM   4419  C  C     . VAL B  1 177 ? 56.242  -4.405  -40.667 1.00 10.87 ? 188 VAL B C     1 
ATOM   4420  O  O     . VAL B  1 177 ? 57.445  -4.671  -40.756 1.00 10.23 ? 188 VAL B O     1 
ATOM   4421  C  CB    . VAL B  1 177 ? 54.666  -5.988  -39.443 1.00 10.07 ? 188 VAL B CB    1 
ATOM   4422  C  CG1   . VAL B  1 177 ? 55.604  -7.194  -39.608 1.00 9.74  ? 188 VAL B CG1   1 
ATOM   4423  C  CG2   . VAL B  1 177 ? 53.785  -6.180  -38.202 1.00 9.78  ? 188 VAL B CG2   1 
ATOM   4424  N  N     . GLU B  1 178 ? 55.527  -3.892  -41.688 1.00 6.67  ? 189 GLU B N     1 
ATOM   4425  C  CA    . GLU B  1 178 ? 56.142  -3.587  -42.987 1.00 7.22  ? 189 GLU B CA    1 
ATOM   4426  C  C     . GLU B  1 178 ? 57.309  -2.608  -42.822 1.00 11.23 ? 189 GLU B C     1 
ATOM   4427  O  O     . GLU B  1 178 ? 58.400  -2.822  -43.377 1.00 11.80 ? 189 GLU B O     1 
ATOM   4428  C  CB    . GLU B  1 178 ? 55.087  -2.957  -43.915 1.00 8.11  ? 189 GLU B CB    1 
ATOM   4429  C  CG    . GLU B  1 178 ? 55.687  -2.585  -45.263 1.00 15.56 ? 189 GLU B CG    1 
ATOM   4430  C  CD    . GLU B  1 178 ? 54.658  -1.992  -46.189 1.00 15.66 ? 189 GLU B CD    1 
ATOM   4431  O  OE1   . GLU B  1 178 ? 53.881  -2.774  -46.772 1.00 12.38 ? 189 GLU B OE1   1 
ATOM   4432  O  OE2   . GLU B  1 178 ? 54.557  -0.747  -46.247 1.00 18.31 ? 189 GLU B OE2   1 
ATOM   4433  N  N     . GLU B  1 179 ? 57.076  -1.557  -42.043 1.00 9.51  ? 190 GLU B N     1 
ATOM   4434  C  CA    . GLU B  1 179 ? 58.053  -0.513  -41.788 1.00 10.37 ? 190 GLU B CA    1 
ATOM   4435  C  C     . GLU B  1 179 ? 59.304  -1.068  -41.095 1.00 13.60 ? 190 GLU B C     1 
ATOM   4436  O  O     . GLU B  1 179 ? 60.409  -0.749  -41.532 1.00 10.28 ? 190 GLU B O     1 
ATOM   4437  C  CB    . GLU B  1 179 ? 57.433  0.617   -40.949 1.00 11.57 ? 190 GLU B CB    1 
ATOM   4438  C  CG    . GLU B  1 179 ? 58.395  1.752   -40.646 1.00 20.77 ? 190 GLU B CG    1 
ATOM   4439  C  CD    . GLU B  1 179 ? 57.766  2.831   -39.793 1.00 35.61 ? 190 GLU B CD    1 
ATOM   4440  O  OE1   . GLU B  1 179 ? 57.976  2.801   -38.561 1.00 30.25 ? 190 GLU B OE1   1 
ATOM   4441  O  OE2   . GLU B  1 179 ? 56.950  3.613   -40.332 1.00 30.78 ? 190 GLU B OE2   1 
ATOM   4442  N  N     . ALA B  1 180 ? 59.129  -1.866  -40.013 1.00 11.33 ? 191 ALA B N     1 
ATOM   4443  C  CA    . ALA B  1 180 ? 60.259  -2.448  -39.276 1.00 11.16 ? 191 ALA B CA    1 
ATOM   4444  C  C     . ALA B  1 180 ? 61.262  -3.170  -40.177 1.00 14.15 ? 191 ALA B C     1 
ATOM   4445  O  O     . ALA B  1 180 ? 62.464  -3.068  -39.946 1.00 14.32 ? 191 ALA B O     1 
ATOM   4446  C  CB    . ALA B  1 180 ? 59.751  -3.401  -38.198 1.00 12.08 ? 191 ALA B CB    1 
ATOM   4447  N  N     . PHE B  1 181 ? 60.761  -3.876  -41.218 1.00 11.41 ? 192 PHE B N     1 
ATOM   4448  C  CA    . PHE B  1 181 ? 61.540  -4.719  -42.124 1.00 10.40 ? 192 PHE B CA    1 
ATOM   4449  C  C     . PHE B  1 181 ? 61.543  -4.241  -43.581 1.00 13.32 ? 192 PHE B C     1 
ATOM   4450  O  O     . PHE B  1 181 ? 61.861  -5.017  -44.486 1.00 12.87 ? 192 PHE B O     1 
ATOM   4451  C  CB    . PHE B  1 181 ? 60.969  -6.154  -42.041 1.00 11.16 ? 192 PHE B CB    1 
ATOM   4452  C  CG    . PHE B  1 181 ? 60.952  -6.698  -40.626 1.00 11.79 ? 192 PHE B CG    1 
ATOM   4453  C  CD1   . PHE B  1 181 ? 59.750  -6.957  -39.979 1.00 13.73 ? 192 PHE B CD1   1 
ATOM   4454  C  CD2   . PHE B  1 181 ? 62.139  -6.889  -39.920 1.00 13.00 ? 192 PHE B CD2   1 
ATOM   4455  C  CE1   . PHE B  1 181 ? 59.735  -7.446  -38.667 1.00 13.48 ? 192 PHE B CE1   1 
ATOM   4456  C  CE2   . PHE B  1 181 ? 62.121  -7.369  -38.601 1.00 14.18 ? 192 PHE B CE2   1 
ATOM   4457  C  CZ    . PHE B  1 181 ? 60.921  -7.637  -37.986 1.00 11.92 ? 192 PHE B CZ    1 
ATOM   4458  N  N     . TYR B  1 182 ? 61.189  -2.971  -43.805 1.00 10.62 ? 193 TYR B N     1 
ATOM   4459  C  CA    . TYR B  1 182 ? 61.096  -2.413  -45.145 1.00 10.87 ? 193 TYR B CA    1 
ATOM   4460  C  C     . TYR B  1 182 ? 62.377  -2.506  -45.944 1.00 14.53 ? 193 TYR B C     1 
ATOM   4461  O  O     . TYR B  1 182 ? 62.318  -2.692  -47.155 1.00 13.63 ? 193 TYR B O     1 
ATOM   4462  C  CB    . TYR B  1 182 ? 60.618  -0.959  -45.099 1.00 11.31 ? 193 TYR B CB    1 
ATOM   4463  C  CG    . TYR B  1 182 ? 59.879  -0.572  -46.358 1.00 13.90 ? 193 TYR B CG    1 
ATOM   4464  C  CD1   . TYR B  1 182 ? 60.353  0.441   -47.186 1.00 15.49 ? 193 TYR B CD1   1 
ATOM   4465  C  CD2   . TYR B  1 182 ? 58.706  -1.227  -46.731 1.00 14.79 ? 193 TYR B CD2   1 
ATOM   4466  C  CE1   . TYR B  1 182 ? 59.661  0.815   -48.338 1.00 13.88 ? 193 TYR B CE1   1 
ATOM   4467  C  CE2   . TYR B  1 182 ? 57.982  -0.831  -47.854 1.00 15.51 ? 193 TYR B CE2   1 
ATOM   4468  C  CZ    . TYR B  1 182 ? 58.465  0.190   -48.654 1.00 18.67 ? 193 TYR B CZ    1 
ATOM   4469  O  OH    . TYR B  1 182 ? 57.783  0.514   -49.793 1.00 20.20 ? 193 TYR B OH    1 
ATOM   4470  N  N     . THR B  1 183 ? 63.528  -2.433  -45.266 1.00 14.34 ? 194 THR B N     1 
ATOM   4471  C  CA    . THR B  1 183 ? 64.828  -2.435  -45.958 1.00 14.69 ? 194 THR B CA    1 
ATOM   4472  C  C     . THR B  1 183 ? 65.603  -3.751  -45.833 1.00 19.89 ? 194 THR B C     1 
ATOM   4473  O  O     . THR B  1 183 ? 66.820  -3.774  -46.053 1.00 19.94 ? 194 THR B O     1 
ATOM   4474  C  CB    . THR B  1 183 ? 65.649  -1.216  -45.518 1.00 19.81 ? 194 THR B CB    1 
ATOM   4475  O  OG1   . THR B  1 183 ? 65.938  -1.359  -44.131 1.00 15.96 ? 194 THR B OG1   1 
ATOM   4476  C  CG2   . THR B  1 183 ? 64.922  0.126   -45.773 1.00 19.25 ? 194 THR B CG2   1 
ATOM   4477  N  N     . THR B  1 184 ? 64.909  -4.857  -45.507 1.00 15.20 ? 195 THR B N     1 
ATOM   4478  C  CA    . THR B  1 184 ? 65.543  -6.175  -45.414 1.00 14.23 ? 195 THR B CA    1 
ATOM   4479  C  C     . THR B  1 184 ? 64.834  -7.204  -46.263 1.00 16.99 ? 195 THR B C     1 
ATOM   4480  O  O     . THR B  1 184 ? 63.613  -7.138  -46.426 1.00 15.03 ? 195 THR B O     1 
ATOM   4481  C  CB    . THR B  1 184 ? 65.705  -6.669  -43.948 1.00 17.34 ? 195 THR B CB    1 
ATOM   4482  O  OG1   . THR B  1 184 ? 66.432  -7.910  -43.981 1.00 14.45 ? 195 THR B OG1   1 
ATOM   4483  C  CG2   . THR B  1 184 ? 64.344  -6.938  -43.256 1.00 12.94 ? 195 THR B CG2   1 
ATOM   4484  N  N     . ASP B  1 185 ? 65.603  -8.184  -46.773 1.00 13.82 ? 196 ASP B N     1 
ATOM   4485  C  CA    . ASP B  1 185 ? 65.083  -9.308  -47.553 1.00 13.46 ? 196 ASP B CA    1 
ATOM   4486  C  C     . ASP B  1 185 ? 64.894  -10.520 -46.622 1.00 16.48 ? 196 ASP B C     1 
ATOM   4487  O  O     . ASP B  1 185 ? 64.412  -11.566 -47.060 1.00 17.45 ? 196 ASP B O     1 
ATOM   4488  C  CB    . ASP B  1 185 ? 66.043  -9.661  -48.712 1.00 14.64 ? 196 ASP B CB    1 
ATOM   4489  C  CG    . ASP B  1 185 ? 67.464  -10.015 -48.308 1.00 23.93 ? 196 ASP B CG    1 
ATOM   4490  O  OD1   . ASP B  1 185 ? 67.882  -9.628  -47.196 1.00 21.74 ? 196 ASP B OD1   1 
ATOM   4491  O  OD2   . ASP B  1 185 ? 68.173  -10.626 -49.128 1.00 32.74 ? 196 ASP B OD2   1 
ATOM   4492  N  N     . ARG B  1 186 ? 65.259  -10.363 -45.334 1.00 13.11 ? 197 ARG B N     1 
ATOM   4493  C  CA    . ARG B  1 186 ? 65.127  -11.424 -44.333 1.00 12.96 ? 197 ARG B CA    1 
ATOM   4494  C  C     . ARG B  1 186 ? 63.712  -11.604 -43.822 1.00 14.91 ? 197 ARG B C     1 
ATOM   4495  O  O     . ARG B  1 186 ? 63.409  -12.615 -43.189 1.00 12.95 ? 197 ARG B O     1 
ATOM   4496  C  CB    . ARG B  1 186 ? 66.123  -11.236 -43.189 1.00 13.95 ? 197 ARG B CB    1 
ATOM   4497  C  CG    . ARG B  1 186 ? 67.569  -11.444 -43.692 1.00 16.04 ? 197 ARG B CG    1 
ATOM   4498  C  CD    . ARG B  1 186 ? 68.511  -11.798 -42.584 1.00 19.86 ? 197 ARG B CD    1 
ATOM   4499  N  NE    . ARG B  1 186 ? 68.039  -12.953 -41.826 1.00 16.63 ? 197 ARG B NE    1 
ATOM   4500  C  CZ    . ARG B  1 186 ? 68.289  -13.127 -40.539 1.00 22.63 ? 197 ARG B CZ    1 
ATOM   4501  N  NH1   . ARG B  1 186 ? 67.803  -14.181 -39.902 1.00 13.52 ? 197 ARG B NH1   1 
ATOM   4502  N  NH2   . ARG B  1 186 ? 69.026  -12.242 -39.873 1.00 16.63 ? 197 ARG B NH2   1 
ATOM   4503  N  N     . VAL B  1 187 ? 62.842  -10.629 -44.098 1.00 12.86 ? 198 VAL B N     1 
ATOM   4504  C  CA    . VAL B  1 187 ? 61.422  -10.700 -43.779 1.00 11.62 ? 198 VAL B CA    1 
ATOM   4505  C  C     . VAL B  1 187 ? 60.642  -10.186 -44.987 1.00 15.32 ? 198 VAL B C     1 
ATOM   4506  O  O     . VAL B  1 187 ? 60.824  -9.032  -45.384 1.00 14.28 ? 198 VAL B O     1 
ATOM   4507  C  CB    . VAL B  1 187 ? 60.981  -9.944  -42.486 1.00 13.54 ? 198 VAL B CB    1 
ATOM   4508  C  CG1   . VAL B  1 187 ? 59.495  -10.206 -42.190 1.00 13.13 ? 198 VAL B CG1   1 
ATOM   4509  C  CG2   . VAL B  1 187 ? 61.827  -10.346 -41.288 1.00 13.24 ? 198 VAL B CG2   1 
ATOM   4510  N  N     . MET B  1 188 ? 59.743  -11.028 -45.530 1.00 10.82 ? 199 MET B N     1 
ATOM   4511  C  CA    . MET B  1 188 ? 58.863  -10.597 -46.590 1.00 11.43 ? 199 MET B CA    1 
ATOM   4512  C  C     . MET B  1 188 ? 57.546  -10.334 -45.892 1.00 13.46 ? 199 MET B C     1 
ATOM   4513  O  O     . MET B  1 188 ? 57.037  -11.214 -45.180 1.00 12.18 ? 199 MET B O     1 
ATOM   4514  C  CB    . MET B  1 188 ? 58.653  -11.660 -47.677 1.00 14.56 ? 199 MET B CB    1 
ATOM   4515  C  CG    . MET B  1 188 ? 57.575  -11.248 -48.673 1.00 19.70 ? 199 MET B CG    1 
ATOM   4516  S  SD    . MET B  1 188 ? 57.475  -12.227 -50.175 1.00 25.55 ? 199 MET B SD    1 
ATOM   4517  C  CE    . MET B  1 188 ? 58.978  -11.759 -50.980 1.00 21.49 ? 199 MET B CE    1 
ATOM   4518  N  N     . THR B  1 189 ? 57.004  -9.147  -46.090 1.00 9.64  ? 200 THR B N     1 
ATOM   4519  C  CA    . THR B  1 189 ? 55.711  -8.782  -45.498 1.00 10.11 ? 200 THR B CA    1 
ATOM   4520  C  C     . THR B  1 189 ? 54.669  -8.802  -46.602 1.00 13.32 ? 200 THR B C     1 
ATOM   4521  O  O     . THR B  1 189 ? 54.919  -8.269  -47.692 1.00 11.54 ? 200 THR B O     1 
ATOM   4522  C  CB    . THR B  1 189 ? 55.783  -7.449  -44.758 1.00 12.40 ? 200 THR B CB    1 
ATOM   4523  O  OG1   . THR B  1 189 ? 56.162  -6.397  -45.675 1.00 12.98 ? 200 THR B OG1   1 
ATOM   4524  C  CG2   . THR B  1 189 ? 56.711  -7.516  -43.520 1.00 9.00  ? 200 THR B CG2   1 
ATOM   4525  N  N     . VAL B  1 190 ? 53.554  -9.503  -46.357 1.00 8.82  ? 201 VAL B N     1 
ATOM   4526  C  CA    . VAL B  1 190 ? 52.451  -9.615  -47.308 1.00 9.25  ? 201 VAL B CA    1 
ATOM   4527  C  C     . VAL B  1 190 ? 51.159  -9.141  -46.636 1.00 12.32 ? 201 VAL B C     1 
ATOM   4528  O  O     . VAL B  1 190 ? 50.684  -9.801  -45.708 1.00 11.86 ? 201 VAL B O     1 
ATOM   4529  C  CB    . VAL B  1 190 ? 52.291  -11.058 -47.869 1.00 11.52 ? 201 VAL B CB    1 
ATOM   4530  C  CG1   . VAL B  1 190 ? 51.173  -11.110 -48.919 1.00 12.00 ? 201 VAL B CG1   1 
ATOM   4531  C  CG2   . VAL B  1 190 ? 53.611  -11.565 -48.456 1.00 10.98 ? 201 VAL B CG2   1 
ATOM   4532  N  N     . SER B  1 191 ? 50.601  -7.989  -47.077 1.00 8.96  ? 202 SER B N     1 
ATOM   4533  C  CA    . SER B  1 191 ? 49.347  -7.511  -46.476 1.00 7.44  ? 202 SER B CA    1 
ATOM   4534  C  C     . SER B  1 191 ? 48.235  -7.416  -47.532 1.00 12.25 ? 202 SER B C     1 
ATOM   4535  O  O     . SER B  1 191 ? 48.463  -6.930  -48.655 1.00 10.93 ? 202 SER B O     1 
ATOM   4536  C  CB    . SER B  1 191 ? 49.548  -6.183  -45.751 1.00 8.83  ? 202 SER B CB    1 
ATOM   4537  O  OG    . SER B  1 191 ? 48.333  -5.687  -45.196 1.00 8.49  ? 202 SER B OG    1 
ATOM   4538  N  N     . PHE B  1 192 ? 47.030  -7.915  -47.171 1.00 9.02  ? 203 PHE B N     1 
ATOM   4539  C  CA    . PHE B  1 192 ? 45.779  -7.810  -47.946 1.00 7.68  ? 203 PHE B CA    1 
ATOM   4540  C  C     . PHE B  1 192 ? 44.935  -6.863  -47.116 1.00 9.79  ? 203 PHE B C     1 
ATOM   4541  O  O     . PHE B  1 192 ? 44.796  -7.061  -45.908 1.00 8.77  ? 203 PHE B O     1 
ATOM   4542  C  CB    . PHE B  1 192 ? 45.085  -9.180  -48.085 1.00 9.45  ? 203 PHE B CB    1 
ATOM   4543  C  CG    . PHE B  1 192 ? 45.969  -10.237 -48.714 1.00 10.60 ? 203 PHE B CG    1 
ATOM   4544  C  CD1   . PHE B  1 192 ? 46.854  -10.980 -47.938 1.00 9.95  ? 203 PHE B CD1   1 
ATOM   4545  C  CD2   . PHE B  1 192 ? 45.895  -10.506 -50.079 1.00 11.59 ? 203 PHE B CD2   1 
ATOM   4546  C  CE1   . PHE B  1 192 ? 47.678  -11.952 -48.524 1.00 10.82 ? 203 PHE B CE1   1 
ATOM   4547  C  CE2   . PHE B  1 192 ? 46.739  -11.461 -50.667 1.00 13.30 ? 203 PHE B CE2   1 
ATOM   4548  C  CZ    . PHE B  1 192 ? 47.625  -12.174 -49.885 1.00 10.42 ? 203 PHE B CZ    1 
ATOM   4549  N  N     . HIS B  1 193 ? 44.436  -5.782  -47.709 1.00 7.72  ? 204 HIS B N     1 
ATOM   4550  C  CA    . HIS B  1 193 ? 43.726  -4.780  -46.896 1.00 6.89  ? 204 HIS B CA    1 
ATOM   4551  C  C     . HIS B  1 193 ? 42.895  -3.851  -47.753 1.00 12.84 ? 204 HIS B C     1 
ATOM   4552  O  O     . HIS B  1 193 ? 43.153  -3.704  -48.961 1.00 12.05 ? 204 HIS B O     1 
ATOM   4553  C  CB    . HIS B  1 193 ? 44.752  -3.895  -46.094 1.00 8.59  ? 204 HIS B CB    1 
ATOM   4554  C  CG    . HIS B  1 193 ? 45.904  -3.427  -46.938 1.00 11.70 ? 204 HIS B CG    1 
ATOM   4555  N  ND1   . HIS B  1 193 ? 47.076  -4.178  -47.047 1.00 12.54 ? 204 HIS B ND1   1 
ATOM   4556  C  CD2   . HIS B  1 193 ? 45.987  -2.372  -47.778 1.00 14.17 ? 204 HIS B CD2   1 
ATOM   4557  C  CE1   . HIS B  1 193 ? 47.833  -3.546  -47.931 1.00 12.51 ? 204 HIS B CE1   1 
ATOM   4558  N  NE2   . HIS B  1 193 ? 47.230  -2.449  -48.394 1.00 13.42 ? 204 HIS B NE2   1 
ATOM   4559  N  N     . LYS B  1 194 ? 41.959  -3.159  -47.103 1.00 9.23  ? 205 LYS B N     1 
ATOM   4560  C  CA    . LYS B  1 194 ? 41.240  -2.091  -47.788 1.00 9.65  ? 205 LYS B CA    1 
ATOM   4561  C  C     . LYS B  1 194 ? 42.228  -0.933  -47.899 1.00 14.41 ? 205 LYS B C     1 
ATOM   4562  O  O     . LYS B  1 194 ? 42.955  -0.618  -46.935 1.00 14.14 ? 205 LYS B O     1 
ATOM   4563  C  CB    . LYS B  1 194 ? 39.995  -1.638  -47.013 1.00 11.91 ? 205 LYS B CB    1 
ATOM   4564  C  CG    . LYS B  1 194 ? 39.462  -0.292  -47.547 1.00 19.49 ? 205 LYS B CG    1 
ATOM   4565  C  CD    . LYS B  1 194 ? 38.061  0.031   -47.145 1.00 29.96 ? 205 LYS B CD    1 
ATOM   4566  C  CE    . LYS B  1 194 ? 37.572  1.373   -47.675 1.00 29.55 ? 205 LYS B CE    1 
ATOM   4567  N  NZ    . LYS B  1 194 ? 37.440  1.363   -49.149 1.00 38.14 ? 205 LYS B NZ    1 
ATOM   4568  N  N     . TYR B  1 195 ? 42.266  -0.307  -49.078 1.00 13.81 ? 206 TYR B N     1 
ATOM   4569  C  CA    . TYR B  1 195 ? 43.124  0.834   -49.373 1.00 14.81 ? 206 TYR B CA    1 
ATOM   4570  C  C     . TYR B  1 195 ? 42.278  1.881   -50.119 1.00 21.52 ? 206 TYR B C     1 
ATOM   4571  O  O     . TYR B  1 195 ? 41.456  1.526   -50.957 1.00 22.29 ? 206 TYR B O     1 
ATOM   4572  C  CB    . TYR B  1 195 ? 44.335  0.401   -50.230 1.00 17.93 ? 206 TYR B CB    1 
ATOM   4573  C  CG    . TYR B  1 195 ? 45.327  1.505   -50.543 1.00 21.00 ? 206 TYR B CG    1 
ATOM   4574  C  CD1   . TYR B  1 195 ? 45.274  2.195   -51.752 1.00 23.86 ? 206 TYR B CD1   1 
ATOM   4575  C  CD2   . TYR B  1 195 ? 46.266  1.914   -49.600 1.00 21.74 ? 206 TYR B CD2   1 
ATOM   4576  C  CE1   . TYR B  1 195 ? 46.153  3.239   -52.027 1.00 24.35 ? 206 TYR B CE1   1 
ATOM   4577  C  CE2   . TYR B  1 195 ? 47.158  2.948   -49.868 1.00 22.20 ? 206 TYR B CE2   1 
ATOM   4578  C  CZ    . TYR B  1 195 ? 47.091  3.616   -51.081 1.00 28.08 ? 206 TYR B CZ    1 
ATOM   4579  O  OH    . TYR B  1 195 ? 47.960  4.644   -51.357 1.00 26.04 ? 206 TYR B OH    1 
ATOM   4580  N  N     . GLY B  1 196 ? 42.471  3.138   -49.769 1.00 20.61 ? 207 GLY B N     1 
ATOM   4581  C  CA    . GLY B  1 196 ? 41.735  4.259   -50.340 1.00 20.84 ? 207 GLY B CA    1 
ATOM   4582  C  C     . GLY B  1 196 ? 41.083  5.061   -49.236 1.00 25.08 ? 207 GLY B C     1 
ATOM   4583  O  O     . GLY B  1 196 ? 39.996  4.708   -48.770 1.00 24.59 ? 207 GLY B O     1 
ATOM   4584  N  N     . GLU B  1 197 ? 41.777  6.101   -48.763 1.00 22.54 ? 208 GLU B N     1 
ATOM   4585  C  CA    . GLU B  1 197 ? 41.295  6.986   -47.695 1.00 23.59 ? 208 GLU B CA    1 
ATOM   4586  C  C     . GLU B  1 197 ? 40.773  6.133   -46.519 1.00 25.20 ? 208 GLU B C     1 
ATOM   4587  O  O     . GLU B  1 197 ? 39.616  6.229   -46.123 1.00 26.60 ? 208 GLU B O     1 
ATOM   4588  C  CB    . GLU B  1 197 ? 40.205  7.954   -48.240 1.00 25.82 ? 208 GLU B CB    1 
ATOM   4589  C  CG    . GLU B  1 197 ? 40.696  8.921   -49.318 1.00 36.61 ? 208 GLU B CG    1 
ATOM   4590  C  CD    . GLU B  1 197 ? 39.664  9.871   -49.904 1.00 65.15 ? 208 GLU B CD    1 
ATOM   4591  O  OE1   . GLU B  1 197 ? 39.981  10.523  -50.925 1.00 61.08 ? 208 GLU B OE1   1 
ATOM   4592  O  OE2   . GLU B  1 197 ? 38.544  9.969   -49.350 1.00 63.43 ? 208 GLU B OE2   1 
ATOM   4593  N  N     . TYR B  1 198 ? 41.610  5.196   -46.060 1.00 17.55 ? 209 TYR B N     1 
ATOM   4594  C  CA    . TYR B  1 198 ? 41.249  4.268   -44.989 1.00 15.45 ? 209 TYR B CA    1 
ATOM   4595  C  C     . TYR B  1 198 ? 42.441  4.146   -44.069 1.00 15.34 ? 209 TYR B C     1 
ATOM   4596  O  O     . TYR B  1 198 ? 43.570  4.262   -44.528 1.00 15.41 ? 209 TYR B O     1 
ATOM   4597  C  CB    . TYR B  1 198 ? 40.904  2.894   -45.601 1.00 15.44 ? 209 TYR B CB    1 
ATOM   4598  C  CG    . TYR B  1 198 ? 40.049  2.023   -44.710 1.00 16.93 ? 209 TYR B CG    1 
ATOM   4599  C  CD1   . TYR B  1 198 ? 40.532  0.818   -44.212 1.00 17.87 ? 209 TYR B CD1   1 
ATOM   4600  C  CD2   . TYR B  1 198 ? 38.723  2.358   -44.438 1.00 18.69 ? 209 TYR B CD2   1 
ATOM   4601  C  CE1   . TYR B  1 198 ? 39.729  -0.021  -43.444 1.00 18.48 ? 209 TYR B CE1   1 
ATOM   4602  C  CE2   . TYR B  1 198 ? 37.906  1.519   -43.683 1.00 19.48 ? 209 TYR B CE2   1 
ATOM   4603  C  CZ    . TYR B  1 198 ? 38.418  0.337   -43.180 1.00 24.47 ? 209 TYR B CZ    1 
ATOM   4604  O  OH    . TYR B  1 198 ? 37.626  -0.484  -42.430 1.00 25.52 ? 209 TYR B OH    1 
ATOM   4605  N  N     . PHE B  1 199 ? 42.204  3.927   -42.785 1.00 12.41 ? 210 PHE B N     1 
ATOM   4606  C  CA    . PHE B  1 199 ? 43.298  3.794   -41.807 1.00 11.81 ? 210 PHE B CA    1 
ATOM   4607  C  C     . PHE B  1 199 ? 44.204  2.588   -42.168 1.00 13.35 ? 210 PHE B C     1 
ATOM   4608  O  O     . PHE B  1 199 ? 43.650  1.548   -42.512 1.00 11.69 ? 210 PHE B O     1 
ATOM   4609  C  CB    . PHE B  1 199 ? 42.715  3.581   -40.397 1.00 12.20 ? 210 PHE B CB    1 
ATOM   4610  C  CG    . PHE B  1 199 ? 43.764  3.617   -39.307 1.00 12.66 ? 210 PHE B CG    1 
ATOM   4611  C  CD1   . PHE B  1 199 ? 44.423  2.449   -38.908 1.00 13.24 ? 210 PHE B CD1   1 
ATOM   4612  C  CD2   . PHE B  1 199 ? 44.169  4.829   -38.746 1.00 13.27 ? 210 PHE B CD2   1 
ATOM   4613  C  CE1   . PHE B  1 199 ? 45.444  2.491   -37.951 1.00 13.34 ? 210 PHE B CE1   1 
ATOM   4614  C  CE2   . PHE B  1 199 ? 45.162  4.865   -37.752 1.00 15.45 ? 210 PHE B CE2   1 
ATOM   4615  C  CZ    . PHE B  1 199 ? 45.810  3.698   -37.380 1.00 12.94 ? 210 PHE B CZ    1 
ATOM   4616  N  N     . PRO B  1 200 ? 45.559  2.653   -42.034 1.00 10.91 ? 211 PRO B N     1 
ATOM   4617  C  CA    . PRO B  1 200 ? 46.395  3.798   -41.641 1.00 12.17 ? 211 PRO B CA    1 
ATOM   4618  C  C     . PRO B  1 200 ? 46.792  4.740   -42.789 1.00 18.75 ? 211 PRO B C     1 
ATOM   4619  O  O     . PRO B  1 200 ? 47.474  5.735   -42.540 1.00 19.05 ? 211 PRO B O     1 
ATOM   4620  C  CB    . PRO B  1 200 ? 47.617  3.117   -41.011 1.00 13.82 ? 211 PRO B CB    1 
ATOM   4621  C  CG    . PRO B  1 200 ? 47.758  1.832   -41.772 1.00 16.57 ? 211 PRO B CG    1 
ATOM   4622  C  CD    . PRO B  1 200 ? 46.387  1.453   -42.273 1.00 11.91 ? 211 PRO B CD    1 
ATOM   4623  N  N     . GLY B  1 201 ? 46.379  4.429   -44.014 1.00 16.57 ? 212 GLY B N     1 
ATOM   4624  C  CA    . GLY B  1 201 ? 46.658  5.273   -45.180 1.00 17.39 ? 212 GLY B CA    1 
ATOM   4625  C  C     . GLY B  1 201 ? 47.797  4.787   -46.045 1.00 22.11 ? 212 GLY B C     1 
ATOM   4626  O  O     . GLY B  1 201 ? 48.074  5.377   -47.088 1.00 23.68 ? 212 GLY B O     1 
ATOM   4627  N  N     . THR B  1 202 ? 48.443  3.689   -45.636 1.00 16.56 ? 213 THR B N     1 
ATOM   4628  C  CA    . THR B  1 202 ? 49.588  3.092   -46.341 1.00 15.54 ? 213 THR B CA    1 
ATOM   4629  C  C     . THR B  1 202 ? 49.187  1.780   -47.003 1.00 17.02 ? 213 THR B C     1 
ATOM   4630  O  O     . THR B  1 202 ? 48.021  1.392   -46.949 1.00 17.49 ? 213 THR B O     1 
ATOM   4631  C  CB    . THR B  1 202 ? 50.748  2.948   -45.346 1.00 20.78 ? 213 THR B CB    1 
ATOM   4632  O  OG1   . THR B  1 202 ? 50.242  2.348   -44.149 1.00 17.70 ? 213 THR B OG1   1 
ATOM   4633  C  CG2   . THR B  1 202 ? 51.379  4.290   -45.000 1.00 22.01 ? 213 THR B CG2   1 
ATOM   4634  N  N     . GLY B  1 203 ? 50.142  1.078   -47.595 1.00 12.79 ? 214 GLY B N     1 
ATOM   4635  C  CA    . GLY B  1 203 ? 49.841  -0.202  -48.209 1.00 12.20 ? 214 GLY B CA    1 
ATOM   4636  C  C     . GLY B  1 203 ? 49.446  -0.081  -49.660 1.00 15.40 ? 214 GLY B C     1 
ATOM   4637  O  O     . GLY B  1 203 ? 48.605  -0.835  -50.145 1.00 12.95 ? 214 GLY B O     1 
ATOM   4638  N  N     . ASP B  1 204 ? 50.067  0.871   -50.366 1.00 11.67 ? 215 ASP B N     1 
ATOM   4639  C  CA    . ASP B  1 204 ? 49.809  1.019   -51.797 1.00 10.89 ? 215 ASP B CA    1 
ATOM   4640  C  C     . ASP B  1 204 ? 50.481  -0.171  -52.486 1.00 13.91 ? 215 ASP B C     1 
ATOM   4641  O  O     . ASP B  1 204 ? 51.529  -0.649  -52.027 1.00 13.44 ? 215 ASP B O     1 
ATOM   4642  C  CB    . ASP B  1 204 ? 50.436  2.345   -52.303 1.00 12.25 ? 215 ASP B CB    1 
ATOM   4643  C  CG    . ASP B  1 204 ? 50.104  2.661   -53.758 1.00 21.63 ? 215 ASP B CG    1 
ATOM   4644  O  OD1   . ASP B  1 204 ? 50.656  2.003   -54.640 1.00 19.84 ? 215 ASP B OD1   1 
ATOM   4645  O  OD2   . ASP B  1 204 ? 49.185  3.462   -53.997 1.00 27.30 ? 215 ASP B OD2   1 
ATOM   4646  N  N     . LEU B  1 205 ? 49.895  -0.618  -53.608 1.00 12.61 ? 216 LEU B N     1 
ATOM   4647  C  CA    . LEU B  1 205 ? 50.415  -1.655  -54.501 1.00 13.78 ? 216 LEU B CA    1 
ATOM   4648  C  C     . LEU B  1 205 ? 51.907  -1.375  -54.833 1.00 15.88 ? 216 LEU B C     1 
ATOM   4649  O  O     . LEU B  1 205 ? 52.721  -2.296  -54.972 1.00 15.33 ? 216 LEU B O     1 
ATOM   4650  C  CB    . LEU B  1 205 ? 49.574  -1.565  -55.836 1.00 14.40 ? 216 LEU B CB    1 
ATOM   4651  C  CG    . LEU B  1 205 ? 49.967  -2.515  -56.993 1.00 19.13 ? 216 LEU B CG    1 
ATOM   4652  C  CD1   . LEU B  1 205 ? 49.882  -3.956  -56.559 1.00 21.49 ? 216 LEU B CD1   1 
ATOM   4653  C  CD2   . LEU B  1 205 ? 49.053  -2.349  -58.160 1.00 19.73 ? 216 LEU B CD2   1 
ATOM   4654  N  N     . ARG B  1 206 ? 52.246  -0.093  -54.966 1.00 13.16 ? 217 ARG B N     1 
ATOM   4655  C  CA    . ARG B  1 206 ? 53.587  0.359   -55.350 1.00 14.04 ? 217 ARG B CA    1 
ATOM   4656  C  C     . ARG B  1 206 ? 54.592  0.438   -54.210 1.00 17.51 ? 217 ARG B C     1 
ATOM   4657  O  O     . ARG B  1 206 ? 55.761  0.749   -54.457 1.00 16.27 ? 217 ARG B O     1 
ATOM   4658  C  CB    . ARG B  1 206 ? 53.505  1.681   -56.135 1.00 13.64 ? 217 ARG B CB    1 
ATOM   4659  C  CG    . ARG B  1 206 ? 52.812  1.474   -57.478 1.00 16.46 ? 217 ARG B CG    1 
ATOM   4660  C  CD    . ARG B  1 206 ? 52.157  2.740   -57.972 1.00 14.63 ? 217 ARG B CD    1 
ATOM   4661  N  NE    . ARG B  1 206 ? 51.085  3.222   -57.095 1.00 14.08 ? 217 ARG B NE    1 
ATOM   4662  C  CZ    . ARG B  1 206 ? 50.394  4.328   -57.336 1.00 24.91 ? 217 ARG B CZ    1 
ATOM   4663  N  NH1   . ARG B  1 206 ? 50.612  5.027   -58.449 1.00 14.40 ? 217 ARG B NH1   1 
ATOM   4664  N  NH2   . ARG B  1 206 ? 49.469  4.737   -56.480 1.00 18.01 ? 217 ARG B NH2   1 
ATOM   4665  N  N     . ASP B  1 207 ? 54.145  0.189   -52.963 1.00 12.32 ? 218 ASP B N     1 
ATOM   4666  C  CA    . ASP B  1 207 ? 55.050  0.125   -51.820 1.00 11.87 ? 218 ASP B CA    1 
ATOM   4667  C  C     . ASP B  1 207 ? 55.603  -1.296  -51.812 1.00 17.10 ? 218 ASP B C     1 
ATOM   4668  O  O     . ASP B  1 207 ? 54.924  -2.237  -51.382 1.00 16.77 ? 218 ASP B O     1 
ATOM   4669  C  CB    . ASP B  1 207 ? 54.328  0.481   -50.517 1.00 12.59 ? 218 ASP B CB    1 
ATOM   4670  C  CG    . ASP B  1 207 ? 53.874  1.930   -50.504 1.00 21.64 ? 218 ASP B CG    1 
ATOM   4671  O  OD1   . ASP B  1 207 ? 52.929  2.244   -49.763 1.00 19.06 ? 218 ASP B OD1   1 
ATOM   4672  O  OD2   . ASP B  1 207 ? 54.408  2.726   -51.307 1.00 23.18 ? 218 ASP B OD2   1 
ATOM   4673  N  N     . ILE B  1 208 ? 56.795  -1.465  -52.388 1.00 13.88 ? 219 ILE B N     1 
ATOM   4674  C  CA    . ILE B  1 208 ? 57.402  -2.796  -52.566 1.00 13.59 ? 219 ILE B CA    1 
ATOM   4675  C  C     . ILE B  1 208 ? 58.673  -3.053  -51.752 1.00 14.56 ? 219 ILE B C     1 
ATOM   4676  O  O     . ILE B  1 208 ? 59.310  -4.090  -51.933 1.00 13.78 ? 219 ILE B O     1 
ATOM   4677  C  CB    . ILE B  1 208 ? 57.651  -3.063  -54.086 1.00 17.10 ? 219 ILE B CB    1 
ATOM   4678  C  CG1   . ILE B  1 208 ? 58.728  -2.078  -54.655 1.00 17.37 ? 219 ILE B CG1   1 
ATOM   4679  C  CG2   . ILE B  1 208 ? 56.339  -3.027  -54.879 1.00 18.62 ? 219 ILE B CG2   1 
ATOM   4680  C  CD1   . ILE B  1 208 ? 59.269  -2.389  -56.089 1.00 20.48 ? 219 ILE B CD1   1 
ATOM   4681  N  N     . GLY B  1 209 ? 59.056  -2.118  -50.899 1.00 13.46 ? 220 GLY B N     1 
ATOM   4682  C  CA    . GLY B  1 209 ? 60.301  -2.252  -50.136 1.00 13.45 ? 220 GLY B CA    1 
ATOM   4683  C  C     . GLY B  1 209 ? 61.371  -1.322  -50.682 1.00 18.89 ? 220 GLY B C     1 
ATOM   4684  O  O     . GLY B  1 209 ? 61.174  -0.705  -51.737 1.00 18.22 ? 220 GLY B O     1 
ATOM   4685  N  N     . ALA B  1 210 ? 62.525  -1.224  -49.993 1.00 16.42 ? 221 ALA B N     1 
ATOM   4686  C  CA    . ALA B  1 210 ? 63.619  -0.357  -50.439 1.00 17.14 ? 221 ALA B CA    1 
ATOM   4687  C  C     . ALA B  1 210 ? 64.971  -0.976  -50.117 1.00 22.21 ? 221 ALA B C     1 
ATOM   4688  O  O     . ALA B  1 210 ? 65.058  -1.822  -49.222 1.00 20.12 ? 221 ALA B O     1 
ATOM   4689  C  CB    . ALA B  1 210 ? 63.490  1.019   -49.795 1.00 17.93 ? 221 ALA B CB    1 
ATOM   4690  N  N     . GLY B  1 211 ? 66.009  -0.576  -50.866 1.00 19.57 ? 222 GLY B N     1 
ATOM   4691  C  CA    . GLY B  1 211 ? 67.360  -1.085  -50.662 1.00 19.30 ? 222 GLY B CA    1 
ATOM   4692  C  C     . GLY B  1 211 ? 67.384  -2.585  -50.810 1.00 20.83 ? 222 GLY B C     1 
ATOM   4693  O  O     . GLY B  1 211 ? 66.772  -3.107  -51.743 1.00 20.12 ? 222 GLY B O     1 
ATOM   4694  N  N     . LYS B  1 212 ? 67.985  -3.301  -49.835 1.00 16.29 ? 223 LYS B N     1 
ATOM   4695  C  CA    . LYS B  1 212 ? 68.019  -4.777  -49.860 1.00 16.02 ? 223 LYS B CA    1 
ATOM   4696  C  C     . LYS B  1 212 ? 66.618  -5.411  -49.793 1.00 19.90 ? 223 LYS B C     1 
ATOM   4697  O  O     . LYS B  1 212 ? 66.426  -6.551  -50.247 1.00 17.48 ? 223 LYS B O     1 
ATOM   4698  C  CB    . LYS B  1 212 ? 68.876  -5.322  -48.720 1.00 21.06 ? 223 LYS B CB    1 
ATOM   4699  C  CG    . LYS B  1 212 ? 70.052  -6.140  -49.209 1.00 43.28 ? 223 LYS B CG    1 
ATOM   4700  C  CD    . LYS B  1 212 ? 70.562  -7.101  -48.152 1.00 53.22 ? 223 LYS B CD    1 
ATOM   4701  C  CE    . LYS B  1 212 ? 71.646  -7.973  -48.739 1.00 65.83 ? 223 LYS B CE    1 
ATOM   4702  N  NZ    . LYS B  1 212 ? 71.980  -9.122  -47.860 1.00 75.55 ? 223 LYS B NZ    1 
ATOM   4703  N  N     . GLY B  1 213 ? 65.672  -4.668  -49.209 1.00 16.65 ? 224 GLY B N     1 
ATOM   4704  C  CA    . GLY B  1 213 ? 64.290  -5.103  -49.059 1.00 16.36 ? 224 GLY B CA    1 
ATOM   4705  C  C     . GLY B  1 213 ? 63.396  -4.831  -50.256 1.00 18.12 ? 224 GLY B C     1 
ATOM   4706  O  O     . GLY B  1 213 ? 62.206  -5.146  -50.197 1.00 15.41 ? 224 GLY B O     1 
ATOM   4707  N  N     . LYS B  1 214 ? 63.943  -4.261  -51.365 1.00 14.00 ? 225 LYS B N     1 
ATOM   4708  C  CA    . LYS B  1 214 ? 63.127  -4.010  -52.566 1.00 13.87 ? 225 LYS B CA    1 
ATOM   4709  C  C     . LYS B  1 214 ? 62.610  -5.356  -53.095 1.00 16.96 ? 225 LYS B C     1 
ATOM   4710  O  O     . LYS B  1 214 ? 63.417  -6.259  -53.309 1.00 16.40 ? 225 LYS B O     1 
ATOM   4711  C  CB    . LYS B  1 214 ? 63.934  -3.279  -53.663 1.00 16.68 ? 225 LYS B CB    1 
ATOM   4712  C  CG    . LYS B  1 214 ? 63.065  -2.881  -54.873 1.00 23.25 ? 225 LYS B CG    1 
ATOM   4713  C  CD    . LYS B  1 214 ? 63.887  -2.129  -55.946 1.00 25.32 ? 225 LYS B CD    1 
ATOM   4714  C  CE    . LYS B  1 214 ? 63.017  -1.612  -57.070 1.00 45.35 ? 225 LYS B CE    1 
ATOM   4715  N  NZ    . LYS B  1 214 ? 63.797  -1.382  -58.322 1.00 59.84 ? 225 LYS B NZ    1 
ATOM   4716  N  N     . TYR B  1 215 ? 61.269  -5.477  -53.305 1.00 13.64 ? 226 TYR B N     1 
ATOM   4717  C  CA    . TYR B  1 215 ? 60.518  -6.684  -53.741 1.00 14.55 ? 226 TYR B CA    1 
ATOM   4718  C  C     . TYR B  1 215 ? 60.163  -7.608  -52.557 1.00 17.40 ? 226 TYR B C     1 
ATOM   4719  O  O     . TYR B  1 215 ? 59.560  -8.658  -52.774 1.00 17.03 ? 226 TYR B O     1 
ATOM   4720  C  CB    . TYR B  1 215 ? 61.170  -7.478  -54.902 1.00 17.12 ? 226 TYR B CB    1 
ATOM   4721  C  CG    . TYR B  1 215 ? 61.356  -6.644  -56.150 1.00 21.05 ? 226 TYR B CG    1 
ATOM   4722  C  CD1   . TYR B  1 215 ? 60.258  -6.161  -56.861 1.00 22.72 ? 226 TYR B CD1   1 
ATOM   4723  C  CD2   . TYR B  1 215 ? 62.628  -6.312  -56.606 1.00 22.50 ? 226 TYR B CD2   1 
ATOM   4724  C  CE1   . TYR B  1 215 ? 60.424  -5.353  -57.987 1.00 24.55 ? 226 TYR B CE1   1 
ATOM   4725  C  CE2   . TYR B  1 215 ? 62.805  -5.499  -57.724 1.00 23.37 ? 226 TYR B CE2   1 
ATOM   4726  C  CZ    . TYR B  1 215 ? 61.699  -5.040  -58.424 1.00 32.20 ? 226 TYR B CZ    1 
ATOM   4727  O  OH    . TYR B  1 215 ? 61.857  -4.265  -59.549 1.00 35.58 ? 226 TYR B OH    1 
ATOM   4728  N  N     . TYR B  1 216 ? 60.513  -7.194  -51.317 1.00 14.37 ? 227 TYR B N     1 
ATOM   4729  C  CA    . TYR B  1 216 ? 60.223  -7.963  -50.095 1.00 13.95 ? 227 TYR B CA    1 
ATOM   4730  C  C     . TYR B  1 216 ? 59.101  -7.389  -49.250 1.00 15.19 ? 227 TYR B C     1 
ATOM   4731  O  O     . TYR B  1 216 ? 58.928  -7.785  -48.111 1.00 14.38 ? 227 TYR B O     1 
ATOM   4732  C  CB    . TYR B  1 216 ? 61.494  -8.285  -49.285 1.00 13.84 ? 227 TYR B CB    1 
ATOM   4733  C  CG    . TYR B  1 216 ? 62.464  -9.107  -50.107 1.00 15.81 ? 227 TYR B CG    1 
ATOM   4734  C  CD1   . TYR B  1 216 ? 63.376  -8.496  -50.961 1.00 18.14 ? 227 TYR B CD1   1 
ATOM   4735  C  CD2   . TYR B  1 216 ? 62.455  -10.498 -50.047 1.00 16.21 ? 227 TYR B CD2   1 
ATOM   4736  C  CE1   . TYR B  1 216 ? 64.224  -9.248  -51.775 1.00 18.41 ? 227 TYR B CE1   1 
ATOM   4737  C  CE2   . TYR B  1 216 ? 63.306  -11.261 -50.849 1.00 17.47 ? 227 TYR B CE2   1 
ATOM   4738  C  CZ    . TYR B  1 216 ? 64.198  -10.630 -51.701 1.00 23.54 ? 227 TYR B CZ    1 
ATOM   4739  O  OH    . TYR B  1 216 ? 65.073  -11.371 -52.457 1.00 23.71 ? 227 TYR B OH    1 
ATOM   4740  N  N     . ALA B  1 217 ? 58.346  -6.452  -49.802 1.00 13.29 ? 228 ALA B N     1 
ATOM   4741  C  CA    . ALA B  1 217 ? 57.113  -5.932  -49.181 1.00 12.49 ? 228 ALA B CA    1 
ATOM   4742  C  C     . ALA B  1 217 ? 56.041  -6.083  -50.260 1.00 15.57 ? 228 ALA B C     1 
ATOM   4743  O  O     . ALA B  1 217 ? 56.284  -5.742  -51.426 1.00 14.61 ? 228 ALA B O     1 
ATOM   4744  C  CB    . ALA B  1 217 ? 57.265  -4.483  -48.750 1.00 12.80 ? 228 ALA B CB    1 
ATOM   4745  N  N     . VAL B  1 218 ? 54.915  -6.739  -49.917 1.00 11.19 ? 229 VAL B N     1 
ATOM   4746  C  CA    . VAL B  1 218 ? 53.859  -7.060  -50.893 1.00 10.61 ? 229 VAL B CA    1 
ATOM   4747  C  C     . VAL B  1 218 ? 52.549  -6.527  -50.320 1.00 14.56 ? 229 VAL B C     1 
ATOM   4748  O  O     . VAL B  1 218 ? 52.211  -6.838  -49.179 1.00 14.20 ? 229 VAL B O     1 
ATOM   4749  C  CB    . VAL B  1 218 ? 53.794  -8.602  -51.157 1.00 13.66 ? 229 VAL B CB    1 
ATOM   4750  C  CG1   . VAL B  1 218 ? 52.662  -8.972  -52.105 1.00 13.25 ? 229 VAL B CG1   1 
ATOM   4751  C  CG2   . VAL B  1 218 ? 55.131  -9.155  -51.662 1.00 13.40 ? 229 VAL B CG2   1 
ATOM   4752  N  N     . ASN B  1 219 ? 51.817  -5.743  -51.115 1.00 10.02 ? 230 ASN B N     1 
ATOM   4753  C  CA    . ASN B  1 219 ? 50.574  -5.140  -50.664 1.00 10.81 ? 230 ASN B CA    1 
ATOM   4754  C  C     . ASN B  1 219 ? 49.488  -5.366  -51.700 1.00 15.43 ? 230 ASN B C     1 
ATOM   4755  O  O     . ASN B  1 219 ? 49.673  -5.032  -52.874 1.00 15.63 ? 230 ASN B O     1 
ATOM   4756  C  CB    . ASN B  1 219 ? 50.786  -3.646  -50.427 1.00 9.72  ? 230 ASN B CB    1 
ATOM   4757  C  CG    . ASN B  1 219 ? 51.584  -3.354  -49.195 1.00 18.28 ? 230 ASN B CG    1 
ATOM   4758  O  OD1   . ASN B  1 219 ? 51.145  -3.656  -48.088 1.00 11.42 ? 230 ASN B OD1   1 
ATOM   4759  N  ND2   . ASN B  1 219 ? 52.769  -2.729  -49.348 1.00 11.38 ? 230 ASN B ND2   1 
ATOM   4760  N  N     . PHE B  1 220 ? 48.377  -5.973  -51.273 1.00 10.49 ? 231 PHE B N     1 
ATOM   4761  C  CA    . PHE B  1 220 ? 47.239  -6.210  -52.145 1.00 9.23  ? 231 PHE B CA    1 
ATOM   4762  C  C     . PHE B  1 220 ? 46.108  -5.285  -51.703 1.00 12.92 ? 231 PHE B C     1 
ATOM   4763  O  O     . PHE B  1 220 ? 45.372  -5.629  -50.777 1.00 12.16 ? 231 PHE B O     1 
ATOM   4764  C  CB    . PHE B  1 220 ? 46.778  -7.666  -52.086 1.00 10.20 ? 231 PHE B CB    1 
ATOM   4765  C  CG    . PHE B  1 220 ? 45.937  -8.056  -53.286 1.00 11.31 ? 231 PHE B CG    1 
ATOM   4766  C  CD1   . PHE B  1 220 ? 46.341  -9.080  -54.134 1.00 14.16 ? 231 PHE B CD1   1 
ATOM   4767  C  CD2   . PHE B  1 220 ? 44.728  -7.415  -53.553 1.00 11.51 ? 231 PHE B CD2   1 
ATOM   4768  C  CE1   . PHE B  1 220 ? 45.557  -9.449  -55.243 1.00 14.02 ? 231 PHE B CE1   1 
ATOM   4769  C  CE2   . PHE B  1 220 ? 43.954  -7.776  -54.668 1.00 14.29 ? 231 PHE B CE2   1 
ATOM   4770  C  CZ    . PHE B  1 220 ? 44.363  -8.812  -55.486 1.00 11.46 ? 231 PHE B CZ    1 
ATOM   4771  N  N     . PRO B  1 221 ? 45.935  -4.120  -52.352 1.00 12.76 ? 232 PRO B N     1 
ATOM   4772  C  CA    . PRO B  1 221 ? 44.838  -3.229  -51.953 1.00 12.71 ? 232 PRO B CA    1 
ATOM   4773  C  C     . PRO B  1 221 ? 43.491  -3.733  -52.438 1.00 14.94 ? 232 PRO B C     1 
ATOM   4774  O  O     . PRO B  1 221 ? 43.350  -4.146  -53.596 1.00 13.62 ? 232 PRO B O     1 
ATOM   4775  C  CB    . PRO B  1 221 ? 45.209  -1.884  -52.585 1.00 15.22 ? 232 PRO B CB    1 
ATOM   4776  C  CG    . PRO B  1 221 ? 46.306  -2.155  -53.530 1.00 19.22 ? 232 PRO B CG    1 
ATOM   4777  C  CD    . PRO B  1 221 ? 46.713  -3.570  -53.482 1.00 14.64 ? 232 PRO B CD    1 
ATOM   4778  N  N     . MET B  1 222 ? 42.478  -3.684  -51.549 1.00 11.96 ? 233 MET B N     1 
ATOM   4779  C  CA    . MET B  1 222 ? 41.138  -4.165  -51.882 1.00 10.55 ? 233 MET B CA    1 
ATOM   4780  C  C     . MET B  1 222 ? 40.087  -3.086  -51.661 1.00 14.93 ? 233 MET B C     1 
ATOM   4781  O  O     . MET B  1 222 ? 40.313  -2.137  -50.902 1.00 14.29 ? 233 MET B O     1 
ATOM   4782  C  CB    . MET B  1 222 ? 40.813  -5.401  -51.044 1.00 12.53 ? 233 MET B CB    1 
ATOM   4783  C  CG    . MET B  1 222 ? 41.637  -6.642  -51.434 1.00 15.46 ? 233 MET B CG    1 
ATOM   4784  S  SD    . MET B  1 222 ? 41.551  -7.910  -50.148 1.00 18.53 ? 233 MET B SD    1 
ATOM   4785  C  CE    . MET B  1 222 ? 42.354  -9.210  -50.919 1.00 16.25 ? 233 MET B CE    1 
ATOM   4786  N  N     . ARG B  1 223 ? 38.917  -3.256  -52.293 1.00 11.26 ? 234 ARG B N     1 
ATOM   4787  C  CA    . ARG B  1 223 ? 37.800  -2.339  -52.149 1.00 10.40 ? 234 ARG B CA    1 
ATOM   4788  C  C     . ARG B  1 223 ? 36.759  -2.963  -51.196 1.00 13.13 ? 234 ARG B C     1 
ATOM   4789  O  O     . ARG B  1 223 ? 36.906  -4.117  -50.819 1.00 11.21 ? 234 ARG B O     1 
ATOM   4790  C  CB    . ARG B  1 223 ? 37.174  -2.046  -53.541 1.00 8.71  ? 234 ARG B CB    1 
ATOM   4791  C  CG    . ARG B  1 223 ? 38.155  -1.437  -54.549 1.00 12.35 ? 234 ARG B CG    1 
ATOM   4792  C  CD    . ARG B  1 223 ? 38.745  -0.099  -54.103 1.00 15.09 ? 234 ARG B CD    1 
ATOM   4793  N  NE    . ARG B  1 223 ? 39.545  0.437   -55.200 1.00 17.56 ? 234 ARG B NE    1 
ATOM   4794  C  CZ    . ARG B  1 223 ? 40.857  0.630   -55.183 1.00 25.60 ? 234 ARG B CZ    1 
ATOM   4795  N  NH1   . ARG B  1 223 ? 41.543  0.475   -54.054 1.00 16.54 ? 234 ARG B NH1   1 
ATOM   4796  N  NH2   . ARG B  1 223 ? 41.484  1.056   -56.276 1.00 11.86 ? 234 ARG B NH2   1 
ATOM   4797  N  N     . ASP B  1 224 ? 35.737  -2.191  -50.800 1.00 10.30 ? 235 ASP B N     1 
ATOM   4798  C  CA    . ASP B  1 224 ? 34.650  -2.657  -49.927 1.00 9.94  ? 235 ASP B CA    1 
ATOM   4799  C  C     . ASP B  1 224 ? 33.976  -3.882  -50.498 1.00 14.26 ? 235 ASP B C     1 
ATOM   4800  O  O     . ASP B  1 224 ? 33.868  -4.021  -51.726 1.00 13.98 ? 235 ASP B O     1 
ATOM   4801  C  CB    . ASP B  1 224 ? 33.538  -1.588  -49.818 1.00 11.25 ? 235 ASP B CB    1 
ATOM   4802  C  CG    . ASP B  1 224 ? 33.919  -0.288  -49.140 1.00 23.57 ? 235 ASP B CG    1 
ATOM   4803  O  OD1   . ASP B  1 224 ? 35.113  -0.065  -48.926 1.00 25.59 ? 235 ASP B OD1   1 
ATOM   4804  O  OD2   . ASP B  1 224 ? 33.006  0.487   -48.788 1.00 28.20 ? 235 ASP B OD2   1 
ATOM   4805  N  N     . GLY B  1 225 ? 33.428  -4.706  -49.606 1.00 11.40 ? 236 GLY B N     1 
ATOM   4806  C  CA    . GLY B  1 225 ? 32.594  -5.842  -49.974 1.00 10.73 ? 236 GLY B CA    1 
ATOM   4807  C  C     . GLY B  1 225 ? 33.240  -7.083  -50.522 1.00 14.91 ? 236 GLY B C     1 
ATOM   4808  O  O     . GLY B  1 225 ? 32.532  -7.944  -51.053 1.00 14.30 ? 236 GLY B O     1 
ATOM   4809  N  N     . ILE B  1 226 ? 34.573  -7.237  -50.368 1.00 11.32 ? 237 ILE B N     1 
ATOM   4810  C  CA    . ILE B  1 226 ? 35.184  -8.470  -50.842 1.00 10.10 ? 237 ILE B CA    1 
ATOM   4811  C  C     . ILE B  1 226 ? 34.537  -9.698  -50.126 1.00 13.25 ? 237 ILE B C     1 
ATOM   4812  O  O     . ILE B  1 226 ? 34.250  -9.629  -48.932 1.00 10.31 ? 237 ILE B O     1 
ATOM   4813  C  CB    . ILE B  1 226 ? 36.720  -8.442  -50.743 1.00 13.48 ? 237 ILE B CB    1 
ATOM   4814  C  CG1   . ILE B  1 226 ? 37.307  -9.544  -51.666 1.00 13.70 ? 237 ILE B CG1   1 
ATOM   4815  C  CG2   . ILE B  1 226 ? 37.196  -8.594  -49.278 1.00 13.48 ? 237 ILE B CG2   1 
ATOM   4816  C  CD1   . ILE B  1 226 ? 38.670  -9.291  -52.110 1.00 20.14 ? 237 ILE B CD1   1 
ATOM   4817  N  N     . ASP B  1 227 ? 34.305  -10.782 -50.874 1.00 10.77 ? 238 ASP B N     1 
ATOM   4818  C  CA    . ASP B  1 227 ? 33.649  -12.001 -50.375 1.00 10.65 ? 238 ASP B CA    1 
ATOM   4819  C  C     . ASP B  1 227 ? 34.597  -13.182 -50.362 1.00 13.84 ? 238 ASP B C     1 
ATOM   4820  O  O     . ASP B  1 227 ? 35.713  -13.055 -50.836 1.00 13.49 ? 238 ASP B O     1 
ATOM   4821  C  CB    . ASP B  1 227 ? 32.367  -12.294 -51.180 1.00 11.98 ? 238 ASP B CB    1 
ATOM   4822  C  CG    . ASP B  1 227 ? 32.510  -12.367 -52.702 1.00 20.74 ? 238 ASP B CG    1 
ATOM   4823  O  OD1   . ASP B  1 227 ? 33.607  -12.755 -53.189 1.00 16.81 ? 238 ASP B OD1   1 
ATOM   4824  O  OD2   . ASP B  1 227 ? 31.508  -12.102 -53.403 1.00 22.18 ? 238 ASP B OD2   1 
ATOM   4825  N  N     . ASP B  1 228 ? 34.166  -14.323 -49.797 1.00 11.97 ? 239 ASP B N     1 
ATOM   4826  C  CA    . ASP B  1 228 ? 34.981  -15.530 -49.661 1.00 10.94 ? 239 ASP B CA    1 
ATOM   4827  C  C     . ASP B  1 228 ? 35.519  -15.974 -51.017 1.00 16.41 ? 239 ASP B C     1 
ATOM   4828  O  O     . ASP B  1 228 ? 36.691  -16.313 -51.131 1.00 12.76 ? 239 ASP B O     1 
ATOM   4829  C  CB    . ASP B  1 228 ? 34.140  -16.677 -49.078 1.00 11.33 ? 239 ASP B CB    1 
ATOM   4830  C  CG    . ASP B  1 228 ? 33.690  -16.468 -47.650 1.00 10.69 ? 239 ASP B CG    1 
ATOM   4831  O  OD1   . ASP B  1 228 ? 34.231  -15.547 -46.984 1.00 9.70  ? 239 ASP B OD1   1 
ATOM   4832  O  OD2   . ASP B  1 228 ? 32.810  -17.235 -47.186 1.00 10.04 ? 239 ASP B OD2   1 
ATOM   4833  N  N     . GLU B  1 229 ? 34.649  -15.959 -52.029 1.00 16.74 ? 240 GLU B N     1 
ATOM   4834  C  CA    . GLU B  1 229 ? 34.964  -16.411 -53.392 1.00 18.51 ? 240 GLU B CA    1 
ATOM   4835  C  C     . GLU B  1 229 ? 36.136  -15.607 -53.992 1.00 20.56 ? 240 GLU B C     1 
ATOM   4836  O  O     . GLU B  1 229 ? 37.168  -16.198 -54.317 1.00 20.59 ? 240 GLU B O     1 
ATOM   4837  C  CB    . GLU B  1 229 ? 33.692  -16.346 -54.271 1.00 20.50 ? 240 GLU B CB    1 
ATOM   4838  C  CG    . GLU B  1 229 ? 32.509  -17.171 -53.752 1.00 34.17 ? 240 GLU B CG    1 
ATOM   4839  C  CD    . GLU B  1 229 ? 31.764  -16.768 -52.481 1.00 56.76 ? 240 GLU B CD    1 
ATOM   4840  O  OE1   . GLU B  1 229 ? 31.750  -15.566 -52.118 1.00 28.95 ? 240 GLU B OE1   1 
ATOM   4841  O  OE2   . GLU B  1 229 ? 31.182  -17.679 -51.845 1.00 57.05 ? 240 GLU B OE2   1 
ATOM   4842  N  N     . SER B  1 230 ? 36.025  -14.267 -54.003 1.00 14.91 ? 241 SER B N     1 
ATOM   4843  C  CA    . SER B  1 230 ? 37.025  -13.335 -54.532 1.00 14.06 ? 241 SER B CA    1 
ATOM   4844  C  C     . SER B  1 230 ? 38.345  -13.339 -53.726 1.00 17.54 ? 241 SER B C     1 
ATOM   4845  O  O     . SER B  1 230 ? 39.416  -13.284 -54.323 1.00 16.04 ? 241 SER B O     1 
ATOM   4846  C  CB    . SER B  1 230 ? 36.454  -11.925 -54.571 1.00 17.97 ? 241 SER B CB    1 
ATOM   4847  O  OG    . SER B  1 230 ? 35.282  -11.877 -55.362 1.00 27.32 ? 241 SER B OG    1 
ATOM   4848  N  N     . TYR B  1 231 ? 38.262  -13.363 -52.378 1.00 13.14 ? 242 TYR B N     1 
ATOM   4849  C  CA    . TYR B  1 231 ? 39.432  -13.403 -51.500 1.00 13.74 ? 242 TYR B CA    1 
ATOM   4850  C  C     . TYR B  1 231 ? 40.211  -14.700 -51.729 1.00 18.47 ? 242 TYR B C     1 
ATOM   4851  O  O     . TYR B  1 231 ? 41.425  -14.643 -51.939 1.00 17.71 ? 242 TYR B O     1 
ATOM   4852  C  CB    . TYR B  1 231 ? 39.016  -13.294 -50.009 1.00 13.50 ? 242 TYR B CB    1 
ATOM   4853  C  CG    . TYR B  1 231 ? 40.075  -12.704 -49.099 1.00 12.64 ? 242 TYR B CG    1 
ATOM   4854  C  CD1   . TYR B  1 231 ? 40.033  -11.364 -48.725 1.00 14.05 ? 242 TYR B CD1   1 
ATOM   4855  C  CD2   . TYR B  1 231 ? 41.093  -13.501 -48.569 1.00 12.16 ? 242 TYR B CD2   1 
ATOM   4856  C  CE1   . TYR B  1 231 ? 40.994  -10.821 -47.865 1.00 14.03 ? 242 TYR B CE1   1 
ATOM   4857  C  CE2   . TYR B  1 231 ? 42.076  -12.962 -47.747 1.00 12.13 ? 242 TYR B CE2   1 
ATOM   4858  C  CZ    . TYR B  1 231 ? 42.022  -11.623 -47.397 1.00 11.91 ? 242 TYR B CZ    1 
ATOM   4859  O  OH    . TYR B  1 231 ? 42.952  -11.119 -46.523 1.00 11.62 ? 242 TYR B OH    1 
ATOM   4860  N  N     . GLY B  1 232 ? 39.498  -15.833 -51.734 1.00 16.90 ? 243 GLY B N     1 
ATOM   4861  C  CA    . GLY B  1 232 ? 40.084  -17.164 -51.890 1.00 16.96 ? 243 GLY B CA    1 
ATOM   4862  C  C     . GLY B  1 232 ? 40.791  -17.379 -53.208 1.00 21.31 ? 243 GLY B C     1 
ATOM   4863  O  O     . GLY B  1 232 ? 41.836  -18.036 -53.244 1.00 19.66 ? 243 GLY B O     1 
ATOM   4864  N  N     . GLN B  1 233 ? 40.228  -16.790 -54.291 1.00 18.89 ? 244 GLN B N     1 
ATOM   4865  C  CA    . GLN B  1 233 ? 40.768  -16.869 -55.661 1.00 19.45 ? 244 GLN B CA    1 
ATOM   4866  C  C     . GLN B  1 233 ? 42.076  -16.109 -55.803 1.00 22.00 ? 244 GLN B C     1 
ATOM   4867  O  O     . GLN B  1 233 ? 42.863  -16.418 -56.690 1.00 22.09 ? 244 GLN B O     1 
ATOM   4868  C  CB    . GLN B  1 233 ? 39.738  -16.391 -56.695 1.00 21.24 ? 244 GLN B CB    1 
ATOM   4869  C  CG    . GLN B  1 233 ? 38.636  -17.417 -57.021 1.00 50.63 ? 244 GLN B CG    1 
ATOM   4870  C  CD    . GLN B  1 233 ? 39.118  -18.786 -57.471 1.00 80.67 ? 244 GLN B CD    1 
ATOM   4871  O  OE1   . GLN B  1 233 ? 40.069  -18.929 -58.253 1.00 80.11 ? 244 GLN B OE1   1 
ATOM   4872  N  NE2   . GLN B  1 233 ? 38.435  -19.828 -57.013 1.00 71.74 ? 244 GLN B NE2   1 
ATOM   4873  N  N     . ILE B  1 234 ? 42.312  -15.111 -54.947 1.00 17.02 ? 245 ILE B N     1 
ATOM   4874  C  CA    . ILE B  1 234 ? 43.595  -14.419 -54.991 1.00 17.49 ? 245 ILE B CA    1 
ATOM   4875  C  C     . ILE B  1 234 ? 44.566  -14.876 -53.913 1.00 17.60 ? 245 ILE B C     1 
ATOM   4876  O  O     . ILE B  1 234 ? 45.772  -14.805 -54.148 1.00 16.00 ? 245 ILE B O     1 
ATOM   4877  C  CB    . ILE B  1 234 ? 43.522  -12.879 -55.064 1.00 21.71 ? 245 ILE B CB    1 
ATOM   4878  C  CG1   . ILE B  1 234 ? 42.986  -12.248 -53.793 1.00 21.46 ? 245 ILE B CG1   1 
ATOM   4879  C  CG2   . ILE B  1 234 ? 42.843  -12.396 -56.326 1.00 25.57 ? 245 ILE B CG2   1 
ATOM   4880  C  CD1   . ILE B  1 234 ? 44.031  -11.752 -52.930 1.00 30.01 ? 245 ILE B CD1   1 
ATOM   4881  N  N     . PHE B  1 235 ? 44.068  -15.228 -52.700 1.00 12.35 ? 246 PHE B N     1 
ATOM   4882  C  CA    . PHE B  1 235 ? 44.977  -15.575 -51.592 1.00 10.33 ? 246 PHE B CA    1 
ATOM   4883  C  C     . PHE B  1 235 ? 45.852  -16.774 -51.910 1.00 13.04 ? 246 PHE B C     1 
ATOM   4884  O  O     . PHE B  1 235 ? 47.074  -16.682 -51.763 1.00 13.79 ? 246 PHE B O     1 
ATOM   4885  C  CB    . PHE B  1 235 ? 44.229  -15.780 -50.255 1.00 10.97 ? 246 PHE B CB    1 
ATOM   4886  C  CG    . PHE B  1 235 ? 45.139  -15.969 -49.050 1.00 11.73 ? 246 PHE B CG    1 
ATOM   4887  C  CD1   . PHE B  1 235 ? 45.507  -17.245 -48.626 1.00 13.66 ? 246 PHE B CD1   1 
ATOM   4888  C  CD2   . PHE B  1 235 ? 45.546  -14.879 -48.286 1.00 12.96 ? 246 PHE B CD2   1 
ATOM   4889  C  CE1   . PHE B  1 235 ? 46.314  -17.426 -47.499 1.00 13.61 ? 246 PHE B CE1   1 
ATOM   4890  C  CE2   . PHE B  1 235 ? 46.325  -15.059 -47.134 1.00 14.35 ? 246 PHE B CE2   1 
ATOM   4891  C  CZ    . PHE B  1 235 ? 46.704  -16.331 -46.741 1.00 12.24 ? 246 PHE B CZ    1 
ATOM   4892  N  N     . LYS B  1 236 ? 45.241  -17.912 -52.295 1.00 10.12 ? 247 LYS B N     1 
ATOM   4893  C  CA    . LYS B  1 236 ? 46.000  -19.139 -52.566 1.00 11.46 ? 247 LYS B CA    1 
ATOM   4894  C  C     . LYS B  1 236 ? 47.108  -18.932 -53.644 1.00 16.30 ? 247 LYS B C     1 
ATOM   4895  O  O     . LYS B  1 236 ? 48.272  -19.235 -53.347 1.00 15.52 ? 247 LYS B O     1 
ATOM   4896  C  CB    . LYS B  1 236 ? 45.075  -20.331 -52.890 1.00 14.61 ? 247 LYS B CB    1 
ATOM   4897  C  CG    . LYS B  1 236 ? 45.806  -21.685 -52.855 1.00 22.98 ? 247 LYS B CG    1 
ATOM   4898  C  CD    . LYS B  1 236 ? 44.847  -22.834 -53.168 1.00 30.73 ? 247 LYS B CD    1 
ATOM   4899  C  CE    . LYS B  1 236 ? 45.547  -24.157 -53.319 1.00 44.20 ? 247 LYS B CE    1 
ATOM   4900  N  NZ    . LYS B  1 236 ? 44.566  -25.256 -53.530 1.00 50.26 ? 247 LYS B NZ    1 
ATOM   4901  N  N     . PRO B  1 237 ? 46.815  -18.336 -54.824 1.00 15.46 ? 248 PRO B N     1 
ATOM   4902  C  CA    . PRO B  1 237 ? 47.884  -18.121 -55.821 1.00 15.12 ? 248 PRO B CA    1 
ATOM   4903  C  C     . PRO B  1 237 ? 48.962  -17.151 -55.361 1.00 15.08 ? 248 PRO B C     1 
ATOM   4904  O  O     . PRO B  1 237 ? 50.130  -17.365 -55.664 1.00 14.39 ? 248 PRO B O     1 
ATOM   4905  C  CB    . PRO B  1 237 ? 47.124  -17.531 -57.026 1.00 17.64 ? 248 PRO B CB    1 
ATOM   4906  C  CG    . PRO B  1 237 ? 45.728  -18.014 -56.860 1.00 21.81 ? 248 PRO B CG    1 
ATOM   4907  C  CD    . PRO B  1 237 ? 45.505  -17.930 -55.382 1.00 17.52 ? 248 PRO B CD    1 
ATOM   4908  N  N     . ILE B  1 238 ? 48.589  -16.078 -54.646 1.00 13.09 ? 249 ILE B N     1 
ATOM   4909  C  CA    . ILE B  1 238 ? 49.596  -15.113 -54.191 1.00 13.51 ? 249 ILE B CA    1 
ATOM   4910  C  C     . ILE B  1 238 ? 50.549  -15.790 -53.220 1.00 15.80 ? 249 ILE B C     1 
ATOM   4911  O  O     . ILE B  1 238 ? 51.763  -15.708 -53.399 1.00 14.75 ? 249 ILE B O     1 
ATOM   4912  C  CB    . ILE B  1 238 ? 48.974  -13.796 -53.636 1.00 16.71 ? 249 ILE B CB    1 
ATOM   4913  C  CG1   . ILE B  1 238 ? 48.304  -12.936 -54.761 1.00 16.94 ? 249 ILE B CG1   1 
ATOM   4914  C  CG2   . ILE B  1 238 ? 50.010  -12.959 -52.821 1.00 16.66 ? 249 ILE B CG2   1 
ATOM   4915  C  CD1   . ILE B  1 238 ? 49.246  -12.297 -55.810 1.00 26.86 ? 249 ILE B CD1   1 
ATOM   4916  N  N     . ILE B  1 239 ? 49.989  -16.446 -52.188 1.00 13.26 ? 250 ILE B N     1 
ATOM   4917  C  CA    . ILE B  1 239 ? 50.776  -17.130 -51.169 1.00 11.67 ? 250 ILE B CA    1 
ATOM   4918  C  C     . ILE B  1 239 ? 51.579  -18.284 -51.774 1.00 14.25 ? 250 ILE B C     1 
ATOM   4919  O  O     . ILE B  1 239 ? 52.742  -18.441 -51.410 1.00 11.32 ? 250 ILE B O     1 
ATOM   4920  C  CB    . ILE B  1 239 ? 49.933  -17.495 -49.914 1.00 13.39 ? 250 ILE B CB    1 
ATOM   4921  C  CG1   . ILE B  1 239 ? 49.336  -16.206 -49.261 1.00 12.09 ? 250 ILE B CG1   1 
ATOM   4922  C  CG2   . ILE B  1 239 ? 50.741  -18.352 -48.890 1.00 13.94 ? 250 ILE B CG2   1 
ATOM   4923  C  CD1   . ILE B  1 239 ? 50.361  -15.017 -48.779 1.00 12.49 ? 250 ILE B CD1   1 
ATOM   4924  N  N     . SER B  1 240 ? 50.998  -19.055 -52.717 1.00 13.51 ? 251 SER B N     1 
ATOM   4925  C  CA    . SER B  1 240 ? 51.778  -20.130 -53.376 1.00 14.86 ? 251 SER B CA    1 
ATOM   4926  C  C     . SER B  1 240 ? 53.016  -19.577 -54.115 1.00 17.14 ? 251 SER B C     1 
ATOM   4927  O  O     . SER B  1 240 ? 54.077  -20.198 -54.061 1.00 17.03 ? 251 SER B O     1 
ATOM   4928  C  CB    . SER B  1 240 ? 50.920  -20.936 -54.354 1.00 19.08 ? 251 SER B CB    1 
ATOM   4929  O  OG    . SER B  1 240 ? 49.823  -21.526 -53.676 1.00 21.44 ? 251 SER B OG    1 
ATOM   4930  N  N     . LYS B  1 241 ? 52.875  -18.425 -54.794 1.00 14.61 ? 252 LYS B N     1 
ATOM   4931  C  CA    . LYS B  1 241 ? 53.977  -17.794 -55.545 1.00 14.00 ? 252 LYS B CA    1 
ATOM   4932  C  C     . LYS B  1 241 ? 55.032  -17.235 -54.600 1.00 18.13 ? 252 LYS B C     1 
ATOM   4933  O  O     . LYS B  1 241 ? 56.248  -17.406 -54.816 1.00 17.38 ? 252 LYS B O     1 
ATOM   4934  C  CB    . LYS B  1 241 ? 53.455  -16.702 -56.500 1.00 14.88 ? 252 LYS B CB    1 
ATOM   4935  C  CG    . LYS B  1 241 ? 54.511  -16.194 -57.494 1.00 17.69 ? 252 LYS B CG    1 
ATOM   4936  C  CD    . LYS B  1 241 ? 54.919  -17.269 -58.497 1.00 25.18 ? 252 LYS B CD    1 
ATOM   4937  C  CE    . LYS B  1 241 ? 55.987  -16.809 -59.459 1.00 39.49 ? 252 LYS B CE    1 
ATOM   4938  N  NZ    . LYS B  1 241 ? 56.232  -17.829 -60.521 1.00 44.82 ? 252 LYS B NZ    1 
ATOM   4939  N  N     . VAL B  1 242 ? 54.563  -16.593 -53.527 1.00 12.98 ? 253 VAL B N     1 
ATOM   4940  C  CA    . VAL B  1 242 ? 55.437  -16.103 -52.484 1.00 12.83 ? 253 VAL B CA    1 
ATOM   4941  C  C     . VAL B  1 242 ? 56.246  -17.300 -51.924 1.00 15.86 ? 253 VAL B C     1 
ATOM   4942  O  O     . VAL B  1 242 ? 57.456  -17.190 -51.836 1.00 14.15 ? 253 VAL B O     1 
ATOM   4943  C  CB    . VAL B  1 242 ? 54.631  -15.381 -51.370 1.00 15.89 ? 253 VAL B CB    1 
ATOM   4944  C  CG1   . VAL B  1 242 ? 55.456  -15.239 -50.093 1.00 14.95 ? 253 VAL B CG1   1 
ATOM   4945  C  CG2   . VAL B  1 242 ? 54.107  -14.025 -51.850 1.00 15.20 ? 253 VAL B CG2   1 
ATOM   4946  N  N     . MET B  1 243 ? 55.588  -18.435 -51.592 1.00 14.43 ? 254 MET B N     1 
ATOM   4947  C  CA    . MET B  1 243 ? 56.316  -19.598 -51.052 1.00 13.31 ? 254 MET B CA    1 
ATOM   4948  C  C     . MET B  1 243 ? 57.366  -20.129 -52.061 1.00 19.27 ? 254 MET B C     1 
ATOM   4949  O  O     . MET B  1 243 ? 58.496  -20.473 -51.681 1.00 19.38 ? 254 MET B O     1 
ATOM   4950  C  CB    . MET B  1 243 ? 55.341  -20.722 -50.658 1.00 14.78 ? 254 MET B CB    1 
ATOM   4951  C  CG    . MET B  1 243 ? 54.438  -20.367 -49.491 1.00 15.67 ? 254 MET B CG    1 
ATOM   4952  S  SD    . MET B  1 243 ? 55.347  -20.304 -47.937 1.00 17.81 ? 254 MET B SD    1 
ATOM   4953  C  CE    . MET B  1 243 ? 53.938  -20.128 -46.753 1.00 14.14 ? 254 MET B CE    1 
ATOM   4954  N  N     . GLU B  1 244 ? 56.995  -20.165 -53.337 1.00 17.58 ? 255 GLU B N     1 
ATOM   4955  C  CA    . GLU B  1 244 ? 57.865  -20.661 -54.397 1.00 17.77 ? 255 GLU B CA    1 
ATOM   4956  C  C     . GLU B  1 244 ? 59.098  -19.793 -54.558 1.00 19.15 ? 255 GLU B C     1 
ATOM   4957  O  O     . GLU B  1 244 ? 60.212  -20.305 -54.590 1.00 19.67 ? 255 GLU B O     1 
ATOM   4958  C  CB    . GLU B  1 244 ? 57.078  -20.724 -55.709 1.00 19.36 ? 255 GLU B CB    1 
ATOM   4959  C  CG    . GLU B  1 244 ? 57.879  -21.250 -56.885 1.00 29.82 ? 255 GLU B CG    1 
ATOM   4960  C  CD    . GLU B  1 244 ? 57.239  -20.962 -58.225 1.00 48.72 ? 255 GLU B CD    1 
ATOM   4961  O  OE1   . GLU B  1 244 ? 56.019  -20.678 -58.261 1.00 45.37 ? 255 GLU B OE1   1 
ATOM   4962  O  OE2   . GLU B  1 244 ? 57.965  -21.011 -59.242 1.00 45.31 ? 255 GLU B OE2   1 
ATOM   4963  N  N     . MET B  1 245 ? 58.903  -18.494 -54.649 1.00 15.29 ? 256 MET B N     1 
ATOM   4964  C  CA    . MET B  1 245 ? 59.981  -17.540 -54.879 1.00 15.38 ? 256 MET B CA    1 
ATOM   4965  C  C     . MET B  1 245 ? 60.789  -17.242 -53.631 1.00 19.38 ? 256 MET B C     1 
ATOM   4966  O  O     . MET B  1 245 ? 62.011  -17.196 -53.696 1.00 20.30 ? 256 MET B O     1 
ATOM   4967  C  CB    . MET B  1 245 ? 59.430  -16.232 -55.469 1.00 17.45 ? 256 MET B CB    1 
ATOM   4968  C  CG    . MET B  1 245 ? 58.661  -16.419 -56.777 1.00 20.54 ? 256 MET B CG    1 
ATOM   4969  S  SD    . MET B  1 245 ? 59.613  -17.276 -58.071 1.00 23.68 ? 256 MET B SD    1 
ATOM   4970  C  CE    . MET B  1 245 ? 60.958  -16.132 -58.293 1.00 21.06 ? 256 MET B CE    1 
ATOM   4971  N  N     . TYR B  1 246 ? 60.113  -17.036 -52.499 1.00 14.58 ? 257 TYR B N     1 
ATOM   4972  C  CA    . TYR B  1 246 ? 60.765  -16.634 -51.254 1.00 14.34 ? 257 TYR B CA    1 
ATOM   4973  C  C     . TYR B  1 246 ? 61.302  -17.764 -50.407 1.00 17.72 ? 257 TYR B C     1 
ATOM   4974  O  O     . TYR B  1 246 ? 62.280  -17.553 -49.695 1.00 19.17 ? 257 TYR B O     1 
ATOM   4975  C  CB    . TYR B  1 246 ? 59.846  -15.697 -50.446 1.00 14.44 ? 257 TYR B CB    1 
ATOM   4976  C  CG    . TYR B  1 246 ? 60.527  -15.018 -49.282 1.00 14.93 ? 257 TYR B CG    1 
ATOM   4977  C  CD1   . TYR B  1 246 ? 60.048  -15.169 -47.986 1.00 15.78 ? 257 TYR B CD1   1 
ATOM   4978  C  CD2   . TYR B  1 246 ? 61.657  -14.223 -49.475 1.00 15.06 ? 257 TYR B CD2   1 
ATOM   4979  C  CE1   . TYR B  1 246 ? 60.687  -14.570 -46.904 1.00 13.89 ? 257 TYR B CE1   1 
ATOM   4980  C  CE2   . TYR B  1 246 ? 62.313  -13.634 -48.399 1.00 15.40 ? 257 TYR B CE2   1 
ATOM   4981  C  CZ    . TYR B  1 246 ? 61.816  -13.801 -47.117 1.00 17.63 ? 257 TYR B CZ    1 
ATOM   4982  O  OH    . TYR B  1 246 ? 62.419  -13.173 -46.062 1.00 16.42 ? 257 TYR B OH    1 
ATOM   4983  N  N     . GLN B  1 247 ? 60.652  -18.934 -50.435 1.00 14.15 ? 258 GLN B N     1 
ATOM   4984  C  CA    . GLN B  1 247 ? 61.077  -20.130 -49.682 1.00 14.60 ? 258 GLN B CA    1 
ATOM   4985  C  C     . GLN B  1 247 ? 61.391  -19.796 -48.203 1.00 18.47 ? 258 GLN B C     1 
ATOM   4986  O  O     . GLN B  1 247 ? 62.520  -19.999 -47.733 1.00 15.98 ? 258 GLN B O     1 
ATOM   4987  C  CB    . GLN B  1 247 ? 62.309  -20.789 -50.375 1.00 16.72 ? 258 GLN B CB    1 
ATOM   4988  C  CG    . GLN B  1 247 ? 62.016  -21.242 -51.805 1.00 31.77 ? 258 GLN B CG    1 
ATOM   4989  C  CD    . GLN B  1 247 ? 63.158  -22.056 -52.346 1.00 62.50 ? 258 GLN B CD    1 
ATOM   4990  O  OE1   . GLN B  1 247 ? 63.198  -23.283 -52.198 1.00 59.51 ? 258 GLN B OE1   1 
ATOM   4991  N  NE2   . GLN B  1 247 ? 64.132  -21.388 -52.949 1.00 57.85 ? 258 GLN B NE2   1 
ATOM   4992  N  N     . PRO B  1 248 ? 60.424  -19.233 -47.450 1.00 15.06 ? 259 PRO B N     1 
ATOM   4993  C  CA    . PRO B  1 248 ? 60.711  -18.919 -46.043 1.00 13.11 ? 259 PRO B CA    1 
ATOM   4994  C  C     . PRO B  1 248 ? 60.808  -20.197 -45.218 1.00 15.28 ? 259 PRO B C     1 
ATOM   4995  O  O     . PRO B  1 248 ? 60.330  -21.252 -45.656 1.00 15.14 ? 259 PRO B O     1 
ATOM   4996  C  CB    . PRO B  1 248 ? 59.479  -18.096 -45.630 1.00 14.31 ? 259 PRO B CB    1 
ATOM   4997  C  CG    . PRO B  1 248 ? 58.367  -18.697 -46.428 1.00 18.59 ? 259 PRO B CG    1 
ATOM   4998  C  CD    . PRO B  1 248 ? 59.007  -18.931 -47.788 1.00 15.78 ? 259 PRO B CD    1 
ATOM   4999  N  N     . SER B  1 249 ? 61.422  -20.120 -44.039 1.00 13.58 ? 260 SER B N     1 
ATOM   5000  C  CA    . SER B  1 249 ? 61.480  -21.312 -43.172 1.00 13.10 ? 260 SER B CA    1 
ATOM   5001  C  C     . SER B  1 249 ? 60.544  -21.216 -41.938 1.00 15.09 ? 260 SER B C     1 
ATOM   5002  O  O     . SER B  1 249 ? 60.426  -22.163 -41.158 1.00 13.06 ? 260 SER B O     1 
ATOM   5003  C  CB    . SER B  1 249 ? 62.913  -21.654 -42.791 1.00 14.42 ? 260 SER B CB    1 
ATOM   5004  O  OG    . SER B  1 249 ? 63.509  -20.576 -42.092 1.00 16.70 ? 260 SER B OG    1 
ATOM   5005  N  N     . ALA B  1 250 ? 59.850  -20.066 -41.783 1.00 12.07 ? 261 ALA B N     1 
ATOM   5006  C  CA    . ALA B  1 250 ? 58.902  -19.843 -40.688 1.00 10.43 ? 261 ALA B CA    1 
ATOM   5007  C  C     . ALA B  1 250 ? 57.893  -18.800 -41.178 1.00 13.18 ? 261 ALA B C     1 
ATOM   5008  O  O     . ALA B  1 250 ? 58.200  -18.007 -42.080 1.00 11.97 ? 261 ALA B O     1 
ATOM   5009  C  CB    . ALA B  1 250 ? 59.619  -19.362 -39.417 1.00 11.07 ? 261 ALA B CB    1 
ATOM   5010  N  N     . VAL B  1 251 ? 56.670  -18.840 -40.621 1.00 8.16  ? 262 VAL B N     1 
ATOM   5011  C  CA    . VAL B  1 251 ? 55.593  -17.932 -41.059 1.00 7.02  ? 262 VAL B CA    1 
ATOM   5012  C  C     . VAL B  1 251 ? 54.906  -17.352 -39.863 1.00 8.87  ? 262 VAL B C     1 
ATOM   5013  O  O     . VAL B  1 251 ? 54.665  -18.063 -38.880 1.00 9.42  ? 262 VAL B O     1 
ATOM   5014  C  CB    . VAL B  1 251 ? 54.546  -18.682 -41.944 1.00 11.42 ? 262 VAL B CB    1 
ATOM   5015  C  CG1   . VAL B  1 251 ? 53.430  -17.725 -42.428 1.00 10.44 ? 262 VAL B CG1   1 
ATOM   5016  C  CG2   . VAL B  1 251 ? 55.211  -19.393 -43.130 1.00 11.87 ? 262 VAL B CG2   1 
ATOM   5017  N  N     . VAL B  1 252 ? 54.554  -16.072 -39.953 1.00 7.25  ? 263 VAL B N     1 
ATOM   5018  C  CA    . VAL B  1 252 ? 53.749  -15.393 -38.933 1.00 6.74  ? 263 VAL B CA    1 
ATOM   5019  C  C     . VAL B  1 252 ? 52.480  -14.973 -39.670 1.00 10.59 ? 263 VAL B C     1 
ATOM   5020  O  O     . VAL B  1 252 ? 52.576  -14.311 -40.706 1.00 10.44 ? 263 VAL B O     1 
ATOM   5021  C  CB    . VAL B  1 252 ? 54.460  -14.186 -38.273 1.00 9.29  ? 263 VAL B CB    1 
ATOM   5022  C  CG1   . VAL B  1 252 ? 53.516  -13.502 -37.270 1.00 8.03  ? 263 VAL B CG1   1 
ATOM   5023  C  CG2   . VAL B  1 252 ? 55.728  -14.635 -37.556 1.00 9.48  ? 263 VAL B CG2   1 
ATOM   5024  N  N     . LEU B  1 253 ? 51.308  -15.346 -39.137 1.00 9.03  ? 264 LEU B N     1 
ATOM   5025  C  CA    . LEU B  1 253 ? 50.034  -15.027 -39.773 1.00 7.82  ? 264 LEU B CA    1 
ATOM   5026  C  C     . LEU B  1 253 ? 49.182  -14.214 -38.818 1.00 12.08 ? 264 LEU B C     1 
ATOM   5027  O  O     . LEU B  1 253 ? 48.720  -14.714 -37.781 1.00 9.41  ? 264 LEU B O     1 
ATOM   5028  C  CB    . LEU B  1 253 ? 49.312  -16.318 -40.220 1.00 7.66  ? 264 LEU B CB    1 
ATOM   5029  C  CG    . LEU B  1 253 ? 47.886  -16.156 -40.798 1.00 10.68 ? 264 LEU B CG    1 
ATOM   5030  C  CD1   . LEU B  1 253 ? 47.901  -15.327 -42.102 1.00 8.36  ? 264 LEU B CD1   1 
ATOM   5031  C  CD2   . LEU B  1 253 ? 47.255  -17.523 -41.066 1.00 10.09 ? 264 LEU B CD2   1 
ATOM   5032  N  N     . GLN B  1 254 ? 48.992  -12.946 -39.152 1.00 9.15  ? 265 GLN B N     1 
ATOM   5033  C  CA    . GLN B  1 254 ? 48.149  -12.056 -38.336 1.00 8.28  ? 265 GLN B CA    1 
ATOM   5034  C  C     . GLN B  1 254 ? 46.710  -12.279 -38.850 1.00 10.24 ? 265 GLN B C     1 
ATOM   5035  O  O     . GLN B  1 254 ? 46.464  -12.159 -40.057 1.00 7.74  ? 265 GLN B O     1 
ATOM   5036  C  CB    . GLN B  1 254 ? 48.648  -10.605 -38.515 1.00 9.48  ? 265 GLN B CB    1 
ATOM   5037  C  CG    . GLN B  1 254 ? 48.120  -9.599  -37.456 1.00 4.73  ? 265 GLN B CG    1 
ATOM   5038  C  CD    . GLN B  1 254 ? 46.811  -8.961  -37.844 1.00 9.57  ? 265 GLN B CD    1 
ATOM   5039  O  OE1   . GLN B  1 254 ? 46.045  -9.486  -38.671 1.00 6.86  ? 265 GLN B OE1   1 
ATOM   5040  N  NE2   . GLN B  1 254 ? 46.508  -7.796  -37.249 1.00 7.59  ? 265 GLN B NE2   1 
ATOM   5041  N  N     . CYS B  1 255 ? 45.793  -12.704 -37.958 1.00 7.62  ? 266 CYS B N     1 
ATOM   5042  C  CA    . CYS B  1 255 ? 44.406  -13.077 -38.258 1.00 6.80  ? 266 CYS B CA    1 
ATOM   5043  C  C     . CYS B  1 255 ? 43.364  -12.042 -37.817 1.00 9.39  ? 266 CYS B C     1 
ATOM   5044  O  O     . CYS B  1 255 ? 42.311  -12.446 -37.368 1.00 9.64  ? 266 CYS B O     1 
ATOM   5045  C  CB    . CYS B  1 255 ? 44.086  -14.456 -37.666 1.00 7.12  ? 266 CYS B CB    1 
ATOM   5046  S  SG    . CYS B  1 255 ? 45.205  -15.767 -38.212 1.00 10.17 ? 266 CYS B SG    1 
ATOM   5047  N  N     . GLY B  1 256 ? 43.638  -10.744 -37.970 1.00 6.86  ? 267 GLY B N     1 
ATOM   5048  C  CA    . GLY B  1 256 ? 42.689  -9.705  -37.596 1.00 7.50  ? 267 GLY B CA    1 
ATOM   5049  C  C     . GLY B  1 256 ? 41.322  -10.018 -38.164 1.00 10.95 ? 267 GLY B C     1 
ATOM   5050  O  O     . GLY B  1 256 ? 41.203  -10.320 -39.361 1.00 10.42 ? 267 GLY B O     1 
ATOM   5051  N  N     . ALA B  1 257 ? 40.314  -10.093 -37.281 1.00 8.32  ? 268 ALA B N     1 
ATOM   5052  C  CA    . ALA B  1 257 ? 38.955  -10.519 -37.630 1.00 8.11  ? 268 ALA B CA    1 
ATOM   5053  C  C     . ALA B  1 257 ? 38.044  -9.368  -38.096 1.00 11.34 ? 268 ALA B C     1 
ATOM   5054  O  O     . ALA B  1 257 ? 36.858  -9.573  -38.285 1.00 8.88  ? 268 ALA B O     1 
ATOM   5055  C  CB    . ALA B  1 257 ? 38.310  -11.292 -36.463 1.00 8.51  ? 268 ALA B CB    1 
ATOM   5056  N  N     . ASP B  1 258 ? 38.601  -8.167  -38.281 1.00 7.90  ? 269 ASP B N     1 
ATOM   5057  C  CA    . ASP B  1 258 ? 37.834  -7.023  -38.778 1.00 7.20  ? 269 ASP B CA    1 
ATOM   5058  C  C     . ASP B  1 258 ? 37.620  -7.091  -40.281 1.00 8.62  ? 269 ASP B C     1 
ATOM   5059  O  O     . ASP B  1 258 ? 36.934  -6.239  -40.836 1.00 8.94  ? 269 ASP B O     1 
ATOM   5060  C  CB    . ASP B  1 258 ? 38.451  -5.700  -38.328 1.00 8.64  ? 269 ASP B CB    1 
ATOM   5061  C  CG    . ASP B  1 258 ? 39.952  -5.600  -38.530 1.00 13.97 ? 269 ASP B CG    1 
ATOM   5062  O  OD1   . ASP B  1 258 ? 40.553  -4.651  -37.994 1.00 11.11 ? 269 ASP B OD1   1 
ATOM   5063  O  OD2   . ASP B  1 258 ? 40.518  -6.459  -39.253 1.00 11.03 ? 269 ASP B OD2   1 
ATOM   5064  N  N     . SER B  1 259 ? 38.168  -8.136  -40.934 1.00 6.01  ? 270 SER B N     1 
ATOM   5065  C  CA    . SER B  1 259 ? 37.939  -8.389  -42.357 1.00 6.31  ? 270 SER B CA    1 
ATOM   5066  C  C     . SER B  1 259 ? 36.653  -9.223  -42.535 1.00 8.81  ? 270 SER B C     1 
ATOM   5067  O  O     . SER B  1 259 ? 36.300  -9.551  -43.676 1.00 8.70  ? 270 SER B O     1 
ATOM   5068  C  CB    . SER B  1 259 ? 39.150  -9.075  -42.999 1.00 7.92  ? 270 SER B CB    1 
ATOM   5069  O  OG    . SER B  1 259 ? 39.765  -9.999  -42.113 1.00 12.97 ? 270 SER B OG    1 
ATOM   5070  N  N     . LEU B  1 260 ? 35.942  -9.557  -41.420 1.00 6.50  ? 271 LEU B N     1 
ATOM   5071  C  CA    . LEU B  1 260 ? 34.678  -10.319 -41.513 1.00 6.33  ? 271 LEU B CA    1 
ATOM   5072  C  C     . LEU B  1 260 ? 33.525  -9.410  -41.846 1.00 9.99  ? 271 LEU B C     1 
ATOM   5073  O  O     . LEU B  1 260 ? 33.481  -8.238  -41.430 1.00 10.06 ? 271 LEU B O     1 
ATOM   5074  C  CB    . LEU B  1 260 ? 34.340  -11.003 -40.162 1.00 5.71  ? 271 LEU B CB    1 
ATOM   5075  C  CG    . LEU B  1 260 ? 35.320  -12.071 -39.653 1.00 9.27  ? 271 LEU B CG    1 
ATOM   5076  C  CD1   . LEU B  1 260 ? 34.939  -12.514 -38.255 1.00 7.51  ? 271 LEU B CD1   1 
ATOM   5077  C  CD2   . LEU B  1 260 ? 35.401  -13.268 -40.628 1.00 9.06  ? 271 LEU B CD2   1 
ATOM   5078  N  N     . SER B  1 261 ? 32.521  -9.995  -42.473 1.00 8.94  ? 272 SER B N     1 
ATOM   5079  C  CA    . SER B  1 261 ? 31.256  -9.321  -42.747 1.00 9.24  ? 272 SER B CA    1 
ATOM   5080  C  C     . SER B  1 261 ? 30.661  -8.852  -41.406 1.00 13.49 ? 272 SER B C     1 
ATOM   5081  O  O     . SER B  1 261 ? 30.738  -9.579  -40.391 1.00 10.92 ? 272 SER B O     1 
ATOM   5082  C  CB    . SER B  1 261 ? 30.286  -10.309 -43.392 1.00 11.99 ? 272 SER B CB    1 
ATOM   5083  O  OG    . SER B  1 261 ? 29.012  -9.712  -43.588 1.00 13.31 ? 272 SER B OG    1 
ATOM   5084  N  N     . GLY B  1 262 ? 30.087  -7.653  -41.416 1.00 10.11 ? 273 GLY B N     1 
ATOM   5085  C  CA    . GLY B  1 262 ? 29.419  -7.079  -40.256 1.00 9.76  ? 273 GLY B CA    1 
ATOM   5086  C  C     . GLY B  1 262 ? 30.316  -6.553  -39.162 1.00 12.50 ? 273 GLY B C     1 
ATOM   5087  O  O     . GLY B  1 262 ? 29.827  -6.249  -38.067 1.00 11.31 ? 273 GLY B O     1 
ATOM   5088  N  N     . ASP B  1 263 ? 31.611  -6.364  -39.457 1.00 8.95  ? 274 ASP B N     1 
ATOM   5089  C  CA    . ASP B  1 263 ? 32.518  -5.794  -38.454 1.00 8.66  ? 274 ASP B CA    1 
ATOM   5090  C  C     . ASP B  1 263 ? 32.112  -4.340  -38.213 1.00 12.49 ? 274 ASP B C     1 
ATOM   5091  O  O     . ASP B  1 263 ? 31.782  -3.633  -39.179 1.00 11.54 ? 274 ASP B O     1 
ATOM   5092  C  CB    . ASP B  1 263 ? 33.985  -5.894  -38.880 1.00 9.59  ? 274 ASP B CB    1 
ATOM   5093  C  CG    . ASP B  1 263 ? 34.913  -5.440  -37.778 1.00 11.36 ? 274 ASP B CG    1 
ATOM   5094  O  OD1   . ASP B  1 263 ? 35.170  -6.241  -36.847 1.00 11.79 ? 274 ASP B OD1   1 
ATOM   5095  O  OD2   . ASP B  1 263 ? 35.314  -4.279  -37.799 1.00 10.50 ? 274 ASP B OD2   1 
ATOM   5096  N  N     . ARG B  1 264 ? 32.137  -3.903  -36.938 1.00 11.62 ? 275 ARG B N     1 
ATOM   5097  C  CA    A ARG B  1 264 ? 31.779  -2.535  -36.529 0.53 12.23 ? 275 ARG B CA    1 
ATOM   5098  C  CA    B ARG B  1 264 ? 31.761  -2.541  -36.553 0.47 12.20 ? 275 ARG B CA    1 
ATOM   5099  C  C     . ARG B  1 264 ? 32.572  -1.478  -37.290 1.00 16.22 ? 275 ARG B C     1 
ATOM   5100  O  O     . ARG B  1 264 ? 32.036  -0.417  -37.591 1.00 15.96 ? 275 ARG B O     1 
ATOM   5101  C  CB    A ARG B  1 264 ? 32.026  -2.322  -35.020 0.53 12.69 ? 275 ARG B CB    1 
ATOM   5102  C  CB    B ARG B  1 264 ? 31.898  -2.357  -35.033 0.47 12.90 ? 275 ARG B CB    1 
ATOM   5103  C  CG    A ARG B  1 264 ? 30.867  -2.666  -34.094 0.53 22.74 ? 275 ARG B CG    1 
ATOM   5104  C  CG    B ARG B  1 264 ? 31.055  -1.224  -34.462 0.47 24.77 ? 275 ARG B CG    1 
ATOM   5105  C  CD    A ARG B  1 264 ? 31.123  -2.183  -32.651 0.53 30.12 ? 275 ARG B CD    1 
ATOM   5106  C  CD    B ARG B  1 264 ? 30.567  -1.543  -33.050 0.47 40.99 ? 275 ARG B CD    1 
ATOM   5107  N  NE    A ARG B  1 264 ? 31.331  -0.726  -32.546 0.53 34.32 ? 275 ARG B NE    1 
ATOM   5108  N  NE    B ARG B  1 264 ? 29.754  -2.762  -33.001 0.47 49.10 ? 275 ARG B NE    1 
ATOM   5109  C  CZ    A ARG B  1 264 ? 31.771  -0.091  -31.459 0.53 38.88 ? 275 ARG B CZ    1 
ATOM   5110  C  CZ    B ARG B  1 264 ? 29.342  -3.352  -31.883 0.47 63.38 ? 275 ARG B CZ    1 
ATOM   5111  N  NH1   A ARG B  1 264 ? 32.079  -0.771  -30.361 0.53 14.02 ? 275 ARG B NH1   1 
ATOM   5112  N  NH1   B ARG B  1 264 ? 29.658  -2.840  -30.699 0.47 51.31 ? 275 ARG B NH1   1 
ATOM   5113  N  NH2   A ARG B  1 264 ? 31.915  1.227   -31.465 0.53 29.52 ? 275 ARG B NH2   1 
ATOM   5114  N  NH2   B ARG B  1 264 ? 28.610  -4.458  -31.941 0.47 49.42 ? 275 ARG B NH2   1 
ATOM   5115  N  N     . LEU B  1 265 ? 33.861  -1.741  -37.557 1.00 11.73 ? 276 LEU B N     1 
ATOM   5116  C  CA    . LEU B  1 265 ? 34.739  -0.776  -38.231 1.00 10.97 ? 276 LEU B CA    1 
ATOM   5117  C  C     . LEU B  1 265 ? 35.077  -1.136  -39.673 1.00 16.09 ? 276 LEU B C     1 
ATOM   5118  O  O     . LEU B  1 265 ? 35.352  -0.239  -40.461 1.00 17.81 ? 276 LEU B O     1 
ATOM   5119  C  CB    . LEU B  1 265 ? 36.061  -0.593  -37.433 1.00 10.52 ? 276 LEU B CB    1 
ATOM   5120  C  CG    . LEU B  1 265 ? 36.003  -0.093  -35.982 1.00 15.90 ? 276 LEU B CG    1 
ATOM   5121  C  CD1   . LEU B  1 265 ? 37.389  0.270   -35.496 1.00 15.56 ? 276 LEU B CD1   1 
ATOM   5122  C  CD2   . LEU B  1 265 ? 35.067  1.085   -35.791 1.00 20.75 ? 276 LEU B CD2   1 
ATOM   5123  N  N     . GLY B  1 266 ? 35.073  -2.422  -40.006 1.00 11.39 ? 277 GLY B N     1 
ATOM   5124  C  CA    . GLY B  1 266 ? 35.420  -2.910  -41.337 1.00 10.92 ? 277 GLY B CA    1 
ATOM   5125  C  C     . GLY B  1 266 ? 34.316  -2.829  -42.377 1.00 15.30 ? 277 GLY B C     1 
ATOM   5126  O  O     . GLY B  1 266 ? 33.151  -2.594  -42.055 1.00 16.37 ? 277 GLY B O     1 
ATOM   5127  N  N     . CYS B  1 267 ? 34.679  -3.054  -43.634 1.00 12.23 ? 278 CYS B N     1 
ATOM   5128  C  CA    . CYS B  1 267 ? 33.754  -2.960  -44.771 1.00 13.03 ? 278 CYS B CA    1 
ATOM   5129  C  C     . CYS B  1 267 ? 33.990  -4.081  -45.761 1.00 13.48 ? 278 CYS B C     1 
ATOM   5130  O  O     . CYS B  1 267 ? 33.709  -3.928  -46.956 1.00 12.25 ? 278 CYS B O     1 
ATOM   5131  C  CB    . CYS B  1 267 ? 33.903  -1.597  -45.427 1.00 15.55 ? 278 CYS B CB    1 
ATOM   5132  S  SG    . CYS B  1 267 ? 35.599  -1.260  -45.931 1.00 20.55 ? 278 CYS B SG    1 
ATOM   5133  N  N     . PHE B  1 268 ? 34.437  -5.247  -45.255 1.00 9.00  ? 279 PHE B N     1 
ATOM   5134  C  CA    . PHE B  1 268 ? 34.597  -6.445  -46.075 1.00 8.39  ? 279 PHE B CA    1 
ATOM   5135  C  C     . PHE B  1 268 ? 33.395  -7.381  -45.853 1.00 12.83 ? 279 PHE B C     1 
ATOM   5136  O  O     . PHE B  1 268 ? 32.557  -7.130  -44.973 1.00 12.76 ? 279 PHE B O     1 
ATOM   5137  C  CB    . PHE B  1 268 ? 35.924  -7.156  -45.766 1.00 10.54 ? 279 PHE B CB    1 
ATOM   5138  C  CG    . PHE B  1 268 ? 37.210  -6.637  -46.385 1.00 10.71 ? 279 PHE B CG    1 
ATOM   5139  C  CD1   . PHE B  1 268 ? 38.409  -7.327  -46.215 1.00 11.66 ? 279 PHE B CD1   1 
ATOM   5140  C  CD2   . PHE B  1 268 ? 37.213  -5.500  -47.188 1.00 11.53 ? 279 PHE B CD2   1 
ATOM   5141  C  CE1   . PHE B  1 268 ? 39.593  -6.859  -46.773 1.00 11.82 ? 279 PHE B CE1   1 
ATOM   5142  C  CE2   . PHE B  1 268 ? 38.410  -5.034  -47.758 1.00 13.54 ? 279 PHE B CE2   1 
ATOM   5143  C  CZ    . PHE B  1 268 ? 39.579  -5.740  -47.580 1.00 11.61 ? 279 PHE B CZ    1 
ATOM   5144  N  N     . ASN B  1 269 ? 33.312  -8.457  -46.634 1.00 9.27  ? 280 ASN B N     1 
ATOM   5145  C  CA    . ASN B  1 269 ? 32.184  -9.362  -46.549 1.00 9.47  ? 280 ASN B CA    1 
ATOM   5146  C  C     . ASN B  1 269 ? 32.604  -10.827 -46.460 1.00 11.81 ? 280 ASN B C     1 
ATOM   5147  O  O     . ASN B  1 269 ? 31.983  -11.704 -47.075 1.00 10.26 ? 280 ASN B O     1 
ATOM   5148  C  CB    . ASN B  1 269 ? 31.201  -9.097  -47.732 1.00 11.32 ? 280 ASN B CB    1 
ATOM   5149  C  CG    . ASN B  1 269 ? 29.805  -9.625  -47.501 1.00 17.96 ? 280 ASN B CG    1 
ATOM   5150  O  OD1   . ASN B  1 269 ? 29.424  -9.938  -46.364 1.00 13.06 ? 280 ASN B OD1   1 
ATOM   5151  N  ND2   . ASN B  1 269 ? 28.995  -9.721  -48.569 1.00 8.98  ? 280 ASN B ND2   1 
ATOM   5152  N  N     . LEU B  1 270 ? 33.672  -11.112 -45.687 1.00 9.14  ? 281 LEU B N     1 
ATOM   5153  C  CA    . LEU B  1 270 ? 34.090  -12.523 -45.552 1.00 8.34  ? 281 LEU B CA    1 
ATOM   5154  C  C     . LEU B  1 270 ? 33.268  -13.200 -44.477 1.00 11.39 ? 281 LEU B C     1 
ATOM   5155  O  O     . LEU B  1 270 ? 32.871  -12.547 -43.515 1.00 11.09 ? 281 LEU B O     1 
ATOM   5156  C  CB    . LEU B  1 270 ? 35.579  -12.607 -45.104 1.00 7.71  ? 281 LEU B CB    1 
ATOM   5157  C  CG    . LEU B  1 270 ? 36.612  -11.939 -46.010 1.00 10.67 ? 281 LEU B CG    1 
ATOM   5158  C  CD1   . LEU B  1 270 ? 38.009  -12.099 -45.439 1.00 10.73 ? 281 LEU B CD1   1 
ATOM   5159  C  CD2   . LEU B  1 270 ? 36.540  -12.493 -47.443 1.00 10.73 ? 281 LEU B CD2   1 
ATOM   5160  N  N     . THR B  1 271 ? 33.094  -14.524 -44.584 1.00 8.90  ? 282 THR B N     1 
ATOM   5161  C  CA    . THR B  1 271 ? 32.476  -15.295 -43.513 1.00 7.56  ? 282 THR B CA    1 
ATOM   5162  C  C     . THR B  1 271 ? 33.657  -15.840 -42.692 1.00 11.26 ? 282 THR B C     1 
ATOM   5163  O  O     . THR B  1 271 ? 34.809  -15.692 -43.100 1.00 9.28  ? 282 THR B O     1 
ATOM   5164  C  CB    . THR B  1 271 ? 31.632  -16.448 -44.081 1.00 10.76 ? 282 THR B CB    1 
ATOM   5165  O  OG1   . THR B  1 271 ? 32.480  -17.421 -44.681 1.00 10.56 ? 282 THR B OG1   1 
ATOM   5166  C  CG2   . THR B  1 271 ? 30.577  -15.967 -45.095 1.00 12.06 ? 282 THR B CG2   1 
ATOM   5167  N  N     . VAL B  1 272 ? 33.375  -16.546 -41.593 1.00 7.55  ? 283 VAL B N     1 
ATOM   5168  C  CA    . VAL B  1 272 ? 34.436  -17.206 -40.822 1.00 7.51  ? 283 VAL B CA    1 
ATOM   5169  C  C     . VAL B  1 272 ? 35.157  -18.279 -41.689 1.00 11.31 ? 283 VAL B C     1 
ATOM   5170  O  O     . VAL B  1 272 ? 36.375  -18.409 -41.610 1.00 10.44 ? 283 VAL B O     1 
ATOM   5171  C  CB    . VAL B  1 272 ? 33.854  -17.742 -39.492 1.00 10.22 ? 283 VAL B CB    1 
ATOM   5172  C  CG1   . VAL B  1 272 ? 34.766  -18.803 -38.852 1.00 9.50  ? 283 VAL B CG1   1 
ATOM   5173  C  CG2   . VAL B  1 272 ? 33.593  -16.570 -38.519 1.00 9.91  ? 283 VAL B CG2   1 
ATOM   5174  N  N     . LYS B  1 273 ? 34.424  -18.975 -42.584 1.00 8.75  ? 284 LYS B N     1 
ATOM   5175  C  CA    . LYS B  1 273 ? 35.050  -19.982 -43.460 1.00 9.37  ? 284 LYS B CA    1 
ATOM   5176  C  C     . LYS B  1 273 ? 36.041  -19.364 -44.460 1.00 11.70 ? 284 LYS B C     1 
ATOM   5177  O  O     . LYS B  1 273 ? 37.119  -19.920 -44.694 1.00 9.65  ? 284 LYS B O     1 
ATOM   5178  C  CB    . LYS B  1 273 ? 33.990  -20.776 -44.238 1.00 10.79 ? 284 LYS B CB    1 
ATOM   5179  C  CG    . LYS B  1 273 ? 33.246  -21.768 -43.389 1.00 14.65 ? 284 LYS B CG    1 
ATOM   5180  C  CD    . LYS B  1 273 ? 32.224  -22.554 -44.218 1.00 14.73 ? 284 LYS B CD    1 
ATOM   5181  C  CE    . LYS B  1 273 ? 31.396  -23.407 -43.264 1.00 21.85 ? 284 LYS B CE    1 
ATOM   5182  N  NZ    . LYS B  1 273 ? 30.581  -24.450 -43.978 1.00 17.95 ? 284 LYS B NZ    1 
ATOM   5183  N  N     . GLY B  1 274 ? 35.667  -18.226 -45.030 1.00 9.40  ? 285 GLY B N     1 
ATOM   5184  C  CA    . GLY B  1 274 ? 36.531  -17.542 -45.989 1.00 8.76  ? 285 GLY B CA    1 
ATOM   5185  C  C     . GLY B  1 274 ? 37.770  -16.985 -45.323 1.00 10.99 ? 285 GLY B C     1 
ATOM   5186  O  O     . GLY B  1 274 ? 38.864  -17.038 -45.885 1.00 10.40 ? 285 GLY B O     1 
ATOM   5187  N  N     . HIS B  1 275 ? 37.615  -16.498 -44.094 1.00 6.51  ? 286 HIS B N     1 
ATOM   5188  C  CA    . HIS B  1 275 ? 38.748  -15.980 -43.317 1.00 5.55  ? 286 HIS B CA    1 
ATOM   5189  C  C     . HIS B  1 275 ? 39.648  -17.172 -42.940 1.00 9.23  ? 286 HIS B C     1 
ATOM   5190  O  O     . HIS B  1 275 ? 40.847  -17.151 -43.232 1.00 9.93  ? 286 HIS B O     1 
ATOM   5191  C  CB    . HIS B  1 275 ? 38.200  -15.272 -42.053 1.00 6.00  ? 286 HIS B CB    1 
ATOM   5192  C  CG    . HIS B  1 275 ? 39.191  -14.386 -41.349 1.00 8.88  ? 286 HIS B CG    1 
ATOM   5193  N  ND1   . HIS B  1 275 ? 40.069  -14.889 -40.393 1.00 9.31  ? 286 HIS B ND1   1 
ATOM   5194  C  CD2   . HIS B  1 275 ? 39.328  -13.042 -41.404 1.00 8.72  ? 286 HIS B CD2   1 
ATOM   5195  C  CE1   . HIS B  1 275 ? 40.733  -13.844 -39.934 1.00 9.08  ? 286 HIS B CE1   1 
ATOM   5196  N  NE2   . HIS B  1 275 ? 40.302  -12.706 -40.500 1.00 9.14  ? 286 HIS B NE2   1 
ATOM   5197  N  N     . ALA B  1 276 ? 39.055  -18.261 -42.394 1.00 8.06  ? 287 ALA B N     1 
ATOM   5198  C  CA    . ALA B  1 276 ? 39.819  -19.436 -41.968 1.00 8.06  ? 287 ALA B CA    1 
ATOM   5199  C  C     . ALA B  1 276 ? 40.485  -20.190 -43.106 1.00 10.81 ? 287 ALA B C     1 
ATOM   5200  O  O     . ALA B  1 276 ? 41.485  -20.869 -42.872 1.00 9.55  ? 287 ALA B O     1 
ATOM   5201  C  CB    . ALA B  1 276 ? 38.960  -20.374 -41.128 1.00 8.54  ? 287 ALA B CB    1 
ATOM   5202  N  N     . LYS B  1 277 ? 39.982  -20.036 -44.335 1.00 8.81  ? 288 LYS B N     1 
ATOM   5203  C  CA    . LYS B  1 277 ? 40.595  -20.657 -45.514 1.00 9.29  ? 288 LYS B CA    1 
ATOM   5204  C  C     . LYS B  1 277 ? 42.053  -20.199 -45.654 1.00 12.38 ? 288 LYS B C     1 
ATOM   5205  O  O     . LYS B  1 277 ? 42.913  -20.988 -46.055 1.00 11.19 ? 288 LYS B O     1 
ATOM   5206  C  CB    . LYS B  1 277 ? 39.780  -20.332 -46.778 1.00 12.06 ? 288 LYS B CB    1 
ATOM   5207  C  CG    . LYS B  1 277 ? 40.335  -20.962 -48.070 1.00 18.27 ? 288 LYS B CG    1 
ATOM   5208  C  CD    . LYS B  1 277 ? 40.363  -22.477 -47.991 1.00 26.65 ? 288 LYS B CD    1 
ATOM   5209  C  CE    . LYS B  1 277 ? 41.051  -23.076 -49.190 1.00 57.62 ? 288 LYS B CE    1 
ATOM   5210  N  NZ    . LYS B  1 277 ? 41.473  -24.484 -48.944 1.00 71.99 ? 288 LYS B NZ    1 
ATOM   5211  N  N     . CYS B  1 278 ? 42.353  -18.954 -45.232 1.00 9.23  ? 289 CYS B N     1 
ATOM   5212  C  CA    . CYS B  1 278 ? 43.726  -18.445 -45.243 1.00 8.19  ? 289 CYS B CA    1 
ATOM   5213  C  C     . CYS B  1 278 ? 44.633  -19.294 -44.335 1.00 9.86  ? 289 CYS B C     1 
ATOM   5214  O  O     . CYS B  1 278 ? 45.768  -19.604 -44.715 1.00 8.30  ? 289 CYS B O     1 
ATOM   5215  C  CB    . CYS B  1 278 ? 43.742  -16.979 -44.840 1.00 8.19  ? 289 CYS B CB    1 
ATOM   5216  S  SG    . CYS B  1 278 ? 42.771  -15.935 -45.941 1.00 12.22 ? 289 CYS B SG    1 
ATOM   5217  N  N     . VAL B  1 279 ? 44.140  -19.655 -43.131 1.00 7.70  ? 290 VAL B N     1 
ATOM   5218  C  CA    . VAL B  1 279 ? 44.903  -20.499 -42.199 1.00 7.97  ? 290 VAL B CA    1 
ATOM   5219  C  C     . VAL B  1 279 ? 45.144  -21.862 -42.840 1.00 12.24 ? 290 VAL B C     1 
ATOM   5220  O  O     . VAL B  1 279 ? 46.273  -22.333 -42.830 1.00 11.78 ? 290 VAL B O     1 
ATOM   5221  C  CB    . VAL B  1 279 ? 44.230  -20.617 -40.803 1.00 11.08 ? 290 VAL B CB    1 
ATOM   5222  C  CG1   . VAL B  1 279 ? 45.013  -21.551 -39.884 1.00 10.53 ? 290 VAL B CG1   1 
ATOM   5223  C  CG2   . VAL B  1 279 ? 44.075  -19.243 -40.149 1.00 10.64 ? 290 VAL B CG2   1 
ATOM   5224  N  N     . GLU B  1 280 ? 44.100  -22.477 -43.435 1.00 10.28 ? 291 GLU B N     1 
ATOM   5225  C  CA    . GLU B  1 280 ? 44.235  -23.778 -44.104 1.00 11.71 ? 291 GLU B CA    1 
ATOM   5226  C  C     . GLU B  1 280 ? 45.309  -23.700 -45.192 1.00 13.97 ? 291 GLU B C     1 
ATOM   5227  O  O     . GLU B  1 280 ? 46.219  -24.527 -45.214 1.00 12.66 ? 291 GLU B O     1 
ATOM   5228  C  CB    . GLU B  1 280 ? 42.895  -24.195 -44.766 1.00 13.87 ? 291 GLU B CB    1 
ATOM   5229  C  CG    . GLU B  1 280 ? 41.770  -24.396 -43.771 1.00 23.59 ? 291 GLU B CG    1 
ATOM   5230  C  CD    . GLU B  1 280 ? 40.431  -24.750 -44.386 1.00 49.15 ? 291 GLU B CD    1 
ATOM   5231  O  OE1   . GLU B  1 280 ? 40.417  -25.390 -45.461 1.00 48.55 ? 291 GLU B OE1   1 
ATOM   5232  O  OE2   . GLU B  1 280 ? 39.395  -24.373 -43.796 1.00 47.63 ? 291 GLU B OE2   1 
ATOM   5233  N  N     . VAL B  1 281 ? 45.229  -22.682 -46.059 1.00 11.19 ? 292 VAL B N     1 
ATOM   5234  C  CA    . VAL B  1 281 ? 46.214  -22.492 -47.129 1.00 9.84  ? 292 VAL B CA    1 
ATOM   5235  C  C     . VAL B  1 281 ? 47.652  -22.409 -46.589 1.00 13.77 ? 292 VAL B C     1 
ATOM   5236  O  O     . VAL B  1 281 ? 48.526  -23.130 -47.076 1.00 14.67 ? 292 VAL B O     1 
ATOM   5237  C  CB    . VAL B  1 281 ? 45.837  -21.306 -48.048 1.00 12.45 ? 292 VAL B CB    1 
ATOM   5238  C  CG1   . VAL B  1 281 ? 47.001  -20.922 -48.976 1.00 12.04 ? 292 VAL B CG1   1 
ATOM   5239  C  CG2   . VAL B  1 281 ? 44.577  -21.631 -48.854 1.00 12.11 ? 292 VAL B CG2   1 
ATOM   5240  N  N     . VAL B  1 282 ? 47.897  -21.545 -45.594 1.00 11.38 ? 293 VAL B N     1 
ATOM   5241  C  CA    . VAL B  1 282 ? 49.239  -21.365 -45.011 1.00 11.51 ? 293 VAL B CA    1 
ATOM   5242  C  C     . VAL B  1 282 ? 49.750  -22.699 -44.415 1.00 16.46 ? 293 VAL B C     1 
ATOM   5243  O  O     . VAL B  1 282 ? 50.923  -23.044 -44.609 1.00 15.26 ? 293 VAL B O     1 
ATOM   5244  C  CB    . VAL B  1 282 ? 49.283  -20.171 -44.007 1.00 13.31 ? 293 VAL B CB    1 
ATOM   5245  C  CG1   . VAL B  1 282 ? 50.624  -20.114 -43.274 1.00 12.90 ? 293 VAL B CG1   1 
ATOM   5246  C  CG2   . VAL B  1 282 ? 49.038  -18.841 -44.746 1.00 12.22 ? 293 VAL B CG2   1 
ATOM   5247  N  N     . LYS B  1 283 ? 48.856  -23.472 -43.750 1.00 13.53 ? 294 LYS B N     1 
ATOM   5248  C  CA    . LYS B  1 283 ? 49.239  -24.772 -43.145 1.00 12.52 ? 294 LYS B CA    1 
ATOM   5249  C  C     . LYS B  1 283 ? 49.771  -25.796 -44.163 1.00 17.53 ? 294 LYS B C     1 
ATOM   5250  O  O     . LYS B  1 283 ? 50.652  -26.582 -43.816 1.00 16.77 ? 294 LYS B O     1 
ATOM   5251  C  CB    . LYS B  1 283 ? 48.072  -25.407 -42.390 1.00 14.32 ? 294 LYS B CB    1 
ATOM   5252  C  CG    . LYS B  1 283 ? 47.857  -24.847 -41.002 1.00 19.25 ? 294 LYS B CG    1 
ATOM   5253  C  CD    . LYS B  1 283 ? 46.752  -25.636 -40.293 1.00 25.18 ? 294 LYS B CD    1 
ATOM   5254  C  CE    . LYS B  1 283 ? 47.217  -27.017 -39.874 1.00 22.36 ? 294 LYS B CE    1 
ATOM   5255  N  NZ    . LYS B  1 283 ? 46.083  -27.884 -39.455 1.00 31.98 ? 294 LYS B NZ    1 
ATOM   5256  N  N     . THR B  1 284 ? 49.247  -25.797 -45.402 1.00 15.57 ? 295 THR B N     1 
ATOM   5257  C  CA    . THR B  1 284 ? 49.653  -26.775 -46.439 1.00 15.11 ? 295 THR B CA    1 
ATOM   5258  C  C     . THR B  1 284 ? 51.142  -26.712 -46.745 1.00 19.37 ? 295 THR B C     1 
ATOM   5259  O  O     . THR B  1 284 ? 51.684  -27.682 -47.248 1.00 19.86 ? 295 THR B O     1 
ATOM   5260  C  CB    . THR B  1 284 ? 48.783  -26.688 -47.720 1.00 19.26 ? 295 THR B CB    1 
ATOM   5261  O  OG1   . THR B  1 284 ? 49.116  -25.507 -48.460 1.00 16.67 ? 295 THR B OG1   1 
ATOM   5262  C  CG2   . THR B  1 284 ? 47.274  -26.748 -47.425 1.00 18.15 ? 295 THR B CG2   1 
ATOM   5263  N  N     . PHE B  1 285 ? 51.815  -25.599 -46.400 1.00 14.80 ? 296 PHE B N     1 
ATOM   5264  C  CA    . PHE B  1 285 ? 53.251  -25.459 -46.640 1.00 15.04 ? 296 PHE B CA    1 
ATOM   5265  C  C     . PHE B  1 285 ? 54.140  -26.134 -45.589 1.00 18.84 ? 296 PHE B C     1 
ATOM   5266  O  O     . PHE B  1 285 ? 55.349  -26.219 -45.786 1.00 18.40 ? 296 PHE B O     1 
ATOM   5267  C  CB    . PHE B  1 285 ? 53.640  -24.006 -46.919 1.00 15.27 ? 296 PHE B CB    1 
ATOM   5268  C  CG    . PHE B  1 285 ? 52.940  -23.527 -48.169 1.00 15.11 ? 296 PHE B CG    1 
ATOM   5269  C  CD1   . PHE B  1 285 ? 53.462  -23.806 -49.428 1.00 16.84 ? 296 PHE B CD1   1 
ATOM   5270  C  CD2   . PHE B  1 285 ? 51.702  -22.891 -48.093 1.00 16.30 ? 296 PHE B CD2   1 
ATOM   5271  C  CE1   . PHE B  1 285 ? 52.787  -23.404 -50.584 1.00 16.74 ? 296 PHE B CE1   1 
ATOM   5272  C  CE2   . PHE B  1 285 ? 51.037  -22.476 -49.246 1.00 18.76 ? 296 PHE B CE2   1 
ATOM   5273  C  CZ    . PHE B  1 285 ? 51.587  -22.735 -50.485 1.00 16.96 ? 296 PHE B CZ    1 
ATOM   5274  N  N     . ASN B  1 286 ? 53.535  -26.624 -44.485 1.00 15.36 ? 297 ASN B N     1 
ATOM   5275  C  CA    . ASN B  1 286 ? 54.217  -27.358 -43.421 1.00 14.98 ? 297 ASN B CA    1 
ATOM   5276  C  C     . ASN B  1 286 ? 55.417  -26.624 -42.857 1.00 20.31 ? 297 ASN B C     1 
ATOM   5277  O  O     . ASN B  1 286 ? 56.492  -27.222 -42.663 1.00 20.29 ? 297 ASN B O     1 
ATOM   5278  C  CB    . ASN B  1 286 ? 54.613  -28.787 -43.897 1.00 18.88 ? 297 ASN B CB    1 
ATOM   5279  C  CG    . ASN B  1 286 ? 53.477  -29.592 -44.464 1.00 38.14 ? 297 ASN B CG    1 
ATOM   5280  O  OD1   . ASN B  1 286 ? 52.424  -29.730 -43.849 1.00 32.36 ? 297 ASN B OD1   1 
ATOM   5281  N  ND2   . ASN B  1 286 ? 53.677  -30.178 -45.637 1.00 33.46 ? 297 ASN B ND2   1 
ATOM   5282  N  N     . LEU B  1 287 ? 55.248  -25.316 -42.595 1.00 14.44 ? 298 LEU B N     1 
ATOM   5283  C  CA    . LEU B  1 287 ? 56.311  -24.520 -42.010 1.00 12.57 ? 298 LEU B CA    1 
ATOM   5284  C  C     . LEU B  1 287 ? 55.921  -24.117 -40.592 1.00 15.21 ? 298 LEU B C     1 
ATOM   5285  O  O     . LEU B  1 287 ? 54.738  -23.886 -40.365 1.00 14.52 ? 298 LEU B O     1 
ATOM   5286  C  CB    . LEU B  1 287 ? 56.533  -23.245 -42.849 1.00 12.51 ? 298 LEU B CB    1 
ATOM   5287  C  CG    . LEU B  1 287 ? 57.037  -23.411 -44.276 1.00 15.28 ? 298 LEU B CG    1 
ATOM   5288  C  CD1   . LEU B  1 287 ? 56.969  -22.067 -44.999 1.00 14.88 ? 298 LEU B CD1   1 
ATOM   5289  C  CD2   . LEU B  1 287 ? 58.467  -24.001 -44.300 1.00 12.74 ? 298 LEU B CD2   1 
ATOM   5290  N  N     . PRO B  1 288 ? 56.890  -24.015 -39.638 1.00 12.71 ? 299 PRO B N     1 
ATOM   5291  C  CA    . PRO B  1 288 ? 56.579  -23.496 -38.288 1.00 11.82 ? 299 PRO B CA    1 
ATOM   5292  C  C     . PRO B  1 288 ? 55.732  -22.233 -38.454 1.00 15.02 ? 299 PRO B C     1 
ATOM   5293  O  O     . PRO B  1 288 ? 56.050  -21.359 -39.276 1.00 13.10 ? 299 PRO B O     1 
ATOM   5294  C  CB    . PRO B  1 288 ? 57.952  -23.093 -37.748 1.00 13.46 ? 299 PRO B CB    1 
ATOM   5295  C  CG    . PRO B  1 288 ? 58.902  -23.994 -38.439 1.00 18.38 ? 299 PRO B CG    1 
ATOM   5296  C  CD    . PRO B  1 288 ? 58.340  -24.279 -39.789 1.00 14.13 ? 299 PRO B CD    1 
ATOM   5297  N  N     . LEU B  1 289 ? 54.617  -22.186 -37.738 1.00 10.92 ? 300 LEU B N     1 
ATOM   5298  C  CA    . LEU B  1 289 ? 53.650  -21.114 -37.920 1.00 9.33  ? 300 LEU B CA    1 
ATOM   5299  C  C     . LEU B  1 289 ? 53.207  -20.463 -36.614 1.00 12.12 ? 300 LEU B C     1 
ATOM   5300  O  O     . LEU B  1 289 ? 52.783  -21.155 -35.673 1.00 11.16 ? 300 LEU B O     1 
ATOM   5301  C  CB    . LEU B  1 289 ? 52.446  -21.715 -38.677 1.00 8.79  ? 300 LEU B CB    1 
ATOM   5302  C  CG    . LEU B  1 289 ? 51.140  -20.884 -38.796 1.00 10.61 ? 300 LEU B CG    1 
ATOM   5303  C  CD1   . LEU B  1 289 ? 51.385  -19.577 -39.590 1.00 8.95  ? 300 LEU B CD1   1 
ATOM   5304  C  CD2   . LEU B  1 289 ? 50.057  -21.712 -39.511 1.00 11.51 ? 300 LEU B CD2   1 
ATOM   5305  N  N     . LEU B  1 290 ? 53.303  -19.114 -36.562 1.00 7.92  ? 301 LEU B N     1 
ATOM   5306  C  CA    . LEU B  1 290 ? 52.835  -18.363 -35.401 1.00 7.76  ? 301 LEU B CA    1 
ATOM   5307  C  C     . LEU B  1 290 ? 51.558  -17.625 -35.841 1.00 9.79  ? 301 LEU B C     1 
ATOM   5308  O  O     . LEU B  1 290 ? 51.610  -16.830 -36.781 1.00 8.71  ? 301 LEU B O     1 
ATOM   5309  C  CB    . LEU B  1 290 ? 53.917  -17.356 -34.946 1.00 8.05  ? 301 LEU B CB    1 
ATOM   5310  C  CG    . LEU B  1 290 ? 53.486  -16.426 -33.784 1.00 12.39 ? 301 LEU B CG    1 
ATOM   5311  C  CD1   . LEU B  1 290 ? 53.224  -17.212 -32.488 1.00 11.36 ? 301 LEU B CD1   1 
ATOM   5312  C  CD2   . LEU B  1 290 ? 54.526  -15.328 -33.544 1.00 11.67 ? 301 LEU B CD2   1 
ATOM   5313  N  N     . MET B  1 291 ? 50.427  -17.926 -35.205 1.00 6.34  ? 302 MET B N     1 
ATOM   5314  C  CA    . MET B  1 291 ? 49.115  -17.346 -35.525 1.00 5.15  ? 302 MET B CA    1 
ATOM   5315  C  C     . MET B  1 291 ? 48.762  -16.351 -34.453 1.00 8.30  ? 302 MET B C     1 
ATOM   5316  O  O     . MET B  1 291 ? 48.763  -16.695 -33.261 1.00 9.16  ? 302 MET B O     1 
ATOM   5317  C  CB    . MET B  1 291 ? 48.038  -18.445 -35.570 1.00 6.74  ? 302 MET B CB    1 
ATOM   5318  C  CG    . MET B  1 291 ? 48.171  -19.376 -36.789 1.00 9.90  ? 302 MET B CG    1 
ATOM   5319  S  SD    . MET B  1 291 ? 47.178  -20.893 -36.643 1.00 13.26 ? 302 MET B SD    1 
ATOM   5320  C  CE    . MET B  1 291 ? 45.516  -20.208 -36.336 1.00 10.39 ? 302 MET B CE    1 
ATOM   5321  N  N     . LEU B  1 292 ? 48.483  -15.109 -34.874 1.00 6.72  ? 303 LEU B N     1 
ATOM   5322  C  CA    . LEU B  1 292 ? 48.204  -13.995 -33.977 1.00 5.10  ? 303 LEU B CA    1 
ATOM   5323  C  C     . LEU B  1 292 ? 46.845  -13.350 -34.236 1.00 7.93  ? 303 LEU B C     1 
ATOM   5324  O  O     . LEU B  1 292 ? 46.276  -13.518 -35.322 1.00 7.13  ? 303 LEU B O     1 
ATOM   5325  C  CB    . LEU B  1 292 ? 49.320  -12.930 -34.157 1.00 5.62  ? 303 LEU B CB    1 
ATOM   5326  C  CG    . LEU B  1 292 ? 50.770  -13.417 -33.950 1.00 9.27  ? 303 LEU B CG    1 
ATOM   5327  C  CD1   . LEU B  1 292 ? 51.753  -12.342 -34.312 1.00 8.37  ? 303 LEU B CD1   1 
ATOM   5328  C  CD2   . LEU B  1 292 ? 50.974  -13.952 -32.505 1.00 8.32  ? 303 LEU B CD2   1 
ATOM   5329  N  N     . GLY B  1 293 ? 46.342  -12.616 -33.235 1.00 7.21  ? 304 GLY B N     1 
ATOM   5330  C  CA    . GLY B  1 293 ? 45.093  -11.861 -33.340 1.00 6.90  ? 304 GLY B CA    1 
ATOM   5331  C  C     . GLY B  1 293 ? 45.248  -10.579 -34.159 1.00 10.23 ? 304 GLY B C     1 
ATOM   5332  O  O     . GLY B  1 293 ? 46.029  -10.518 -35.111 1.00 7.70  ? 304 GLY B O     1 
ATOM   5333  N  N     . GLY B  1 294 ? 44.530  -9.543  -33.763 1.00 7.36  ? 305 GLY B N     1 
ATOM   5334  C  CA    . GLY B  1 294 ? 44.576  -8.248  -34.427 1.00 8.03  ? 305 GLY B CA    1 
ATOM   5335  C  C     . GLY B  1 294 ? 43.279  -7.515  -34.176 1.00 10.18 ? 305 GLY B C     1 
ATOM   5336  O  O     . GLY B  1 294 ? 42.715  -7.627  -33.081 1.00 7.77  ? 305 GLY B O     1 
ATOM   5337  N  N     . GLY B  1 295 ? 42.787  -6.815  -35.186 1.00 7.12  ? 306 GLY B N     1 
ATOM   5338  C  CA    . GLY B  1 295 ? 41.520  -6.098  -35.059 1.00 6.76  ? 306 GLY B CA    1 
ATOM   5339  C  C     . GLY B  1 295 ? 40.347  -7.065  -35.056 1.00 10.58 ? 306 GLY B C     1 
ATOM   5340  O  O     . GLY B  1 295 ? 40.538  -8.279  -35.091 1.00 10.26 ? 306 GLY B O     1 
ATOM   5341  N  N     . GLY B  1 296 ? 39.136  -6.535  -34.988 1.00 6.24  ? 307 GLY B N     1 
ATOM   5342  C  CA    . GLY B  1 296 ? 37.915  -7.340  -34.904 1.00 6.44  ? 307 GLY B CA    1 
ATOM   5343  C  C     . GLY B  1 296 ? 37.087  -6.676  -33.827 1.00 11.09 ? 307 GLY B C     1 
ATOM   5344  O  O     . GLY B  1 296 ? 37.466  -6.659  -32.648 1.00 10.48 ? 307 GLY B O     1 
ATOM   5345  N  N     . TYR B  1 297 ? 35.968  -6.101  -34.245 1.00 8.16  ? 308 TYR B N     1 
ATOM   5346  C  CA    . TYR B  1 297 ? 35.127  -5.223  -33.434 1.00 7.13  ? 308 TYR B CA    1 
ATOM   5347  C  C     . TYR B  1 297 ? 33.670  -5.627  -33.218 1.00 10.03 ? 308 TYR B C     1 
ATOM   5348  O  O     . TYR B  1 297 ? 32.994  -4.955  -32.450 1.00 9.64  ? 308 TYR B O     1 
ATOM   5349  C  CB    . TYR B  1 297 ? 35.325  -3.755  -33.915 1.00 8.11  ? 308 TYR B CB    1 
ATOM   5350  C  CG    . TYR B  1 297 ? 36.805  -3.409  -33.989 1.00 7.95  ? 308 TYR B CG    1 
ATOM   5351  C  CD1   . TYR B  1 297 ? 37.496  -3.470  -35.201 1.00 8.89  ? 308 TYR B CD1   1 
ATOM   5352  C  CD2   . TYR B  1 297 ? 37.550  -3.211  -32.825 1.00 8.17  ? 308 TYR B CD2   1 
ATOM   5353  C  CE1   . TYR B  1 297 ? 38.878  -3.286  -35.254 1.00 6.51  ? 308 TYR B CE1   1 
ATOM   5354  C  CE2   . TYR B  1 297 ? 38.920  -2.989  -32.870 1.00 9.05  ? 308 TYR B CE2   1 
ATOM   5355  C  CZ    . TYR B  1 297 ? 39.579  -3.019  -34.088 1.00 9.25  ? 308 TYR B CZ    1 
ATOM   5356  O  OH    . TYR B  1 297 ? 40.932  -2.823  -34.100 1.00 8.83  ? 308 TYR B OH    1 
ATOM   5357  N  N     . THR B  1 298 ? 33.198  -6.699  -33.875 1.00 8.94  ? 309 THR B N     1 
ATOM   5358  C  CA    A THR B  1 298 ? 31.883  -7.301  -33.622 0.58 8.54  ? 309 THR B CA    1 
ATOM   5359  C  CA    B THR B  1 298 ? 31.880  -7.303  -33.632 0.42 8.60  ? 309 THR B CA    1 
ATOM   5360  C  C     . THR B  1 298 ? 32.299  -8.531  -32.850 1.00 11.23 ? 309 THR B C     1 
ATOM   5361  O  O     . THR B  1 298 ? 32.716  -9.540  -33.431 1.00 9.51  ? 309 THR B O     1 
ATOM   5362  C  CB    A THR B  1 298 ? 31.109  -7.558  -34.919 0.58 13.56 ? 309 THR B CB    1 
ATOM   5363  C  CB    B THR B  1 298 ? 31.132  -7.581  -34.944 0.42 15.55 ? 309 THR B CB    1 
ATOM   5364  O  OG1   A THR B  1 298 ? 30.961  -6.302  -35.573 0.58 10.51 ? 309 THR B OG1   1 
ATOM   5365  O  OG1   B THR B  1 298 ? 30.943  -6.334  -35.604 0.42 14.14 ? 309 THR B OG1   1 
ATOM   5366  C  CG2   A THR B  1 298 ? 29.726  -8.110  -34.645 0.58 10.43 ? 309 THR B CG2   1 
ATOM   5367  C  CG2   B THR B  1 298 ? 29.770  -8.210  -34.704 0.42 13.87 ? 309 THR B CG2   1 
ATOM   5368  N  N     . ILE B  1 299 ? 32.370  -8.377  -31.544 1.00 9.34  ? 310 ILE B N     1 
ATOM   5369  C  CA    . ILE B  1 299 ? 32.993  -9.363  -30.662 1.00 9.05  ? 310 ILE B CA    1 
ATOM   5370  C  C     . ILE B  1 299 ? 32.511  -10.777 -30.748 1.00 10.84 ? 310 ILE B C     1 
ATOM   5371  O  O     . ILE B  1 299 ? 33.326  -11.697 -30.659 1.00 9.16  ? 310 ILE B O     1 
ATOM   5372  C  CB    . ILE B  1 299 ? 33.236  -8.807  -29.236 1.00 11.93 ? 310 ILE B CB    1 
ATOM   5373  C  CG1   . ILE B  1 299 ? 31.911  -8.646  -28.442 1.00 11.99 ? 310 ILE B CG1   1 
ATOM   5374  C  CG2   . ILE B  1 299 ? 34.034  -7.452  -29.341 1.00 8.33  ? 310 ILE B CG2   1 
ATOM   5375  C  CD1   . ILE B  1 299 ? 32.092  -8.167  -26.926 1.00 16.23 ? 310 ILE B CD1   1 
ATOM   5376  N  N     . ARG B  1 300 ? 31.203  -10.969 -30.973 1.00 7.90  ? 311 ARG B N     1 
ATOM   5377  C  CA    . ARG B  1 300 ? 30.695  -12.335 -31.137 1.00 8.83  ? 311 ARG B CA    1 
ATOM   5378  C  C     . ARG B  1 300 ? 31.340  -12.986 -32.360 1.00 11.28 ? 311 ARG B C     1 
ATOM   5379  O  O     . ARG B  1 300 ? 31.641  -14.184 -32.328 1.00 9.80  ? 311 ARG B O     1 
ATOM   5380  C  CB    . ARG B  1 300 ? 29.162  -12.351 -31.253 1.00 9.76  ? 311 ARG B CB    1 
ATOM   5381  C  CG    . ARG B  1 300 ? 28.576  -11.598 -32.473 1.00 12.50 ? 311 ARG B CG    1 
ATOM   5382  C  CD    . ARG B  1 300 ? 27.056  -11.487 -32.392 1.00 10.40 ? 311 ARG B CD    1 
ATOM   5383  N  NE    . ARG B  1 300 ? 26.519  -10.867 -33.606 1.00 13.80 ? 311 ARG B NE    1 
ATOM   5384  C  CZ    . ARG B  1 300 ? 26.466  -9.555  -33.807 1.00 18.35 ? 311 ARG B CZ    1 
ATOM   5385  N  NH1   . ARG B  1 300 ? 26.844  -8.716  -32.855 1.00 11.34 ? 311 ARG B NH1   1 
ATOM   5386  N  NH2   . ARG B  1 300 ? 25.973  -9.074  -34.935 1.00 18.51 ? 311 ARG B NH2   1 
ATOM   5387  N  N     . ASN B  1 301 ? 31.571  -12.190 -33.423 1.00 8.04  ? 312 ASN B N     1 
ATOM   5388  C  CA    . ASN B  1 301 ? 32.166  -12.697 -34.659 1.00 8.74  ? 312 ASN B CA    1 
ATOM   5389  C  C     . ASN B  1 301 ? 33.657  -12.964 -34.521 1.00 10.20 ? 312 ASN B C     1 
ATOM   5390  O  O     . ASN B  1 301 ? 34.145  -13.918 -35.111 1.00 7.94  ? 312 ASN B O     1 
ATOM   5391  C  CB    . ASN B  1 301 ? 31.837  -11.808 -35.833 1.00 7.20  ? 312 ASN B CB    1 
ATOM   5392  C  CG    . ASN B  1 301 ? 30.388  -11.932 -36.255 1.00 12.23 ? 312 ASN B CG    1 
ATOM   5393  O  OD1   . ASN B  1 301 ? 29.659  -12.860 -35.856 1.00 8.84  ? 312 ASN B OD1   1 
ATOM   5394  N  ND2   . ASN B  1 301 ? 29.931  -10.982 -37.049 1.00 8.79  ? 312 ASN B ND2   1 
ATOM   5395  N  N     . VAL B  1 302 ? 34.360  -12.155 -33.717 1.00 8.84  ? 313 VAL B N     1 
ATOM   5396  C  CA    . VAL B  1 302 ? 35.797  -12.366 -33.409 1.00 6.72  ? 313 VAL B CA    1 
ATOM   5397  C  C     . VAL B  1 302 ? 35.926  -13.729 -32.669 1.00 9.32  ? 313 VAL B C     1 
ATOM   5398  O  O     . VAL B  1 302 ? 36.768  -14.537 -33.051 1.00 8.30  ? 313 VAL B O     1 
ATOM   5399  C  CB    . VAL B  1 302 ? 36.341  -11.224 -32.528 1.00 10.18 ? 313 VAL B CB    1 
ATOM   5400  C  CG1   . VAL B  1 302 ? 37.759  -11.518 -32.065 1.00 9.43  ? 313 VAL B CG1   1 
ATOM   5401  C  CG2   . VAL B  1 302 ? 36.287  -9.886  -33.271 1.00 10.35 ? 313 VAL B CG2   1 
ATOM   5402  N  N     . ALA B  1 303 ? 35.089  -13.975 -31.625 1.00 7.05  ? 314 ALA B N     1 
ATOM   5403  C  CA    . ALA B  1 303 ? 35.121  -15.246 -30.874 1.00 8.09  ? 314 ALA B CA    1 
ATOM   5404  C  C     . ALA B  1 303 ? 34.872  -16.432 -31.805 1.00 10.55 ? 314 ALA B C     1 
ATOM   5405  O  O     . ALA B  1 303 ? 35.631  -17.407 -31.743 1.00 10.20 ? 314 ALA B O     1 
ATOM   5406  C  CB    . ALA B  1 303 ? 34.102  -15.232 -29.732 1.00 8.19  ? 314 ALA B CB    1 
ATOM   5407  N  N     . ARG B  1 304 ? 33.867  -16.343 -32.711 1.00 7.64  ? 315 ARG B N     1 
ATOM   5408  C  CA    . ARG B  1 304 ? 33.590  -17.433 -33.662 1.00 6.96  ? 315 ARG B CA    1 
ATOM   5409  C  C     . ARG B  1 304 ? 34.831  -17.683 -34.572 1.00 9.57  ? 315 ARG B C     1 
ATOM   5410  O  O     . ARG B  1 304 ? 35.265  -18.840 -34.769 1.00 7.97  ? 315 ARG B O     1 
ATOM   5411  C  CB    . ARG B  1 304 ? 32.408  -17.058 -34.581 1.00 6.17  ? 315 ARG B CB    1 
ATOM   5412  C  CG    . ARG B  1 304 ? 31.028  -17.080 -33.897 1.00 7.56  ? 315 ARG B CG    1 
ATOM   5413  C  CD    . ARG B  1 304 ? 30.009  -16.348 -34.761 1.00 9.20  ? 315 ARG B CD    1 
ATOM   5414  N  NE    . ARG B  1 304 ? 28.669  -16.808 -34.433 1.00 9.77  ? 315 ARG B NE    1 
ATOM   5415  C  CZ    . ARG B  1 304 ? 27.641  -16.027 -34.143 1.00 14.12 ? 315 ARG B CZ    1 
ATOM   5416  N  NH1   . ARG B  1 304 ? 26.472  -16.561 -33.801 1.00 8.26  ? 315 ARG B NH1   1 
ATOM   5417  N  NH2   . ARG B  1 304 ? 27.759  -14.706 -34.215 1.00 9.41  ? 315 ARG B NH2   1 
ATOM   5418  N  N     . CYS B  1 305 ? 35.364  -16.585 -35.143 1.00 6.83  ? 316 CYS B N     1 
ATOM   5419  C  CA    . CYS B  1 305 ? 36.504  -16.611 -36.090 1.00 6.07  ? 316 CYS B CA    1 
ATOM   5420  C  C     . CYS B  1 305 ? 37.725  -17.293 -35.496 1.00 9.61  ? 316 CYS B C     1 
ATOM   5421  O  O     . CYS B  1 305 ? 38.236  -18.273 -36.063 1.00 8.61  ? 316 CYS B O     1 
ATOM   5422  C  CB    . CYS B  1 305 ? 36.851  -15.202 -36.571 1.00 6.40  ? 316 CYS B CB    1 
ATOM   5423  S  SG    . CYS B  1 305 ? 37.916  -15.184 -38.040 1.00 10.13 ? 316 CYS B SG    1 
ATOM   5424  N  N     . TRP B  1 306 ? 38.160  -16.804 -34.325 1.00 7.18  ? 317 TRP B N     1 
ATOM   5425  C  CA    . TRP B  1 306 ? 39.375  -17.335 -33.690 1.00 6.56  ? 317 TRP B CA    1 
ATOM   5426  C  C     . TRP B  1 306 ? 39.195  -18.735 -33.090 1.00 10.72 ? 317 TRP B C     1 
ATOM   5427  O  O     . TRP B  1 306 ? 40.148  -19.528 -33.087 1.00 8.95  ? 317 TRP B O     1 
ATOM   5428  C  CB    . TRP B  1 306 ? 39.918  -16.334 -32.720 1.00 5.02  ? 317 TRP B CB    1 
ATOM   5429  C  CG    . TRP B  1 306 ? 40.431  -15.089 -33.410 1.00 5.95  ? 317 TRP B CG    1 
ATOM   5430  C  CD1   . TRP B  1 306 ? 40.770  -14.948 -34.726 1.00 8.86  ? 317 TRP B CD1   1 
ATOM   5431  C  CD2   . TRP B  1 306 ? 40.725  -13.838 -32.784 1.00 5.58  ? 317 TRP B CD2   1 
ATOM   5432  N  NE1   . TRP B  1 306 ? 41.241  -13.675 -34.960 1.00 7.67  ? 317 TRP B NE1   1 
ATOM   5433  C  CE2   . TRP B  1 306 ? 41.228  -12.975 -33.782 1.00 8.22  ? 317 TRP B CE2   1 
ATOM   5434  C  CE3   . TRP B  1 306 ? 40.631  -13.365 -31.460 1.00 5.88  ? 317 TRP B CE3   1 
ATOM   5435  C  CZ2   . TRP B  1 306 ? 41.606  -11.648 -33.506 1.00 7.37  ? 317 TRP B CZ2   1 
ATOM   5436  C  CZ3   . TRP B  1 306 ? 41.030  -12.057 -31.188 1.00 6.81  ? 317 TRP B CZ3   1 
ATOM   5437  C  CH2   . TRP B  1 306 ? 41.527  -11.224 -32.198 1.00 7.09  ? 317 TRP B CH2   1 
ATOM   5438  N  N     . THR B  1 307 ? 37.954  -19.059 -32.668 1.00 5.80  ? 318 THR B N     1 
ATOM   5439  C  CA    . THR B  1 307 ? 37.639  -20.403 -32.197 1.00 6.80  ? 318 THR B CA    1 
ATOM   5440  C  C     . THR B  1 307 ? 37.792  -21.364 -33.388 1.00 10.07 ? 318 THR B C     1 
ATOM   5441  O  O     . THR B  1 307 ? 38.462  -22.396 -33.276 1.00 10.65 ? 318 THR B O     1 
ATOM   5442  C  CB    . THR B  1 307 ? 36.227  -20.466 -31.583 1.00 9.79  ? 318 THR B CB    1 
ATOM   5443  O  OG1   . THR B  1 307 ? 36.239  -19.755 -30.328 1.00 10.79 ? 318 THR B OG1   1 
ATOM   5444  C  CG2   . THR B  1 307 ? 35.741  -21.931 -31.372 1.00 12.40 ? 318 THR B CG2   1 
ATOM   5445  N  N     . TYR B  1 308 ? 37.177  -21.024 -34.515 1.00 8.18  ? 319 TYR B N     1 
ATOM   5446  C  CA    . TYR B  1 308 ? 37.262  -21.888 -35.692 1.00 7.29  ? 319 TYR B CA    1 
ATOM   5447  C  C     . TYR B  1 308 ? 38.687  -22.026 -36.212 1.00 11.11 ? 319 TYR B C     1 
ATOM   5448  O  O     . TYR B  1 308 ? 39.088  -23.117 -36.593 1.00 11.41 ? 319 TYR B O     1 
ATOM   5449  C  CB    . TYR B  1 308 ? 36.309  -21.412 -36.798 1.00 7.53  ? 319 TYR B CB    1 
ATOM   5450  C  CG    . TYR B  1 308 ? 36.222  -22.386 -37.953 1.00 8.77  ? 319 TYR B CG    1 
ATOM   5451  C  CD1   . TYR B  1 308 ? 35.748  -23.682 -37.764 1.00 10.32 ? 319 TYR B CD1   1 
ATOM   5452  C  CD2   . TYR B  1 308 ? 36.573  -21.999 -39.241 1.00 10.06 ? 319 TYR B CD2   1 
ATOM   5453  C  CE1   . TYR B  1 308 ? 35.644  -24.582 -38.835 1.00 9.75  ? 319 TYR B CE1   1 
ATOM   5454  C  CE2   . TYR B  1 308 ? 36.483  -22.892 -40.320 1.00 11.41 ? 319 TYR B CE2   1 
ATOM   5455  C  CZ    . TYR B  1 308 ? 36.018  -24.179 -40.111 1.00 15.79 ? 319 TYR B CZ    1 
ATOM   5456  O  OH    . TYR B  1 308 ? 35.914  -25.042 -41.184 1.00 14.80 ? 319 TYR B OH    1 
ATOM   5457  N  N     . GLU B  1 309 ? 39.460  -20.933 -36.219 1.00 6.95  ? 320 GLU B N     1 
ATOM   5458  C  CA    . GLU B  1 309 ? 40.855  -20.978 -36.687 1.00 5.42  ? 320 GLU B CA    1 
ATOM   5459  C  C     . GLU B  1 309 ? 41.730  -21.785 -35.754 1.00 8.39  ? 320 GLU B C     1 
ATOM   5460  O  O     . GLU B  1 309 ? 42.718  -22.371 -36.204 1.00 10.79 ? 320 GLU B O     1 
ATOM   5461  C  CB    . GLU B  1 309 ? 41.385  -19.545 -36.895 1.00 5.73  ? 320 GLU B CB    1 
ATOM   5462  C  CG    . GLU B  1 309 ? 40.791  -19.041 -38.221 1.00 6.45  ? 320 GLU B CG    1 
ATOM   5463  C  CD    . GLU B  1 309 ? 40.890  -17.568 -38.553 1.00 13.93 ? 320 GLU B CD    1 
ATOM   5464  O  OE1   . GLU B  1 309 ? 41.247  -16.757 -37.669 1.00 7.85  ? 320 GLU B OE1   1 
ATOM   5465  O  OE2   . GLU B  1 309 ? 40.537  -17.218 -39.702 1.00 9.09  ? 320 GLU B OE2   1 
ATOM   5466  N  N     . THR B  1 310 ? 41.371  -21.834 -34.461 1.00 5.57  ? 321 THR B N     1 
ATOM   5467  C  CA    . THR B  1 310 ? 42.093  -22.708 -33.517 1.00 6.43  ? 321 THR B CA    1 
ATOM   5468  C  C     . THR B  1 310 ? 41.792  -24.201 -33.933 1.00 9.04  ? 321 THR B C     1 
ATOM   5469  O  O     . THR B  1 310 ? 42.708  -25.002 -33.998 1.00 8.71  ? 321 THR B O     1 
ATOM   5470  C  CB    . THR B  1 310 ? 41.720  -22.434 -32.042 1.00 12.35 ? 321 THR B CB    1 
ATOM   5471  O  OG1   . THR B  1 310 ? 41.916  -21.041 -31.722 1.00 10.87 ? 321 THR B OG1   1 
ATOM   5472  C  CG2   . THR B  1 310 ? 42.554  -23.299 -31.074 1.00 11.96 ? 321 THR B CG2   1 
ATOM   5473  N  N     . ALA B  1 311 ? 40.530  -24.534 -34.247 1.00 8.37  ? 322 ALA B N     1 
ATOM   5474  C  CA    . ALA B  1 311 ? 40.151  -25.880 -34.715 1.00 8.33  ? 322 ALA B CA    1 
ATOM   5475  C  C     . ALA B  1 311 ? 40.893  -26.222 -36.018 1.00 12.52 ? 322 ALA B C     1 
ATOM   5476  O  O     . ALA B  1 311 ? 41.329  -27.361 -36.203 1.00 11.18 ? 322 ALA B O     1 
ATOM   5477  C  CB    . ALA B  1 311 ? 38.642  -25.941 -34.946 1.00 8.91  ? 322 ALA B CB    1 
ATOM   5478  N  N     . VAL B  1 312 ? 41.018  -25.234 -36.937 1.00 9.78  ? 323 VAL B N     1 
ATOM   5479  C  CA    . VAL B  1 312 ? 41.746  -25.416 -38.205 1.00 9.14  ? 323 VAL B CA    1 
ATOM   5480  C  C     . VAL B  1 312 ? 43.212  -25.748 -37.887 1.00 12.59 ? 323 VAL B C     1 
ATOM   5481  O  O     . VAL B  1 312 ? 43.742  -26.717 -38.443 1.00 12.32 ? 323 VAL B O     1 
ATOM   5482  C  CB    . VAL B  1 312 ? 41.613  -24.221 -39.183 1.00 11.80 ? 323 VAL B CB    1 
ATOM   5483  C  CG1   . VAL B  1 312 ? 42.617  -24.331 -40.353 1.00 11.05 ? 323 VAL B CG1   1 
ATOM   5484  C  CG2   . VAL B  1 312 ? 40.177  -24.098 -39.708 1.00 11.04 ? 323 VAL B CG2   1 
ATOM   5485  N  N     . ALA B  1 313 ? 43.838  -24.992 -36.964 1.00 9.70  ? 324 ALA B N     1 
ATOM   5486  C  CA    . ALA B  1 313 ? 45.225  -25.226 -36.532 1.00 10.93 ? 324 ALA B CA    1 
ATOM   5487  C  C     . ALA B  1 313 ? 45.372  -26.669 -35.984 1.00 15.71 ? 324 ALA B C     1 
ATOM   5488  O  O     . ALA B  1 313 ? 46.365  -27.338 -36.267 1.00 16.33 ? 324 ALA B O     1 
ATOM   5489  C  CB    . ALA B  1 313 ? 45.611  -24.212 -35.451 1.00 11.85 ? 324 ALA B CB    1 
ATOM   5490  N  N     . LEU B  1 314 ? 44.351  -27.153 -35.264 1.00 11.94 ? 325 LEU B N     1 
ATOM   5491  C  CA    . LEU B  1 314 ? 44.317  -28.507 -34.681 1.00 11.74 ? 325 LEU B CA    1 
ATOM   5492  C  C     . LEU B  1 314 ? 43.909  -29.571 -35.684 1.00 16.16 ? 325 LEU B C     1 
ATOM   5493  O  O     . LEU B  1 314 ? 43.801  -30.743 -35.321 1.00 14.86 ? 325 LEU B O     1 
ATOM   5494  C  CB    . LEU B  1 314 ? 43.358  -28.539 -33.469 1.00 11.92 ? 325 LEU B CB    1 
ATOM   5495  C  CG    . LEU B  1 314 ? 43.793  -27.757 -32.234 1.00 15.58 ? 325 LEU B CG    1 
ATOM   5496  C  CD1   . LEU B  1 314 ? 42.622  -27.539 -31.284 1.00 14.27 ? 325 LEU B CD1   1 
ATOM   5497  C  CD2   . LEU B  1 314 ? 44.953  -28.435 -31.536 1.00 15.43 ? 325 LEU B CD2   1 
ATOM   5498  N  N     . ASP B  1 315 ? 43.666  -29.181 -36.934 1.00 13.53 ? 326 ASP B N     1 
ATOM   5499  C  CA    . ASP B  1 315 ? 43.251  -30.095 -37.997 1.00 14.75 ? 326 ASP B CA    1 
ATOM   5500  C  C     . ASP B  1 315 ? 41.982  -30.865 -37.619 1.00 19.12 ? 326 ASP B C     1 
ATOM   5501  O  O     . ASP B  1 315 ? 41.894  -32.079 -37.818 1.00 17.67 ? 326 ASP B O     1 
ATOM   5502  C  CB    . ASP B  1 315 ? 44.412  -31.044 -38.404 1.00 17.55 ? 326 ASP B CB    1 
ATOM   5503  C  CG    . ASP B  1 315 ? 44.155  -31.796 -39.708 1.00 34.64 ? 326 ASP B CG    1 
ATOM   5504  O  OD1   . ASP B  1 315 ? 44.486  -32.997 -39.771 1.00 39.92 ? 326 ASP B OD1   1 
ATOM   5505  O  OD2   . ASP B  1 315 ? 43.553  -31.199 -40.639 1.00 33.73 ? 326 ASP B OD2   1 
ATOM   5506  N  N     . CYS B  1 316 ? 40.989  -30.161 -37.069 1.00 16.03 ? 327 CYS B N     1 
ATOM   5507  C  CA    . CYS B  1 316 ? 39.750  -30.830 -36.723 1.00 16.75 ? 327 CYS B CA    1 
ATOM   5508  C  C     . CYS B  1 316 ? 38.568  -29.946 -36.985 1.00 19.34 ? 327 CYS B C     1 
ATOM   5509  O  O     . CYS B  1 316 ? 38.711  -28.720 -37.112 1.00 18.41 ? 327 CYS B O     1 
ATOM   5510  C  CB    . CYS B  1 316 ? 39.773  -31.326 -35.284 1.00 18.67 ? 327 CYS B CB    1 
ATOM   5511  S  SG    . CYS B  1 316 ? 39.507  -30.026 -34.066 1.00 23.39 ? 327 CYS B SG    1 
ATOM   5512  N  N     . GLU B  1 317 ? 37.402  -30.579 -37.128 1.00 14.35 ? 328 GLU B N     1 
ATOM   5513  C  CA    . GLU B  1 317 ? 36.184  -29.837 -37.333 1.00 12.27 ? 328 GLU B CA    1 
ATOM   5514  C  C     . GLU B  1 317 ? 35.423  -29.756 -36.029 1.00 14.31 ? 328 GLU B C     1 
ATOM   5515  O  O     . GLU B  1 317 ? 35.638  -30.546 -35.108 1.00 14.41 ? 328 GLU B O     1 
ATOM   5516  C  CB    . GLU B  1 317 ? 35.344  -30.436 -38.462 1.00 13.26 ? 328 GLU B CB    1 
ATOM   5517  C  CG    . GLU B  1 317 ? 35.575  -29.724 -39.800 1.00 21.54 ? 328 GLU B CG    1 
ATOM   5518  C  CD    . GLU B  1 317 ? 35.167  -28.258 -39.883 1.00 26.64 ? 328 GLU B CD    1 
ATOM   5519  O  OE1   . GLU B  1 317 ? 34.447  -27.778 -38.976 1.00 13.42 ? 328 GLU B OE1   1 
ATOM   5520  O  OE2   . GLU B  1 317 ? 35.587  -27.583 -40.851 1.00 18.72 ? 328 GLU B OE2   1 
ATOM   5521  N  N     . ILE B  1 318 ? 34.569  -28.766 -35.935 1.00 10.98 ? 329 ILE B N     1 
ATOM   5522  C  CA    . ILE B  1 318 ? 33.729  -28.555 -34.758 1.00 9.23  ? 329 ILE B CA    1 
ATOM   5523  C  C     . ILE B  1 318 ? 32.307  -28.264 -35.266 1.00 11.81 ? 329 ILE B C     1 
ATOM   5524  O  O     . ILE B  1 318 ? 32.159  -27.731 -36.365 1.00 8.80  ? 329 ILE B O     1 
ATOM   5525  C  CB    . ILE B  1 318 ? 34.291  -27.462 -33.825 1.00 11.41 ? 329 ILE B CB    1 
ATOM   5526  C  CG1   . ILE B  1 318 ? 34.664  -26.163 -34.594 1.00 11.33 ? 329 ILE B CG1   1 
ATOM   5527  C  CG2   . ILE B  1 318 ? 35.494  -28.002 -33.027 1.00 11.65 ? 329 ILE B CG2   1 
ATOM   5528  C  CD1   . ILE B  1 318 ? 35.111  -24.988 -33.673 1.00 10.57 ? 329 ILE B CD1   1 
ATOM   5529  N  N     . PRO B  1 319 ? 31.262  -28.627 -34.501 1.00 9.88  ? 330 PRO B N     1 
ATOM   5530  C  CA    . PRO B  1 319 ? 29.895  -28.409 -35.005 1.00 8.72  ? 330 PRO B CA    1 
ATOM   5531  C  C     . PRO B  1 319 ? 29.505  -26.952 -35.148 1.00 12.00 ? 330 PRO B C     1 
ATOM   5532  O  O     . PRO B  1 319 ? 29.993  -26.090 -34.403 1.00 9.76  ? 330 PRO B O     1 
ATOM   5533  C  CB    . PRO B  1 319 ? 29.001  -29.112 -33.965 1.00 11.13 ? 330 PRO B CB    1 
ATOM   5534  C  CG    . PRO B  1 319 ? 29.840  -29.340 -32.760 1.00 15.14 ? 330 PRO B CG    1 
ATOM   5535  C  CD    . PRO B  1 319 ? 31.279  -29.304 -33.180 1.00 11.76 ? 330 PRO B CD    1 
ATOM   5536  N  N     . ASN B  1 320 ? 28.571  -26.690 -36.067 1.00 9.24  ? 331 ASN B N     1 
ATOM   5537  C  CA    . ASN B  1 320 ? 28.053  -25.337 -36.253 1.00 8.84  ? 331 ASN B CA    1 
ATOM   5538  C  C     . ASN B  1 320 ? 27.250  -24.936 -35.009 1.00 10.98 ? 331 ASN B C     1 
ATOM   5539  O  O     . ASN B  1 320 ? 27.177  -23.753 -34.652 1.00 12.09 ? 331 ASN B O     1 
ATOM   5540  C  CB    . ASN B  1 320 ? 27.158  -25.265 -37.494 1.00 7.59  ? 331 ASN B CB    1 
ATOM   5541  C  CG    . ASN B  1 320 ? 26.987  -23.851 -37.973 1.00 14.36 ? 331 ASN B CG    1 
ATOM   5542  O  OD1   . ASN B  1 320 ? 27.856  -22.999 -37.773 1.00 7.96  ? 331 ASN B OD1   1 
ATOM   5543  N  ND2   . ASN B  1 320 ? 25.855  -23.569 -38.611 1.00 8.83  ? 331 ASN B ND2   1 
ATOM   5544  N  N     . GLU B  1 321 ? 26.631  -25.925 -34.365 1.00 8.46  ? 332 GLU B N     1 
ATOM   5545  C  CA    . GLU B  1 321 ? 25.830  -25.716 -33.158 1.00 10.15 ? 332 GLU B CA    1 
ATOM   5546  C  C     . GLU B  1 321 ? 26.777  -25.279 -32.020 1.00 12.24 ? 332 GLU B C     1 
ATOM   5547  O  O     . GLU B  1 321 ? 27.643  -26.052 -31.606 1.00 9.74  ? 332 GLU B O     1 
ATOM   5548  C  CB    . GLU B  1 321 ? 25.145  -27.046 -32.789 1.00 11.53 ? 332 GLU B CB    1 
ATOM   5549  C  CG    . GLU B  1 321 ? 24.220  -26.969 -31.595 1.00 16.67 ? 332 GLU B CG    1 
ATOM   5550  C  CD    . GLU B  1 321 ? 22.868  -26.330 -31.827 1.00 20.63 ? 332 GLU B CD    1 
ATOM   5551  O  OE1   . GLU B  1 321 ? 22.449  -26.159 -32.996 1.00 22.32 ? 332 GLU B OE1   1 
ATOM   5552  O  OE2   . GLU B  1 321 ? 22.219  -25.999 -30.814 1.00 25.71 ? 332 GLU B OE2   1 
ATOM   5553  N  N     . LEU B  1 322 ? 26.644  -24.040 -31.546 1.00 10.91 ? 333 LEU B N     1 
ATOM   5554  C  CA    . LEU B  1 322 ? 27.552  -23.601 -30.475 1.00 10.66 ? 333 LEU B CA    1 
ATOM   5555  C  C     . LEU B  1 322 ? 27.302  -24.364 -29.186 1.00 14.01 ? 333 LEU B C     1 
ATOM   5556  O  O     . LEU B  1 322 ? 26.141  -24.553 -28.816 1.00 11.67 ? 333 LEU B O     1 
ATOM   5557  C  CB    . LEU B  1 322 ? 27.433  -22.100 -30.190 1.00 10.62 ? 333 LEU B CB    1 
ATOM   5558  C  CG    . LEU B  1 322 ? 27.944  -21.160 -31.269 1.00 14.50 ? 333 LEU B CG    1 
ATOM   5559  C  CD1   . LEU B  1 322 ? 27.541  -19.746 -30.940 1.00 14.37 ? 333 LEU B CD1   1 
ATOM   5560  C  CD2   . LEU B  1 322 ? 29.453  -21.256 -31.436 1.00 11.07 ? 333 LEU B CD2   1 
ATOM   5561  N  N     . PRO B  1 323 ? 28.357  -24.777 -28.455 1.00 11.50 ? 334 PRO B N     1 
ATOM   5562  C  CA    . PRO B  1 323 ? 28.100  -25.438 -27.170 1.00 11.10 ? 334 PRO B CA    1 
ATOM   5563  C  C     . PRO B  1 323 ? 27.693  -24.360 -26.169 1.00 14.82 ? 334 PRO B C     1 
ATOM   5564  O  O     . PRO B  1 323 ? 27.997  -23.184 -26.378 1.00 12.15 ? 334 PRO B O     1 
ATOM   5565  C  CB    . PRO B  1 323 ? 29.464  -26.014 -26.797 1.00 12.57 ? 334 PRO B CB    1 
ATOM   5566  C  CG    . PRO B  1 323 ? 30.465  -25.018 -27.387 1.00 16.77 ? 334 PRO B CG    1 
ATOM   5567  C  CD    . PRO B  1 323 ? 29.806  -24.586 -28.696 1.00 12.57 ? 334 PRO B CD    1 
ATOM   5568  N  N     . TYR B  1 324 ? 27.051  -24.739 -25.070 1.00 13.06 ? 335 TYR B N     1 
ATOM   5569  C  CA    . TYR B  1 324 ? 26.764  -23.718 -24.074 1.00 12.79 ? 335 TYR B CA    1 
ATOM   5570  C  C     . TYR B  1 324 ? 28.092  -23.149 -23.565 1.00 14.15 ? 335 TYR B C     1 
ATOM   5571  O  O     . TYR B  1 324 ? 29.088  -23.869 -23.501 1.00 13.08 ? 335 TYR B O     1 
ATOM   5572  C  CB    . TYR B  1 324 ? 25.971  -24.329 -22.906 1.00 13.67 ? 335 TYR B CB    1 
ATOM   5573  C  CG    . TYR B  1 324 ? 25.465  -23.289 -21.934 1.00 13.94 ? 335 TYR B CG    1 
ATOM   5574  C  CD1   . TYR B  1 324 ? 25.956  -23.225 -20.635 1.00 16.08 ? 335 TYR B CD1   1 
ATOM   5575  C  CD2   . TYR B  1 324 ? 24.498  -22.358 -22.317 1.00 14.10 ? 335 TYR B CD2   1 
ATOM   5576  C  CE1   . TYR B  1 324 ? 25.497  -22.252 -19.738 1.00 16.32 ? 335 TYR B CE1   1 
ATOM   5577  C  CE2   . TYR B  1 324 ? 24.064  -21.362 -21.444 1.00 14.24 ? 335 TYR B CE2   1 
ATOM   5578  C  CZ    . TYR B  1 324 ? 24.555  -21.324 -20.151 1.00 16.78 ? 335 TYR B CZ    1 
ATOM   5579  O  OH    . TYR B  1 324 ? 24.105  -20.353 -19.287 1.00 14.52 ? 335 TYR B OH    1 
ATOM   5580  N  N     . ASN B  1 325 ? 28.117  -21.858 -23.237 1.00 10.91 ? 336 ASN B N     1 
ATOM   5581  C  CA    . ASN B  1 325 ? 29.318  -21.204 -22.736 1.00 10.76 ? 336 ASN B CA    1 
ATOM   5582  C  C     . ASN B  1 325 ? 28.927  -19.980 -21.899 1.00 13.65 ? 336 ASN B C     1 
ATOM   5583  O  O     . ASN B  1 325 ? 27.762  -19.598 -21.880 1.00 10.99 ? 336 ASN B O     1 
ATOM   5584  C  CB    . ASN B  1 325 ? 30.261  -20.846 -23.932 1.00 8.15  ? 336 ASN B CB    1 
ATOM   5585  C  CG    . ASN B  1 325 ? 29.664  -19.854 -24.891 1.00 15.03 ? 336 ASN B CG    1 
ATOM   5586  O  OD1   . ASN B  1 325 ? 29.778  -18.653 -24.687 1.00 9.70  ? 336 ASN B OD1   1 
ATOM   5587  N  ND2   . ASN B  1 325 ? 29.008  -20.329 -25.954 1.00 7.85  ? 336 ASN B ND2   1 
ATOM   5588  N  N     . ASP B  1 326 ? 29.912  -19.350 -21.230 1.00 13.17 ? 337 ASP B N     1 
ATOM   5589  C  CA    . ASP B  1 326 ? 29.728  -18.192 -20.350 1.00 11.43 ? 337 ASP B CA    1 
ATOM   5590  C  C     . ASP B  1 326 ? 29.077  -16.972 -21.002 1.00 14.35 ? 337 ASP B C     1 
ATOM   5591  O  O     . ASP B  1 326 ? 28.505  -16.132 -20.304 1.00 12.58 ? 337 ASP B O     1 
ATOM   5592  C  CB    . ASP B  1 326 ? 31.090  -17.785 -19.761 1.00 12.49 ? 337 ASP B CB    1 
ATOM   5593  C  CG    . ASP B  1 326 ? 31.715  -18.763 -18.777 1.00 19.98 ? 337 ASP B CG    1 
ATOM   5594  O  OD1   . ASP B  1 326 ? 31.075  -19.790 -18.467 1.00 18.34 ? 337 ASP B OD1   1 
ATOM   5595  O  OD2   . ASP B  1 326 ? 32.838  -18.485 -18.299 1.00 25.58 ? 337 ASP B OD2   1 
ATOM   5596  N  N     . TYR B  1 327 ? 29.178  -16.860 -22.343 1.00 10.75 ? 338 TYR B N     1 
ATOM   5597  C  CA    . TYR B  1 327 ? 28.676  -15.719 -23.111 1.00 9.94  ? 338 TYR B CA    1 
ATOM   5598  C  C     . TYR B  1 327 ? 27.685  -16.179 -24.175 1.00 11.67 ? 338 TYR B C     1 
ATOM   5599  O  O     . TYR B  1 327 ? 27.572  -15.554 -25.228 1.00 9.48  ? 338 TYR B O     1 
ATOM   5600  C  CB    . TYR B  1 327 ? 29.906  -15.022 -23.776 1.00 10.07 ? 338 TYR B CB    1 
ATOM   5601  C  CG    . TYR B  1 327 ? 30.979  -14.764 -22.743 1.00 11.33 ? 338 TYR B CG    1 
ATOM   5602  C  CD1   . TYR B  1 327 ? 32.153  -15.512 -22.730 1.00 12.98 ? 338 TYR B CD1   1 
ATOM   5603  C  CD2   . TYR B  1 327 ? 30.747  -13.900 -21.675 1.00 12.70 ? 338 TYR B CD2   1 
ATOM   5604  C  CE1   . TYR B  1 327 ? 33.111  -15.335 -21.732 1.00 11.22 ? 338 TYR B CE1   1 
ATOM   5605  C  CE2   . TYR B  1 327 ? 31.698  -13.712 -20.676 1.00 14.69 ? 338 TYR B CE2   1 
ATOM   5606  C  CZ    . TYR B  1 327 ? 32.885  -14.419 -20.718 1.00 15.37 ? 338 TYR B CZ    1 
ATOM   5607  O  OH    . TYR B  1 327 ? 33.790  -14.260 -19.710 1.00 16.54 ? 338 TYR B OH    1 
ATOM   5608  N  N     . PHE B  1 328 ? 26.943  -17.250 -23.894 1.00 8.95  ? 339 PHE B N     1 
ATOM   5609  C  CA    . PHE B  1 328 ? 26.058  -17.863 -24.888 1.00 8.45  ? 339 PHE B CA    1 
ATOM   5610  C  C     . PHE B  1 328 ? 25.084  -16.867 -25.534 1.00 13.23 ? 339 PHE B C     1 
ATOM   5611  O  O     . PHE B  1 328 ? 24.879  -16.897 -26.757 1.00 12.09 ? 339 PHE B O     1 
ATOM   5612  C  CB    . PHE B  1 328 ? 25.321  -19.063 -24.262 1.00 8.88  ? 339 PHE B CB    1 
ATOM   5613  C  CG    . PHE B  1 328 ? 24.595  -19.953 -25.245 1.00 10.43 ? 339 PHE B CG    1 
ATOM   5614  C  CD1   . PHE B  1 328 ? 23.204  -20.040 -25.232 1.00 13.06 ? 339 PHE B CD1   1 
ATOM   5615  C  CD2   . PHE B  1 328 ? 25.301  -20.822 -26.076 1.00 11.42 ? 339 PHE B CD2   1 
ATOM   5616  C  CE1   . PHE B  1 328 ? 22.529  -20.920 -26.092 1.00 13.49 ? 339 PHE B CE1   1 
ATOM   5617  C  CE2   . PHE B  1 328 ? 24.627  -21.699 -26.936 1.00 13.85 ? 339 PHE B CE2   1 
ATOM   5618  C  CZ    . PHE B  1 328 ? 23.245  -21.735 -26.945 1.00 12.56 ? 339 PHE B CZ    1 
ATOM   5619  N  N     . GLU B  1 329 ? 24.533  -15.958 -24.713 1.00 10.25 ? 340 GLU B N     1 
ATOM   5620  C  CA    . GLU B  1 329 ? 23.591  -14.933 -25.168 1.00 8.99  ? 340 GLU B CA    1 
ATOM   5621  C  C     . GLU B  1 329 ? 24.176  -13.958 -26.203 1.00 12.87 ? 340 GLU B C     1 
ATOM   5622  O  O     . GLU B  1 329 ? 23.404  -13.326 -26.933 1.00 13.62 ? 340 GLU B O     1 
ATOM   5623  C  CB    . GLU B  1 329 ? 22.939  -14.186 -23.972 1.00 9.69  ? 340 GLU B CB    1 
ATOM   5624  C  CG    . GLU B  1 329 ? 23.855  -13.213 -23.234 1.00 12.04 ? 340 GLU B CG    1 
ATOM   5625  C  CD    . GLU B  1 329 ? 24.852  -13.791 -22.246 1.00 16.80 ? 340 GLU B CD    1 
ATOM   5626  O  OE1   . GLU B  1 329 ? 25.429  -12.992 -21.479 1.00 12.80 ? 340 GLU B OE1   1 
ATOM   5627  O  OE2   . GLU B  1 329 ? 25.055  -15.026 -22.221 1.00 14.41 ? 340 GLU B OE2   1 
ATOM   5628  N  N     . TYR B  1 330 ? 25.529  -13.833 -26.282 1.00 9.92  ? 341 TYR B N     1 
ATOM   5629  C  CA    . TYR B  1 330 ? 26.164  -12.904 -27.250 1.00 9.66  ? 341 TYR B CA    1 
ATOM   5630  C  C     . TYR B  1 330 ? 26.037  -13.406 -28.675 1.00 12.30 ? 341 TYR B C     1 
ATOM   5631  O  O     . TYR B  1 330 ? 26.188  -12.620 -29.605 1.00 10.42 ? 341 TYR B O     1 
ATOM   5632  C  CB    . TYR B  1 330 ? 27.675  -12.760 -26.980 1.00 9.89  ? 341 TYR B CB    1 
ATOM   5633  C  CG    . TYR B  1 330 ? 28.121  -12.007 -25.739 1.00 12.07 ? 341 TYR B CG    1 
ATOM   5634  C  CD1   . TYR B  1 330 ? 27.611  -12.330 -24.476 1.00 13.00 ? 341 TYR B CD1   1 
ATOM   5635  C  CD2   . TYR B  1 330 ? 29.197  -11.124 -25.794 1.00 13.31 ? 341 TYR B CD2   1 
ATOM   5636  C  CE1   . TYR B  1 330 ? 28.099  -11.713 -23.316 1.00 14.91 ? 341 TYR B CE1   1 
ATOM   5637  C  CE2   . TYR B  1 330 ? 29.724  -10.540 -24.638 1.00 13.83 ? 341 TYR B CE2   1 
ATOM   5638  C  CZ    . TYR B  1 330 ? 29.172  -10.834 -23.403 1.00 19.80 ? 341 TYR B CZ    1 
ATOM   5639  O  OH    . TYR B  1 330 ? 29.728  -10.251 -22.278 1.00 19.29 ? 341 TYR B OH    1 
ATOM   5640  N  N     . PHE B  1 331 ? 25.787  -14.711 -28.841 1.00 9.54  ? 342 PHE B N     1 
ATOM   5641  C  CA    . PHE B  1 331 ? 25.739  -15.399 -30.116 1.00 8.32  ? 342 PHE B CA    1 
ATOM   5642  C  C     . PHE B  1 331 ? 24.340  -15.585 -30.702 1.00 11.70 ? 342 PHE B C     1 
ATOM   5643  O  O     . PHE B  1 331 ? 24.168  -16.303 -31.684 1.00 11.17 ? 342 PHE B O     1 
ATOM   5644  C  CB    . PHE B  1 331 ? 26.505  -16.732 -30.038 1.00 9.28  ? 342 PHE B CB    1 
ATOM   5645  C  CG    . PHE B  1 331 ? 27.926  -16.606 -29.520 1.00 10.17 ? 342 PHE B CG    1 
ATOM   5646  C  CD1   . PHE B  1 331 ? 28.222  -16.871 -28.186 1.00 11.35 ? 342 PHE B CD1   1 
ATOM   5647  C  CD2   . PHE B  1 331 ? 28.961  -16.195 -30.364 1.00 9.09  ? 342 PHE B CD2   1 
ATOM   5648  C  CE1   . PHE B  1 331 ? 29.536  -16.773 -27.715 1.00 12.01 ? 342 PHE B CE1   1 
ATOM   5649  C  CE2   . PHE B  1 331 ? 30.261  -16.071 -29.889 1.00 11.29 ? 342 PHE B CE2   1 
ATOM   5650  C  CZ    . PHE B  1 331 ? 30.549  -16.366 -28.569 1.00 10.55 ? 342 PHE B CZ    1 
ATOM   5651  N  N     . GLY B  1 332 ? 23.356  -14.915 -30.119 1.00 9.52  ? 343 GLY B N     1 
ATOM   5652  C  CA    . GLY B  1 332 ? 22.018  -14.895 -30.700 1.00 8.84  ? 343 GLY B CA    1 
ATOM   5653  C  C     . GLY B  1 332 ? 22.042  -14.086 -31.993 1.00 13.38 ? 343 GLY B C     1 
ATOM   5654  O  O     . GLY B  1 332 ? 22.992  -13.317 -32.226 1.00 13.77 ? 343 GLY B O     1 
ATOM   5655  N  N     . PRO B  1 333 ? 21.031  -14.246 -32.876 1.00 11.03 ? 344 PRO B N     1 
ATOM   5656  C  CA    . PRO B  1 333 ? 19.796  -15.043 -32.669 1.00 11.41 ? 344 PRO B CA    1 
ATOM   5657  C  C     . PRO B  1 333 ? 19.882  -16.523 -33.014 1.00 13.80 ? 344 PRO B C     1 
ATOM   5658  O  O     . PRO B  1 333 ? 18.981  -17.292 -32.664 1.00 14.49 ? 344 PRO B O     1 
ATOM   5659  C  CB    . PRO B  1 333 ? 18.798  -14.357 -33.626 1.00 13.86 ? 344 PRO B CB    1 
ATOM   5660  C  CG    . PRO B  1 333 ? 19.642  -13.865 -34.765 1.00 17.64 ? 344 PRO B CG    1 
ATOM   5661  C  CD    . PRO B  1 333 ? 20.966  -13.450 -34.124 1.00 13.93 ? 344 PRO B CD    1 
ATOM   5662  N  N     . ASP B  1 334 ? 20.965  -16.885 -33.711 1.00 10.23 ? 345 ASP B N     1 
ATOM   5663  C  CA    A ASP B  1 334 ? 21.176  -18.214 -34.274 0.77 11.00 ? 345 ASP B CA    1 
ATOM   5664  C  CA    B ASP B  1 334 ? 21.354  -18.156 -34.331 0.23 10.96 ? 345 ASP B CA    1 
ATOM   5665  C  C     . ASP B  1 334 ? 21.983  -19.172 -33.395 1.00 13.95 ? 345 ASP B C     1 
ATOM   5666  O  O     . ASP B  1 334 ? 21.791  -20.389 -33.541 1.00 13.81 ? 345 ASP B O     1 
ATOM   5667  C  CB    A ASP B  1 334 ? 21.855  -18.061 -35.654 0.77 13.04 ? 345 ASP B CB    1 
ATOM   5668  C  CB    B ASP B  1 334 ? 22.457  -17.823 -35.368 0.23 13.43 ? 345 ASP B CB    1 
ATOM   5669  C  CG    A ASP B  1 334 ? 23.139  -17.233 -35.521 0.77 15.00 ? 345 ASP B CG    1 
ATOM   5670  C  CG    B ASP B  1 334 ? 22.162  -18.083 -36.823 0.23 23.51 ? 345 ASP B CG    1 
ATOM   5671  O  OD1   A ASP B  1 334 ? 23.045  -15.972 -35.473 0.77 17.97 ? 345 ASP B OD1   1 
ATOM   5672  O  OD1   B ASP B  1 334 ? 21.028  -18.496 -37.135 0.23 26.69 ? 345 ASP B OD1   1 
ATOM   5673  O  OD2   A ASP B  1 334 ? 24.181  -17.820 -35.281 0.77 16.56 ? 345 ASP B OD2   1 
ATOM   5674  O  OD2   B ASP B  1 334 ? 23.066  -17.867 -37.654 0.23 24.83 ? 345 ASP B OD2   1 
ATOM   5675  N  N     . PHE B  1 335 ? 22.892  -18.679 -32.530 1.00 10.70 ? 346 PHE B N     1 
ATOM   5676  C  CA    . PHE B  1 335 ? 23.711  -19.551 -31.681 1.00 9.58  ? 346 PHE B CA    1 
ATOM   5677  C  C     . PHE B  1 335 ? 24.500  -20.548 -32.572 1.00 11.87 ? 346 PHE B C     1 
ATOM   5678  O  O     . PHE B  1 335 ? 24.690  -21.711 -32.181 1.00 11.40 ? 346 PHE B O     1 
ATOM   5679  C  CB    . PHE B  1 335 ? 22.888  -20.268 -30.581 1.00 9.69  ? 346 PHE B CB    1 
ATOM   5680  C  CG    . PHE B  1 335 ? 22.088  -19.273 -29.781 1.00 8.82  ? 346 PHE B CG    1 
ATOM   5681  C  CD1   . PHE B  1 335 ? 20.743  -19.061 -30.056 1.00 10.38 ? 346 PHE B CD1   1 
ATOM   5682  C  CD2   . PHE B  1 335 ? 22.704  -18.471 -28.823 1.00 8.83  ? 346 PHE B CD2   1 
ATOM   5683  C  CE1   . PHE B  1 335 ? 20.019  -18.074 -29.371 1.00 10.69 ? 346 PHE B CE1   1 
ATOM   5684  C  CE2   . PHE B  1 335 ? 21.985  -17.489 -28.148 1.00 10.78 ? 346 PHE B CE2   1 
ATOM   5685  C  CZ    . PHE B  1 335 ? 20.642  -17.318 -28.408 1.00 8.28  ? 346 PHE B CZ    1 
ATOM   5686  N  N     . LYS B  1 336 ? 24.908  -20.092 -33.787 1.00 9.38  ? 347 LYS B N     1 
ATOM   5687  C  CA    . LYS B  1 336 ? 25.733  -20.899 -34.715 1.00 9.10  ? 347 LYS B CA    1 
ATOM   5688  C  C     . LYS B  1 336 ? 27.155  -20.355 -34.739 1.00 11.27 ? 347 LYS B C     1 
ATOM   5689  O  O     . LYS B  1 336 ? 27.380  -19.177 -34.433 1.00 10.96 ? 347 LYS B O     1 
ATOM   5690  C  CB    . LYS B  1 336 ? 25.184  -20.948 -36.159 1.00 9.89  ? 347 LYS B CB    1 
ATOM   5691  C  CG    . LYS B  1 336 ? 23.766  -21.545 -36.317 1.00 7.28  ? 347 LYS B CG    1 
ATOM   5692  C  CD    . LYS B  1 336 ? 23.668  -22.986 -35.755 1.00 13.04 ? 347 LYS B CD    1 
ATOM   5693  C  CE    . LYS B  1 336 ? 22.274  -23.562 -35.909 1.00 17.78 ? 347 LYS B CE    1 
ATOM   5694  N  NZ    . LYS B  1 336 ? 22.079  -24.711 -35.000 1.00 18.65 ? 347 LYS B NZ    1 
ATOM   5695  N  N     . LEU B  1 337 ? 28.111  -21.204 -35.091 1.00 7.34  ? 348 LEU B N     1 
ATOM   5696  C  CA    . LEU B  1 337 ? 29.514  -20.796 -35.147 1.00 7.14  ? 348 LEU B CA    1 
ATOM   5697  C  C     . LEU B  1 337 ? 29.749  -19.977 -36.423 1.00 10.70 ? 348 LEU B C     1 
ATOM   5698  O  O     . LEU B  1 337 ? 30.416  -18.941 -36.389 1.00 9.84  ? 348 LEU B O     1 
ATOM   5699  C  CB    . LEU B  1 337 ? 30.410  -22.074 -35.158 1.00 6.83  ? 348 LEU B CB    1 
ATOM   5700  C  CG    . LEU B  1 337 ? 31.949  -21.861 -35.379 1.00 10.20 ? 348 LEU B CG    1 
ATOM   5701  C  CD1   . LEU B  1 337 ? 32.604  -21.069 -34.245 1.00 9.14  ? 348 LEU B CD1   1 
ATOM   5702  C  CD2   . LEU B  1 337 ? 32.656  -23.193 -35.542 1.00 8.93  ? 348 LEU B CD2   1 
ATOM   5703  N  N     . HIS B  1 338 ? 29.241  -20.479 -37.555 1.00 9.29  ? 349 HIS B N     1 
ATOM   5704  C  CA    . HIS B  1 338 ? 29.442  -19.875 -38.858 1.00 7.66  ? 349 HIS B CA    1 
ATOM   5705  C  C     . HIS B  1 338 ? 28.491  -18.709 -39.147 1.00 12.12 ? 349 HIS B C     1 
ATOM   5706  O  O     . HIS B  1 338 ? 27.376  -18.660 -38.616 1.00 9.89  ? 349 HIS B O     1 
ATOM   5707  C  CB    . HIS B  1 338 ? 29.458  -20.945 -39.948 1.00 7.72  ? 349 HIS B CB    1 
ATOM   5708  C  CG    . HIS B  1 338 ? 30.688  -21.794 -39.817 1.00 11.15 ? 349 HIS B CG    1 
ATOM   5709  N  ND1   . HIS B  1 338 ? 31.948  -21.278 -40.104 1.00 12.54 ? 349 HIS B ND1   1 
ATOM   5710  C  CD2   . HIS B  1 338 ? 30.836  -23.020 -39.263 1.00 11.82 ? 349 HIS B CD2   1 
ATOM   5711  C  CE1   . HIS B  1 338 ? 32.808  -22.236 -39.794 1.00 11.49 ? 349 HIS B CE1   1 
ATOM   5712  N  NE2   . HIS B  1 338 ? 32.183  -23.321 -39.327 1.00 11.98 ? 349 HIS B NE2   1 
ATOM   5713  N  N     . ILE B  1 339 ? 28.963  -17.749 -39.937 1.00 8.30  ? 350 ILE B N     1 
ATOM   5714  C  CA    . ILE B  1 339 ? 28.171  -16.546 -40.214 1.00 7.92  ? 350 ILE B CA    1 
ATOM   5715  C  C     . ILE B  1 339 ? 27.869  -16.430 -41.696 1.00 14.32 ? 350 ILE B C     1 
ATOM   5716  O  O     . ILE B  1 339 ? 28.631  -16.915 -42.531 1.00 13.32 ? 350 ILE B O     1 
ATOM   5717  C  CB    . ILE B  1 339 ? 28.874  -15.277 -39.652 1.00 10.78 ? 350 ILE B CB    1 
ATOM   5718  C  CG1   . ILE B  1 339 ? 30.189  -14.932 -40.425 1.00 11.96 ? 350 ILE B CG1   1 
ATOM   5719  C  CG2   . ILE B  1 339 ? 29.120  -15.425 -38.140 1.00 9.62  ? 350 ILE B CG2   1 
ATOM   5720  C  CD1   . ILE B  1 339 ? 30.932  -13.571 -40.036 1.00 16.10 ? 350 ILE B CD1   1 
ATOM   5721  N  N     . SER B  1 340 ? 26.754  -15.788 -42.020 1.00 12.88 ? 351 SER B N     1 
ATOM   5722  C  CA    . SER B  1 340 ? 26.374  -15.555 -43.404 1.00 13.25 ? 351 SER B CA    1 
ATOM   5723  C  C     . SER B  1 340 ? 26.954  -14.245 -43.908 1.00 15.10 ? 351 SER B C     1 
ATOM   5724  O  O     . SER B  1 340 ? 27.023  -13.278 -43.140 1.00 13.51 ? 351 SER B O     1 
ATOM   5725  C  CB    . SER B  1 340 ? 24.855  -15.489 -43.526 1.00 19.05 ? 351 SER B CB    1 
ATOM   5726  O  OG    . SER B  1 340 ? 24.319  -16.801 -43.511 1.00 30.93 ? 351 SER B OG    1 
ATOM   5727  N  N     . PRO B  1 341 ? 27.264  -14.129 -45.217 1.00 13.11 ? 352 PRO B N     1 
ATOM   5728  C  CA    . PRO B  1 341 ? 27.683  -12.819 -45.724 1.00 13.32 ? 352 PRO B CA    1 
ATOM   5729  C  C     . PRO B  1 341 ? 26.455  -11.904 -45.848 1.00 16.61 ? 352 PRO B C     1 
ATOM   5730  O  O     . PRO B  1 341 ? 25.318  -12.371 -45.732 1.00 15.06 ? 352 PRO B O     1 
ATOM   5731  C  CB    . PRO B  1 341 ? 28.302  -13.145 -47.090 1.00 15.06 ? 352 PRO B CB    1 
ATOM   5732  C  CG    . PRO B  1 341 ? 27.549  -14.347 -47.572 1.00 19.19 ? 352 PRO B CG    1 
ATOM   5733  C  CD    . PRO B  1 341 ? 27.182  -15.135 -46.304 1.00 14.74 ? 352 PRO B CD    1 
ATOM   5734  N  N     . SER B  1 342 ? 26.684  -10.601 -46.022 1.00 13.14 ? 353 SER B N     1 
ATOM   5735  C  CA    . SER B  1 342 ? 25.595  -9.654  -46.191 1.00 12.58 ? 353 SER B CA    1 
ATOM   5736  C  C     . SER B  1 342 ? 25.292  -9.462  -47.698 1.00 15.46 ? 353 SER B C     1 
ATOM   5737  O  O     . SER B  1 342 ? 25.946  -10.071 -48.554 1.00 13.05 ? 353 SER B O     1 
ATOM   5738  C  CB    . SER B  1 342 ? 25.974  -8.325  -45.553 1.00 14.47 ? 353 SER B CB    1 
ATOM   5739  O  OG    . SER B  1 342 ? 26.960  -7.691  -46.352 1.00 17.48 ? 353 SER B OG    1 
ATOM   5740  N  N     . ASN B  1 343 ? 24.303  -8.605  -48.017 1.00 12.92 ? 354 ASN B N     1 
ATOM   5741  C  CA    . ASN B  1 343 ? 23.946  -8.286  -49.404 1.00 13.99 ? 354 ASN B CA    1 
ATOM   5742  C  C     . ASN B  1 343 ? 24.814  -7.125  -49.943 1.00 19.44 ? 354 ASN B C     1 
ATOM   5743  O  O     . ASN B  1 343 ? 24.515  -6.605  -51.023 1.00 20.53 ? 354 ASN B O     1 
ATOM   5744  C  CB    . ASN B  1 343 ? 22.450  -7.879  -49.471 1.00 13.29 ? 354 ASN B CB    1 
ATOM   5745  C  CG    . ASN B  1 343 ? 22.095  -6.625  -48.725 1.00 29.17 ? 354 ASN B CG    1 
ATOM   5746  O  OD1   . ASN B  1 343 ? 22.745  -6.240  -47.742 1.00 23.56 ? 354 ASN B OD1   1 
ATOM   5747  N  ND2   . ASN B  1 343 ? 21.018  -5.967  -49.156 1.00 26.60 ? 354 ASN B ND2   1 
ATOM   5748  N  N     . MET B  1 344 ? 25.825  -6.653  -49.170 1.00 14.51 ? 355 MET B N     1 
ATOM   5749  C  CA    . MET B  1 344 ? 26.653  -5.513  -49.612 1.00 13.42 ? 355 MET B CA    1 
ATOM   5750  C  C     . MET B  1 344 ? 27.330  -5.766  -50.963 1.00 16.32 ? 355 MET B C     1 
ATOM   5751  O  O     . MET B  1 344 ? 27.728  -6.899  -51.273 1.00 15.54 ? 355 MET B O     1 
ATOM   5752  C  CB    . MET B  1 344 ? 27.655  -5.079  -48.522 1.00 14.57 ? 355 MET B CB    1 
ATOM   5753  C  CG    . MET B  1 344 ? 28.916  -5.977  -48.448 1.00 16.03 ? 355 MET B CG    1 
ATOM   5754  S  SD    . MET B  1 344 ? 30.166  -5.435  -47.268 1.00 18.52 ? 355 MET B SD    1 
ATOM   5755  C  CE    . MET B  1 344 ? 30.468  -3.767  -47.825 1.00 15.25 ? 355 MET B CE    1 
ATOM   5756  N  N     . THR B  1 345 ? 27.426  -4.714  -51.793 1.00 15.01 ? 356 THR B N     1 
ATOM   5757  C  CA    . THR B  1 345 ? 28.063  -4.887  -53.101 1.00 14.23 ? 356 THR B CA    1 
ATOM   5758  C  C     . THR B  1 345 ? 29.553  -5.214  -52.934 1.00 15.27 ? 356 THR B C     1 
ATOM   5759  O  O     . THR B  1 345 ? 30.222  -4.582  -52.118 1.00 14.95 ? 356 THR B O     1 
ATOM   5760  C  CB    . THR B  1 345 ? 27.903  -3.601  -53.957 1.00 22.51 ? 356 THR B CB    1 
ATOM   5761  O  OG1   . THR B  1 345 ? 26.519  -3.253  -54.040 1.00 23.15 ? 356 THR B OG1   1 
ATOM   5762  C  CG2   . THR B  1 345 ? 28.456  -3.769  -55.376 1.00 24.19 ? 356 THR B CG2   1 
ATOM   5763  N  N     . ASN B  1 346 ? 30.057  -6.160  -53.732 1.00 13.21 ? 357 ASN B N     1 
ATOM   5764  C  CA    . ASN B  1 346 ? 31.487  -6.437  -53.800 1.00 13.69 ? 357 ASN B CA    1 
ATOM   5765  C  C     . ASN B  1 346 ? 32.062  -5.447  -54.855 1.00 19.29 ? 357 ASN B C     1 
ATOM   5766  O  O     . ASN B  1 346 ? 31.859  -5.650  -56.047 1.00 19.15 ? 357 ASN B O     1 
ATOM   5767  C  CB    . ASN B  1 346 ? 31.756  -7.886  -54.231 1.00 11.46 ? 357 ASN B CB    1 
ATOM   5768  C  CG    . ASN B  1 346 ? 33.237  -8.195  -54.276 1.00 19.31 ? 357 ASN B CG    1 
ATOM   5769  O  OD1   . ASN B  1 346 ? 34.090  -7.354  -53.952 1.00 18.58 ? 357 ASN B OD1   1 
ATOM   5770  N  ND2   . ASN B  1 346 ? 33.583  -9.396  -54.693 1.00 14.07 ? 357 ASN B ND2   1 
ATOM   5771  N  N     . GLN B  1 347 ? 32.769  -4.398  -54.414 1.00 15.31 ? 358 GLN B N     1 
ATOM   5772  C  CA    . GLN B  1 347 ? 33.370  -3.421  -55.335 1.00 14.78 ? 358 GLN B CA    1 
ATOM   5773  C  C     . GLN B  1 347 ? 34.628  -3.916  -56.087 1.00 18.48 ? 358 GLN B C     1 
ATOM   5774  O  O     . GLN B  1 347 ? 35.120  -3.247  -57.004 1.00 18.58 ? 358 GLN B O     1 
ATOM   5775  C  CB    . GLN B  1 347 ? 33.577  -2.106  -54.614 1.00 16.43 ? 358 GLN B CB    1 
ATOM   5776  C  CG    . GLN B  1 347 ? 32.244  -1.389  -54.420 1.00 35.92 ? 358 GLN B CG    1 
ATOM   5777  C  CD    . GLN B  1 347 ? 32.359  -0.185  -53.546 1.00 52.81 ? 358 GLN B CD    1 
ATOM   5778  O  OE1   . GLN B  1 347 ? 33.164  0.723   -53.796 1.00 50.15 ? 358 GLN B OE1   1 
ATOM   5779  N  NE2   . GLN B  1 347 ? 31.511  -0.132  -52.527 1.00 38.16 ? 358 GLN B NE2   1 
ATOM   5780  N  N     . ASN B  1 348 ? 35.105  -5.113  -55.721 1.00 15.77 ? 359 ASN B N     1 
ATOM   5781  C  CA    . ASN B  1 348 ? 36.240  -5.816  -56.300 1.00 16.13 ? 359 ASN B CA    1 
ATOM   5782  C  C     . ASN B  1 348 ? 35.815  -6.663  -57.481 1.00 20.63 ? 359 ASN B C     1 
ATOM   5783  O  O     . ASN B  1 348 ? 35.507  -7.866  -57.338 1.00 20.43 ? 359 ASN B O     1 
ATOM   5784  C  CB    . ASN B  1 348 ? 36.922  -6.693  -55.258 1.00 18.24 ? 359 ASN B CB    1 
ATOM   5785  C  CG    . ASN B  1 348 ? 37.406  -5.919  -54.071 1.00 21.35 ? 359 ASN B CG    1 
ATOM   5786  O  OD1   . ASN B  1 348 ? 38.464  -5.292  -54.119 1.00 15.95 ? 359 ASN B OD1   1 
ATOM   5787  N  ND2   . ASN B  1 348 ? 36.590  -5.876  -53.019 1.00 10.11 ? 359 ASN B ND2   1 
ATOM   5788  N  N     . THR B  1 349 ? 35.858  -6.064  -58.675 1.00 14.73 ? 360 THR B N     1 
ATOM   5789  C  CA    . THR B  1 349 ? 35.468  -6.808  -59.876 1.00 14.21 ? 360 THR B CA    1 
ATOM   5790  C  C     . THR B  1 349 ? 36.445  -7.956  -60.120 1.00 15.36 ? 360 THR B C     1 
ATOM   5791  O  O     . THR B  1 349 ? 37.601  -7.856  -59.688 1.00 15.14 ? 360 THR B O     1 
ATOM   5792  C  CB    . THR B  1 349 ? 35.418  -5.888  -61.112 1.00 13.73 ? 360 THR B CB    1 
ATOM   5793  O  OG1   . THR B  1 349 ? 36.754  -5.432  -61.362 1.00 13.14 ? 360 THR B OG1   1 
ATOM   5794  C  CG2   . THR B  1 349 ? 34.465  -4.703  -60.934 1.00 12.66 ? 360 THR B CG2   1 
ATOM   5795  N  N     . PRO B  1 350 ? 36.034  -9.029  -60.844 1.00 14.19 ? 361 PRO B N     1 
ATOM   5796  C  CA    . PRO B  1 350 ? 36.976  -10.116 -61.142 1.00 13.55 ? 361 PRO B CA    1 
ATOM   5797  C  C     . PRO B  1 350 ? 38.212  -9.614  -61.895 1.00 16.98 ? 361 PRO B C     1 
ATOM   5798  O  O     . PRO B  1 350 ? 39.315  -10.101 -61.643 1.00 15.66 ? 361 PRO B O     1 
ATOM   5799  C  CB    . PRO B  1 350 ? 36.137  -11.066 -62.028 1.00 15.68 ? 361 PRO B CB    1 
ATOM   5800  C  CG    . PRO B  1 350 ? 34.733  -10.824 -61.586 1.00 20.58 ? 361 PRO B CG    1 
ATOM   5801  C  CD    . PRO B  1 350 ? 34.692  -9.327  -61.403 1.00 16.21 ? 361 PRO B CD    1 
ATOM   5802  N  N     . GLU B  1 351 ? 38.032  -8.620  -62.812 1.00 12.52 ? 362 GLU B N     1 
ATOM   5803  C  CA    . GLU B  1 351 ? 39.149  -8.068  -63.586 1.00 11.00 ? 362 GLU B CA    1 
ATOM   5804  C  C     . GLU B  1 351 ? 40.103  -7.283  -62.685 1.00 13.07 ? 362 GLU B C     1 
ATOM   5805  O  O     . GLU B  1 351 ? 41.304  -7.395  -62.855 1.00 13.46 ? 362 GLU B O     1 
ATOM   5806  C  CB    . GLU B  1 351 ? 38.643  -7.192  -64.749 1.00 12.22 ? 362 GLU B CB    1 
ATOM   5807  C  CG    . GLU B  1 351 ? 37.810  -7.968  -65.761 1.00 14.71 ? 362 GLU B CG    1 
ATOM   5808  C  CD    . GLU B  1 351 ? 36.401  -8.301  -65.313 1.00 23.92 ? 362 GLU B CD    1 
ATOM   5809  O  OE1   . GLU B  1 351 ? 35.837  -7.566  -64.466 1.00 18.28 ? 362 GLU B OE1   1 
ATOM   5810  O  OE2   . GLU B  1 351 ? 35.897  -9.362  -65.738 1.00 35.40 ? 362 GLU B OE2   1 
ATOM   5811  N  N     . TYR B  1 352 ? 39.569  -6.489  -61.743 1.00 11.46 ? 363 TYR B N     1 
ATOM   5812  C  CA    . TYR B  1 352 ? 40.394  -5.732  -60.784 1.00 11.82 ? 363 TYR B CA    1 
ATOM   5813  C  C     . TYR B  1 352 ? 41.287  -6.716  -59.995 1.00 15.32 ? 363 TYR B C     1 
ATOM   5814  O  O     . TYR B  1 352 ? 42.496  -6.506  -59.887 1.00 14.29 ? 363 TYR B O     1 
ATOM   5815  C  CB    . TYR B  1 352 ? 39.500  -4.914  -59.819 1.00 13.07 ? 363 TYR B CB    1 
ATOM   5816  C  CG    . TYR B  1 352 ? 40.272  -4.297  -58.666 1.00 14.09 ? 363 TYR B CG    1 
ATOM   5817  C  CD1   . TYR B  1 352 ? 40.439  -4.984  -57.461 1.00 14.74 ? 363 TYR B CD1   1 
ATOM   5818  C  CD2   . TYR B  1 352 ? 40.852  -3.034  -58.786 1.00 14.39 ? 363 TYR B CD2   1 
ATOM   5819  C  CE1   . TYR B  1 352 ? 41.164  -4.426  -56.403 1.00 13.34 ? 363 TYR B CE1   1 
ATOM   5820  C  CE2   . TYR B  1 352 ? 41.614  -2.487  -57.752 1.00 14.38 ? 363 TYR B CE2   1 
ATOM   5821  C  CZ    . TYR B  1 352 ? 41.752  -3.182  -56.559 1.00 16.27 ? 363 TYR B CZ    1 
ATOM   5822  O  OH    . TYR B  1 352 ? 42.497  -2.643  -55.555 1.00 13.99 ? 363 TYR B OH    1 
ATOM   5823  N  N     . MET B  1 353 ? 40.688  -7.791  -59.471 1.00 13.82 ? 364 MET B N     1 
ATOM   5824  C  CA    . MET B  1 353 ? 41.397  -8.811  -58.672 1.00 14.19 ? 364 MET B CA    1 
ATOM   5825  C  C     . MET B  1 353 ? 42.530  -9.447  -59.452 1.00 17.28 ? 364 MET B C     1 
ATOM   5826  O  O     . MET B  1 353 ? 43.640  -9.571  -58.933 1.00 15.68 ? 364 MET B O     1 
ATOM   5827  C  CB    . MET B  1 353 ? 40.427  -9.900  -58.161 1.00 15.83 ? 364 MET B CB    1 
ATOM   5828  C  CG    . MET B  1 353 ? 39.368  -9.400  -57.171 1.00 20.23 ? 364 MET B CG    1 
ATOM   5829  S  SD    . MET B  1 353 ? 39.969  -8.528  -55.694 1.00 25.34 ? 364 MET B SD    1 
ATOM   5830  C  CE    . MET B  1 353 ? 40.869  -9.824  -54.847 1.00 22.52 ? 364 MET B CE    1 
ATOM   5831  N  N     . GLU B  1 354 ? 42.257  -9.848  -60.710 1.00 15.32 ? 365 GLU B N     1 
ATOM   5832  C  CA    . GLU B  1 354 ? 43.269  -10.504 -61.540 1.00 14.59 ? 365 GLU B CA    1 
ATOM   5833  C  C     . GLU B  1 354 ? 44.321  -9.528  -62.007 1.00 15.70 ? 365 GLU B C     1 
ATOM   5834  O  O     . GLU B  1 354 ? 45.502  -9.873  -62.013 1.00 14.53 ? 365 GLU B O     1 
ATOM   5835  C  CB    . GLU B  1 354 ? 42.613  -11.240 -62.724 1.00 15.97 ? 365 GLU B CB    1 
ATOM   5836  C  CG    . GLU B  1 354 ? 41.711  -12.394 -62.285 1.00 21.12 ? 365 GLU B CG    1 
ATOM   5837  C  CD    . GLU B  1 354 ? 42.456  -13.532 -61.610 1.00 34.31 ? 365 GLU B CD    1 
ATOM   5838  O  OE1   . GLU B  1 354 ? 41.966  -14.023 -60.570 1.00 29.62 ? 365 GLU B OE1   1 
ATOM   5839  O  OE2   . GLU B  1 354 ? 43.569  -13.873 -62.069 1.00 28.15 ? 365 GLU B OE2   1 
ATOM   5840  N  N     . LYS B  1 355 ? 43.917  -8.292  -62.355 1.00 11.96 ? 366 LYS B N     1 
ATOM   5841  C  CA    . LYS B  1 355 ? 44.923  -7.292  -62.750 1.00 10.88 ? 366 LYS B CA    1 
ATOM   5842  C  C     . LYS B  1 355 ? 45.910  -7.018  -61.580 1.00 14.03 ? 366 LYS B C     1 
ATOM   5843  O  O     . LYS B  1 355 ? 47.120  -6.998  -61.809 1.00 13.89 ? 366 LYS B O     1 
ATOM   5844  C  CB    . LYS B  1 355 ? 44.256  -5.989  -63.231 1.00 12.06 ? 366 LYS B CB    1 
ATOM   5845  C  CG    . LYS B  1 355 ? 45.275  -4.959  -63.691 1.00 14.47 ? 366 LYS B CG    1 
ATOM   5846  C  CD    . LYS B  1 355 ? 46.026  -5.422  -64.968 1.00 12.78 ? 366 LYS B CD    1 
ATOM   5847  C  CE    . LYS B  1 355 ? 47.021  -4.362  -65.361 1.00 24.23 ? 366 LYS B CE    1 
ATOM   5848  N  NZ    . LYS B  1 355 ? 47.693  -4.701  -66.655 1.00 24.49 ? 366 LYS B NZ    1 
ATOM   5849  N  N     . ILE B  1 356 ? 45.399  -6.829  -60.333 1.00 11.71 ? 367 ILE B N     1 
ATOM   5850  C  CA    . ILE B  1 356 ? 46.306  -6.625  -59.178 1.00 10.26 ? 367 ILE B CA    1 
ATOM   5851  C  C     . ILE B  1 356 ? 47.211  -7.838  -58.959 1.00 13.30 ? 367 ILE B C     1 
ATOM   5852  O  O     . ILE B  1 356 ? 48.410  -7.677  -58.734 1.00 12.27 ? 367 ILE B O     1 
ATOM   5853  C  CB    . ILE B  1 356 ? 45.577  -6.185  -57.879 1.00 13.80 ? 367 ILE B CB    1 
ATOM   5854  C  CG1   . ILE B  1 356 ? 44.767  -4.868  -58.072 1.00 13.70 ? 367 ILE B CG1   1 
ATOM   5855  C  CG2   . ILE B  1 356 ? 46.563  -6.090  -56.663 1.00 13.73 ? 367 ILE B CG2   1 
ATOM   5856  C  CD1   . ILE B  1 356 ? 45.579  -3.595  -58.658 1.00 18.84 ? 367 ILE B CD1   1 
ATOM   5857  N  N     . LYS B  1 357 ? 46.634  -9.050  -58.986 1.00 12.36 ? 368 LYS B N     1 
ATOM   5858  C  CA    . LYS B  1 357 ? 47.364  -10.315 -58.815 1.00 12.31 ? 368 LYS B CA    1 
ATOM   5859  C  C     . LYS B  1 357 ? 48.513  -10.403 -59.857 1.00 16.97 ? 368 LYS B C     1 
ATOM   5860  O  O     . LYS B  1 357 ? 49.631  -10.778 -59.514 1.00 15.23 ? 368 LYS B O     1 
ATOM   5861  C  CB    . LYS B  1 357 ? 46.369  -11.475 -58.998 1.00 15.62 ? 368 LYS B CB    1 
ATOM   5862  C  CG    . LYS B  1 357 ? 46.913  -12.886 -58.744 1.00 29.34 ? 368 LYS B CG    1 
ATOM   5863  C  CD    . LYS B  1 357 ? 46.064  -13.967 -59.454 1.00 29.46 ? 368 LYS B CD    1 
ATOM   5864  C  CE    . LYS B  1 357 ? 44.778  -14.348 -58.740 1.00 32.69 ? 368 LYS B CE    1 
ATOM   5865  N  NZ    . LYS B  1 357 ? 44.026  -15.482 -59.389 1.00 23.45 ? 368 LYS B NZ    1 
ATOM   5866  N  N     . GLN B  1 358 ? 48.239  -10.015 -61.106 1.00 14.84 ? 369 GLN B N     1 
ATOM   5867  C  CA    . GLN B  1 358 ? 49.233  -10.020 -62.169 1.00 15.42 ? 369 GLN B CA    1 
ATOM   5868  C  C     . GLN B  1 358 ? 50.369  -9.046  -61.915 1.00 18.04 ? 369 GLN B C     1 
ATOM   5869  O  O     . GLN B  1 358 ? 51.530  -9.444  -62.060 1.00 16.05 ? 369 GLN B O     1 
ATOM   5870  C  CB    . GLN B  1 358 ? 48.584  -9.920  -63.551 1.00 17.10 ? 369 GLN B CB    1 
ATOM   5871  C  CG    . GLN B  1 358 ? 48.004  -11.295 -63.923 1.00 39.08 ? 369 GLN B CG    1 
ATOM   5872  C  CD    . GLN B  1 358 ? 47.332  -11.430 -65.266 1.00 57.98 ? 369 GLN B CD    1 
ATOM   5873  O  OE1   . GLN B  1 358 ? 47.503  -10.622 -66.189 1.00 55.18 ? 369 GLN B OE1   1 
ATOM   5874  N  NE2   . GLN B  1 358 ? 46.577  -12.507 -65.408 1.00 45.70 ? 369 GLN B NE2   1 
ATOM   5875  N  N     . ARG B  1 359 ? 50.057  -7.820  -61.433 1.00 14.78 ? 370 ARG B N     1 
ATOM   5876  C  CA    . ARG B  1 359 ? 51.091  -6.836  -61.083 1.00 16.62 ? 370 ARG B CA    1 
ATOM   5877  C  C     . ARG B  1 359 ? 51.987  -7.353  -59.930 1.00 21.15 ? 370 ARG B C     1 
ATOM   5878  O  O     . ARG B  1 359 ? 53.216  -7.218  -60.003 1.00 21.57 ? 370 ARG B O     1 
ATOM   5879  C  CB    . ARG B  1 359 ? 50.499  -5.445  -60.785 1.00 17.39 ? 370 ARG B CB    1 
ATOM   5880  C  CG    . ARG B  1 359 ? 49.883  -4.763  -62.036 1.00 25.48 ? 370 ARG B CG    1 
ATOM   5881  C  CD    . ARG B  1 359 ? 49.862  -3.235  -61.981 1.00 31.09 ? 370 ARG B CD    1 
ATOM   5882  N  NE    . ARG B  1 359 ? 49.310  -2.669  -63.220 1.00 30.11 ? 370 ARG B NE    1 
ATOM   5883  C  CZ    . ARG B  1 359 ? 48.819  -1.438  -63.339 1.00 38.95 ? 370 ARG B CZ    1 
ATOM   5884  N  NH1   . ARG B  1 359 ? 48.800  -0.620  -62.296 1.00 24.72 ? 370 ARG B NH1   1 
ATOM   5885  N  NH2   . ARG B  1 359 ? 48.337  -1.019  -64.504 1.00 23.45 ? 370 ARG B NH2   1 
ATOM   5886  N  N     . LEU B  1 360 ? 51.385  -8.008  -58.906 1.00 16.89 ? 371 LEU B N     1 
ATOM   5887  C  CA    . LEU B  1 360 ? 52.142  -8.600  -57.788 1.00 16.24 ? 371 LEU B CA    1 
ATOM   5888  C  C     . LEU B  1 360 ? 53.000  -9.781  -58.271 1.00 19.27 ? 371 LEU B C     1 
ATOM   5889  O  O     . LEU B  1 360 ? 54.135  -9.935  -57.808 1.00 18.68 ? 371 LEU B O     1 
ATOM   5890  C  CB    . LEU B  1 360 ? 51.207  -9.059  -56.643 1.00 16.62 ? 371 LEU B CB    1 
ATOM   5891  C  CG    . LEU B  1 360 ? 50.432  -7.945  -55.903 1.00 20.73 ? 371 LEU B CG    1 
ATOM   5892  C  CD1   . LEU B  1 360 ? 49.708  -8.516  -54.694 1.00 20.35 ? 371 LEU B CD1   1 
ATOM   5893  C  CD2   . LEU B  1 360 ? 51.353  -6.849  -55.437 1.00 21.62 ? 371 LEU B CD2   1 
ATOM   5894  N  N     . PHE B  1 361 ? 52.468  -10.606 -59.196 1.00 16.53 ? 372 PHE B N     1 
ATOM   5895  C  CA    A PHE B  1 361 ? 53.235  -11.731 -59.754 0.55 16.79 ? 372 PHE B CA    1 
ATOM   5896  C  CA    B PHE B  1 361 ? 53.234  -11.735 -59.737 0.45 16.57 ? 372 PHE B CA    1 
ATOM   5897  C  C     . PHE B  1 361 ? 54.475  -11.207 -60.479 1.00 21.26 ? 372 PHE B C     1 
ATOM   5898  O  O     . PHE B  1 361 ? 55.537  -11.812 -60.380 1.00 21.27 ? 372 PHE B O     1 
ATOM   5899  C  CB    A PHE B  1 361 ? 52.386  -12.565 -60.715 0.55 18.27 ? 372 PHE B CB    1 
ATOM   5900  C  CB    B PHE B  1 361 ? 52.361  -12.612 -60.644 0.45 17.91 ? 372 PHE B CB    1 
ATOM   5901  C  CG    A PHE B  1 361 ? 51.394  -13.510 -60.085 0.55 19.37 ? 372 PHE B CG    1 
ATOM   5902  C  CG    B PHE B  1 361 ? 51.741  -13.822 -59.980 0.45 18.91 ? 372 PHE B CG    1 
ATOM   5903  C  CD1   A PHE B  1 361 ? 51.517  -13.888 -58.748 0.55 21.84 ? 372 PHE B CD1   1 
ATOM   5904  C  CD1   B PHE B  1 361 ? 52.081  -15.106 -60.383 0.45 21.10 ? 372 PHE B CD1   1 
ATOM   5905  C  CD2   A PHE B  1 361 ? 50.362  -14.056 -60.834 0.55 20.75 ? 372 PHE B CD2   1 
ATOM   5906  C  CD2   B PHE B  1 361 ? 50.807  -13.676 -58.958 0.45 20.28 ? 372 PHE B CD2   1 
ATOM   5907  C  CE1   A PHE B  1 361 ? 50.612  -14.779 -58.171 0.55 22.29 ? 372 PHE B CE1   1 
ATOM   5908  C  CE1   B PHE B  1 361 ? 51.493  -16.223 -59.783 0.45 21.66 ? 372 PHE B CE1   1 
ATOM   5909  C  CE2   A PHE B  1 361 ? 49.462  -14.958 -60.258 0.55 23.76 ? 372 PHE B CE2   1 
ATOM   5910  C  CE2   B PHE B  1 361 ? 50.226  -14.795 -58.355 0.45 22.56 ? 372 PHE B CE2   1 
ATOM   5911  C  CZ    A PHE B  1 361 ? 49.594  -15.312 -58.930 0.55 21.47 ? 372 PHE B CZ    1 
ATOM   5912  C  CZ    B PHE B  1 361 ? 50.567  -16.061 -58.776 0.45 20.53 ? 372 PHE B CZ    1 
ATOM   5913  N  N     . GLU B  1 362 ? 54.349  -10.050 -61.170 1.00 19.16 ? 373 GLU B N     1 
ATOM   5914  C  CA    . GLU B  1 362 ? 55.479  -9.412  -61.879 1.00 19.47 ? 373 GLU B CA    1 
ATOM   5915  C  C     . GLU B  1 362 ? 56.566  -9.019  -60.886 1.00 24.84 ? 373 GLU B C     1 
ATOM   5916  O  O     . GLU B  1 362 ? 57.749  -9.234  -61.156 1.00 23.93 ? 373 GLU B O     1 
ATOM   5917  C  CB    A GLU B  1 362 ? 55.024  -8.167  -62.659 0.79 20.40 ? 373 GLU B CB    1 
ATOM   5918  C  CG    A GLU B  1 362 ? 54.216  -8.475  -63.901 0.79 25.89 ? 373 GLU B CG    1 
ATOM   5919  C  CD    A GLU B  1 362 ? 53.558  -7.289  -64.583 0.79 53.53 ? 373 GLU B CD    1 
ATOM   5920  O  OE1   A GLU B  1 362 ? 53.526  -6.182  -63.995 0.79 47.04 ? 373 GLU B OE1   1 
ATOM   5921  O  OE2   A GLU B  1 362 ? 53.042  -7.482  -65.707 0.79 57.35 ? 373 GLU B OE2   1 
ATOM   5922  N  N     . ASN B  1 363 ? 56.165  -8.471  -59.718 1.00 20.20 ? 374 ASN B N     1 
ATOM   5923  C  CA    . ASN B  1 363 ? 57.104  -8.112  -58.649 1.00 19.37 ? 374 ASN B CA    1 
ATOM   5924  C  C     . ASN B  1 363 ? 57.759  -9.352  -58.048 1.00 20.75 ? 374 ASN B C     1 
ATOM   5925  O  O     . ASN B  1 363 ? 58.953  -9.328  -57.763 1.00 22.14 ? 374 ASN B O     1 
ATOM   5926  C  CB    . ASN B  1 363 ? 56.405  -7.300  -57.543 1.00 14.91 ? 374 ASN B CB    1 
ATOM   5927  C  CG    . ASN B  1 363 ? 55.901  -5.947  -57.994 1.00 28.44 ? 374 ASN B CG    1 
ATOM   5928  O  OD1   . ASN B  1 363 ? 56.346  -5.387  -59.002 1.00 21.95 ? 374 ASN B OD1   1 
ATOM   5929  N  ND2   . ASN B  1 363 ? 54.973  -5.380  -57.243 1.00 17.46 ? 374 ASN B ND2   1 
ATOM   5930  N  N     . LEU B  1 364 ? 56.987  -10.430 -57.853 1.00 17.55 ? 375 LEU B N     1 
ATOM   5931  C  CA    . LEU B  1 364 ? 57.513  -11.664 -57.271 1.00 17.35 ? 375 LEU B CA    1 
ATOM   5932  C  C     . LEU B  1 364 ? 58.523  -12.347 -58.170 1.00 23.73 ? 375 LEU B C     1 
ATOM   5933  O  O     . LEU B  1 364 ? 59.487  -12.950 -57.682 1.00 21.95 ? 375 LEU B O     1 
ATOM   5934  C  CB    . LEU B  1 364 ? 56.395  -12.625 -56.883 1.00 16.50 ? 375 LEU B CB    1 
ATOM   5935  C  CG    . LEU B  1 364 ? 55.596  -12.173 -55.650 1.00 19.57 ? 375 LEU B CG    1 
ATOM   5936  C  CD1   . LEU B  1 364 ? 54.352  -13.017 -55.475 1.00 18.20 ? 375 LEU B CD1   1 
ATOM   5937  C  CD2   . LEU B  1 364 ? 56.467  -12.179 -54.391 1.00 20.84 ? 375 LEU B CD2   1 
ATOM   5938  N  N     . ARG B  1 365 ? 58.320  -12.218 -59.485 1.00 23.92 ? 376 ARG B N     1 
ATOM   5939  C  CA    . ARG B  1 365 ? 59.229  -12.789 -60.490 1.00 25.53 ? 376 ARG B CA    1 
ATOM   5940  C  C     . ARG B  1 365 ? 60.600  -12.122 -60.450 1.00 29.95 ? 376 ARG B C     1 
ATOM   5941  O  O     . ARG B  1 365 ? 61.581  -12.743 -60.856 1.00 31.01 ? 376 ARG B O     1 
ATOM   5942  C  CB    . ARG B  1 365 ? 58.601  -12.713 -61.884 1.00 26.58 ? 376 ARG B CB    1 
ATOM   5943  C  CG    . ARG B  1 365 ? 57.557  -13.810 -62.071 1.00 38.36 ? 376 ARG B CG    1 
ATOM   5944  C  CD    . ARG B  1 365 ? 56.792  -13.676 -63.368 1.00 46.01 ? 376 ARG B CD    1 
ATOM   5945  N  NE    . ARG B  1 365 ? 55.583  -14.501 -63.340 1.00 52.15 ? 376 ARG B NE    1 
ATOM   5946  C  CZ    . ARG B  1 365 ? 54.364  -14.056 -63.618 1.00 60.41 ? 376 ARG B CZ    1 
ATOM   5947  N  NH1   . ARG B  1 365 ? 54.177  -12.790 -63.971 1.00 37.36 ? 376 ARG B NH1   1 
ATOM   5948  N  NH2   . ARG B  1 365 ? 53.323  -14.877 -63.563 1.00 52.91 ? 376 ARG B NH2   1 
ATOM   5949  N  N     . MET B  1 366 ? 60.675  -10.900 -59.891 1.00 25.85 ? 377 MET B N     1 
ATOM   5950  C  CA    . MET B  1 366 ? 61.910  -10.131 -59.708 1.00 25.96 ? 377 MET B CA    1 
ATOM   5951  C  C     . MET B  1 366 ? 62.828  -10.650 -58.584 1.00 29.81 ? 377 MET B C     1 
ATOM   5952  O  O     . MET B  1 366 ? 63.952  -10.164 -58.493 1.00 28.69 ? 377 MET B O     1 
ATOM   5953  C  CB    . MET B  1 366 ? 61.616  -8.633  -59.480 1.00 28.63 ? 377 MET B CB    1 
ATOM   5954  C  CG    . MET B  1 366 ? 60.983  -7.923  -60.656 1.00 33.36 ? 377 MET B CG    1 
ATOM   5955  S  SD    . MET B  1 366 ? 61.941  -7.982  -62.192 1.00 38.44 ? 377 MET B SD    1 
ATOM   5956  C  CE    . MET B  1 366 ? 63.440  -7.106  -61.697 1.00 34.92 ? 377 MET B CE    1 
ATOM   5957  N  N     . LEU B  1 367 ? 62.363  -11.579 -57.708 1.00 27.51 ? 378 LEU B N     1 
ATOM   5958  C  CA    . LEU B  1 367 ? 63.197  -12.142 -56.624 1.00 28.85 ? 378 LEU B CA    1 
ATOM   5959  C  C     . LEU B  1 367 ? 64.350  -13.001 -57.214 1.00 38.91 ? 378 LEU B C     1 
ATOM   5960  O  O     . LEU B  1 367 ? 64.114  -13.774 -58.157 1.00 38.26 ? 378 LEU B O     1 
ATOM   5961  C  CB    . LEU B  1 367 ? 62.393  -13.043 -55.646 1.00 28.23 ? 378 LEU B CB    1 
ATOM   5962  C  CG    . LEU B  1 367 ? 61.313  -12.469 -54.702 1.00 32.34 ? 378 LEU B CG    1 
ATOM   5963  C  CD1   . LEU B  1 367 ? 61.161  -13.368 -53.474 1.00 30.87 ? 378 LEU B CD1   1 
ATOM   5964  C  CD2   . LEU B  1 367 ? 61.636  -11.079 -54.214 1.00 33.60 ? 378 LEU B CD2   1 
ATOM   5965  N  N     . PRO B  1 368 ? 65.581  -12.915 -56.655 1.00 40.23 ? 379 PRO B N     1 
ATOM   5966  C  CA    . PRO B  1 368 ? 66.679  -13.752 -57.179 1.00 48.86 ? 379 PRO B CA    1 
ATOM   5967  C  C     . PRO B  1 368 ? 66.607  -15.187 -56.671 1.00 94.25 ? 379 PRO B C     1 
ATOM   5968  O  O     . PRO B  1 368 ? 66.248  -15.418 -55.519 1.00 66.47 ? 379 PRO B O     1 
ATOM   5969  C  CB    . PRO B  1 368 ? 67.955  -13.046 -56.693 1.00 49.81 ? 379 PRO B CB    1 
ATOM   5970  C  CG    . PRO B  1 368 ? 67.510  -11.962 -55.740 1.00 51.68 ? 379 PRO B CG    1 
ATOM   5971  C  CD    . PRO B  1 368 ? 66.032  -12.073 -55.529 1.00 45.09 ? 379 PRO B CD    1 
ATOM   5972  N  N     . LYS C  1 2   ? 3.411   -10.738 -67.771 1.00 43.08 ? 13  LYS C N     1 
ATOM   5973  C  CA    . LYS C  1 2   ? 4.466   -9.770  -67.452 1.00 42.38 ? 13  LYS C CA    1 
ATOM   5974  C  C     . LYS C  1 2   ? 5.327   -10.212 -66.262 1.00 42.54 ? 13  LYS C C     1 
ATOM   5975  O  O     . LYS C  1 2   ? 6.514   -9.865  -66.203 1.00 42.43 ? 13  LYS C O     1 
ATOM   5976  C  CB    . LYS C  1 2   ? 3.877   -8.374  -67.198 1.00 45.75 ? 13  LYS C CB    1 
ATOM   5977  N  N     . LYS C  1 3   ? 4.740   -10.963 -65.307 1.00 35.19 ? 14  LYS C N     1 
ATOM   5978  C  CA    . LYS C  1 3   ? 5.523   -11.444 -64.170 1.00 32.47 ? 14  LYS C CA    1 
ATOM   5979  C  C     . LYS C  1 3   ? 6.218   -12.755 -64.533 1.00 34.24 ? 14  LYS C C     1 
ATOM   5980  O  O     . LYS C  1 3   ? 5.603   -13.640 -65.146 1.00 34.51 ? 14  LYS C O     1 
ATOM   5981  C  CB    . LYS C  1 3   ? 4.664   -11.595 -62.913 1.00 33.48 ? 14  LYS C CB    1 
ATOM   5982  C  CG    . LYS C  1 3   ? 4.272   -10.280 -62.258 1.00 35.39 ? 14  LYS C CG    1 
ATOM   5983  C  CD    . LYS C  1 3   ? 3.279   -10.517 -61.119 1.00 41.95 ? 14  LYS C CD    1 
ATOM   5984  C  CE    . LYS C  1 3   ? 2.821   -9.219  -60.494 1.00 47.06 ? 14  LYS C CE    1 
ATOM   5985  N  NZ    . LYS C  1 3   ? 1.771   -9.435  -59.461 1.00 47.92 ? 14  LYS C NZ    1 
ATOM   5986  N  N     . LYS C  1 4   ? 7.508   -12.865 -64.174 1.00 26.54 ? 15  LYS C N     1 
ATOM   5987  C  CA    . LYS C  1 4   ? 8.326   -14.042 -64.438 1.00 24.66 ? 15  LYS C CA    1 
ATOM   5988  C  C     . LYS C  1 4   ? 8.174   -15.076 -63.305 1.00 26.80 ? 15  LYS C C     1 
ATOM   5989  O  O     . LYS C  1 4   ? 8.135   -14.717 -62.126 1.00 24.23 ? 15  LYS C O     1 
ATOM   5990  C  CB    . LYS C  1 4   ? 9.795   -13.631 -64.637 1.00 26.51 ? 15  LYS C CB    1 
ATOM   5991  C  CG    . LYS C  1 4   ? 10.709  -14.755 -65.092 1.00 33.24 ? 15  LYS C CG    1 
ATOM   5992  C  CD    . LYS C  1 4   ? 12.108  -14.228 -65.347 1.00 40.52 ? 15  LYS C CD    1 
ATOM   5993  C  CE    . LYS C  1 4   ? 13.091  -15.345 -65.526 1.00 47.45 ? 15  LYS C CE    1 
ATOM   5994  N  NZ    . LYS C  1 4   ? 14.493  -14.846 -65.605 1.00 57.00 ? 15  LYS C NZ    1 
ATOM   5995  N  N     . VAL C  1 5   ? 8.069   -16.360 -63.689 1.00 22.94 ? 16  VAL C N     1 
ATOM   5996  C  CA    . VAL C  1 5   ? 7.892   -17.501 -62.794 1.00 21.75 ? 16  VAL C CA    1 
ATOM   5997  C  C     . VAL C  1 5   ? 9.018   -18.517 -63.056 1.00 26.09 ? 16  VAL C C     1 
ATOM   5998  O  O     . VAL C  1 5   ? 9.181   -18.969 -64.190 1.00 26.77 ? 16  VAL C O     1 
ATOM   5999  C  CB    . VAL C  1 5   ? 6.484   -18.164 -62.987 1.00 24.16 ? 16  VAL C CB    1 
ATOM   6000  C  CG1   . VAL C  1 5   ? 6.305   -19.390 -62.085 1.00 23.05 ? 16  VAL C CG1   1 
ATOM   6001  C  CG2   . VAL C  1 5   ? 5.345   -17.167 -62.766 1.00 23.66 ? 16  VAL C CG2   1 
ATOM   6002  N  N     . CYS C  1 6   ? 9.793   -18.864 -62.015 1.00 21.22 ? 17  CYS C N     1 
ATOM   6003  C  CA    . CYS C  1 6   ? 10.810  -19.919 -62.079 1.00 20.10 ? 17  CYS C CA    1 
ATOM   6004  C  C     . CYS C  1 6   ? 10.299  -21.082 -61.259 1.00 21.47 ? 17  CYS C C     1 
ATOM   6005  O  O     . CYS C  1 6   ? 9.738   -20.883 -60.182 1.00 19.76 ? 17  CYS C O     1 
ATOM   6006  C  CB    . CYS C  1 6   ? 12.176  -19.439 -61.612 1.00 20.68 ? 17  CYS C CB    1 
ATOM   6007  S  SG    . CYS C  1 6   ? 12.911  -18.207 -62.708 1.00 25.07 ? 17  CYS C SG    1 
ATOM   6008  N  N     . TYR C  1 7   ? 10.461  -22.293 -61.780 1.00 17.79 ? 18  TYR C N     1 
ATOM   6009  C  CA    . TYR C  1 7   ? 9.877   -23.484 -61.181 1.00 16.95 ? 18  TYR C CA    1 
ATOM   6010  C  C     . TYR C  1 7   ? 10.933  -24.537 -60.952 1.00 21.90 ? 18  TYR C C     1 
ATOM   6011  O  O     . TYR C  1 7   ? 11.719  -24.817 -61.859 1.00 21.35 ? 18  TYR C O     1 
ATOM   6012  C  CB    . TYR C  1 7   ? 8.753   -23.951 -62.127 1.00 17.05 ? 18  TYR C CB    1 
ATOM   6013  C  CG    . TYR C  1 7   ? 8.166   -25.321 -61.881 1.00 15.74 ? 18  TYR C CG    1 
ATOM   6014  C  CD1   . TYR C  1 7   ? 8.789   -26.464 -62.377 1.00 17.28 ? 18  TYR C CD1   1 
ATOM   6015  C  CD2   . TYR C  1 7   ? 6.892   -25.462 -61.348 1.00 15.43 ? 18  TYR C CD2   1 
ATOM   6016  C  CE1   . TYR C  1 7   ? 8.210   -27.725 -62.230 1.00 14.99 ? 18  TYR C CE1   1 
ATOM   6017  C  CE2   . TYR C  1 7   ? 6.312   -26.713 -61.179 1.00 15.42 ? 18  TYR C CE2   1 
ATOM   6018  C  CZ    . TYR C  1 7   ? 6.959   -27.841 -61.655 1.00 21.11 ? 18  TYR C CZ    1 
ATOM   6019  O  OH    . TYR C  1 7   ? 6.373   -29.068 -61.527 1.00 20.92 ? 18  TYR C OH    1 
ATOM   6020  N  N     . TYR C  1 8   ? 10.952  -25.117 -59.735 1.00 18.50 ? 19  TYR C N     1 
ATOM   6021  C  CA    . TYR C  1 8   ? 11.979  -26.073 -59.300 1.00 17.79 ? 19  TYR C CA    1 
ATOM   6022  C  C     . TYR C  1 8   ? 11.456  -27.455 -59.160 1.00 20.68 ? 19  TYR C C     1 
ATOM   6023  O  O     . TYR C  1 8   ? 10.483  -27.698 -58.434 1.00 21.23 ? 19  TYR C O     1 
ATOM   6024  C  CB    . TYR C  1 8   ? 12.705  -25.572 -58.016 1.00 18.84 ? 19  TYR C CB    1 
ATOM   6025  C  CG    . TYR C  1 8   ? 13.425  -24.271 -58.290 1.00 18.60 ? 19  TYR C CG    1 
ATOM   6026  C  CD1   . TYR C  1 8   ? 12.736  -23.059 -58.295 1.00 19.56 ? 19  TYR C CD1   1 
ATOM   6027  C  CD2   . TYR C  1 8   ? 14.764  -24.260 -58.676 1.00 18.42 ? 19  TYR C CD2   1 
ATOM   6028  C  CE1   . TYR C  1 8   ? 13.358  -21.874 -58.685 1.00 20.14 ? 19  TYR C CE1   1 
ATOM   6029  C  CE2   . TYR C  1 8   ? 15.400  -23.075 -59.053 1.00 19.09 ? 19  TYR C CE2   1 
ATOM   6030  C  CZ    . TYR C  1 8   ? 14.688  -21.886 -59.065 1.00 22.65 ? 19  TYR C CZ    1 
ATOM   6031  O  OH    . TYR C  1 8   ? 15.296  -20.704 -59.423 1.00 23.55 ? 19  TYR C OH    1 
ATOM   6032  N  N     . TYR C  1 9   ? 12.106  -28.385 -59.865 1.00 16.87 ? 20  TYR C N     1 
ATOM   6033  C  CA    . TYR C  1 9   ? 11.689  -29.774 -59.866 1.00 17.22 ? 20  TYR C CA    1 
ATOM   6034  C  C     . TYR C  1 9   ? 12.842  -30.678 -60.275 1.00 21.81 ? 20  TYR C C     1 
ATOM   6035  O  O     . TYR C  1 9   ? 13.573  -30.362 -61.216 1.00 21.23 ? 20  TYR C O     1 
ATOM   6036  C  CB    . TYR C  1 9   ? 10.518  -29.937 -60.854 1.00 18.34 ? 20  TYR C CB    1 
ATOM   6037  C  CG    . TYR C  1 9   ? 10.039  -31.351 -61.076 1.00 19.11 ? 20  TYR C CG    1 
ATOM   6038  C  CD1   . TYR C  1 9   ? 10.427  -32.069 -62.205 1.00 20.72 ? 20  TYR C CD1   1 
ATOM   6039  C  CD2   . TYR C  1 9   ? 9.153   -31.955 -60.188 1.00 19.44 ? 20  TYR C CD2   1 
ATOM   6040  C  CE1   . TYR C  1 9   ? 9.982   -33.373 -62.420 1.00 21.41 ? 20  TYR C CE1   1 
ATOM   6041  C  CE2   . TYR C  1 9   ? 8.691   -33.252 -60.399 1.00 19.98 ? 20  TYR C CE2   1 
ATOM   6042  C  CZ    . TYR C  1 9   ? 9.107   -33.956 -61.518 1.00 24.45 ? 20  TYR C CZ    1 
ATOM   6043  O  OH    . TYR C  1 9   ? 8.652   -35.237 -61.715 1.00 20.35 ? 20  TYR C OH    1 
ATOM   6044  N  N     . ASP C  1 10  ? 12.961  -31.816 -59.584 1.00 19.01 ? 21  ASP C N     1 
ATOM   6045  C  CA    . ASP C  1 10  ? 13.932  -32.860 -59.886 1.00 18.65 ? 21  ASP C CA    1 
ATOM   6046  C  C     . ASP C  1 10  ? 13.120  -34.115 -60.193 1.00 23.39 ? 21  ASP C C     1 
ATOM   6047  O  O     . ASP C  1 10  ? 12.306  -34.525 -59.365 1.00 21.90 ? 21  ASP C O     1 
ATOM   6048  C  CB    . ASP C  1 10  ? 14.892  -33.099 -58.703 1.00 19.40 ? 21  ASP C CB    1 
ATOM   6049  C  CG    . ASP C  1 10  ? 16.007  -34.093 -59.032 1.00 20.01 ? 21  ASP C CG    1 
ATOM   6050  O  OD1   . ASP C  1 10  ? 17.171  -33.661 -59.154 1.00 21.98 ? 21  ASP C OD1   1 
ATOM   6051  O  OD2   . ASP C  1 10  ? 15.702  -35.290 -59.222 1.00 21.35 ? 21  ASP C OD2   1 
ATOM   6052  N  N     . GLY C  1 11  ? 13.365  -34.713 -61.365 1.00 21.86 ? 22  GLY C N     1 
ATOM   6053  C  CA    . GLY C  1 11  ? 12.673  -35.904 -61.859 1.00 21.67 ? 22  GLY C CA    1 
ATOM   6054  C  C     . GLY C  1 11  ? 12.673  -37.125 -60.958 1.00 25.50 ? 22  GLY C C     1 
ATOM   6055  O  O     . GLY C  1 11  ? 11.828  -38.010 -61.121 1.00 25.20 ? 22  GLY C O     1 
ATOM   6056  N  N     . ASP C  1 12  ? 13.624  -37.197 -60.012 1.00 21.77 ? 23  ASP C N     1 
ATOM   6057  C  CA    . ASP C  1 12  ? 13.722  -38.301 -59.050 1.00 21.49 ? 23  ASP C CA    1 
ATOM   6058  C  C     . ASP C  1 12  ? 12.770  -38.142 -57.868 1.00 22.56 ? 23  ASP C C     1 
ATOM   6059  O  O     . ASP C  1 12  ? 12.520  -39.118 -57.158 1.00 20.00 ? 23  ASP C O     1 
ATOM   6060  C  CB    . ASP C  1 12  ? 15.154  -38.404 -58.489 1.00 24.30 ? 23  ASP C CB    1 
ATOM   6061  C  CG    . ASP C  1 12  ? 16.216  -38.853 -59.477 1.00 39.71 ? 23  ASP C CG    1 
ATOM   6062  O  OD1   . ASP C  1 12  ? 17.424  -38.633 -59.193 1.00 42.65 ? 23  ASP C OD1   1 
ATOM   6063  O  OD2   . ASP C  1 12  ? 15.848  -39.425 -60.531 1.00 40.82 ? 23  ASP C OD2   1 
ATOM   6064  N  N     . ILE C  1 13  ? 12.269  -36.904 -57.621 1.00 20.41 ? 24  ILE C N     1 
ATOM   6065  C  CA    . ILE C  1 13  ? 11.422  -36.624 -56.446 1.00 19.32 ? 24  ILE C CA    1 
ATOM   6066  C  C     . ILE C  1 13  ? 10.291  -37.619 -56.208 1.00 20.88 ? 24  ILE C C     1 
ATOM   6067  O  O     . ILE C  1 13  ? 10.111  -38.064 -55.086 1.00 19.54 ? 24  ILE C O     1 
ATOM   6068  C  CB    . ILE C  1 13  ? 10.988  -35.136 -56.336 1.00 22.36 ? 24  ILE C CB    1 
ATOM   6069  C  CG1   . ILE C  1 13  ? 10.702  -34.719 -54.873 1.00 21.96 ? 24  ILE C CG1   1 
ATOM   6070  C  CG2   . ILE C  1 13  ? 9.831   -34.778 -57.283 1.00 23.11 ? 24  ILE C CG2   1 
ATOM   6071  C  CD1   . ILE C  1 13  ? 11.949  -34.643 -53.995 1.00 23.00 ? 24  ILE C CD1   1 
ATOM   6072  N  N     . GLY C  1 14  ? 9.599   -38.005 -57.276 1.00 17.31 ? 25  GLY C N     1 
ATOM   6073  C  CA    . GLY C  1 14  ? 8.467   -38.925 -57.201 1.00 16.74 ? 25  GLY C CA    1 
ATOM   6074  C  C     . GLY C  1 14  ? 8.805   -40.351 -56.856 1.00 20.86 ? 25  GLY C C     1 
ATOM   6075  O  O     . GLY C  1 14  ? 7.898   -41.135 -56.561 1.00 19.99 ? 25  GLY C O     1 
ATOM   6076  N  N     . ASN C  1 15  ? 10.110  -40.695 -56.851 1.00 19.54 ? 26  ASN C N     1 
ATOM   6077  C  CA    . ASN C  1 15  ? 10.560  -42.047 -56.530 1.00 19.95 ? 26  ASN C CA    1 
ATOM   6078  C  C     . ASN C  1 15  ? 10.755  -42.317 -55.059 1.00 23.75 ? 26  ASN C C     1 
ATOM   6079  O  O     . ASN C  1 15  ? 10.803  -43.476 -54.658 1.00 23.54 ? 26  ASN C O     1 
ATOM   6080  C  CB    . ASN C  1 15  ? 11.786  -42.440 -57.373 1.00 25.18 ? 26  ASN C CB    1 
ATOM   6081  C  CG    . ASN C  1 15  ? 11.511  -42.398 -58.859 1.00 40.10 ? 26  ASN C CG    1 
ATOM   6082  O  OD1   . ASN C  1 15  ? 10.409  -42.711 -59.323 1.00 34.44 ? 26  ASN C OD1   1 
ATOM   6083  N  ND2   . ASN C  1 15  ? 12.489  -41.970 -59.635 1.00 28.85 ? 26  ASN C ND2   1 
ATOM   6084  N  N     . TYR C  1 16  ? 10.845  -41.252 -54.232 1.00 19.30 ? 27  TYR C N     1 
ATOM   6085  C  CA    . TYR C  1 16  ? 11.000  -41.394 -52.787 1.00 18.14 ? 27  TYR C CA    1 
ATOM   6086  C  C     . TYR C  1 16  ? 9.712   -41.902 -52.211 1.00 22.86 ? 27  TYR C C     1 
ATOM   6087  O  O     . TYR C  1 16  ? 8.639   -41.448 -52.602 1.00 23.43 ? 27  TYR C O     1 
ATOM   6088  C  CB    . TYR C  1 16  ? 11.493  -40.080 -52.161 1.00 18.14 ? 27  TYR C CB    1 
ATOM   6089  C  CG    . TYR C  1 16  ? 12.870  -39.732 -52.678 1.00 18.46 ? 27  TYR C CG    1 
ATOM   6090  C  CD1   . TYR C  1 16  ? 13.033  -38.842 -53.734 1.00 19.63 ? 27  TYR C CD1   1 
ATOM   6091  C  CD2   . TYR C  1 16  ? 14.009  -40.355 -52.164 1.00 18.92 ? 27  TYR C CD2   1 
ATOM   6092  C  CE1   . TYR C  1 16  ? 14.290  -38.569 -54.262 1.00 19.64 ? 27  TYR C CE1   1 
ATOM   6093  C  CE2   . TYR C  1 16  ? 15.275  -40.085 -52.681 1.00 18.69 ? 27  TYR C CE2   1 
ATOM   6094  C  CZ    . TYR C  1 16  ? 15.409  -39.186 -53.726 1.00 23.40 ? 27  TYR C CZ    1 
ATOM   6095  O  OH    . TYR C  1 16  ? 16.639  -38.898 -54.245 1.00 22.37 ? 27  TYR C OH    1 
ATOM   6096  N  N     . TYR C  1 17  ? 9.811   -42.953 -51.402 1.00 18.99 ? 28  TYR C N     1 
ATOM   6097  C  CA    . TYR C  1 17  ? 8.671   -43.674 -50.881 1.00 18.82 ? 28  TYR C CA    1 
ATOM   6098  C  C     . TYR C  1 17  ? 8.721   -43.776 -49.375 1.00 20.88 ? 28  TYR C C     1 
ATOM   6099  O  O     . TYR C  1 17  ? 9.667   -44.349 -48.843 1.00 18.69 ? 28  TYR C O     1 
ATOM   6100  C  CB    . TYR C  1 17  ? 8.617   -45.073 -51.547 1.00 20.48 ? 28  TYR C CB    1 
ATOM   6101  C  CG    . TYR C  1 17  ? 7.368   -45.870 -51.239 1.00 23.54 ? 28  TYR C CG    1 
ATOM   6102  C  CD1   . TYR C  1 17  ? 6.113   -45.422 -51.645 1.00 25.68 ? 28  TYR C CD1   1 
ATOM   6103  C  CD2   . TYR C  1 17  ? 7.443   -47.094 -50.586 1.00 24.11 ? 28  TYR C CD2   1 
ATOM   6104  C  CE1   . TYR C  1 17  ? 4.958   -46.147 -51.356 1.00 27.29 ? 28  TYR C CE1   1 
ATOM   6105  C  CE2   . TYR C  1 17  ? 6.298   -47.846 -50.323 1.00 25.33 ? 28  TYR C CE2   1 
ATOM   6106  C  CZ    . TYR C  1 17  ? 5.057   -47.364 -50.702 1.00 34.53 ? 28  TYR C CZ    1 
ATOM   6107  O  OH    . TYR C  1 17  ? 3.928   -48.105 -50.460 1.00 39.07 ? 28  TYR C OH    1 
ATOM   6108  N  N     . TYR C  1 18  ? 7.702   -43.215 -48.686 1.00 17.04 ? 29  TYR C N     1 
ATOM   6109  C  CA    . TYR C  1 18  ? 7.606   -43.219 -47.216 1.00 17.07 ? 29  TYR C CA    1 
ATOM   6110  C  C     . TYR C  1 18  ? 7.307   -44.594 -46.608 1.00 23.83 ? 29  TYR C C     1 
ATOM   6111  O  O     . TYR C  1 18  ? 7.521   -44.785 -45.405 1.00 24.38 ? 29  TYR C O     1 
ATOM   6112  C  CB    . TYR C  1 18  ? 6.555   -42.199 -46.723 1.00 16.95 ? 29  TYR C CB    1 
ATOM   6113  C  CG    . TYR C  1 18  ? 7.060   -40.774 -46.565 1.00 16.34 ? 29  TYR C CG    1 
ATOM   6114  C  CD1   . TYR C  1 18  ? 6.969   -40.115 -45.344 1.00 17.95 ? 29  TYR C CD1   1 
ATOM   6115  C  CD2   . TYR C  1 18  ? 7.561   -40.063 -47.656 1.00 15.94 ? 29  TYR C CD2   1 
ATOM   6116  C  CE1   . TYR C  1 18  ? 7.384   -38.789 -45.204 1.00 18.57 ? 29  TYR C CE1   1 
ATOM   6117  C  CE2   . TYR C  1 18  ? 8.016   -38.749 -47.519 1.00 15.77 ? 29  TYR C CE2   1 
ATOM   6118  C  CZ    . TYR C  1 18  ? 7.912   -38.114 -46.290 1.00 18.71 ? 29  TYR C CZ    1 
ATOM   6119  O  OH    . TYR C  1 18  ? 8.279   -36.799 -46.150 1.00 14.73 ? 29  TYR C OH    1 
ATOM   6120  N  N     . GLY C  1 19  ? 6.819   -45.523 -47.424 1.00 21.09 ? 30  GLY C N     1 
ATOM   6121  C  CA    . GLY C  1 19  ? 6.481   -46.875 -46.971 1.00 21.61 ? 30  GLY C CA    1 
ATOM   6122  C  C     . GLY C  1 19  ? 5.020   -47.203 -47.218 1.00 26.81 ? 30  GLY C C     1 
ATOM   6123  O  O     . GLY C  1 19  ? 4.196   -46.296 -47.397 1.00 25.07 ? 30  GLY C O     1 
ATOM   6124  N  N     . GLN C  1 20  ? 4.681   -48.511 -47.232 1.00 24.80 ? 31  GLN C N     1 
ATOM   6125  C  CA    . GLN C  1 20  ? 3.311   -48.972 -47.468 1.00 24.95 ? 31  GLN C CA    1 
ATOM   6126  C  C     . GLN C  1 20  ? 2.372   -48.423 -46.411 1.00 27.12 ? 31  GLN C C     1 
ATOM   6127  O  O     . GLN C  1 20  ? 2.687   -48.479 -45.227 1.00 26.24 ? 31  GLN C O     1 
ATOM   6128  C  CB    . GLN C  1 20  ? 3.237   -50.521 -47.522 1.00 27.10 ? 31  GLN C CB    1 
ATOM   6129  C  CG    . GLN C  1 20  ? 1.861   -51.036 -47.998 1.00 48.43 ? 31  GLN C CG    1 
ATOM   6130  C  CD    . GLN C  1 20  ? 1.900   -52.312 -48.814 1.00 72.40 ? 31  GLN C CD    1 
ATOM   6131  O  OE1   . GLN C  1 20  ? 2.702   -53.231 -48.571 1.00 66.44 ? 31  GLN C OE1   1 
ATOM   6132  N  NE2   . GLN C  1 20  ? 0.988   -52.413 -49.776 1.00 62.00 ? 31  GLN C NE2   1 
ATOM   6133  N  N     . GLY C  1 21  ? 1.255   -47.854 -46.854 1.00 23.33 ? 32  GLY C N     1 
ATOM   6134  C  CA    . GLY C  1 21  ? 0.252   -47.306 -45.951 1.00 22.40 ? 32  GLY C CA    1 
ATOM   6135  C  C     . GLY C  1 21  ? 0.481   -45.868 -45.528 1.00 24.83 ? 32  GLY C C     1 
ATOM   6136  O  O     . GLY C  1 21  ? -0.428  -45.238 -44.973 1.00 24.13 ? 32  GLY C O     1 
ATOM   6137  N  N     . HIS C  1 22  ? 1.690   -45.330 -45.760 1.00 19.54 ? 33  HIS C N     1 
ATOM   6138  C  CA    . HIS C  1 22  ? 1.954   -43.949 -45.359 1.00 18.11 ? 33  HIS C CA    1 
ATOM   6139  C  C     . HIS C  1 22  ? 1.215   -42.959 -46.280 1.00 20.69 ? 33  HIS C C     1 
ATOM   6140  O  O     . HIS C  1 22  ? 1.327   -43.072 -47.505 1.00 20.83 ? 33  HIS C O     1 
ATOM   6141  C  CB    . HIS C  1 22  ? 3.463   -43.639 -45.274 1.00 17.50 ? 33  HIS C CB    1 
ATOM   6142  C  CG    . HIS C  1 22  ? 3.744   -42.469 -44.383 1.00 19.47 ? 33  HIS C CG    1 
ATOM   6143  N  ND1   . HIS C  1 22  ? 3.429   -41.177 -44.777 1.00 19.87 ? 33  HIS C ND1   1 
ATOM   6144  C  CD2   . HIS C  1 22  ? 4.251   -42.436 -43.119 1.00 19.94 ? 33  HIS C CD2   1 
ATOM   6145  C  CE1   . HIS C  1 22  ? 3.769   -40.395 -43.764 1.00 19.16 ? 33  HIS C CE1   1 
ATOM   6146  N  NE2   . HIS C  1 22  ? 4.265   -41.102 -42.736 1.00 19.67 ? 33  HIS C NE2   1 
ATOM   6147  N  N     . PRO C  1 23  ? 0.455   -41.987 -45.715 1.00 17.61 ? 34  PRO C N     1 
ATOM   6148  C  CA    . PRO C  1 23  ? -0.285  -41.041 -46.580 1.00 15.87 ? 34  PRO C CA    1 
ATOM   6149  C  C     . PRO C  1 23  ? 0.570   -40.075 -47.371 1.00 18.47 ? 34  PRO C C     1 
ATOM   6150  O  O     . PRO C  1 23  ? 0.116   -39.590 -48.410 1.00 18.46 ? 34  PRO C O     1 
ATOM   6151  C  CB    . PRO C  1 23  ? -1.222  -40.302 -45.616 1.00 17.03 ? 34  PRO C CB    1 
ATOM   6152  C  CG    . PRO C  1 23  ? -0.647  -40.498 -44.272 1.00 21.67 ? 34  PRO C CG    1 
ATOM   6153  C  CD    . PRO C  1 23  ? 0.179   -41.750 -44.283 1.00 17.58 ? 34  PRO C CD    1 
ATOM   6154  N  N     . MET C  1 24  ? 1.805   -39.783 -46.891 1.00 14.41 ? 35  MET C N     1 
ATOM   6155  C  CA    . MET C  1 24  ? 2.672   -38.862 -47.604 1.00 12.77 ? 35  MET C CA    1 
ATOM   6156  C  C     . MET C  1 24  ? 3.239   -39.543 -48.855 1.00 17.85 ? 35  MET C C     1 
ATOM   6157  O  O     . MET C  1 24  ? 3.983   -40.522 -48.745 1.00 17.19 ? 35  MET C O     1 
ATOM   6158  C  CB    . MET C  1 24  ? 3.750   -38.250 -46.683 1.00 13.56 ? 35  MET C CB    1 
ATOM   6159  C  CG    . MET C  1 24  ? 4.706   -37.308 -47.414 1.00 15.28 ? 35  MET C CG    1 
ATOM   6160  S  SD    . MET C  1 24  ? 3.935   -35.923 -48.281 1.00 17.82 ? 35  MET C SD    1 
ATOM   6161  C  CE    . MET C  1 24  ? 4.143   -34.624 -47.023 1.00 15.29 ? 35  MET C CE    1 
ATOM   6162  N  N     . LYS C  1 25  ? 2.875   -39.009 -50.042 1.00 14.79 ? 36  LYS C N     1 
ATOM   6163  C  CA    . LYS C  1 25  ? 3.270   -39.579 -51.346 1.00 14.47 ? 36  LYS C CA    1 
ATOM   6164  C  C     . LYS C  1 25  ? 4.052   -38.595 -52.199 1.00 18.43 ? 36  LYS C C     1 
ATOM   6165  O  O     . LYS C  1 25  ? 3.433   -37.840 -52.952 1.00 17.72 ? 36  LYS C O     1 
ATOM   6166  C  CB    . LYS C  1 25  ? 2.030   -40.045 -52.167 1.00 15.98 ? 36  LYS C CB    1 
ATOM   6167  C  CG    . LYS C  1 25  ? 0.971   -40.848 -51.415 1.00 21.06 ? 36  LYS C CG    1 
ATOM   6168  C  CD    . LYS C  1 25  ? 1.324   -42.294 -51.295 1.00 30.33 ? 36  LYS C CD    1 
ATOM   6169  C  CE    . LYS C  1 25  ? 0.187   -43.105 -50.719 1.00 34.87 ? 36  LYS C CE    1 
ATOM   6170  N  NZ    . LYS C  1 25  ? 0.647   -44.470 -50.353 1.00 34.98 ? 36  LYS C NZ    1 
ATOM   6171  N  N     . PRO C  1 26  ? 5.402   -38.639 -52.208 1.00 15.74 ? 37  PRO C N     1 
ATOM   6172  C  CA    . PRO C  1 26  ? 6.159   -37.722 -53.084 1.00 15.24 ? 37  PRO C CA    1 
ATOM   6173  C  C     . PRO C  1 26  ? 5.774   -37.846 -54.559 1.00 17.25 ? 37  PRO C C     1 
ATOM   6174  O  O     . PRO C  1 26  ? 5.961   -36.897 -55.307 1.00 18.26 ? 37  PRO C O     1 
ATOM   6175  C  CB    . PRO C  1 26  ? 7.613   -38.124 -52.822 1.00 17.36 ? 37  PRO C CB    1 
ATOM   6176  C  CG    . PRO C  1 26  ? 7.577   -38.619 -51.384 1.00 21.61 ? 37  PRO C CG    1 
ATOM   6177  C  CD    . PRO C  1 26  ? 6.309   -39.431 -51.357 1.00 17.50 ? 37  PRO C CD    1 
ATOM   6178  N  N     . HIS C  1 27  ? 5.186   -38.984 -54.965 1.00 16.97 ? 38  HIS C N     1 
ATOM   6179  C  CA    . HIS C  1 27  ? 4.679   -39.215 -56.334 1.00 17.89 ? 38  HIS C CA    1 
ATOM   6180  C  C     . HIS C  1 27  ? 3.671   -38.121 -56.758 1.00 20.51 ? 38  HIS C C     1 
ATOM   6181  O  O     . HIS C  1 27  ? 3.614   -37.767 -57.943 1.00 20.86 ? 38  HIS C O     1 
ATOM   6182  C  CB    . HIS C  1 27  ? 4.041   -40.616 -56.438 1.00 19.80 ? 38  HIS C CB    1 
ATOM   6183  C  CG    . HIS C  1 27  ? 3.445   -40.923 -57.785 1.00 24.44 ? 38  HIS C CG    1 
ATOM   6184  N  ND1   . HIS C  1 27  ? 4.218   -40.938 -58.928 1.00 26.90 ? 38  HIS C ND1   1 
ATOM   6185  C  CD2   . HIS C  1 27  ? 2.171   -41.223 -58.116 1.00 26.98 ? 38  HIS C CD2   1 
ATOM   6186  C  CE1   . HIS C  1 27  ? 3.396   -41.240 -59.917 1.00 26.86 ? 38  HIS C CE1   1 
ATOM   6187  N  NE2   . HIS C  1 27  ? 2.154   -41.435 -59.477 1.00 27.07 ? 38  HIS C NE2   1 
ATOM   6188  N  N     . ARG C  1 28  ? 2.947   -37.519 -55.778 1.00 16.81 ? 39  ARG C N     1 
ATOM   6189  C  CA    . ARG C  1 28  ? 1.979   -36.440 -56.073 1.00 16.47 ? 39  ARG C CA    1 
ATOM   6190  C  C     . ARG C  1 28  ? 2.638   -35.217 -56.744 1.00 18.68 ? 39  ARG C C     1 
ATOM   6191  O  O     . ARG C  1 28  ? 1.978   -34.492 -57.479 1.00 17.83 ? 39  ARG C O     1 
ATOM   6192  C  CB    . ARG C  1 28  ? 1.198   -36.043 -54.801 1.00 16.64 ? 39  ARG C CB    1 
ATOM   6193  C  CG    . ARG C  1 28  ? 2.006   -35.159 -53.848 1.00 13.92 ? 39  ARG C CG    1 
ATOM   6194  C  CD    . ARG C  1 28  ? 1.665   -35.347 -52.385 1.00 14.59 ? 39  ARG C CD    1 
ATOM   6195  N  NE    . ARG C  1 28  ? 2.748   -34.732 -51.620 1.00 15.78 ? 39  ARG C NE    1 
ATOM   6196  C  CZ    . ARG C  1 28  ? 2.623   -33.698 -50.803 1.00 24.19 ? 39  ARG C CZ    1 
ATOM   6197  N  NH1   . ARG C  1 28  ? 1.413   -33.278 -50.425 1.00 12.60 ? 39  ARG C NH1   1 
ATOM   6198  N  NH2   . ARG C  1 28  ? 3.699   -33.139 -50.275 1.00 13.39 ? 39  ARG C NH2   1 
ATOM   6199  N  N     . ILE C  1 29  ? 3.942   -34.988 -56.482 1.00 12.97 ? 40  ILE C N     1 
ATOM   6200  C  CA    . ILE C  1 29  ? 4.684   -33.874 -57.087 1.00 12.07 ? 40  ILE C CA    1 
ATOM   6201  C  C     . ILE C  1 29  ? 4.935   -34.194 -58.574 1.00 17.27 ? 40  ILE C C     1 
ATOM   6202  O  O     . ILE C  1 29  ? 4.891   -33.289 -59.404 1.00 18.56 ? 40  ILE C O     1 
ATOM   6203  C  CB    . ILE C  1 29  ? 6.009   -33.623 -56.315 1.00 14.29 ? 40  ILE C CB    1 
ATOM   6204  C  CG1   A ILE C  1 29  ? 5.721   -33.359 -54.813 0.85 14.60 ? 40  ILE C CG1   1 
ATOM   6205  C  CG2   . ILE C  1 29  ? 6.813   -32.480 -56.953 1.00 15.76 ? 40  ILE C CG2   1 
ATOM   6206  C  CD1   A ILE C  1 29  ? 6.867   -33.856 -53.855 0.85 18.65 ? 40  ILE C CD1   1 
ATOM   6207  N  N     . ARG C  1 30  ? 5.211   -35.469 -58.903 1.00 15.82 ? 41  ARG C N     1 
ATOM   6208  C  CA    . ARG C  1 30  ? 5.445   -35.878 -60.310 1.00 15.56 ? 41  ARG C CA    1 
ATOM   6209  C  C     . ARG C  1 30  ? 4.129   -35.766 -61.113 1.00 20.07 ? 41  ARG C C     1 
ATOM   6210  O  O     . ARG C  1 30  ? 4.141   -35.335 -62.271 1.00 21.27 ? 41  ARG C O     1 
ATOM   6211  C  CB    . ARG C  1 30  ? 6.012   -37.310 -60.366 1.00 15.37 ? 41  ARG C CB    1 
ATOM   6212  C  CG    . ARG C  1 30  ? 6.105   -37.881 -61.816 1.00 23.32 ? 41  ARG C CG    1 
ATOM   6213  C  CD    . ARG C  1 30  ? 7.101   -39.023 -61.931 1.00 23.21 ? 41  ARG C CD    1 
ATOM   6214  N  NE    . ARG C  1 30  ? 6.785   -40.070 -60.968 1.00 29.55 ? 41  ARG C NE    1 
ATOM   6215  C  CZ    . ARG C  1 30  ? 7.663   -40.931 -60.472 1.00 42.35 ? 41  ARG C CZ    1 
ATOM   6216  N  NH1   . ARG C  1 30  ? 8.926   -40.916 -60.884 1.00 33.09 ? 41  ARG C NH1   1 
ATOM   6217  N  NH2   . ARG C  1 30  ? 7.285   -41.822 -59.571 1.00 27.99 ? 41  ARG C NH2   1 
ATOM   6218  N  N     . MET C  1 31  ? 3.004   -36.113 -60.466 1.00 17.09 ? 42  MET C N     1 
ATOM   6219  C  CA    . MET C  1 31  ? 1.642   -36.035 -61.029 1.00 17.20 ? 42  MET C CA    1 
ATOM   6220  C  C     . MET C  1 31  ? 1.329   -34.587 -61.360 1.00 23.36 ? 42  MET C C     1 
ATOM   6221  O  O     . MET C  1 31  ? 0.794   -34.301 -62.434 1.00 23.12 ? 42  MET C O     1 
ATOM   6222  C  CB    . MET C  1 31  ? 0.620   -36.563 -60.023 1.00 18.94 ? 42  MET C CB    1 
ATOM   6223  C  CG    . MET C  1 31  ? 0.611   -38.068 -59.880 1.00 21.28 ? 42  MET C CG    1 
ATOM   6224  S  SD    . MET C  1 31  ? -0.638  -38.592 -58.679 1.00 24.45 ? 42  MET C SD    1 
ATOM   6225  C  CE    . MET C  1 31  ? -2.208  -38.134 -59.581 1.00 21.00 ? 42  MET C CE    1 
ATOM   6226  N  N     . THR C  1 32  ? 1.696   -33.658 -60.436 1.00 18.22 ? 43  THR C N     1 
ATOM   6227  C  CA    . THR C  1 32  ? 1.510   -32.224 -60.620 1.00 17.06 ? 43  THR C CA    1 
ATOM   6228  C  C     . THR C  1 32  ? 2.344   -31.794 -61.818 1.00 20.06 ? 43  THR C C     1 
ATOM   6229  O  O     . THR C  1 32  ? 1.820   -31.136 -62.724 1.00 18.88 ? 43  THR C O     1 
ATOM   6230  C  CB    . THR C  1 32  ? 1.987   -31.452 -59.353 1.00 18.17 ? 43  THR C CB    1 
ATOM   6231  O  OG1   . THR C  1 32  ? 1.253   -31.894 -58.215 1.00 18.08 ? 43  THR C OG1   1 
ATOM   6232  C  CG2   . THR C  1 32  ? 1.877   -29.968 -59.521 1.00 15.18 ? 43  THR C CG2   1 
ATOM   6233  N  N     . HIS C  1 33  ? 3.651   -32.158 -61.815 1.00 16.63 ? 44  HIS C N     1 
ATOM   6234  C  CA    . HIS C  1 33  ? 4.572   -31.784 -62.887 1.00 16.68 ? 44  HIS C CA    1 
ATOM   6235  C  C     . HIS C  1 33  ? 4.060   -32.253 -64.268 1.00 22.13 ? 44  HIS C C     1 
ATOM   6236  O  O     . HIS C  1 33  ? 4.061   -31.483 -65.240 1.00 21.91 ? 44  HIS C O     1 
ATOM   6237  C  CB    . HIS C  1 33  ? 5.964   -32.378 -62.618 1.00 17.20 ? 44  HIS C CB    1 
ATOM   6238  C  CG    . HIS C  1 33  ? 6.990   -31.949 -63.608 1.00 20.86 ? 44  HIS C CG    1 
ATOM   6239  N  ND1   . HIS C  1 33  ? 7.457   -30.655 -63.635 1.00 22.95 ? 44  HIS C ND1   1 
ATOM   6240  C  CD2   . HIS C  1 33  ? 7.577   -32.652 -64.598 1.00 22.41 ? 44  HIS C CD2   1 
ATOM   6241  C  CE1   . HIS C  1 33  ? 8.338   -30.619 -64.618 1.00 22.76 ? 44  HIS C CE1   1 
ATOM   6242  N  NE2   . HIS C  1 33  ? 8.452   -31.803 -65.211 1.00 22.84 ? 44  HIS C NE2   1 
ATOM   6243  N  N     . ASN C  1 34  ? 3.627   -33.500 -64.333 1.00 18.26 ? 45  ASN C N     1 
ATOM   6244  C  CA    . ASN C  1 34  ? 3.166   -34.066 -65.586 1.00 18.81 ? 45  ASN C CA    1 
ATOM   6245  C  C     . ASN C  1 34  ? 1.880   -33.400 -66.084 1.00 23.03 ? 45  ASN C C     1 
ATOM   6246  O  O     . ASN C  1 34  ? 1.778   -33.095 -67.274 1.00 22.80 ? 45  ASN C O     1 
ATOM   6247  C  CB    . ASN C  1 34  ? 3.055   -35.582 -65.490 1.00 14.76 ? 45  ASN C CB    1 
ATOM   6248  C  CG    . ASN C  1 34  ? 2.674   -36.205 -66.811 1.00 34.27 ? 45  ASN C CG    1 
ATOM   6249  O  OD1   . ASN C  1 34  ? 1.540   -36.610 -67.000 1.00 24.75 ? 45  ASN C OD1   1 
ATOM   6250  N  ND2   . ASN C  1 34  ? 3.572   -36.189 -67.777 1.00 29.10 ? 45  ASN C ND2   1 
ATOM   6251  N  N     . LEU C  1 35  ? 0.940   -33.120 -65.173 1.00 20.27 ? 46  LEU C N     1 
ATOM   6252  C  CA    . LEU C  1 35  ? -0.313  -32.451 -65.530 1.00 21.50 ? 46  LEU C CA    1 
ATOM   6253  C  C     . LEU C  1 35  ? -0.016  -31.048 -66.075 1.00 27.71 ? 46  LEU C C     1 
ATOM   6254  O  O     . LEU C  1 35  ? -0.487  -30.715 -67.163 1.00 26.77 ? 46  LEU C O     1 
ATOM   6255  C  CB    . LEU C  1 35  ? -1.276  -32.427 -64.328 1.00 21.84 ? 46  LEU C CB    1 
ATOM   6256  C  CG    . LEU C  1 35  ? -2.710  -31.953 -64.583 1.00 27.16 ? 46  LEU C CG    1 
ATOM   6257  C  CD1   . LEU C  1 35  ? -3.391  -32.793 -65.692 1.00 27.35 ? 46  LEU C CD1   1 
ATOM   6258  C  CD2   . LEU C  1 35  ? -3.536  -31.992 -63.287 1.00 26.48 ? 46  LEU C CD2   1 
ATOM   6259  N  N     . LEU C  1 36  ? 0.859   -30.278 -65.391 1.00 26.07 ? 47  LEU C N     1 
ATOM   6260  C  CA    . LEU C  1 36  ? 1.230   -28.940 -65.858 1.00 27.02 ? 47  LEU C CA    1 
ATOM   6261  C  C     . LEU C  1 36  ? 2.032   -28.881 -67.166 1.00 29.99 ? 47  LEU C C     1 
ATOM   6262  O  O     . LEU C  1 36  ? 1.875   -27.916 -67.929 1.00 31.12 ? 47  LEU C O     1 
ATOM   6263  C  CB    . LEU C  1 36  ? 1.763   -28.012 -64.739 1.00 27.47 ? 47  LEU C CB    1 
ATOM   6264  C  CG    . LEU C  1 36  ? 3.075   -28.361 -64.067 1.00 32.53 ? 47  LEU C CG    1 
ATOM   6265  C  CD1   . LEU C  1 36  ? 4.250   -27.848 -64.873 1.00 34.11 ? 47  LEU C CD1   1 
ATOM   6266  C  CD2   . LEU C  1 36  ? 3.133   -27.764 -62.658 1.00 31.61 ? 47  LEU C CD2   1 
ATOM   6267  N  N     . LEU C  1 37  ? 2.848   -29.919 -67.458 1.00 25.16 ? 48  LEU C N     1 
ATOM   6268  C  CA    . LEU C  1 37  ? 3.567   -30.009 -68.741 1.00 24.06 ? 48  LEU C CA    1 
ATOM   6269  C  C     . LEU C  1 37  ? 2.535   -30.226 -69.868 1.00 25.62 ? 48  LEU C C     1 
ATOM   6270  O  O     . LEU C  1 37  ? 2.639   -29.605 -70.927 1.00 24.80 ? 48  LEU C O     1 
ATOM   6271  C  CB    . LEU C  1 37  ? 4.554   -31.187 -68.764 1.00 24.18 ? 48  LEU C CB    1 
ATOM   6272  C  CG    . LEU C  1 37  ? 5.828   -31.107 -67.923 1.00 29.49 ? 48  LEU C CG    1 
ATOM   6273  C  CD1   . LEU C  1 37  ? 6.666   -32.372 -68.112 1.00 29.44 ? 48  LEU C CD1   1 
ATOM   6274  C  CD2   . LEU C  1 37  ? 6.680   -29.890 -68.288 1.00 31.12 ? 48  LEU C CD2   1 
ATOM   6275  N  N     . ASN C  1 38  ? 1.544   -31.106 -69.619 1.00 21.66 ? 49  ASN C N     1 
ATOM   6276  C  CA    . ASN C  1 38  ? 0.469   -31.423 -70.573 1.00 22.22 ? 49  ASN C CA    1 
ATOM   6277  C  C     . ASN C  1 38  ? -0.504  -30.264 -70.853 1.00 25.83 ? 49  ASN C C     1 
ATOM   6278  O  O     . ASN C  1 38  ? -1.152  -30.244 -71.905 1.00 25.22 ? 49  ASN C O     1 
ATOM   6279  C  CB    . ASN C  1 38  ? -0.240  -32.703 -70.187 1.00 21.79 ? 49  ASN C CB    1 
ATOM   6280  C  CG    . ASN C  1 38  ? 0.569   -33.892 -70.628 1.00 35.60 ? 49  ASN C CG    1 
ATOM   6281  O  OD1   . ASN C  1 38  ? 0.722   -34.142 -71.821 1.00 26.95 ? 49  ASN C OD1   1 
ATOM   6282  N  ND2   . ASN C  1 38  ? 1.166   -34.610 -69.687 1.00 24.10 ? 49  ASN C ND2   1 
ATOM   6283  N  N     . TYR C  1 39  ? -0.591  -29.299 -69.918 1.00 21.06 ? 50  TYR C N     1 
ATOM   6284  C  CA    . TYR C  1 39  ? -1.390  -28.088 -70.074 1.00 20.16 ? 50  TYR C CA    1 
ATOM   6285  C  C     . TYR C  1 39  ? -0.572  -27.064 -70.871 1.00 24.39 ? 50  TYR C C     1 
ATOM   6286  O  O     . TYR C  1 39  ? -1.106  -26.038 -71.276 1.00 24.32 ? 50  TYR C O     1 
ATOM   6287  C  CB    . TYR C  1 39  ? -1.760  -27.510 -68.699 1.00 20.96 ? 50  TYR C CB    1 
ATOM   6288  C  CG    . TYR C  1 39  ? -3.150  -27.868 -68.229 1.00 20.11 ? 50  TYR C CG    1 
ATOM   6289  C  CD1   . TYR C  1 39  ? -4.279  -27.397 -68.899 1.00 20.70 ? 50  TYR C CD1   1 
ATOM   6290  C  CD2   . TYR C  1 39  ? -3.344  -28.610 -67.070 1.00 19.56 ? 50  TYR C CD2   1 
ATOM   6291  C  CE1   . TYR C  1 39  ? -5.564  -27.680 -68.437 1.00 18.40 ? 50  TYR C CE1   1 
ATOM   6292  C  CE2   . TYR C  1 39  ? -4.623  -28.891 -66.595 1.00 19.25 ? 50  TYR C CE2   1 
ATOM   6293  C  CZ    . TYR C  1 39  ? -5.731  -28.418 -67.278 1.00 20.77 ? 50  TYR C CZ    1 
ATOM   6294  O  OH    . TYR C  1 39  ? -6.992  -28.716 -66.824 1.00 20.78 ? 50  TYR C OH    1 
ATOM   6295  N  N     . GLY C  1 40  ? 0.720   -27.347 -71.061 1.00 20.48 ? 51  GLY C N     1 
ATOM   6296  C  CA    . GLY C  1 40  ? 1.643   -26.489 -71.797 1.00 21.51 ? 51  GLY C CA    1 
ATOM   6297  C  C     . GLY C  1 40  ? 2.195   -25.328 -70.996 1.00 28.06 ? 51  GLY C C     1 
ATOM   6298  O  O     . GLY C  1 40  ? 2.738   -24.385 -71.579 1.00 29.37 ? 51  GLY C O     1 
ATOM   6299  N  N     . LEU C  1 41  ? 2.106   -25.398 -69.650 1.00 25.52 ? 52  LEU C N     1 
ATOM   6300  C  CA    . LEU C  1 41  ? 2.588   -24.328 -68.767 1.00 25.86 ? 52  LEU C CA    1 
ATOM   6301  C  C     . LEU C  1 41  ? 4.109   -24.143 -68.783 1.00 30.53 ? 52  LEU C C     1 
ATOM   6302  O  O     . LEU C  1 41  ? 4.577   -23.045 -68.503 1.00 29.09 ? 52  LEU C O     1 
ATOM   6303  C  CB    . LEU C  1 41  ? 2.024   -24.442 -67.340 1.00 26.04 ? 52  LEU C CB    1 
ATOM   6304  C  CG    . LEU C  1 41  ? 0.489   -24.445 -67.200 1.00 31.25 ? 52  LEU C CG    1 
ATOM   6305  C  CD1   . LEU C  1 41  ? 0.068   -24.731 -65.771 1.00 31.56 ? 52  LEU C CD1   1 
ATOM   6306  C  CD2   . LEU C  1 41  ? -0.133  -23.133 -67.680 1.00 33.74 ? 52  LEU C CD2   1 
ATOM   6307  N  N     . TYR C  1 42  ? 4.862   -25.178 -69.224 1.00 29.34 ? 53  TYR C N     1 
ATOM   6308  C  CA    . TYR C  1 42  ? 6.324   -25.148 -69.374 1.00 30.31 ? 53  TYR C CA    1 
ATOM   6309  C  C     . TYR C  1 42  ? 6.778   -24.106 -70.414 1.00 35.27 ? 53  TYR C C     1 
ATOM   6310  O  O     . TYR C  1 42  ? 7.928   -23.673 -70.396 1.00 34.57 ? 53  TYR C O     1 
ATOM   6311  C  CB    . TYR C  1 42  ? 6.845   -26.546 -69.764 1.00 32.47 ? 53  TYR C CB    1 
ATOM   6312  C  CG    . TYR C  1 42  ? 6.472   -26.980 -71.167 1.00 35.62 ? 53  TYR C CG    1 
ATOM   6313  C  CD1   . TYR C  1 42  ? 7.325   -26.741 -72.243 1.00 37.85 ? 53  TYR C CD1   1 
ATOM   6314  C  CD2   . TYR C  1 42  ? 5.280   -27.656 -71.417 1.00 36.77 ? 53  TYR C CD2   1 
ATOM   6315  C  CE1   . TYR C  1 42  ? 6.994   -27.149 -73.534 1.00 38.80 ? 53  TYR C CE1   1 
ATOM   6316  C  CE2   . TYR C  1 42  ? 4.939   -28.070 -72.704 1.00 38.21 ? 53  TYR C CE2   1 
ATOM   6317  C  CZ    . TYR C  1 42  ? 5.801   -27.814 -73.759 1.00 47.25 ? 53  TYR C CZ    1 
ATOM   6318  O  OH    . TYR C  1 42  ? 5.470   -28.202 -75.036 1.00 51.77 ? 53  TYR C OH    1 
ATOM   6319  N  N     . ARG C  1 43  ? 5.885   -23.746 -71.347 1.00 33.54 ? 54  ARG C N     1 
ATOM   6320  C  CA    . ARG C  1 43  ? 6.170   -22.768 -72.394 1.00 33.82 ? 54  ARG C CA    1 
ATOM   6321  C  C     . ARG C  1 43  ? 6.254   -21.348 -71.839 1.00 37.52 ? 54  ARG C C     1 
ATOM   6322  O  O     . ARG C  1 43  ? 6.901   -20.492 -72.447 1.00 37.45 ? 54  ARG C O     1 
ATOM   6323  C  CB    . ARG C  1 43  ? 5.094   -22.839 -73.490 1.00 35.96 ? 54  ARG C CB    1 
ATOM   6324  C  CG    . ARG C  1 43  ? 5.610   -23.393 -74.813 1.00 49.41 ? 54  ARG C CG    1 
ATOM   6325  C  CD    . ARG C  1 43  ? 4.869   -24.640 -75.254 1.00 65.17 ? 54  ARG C CD    1 
ATOM   6326  N  NE    . ARG C  1 43  ? 3.448   -24.388 -75.511 1.00 76.28 ? 54  ARG C NE    1 
ATOM   6327  C  CZ    . ARG C  1 43  ? 2.567   -25.326 -75.843 1.00 91.40 ? 54  ARG C CZ    1 
ATOM   6328  N  NH1   . ARG C  1 43  ? 2.950   -26.591 -75.973 1.00 76.00 ? 54  ARG C NH1   1 
ATOM   6329  N  NH2   . ARG C  1 43  ? 1.296   -25.007 -76.050 1.00 79.50 ? 54  ARG C NH2   1 
ATOM   6330  N  N     . LYS C  1 44  ? 5.611   -21.109 -70.681 1.00 33.20 ? 55  LYS C N     1 
ATOM   6331  C  CA    . LYS C  1 44  ? 5.505   -19.795 -70.033 1.00 32.43 ? 55  LYS C CA    1 
ATOM   6332  C  C     . LYS C  1 44  ? 6.414   -19.584 -68.811 1.00 32.57 ? 55  LYS C C     1 
ATOM   6333  O  O     . LYS C  1 44  ? 6.465   -18.465 -68.296 1.00 31.91 ? 55  LYS C O     1 
ATOM   6334  C  CB    . LYS C  1 44  ? 4.030   -19.519 -69.663 1.00 35.73 ? 55  LYS C CB    1 
ATOM   6335  C  CG    . LYS C  1 44  ? 3.080   -19.526 -70.864 1.00 51.56 ? 55  LYS C CG    1 
ATOM   6336  C  CD    . LYS C  1 44  ? 1.613   -19.564 -70.458 1.00 62.85 ? 55  LYS C CD    1 
ATOM   6337  C  CE    . LYS C  1 44  ? 1.003   -18.184 -70.390 1.00 77.80 ? 55  LYS C CE    1 
ATOM   6338  N  NZ    . LYS C  1 44  ? -0.390  -18.174 -70.907 1.00 85.48 ? 55  LYS C NZ    1 
ATOM   6339  N  N     . MET C  1 45  ? 7.119   -20.631 -68.339 1.00 26.49 ? 56  MET C N     1 
ATOM   6340  C  CA    . MET C  1 45  ? 7.992   -20.482 -67.166 1.00 25.08 ? 56  MET C CA    1 
ATOM   6341  C  C     . MET C  1 45  ? 9.359   -21.144 -67.295 1.00 30.56 ? 56  MET C C     1 
ATOM   6342  O  O     . MET C  1 45  ? 9.506   -22.144 -68.010 1.00 30.89 ? 56  MET C O     1 
ATOM   6343  C  CB    . MET C  1 45  ? 7.276   -20.897 -65.854 1.00 26.30 ? 56  MET C CB    1 
ATOM   6344  C  CG    . MET C  1 45  ? 7.198   -22.381 -65.640 1.00 27.70 ? 56  MET C CG    1 
ATOM   6345  S  SD    . MET C  1 45  ? 6.072   -22.918 -64.323 1.00 28.45 ? 56  MET C SD    1 
ATOM   6346  C  CE    . MET C  1 45  ? 5.952   -24.579 -64.769 1.00 24.06 ? 56  MET C CE    1 
ATOM   6347  N  N     . GLU C  1 46  ? 10.356  -20.607 -66.565 1.00 26.10 ? 57  GLU C N     1 
ATOM   6348  C  CA    . GLU C  1 46  ? 11.683  -21.204 -66.567 1.00 26.06 ? 57  GLU C CA    1 
ATOM   6349  C  C     . GLU C  1 46  ? 11.699  -22.383 -65.586 1.00 28.78 ? 57  GLU C C     1 
ATOM   6350  O  O     . GLU C  1 46  ? 11.318  -22.227 -64.425 1.00 28.70 ? 57  GLU C O     1 
ATOM   6351  C  CB    . GLU C  1 46  ? 12.771  -20.156 -66.275 1.00 27.65 ? 57  GLU C CB    1 
ATOM   6352  C  CG    . GLU C  1 46  ? 12.860  -19.083 -67.358 1.00 33.97 ? 57  GLU C CG    1 
ATOM   6353  C  CD    . GLU C  1 46  ? 14.037  -18.127 -67.304 1.00 46.66 ? 57  GLU C CD    1 
ATOM   6354  O  OE1   . GLU C  1 46  ? 14.878  -18.248 -66.385 1.00 33.52 ? 57  GLU C OE1   1 
ATOM   6355  O  OE2   . GLU C  1 46  ? 14.097  -17.222 -68.167 1.00 43.09 ? 57  GLU C OE2   1 
ATOM   6356  N  N     . ILE C  1 47  ? 12.040  -23.576 -66.084 1.00 24.04 ? 58  ILE C N     1 
ATOM   6357  C  CA    . ILE C  1 47  ? 12.072  -24.801 -65.274 1.00 23.01 ? 58  ILE C CA    1 
ATOM   6358  C  C     . ILE C  1 47  ? 13.506  -25.144 -64.911 1.00 26.55 ? 58  ILE C C     1 
ATOM   6359  O  O     . ILE C  1 47  ? 14.354  -25.238 -65.803 1.00 26.74 ? 58  ILE C O     1 
ATOM   6360  C  CB    . ILE C  1 47  ? 11.321  -25.977 -65.954 1.00 26.18 ? 58  ILE C CB    1 
ATOM   6361  C  CG1   . ILE C  1 47  ? 9.808   -25.661 -66.088 1.00 26.78 ? 58  ILE C CG1   1 
ATOM   6362  C  CG2   . ILE C  1 47  ? 11.567  -27.307 -65.206 1.00 26.99 ? 58  ILE C CG2   1 
ATOM   6363  C  CD1   . ILE C  1 47  ? 8.933   -26.781 -66.676 1.00 34.42 ? 58  ILE C CD1   1 
ATOM   6364  N  N     . TYR C  1 48  ? 13.782  -25.325 -63.604 1.00 21.08 ? 59  TYR C N     1 
ATOM   6365  C  CA    . TYR C  1 48  ? 15.131  -25.645 -63.132 1.00 20.60 ? 59  TYR C CA    1 
ATOM   6366  C  C     . TYR C  1 48  ? 15.190  -26.895 -62.311 1.00 22.47 ? 59  TYR C C     1 
ATOM   6367  O  O     . TYR C  1 48  ? 14.306  -27.143 -61.488 1.00 22.24 ? 59  TYR C O     1 
ATOM   6368  C  CB    . TYR C  1 48  ? 15.698  -24.520 -62.268 1.00 21.39 ? 59  TYR C CB    1 
ATOM   6369  C  CG    . TYR C  1 48  ? 15.884  -23.198 -62.966 1.00 23.11 ? 59  TYR C CG    1 
ATOM   6370  C  CD1   . TYR C  1 48  ? 17.128  -22.827 -63.478 1.00 25.04 ? 59  TYR C CD1   1 
ATOM   6371  C  CD2   . TYR C  1 48  ? 14.849  -22.274 -63.033 1.00 23.83 ? 59  TYR C CD2   1 
ATOM   6372  C  CE1   . TYR C  1 48  ? 17.318  -21.588 -64.086 1.00 26.09 ? 59  TYR C CE1   1 
ATOM   6373  C  CE2   . TYR C  1 48  ? 15.028  -21.033 -63.632 1.00 25.28 ? 59  TYR C CE2   1 
ATOM   6374  C  CZ    . TYR C  1 48  ? 16.263  -20.696 -64.160 1.00 31.15 ? 59  TYR C CZ    1 
ATOM   6375  O  OH    . TYR C  1 48  ? 16.431  -19.466 -64.730 1.00 31.41 ? 59  TYR C OH    1 
ATOM   6376  N  N     . ARG C  1 49  ? 16.287  -27.645 -62.463 1.00 19.57 ? 60  ARG C N     1 
ATOM   6377  C  CA    . ARG C  1 49  ? 16.541  -28.820 -61.635 1.00 20.01 ? 60  ARG C CA    1 
ATOM   6378  C  C     . ARG C  1 49  ? 17.343  -28.261 -60.462 1.00 26.69 ? 60  ARG C C     1 
ATOM   6379  O  O     . ARG C  1 49  ? 18.409  -27.672 -60.687 1.00 27.66 ? 60  ARG C O     1 
ATOM   6380  C  CB    . ARG C  1 49  ? 17.332  -29.898 -62.394 1.00 19.87 ? 60  ARG C CB    1 
ATOM   6381  C  CG    . ARG C  1 49  ? 17.447  -31.200 -61.613 1.00 26.97 ? 60  ARG C CG    1 
ATOM   6382  C  CD    . ARG C  1 49  ? 18.264  -32.227 -62.368 1.00 37.15 ? 60  ARG C CD    1 
ATOM   6383  N  NE    . ARG C  1 49  ? 18.634  -33.354 -61.514 1.00 53.37 ? 60  ARG C NE    1 
ATOM   6384  C  CZ    . ARG C  1 49  ? 19.302  -34.428 -61.927 1.00 73.41 ? 60  ARG C CZ    1 
ATOM   6385  N  NH1   . ARG C  1 49  ? 19.666  -34.543 -63.199 1.00 62.88 ? 60  ARG C NH1   1 
ATOM   6386  N  NH2   . ARG C  1 49  ? 19.604  -35.397 -61.074 1.00 60.89 ? 60  ARG C NH2   1 
ATOM   6387  N  N     . PRO C  1 50  ? 16.819  -28.310 -59.221 1.00 23.54 ? 61  PRO C N     1 
ATOM   6388  C  CA    . PRO C  1 50  ? 17.571  -27.701 -58.108 1.00 22.98 ? 61  PRO C CA    1 
ATOM   6389  C  C     . PRO C  1 50  ? 18.777  -28.526 -57.666 1.00 26.48 ? 61  PRO C C     1 
ATOM   6390  O  O     . PRO C  1 50  ? 18.756  -29.750 -57.760 1.00 24.38 ? 61  PRO C O     1 
ATOM   6391  C  CB    . PRO C  1 50  ? 16.525  -27.623 -56.994 1.00 24.07 ? 61  PRO C CB    1 
ATOM   6392  C  CG    . PRO C  1 50  ? 15.638  -28.826 -57.236 1.00 27.86 ? 61  PRO C CG    1 
ATOM   6393  C  CD    . PRO C  1 50  ? 15.562  -28.938 -58.751 1.00 23.60 ? 61  PRO C CD    1 
ATOM   6394  N  N     . HIS C  1 51  ? 19.805  -27.849 -57.140 1.00 26.37 ? 62  HIS C N     1 
ATOM   6395  C  CA    . HIS C  1 51  ? 20.987  -28.489 -56.546 1.00 27.52 ? 62  HIS C CA    1 
ATOM   6396  C  C     . HIS C  1 51  ? 20.485  -29.201 -55.271 1.00 28.23 ? 62  HIS C C     1 
ATOM   6397  O  O     . HIS C  1 51  ? 19.509  -28.751 -54.668 1.00 27.86 ? 62  HIS C O     1 
ATOM   6398  C  CB    . HIS C  1 51  ? 21.986  -27.383 -56.110 1.00 30.64 ? 62  HIS C CB    1 
ATOM   6399  C  CG    . HIS C  1 51  ? 21.415  -26.443 -55.070 1.00 36.17 ? 62  HIS C CG    1 
ATOM   6400  N  ND1   . HIS C  1 51  ? 20.310  -25.636 -55.347 1.00 38.70 ? 62  HIS C ND1   1 
ATOM   6401  C  CD2   . HIS C  1 51  ? 21.733  -26.300 -53.759 1.00 39.23 ? 62  HIS C CD2   1 
ATOM   6402  C  CE1   . HIS C  1 51  ? 20.026  -25.001 -54.216 1.00 38.44 ? 62  HIS C CE1   1 
ATOM   6403  N  NE2   . HIS C  1 51  ? 20.853  -25.359 -53.233 1.00 39.02 ? 62  HIS C NE2   1 
ATOM   6404  N  N     . LYS C  1 52  ? 21.140  -30.281 -54.850 1.00 22.38 ? 63  LYS C N     1 
ATOM   6405  C  CA    . LYS C  1 52  ? 20.805  -30.932 -53.584 1.00 20.74 ? 63  LYS C CA    1 
ATOM   6406  C  C     . LYS C  1 52  ? 21.364  -30.015 -52.473 1.00 23.56 ? 63  LYS C C     1 
ATOM   6407  O  O     . LYS C  1 52  ? 22.545  -29.654 -52.532 1.00 22.75 ? 63  LYS C O     1 
ATOM   6408  C  CB    . LYS C  1 52  ? 21.490  -32.301 -53.510 1.00 21.75 ? 63  LYS C CB    1 
ATOM   6409  C  CG    . LYS C  1 52  ? 20.727  -33.395 -54.217 1.00 24.82 ? 63  LYS C CG    1 
ATOM   6410  C  CD    . LYS C  1 52  ? 21.413  -34.757 -54.049 1.00 33.66 ? 63  LYS C CD    1 
ATOM   6411  C  CE    . LYS C  1 52  ? 20.578  -35.871 -54.649 1.00 49.35 ? 63  LYS C CE    1 
ATOM   6412  N  NZ    . LYS C  1 52  ? 20.528  -35.813 -56.141 1.00 60.04 ? 63  LYS C NZ    1 
ATOM   6413  N  N     . ALA C  1 53  ? 20.532  -29.592 -51.491 1.00 18.74 ? 64  ALA C N     1 
ATOM   6414  C  CA    . ALA C  1 53  ? 21.045  -28.751 -50.399 1.00 17.69 ? 64  ALA C CA    1 
ATOM   6415  C  C     . ALA C  1 53  ? 22.089  -29.552 -49.617 1.00 18.27 ? 64  ALA C C     1 
ATOM   6416  O  O     . ALA C  1 53  ? 21.864  -30.728 -49.378 1.00 15.91 ? 64  ALA C O     1 
ATOM   6417  C  CB    . ALA C  1 53  ? 19.903  -28.338 -49.465 1.00 18.41 ? 64  ALA C CB    1 
ATOM   6418  N  N     . THR C  1 54  ? 23.241  -28.951 -49.252 1.00 13.96 ? 65  THR C N     1 
ATOM   6419  C  CA    . THR C  1 54  ? 24.243  -29.726 -48.518 1.00 12.85 ? 65  THR C CA    1 
ATOM   6420  C  C     . THR C  1 54  ? 23.855  -29.887 -47.044 1.00 15.70 ? 65  THR C C     1 
ATOM   6421  O  O     . THR C  1 54  ? 23.069  -29.098 -46.527 1.00 13.43 ? 65  THR C O     1 
ATOM   6422  C  CB    . THR C  1 54  ? 25.636  -29.063 -48.590 1.00 17.39 ? 65  THR C CB    1 
ATOM   6423  O  OG1   . THR C  1 54  ? 25.580  -27.827 -47.892 1.00 15.22 ? 65  THR C OG1   1 
ATOM   6424  C  CG2   . THR C  1 54  ? 26.132  -28.825 -50.032 1.00 19.12 ? 65  THR C CG2   1 
ATOM   6425  N  N     . ALA C  1 55  ? 24.482  -30.857 -46.353 1.00 14.15 ? 66  ALA C N     1 
ATOM   6426  C  CA    . ALA C  1 55  ? 24.320  -31.078 -44.931 1.00 14.87 ? 66  ALA C CA    1 
ATOM   6427  C  C     . ALA C  1 55  ? 24.732  -29.790 -44.202 1.00 17.96 ? 66  ALA C C     1 
ATOM   6428  O  O     . ALA C  1 55  ? 24.040  -29.373 -43.270 1.00 15.61 ? 66  ALA C O     1 
ATOM   6429  C  CB    . ALA C  1 55  ? 25.189  -32.243 -44.492 1.00 16.67 ? 66  ALA C CB    1 
ATOM   6430  N  N     . GLU C  1 56  ? 25.817  -29.120 -44.685 1.00 15.40 ? 67  GLU C N     1 
ATOM   6431  C  CA    . GLU C  1 56  ? 26.320  -27.863 -44.106 1.00 15.44 ? 67  GLU C CA    1 
ATOM   6432  C  C     . GLU C  1 56  ? 25.246  -26.782 -44.169 1.00 18.57 ? 67  GLU C C     1 
ATOM   6433  O  O     . GLU C  1 56  ? 24.950  -26.159 -43.145 1.00 18.25 ? 67  GLU C O     1 
ATOM   6434  C  CB    . GLU C  1 56  ? 27.625  -27.400 -44.795 1.00 16.52 ? 67  GLU C CB    1 
ATOM   6435  C  CG    . GLU C  1 56  ? 28.824  -28.299 -44.482 1.00 20.41 ? 67  GLU C CG    1 
ATOM   6436  C  CD    . GLU C  1 56  ? 28.858  -29.665 -45.142 1.00 34.15 ? 67  GLU C CD    1 
ATOM   6437  O  OE1   . GLU C  1 56  ? 29.575  -30.553 -44.628 1.00 36.17 ? 67  GLU C OE1   1 
ATOM   6438  O  OE2   . GLU C  1 56  ? 28.138  -29.867 -46.146 1.00 20.74 ? 67  GLU C OE2   1 
ATOM   6439  N  N     . GLU C  1 57  ? 24.600  -26.634 -45.336 1.00 15.80 ? 68  GLU C N     1 
ATOM   6440  C  CA    . GLU C  1 57  ? 23.494  -25.685 -45.559 1.00 15.36 ? 68  GLU C CA    1 
ATOM   6441  C  C     . GLU C  1 57  ? 22.365  -25.923 -44.550 1.00 17.73 ? 68  GLU C C     1 
ATOM   6442  O  O     . GLU C  1 57  ? 21.850  -24.966 -43.965 1.00 17.01 ? 68  GLU C O     1 
ATOM   6443  C  CB    . GLU C  1 57  ? 22.964  -25.810 -47.006 1.00 17.00 ? 68  GLU C CB    1 
ATOM   6444  C  CG    . GLU C  1 57  ? 21.720  -24.982 -47.333 1.00 26.64 ? 68  GLU C CG    1 
ATOM   6445  C  CD    . GLU C  1 57  ? 21.875  -23.470 -47.357 1.00 42.58 ? 68  GLU C CD    1 
ATOM   6446  O  OE1   . GLU C  1 57  ? 23.014  -22.980 -47.531 1.00 32.99 ? 68  GLU C OE1   1 
ATOM   6447  O  OE2   . GLU C  1 57  ? 20.849  -22.774 -47.198 1.00 34.65 ? 68  GLU C OE2   1 
ATOM   6448  N  N     . MET C  1 58  ? 22.008  -27.201 -44.318 1.00 11.52 ? 69  MET C N     1 
ATOM   6449  C  CA    . MET C  1 58  ? 20.933  -27.559 -43.387 1.00 10.42 ? 69  MET C CA    1 
ATOM   6450  C  C     . MET C  1 58  ? 21.263  -27.135 -41.949 1.00 13.62 ? 69  MET C C     1 
ATOM   6451  O  O     . MET C  1 58  ? 20.344  -26.753 -41.212 1.00 13.42 ? 69  MET C O     1 
ATOM   6452  C  CB    . MET C  1 58  ? 20.648  -29.061 -43.448 1.00 11.64 ? 69  MET C CB    1 
ATOM   6453  C  CG    . MET C  1 58  ? 20.099  -29.515 -44.798 1.00 14.08 ? 69  MET C CG    1 
ATOM   6454  S  SD    . MET C  1 58  ? 19.904  -31.292 -44.771 1.00 16.94 ? 69  MET C SD    1 
ATOM   6455  C  CE    . MET C  1 58  ? 19.377  -31.561 -46.450 1.00 13.52 ? 69  MET C CE    1 
ATOM   6456  N  N     . THR C  1 59  ? 22.568  -27.168 -41.572 1.00 11.09 ? 70  THR C N     1 
ATOM   6457  C  CA    . THR C  1 59  ? 23.048  -26.740 -40.244 1.00 10.13 ? 70  THR C CA    1 
ATOM   6458  C  C     . THR C  1 59  ? 23.000  -25.227 -40.014 1.00 14.84 ? 70  THR C C     1 
ATOM   6459  O  O     . THR C  1 59  ? 23.322  -24.772 -38.913 1.00 13.88 ? 70  THR C O     1 
ATOM   6460  C  CB    . THR C  1 59  ? 24.397  -27.373 -39.841 1.00 12.38 ? 70  THR C CB    1 
ATOM   6461  O  OG1   . THR C  1 59  ? 25.416  -26.895 -40.707 1.00 10.88 ? 70  THR C OG1   1 
ATOM   6462  C  CG2   . THR C  1 59  ? 24.354  -28.879 -39.831 1.00 7.52  ? 70  THR C CG2   1 
ATOM   6463  N  N     . LYS C  1 60  ? 22.567  -24.438 -41.021 1.00 11.66 ? 71  LYS C N     1 
ATOM   6464  C  CA    . LYS C  1 60  ? 22.348  -23.004 -40.761 1.00 11.90 ? 71  LYS C CA    1 
ATOM   6465  C  C     . LYS C  1 60  ? 21.183  -22.889 -39.751 1.00 14.85 ? 71  LYS C C     1 
ATOM   6466  O  O     . LYS C  1 60  ? 21.090  -21.902 -39.018 1.00 14.75 ? 71  LYS C O     1 
ATOM   6467  C  CB    . LYS C  1 60  ? 21.995  -22.240 -42.044 1.00 12.27 ? 71  LYS C CB    1 
ATOM   6468  C  CG    . LYS C  1 60  ? 23.184  -22.124 -42.995 1.00 13.76 ? 71  LYS C CG    1 
ATOM   6469  C  CD    . LYS C  1 60  ? 22.882  -21.183 -44.132 1.00 18.22 ? 71  LYS C CD    1 
ATOM   6470  C  CE    . LYS C  1 60  ? 24.018  -21.080 -45.125 1.00 19.28 ? 71  LYS C CE    1 
ATOM   6471  N  NZ    . LYS C  1 60  ? 23.509  -20.575 -46.436 1.00 17.24 ? 71  LYS C NZ    1 
ATOM   6472  N  N     . TYR C  1 61  ? 20.302  -23.909 -39.722 1.00 11.44 ? 72  TYR C N     1 
ATOM   6473  C  CA    . TYR C  1 61  ? 19.174  -23.939 -38.788 1.00 11.43 ? 72  TYR C CA    1 
ATOM   6474  C  C     . TYR C  1 61  ? 19.210  -25.170 -37.885 1.00 13.83 ? 72  TYR C C     1 
ATOM   6475  O  O     . TYR C  1 61  ? 19.186  -25.048 -36.659 1.00 12.36 ? 72  TYR C O     1 
ATOM   6476  C  CB    . TYR C  1 61  ? 17.807  -23.862 -39.523 1.00 12.75 ? 72  TYR C CB    1 
ATOM   6477  C  CG    . TYR C  1 61  ? 16.664  -23.745 -38.536 1.00 14.37 ? 72  TYR C CG    1 
ATOM   6478  C  CD1   . TYR C  1 61  ? 15.716  -24.760 -38.409 1.00 16.65 ? 72  TYR C CD1   1 
ATOM   6479  C  CD2   . TYR C  1 61  ? 16.580  -22.660 -37.667 1.00 15.41 ? 72  TYR C CD2   1 
ATOM   6480  C  CE1   . TYR C  1 61  ? 14.686  -24.670 -37.466 1.00 16.81 ? 72  TYR C CE1   1 
ATOM   6481  C  CE2   . TYR C  1 61  ? 15.551  -22.551 -36.738 1.00 15.91 ? 72  TYR C CE2   1 
ATOM   6482  C  CZ    . TYR C  1 61  ? 14.613  -23.559 -36.635 1.00 20.95 ? 72  TYR C CZ    1 
ATOM   6483  O  OH    . TYR C  1 61  ? 13.637  -23.428 -35.685 1.00 22.51 ? 72  TYR C OH    1 
ATOM   6484  N  N     . HIS C  1 62  ? 19.235  -26.363 -38.501 1.00 10.73 ? 73  HIS C N     1 
ATOM   6485  C  CA    . HIS C  1 62  ? 19.204  -27.606 -37.748 1.00 9.77  ? 73  HIS C CA    1 
ATOM   6486  C  C     . HIS C  1 62  ? 20.511  -27.883 -37.007 1.00 13.33 ? 73  HIS C C     1 
ATOM   6487  O  O     . HIS C  1 62  ? 21.578  -27.431 -37.435 1.00 13.37 ? 73  HIS C O     1 
ATOM   6488  C  CB    . HIS C  1 62  ? 18.821  -28.773 -38.673 1.00 9.21  ? 73  HIS C CB    1 
ATOM   6489  C  CG    . HIS C  1 62  ? 17.449  -28.634 -39.257 1.00 11.82 ? 73  HIS C CG    1 
ATOM   6490  N  ND1   . HIS C  1 62  ? 16.322  -28.884 -38.502 1.00 13.66 ? 73  HIS C ND1   1 
ATOM   6491  C  CD2   . HIS C  1 62  ? 17.067  -28.233 -40.494 1.00 13.30 ? 73  HIS C CD2   1 
ATOM   6492  C  CE1   . HIS C  1 62  ? 15.291  -28.676 -39.312 1.00 13.38 ? 73  HIS C CE1   1 
ATOM   6493  N  NE2   . HIS C  1 62  ? 15.687  -28.263 -40.512 1.00 13.50 ? 73  HIS C NE2   1 
ATOM   6494  N  N     . SER C  1 63  ? 20.415  -28.638 -35.900 1.00 10.06 ? 74  SER C N     1 
ATOM   6495  C  CA    . SER C  1 63  ? 21.580  -29.009 -35.096 1.00 10.55 ? 74  SER C CA    1 
ATOM   6496  C  C     . SER C  1 63  ? 22.418  -30.008 -35.899 1.00 14.24 ? 74  SER C C     1 
ATOM   6497  O  O     . SER C  1 63  ? 21.877  -30.723 -36.758 1.00 11.77 ? 74  SER C O     1 
ATOM   6498  C  CB    . SER C  1 63  ? 21.148  -29.605 -33.761 1.00 12.11 ? 74  SER C CB    1 
ATOM   6499  O  OG    . SER C  1 63  ? 20.711  -30.954 -33.869 1.00 13.51 ? 74  SER C OG    1 
ATOM   6500  N  N     . ASP C  1 64  ? 23.738  -30.018 -35.657 1.00 11.39 ? 75  ASP C N     1 
ATOM   6501  C  CA    . ASP C  1 64  ? 24.669  -30.932 -36.322 1.00 10.51 ? 75  ASP C CA    1 
ATOM   6502  C  C     . ASP C  1 64  ? 24.325  -32.381 -36.019 1.00 13.37 ? 75  ASP C C     1 
ATOM   6503  O  O     . ASP C  1 64  ? 24.336  -33.184 -36.934 1.00 14.32 ? 75  ASP C O     1 
ATOM   6504  C  CB    . ASP C  1 64  ? 26.110  -30.657 -35.886 1.00 11.20 ? 75  ASP C CB    1 
ATOM   6505  C  CG    . ASP C  1 64  ? 26.564  -29.262 -36.250 1.00 13.98 ? 75  ASP C CG    1 
ATOM   6506  O  OD1   . ASP C  1 64  ? 27.471  -29.138 -37.095 1.00 12.99 ? 75  ASP C OD1   1 
ATOM   6507  O  OD2   . ASP C  1 64  ? 25.997  -28.290 -35.692 1.00 15.36 ? 75  ASP C OD2   1 
ATOM   6508  N  N     . GLU C  1 65  ? 24.003  -32.708 -34.752 1.00 10.56 ? 76  GLU C N     1 
ATOM   6509  C  CA    . GLU C  1 65  ? 23.680  -34.083 -34.346 1.00 11.71 ? 76  GLU C CA    1 
ATOM   6510  C  C     . GLU C  1 65  ? 22.431  -34.573 -35.072 1.00 14.31 ? 76  GLU C C     1 
ATOM   6511  O  O     . GLU C  1 65  ? 22.383  -35.723 -35.497 1.00 12.34 ? 76  GLU C O     1 
ATOM   6512  C  CB    . GLU C  1 65  ? 23.470  -34.167 -32.828 1.00 13.84 ? 76  GLU C CB    1 
ATOM   6513  C  CG    . GLU C  1 65  ? 24.756  -34.100 -32.008 1.00 26.63 ? 76  GLU C CG    1 
ATOM   6514  C  CD    . GLU C  1 65  ? 25.756  -35.218 -32.243 1.00 45.66 ? 76  GLU C CD    1 
ATOM   6515  O  OE1   . GLU C  1 65  ? 26.921  -34.899 -32.571 1.00 38.00 ? 76  GLU C OE1   1 
ATOM   6516  O  OE2   . GLU C  1 65  ? 25.375  -36.406 -32.134 1.00 43.73 ? 76  GLU C OE2   1 
ATOM   6517  N  N     . TYR C  1 66  ? 21.428  -33.676 -35.262 1.00 10.83 ? 77  TYR C N     1 
ATOM   6518  C  CA    . TYR C  1 66  ? 20.201  -34.064 -35.955 1.00 10.81 ? 77  TYR C CA    1 
ATOM   6519  C  C     . TYR C  1 66  ? 20.456  -34.319 -37.445 1.00 14.25 ? 77  TYR C C     1 
ATOM   6520  O  O     . TYR C  1 66  ? 19.998  -35.338 -37.987 1.00 13.08 ? 77  TYR C O     1 
ATOM   6521  C  CB    . TYR C  1 66  ? 19.098  -33.017 -35.727 1.00 11.66 ? 77  TYR C CB    1 
ATOM   6522  C  CG    . TYR C  1 66  ? 17.825  -33.287 -36.495 1.00 11.19 ? 77  TYR C CG    1 
ATOM   6523  C  CD1   . TYR C  1 66  ? 17.151  -34.501 -36.365 1.00 12.92 ? 77  TYR C CD1   1 
ATOM   6524  C  CD2   . TYR C  1 66  ? 17.294  -32.333 -37.358 1.00 10.81 ? 77  TYR C CD2   1 
ATOM   6525  C  CE1   . TYR C  1 66  ? 15.990  -34.762 -37.092 1.00 12.92 ? 77  TYR C CE1   1 
ATOM   6526  C  CE2   . TYR C  1 66  ? 16.119  -32.573 -38.068 1.00 11.40 ? 77  TYR C CE2   1 
ATOM   6527  C  CZ    . TYR C  1 66  ? 15.456  -33.782 -37.910 1.00 16.12 ? 77  TYR C CZ    1 
ATOM   6528  O  OH    . TYR C  1 66  ? 14.308  -34.036 -38.624 1.00 14.22 ? 77  TYR C OH    1 
ATOM   6529  N  N     . ILE C  1 67  ? 21.226  -33.428 -38.101 1.00 10.32 ? 78  ILE C N     1 
ATOM   6530  C  CA    . ILE C  1 67  ? 21.540  -33.608 -39.529 1.00 9.60  ? 78  ILE C CA    1 
ATOM   6531  C  C     . ILE C  1 67  ? 22.430  -34.845 -39.734 1.00 14.65 ? 78  ILE C C     1 
ATOM   6532  O  O     . ILE C  1 67  ? 22.229  -35.595 -40.702 1.00 14.75 ? 78  ILE C O     1 
ATOM   6533  C  CB    . ILE C  1 67  ? 22.127  -32.312 -40.156 1.00 11.88 ? 78  ILE C CB    1 
ATOM   6534  C  CG1   . ILE C  1 67  ? 21.070  -31.181 -40.119 1.00 11.31 ? 78  ILE C CG1   1 
ATOM   6535  C  CG2   . ILE C  1 67  ? 22.660  -32.545 -41.614 1.00 13.69 ? 78  ILE C CG2   1 
ATOM   6536  C  CD1   . ILE C  1 67  ? 19.657  -31.553 -40.793 1.00 9.83  ? 78  ILE C CD1   1 
ATOM   6537  N  N     . LYS C  1 68  ? 23.394  -35.064 -38.820 1.00 12.43 ? 79  LYS C N     1 
ATOM   6538  C  CA    . LYS C  1 68  ? 24.295  -36.247 -38.906 1.00 12.25 ? 79  LYS C CA    1 
ATOM   6539  C  C     . LYS C  1 68  ? 23.454  -37.534 -38.825 1.00 15.08 ? 79  LYS C C     1 
ATOM   6540  O  O     . LYS C  1 68  ? 23.690  -38.484 -39.585 1.00 14.52 ? 79  LYS C O     1 
ATOM   6541  C  CB    . LYS C  1 68  ? 25.368  -36.219 -37.788 1.00 15.61 ? 79  LYS C CB    1 
ATOM   6542  C  CG    . LYS C  1 68  ? 26.342  -37.409 -37.860 1.00 28.54 ? 79  LYS C CG    1 
ATOM   6543  C  CD    . LYS C  1 68  ? 27.501  -37.270 -36.865 1.00 44.22 ? 79  LYS C CD    1 
ATOM   6544  C  CE    . LYS C  1 68  ? 28.092  -38.607 -36.457 1.00 54.82 ? 79  LYS C CE    1 
ATOM   6545  N  NZ    . LYS C  1 68  ? 28.713  -39.327 -37.604 1.00 62.05 ? 79  LYS C NZ    1 
ATOM   6546  N  N     . PHE C  1 69  ? 22.466  -37.552 -37.910 1.00 12.27 ? 80  PHE C N     1 
ATOM   6547  C  CA    . PHE C  1 69  ? 21.545  -38.679 -37.753 1.00 11.46 ? 80  PHE C CA    1 
ATOM   6548  C  C     . PHE C  1 69  ? 20.771  -38.912 -39.059 1.00 15.22 ? 80  PHE C C     1 
ATOM   6549  O  O     . PHE C  1 69  ? 20.713  -40.040 -39.539 1.00 15.15 ? 80  PHE C O     1 
ATOM   6550  C  CB    . PHE C  1 69  ? 20.553  -38.402 -36.598 1.00 13.55 ? 80  PHE C CB    1 
ATOM   6551  C  CG    . PHE C  1 69  ? 19.371  -39.354 -36.543 1.00 16.02 ? 80  PHE C CG    1 
ATOM   6552  C  CD1   . PHE C  1 69  ? 18.117  -38.959 -36.992 1.00 17.97 ? 80  PHE C CD1   1 
ATOM   6553  C  CD2   . PHE C  1 69  ? 19.522  -40.649 -36.064 1.00 18.44 ? 80  PHE C CD2   1 
ATOM   6554  C  CE1   . PHE C  1 69  ? 17.038  -39.844 -36.960 1.00 18.90 ? 80  PHE C CE1   1 
ATOM   6555  C  CE2   . PHE C  1 69  ? 18.436  -41.529 -36.018 1.00 19.94 ? 80  PHE C CE2   1 
ATOM   6556  C  CZ    . PHE C  1 69  ? 17.204  -41.120 -36.470 1.00 17.84 ? 80  PHE C CZ    1 
ATOM   6557  N  N     . LEU C  1 70  ? 20.165  -37.847 -39.628 1.00 12.42 ? 81  LEU C N     1 
ATOM   6558  C  CA    . LEU C  1 70  ? 19.386  -37.936 -40.875 1.00 11.94 ? 81  LEU C CA    1 
ATOM   6559  C  C     . LEU C  1 70  ? 20.226  -38.486 -42.008 1.00 16.38 ? 81  LEU C C     1 
ATOM   6560  O  O     . LEU C  1 70  ? 19.728  -39.266 -42.817 1.00 15.24 ? 81  LEU C O     1 
ATOM   6561  C  CB    . LEU C  1 70  ? 18.801  -36.559 -41.267 1.00 11.13 ? 81  LEU C CB    1 
ATOM   6562  C  CG    . LEU C  1 70  ? 17.631  -35.994 -40.415 1.00 14.45 ? 81  LEU C CG    1 
ATOM   6563  C  CD1   . LEU C  1 70  ? 17.130  -34.713 -41.013 1.00 13.72 ? 81  LEU C CD1   1 
ATOM   6564  C  CD2   . LEU C  1 70  ? 16.422  -36.966 -40.345 1.00 14.25 ? 81  LEU C CD2   1 
ATOM   6565  N  N     . ARG C  1 71  ? 21.512  -38.088 -42.050 1.00 13.30 ? 82  ARG C N     1 
ATOM   6566  C  CA    A ARG C  1 71  ? 22.478  -38.528 -43.056 0.51 13.69 ? 82  ARG C CA    1 
ATOM   6567  C  CA    B ARG C  1 71  ? 22.454  -38.535 -43.075 0.49 13.20 ? 82  ARG C CA    1 
ATOM   6568  C  C     . ARG C  1 71  ? 22.878  -39.996 -42.848 1.00 17.83 ? 82  ARG C C     1 
ATOM   6569  O  O     . ARG C  1 71  ? 23.260  -40.675 -43.799 1.00 18.58 ? 82  ARG C O     1 
ATOM   6570  C  CB    A ARG C  1 71  ? 23.730  -37.656 -42.922 0.51 15.07 ? 82  ARG C CB    1 
ATOM   6571  C  CB    B ARG C  1 71  ? 23.677  -37.575 -43.121 0.49 12.48 ? 82  ARG C CB    1 
ATOM   6572  C  CG    A ARG C  1 71  ? 24.399  -37.311 -44.226 0.51 29.31 ? 82  ARG C CG    1 
ATOM   6573  C  CG    B ARG C  1 71  ? 24.935  -38.067 -43.861 0.49 19.17 ? 82  ARG C CG    1 
ATOM   6574  C  CD    A ARG C  1 71  ? 25.435  -36.249 -43.964 0.51 33.11 ? 82  ARG C CD    1 
ATOM   6575  C  CD    B ARG C  1 71  ? 24.836  -38.002 -45.377 0.49 20.19 ? 82  ARG C CD    1 
ATOM   6576  N  NE    A ARG C  1 71  ? 26.423  -36.184 -45.035 0.51 37.92 ? 82  ARG C NE    1 
ATOM   6577  N  NE    B ARG C  1 71  ? 24.003  -39.076 -45.928 0.49 23.34 ? 82  ARG C NE    1 
ATOM   6578  C  CZ    A ARG C  1 71  ? 27.512  -35.427 -45.002 0.51 50.74 ? 82  ARG C CZ    1 
ATOM   6579  C  CZ    B ARG C  1 71  ? 23.657  -39.168 -47.206 0.49 36.37 ? 82  ARG C CZ    1 
ATOM   6580  N  NH1   A ARG C  1 71  ? 27.772  -34.671 -43.944 0.51 33.83 ? 82  ARG C NH1   1 
ATOM   6581  N  NH1   B ARG C  1 71  ? 24.081  -38.265 -48.082 0.49 22.54 ? 82  ARG C NH1   1 
ATOM   6582  N  NH2   A ARG C  1 71  ? 28.362  -35.438 -46.017 0.51 48.39 ? 82  ARG C NH2   1 
ATOM   6583  N  NH2   B ARG C  1 71  ? 22.882  -40.162 -47.620 0.49 19.76 ? 82  ARG C NH2   1 
ATOM   6584  N  N     . SER C  1 72  ? 22.810  -40.467 -41.610 1.00 14.02 ? 83  SER C N     1 
ATOM   6585  C  CA    . SER C  1 72  ? 23.254  -41.807 -41.209 1.00 14.50 ? 83  SER C CA    1 
ATOM   6586  C  C     . SER C  1 72  ? 22.212  -42.902 -41.137 1.00 18.92 ? 83  SER C C     1 
ATOM   6587  O  O     . SER C  1 72  ? 22.556  -44.059 -41.335 1.00 19.37 ? 83  SER C O     1 
ATOM   6588  C  CB    . SER C  1 72  ? 23.955  -41.725 -39.855 1.00 17.57 ? 83  SER C CB    1 
ATOM   6589  O  OG    . SER C  1 72  ? 25.001  -40.771 -39.925 1.00 21.53 ? 83  SER C OG    1 
ATOM   6590  N  N     . ILE C  1 73  ? 20.988  -42.568 -40.744 1.00 15.91 ? 84  ILE C N     1 
ATOM   6591  C  CA    . ILE C  1 73  ? 19.909  -43.541 -40.533 1.00 15.95 ? 84  ILE C CA    1 
ATOM   6592  C  C     . ILE C  1 73  ? 19.476  -44.284 -41.803 1.00 18.16 ? 84  ILE C C     1 
ATOM   6593  O  O     . ILE C  1 73  ? 19.286  -43.675 -42.856 1.00 15.88 ? 84  ILE C O     1 
ATOM   6594  C  CB    . ILE C  1 73  ? 18.726  -42.911 -39.736 1.00 19.55 ? 84  ILE C CB    1 
ATOM   6595  C  CG1   . ILE C  1 73  ? 17.812  -43.981 -39.111 1.00 20.43 ? 84  ILE C CG1   1 
ATOM   6596  C  CG2   . ILE C  1 73  ? 17.928  -41.909 -40.592 1.00 20.77 ? 84  ILE C CG2   1 
ATOM   6597  C  CD1   . ILE C  1 73  ? 18.383  -44.797 -38.074 1.00 19.27 ? 84  ILE C CD1   1 
ATOM   6598  N  N     . ARG C  1 74  ? 19.319  -45.613 -41.696 1.00 15.69 ? 85  ARG C N     1 
ATOM   6599  C  CA    . ARG C  1 74  ? 18.921  -46.435 -42.850 1.00 16.67 ? 85  ARG C CA    1 
ATOM   6600  C  C     . ARG C  1 74  ? 17.913  -47.464 -42.348 1.00 19.38 ? 85  ARG C C     1 
ATOM   6601  O  O     . ARG C  1 74  ? 17.998  -47.850 -41.179 1.00 18.74 ? 85  ARG C O     1 
ATOM   6602  C  CB    . ARG C  1 74  ? 20.145  -47.188 -43.454 1.00 17.93 ? 85  ARG C CB    1 
ATOM   6603  C  CG    . ARG C  1 74  ? 21.377  -46.361 -43.854 1.00 30.51 ? 85  ARG C CG    1 
ATOM   6604  C  CD    . ARG C  1 74  ? 21.286  -45.735 -45.239 1.00 38.61 ? 85  ARG C CD    1 
ATOM   6605  N  NE    . ARG C  1 74  ? 22.549  -45.103 -45.658 1.00 49.39 ? 85  ARG C NE    1 
ATOM   6606  C  CZ    . ARG C  1 74  ? 22.902  -43.840 -45.403 1.00 56.49 ? 85  ARG C CZ    1 
ATOM   6607  N  NH1   . ARG C  1 74  ? 24.062  -43.366 -45.842 1.00 41.37 ? 85  ARG C NH1   1 
ATOM   6608  N  NH2   . ARG C  1 74  ? 22.100  -43.045 -44.705 1.00 31.95 ? 85  ARG C NH2   1 
ATOM   6609  N  N     . PRO C  1 75  ? 16.966  -47.958 -43.173 1.00 18.48 ? 86  PRO C N     1 
ATOM   6610  C  CA    . PRO C  1 75  ? 16.039  -48.981 -42.660 1.00 19.31 ? 86  PRO C CA    1 
ATOM   6611  C  C     . PRO C  1 75  ? 16.730  -50.181 -41.983 1.00 27.01 ? 86  PRO C C     1 
ATOM   6612  O  O     . PRO C  1 75  ? 16.204  -50.707 -41.011 1.00 27.98 ? 86  PRO C O     1 
ATOM   6613  C  CB    . PRO C  1 75  ? 15.253  -49.398 -43.901 1.00 21.52 ? 86  PRO C CB    1 
ATOM   6614  C  CG    . PRO C  1 75  ? 15.289  -48.196 -44.800 1.00 25.40 ? 86  PRO C CG    1 
ATOM   6615  C  CD    . PRO C  1 75  ? 16.686  -47.635 -44.590 1.00 20.31 ? 86  PRO C CD    1 
ATOM   6616  N  N     . ASP C  1 76  ? 17.936  -50.555 -42.431 1.00 26.60 ? 87  ASP C N     1 
ATOM   6617  C  CA    . ASP C  1 76  ? 18.666  -51.723 -41.890 1.00 28.15 ? 87  ASP C CA    1 
ATOM   6618  C  C     . ASP C  1 76  ? 19.625  -51.469 -40.730 1.00 31.35 ? 87  ASP C C     1 
ATOM   6619  O  O     . ASP C  1 76  ? 20.373  -52.376 -40.371 1.00 32.10 ? 87  ASP C O     1 
ATOM   6620  C  CB    . ASP C  1 76  ? 19.378  -52.501 -43.024 1.00 30.42 ? 87  ASP C CB    1 
ATOM   6621  C  CG    . ASP C  1 76  ? 20.491  -51.764 -43.753 1.00 45.37 ? 87  ASP C CG    1 
ATOM   6622  O  OD1   . ASP C  1 76  ? 20.921  -52.252 -44.826 1.00 48.87 ? 87  ASP C OD1   1 
ATOM   6623  O  OD2   . ASP C  1 76  ? 20.897  -50.673 -43.285 1.00 48.91 ? 87  ASP C OD2   1 
ATOM   6624  N  N     . ASN C  1 77  ? 19.667  -50.245 -40.182 1.00 26.37 ? 88  ASN C N     1 
ATOM   6625  C  CA    . ASN C  1 77  ? 20.572  -49.947 -39.062 1.00 24.31 ? 88  ASN C CA    1 
ATOM   6626  C  C     . ASN C  1 77  ? 19.867  -49.324 -37.867 1.00 27.82 ? 88  ASN C C     1 
ATOM   6627  O  O     . ASN C  1 77  ? 20.527  -48.975 -36.893 1.00 27.65 ? 88  ASN C O     1 
ATOM   6628  C  CB    . ASN C  1 77  ? 21.809  -49.123 -39.515 1.00 22.48 ? 88  ASN C CB    1 
ATOM   6629  C  CG    . ASN C  1 77  ? 21.546  -47.678 -39.914 1.00 31.04 ? 88  ASN C CG    1 
ATOM   6630  O  OD1   . ASN C  1 77  ? 20.511  -47.079 -39.605 1.00 24.90 ? 88  ASN C OD1   1 
ATOM   6631  N  ND2   . ASN C  1 77  ? 22.493  -47.075 -40.604 1.00 19.25 ? 88  ASN C ND2   1 
ATOM   6632  N  N     . MET C  1 78  ? 18.527  -49.202 -37.920 1.00 26.58 ? 89  MET C N     1 
ATOM   6633  C  CA    . MET C  1 78  ? 17.707  -48.598 -36.848 1.00 26.12 ? 89  MET C CA    1 
ATOM   6634  C  C     . MET C  1 78  ? 17.973  -49.092 -35.417 1.00 32.03 ? 89  MET C C     1 
ATOM   6635  O  O     . MET C  1 78  ? 17.820  -48.308 -34.483 1.00 30.95 ? 89  MET C O     1 
ATOM   6636  C  CB    . MET C  1 78  ? 16.215  -48.695 -37.168 1.00 28.18 ? 89  MET C CB    1 
ATOM   6637  C  CG    . MET C  1 78  ? 15.827  -48.083 -38.499 1.00 30.61 ? 89  MET C CG    1 
ATOM   6638  S  SD    . MET C  1 78  ? 14.044  -48.171 -38.784 1.00 34.08 ? 89  MET C SD    1 
ATOM   6639  C  CE    . MET C  1 78  ? 13.836  -49.932 -39.034 1.00 31.40 ? 89  MET C CE    1 
ATOM   6640  N  N     . SER C  1 79  ? 18.374  -50.383 -35.240 1.00 31.10 ? 90  SER C N     1 
ATOM   6641  C  CA    . SER C  1 79  ? 18.676  -50.990 -33.930 1.00 31.43 ? 90  SER C CA    1 
ATOM   6642  C  C     . SER C  1 79  ? 19.801  -50.247 -33.210 1.00 36.63 ? 90  SER C C     1 
ATOM   6643  O  O     . SER C  1 79  ? 19.746  -50.078 -31.992 1.00 39.26 ? 90  SER C O     1 
ATOM   6644  C  CB    . SER C  1 79  ? 19.040  -52.466 -34.093 1.00 36.78 ? 90  SER C CB    1 
ATOM   6645  O  OG    . SER C  1 79  ? 20.361  -52.653 -34.587 1.00 42.74 ? 90  SER C OG    1 
ATOM   6646  N  N     . GLU C  1 80  ? 20.796  -49.769 -33.974 1.00 31.15 ? 91  GLU C N     1 
ATOM   6647  C  CA    . GLU C  1 80  ? 21.937  -49.000 -33.489 1.00 30.25 ? 91  GLU C CA    1 
ATOM   6648  C  C     . GLU C  1 80  ? 21.545  -47.589 -33.076 1.00 33.15 ? 91  GLU C C     1 
ATOM   6649  O  O     . GLU C  1 80  ? 22.275  -46.967 -32.299 1.00 33.29 ? 91  GLU C O     1 
ATOM   6650  C  CB    . GLU C  1 80  ? 22.981  -48.866 -34.611 1.00 31.73 ? 91  GLU C CB    1 
ATOM   6651  C  CG    . GLU C  1 80  ? 23.743  -50.141 -34.925 1.00 41.87 ? 91  GLU C CG    1 
ATOM   6652  C  CD    . GLU C  1 80  ? 24.216  -50.241 -36.360 1.00 49.80 ? 91  GLU C CD    1 
ATOM   6653  O  OE1   . GLU C  1 80  ? 23.921  -51.272 -37.007 1.00 42.44 ? 91  GLU C OE1   1 
ATOM   6654  O  OE2   . GLU C  1 80  ? 24.850  -49.281 -36.853 1.00 39.93 ? 91  GLU C OE2   1 
ATOM   6655  N  N     . TYR C  1 81  ? 20.439  -47.051 -33.646 1.00 27.33 ? 92  TYR C N     1 
ATOM   6656  C  CA    . TYR C  1 81  ? 20.022  -45.660 -33.439 1.00 25.50 ? 92  TYR C CA    1 
ATOM   6657  C  C     . TYR C  1 81  ? 18.739  -45.449 -32.638 1.00 28.67 ? 92  TYR C C     1 
ATOM   6658  O  O     . TYR C  1 81  ? 18.146  -44.375 -32.766 1.00 27.65 ? 92  TYR C O     1 
ATOM   6659  C  CB    . TYR C  1 81  ? 19.902  -44.952 -34.805 1.00 25.27 ? 92  TYR C CB    1 
ATOM   6660  C  CG    . TYR C  1 81  ? 21.212  -44.766 -35.533 1.00 26.60 ? 92  TYR C CG    1 
ATOM   6661  C  CD1   . TYR C  1 81  ? 21.622  -45.665 -36.516 1.00 28.05 ? 92  TYR C CD1   1 
ATOM   6662  C  CD2   . TYR C  1 81  ? 22.037  -43.681 -35.257 1.00 27.46 ? 92  TYR C CD2   1 
ATOM   6663  C  CE1   . TYR C  1 81  ? 22.837  -45.506 -37.181 1.00 28.27 ? 92  TYR C CE1   1 
ATOM   6664  C  CE2   . TYR C  1 81  ? 23.241  -43.496 -35.936 1.00 28.18 ? 92  TYR C CE2   1 
ATOM   6665  C  CZ    . TYR C  1 81  ? 23.640  -44.415 -36.892 1.00 32.57 ? 92  TYR C CZ    1 
ATOM   6666  O  OH    . TYR C  1 81  ? 24.840  -44.245 -37.533 1.00 32.46 ? 92  TYR C OH    1 
ATOM   6667  N  N     . SER C  1 82  ? 18.322  -46.421 -31.792 1.00 24.76 ? 93  SER C N     1 
ATOM   6668  C  CA    . SER C  1 82  ? 17.086  -46.304 -31.007 1.00 24.41 ? 93  SER C CA    1 
ATOM   6669  C  C     . SER C  1 82  ? 17.012  -45.049 -30.119 1.00 26.63 ? 93  SER C C     1 
ATOM   6670  O  O     . SER C  1 82  ? 15.961  -44.400 -30.074 1.00 25.70 ? 93  SER C O     1 
ATOM   6671  C  CB    . SER C  1 82  ? 16.833  -47.567 -30.187 1.00 29.35 ? 93  SER C CB    1 
ATOM   6672  O  OG    . SER C  1 82  ? 17.763  -47.650 -29.120 1.00 39.57 ? 93  SER C OG    1 
ATOM   6673  N  N     . LYS C  1 83  ? 18.115  -44.704 -29.431 1.00 22.74 ? 94  LYS C N     1 
ATOM   6674  C  CA    . LYS C  1 83  ? 18.159  -43.516 -28.569 1.00 22.84 ? 94  LYS C CA    1 
ATOM   6675  C  C     . LYS C  1 83  ? 18.046  -42.232 -29.404 1.00 24.92 ? 94  LYS C C     1 
ATOM   6676  O  O     . LYS C  1 83  ? 17.304  -41.316 -29.032 1.00 23.48 ? 94  LYS C O     1 
ATOM   6677  C  CB    . LYS C  1 83  ? 19.397  -43.518 -27.649 1.00 25.61 ? 94  LYS C CB    1 
ATOM   6678  C  CG    . LYS C  1 83  ? 19.345  -44.569 -26.530 1.00 42.15 ? 94  LYS C CG    1 
ATOM   6679  C  CD    . LYS C  1 83  ? 18.343  -44.211 -25.405 1.00 59.29 ? 94  LYS C CD    1 
ATOM   6680  C  CE    . LYS C  1 83  ? 17.092  -45.071 -25.412 1.00 71.55 ? 94  LYS C CE    1 
ATOM   6681  N  NZ    . LYS C  1 83  ? 16.028  -44.517 -24.525 1.00 78.88 ? 94  LYS C NZ    1 
ATOM   6682  N  N     . GLN C  1 84  ? 18.755  -42.205 -30.560 1.00 20.71 ? 95  GLN C N     1 
ATOM   6683  C  CA    A GLN C  1 84  ? 18.752  -41.088 -31.503 0.47 19.80 ? 95  GLN C CA    1 
ATOM   6684  C  CA    B GLN C  1 84  ? 18.713  -41.055 -31.464 0.53 20.01 ? 95  GLN C CA    1 
ATOM   6685  C  C     . GLN C  1 84  ? 17.355  -40.937 -32.128 1.00 20.92 ? 95  GLN C C     1 
ATOM   6686  O  O     . GLN C  1 84  ? 16.872  -39.819 -32.316 1.00 18.94 ? 95  GLN C O     1 
ATOM   6687  C  CB    A GLN C  1 84  ? 19.832  -41.302 -32.586 0.47 21.26 ? 95  GLN C CB    1 
ATOM   6688  C  CB    B GLN C  1 84  ? 19.842  -41.083 -32.501 0.53 21.67 ? 95  GLN C CB    1 
ATOM   6689  C  CG    A GLN C  1 84  ? 21.283  -41.350 -32.046 0.47 28.82 ? 95  GLN C CG    1 
ATOM   6690  C  CG    B GLN C  1 84  ? 21.169  -40.562 -31.944 0.53 32.71 ? 95  GLN C CG    1 
ATOM   6691  C  CD    A GLN C  1 84  ? 21.782  -42.733 -31.650 0.47 34.79 ? 95  GLN C CD    1 
ATOM   6692  C  CD    B GLN C  1 84  ? 22.226  -40.470 -33.012 0.53 46.23 ? 95  GLN C CD    1 
ATOM   6693  O  OE1   A GLN C  1 84  ? 21.103  -43.512 -30.971 0.47 22.17 ? 95  GLN C OE1   1 
ATOM   6694  O  OE1   B GLN C  1 84  ? 22.173  -39.618 -33.895 0.53 42.13 ? 95  GLN C OE1   1 
ATOM   6695  N  NE2   A GLN C  1 84  ? 23.022  -43.049 -32.018 0.47 32.20 ? 95  GLN C NE2   1 
ATOM   6696  N  NE2   B GLN C  1 84  ? 23.215  -41.341 -32.956 0.53 39.66 ? 95  GLN C NE2   1 
ATOM   6697  N  N     . MET C  1 85  ? 16.691  -42.076 -32.405 1.00 14.78 ? 96  MET C N     1 
ATOM   6698  C  CA    . MET C  1 85  ? 15.355  -42.062 -33.005 1.00 15.79 ? 96  MET C CA    1 
ATOM   6699  C  C     . MET C  1 85  ? 14.339  -41.431 -32.052 1.00 20.01 ? 96  MET C C     1 
ATOM   6700  O  O     . MET C  1 85  ? 13.494  -40.650 -32.486 1.00 19.27 ? 96  MET C O     1 
ATOM   6701  C  CB    . MET C  1 85  ? 14.936  -43.479 -33.409 1.00 18.80 ? 96  MET C CB    1 
ATOM   6702  C  CG    . MET C  1 85  ? 15.525  -43.916 -34.726 1.00 22.57 ? 96  MET C CG    1 
ATOM   6703  S  SD    . MET C  1 85  ? 15.256  -45.676 -34.986 1.00 27.46 ? 96  MET C SD    1 
ATOM   6704  C  CE    . MET C  1 85  ? 13.543  -45.667 -35.525 1.00 24.61 ? 96  MET C CE    1 
ATOM   6705  N  N     . GLN C  1 86  ? 14.472  -41.707 -30.743 1.00 17.57 ? 97  GLN C N     1 
ATOM   6706  C  CA    . GLN C  1 86  ? 13.592  -41.111 -29.732 1.00 16.41 ? 97  GLN C CA    1 
ATOM   6707  C  C     . GLN C  1 86  ? 13.926  -39.627 -29.589 1.00 19.60 ? 97  GLN C C     1 
ATOM   6708  O  O     . GLN C  1 86  ? 13.022  -38.807 -29.536 1.00 18.62 ? 97  GLN C O     1 
ATOM   6709  C  CB    . GLN C  1 86  ? 13.746  -41.825 -28.387 1.00 16.91 ? 97  GLN C CB    1 
ATOM   6710  C  CG    . GLN C  1 86  ? 12.868  -41.221 -27.271 1.00 19.20 ? 97  GLN C CG    1 
ATOM   6711  C  CD    . GLN C  1 86  ? 12.861  -42.061 -26.028 1.00 38.01 ? 97  GLN C CD    1 
ATOM   6712  O  OE1   . GLN C  1 86  ? 13.148  -43.262 -26.069 1.00 35.14 ? 97  GLN C OE1   1 
ATOM   6713  N  NE2   . GLN C  1 86  ? 12.512  -41.452 -24.891 1.00 27.30 ? 97  GLN C NE2   1 
ATOM   6714  N  N     . ARG C  1 87  ? 15.220  -39.287 -29.530 1.00 18.34 ? 98  ARG C N     1 
ATOM   6715  C  CA    . ARG C  1 87  ? 15.651  -37.886 -29.414 1.00 18.02 ? 98  ARG C CA    1 
ATOM   6716  C  C     . ARG C  1 87  ? 15.155  -37.028 -30.565 1.00 21.29 ? 98  ARG C C     1 
ATOM   6717  O  O     . ARG C  1 87  ? 14.790  -35.869 -30.345 1.00 21.79 ? 98  ARG C O     1 
ATOM   6718  C  CB    . ARG C  1 87  ? 17.179  -37.787 -29.366 1.00 18.06 ? 98  ARG C CB    1 
ATOM   6719  C  CG    . ARG C  1 87  ? 17.685  -36.397 -28.978 1.00 22.76 ? 98  ARG C CG    1 
ATOM   6720  C  CD    . ARG C  1 87  ? 19.198  -36.337 -28.961 1.00 35.45 ? 98  ARG C CD    1 
ATOM   6721  N  NE    . ARG C  1 87  ? 19.727  -36.652 -27.635 1.00 52.27 ? 98  ARG C NE    1 
ATOM   6722  C  CZ    . ARG C  1 87  ? 20.280  -37.813 -27.292 1.00 71.51 ? 98  ARG C CZ    1 
ATOM   6723  N  NH1   . ARG C  1 87  ? 20.724  -38.002 -26.058 1.00 59.30 ? 98  ARG C NH1   1 
ATOM   6724  N  NH2   . ARG C  1 87  ? 20.398  -38.791 -28.183 1.00 60.40 ? 98  ARG C NH2   1 
ATOM   6725  N  N     . PHE C  1 88  ? 15.210  -37.561 -31.796 1.00 14.86 ? 99  PHE C N     1 
ATOM   6726  C  CA    . PHE C  1 88  ? 14.871  -36.759 -32.977 1.00 13.87 ? 99  PHE C CA    1 
ATOM   6727  C  C     . PHE C  1 88  ? 13.482  -37.010 -33.540 1.00 17.63 ? 99  PHE C C     1 
ATOM   6728  O  O     . PHE C  1 88  ? 13.135  -36.425 -34.565 1.00 16.59 ? 99  PHE C O     1 
ATOM   6729  C  CB    . PHE C  1 88  ? 15.995  -36.881 -34.045 1.00 14.59 ? 99  PHE C CB    1 
ATOM   6730  C  CG    . PHE C  1 88  ? 17.396  -36.584 -33.525 1.00 16.13 ? 99  PHE C CG    1 
ATOM   6731  C  CD1   . PHE C  1 88  ? 17.680  -35.381 -32.878 1.00 17.70 ? 99  PHE C CD1   1 
ATOM   6732  C  CD2   . PHE C  1 88  ? 18.440  -37.478 -33.738 1.00 17.31 ? 99  PHE C CD2   1 
ATOM   6733  C  CE1   . PHE C  1 88  ? 18.974  -35.097 -32.421 1.00 17.61 ? 99  PHE C CE1   1 
ATOM   6734  C  CE2   . PHE C  1 88  ? 19.731  -37.200 -33.268 1.00 19.39 ? 99  PHE C CE2   1 
ATOM   6735  C  CZ    . PHE C  1 88  ? 19.987  -36.012 -32.608 1.00 17.09 ? 99  PHE C CZ    1 
ATOM   6736  N  N     . ASN C  1 89  ? 12.676  -37.858 -32.843 1.00 15.76 ? 100 ASN C N     1 
ATOM   6737  C  CA    . ASN C  1 89  ? 11.287  -38.215 -33.208 1.00 15.58 ? 100 ASN C CA    1 
ATOM   6738  C  C     . ASN C  1 89  ? 11.190  -38.815 -34.617 1.00 20.07 ? 100 ASN C C     1 
ATOM   6739  O  O     . ASN C  1 89  ? 10.350  -38.403 -35.432 1.00 19.37 ? 100 ASN C O     1 
ATOM   6740  C  CB    . ASN C  1 89  ? 10.343  -37.009 -33.020 1.00 14.93 ? 100 ASN C CB    1 
ATOM   6741  C  CG    . ASN C  1 89  ? 8.869   -37.329 -33.081 1.00 31.02 ? 100 ASN C CG    1 
ATOM   6742  O  OD1   . ASN C  1 89  ? 8.398   -38.316 -32.503 1.00 23.63 ? 100 ASN C OD1   1 
ATOM   6743  N  ND2   . ASN C  1 89  ? 8.122   -36.522 -33.823 1.00 21.28 ? 100 ASN C ND2   1 
ATOM   6744  N  N     . VAL C  1 90  ? 12.078  -39.776 -34.918 1.00 15.92 ? 101 VAL C N     1 
ATOM   6745  C  CA    . VAL C  1 90  ? 12.091  -40.428 -36.229 1.00 16.08 ? 101 VAL C CA    1 
ATOM   6746  C  C     . VAL C  1 90  ? 11.742  -41.893 -35.988 1.00 24.58 ? 101 VAL C C     1 
ATOM   6747  O  O     . VAL C  1 90  ? 12.219  -42.481 -35.011 1.00 23.83 ? 101 VAL C O     1 
ATOM   6748  C  CB    . VAL C  1 90  ? 13.428  -40.210 -36.978 1.00 19.00 ? 101 VAL C CB    1 
ATOM   6749  C  CG1   . VAL C  1 90  ? 13.619  -41.198 -38.144 1.00 18.99 ? 101 VAL C CG1   1 
ATOM   6750  C  CG2   . VAL C  1 90  ? 13.534  -38.768 -37.477 1.00 17.92 ? 101 VAL C CG2   1 
ATOM   6751  N  N     . GLY C  1 91  ? 10.862  -42.428 -36.831 1.00 22.65 ? 102 GLY C N     1 
ATOM   6752  C  CA    . GLY C  1 91  ? 10.430  -43.814 -36.751 1.00 23.33 ? 102 GLY C CA    1 
ATOM   6753  C  C     . GLY C  1 91  ? 8.942   -44.019 -36.567 1.00 29.07 ? 102 GLY C C     1 
ATOM   6754  O  O     . GLY C  1 91  ? 8.480   -45.153 -36.691 1.00 30.03 ? 102 GLY C O     1 
ATOM   6755  N  N     . GLU C  1 92  ? 8.182   -42.950 -36.265 1.00 25.66 ? 103 GLU C N     1 
ATOM   6756  C  CA    . GLU C  1 92  ? 6.721   -43.040 -36.050 1.00 25.15 ? 103 GLU C CA    1 
ATOM   6757  C  C     . GLU C  1 92  ? 5.998   -42.352 -37.207 1.00 23.46 ? 103 GLU C C     1 
ATOM   6758  O  O     . GLU C  1 92  ? 5.955   -42.942 -38.281 1.00 22.11 ? 103 GLU C O     1 
ATOM   6759  C  CB    . GLU C  1 92  ? 6.321   -42.489 -34.663 1.00 26.87 ? 103 GLU C CB    1 
ATOM   6760  C  CG    . GLU C  1 92  ? 6.835   -43.341 -33.507 1.00 40.08 ? 103 GLU C CG    1 
ATOM   6761  C  CD    . GLU C  1 92  ? 6.281   -44.754 -33.421 1.00 71.60 ? 103 GLU C CD    1 
ATOM   6762  O  OE1   . GLU C  1 92  ? 5.061   -44.935 -33.644 1.00 65.94 ? 103 GLU C OE1   1 
ATOM   6763  O  OE2   . GLU C  1 92  ? 7.066   -45.679 -33.111 1.00 70.76 ? 103 GLU C OE2   1 
ATOM   6764  N  N     . ASP C  1 93  ? 5.514   -41.090 -37.048 1.00 19.30 ? 104 ASP C N     1 
ATOM   6765  C  CA    . ASP C  1 93  ? 4.885   -40.376 -38.167 1.00 18.38 ? 104 ASP C CA    1 
ATOM   6766  C  C     . ASP C  1 93  ? 5.905   -40.128 -39.275 1.00 20.33 ? 104 ASP C C     1 
ATOM   6767  O  O     . ASP C  1 93  ? 5.542   -40.057 -40.437 1.00 19.36 ? 104 ASP C O     1 
ATOM   6768  C  CB    . ASP C  1 93  ? 4.308   -39.016 -37.736 1.00 20.13 ? 104 ASP C CB    1 
ATOM   6769  C  CG    . ASP C  1 93  ? 3.063   -39.089 -36.891 1.00 29.03 ? 104 ASP C CG    1 
ATOM   6770  O  OD1   . ASP C  1 93  ? 2.285   -40.059 -37.061 1.00 27.76 ? 104 ASP C OD1   1 
ATOM   6771  O  OD2   . ASP C  1 93  ? 2.848   -38.157 -36.070 1.00 33.26 ? 104 ASP C OD2   1 
ATOM   6772  N  N     . CYS C  1 94  ? 7.180   -39.986 -38.897 1.00 15.50 ? 105 CYS C N     1 
ATOM   6773  C  CA    . CYS C  1 94  ? 8.298   -39.705 -39.794 1.00 14.51 ? 105 CYS C CA    1 
ATOM   6774  C  C     . CYS C  1 94  ? 9.161   -40.965 -39.913 1.00 18.42 ? 105 CYS C C     1 
ATOM   6775  O  O     . CYS C  1 94  ? 10.140  -41.116 -39.166 1.00 17.34 ? 105 CYS C O     1 
ATOM   6776  C  CB    . CYS C  1 94  ? 9.101   -38.535 -39.244 1.00 14.57 ? 105 CYS C CB    1 
ATOM   6777  S  SG    . CYS C  1 94  ? 8.099   -37.070 -38.926 1.00 18.14 ? 105 CYS C SG    1 
ATOM   6778  N  N     . PRO C  1 95  ? 8.792   -41.893 -40.817 1.00 16.33 ? 106 PRO C N     1 
ATOM   6779  C  CA    . PRO C  1 95  ? 9.559   -43.149 -40.926 1.00 16.17 ? 106 PRO C CA    1 
ATOM   6780  C  C     . PRO C  1 95  ? 10.959  -42.987 -41.498 1.00 20.95 ? 106 PRO C C     1 
ATOM   6781  O  O     . PRO C  1 95  ? 11.281  -41.983 -42.138 1.00 19.11 ? 106 PRO C O     1 
ATOM   6782  C  CB    . PRO C  1 95  ? 8.711   -43.987 -41.897 1.00 17.60 ? 106 PRO C CB    1 
ATOM   6783  C  CG    . PRO C  1 95  ? 8.025   -42.957 -42.767 1.00 22.53 ? 106 PRO C CG    1 
ATOM   6784  C  CD    . PRO C  1 95  ? 7.658   -41.877 -41.771 1.00 18.84 ? 106 PRO C CD    1 
ATOM   6785  N  N     . VAL C  1 96  ? 11.777  -44.027 -41.292 1.00 18.15 ? 107 VAL C N     1 
ATOM   6786  C  CA    . VAL C  1 96  ? 13.082  -44.137 -41.912 1.00 16.99 ? 107 VAL C CA    1 
ATOM   6787  C  C     . VAL C  1 96  ? 12.785  -44.812 -43.266 1.00 21.40 ? 107 VAL C C     1 
ATOM   6788  O  O     . VAL C  1 96  ? 12.213  -45.895 -43.296 1.00 22.48 ? 107 VAL C O     1 
ATOM   6789  C  CB    . VAL C  1 96  ? 14.051  -45.011 -41.070 1.00 20.94 ? 107 VAL C CB    1 
ATOM   6790  C  CG1   . VAL C  1 96  ? 15.370  -45.208 -41.805 1.00 21.36 ? 107 VAL C CG1   1 
ATOM   6791  C  CG2   . VAL C  1 96  ? 14.279  -44.420 -39.676 1.00 20.79 ? 107 VAL C CG2   1 
ATOM   6792  N  N     . PHE C  1 97  ? 13.189  -44.194 -44.370 1.00 16.19 ? 108 PHE C N     1 
ATOM   6793  C  CA    . PHE C  1 97  ? 12.999  -44.806 -45.670 1.00 15.28 ? 108 PHE C CA    1 
ATOM   6794  C  C     . PHE C  1 97  ? 14.236  -44.631 -46.517 1.00 21.24 ? 108 PHE C C     1 
ATOM   6795  O  O     . PHE C  1 97  ? 15.061  -43.763 -46.216 1.00 20.81 ? 108 PHE C O     1 
ATOM   6796  C  CB    . PHE C  1 97  ? 11.720  -44.298 -46.361 1.00 15.72 ? 108 PHE C CB    1 
ATOM   6797  C  CG    . PHE C  1 97  ? 11.636  -42.809 -46.589 1.00 14.98 ? 108 PHE C CG    1 
ATOM   6798  C  CD1   . PHE C  1 97  ? 10.926  -41.990 -45.707 1.00 15.95 ? 108 PHE C CD1   1 
ATOM   6799  C  CD2   . PHE C  1 97  ? 12.196  -42.231 -47.725 1.00 14.04 ? 108 PHE C CD2   1 
ATOM   6800  C  CE1   . PHE C  1 97  ? 10.817  -40.615 -45.943 1.00 15.59 ? 108 PHE C CE1   1 
ATOM   6801  C  CE2   . PHE C  1 97  ? 12.054  -40.860 -47.979 1.00 16.36 ? 108 PHE C CE2   1 
ATOM   6802  C  CZ    . PHE C  1 97  ? 11.360  -40.061 -47.091 1.00 13.74 ? 108 PHE C CZ    1 
ATOM   6803  N  N     . ASP C  1 98  ? 14.382  -45.457 -47.575 1.00 18.98 ? 109 ASP C N     1 
ATOM   6804  C  CA    . ASP C  1 98  ? 15.530  -45.412 -48.468 1.00 18.39 ? 109 ASP C CA    1 
ATOM   6805  C  C     . ASP C  1 98  ? 15.594  -44.079 -49.158 1.00 21.25 ? 109 ASP C C     1 
ATOM   6806  O  O     . ASP C  1 98  ? 14.598  -43.637 -49.743 1.00 19.59 ? 109 ASP C O     1 
ATOM   6807  C  CB    . ASP C  1 98  ? 15.471  -46.546 -49.522 1.00 19.81 ? 109 ASP C CB    1 
ATOM   6808  C  CG    . ASP C  1 98  ? 15.772  -47.943 -48.990 1.00 34.16 ? 109 ASP C CG    1 
ATOM   6809  O  OD1   . ASP C  1 98  ? 16.660  -48.073 -48.118 1.00 35.06 ? 109 ASP C OD1   1 
ATOM   6810  O  OD2   . ASP C  1 98  ? 15.146  -48.911 -49.475 1.00 40.86 ? 109 ASP C OD2   1 
ATOM   6811  N  N     . GLY C  1 99  ? 16.746  -43.424 -49.057 1.00 17.45 ? 110 GLY C N     1 
ATOM   6812  C  CA    . GLY C  1 99  ? 16.931  -42.128 -49.707 1.00 17.56 ? 110 GLY C CA    1 
ATOM   6813  C  C     . GLY C  1 99  ? 16.328  -40.952 -48.951 1.00 19.89 ? 110 GLY C C     1 
ATOM   6814  O  O     . GLY C  1 99  ? 16.182  -39.865 -49.520 1.00 18.36 ? 110 GLY C O     1 
ATOM   6815  N  N     . LEU C  1 100 ? 15.986  -41.159 -47.665 1.00 15.96 ? 111 LEU C N     1 
ATOM   6816  C  CA    . LEU C  1 100 ? 15.444  -40.121 -46.775 1.00 15.80 ? 111 LEU C CA    1 
ATOM   6817  C  C     . LEU C  1 100 ? 16.261  -38.824 -46.854 1.00 17.47 ? 111 LEU C C     1 
ATOM   6818  O  O     . LEU C  1 100 ? 15.680  -37.759 -47.061 1.00 16.19 ? 111 LEU C O     1 
ATOM   6819  C  CB    . LEU C  1 100 ? 15.371  -40.625 -45.317 1.00 15.82 ? 111 LEU C CB    1 
ATOM   6820  C  CG    . LEU C  1 100 ? 15.108  -39.573 -44.216 1.00 19.98 ? 111 LEU C CG    1 
ATOM   6821  C  CD1   . LEU C  1 100 ? 13.781  -38.818 -44.474 1.00 22.18 ? 111 LEU C CD1   1 
ATOM   6822  C  CD2   . LEU C  1 100 ? 15.052  -40.235 -42.859 1.00 19.68 ? 111 LEU C CD2   1 
ATOM   6823  N  N     . PHE C  1 101 ? 17.591  -38.915 -46.708 1.00 13.97 ? 112 PHE C N     1 
ATOM   6824  C  CA    . PHE C  1 101 ? 18.437  -37.718 -46.751 1.00 12.93 ? 112 PHE C CA    1 
ATOM   6825  C  C     . PHE C  1 101 ? 18.388  -37.028 -48.089 1.00 16.28 ? 112 PHE C C     1 
ATOM   6826  O  O     . PHE C  1 101 ? 18.177  -35.826 -48.127 1.00 15.68 ? 112 PHE C O     1 
ATOM   6827  C  CB    . PHE C  1 101 ? 19.887  -38.008 -46.291 1.00 14.27 ? 112 PHE C CB    1 
ATOM   6828  C  CG    . PHE C  1 101 ? 20.670  -36.741 -46.044 1.00 15.10 ? 112 PHE C CG    1 
ATOM   6829  C  CD1   . PHE C  1 101 ? 20.432  -35.965 -44.915 1.00 18.65 ? 112 PHE C CD1   1 
ATOM   6830  C  CD2   . PHE C  1 101 ? 21.624  -36.307 -46.951 1.00 16.86 ? 112 PHE C CD2   1 
ATOM   6831  C  CE1   . PHE C  1 101 ? 21.134  -34.776 -44.705 1.00 18.69 ? 112 PHE C CE1   1 
ATOM   6832  C  CE2   . PHE C  1 101 ? 22.352  -35.130 -46.719 1.00 19.54 ? 112 PHE C CE2   1 
ATOM   6833  C  CZ    . PHE C  1 101 ? 22.092  -34.372 -45.606 1.00 17.75 ? 112 PHE C CZ    1 
ATOM   6834  N  N     . GLU C  1 102 ? 18.492  -37.780 -49.206 1.00 14.36 ? 113 GLU C N     1 
ATOM   6835  C  CA    . GLU C  1 102 ? 18.445  -37.156 -50.539 1.00 14.32 ? 113 GLU C CA    1 
ATOM   6836  C  C     . GLU C  1 102 ? 17.087  -36.494 -50.819 1.00 17.41 ? 113 GLU C C     1 
ATOM   6837  O  O     . GLU C  1 102 ? 17.036  -35.469 -51.483 1.00 16.66 ? 113 GLU C O     1 
ATOM   6838  C  CB    . GLU C  1 102 ? 18.820  -38.166 -51.639 1.00 16.24 ? 113 GLU C CB    1 
ATOM   6839  C  CG    . GLU C  1 102 ? 20.280  -38.594 -51.573 1.00 25.69 ? 113 GLU C CG    1 
ATOM   6840  C  CD    . GLU C  1 102 ? 20.656  -39.630 -50.522 1.00 38.56 ? 113 GLU C CD    1 
ATOM   6841  O  OE1   . GLU C  1 102 ? 21.869  -39.770 -50.245 1.00 30.62 ? 113 GLU C OE1   1 
ATOM   6842  O  OE2   . GLU C  1 102 ? 19.749  -40.288 -49.962 1.00 29.80 ? 113 GLU C OE2   1 
ATOM   6843  N  N     . PHE C  1 103 ? 16.008  -37.041 -50.280 1.00 15.02 ? 114 PHE C N     1 
ATOM   6844  C  CA    . PHE C  1 103 ? 14.679  -36.418 -50.435 1.00 14.44 ? 114 PHE C CA    1 
ATOM   6845  C  C     . PHE C  1 103 ? 14.700  -35.044 -49.754 1.00 17.11 ? 114 PHE C C     1 
ATOM   6846  O  O     . PHE C  1 103 ? 14.327  -34.059 -50.376 1.00 15.31 ? 114 PHE C O     1 
ATOM   6847  C  CB    . PHE C  1 103 ? 13.577  -37.319 -49.854 1.00 15.45 ? 114 PHE C CB    1 
ATOM   6848  C  CG    . PHE C  1 103 ? 12.233  -36.642 -49.705 1.00 16.54 ? 114 PHE C CG    1 
ATOM   6849  C  CD1   . PHE C  1 103 ? 11.805  -36.171 -48.465 1.00 18.76 ? 114 PHE C CD1   1 
ATOM   6850  C  CD2   . PHE C  1 103 ? 11.391  -36.479 -50.803 1.00 17.71 ? 114 PHE C CD2   1 
ATOM   6851  C  CE1   . PHE C  1 103 ? 10.559  -35.539 -48.328 1.00 20.47 ? 114 PHE C CE1   1 
ATOM   6852  C  CE2   . PHE C  1 103 ? 10.152  -35.829 -50.669 1.00 20.52 ? 114 PHE C CE2   1 
ATOM   6853  C  CZ    . PHE C  1 103 ? 9.741   -35.379 -49.431 1.00 19.45 ? 114 PHE C CZ    1 
ATOM   6854  N  N     . CYS C  1 104 ? 15.210  -34.979 -48.512 1.00 14.00 ? 115 CYS C N     1 
ATOM   6855  C  CA    . CYS C  1 104 ? 15.372  -33.716 -47.758 1.00 12.62 ? 115 CYS C CA    1 
ATOM   6856  C  C     . CYS C  1 104 ? 16.237  -32.719 -48.535 1.00 16.18 ? 115 CYS C C     1 
ATOM   6857  O  O     . CYS C  1 104 ? 15.889  -31.540 -48.603 1.00 15.97 ? 115 CYS C O     1 
ATOM   6858  C  CB    . CYS C  1 104 ? 15.965  -34.005 -46.378 1.00 12.60 ? 115 CYS C CB    1 
ATOM   6859  S  SG    . CYS C  1 104 ? 14.877  -34.988 -45.316 1.00 16.19 ? 115 CYS C SG    1 
ATOM   6860  N  N     . GLN C  1 105 ? 17.351  -33.197 -49.150 1.00 10.91 ? 116 GLN C N     1 
ATOM   6861  C  CA    . GLN C  1 105 ? 18.255  -32.346 -49.944 1.00 10.93 ? 116 GLN C CA    1 
ATOM   6862  C  C     . GLN C  1 105 ? 17.559  -31.742 -51.161 1.00 15.65 ? 116 GLN C C     1 
ATOM   6863  O  O     . GLN C  1 105 ? 17.825  -30.595 -51.512 1.00 15.45 ? 116 GLN C O     1 
ATOM   6864  C  CB    . GLN C  1 105 ? 19.481  -33.155 -50.422 1.00 10.80 ? 116 GLN C CB    1 
ATOM   6865  C  CG    . GLN C  1 105 ? 20.387  -33.615 -49.309 1.00 15.66 ? 116 GLN C CG    1 
ATOM   6866  C  CD    . GLN C  1 105 ? 21.615  -34.232 -49.910 1.00 23.03 ? 116 GLN C CD    1 
ATOM   6867  O  OE1   . GLN C  1 105 ? 21.586  -35.369 -50.366 1.00 19.03 ? 116 GLN C OE1   1 
ATOM   6868  N  NE2   . GLN C  1 105 ? 22.675  -33.457 -50.008 1.00 17.86 ? 116 GLN C NE2   1 
ATOM   6869  N  N     . LEU C  1 106 ? 16.702  -32.522 -51.830 1.00 13.90 ? 117 LEU C N     1 
ATOM   6870  C  CA    . LEU C  1 106 ? 16.010  -32.027 -53.034 1.00 15.10 ? 117 LEU C CA    1 
ATOM   6871  C  C     . LEU C  1 106 ? 14.879  -31.077 -52.675 1.00 18.22 ? 117 LEU C C     1 
ATOM   6872  O  O     . LEU C  1 106 ? 14.727  -30.024 -53.314 1.00 16.83 ? 117 LEU C O     1 
ATOM   6873  C  CB    . LEU C  1 106 ? 15.471  -33.205 -53.854 1.00 15.89 ? 117 LEU C CB    1 
ATOM   6874  C  CG    . LEU C  1 106 ? 16.525  -34.054 -54.550 1.00 20.73 ? 117 LEU C CG    1 
ATOM   6875  C  CD1   . LEU C  1 106 ? 15.893  -35.305 -55.133 1.00 21.21 ? 117 LEU C CD1   1 
ATOM   6876  C  CD2   . LEU C  1 106 ? 17.238  -33.261 -55.657 1.00 23.01 ? 117 LEU C CD2   1 
ATOM   6877  N  N     . SER C  1 107 ? 14.082  -31.455 -51.650 1.00 15.94 ? 118 SER C N     1 
ATOM   6878  C  CA    . SER C  1 107 ? 12.988  -30.640 -51.104 1.00 14.15 ? 118 SER C CA    1 
ATOM   6879  C  C     . SER C  1 107 ? 13.579  -29.276 -50.705 1.00 16.42 ? 118 SER C C     1 
ATOM   6880  O  O     . SER C  1 107 ? 13.087  -28.234 -51.152 1.00 14.55 ? 118 SER C O     1 
ATOM   6881  C  CB    . SER C  1 107 ? 12.399  -31.333 -49.881 1.00 16.67 ? 118 SER C CB    1 
ATOM   6882  O  OG    . SER C  1 107 ? 11.416  -30.544 -49.230 1.00 17.52 ? 118 SER C OG    1 
ATOM   6883  N  N     . THR C  1 108 ? 14.675  -29.294 -49.916 1.00 12.09 ? 119 THR C N     1 
ATOM   6884  C  CA    . THR C  1 108 ? 15.363  -28.082 -49.447 1.00 11.97 ? 119 THR C CA    1 
ATOM   6885  C  C     . THR C  1 108 ? 16.039  -27.299 -50.574 1.00 15.93 ? 119 THR C C     1 
ATOM   6886  O  O     . THR C  1 108 ? 15.906  -26.069 -50.633 1.00 14.21 ? 119 THR C O     1 
ATOM   6887  C  CB    . THR C  1 108 ? 16.322  -28.416 -48.278 1.00 16.37 ? 119 THR C CB    1 
ATOM   6888  O  OG1   . THR C  1 108 ? 15.581  -29.079 -47.254 1.00 15.74 ? 119 THR C OG1   1 
ATOM   6889  C  CG2   . THR C  1 108 ? 16.969  -27.189 -47.688 1.00 16.93 ? 119 THR C CG2   1 
ATOM   6890  N  N     . GLY C  1 109 ? 16.784  -28.002 -51.433 1.00 13.79 ? 120 GLY C N     1 
ATOM   6891  C  CA    . GLY C  1 109 ? 17.467  -27.386 -52.571 1.00 13.87 ? 120 GLY C CA    1 
ATOM   6892  C  C     . GLY C  1 109 ? 16.544  -26.517 -53.410 1.00 16.41 ? 120 GLY C C     1 
ATOM   6893  O  O     . GLY C  1 109 ? 16.916  -25.406 -53.804 1.00 15.84 ? 120 GLY C O     1 
ATOM   6894  N  N     . GLY C  1 110 ? 15.333  -27.015 -53.678 1.00 12.93 ? 121 GLY C N     1 
ATOM   6895  C  CA    . GLY C  1 110 ? 14.359  -26.264 -54.470 1.00 14.55 ? 121 GLY C CA    1 
ATOM   6896  C  C     . GLY C  1 110 ? 13.913  -24.975 -53.809 1.00 16.80 ? 121 GLY C C     1 
ATOM   6897  O  O     . GLY C  1 110 ? 13.795  -23.941 -54.480 1.00 16.81 ? 121 GLY C O     1 
ATOM   6898  N  N     . SER C  1 111 ? 13.676  -25.023 -52.468 1.00 12.51 ? 122 SER C N     1 
ATOM   6899  C  CA    . SER C  1 111 ? 13.245  -23.850 -51.711 1.00 11.05 ? 122 SER C CA    1 
ATOM   6900  C  C     . SER C  1 111 ? 14.330  -22.790 -51.628 1.00 14.33 ? 122 SER C C     1 
ATOM   6901  O  O     . SER C  1 111 ? 14.053  -21.619 -51.873 1.00 13.07 ? 122 SER C O     1 
ATOM   6902  C  CB    . SER C  1 111 ? 12.725  -24.248 -50.328 1.00 11.74 ? 122 SER C CB    1 
ATOM   6903  O  OG    . SER C  1 111 ? 11.586  -25.093 -50.470 1.00 15.46 ? 122 SER C OG    1 
ATOM   6904  N  N     . VAL C  1 112 ? 15.560  -23.199 -51.285 1.00 12.97 ? 123 VAL C N     1 
ATOM   6905  C  CA    . VAL C  1 112 ? 16.716  -22.295 -51.179 1.00 13.63 ? 123 VAL C CA    1 
ATOM   6906  C  C     . VAL C  1 112 ? 17.058  -21.703 -52.572 1.00 17.47 ? 123 VAL C C     1 
ATOM   6907  O  O     . VAL C  1 112 ? 17.266  -20.491 -52.673 1.00 17.43 ? 123 VAL C O     1 
ATOM   6908  C  CB    . VAL C  1 112 ? 17.933  -22.965 -50.478 1.00 17.63 ? 123 VAL C CB    1 
ATOM   6909  C  CG1   . VAL C  1 112 ? 19.163  -22.056 -50.507 1.00 18.07 ? 123 VAL C CG1   1 
ATOM   6910  C  CG2   . VAL C  1 112 ? 17.597  -23.355 -49.028 1.00 17.61 ? 123 VAL C CG2   1 
ATOM   6911  N  N     . ALA C  1 113 ? 17.063  -22.539 -53.645 1.00 15.94 ? 124 ALA C N     1 
ATOM   6912  C  CA    . ALA C  1 113 ? 17.365  -22.040 -55.008 1.00 16.55 ? 124 ALA C CA    1 
ATOM   6913  C  C     . ALA C  1 113 ? 16.348  -20.963 -55.423 1.00 19.62 ? 124 ALA C C     1 
ATOM   6914  O  O     . ALA C  1 113 ? 16.724  -19.920 -55.976 1.00 18.45 ? 124 ALA C O     1 
ATOM   6915  C  CB    . ALA C  1 113 ? 17.353  -23.181 -56.002 1.00 17.92 ? 124 ALA C CB    1 
ATOM   6916  N  N     . GLY C  1 114 ? 15.082  -21.190 -55.080 1.00 16.66 ? 125 GLY C N     1 
ATOM   6917  C  CA    . GLY C  1 114 ? 14.024  -20.221 -55.334 1.00 16.76 ? 125 GLY C CA    1 
ATOM   6918  C  C     . GLY C  1 114 ? 14.281  -18.911 -54.618 1.00 17.54 ? 125 GLY C C     1 
ATOM   6919  O  O     . GLY C  1 114 ? 14.095  -17.835 -55.187 1.00 16.20 ? 125 GLY C O     1 
ATOM   6920  N  N     . ALA C  1 115 ? 14.714  -18.991 -53.347 1.00 13.01 ? 126 ALA C N     1 
ATOM   6921  C  CA    . ALA C  1 115 ? 15.003  -17.803 -52.542 1.00 11.87 ? 126 ALA C CA    1 
ATOM   6922  C  C     . ALA C  1 115 ? 16.189  -17.056 -53.165 1.00 17.10 ? 126 ALA C C     1 
ATOM   6923  O  O     . ALA C  1 115 ? 16.143  -15.838 -53.260 1.00 15.97 ? 126 ALA C O     1 
ATOM   6924  C  CB    . ALA C  1 115 ? 15.329  -18.216 -51.095 1.00 11.75 ? 126 ALA C CB    1 
ATOM   6925  N  N     . VAL C  1 116 ? 17.240  -17.790 -53.604 1.00 15.58 ? 127 VAL C N     1 
ATOM   6926  C  CA    . VAL C  1 116 ? 18.417  -17.172 -54.230 1.00 15.20 ? 127 VAL C CA    1 
ATOM   6927  C  C     . VAL C  1 116 ? 17.982  -16.415 -55.507 1.00 20.60 ? 127 VAL C C     1 
ATOM   6928  O  O     . VAL C  1 116 ? 18.385  -15.269 -55.721 1.00 21.21 ? 127 VAL C O     1 
ATOM   6929  C  CB    . VAL C  1 116 ? 19.532  -18.207 -54.526 1.00 18.45 ? 127 VAL C CB    1 
ATOM   6930  C  CG1   . VAL C  1 116 ? 20.637  -17.593 -55.402 1.00 18.37 ? 127 VAL C CG1   1 
ATOM   6931  C  CG2   . VAL C  1 116 ? 20.124  -18.760 -53.226 1.00 18.06 ? 127 VAL C CG2   1 
ATOM   6932  N  N     . LYS C  1 117 ? 17.140  -17.051 -56.321 1.00 18.17 ? 128 LYS C N     1 
ATOM   6933  C  CA    . LYS C  1 117 ? 16.655  -16.461 -57.575 1.00 18.52 ? 128 LYS C CA    1 
ATOM   6934  C  C     . LYS C  1 117 ? 15.876  -15.154 -57.347 1.00 20.28 ? 128 LYS C C     1 
ATOM   6935  O  O     . LYS C  1 117 ? 16.040  -14.204 -58.116 1.00 18.64 ? 128 LYS C O     1 
ATOM   6936  C  CB    . LYS C  1 117 ? 15.841  -17.496 -58.379 1.00 20.22 ? 128 LYS C CB    1 
ATOM   6937  C  CG    . LYS C  1 117 ? 15.690  -17.174 -59.873 1.00 29.26 ? 128 LYS C CG    1 
ATOM   6938  C  CD    . LYS C  1 117 ? 16.958  -17.419 -60.696 1.00 33.09 ? 128 LYS C CD    1 
ATOM   6939  C  CE    . LYS C  1 117 ? 16.649  -17.272 -62.171 1.00 34.50 ? 128 LYS C CE    1 
ATOM   6940  N  NZ    . LYS C  1 117 ? 17.881  -17.232 -62.993 1.00 28.65 ? 128 LYS C NZ    1 
ATOM   6941  N  N     . LEU C  1 118 ? 15.078  -15.097 -56.264 1.00 16.51 ? 129 LEU C N     1 
ATOM   6942  C  CA    . LEU C  1 118 ? 14.308  -13.910 -55.878 1.00 15.43 ? 129 LEU C CA    1 
ATOM   6943  C  C     . LEU C  1 118 ? 15.236  -12.834 -55.338 1.00 20.96 ? 129 LEU C C     1 
ATOM   6944  O  O     . LEU C  1 118 ? 15.081  -11.659 -55.680 1.00 22.00 ? 129 LEU C O     1 
ATOM   6945  C  CB    . LEU C  1 118 ? 13.238  -14.268 -54.824 1.00 14.93 ? 129 LEU C CB    1 
ATOM   6946  C  CG    . LEU C  1 118 ? 12.059  -15.115 -55.317 1.00 16.73 ? 129 LEU C CG    1 
ATOM   6947  C  CD1   . LEU C  1 118 ? 11.361  -15.840 -54.135 1.00 14.91 ? 129 LEU C CD1   1 
ATOM   6948  C  CD2   . LEU C  1 118 ? 11.056  -14.254 -56.094 1.00 16.41 ? 129 LEU C CD2   1 
ATOM   6949  N  N     . ASN C  1 119 ? 16.244  -13.232 -54.537 1.00 18.87 ? 130 ASN C N     1 
ATOM   6950  C  CA    . ASN C  1 119 ? 17.218  -12.284 -53.991 1.00 18.66 ? 130 ASN C CA    1 
ATOM   6951  C  C     . ASN C  1 119 ? 18.009  -11.615 -55.117 1.00 24.86 ? 130 ASN C C     1 
ATOM   6952  O  O     . ASN C  1 119 ? 18.315  -10.434 -55.036 1.00 25.51 ? 130 ASN C O     1 
ATOM   6953  C  CB    . ASN C  1 119 ? 18.172  -13.007 -53.066 1.00 14.92 ? 130 ASN C CB    1 
ATOM   6954  C  CG    . ASN C  1 119 ? 17.622  -13.275 -51.684 1.00 21.14 ? 130 ASN C CG    1 
ATOM   6955  O  OD1   . ASN C  1 119 ? 16.617  -12.706 -51.260 1.00 17.19 ? 130 ASN C OD1   1 
ATOM   6956  N  ND2   . ASN C  1 119 ? 18.340  -14.081 -50.927 1.00 16.64 ? 130 ASN C ND2   1 
ATOM   6957  N  N     . ARG C  1 120 ? 18.325  -12.377 -56.166 1.00 22.33 ? 131 ARG C N     1 
ATOM   6958  C  CA    . ARG C  1 120 ? 19.078  -11.895 -57.327 1.00 22.08 ? 131 ARG C CA    1 
ATOM   6959  C  C     . ARG C  1 120 ? 18.235  -11.063 -58.272 1.00 26.73 ? 131 ARG C C     1 
ATOM   6960  O  O     . ARG C  1 120 ? 18.779  -10.534 -59.240 1.00 25.21 ? 131 ARG C O     1 
ATOM   6961  C  CB    . ARG C  1 120 ? 19.722  -13.067 -58.066 1.00 19.12 ? 131 ARG C CB    1 
ATOM   6962  C  CG    . ARG C  1 120 ? 20.919  -13.604 -57.312 1.00 26.52 ? 131 ARG C CG    1 
ATOM   6963  C  CD    . ARG C  1 120 ? 21.421  -14.906 -57.881 1.00 29.68 ? 131 ARG C CD    1 
ATOM   6964  N  NE    . ARG C  1 120 ? 22.678  -15.273 -57.236 1.00 41.16 ? 131 ARG C NE    1 
ATOM   6965  C  CZ    . ARG C  1 120 ? 23.347  -16.398 -57.462 1.00 54.09 ? 131 ARG C CZ    1 
ATOM   6966  N  NH1   . ARG C  1 120 ? 24.481  -16.640 -56.822 1.00 35.13 ? 131 ARG C NH1   1 
ATOM   6967  N  NH2   . ARG C  1 120 ? 22.875  -17.299 -58.313 1.00 44.04 ? 131 ARG C NH2   1 
ATOM   6968  N  N     . GLN C  1 121 ? 16.906  -10.950 -57.997 1.00 24.58 ? 132 GLN C N     1 
ATOM   6969  C  CA    . GLN C  1 121 ? 15.933  -10.184 -58.790 1.00 25.15 ? 132 GLN C CA    1 
ATOM   6970  C  C     . GLN C  1 121 ? 15.893  -10.719 -60.226 1.00 30.14 ? 132 GLN C C     1 
ATOM   6971  O  O     . GLN C  1 121 ? 15.878  -9.958  -61.197 1.00 30.73 ? 132 GLN C O     1 
ATOM   6972  C  CB    . GLN C  1 121 ? 16.251  -8.671  -58.725 1.00 26.62 ? 132 GLN C CB    1 
ATOM   6973  C  CG    . GLN C  1 121 ? 16.015  -8.082  -57.347 1.00 34.20 ? 132 GLN C CG    1 
ATOM   6974  C  CD    . GLN C  1 121 ? 16.464  -6.654  -57.285 1.00 53.38 ? 132 GLN C CD    1 
ATOM   6975  O  OE1   . GLN C  1 121 ? 15.844  -5.755  -57.859 1.00 49.19 ? 132 GLN C OE1   1 
ATOM   6976  N  NE2   . GLN C  1 121 ? 17.555  -6.420  -56.585 1.00 46.92 ? 132 GLN C NE2   1 
ATOM   6977  N  N     . GLN C  1 122 ? 15.940  -12.052 -60.347 1.00 25.37 ? 133 GLN C N     1 
ATOM   6978  C  CA    . GLN C  1 122 ? 15.946  -12.732 -61.639 1.00 24.01 ? 133 GLN C CA    1 
ATOM   6979  C  C     . GLN C  1 122 ? 14.596  -13.394 -61.907 1.00 25.86 ? 133 GLN C C     1 
ATOM   6980  O  O     . GLN C  1 122 ? 14.398  -13.989 -62.961 1.00 25.15 ? 133 GLN C O     1 
ATOM   6981  C  CB    . GLN C  1 122 ? 17.124  -13.712 -61.729 1.00 24.65 ? 133 GLN C CB    1 
ATOM   6982  C  CG    . GLN C  1 122 ? 18.474  -12.995 -61.855 1.00 31.11 ? 133 GLN C CG    1 
ATOM   6983  C  CD    . GLN C  1 122 ? 19.683  -13.903 -61.799 1.00 42.36 ? 133 GLN C CD    1 
ATOM   6984  O  OE1   . GLN C  1 122 ? 19.594  -15.136 -61.853 1.00 33.47 ? 133 GLN C OE1   1 
ATOM   6985  N  NE2   . GLN C  1 122 ? 20.855  -13.299 -61.694 1.00 38.67 ? 133 GLN C NE2   1 
ATOM   6986  N  N     . THR C  1 123 ? 13.654  -13.260 -60.948 1.00 20.95 ? 134 THR C N     1 
ATOM   6987  C  CA    . THR C  1 123 ? 12.292  -13.795 -61.049 1.00 19.49 ? 134 THR C CA    1 
ATOM   6988  C  C     . THR C  1 123 ? 11.384  -13.009 -60.131 1.00 22.67 ? 134 THR C C     1 
ATOM   6989  O  O     . THR C  1 123 ? 11.863  -12.389 -59.178 1.00 20.81 ? 134 THR C O     1 
ATOM   6990  C  CB    . THR C  1 123 ? 12.254  -15.312 -60.795 1.00 18.83 ? 134 THR C CB    1 
ATOM   6991  O  OG1   . THR C  1 123 ? 11.028  -15.839 -61.295 1.00 20.81 ? 134 THR C OG1   1 
ATOM   6992  C  CG2   . THR C  1 123 ? 12.423  -15.683 -59.325 1.00 17.30 ? 134 THR C CG2   1 
ATOM   6993  N  N     . ASP C  1 124 ? 10.084  -13.027 -60.425 1.00 20.13 ? 135 ASP C N     1 
ATOM   6994  C  CA    . ASP C  1 124 ? 9.073   -12.365 -59.604 1.00 19.66 ? 135 ASP C CA    1 
ATOM   6995  C  C     . ASP C  1 124 ? 8.505   -13.392 -58.639 1.00 20.94 ? 135 ASP C C     1 
ATOM   6996  O  O     . ASP C  1 124 ? 8.250   -13.075 -57.480 1.00 20.60 ? 135 ASP C O     1 
ATOM   6997  C  CB    . ASP C  1 124 ? 7.970   -11.756 -60.493 1.00 21.27 ? 135 ASP C CB    1 
ATOM   6998  C  CG    . ASP C  1 124 ? 8.518   -10.665 -61.384 1.00 28.34 ? 135 ASP C CG    1 
ATOM   6999  O  OD1   . ASP C  1 124 ? 8.551   -10.868 -62.621 1.00 27.69 ? 135 ASP C OD1   1 
ATOM   7000  O  OD2   . ASP C  1 124 ? 9.019   -9.658  -60.843 1.00 31.30 ? 135 ASP C OD2   1 
ATOM   7001  N  N     . MET C  1 125 ? 8.346   -14.639 -59.127 1.00 16.81 ? 136 MET C N     1 
ATOM   7002  C  CA    . MET C  1 125 ? 7.859   -15.784 -58.371 1.00 16.19 ? 136 MET C CA    1 
ATOM   7003  C  C     . MET C  1 125 ? 8.773   -16.978 -58.589 1.00 20.99 ? 136 MET C C     1 
ATOM   7004  O  O     . MET C  1 125 ? 9.284   -17.179 -59.690 1.00 20.05 ? 136 MET C O     1 
ATOM   7005  C  CB    . MET C  1 125 ? 6.431   -16.165 -58.808 1.00 18.29 ? 136 MET C CB    1 
ATOM   7006  C  CG    . MET C  1 125 ? 5.363   -15.216 -58.296 1.00 23.11 ? 136 MET C CG    1 
ATOM   7007  S  SD    . MET C  1 125 ? 3.826   -15.273 -59.270 1.00 28.96 ? 136 MET C SD    1 
ATOM   7008  C  CE    . MET C  1 125 ? 4.261   -14.212 -60.578 1.00 25.34 ? 136 MET C CE    1 
ATOM   7009  N  N     . ALA C  1 126 ? 8.945   -17.788 -57.542 1.00 17.04 ? 137 ALA C N     1 
ATOM   7010  C  CA    . ALA C  1 126 ? 9.666   -19.050 -57.581 1.00 15.56 ? 137 ALA C CA    1 
ATOM   7011  C  C     . ALA C  1 126 ? 8.713   -20.086 -56.970 1.00 18.78 ? 137 ALA C C     1 
ATOM   7012  O  O     . ALA C  1 126 ? 8.015   -19.793 -55.992 1.00 16.63 ? 137 ALA C O     1 
ATOM   7013  C  CB    . ALA C  1 126 ? 10.954  -18.974 -56.773 1.00 16.25 ? 137 ALA C CB    1 
ATOM   7014  N  N     . VAL C  1 127 ? 8.685   -21.286 -57.549 1.00 15.29 ? 138 VAL C N     1 
ATOM   7015  C  CA    . VAL C  1 127 ? 7.775   -22.359 -57.138 1.00 15.16 ? 138 VAL C CA    1 
ATOM   7016  C  C     . VAL C  1 127 ? 8.553   -23.635 -56.845 1.00 17.57 ? 138 VAL C C     1 
ATOM   7017  O  O     . VAL C  1 127 ? 9.361   -24.064 -57.672 1.00 18.09 ? 138 VAL C O     1 
ATOM   7018  C  CB    . VAL C  1 127 ? 6.716   -22.632 -58.258 1.00 17.62 ? 138 VAL C CB    1 
ATOM   7019  C  CG1   . VAL C  1 127 ? 5.680   -23.628 -57.778 1.00 16.46 ? 138 VAL C CG1   1 
ATOM   7020  C  CG2   . VAL C  1 127 ? 6.042   -21.343 -58.717 1.00 18.36 ? 138 VAL C CG2   1 
ATOM   7021  N  N     . ASN C  1 128 ? 8.267   -24.262 -55.697 1.00 13.33 ? 139 ASN C N     1 
ATOM   7022  C  CA    . ASN C  1 128 ? 8.881   -25.529 -55.300 1.00 13.01 ? 139 ASN C CA    1 
ATOM   7023  C  C     . ASN C  1 128 ? 7.827   -26.366 -54.604 1.00 16.40 ? 139 ASN C C     1 
ATOM   7024  O  O     . ASN C  1 128 ? 7.675   -26.291 -53.377 1.00 14.00 ? 139 ASN C O     1 
ATOM   7025  C  CB    . ASN C  1 128 ? 10.106  -25.322 -54.366 1.00 12.60 ? 139 ASN C CB    1 
ATOM   7026  C  CG    . ASN C  1 128 ? 10.732  -26.640 -53.953 1.00 25.35 ? 139 ASN C CG    1 
ATOM   7027  O  OD1   . ASN C  1 128 ? 10.739  -27.600 -54.718 1.00 18.32 ? 139 ASN C OD1   1 
ATOM   7028  N  ND2   . ASN C  1 128 ? 11.248  -26.745 -52.729 1.00 17.21 ? 139 ASN C ND2   1 
ATOM   7029  N  N     . TRP C  1 129 ? 7.094   -27.174 -55.383 1.00 14.61 ? 140 TRP C N     1 
ATOM   7030  C  CA    . TRP C  1 129 ? 6.040   -28.021 -54.823 1.00 14.77 ? 140 TRP C CA    1 
ATOM   7031  C  C     . TRP C  1 129 ? 6.559   -29.156 -53.914 1.00 16.89 ? 140 TRP C C     1 
ATOM   7032  O  O     . TRP C  1 129 ? 5.792   -29.691 -53.105 1.00 15.92 ? 140 TRP C O     1 
ATOM   7033  C  CB    . TRP C  1 129 ? 5.130   -28.562 -55.926 1.00 13.75 ? 140 TRP C CB    1 
ATOM   7034  C  CG    . TRP C  1 129 ? 4.385   -27.501 -56.700 1.00 14.61 ? 140 TRP C CG    1 
ATOM   7035  C  CD1   . TRP C  1 129 ? 4.317   -27.379 -58.056 1.00 17.15 ? 140 TRP C CD1   1 
ATOM   7036  C  CD2   . TRP C  1 129 ? 3.622   -26.397 -56.155 1.00 14.43 ? 140 TRP C CD2   1 
ATOM   7037  N  NE1   . TRP C  1 129 ? 3.530   -26.293 -58.395 1.00 16.69 ? 140 TRP C NE1   1 
ATOM   7038  C  CE2   . TRP C  1 129 ? 3.070   -25.692 -57.244 1.00 18.46 ? 140 TRP C CE2   1 
ATOM   7039  C  CE3   . TRP C  1 129 ? 3.318   -25.962 -54.842 1.00 15.56 ? 140 TRP C CE3   1 
ATOM   7040  C  CZ2   . TRP C  1 129 ? 2.272   -24.545 -57.067 1.00 17.82 ? 140 TRP C CZ2   1 
ATOM   7041  C  CZ3   . TRP C  1 129 ? 2.541   -24.820 -54.670 1.00 16.68 ? 140 TRP C CZ3   1 
ATOM   7042  C  CH2   . TRP C  1 129 ? 2.003   -24.145 -55.770 1.00 17.44 ? 140 TRP C CH2   1 
ATOM   7043  N  N     . ALA C  1 130 ? 7.863   -29.471 -54.006 1.00 13.33 ? 141 ALA C N     1 
ATOM   7044  C  CA    . ALA C  1 130 ? 8.494   -30.493 -53.155 1.00 14.34 ? 141 ALA C CA    1 
ATOM   7045  C  C     . ALA C  1 130 ? 8.873   -29.914 -51.767 1.00 15.85 ? 141 ALA C C     1 
ATOM   7046  O  O     . ALA C  1 130 ? 9.296   -30.660 -50.876 1.00 15.89 ? 141 ALA C O     1 
ATOM   7047  C  CB    . ALA C  1 130 ? 9.722   -31.065 -53.846 1.00 15.37 ? 141 ALA C CB    1 
ATOM   7048  N  N     . GLY C  1 131 ? 8.717   -28.600 -51.603 1.00 12.37 ? 142 GLY C N     1 
ATOM   7049  C  CA    . GLY C  1 131 ? 8.996   -27.919 -50.335 1.00 11.99 ? 142 GLY C CA    1 
ATOM   7050  C  C     . GLY C  1 131 ? 7.747   -27.665 -49.508 1.00 16.02 ? 142 GLY C C     1 
ATOM   7051  O  O     . GLY C  1 131 ? 6.697   -28.267 -49.775 1.00 12.37 ? 142 GLY C O     1 
ATOM   7052  N  N     . GLY C  1 132 ? 7.874   -26.807 -48.477 1.00 13.39 ? 143 GLY C N     1 
ATOM   7053  C  CA    . GLY C  1 132 ? 6.760   -26.470 -47.580 1.00 13.10 ? 143 GLY C CA    1 
ATOM   7054  C  C     . GLY C  1 132 ? 6.586   -27.405 -46.393 1.00 15.11 ? 143 GLY C C     1 
ATOM   7055  O  O     . GLY C  1 132 ? 5.502   -27.478 -45.781 1.00 14.86 ? 143 GLY C O     1 
ATOM   7056  N  N     . LEU C  1 133 ? 7.681   -28.071 -45.999 1.00 10.82 ? 144 LEU C N     1 
ATOM   7057  C  CA    . LEU C  1 133 ? 7.639   -29.042 -44.909 1.00 10.86 ? 144 LEU C CA    1 
ATOM   7058  C  C     . LEU C  1 133 ? 7.780   -28.354 -43.540 1.00 13.34 ? 144 LEU C C     1 
ATOM   7059  O  O     . LEU C  1 133 ? 8.780   -28.457 -42.820 1.00 10.94 ? 144 LEU C O     1 
ATOM   7060  C  CB    A LEU C  1 133 ? 8.578   -30.231 -45.169 1.00 10.88 ? 144 LEU C CB    1 
ATOM   7061  C  CG    A LEU C  1 133 ? 8.326   -30.967 -46.533 1.00 15.09 ? 144 LEU C CG    1 
ATOM   7062  C  CD1   A LEU C  1 133 ? 9.186   -32.225 -46.646 1.00 15.49 ? 144 LEU C CD1   1 
ATOM   7063  C  CD2   A LEU C  1 133 ? 6.813   -31.323 -46.750 1.00 11.90 ? 144 LEU C CD2   1 
ATOM   7064  N  N     . HIS C  1 134 ? 6.704   -27.614 -43.223 1.00 10.29 ? 145 HIS C N     1 
ATOM   7065  C  CA    . HIS C  1 134 ? 6.578   -26.685 -42.116 1.00 8.80  ? 145 HIS C CA    1 
ATOM   7066  C  C     . HIS C  1 134 ? 6.770   -27.158 -40.688 1.00 11.59 ? 145 HIS C C     1 
ATOM   7067  O  O     . HIS C  1 134 ? 7.009   -26.299 -39.848 1.00 10.99 ? 145 HIS C O     1 
ATOM   7068  C  CB    . HIS C  1 134 ? 5.300   -25.808 -42.262 1.00 9.53  ? 145 HIS C CB    1 
ATOM   7069  C  CG    . HIS C  1 134 ? 3.990   -26.553 -42.199 1.00 11.40 ? 145 HIS C CG    1 
ATOM   7070  N  ND1   . HIS C  1 134 ? 2.785   -25.869 -42.124 1.00 12.04 ? 145 HIS C ND1   1 
ATOM   7071  C  CD2   . HIS C  1 134 ? 3.729   -27.876 -42.296 1.00 12.40 ? 145 HIS C CD2   1 
ATOM   7072  C  CE1   . HIS C  1 134 ? 1.844   -26.797 -42.118 1.00 12.02 ? 145 HIS C CE1   1 
ATOM   7073  N  NE2   . HIS C  1 134 ? 2.367   -28.020 -42.215 1.00 12.13 ? 145 HIS C NE2   1 
ATOM   7074  N  N     . HIS C  1 135 ? 6.670   -28.472 -40.394 1.00 8.15  ? 146 HIS C N     1 
ATOM   7075  C  CA    . HIS C  1 135 ? 6.789   -28.931 -38.991 1.00 9.33  ? 146 HIS C CA    1 
ATOM   7076  C  C     . HIS C  1 135 ? 8.195   -29.181 -38.485 1.00 13.53 ? 146 HIS C C     1 
ATOM   7077  O  O     . HIS C  1 135 ? 8.381   -29.245 -37.271 1.00 12.77 ? 146 HIS C O     1 
ATOM   7078  C  CB    . HIS C  1 135 ? 5.956   -30.197 -38.738 1.00 9.73  ? 146 HIS C CB    1 
ATOM   7079  C  CG    . HIS C  1 135 ? 4.507   -30.063 -39.096 1.00 12.69 ? 146 HIS C CG    1 
ATOM   7080  N  ND1   . HIS C  1 135 ? 3.686   -29.110 -38.497 1.00 14.25 ? 146 HIS C ND1   1 
ATOM   7081  C  CD2   . HIS C  1 135 ? 3.770   -30.793 -39.968 1.00 13.45 ? 146 HIS C CD2   1 
ATOM   7082  C  CE1   . HIS C  1 135 ? 2.488   -29.276 -39.057 1.00 13.52 ? 146 HIS C CE1   1 
ATOM   7083  N  NE2   . HIS C  1 135 ? 2.497   -30.282 -39.942 1.00 12.96 ? 146 HIS C NE2   1 
ATOM   7084  N  N     . ALA C  1 136 ? 9.170   -29.402 -39.383 1.00 11.29 ? 147 ALA C N     1 
ATOM   7085  C  CA    . ALA C  1 136 ? 10.524  -29.746 -38.922 1.00 12.37 ? 147 ALA C CA    1 
ATOM   7086  C  C     . ALA C  1 136 ? 11.112  -28.668 -38.004 1.00 14.43 ? 147 ALA C C     1 
ATOM   7087  O  O     . ALA C  1 136 ? 11.028  -27.475 -38.309 1.00 12.12 ? 147 ALA C O     1 
ATOM   7088  C  CB    . ALA C  1 136 ? 11.429  -30.042 -40.106 1.00 13.63 ? 147 ALA C CB    1 
ATOM   7089  N  N     . LYS C  1 137 ? 11.667  -29.104 -36.850 1.00 11.85 ? 148 LYS C N     1 
ATOM   7090  C  CA    . LYS C  1 137 ? 12.280  -28.234 -35.833 1.00 11.01 ? 148 LYS C CA    1 
ATOM   7091  C  C     . LYS C  1 137 ? 13.813  -28.343 -35.853 1.00 15.62 ? 148 LYS C C     1 
ATOM   7092  O  O     . LYS C  1 137 ? 14.357  -29.183 -36.569 1.00 14.03 ? 148 LYS C O     1 
ATOM   7093  C  CB    . LYS C  1 137 ? 11.757  -28.620 -34.431 1.00 13.43 ? 148 LYS C CB    1 
ATOM   7094  C  CG    . LYS C  1 137 ? 10.266  -28.963 -34.380 1.00 23.75 ? 148 LYS C CG    1 
ATOM   7095  C  CD    . LYS C  1 137 ? 9.379   -27.741 -34.337 1.00 27.27 ? 148 LYS C CD    1 
ATOM   7096  C  CE    . LYS C  1 137 ? 7.996   -28.038 -33.756 1.00 31.13 ? 148 LYS C CE    1 
ATOM   7097  N  NZ    . LYS C  1 137 ? 7.200   -28.991 -34.605 1.00 30.59 ? 148 LYS C NZ    1 
ATOM   7098  N  N     . LYS C  1 138 ? 14.515  -27.526 -35.029 1.00 12.45 ? 149 LYS C N     1 
ATOM   7099  C  CA    . LYS C  1 138 ? 15.988  -27.516 -35.026 1.00 11.15 ? 149 LYS C CA    1 
ATOM   7100  C  C     . LYS C  1 138 ? 16.551  -28.931 -34.872 1.00 13.85 ? 149 LYS C C     1 
ATOM   7101  O  O     . LYS C  1 138 ? 17.491  -29.306 -35.587 1.00 14.99 ? 149 LYS C O     1 
ATOM   7102  C  CB    . LYS C  1 138 ? 16.542  -26.600 -33.902 1.00 12.96 ? 149 LYS C CB    1 
ATOM   7103  C  CG    . LYS C  1 138 ? 16.190  -25.109 -34.076 1.00 18.30 ? 149 LYS C CG    1 
ATOM   7104  C  CD    . LYS C  1 138 ? 16.623  -24.271 -32.842 1.00 27.61 ? 149 LYS C CD    1 
ATOM   7105  C  CE    . LYS C  1 138 ? 16.311  -22.788 -32.980 1.00 32.59 ? 149 LYS C CE    1 
ATOM   7106  N  NZ    . LYS C  1 138 ? 14.840  -22.510 -32.993 1.00 28.44 ? 149 LYS C NZ    1 
ATOM   7107  N  N     . SER C  1 139 ? 15.983  -29.716 -33.953 1.00 10.67 ? 150 SER C N     1 
ATOM   7108  C  CA    . SER C  1 139 ? 16.501  -31.073 -33.715 1.00 11.51 ? 150 SER C CA    1 
ATOM   7109  C  C     . SER C  1 139 ? 15.388  -32.090 -33.547 1.00 15.68 ? 150 SER C C     1 
ATOM   7110  O  O     . SER C  1 139 ? 15.467  -32.977 -32.685 1.00 14.80 ? 150 SER C O     1 
ATOM   7111  C  CB    . SER C  1 139 ? 17.429  -31.072 -32.501 1.00 17.14 ? 150 SER C CB    1 
ATOM   7112  O  OG    . SER C  1 139 ? 16.671  -30.637 -31.385 1.00 29.45 ? 150 SER C OG    1 
ATOM   7113  N  N     . GLU C  1 140 ? 14.361  -31.991 -34.402 1.00 12.12 ? 151 GLU C N     1 
ATOM   7114  C  CA    . GLU C  1 140 ? 13.236  -32.888 -34.331 1.00 12.44 ? 151 GLU C CA    1 
ATOM   7115  C  C     . GLU C  1 140 ? 12.435  -32.930 -35.636 1.00 17.61 ? 151 GLU C C     1 
ATOM   7116  O  O     . GLU C  1 140 ? 12.043  -31.873 -36.184 1.00 16.85 ? 151 GLU C O     1 
ATOM   7117  C  CB    . GLU C  1 140 ? 12.293  -32.420 -33.207 1.00 14.47 ? 151 GLU C CB    1 
ATOM   7118  C  CG    . GLU C  1 140 ? 11.385  -33.528 -32.713 1.00 25.31 ? 151 GLU C CG    1 
ATOM   7119  C  CD    . GLU C  1 140 ? 10.225  -33.124 -31.824 1.00 40.06 ? 151 GLU C CD    1 
ATOM   7120  O  OE1   . GLU C  1 140 ? 9.894   -31.920 -31.765 1.00 26.89 ? 151 GLU C OE1   1 
ATOM   7121  O  OE2   . GLU C  1 140 ? 9.598   -34.034 -31.240 1.00 38.89 ? 151 GLU C OE2   1 
ATOM   7122  N  N     . ALA C  1 141 ? 12.181  -34.160 -36.113 1.00 13.06 ? 152 ALA C N     1 
ATOM   7123  C  CA    . ALA C  1 141 ? 11.274  -34.435 -37.224 1.00 12.33 ? 152 ALA C CA    1 
ATOM   7124  C  C     . ALA C  1 141 ? 9.865   -34.401 -36.616 1.00 15.26 ? 152 ALA C C     1 
ATOM   7125  O  O     . ALA C  1 141 ? 9.672   -34.701 -35.426 1.00 14.21 ? 152 ALA C O     1 
ATOM   7126  C  CB    . ALA C  1 141 ? 11.540  -35.819 -37.800 1.00 13.06 ? 152 ALA C CB    1 
ATOM   7127  N  N     . SER C  1 142 ? 8.869   -34.081 -37.442 1.00 13.30 ? 153 SER C N     1 
ATOM   7128  C  CA    . SER C  1 142 ? 7.498   -33.967 -36.982 1.00 13.14 ? 153 SER C CA    1 
ATOM   7129  C  C     . SER C  1 142 ? 6.564   -33.946 -38.201 1.00 14.33 ? 153 SER C C     1 
ATOM   7130  O  O     . SER C  1 142 ? 6.905   -33.321 -39.192 1.00 12.04 ? 153 SER C O     1 
ATOM   7131  C  CB    . SER C  1 142 ? 7.344   -32.628 -36.251 1.00 15.23 ? 153 SER C CB    1 
ATOM   7132  O  OG    . SER C  1 142 ? 6.073   -32.566 -35.644 1.00 26.92 ? 153 SER C OG    1 
ATOM   7133  N  N     . GLY C  1 143 ? 5.387   -34.557 -38.091 1.00 12.60 ? 154 GLY C N     1 
ATOM   7134  C  CA    . GLY C  1 143 ? 4.357   -34.527 -39.138 1.00 12.45 ? 154 GLY C CA    1 
ATOM   7135  C  C     . GLY C  1 143 ? 4.827   -34.725 -40.566 1.00 15.87 ? 154 GLY C C     1 
ATOM   7136  O  O     . GLY C  1 143 ? 4.486   -33.935 -41.462 1.00 15.50 ? 154 GLY C O     1 
ATOM   7137  N  N     . PHE C  1 144 ? 5.637   -35.786 -40.790 1.00 12.89 ? 155 PHE C N     1 
ATOM   7138  C  CA    . PHE C  1 144 ? 6.173   -36.185 -42.113 1.00 11.85 ? 155 PHE C CA    1 
ATOM   7139  C  C     . PHE C  1 144 ? 7.265   -35.238 -42.679 1.00 14.38 ? 155 PHE C C     1 
ATOM   7140  O  O     . PHE C  1 144 ? 7.668   -35.398 -43.836 1.00 14.36 ? 155 PHE C O     1 
ATOM   7141  C  CB    . PHE C  1 144 ? 5.028   -36.363 -43.150 1.00 13.21 ? 155 PHE C CB    1 
ATOM   7142  C  CG    . PHE C  1 144 ? 3.714   -36.976 -42.670 1.00 13.91 ? 155 PHE C CG    1 
ATOM   7143  C  CD1   . PHE C  1 144 ? 3.697   -37.931 -41.656 1.00 14.88 ? 155 PHE C CD1   1 
ATOM   7144  C  CD2   . PHE C  1 144 ? 2.512   -36.658 -43.290 1.00 16.25 ? 155 PHE C CD2   1 
ATOM   7145  C  CE1   . PHE C  1 144 ? 2.504   -38.512 -41.233 1.00 14.79 ? 155 PHE C CE1   1 
ATOM   7146  C  CE2   . PHE C  1 144 ? 1.313   -37.271 -42.886 1.00 18.16 ? 155 PHE C CE2   1 
ATOM   7147  C  CZ    . PHE C  1 144 ? 1.321   -38.192 -41.860 1.00 14.88 ? 155 PHE C CZ    1 
ATOM   7148  N  N     . CYS C  1 145 ? 7.713   -34.252 -41.873 1.00 10.96 ? 156 CYS C N     1 
ATOM   7149  C  CA    . CYS C  1 145 ? 8.716   -33.226 -42.224 1.00 10.07 ? 156 CYS C CA    1 
ATOM   7150  C  C     . CYS C  1 145 ? 10.021  -33.528 -41.499 1.00 14.17 ? 156 CYS C C     1 
ATOM   7151  O  O     . CYS C  1 145 ? 9.992   -33.756 -40.288 1.00 15.45 ? 156 CYS C O     1 
ATOM   7152  C  CB    . CYS C  1 145 ? 8.204   -31.834 -41.844 1.00 10.20 ? 156 CYS C CB    1 
ATOM   7153  S  SG    . CYS C  1 145 ? 6.574   -31.428 -42.516 1.00 13.46 ? 156 CYS C SG    1 
ATOM   7154  N  N     . TYR C  1 146 ? 11.174  -33.466 -42.193 1.00 11.06 ? 157 TYR C N     1 
ATOM   7155  C  CA    . TYR C  1 146 ? 12.436  -33.776 -41.488 1.00 11.03 ? 157 TYR C CA    1 
ATOM   7156  C  C     . TYR C  1 146 ? 13.356  -32.567 -41.484 1.00 13.05 ? 157 TYR C C     1 
ATOM   7157  O  O     . TYR C  1 146 ? 13.948  -32.252 -40.452 1.00 13.42 ? 157 TYR C O     1 
ATOM   7158  C  CB    . TYR C  1 146 ? 13.168  -34.968 -42.125 1.00 11.34 ? 157 TYR C CB    1 
ATOM   7159  C  CG    . TYR C  1 146 ? 12.334  -36.229 -42.251 1.00 11.58 ? 157 TYR C CG    1 
ATOM   7160  C  CD1   . TYR C  1 146 ? 11.382  -36.364 -43.267 1.00 12.88 ? 157 TYR C CD1   1 
ATOM   7161  C  CD2   . TYR C  1 146 ? 12.502  -37.291 -41.363 1.00 11.46 ? 157 TYR C CD2   1 
ATOM   7162  C  CE1   . TYR C  1 146 ? 10.594  -37.512 -43.371 1.00 12.52 ? 157 TYR C CE1   1 
ATOM   7163  C  CE2   . TYR C  1 146 ? 11.749  -38.462 -41.484 1.00 12.40 ? 157 TYR C CE2   1 
ATOM   7164  C  CZ    . TYR C  1 146 ? 10.800  -38.565 -42.494 1.00 17.75 ? 157 TYR C CZ    1 
ATOM   7165  O  OH    . TYR C  1 146 ? 10.051  -39.699 -42.620 1.00 16.37 ? 157 TYR C OH    1 
ATOM   7166  N  N     . VAL C  1 147 ? 13.457  -31.885 -42.623 1.00 10.35 ? 158 VAL C N     1 
ATOM   7167  C  CA    . VAL C  1 147 ? 14.277  -30.681 -42.751 1.00 10.42 ? 158 VAL C CA    1 
ATOM   7168  C  C     . VAL C  1 147 ? 13.360  -29.529 -43.129 1.00 13.61 ? 158 VAL C C     1 
ATOM   7169  O  O     . VAL C  1 147 ? 12.593  -29.613 -44.101 1.00 10.20 ? 158 VAL C O     1 
ATOM   7170  C  CB    . VAL C  1 147 ? 15.467  -30.886 -43.739 1.00 13.37 ? 158 VAL C CB    1 
ATOM   7171  C  CG1   . VAL C  1 147 ? 16.266  -29.588 -43.949 1.00 12.73 ? 158 VAL C CG1   1 
ATOM   7172  C  CG2   . VAL C  1 147 ? 16.387  -32.000 -43.237 1.00 12.59 ? 158 VAL C CG2   1 
ATOM   7173  N  N     . ASN C  1 148 ? 13.470  -28.443 -42.376 1.00 12.20 ? 159 ASN C N     1 
ATOM   7174  C  CA    . ASN C  1 148 ? 12.618  -27.294 -42.608 1.00 11.87 ? 159 ASN C CA    1 
ATOM   7175  C  C     . ASN C  1 148 ? 13.122  -26.430 -43.739 1.00 14.02 ? 159 ASN C C     1 
ATOM   7176  O  O     . ASN C  1 148 ? 13.817  -25.428 -43.526 1.00 11.81 ? 159 ASN C O     1 
ATOM   7177  C  CB    . ASN C  1 148 ? 12.316  -26.525 -41.327 1.00 11.38 ? 159 ASN C CB    1 
ATOM   7178  C  CG    . ASN C  1 148 ? 11.008  -25.783 -41.435 1.00 16.99 ? 159 ASN C CG    1 
ATOM   7179  O  OD1   . ASN C  1 148 ? 10.764  -25.085 -42.419 1.00 12.01 ? 159 ASN C OD1   1 
ATOM   7180  N  ND2   . ASN C  1 148 ? 10.155  -25.889 -40.419 1.00 12.49 ? 159 ASN C ND2   1 
ATOM   7181  N  N     . ASP C  1 149 ? 12.749  -26.826 -44.974 1.00 10.68 ? 160 ASP C N     1 
ATOM   7182  C  CA    . ASP C  1 149 ? 13.166  -26.108 -46.192 1.00 9.47  ? 160 ASP C CA    1 
ATOM   7183  C  C     . ASP C  1 149 ? 12.676  -24.649 -46.157 1.00 12.51 ? 160 ASP C C     1 
ATOM   7184  O  O     . ASP C  1 149 ? 13.371  -23.754 -46.648 1.00 12.43 ? 160 ASP C O     1 
ATOM   7185  C  CB    . ASP C  1 149 ? 12.604  -26.830 -47.429 1.00 10.01 ? 160 ASP C CB    1 
ATOM   7186  C  CG    . ASP C  1 149 ? 11.091  -26.775 -47.481 1.00 13.48 ? 160 ASP C CG    1 
ATOM   7187  O  OD1   . ASP C  1 149 ? 10.448  -27.505 -46.701 1.00 15.72 ? 160 ASP C OD1   1 
ATOM   7188  O  OD2   . ASP C  1 149 ? 10.554  -25.921 -48.225 1.00 13.87 ? 160 ASP C OD2   1 
ATOM   7189  N  N     . ILE C  1 150 ? 11.514  -24.409 -45.519 1.00 9.96  ? 161 ILE C N     1 
ATOM   7190  C  CA    . ILE C  1 150 ? 10.920  -23.069 -45.418 1.00 10.56 ? 161 ILE C CA    1 
ATOM   7191  C  C     . ILE C  1 150 ? 11.827  -22.119 -44.636 1.00 12.70 ? 161 ILE C C     1 
ATOM   7192  O  O     . ILE C  1 150 ? 12.146  -21.030 -45.123 1.00 12.30 ? 161 ILE C O     1 
ATOM   7193  C  CB    . ILE C  1 150 ? 9.511   -23.092 -44.793 1.00 13.27 ? 161 ILE C CB    1 
ATOM   7194  C  CG1   . ILE C  1 150 ? 8.610   -24.155 -45.446 1.00 14.11 ? 161 ILE C CG1   1 
ATOM   7195  C  CG2   . ILE C  1 150 ? 8.888   -21.671 -44.840 1.00 13.36 ? 161 ILE C CG2   1 
ATOM   7196  C  CD1   . ILE C  1 150 ? 7.199   -24.215 -44.845 1.00 10.10 ? 161 ILE C CD1   1 
ATOM   7197  N  N     . VAL C  1 151 ? 12.178  -22.512 -43.403 1.00 9.28  ? 162 VAL C N     1 
ATOM   7198  C  CA    . VAL C  1 151 ? 13.079  -21.745 -42.530 1.00 8.17  ? 162 VAL C CA    1 
ATOM   7199  C  C     . VAL C  1 151 ? 14.390  -21.472 -43.267 1.00 13.11 ? 162 VAL C C     1 
ATOM   7200  O  O     . VAL C  1 151 ? 14.870  -20.332 -43.265 1.00 12.46 ? 162 VAL C O     1 
ATOM   7201  C  CB    . VAL C  1 151 ? 13.302  -22.470 -41.177 1.00 11.83 ? 162 VAL C CB    1 
ATOM   7202  C  CG1   . VAL C  1 151 ? 14.336  -21.729 -40.312 1.00 11.54 ? 162 VAL C CG1   1 
ATOM   7203  C  CG2   . VAL C  1 151 ? 11.979  -22.619 -40.418 1.00 10.57 ? 162 VAL C CG2   1 
ATOM   7204  N  N     . LEU C  1 152 ? 14.960  -22.505 -43.921 1.00 11.07 ? 163 LEU C N     1 
ATOM   7205  C  CA    . LEU C  1 152 ? 16.207  -22.328 -44.679 1.00 9.83  ? 163 LEU C CA    1 
ATOM   7206  C  C     . LEU C  1 152 ? 16.062  -21.348 -45.851 1.00 12.33 ? 163 LEU C C     1 
ATOM   7207  O  O     . LEU C  1 152 ? 16.933  -20.498 -46.027 1.00 11.62 ? 163 LEU C O     1 
ATOM   7208  C  CB    . LEU C  1 152 ? 16.771  -23.669 -45.132 1.00 9.60  ? 163 LEU C CB    1 
ATOM   7209  C  CG    . LEU C  1 152 ? 17.256  -24.534 -43.939 1.00 12.26 ? 163 LEU C CG    1 
ATOM   7210  C  CD1   . LEU C  1 152 ? 17.450  -25.985 -44.354 1.00 12.77 ? 163 LEU C CD1   1 
ATOM   7211  C  CD2   . LEU C  1 152 ? 18.558  -23.972 -43.335 1.00 11.42 ? 163 LEU C CD2   1 
ATOM   7212  N  N     . ALA C  1 153 ? 14.943  -21.410 -46.592 1.00 10.12 ? 164 ALA C N     1 
ATOM   7213  C  CA    . ALA C  1 153 ? 14.692  -20.447 -47.684 1.00 11.83 ? 164 ALA C CA    1 
ATOM   7214  C  C     . ALA C  1 153 ? 14.511  -19.040 -47.099 1.00 15.13 ? 164 ALA C C     1 
ATOM   7215  O  O     . ALA C  1 153 ? 15.012  -18.071 -47.682 1.00 13.36 ? 164 ALA C O     1 
ATOM   7216  C  CB    . ALA C  1 153 ? 13.441  -20.840 -48.453 1.00 12.78 ? 164 ALA C CB    1 
ATOM   7217  N  N     . ILE C  1 154 ? 13.819  -18.927 -45.924 1.00 11.45 ? 165 ILE C N     1 
ATOM   7218  C  CA    . ILE C  1 154 ? 13.602  -17.611 -45.308 1.00 11.29 ? 165 ILE C CA    1 
ATOM   7219  C  C     . ILE C  1 154 ? 14.927  -17.019 -44.817 1.00 14.17 ? 165 ILE C C     1 
ATOM   7220  O  O     . ILE C  1 154 ? 15.175  -15.831 -45.042 1.00 14.05 ? 165 ILE C O     1 
ATOM   7221  C  CB    . ILE C  1 154 ? 12.476  -17.606 -44.232 1.00 13.33 ? 165 ILE C CB    1 
ATOM   7222  C  CG1   . ILE C  1 154 ? 11.085  -17.839 -44.895 1.00 12.16 ? 165 ILE C CG1   1 
ATOM   7223  C  CG2   . ILE C  1 154 ? 12.471  -16.276 -43.445 1.00 11.96 ? 165 ILE C CG2   1 
ATOM   7224  C  CD1   . ILE C  1 154 ? 9.982   -18.195 -43.859 1.00 12.94 ? 165 ILE C CD1   1 
ATOM   7225  N  N     . LEU C  1 155 ? 15.795  -17.848 -44.207 1.00 11.58 ? 166 LEU C N     1 
ATOM   7226  C  CA    . LEU C  1 155 ? 17.120  -17.371 -43.792 1.00 11.43 ? 166 LEU C CA    1 
ATOM   7227  C  C     . LEU C  1 155 ? 17.854  -16.778 -45.009 1.00 14.29 ? 166 LEU C C     1 
ATOM   7228  O  O     . LEU C  1 155 ? 18.471  -15.717 -44.888 1.00 12.66 ? 166 LEU C O     1 
ATOM   7229  C  CB    . LEU C  1 155 ? 17.951  -18.482 -43.134 1.00 11.17 ? 166 LEU C CB    1 
ATOM   7230  C  CG    . LEU C  1 155 ? 17.477  -18.956 -41.737 1.00 15.69 ? 166 LEU C CG    1 
ATOM   7231  C  CD1   . LEU C  1 155 ? 18.378  -20.075 -41.197 1.00 15.06 ? 166 LEU C CD1   1 
ATOM   7232  C  CD2   . LEU C  1 155 ? 17.403  -17.787 -40.718 1.00 18.11 ? 166 LEU C CD2   1 
ATOM   7233  N  N     . GLU C  1 156 ? 17.750  -17.435 -46.179 1.00 11.65 ? 167 GLU C N     1 
ATOM   7234  C  CA    . GLU C  1 156 ? 18.361  -16.927 -47.423 1.00 12.12 ? 167 GLU C CA    1 
ATOM   7235  C  C     . GLU C  1 156 ? 17.733  -15.592 -47.841 1.00 17.04 ? 167 GLU C C     1 
ATOM   7236  O  O     . GLU C  1 156 ? 18.461  -14.636 -48.125 1.00 15.81 ? 167 GLU C O     1 
ATOM   7237  C  CB    . GLU C  1 156 ? 18.249  -17.967 -48.565 1.00 14.13 ? 167 GLU C CB    1 
ATOM   7238  C  CG    . GLU C  1 156 ? 18.964  -17.559 -49.863 1.00 17.58 ? 167 GLU C CG    1 
ATOM   7239  C  CD    . GLU C  1 156 ? 20.464  -17.325 -49.761 1.00 32.48 ? 167 GLU C CD    1 
ATOM   7240  O  OE1   . GLU C  1 156 ? 21.005  -16.544 -50.578 1.00 29.05 ? 167 GLU C OE1   1 
ATOM   7241  O  OE2   . GLU C  1 156 ? 21.095  -17.899 -48.846 1.00 21.76 ? 167 GLU C OE2   1 
ATOM   7242  N  N     . LEU C  1 157 ? 16.377  -15.496 -47.804 1.00 13.70 ? 168 LEU C N     1 
ATOM   7243  C  CA    . LEU C  1 157 ? 15.678  -14.241 -48.144 1.00 12.90 ? 168 LEU C CA    1 
ATOM   7244  C  C     . LEU C  1 157 ? 16.078  -13.100 -47.219 1.00 14.43 ? 168 LEU C C     1 
ATOM   7245  O  O     . LEU C  1 157 ? 16.243  -11.973 -47.683 1.00 13.13 ? 168 LEU C O     1 
ATOM   7246  C  CB    . LEU C  1 157 ? 14.156  -14.413 -48.103 1.00 12.61 ? 168 LEU C CB    1 
ATOM   7247  C  CG    . LEU C  1 157 ? 13.521  -15.270 -49.204 1.00 15.53 ? 168 LEU C CG    1 
ATOM   7248  C  CD1   . LEU C  1 157 ? 12.041  -15.446 -48.934 1.00 15.09 ? 168 LEU C CD1   1 
ATOM   7249  C  CD2   . LEU C  1 157 ? 13.710  -14.621 -50.592 1.00 17.28 ? 168 LEU C CD2   1 
ATOM   7250  N  N     . LEU C  1 158 ? 16.293  -13.401 -45.932 1.00 9.84  ? 169 LEU C N     1 
ATOM   7251  C  CA    . LEU C  1 158 ? 16.693  -12.408 -44.928 1.00 10.10 ? 169 LEU C CA    1 
ATOM   7252  C  C     . LEU C  1 158 ? 18.016  -11.714 -45.202 1.00 15.04 ? 169 LEU C C     1 
ATOM   7253  O  O     . LEU C  1 158 ? 18.283  -10.659 -44.633 1.00 14.79 ? 169 LEU C O     1 
ATOM   7254  C  CB    . LEU C  1 158 ? 16.649  -12.997 -43.521 1.00 9.81  ? 169 LEU C CB    1 
ATOM   7255  C  CG    . LEU C  1 158 ? 15.254  -13.207 -42.964 1.00 12.91 ? 169 LEU C CG    1 
ATOM   7256  C  CD1   . LEU C  1 158 ? 15.318  -14.042 -41.700 1.00 12.02 ? 169 LEU C CD1   1 
ATOM   7257  C  CD2   . LEU C  1 158 ? 14.530  -11.850 -42.718 1.00 15.66 ? 169 LEU C CD2   1 
ATOM   7258  N  N     . LYS C  1 159 ? 18.855  -12.306 -46.069 1.00 11.38 ? 170 LYS C N     1 
ATOM   7259  C  CA    . LYS C  1 159 ? 20.116  -11.652 -46.454 1.00 11.86 ? 170 LYS C CA    1 
ATOM   7260  C  C     . LYS C  1 159 ? 19.830  -10.380 -47.302 1.00 17.51 ? 170 LYS C C     1 
ATOM   7261  O  O     . LYS C  1 159 ? 20.623  -9.432  -47.273 1.00 17.12 ? 170 LYS C O     1 
ATOM   7262  C  CB    . LYS C  1 159 ? 20.983  -12.646 -47.262 1.00 12.78 ? 170 LYS C CB    1 
ATOM   7263  C  CG    . LYS C  1 159 ? 21.659  -13.675 -46.369 1.00 22.32 ? 170 LYS C CG    1 
ATOM   7264  C  CD    . LYS C  1 159 ? 21.854  -15.017 -47.075 1.00 30.84 ? 170 LYS C CD    1 
ATOM   7265  C  CE    . LYS C  1 159 ? 23.266  -15.201 -47.518 1.00 27.77 ? 170 LYS C CE    1 
ATOM   7266  N  NZ    . LYS C  1 159 ? 23.462  -16.501 -48.229 1.00 21.12 ? 170 LYS C NZ    1 
ATOM   7267  N  N     . TYR C  1 160 ? 18.714  -10.386 -48.085 1.00 14.78 ? 171 TYR C N     1 
ATOM   7268  C  CA    . TYR C  1 160 ? 18.357  -9.323  -49.037 1.00 14.78 ? 171 TYR C CA    1 
ATOM   7269  C  C     . TYR C  1 160 ? 17.046  -8.571  -48.705 1.00 20.97 ? 171 TYR C C     1 
ATOM   7270  O  O     . TYR C  1 160 ? 16.722  -7.579  -49.363 1.00 20.59 ? 171 TYR C O     1 
ATOM   7271  C  CB    . TYR C  1 160 ? 18.324  -9.883  -50.491 1.00 16.46 ? 171 TYR C CB    1 
ATOM   7272  C  CG    . TYR C  1 160 ? 19.685  -10.294 -51.034 1.00 18.85 ? 171 TYR C CG    1 
ATOM   7273  C  CD1   . TYR C  1 160 ? 20.364  -9.499  -51.956 1.00 21.69 ? 171 TYR C CD1   1 
ATOM   7274  C  CD2   . TYR C  1 160 ? 20.312  -11.457 -50.593 1.00 19.38 ? 171 TYR C CD2   1 
ATOM   7275  C  CE1   . TYR C  1 160 ? 21.646  -9.842  -52.405 1.00 20.88 ? 171 TYR C CE1   1 
ATOM   7276  C  CE2   . TYR C  1 160 ? 21.610  -11.780 -50.994 1.00 19.75 ? 171 TYR C CE2   1 
ATOM   7277  C  CZ    . TYR C  1 160 ? 22.269  -10.978 -51.908 1.00 28.67 ? 171 TYR C CZ    1 
ATOM   7278  O  OH    . TYR C  1 160 ? 23.536  -11.345 -52.323 1.00 31.21 ? 171 TYR C OH    1 
ATOM   7279  N  N     . HIS C  1 161 ? 16.305  -9.055  -47.702 1.00 15.77 ? 172 HIS C N     1 
ATOM   7280  C  CA    . HIS C  1 161 ? 15.014  -8.524  -47.317 1.00 15.34 ? 172 HIS C CA    1 
ATOM   7281  C  C     . HIS C  1 161 ? 14.947  -8.234  -45.849 1.00 17.61 ? 172 HIS C C     1 
ATOM   7282  O  O     . HIS C  1 161 ? 15.175  -9.124  -45.024 1.00 16.52 ? 172 HIS C O     1 
ATOM   7283  C  CB    . HIS C  1 161 ? 13.909  -9.505  -47.751 1.00 16.47 ? 172 HIS C CB    1 
ATOM   7284  C  CG    . HIS C  1 161 ? 13.857  -9.675  -49.240 1.00 19.94 ? 172 HIS C CG    1 
ATOM   7285  N  ND1   . HIS C  1 161 ? 14.561  -10.680 -49.873 1.00 21.96 ? 172 HIS C ND1   1 
ATOM   7286  C  CD2   . HIS C  1 161 ? 13.257  -8.906  -50.179 1.00 21.81 ? 172 HIS C CD2   1 
ATOM   7287  C  CE1   . HIS C  1 161 ? 14.316  -10.539 -51.169 1.00 21.00 ? 172 HIS C CE1   1 
ATOM   7288  N  NE2   . HIS C  1 161 ? 13.557  -9.473  -51.405 1.00 21.77 ? 172 HIS C NE2   1 
ATOM   7289  N  N     . GLN C  1 162 ? 14.617  -6.975  -45.500 1.00 15.58 ? 173 GLN C N     1 
ATOM   7290  C  CA    . GLN C  1 162 ? 14.525  -6.586  -44.098 1.00 15.88 ? 173 GLN C CA    1 
ATOM   7291  C  C     . GLN C  1 162 ? 13.369  -7.308  -43.404 1.00 17.70 ? 173 GLN C C     1 
ATOM   7292  O  O     . GLN C  1 162 ? 13.497  -7.692  -42.244 1.00 15.35 ? 173 GLN C O     1 
ATOM   7293  C  CB    A GLN C  1 162 ? 14.403  -5.051  -43.948 0.77 17.58 ? 173 GLN C CB    1 
ATOM   7294  C  CG    A GLN C  1 162 ? 15.729  -4.332  -44.216 0.77 42.16 ? 173 GLN C CG    1 
ATOM   7295  C  CD    A GLN C  1 162 ? 15.640  -2.832  -44.435 0.77 70.68 ? 173 GLN C CD    1 
ATOM   7296  O  OE1   A GLN C  1 162 ? 14.570  -2.246  -44.660 0.77 67.99 ? 173 GLN C OE1   1 
ATOM   7297  N  NE2   A GLN C  1 162 ? 16.791  -2.176  -44.415 0.77 63.57 ? 173 GLN C NE2   1 
ATOM   7298  N  N     . ARG C  1 163 ? 12.238  -7.468  -44.114 1.00 14.76 ? 174 ARG C N     1 
ATOM   7299  C  CA    . ARG C  1 163 ? 11.040  -8.102  -43.571 1.00 14.13 ? 174 ARG C CA    1 
ATOM   7300  C  C     . ARG C  1 163 ? 10.477  -9.104  -44.546 1.00 17.93 ? 174 ARG C C     1 
ATOM   7301  O  O     . ARG C  1 163 ? 10.237  -8.790  -45.722 1.00 18.61 ? 174 ARG C O     1 
ATOM   7302  C  CB    . ARG C  1 163 ? 9.968   -7.064  -43.232 1.00 14.24 ? 174 ARG C CB    1 
ATOM   7303  C  CG    . ARG C  1 163 ? 10.314  -6.151  -42.043 1.00 19.53 ? 174 ARG C CG    1 
ATOM   7304  C  CD    . ARG C  1 163 ? 9.216   -5.119  -41.786 1.00 21.62 ? 174 ARG C CD    1 
ATOM   7305  N  NE    . ARG C  1 163 ? 8.944   -4.319  -42.982 1.00 31.92 ? 174 ARG C NE    1 
ATOM   7306  C  CZ    . ARG C  1 163 ? 9.583   -3.199  -43.306 1.00 47.59 ? 174 ARG C CZ    1 
ATOM   7307  N  NH1   . ARG C  1 163 ? 9.299   -2.571  -44.439 1.00 31.38 ? 174 ARG C NH1   1 
ATOM   7308  N  NH2   . ARG C  1 163 ? 10.513  -2.701  -42.499 1.00 32.90 ? 174 ARG C NH2   1 
ATOM   7309  N  N     . VAL C  1 164 ? 10.256  -10.321 -44.041 1.00 13.26 ? 175 VAL C N     1 
ATOM   7310  C  CA    . VAL C  1 164 ? 9.696   -11.417 -44.835 1.00 12.53 ? 175 VAL C CA    1 
ATOM   7311  C  C     . VAL C  1 164 ? 8.376   -11.867 -44.210 1.00 14.70 ? 175 VAL C C     1 
ATOM   7312  O  O     . VAL C  1 164 ? 8.303   -12.093 -42.999 1.00 12.96 ? 175 VAL C O     1 
ATOM   7313  C  CB    . VAL C  1 164 ? 10.699  -12.602 -44.956 1.00 15.19 ? 175 VAL C CB    1 
ATOM   7314  C  CG1   . VAL C  1 164 ? 10.039  -13.809 -45.620 1.00 15.01 ? 175 VAL C CG1   1 
ATOM   7315  C  CG2   . VAL C  1 164 ? 11.948  -12.195 -45.728 1.00 14.29 ? 175 VAL C CG2   1 
ATOM   7316  N  N     . LEU C  1 165 ? 7.352   -12.029 -45.047 1.00 11.35 ? 176 LEU C N     1 
ATOM   7317  C  CA    . LEU C  1 165 ? 6.057   -12.490 -44.599 1.00 12.30 ? 176 LEU C CA    1 
ATOM   7318  C  C     . LEU C  1 165 ? 5.844   -13.936 -45.007 1.00 14.26 ? 176 LEU C C     1 
ATOM   7319  O  O     . LEU C  1 165 ? 5.981   -14.278 -46.176 1.00 13.92 ? 176 LEU C O     1 
ATOM   7320  C  CB    . LEU C  1 165 ? 4.940   -11.590 -45.184 1.00 12.39 ? 176 LEU C CB    1 
ATOM   7321  C  CG    . LEU C  1 165 ? 3.512   -12.015 -44.878 1.00 15.08 ? 176 LEU C CG    1 
ATOM   7322  C  CD1   . LEU C  1 165 ? 3.199   -11.924 -43.364 1.00 13.97 ? 176 LEU C CD1   1 
ATOM   7323  C  CD2   . LEU C  1 165 ? 2.534   -11.229 -45.698 1.00 16.43 ? 176 LEU C CD2   1 
ATOM   7324  N  N     . TYR C  1 166 ? 5.492   -14.775 -44.030 1.00 11.55 ? 177 TYR C N     1 
ATOM   7325  C  CA    . TYR C  1 166 ? 5.200   -16.184 -44.235 1.00 9.74  ? 177 TYR C CA    1 
ATOM   7326  C  C     . TYR C  1 166 ? 3.700   -16.429 -44.053 1.00 14.47 ? 177 TYR C C     1 
ATOM   7327  O  O     . TYR C  1 166 ? 3.133   -16.083 -43.009 1.00 13.44 ? 177 TYR C O     1 
ATOM   7328  C  CB    . TYR C  1 166 ? 6.030   -17.050 -43.278 1.00 9.45  ? 177 TYR C CB    1 
ATOM   7329  C  CG    . TYR C  1 166 ? 5.678   -18.514 -43.354 1.00 9.83  ? 177 TYR C CG    1 
ATOM   7330  C  CD1   . TYR C  1 166 ? 6.025   -19.278 -44.472 1.00 10.81 ? 177 TYR C CD1   1 
ATOM   7331  C  CD2   . TYR C  1 166 ? 4.976   -19.137 -42.327 1.00 9.86  ? 177 TYR C CD2   1 
ATOM   7332  C  CE1   . TYR C  1 166 ? 5.682   -20.626 -44.559 1.00 11.37 ? 177 TYR C CE1   1 
ATOM   7333  C  CE2   . TYR C  1 166 ? 4.656   -20.493 -42.391 1.00 10.36 ? 177 TYR C CE2   1 
ATOM   7334  C  CZ    . TYR C  1 166 ? 4.994   -21.227 -43.519 1.00 14.22 ? 177 TYR C CZ    1 
ATOM   7335  O  OH    . TYR C  1 166 ? 4.644   -22.551 -43.612 1.00 11.27 ? 177 TYR C OH    1 
ATOM   7336  N  N     . ILE C  1 167 ? 3.048   -17.000 -45.086 1.00 10.53 ? 178 ILE C N     1 
ATOM   7337  C  CA    . ILE C  1 167 ? 1.619   -17.326 -45.026 1.00 10.70 ? 178 ILE C CA    1 
ATOM   7338  C  C     . ILE C  1 167 ? 1.475   -18.826 -45.234 1.00 13.25 ? 178 ILE C C     1 
ATOM   7339  O  O     . ILE C  1 167 ? 2.104   -19.390 -46.143 1.00 12.77 ? 178 ILE C O     1 
ATOM   7340  C  CB    . ILE C  1 167 ? 0.763   -16.512 -46.035 1.00 13.76 ? 178 ILE C CB    1 
ATOM   7341  C  CG1   . ILE C  1 167 ? 1.041   -14.979 -45.921 1.00 13.60 ? 178 ILE C CG1   1 
ATOM   7342  C  CG2   . ILE C  1 167 ? -0.731  -16.841 -45.864 1.00 13.13 ? 178 ILE C CG2   1 
ATOM   7343  C  CD1   . ILE C  1 167 ? 0.568   -14.208 -47.127 1.00 15.49 ? 178 ILE C CD1   1 
ATOM   7344  N  N     . ASP C  1 168 ? 0.669   -19.463 -44.397 1.00 9.59  ? 179 ASP C N     1 
ATOM   7345  C  CA    . ASP C  1 168 ? 0.525   -20.913 -44.385 1.00 10.21 ? 179 ASP C CA    1 
ATOM   7346  C  C     . ASP C  1 168 ? -0.944  -21.294 -44.454 1.00 13.99 ? 179 ASP C C     1 
ATOM   7347  O  O     . ASP C  1 168 ? -1.650  -21.121 -43.469 1.00 13.15 ? 179 ASP C O     1 
ATOM   7348  C  CB    . ASP C  1 168 ? 1.193   -21.440 -43.082 1.00 11.82 ? 179 ASP C CB    1 
ATOM   7349  C  CG    . ASP C  1 168 ? 1.348   -22.943 -42.953 1.00 13.65 ? 179 ASP C CG    1 
ATOM   7350  O  OD1   . ASP C  1 168 ? 0.402   -23.665 -43.291 1.00 12.02 ? 179 ASP C OD1   1 
ATOM   7351  O  OD2   . ASP C  1 168 ? 2.410   -23.386 -42.476 1.00 12.25 ? 179 ASP C OD2   1 
ATOM   7352  N  N     . ILE C  1 169 ? -1.399  -21.815 -45.619 1.00 11.47 ? 180 ILE C N     1 
ATOM   7353  C  CA    . ILE C  1 169 ? -2.811  -22.206 -45.850 1.00 11.40 ? 180 ILE C CA    1 
ATOM   7354  C  C     . ILE C  1 169 ? -2.986  -23.706 -45.795 1.00 17.08 ? 180 ILE C C     1 
ATOM   7355  O  O     . ILE C  1 169 ? -4.062  -24.235 -46.089 1.00 15.42 ? 180 ILE C O     1 
ATOM   7356  C  CB    . ILE C  1 169 ? -3.426  -21.570 -47.125 1.00 13.77 ? 180 ILE C CB    1 
ATOM   7357  C  CG1   . ILE C  1 169 ? -2.774  -22.134 -48.421 1.00 14.46 ? 180 ILE C CG1   1 
ATOM   7358  C  CG2   . ILE C  1 169 ? -3.361  -20.045 -47.031 1.00 13.32 ? 180 ILE C CG2   1 
ATOM   7359  C  CD1   . ILE C  1 169 ? -3.429  -21.672 -49.762 1.00 16.22 ? 180 ILE C CD1   1 
ATOM   7360  N  N     . ASP C  1 170 ? -1.918  -24.403 -45.363 1.00 14.23 ? 181 ASP C N     1 
ATOM   7361  C  CA    . ASP C  1 170 ? -2.009  -25.847 -45.100 1.00 12.93 ? 181 ASP C CA    1 
ATOM   7362  C  C     . ASP C  1 170 ? -3.064  -25.992 -43.979 1.00 15.95 ? 181 ASP C C     1 
ATOM   7363  O  O     . ASP C  1 170 ? -3.228  -25.059 -43.165 1.00 15.04 ? 181 ASP C O     1 
ATOM   7364  C  CB    . ASP C  1 170 ? -0.644  -26.323 -44.569 1.00 13.56 ? 181 ASP C CB    1 
ATOM   7365  C  CG    . ASP C  1 170 ? -0.526  -27.820 -44.442 1.00 14.34 ? 181 ASP C CG    1 
ATOM   7366  O  OD1   . ASP C  1 170 ? 0.250   -28.426 -45.233 1.00 13.84 ? 181 ASP C OD1   1 
ATOM   7367  O  OD2   . ASP C  1 170 ? -1.163  -28.381 -43.533 1.00 10.44 ? 181 ASP C OD2   1 
ATOM   7368  N  N     . ILE C  1 171 ? -3.784  -27.136 -43.917 1.00 11.25 ? 182 ILE C N     1 
ATOM   7369  C  CA    . ILE C  1 171 ? -4.772  -27.337 -42.842 1.00 10.65 ? 182 ILE C CA    1 
ATOM   7370  C  C     . ILE C  1 171 ? -4.117  -27.384 -41.433 1.00 13.35 ? 182 ILE C C     1 
ATOM   7371  O  O     . ILE C  1 171 ? -4.788  -27.129 -40.436 1.00 13.26 ? 182 ILE C O     1 
ATOM   7372  C  CB    . ILE C  1 171 ? -5.719  -28.545 -43.093 1.00 13.28 ? 182 ILE C CB    1 
ATOM   7373  C  CG1   . ILE C  1 171 ? -6.983  -28.451 -42.177 1.00 13.99 ? 182 ILE C CG1   1 
ATOM   7374  C  CG2   . ILE C  1 171 ? -4.993  -29.890 -42.866 1.00 13.54 ? 182 ILE C CG2   1 
ATOM   7375  C  CD1   . ILE C  1 171 ? -8.023  -29.512 -42.451 1.00 13.87 ? 182 ILE C CD1   1 
ATOM   7376  N  N     . HIS C  1 172 ? -2.821  -27.733 -41.353 1.00 11.27 ? 183 HIS C N     1 
ATOM   7377  C  CA    . HIS C  1 172 ? -2.119  -27.843 -40.071 1.00 10.03 ? 183 HIS C CA    1 
ATOM   7378  C  C     . HIS C  1 172 ? -1.340  -26.574 -39.751 1.00 12.02 ? 183 HIS C C     1 
ATOM   7379  O  O     . HIS C  1 172 ? -0.880  -25.881 -40.657 1.00 11.38 ? 183 HIS C O     1 
ATOM   7380  C  CB    . HIS C  1 172 ? -1.178  -29.068 -40.068 1.00 10.48 ? 183 HIS C CB    1 
ATOM   7381  C  CG    . HIS C  1 172 ? -1.867  -30.353 -40.425 1.00 12.96 ? 183 HIS C CG    1 
ATOM   7382  N  ND1   . HIS C  1 172 ? -1.865  -30.838 -41.727 1.00 13.75 ? 183 HIS C ND1   1 
ATOM   7383  C  CD2   . HIS C  1 172 ? -2.558  -31.209 -39.632 1.00 15.02 ? 183 HIS C CD2   1 
ATOM   7384  C  CE1   . HIS C  1 172 ? -2.538  -31.984 -41.675 1.00 14.33 ? 183 HIS C CE1   1 
ATOM   7385  N  NE2   . HIS C  1 172 ? -2.989  -32.237 -40.436 1.00 15.06 ? 183 HIS C NE2   1 
ATOM   7386  N  N     . HIS C  1 173 ? -1.189  -26.280 -38.456 1.00 10.22 ? 184 HIS C N     1 
ATOM   7387  C  CA    . HIS C  1 173 ? -0.449  -25.114 -37.968 1.00 9.78  ? 184 HIS C CA    1 
ATOM   7388  C  C     . HIS C  1 173 ? 1.017   -25.193 -38.425 1.00 13.21 ? 184 HIS C C     1 
ATOM   7389  O  O     . HIS C  1 173 ? 1.640   -26.239 -38.254 1.00 13.34 ? 184 HIS C O     1 
ATOM   7390  C  CB    . HIS C  1 173 ? -0.490  -25.047 -36.429 1.00 9.72  ? 184 HIS C CB    1 
ATOM   7391  C  CG    . HIS C  1 173 ? 0.336   -23.924 -35.864 1.00 11.99 ? 184 HIS C CG    1 
ATOM   7392  N  ND1   . HIS C  1 173 ? 1.244   -24.137 -34.852 1.00 13.42 ? 184 HIS C ND1   1 
ATOM   7393  C  CD2   . HIS C  1 173 ? 0.330   -22.604 -36.184 1.00 12.77 ? 184 HIS C CD2   1 
ATOM   7394  C  CE1   . HIS C  1 173 ? 1.761   -22.944 -34.571 1.00 12.91 ? 184 HIS C CE1   1 
ATOM   7395  N  NE2   . HIS C  1 173 ? 1.231   -21.986 -35.339 1.00 12.52 ? 184 HIS C NE2   1 
ATOM   7396  N  N     . GLY C  1 174 ? 1.546   -24.083 -38.945 1.00 10.61 ? 185 GLY C N     1 
ATOM   7397  C  CA    . GLY C  1 174 ? 2.950   -23.979 -39.363 1.00 9.00  ? 185 GLY C CA    1 
ATOM   7398  C  C     . GLY C  1 174 ? 3.843   -23.767 -38.148 1.00 11.79 ? 185 GLY C C     1 
ATOM   7399  O  O     . GLY C  1 174 ? 4.529   -22.745 -38.042 1.00 11.35 ? 185 GLY C O     1 
ATOM   7400  N  N     . ASP C  1 175 ? 3.858   -24.738 -37.233 1.00 9.79  ? 186 ASP C N     1 
ATOM   7401  C  CA    . ASP C  1 175 ? 4.614   -24.645 -35.968 1.00 10.40 ? 186 ASP C CA    1 
ATOM   7402  C  C     . ASP C  1 175 ? 6.123   -24.491 -36.081 1.00 13.63 ? 186 ASP C C     1 
ATOM   7403  O  O     . ASP C  1 175 ? 6.692   -23.706 -35.323 1.00 12.84 ? 186 ASP C O     1 
ATOM   7404  C  CB    . ASP C  1 175 ? 4.261   -25.786 -34.986 1.00 12.29 ? 186 ASP C CB    1 
ATOM   7405  C  CG    . ASP C  1 175 ? 4.579   -27.186 -35.482 1.00 15.34 ? 186 ASP C CG    1 
ATOM   7406  O  OD1   . ASP C  1 175 ? 4.666   -28.102 -34.644 1.00 12.72 ? 186 ASP C OD1   1 
ATOM   7407  O  OD2   . ASP C  1 175 ? 4.748   -27.362 -36.709 1.00 16.01 ? 186 ASP C OD2   1 
ATOM   7408  N  N     . GLY C  1 176 ? 6.762   -25.244 -36.976 1.00 10.73 ? 187 GLY C N     1 
ATOM   7409  C  CA    . GLY C  1 176 ? 8.226   -25.199 -37.106 1.00 11.02 ? 187 GLY C CA    1 
ATOM   7410  C  C     . GLY C  1 176 ? 8.745   -23.855 -37.569 1.00 13.19 ? 187 GLY C C     1 
ATOM   7411  O  O     . GLY C  1 176 ? 9.769   -23.378 -37.083 1.00 13.54 ? 187 GLY C O     1 
ATOM   7412  N  N     . VAL C  1 177 ? 8.041   -23.241 -38.525 1.00 10.10 ? 188 VAL C N     1 
ATOM   7413  C  CA    . VAL C  1 177 ? 8.378   -21.923 -39.090 1.00 9.37  ? 188 VAL C CA    1 
ATOM   7414  C  C     . VAL C  1 177 ? 8.084   -20.849 -38.037 1.00 13.51 ? 188 VAL C C     1 
ATOM   7415  O  O     . VAL C  1 177 ? 8.923   -19.971 -37.784 1.00 12.32 ? 188 VAL C O     1 
ATOM   7416  C  CB    . VAL C  1 177 ? 7.623   -21.613 -40.404 1.00 11.31 ? 188 VAL C CB    1 
ATOM   7417  C  CG1   . VAL C  1 177 ? 8.172   -20.316 -41.034 1.00 10.50 ? 188 VAL C CG1   1 
ATOM   7418  C  CG2   . VAL C  1 177 ? 7.733   -22.783 -41.398 1.00 10.83 ? 188 VAL C CG2   1 
ATOM   7419  N  N     . GLU C  1 178 ? 6.900   -20.934 -37.411 1.00 10.40 ? 189 GLU C N     1 
ATOM   7420  C  CA    . GLU C  1 178 ? 6.532   -20.003 -36.354 1.00 10.56 ? 189 GLU C CA    1 
ATOM   7421  C  C     . GLU C  1 178 ? 7.586   -20.048 -35.222 1.00 12.98 ? 189 GLU C C     1 
ATOM   7422  O  O     . GLU C  1 178 ? 8.039   -19.001 -34.768 1.00 12.29 ? 189 GLU C O     1 
ATOM   7423  C  CB    . GLU C  1 178 ? 5.138   -20.354 -35.798 1.00 11.36 ? 189 GLU C CB    1 
ATOM   7424  C  CG    . GLU C  1 178 ? 4.738   -19.495 -34.605 1.00 14.33 ? 189 GLU C CG    1 
ATOM   7425  C  CD    . GLU C  1 178 ? 3.406   -19.925 -34.024 1.00 17.45 ? 189 GLU C CD    1 
ATOM   7426  O  OE1   . GLU C  1 178 ? 2.369   -19.592 -34.636 1.00 14.65 ? 189 GLU C OE1   1 
ATOM   7427  O  OE2   . GLU C  1 178 ? 3.397   -20.624 -32.985 1.00 16.79 ? 189 GLU C OE2   1 
ATOM   7428  N  N     . GLU C  1 179 ? 7.972   -21.250 -34.782 1.00 9.43  ? 190 GLU C N     1 
ATOM   7429  C  CA    . GLU C  1 179 ? 8.937   -21.377 -33.689 1.00 10.01 ? 190 GLU C CA    1 
ATOM   7430  C  C     . GLU C  1 179 ? 10.295  -20.774 -34.052 1.00 13.08 ? 190 GLU C C     1 
ATOM   7431  O  O     . GLU C  1 179 ? 10.870  -20.058 -33.233 1.00 12.43 ? 190 GLU C O     1 
ATOM   7432  C  CB    . GLU C  1 179 ? 9.111   -22.854 -33.281 1.00 11.58 ? 190 GLU C CB    1 
ATOM   7433  C  CG    . GLU C  1 179 ? 10.143  -23.058 -32.182 1.00 17.77 ? 190 GLU C CG    1 
ATOM   7434  C  CD    . GLU C  1 179 ? 10.446  -24.520 -31.954 1.00 28.42 ? 190 GLU C CD    1 
ATOM   7435  O  OE1   . GLU C  1 179 ? 10.982  -25.164 -32.878 1.00 23.46 ? 190 GLU C OE1   1 
ATOM   7436  O  OE2   . GLU C  1 179 ? 10.094  -25.036 -30.874 1.00 31.19 ? 190 GLU C OE2   1 
ATOM   7437  N  N     . ALA C  1 180 ? 10.796  -21.045 -35.269 1.00 9.85  ? 191 ALA C N     1 
ATOM   7438  C  CA    . ALA C  1 180 ? 12.088  -20.521 -35.746 1.00 9.59  ? 191 ALA C CA    1 
ATOM   7439  C  C     . ALA C  1 180 ? 12.149  -18.996 -35.628 1.00 13.87 ? 191 ALA C C     1 
ATOM   7440  O  O     . ALA C  1 180 ? 13.185  -18.453 -35.242 1.00 13.44 ? 191 ALA C O     1 
ATOM   7441  C  CB    . ALA C  1 180 ? 12.289  -20.900 -37.206 1.00 10.16 ? 191 ALA C CB    1 
ATOM   7442  N  N     . PHE C  1 181 ? 11.047  -18.315 -36.011 1.00 10.95 ? 192 PHE C N     1 
ATOM   7443  C  CA    . PHE C  1 181 ? 10.982  -16.847 -36.081 1.00 9.32  ? 192 PHE C CA    1 
ATOM   7444  C  C     . PHE C  1 181 ? 10.149  -16.198 -34.985 1.00 12.83 ? 192 PHE C C     1 
ATOM   7445  O  O     . PHE C  1 181 ? 9.776   -15.011 -35.094 1.00 9.77  ? 192 PHE C O     1 
ATOM   7446  C  CB    . PHE C  1 181 ? 10.497  -16.422 -37.476 1.00 10.14 ? 192 PHE C CB    1 
ATOM   7447  C  CG    . PHE C  1 181 ? 11.430  -16.908 -38.570 1.00 10.19 ? 192 PHE C CG    1 
ATOM   7448  C  CD1   . PHE C  1 181 ? 10.988  -17.817 -39.530 1.00 12.19 ? 192 PHE C CD1   1 
ATOM   7449  C  CD2   . PHE C  1 181 ? 12.786  -16.567 -38.557 1.00 11.93 ? 192 PHE C CD2   1 
ATOM   7450  C  CE1   . PHE C  1 181 ? 11.864  -18.332 -40.492 1.00 12.24 ? 192 PHE C CE1   1 
ATOM   7451  C  CE2   . PHE C  1 181 ? 13.662  -17.073 -39.531 1.00 13.88 ? 192 PHE C CE2   1 
ATOM   7452  C  CZ    . PHE C  1 181 ? 13.190  -17.943 -40.495 1.00 11.80 ? 192 PHE C CZ    1 
ATOM   7453  N  N     . TYR C  1 182 ? 9.910   -16.955 -33.904 1.00 10.97 ? 193 TYR C N     1 
ATOM   7454  C  CA    . TYR C  1 182 ? 9.032   -16.544 -32.799 1.00 10.53 ? 193 TYR C CA    1 
ATOM   7455  C  C     . TYR C  1 182 ? 9.460   -15.294 -32.083 1.00 13.04 ? 193 TYR C C     1 
ATOM   7456  O  O     . TYR C  1 182 ? 8.605   -14.554 -31.616 1.00 12.07 ? 193 TYR C O     1 
ATOM   7457  C  CB    . TYR C  1 182 ? 8.835   -17.671 -31.786 1.00 10.77 ? 193 TYR C CB    1 
ATOM   7458  C  CG    . TYR C  1 182 ? 7.504   -17.599 -31.070 1.00 11.91 ? 193 TYR C CG    1 
ATOM   7459  C  CD1   . TYR C  1 182 ? 7.440   -17.464 -29.686 1.00 12.70 ? 193 TYR C CD1   1 
ATOM   7460  C  CD2   . TYR C  1 182 ? 6.303   -17.677 -31.779 1.00 12.98 ? 193 TYR C CD2   1 
ATOM   7461  C  CE1   . TYR C  1 182 ? 6.209   -17.443 -29.017 1.00 16.09 ? 193 TYR C CE1   1 
ATOM   7462  C  CE2   . TYR C  1 182 ? 5.073   -17.681 -31.122 1.00 13.75 ? 193 TYR C CE2   1 
ATOM   7463  C  CZ    . TYR C  1 182 ? 5.029   -17.553 -29.741 1.00 19.64 ? 193 TYR C CZ    1 
ATOM   7464  O  OH    . TYR C  1 182 ? 3.810   -17.512 -29.112 1.00 16.44 ? 193 TYR C OH    1 
ATOM   7465  N  N     . THR C  1 183 ? 10.762  -15.031 -32.029 1.00 10.09 ? 194 THR C N     1 
ATOM   7466  C  CA    . THR C  1 183 ? 11.247  -13.867 -31.279 1.00 10.12 ? 194 THR C CA    1 
ATOM   7467  C  C     . THR C  1 183 ? 11.819  -12.788 -32.182 1.00 14.75 ? 194 THR C C     1 
ATOM   7468  O  O     . THR C  1 183 ? 12.554  -11.906 -31.698 1.00 14.53 ? 194 THR C O     1 
ATOM   7469  C  CB    . THR C  1 183 ? 12.240  -14.307 -30.166 1.00 14.27 ? 194 THR C CB    1 
ATOM   7470  O  OG1   . THR C  1 183 ? 13.417  -14.821 -30.786 1.00 13.47 ? 194 THR C OG1   1 
ATOM   7471  C  CG2   . THR C  1 183 ? 11.650  -15.335 -29.210 1.00 11.24 ? 194 THR C CG2   1 
ATOM   7472  N  N     . THR C  1 184 ? 11.491  -12.848 -33.479 1.00 11.57 ? 195 THR C N     1 
ATOM   7473  C  CA    . THR C  1 184 ? 11.923  -11.814 -34.413 1.00 11.97 ? 195 THR C CA    1 
ATOM   7474  C  C     . THR C  1 184 ? 10.773  -11.084 -35.067 1.00 14.02 ? 195 THR C C     1 
ATOM   7475  O  O     . THR C  1 184 ? 9.753   -11.690 -35.402 1.00 12.70 ? 195 THR C O     1 
ATOM   7476  C  CB    . THR C  1 184 ? 12.972  -12.309 -35.440 1.00 16.65 ? 195 THR C CB    1 
ATOM   7477  O  OG1   . THR C  1 184 ? 13.430  -11.170 -36.181 1.00 13.66 ? 195 THR C OG1   1 
ATOM   7478  C  CG2   . THR C  1 184 ? 12.409  -13.368 -36.410 1.00 11.12 ? 195 THR C CG2   1 
ATOM   7479  N  N     . ASP C  1 185 ? 10.985  -9.790  -35.324 1.00 11.25 ? 196 ASP C N     1 
ATOM   7480  C  CA    . ASP C  1 185 ? 10.030  -8.974  -36.060 1.00 12.66 ? 196 ASP C CA    1 
ATOM   7481  C  C     . ASP C  1 185 ? 10.442  -8.957  -37.537 1.00 15.95 ? 196 ASP C C     1 
ATOM   7482  O  O     . ASP C  1 185 ? 9.743   -8.376  -38.358 1.00 17.63 ? 196 ASP C O     1 
ATOM   7483  C  CB    . ASP C  1 185 ? 9.960   -7.536  -35.494 1.00 14.01 ? 196 ASP C CB    1 
ATOM   7484  C  CG    . ASP C  1 185 ? 11.271  -6.760  -35.477 1.00 19.93 ? 196 ASP C CG    1 
ATOM   7485  O  OD1   . ASP C  1 185 ? 12.307  -7.334  -35.858 1.00 20.18 ? 196 ASP C OD1   1 
ATOM   7486  O  OD2   . ASP C  1 185 ? 11.262  -5.597  -35.033 1.00 22.76 ? 196 ASP C OD2   1 
ATOM   7487  N  N     . ARG C  1 186 ? 11.573  -9.585  -37.876 1.00 11.47 ? 197 ARG C N     1 
ATOM   7488  C  CA    . ARG C  1 186 ? 12.049  -9.621  -39.280 1.00 12.12 ? 197 ARG C CA    1 
ATOM   7489  C  C     . ARG C  1 186 ? 11.329  -10.658 -40.097 1.00 13.21 ? 197 ARG C C     1 
ATOM   7490  O  O     . ARG C  1 186 ? 11.422  -10.649 -41.329 1.00 12.94 ? 197 ARG C O     1 
ATOM   7491  C  CB    . ARG C  1 186 ? 13.569  -9.817  -39.359 1.00 12.05 ? 197 ARG C CB    1 
ATOM   7492  C  CG    . ARG C  1 186 ? 14.311  -8.578  -38.852 1.00 19.39 ? 197 ARG C CG    1 
ATOM   7493  C  CD    . ARG C  1 186 ? 15.732  -8.545  -39.357 1.00 24.61 ? 197 ARG C CD    1 
ATOM   7494  N  NE    . ARG C  1 186 ? 15.814  -8.631  -40.820 1.00 16.36 ? 197 ARG C NE    1 
ATOM   7495  C  CZ    . ARG C  1 186 ? 16.880  -9.077  -41.472 1.00 24.73 ? 197 ARG C CZ    1 
ATOM   7496  N  NH1   . ARG C  1 186 ? 16.882  -9.127  -42.795 1.00 15.57 ? 197 ARG C NH1   1 
ATOM   7497  N  NH2   . ARG C  1 186 ? 17.950  -9.483  -40.805 1.00 15.39 ? 197 ARG C NH2   1 
ATOM   7498  N  N     . VAL C  1 187 ? 10.569  -11.524 -39.420 1.00 10.20 ? 198 VAL C N     1 
ATOM   7499  C  CA    . VAL C  1 187 ? 9.707   -12.512 -40.080 1.00 10.09 ? 198 VAL C CA    1 
ATOM   7500  C  C     . VAL C  1 187 ? 8.370   -12.543 -39.369 1.00 16.04 ? 198 VAL C C     1 
ATOM   7501  O  O     . VAL C  1 187 ? 8.329   -12.805 -38.156 1.00 15.92 ? 198 VAL C O     1 
ATOM   7502  C  CB    . VAL C  1 187 ? 10.290  -13.946 -40.187 1.00 11.60 ? 198 VAL C CB    1 
ATOM   7503  C  CG1   . VAL C  1 187 ? 9.324   -14.865 -40.957 1.00 11.51 ? 198 VAL C CG1   1 
ATOM   7504  C  CG2   . VAL C  1 187 ? 11.684  -13.949 -40.814 1.00 10.53 ? 198 VAL C CG2   1 
ATOM   7505  N  N     . MET C  1 188 ? 7.274   -12.302 -40.133 1.00 13.51 ? 199 MET C N     1 
ATOM   7506  C  CA    . MET C  1 188 ? 5.936   -12.426 -39.590 1.00 12.72 ? 199 MET C CA    1 
ATOM   7507  C  C     . MET C  1 188 ? 5.341   -13.723 -40.120 1.00 13.93 ? 199 MET C C     1 
ATOM   7508  O  O     . MET C  1 188 ? 5.374   -13.977 -41.325 1.00 13.74 ? 199 MET C O     1 
ATOM   7509  C  CB    . MET C  1 188 ? 5.028   -11.243 -39.941 1.00 15.57 ? 199 MET C CB    1 
ATOM   7510  C  CG    . MET C  1 188 ? 3.704   -11.335 -39.217 1.00 21.35 ? 199 MET C CG    1 
ATOM   7511  S  SD    . MET C  1 188 ? 2.604   -10.010 -39.667 1.00 27.81 ? 199 MET C SD    1 
ATOM   7512  C  CE    . MET C  1 188 ? 2.377   -9.253  -38.170 1.00 23.66 ? 199 MET C CE    1 
ATOM   7513  N  N     . THR C  1 189 ? 4.842   -14.557 -39.213 1.00 12.05 ? 200 THR C N     1 
ATOM   7514  C  CA    . THR C  1 189 ? 4.244   -15.848 -39.602 1.00 11.64 ? 200 THR C CA    1 
ATOM   7515  C  C     . THR C  1 189 ? 2.753   -15.767 -39.437 1.00 13.41 ? 200 THR C C     1 
ATOM   7516  O  O     . THR C  1 189 ? 2.271   -15.325 -38.392 1.00 12.48 ? 200 THR C O     1 
ATOM   7517  C  CB    . THR C  1 189 ? 4.874   -17.023 -38.843 1.00 13.21 ? 200 THR C CB    1 
ATOM   7518  O  OG1   . THR C  1 189 ? 4.652   -16.844 -37.438 1.00 12.07 ? 200 THR C OG1   1 
ATOM   7519  C  CG2   . THR C  1 189 ? 6.412   -17.167 -39.134 1.00 10.36 ? 200 THR C CG2   1 
ATOM   7520  N  N     . VAL C  1 190 ? 2.011   -16.160 -40.490 1.00 11.99 ? 201 VAL C N     1 
ATOM   7521  C  CA    . VAL C  1 190 ? 0.550   -16.130 -40.480 1.00 11.17 ? 201 VAL C CA    1 
ATOM   7522  C  C     . VAL C  1 190 ? 0.057   -17.519 -40.861 1.00 14.20 ? 201 VAL C C     1 
ATOM   7523  O  O     . VAL C  1 190 ? 0.305   -17.986 -41.977 1.00 14.68 ? 201 VAL C O     1 
ATOM   7524  C  CB    . VAL C  1 190 ? -0.037  -15.032 -41.411 1.00 14.60 ? 201 VAL C CB    1 
ATOM   7525  C  CG1   . VAL C  1 190 ? -1.569  -14.996 -41.309 1.00 13.79 ? 201 VAL C CG1   1 
ATOM   7526  C  CG2   . VAL C  1 190 ? 0.553   -13.643 -41.099 1.00 13.71 ? 201 VAL C CG2   1 
ATOM   7527  N  N     . SER C  1 191 ? -0.631  -18.167 -39.939 1.00 12.69 ? 202 SER C N     1 
ATOM   7528  C  CA    . SER C  1 191 ? -1.152  -19.508 -40.157 1.00 12.73 ? 202 SER C CA    1 
ATOM   7529  C  C     . SER C  1 191 ? -2.652  -19.596 -39.938 1.00 15.98 ? 202 SER C C     1 
ATOM   7530  O  O     . SER C  1 191 ? -3.174  -19.128 -38.932 1.00 15.44 ? 202 SER C O     1 
ATOM   7531  C  CB    . SER C  1 191 ? -0.405  -20.544 -39.309 1.00 13.91 ? 202 SER C CB    1 
ATOM   7532  O  OG    . SER C  1 191 ? -0.863  -21.856 -39.609 1.00 16.07 ? 202 SER C OG    1 
ATOM   7533  N  N     . PHE C  1 192 ? -3.345  -20.197 -40.919 1.00 12.82 ? 203 PHE C N     1 
ATOM   7534  C  CA    . PHE C  1 192 ? -4.790  -20.489 -40.859 1.00 12.11 ? 203 PHE C CA    1 
ATOM   7535  C  C     . PHE C  1 192 ? -4.829  -21.997 -40.752 1.00 14.75 ? 203 PHE C C     1 
ATOM   7536  O  O     . PHE C  1 192 ? -4.219  -22.670 -41.602 1.00 11.99 ? 203 PHE C O     1 
ATOM   7537  C  CB    . PHE C  1 192 ? -5.476  -20.031 -42.155 1.00 13.48 ? 203 PHE C CB    1 
ATOM   7538  C  CG    . PHE C  1 192 ? -5.327  -18.551 -42.418 1.00 12.78 ? 203 PHE C CG    1 
ATOM   7539  C  CD1   . PHE C  1 192 ? -4.244  -18.062 -43.147 1.00 12.95 ? 203 PHE C CD1   1 
ATOM   7540  C  CD2   . PHE C  1 192 ? -6.301  -17.652 -41.991 1.00 13.35 ? 203 PHE C CD2   1 
ATOM   7541  C  CE1   . PHE C  1 192 ? -4.108  -16.688 -43.395 1.00 14.79 ? 203 PHE C CE1   1 
ATOM   7542  C  CE2   . PHE C  1 192 ? -6.139  -16.272 -42.189 1.00 15.61 ? 203 PHE C CE2   1 
ATOM   7543  C  CZ    . PHE C  1 192 ? -5.056  -15.800 -42.906 1.00 13.66 ? 203 PHE C CZ    1 
ATOM   7544  N  N     . HIS C  1 193 ? -5.482  -22.537 -39.707 1.00 10.90 ? 204 HIS C N     1 
ATOM   7545  C  CA    . HIS C  1 193 ? -5.443  -23.997 -39.518 1.00 12.18 ? 204 HIS C CA    1 
ATOM   7546  C  C     . HIS C  1 193 ? -6.532  -24.547 -38.666 1.00 16.81 ? 204 HIS C C     1 
ATOM   7547  O  O     . HIS C  1 193 ? -7.059  -23.858 -37.789 1.00 17.09 ? 204 HIS C O     1 
ATOM   7548  C  CB    . HIS C  1 193 ? -4.089  -24.396 -38.847 1.00 12.59 ? 204 HIS C CB    1 
ATOM   7549  C  CG    . HIS C  1 193 ? -3.743  -23.494 -37.703 1.00 15.52 ? 204 HIS C CG    1 
ATOM   7550  N  ND1   . HIS C  1 193 ? -2.944  -22.377 -37.887 1.00 16.58 ? 204 HIS C ND1   1 
ATOM   7551  C  CD2   . HIS C  1 193 ? -4.200  -23.503 -36.428 1.00 16.36 ? 204 HIS C CD2   1 
ATOM   7552  C  CE1   . HIS C  1 193 ? -2.897  -21.776 -36.710 1.00 15.36 ? 204 HIS C CE1   1 
ATOM   7553  N  NE2   . HIS C  1 193 ? -3.634  -22.419 -35.800 1.00 15.75 ? 204 HIS C NE2   1 
ATOM   7554  N  N     . LYS C  1 194 ? -6.810  -25.837 -38.844 1.00 13.80 ? 205 LYS C N     1 
ATOM   7555  C  CA    . LYS C  1 194 ? -7.732  -26.538 -37.955 1.00 13.34 ? 205 LYS C CA    1 
ATOM   7556  C  C     . LYS C  1 194 ? -7.059  -26.585 -36.588 1.00 17.53 ? 205 LYS C C     1 
ATOM   7557  O  O     . LYS C  1 194 ? -5.843  -26.862 -36.465 1.00 15.81 ? 205 LYS C O     1 
ATOM   7558  C  CB    . LYS C  1 194 ? -8.081  -27.951 -38.485 1.00 15.10 ? 205 LYS C CB    1 
ATOM   7559  C  CG    . LYS C  1 194 ? -8.581  -28.944 -37.427 1.00 23.12 ? 205 LYS C CG    1 
ATOM   7560  C  CD    . LYS C  1 194 ? -10.037 -28.772 -36.969 1.00 27.92 ? 205 LYS C CD    1 
ATOM   7561  C  CE    . LYS C  1 194 ? -10.337 -29.844 -35.936 1.00 24.91 ? 205 LYS C CE    1 
ATOM   7562  N  NZ    . LYS C  1 194 ? -11.712 -29.763 -35.415 1.00 36.84 ? 205 LYS C NZ    1 
ATOM   7563  N  N     . TYR C  1 195 ? -7.838  -26.261 -35.558 1.00 13.83 ? 206 TYR C N     1 
ATOM   7564  C  CA    . TYR C  1 195 ? -7.325  -26.238 -34.191 1.00 14.51 ? 206 TYR C CA    1 
ATOM   7565  C  C     . TYR C  1 195 ? -8.343  -26.910 -33.262 1.00 22.15 ? 206 TYR C C     1 
ATOM   7566  O  O     . TYR C  1 195 ? -9.538  -26.629 -33.371 1.00 22.95 ? 206 TYR C O     1 
ATOM   7567  C  CB    . TYR C  1 195 ? -7.077  -24.783 -33.760 1.00 15.24 ? 206 TYR C CB    1 
ATOM   7568  C  CG    . TYR C  1 195 ? -6.475  -24.649 -32.376 1.00 17.55 ? 206 TYR C CG    1 
ATOM   7569  C  CD1   . TYR C  1 195 ? -7.278  -24.385 -31.266 1.00 19.28 ? 206 TYR C CD1   1 
ATOM   7570  C  CD2   . TYR C  1 195 ? -5.106  -24.823 -32.167 1.00 17.53 ? 206 TYR C CD2   1 
ATOM   7571  C  CE1   . TYR C  1 195 ? -6.733  -24.303 -29.984 1.00 20.24 ? 206 TYR C CE1   1 
ATOM   7572  C  CE2   . TYR C  1 195 ? -4.550  -24.725 -30.892 1.00 17.52 ? 206 TYR C CE2   1 
ATOM   7573  C  CZ    . TYR C  1 195 ? -5.363  -24.439 -29.806 1.00 23.61 ? 206 TYR C CZ    1 
ATOM   7574  O  OH    . TYR C  1 195 ? -4.823  -24.346 -28.545 1.00 21.01 ? 206 TYR C OH    1 
ATOM   7575  N  N     . GLY C  1 196 ? -7.850  -27.740 -32.342 1.00 18.90 ? 207 GLY C N     1 
ATOM   7576  C  CA    . GLY C  1 196 ? -8.670  -28.458 -31.370 1.00 19.33 ? 207 GLY C CA    1 
ATOM   7577  C  C     . GLY C  1 196 ? -8.635  -29.947 -31.621 1.00 25.09 ? 207 GLY C C     1 
ATOM   7578  O  O     . GLY C  1 196 ? -9.147  -30.400 -32.640 1.00 25.46 ? 207 GLY C O     1 
ATOM   7579  N  N     . GLU C  1 197 ? -7.993  -30.724 -30.718 1.00 24.36 ? 208 GLU C N     1 
ATOM   7580  C  CA    . GLU C  1 197 ? -7.846  -32.190 -30.854 1.00 24.96 ? 208 GLU C CA    1 
ATOM   7581  C  C     . GLU C  1 197 ? -7.364  -32.510 -32.280 1.00 26.69 ? 208 GLU C C     1 
ATOM   7582  O  O     . GLU C  1 197 ? -7.995  -33.272 -33.016 1.00 27.02 ? 208 GLU C O     1 
ATOM   7583  C  CB    . GLU C  1 197 ? -9.168  -32.924 -30.509 1.00 26.73 ? 208 GLU C CB    1 
ATOM   7584  C  CG    . GLU C  1 197 ? -9.599  -32.757 -29.053 1.00 40.11 ? 208 GLU C CG    1 
ATOM   7585  C  CD    . GLU C  1 197 ? -10.898 -33.428 -28.634 1.00 68.69 ? 208 GLU C CD    1 
ATOM   7586  O  OE1   . GLU C  1 197 ? -10.985 -33.846 -27.456 1.00 69.78 ? 208 GLU C OE1   1 
ATOM   7587  O  OE2   . GLU C  1 197 ? -11.832 -33.519 -29.464 1.00 62.51 ? 208 GLU C OE2   1 
ATOM   7588  N  N     . TYR C  1 198 ? -6.284  -31.836 -32.693 1.00 19.71 ? 209 TYR C N     1 
ATOM   7589  C  CA    . TYR C  1 198 ? -5.751  -31.970 -34.040 1.00 18.19 ? 209 TYR C CA    1 
ATOM   7590  C  C     . TYR C  1 198 ? -4.263  -31.714 -34.063 1.00 19.46 ? 209 TYR C C     1 
ATOM   7591  O  O     . TYR C  1 198 ? -3.763  -30.889 -33.303 1.00 18.34 ? 209 TYR C O     1 
ATOM   7592  C  CB    . TYR C  1 198 ? -6.456  -30.982 -34.978 1.00 18.41 ? 209 TYR C CB    1 
ATOM   7593  C  CG    . TYR C  1 198 ? -6.489  -31.425 -36.421 1.00 18.86 ? 209 TYR C CG    1 
ATOM   7594  C  CD1   . TYR C  1 198 ? -5.728  -30.773 -37.390 1.00 19.14 ? 209 TYR C CD1   1 
ATOM   7595  C  CD2   . TYR C  1 198 ? -7.342  -32.447 -36.839 1.00 20.49 ? 209 TYR C CD2   1 
ATOM   7596  C  CE1   . TYR C  1 198 ? -5.812  -31.130 -38.737 1.00 17.54 ? 209 TYR C CE1   1 
ATOM   7597  C  CE2   . TYR C  1 198 ? -7.406  -32.835 -38.178 1.00 21.72 ? 209 TYR C CE2   1 
ATOM   7598  C  CZ    . TYR C  1 198 ? -6.635  -32.178 -39.122 1.00 28.34 ? 209 TYR C CZ    1 
ATOM   7599  O  OH    . TYR C  1 198 ? -6.673  -32.582 -40.434 1.00 30.65 ? 209 TYR C OH    1 
ATOM   7600  N  N     . PHE C  1 199 ? -3.563  -32.407 -34.959 1.00 15.38 ? 210 PHE C N     1 
ATOM   7601  C  CA    . PHE C  1 199 ? -2.109  -32.261 -35.091 1.00 14.19 ? 210 PHE C CA    1 
ATOM   7602  C  C     . PHE C  1 199 ? -1.753  -30.833 -35.572 1.00 17.23 ? 210 PHE C C     1 
ATOM   7603  O  O     . PHE C  1 199 ? -2.435  -30.307 -36.466 1.00 15.84 ? 210 PHE C O     1 
ATOM   7604  C  CB    . PHE C  1 199 ? -1.555  -33.322 -36.066 1.00 15.36 ? 210 PHE C CB    1 
ATOM   7605  C  CG    . PHE C  1 199 ? -0.044  -33.312 -36.167 1.00 15.52 ? 210 PHE C CG    1 
ATOM   7606  C  CD1   . PHE C  1 199 ? 0.602   -32.502 -37.094 1.00 16.23 ? 210 PHE C CD1   1 
ATOM   7607  C  CD2   . PHE C  1 199 ? 0.732   -34.071 -35.297 1.00 17.01 ? 210 PHE C CD2   1 
ATOM   7608  C  CE1   . PHE C  1 199 ? 2.001   -32.433 -37.131 1.00 17.26 ? 210 PHE C CE1   1 
ATOM   7609  C  CE2   . PHE C  1 199 ? 2.130   -34.043 -35.368 1.00 19.08 ? 210 PHE C CE2   1 
ATOM   7610  C  CZ    . PHE C  1 199 ? 2.753   -33.234 -36.293 1.00 16.93 ? 210 PHE C CZ    1 
ATOM   7611  N  N     . PRO C  1 200 ? -0.677  -30.201 -35.050 1.00 15.60 ? 211 PRO C N     1 
ATOM   7612  C  CA    . PRO C  1 200 ? 0.244   -30.647 -33.983 1.00 15.77 ? 211 PRO C CA    1 
ATOM   7613  C  C     . PRO C  1 200 ? -0.178  -30.279 -32.559 1.00 19.87 ? 211 PRO C C     1 
ATOM   7614  O  O     . PRO C  1 200 ? 0.490   -30.672 -31.608 1.00 20.60 ? 211 PRO C O     1 
ATOM   7615  C  CB    . PRO C  1 200 ? 1.564   -29.982 -34.377 1.00 17.28 ? 211 PRO C CB    1 
ATOM   7616  C  CG    . PRO C  1 200 ? 1.164   -28.716 -35.107 1.00 21.06 ? 211 PRO C CG    1 
ATOM   7617  C  CD    . PRO C  1 200 ? -0.286  -28.869 -35.558 1.00 17.12 ? 211 PRO C CD    1 
ATOM   7618  N  N     . GLY C  1 201 ? -1.284  -29.559 -32.411 1.00 16.04 ? 212 GLY C N     1 
ATOM   7619  C  CA    . GLY C  1 201 ? -1.784  -29.184 -31.089 1.00 15.40 ? 212 GLY C CA    1 
ATOM   7620  C  C     . GLY C  1 201 ? -1.425  -27.766 -30.688 1.00 18.07 ? 212 GLY C C     1 
ATOM   7621  O  O     . GLY C  1 201 ? -1.792  -27.321 -29.601 1.00 18.91 ? 212 GLY C O     1 
ATOM   7622  N  N     . THR C  1 202 ? -0.750  -27.033 -31.576 1.00 13.21 ? 213 THR C N     1 
ATOM   7623  C  CA    . THR C  1 202 ? -0.291  -25.647 -31.337 1.00 12.14 ? 213 THR C CA    1 
ATOM   7624  C  C     . THR C  1 202 ? -1.037  -24.647 -32.233 1.00 15.42 ? 213 THR C C     1 
ATOM   7625  O  O     . THR C  1 202 ? -1.964  -25.022 -32.933 1.00 14.28 ? 213 THR C O     1 
ATOM   7626  C  CB    . THR C  1 202 ? 1.228   -25.580 -31.595 1.00 20.44 ? 213 THR C CB    1 
ATOM   7627  O  OG1   . THR C  1 202 ? 1.470   -26.173 -32.867 1.00 19.53 ? 213 THR C OG1   1 
ATOM   7628  C  CG2   . THR C  1 202 ? 2.046   -26.277 -30.494 1.00 20.70 ? 213 THR C CG2   1 
ATOM   7629  N  N     . GLY C  1 203 ? -0.609  -23.387 -32.221 1.00 12.95 ? 214 GLY C N     1 
ATOM   7630  C  CA    . GLY C  1 203 ? -1.251  -22.356 -33.024 1.00 13.49 ? 214 GLY C CA    1 
ATOM   7631  C  C     . GLY C  1 203 ? -2.532  -21.810 -32.431 1.00 17.28 ? 214 GLY C C     1 
ATOM   7632  O  O     . GLY C  1 203 ? -3.478  -21.519 -33.165 1.00 15.26 ? 214 GLY C O     1 
ATOM   7633  N  N     . ASP C  1 204 ? -2.551  -21.641 -31.099 1.00 13.86 ? 215 ASP C N     1 
ATOM   7634  C  CA    . ASP C  1 204 ? -3.676  -21.027 -30.376 1.00 14.36 ? 215 ASP C CA    1 
ATOM   7635  C  C     . ASP C  1 204 ? -3.720  -19.538 -30.750 1.00 18.44 ? 215 ASP C C     1 
ATOM   7636  O  O     . ASP C  1 204 ? -2.679  -18.941 -31.018 1.00 18.68 ? 215 ASP C O     1 
ATOM   7637  C  CB    . ASP C  1 204 ? -3.429  -21.142 -28.860 1.00 16.30 ? 215 ASP C CB    1 
ATOM   7638  C  CG    . ASP C  1 204 ? -4.621  -20.766 -27.997 1.00 31.05 ? 215 ASP C CG    1 
ATOM   7639  O  OD1   . ASP C  1 204 ? -4.907  -19.558 -27.868 1.00 35.79 ? 215 ASP C OD1   1 
ATOM   7640  O  OD2   . ASP C  1 204 ? -5.216  -21.663 -27.405 1.00 34.96 ? 215 ASP C OD2   1 
ATOM   7641  N  N     . LEU C  1 205 ? -4.913  -18.940 -30.732 1.00 15.29 ? 216 LEU C N     1 
ATOM   7642  C  CA    . LEU C  1 205 ? -5.146  -17.517 -30.982 1.00 16.43 ? 216 LEU C CA    1 
ATOM   7643  C  C     . LEU C  1 205 ? -4.189  -16.638 -30.130 1.00 17.49 ? 216 LEU C C     1 
ATOM   7644  O  O     . LEU C  1 205 ? -3.708  -15.616 -30.617 1.00 16.75 ? 216 LEU C O     1 
ATOM   7645  C  CB    . LEU C  1 205 ? -6.617  -17.195 -30.599 1.00 17.28 ? 216 LEU C CB    1 
ATOM   7646  C  CG    . LEU C  1 205 ? -7.078  -15.753 -30.737 1.00 22.13 ? 216 LEU C CG    1 
ATOM   7647  C  CD1   . LEU C  1 205 ? -6.951  -15.278 -32.181 1.00 23.22 ? 216 LEU C CD1   1 
ATOM   7648  C  CD2   . LEU C  1 205 ? -8.494  -15.599 -30.236 1.00 23.23 ? 216 LEU C CD2   1 
ATOM   7649  N  N     . ARG C  1 206 ? -3.906  -17.064 -28.881 1.00 14.19 ? 217 ARG C N     1 
ATOM   7650  C  CA    . ARG C  1 206 ? -3.032  -16.328 -27.948 1.00 14.73 ? 217 ARG C CA    1 
ATOM   7651  C  C     . ARG C  1 206 ? -1.525  -16.415 -28.263 1.00 19.03 ? 217 ARG C C     1 
ATOM   7652  O  O     . ARG C  1 206 ? -0.740  -15.695 -27.645 1.00 19.87 ? 217 ARG C O     1 
ATOM   7653  C  CB    . ARG C  1 206 ? -3.332  -16.715 -26.478 1.00 16.09 ? 217 ARG C CB    1 
ATOM   7654  C  CG    A ARG C  1 206 ? -2.768  -18.051 -26.006 0.67 28.47 ? 217 ARG C CG    1 
ATOM   7655  C  CD    A ARG C  1 206 ? -3.181  -18.308 -24.566 0.67 48.21 ? 217 ARG C CD    1 
ATOM   7656  N  NE    A ARG C  1 206 ? -2.674  -19.582 -24.053 0.67 67.10 ? 217 ARG C NE    1 
ATOM   7657  C  CZ    A ARG C  1 206 ? -1.564  -19.716 -23.334 0.67 86.12 ? 217 ARG C CZ    1 
ATOM   7658  N  NH1   A ARG C  1 206 ? -0.815  -18.656 -23.050 0.67 74.50 ? 217 ARG C NH1   1 
ATOM   7659  N  NH2   A ARG C  1 206 ? -1.184  -20.913 -22.907 0.67 75.01 ? 217 ARG C NH2   1 
ATOM   7660  N  N     . ASP C  1 207 ? -1.124  -17.308 -29.185 1.00 15.12 ? 218 ASP C N     1 
ATOM   7661  C  CA    . ASP C  1 207 ? 0.290   -17.470 -29.590 1.00 14.34 ? 218 ASP C CA    1 
ATOM   7662  C  C     . ASP C  1 207 ? 0.651   -16.366 -30.586 1.00 16.45 ? 218 ASP C C     1 
ATOM   7663  O  O     . ASP C  1 207 ? 0.421   -16.480 -31.788 1.00 16.17 ? 218 ASP C O     1 
ATOM   7664  C  CB    . ASP C  1 207 ? 0.539   -18.877 -30.162 1.00 15.18 ? 218 ASP C CB    1 
ATOM   7665  C  CG    . ASP C  1 207 ? 0.247   -19.996 -29.183 1.00 24.75 ? 218 ASP C CG    1 
ATOM   7666  O  OD1   . ASP C  1 207 ? 0.074   -21.149 -29.637 1.00 24.36 ? 218 ASP C OD1   1 
ATOM   7667  O  OD2   . ASP C  1 207 ? 0.192   -19.721 -27.957 1.00 24.05 ? 218 ASP C OD2   1 
ATOM   7668  N  N     . ILE C  1 208 ? 1.162   -15.263 -30.059 1.00 13.28 ? 219 ILE C N     1 
ATOM   7669  C  CA    . ILE C  1 208 ? 1.439   -14.071 -30.857 1.00 13.25 ? 219 ILE C CA    1 
ATOM   7670  C  C     . ILE C  1 208 ? 2.924   -13.729 -30.978 1.00 15.79 ? 219 ILE C C     1 
ATOM   7671  O  O     . ILE C  1 208 ? 3.239   -12.664 -31.505 1.00 14.73 ? 219 ILE C O     1 
ATOM   7672  C  CB    . ILE C  1 208 ? 0.615   -12.857 -30.287 1.00 16.86 ? 219 ILE C CB    1 
ATOM   7673  C  CG1   . ILE C  1 208 ? 1.043   -12.532 -28.826 1.00 17.38 ? 219 ILE C CG1   1 
ATOM   7674  C  CG2   . ILE C  1 208 ? -0.897  -13.139 -30.375 1.00 19.66 ? 219 ILE C CG2   1 
ATOM   7675  C  CD1   . ILE C  1 208 ? 0.559   -11.106 -28.216 1.00 24.70 ? 219 ILE C CD1   1 
ATOM   7676  N  N     . GLY C  1 209 ? 3.827   -14.576 -30.473 1.00 12.43 ? 220 GLY C N     1 
ATOM   7677  C  CA    . GLY C  1 209 ? 5.250   -14.218 -30.565 1.00 12.41 ? 220 GLY C CA    1 
ATOM   7678  C  C     . GLY C  1 209 ? 5.825   -13.764 -29.230 1.00 16.66 ? 220 GLY C C     1 
ATOM   7679  O  O     . GLY C  1 209 ? 5.083   -13.624 -28.255 1.00 15.20 ? 220 GLY C O     1 
ATOM   7680  N  N     . ALA C  1 210 ? 7.149   -13.584 -29.142 1.00 14.22 ? 221 ALA C N     1 
ATOM   7681  C  CA    . ALA C  1 210 ? 7.760   -13.135 -27.852 1.00 14.54 ? 221 ALA C CA    1 
ATOM   7682  C  C     . ALA C  1 210 ? 8.926   -12.198 -28.133 1.00 17.05 ? 221 ALA C C     1 
ATOM   7683  O  O     . ALA C  1 210 ? 9.425   -12.188 -29.254 1.00 15.28 ? 221 ALA C O     1 
ATOM   7684  C  CB    . ALA C  1 210 ? 8.213   -14.334 -27.018 1.00 14.96 ? 221 ALA C CB    1 
ATOM   7685  N  N     . GLY C  1 211 ? 9.326   -11.401 -27.148 1.00 14.73 ? 222 GLY C N     1 
ATOM   7686  C  CA    . GLY C  1 211 ? 10.411  -10.432 -27.322 1.00 14.84 ? 222 GLY C CA    1 
ATOM   7687  C  C     . GLY C  1 211 ? 10.083  -9.466  -28.444 1.00 19.09 ? 222 GLY C C     1 
ATOM   7688  O  O     . GLY C  1 211 ? 8.926   -9.043  -28.563 1.00 17.57 ? 222 GLY C O     1 
ATOM   7689  N  N     . LYS C  1 212 ? 11.066  -9.180  -29.331 1.00 16.14 ? 223 LYS C N     1 
ATOM   7690  C  CA    . LYS C  1 212 ? 10.863  -8.293  -30.502 1.00 15.85 ? 223 LYS C CA    1 
ATOM   7691  C  C     . LYS C  1 212 ? 9.825   -8.848  -31.479 1.00 17.50 ? 223 LYS C C     1 
ATOM   7692  O  O     . LYS C  1 212 ? 9.276   -8.088  -32.261 1.00 16.51 ? 223 LYS C O     1 
ATOM   7693  C  CB    . LYS C  1 212 ? 12.188  -8.080  -31.273 1.00 17.77 ? 223 LYS C CB    1 
ATOM   7694  C  CG    . LYS C  1 212 ? 13.220  -7.257  -30.498 1.00 28.50 ? 223 LYS C CG    1 
ATOM   7695  C  CD    . LYS C  1 212 ? 14.474  -7.022  -31.337 1.00 42.20 ? 223 LYS C CD    1 
ATOM   7696  C  CE    . LYS C  1 212 ? 15.527  -6.229  -30.598 1.00 62.31 ? 223 LYS C CE    1 
ATOM   7697  N  NZ    . LYS C  1 212 ? 16.790  -6.108  -31.386 1.00 70.33 ? 223 LYS C NZ    1 
ATOM   7698  N  N     . GLY C  1 213 ? 9.611   -10.168 -31.452 1.00 14.25 ? 224 GLY C N     1 
ATOM   7699  C  CA    . GLY C  1 213 ? 8.628   -10.845 -32.296 1.00 13.51 ? 224 GLY C CA    1 
ATOM   7700  C  C     . GLY C  1 213 ? 7.224   -10.831 -31.711 1.00 16.30 ? 224 GLY C C     1 
ATOM   7701  O  O     . GLY C  1 213 ? 6.332   -11.439 -32.291 1.00 15.51 ? 224 GLY C O     1 
ATOM   7702  N  N     . LYS C  1 214 ? 7.003   -10.193 -30.529 1.00 12.32 ? 225 LYS C N     1 
ATOM   7703  C  CA    . LYS C  1 214 ? 5.631   -10.135 -29.974 1.00 12.32 ? 225 LYS C CA    1 
ATOM   7704  C  C     . LYS C  1 214 ? 4.742   -9.343  -30.962 1.00 16.17 ? 225 LYS C C     1 
ATOM   7705  O  O     . LYS C  1 214 ? 5.119   -8.247  -31.381 1.00 15.17 ? 225 LYS C O     1 
ATOM   7706  C  CB    . LYS C  1 214 ? 5.604   -9.499  -28.579 1.00 14.56 ? 225 LYS C CB    1 
ATOM   7707  C  CG    . LYS C  1 214 ? 4.245   -9.616  -27.901 1.00 17.83 ? 225 LYS C CG    1 
ATOM   7708  C  CD    . LYS C  1 214 ? 4.254   -8.916  -26.516 1.00 26.58 ? 225 LYS C CD    1 
ATOM   7709  C  CE    . LYS C  1 214 ? 2.914   -9.050  -25.834 1.00 36.91 ? 225 LYS C CE    1 
ATOM   7710  N  NZ    . LYS C  1 214 ? 2.865   -8.307  -24.548 1.00 51.40 ? 225 LYS C NZ    1 
ATOM   7711  N  N     . TYR C  1 215 ? 3.619   -9.963  -31.397 1.00 13.98 ? 226 TYR C N     1 
ATOM   7712  C  CA    . TYR C  1 215 ? 2.657   -9.469  -32.398 1.00 13.88 ? 226 TYR C CA    1 
ATOM   7713  C  C     . TYR C  1 215 ? 3.082   -9.820  -33.827 1.00 17.30 ? 226 TYR C C     1 
ATOM   7714  O  O     . TYR C  1 215 ? 2.376   -9.482  -34.782 1.00 16.89 ? 226 TYR C O     1 
ATOM   7715  C  CB    . TYR C  1 215 ? 2.324   -7.964  -32.218 1.00 15.23 ? 226 TYR C CB    1 
ATOM   7716  C  CG    . TYR C  1 215 ? 1.753   -7.642  -30.848 1.00 19.30 ? 226 TYR C CG    1 
ATOM   7717  C  CD1   . TYR C  1 215 ? 0.501   -8.115  -30.463 1.00 21.36 ? 226 TYR C CD1   1 
ATOM   7718  C  CD2   . TYR C  1 215 ? 2.441   -6.818  -29.959 1.00 21.56 ? 226 TYR C CD2   1 
ATOM   7719  C  CE1   . TYR C  1 215 ? -0.041  -7.801  -29.217 1.00 21.87 ? 226 TYR C CE1   1 
ATOM   7720  C  CE2   . TYR C  1 215 ? 1.918   -6.514  -28.698 1.00 22.70 ? 226 TYR C CE2   1 
ATOM   7721  C  CZ    . TYR C  1 215 ? 0.672   -7.005  -28.337 1.00 30.86 ? 226 TYR C CZ    1 
ATOM   7722  O  OH    . TYR C  1 215 ? 0.131   -6.713  -27.110 1.00 35.07 ? 226 TYR C OH    1 
ATOM   7723  N  N     . TYR C  1 216 ? 4.228   -10.530 -33.979 1.00 13.46 ? 227 TYR C N     1 
ATOM   7724  C  CA    . TYR C  1 216 ? 4.728   -10.949 -35.292 1.00 12.47 ? 227 TYR C CA    1 
ATOM   7725  C  C     . TYR C  1 216 ? 4.462   -12.446 -35.610 1.00 14.79 ? 227 TYR C C     1 
ATOM   7726  O  O     . TYR C  1 216 ? 4.958   -12.966 -36.596 1.00 13.42 ? 227 TYR C O     1 
ATOM   7727  C  CB    . TYR C  1 216 ? 6.187   -10.514 -35.523 1.00 13.40 ? 227 TYR C CB    1 
ATOM   7728  C  CG    . TYR C  1 216 ? 6.344   -9.004  -35.524 1.00 13.92 ? 227 TYR C CG    1 
ATOM   7729  C  CD1   . TYR C  1 216 ? 6.593   -8.307  -34.345 1.00 15.37 ? 227 TYR C CD1   1 
ATOM   7730  C  CD2   . TYR C  1 216 ? 6.257   -8.274  -36.708 1.00 13.90 ? 227 TYR C CD2   1 
ATOM   7731  C  CE1   . TYR C  1 216 ? 6.690   -6.913  -34.336 1.00 15.74 ? 227 TYR C CE1   1 
ATOM   7732  C  CE2   . TYR C  1 216 ? 6.390   -6.885  -36.714 1.00 14.44 ? 227 TYR C CE2   1 
ATOM   7733  C  CZ    . TYR C  1 216 ? 6.609   -6.211  -35.527 1.00 19.21 ? 227 TYR C CZ    1 
ATOM   7734  O  OH    . TYR C  1 216 ? 6.769   -4.846  -35.541 1.00 17.83 ? 227 TYR C OH    1 
ATOM   7735  N  N     . ALA C  1 217 ? 3.648   -13.115 -34.781 1.00 13.27 ? 228 ALA C N     1 
ATOM   7736  C  CA    . ALA C  1 217 ? 3.147   -14.468 -35.041 1.00 12.27 ? 228 ALA C CA    1 
ATOM   7737  C  C     . ALA C  1 217 ? 1.627   -14.322 -34.991 1.00 16.32 ? 228 ALA C C     1 
ATOM   7738  O  O     . ALA C  1 217 ? 1.081   -13.728 -34.040 1.00 14.91 ? 228 ALA C O     1 
ATOM   7739  C  CB    . ALA C  1 217 ? 3.639   -15.457 -33.991 1.00 12.42 ? 228 ALA C CB    1 
ATOM   7740  N  N     . VAL C  1 218 ? 0.954   -14.788 -36.051 1.00 11.18 ? 229 VAL C N     1 
ATOM   7741  C  CA    . VAL C  1 218 ? -0.495  -14.647 -36.202 1.00 10.97 ? 229 VAL C CA    1 
ATOM   7742  C  C     . VAL C  1 218 ? -1.083  -16.042 -36.400 1.00 15.65 ? 229 VAL C C     1 
ATOM   7743  O  O     . VAL C  1 218 ? -0.619  -16.780 -37.263 1.00 16.11 ? 229 VAL C O     1 
ATOM   7744  C  CB    . VAL C  1 218 ? -0.849  -13.692 -37.390 1.00 14.78 ? 229 VAL C CB    1 
ATOM   7745  C  CG1   . VAL C  1 218 ? -2.366  -13.622 -37.634 1.00 14.03 ? 229 VAL C CG1   1 
ATOM   7746  C  CG2   . VAL C  1 218 ? -0.267  -12.279 -37.173 1.00 14.71 ? 229 VAL C CG2   1 
ATOM   7747  N  N     . ASN C  1 219 ? -2.103  -16.388 -35.606 1.00 12.78 ? 230 ASN C N     1 
ATOM   7748  C  CA    . ASN C  1 219 ? -2.768  -17.683 -35.687 1.00 12.63 ? 230 ASN C CA    1 
ATOM   7749  C  C     . ASN C  1 219 ? -4.268  -17.518 -35.804 1.00 15.47 ? 230 ASN C C     1 
ATOM   7750  O  O     . ASN C  1 219 ? -4.871  -16.797 -35.014 1.00 14.16 ? 230 ASN C O     1 
ATOM   7751  C  CB    . ASN C  1 219 ? -2.390  -18.584 -34.500 1.00 10.64 ? 230 ASN C CB    1 
ATOM   7752  C  CG    . ASN C  1 219 ? -0.959  -19.040 -34.607 1.00 18.72 ? 230 ASN C CG    1 
ATOM   7753  O  OD1   . ASN C  1 219 ? -0.586  -19.708 -35.565 1.00 15.51 ? 230 ASN C OD1   1 
ATOM   7754  N  ND2   . ASN C  1 219 ? -0.111  -18.614 -33.686 1.00 11.21 ? 230 ASN C ND2   1 
ATOM   7755  N  N     . PHE C  1 220 ? -4.858  -18.150 -36.827 1.00 12.75 ? 231 PHE C N     1 
ATOM   7756  C  CA    . PHE C  1 220 ? -6.307  -18.140 -37.031 1.00 12.38 ? 231 PHE C CA    1 
ATOM   7757  C  C     . PHE C  1 220 ? -6.777  -19.583 -36.865 1.00 15.20 ? 231 PHE C C     1 
ATOM   7758  O  O     . PHE C  1 220 ? -6.803  -20.340 -37.841 1.00 13.97 ? 231 PHE C O     1 
ATOM   7759  C  CB    . PHE C  1 220 ? -6.729  -17.562 -38.387 1.00 14.28 ? 231 PHE C CB    1 
ATOM   7760  C  CG    . PHE C  1 220 ? -8.191  -17.128 -38.417 1.00 15.88 ? 231 PHE C CG    1 
ATOM   7761  C  CD1   . PHE C  1 220 ? -8.539  -15.825 -38.764 1.00 17.80 ? 231 PHE C CD1   1 
ATOM   7762  C  CD2   . PHE C  1 220 ? -9.211  -18.022 -38.089 1.00 18.15 ? 231 PHE C CD2   1 
ATOM   7763  C  CE1   . PHE C  1 220 ? -9.880  -15.411 -38.749 1.00 18.98 ? 231 PHE C CE1   1 
ATOM   7764  C  CE2   . PHE C  1 220 ? -10.553 -17.607 -38.070 1.00 21.02 ? 231 PHE C CE2   1 
ATOM   7765  C  CZ    . PHE C  1 220 ? -10.874 -16.302 -38.402 1.00 18.55 ? 231 PHE C CZ    1 
ATOM   7766  N  N     . PRO C  1 221 ? -7.120  -19.976 -35.614 1.00 12.09 ? 232 PRO C N     1 
ATOM   7767  C  CA    . PRO C  1 221 ? -7.578  -21.344 -35.373 1.00 12.64 ? 232 PRO C CA    1 
ATOM   7768  C  C     . PRO C  1 221 ? -8.992  -21.540 -35.930 1.00 17.31 ? 232 PRO C C     1 
ATOM   7769  O  O     . PRO C  1 221 ? -9.852  -20.657 -35.775 1.00 15.91 ? 232 PRO C O     1 
ATOM   7770  C  CB    . PRO C  1 221 ? -7.538  -21.443 -33.850 1.00 14.34 ? 232 PRO C CB    1 
ATOM   7771  C  CG    . PRO C  1 221 ? -7.809  -20.055 -33.379 1.00 17.76 ? 232 PRO C CG    1 
ATOM   7772  C  CD    . PRO C  1 221 ? -7.098  -19.187 -34.363 1.00 13.72 ? 232 PRO C CD    1 
ATOM   7773  N  N     . MET C  1 222 ? -9.216  -22.670 -36.608 1.00 13.44 ? 233 MET C N     1 
ATOM   7774  C  CA    . MET C  1 222 ? -10.493 -22.962 -37.257 1.00 13.11 ? 233 MET C CA    1 
ATOM   7775  C  C     . MET C  1 222 ? -11.089 -24.288 -36.836 1.00 20.41 ? 233 MET C C     1 
ATOM   7776  O  O     . MET C  1 222 ? -10.383 -25.194 -36.398 1.00 20.35 ? 233 MET C O     1 
ATOM   7777  C  CB    . MET C  1 222 ? -10.316 -22.953 -38.789 1.00 15.00 ? 233 MET C CB    1 
ATOM   7778  C  CG    . MET C  1 222 ? -10.158 -21.582 -39.360 1.00 17.51 ? 233 MET C CG    1 
ATOM   7779  S  SD    . MET C  1 222 ? -9.525  -21.639 -41.049 1.00 21.16 ? 233 MET C SD    1 
ATOM   7780  C  CE    . MET C  1 222 ? -9.531  -19.833 -41.434 1.00 18.56 ? 233 MET C CE    1 
ATOM   7781  N  N     . ARG C  1 223 ? -12.400 -24.410 -36.999 1.00 18.06 ? 234 ARG C N     1 
ATOM   7782  C  CA    . ARG C  1 223 ? -13.106 -25.657 -36.734 1.00 17.60 ? 234 ARG C CA    1 
ATOM   7783  C  C     . ARG C  1 223 ? -13.298 -26.428 -38.071 1.00 18.79 ? 234 ARG C C     1 
ATOM   7784  O  O     . ARG C  1 223 ? -12.956 -25.929 -39.149 1.00 16.90 ? 234 ARG C O     1 
ATOM   7785  C  CB    . ARG C  1 223 ? -14.455 -25.346 -36.057 1.00 17.57 ? 234 ARG C CB    1 
ATOM   7786  C  CG    . ARG C  1 223 ? -14.307 -24.881 -34.598 1.00 26.95 ? 234 ARG C CG    1 
ATOM   7787  C  CD    . ARG C  1 223 ? -15.610 -24.304 -34.092 1.00 37.43 ? 234 ARG C CD    1 
ATOM   7788  N  NE    . ARG C  1 223 ? -15.491 -23.680 -32.772 1.00 49.73 ? 234 ARG C NE    1 
ATOM   7789  C  CZ    . ARG C  1 223 ? -16.430 -22.913 -32.221 1.00 72.06 ? 234 ARG C CZ    1 
ATOM   7790  N  NH1   . ARG C  1 223 ? -16.242 -22.386 -31.019 1.00 64.67 ? 234 ARG C NH1   1 
ATOM   7791  N  NH2   . ARG C  1 223 ? -17.552 -22.644 -32.881 1.00 60.07 ? 234 ARG C NH2   1 
ATOM   7792  N  N     . ASP C  1 224 ? -13.835 -27.649 -37.998 1.00 16.70 ? 235 ASP C N     1 
ATOM   7793  C  CA    . ASP C  1 224 ? -14.123 -28.459 -39.184 1.00 17.39 ? 235 ASP C CA    1 
ATOM   7794  C  C     . ASP C  1 224 ? -15.026 -27.734 -40.199 1.00 20.10 ? 235 ASP C C     1 
ATOM   7795  O  O     . ASP C  1 224 ? -15.845 -26.886 -39.819 1.00 18.44 ? 235 ASP C O     1 
ATOM   7796  C  CB    . ASP C  1 224 ? -14.905 -29.720 -38.753 1.00 19.79 ? 235 ASP C CB    1 
ATOM   7797  C  CG    . ASP C  1 224 ? -14.139 -30.787 -38.018 1.00 29.44 ? 235 ASP C CG    1 
ATOM   7798  O  OD1   . ASP C  1 224 ? -12.943 -30.580 -37.751 1.00 27.64 ? 235 ASP C OD1   1 
ATOM   7799  O  OD2   . ASP C  1 224 ? -14.733 -31.846 -37.731 1.00 38.09 ? 235 ASP C OD2   1 
ATOM   7800  N  N     . GLY C  1 225 ? -14.891 -28.118 -41.465 1.00 16.31 ? 236 GLY C N     1 
ATOM   7801  C  CA    . GLY C  1 225 ? -15.803 -27.747 -42.536 1.00 16.53 ? 236 GLY C CA    1 
ATOM   7802  C  C     . GLY C  1 225 ? -15.781 -26.357 -43.128 1.00 20.44 ? 236 GLY C C     1 
ATOM   7803  O  O     . GLY C  1 225 ? -16.713 -26.006 -43.867 1.00 18.26 ? 236 GLY C O     1 
ATOM   7804  N  N     . ILE C  1 226 ? -14.710 -25.569 -42.880 1.00 16.86 ? 237 ILE C N     1 
ATOM   7805  C  CA    . ILE C  1 226 ? -14.626 -24.237 -43.491 1.00 16.82 ? 237 ILE C CA    1 
ATOM   7806  C  C     . ILE C  1 226 ? -14.738 -24.357 -45.007 1.00 21.20 ? 237 ILE C C     1 
ATOM   7807  O  O     . ILE C  1 226 ? -14.166 -25.285 -45.600 1.00 21.02 ? 237 ILE C O     1 
ATOM   7808  C  CB    . ILE C  1 226 ? -13.407 -23.406 -43.030 1.00 20.12 ? 237 ILE C CB    1 
ATOM   7809  C  CG1   . ILE C  1 226 ? -13.606 -21.919 -43.407 1.00 21.27 ? 237 ILE C CG1   1 
ATOM   7810  C  CG2   . ILE C  1 226 ? -12.107 -23.963 -43.629 1.00 19.59 ? 237 ILE C CG2   1 
ATOM   7811  C  CD1   . ILE C  1 226 ? -13.003 -21.001 -42.576 1.00 27.29 ? 237 ILE C CD1   1 
ATOM   7812  N  N     . ASP C  1 227 ? -15.526 -23.458 -45.625 1.00 17.61 ? 238 ASP C N     1 
ATOM   7813  C  CA    . ASP C  1 227 ? -15.777 -23.487 -47.072 1.00 17.27 ? 238 ASP C CA    1 
ATOM   7814  C  C     . ASP C  1 227 ? -15.147 -22.291 -47.786 1.00 20.12 ? 238 ASP C C     1 
ATOM   7815  O  O     . ASP C  1 227 ? -14.569 -21.415 -47.120 1.00 19.10 ? 238 ASP C O     1 
ATOM   7816  C  CB    . ASP C  1 227 ? -17.310 -23.605 -47.323 1.00 19.38 ? 238 ASP C CB    1 
ATOM   7817  C  CG    . ASP C  1 227 ? -18.156 -22.502 -46.716 1.00 30.06 ? 238 ASP C CG    1 
ATOM   7818  O  OD1   . ASP C  1 227 ? -17.580 -21.484 -46.271 1.00 27.49 ? 238 ASP C OD1   1 
ATOM   7819  O  OD2   . ASP C  1 227 ? -19.393 -22.648 -46.698 1.00 37.09 ? 238 ASP C OD2   1 
ATOM   7820  N  N     . ASP C  1 228 ? -15.224 -22.259 -49.136 1.00 18.00 ? 239 ASP C N     1 
ATOM   7821  C  CA    . ASP C  1 228 ? -14.641 -21.199 -49.964 1.00 17.63 ? 239 ASP C CA    1 
ATOM   7822  C  C     . ASP C  1 228 ? -15.018 -19.781 -49.525 1.00 24.17 ? 239 ASP C C     1 
ATOM   7823  O  O     . ASP C  1 228 ? -14.130 -18.928 -49.406 1.00 24.28 ? 239 ASP C O     1 
ATOM   7824  C  CB    . ASP C  1 228 ? -15.025 -21.385 -51.445 1.00 19.17 ? 239 ASP C CB    1 
ATOM   7825  C  CG    . ASP C  1 228 ? -14.285 -22.503 -52.139 1.00 22.27 ? 239 ASP C CG    1 
ATOM   7826  O  OD1   . ASP C  1 228 ? -13.376 -23.100 -51.504 1.00 19.22 ? 239 ASP C OD1   1 
ATOM   7827  O  OD2   . ASP C  1 228 ? -14.587 -22.762 -53.324 1.00 21.61 ? 239 ASP C OD2   1 
ATOM   7828  N  N     . GLU C  1 229 ? -16.324 -19.527 -49.305 1.00 21.84 ? 240 GLU C N     1 
ATOM   7829  C  CA    . GLU C  1 229 ? -16.810 -18.192 -48.906 1.00 21.56 ? 240 GLU C CA    1 
ATOM   7830  C  C     . GLU C  1 229 ? -16.340 -17.741 -47.520 1.00 21.60 ? 240 GLU C C     1 
ATOM   7831  O  O     . GLU C  1 229 ? -15.911 -16.603 -47.378 1.00 22.25 ? 240 GLU C O     1 
ATOM   7832  C  CB    . GLU C  1 229 ? -18.343 -18.051 -49.061 1.00 23.25 ? 240 GLU C CB    1 
ATOM   7833  C  CG    . GLU C  1 229 ? -19.196 -18.911 -48.139 1.00 38.09 ? 240 GLU C CG    1 
ATOM   7834  C  CD    . GLU C  1 229 ? -20.607 -18.422 -47.839 1.00 67.46 ? 240 GLU C CD    1 
ATOM   7835  O  OE1   . GLU C  1 229 ? -21.262 -19.032 -46.963 1.00 69.10 ? 240 GLU C OE1   1 
ATOM   7836  O  OE2   . GLU C  1 229 ? -21.054 -17.429 -48.458 1.00 57.15 ? 240 GLU C OE2   1 
ATOM   7837  N  N     . SER C  1 230 ? -16.426 -18.613 -46.514 1.00 16.47 ? 241 SER C N     1 
ATOM   7838  C  CA    . SER C  1 230 ? -16.009 -18.283 -45.148 1.00 17.12 ? 241 SER C CA    1 
ATOM   7839  C  C     . SER C  1 230 ? -14.490 -18.036 -45.102 1.00 21.26 ? 241 SER C C     1 
ATOM   7840  O  O     . SER C  1 230 ? -14.045 -17.036 -44.530 1.00 21.41 ? 241 SER C O     1 
ATOM   7841  C  CB    . SER C  1 230 ? -16.388 -19.404 -44.192 1.00 20.99 ? 241 SER C CB    1 
ATOM   7842  O  OG    . SER C  1 230 ? -17.788 -19.625 -44.217 1.00 35.34 ? 241 SER C OG    1 
ATOM   7843  N  N     . TYR C  1 231 ? -13.706 -18.913 -45.748 1.00 18.04 ? 242 TYR C N     1 
ATOM   7844  C  CA    . TYR C  1 231 ? -12.240 -18.797 -45.780 1.00 17.00 ? 242 TYR C CA    1 
ATOM   7845  C  C     . TYR C  1 231 ? -11.811 -17.510 -46.464 1.00 19.78 ? 242 TYR C C     1 
ATOM   7846  O  O     . TYR C  1 231 ? -11.057 -16.745 -45.868 1.00 18.78 ? 242 TYR C O     1 
ATOM   7847  C  CB    . TYR C  1 231 ? -11.610 -20.000 -46.484 1.00 16.75 ? 242 TYR C CB    1 
ATOM   7848  C  CG    . TYR C  1 231 ? -10.159 -20.253 -46.121 1.00 16.07 ? 242 TYR C CG    1 
ATOM   7849  C  CD1   . TYR C  1 231 ? -9.815  -21.203 -45.160 1.00 17.20 ? 242 TYR C CD1   1 
ATOM   7850  C  CD2   . TYR C  1 231 ? -9.127  -19.596 -46.790 1.00 16.33 ? 242 TYR C CD2   1 
ATOM   7851  C  CE1   . TYR C  1 231 ? -8.476  -21.468 -44.850 1.00 16.89 ? 242 TYR C CE1   1 
ATOM   7852  C  CE2   . TYR C  1 231 ? -7.789  -19.838 -46.474 1.00 16.37 ? 242 TYR C CE2   1 
ATOM   7853  C  CZ    . TYR C  1 231 ? -7.470  -20.779 -45.509 1.00 18.02 ? 242 TYR C CZ    1 
ATOM   7854  O  OH    . TYR C  1 231 ? -6.156  -21.052 -45.243 1.00 16.16 ? 242 TYR C OH    1 
ATOM   7855  N  N     . GLY C  1 232 ? -12.304 -17.290 -47.687 1.00 18.04 ? 243 GLY C N     1 
ATOM   7856  C  CA    . GLY C  1 232 ? -12.037 -16.111 -48.504 1.00 18.61 ? 243 GLY C CA    1 
ATOM   7857  C  C     . GLY C  1 232 ? -12.349 -14.789 -47.816 1.00 24.30 ? 243 GLY C C     1 
ATOM   7858  O  O     . GLY C  1 232 ? -11.593 -13.824 -47.963 1.00 24.90 ? 243 GLY C O     1 
ATOM   7859  N  N     . GLN C  1 233 ? -13.450 -14.740 -47.041 1.00 21.33 ? 244 GLN C N     1 
ATOM   7860  C  CA    . GLN C  1 233 ? -13.862 -13.535 -46.303 1.00 22.37 ? 244 GLN C CA    1 
ATOM   7861  C  C     . GLN C  1 233 ? -12.992 -13.288 -45.057 1.00 27.17 ? 244 GLN C C     1 
ATOM   7862  O  O     . GLN C  1 233 ? -13.057 -12.210 -44.466 1.00 28.39 ? 244 GLN C O     1 
ATOM   7863  C  CB    . GLN C  1 233 ? -15.366 -13.581 -45.946 1.00 24.09 ? 244 GLN C CB    1 
ATOM   7864  C  CG    . GLN C  1 233 ? -16.262 -13.241 -47.150 1.00 47.20 ? 244 GLN C CG    1 
ATOM   7865  C  CD    . GLN C  1 233 ? -17.734 -13.612 -47.018 1.00 76.33 ? 244 GLN C CD    1 
ATOM   7866  O  OE1   . GLN C  1 233 ? -18.209 -14.129 -45.998 1.00 70.98 ? 244 GLN C OE1   1 
ATOM   7867  N  NE2   . GLN C  1 233 ? -18.498 -13.364 -48.076 1.00 72.44 ? 244 GLN C NE2   1 
ATOM   7868  N  N     . ILE C  1 234 ? -12.176 -14.277 -44.670 1.00 21.45 ? 245 ILE C N     1 
ATOM   7869  C  CA    . ILE C  1 234 ? -11.231 -14.187 -43.542 1.00 20.71 ? 245 ILE C CA    1 
ATOM   7870  C  C     . ILE C  1 234 ? -9.857  -13.847 -44.140 1.00 20.48 ? 245 ILE C C     1 
ATOM   7871  O  O     . ILE C  1 234 ? -9.211  -12.914 -43.697 1.00 17.68 ? 245 ILE C O     1 
ATOM   7872  C  CB    . ILE C  1 234 ? -11.212 -15.559 -42.795 1.00 23.97 ? 245 ILE C CB    1 
ATOM   7873  C  CG1   . ILE C  1 234 ? -12.287 -15.609 -41.737 1.00 25.14 ? 245 ILE C CG1   1 
ATOM   7874  C  CG2   . ILE C  1 234 ? -9.831  -15.970 -42.239 1.00 25.83 ? 245 ILE C CG2   1 
ATOM   7875  C  CD1   . ILE C  1 234 ? -12.720 -16.999 -41.526 1.00 27.68 ? 245 ILE C CD1   1 
ATOM   7876  N  N     . PHE C  1 235 ? -9.408  -14.657 -45.119 1.00 16.17 ? 246 PHE C N     1 
ATOM   7877  C  CA    . PHE C  1 235 ? -8.095  -14.547 -45.736 1.00 15.38 ? 246 PHE C CA    1 
ATOM   7878  C  C     . PHE C  1 235 ? -7.793  -13.162 -46.299 1.00 18.91 ? 246 PHE C C     1 
ATOM   7879  O  O     . PHE C  1 235 ? -6.750  -12.585 -45.968 1.00 16.02 ? 246 PHE C O     1 
ATOM   7880  C  CB    . PHE C  1 235 ? -7.901  -15.656 -46.807 1.00 16.07 ? 246 PHE C CB    1 
ATOM   7881  C  CG    . PHE C  1 235 ? -6.478  -15.747 -47.300 1.00 16.46 ? 246 PHE C CG    1 
ATOM   7882  C  CD1   . PHE C  1 235 ? -6.047  -14.977 -48.375 1.00 17.87 ? 246 PHE C CD1   1 
ATOM   7883  C  CD2   . PHE C  1 235 ? -5.556  -16.576 -46.665 1.00 16.68 ? 246 PHE C CD2   1 
ATOM   7884  C  CE1   . PHE C  1 235 ? -4.722  -15.048 -48.821 1.00 17.99 ? 246 PHE C CE1   1 
ATOM   7885  C  CE2   . PHE C  1 235 ? -4.221  -16.612 -47.085 1.00 17.36 ? 246 PHE C CE2   1 
ATOM   7886  C  CZ    . PHE C  1 235 ? -3.815  -15.855 -48.164 1.00 16.13 ? 246 PHE C CZ    1 
ATOM   7887  N  N     . LYS C  1 236 ? -8.667  -12.643 -47.188 1.00 17.44 ? 247 LYS C N     1 
ATOM   7888  C  CA    . LYS C  1 236 ? -8.422  -11.338 -47.803 1.00 17.22 ? 247 LYS C CA    1 
ATOM   7889  C  C     . LYS C  1 236 ? -8.308  -10.162 -46.791 1.00 21.07 ? 247 LYS C C     1 
ATOM   7890  O  O     . LYS C  1 236 ? -7.292  -9.466  -46.845 1.00 20.35 ? 247 LYS C O     1 
ATOM   7891  C  CB    . LYS C  1 236 ? -9.398  -11.032 -48.956 1.00 18.73 ? 247 LYS C CB    1 
ATOM   7892  C  CG    . LYS C  1 236 ? -8.980  -9.815  -49.787 1.00 29.99 ? 247 LYS C CG    1 
ATOM   7893  C  CD    . LYS C  1 236 ? -9.986  -9.475  -50.878 1.00 39.25 ? 247 LYS C CD    1 
ATOM   7894  C  CE    . LYS C  1 236 ? -9.577  -8.217  -51.599 1.00 54.85 ? 247 LYS C CE    1 
ATOM   7895  N  NZ    . LYS C  1 236 ? -10.478 -7.911  -52.742 1.00 69.95 ? 247 LYS C NZ    1 
ATOM   7896  N  N     . PRO C  1 237 ? -9.277  -9.898  -45.878 1.00 20.05 ? 248 PRO C N     1 
ATOM   7897  C  CA    . PRO C  1 237 ? -9.096  -8.781  -44.921 1.00 19.92 ? 248 PRO C CA    1 
ATOM   7898  C  C     . PRO C  1 237 ? -7.856  -8.946  -44.019 1.00 20.97 ? 248 PRO C C     1 
ATOM   7899  O  O     . PRO C  1 237 ? -7.148  -7.973  -43.772 1.00 19.54 ? 248 PRO C O     1 
ATOM   7900  C  CB    . PRO C  1 237 ? -10.375 -8.834  -44.075 1.00 22.08 ? 248 PRO C CB    1 
ATOM   7901  C  CG    . PRO C  1 237 ? -11.342 -9.552  -44.897 1.00 26.99 ? 248 PRO C CG    1 
ATOM   7902  C  CD    . PRO C  1 237 ? -10.565 -10.576 -45.638 1.00 22.19 ? 248 PRO C CD    1 
ATOM   7903  N  N     . ILE C  1 238 ? -7.585  -10.179 -43.548 1.00 16.82 ? 249 ILE C N     1 
ATOM   7904  C  CA    . ILE C  1 238 ? -6.428  -10.444 -42.675 1.00 16.29 ? 249 ILE C CA    1 
ATOM   7905  C  C     . ILE C  1 238 ? -5.107  -10.129 -43.382 1.00 20.48 ? 249 ILE C C     1 
ATOM   7906  O  O     . ILE C  1 238 ? -4.304  -9.342  -42.856 1.00 20.34 ? 249 ILE C O     1 
ATOM   7907  C  CB    . ILE C  1 238 ? -6.447  -11.857 -42.015 1.00 19.46 ? 249 ILE C CB    1 
ATOM   7908  C  CG1   . ILE C  1 238 ? -7.669  -12.072 -41.039 1.00 20.19 ? 249 ILE C CG1   1 
ATOM   7909  C  CG2   . ILE C  1 238 ? -5.094  -12.208 -41.338 1.00 20.16 ? 249 ILE C CG2   1 
ATOM   7910  C  CD1   . ILE C  1 238 ? -7.696  -11.288 -39.730 1.00 27.97 ? 249 ILE C CD1   1 
ATOM   7911  N  N     . ILE C  1 239 ? -4.893  -10.724 -44.576 1.00 17.53 ? 250 ILE C N     1 
ATOM   7912  C  CA    . ILE C  1 239 ? -3.671  -10.526 -45.355 1.00 17.05 ? 250 ILE C CA    1 
ATOM   7913  C  C     . ILE C  1 239 ? -3.505  -9.063  -45.778 1.00 19.99 ? 250 ILE C C     1 
ATOM   7914  O  O     . ILE C  1 239 ? -2.411  -8.512  -45.614 1.00 17.10 ? 250 ILE C O     1 
ATOM   7915  C  CB    . ILE C  1 239 ? -3.502  -11.581 -46.508 1.00 19.20 ? 250 ILE C CB    1 
ATOM   7916  C  CG1   . ILE C  1 239 ? -3.445  -13.034 -45.943 1.00 19.39 ? 250 ILE C CG1   1 
ATOM   7917  C  CG2   . ILE C  1 239 ? -2.293  -11.279 -47.391 1.00 18.65 ? 250 ILE C CG2   1 
ATOM   7918  C  CD1   . ILE C  1 239 ? -2.356  -13.364 -44.784 1.00 18.30 ? 250 ILE C CD1   1 
ATOM   7919  N  N     . SER C  1 240 ? -4.609  -8.406  -46.207 1.00 16.29 ? 251 SER C N     1 
ATOM   7920  C  CA    . SER C  1 240 ? -4.590  -6.980  -46.541 1.00 16.59 ? 251 SER C CA    1 
ATOM   7921  C  C     . SER C  1 240 ? -4.124  -6.119  -45.350 1.00 18.54 ? 251 SER C C     1 
ATOM   7922  O  O     . SER C  1 240 ? -3.296  -5.240  -45.537 1.00 19.05 ? 251 SER C O     1 
ATOM   7923  C  CB    . SER C  1 240 ? -5.962  -6.508  -47.010 1.00 21.61 ? 251 SER C CB    1 
ATOM   7924  O  OG    . SER C  1 240 ? -6.284  -7.149  -48.234 1.00 30.61 ? 251 SER C OG    1 
ATOM   7925  N  N     . LYS C  1 241 ? -4.618  -6.393  -44.140 1.00 15.45 ? 252 LYS C N     1 
ATOM   7926  C  CA    . LYS C  1 241 ? -4.223  -5.653  -42.934 1.00 15.14 ? 252 LYS C CA    1 
ATOM   7927  C  C     . LYS C  1 241 ? -2.747  -5.999  -42.582 1.00 20.39 ? 252 LYS C C     1 
ATOM   7928  O  O     . LYS C  1 241 ? -1.989  -5.118  -42.181 1.00 20.19 ? 252 LYS C O     1 
ATOM   7929  C  CB    . LYS C  1 241 ? -5.178  -5.985  -41.769 1.00 18.09 ? 252 LYS C CB    1 
ATOM   7930  C  CG    . LYS C  1 241 ? -4.967  -5.129  -40.512 1.00 29.48 ? 252 LYS C CG    1 
ATOM   7931  C  CD    . LYS C  1 241 ? -5.482  -3.690  -40.644 1.00 46.24 ? 252 LYS C CD    1 
ATOM   7932  C  CE    . LYS C  1 241 ? -5.132  -2.854  -39.436 1.00 61.39 ? 252 LYS C CE    1 
ATOM   7933  N  NZ    . LYS C  1 241 ? -5.669  -3.442  -38.171 1.00 70.23 ? 252 LYS C NZ    1 
ATOM   7934  N  N     . VAL C  1 242 ? -2.338  -7.281  -42.763 1.00 17.02 ? 253 VAL C N     1 
ATOM   7935  C  CA    . VAL C  1 242 ? -0.939  -7.691  -42.501 1.00 15.57 ? 253 VAL C CA    1 
ATOM   7936  C  C     . VAL C  1 242 ? -0.011  -6.903  -43.444 1.00 18.25 ? 253 VAL C C     1 
ATOM   7937  O  O     . VAL C  1 242 ? 0.989   -6.335  -42.997 1.00 17.80 ? 253 VAL C O     1 
ATOM   7938  C  CB    . VAL C  1 242 ? -0.758  -9.225  -42.671 1.00 18.14 ? 253 VAL C CB    1 
ATOM   7939  C  CG1   . VAL C  1 242 ? 0.717   -9.582  -42.788 1.00 17.30 ? 253 VAL C CG1   1 
ATOM   7940  C  CG2   . VAL C  1 242 ? -1.404  -9.993  -41.513 1.00 17.25 ? 253 VAL C CG2   1 
ATOM   7941  N  N     . MET C  1 243 ? -0.362  -6.839  -44.742 1.00 15.74 ? 254 MET C N     1 
ATOM   7942  C  CA    . MET C  1 243 ? 0.442   -6.109  -45.729 1.00 15.85 ? 254 MET C CA    1 
ATOM   7943  C  C     . MET C  1 243 ? 0.570   -4.613  -45.387 1.00 20.47 ? 254 MET C C     1 
ATOM   7944  O  O     . MET C  1 243 ? 1.670   -4.050  -45.455 1.00 19.72 ? 254 MET C O     1 
ATOM   7945  C  CB    . MET C  1 243 ? -0.119  -6.300  -47.145 1.00 17.18 ? 254 MET C CB    1 
ATOM   7946  C  CG    . MET C  1 243 ? -0.013  -7.722  -47.640 1.00 19.85 ? 254 MET C CG    1 
ATOM   7947  S  SD    . MET C  1 243 ? 1.668   -8.183  -48.072 1.00 21.77 ? 254 MET C SD    1 
ATOM   7948  C  CE    . MET C  1 243 ? 1.341   -9.821  -48.849 1.00 18.20 ? 254 MET C CE    1 
ATOM   7949  N  N     . GLU C  1 244 ? -0.549  -3.995  -44.975 1.00 17.94 ? 255 GLU C N     1 
ATOM   7950  C  CA    . GLU C  1 244 ? -0.594  -2.585  -44.599 1.00 18.40 ? 255 GLU C CA    1 
ATOM   7951  C  C     . GLU C  1 244 ? 0.310   -2.296  -43.386 1.00 21.04 ? 255 GLU C C     1 
ATOM   7952  O  O     . GLU C  1 244 ? 1.130   -1.379  -43.437 1.00 21.90 ? 255 GLU C O     1 
ATOM   7953  C  CB    . GLU C  1 244 ? -2.049  -2.165  -44.303 1.00 19.77 ? 255 GLU C CB    1 
ATOM   7954  C  CG    . GLU C  1 244 ? -2.177  -0.750  -43.764 1.00 32.15 ? 255 GLU C CG    1 
ATOM   7955  C  CD    . GLU C  1 244 ? -3.577  -0.316  -43.384 1.00 55.22 ? 255 GLU C CD    1 
ATOM   7956  O  OE1   . GLU C  1 244 ? -4.245  -1.058  -42.631 1.00 39.76 ? 255 GLU C OE1   1 
ATOM   7957  O  OE2   . GLU C  1 244 ? -3.986  0.795   -43.790 1.00 60.97 ? 255 GLU C OE2   1 
ATOM   7958  N  N     . MET C  1 245 ? 0.149   -3.075  -42.313 1.00 17.09 ? 256 MET C N     1 
ATOM   7959  C  CA    . MET C  1 245 ? 0.876   -2.896  -41.053 1.00 16.38 ? 256 MET C CA    1 
ATOM   7960  C  C     . MET C  1 245 ? 2.336   -3.340  -41.115 1.00 19.55 ? 256 MET C C     1 
ATOM   7961  O  O     . MET C  1 245 ? 3.215   -2.658  -40.590 1.00 17.86 ? 256 MET C O     1 
ATOM   7962  C  CB    . MET C  1 245 ? 0.150   -3.617  -39.907 1.00 18.72 ? 256 MET C CB    1 
ATOM   7963  C  CG    . MET C  1 245 ? -1.299  -3.156  -39.685 1.00 22.69 ? 256 MET C CG    1 
ATOM   7964  S  SD    . MET C  1 245 ? -1.501  -1.348  -39.608 1.00 27.66 ? 256 MET C SD    1 
ATOM   7965  C  CE    . MET C  1 245 ? -0.782  -1.036  -38.004 1.00 23.83 ? 256 MET C CE    1 
ATOM   7966  N  N     . TYR C  1 246 ? 2.590   -4.488  -41.742 1.00 16.01 ? 257 TYR C N     1 
ATOM   7967  C  CA    . TYR C  1 246 ? 3.921   -5.081  -41.788 1.00 14.54 ? 257 TYR C CA    1 
ATOM   7968  C  C     . TYR C  1 246 ? 4.836   -4.621  -42.915 1.00 19.31 ? 257 TYR C C     1 
ATOM   7969  O  O     . TYR C  1 246 ? 6.056   -4.619  -42.733 1.00 19.57 ? 257 TYR C O     1 
ATOM   7970  C  CB    . TYR C  1 246 ? 3.823   -6.619  -41.669 1.00 13.49 ? 257 TYR C CB    1 
ATOM   7971  C  CG    . TYR C  1 246 ? 5.147   -7.322  -41.435 1.00 13.65 ? 257 TYR C CG    1 
ATOM   7972  C  CD1   . TYR C  1 246 ? 5.621   -8.276  -42.335 1.00 14.85 ? 257 TYR C CD1   1 
ATOM   7973  C  CD2   . TYR C  1 246 ? 5.930   -7.027  -40.320 1.00 13.16 ? 257 TYR C CD2   1 
ATOM   7974  C  CE1   . TYR C  1 246 ? 6.832   -8.931  -42.122 1.00 14.46 ? 257 TYR C CE1   1 
ATOM   7975  C  CE2   . TYR C  1 246 ? 7.142   -7.684  -40.093 1.00 13.58 ? 257 TYR C CE2   1 
ATOM   7976  C  CZ    . TYR C  1 246 ? 7.592   -8.628  -41.003 1.00 19.33 ? 257 TYR C CZ    1 
ATOM   7977  O  OH    . TYR C  1 246 ? 8.788   -9.269  -40.782 1.00 15.77 ? 257 TYR C OH    1 
ATOM   7978  N  N     . GLN C  1 247 ? 4.265   -4.283  -44.084 1.00 16.37 ? 258 GLN C N     1 
ATOM   7979  C  CA    . GLN C  1 247 ? 4.987   -3.815  -45.271 1.00 15.81 ? 258 GLN C CA    1 
ATOM   7980  C  C     . GLN C  1 247 ? 6.204   -4.704  -45.593 1.00 19.61 ? 258 GLN C C     1 
ATOM   7981  O  O     . GLN C  1 247 ? 7.345   -4.253  -45.514 1.00 19.90 ? 258 GLN C O     1 
ATOM   7982  C  CB    . GLN C  1 247 ? 5.364   -2.330  -45.102 1.00 17.88 ? 258 GLN C CB    1 
ATOM   7983  C  CG    . GLN C  1 247 ? 4.135   -1.437  -45.078 1.00 27.39 ? 258 GLN C CG    1 
ATOM   7984  C  CD    . GLN C  1 247 ? 4.378   -0.189  -44.295 1.00 53.30 ? 258 GLN C CD    1 
ATOM   7985  O  OE1   . GLN C  1 247 ? 3.811   0.008   -43.217 1.00 56.64 ? 258 GLN C OE1   1 
ATOM   7986  N  NE2   . GLN C  1 247 ? 5.220   0.680   -44.816 1.00 39.32 ? 258 GLN C NE2   1 
ATOM   7987  N  N     . PRO C  1 248 ? 5.983   -6.006  -45.852 1.00 14.23 ? 259 PRO C N     1 
ATOM   7988  C  CA    . PRO C  1 248 ? 7.128   -6.886  -46.127 1.00 13.93 ? 259 PRO C CA    1 
ATOM   7989  C  C     . PRO C  1 248 ? 7.690   -6.651  -47.527 1.00 19.10 ? 259 PRO C C     1 
ATOM   7990  O  O     . PRO C  1 248 ? 6.987   -6.127  -48.395 1.00 18.92 ? 259 PRO C O     1 
ATOM   7991  C  CB    . PRO C  1 248 ? 6.508   -8.289  -46.001 1.00 15.29 ? 259 PRO C CB    1 
ATOM   7992  C  CG    . PRO C  1 248 ? 5.070   -8.101  -46.478 1.00 19.11 ? 259 PRO C CG    1 
ATOM   7993  C  CD    . PRO C  1 248 ? 4.689   -6.733  -45.963 1.00 14.96 ? 259 PRO C CD    1 
ATOM   7994  N  N     . SER C  1 249 ? 8.945   -7.042  -47.765 1.00 17.56 ? 260 SER C N     1 
ATOM   7995  C  CA    . SER C  1 249 ? 9.519   -6.895  -49.103 1.00 16.44 ? 260 SER C CA    1 
ATOM   7996  C  C     . SER C  1 249 ? 9.583   -8.212  -49.861 1.00 19.39 ? 260 SER C C     1 
ATOM   7997  O  O     . SER C  1 249 ? 9.916   -8.207  -51.040 1.00 18.14 ? 260 SER C O     1 
ATOM   7998  C  CB    . SER C  1 249 ? 10.855  -6.163  -49.066 1.00 19.48 ? 260 SER C CB    1 
ATOM   7999  O  OG    . SER C  1 249 ? 11.781  -6.851  -48.251 1.00 25.05 ? 260 SER C OG    1 
ATOM   8000  N  N     . ALA C  1 250 ? 9.248   -9.347  -49.199 1.00 15.69 ? 261 ALA C N     1 
ATOM   8001  C  CA    . ALA C  1 250 ? 9.187   -10.669 -49.832 1.00 15.22 ? 261 ALA C CA    1 
ATOM   8002  C  C     . ALA C  1 250 ? 8.147   -11.506 -49.105 1.00 16.94 ? 261 ALA C C     1 
ATOM   8003  O  O     . ALA C  1 250 ? 7.799   -11.202 -47.962 1.00 16.94 ? 261 ALA C O     1 
ATOM   8004  C  CB    . ALA C  1 250 ? 10.550  -11.359 -49.818 1.00 16.08 ? 261 ALA C CB    1 
ATOM   8005  N  N     . VAL C  1 251 ? 7.571   -12.497 -49.799 1.00 12.53 ? 262 VAL C N     1 
ATOM   8006  C  CA    . VAL C  1 251 ? 6.520   -13.347 -49.230 1.00 12.10 ? 262 VAL C CA    1 
ATOM   8007  C  C     . VAL C  1 251 ? 6.815   -14.793 -49.539 1.00 15.29 ? 262 VAL C C     1 
ATOM   8008  O  O     . VAL C  1 251 ? 7.216   -15.115 -50.666 1.00 15.10 ? 262 VAL C O     1 
ATOM   8009  C  CB    . VAL C  1 251 ? 5.087   -12.969 -49.728 1.00 15.53 ? 262 VAL C CB    1 
ATOM   8010  C  CG1   . VAL C  1 251 ? 4.000   -13.811 -49.039 1.00 15.14 ? 262 VAL C CG1   1 
ATOM   8011  C  CG2   . VAL C  1 251 ? 4.794   -11.481 -49.542 1.00 15.72 ? 262 VAL C CG2   1 
ATOM   8012  N  N     . VAL C  1 252 ? 6.552   -15.674 -48.553 1.00 11.58 ? 263 VAL C N     1 
ATOM   8013  C  CA    . VAL C  1 252 ? 6.658   -17.118 -48.686 1.00 11.05 ? 263 VAL C CA    1 
ATOM   8014  C  C     . VAL C  1 252 ? 5.261   -17.658 -48.402 1.00 15.62 ? 263 VAL C C     1 
ATOM   8015  O  O     . VAL C  1 252 ? 4.704   -17.427 -47.316 1.00 15.05 ? 263 VAL C O     1 
ATOM   8016  C  CB    . VAL C  1 252 ? 7.736   -17.759 -47.767 1.00 14.78 ? 263 VAL C CB    1 
ATOM   8017  C  CG1   . VAL C  1 252 ? 7.749   -19.282 -47.930 1.00 14.25 ? 263 VAL C CG1   1 
ATOM   8018  C  CG2   . VAL C  1 252 ? 9.112   -17.173 -48.050 1.00 14.11 ? 263 VAL C CG2   1 
ATOM   8019  N  N     . LEU C  1 253 ? 4.679   -18.343 -49.394 1.00 12.34 ? 264 LEU C N     1 
ATOM   8020  C  CA    . LEU C  1 253 ? 3.332   -18.880 -49.256 1.00 12.33 ? 264 LEU C CA    1 
ATOM   8021  C  C     . LEU C  1 253 ? 3.381   -20.386 -49.320 1.00 15.38 ? 264 LEU C C     1 
ATOM   8022  O  O     . LEU C  1 253 ? 3.720   -20.951 -50.371 1.00 15.68 ? 264 LEU C O     1 
ATOM   8023  C  CB    . LEU C  1 253 ? 2.401   -18.313 -50.362 1.00 11.98 ? 264 LEU C CB    1 
ATOM   8024  C  CG    . LEU C  1 253 ? 0.942   -18.878 -50.417 1.00 15.31 ? 264 LEU C CG    1 
ATOM   8025  C  CD1   . LEU C  1 253 ? 0.166   -18.586 -49.117 1.00 14.81 ? 264 LEU C CD1   1 
ATOM   8026  C  CD2   . LEU C  1 253 ? 0.181   -18.294 -51.594 1.00 17.51 ? 264 LEU C CD2   1 
ATOM   8027  N  N     . GLN C  1 254 ? 3.075   -21.039 -48.186 1.00 11.93 ? 265 GLN C N     1 
ATOM   8028  C  CA    . GLN C  1 254 ? 3.016   -22.500 -48.095 1.00 12.07 ? 265 GLN C CA    1 
ATOM   8029  C  C     . GLN C  1 254 ? 1.602   -22.893 -48.557 1.00 15.38 ? 265 GLN C C     1 
ATOM   8030  O  O     . GLN C  1 254 ? 0.620   -22.410 -47.992 1.00 13.60 ? 265 GLN C O     1 
ATOM   8031  C  CB    . GLN C  1 254 ? 3.325   -22.936 -46.655 1.00 12.64 ? 265 GLN C CB    1 
ATOM   8032  C  CG    . GLN C  1 254 ? 3.692   -24.418 -46.511 1.00 5.09  ? 265 GLN C CG    1 
ATOM   8033  C  CD    . GLN C  1 254 ? 2.528   -25.309 -46.216 1.00 15.68 ? 265 GLN C CD    1 
ATOM   8034  O  OE1   . GLN C  1 254 ? 1.379   -24.979 -46.505 1.00 15.55 ? 265 GLN C OE1   1 
ATOM   8035  N  NE2   . GLN C  1 254 ? 2.794   -26.490 -45.649 1.00 10.47 ? 265 GLN C NE2   1 
ATOM   8036  N  N     . CYS C  1 255 ? 1.498   -23.692 -49.651 1.00 12.88 ? 266 CYS C N     1 
ATOM   8037  C  CA    . CYS C  1 255 ? 0.213   -24.025 -50.285 1.00 12.27 ? 266 CYS C CA    1 
ATOM   8038  C  C     . CYS C  1 255 ? -0.254  -25.444 -50.017 1.00 17.13 ? 266 CYS C C     1 
ATOM   8039  O  O     . CYS C  1 255 ? -0.847  -26.045 -50.909 1.00 16.55 ? 266 CYS C O     1 
ATOM   8040  C  CB    . CYS C  1 255 ? 0.266   -23.743 -51.792 1.00 11.58 ? 266 CYS C CB    1 
ATOM   8041  S  SG    . CYS C  1 255 ? 0.734   -22.055 -52.229 1.00 15.22 ? 266 CYS C SG    1 
ATOM   8042  N  N     . GLY C  1 256 ? -0.023  -25.952 -48.802 1.00 14.07 ? 267 GLY C N     1 
ATOM   8043  C  CA    . GLY C  1 256 ? -0.439  -27.297 -48.386 1.00 13.96 ? 267 GLY C CA    1 
ATOM   8044  C  C     . GLY C  1 256 ? -1.866  -27.522 -48.831 1.00 17.62 ? 267 GLY C C     1 
ATOM   8045  O  O     . GLY C  1 256 ? -2.736  -26.681 -48.574 1.00 16.26 ? 267 GLY C O     1 
ATOM   8046  N  N     . ALA C  1 257 ? -2.072  -28.591 -49.608 1.00 14.87 ? 268 ALA C N     1 
ATOM   8047  C  CA    . ALA C  1 257 ? -3.336  -28.932 -50.260 1.00 13.82 ? 268 ALA C CA    1 
ATOM   8048  C  C     . ALA C  1 257 ? -4.275  -29.810 -49.439 1.00 17.28 ? 268 ALA C C     1 
ATOM   8049  O  O     . ALA C  1 257 ? -5.342  -30.194 -49.928 1.00 16.59 ? 268 ALA C O     1 
ATOM   8050  C  CB    . ALA C  1 257 ? -3.037  -29.567 -51.610 1.00 14.72 ? 268 ALA C CB    1 
ATOM   8051  N  N     . ASP C  1 258 ? -3.910  -30.106 -48.180 1.00 11.58 ? 269 ASP C N     1 
ATOM   8052  C  CA    . ASP C  1 258 ? -4.751  -30.885 -47.272 1.00 11.08 ? 269 ASP C CA    1 
ATOM   8053  C  C     . ASP C  1 258 ? -5.904  -30.058 -46.669 1.00 14.93 ? 269 ASP C C     1 
ATOM   8054  O  O     . ASP C  1 258 ? -6.739  -30.583 -45.919 1.00 14.19 ? 269 ASP C O     1 
ATOM   8055  C  CB    . ASP C  1 258 ? -3.926  -31.580 -46.188 1.00 13.20 ? 269 ASP C CB    1 
ATOM   8056  C  CG    . ASP C  1 258 ? -2.909  -30.701 -45.499 1.00 14.17 ? 269 ASP C CG    1 
ATOM   8057  O  OD1   . ASP C  1 258 ? -3.001  -29.467 -45.638 1.00 12.10 ? 269 ASP C OD1   1 
ATOM   8058  O  OD2   . ASP C  1 258 ? -2.053  -31.250 -44.781 1.00 12.50 ? 269 ASP C OD2   1 
ATOM   8059  N  N     . SER C  1 259 ? -5.969  -28.763 -47.035 1.00 12.71 ? 270 SER C N     1 
ATOM   8060  C  CA    . SER C  1 259 ? -7.086  -27.882 -46.653 1.00 12.04 ? 270 SER C CA    1 
ATOM   8061  C  C     . SER C  1 259 ? -8.236  -28.013 -47.703 1.00 17.33 ? 270 SER C C     1 
ATOM   8062  O  O     . SER C  1 259 ? -9.276  -27.371 -47.561 1.00 17.45 ? 270 SER C O     1 
ATOM   8063  C  CB    . SER C  1 259 ? -6.626  -26.434 -46.522 1.00 11.57 ? 270 SER C CB    1 
ATOM   8064  O  OG    . SER C  1 259 ? -5.726  -26.055 -47.551 1.00 15.07 ? 270 SER C OG    1 
ATOM   8065  N  N     . LEU C  1 260 ? -8.068  -28.901 -48.710 1.00 13.74 ? 271 LEU C N     1 
ATOM   8066  C  CA    . LEU C  1 260 ? -9.083  -29.140 -49.732 1.00 13.88 ? 271 LEU C CA    1 
ATOM   8067  C  C     . LEU C  1 260 ? -10.142 -30.118 -49.245 1.00 17.18 ? 271 LEU C C     1 
ATOM   8068  O  O     . LEU C  1 260 ? -9.858  -31.054 -48.493 1.00 14.94 ? 271 LEU C O     1 
ATOM   8069  C  CB    . LEU C  1 260 ? -8.454  -29.708 -51.026 1.00 13.57 ? 271 LEU C CB    1 
ATOM   8070  C  CG    . LEU C  1 260 ? -7.569  -28.790 -51.890 1.00 17.70 ? 271 LEU C CG    1 
ATOM   8071  C  CD1   . LEU C  1 260 ? -6.993  -29.560 -53.060 1.00 16.79 ? 271 LEU C CD1   1 
ATOM   8072  C  CD2   . LEU C  1 260 ? -8.310  -27.545 -52.363 1.00 20.98 ? 271 LEU C CD2   1 
ATOM   8073  N  N     . SER C  1 261 ? -11.379 -29.942 -49.747 1.00 16.23 ? 272 SER C N     1 
ATOM   8074  C  CA    . SER C  1 261 ? -12.468 -30.884 -49.491 1.00 15.10 ? 272 SER C CA    1 
ATOM   8075  C  C     . SER C  1 261 ? -11.997 -32.273 -49.983 1.00 17.79 ? 272 SER C C     1 
ATOM   8076  O  O     . SER C  1 261 ? -11.316 -32.356 -51.007 1.00 17.00 ? 272 SER C O     1 
ATOM   8077  C  CB    . SER C  1 261 ? -13.673 -30.501 -50.352 1.00 17.66 ? 272 SER C CB    1 
ATOM   8078  O  OG    . SER C  1 261 ? -14.762 -31.350 -50.021 1.00 23.74 ? 272 SER C OG    1 
ATOM   8079  N  N     . GLY C  1 262 ? -12.372 -33.323 -49.272 1.00 17.00 ? 273 GLY C N     1 
ATOM   8080  C  CA    . GLY C  1 262 ? -12.034 -34.689 -49.663 1.00 18.19 ? 273 GLY C CA    1 
ATOM   8081  C  C     . GLY C  1 262 ? -10.616 -35.116 -49.334 1.00 21.89 ? 273 GLY C C     1 
ATOM   8082  O  O     . GLY C  1 262 ? -10.200 -36.202 -49.748 1.00 19.70 ? 273 GLY C O     1 
ATOM   8083  N  N     . ASP C  1 263 ? -9.853  -34.283 -48.582 1.00 17.57 ? 274 ASP C N     1 
ATOM   8084  C  CA    . ASP C  1 263 ? -8.493  -34.701 -48.217 1.00 17.27 ? 274 ASP C CA    1 
ATOM   8085  C  C     . ASP C  1 263 ? -8.539  -35.889 -47.272 1.00 21.74 ? 274 ASP C C     1 
ATOM   8086  O  O     . ASP C  1 263 ? -9.363  -35.912 -46.355 1.00 20.87 ? 274 ASP C O     1 
ATOM   8087  C  CB    . ASP C  1 263 ? -7.649  -33.559 -47.622 1.00 17.33 ? 274 ASP C CB    1 
ATOM   8088  C  CG    . ASP C  1 263 ? -6.202  -34.009 -47.443 1.00 20.71 ? 274 ASP C CG    1 
ATOM   8089  O  OD1   . ASP C  1 263 ? -5.452  -34.014 -48.449 1.00 21.23 ? 274 ASP C OD1   1 
ATOM   8090  O  OD2   . ASP C  1 263 ? -5.840  -34.410 -46.314 1.00 17.08 ? 274 ASP C OD2   1 
ATOM   8091  N  N     . ARG C  1 264 ? -7.662  -36.883 -47.501 1.00 19.15 ? 275 ARG C N     1 
ATOM   8092  C  CA    . ARG C  1 264 ? -7.582  -38.104 -46.680 1.00 19.00 ? 275 ARG C CA    1 
ATOM   8093  C  C     . ARG C  1 264 ? -7.406  -37.817 -45.208 1.00 22.32 ? 275 ARG C C     1 
ATOM   8094  O  O     . ARG C  1 264 ? -7.963  -38.534 -44.375 1.00 21.92 ? 275 ARG C O     1 
ATOM   8095  C  CB    . ARG C  1 264 ? -6.431  -39.018 -47.153 1.00 19.44 ? 275 ARG C CB    1 
ATOM   8096  C  CG    . ARG C  1 264 ? -6.796  -39.884 -48.368 1.00 36.85 ? 275 ARG C CG    1 
ATOM   8097  C  CD    . ARG C  1 264 ? -5.707  -40.899 -48.709 1.00 49.58 ? 275 ARG C CD    1 
ATOM   8098  N  NE    . ARG C  1 264 ? -5.444  -41.840 -47.613 1.00 61.04 ? 275 ARG C NE    1 
ATOM   8099  C  CZ    . ARG C  1 264 ? -4.424  -42.694 -47.576 1.00 77.91 ? 275 ARG C CZ    1 
ATOM   8100  N  NH1   . ARG C  1 264 ? -3.556  -42.751 -48.580 1.00 59.28 ? 275 ARG C NH1   1 
ATOM   8101  N  NH2   . ARG C  1 264 ? -4.264  -43.499 -46.534 1.00 71.86 ? 275 ARG C NH2   1 
ATOM   8102  N  N     . LEU C  1 265 ? -6.615  -36.777 -44.877 1.00 19.05 ? 276 LEU C N     1 
ATOM   8103  C  CA    . LEU C  1 265 ? -6.332  -36.425 -43.491 1.00 17.91 ? 276 LEU C CA    1 
ATOM   8104  C  C     . LEU C  1 265 ? -7.061  -35.172 -43.019 1.00 22.13 ? 276 LEU C C     1 
ATOM   8105  O  O     . LEU C  1 265 ? -7.352  -35.062 -41.844 1.00 22.68 ? 276 LEU C O     1 
ATOM   8106  C  CB    . LEU C  1 265 ? -4.810  -36.272 -43.264 1.00 17.22 ? 276 LEU C CB    1 
ATOM   8107  C  CG    . LEU C  1 265 ? -3.901  -37.523 -43.378 1.00 20.91 ? 276 LEU C CG    1 
ATOM   8108  C  CD1   . LEU C  1 265 ? -2.475  -37.194 -42.914 1.00 18.70 ? 276 LEU C CD1   1 
ATOM   8109  C  CD2   . LEU C  1 265 ? -4.431  -38.706 -42.557 1.00 25.28 ? 276 LEU C CD2   1 
ATOM   8110  N  N     . GLY C  1 266 ? -7.324  -34.238 -43.923 1.00 18.29 ? 277 GLY C N     1 
ATOM   8111  C  CA    . GLY C  1 266 ? -7.968  -32.979 -43.588 1.00 18.64 ? 277 GLY C CA    1 
ATOM   8112  C  C     . GLY C  1 266 ? -9.463  -33.047 -43.336 1.00 24.24 ? 277 GLY C C     1 
ATOM   8113  O  O     . GLY C  1 266 ? -10.120 -34.028 -43.702 1.00 24.28 ? 277 GLY C O     1 
ATOM   8114  N  N     . CYS C  1 267 ? -10.016 -31.967 -42.735 1.00 18.98 ? 278 CYS C N     1 
ATOM   8115  C  CA    . CYS C  1 267 ? -11.430 -31.856 -42.382 1.00 17.96 ? 278 CYS C CA    1 
ATOM   8116  C  C     . CYS C  1 267 ? -12.008 -30.495 -42.839 1.00 20.75 ? 278 CYS C C     1 
ATOM   8117  O  O     . CYS C  1 267 ? -13.022 -30.041 -42.307 1.00 21.26 ? 278 CYS C O     1 
ATOM   8118  C  CB    A CYS C  1 267 ? -11.633 -32.082 -40.885 0.86 17.90 ? 278 CYS C CB    1 
ATOM   8119  C  CB    B CYS C  1 267 ? -11.636 -32.082 -40.884 0.14 18.84 ? 278 CYS C CB    1 
ATOM   8120  S  SG    A CYS C  1 267 ? -10.555 -31.067 -39.828 0.86 21.41 ? 278 CYS C SG    1 
ATOM   8121  S  SG    B CYS C  1 267 ? -10.954 -33.640 -40.254 0.14 23.10 ? 278 CYS C SG    1 
ATOM   8122  N  N     . PHE C  1 268 ? -11.364 -29.854 -43.824 1.00 15.86 ? 279 PHE C N     1 
ATOM   8123  C  CA    . PHE C  1 268 ? -11.813 -28.575 -44.393 1.00 14.52 ? 279 PHE C CA    1 
ATOM   8124  C  C     . PHE C  1 268 ? -12.631 -28.855 -45.672 1.00 18.60 ? 279 PHE C C     1 
ATOM   8125  O  O     . PHE C  1 268 ? -12.693 -30.008 -46.107 1.00 18.16 ? 279 PHE C O     1 
ATOM   8126  C  CB    . PHE C  1 268 ? -10.635 -27.641 -44.665 1.00 15.02 ? 279 PHE C CB    1 
ATOM   8127  C  CG    . PHE C  1 268 ? -10.111 -26.806 -43.501 1.00 14.77 ? 279 PHE C CG    1 
ATOM   8128  C  CD1   . PHE C  1 268 ? -9.108  -25.862 -43.700 1.00 16.69 ? 279 PHE C CD1   1 
ATOM   8129  C  CD2   . PHE C  1 268 ? -10.650 -26.937 -42.220 1.00 14.68 ? 279 PHE C CD2   1 
ATOM   8130  C  CE1   . PHE C  1 268 ? -8.637  -25.076 -42.639 1.00 16.17 ? 279 PHE C CE1   1 
ATOM   8131  C  CE2   . PHE C  1 268 ? -10.137 -26.185 -41.147 1.00 17.01 ? 279 PHE C CE2   1 
ATOM   8132  C  CZ    . PHE C  1 268 ? -9.139  -25.255 -41.372 1.00 14.72 ? 279 PHE C CZ    1 
ATOM   8133  N  N     . ASN C  1 269 ? -13.288 -27.829 -46.240 1.00 15.16 ? 280 ASN C N     1 
ATOM   8134  C  CA    . ASN C  1 269 ? -14.163 -28.007 -47.403 1.00 14.85 ? 280 ASN C CA    1 
ATOM   8135  C  C     . ASN C  1 269 ? -13.902 -26.984 -48.502 1.00 20.06 ? 280 ASN C C     1 
ATOM   8136  O  O     . ASN C  1 269 ? -14.834 -26.498 -49.145 1.00 20.75 ? 280 ASN C O     1 
ATOM   8137  C  CB    . ASN C  1 269 ? -15.652 -28.024 -46.936 1.00 14.73 ? 280 ASN C CB    1 
ATOM   8138  C  CG    . ASN C  1 269 ? -16.649 -28.599 -47.946 1.00 30.13 ? 280 ASN C CG    1 
ATOM   8139  O  OD1   . ASN C  1 269 ? -16.285 -29.332 -48.870 1.00 18.69 ? 280 ASN C OD1   1 
ATOM   8140  N  ND2   . ASN C  1 269 ? -17.942 -28.292 -47.783 1.00 20.68 ? 280 ASN C ND2   1 
ATOM   8141  N  N     . LEU C  1 270 ? -12.621 -26.686 -48.765 1.00 16.04 ? 281 LEU C N     1 
ATOM   8142  C  CA    . LEU C  1 270 ? -12.267 -25.744 -49.824 1.00 16.31 ? 281 LEU C CA    1 
ATOM   8143  C  C     . LEU C  1 270 ? -12.232 -26.433 -51.177 1.00 20.93 ? 281 LEU C C     1 
ATOM   8144  O  O     . LEU C  1 270 ? -11.933 -27.630 -51.253 1.00 19.99 ? 281 LEU C O     1 
ATOM   8145  C  CB    . LEU C  1 270 ? -10.872 -25.122 -49.567 1.00 15.84 ? 281 LEU C CB    1 
ATOM   8146  C  CG    . LEU C  1 270 ? -10.673 -24.296 -48.294 1.00 19.03 ? 281 LEU C CG    1 
ATOM   8147  C  CD1   . LEU C  1 270 ? -9.255  -23.702 -48.262 1.00 17.36 ? 281 LEU C CD1   1 
ATOM   8148  C  CD2   . LEU C  1 270 ? -11.715 -23.166 -48.208 1.00 19.96 ? 281 LEU C CD2   1 
ATOM   8149  N  N     . THR C  1 271 ? -12.466 -25.668 -52.256 1.00 17.52 ? 282 THR C N     1 
ATOM   8150  C  CA    . THR C  1 271 ? -12.327 -26.225 -53.595 1.00 16.87 ? 282 THR C CA    1 
ATOM   8151  C  C     . THR C  1 271 ? -10.945 -25.776 -54.045 1.00 20.30 ? 282 THR C C     1 
ATOM   8152  O  O     . THR C  1 271 ? -10.296 -24.966 -53.361 1.00 18.61 ? 282 THR C O     1 
ATOM   8153  C  CB    . THR C  1 271 ? -13.399 -25.662 -54.578 1.00 21.90 ? 282 THR C CB    1 
ATOM   8154  O  OG1   . THR C  1 271 ? -13.225 -24.246 -54.760 1.00 22.53 ? 282 THR C OG1   1 
ATOM   8155  C  CG2   . THR C  1 271 ? -14.828 -26.021 -54.187 1.00 16.10 ? 282 THR C CG2   1 
ATOM   8156  N  N     . VAL C  1 272 ? -10.524 -26.236 -55.227 1.00 16.33 ? 283 VAL C N     1 
ATOM   8157  C  CA    . VAL C  1 272 ? -9.254  -25.815 -55.798 1.00 15.63 ? 283 VAL C CA    1 
ATOM   8158  C  C     . VAL C  1 272 ? -9.305  -24.282 -56.044 1.00 20.10 ? 283 VAL C C     1 
ATOM   8159  O  O     . VAL C  1 272 ? -8.312  -23.583 -55.808 1.00 20.29 ? 283 VAL C O     1 
ATOM   8160  C  CB    . VAL C  1 272 ? -8.918  -26.664 -57.047 1.00 18.06 ? 283 VAL C CB    1 
ATOM   8161  C  CG1   . VAL C  1 272 ? -7.806  -26.026 -57.879 1.00 17.38 ? 283 VAL C CG1   1 
ATOM   8162  C  CG2   . VAL C  1 272 ? -8.541  -28.091 -56.639 1.00 17.68 ? 283 VAL C CG2   1 
ATOM   8163  N  N     . LYS C  1 273 ? -10.481 -23.755 -56.472 1.00 16.71 ? 284 LYS C N     1 
ATOM   8164  C  CA    . LYS C  1 273 ? -10.640 -22.316 -56.719 1.00 16.27 ? 284 LYS C CA    1 
ATOM   8165  C  C     . LYS C  1 273 ? -10.538 -21.504 -55.440 1.00 17.84 ? 284 LYS C C     1 
ATOM   8166  O  O     . LYS C  1 273 ? -9.929  -20.449 -55.450 1.00 19.53 ? 284 LYS C O     1 
ATOM   8167  C  CB    . LYS C  1 273 ? -11.962 -21.998 -57.450 1.00 19.08 ? 284 LYS C CB    1 
ATOM   8168  C  CG    . LYS C  1 273 ? -11.799 -21.943 -58.963 1.00 34.26 ? 284 LYS C CG    1 
ATOM   8169  C  CD    . LYS C  1 273 ? -13.151 -21.799 -59.653 1.00 44.19 ? 284 LYS C CD    1 
ATOM   8170  C  CE    . LYS C  1 273 ? -13.052 -21.926 -61.157 1.00 53.56 ? 284 LYS C CE    1 
ATOM   8171  N  NZ    . LYS C  1 273 ? -14.385 -22.168 -61.773 1.00 62.70 ? 284 LYS C NZ    1 
ATOM   8172  N  N     . GLY C  1 274 ? -11.098 -22.023 -54.364 1.00 16.11 ? 285 GLY C N     1 
ATOM   8173  C  CA    . GLY C  1 274 ? -11.096 -21.373 -53.057 1.00 16.76 ? 285 GLY C CA    1 
ATOM   8174  C  C     . GLY C  1 274 ? -9.705  -21.335 -52.465 1.00 20.82 ? 285 GLY C C     1 
ATOM   8175  O  O     . GLY C  1 274 ? -9.302  -20.326 -51.882 1.00 18.51 ? 285 GLY C O     1 
ATOM   8176  N  N     . HIS C  1 275 ? -8.943  -22.429 -52.677 1.00 16.61 ? 286 HIS C N     1 
ATOM   8177  C  CA    . HIS C  1 275 ? -7.565  -22.547 -52.223 1.00 14.59 ? 286 HIS C CA    1 
ATOM   8178  C  C     . HIS C  1 275 ? -6.685  -21.589 -53.044 1.00 18.70 ? 286 HIS C C     1 
ATOM   8179  O  O     . HIS C  1 275 ? -5.952  -20.790 -52.455 1.00 17.86 ? 286 HIS C O     1 
ATOM   8180  C  CB    . HIS C  1 275 ? -7.125  -24.003 -52.372 1.00 14.21 ? 286 HIS C CB    1 
ATOM   8181  C  CG    . HIS C  1 275 ? -5.890  -24.386 -51.630 1.00 16.50 ? 286 HIS C CG    1 
ATOM   8182  N  ND1   . HIS C  1 275 ? -4.632  -24.213 -52.186 1.00 17.04 ? 286 HIS C ND1   1 
ATOM   8183  C  CD2   . HIS C  1 275 ? -5.763  -25.013 -50.435 1.00 16.05 ? 286 HIS C CD2   1 
ATOM   8184  C  CE1   . HIS C  1 275 ? -3.785  -24.741 -51.311 1.00 15.84 ? 286 HIS C CE1   1 
ATOM   8185  N  NE2   . HIS C  1 275 ? -4.418  -25.231 -50.247 1.00 15.92 ? 286 HIS C NE2   1 
ATOM   8186  N  N     . ALA C  1 276 ? -6.814  -21.604 -54.393 1.00 15.87 ? 287 ALA C N     1 
ATOM   8187  C  CA    . ALA C  1 276 ? -6.038  -20.730 -55.299 1.00 15.90 ? 287 ALA C CA    1 
ATOM   8188  C  C     . ALA C  1 276 ? -6.328  -19.232 -55.160 1.00 18.23 ? 287 ALA C C     1 
ATOM   8189  O  O     . ALA C  1 276 ? -5.452  -18.420 -55.446 1.00 17.71 ? 287 ALA C O     1 
ATOM   8190  C  CB    . ALA C  1 276 ? -6.204  -21.174 -56.746 1.00 16.62 ? 287 ALA C CB    1 
ATOM   8191  N  N     . LYS C  1 277 ? -7.521  -18.864 -54.651 1.00 15.99 ? 288 LYS C N     1 
ATOM   8192  C  CA    . LYS C  1 277 ? -7.875  -17.466 -54.385 1.00 16.16 ? 288 LYS C CA    1 
ATOM   8193  C  C     . LYS C  1 277 ? -6.826  -16.836 -53.427 1.00 20.15 ? 288 LYS C C     1 
ATOM   8194  O  O     . LYS C  1 277 ? -6.516  -15.658 -53.560 1.00 19.85 ? 288 LYS C O     1 
ATOM   8195  C  CB    . LYS C  1 277 ? -9.311  -17.374 -53.793 1.00 18.10 ? 288 LYS C CB    1 
ATOM   8196  C  CG    . LYS C  1 277 ? -9.846  -15.939 -53.559 1.00 28.47 ? 288 LYS C CG    1 
ATOM   8197  C  CD    . LYS C  1 277 ? -9.881  -15.067 -54.832 1.00 40.36 ? 288 LYS C CD    1 
ATOM   8198  C  CE    . LYS C  1 277 ? -10.940 -15.487 -55.834 1.00 56.32 ? 288 LYS C CE    1 
ATOM   8199  N  NZ    . LYS C  1 277 ? -10.846 -14.711 -57.101 1.00 65.12 ? 288 LYS C NZ    1 
ATOM   8200  N  N     . CYS C  1 278 ? -6.223  -17.651 -52.529 1.00 16.69 ? 289 CYS C N     1 
ATOM   8201  C  CA    . CYS C  1 278 ? -5.155  -17.201 -51.622 1.00 15.27 ? 289 CYS C CA    1 
ATOM   8202  C  C     . CYS C  1 278 ? -3.927  -16.759 -52.408 1.00 18.74 ? 289 CYS C C     1 
ATOM   8203  O  O     . CYS C  1 278 ? -3.338  -15.713 -52.108 1.00 19.99 ? 289 CYS C O     1 
ATOM   8204  C  CB    . CYS C  1 278 ? -4.811  -18.307 -50.630 1.00 14.78 ? 289 CYS C CB    1 
ATOM   8205  S  SG    . CYS C  1 278 ? -6.193  -18.777 -49.568 1.00 18.13 ? 289 CYS C SG    1 
ATOM   8206  N  N     . VAL C  1 279 ? -3.563  -17.535 -53.447 1.00 15.79 ? 290 VAL C N     1 
ATOM   8207  C  CA    . VAL C  1 279 ? -2.449  -17.204 -54.349 1.00 14.91 ? 290 VAL C CA    1 
ATOM   8208  C  C     . VAL C  1 279 ? -2.790  -15.899 -55.094 1.00 20.57 ? 290 VAL C C     1 
ATOM   8209  O  O     . VAL C  1 279 ? -1.933  -15.013 -55.181 1.00 20.26 ? 290 VAL C O     1 
ATOM   8210  C  CB    . VAL C  1 279 ? -2.145  -18.369 -55.340 1.00 17.65 ? 290 VAL C CB    1 
ATOM   8211  C  CG1   . VAL C  1 279 ? -0.942  -18.043 -56.210 1.00 17.93 ? 290 VAL C CG1   1 
ATOM   8212  C  CG2   . VAL C  1 279 ? -1.932  -19.683 -54.596 1.00 15.75 ? 290 VAL C CG2   1 
ATOM   8213  N  N     . GLU C  1 280 ? -4.039  -15.769 -55.599 1.00 17.73 ? 291 GLU C N     1 
ATOM   8214  C  CA    . GLU C  1 280 ? -4.478  -14.562 -56.325 1.00 18.76 ? 291 GLU C CA    1 
ATOM   8215  C  C     . GLU C  1 280 ? -4.354  -13.324 -55.438 1.00 23.30 ? 291 GLU C C     1 
ATOM   8216  O  O     . GLU C  1 280 ? -3.811  -12.311 -55.873 1.00 25.84 ? 291 GLU C O     1 
ATOM   8217  C  CB    . GLU C  1 280 ? -5.936  -14.704 -56.774 1.00 20.87 ? 291 GLU C CB    1 
ATOM   8218  C  CG    . GLU C  1 280 ? -6.156  -15.511 -58.033 1.00 38.07 ? 291 GLU C CG    1 
ATOM   8219  C  CD    . GLU C  1 280 ? -7.633  -15.663 -58.337 1.00 68.72 ? 291 GLU C CD    1 
ATOM   8220  O  OE1   . GLU C  1 280 ? -8.229  -16.663 -57.879 1.00 63.25 ? 291 GLU C OE1   1 
ATOM   8221  O  OE2   . GLU C  1 280 ? -8.214  -14.739 -58.951 1.00 70.98 ? 291 GLU C OE2   1 
ATOM   8222  N  N     . VAL C  1 281 ? -4.864  -13.410 -54.196 1.00 19.70 ? 292 VAL C N     1 
ATOM   8223  C  CA    . VAL C  1 281 ? -4.819  -12.328 -53.206 1.00 18.79 ? 292 VAL C CA    1 
ATOM   8224  C  C     . VAL C  1 281 ? -3.391  -11.890 -52.939 1.00 22.22 ? 292 VAL C C     1 
ATOM   8225  O  O     . VAL C  1 281 ? -3.106  -10.687 -53.003 1.00 23.36 ? 292 VAL C O     1 
ATOM   8226  C  CB    . VAL C  1 281 ? -5.586  -12.727 -51.909 1.00 23.28 ? 292 VAL C CB    1 
ATOM   8227  C  CG1   . VAL C  1 281 ? -5.253  -11.802 -50.730 1.00 22.90 ? 292 VAL C CG1   1 
ATOM   8228  C  CG2   . VAL C  1 281 ? -7.097  -12.765 -52.163 1.00 23.20 ? 292 VAL C CG2   1 
ATOM   8229  N  N     . VAL C  1 282 ? -2.487  -12.854 -52.643 1.00 17.17 ? 293 VAL C N     1 
ATOM   8230  C  CA    . VAL C  1 282 ? -1.078  -12.555 -52.338 1.00 15.83 ? 293 VAL C CA    1 
ATOM   8231  C  C     . VAL C  1 282 ? -0.410  -11.872 -53.539 1.00 20.77 ? 293 VAL C C     1 
ATOM   8232  O  O     . VAL C  1 282 ? 0.280   -10.857 -53.372 1.00 19.89 ? 293 VAL C O     1 
ATOM   8233  C  CB    . VAL C  1 282 ? -0.302  -13.798 -51.813 1.00 17.89 ? 293 VAL C CB    1 
ATOM   8234  C  CG1   . VAL C  1 282 ? 1.191   -13.513 -51.677 1.00 17.10 ? 293 VAL C CG1   1 
ATOM   8235  C  CG2   . VAL C  1 282 ? -0.881  -14.282 -50.478 1.00 17.05 ? 293 VAL C CG2   1 
ATOM   8236  N  N     . LYS C  1 283 ? -0.650  -12.407 -54.748 1.00 18.11 ? 294 LYS C N     1 
ATOM   8237  C  CA    . LYS C  1 283 ? -0.117  -11.836 -55.998 1.00 18.10 ? 294 LYS C CA    1 
ATOM   8238  C  C     . LYS C  1 283 ? -0.459  -10.345 -56.197 1.00 23.38 ? 294 LYS C C     1 
ATOM   8239  O  O     . LYS C  1 283 ? 0.393   -9.623  -56.714 1.00 23.65 ? 294 LYS C O     1 
ATOM   8240  C  CB    . LYS C  1 283 ? -0.625  -12.639 -57.201 1.00 20.40 ? 294 LYS C CB    1 
ATOM   8241  C  CG    . LYS C  1 283 ? 0.214   -13.875 -57.521 1.00 24.02 ? 294 LYS C CG    1 
ATOM   8242  C  CD    . LYS C  1 283 ? -0.217  -14.496 -58.845 1.00 33.84 ? 294 LYS C CD    1 
ATOM   8243  C  CE    . LYS C  1 283 ? 0.173   -13.681 -60.059 1.00 34.92 ? 294 LYS C CE    1 
ATOM   8244  N  NZ    . LYS C  1 283 ? -0.770  -13.906 -61.177 1.00 46.36 ? 294 LYS C NZ    1 
ATOM   8245  N  N     . THR C  1 284 ? -1.679  -9.880  -55.779 1.00 21.33 ? 295 THR C N     1 
ATOM   8246  C  CA    . THR C  1 284 ? -2.092  -8.465  -55.939 1.00 21.42 ? 295 THR C CA    1 
ATOM   8247  C  C     . THR C  1 284 ? -1.125  -7.459  -55.320 1.00 25.85 ? 295 THR C C     1 
ATOM   8248  O  O     . THR C  1 284 ? -1.101  -6.307  -55.750 1.00 27.18 ? 295 THR C O     1 
ATOM   8249  C  CB    . THR C  1 284 ? -3.524  -8.161  -55.422 1.00 26.87 ? 295 THR C CB    1 
ATOM   8250  O  OG1   . THR C  1 284 ? -3.600  -8.312  -54.009 1.00 26.48 ? 295 THR C OG1   1 
ATOM   8251  C  CG2   . THR C  1 284 ? -4.610  -8.943  -56.132 1.00 25.37 ? 295 THR C CG2   1 
ATOM   8252  N  N     . PHE C  1 285 ? -0.352  -7.876  -54.300 1.00 19.85 ? 296 PHE C N     1 
ATOM   8253  C  CA    . PHE C  1 285 ? 0.593   -6.985  -53.609 1.00 18.45 ? 296 PHE C CA    1 
ATOM   8254  C  C     . PHE C  1 285 ? 1.907   -6.728  -54.347 1.00 22.04 ? 296 PHE C C     1 
ATOM   8255  O  O     . PHE C  1 285 ? 2.664   -5.845  -53.950 1.00 22.44 ? 296 PHE C O     1 
ATOM   8256  C  CB    . PHE C  1 285 ? 0.793   -7.425  -52.146 1.00 19.39 ? 296 PHE C CB    1 
ATOM   8257  C  CG    . PHE C  1 285 ? -0.498  -7.341  -51.370 1.00 20.58 ? 296 PHE C CG    1 
ATOM   8258  C  CD1   . PHE C  1 285 ? -0.927  -6.127  -50.832 1.00 23.20 ? 296 PHE C CD1   1 
ATOM   8259  C  CD2   . PHE C  1 285 ? -1.339  -8.445  -51.266 1.00 22.34 ? 296 PHE C CD2   1 
ATOM   8260  C  CE1   . PHE C  1 285 ? -2.146  -6.036  -50.151 1.00 23.29 ? 296 PHE C CE1   1 
ATOM   8261  C  CE2   . PHE C  1 285 ? -2.566  -8.351  -50.594 1.00 25.24 ? 296 PHE C CE2   1 
ATOM   8262  C  CZ    . PHE C  1 285 ? -2.953  -7.150  -50.027 1.00 23.28 ? 296 PHE C CZ    1 
ATOM   8263  N  N     . ASN C  1 286 ? 2.157   -7.462  -55.445 1.00 19.24 ? 297 ASN C N     1 
ATOM   8264  C  CA    . ASN C  1 286 ? 3.316   -7.276  -56.329 1.00 19.59 ? 297 ASN C CA    1 
ATOM   8265  C  C     . ASN C  1 286 ? 4.662   -7.383  -55.606 1.00 24.01 ? 297 ASN C C     1 
ATOM   8266  O  O     . ASN C  1 286 ? 5.574   -6.574  -55.821 1.00 24.81 ? 297 ASN C O     1 
ATOM   8267  C  CB    . ASN C  1 286 ? 3.174   -5.956  -57.127 1.00 21.71 ? 297 ASN C CB    1 
ATOM   8268  C  CG    . ASN C  1 286 ? 1.886   -5.862  -57.904 1.00 42.09 ? 297 ASN C CG    1 
ATOM   8269  O  OD1   . ASN C  1 286 ? 1.488   -6.795  -58.599 1.00 29.63 ? 297 ASN C OD1   1 
ATOM   8270  N  ND2   . ASN C  1 286 ? 1.198   -4.738  -57.788 1.00 37.58 ? 297 ASN C ND2   1 
ATOM   8271  N  N     . LEU C  1 287 ? 4.774   -8.387  -54.731 1.00 19.05 ? 298 LEU C N     1 
ATOM   8272  C  CA    . LEU C  1 287 ? 6.005   -8.619  -53.965 1.00 18.29 ? 298 LEU C CA    1 
ATOM   8273  C  C     . LEU C  1 287 ? 6.682   -9.913  -54.406 1.00 21.18 ? 298 LEU C C     1 
ATOM   8274  O  O     . LEU C  1 287 ? 5.972   -10.886 -54.703 1.00 20.34 ? 298 LEU C O     1 
ATOM   8275  C  CB    . LEU C  1 287 ? 5.700   -8.700  -52.444 1.00 17.24 ? 298 LEU C CB    1 
ATOM   8276  C  CG    . LEU C  1 287 ? 5.184   -7.443  -51.721 1.00 20.07 ? 298 LEU C CG    1 
ATOM   8277  C  CD1   . LEU C  1 287 ? 4.819   -7.772  -50.292 1.00 20.35 ? 298 LEU C CD1   1 
ATOM   8278  C  CD2   . LEU C  1 287 ? 6.216   -6.279  -51.741 1.00 21.24 ? 298 LEU C CD2   1 
ATOM   8279  N  N     . PRO C  1 288 ? 8.039   -9.968  -54.391 1.00 18.27 ? 299 PRO C N     1 
ATOM   8280  C  CA    . PRO C  1 288 ? 8.735   -11.233 -54.706 1.00 17.92 ? 299 PRO C CA    1 
ATOM   8281  C  C     . PRO C  1 288 ? 8.123   -12.364 -53.882 1.00 21.21 ? 299 PRO C C     1 
ATOM   8282  O  O     . PRO C  1 288 ? 7.874   -12.216 -52.670 1.00 20.90 ? 299 PRO C O     1 
ATOM   8283  C  CB    . PRO C  1 288 ? 10.186  -10.952 -54.304 1.00 19.57 ? 299 PRO C CB    1 
ATOM   8284  C  CG    . PRO C  1 288 ? 10.327  -9.468  -54.428 1.00 24.29 ? 299 PRO C CG    1 
ATOM   8285  C  CD    . PRO C  1 288 ? 9.004   -8.901  -54.028 1.00 19.88 ? 299 PRO C CD    1 
ATOM   8286  N  N     . LEU C  1 289 ? 7.770   -13.452 -54.563 1.00 16.27 ? 300 LEU C N     1 
ATOM   8287  C  CA    . LEU C  1 289 ? 6.993   -14.505 -53.935 1.00 15.05 ? 300 LEU C CA    1 
ATOM   8288  C  C     . LEU C  1 289 ? 7.520   -15.893 -54.124 1.00 19.60 ? 300 LEU C C     1 
ATOM   8289  O  O     . LEU C  1 289 ? 7.766   -16.317 -55.256 1.00 20.15 ? 300 LEU C O     1 
ATOM   8290  C  CB    . LEU C  1 289 ? 5.540   -14.375 -54.460 1.00 15.62 ? 300 LEU C CB    1 
ATOM   8291  C  CG    . LEU C  1 289 ? 4.535   -15.518 -54.241 1.00 18.94 ? 300 LEU C CG    1 
ATOM   8292  C  CD1   . LEU C  1 289 ? 4.169   -15.669 -52.786 1.00 17.70 ? 300 LEU C CD1   1 
ATOM   8293  C  CD2   . LEU C  1 289 ? 3.275   -15.255 -55.027 1.00 20.50 ? 300 LEU C CD2   1 
ATOM   8294  N  N     . LEU C  1 290 ? 7.641   -16.638 -53.003 1.00 14.38 ? 301 LEU C N     1 
ATOM   8295  C  CA    . LEU C  1 290 ? 8.081   -18.028 -53.024 1.00 13.38 ? 301 LEU C CA    1 
ATOM   8296  C  C     . LEU C  1 290 ? 6.883   -18.892 -52.674 1.00 15.26 ? 301 LEU C C     1 
ATOM   8297  O  O     . LEU C  1 290 ? 6.332   -18.768 -51.579 1.00 15.38 ? 301 LEU C O     1 
ATOM   8298  C  CB    . LEU C  1 290 ? 9.273   -18.258 -52.056 1.00 12.56 ? 301 LEU C CB    1 
ATOM   8299  C  CG    . LEU C  1 290 ? 9.844   -19.701 -51.960 1.00 16.07 ? 301 LEU C CG    1 
ATOM   8300  C  CD1   . LEU C  1 290 ? 10.455  -20.168 -53.307 1.00 13.92 ? 301 LEU C CD1   1 
ATOM   8301  C  CD2   . LEU C  1 290 ? 10.933  -19.793 -50.851 1.00 12.98 ? 301 LEU C CD2   1 
ATOM   8302  N  N     . MET C  1 291 ? 6.437   -19.726 -53.631 1.00 12.20 ? 302 MET C N     1 
ATOM   8303  C  CA    . MET C  1 291 ? 5.281   -20.601 -53.442 1.00 10.92 ? 302 MET C CA    1 
ATOM   8304  C  C     . MET C  1 291 ? 5.767   -22.008 -53.191 1.00 13.92 ? 302 MET C C     1 
ATOM   8305  O  O     . MET C  1 291 ? 6.524   -22.554 -53.996 1.00 14.50 ? 302 MET C O     1 
ATOM   8306  C  CB    . MET C  1 291 ? 4.365   -20.559 -54.694 1.00 13.20 ? 302 MET C CB    1 
ATOM   8307  C  CG    . MET C  1 291 ? 3.662   -19.207 -54.871 1.00 16.41 ? 302 MET C CG    1 
ATOM   8308  S  SD    . MET C  1 291 ? 2.871   -19.048 -56.509 1.00 19.23 ? 302 MET C SD    1 
ATOM   8309  C  CE    . MET C  1 291 ? 1.743   -20.417 -56.464 1.00 15.21 ? 302 MET C CE    1 
ATOM   8310  N  N     . LEU C  1 292 ? 5.331   -22.605 -52.087 1.00 11.94 ? 303 LEU C N     1 
ATOM   8311  C  CA    . LEU C  1 292 ? 5.794   -23.937 -51.667 1.00 11.34 ? 303 LEU C CA    1 
ATOM   8312  C  C     . LEU C  1 292 ? 4.641   -24.904 -51.498 1.00 15.69 ? 303 LEU C C     1 
ATOM   8313  O  O     . LEU C  1 292 ? 3.503   -24.483 -51.325 1.00 14.06 ? 303 LEU C O     1 
ATOM   8314  C  CB    . LEU C  1 292 ? 6.555   -23.795 -50.303 1.00 10.68 ? 303 LEU C CB    1 
ATOM   8315  C  CG    . LEU C  1 292 ? 7.767   -22.841 -50.327 1.00 13.77 ? 303 LEU C CG    1 
ATOM   8316  C  CD1   . LEU C  1 292 ? 8.446   -22.755 -48.955 1.00 12.64 ? 303 LEU C CD1   1 
ATOM   8317  C  CD2   . LEU C  1 292 ? 8.794   -23.285 -51.426 1.00 13.87 ? 303 LEU C CD2   1 
ATOM   8318  N  N     . GLY C  1 293 ? 4.964   -26.186 -51.506 1.00 13.65 ? 304 GLY C N     1 
ATOM   8319  C  CA    . GLY C  1 293 ? 4.010   -27.265 -51.290 1.00 13.62 ? 304 GLY C CA    1 
ATOM   8320  C  C     . GLY C  1 293 ? 3.716   -27.454 -49.819 1.00 16.45 ? 304 GLY C C     1 
ATOM   8321  O  O     . GLY C  1 293 ? 3.671   -26.481 -49.067 1.00 14.96 ? 304 GLY C O     1 
ATOM   8322  N  N     . GLY C  1 294 ? 3.500   -28.695 -49.412 1.00 13.94 ? 305 GLY C N     1 
ATOM   8323  C  CA    . GLY C  1 294 ? 3.195   -29.028 -48.023 1.00 14.08 ? 305 GLY C CA    1 
ATOM   8324  C  C     . GLY C  1 294 ? 2.379   -30.298 -47.955 1.00 15.20 ? 305 GLY C C     1 
ATOM   8325  O  O     . GLY C  1 294 ? 2.614   -31.214 -48.732 1.00 14.63 ? 305 GLY C O     1 
ATOM   8326  N  N     . GLY C  1 295 ? 1.407   -30.342 -47.064 1.00 11.33 ? 306 GLY C N     1 
ATOM   8327  C  CA    . GLY C  1 295 ? 0.512   -31.489 -46.942 1.00 11.67 ? 306 GLY C CA    1 
ATOM   8328  C  C     . GLY C  1 295 ? -0.378  -31.637 -48.163 1.00 14.78 ? 306 GLY C C     1 
ATOM   8329  O  O     . GLY C  1 295 ? -0.310  -30.832 -49.084 1.00 13.78 ? 306 GLY C O     1 
ATOM   8330  N  N     . GLY C  1 296 ? -1.202  -32.667 -48.179 1.00 15.00 ? 307 GLY C N     1 
ATOM   8331  C  CA    . GLY C  1 296 ? -2.073  -32.940 -49.315 1.00 15.70 ? 307 GLY C CA    1 
ATOM   8332  C  C     . GLY C  1 296 ? -2.012  -34.428 -49.553 1.00 18.44 ? 307 GLY C C     1 
ATOM   8333  O  O     . GLY C  1 296 ? -0.972  -34.945 -49.954 1.00 17.06 ? 307 GLY C O     1 
ATOM   8334  N  N     . TYR C  1 297 ? -3.109  -35.127 -49.238 1.00 16.09 ? 308 TYR C N     1 
ATOM   8335  C  CA    . TYR C  1 297 ? -3.138  -36.589 -49.197 1.00 15.65 ? 308 TYR C CA    1 
ATOM   8336  C  C     . TYR C  1 297 ? -4.070  -37.313 -50.161 1.00 20.99 ? 308 TYR C C     1 
ATOM   8337  O  O     . TYR C  1 297 ? -3.980  -38.540 -50.283 1.00 21.19 ? 308 TYR C O     1 
ATOM   8338  C  CB    . TYR C  1 297 ? -3.237  -37.058 -47.735 1.00 15.24 ? 308 TYR C CB    1 
ATOM   8339  C  CG    . TYR C  1 297 ? -2.168  -36.380 -46.901 1.00 16.44 ? 308 TYR C CG    1 
ATOM   8340  C  CD1   . TYR C  1 297 ? -2.461  -35.252 -46.137 1.00 17.98 ? 308 TYR C CD1   1 
ATOM   8341  C  CD2   . TYR C  1 297 ? -0.838  -36.786 -46.976 1.00 16.68 ? 308 TYR C CD2   1 
ATOM   8342  C  CE1   . TYR C  1 297 ? -1.461  -34.565 -45.445 1.00 16.61 ? 308 TYR C CE1   1 
ATOM   8343  C  CE2   . TYR C  1 297 ? 0.167   -36.114 -46.283 1.00 17.04 ? 308 TYR C CE2   1 
ATOM   8344  C  CZ    . TYR C  1 297 ? -0.145  -34.991 -45.538 1.00 20.42 ? 308 TYR C CZ    1 
ATOM   8345  O  OH    . TYR C  1 297 ? 0.858   -34.330 -44.881 1.00 17.35 ? 308 TYR C OH    1 
ATOM   8346  N  N     . THR C  1 298 ? -4.964  -36.564 -50.826 1.00 18.09 ? 309 THR C N     1 
ATOM   8347  C  CA    . THR C  1 298 ? -5.817  -37.080 -51.911 1.00 17.44 ? 309 THR C CA    1 
ATOM   8348  C  C     . THR C  1 298 ? -5.055  -36.580 -53.131 1.00 19.03 ? 309 THR C C     1 
ATOM   8349  O  O     . THR C  1 298 ? -5.179  -35.419 -53.542 1.00 17.48 ? 309 THR C O     1 
ATOM   8350  C  CB    . THR C  1 298 ? -7.271  -36.613 -51.768 1.00 21.92 ? 309 THR C CB    1 
ATOM   8351  O  OG1   . THR C  1 298 ? -7.779  -37.134 -50.539 1.00 17.67 ? 309 THR C OG1   1 
ATOM   8352  C  CG2   . THR C  1 298 ? -8.150  -37.142 -52.899 1.00 20.99 ? 309 THR C CG2   1 
ATOM   8353  N  N     . ILE C  1 299 ? -4.129  -37.417 -53.598 1.00 16.07 ? 310 ILE C N     1 
ATOM   8354  C  CA    . ILE C  1 299 ? -3.143  -37.065 -54.611 1.00 16.34 ? 310 ILE C CA    1 
ATOM   8355  C  C     . ILE C  1 299 ? -3.664  -36.532 -55.924 1.00 17.95 ? 310 ILE C C     1 
ATOM   8356  O  O     . ILE C  1 299 ? -3.062  -35.609 -56.449 1.00 18.00 ? 310 ILE C O     1 
ATOM   8357  C  CB    . ILE C  1 299 ? -1.985  -38.091 -54.722 1.00 19.99 ? 310 ILE C CB    1 
ATOM   8358  C  CG1   . ILE C  1 299 ? -2.423  -39.368 -55.499 1.00 20.60 ? 310 ILE C CG1   1 
ATOM   8359  C  CG2   . ILE C  1 299 ? -1.432  -38.418 -53.301 1.00 20.36 ? 310 ILE C CG2   1 
ATOM   8360  C  CD1   . ILE C  1 299 ? -1.247  -40.417 -55.763 1.00 32.31 ? 310 ILE C CD1   1 
ATOM   8361  N  N     . ARG C  1 300 ? -4.823  -37.016 -56.409 1.00 13.89 ? 311 ARG C N     1 
ATOM   8362  C  CA    . ARG C  1 300 ? -5.403  -36.464 -57.643 1.00 14.56 ? 311 ARG C CA    1 
ATOM   8363  C  C     . ARG C  1 300 ? -5.784  -34.965 -57.442 1.00 18.29 ? 311 ARG C C     1 
ATOM   8364  O  O     . ARG C  1 300 ? -5.567  -34.156 -58.348 1.00 18.49 ? 311 ARG C O     1 
ATOM   8365  C  CB    . ARG C  1 300 ? -6.609  -37.307 -58.138 1.00 14.81 ? 311 ARG C CB    1 
ATOM   8366  C  CG    . ARG C  1 300 ? -7.851  -37.229 -57.241 1.00 22.54 ? 311 ARG C CG    1 
ATOM   8367  C  CD    . ARG C  1 300 ? -8.921  -38.223 -57.645 1.00 23.97 ? 311 ARG C CD    1 
ATOM   8368  N  NE    . ARG C  1 300 ? -10.082 -38.201 -56.747 1.00 21.01 ? 311 ARG C NE    1 
ATOM   8369  C  CZ    . ARG C  1 300 ? -10.181 -38.906 -55.625 1.00 35.70 ? 311 ARG C CZ    1 
ATOM   8370  N  NH1   . ARG C  1 300 ? -9.174  -39.670 -55.221 1.00 28.06 ? 311 ARG C NH1   1 
ATOM   8371  N  NH2   . ARG C  1 300 ? -11.272 -38.822 -54.879 1.00 27.58 ? 311 ARG C NH2   1 
ATOM   8372  N  N     . ASN C  1 301 ? -6.287  -34.611 -56.238 1.00 15.30 ? 312 ASN C N     1 
ATOM   8373  C  CA    . ASN C  1 301 ? -6.657  -33.227 -55.856 1.00 15.08 ? 312 ASN C CA    1 
ATOM   8374  C  C     . ASN C  1 301 ? -5.427  -32.356 -55.565 1.00 18.82 ? 312 ASN C C     1 
ATOM   8375  O  O     . ASN C  1 301 ? -5.440  -31.156 -55.849 1.00 19.52 ? 312 ASN C O     1 
ATOM   8376  C  CB    . ASN C  1 301 ? -7.635  -33.242 -54.685 1.00 16.82 ? 312 ASN C CB    1 
ATOM   8377  C  CG    . ASN C  1 301 ? -8.963  -33.873 -55.043 1.00 23.60 ? 312 ASN C CG    1 
ATOM   8378  O  OD1   . ASN C  1 301 ? -9.313  -34.008 -56.215 1.00 19.79 ? 312 ASN C OD1   1 
ATOM   8379  N  ND2   . ASN C  1 301 ? -9.730  -34.254 -54.051 1.00 17.25 ? 312 ASN C ND2   1 
ATOM   8380  N  N     . VAL C  1 302 ? -4.334  -32.974 -55.108 1.00 14.62 ? 313 VAL C N     1 
ATOM   8381  C  CA    . VAL C  1 302 ? -3.065  -32.258 -54.902 1.00 13.26 ? 313 VAL C CA    1 
ATOM   8382  C  C     . VAL C  1 302 ? -2.530  -31.791 -56.260 1.00 17.98 ? 313 VAL C C     1 
ATOM   8383  O  O     . VAL C  1 302 ? -2.211  -30.613 -56.427 1.00 15.79 ? 313 VAL C O     1 
ATOM   8384  C  CB    . VAL C  1 302 ? -2.038  -33.109 -54.116 1.00 15.47 ? 313 VAL C CB    1 
ATOM   8385  C  CG1   . VAL C  1 302 ? -0.701  -32.389 -54.012 1.00 15.83 ? 313 VAL C CG1   1 
ATOM   8386  C  CG2   . VAL C  1 302 ? -2.560  -33.429 -52.730 1.00 14.46 ? 313 VAL C CG2   1 
ATOM   8387  N  N     . ALA C  1 303 ? -2.503  -32.713 -57.255 1.00 16.75 ? 314 ALA C N     1 
ATOM   8388  C  CA    . ALA C  1 303 ? -2.025  -32.398 -58.599 1.00 16.75 ? 314 ALA C CA    1 
ATOM   8389  C  C     . ALA C  1 303 ? -2.904  -31.338 -59.251 1.00 17.57 ? 314 ALA C C     1 
ATOM   8390  O  O     . ALA C  1 303 ? -2.369  -30.426 -59.878 1.00 17.59 ? 314 ALA C O     1 
ATOM   8391  C  CB    . ALA C  1 303 ? -1.971  -33.658 -59.454 1.00 17.52 ? 314 ALA C CB    1 
ATOM   8392  N  N     . ARG C  1 304 ? -4.226  -31.408 -59.050 1.00 14.48 ? 315 ARG C N     1 
ATOM   8393  C  CA    . ARG C  1 304 ? -5.147  -30.385 -59.604 1.00 14.37 ? 315 ARG C CA    1 
ATOM   8394  C  C     . ARG C  1 304 ? -4.856  -29.019 -58.968 1.00 18.47 ? 315 ARG C C     1 
ATOM   8395  O  O     . ARG C  1 304 ? -4.730  -28.029 -59.676 1.00 17.96 ? 315 ARG C O     1 
ATOM   8396  C  CB    . ARG C  1 304 ? -6.601  -30.738 -59.299 1.00 13.57 ? 315 ARG C CB    1 
ATOM   8397  C  CG    . ARG C  1 304 ? -7.160  -31.920 -60.090 1.00 19.55 ? 315 ARG C CG    1 
ATOM   8398  C  CD    . ARG C  1 304 ? -8.431  -32.419 -59.465 1.00 19.91 ? 315 ARG C CD    1 
ATOM   8399  N  NE    . ARG C  1 304 ? -9.259  -33.079 -60.473 1.00 22.15 ? 315 ARG C NE    1 
ATOM   8400  C  CZ    . ARG C  1 304 ? -9.812  -34.279 -60.336 1.00 30.73 ? 315 ARG C CZ    1 
ATOM   8401  N  NH1   . ARG C  1 304 ? -10.518 -34.804 -61.326 1.00 22.71 ? 315 ARG C NH1   1 
ATOM   8402  N  NH2   . ARG C  1 304 ? -9.682  -34.954 -59.199 1.00 17.14 ? 315 ARG C NH2   1 
ATOM   8403  N  N     . CYS C  1 305 ? -4.744  -28.987 -57.621 1.00 15.21 ? 316 CYS C N     1 
ATOM   8404  C  CA    . CYS C  1 305 ? -4.514  -27.760 -56.854 1.00 13.88 ? 316 CYS C CA    1 
ATOM   8405  C  C     . CYS C  1 305 ? -3.233  -27.042 -57.276 1.00 17.70 ? 316 CYS C C     1 
ATOM   8406  O  O     . CYS C  1 305 ? -3.271  -25.863 -57.599 1.00 17.21 ? 316 CYS C O     1 
ATOM   8407  C  CB    . CYS C  1 305 ? -4.511  -28.065 -55.363 1.00 14.43 ? 316 CYS C CB    1 
ATOM   8408  S  SG    . CYS C  1 305 ? -4.709  -26.604 -54.309 1.00 18.18 ? 316 CYS C SG    1 
ATOM   8409  N  N     . TRP C  1 306 ? -2.104  -27.749 -57.277 1.00 15.82 ? 317 TRP C N     1 
ATOM   8410  C  CA    . TRP C  1 306 ? -0.804  -27.167 -57.611 1.00 15.38 ? 317 TRP C CA    1 
ATOM   8411  C  C     . TRP C  1 306 ? -0.633  -26.834 -59.085 1.00 17.62 ? 317 TRP C C     1 
ATOM   8412  O  O     . TRP C  1 306 ? 0.029   -25.852 -59.414 1.00 16.88 ? 317 TRP C O     1 
ATOM   8413  C  CB    . TRP C  1 306 ? 0.335   -27.988 -56.993 1.00 14.81 ? 317 TRP C CB    1 
ATOM   8414  C  CG    . TRP C  1 306 ? 0.304   -28.017 -55.479 1.00 15.28 ? 317 TRP C CG    1 
ATOM   8415  C  CD1   . TRP C  1 306 ? -0.362  -27.152 -54.651 1.00 17.59 ? 317 TRP C CD1   1 
ATOM   8416  C  CD2   . TRP C  1 306 ? 1.008   -28.927 -54.622 1.00 14.71 ? 317 TRP C CD2   1 
ATOM   8417  N  NE1   . TRP C  1 306 ? -0.150  -27.493 -53.335 1.00 15.65 ? 317 TRP C NE1   1 
ATOM   8418  C  CE2   . TRP C  1 306 ? 0.719   -28.553 -53.285 1.00 17.68 ? 317 TRP C CE2   1 
ATOM   8419  C  CE3   . TRP C  1 306 ? 1.851   -30.030 -54.849 1.00 15.66 ? 317 TRP C CE3   1 
ATOM   8420  C  CZ2   . TRP C  1 306 ? 1.233   -29.251 -52.182 1.00 16.39 ? 317 TRP C CZ2   1 
ATOM   8421  C  CZ3   . TRP C  1 306 ? 2.382   -30.703 -53.752 1.00 17.17 ? 317 TRP C CZ3   1 
ATOM   8422  C  CH2   . TRP C  1 306 ? 2.065   -30.316 -52.438 1.00 17.77 ? 317 TRP C CH2   1 
ATOM   8423  N  N     . THR C  1 307 ? -1.310  -27.572 -59.974 1.00 14.92 ? 318 THR C N     1 
ATOM   8424  C  CA    . THR C  1 307 ? -1.306  -27.234 -61.406 1.00 14.82 ? 318 THR C CA    1 
ATOM   8425  C  C     . THR C  1 307 ? -2.020  -25.886 -61.571 1.00 17.68 ? 318 THR C C     1 
ATOM   8426  O  O     . THR C  1 307 ? -1.483  -24.980 -62.200 1.00 17.86 ? 318 THR C O     1 
ATOM   8427  C  CB    . THR C  1 307 ? -2.015  -28.333 -62.222 1.00 22.13 ? 318 THR C CB    1 
ATOM   8428  O  OG1   . THR C  1 307 ? -1.274  -29.548 -62.102 1.00 20.16 ? 318 THR C OG1   1 
ATOM   8429  C  CG2   . THR C  1 307 ? -2.190  -27.951 -63.705 1.00 19.35 ? 318 THR C CG2   1 
ATOM   8430  N  N     . TYR C  1 308 ? -3.220  -25.765 -60.992 1.00 15.77 ? 319 TYR C N     1 
ATOM   8431  C  CA    . TYR C  1 308 ? -4.018  -24.541 -61.079 1.00 16.01 ? 319 TYR C CA    1 
ATOM   8432  C  C     . TYR C  1 308 ? -3.311  -23.360 -60.427 1.00 20.84 ? 319 TYR C C     1 
ATOM   8433  O  O     . TYR C  1 308 ? -3.301  -22.268 -60.993 1.00 21.04 ? 319 TYR C O     1 
ATOM   8434  C  CB    . TYR C  1 308 ? -5.426  -24.739 -60.522 1.00 16.73 ? 319 TYR C CB    1 
ATOM   8435  C  CG    . TYR C  1 308 ? -6.333  -23.561 -60.801 1.00 19.11 ? 319 TYR C CG    1 
ATOM   8436  C  CD1   . TYR C  1 308 ? -6.689  -23.219 -62.109 1.00 21.16 ? 319 TYR C CD1   1 
ATOM   8437  C  CD2   . TYR C  1 308 ? -6.853  -22.796 -59.759 1.00 19.99 ? 319 TYR C CD2   1 
ATOM   8438  C  CE1   . TYR C  1 308 ? -7.509  -22.118 -62.370 1.00 21.96 ? 319 TYR C CE1   1 
ATOM   8439  C  CE2   . TYR C  1 308 ? -7.681  -21.699 -60.008 1.00 20.51 ? 319 TYR C CE2   1 
ATOM   8440  C  CZ    . TYR C  1 308 ? -8.013  -21.372 -61.313 1.00 26.02 ? 319 TYR C CZ    1 
ATOM   8441  O  OH    . TYR C  1 308 ? -8.828  -20.295 -61.536 1.00 25.55 ? 319 TYR C OH    1 
ATOM   8442  N  N     . GLU C  1 309 ? -2.639  -23.600 -59.289 1.00 17.57 ? 320 GLU C N     1 
ATOM   8443  C  CA    . GLU C  1 309 ? -1.878  -22.546 -58.615 1.00 15.58 ? 320 GLU C CA    1 
ATOM   8444  C  C     . GLU C  1 309 ? -0.658  -22.102 -59.410 1.00 18.94 ? 320 GLU C C     1 
ATOM   8445  O  O     . GLU C  1 309 ? -0.325  -20.928 -59.388 1.00 18.34 ? 320 GLU C O     1 
ATOM   8446  C  CB    . GLU C  1 309 ? -1.610  -22.894 -57.151 1.00 16.39 ? 320 GLU C CB    1 
ATOM   8447  C  CG    . GLU C  1 309 ? -2.930  -22.862 -56.396 1.00 14.58 ? 320 GLU C CG    1 
ATOM   8448  C  CD    . GLU C  1 309 ? -2.973  -23.377 -54.981 1.00 18.14 ? 320 GLU C CD    1 
ATOM   8449  O  OE1   . GLU C  1 309 ? -2.066  -24.141 -54.586 1.00 14.49 ? 320 GLU C OE1   1 
ATOM   8450  O  OE2   . GLU C  1 309 ? -3.972  -23.080 -54.290 1.00 21.41 ? 320 GLU C OE2   1 
ATOM   8451  N  N     . THR C  1 310 ? -0.088  -22.998 -60.230 1.00 16.95 ? 321 THR C N     1 
ATOM   8452  C  CA    . THR C  1 310 ? 1.016   -22.641 -61.126 1.00 16.72 ? 321 THR C CA    1 
ATOM   8453  C  C     . THR C  1 310 ? 0.431   -21.783 -62.270 1.00 20.94 ? 321 THR C C     1 
ATOM   8454  O  O     . THR C  1 310 ? 1.036   -20.785 -62.668 1.00 21.70 ? 321 THR C O     1 
ATOM   8455  C  CB    . THR C  1 310 ? 1.730   -23.898 -61.656 1.00 16.50 ? 321 THR C CB    1 
ATOM   8456  O  OG1   . THR C  1 310 ? 2.086   -24.745 -60.553 1.00 18.24 ? 321 THR C OG1   1 
ATOM   8457  C  CG2   . THR C  1 310 ? 2.976   -23.559 -62.437 1.00 18.37 ? 321 THR C CG2   1 
ATOM   8458  N  N     . ALA C  1 311 ? -0.762  -22.148 -62.754 1.00 18.85 ? 322 ALA C N     1 
ATOM   8459  C  CA    . ALA C  1 311 ? -1.447  -21.399 -63.812 1.00 18.93 ? 322 ALA C CA    1 
ATOM   8460  C  C     . ALA C  1 311 ? -1.811  -20.001 -63.279 1.00 23.07 ? 322 ALA C C     1 
ATOM   8461  O  O     . ALA C  1 311 ? -1.632  -19.002 -63.988 1.00 22.73 ? 322 ALA C O     1 
ATOM   8462  C  CB    . ALA C  1 311 ? -2.689  -22.149 -64.268 1.00 19.96 ? 322 ALA C CB    1 
ATOM   8463  N  N     . VAL C  1 312 ? -2.223  -19.921 -61.988 1.00 20.03 ? 323 VAL C N     1 
ATOM   8464  C  CA    . VAL C  1 312 ? -2.518  -18.641 -61.333 1.00 18.72 ? 323 VAL C CA    1 
ATOM   8465  C  C     . VAL C  1 312 ? -1.241  -17.775 -61.283 1.00 22.94 ? 323 VAL C C     1 
ATOM   8466  O  O     . VAL C  1 312 ? -1.289  -16.609 -61.687 1.00 23.01 ? 323 VAL C O     1 
ATOM   8467  C  CB    . VAL C  1 312 ? -3.205  -18.830 -59.959 1.00 23.05 ? 323 VAL C CB    1 
ATOM   8468  C  CG1   . VAL C  1 312 ? -3.214  -17.526 -59.150 1.00 22.99 ? 323 VAL C CG1   1 
ATOM   8469  C  CG2   . VAL C  1 312 ? -4.623  -19.362 -60.131 1.00 22.73 ? 323 VAL C CG2   1 
ATOM   8470  N  N     . ALA C  1 313 ? -0.089  -18.350 -60.837 1.00 19.28 ? 324 ALA C N     1 
ATOM   8471  C  CA    . ALA C  1 313 ? 1.194   -17.637 -60.806 1.00 19.48 ? 324 ALA C CA    1 
ATOM   8472  C  C     . ALA C  1 313 ? 1.521   -17.024 -62.184 1.00 24.02 ? 324 ALA C C     1 
ATOM   8473  O  O     . ALA C  1 313 ? 2.008   -15.897 -62.265 1.00 23.16 ? 324 ALA C O     1 
ATOM   8474  C  CB    . ALA C  1 313 ? 2.313   -18.586 -60.392 1.00 20.42 ? 324 ALA C CB    1 
ATOM   8475  N  N     . LEU C  1 314 ? 1.262   -17.782 -63.252 1.00 22.31 ? 325 LEU C N     1 
ATOM   8476  C  CA    . LEU C  1 314 ? 1.526   -17.379 -64.636 1.00 22.74 ? 325 LEU C CA    1 
ATOM   8477  C  C     . LEU C  1 314 ? 0.423   -16.488 -65.226 1.00 28.48 ? 325 LEU C C     1 
ATOM   8478  O  O     . LEU C  1 314 ? 0.559   -16.048 -66.373 1.00 27.99 ? 325 LEU C O     1 
ATOM   8479  C  CB    . LEU C  1 314 ? 1.661   -18.650 -65.504 1.00 22.74 ? 325 LEU C CB    1 
ATOM   8480  C  CG    . LEU C  1 314 ? 2.864   -19.543 -65.254 1.00 27.41 ? 325 LEU C CG    1 
ATOM   8481  C  CD1   . LEU C  1 314 ? 2.612   -20.946 -65.787 1.00 27.67 ? 325 LEU C CD1   1 
ATOM   8482  C  CD2   . LEU C  1 314 ? 4.117   -18.953 -65.850 1.00 29.59 ? 325 LEU C CD2   1 
ATOM   8483  N  N     . ASP C  1 315 ? -0.684  -16.249 -64.473 1.00 26.24 ? 326 ASP C N     1 
ATOM   8484  C  CA    . ASP C  1 315 ? -1.860  -15.488 -64.941 1.00 27.95 ? 326 ASP C CA    1 
ATOM   8485  C  C     . ASP C  1 315 ? -2.357  -16.104 -66.274 1.00 33.23 ? 326 ASP C C     1 
ATOM   8486  O  O     . ASP C  1 315 ? -2.605  -15.413 -67.275 1.00 31.36 ? 326 ASP C O     1 
ATOM   8487  C  CB    . ASP C  1 315 ? -1.548  -13.982 -65.060 1.00 30.68 ? 326 ASP C CB    1 
ATOM   8488  C  CG    . ASP C  1 315 ? -2.776  -13.130 -65.270 1.00 47.67 ? 326 ASP C CG    1 
ATOM   8489  O  OD1   . ASP C  1 315 ? -2.808  -12.379 -66.268 1.00 49.79 ? 326 ASP C OD1   1 
ATOM   8490  O  OD2   . ASP C  1 315 ? -3.738  -13.264 -64.474 1.00 53.37 ? 326 ASP C OD2   1 
ATOM   8491  N  N     . CYS C  1 316 ? -2.428  -17.435 -66.273 1.00 31.78 ? 327 CYS C N     1 
ATOM   8492  C  CA    . CYS C  1 316 ? -2.791  -18.228 -67.431 1.00 34.07 ? 327 CYS C CA    1 
ATOM   8493  C  C     . CYS C  1 316 ? -4.052  -19.006 -67.118 1.00 37.53 ? 327 CYS C C     1 
ATOM   8494  O  O     . CYS C  1 316 ? -4.073  -19.834 -66.195 1.00 37.03 ? 327 CYS C O     1 
ATOM   8495  C  CB    . CYS C  1 316 ? -1.633  -19.146 -67.819 1.00 36.30 ? 327 CYS C CB    1 
ATOM   8496  S  SG    . CYS C  1 316 ? -1.961  -20.204 -69.252 1.00 41.87 ? 327 CYS C SG    1 
ATOM   8497  N  N     . GLU C  1 317 ? -5.126  -18.712 -67.849 1.00 32.86 ? 328 GLU C N     1 
ATOM   8498  C  CA    . GLU C  1 317 ? -6.353  -19.452 -67.623 1.00 33.21 ? 328 GLU C CA    1 
ATOM   8499  C  C     . GLU C  1 317 ? -6.248  -20.785 -68.355 1.00 35.36 ? 328 GLU C C     1 
ATOM   8500  O  O     . GLU C  1 317 ? -5.789  -20.832 -69.502 1.00 36.48 ? 328 GLU C O     1 
ATOM   8501  C  CB    . GLU C  1 317 ? -7.620  -18.650 -67.973 1.00 35.34 ? 328 GLU C CB    1 
ATOM   8502  C  CG    . GLU C  1 317 ? -7.695  -18.091 -69.383 1.00 51.56 ? 328 GLU C CG    1 
ATOM   8503  C  CD    . GLU C  1 317 ? -9.008  -17.384 -69.663 1.00 79.19 ? 328 GLU C CD    1 
ATOM   8504  O  OE1   . GLU C  1 317 ? -9.208  -16.265 -69.135 1.00 74.10 ? 328 GLU C OE1   1 
ATOM   8505  O  OE2   . GLU C  1 317 ? -9.848  -17.964 -70.389 1.00 74.45 ? 328 GLU C OE2   1 
ATOM   8506  N  N     . ILE C  1 318 ? -6.546  -21.871 -67.654 1.00 28.87 ? 329 ILE C N     1 
ATOM   8507  C  CA    . ILE C  1 318 ? -6.435  -23.207 -68.246 1.00 26.28 ? 329 ILE C CA    1 
ATOM   8508  C  C     . ILE C  1 318 ? -7.792  -23.896 -68.319 1.00 27.52 ? 329 ILE C C     1 
ATOM   8509  O  O     . ILE C  1 318 ? -8.595  -23.704 -67.405 1.00 26.54 ? 329 ILE C O     1 
ATOM   8510  C  CB    . ILE C  1 318 ? -5.325  -24.087 -67.589 1.00 27.63 ? 329 ILE C CB    1 
ATOM   8511  C  CG1   . ILE C  1 318 ? -5.487  -24.231 -66.057 1.00 26.55 ? 329 ILE C CG1   1 
ATOM   8512  C  CG2   . ILE C  1 318 ? -3.930  -23.630 -68.006 1.00 27.34 ? 329 ILE C CG2   1 
ATOM   8513  C  CD1   . ILE C  1 318 ? -4.529  -25.291 -65.392 1.00 22.83 ? 329 ILE C CD1   1 
ATOM   8514  N  N     . PRO C  1 319 ? -8.074  -24.702 -69.379 1.00 23.33 ? 330 PRO C N     1 
ATOM   8515  C  CA    . PRO C  1 319 ? -9.381  -25.379 -69.468 1.00 23.23 ? 330 PRO C CA    1 
ATOM   8516  C  C     . PRO C  1 319 ? -9.685  -26.278 -68.283 1.00 27.30 ? 330 PRO C C     1 
ATOM   8517  O  O     . PRO C  1 319 ? -8.764  -26.843 -67.684 1.00 27.61 ? 330 PRO C O     1 
ATOM   8518  C  CB    . PRO C  1 319 ? -9.256  -26.237 -70.733 1.00 25.41 ? 330 PRO C CB    1 
ATOM   8519  C  CG    . PRO C  1 319 ? -8.200  -25.615 -71.514 1.00 30.05 ? 330 PRO C CG    1 
ATOM   8520  C  CD    . PRO C  1 319 ? -7.234  -25.023 -70.546 1.00 25.39 ? 330 PRO C CD    1 
ATOM   8521  N  N     . ASN C  1 320 ? -10.986 -26.437 -67.973 1.00 22.00 ? 331 ASN C N     1 
ATOM   8522  C  CA    . ASN C  1 320 ? -11.452 -27.308 -66.914 1.00 20.83 ? 331 ASN C CA    1 
ATOM   8523  C  C     . ASN C  1 320 ? -11.308 -28.771 -67.333 1.00 24.17 ? 331 ASN C C     1 
ATOM   8524  O  O     . ASN C  1 320 ? -11.240 -29.642 -66.481 1.00 21.83 ? 331 ASN C O     1 
ATOM   8525  C  CB    . ASN C  1 320 ? -12.905 -27.000 -66.541 1.00 23.76 ? 331 ASN C CB    1 
ATOM   8526  C  CG    . ASN C  1 320 ? -13.389 -27.715 -65.297 1.00 33.14 ? 331 ASN C CG    1 
ATOM   8527  O  OD1   . ASN C  1 320 ? -12.689 -27.801 -64.270 1.00 25.67 ? 331 ASN C OD1   1 
ATOM   8528  N  ND2   . ASN C  1 320 ? -14.609 -28.226 -65.353 1.00 19.31 ? 331 ASN C ND2   1 
ATOM   8529  N  N     . GLU C  1 321 ? -11.248 -29.027 -68.649 1.00 22.02 ? 332 GLU C N     1 
ATOM   8530  C  CA    . GLU C  1 321 ? -11.088 -30.363 -69.204 1.00 21.73 ? 332 GLU C CA    1 
ATOM   8531  C  C     . GLU C  1 321 ? -9.629  -30.684 -69.080 1.00 24.42 ? 332 GLU C C     1 
ATOM   8532  O  O     . GLU C  1 321 ? -8.789  -29.965 -69.642 1.00 23.76 ? 332 GLU C O     1 
ATOM   8533  C  CB    . GLU C  1 321 ? -11.528 -30.386 -70.685 1.00 23.00 ? 332 GLU C CB    1 
ATOM   8534  C  CG    . GLU C  1 321 ? -13.039 -30.424 -70.866 1.00 30.29 ? 332 GLU C CG    1 
ATOM   8535  C  CD    . GLU C  1 321 ? -13.774 -29.162 -70.456 1.00 41.95 ? 332 GLU C CD    1 
ATOM   8536  O  OE1   . GLU C  1 321 ? -14.777 -29.270 -69.716 1.00 42.96 ? 332 GLU C OE1   1 
ATOM   8537  O  OE2   . GLU C  1 321 ? -13.300 -28.061 -70.814 1.00 28.97 ? 332 GLU C OE2   1 
ATOM   8538  N  N     . LEU C  1 322 ? -9.311  -31.722 -68.301 1.00 21.21 ? 333 LEU C N     1 
ATOM   8539  C  CA    . LEU C  1 322 ? -7.909  -32.103 -68.110 1.00 21.01 ? 333 LEU C CA    1 
ATOM   8540  C  C     . LEU C  1 322 ? -7.290  -32.584 -69.424 1.00 25.57 ? 333 LEU C C     1 
ATOM   8541  O  O     . LEU C  1 322 ? -7.929  -33.345 -70.151 1.00 26.04 ? 333 LEU C O     1 
ATOM   8542  C  CB    . LEU C  1 322 ? -7.767  -33.209 -67.058 1.00 20.96 ? 333 LEU C CB    1 
ATOM   8543  C  CG    . LEU C  1 322 ? -8.036  -32.828 -65.611 1.00 24.93 ? 333 LEU C CG    1 
ATOM   8544  C  CD1   . LEU C  1 322 ? -8.204  -34.037 -64.797 1.00 24.58 ? 333 LEU C CD1   1 
ATOM   8545  C  CD2   . LEU C  1 322 ? -6.923  -31.977 -65.024 1.00 25.47 ? 333 LEU C CD2   1 
ATOM   8546  N  N     . PRO C  1 323 ? -6.054  -32.171 -69.756 1.00 22.67 ? 334 PRO C N     1 
ATOM   8547  C  CA    . PRO C  1 323 ? -5.424  -32.714 -70.966 1.00 21.46 ? 334 PRO C CA    1 
ATOM   8548  C  C     . PRO C  1 323 ? -5.033  -34.165 -70.688 1.00 24.36 ? 334 PRO C C     1 
ATOM   8549  O  O     . PRO C  1 323 ? -5.032  -34.598 -69.519 1.00 24.27 ? 334 PRO C O     1 
ATOM   8550  C  CB    . PRO C  1 323 ? -4.183  -31.843 -71.138 1.00 23.33 ? 334 PRO C CB    1 
ATOM   8551  C  CG    . PRO C  1 323 ? -3.821  -31.410 -69.727 1.00 27.67 ? 334 PRO C CG    1 
ATOM   8552  C  CD    . PRO C  1 323 ? -5.114  -31.331 -68.972 1.00 23.52 ? 334 PRO C CD    1 
ATOM   8553  N  N     . TYR C  1 324 ? -4.684  -34.921 -71.748 1.00 19.27 ? 335 TYR C N     1 
ATOM   8554  C  CA    . TYR C  1 324 ? -4.238  -36.285 -71.542 1.00 18.01 ? 335 TYR C CA    1 
ATOM   8555  C  C     . TYR C  1 324 ? -2.887  -36.210 -70.837 1.00 21.70 ? 335 TYR C C     1 
ATOM   8556  O  O     . TYR C  1 324 ? -2.106  -35.319 -71.147 1.00 20.75 ? 335 TYR C O     1 
ATOM   8557  C  CB    . TYR C  1 324 ? -4.104  -37.060 -72.868 1.00 17.54 ? 335 TYR C CB    1 
ATOM   8558  C  CG    . TYR C  1 324 ? -3.804  -38.510 -72.588 1.00 17.49 ? 335 TYR C CG    1 
ATOM   8559  C  CD1   . TYR C  1 324 ? -2.498  -38.989 -72.626 1.00 19.49 ? 335 TYR C CD1   1 
ATOM   8560  C  CD2   . TYR C  1 324 ? -4.795  -39.361 -72.107 1.00 18.34 ? 335 TYR C CD2   1 
ATOM   8561  C  CE1   . TYR C  1 324 ? -2.190  -40.285 -72.211 1.00 19.88 ? 335 TYR C CE1   1 
ATOM   8562  C  CE2   . TYR C  1 324 ? -4.496  -40.643 -71.663 1.00 19.27 ? 335 TYR C CE2   1 
ATOM   8563  C  CZ    . TYR C  1 324 ? -3.196  -41.110 -71.731 1.00 26.13 ? 335 TYR C CZ    1 
ATOM   8564  O  OH    . TYR C  1 324 ? -2.937  -42.404 -71.335 1.00 28.53 ? 335 TYR C OH    1 
ATOM   8565  N  N     . ASN C  1 325 ? -2.613  -37.134 -69.901 1.00 19.01 ? 336 ASN C N     1 
ATOM   8566  C  CA    . ASN C  1 325 ? -1.350  -37.127 -69.171 1.00 19.71 ? 336 ASN C CA    1 
ATOM   8567  C  C     . ASN C  1 325 ? -0.982  -38.548 -68.708 1.00 24.74 ? 336 ASN C C     1 
ATOM   8568  O  O     . ASN C  1 325 ? -1.824  -39.438 -68.765 1.00 24.80 ? 336 ASN C O     1 
ATOM   8569  C  CB    . ASN C  1 325 ? -1.425  -36.094 -67.980 1.00 17.70 ? 336 ASN C CB    1 
ATOM   8570  C  CG    . ASN C  1 325 ? -2.480  -36.430 -66.977 1.00 29.15 ? 336 ASN C CG    1 
ATOM   8571  O  OD1   . ASN C  1 325 ? -2.274  -37.281 -66.112 1.00 22.81 ? 336 ASN C OD1   1 
ATOM   8572  N  ND2   . ASN C  1 325 ? -3.667  -35.840 -67.119 1.00 19.55 ? 336 ASN C ND2   1 
ATOM   8573  N  N     . ASP C  1 326 ? 0.262   -38.749 -68.215 1.00 22.63 ? 337 ASP C N     1 
ATOM   8574  C  CA    . ASP C  1 326 ? 0.739   -40.058 -67.727 1.00 22.51 ? 337 ASP C CA    1 
ATOM   8575  C  C     . ASP C  1 326 ? -0.111  -40.644 -66.624 1.00 24.11 ? 337 ASP C C     1 
ATOM   8576  O  O     . ASP C  1 326 ? -0.006  -41.836 -66.351 1.00 22.67 ? 337 ASP C O     1 
ATOM   8577  C  CB    . ASP C  1 326 ? 2.186   -39.952 -67.204 1.00 24.02 ? 337 ASP C CB    1 
ATOM   8578  C  CG    . ASP C  1 326 ? 3.256   -39.758 -68.243 1.00 30.12 ? 337 ASP C CG    1 
ATOM   8579  O  OD1   . ASP C  1 326 ? 2.910   -39.606 -69.429 1.00 30.25 ? 337 ASP C OD1   1 
ATOM   8580  O  OD2   . ASP C  1 326 ? 4.445   -39.717 -67.863 1.00 36.89 ? 337 ASP C OD2   1 
ATOM   8581  N  N     . TYR C  1 327 ? -0.922  -39.817 -65.952 1.00 21.37 ? 338 TYR C N     1 
ATOM   8582  C  CA    . TYR C  1 327 ? -1.736  -40.279 -64.829 1.00 20.74 ? 338 TYR C CA    1 
ATOM   8583  C  C     . TYR C  1 327 ? -3.228  -40.026 -65.012 1.00 25.20 ? 338 TYR C C     1 
ATOM   8584  O  O     . TYR C  1 327 ? -3.986  -40.012 -64.032 1.00 24.07 ? 338 TYR C O     1 
ATOM   8585  C  CB    . TYR C  1 327 ? -1.202  -39.659 -63.499 1.00 21.22 ? 338 TYR C CB    1 
ATOM   8586  C  CG    . TYR C  1 327 ? 0.288   -39.846 -63.354 1.00 22.14 ? 338 TYR C CG    1 
ATOM   8587  C  CD1   . TYR C  1 327 ? 1.167   -38.796 -63.606 1.00 23.79 ? 338 TYR C CD1   1 
ATOM   8588  C  CD2   . TYR C  1 327 ? 0.830   -41.108 -63.122 1.00 22.98 ? 338 TYR C CD2   1 
ATOM   8589  C  CE1   . TYR C  1 327 ? 2.544   -38.987 -63.594 1.00 23.83 ? 338 TYR C CE1   1 
ATOM   8590  C  CE2   . TYR C  1 327 ? 2.208   -41.311 -63.106 1.00 23.86 ? 338 TYR C CE2   1 
ATOM   8591  C  CZ    . TYR C  1 327 ? 3.060   -40.246 -63.346 1.00 29.08 ? 338 TYR C CZ    1 
ATOM   8592  O  OH    . TYR C  1 327 ? 4.421   -40.421 -63.311 1.00 28.31 ? 338 TYR C OH    1 
ATOM   8593  N  N     . PHE C  1 328 ? -3.661  -39.887 -66.280 1.00 22.27 ? 339 PHE C N     1 
ATOM   8594  C  CA    . PHE C  1 328 ? -5.048  -39.573 -66.650 1.00 21.51 ? 339 PHE C CA    1 
ATOM   8595  C  C     . PHE C  1 328 ? -6.132  -40.314 -65.878 1.00 24.96 ? 339 PHE C C     1 
ATOM   8596  O  O     . PHE C  1 328 ? -7.070  -39.681 -65.391 1.00 25.24 ? 339 PHE C O     1 
ATOM   8597  C  CB    . PHE C  1 328 ? -5.254  -39.691 -68.167 1.00 23.34 ? 339 PHE C CB    1 
ATOM   8598  C  CG    . PHE C  1 328 ? -6.516  -39.032 -68.679 1.00 25.16 ? 339 PHE C CG    1 
ATOM   8599  C  CD1   . PHE C  1 328 ? -7.643  -39.786 -68.972 1.00 28.48 ? 339 PHE C CD1   1 
ATOM   8600  C  CD2   . PHE C  1 328 ? -6.575  -37.652 -68.862 1.00 27.09 ? 339 PHE C CD2   1 
ATOM   8601  C  CE1   . PHE C  1 328 ? -8.799  -39.180 -69.475 1.00 29.83 ? 339 PHE C CE1   1 
ATOM   8602  C  CE2   . PHE C  1 328 ? -7.731  -37.043 -69.357 1.00 29.73 ? 339 PHE C CE2   1 
ATOM   8603  C  CZ    . PHE C  1 328 ? -8.839  -37.807 -69.650 1.00 28.88 ? 339 PHE C CZ    1 
ATOM   8604  N  N     . GLU C  1 329 ? -5.987  -41.636 -65.718 1.00 20.54 ? 340 GLU C N     1 
ATOM   8605  C  CA    . GLU C  1 329 ? -6.970  -42.471 -65.017 1.00 20.38 ? 340 GLU C CA    1 
ATOM   8606  C  C     . GLU C  1 329 ? -7.164  -42.116 -63.523 1.00 25.78 ? 340 GLU C C     1 
ATOM   8607  O  O     . GLU C  1 329 ? -8.236  -42.390 -62.974 1.00 25.08 ? 340 GLU C O     1 
ATOM   8608  C  CB    . GLU C  1 329 ? -6.660  -43.975 -65.219 1.00 21.59 ? 340 GLU C CB    1 
ATOM   8609  C  CG    . GLU C  1 329 ? -5.406  -44.465 -64.493 1.00 27.49 ? 340 GLU C CG    1 
ATOM   8610  C  CD    . GLU C  1 329 ? -4.064  -44.242 -65.170 1.00 40.82 ? 340 GLU C CD    1 
ATOM   8611  O  OE1   . GLU C  1 329 ? -3.963  -43.388 -66.081 1.00 34.40 ? 340 GLU C OE1   1 
ATOM   8612  O  OE2   . GLU C  1 329 ? -3.099  -44.934 -64.779 1.00 38.98 ? 340 GLU C OE2   1 
ATOM   8613  N  N     . TYR C  1 330 ? -6.131  -41.499 -62.872 1.00 23.62 ? 341 TYR C N     1 
ATOM   8614  C  CA    . TYR C  1 330 ? -6.199  -41.092 -61.454 1.00 23.60 ? 341 TYR C CA    1 
ATOM   8615  C  C     . TYR C  1 330 ? -7.248  -39.984 -61.271 1.00 27.75 ? 341 TYR C C     1 
ATOM   8616  O  O     . TYR C  1 330 ? -7.743  -39.773 -60.162 1.00 27.39 ? 341 TYR C O     1 
ATOM   8617  C  CB    . TYR C  1 330 ? -4.842  -40.527 -60.977 1.00 25.31 ? 341 TYR C CB    1 
ATOM   8618  C  CG    . TYR C  1 330 ? -3.698  -41.498 -60.727 1.00 27.68 ? 341 TYR C CG    1 
ATOM   8619  C  CD1   . TYR C  1 330 ? -3.073  -42.159 -61.782 1.00 29.00 ? 341 TYR C CD1   1 
ATOM   8620  C  CD2   . TYR C  1 330 ? -3.111  -41.598 -59.467 1.00 29.32 ? 341 TYR C CD2   1 
ATOM   8621  C  CE1   . TYR C  1 330 ? -1.960  -42.978 -61.572 1.00 29.95 ? 341 TYR C CE1   1 
ATOM   8622  C  CE2   . TYR C  1 330 ? -1.996  -42.411 -59.243 1.00 30.63 ? 341 TYR C CE2   1 
ATOM   8623  C  CZ    . TYR C  1 330 ? -1.409  -43.084 -60.302 1.00 38.47 ? 341 TYR C CZ    1 
ATOM   8624  O  OH    . TYR C  1 330 ? -0.281  -43.851 -60.080 1.00 36.31 ? 341 TYR C OH    1 
ATOM   8625  N  N     . PHE C  1 331 ? -7.583  -39.276 -62.371 1.00 24.16 ? 342 PHE C N     1 
ATOM   8626  C  CA    . PHE C  1 331 ? -8.503  -38.141 -62.373 1.00 23.00 ? 342 PHE C CA    1 
ATOM   8627  C  C     . PHE C  1 331 ? -9.981  -38.463 -62.692 1.00 27.57 ? 342 PHE C C     1 
ATOM   8628  O  O     . PHE C  1 331 ? -10.817 -37.552 -62.773 1.00 26.34 ? 342 PHE C O     1 
ATOM   8629  C  CB    . PHE C  1 331 ? -7.942  -37.024 -63.264 1.00 23.86 ? 342 PHE C CB    1 
ATOM   8630  C  CG    . PHE C  1 331 ? -6.550  -36.581 -62.879 1.00 24.00 ? 342 PHE C CG    1 
ATOM   8631  C  CD1   . PHE C  1 331 ? -6.339  -35.786 -61.755 1.00 25.58 ? 342 PHE C CD1   1 
ATOM   8632  C  CD2   . PHE C  1 331 ? -5.448  -36.965 -63.632 1.00 25.00 ? 342 PHE C CD2   1 
ATOM   8633  C  CE1   . PHE C  1 331 ? -5.054  -35.373 -61.400 1.00 25.48 ? 342 PHE C CE1   1 
ATOM   8634  C  CE2   . PHE C  1 331 ? -4.152  -36.565 -63.263 1.00 27.43 ? 342 PHE C CE2   1 
ATOM   8635  C  CZ    . PHE C  1 331 ? -3.967  -35.763 -62.155 1.00 25.09 ? 342 PHE C CZ    1 
ATOM   8636  N  N     . GLY C  1 332 ? -10.288 -39.749 -62.824 1.00 24.21 ? 343 GLY C N     1 
ATOM   8637  C  CA    . GLY C  1 332 ? -11.640 -40.224 -63.087 1.00 24.43 ? 343 GLY C CA    1 
ATOM   8638  C  C     . GLY C  1 332 ? -12.558 -40.089 -61.891 1.00 30.25 ? 343 GLY C C     1 
ATOM   8639  O  O     . GLY C  1 332 ? -12.077 -39.886 -60.772 1.00 30.83 ? 343 GLY C O     1 
ATOM   8640  N  N     . PRO C  1 333 ? -13.892 -40.166 -62.080 1.00 27.85 ? 344 PRO C N     1 
ATOM   8641  C  CA    . PRO C  1 333 ? -14.624 -40.437 -63.327 1.00 27.99 ? 344 PRO C CA    1 
ATOM   8642  C  C     . PRO C  1 333 ? -14.991 -39.214 -64.180 1.00 32.86 ? 344 PRO C C     1 
ATOM   8643  O  O     . PRO C  1 333 ? -15.444 -39.379 -65.318 1.00 32.20 ? 344 PRO C O     1 
ATOM   8644  C  CB    . PRO C  1 333 ? -15.853 -41.200 -62.822 1.00 29.93 ? 344 PRO C CB    1 
ATOM   8645  C  CG    . PRO C  1 333 ? -16.140 -40.597 -61.466 1.00 34.58 ? 344 PRO C CG    1 
ATOM   8646  C  CD    . PRO C  1 333 ? -14.818 -40.059 -60.933 1.00 29.99 ? 344 PRO C CD    1 
ATOM   8647  N  N     . ASP C  1 334 ? -14.775 -37.992 -63.644 1.00 30.08 ? 345 ASP C N     1 
ATOM   8648  C  CA    . ASP C  1 334 ? -15.101 -36.705 -64.288 1.00 28.78 ? 345 ASP C CA    1 
ATOM   8649  C  C     . ASP C  1 334 ? -14.016 -36.188 -65.242 1.00 29.84 ? 345 ASP C C     1 
ATOM   8650  O  O     . ASP C  1 334 ? -14.346 -35.518 -66.225 1.00 28.88 ? 345 ASP C O     1 
ATOM   8651  C  CB    . ASP C  1 334 ? -15.374 -35.635 -63.201 1.00 29.91 ? 345 ASP C CB    1 
ATOM   8652  C  CG    . ASP C  1 334 ? -14.213 -35.458 -62.221 1.00 29.76 ? 345 ASP C CG    1 
ATOM   8653  O  OD1   . ASP C  1 334 ? -13.967 -36.391 -61.409 1.00 28.44 ? 345 ASP C OD1   1 
ATOM   8654  O  OD2   . ASP C  1 334 ? -13.477 -34.451 -62.349 1.00 26.74 ? 345 ASP C OD2   1 
ATOM   8655  N  N     . PHE C  1 335 ? -12.728 -36.416 -64.905 1.00 24.45 ? 346 PHE C N     1 
ATOM   8656  C  CA    . PHE C  1 335 ? -11.571 -35.933 -65.686 1.00 23.70 ? 346 PHE C CA    1 
ATOM   8657  C  C     . PHE C  1 335 ? -11.517 -34.388 -65.830 1.00 24.58 ? 346 PHE C C     1 
ATOM   8658  O  O     . PHE C  1 335 ? -11.063 -33.845 -66.848 1.00 23.01 ? 346 PHE C O     1 
ATOM   8659  C  CB    . PHE C  1 335 ? -11.423 -36.692 -67.020 1.00 25.82 ? 346 PHE C CB    1 
ATOM   8660  C  CG    . PHE C  1 335 ? -11.408 -38.193 -66.842 1.00 27.05 ? 346 PHE C CG    1 
ATOM   8661  C  CD1   . PHE C  1 335 ? -12.568 -38.944 -67.022 1.00 30.61 ? 346 PHE C CD1   1 
ATOM   8662  C  CD2   . PHE C  1 335 ? -10.238 -38.856 -66.472 1.00 28.40 ? 346 PHE C CD2   1 
ATOM   8663  C  CE1   . PHE C  1 335 ? -12.557 -40.334 -66.835 1.00 31.43 ? 346 PHE C CE1   1 
ATOM   8664  C  CE2   . PHE C  1 335 ? -10.220 -40.248 -66.317 1.00 30.95 ? 346 PHE C CE2   1 
ATOM   8665  C  CZ    . PHE C  1 335 ? -11.378 -40.977 -66.502 1.00 29.37 ? 346 PHE C CZ    1 
ATOM   8666  N  N     . LYS C  1 336 ? -11.934 -33.690 -64.764 1.00 19.35 ? 347 LYS C N     1 
ATOM   8667  C  CA    . LYS C  1 336 ? -11.921 -32.224 -64.736 1.00 19.19 ? 347 LYS C CA    1 
ATOM   8668  C  C     . LYS C  1 336 ? -10.859 -31.725 -63.765 1.00 24.34 ? 347 LYS C C     1 
ATOM   8669  O  O     . LYS C  1 336 ? -10.414 -32.477 -62.899 1.00 23.81 ? 347 LYS C O     1 
ATOM   8670  C  CB    . LYS C  1 336 ? -13.306 -31.652 -64.344 1.00 20.75 ? 347 LYS C CB    1 
ATOM   8671  C  CG    . LYS C  1 336 ? -14.489 -32.127 -65.220 1.00 27.15 ? 347 LYS C CG    1 
ATOM   8672  C  CD    . LYS C  1 336 ? -14.361 -31.725 -66.681 1.00 33.11 ? 347 LYS C CD    1 
ATOM   8673  C  CE    . LYS C  1 336 ? -15.636 -32.042 -67.431 1.00 43.94 ? 347 LYS C CE    1 
ATOM   8674  N  NZ    . LYS C  1 336 ? -15.468 -31.854 -68.890 1.00 51.98 ? 347 LYS C NZ    1 
ATOM   8675  N  N     . LEU C  1 337 ? -10.439 -30.470 -63.936 1.00 21.31 ? 348 LEU C N     1 
ATOM   8676  C  CA    . LEU C  1 337 ? -9.446  -29.801 -63.093 1.00 20.68 ? 348 LEU C CA    1 
ATOM   8677  C  C     . LEU C  1 337 ? -10.058 -29.386 -61.761 1.00 24.10 ? 348 LEU C C     1 
ATOM   8678  O  O     . LEU C  1 337 ? -9.457  -29.602 -60.706 1.00 22.17 ? 348 LEU C O     1 
ATOM   8679  C  CB    . LEU C  1 337 ? -8.911  -28.560 -63.829 1.00 20.97 ? 348 LEU C CB    1 
ATOM   8680  C  CG    . LEU C  1 337 ? -7.871  -27.708 -63.094 1.00 24.94 ? 348 LEU C CG    1 
ATOM   8681  C  CD1   . LEU C  1 337 ? -6.560  -28.477 -62.904 1.00 25.77 ? 348 LEU C CD1   1 
ATOM   8682  C  CD2   . LEU C  1 337 ? -7.638  -26.410 -63.827 1.00 24.48 ? 348 LEU C CD2   1 
ATOM   8683  N  N     . HIS C  1 338 ? -11.241 -28.758 -61.809 1.00 21.18 ? 349 HIS C N     1 
ATOM   8684  C  CA    . HIS C  1 338 ? -11.907 -28.243 -60.622 1.00 20.95 ? 349 HIS C CA    1 
ATOM   8685  C  C     . HIS C  1 338 ? -12.679 -29.264 -59.859 1.00 26.46 ? 349 HIS C C     1 
ATOM   8686  O  O     . HIS C  1 338 ? -12.994 -30.331 -60.404 1.00 27.74 ? 349 HIS C O     1 
ATOM   8687  C  CB    . HIS C  1 338 ? -12.674 -26.950 -60.942 1.00 21.26 ? 349 HIS C CB    1 
ATOM   8688  C  CG    . HIS C  1 338 ? -11.719 -25.869 -61.338 1.00 23.98 ? 349 HIS C CG    1 
ATOM   8689  N  ND1   . HIS C  1 338 ? -10.922 -25.233 -60.395 1.00 25.19 ? 349 HIS C ND1   1 
ATOM   8690  C  CD2   . HIS C  1 338 ? -11.356 -25.449 -62.570 1.00 25.39 ? 349 HIS C CD2   1 
ATOM   8691  C  CE1   . HIS C  1 338 ? -10.140 -24.416 -61.078 1.00 24.27 ? 349 HIS C CE1   1 
ATOM   8692  N  NE2   . HIS C  1 338 ? -10.366 -24.503 -62.389 1.00 25.05 ? 349 HIS C NE2   1 
ATOM   8693  N  N     . ILE C  1 339 ? -12.863 -29.015 -58.554 1.00 21.60 ? 350 ILE C N     1 
ATOM   8694  C  CA    . ILE C  1 339 ? -13.535 -29.961 -57.659 1.00 21.15 ? 350 ILE C CA    1 
ATOM   8695  C  C     . ILE C  1 339 ? -14.751 -29.342 -57.014 1.00 25.55 ? 350 ILE C C     1 
ATOM   8696  O  O     . ILE C  1 339 ? -14.810 -28.122 -56.853 1.00 24.47 ? 350 ILE C O     1 
ATOM   8697  C  CB    . ILE C  1 339 ? -12.576 -30.617 -56.608 1.00 24.25 ? 350 ILE C CB    1 
ATOM   8698  C  CG1   . ILE C  1 339 ? -12.179 -29.639 -55.456 1.00 24.40 ? 350 ILE C CG1   1 
ATOM   8699  C  CG2   . ILE C  1 339 ? -11.353 -31.298 -57.283 1.00 23.76 ? 350 ILE C CG2   1 
ATOM   8700  C  CD1   . ILE C  1 339 ? -11.462 -30.314 -54.179 1.00 28.25 ? 350 ILE C CD1   1 
ATOM   8701  N  N     . SER C  1 340 ? -15.694 -30.176 -56.604 1.00 23.35 ? 351 SER C N     1 
ATOM   8702  C  CA    . SER C  1 340 ? -16.883 -29.662 -55.949 1.00 24.99 ? 351 SER C CA    1 
ATOM   8703  C  C     . SER C  1 340 ? -16.769 -29.838 -54.429 1.00 28.66 ? 351 SER C C     1 
ATOM   8704  O  O     . SER C  1 340 ? -16.171 -30.819 -53.960 1.00 28.06 ? 351 SER C O     1 
ATOM   8705  C  CB    . SER C  1 340 ? -18.146 -30.312 -56.524 1.00 31.36 ? 351 SER C CB    1 
ATOM   8706  O  OG    . SER C  1 340 ? -18.740 -31.286 -55.681 1.00 42.75 ? 351 SER C OG    1 
ATOM   8707  N  N     . PRO C  1 341 ? -17.345 -28.918 -53.620 1.00 25.62 ? 352 PRO C N     1 
ATOM   8708  C  CA    . PRO C  1 341 ? -17.283 -29.119 -52.168 1.00 24.78 ? 352 PRO C CA    1 
ATOM   8709  C  C     . PRO C  1 341 ? -18.217 -30.255 -51.762 1.00 28.27 ? 352 PRO C C     1 
ATOM   8710  O  O     . PRO C  1 341 ? -19.050 -30.710 -52.562 1.00 26.46 ? 352 PRO C O     1 
ATOM   8711  C  CB    . PRO C  1 341 ? -17.749 -27.780 -51.603 1.00 26.82 ? 352 PRO C CB    1 
ATOM   8712  C  CG    . PRO C  1 341 ? -18.662 -27.232 -52.651 1.00 31.35 ? 352 PRO C CG    1 
ATOM   8713  C  CD    . PRO C  1 341 ? -18.116 -27.704 -53.973 1.00 26.49 ? 352 PRO C CD    1 
ATOM   8714  N  N     . SER C  1 342 ? -18.079 -30.711 -50.525 1.00 24.77 ? 353 SER C N     1 
ATOM   8715  C  CA    . SER C  1 342 ? -18.956 -31.752 -50.003 1.00 24.70 ? 353 SER C CA    1 
ATOM   8716  C  C     . SER C  1 342 ? -20.086 -31.067 -49.234 1.00 29.07 ? 353 SER C C     1 
ATOM   8717  O  O     . SER C  1 342 ? -20.101 -29.835 -49.125 1.00 28.45 ? 353 SER C O     1 
ATOM   8718  C  CB    . SER C  1 342 ? -18.174 -32.692 -49.097 1.00 27.47 ? 353 SER C CB    1 
ATOM   8719  O  OG    . SER C  1 342 ? -17.787 -32.014 -47.913 1.00 34.08 ? 353 SER C OG    1 
ATOM   8720  N  N     . ASN C  1 343 ? -21.002 -31.856 -48.674 1.00 27.33 ? 354 ASN C N     1 
ATOM   8721  C  CA    . ASN C  1 343 ? -22.137 -31.357 -47.887 1.00 27.67 ? 354 ASN C CA    1 
ATOM   8722  C  C     . ASN C  1 343 ? -21.806 -31.260 -46.388 1.00 29.46 ? 354 ASN C C     1 
ATOM   8723  O  O     . ASN C  1 343 ? -22.702 -30.965 -45.584 1.00 28.62 ? 354 ASN C O     1 
ATOM   8724  C  CB    . ASN C  1 343 ? -23.365 -32.266 -48.105 1.00 28.98 ? 354 ASN C CB    1 
ATOM   8725  C  CG    . ASN C  1 343 ? -23.166 -33.699 -47.668 1.00 59.22 ? 354 ASN C CG    1 
ATOM   8726  O  OD1   . ASN C  1 343 ? -22.041 -34.200 -47.558 1.00 50.95 ? 354 ASN C OD1   1 
ATOM   8727  N  ND2   . ASN C  1 343 ? -24.264 -34.400 -47.428 1.00 58.58 ? 354 ASN C ND2   1 
ATOM   8728  N  N     . MET C  1 344 ? -20.523 -31.497 -46.006 1.00 23.24 ? 355 MET C N     1 
ATOM   8729  C  CA    . MET C  1 344 ? -20.103 -31.436 -44.613 1.00 21.13 ? 355 MET C CA    1 
ATOM   8730  C  C     . MET C  1 344 ? -20.461 -30.080 -43.995 1.00 24.22 ? 355 MET C C     1 
ATOM   8731  O  O     . MET C  1 344 ? -20.459 -29.051 -44.683 1.00 23.28 ? 355 MET C O     1 
ATOM   8732  C  CB    . MET C  1 344 ? -18.607 -31.755 -44.461 1.00 22.24 ? 355 MET C CB    1 
ATOM   8733  C  CG    . MET C  1 344 ? -17.692 -30.579 -44.790 1.00 23.54 ? 355 MET C CG    1 
ATOM   8734  S  SD    . MET C  1 344 ? -15.945 -30.963 -44.557 1.00 25.29 ? 355 MET C SD    1 
ATOM   8735  C  CE    . MET C  1 344 ? -15.946 -31.492 -42.880 1.00 21.53 ? 355 MET C CE    1 
ATOM   8736  N  N     . THR C  1 345 ? -20.815 -30.104 -42.714 1.00 22.54 ? 356 THR C N     1 
ATOM   8737  C  CA    . THR C  1 345 ? -21.219 -28.922 -41.950 1.00 22.29 ? 356 THR C CA    1 
ATOM   8738  C  C     . THR C  1 345 ? -20.026 -27.988 -41.676 1.00 25.13 ? 356 THR C C     1 
ATOM   8739  O  O     . THR C  1 345 ? -18.975 -28.446 -41.227 1.00 23.60 ? 356 THR C O     1 
ATOM   8740  C  CB    . THR C  1 345 ? -21.908 -29.387 -40.638 1.00 31.10 ? 356 THR C CB    1 
ATOM   8741  O  OG1   . THR C  1 345 ? -23.117 -30.074 -40.984 1.00 34.93 ? 356 THR C OG1   1 
ATOM   8742  C  CG2   . THR C  1 345 ? -22.244 -28.235 -39.693 1.00 25.47 ? 356 THR C CG2   1 
ATOM   8743  N  N     . ASN C  1 346 ? -20.221 -26.678 -41.903 1.00 21.93 ? 357 ASN C N     1 
ATOM   8744  C  CA    . ASN C  1 346 ? -19.200 -25.694 -41.573 1.00 20.43 ? 357 ASN C CA    1 
ATOM   8745  C  C     . ASN C  1 346 ? -19.378 -25.415 -40.078 1.00 23.48 ? 357 ASN C C     1 
ATOM   8746  O  O     . ASN C  1 346 ? -20.357 -24.779 -39.695 1.00 22.76 ? 357 ASN C O     1 
ATOM   8747  C  CB    . ASN C  1 346 ? -19.353 -24.422 -42.425 1.00 16.64 ? 357 ASN C CB    1 
ATOM   8748  C  CG    . ASN C  1 346 ? -18.301 -23.373 -42.112 1.00 28.95 ? 357 ASN C CG    1 
ATOM   8749  O  OD1   . ASN C  1 346 ? -17.391 -23.577 -41.305 1.00 23.46 ? 357 ASN C OD1   1 
ATOM   8750  N  ND2   . ASN C  1 346 ? -18.387 -22.231 -42.747 1.00 20.17 ? 357 ASN C ND2   1 
ATOM   8751  N  N     . GLN C  1 347 ? -18.462 -25.928 -39.229 1.00 17.68 ? 358 GLN C N     1 
ATOM   8752  C  CA    . GLN C  1 347 ? -18.549 -25.742 -37.774 1.00 17.45 ? 358 GLN C CA    1 
ATOM   8753  C  C     . GLN C  1 347 ? -18.084 -24.350 -37.323 1.00 20.10 ? 358 GLN C C     1 
ATOM   8754  O  O     . GLN C  1 347 ? -18.176 -24.028 -36.138 1.00 18.72 ? 358 GLN C O     1 
ATOM   8755  C  CB    . GLN C  1 347 ? -17.764 -26.839 -37.022 1.00 18.88 ? 358 GLN C CB    1 
ATOM   8756  C  CG    . GLN C  1 347 ? -18.216 -28.280 -37.329 1.00 22.49 ? 358 GLN C CG    1 
ATOM   8757  C  CD    . GLN C  1 347 ? -19.607 -28.630 -36.824 1.00 40.12 ? 358 GLN C CD    1 
ATOM   8758  O  OE1   . GLN C  1 347 ? -20.198 -27.935 -35.995 1.00 31.00 ? 358 GLN C OE1   1 
ATOM   8759  N  NE2   . GLN C  1 347 ? -20.160 -29.740 -37.305 1.00 38.79 ? 358 GLN C NE2   1 
ATOM   8760  N  N     . ASN C  1 348 ? -17.567 -23.544 -38.251 1.00 15.64 ? 359 ASN C N     1 
ATOM   8761  C  CA    . ASN C  1 348 ? -17.112 -22.199 -37.936 1.00 15.81 ? 359 ASN C CA    1 
ATOM   8762  C  C     . ASN C  1 348 ? -18.333 -21.282 -38.040 1.00 20.61 ? 359 ASN C C     1 
ATOM   8763  O  O     . ASN C  1 348 ? -18.722 -20.913 -39.132 1.00 20.93 ? 359 ASN C O     1 
ATOM   8764  C  CB    . ASN C  1 348 ? -16.037 -21.760 -38.912 1.00 16.82 ? 359 ASN C CB    1 
ATOM   8765  C  CG    . ASN C  1 348 ? -14.802 -22.638 -38.871 1.00 26.36 ? 359 ASN C CG    1 
ATOM   8766  O  OD1   . ASN C  1 348 ? -13.910 -22.412 -38.067 1.00 15.36 ? 359 ASN C OD1   1 
ATOM   8767  N  ND2   . ASN C  1 348 ? -14.752 -23.682 -39.705 1.00 17.07 ? 359 ASN C ND2   1 
ATOM   8768  N  N     . THR C  1 349 ? -18.948 -20.940 -36.916 1.00 18.33 ? 360 THR C N     1 
ATOM   8769  C  CA    . THR C  1 349 ? -20.128 -20.066 -36.952 1.00 17.53 ? 360 THR C CA    1 
ATOM   8770  C  C     . THR C  1 349 ? -19.693 -18.626 -37.307 1.00 18.74 ? 360 THR C C     1 
ATOM   8771  O  O     . THR C  1 349 ? -18.557 -18.257 -36.996 1.00 16.94 ? 360 THR C O     1 
ATOM   8772  C  CB    . THR C  1 349 ? -20.835 -20.067 -35.586 1.00 20.66 ? 360 THR C CB    1 
ATOM   8773  O  OG1   . THR C  1 349 ? -19.984 -19.441 -34.630 1.00 21.99 ? 360 THR C OG1   1 
ATOM   8774  C  CG2   . THR C  1 349 ? -21.243 -21.465 -35.111 1.00 20.33 ? 360 THR C CG2   1 
ATOM   8775  N  N     . PRO C  1 350 ? -20.585 -17.775 -37.872 1.00 13.87 ? 361 PRO C N     1 
ATOM   8776  C  CA    . PRO C  1 350 ? -20.199 -16.371 -38.134 1.00 13.53 ? 361 PRO C CA    1 
ATOM   8777  C  C     . PRO C  1 350 ? -19.693 -15.640 -36.877 1.00 17.86 ? 361 PRO C C     1 
ATOM   8778  O  O     . PRO C  1 350 ? -18.757 -14.857 -36.983 1.00 18.67 ? 361 PRO C O     1 
ATOM   8779  C  CB    . PRO C  1 350 ? -21.506 -15.748 -38.646 1.00 15.42 ? 361 PRO C CB    1 
ATOM   8780  C  CG    . PRO C  1 350 ? -22.244 -16.917 -39.274 1.00 19.48 ? 361 PRO C CG    1 
ATOM   8781  C  CD    . PRO C  1 350 ? -21.965 -18.054 -38.337 1.00 15.41 ? 361 PRO C CD    1 
ATOM   8782  N  N     . GLU C  1 351 ? -20.292 -15.898 -35.689 1.00 15.08 ? 362 GLU C N     1 
ATOM   8783  C  CA    . GLU C  1 351 ? -19.868 -15.261 -34.437 1.00 14.78 ? 362 GLU C CA    1 
ATOM   8784  C  C     . GLU C  1 351 ? -18.396 -15.660 -34.091 1.00 19.87 ? 362 GLU C C     1 
ATOM   8785  O  O     . GLU C  1 351 ? -17.594 -14.791 -33.728 1.00 18.49 ? 362 GLU C O     1 
ATOM   8786  C  CB    . GLU C  1 351 ? -20.810 -15.648 -33.295 1.00 15.74 ? 362 GLU C CB    1 
ATOM   8787  C  CG    . GLU C  1 351 ? -20.396 -15.118 -31.930 1.00 18.80 ? 362 GLU C CG    1 
ATOM   8788  C  CD    . GLU C  1 351 ? -21.240 -15.595 -30.762 1.00 28.10 ? 362 GLU C CD    1 
ATOM   8789  O  OE1   . GLU C  1 351 ? -21.486 -14.771 -29.855 1.00 30.57 ? 362 GLU C OE1   1 
ATOM   8790  O  OE2   . GLU C  1 351 ? -21.648 -16.781 -30.744 1.00 24.32 ? 362 GLU C OE2   1 
ATOM   8791  N  N     . TYR C  1 352 ? -18.078 -16.965 -34.203 1.00 16.54 ? 363 TYR C N     1 
ATOM   8792  C  CA    . TYR C  1 352 ? -16.749 -17.523 -33.925 1.00 17.22 ? 363 TYR C CA    1 
ATOM   8793  C  C     . TYR C  1 352 ? -15.727 -16.841 -34.834 1.00 19.98 ? 363 TYR C C     1 
ATOM   8794  O  O     . TYR C  1 352 ? -14.690 -16.388 -34.370 1.00 19.76 ? 363 TYR C O     1 
ATOM   8795  C  CB    . TYR C  1 352 ? -16.749 -19.054 -34.185 1.00 19.90 ? 363 TYR C CB    1 
ATOM   8796  C  CG    . TYR C  1 352 ? -15.370 -19.682 -34.106 1.00 23.58 ? 363 TYR C CG    1 
ATOM   8797  C  CD1   . TYR C  1 352 ? -14.608 -19.887 -35.255 1.00 25.15 ? 363 TYR C CD1   1 
ATOM   8798  C  CD2   . TYR C  1 352 ? -14.786 -19.976 -32.875 1.00 25.45 ? 363 TYR C CD2   1 
ATOM   8799  C  CE1   . TYR C  1 352 ? -13.311 -20.404 -35.184 1.00 25.00 ? 363 TYR C CE1   1 
ATOM   8800  C  CE2   . TYR C  1 352 ? -13.492 -20.500 -32.790 1.00 26.97 ? 363 TYR C CE2   1 
ATOM   8801  C  CZ    . TYR C  1 352 ? -12.763 -20.717 -33.949 1.00 32.30 ? 363 TYR C CZ    1 
ATOM   8802  O  OH    . TYR C  1 352 ? -11.509 -21.263 -33.875 1.00 33.93 ? 363 TYR C OH    1 
ATOM   8803  N  N     . MET C  1 353 ? -16.034 -16.791 -36.134 1.00 14.27 ? 364 MET C N     1 
ATOM   8804  C  CA    . MET C  1 353 ? -15.194 -16.184 -37.163 1.00 13.65 ? 364 MET C CA    1 
ATOM   8805  C  C     . MET C  1 353 ? -14.953 -14.695 -36.918 1.00 19.39 ? 364 MET C C     1 
ATOM   8806  O  O     . MET C  1 353 ? -13.815 -14.224 -37.050 1.00 19.46 ? 364 MET C O     1 
ATOM   8807  C  CB    . MET C  1 353 ? -15.779 -16.433 -38.561 1.00 15.35 ? 364 MET C CB    1 
ATOM   8808  C  CG    A MET C  1 353 ? -15.831 -17.910 -38.913 0.56 19.05 ? 364 MET C CG    1 
ATOM   8809  C  CG    B MET C  1 353 ? -15.682 -17.870 -39.015 0.44 18.51 ? 364 MET C CG    1 
ATOM   8810  S  SD    A MET C  1 353 ? -16.049 -18.220 -40.672 0.56 22.81 ? 364 MET C SD    1 
ATOM   8811  S  SD    B MET C  1 353 ? -14.049 -18.541 -38.664 0.44 21.56 ? 364 MET C SD    1 
ATOM   8812  C  CE    A MET C  1 353 ? -17.806 -17.642 -40.900 0.56 19.84 ? 364 MET C CE    1 
ATOM   8813  C  CE    B MET C  1 353 ? -13.859 -19.515 -39.922 0.44 18.89 ? 364 MET C CE    1 
ATOM   8814  N  N     . GLU C  1 354 ? -16.009 -13.968 -36.530 1.00 18.21 ? 365 GLU C N     1 
ATOM   8815  C  CA    . GLU C  1 354 ? -15.934 -12.527 -36.236 1.00 17.91 ? 365 GLU C CA    1 
ATOM   8816  C  C     . GLU C  1 354 ? -15.079 -12.240 -35.010 1.00 19.96 ? 365 GLU C C     1 
ATOM   8817  O  O     . GLU C  1 354 ? -14.267 -11.335 -35.060 1.00 21.05 ? 365 GLU C O     1 
ATOM   8818  C  CB    . GLU C  1 354 ? -17.343 -11.930 -36.043 1.00 19.31 ? 365 GLU C CB    1 
ATOM   8819  C  CG    . GLU C  1 354 ? -17.942 -11.435 -37.343 1.00 34.59 ? 365 GLU C CG    1 
ATOM   8820  C  CD    . GLU C  1 354 ? -19.431 -11.141 -37.301 1.00 70.66 ? 365 GLU C CD    1 
ATOM   8821  O  OE1   . GLU C  1 354 ? -19.894 -10.498 -36.329 1.00 74.06 ? 365 GLU C OE1   1 
ATOM   8822  O  OE2   . GLU C  1 354 ? -20.132 -11.530 -38.263 1.00 64.66 ? 365 GLU C OE2   1 
ATOM   8823  N  N     . LYS C  1 355 ? -15.239 -13.015 -33.926 1.00 15.64 ? 366 LYS C N     1 
ATOM   8824  C  CA    . LYS C  1 355 ? -14.450 -12.827 -32.705 1.00 16.51 ? 366 LYS C CA    1 
ATOM   8825  C  C     . LYS C  1 355 ? -12.944 -13.015 -32.986 1.00 20.44 ? 366 LYS C C     1 
ATOM   8826  O  O     . LYS C  1 355 ? -12.138 -12.218 -32.500 1.00 19.68 ? 366 LYS C O     1 
ATOM   8827  C  CB    . LYS C  1 355 ? -14.908 -13.789 -31.591 1.00 20.46 ? 366 LYS C CB    1 
ATOM   8828  C  CG    . LYS C  1 355 ? -15.916 -13.161 -30.609 1.00 50.71 ? 366 LYS C CG    1 
ATOM   8829  C  CD    . LYS C  1 355 ? -17.314 -12.950 -31.204 1.00 64.11 ? 366 LYS C CD    1 
ATOM   8830  C  CE    . LYS C  1 355 ? -18.200 -12.056 -30.379 1.00 80.54 ? 366 LYS C CE    1 
ATOM   8831  N  NZ    . LYS C  1 355 ? -19.463 -11.744 -31.100 1.00 95.17 ? 366 LYS C NZ    1 
ATOM   8832  N  N     . ILE C  1 356 ? -12.576 -14.052 -33.770 1.00 16.48 ? 367 ILE C N     1 
ATOM   8833  C  CA    . ILE C  1 356 ? -11.154 -14.305 -34.098 1.00 16.69 ? 367 ILE C CA    1 
ATOM   8834  C  C     . ILE C  1 356 ? -10.609 -13.156 -34.943 1.00 19.10 ? 367 ILE C C     1 
ATOM   8835  O  O     . ILE C  1 356 ? -9.553  -12.602 -34.622 1.00 17.86 ? 367 ILE C O     1 
ATOM   8836  C  CB    . ILE C  1 356 ? -10.875 -15.713 -34.740 1.00 18.76 ? 367 ILE C CB    1 
ATOM   8837  C  CG1   . ILE C  1 356 ? -11.403 -16.911 -33.894 1.00 19.50 ? 367 ILE C CG1   1 
ATOM   8838  C  CG2   . ILE C  1 356 ? -9.382  -15.886 -35.105 1.00 19.32 ? 367 ILE C CG2   1 
ATOM   8839  C  CD1   . ILE C  1 356 ? -10.820 -17.152 -32.458 1.00 28.91 ? 367 ILE C CD1   1 
ATOM   8840  N  N     . LYS C  1 357 ? -11.339 -12.770 -35.999 1.00 16.19 ? 368 LYS C N     1 
ATOM   8841  C  CA    . LYS C  1 357 ? -10.946 -11.678 -36.894 1.00 18.01 ? 368 LYS C CA    1 
ATOM   8842  C  C     . LYS C  1 357 ? -10.738 -10.378 -36.116 1.00 24.44 ? 368 LYS C C     1 
ATOM   8843  O  O     . LYS C  1 357 ? -9.747  -9.675  -36.349 1.00 23.24 ? 368 LYS C O     1 
ATOM   8844  C  CB    . LYS C  1 357 ? -12.020 -11.471 -37.983 1.00 22.34 ? 368 LYS C CB    1 
ATOM   8845  C  CG    . LYS C  1 357 ? -11.526 -10.689 -39.202 1.00 44.54 ? 368 LYS C CG    1 
ATOM   8846  C  CD    . LYS C  1 357 ? -12.298 -11.045 -40.480 1.00 57.25 ? 368 LYS C CD    1 
ATOM   8847  C  CE    . LYS C  1 357 ? -13.525 -10.195 -40.720 1.00 70.57 ? 368 LYS C CE    1 
ATOM   8848  N  NZ    . LYS C  1 357 ? -14.262 -10.629 -41.939 1.00 79.51 ? 368 LYS C NZ    1 
ATOM   8849  N  N     . GLN C  1 358 ? -11.659 -10.080 -35.174 1.00 20.71 ? 369 GLN C N     1 
ATOM   8850  C  CA    . GLN C  1 358 ? -11.610 -8.872  -34.340 1.00 21.00 ? 369 GLN C CA    1 
ATOM   8851  C  C     . GLN C  1 358 ? -10.297 -8.867  -33.565 1.00 23.31 ? 369 GLN C C     1 
ATOM   8852  O  O     . GLN C  1 358 ? -9.559  -7.894  -33.637 1.00 23.84 ? 369 GLN C O     1 
ATOM   8853  C  CB    . GLN C  1 358 ? -12.794 -8.862  -33.359 1.00 23.35 ? 369 GLN C CB    1 
ATOM   8854  C  CG    . GLN C  1 358 ? -13.048 -7.503  -32.712 1.00 44.98 ? 369 GLN C CG    1 
ATOM   8855  C  CD    . GLN C  1 358 ? -13.876 -7.604  -31.449 1.00 72.13 ? 369 GLN C CD    1 
ATOM   8856  O  OE1   . GLN C  1 358 ? -14.831 -8.390  -31.342 1.00 66.57 ? 369 GLN C OE1   1 
ATOM   8857  N  NE2   . GLN C  1 358 ? -13.536 -6.781  -30.464 1.00 69.24 ? 369 GLN C NE2   1 
ATOM   8858  N  N     . ARG C  1 359 ? -10.001 -9.970  -32.864 1.00 18.16 ? 370 ARG C N     1 
ATOM   8859  C  CA    . ARG C  1 359 ? -8.768  -10.145 -32.101 1.00 17.83 ? 370 ARG C CA    1 
ATOM   8860  C  C     . ARG C  1 359 ? -7.501  -9.968  -32.940 1.00 20.30 ? 370 ARG C C     1 
ATOM   8861  O  O     . ARG C  1 359 ? -6.574  -9.308  -32.462 1.00 20.24 ? 370 ARG C O     1 
ATOM   8862  C  CB    . ARG C  1 359 ? -8.756  -11.507 -31.385 1.00 19.84 ? 370 ARG C CB    1 
ATOM   8863  C  CG    . ARG C  1 359 ? -7.423  -11.811 -30.672 1.00 31.44 ? 370 ARG C CG    1 
ATOM   8864  C  CD    . ARG C  1 359 ? -7.161  -10.933 -29.436 1.00 36.01 ? 370 ARG C CD    1 
ATOM   8865  N  NE    . ARG C  1 359 ? -8.021  -11.322 -28.318 1.00 43.33 ? 370 ARG C NE    1 
ATOM   8866  C  CZ    . ARG C  1 359 ? -7.843  -12.412 -27.576 1.00 51.89 ? 370 ARG C CZ    1 
ATOM   8867  N  NH1   . ARG C  1 359 ? -6.810  -13.220 -27.803 1.00 25.60 ? 370 ARG C NH1   1 
ATOM   8868  N  NH2   . ARG C  1 359 ? -8.694  -12.705 -26.607 1.00 38.17 ? 370 ARG C NH2   1 
ATOM   8869  N  N     . LEU C  1 360 ? -7.427  -10.586 -34.147 1.00 17.09 ? 371 LEU C N     1 
ATOM   8870  C  CA    . LEU C  1 360 ? -6.237  -10.463 -35.003 1.00 17.25 ? 371 LEU C CA    1 
ATOM   8871  C  C     . LEU C  1 360 ? -6.049  -9.026  -35.453 1.00 23.52 ? 371 LEU C C     1 
ATOM   8872  O  O     . LEU C  1 360 ? -4.926  -8.522  -35.440 1.00 23.01 ? 371 LEU C O     1 
ATOM   8873  C  CB    . LEU C  1 360 ? -6.229  -11.429 -36.221 1.00 17.26 ? 371 LEU C CB    1 
ATOM   8874  C  CG    . LEU C  1 360 ? -6.368  -12.954 -35.973 1.00 21.41 ? 371 LEU C CG    1 
ATOM   8875  C  CD1   . LEU C  1 360 ? -6.084  -13.732 -37.249 1.00 19.53 ? 371 LEU C CD1   1 
ATOM   8876  C  CD2   . LEU C  1 360 ? -5.474  -13.442 -34.876 1.00 23.25 ? 371 LEU C CD2   1 
ATOM   8877  N  N     . PHE C  1 361 ? -7.150  -8.348  -35.814 1.00 22.21 ? 372 PHE C N     1 
ATOM   8878  C  CA    . PHE C  1 361 ? -7.088  -6.942  -36.199 1.00 22.71 ? 372 PHE C CA    1 
ATOM   8879  C  C     . PHE C  1 361 ? -6.539  -6.076  -35.060 1.00 22.80 ? 372 PHE C C     1 
ATOM   8880  O  O     . PHE C  1 361 ? -5.682  -5.222  -35.316 1.00 23.96 ? 372 PHE C O     1 
ATOM   8881  C  CB    . PHE C  1 361 ? -8.449  -6.452  -36.699 1.00 26.41 ? 372 PHE C CB    1 
ATOM   8882  C  CG    . PHE C  1 361 ? -8.591  -6.565  -38.198 1.00 30.03 ? 372 PHE C CG    1 
ATOM   8883  C  CD1   . PHE C  1 361 ? -8.820  -7.797  -38.801 1.00 34.63 ? 372 PHE C CD1   1 
ATOM   8884  C  CD2   . PHE C  1 361 ? -8.496  -5.441  -39.007 1.00 34.28 ? 372 PHE C CD2   1 
ATOM   8885  C  CE1   . PHE C  1 361 ? -8.964  -7.902  -40.184 1.00 35.99 ? 372 PHE C CE1   1 
ATOM   8886  C  CE2   . PHE C  1 361 ? -8.655  -5.546  -40.393 1.00 38.08 ? 372 PHE C CE2   1 
ATOM   8887  C  CZ    . PHE C  1 361 ? -8.880  -6.778  -40.970 1.00 36.58 ? 372 PHE C CZ    1 
ATOM   8888  N  N     . GLU C  1 362 ? -6.953  -6.363  -33.818 1.00 16.18 ? 373 GLU C N     1 
ATOM   8889  C  CA    . GLU C  1 362 ? -6.485  -5.681  -32.605 1.00 17.98 ? 373 GLU C CA    1 
ATOM   8890  C  C     . GLU C  1 362 ? -4.989  -5.949  -32.418 1.00 23.34 ? 373 GLU C C     1 
ATOM   8891  O  O     . GLU C  1 362 ? -4.244  -5.014  -32.123 1.00 22.60 ? 373 GLU C O     1 
ATOM   8892  C  CB    . GLU C  1 362 ? -7.242  -6.161  -31.357 1.00 19.47 ? 373 GLU C CB    1 
ATOM   8893  C  CG    . GLU C  1 362 ? -8.697  -5.718  -31.301 1.00 29.71 ? 373 GLU C CG    1 
ATOM   8894  C  CD    . GLU C  1 362 ? -9.552  -6.424  -30.266 1.00 45.17 ? 373 GLU C CD    1 
ATOM   8895  O  OE1   . GLU C  1 362 ? -8.984  -7.113  -29.388 1.00 36.98 ? 373 GLU C OE1   1 
ATOM   8896  O  OE2   . GLU C  1 362 ? -10.795 -6.282  -30.326 1.00 45.80 ? 373 GLU C OE2   1 
ATOM   8897  N  N     . ASN C  1 363 ? -4.542  -7.214  -32.643 1.00 19.24 ? 374 ASN C N     1 
ATOM   8898  C  CA    . ASN C  1 363 ? -3.114  -7.557  -32.527 1.00 18.98 ? 374 ASN C CA    1 
ATOM   8899  C  C     . ASN C  1 363 ? -2.298  -6.866  -33.612 1.00 21.91 ? 374 ASN C C     1 
ATOM   8900  O  O     . ASN C  1 363 ? -1.201  -6.379  -33.326 1.00 20.58 ? 374 ASN C O     1 
ATOM   8901  C  CB    . ASN C  1 363 ? -2.892  -9.080  -32.564 1.00 16.71 ? 374 ASN C CB    1 
ATOM   8902  C  CG    . ASN C  1 363 ? -3.419  -9.789  -31.353 1.00 26.13 ? 374 ASN C CG    1 
ATOM   8903  O  OD1   . ASN C  1 363 ? -3.554  -9.215  -30.276 1.00 20.13 ? 374 ASN C OD1   1 
ATOM   8904  N  ND2   . ASN C  1 363 ? -3.682  -11.071 -31.487 1.00 21.67 ? 374 ASN C ND2   1 
ATOM   8905  N  N     . LEU C  1 364 ? -2.848  -6.771  -34.841 1.00 17.29 ? 375 LEU C N     1 
ATOM   8906  C  CA    . LEU C  1 364 ? -2.140  -6.117  -35.950 1.00 16.98 ? 375 LEU C CA    1 
ATOM   8907  C  C     . LEU C  1 364 ? -1.945  -4.616  -35.745 1.00 23.44 ? 375 LEU C C     1 
ATOM   8908  O  O     . LEU C  1 364 ? -0.932  -4.070  -36.175 1.00 23.31 ? 375 LEU C O     1 
ATOM   8909  C  CB    . LEU C  1 364 ? -2.780  -6.410  -37.303 1.00 16.24 ? 375 LEU C CB    1 
ATOM   8910  C  CG    . LEU C  1 364 ? -2.709  -7.866  -37.739 1.00 20.63 ? 375 LEU C CG    1 
ATOM   8911  C  CD1   . LEU C  1 364 ? -3.701  -8.132  -38.857 1.00 20.03 ? 375 LEU C CD1   1 
ATOM   8912  C  CD2   . LEU C  1 364 ? -1.280  -8.266  -38.137 1.00 21.18 ? 375 LEU C CD2   1 
ATOM   8913  N  N     . ARG C  1 365 ? -2.869  -3.977  -35.013 1.00 22.80 ? 376 ARG C N     1 
ATOM   8914  C  CA    . ARG C  1 365 ? -2.812  -2.552  -34.655 1.00 23.37 ? 376 ARG C CA    1 
ATOM   8915  C  C     . ARG C  1 365 ? -1.670  -2.255  -33.680 1.00 27.26 ? 376 ARG C C     1 
ATOM   8916  O  O     . ARG C  1 365 ? -1.326  -1.087  -33.487 1.00 26.78 ? 376 ARG C O     1 
ATOM   8917  C  CB    A ARG C  1 365 ? -4.173  -2.091  -34.077 0.96 24.01 ? 376 ARG C CB    1 
ATOM   8918  C  CG    A ARG C  1 365 ? -5.221  -1.908  -35.187 0.96 36.84 ? 376 ARG C CG    1 
ATOM   8919  C  CD    A ARG C  1 365 ? -6.501  -1.232  -34.732 0.96 52.00 ? 376 ARG C CD    1 
ATOM   8920  N  NE    A ARG C  1 365 ? -6.309  0.185   -34.417 0.96 64.51 ? 376 ARG C NE    1 
ATOM   8921  C  CZ    A ARG C  1 365 ? -6.314  0.688   -33.187 0.96 81.88 ? 376 ARG C CZ    1 
ATOM   8922  N  NH1   A ARG C  1 365 ? -6.515  -0.101  -32.138 0.96 70.12 ? 376 ARG C NH1   1 
ATOM   8923  N  NH2   A ARG C  1 365 ? -6.122  1.986   -32.996 0.96 69.80 ? 376 ARG C NH2   1 
ATOM   8924  N  N     . MET C  1 366 ? -1.066  -3.310  -33.086 1.00 24.85 ? 377 MET C N     1 
ATOM   8925  C  CA    . MET C  1 366 ? 0.051   -3.185  -32.131 1.00 25.27 ? 377 MET C CA    1 
ATOM   8926  C  C     . MET C  1 366 ? 1.419   -3.031  -32.794 1.00 29.07 ? 377 MET C C     1 
ATOM   8927  O  O     . MET C  1 366 ? 2.395   -2.681  -32.106 1.00 28.92 ? 377 MET C O     1 
ATOM   8928  C  CB    . MET C  1 366 ? 0.056   -4.340  -31.114 1.00 27.81 ? 377 MET C CB    1 
ATOM   8929  C  CG    . MET C  1 366 ? -1.102  -4.300  -30.136 1.00 31.77 ? 377 MET C CG    1 
ATOM   8930  S  SD    . MET C  1 366 ? -1.190  -2.788  -29.129 1.00 36.99 ? 377 MET C SD    1 
ATOM   8931  C  CE    . MET C  1 366 ? 0.271   -2.994  -28.082 1.00 33.71 ? 377 MET C CE    1 
ATOM   8932  N  N     . LEU C  1 367 ? 1.496   -3.288  -34.120 1.00 24.94 ? 378 LEU C N     1 
ATOM   8933  C  CA    . LEU C  1 367 ? 2.729   -3.178  -34.912 1.00 25.15 ? 378 LEU C CA    1 
ATOM   8934  C  C     . LEU C  1 367 ? 3.456   -1.802  -34.897 1.00 34.87 ? 378 LEU C C     1 
ATOM   8935  O  O     . LEU C  1 367 ? 4.688   -1.816  -34.793 1.00 34.75 ? 378 LEU C O     1 
ATOM   8936  C  CB    . LEU C  1 367 ? 2.545   -3.717  -36.333 1.00 24.30 ? 378 LEU C CB    1 
ATOM   8937  C  CG    . LEU C  1 367 ? 3.099   -5.123  -36.605 1.00 27.16 ? 378 LEU C CG    1 
ATOM   8938  C  CD1   . LEU C  1 367 ? 2.331   -6.206  -35.814 1.00 26.44 ? 378 LEU C CD1   1 
ATOM   8939  C  CD2   . LEU C  1 367 ? 3.047   -5.442  -38.084 1.00 26.93 ? 378 LEU C CD2   1 
ATOM   8940  N  N     . PRO C  1 368 ? 2.791   -0.615  -34.986 1.00 34.40 ? 379 PRO C N     1 
ATOM   8941  C  CA    . PRO C  1 368 ? 3.560   0.650   -34.888 1.00 35.39 ? 379 PRO C CA    1 
ATOM   8942  C  C     . PRO C  1 368 ? 4.021   0.941   -33.455 1.00 42.09 ? 379 PRO C C     1 
ATOM   8943  O  O     . PRO C  1 368 ? 4.914   1.767   -33.256 1.00 43.65 ? 379 PRO C O     1 
ATOM   8944  C  CB    . PRO C  1 368 ? 2.574   1.728   -35.363 1.00 36.94 ? 379 PRO C CB    1 
ATOM   8945  C  CG    . PRO C  1 368 ? 1.332   1.003   -35.789 1.00 40.87 ? 379 PRO C CG    1 
ATOM   8946  C  CD    . PRO C  1 368 ? 1.350   -0.339  -35.129 1.00 36.07 ? 379 PRO C CD    1 
ATOM   8947  N  N     . HIS C  1 369 ? 3.408   0.267   -32.459 1.00 38.49 ? 380 HIS C N     1 
ATOM   8948  C  CA    . HIS C  1 369 ? 3.725   0.423   -31.042 1.00 54.65 ? 380 HIS C CA    1 
ATOM   8949  C  C     . HIS C  1 369 ? 4.683   -0.681  -30.593 1.00 85.21 ? 380 HIS C C     1 
ATOM   8950  O  O     . HIS C  1 369 ? 5.066   -0.734  -29.426 1.00 55.60 ? 380 HIS C O     1 
ATOM   8951  C  CB    . HIS C  1 369 ? 2.436   0.405   -30.194 1.00 55.26 ? 380 HIS C CB    1 
ATOM   8952  C  CG    . HIS C  1 369 ? 1.363   1.316   -30.698 1.00 58.45 ? 380 HIS C CG    1 
ATOM   8953  N  ND1   . HIS C  1 369 ? 1.450   2.690   -30.546 1.00 60.20 ? 380 HIS C ND1   1 
ATOM   8954  C  CD2   . HIS C  1 369 ? 0.211   1.019   -31.341 1.00 59.97 ? 380 HIS C CD2   1 
ATOM   8955  C  CE1   . HIS C  1 369 ? 0.356   3.181   -31.103 1.00 59.51 ? 380 HIS C CE1   1 
ATOM   8956  N  NE2   . HIS C  1 369 ? -0.422  2.214   -31.589 1.00 59.81 ? 380 HIS C NE2   1 
HETATM 8957  ZN ZN    . ZN  D  2 .   ? 19.284  -18.126 -2.875  1.00 11.44 2 401 ZN  A ZN    1 
HETATM 8958  CA CA    . CA  E  3 .   ? 16.855  -22.128 -8.253  1.00 13.95 2 402 CA  A CA    1 
HETATM 8959  NA NA    . NA  F  4 .   ? 17.046  -37.113 -9.954  1.00 11.20 1 403 NA  A NA    1 
HETATM 8960  O  O1    . PG4 G  5 .   ? 19.901  -44.234 2.054   1.00 54.13 ? 404 PG4 A O1    1 
HETATM 8961  C  C1    . PG4 G  5 .   ? 20.612  -42.988 2.057   1.00 53.10 ? 404 PG4 A C1    1 
HETATM 8962  C  C2    . PG4 G  5 .   ? 19.632  -41.818 2.148   1.00 50.88 ? 404 PG4 A C2    1 
HETATM 8963  O  O2    . PG4 G  5 .   ? 19.828  -40.898 1.070   1.00 49.33 ? 404 PG4 A O2    1 
HETATM 8964  C  C3    . PG4 G  5 .   ? 18.733  -40.934 0.159   1.00 48.18 ? 404 PG4 A C3    1 
HETATM 8965  C  C4    . PG4 G  5 .   ? 18.983  -40.050 -1.062  1.00 48.17 ? 404 PG4 A C4    1 
HETATM 8966  O  O3    . PG4 G  5 .   ? 18.945  -40.732 -2.333  1.00 48.51 ? 404 PG4 A O3    1 
HETATM 8967  C  C5    . PG4 G  5 .   ? 18.158  -41.924 -2.445  1.00 49.76 ? 404 PG4 A C5    1 
HETATM 8968  C  C6    . PG4 G  5 .   ? 16.825  -41.678 -3.144  1.00 50.37 ? 404 PG4 A C6    1 
HETATM 8969  O  O4    . PG4 G  5 .   ? 16.140  -42.927 -3.301  1.00 51.86 ? 404 PG4 A O4    1 
HETATM 8970  C  C7    . PG4 G  5 .   ? 14.880  -42.971 -2.627  1.00 53.63 ? 404 PG4 A C7    1 
HETATM 8971  C  C8    . PG4 G  5 .   ? 14.987  -43.717 -1.298  1.00 55.41 ? 404 PG4 A C8    1 
HETATM 8972  O  O5    . PG4 G  5 .   ? 13.680  -44.066 -0.818  1.00 56.25 ? 404 PG4 A O5    1 
HETATM 8973  O  O1    . PG4 H  5 .   ? 15.593  3.016   1.194   1.00 47.38 ? 405 PG4 A O1    1 
HETATM 8974  C  C1    . PG4 H  5 .   ? 14.461  3.148   0.323   1.00 46.06 ? 405 PG4 A C1    1 
HETATM 8975  C  C2    . PG4 H  5 .   ? 13.458  2.031   0.601   1.00 46.09 ? 405 PG4 A C2    1 
HETATM 8976  O  O2    . PG4 H  5 .   ? 13.106  2.068   1.986   1.00 45.02 ? 405 PG4 A O2    1 
HETATM 8977  C  C3    . PG4 H  5 .   ? 12.751  0.796   2.513   1.00 42.20 ? 405 PG4 A C3    1 
HETATM 8978  C  C4    . PG4 H  5 .   ? 12.067  1.002   3.857   1.00 40.52 ? 405 PG4 A C4    1 
HETATM 8979  O  O3    . PG4 H  5 .   ? 13.044  1.110   4.888   1.00 41.52 ? 405 PG4 A O3    1 
HETATM 8980  C  C5    . PG4 H  5 .   ? 12.592  1.918   5.978   1.00 43.85 ? 405 PG4 A C5    1 
HETATM 8981  C  C6    . PG4 H  5 .   ? 12.567  1.160   7.305   1.00 45.75 ? 405 PG4 A C6    1 
HETATM 8982  O  O4    . PG4 H  5 .   ? 13.490  0.070   7.354   1.00 47.67 ? 405 PG4 A O4    1 
HETATM 8983  C  C7    . PG4 H  5 .   ? 13.265  -0.734  8.517   1.00 48.39 ? 405 PG4 A C7    1 
HETATM 8984  C  C8    . PG4 H  5 .   ? 14.539  -1.452  8.949   1.00 48.70 ? 405 PG4 A C8    1 
HETATM 8985  O  O5    . PG4 H  5 .   ? 14.841  -2.517  8.033   1.00 48.69 ? 405 PG4 A O5    1 
HETATM 8986  O  O1    . PG4 I  5 .   ? 12.446  -15.401 23.385  1.00 44.14 ? 406 PG4 A O1    1 
HETATM 8987  C  C1    . PG4 I  5 .   ? 11.511  -16.333 22.822  1.00 42.92 ? 406 PG4 A C1    1 
HETATM 8988  C  C2    . PG4 I  5 .   ? 12.191  -17.688 22.710  1.00 40.79 ? 406 PG4 A C2    1 
HETATM 8989  O  O2    . PG4 I  5 .   ? 13.055  -17.705 21.570  1.00 36.96 ? 406 PG4 A O2    1 
HETATM 8990  C  C3    . PG4 I  5 .   ? 13.872  -18.874 21.556  1.00 34.14 ? 406 PG4 A C3    1 
HETATM 8991  C  C4    . PG4 I  5 .   ? 14.863  -18.805 20.401  1.00 32.55 ? 406 PG4 A C4    1 
HETATM 8992  O  O3    . PG4 I  5 .   ? 15.698  -17.655 20.508  1.00 31.58 ? 406 PG4 A O3    1 
HETATM 8993  C  C5    . PG4 I  5 .   ? 17.052  -17.882 20.094  1.00 33.13 ? 406 PG4 A C5    1 
HETATM 8994  C  C6    . PG4 I  5 .   ? 18.026  -17.075 20.958  1.00 36.27 ? 406 PG4 A C6    1 
HETATM 8995  O  O4    . PG4 I  5 .   ? 18.829  -17.946 21.756  1.00 43.99 ? 406 PG4 A O4    1 
HETATM 8996  C  C7    . PG4 I  5 .   ? 19.236  -17.350 22.994  1.00 49.22 ? 406 PG4 A C7    1 
HETATM 8997  C  C8    . PG4 I  5 .   ? 20.376  -18.122 23.661  1.00 53.29 ? 406 PG4 A C8    1 
HETATM 8998  O  O5    . PG4 I  5 .   ? 20.063  -19.517 23.831  1.00 56.32 ? 406 PG4 A O5    1 
HETATM 8999  O  O1    . SHH J  6 .   ? 19.636  -19.886 -2.094  1.00 9.90  ? 407 SHH A O1    1 
HETATM 9000  O  O2    . SHH J  6 .   ? 20.493  -17.663 -0.936  1.00 11.81 ? 407 SHH A O2    1 
HETATM 9001  N  N1    . SHH J  6 .   ? 20.883  -19.782 -1.456  1.00 12.88 ? 407 SHH A N1    1 
HETATM 9002  C  C1    . SHH J  6 .   ? 21.257  -18.620 -0.886  1.00 11.91 ? 407 SHH A C1    1 
HETATM 9003  C  C2    . SHH J  6 .   ? 22.597  -18.546 -0.195  1.00 8.48  ? 407 SHH A C2    1 
HETATM 9004  C  C3    . SHH J  6 .   ? 23.558  -17.483 -0.789  1.00 11.04 ? 407 SHH A C3    1 
HETATM 9005  C  C4    . SHH J  6 .   ? 24.933  -17.701 -0.133  1.00 14.84 ? 407 SHH A C4    1 
HETATM 9006  C  C5    . SHH J  6 .   ? 25.972  -16.715 -0.701  1.00 18.97 ? 407 SHH A C5    1 
HETATM 9007  C  C6    . SHH J  6 .   ? 27.325  -17.005 -0.024  1.00 21.78 ? 407 SHH A C6    1 
HETATM 9008  C  C7    . SHH J  6 .   ? 28.304  -15.828 -0.183  1.00 22.61 ? 407 SHH A C7    1 
HETATM 9009  C  C8    . SHH J  6 .   ? 28.010  -14.702 0.779   1.00 25.92 ? 407 SHH A C8    1 
HETATM 9010  O  O3    . SHH J  6 .   ? 27.461  -13.712 0.333   1.00 27.41 ? 407 SHH A O3    1 
HETATM 9011  N  N2    . SHH J  6 .   ? 28.377  -14.832 2.094   1.00 27.90 ? 407 SHH A N2    1 
HETATM 9012  C  C9    . SHH J  6 .   ? 28.270  -13.899 3.158   1.00 28.65 ? 407 SHH A C9    1 
HETATM 9013  C  C10   . SHH J  6 .   ? 28.005  -12.534 2.969   1.00 29.96 ? 407 SHH A C10   1 
HETATM 9014  C  C11   . SHH J  6 .   ? 28.001  -11.658 4.055   1.00 30.92 ? 407 SHH A C11   1 
HETATM 9015  C  C12   . SHH J  6 .   ? 28.266  -12.130 5.340   1.00 28.90 ? 407 SHH A C12   1 
HETATM 9016  C  C13   . SHH J  6 .   ? 28.553  -13.478 5.537   1.00 28.01 ? 407 SHH A C13   1 
HETATM 9017  C  C14   . SHH J  6 .   ? 28.581  -14.346 4.451   1.00 27.71 ? 407 SHH A C14   1 
HETATM 9018  ZN ZN    . ZN  K  2 .   ? 42.270  -3.904  -38.329 1.00 10.01 2 401 ZN  B ZN    1 
HETATM 9019  CA CA    . CA  L  3 .   ? 46.063  -6.645  -43.717 1.00 13.54 2 402 CA  B CA    1 
HETATM 9020  NA NA    . NA  M  4 .   ? 60.990  -6.681  -46.072 1.00 10.84 1 403 NA  B NA    1 
HETATM 9021  C  "C3'" . NHE N  7 .   ? 49.115  -10.636 -12.463 1.00 30.52 ? 404 NHE B "C3'" 1 
HETATM 9022  C  "C2'" . NHE N  7 .   ? 48.054  -11.645 -12.792 1.00 28.22 ? 404 NHE B "C2'" 1 
HETATM 9023  C  "C1'" . NHE N  7 .   ? 48.150  -12.184 -14.200 1.00 27.62 ? 404 NHE B "C1'" 1 
HETATM 9024  C  "C6'" . NHE N  7 .   ? 48.398  -11.133 -15.250 1.00 27.80 ? 404 NHE B "C6'" 1 
HETATM 9025  N  N     . NHE N  7 .   ? 46.955  -12.862 -14.544 1.00 24.37 ? 404 NHE B N     1 
HETATM 9026  C  C1    . NHE N  7 .   ? 46.661  -14.209 -14.050 1.00 24.69 ? 404 NHE B C1    1 
HETATM 9027  C  C2    . NHE N  7 .   ? 45.231  -14.627 -14.194 1.00 27.71 ? 404 NHE B C2    1 
HETATM 9028  S  S     . NHE N  7 .   ? 44.657  -16.010 -13.270 1.00 31.28 ? 404 NHE B S     1 
HETATM 9029  O  O1    . NHE N  7 .   ? 45.566  -17.146 -13.600 1.00 32.97 ? 404 NHE B O1    1 
HETATM 9030  O  O2    . NHE N  7 .   ? 43.295  -16.320 -13.621 1.00 31.92 ? 404 NHE B O2    1 
HETATM 9031  O  O3    . NHE N  7 .   ? 44.546  -15.705 -11.827 1.00 27.55 ? 404 NHE B O3    1 
HETATM 9032  C  "C5'" . NHE N  7 .   ? 49.407  -10.092 -14.877 1.00 31.02 ? 404 NHE B "C5'" 1 
HETATM 9033  C  "C4'" . NHE N  7 .   ? 49.215  -9.548  -13.494 1.00 31.28 ? 404 NHE B "C4'" 1 
HETATM 9034  O  O1    . PG4 O  5 .   ? 27.302  -5.656  -27.892 1.00 53.93 ? 405 PG4 B O1    1 
HETATM 9035  C  C1    . PG4 O  5 .   ? 28.408  -6.425  -27.398 1.00 53.01 ? 405 PG4 B C1    1 
HETATM 9036  C  C2    . PG4 O  5 .   ? 27.983  -7.762  -26.790 1.00 52.79 ? 405 PG4 B C2    1 
HETATM 9037  O  O2    . PG4 O  5 .   ? 26.589  -7.821  -26.475 1.00 51.92 ? 405 PG4 B O2    1 
HETATM 9038  C  C3    . PG4 O  5 .   ? 26.310  -8.791  -25.461 1.00 49.89 ? 405 PG4 B C3    1 
HETATM 9039  C  C4    . PG4 O  5 .   ? 24.835  -9.177  -25.479 1.00 47.98 ? 405 PG4 B C4    1 
HETATM 9040  O  O3    . PG4 O  5 .   ? 24.485  -9.647  -26.780 1.00 46.42 ? 405 PG4 B O3    1 
HETATM 9041  C  C5    . PG4 O  5 .   ? 23.076  -9.607  -26.996 1.00 44.36 ? 405 PG4 B C5    1 
HETATM 9042  C  C6    . PG4 O  5 .   ? 22.721  -10.429 -28.229 1.00 40.98 ? 405 PG4 B C6    1 
HETATM 9043  O  O4    . PG4 O  5 .   ? 23.099  -9.724  -29.403 1.00 37.88 ? 405 PG4 B O4    1 
HETATM 9044  C  C7    . PG4 O  5 .   ? 23.370  -10.616 -30.472 1.00 36.71 ? 405 PG4 B C7    1 
HETATM 9045  C  C8    . PG4 O  5 .   ? 23.703  -9.813  -31.718 1.00 38.41 ? 405 PG4 B C8    1 
HETATM 9046  O  O5    . PG4 O  5 .   ? 22.549  -9.650  -32.545 1.00 40.27 ? 405 PG4 B O5    1 
HETATM 9047  O  O1    . PG4 P  5 .   ? 28.775  -23.140 -46.356 1.00 44.26 ? 406 PG4 B O1    1 
HETATM 9048  C  C1    . PG4 P  5 .   ? 28.181  -22.376 -45.293 1.00 42.72 ? 406 PG4 B C1    1 
HETATM 9049  C  C2    . PG4 P  5 .   ? 27.327  -23.255 -44.386 1.00 40.51 ? 406 PG4 B C2    1 
HETATM 9050  O  O2    . PG4 P  5 .   ? 27.986  -23.377 -43.125 1.00 39.31 ? 406 PG4 B O2    1 
HETATM 9051  C  C3    . PG4 P  5 .   ? 27.369  -24.316 -42.257 1.00 35.73 ? 406 PG4 B C3    1 
HETATM 9052  C  C4    . PG4 P  5 .   ? 28.365  -24.813 -41.222 1.00 34.80 ? 406 PG4 B C4    1 
HETATM 9053  O  O3    . PG4 P  5 .   ? 29.331  -25.658 -41.839 1.00 36.78 ? 406 PG4 B O3    1 
HETATM 9054  C  C5    . PG4 P  5 .   ? 30.279  -26.200 -40.918 1.00 37.68 ? 406 PG4 B C5    1 
HETATM 9055  C  C6    . PG4 P  5 .   ? 31.199  -27.201 -41.617 1.00 38.20 ? 406 PG4 B C6    1 
HETATM 9056  O  O4    . PG4 P  5 .   ? 32.054  -26.533 -42.541 1.00 39.55 ? 406 PG4 B O4    1 
HETATM 9057  C  C7    . PG4 P  5 .   ? 32.750  -27.439 -43.395 1.00 40.88 ? 406 PG4 B C7    1 
HETATM 9058  C  C8    . PG4 P  5 .   ? 33.315  -26.708 -44.611 1.00 42.42 ? 406 PG4 B C8    1 
HETATM 9059  O  O5    . PG4 P  5 .   ? 32.266  -26.300 -45.504 1.00 42.86 ? 406 PG4 B O5    1 
HETATM 9060  O  O1    . PG4 Q  5 .   ? 43.114  -1.022  -11.945 1.00 46.50 ? 407 PG4 B O1    1 
HETATM 9061  C  C1    . PG4 Q  5 .   ? 42.224  -1.968  -12.540 1.00 44.02 ? 407 PG4 B C1    1 
HETATM 9062  C  C2    . PG4 Q  5 .   ? 43.039  -2.788  -13.526 1.00 40.43 ? 407 PG4 B C2    1 
HETATM 9063  O  O2    . PG4 Q  5 .   ? 42.153  -3.448  -14.419 1.00 36.12 ? 407 PG4 B O2    1 
HETATM 9064  C  C3    . PG4 Q  5 .   ? 42.857  -4.354  -15.264 1.00 32.56 ? 407 PG4 B C3    1 
HETATM 9065  C  C4    . PG4 Q  5 .   ? 42.549  -5.774  -14.831 1.00 30.80 ? 407 PG4 B C4    1 
HETATM 9066  O  O3    . PG4 Q  5 .   ? 43.787  -6.430  -14.683 1.00 32.71 ? 407 PG4 B O3    1 
HETATM 9067  C  C5    . PG4 Q  5 .   ? 43.702  -7.601  -13.888 1.00 35.09 ? 407 PG4 B C5    1 
HETATM 9068  C  C6    . PG4 Q  5 .   ? 45.086  -7.841  -13.297 1.00 34.64 ? 407 PG4 B C6    1 
HETATM 9069  O  O4    . PG4 Q  5 .   ? 45.136  -7.208  -12.023 1.00 36.62 ? 407 PG4 B O4    1 
HETATM 9070  C  C7    . PG4 Q  5 .   ? 46.286  -7.579  -11.257 1.00 39.61 ? 407 PG4 B C7    1 
HETATM 9071  C  C8    . PG4 Q  5 .   ? 46.204  -6.963  -9.861  1.00 43.08 ? 407 PG4 B C8    1 
HETATM 9072  O  O5    . PG4 Q  5 .   ? 45.798  -5.585  -9.930  1.00 45.88 ? 407 PG4 B O5    1 
HETATM 9073  O  O1    . SHH R  6 .   ? 44.054  -3.454  -37.588 1.00 13.38 ? 408 SHH B O1    1 
HETATM 9074  O  O2    . SHH R  6 .   ? 41.817  -2.510  -36.402 1.00 9.76  ? 408 SHH B O2    1 
HETATM 9075  N  N1    . SHH R  6 .   ? 43.949  -2.168  -37.026 1.00 10.28 ? 408 SHH B N1    1 
HETATM 9076  C  C1    . SHH R  6 .   ? 42.805  -1.768  -36.442 1.00 11.84 ? 408 SHH B C1    1 
HETATM 9077  C  C2    . SHH R  6 .   ? 42.780  -0.376  -35.864 1.00 11.63 ? 408 SHH B C2    1 
HETATM 9078  C  C3    . SHH R  6 .   ? 41.835  0.549   -36.651 1.00 14.61 ? 408 SHH B C3    1 
HETATM 9079  C  C4    . SHH R  6 .   ? 42.030  1.968   -36.082 1.00 16.84 ? 408 SHH B C4    1 
HETATM 9080  C  C5    . SHH R  6 .   ? 40.857  2.888   -36.448 1.00 19.44 ? 408 SHH B C5    1 
HETATM 9081  C  C6    . SHH R  6 .   ? 41.162  4.315   -35.946 1.00 20.23 ? 408 SHH B C6    1 
HETATM 9082  C  C7    . SHH R  6 .   ? 39.937  5.207   -36.146 1.00 21.96 ? 408 SHH B C7    1 
HETATM 9083  C  C8    . SHH R  6 .   ? 38.914  4.977   -35.047 1.00 26.76 ? 408 SHH B C8    1 
HETATM 9084  O  O3    . SHH R  6 .   ? 37.898  4.374   -35.328 1.00 30.52 ? 408 SHH B O3    1 
HETATM 9085  N  N2    . SHH R  6 .   ? 39.148  5.465   -33.796 1.00 28.07 ? 408 SHH B N2    1 
HETATM 9086  C  C9    . SHH R  6 .   ? 38.325  5.394   -32.641 1.00 28.90 ? 408 SHH B C9    1 
HETATM 9087  C  C10   . SHH R  6 .   ? 38.885  5.755   -31.408 1.00 31.56 ? 408 SHH B C10   1 
HETATM 9088  C  C11   . SHH R  6 .   ? 38.115  5.758   -30.239 1.00 31.39 ? 408 SHH B C11   1 
HETATM 9089  C  C12   . SHH R  6 .   ? 36.757  5.448   -30.303 1.00 29.33 ? 408 SHH B C12   1 
HETATM 9090  C  C13   . SHH R  6 .   ? 36.177  5.130   -31.533 1.00 27.78 ? 408 SHH B C13   1 
HETATM 9091  C  C14   . SHH R  6 .   ? 36.961  5.072   -32.683 1.00 27.43 ? 408 SHH B C14   1 
HETATM 9092  ZN ZN    . ZN  S  2 .   ? -0.915  -30.425 -43.414 1.00 13.88 2 401 ZN  C ZN    1 
HETATM 9093  CA CA    . CA  T  3 .   ? -1.695  -23.508 -41.835 1.00 17.75 2 402 CA  C CA    1 
HETATM 9094  NA NA    . NA  U  4 .   ? 8.078   -13.669 -35.931 1.00 12.87 1 403 NA  C NA    1 
HETATM 9095  O  O1    . PG4 V  5 .   ? 18.875  -8.374  -38.222 1.00 49.55 ? 404 PG4 C O1    1 
HETATM 9096  C  C1    . PG4 V  5 .   ? 19.074  -9.412  -37.243 1.00 50.43 ? 404 PG4 C C1    1 
HETATM 9097  C  C2    . PG4 V  5 .   ? 20.085  -10.437 -37.777 1.00 49.22 ? 404 PG4 C C2    1 
HETATM 9098  O  O2    . PG4 V  5 .   ? 19.529  -11.755 -37.907 1.00 47.37 ? 404 PG4 C O2    1 
HETATM 9099  C  C3    . PG4 V  5 .   ? 18.604  -11.881 -38.994 1.00 42.53 ? 404 PG4 C C3    1 
HETATM 9100  C  C4    . PG4 V  5 .   ? 17.899  -13.227 -39.046 1.00 38.34 ? 404 PG4 C C4    1 
HETATM 9101  O  O3    . PG4 V  5 .   ? 17.469  -13.629 -37.750 1.00 34.63 ? 404 PG4 C O3    1 
HETATM 9102  C  C5    . PG4 V  5 .   ? 16.061  -13.859 -37.694 1.00 30.96 ? 404 PG4 C C5    1 
HETATM 9103  C  C6    . PG4 V  5 .   ? 15.800  -15.008 -36.740 1.00 28.67 ? 404 PG4 C C6    1 
HETATM 9104  O  O4    . PG4 V  5 .   ? 16.592  -16.140 -37.088 1.00 28.22 ? 404 PG4 C O4    1 
HETATM 9105  C  C7    . PG4 V  5 .   ? 16.386  -17.183 -36.133 1.00 28.07 ? 404 PG4 C C7    1 
HETATM 9106  C  C8    . PG4 V  5 .   ? 17.011  -18.485 -36.616 1.00 27.17 ? 404 PG4 C C8    1 
HETATM 9107  O  O5    . PG4 V  5 .   ? 18.397  -18.256 -36.904 1.00 26.01 ? 404 PG4 C O5    1 
HETATM 9108  O  O1    . PG4 W  5 .   ? 23.131  -3.528  -52.089 1.00 43.41 ? 405 PG4 C O1    1 
HETATM 9109  C  C1    . PG4 W  5 .   ? 23.014  -2.295  -51.378 1.00 42.82 ? 405 PG4 C C1    1 
HETATM 9110  C  C2    . PG4 W  5 .   ? 23.075  -2.566  -49.884 1.00 42.61 ? 405 PG4 C C2    1 
HETATM 9111  O  O2    . PG4 W  5 .   ? 21.776  -2.961  -49.445 1.00 44.02 ? 405 PG4 C O2    1 
HETATM 9112  C  C3    . PG4 W  5 .   ? 21.348  -2.241  -48.287 1.00 42.84 ? 405 PG4 C C3    1 
HETATM 9113  C  C4    . PG4 W  5 .   ? 19.851  -2.470  -48.067 1.00 42.11 ? 405 PG4 C C4    1 
HETATM 9114  O  O3    . PG4 W  5 .   ? 19.623  -3.840  -47.719 1.00 41.70 ? 405 PG4 C O3    1 
HETATM 9115  C  C5    . PG4 W  5 .   ? 18.248  -4.127  -47.463 1.00 37.76 ? 405 PG4 C C5    1 
HETATM 9116  C  C6    . PG4 W  5 .   ? 18.123  -5.572  -47.002 1.00 33.05 ? 405 PG4 C C6    1 
HETATM 9117  O  O4    . PG4 W  5 .   ? 18.760  -5.724  -45.744 1.00 32.75 ? 405 PG4 C O4    1 
HETATM 9118  C  C7    . PG4 W  5 .   ? 18.600  -7.035  -45.209 1.00 33.17 ? 405 PG4 C C7    1 
HETATM 9119  C  C8    . PG4 W  5 .   ? 19.545  -7.224  -44.032 1.00 34.56 ? 405 PG4 C C8    1 
HETATM 9120  O  O5    . PG4 W  5 .   ? 19.080  -6.470  -42.903 1.00 37.94 ? 405 PG4 C O5    1 
HETATM 9121  O  O1    . SHH X  6 .   ? 0.997   -30.138 -42.734 1.00 14.01 ? 406 SHH C O1    1 
HETATM 9122  O  O2    . SHH X  6 .   ? 0.088   -32.584 -43.346 1.00 13.31 ? 406 SHH C O2    1 
HETATM 9123  N  N1    . SHH X  6 .   ? 1.275   -31.283 -41.973 1.00 15.81 ? 406 SHH C N1    1 
HETATM 9124  C  C1    . SHH X  6 .   ? 0.778   -32.484 -42.337 1.00 18.81 ? 406 SHH C C1    1 
HETATM 9125  C  C2    . SHH X  6 .   ? 1.174   -33.684 -41.510 1.00 17.24 ? 406 SHH C C2    1 
HETATM 9126  C  C3    . SHH X  6 .   ? 0.041   -34.243 -40.648 1.00 16.59 ? 406 SHH C C3    1 
HETATM 9127  C  C4    . SHH X  6 .   ? 0.641   -35.230 -39.637 1.00 18.26 ? 406 SHH C C4    1 
HETATM 9128  C  C5    . SHH X  6 .   ? -0.451  -36.102 -38.986 1.00 21.48 ? 406 SHH C C5    1 
HETATM 9129  C  C6    . SHH X  6 .   ? 0.210   -37.189 -38.131 1.00 24.66 ? 406 SHH C C6    1 
HETATM 9130  C  C7    . SHH X  6 .   ? -0.827  -38.215 -37.654 1.00 28.41 ? 406 SHH C C7    1 
HETATM 9131  C  C8    . SHH X  6 .   ? -0.997  -39.309 -38.686 1.00 32.61 ? 406 SHH C C8    1 
HETATM 9132  O  O3    . SHH X  6 .   ? -1.965  -39.242 -39.418 1.00 33.96 ? 406 SHH C O3    1 
HETATM 9133  N  N2    . SHH X  6 .   ? -0.071  -40.313 -38.769 1.00 35.19 ? 406 SHH C N2    1 
HETATM 9134  C  C9    . SHH X  6 .   ? -0.059  -41.432 -39.641 1.00 38.23 ? 406 SHH C C9    1 
HETATM 9135  C  C10   . SHH X  6 .   ? 1.133   -42.164 -39.767 1.00 37.97 ? 406 SHH C C10   1 
HETATM 9136  C  C11   . SHH X  6 .   ? 1.190   -43.300 -40.577 1.00 39.29 ? 406 SHH C C11   1 
HETATM 9137  C  C12   . SHH X  6 .   ? 0.046   -43.736 -41.250 1.00 41.31 ? 406 SHH C C12   1 
HETATM 9138  C  C13   . SHH X  6 .   ? -1.156  -43.033 -41.117 1.00 42.26 ? 406 SHH C C13   1 
HETATM 9139  C  C14   . SHH X  6 .   ? -1.211  -41.897 -40.311 1.00 41.10 ? 406 SHH C C14   1 
HETATM 9140  O  O     . HOH Y  8 .   ? 8.885   -24.259 10.523  1.00 12.27 ? 501 HOH A O     1 
HETATM 9141  O  O     . HOH Y  8 .   ? 8.765   -21.638 11.592  1.00 10.69 ? 502 HOH A O     1 
HETATM 9142  O  O     . HOH Y  8 .   ? 15.634  -17.584 7.607   1.00 11.59 ? 503 HOH A O     1 
HETATM 9143  O  O     . HOH Y  8 .   ? 15.001  -18.490 -10.238 1.00 11.23 ? 504 HOH A O     1 
HETATM 9144  O  O     . HOH Y  8 .   ? 17.704  -28.596 -8.052  1.00 10.94 ? 505 HOH A O     1 
HETATM 9145  O  O     . HOH Y  8 .   ? 19.553  -25.515 8.485   1.00 12.32 ? 506 HOH A O     1 
HETATM 9146  O  O     . HOH Y  8 .   ? 18.283  -29.824 -10.665 1.00 12.42 ? 507 HOH A O     1 
HETATM 9147  O  O     . HOH Y  8 .   ? 23.406  -20.343 -8.855  1.00 12.44 ? 508 HOH A O     1 
HETATM 9148  O  O     . HOH Y  8 .   ? 17.295  -10.783 -7.493  1.00 12.34 ? 509 HOH A O     1 
HETATM 9149  O  O     . HOH Y  8 .   ? 16.307  -5.799  4.169   1.00 17.06 ? 510 HOH A O     1 
HETATM 9150  O  O     . HOH Y  8 .   ? 19.597  -9.003  4.693   1.00 14.76 ? 511 HOH A O     1 
HETATM 9151  O  O     . HOH Y  8 .   ? 13.991  -4.657  3.909   1.00 18.23 ? 512 HOH A O     1 
HETATM 9152  O  O     . HOH Y  8 .   ? 15.413  -6.333  -16.297 1.00 15.86 ? 513 HOH A O     1 
HETATM 9153  O  O     . HOH Y  8 .   ? 4.466   -7.492  -7.441  1.00 14.08 ? 514 HOH A O     1 
HETATM 9154  O  O     . HOH Y  8 .   ? 14.198  -10.221 -1.918  1.00 11.68 ? 515 HOH A O     1 
HETATM 9155  O  O     . HOH Y  8 .   ? 13.453  -20.236 4.622   1.00 10.66 ? 516 HOH A O     1 
HETATM 9156  O  O     . HOH Y  8 .   ? 9.843   -7.896  -13.933 1.00 11.58 ? 517 HOH A O     1 
HETATM 9157  O  O     . HOH Y  8 .   ? 14.021  -7.784  -3.113  1.00 11.93 ? 518 HOH A O     1 
HETATM 9158  O  O     . HOH Y  8 .   ? 17.005  -26.601 7.957   1.00 10.53 ? 519 HOH A O     1 
HETATM 9159  O  O     . HOH Y  8 .   ? 5.024   -21.343 6.752   1.00 13.00 ? 520 HOH A O     1 
HETATM 9160  O  O     . HOH Y  8 .   ? 17.324  -12.543 5.008   1.00 13.27 ? 521 HOH A O     1 
HETATM 9161  O  O     . HOH Y  8 .   ? 18.896  -37.106 -11.697 1.00 14.45 ? 522 HOH A O     1 
HETATM 9162  O  O     . HOH Y  8 .   ? 25.012  -29.025 -11.156 1.00 15.52 ? 523 HOH A O     1 
HETATM 9163  O  O     . HOH Y  8 .   ? 22.158  -11.017 10.672  1.00 15.83 ? 524 HOH A O     1 
HETATM 9164  O  O     . HOH Y  8 .   ? 20.296  -12.969 11.239  1.00 13.28 ? 525 HOH A O     1 
HETATM 9165  O  O     . HOH Y  8 .   ? 14.840  -20.294 6.969   1.00 10.82 ? 526 HOH A O     1 
HETATM 9166  O  O     . HOH Y  8 .   ? 9.388   -36.213 15.829  1.00 16.60 ? 527 HOH A O     1 
HETATM 9167  O  O     . HOH Y  8 .   ? 18.448  -34.764 -9.060  1.00 20.57 ? 528 HOH A O     1 
HETATM 9168  O  O     . HOH Y  8 .   ? 2.323   -33.835 10.078  1.00 13.46 ? 529 HOH A O     1 
HETATM 9169  O  O     . HOH Y  8 .   ? 17.614  -33.439 -18.065 1.00 18.45 ? 530 HOH A O     1 
HETATM 9170  O  O     . HOH Y  8 .   ? 16.352  -13.035 13.413  1.00 25.19 ? 531 HOH A O     1 
HETATM 9171  O  O     . HOH Y  8 .   ? 20.550  -16.809 17.658  1.00 16.13 ? 532 HOH A O     1 
HETATM 9172  O  O     . HOH Y  8 .   ? 1.175   -31.558 10.833  1.00 17.50 ? 533 HOH A O     1 
HETATM 9173  O  O     . HOH Y  8 .   ? 21.819  -30.494 -21.529 1.00 16.84 ? 534 HOH A O     1 
HETATM 9174  O  O     . HOH Y  8 .   ? 25.663  -21.711 -9.931  1.00 13.85 ? 535 HOH A O     1 
HETATM 9175  O  O     . HOH Y  8 .   ? 28.508  -34.018 2.140   1.00 15.91 ? 536 HOH A O     1 
HETATM 9176  O  O     . HOH Y  8 .   ? 6.310   -1.907  -3.033  1.00 17.57 ? 537 HOH A O     1 
HETATM 9177  O  O     . HOH Y  8 .   ? 7.641   -20.826 8.893   1.00 15.35 ? 538 HOH A O     1 
HETATM 9178  O  O     . HOH Y  8 .   ? 17.935  -31.007 -19.034 1.00 15.19 ? 539 HOH A O     1 
HETATM 9179  O  O     . HOH Y  8 .   ? 8.835   -2.945  14.004  1.00 17.39 ? 540 HOH A O     1 
HETATM 9180  O  O     . HOH Y  8 .   ? -5.114  -2.000  8.127   1.00 23.18 ? 541 HOH A O     1 
HETATM 9181  O  O     . HOH Y  8 .   ? 6.069   -18.117 -14.068 1.00 19.68 ? 542 HOH A O     1 
HETATM 9182  O  O     . HOH Y  8 .   ? 20.584  -40.203 -6.021  1.00 21.46 ? 543 HOH A O     1 
HETATM 9183  O  O     . HOH Y  8 .   ? 16.294  -18.938 -29.873 1.00 17.53 ? 544 HOH A O     1 
HETATM 9184  O  O     . HOH Y  8 .   ? 30.840  -18.923 13.446  1.00 25.08 ? 545 HOH A O     1 
HETATM 9185  O  O     . HOH Y  8 .   ? 12.115  -0.660  12.806  1.00 28.43 ? 546 HOH A O     1 
HETATM 9186  O  O     . HOH Y  8 .   ? -5.616  -1.760  -2.364  1.00 27.36 ? 547 HOH A O     1 
HETATM 9187  O  O     . HOH Y  8 .   ? 22.770  -25.028 18.777  1.00 20.42 ? 548 HOH A O     1 
HETATM 9188  O  O     . HOH Y  8 .   ? 30.639  -21.591 6.538   1.00 21.97 ? 549 HOH A O     1 
HETATM 9189  O  O     . HOH Y  8 .   ? -5.556  -3.362  3.356   1.00 23.32 ? 550 HOH A O     1 
HETATM 9190  O  O     . HOH Y  8 .   ? 9.084   -15.487 15.177  1.00 19.94 ? 551 HOH A O     1 
HETATM 9191  O  O     . HOH Y  8 .   ? -8.237  -22.378 0.065   1.00 19.26 ? 552 HOH A O     1 
HETATM 9192  O  O     . HOH Y  8 .   ? 27.508  -20.146 -11.387 1.00 14.54 ? 553 HOH A O     1 
HETATM 9193  O  O     . HOH Y  8 .   ? 17.651  -6.548  -8.623  1.00 23.13 ? 554 HOH A O     1 
HETATM 9194  O  O     . HOH Y  8 .   ? 4.188   -20.306 17.780  1.00 23.11 ? 555 HOH A O     1 
HETATM 9195  O  O     . HOH Y  8 .   ? 6.765   -15.593 -14.019 1.00 16.59 ? 556 HOH A O     1 
HETATM 9196  O  O     . HOH Y  8 .   ? 28.922  -21.712 1.903   1.00 17.49 ? 557 HOH A O     1 
HETATM 9197  O  O     . HOH Y  8 .   ? -6.674  -6.624  6.954   1.00 21.67 ? 558 HOH A O     1 
HETATM 9198  O  O     . HOH Y  8 .   ? -0.093  -35.253 10.008  1.00 19.13 ? 559 HOH A O     1 
HETATM 9199  O  O     . HOH Y  8 .   ? 4.006   -5.671  -9.415  1.00 26.79 ? 560 HOH A O     1 
HETATM 9200  O  O     . HOH Y  8 .   ? 24.737  -14.648 -4.265  1.00 21.30 ? 561 HOH A O     1 
HETATM 9201  O  O     . HOH Y  8 .   ? 5.576   -13.771 -15.450 1.00 25.57 ? 562 HOH A O     1 
HETATM 9202  O  O     . HOH Y  8 .   ? 17.264  -35.943 18.669  1.00 23.32 ? 563 HOH A O     1 
HETATM 9203  O  O     . HOH Y  8 .   ? 13.165  -37.454 8.464   1.00 18.52 ? 564 HOH A O     1 
HETATM 9204  O  O     . HOH Y  8 .   ? 29.052  -28.918 -24.551 1.00 21.06 ? 565 HOH A O     1 
HETATM 9205  O  O     . HOH Y  8 .   ? 10.057  -23.577 19.757  1.00 22.19 ? 566 HOH A O     1 
HETATM 9206  O  O     . HOH Y  8 .   ? 2.110   -21.508 15.215  1.00 17.76 ? 567 HOH A O     1 
HETATM 9207  O  O     . HOH Y  8 .   ? -6.241  -31.498 9.566   1.00 30.16 ? 568 HOH A O     1 
HETATM 9208  O  O     . HOH Y  8 .   ? 12.270  -39.114 16.193  1.00 22.70 ? 569 HOH A O     1 
HETATM 9209  O  O     . HOH Y  8 .   ? 29.274  -25.637 -13.325 1.00 20.13 ? 570 HOH A O     1 
HETATM 9210  O  O     . HOH Y  8 .   ? 17.779  -43.108 18.374  1.00 23.04 ? 571 HOH A O     1 
HETATM 9211  O  O     . HOH Y  8 .   ? 12.472  -40.749 5.804   1.00 22.62 ? 572 HOH A O     1 
HETATM 9212  O  O     . HOH Y  8 .   ? 4.796   -33.361 14.067  1.00 22.55 ? 573 HOH A O     1 
HETATM 9213  O  O     . HOH Y  8 .   ? 8.796   -0.620  0.044   1.00 18.30 ? 574 HOH A O     1 
HETATM 9214  O  O     . HOH Y  8 .   ? 28.815  -27.667 -1.094  1.00 28.40 ? 575 HOH A O     1 
HETATM 9215  O  O     . HOH Y  8 .   ? 27.447  -19.780 -18.297 1.00 22.13 ? 576 HOH A O     1 
HETATM 9216  O  O     . HOH Y  8 .   ? 5.381   -9.773  15.457  1.00 26.02 ? 577 HOH A O     1 
HETATM 9217  O  O     . HOH Y  8 .   ? 12.083  -42.591 1.830   1.00 27.08 ? 578 HOH A O     1 
HETATM 9218  O  O     . HOH Y  8 .   ? 19.733  -29.666 -17.463 1.00 23.61 ? 579 HOH A O     1 
HETATM 9219  O  O     . HOH Y  8 .   ? -7.261  -24.015 3.516   1.00 21.68 ? 580 HOH A O     1 
HETATM 9220  O  O     . HOH Y  8 .   ? 10.687  -2.673  -1.930  1.00 23.19 ? 581 HOH A O     1 
HETATM 9221  O  O     . HOH Y  8 .   ? 16.359  -42.505 4.403   1.00 27.01 ? 582 HOH A O     1 
HETATM 9222  O  O     . HOH Y  8 .   ? 24.315  -30.856 -7.403  1.00 27.54 ? 583 HOH A O     1 
HETATM 9223  O  O     . HOH Y  8 .   ? 23.395  -22.795 21.333  1.00 22.71 ? 584 HOH A O     1 
HETATM 9224  O  O     . HOH Y  8 .   ? -10.747 -13.923 -2.861  1.00 36.85 ? 585 HOH A O     1 
HETATM 9225  O  O     . HOH Y  8 .   ? -0.165  -29.092 -7.859  1.00 23.16 ? 586 HOH A O     1 
HETATM 9226  O  O     . HOH Y  8 .   ? 1.060   -36.075 -12.831 1.00 23.73 ? 587 HOH A O     1 
HETATM 9227  O  O     . HOH Y  8 .   ? 17.620  -42.451 -17.916 1.00 27.32 ? 588 HOH A O     1 
HETATM 9228  O  O     . HOH Y  8 .   ? 8.714   1.691   -3.010  1.00 24.88 ? 589 HOH A O     1 
HETATM 9229  O  O     . HOH Y  8 .   ? 13.484  -32.744 19.333  1.00 22.43 ? 590 HOH A O     1 
HETATM 9230  O  O     . HOH Y  8 .   ? -6.429  -5.927  4.215   1.00 22.47 ? 591 HOH A O     1 
HETATM 9231  O  O     . HOH Y  8 .   ? 5.889   -18.410 8.110   1.00 23.73 ? 592 HOH A O     1 
HETATM 9232  O  O     . HOH Y  8 .   ? 26.777  -34.688 -14.439 1.00 29.95 ? 593 HOH A O     1 
HETATM 9233  O  O     . HOH Y  8 .   ? 15.132  1.402   -11.429 1.00 29.42 ? 594 HOH A O     1 
HETATM 9234  O  O     . HOH Y  8 .   ? 0.692   -33.592 -13.598 1.00 26.24 ? 595 HOH A O     1 
HETATM 9235  O  O     . HOH Y  8 .   ? 24.877  -23.173 18.965  1.00 26.54 ? 596 HOH A O     1 
HETATM 9236  O  O     . HOH Y  8 .   ? -2.783  -8.378  -4.481  1.00 21.49 ? 597 HOH A O     1 
HETATM 9237  O  O     . HOH Y  8 .   ? 24.776  -11.824 -16.329 1.00 20.78 ? 598 HOH A O     1 
HETATM 9238  O  O     . HOH Y  8 .   ? 5.605   -27.183 18.402  1.00 16.79 ? 599 HOH A O     1 
HETATM 9239  O  O     . HOH Y  8 .   ? 22.384  -29.278 -23.812 1.00 21.01 ? 600 HOH A O     1 
HETATM 9240  O  O     . HOH Y  8 .   ? 25.688  -15.028 -15.651 1.00 30.62 ? 601 HOH A O     1 
HETATM 9241  O  O     . HOH Y  8 .   ? 0.067   -6.804  14.260  1.00 23.41 ? 602 HOH A O     1 
HETATM 9242  O  O     . HOH Y  8 .   ? 8.517   -7.990  -17.470 1.00 25.09 ? 603 HOH A O     1 
HETATM 9243  O  O     . HOH Y  8 .   ? -0.483  -37.913 -0.886  1.00 29.22 ? 604 HOH A O     1 
HETATM 9244  O  O     . HOH Y  8 .   ? 12.882  -22.742 19.940  1.00 35.65 ? 605 HOH A O     1 
HETATM 9245  O  O     . HOH Y  8 .   ? 26.440  -13.486 -2.389  1.00 28.77 ? 606 HOH A O     1 
HETATM 9246  O  O     . HOH Y  8 .   ? 27.287  -26.725 -5.757  1.00 31.33 ? 607 HOH A O     1 
HETATM 9247  O  O     . HOH Y  8 .   ? 5.320   -14.415 15.892  1.00 22.65 ? 608 HOH A O     1 
HETATM 9248  O  O     . HOH Y  8 .   ? 13.765  -42.540 3.931   1.00 25.81 ? 609 HOH A O     1 
HETATM 9249  O  O     . HOH Y  8 .   ? -1.004  -37.704 -5.961  1.00 31.75 ? 610 HOH A O     1 
HETATM 9250  O  O     . HOH Y  8 .   ? -5.796  -3.721  -4.298  1.00 28.68 ? 611 HOH A O     1 
HETATM 9251  O  O     . HOH Y  8 .   ? 24.634  -27.097 19.039  1.00 22.81 ? 612 HOH A O     1 
HETATM 9252  O  O     . HOH Y  8 .   ? 16.097  -9.768  -29.207 1.00 26.21 ? 613 HOH A O     1 
HETATM 9253  O  O     . HOH Y  8 .   ? 27.517  -15.423 -5.719  1.00 22.31 ? 614 HOH A O     1 
HETATM 9254  O  O     . HOH Y  8 .   ? 12.606  -38.022 5.898   1.00 21.49 ? 615 HOH A O     1 
HETATM 9255  O  O     . HOH Y  8 .   ? 9.450   -1.805  -5.828  1.00 28.84 ? 616 HOH A O     1 
HETATM 9256  O  O     . HOH Y  8 .   ? -6.877  -22.797 -2.625  1.00 24.10 ? 617 HOH A O     1 
HETATM 9257  O  O     . HOH Y  8 .   ? 12.616  -2.281  5.207   1.00 28.74 ? 618 HOH A O     1 
HETATM 9258  O  O     . HOH Y  8 .   ? 15.285  -34.418 -19.101 1.00 30.02 ? 619 HOH A O     1 
HETATM 9259  O  O     . HOH Y  8 .   ? 26.377  -41.870 9.286   1.00 27.48 ? 620 HOH A O     1 
HETATM 9260  O  O     . HOH Y  8 .   ? 27.108  -13.446 -17.356 1.00 27.55 ? 621 HOH A O     1 
HETATM 9261  O  O     . HOH Y  8 .   ? 2.026   -1.570  -5.682  1.00 23.74 ? 622 HOH A O     1 
HETATM 9262  O  O     . HOH Y  8 .   ? 29.926  -23.531 0.160   1.00 32.52 ? 623 HOH A O     1 
HETATM 9263  O  O     . HOH Y  8 .   ? 0.515   -42.090 -4.775  1.00 48.57 ? 624 HOH A O     1 
HETATM 9264  O  O     . HOH Y  8 .   ? -6.923  -34.389 -0.098  1.00 41.36 ? 625 HOH A O     1 
HETATM 9265  O  O     . HOH Y  8 .   ? -3.732  -41.010 8.108   1.00 31.00 ? 626 HOH A O     1 
HETATM 9266  O  O     . HOH Y  8 .   ? 4.419   -34.647 11.738  1.00 21.07 ? 627 HOH A O     1 
HETATM 9267  O  O     . HOH Y  8 .   ? 23.478  -32.480 -22.041 1.00 27.10 ? 628 HOH A O     1 
HETATM 9268  O  O     . HOH Y  8 .   ? -7.527  -2.156  1.888   1.00 32.52 ? 629 HOH A O     1 
HETATM 9269  O  O     . HOH Y  8 .   ? 13.694  -29.139 -28.671 1.00 30.13 ? 630 HOH A O     1 
HETATM 9270  O  O     . HOH Y  8 .   ? 10.231  -32.425 -24.825 1.00 26.45 ? 631 HOH A O     1 
HETATM 9271  O  O     . HOH Y  8 .   ? 3.506   -15.764 17.186  1.00 29.55 ? 632 HOH A O     1 
HETATM 9272  O  O     . HOH Y  8 .   ? 10.270  3.807   -3.349  1.00 30.54 ? 633 HOH A O     1 
HETATM 9273  O  O     . HOH Y  8 .   ? -2.563  -29.399 -4.216  1.00 29.32 ? 634 HOH A O     1 
HETATM 9274  O  O     . HOH Y  8 .   ? 13.234  -5.692  -17.758 1.00 25.09 ? 635 HOH A O     1 
HETATM 9275  O  O     . HOH Y  8 .   ? 17.154  -29.105 20.761  1.00 29.53 ? 636 HOH A O     1 
HETATM 9276  O  O     . HOH Y  8 .   ? 2.821   -43.311 -6.634  1.00 35.19 ? 637 HOH A O     1 
HETATM 9277  O  O     . HOH Y  8 .   ? -4.722  -10.573 -4.598  1.00 27.01 ? 638 HOH A O     1 
HETATM 9278  O  O     . HOH Y  8 .   ? 11.433  -41.861 8.166   1.00 28.23 ? 639 HOH A O     1 
HETATM 9279  O  O     . HOH Y  8 .   ? 31.214  -18.901 -0.344  1.00 33.65 ? 640 HOH A O     1 
HETATM 9280  O  O     . HOH Y  8 .   ? 27.197  -15.778 15.302  1.00 36.09 ? 641 HOH A O     1 
HETATM 9281  O  O     . HOH Y  8 .   ? 13.984  -12.274 -22.635 1.00 29.29 ? 642 HOH A O     1 
HETATM 9282  O  O     . HOH Y  8 .   ? -0.096  -23.103 15.745  1.00 35.04 ? 643 HOH A O     1 
HETATM 9283  O  O     . HOH Y  8 .   ? 7.835   -18.107 -25.842 1.00 34.68 ? 644 HOH A O     1 
HETATM 9284  O  O     . HOH Y  8 .   ? 8.202   -26.220 18.116  1.00 26.54 ? 645 HOH A O     1 
HETATM 9285  O  O     . HOH Y  8 .   ? 0.434   4.788   -4.536  1.00 31.50 ? 646 HOH A O     1 
HETATM 9286  O  O     . HOH Y  8 .   ? -7.731  -32.800 1.937   1.00 38.64 ? 647 HOH A O     1 
HETATM 9287  O  O     . HOH Y  8 .   ? 11.186  -4.363  14.262  1.00 26.72 ? 648 HOH A O     1 
HETATM 9288  O  O     . HOH Y  8 .   ? 4.285   -41.436 -8.299  1.00 28.30 ? 649 HOH A O     1 
HETATM 9289  O  O     . HOH Y  8 .   ? 19.748  -6.467  -6.374  1.00 32.68 ? 650 HOH A O     1 
HETATM 9290  O  O     . HOH Y  8 .   ? 8.809   -37.093 11.196  1.00 33.59 ? 651 HOH A O     1 
HETATM 9291  O  O     . HOH Y  8 .   ? 25.415  -33.433 -20.619 1.00 33.37 ? 652 HOH A O     1 
HETATM 9292  O  O     . HOH Y  8 .   ? -0.843  -40.712 0.021   1.00 31.47 ? 653 HOH A O     1 
HETATM 9293  O  O     . HOH Y  8 .   ? 24.042  -27.351 -24.517 1.00 39.92 ? 654 HOH A O     1 
HETATM 9294  O  O     . HOH Y  8 .   ? 29.855  -23.838 -17.526 1.00 28.84 ? 655 HOH A O     1 
HETATM 9295  O  O     . HOH Y  8 .   ? 22.340  -36.747 -23.858 1.00 40.90 ? 656 HOH A O     1 
HETATM 9296  O  O     . HOH Y  8 .   ? 16.655  -4.957  -20.666 1.00 29.90 ? 657 HOH A O     1 
HETATM 9297  O  O     . HOH Y  8 .   ? -5.329  -22.900 12.602  1.00 29.94 ? 658 HOH A O     1 
HETATM 9298  O  O     . HOH Y  8 .   ? 0.870   -18.947 15.037  1.00 32.28 ? 659 HOH A O     1 
HETATM 9299  O  O     . HOH Y  8 .   ? 24.494  -20.989 23.088  1.00 39.55 ? 660 HOH A O     1 
HETATM 9300  O  O     . HOH Y  8 .   ? 1.441   -6.629  18.202  1.00 36.85 ? 661 HOH A O     1 
HETATM 9301  O  O     . HOH Y  8 .   ? -7.337  -8.817  3.509   1.00 30.41 ? 662 HOH A O     1 
HETATM 9302  O  O     . HOH Y  8 .   ? 9.942   -38.627 -26.433 1.00 35.17 ? 663 HOH A O     1 
HETATM 9303  O  O     . HOH Y  8 .   ? 22.397  -14.697 22.017  1.00 35.46 ? 664 HOH A O     1 
HETATM 9304  O  O     . HOH Y  8 .   ? 7.125   -23.358 -25.564 1.00 31.54 ? 665 HOH A O     1 
HETATM 9305  O  O     . HOH Y  8 .   ? 21.790  -45.122 -10.843 1.00 31.19 ? 666 HOH A O     1 
HETATM 9306  O  O     . HOH Y  8 .   ? 19.680  -12.406 -29.861 1.00 27.88 ? 667 HOH A O     1 
HETATM 9307  O  O     . HOH Y  8 .   ? 21.234  -42.644 12.453  1.00 38.74 ? 668 HOH A O     1 
HETATM 9308  O  O     . HOH Y  8 .   ? 12.905  -41.294 12.181  1.00 39.87 ? 669 HOH A O     1 
HETATM 9309  O  O     . HOH Y  8 .   ? 4.085   -9.272  -13.926 1.00 43.55 ? 670 HOH A O     1 
HETATM 9310  O  O     . HOH Y  8 .   ? -5.854  -39.793 6.956   1.00 44.82 ? 671 HOH A O     1 
HETATM 9311  O  O     . HOH Y  8 .   ? 6.488   -36.479 12.074  1.00 28.11 ? 672 HOH A O     1 
HETATM 9312  O  O     . HOH Y  8 .   ? 1.043   -13.478 -10.528 1.00 28.71 ? 673 HOH A O     1 
HETATM 9313  O  O     . HOH Y  8 .   ? -2.524  -34.848 -0.149  1.00 31.38 ? 674 HOH A O     1 
HETATM 9314  O  O     . HOH Y  8 .   ? 17.677  -25.842 -29.761 1.00 32.33 ? 675 HOH A O     1 
HETATM 9315  O  O     . HOH Y  8 .   ? 2.153   -9.098  17.420  1.00 27.45 ? 676 HOH A O     1 
HETATM 9316  O  O     . HOH Y  8 .   ? 25.152  -41.671 -16.300 1.00 29.09 ? 677 HOH A O     1 
HETATM 9317  O  O     . HOH Y  8 .   ? 7.924   -17.252 20.625  1.00 35.25 ? 678 HOH A O     1 
HETATM 9318  O  O     . HOH Y  8 .   ? 16.344  -44.189 -15.838 1.00 26.29 ? 679 HOH A O     1 
HETATM 9319  O  O     . HOH Y  8 .   ? 27.108  -10.657 15.877  1.00 40.38 ? 680 HOH A O     1 
HETATM 9320  O  O     . HOH Y  8 .   ? 30.766  -35.339 15.165  1.00 26.40 ? 681 HOH A O     1 
HETATM 9321  O  O     . HOH Y  8 .   ? 21.888  -6.349  -16.065 1.00 30.11 ? 682 HOH A O     1 
HETATM 9322  O  O     . HOH Y  8 .   ? -4.350  -32.780 -3.442  1.00 33.32 ? 683 HOH A O     1 
HETATM 9323  O  O     . HOH Y  8 .   ? -8.994  -12.363 3.840   1.00 37.30 ? 684 HOH A O     1 
HETATM 9324  O  O     . HOH Y  8 .   ? 17.505  -42.387 11.272  1.00 37.91 ? 685 HOH A O     1 
HETATM 9325  O  O     . HOH Y  8 .   ? 27.948  -32.923 -21.530 1.00 30.21 ? 686 HOH A O     1 
HETATM 9326  O  O     . HOH Y  8 .   ? 8.716   -19.770 -24.334 1.00 30.25 ? 687 HOH A O     1 
HETATM 9327  O  O     . HOH Y  8 .   ? 29.185  -38.103 4.278   1.00 40.20 ? 688 HOH A O     1 
HETATM 9328  O  O     . HOH Y  8 .   ? -1.689  -26.165 -16.514 1.00 28.40 ? 689 HOH A O     1 
HETATM 9329  O  O     . HOH Y  8 .   ? 18.649  -13.803 19.266  1.00 42.24 ? 690 HOH A O     1 
HETATM 9330  O  O     . HOH Y  8 .   ? 21.593  -30.379 21.054  1.00 37.04 ? 691 HOH A O     1 
HETATM 9331  O  O     . HOH Y  8 .   ? -1.180  -21.951 -15.572 1.00 32.44 ? 692 HOH A O     1 
HETATM 9332  O  O     . HOH Y  8 .   ? -2.144  -27.729 -6.066  1.00 40.44 ? 693 HOH A O     1 
HETATM 9333  O  O     . HOH Y  8 .   ? 20.043  -24.021 22.267  1.00 45.05 ? 694 HOH A O     1 
HETATM 9334  O  O     . HOH Y  8 .   ? 17.865  -11.668 11.991  1.00 30.25 ? 695 HOH A O     1 
HETATM 9335  O  O     . HOH Y  8 .   ? 28.287  -31.573 -23.764 1.00 41.64 ? 696 HOH A O     1 
HETATM 9336  O  O     . HOH Y  8 .   ? 0.532   -27.417 16.287  1.00 32.04 ? 697 HOH A O     1 
HETATM 9337  O  O     . HOH Y  8 .   ? 26.666  -30.557 -6.224  1.00 33.34 ? 698 HOH A O     1 
HETATM 9338  O  O     . HOH Y  8 .   ? 16.767  -22.142 20.762  1.00 37.97 ? 699 HOH A O     1 
HETATM 9339  O  O     . HOH Y  8 .   ? -0.285  3.135   0.408   1.00 39.97 ? 700 HOH A O     1 
HETATM 9340  O  O     . HOH Y  8 .   ? 37.484  -23.591 12.283  1.00 34.57 ? 701 HOH A O     1 
HETATM 9341  O  O     . HOH Y  8 .   ? 20.644  -41.272 -23.679 1.00 41.81 ? 702 HOH A O     1 
HETATM 9342  O  O     . HOH Y  8 .   ? 24.982  -35.239 -16.335 1.00 24.97 ? 703 HOH A O     1 
HETATM 9343  O  O     . HOH Y  8 .   ? -4.410  -27.053 -6.768  1.00 47.55 ? 704 HOH A O     1 
HETATM 9344  O  O     . HOH Y  8 .   ? -5.868  -20.615 11.536  1.00 33.82 ? 705 HOH A O     1 
HETATM 9345  O  O     . HOH Y  8 .   ? 12.511  -3.803  -4.638  1.00 36.23 ? 706 HOH A O     1 
HETATM 9346  O  O     . HOH Y  8 .   ? 13.181  -47.129 -4.653  1.00 40.66 ? 707 HOH A O     1 
HETATM 9347  O  O     . HOH Y  8 .   ? -8.467  -36.330 2.137   1.00 44.28 ? 708 HOH A O     1 
HETATM 9348  O  O     . HOH Y  8 .   ? 11.841  -40.053 10.101  1.00 33.58 ? 709 HOH A O     1 
HETATM 9349  O  O     . HOH Y  8 .   ? 6.763   -20.437 -26.721 1.00 30.44 ? 710 HOH A O     1 
HETATM 9350  O  O     . HOH Y  8 .   ? 29.608  -15.132 9.662   1.00 33.72 ? 711 HOH A O     1 
HETATM 9351  O  O     . HOH Y  8 .   ? 6.286   -3.769  16.416  1.00 35.00 ? 712 HOH A O     1 
HETATM 9352  O  O     . HOH Y  8 .   ? 18.185  -8.909  12.201  1.00 38.31 ? 713 HOH A O     1 
HETATM 9353  O  O     . HOH Y  8 .   ? 16.258  -7.900  10.845  1.00 48.08 ? 714 HOH A O     1 
HETATM 9354  O  O     . HOH Y  8 .   ? 9.979   -31.508 -27.553 1.00 34.35 ? 715 HOH A O     1 
HETATM 9355  O  O     . HOH Y  8 .   ? 9.494   -6.075  -15.902 1.00 37.15 ? 716 HOH A O     1 
HETATM 9356  O  O     . HOH Y  8 .   ? 10.122  -12.123 -23.489 1.00 43.84 ? 717 HOH A O     1 
HETATM 9357  O  O     . HOH Y  8 .   ? -0.091  -24.369 -15.261 1.00 34.48 ? 718 HOH A O     1 
HETATM 9358  O  O     . HOH Y  8 .   ? 21.479  -6.302  -8.956  1.00 49.09 ? 719 HOH A O     1 
HETATM 9359  O  O     . HOH Y  8 .   ? 19.823  -30.534 -25.216 1.00 30.26 ? 720 HOH A O     1 
HETATM 9360  O  O     . HOH Y  8 .   ? 1.472   -30.759 -19.019 1.00 29.32 ? 721 HOH A O     1 
HETATM 9361  O  O     . HOH Y  8 .   ? 10.847  -45.637 -0.594  1.00 41.29 ? 722 HOH A O     1 
HETATM 9362  O  O     . HOH Y  8 .   ? 8.872   -1.329  -3.335  1.00 27.91 ? 723 HOH A O     1 
HETATM 9363  O  O     . HOH Y  8 .   ? 4.688   -19.077 -16.368 1.00 30.22 ? 724 HOH A O     1 
HETATM 9364  O  O     . HOH Y  8 .   ? 15.250  -35.037 20.269  1.00 27.32 ? 725 HOH A O     1 
HETATM 9365  O  O     . HOH Y  8 .   ? 28.182  -27.798 -12.947 1.00 29.48 ? 726 HOH A O     1 
HETATM 9366  O  O     . HOH Y  8 .   ? 16.467  -28.118 -29.874 1.00 34.74 ? 727 HOH A O     1 
HETATM 9367  O  O     . HOH Y  8 .   ? -4.473  -30.845 -5.196  1.00 48.46 ? 728 HOH A O     1 
HETATM 9368  O  O     . HOH Y  8 .   ? 23.003  -7.141  7.851   1.00 34.37 ? 729 HOH A O     1 
HETATM 9369  O  O     . HOH Y  8 .   ? 17.984  -4.106  -9.603  1.00 33.68 ? 730 HOH A O     1 
HETATM 9370  O  O     . HOH Y  8 .   ? 2.786   -18.226 16.765  1.00 44.73 ? 731 HOH A O     1 
HETATM 9371  O  O     . HOH Y  8 .   ? 26.090  -34.153 -8.905  1.00 35.33 ? 732 HOH A O     1 
HETATM 9372  O  O     . HOH Y  8 .   ? 7.420   -13.657 17.914  1.00 44.79 ? 733 HOH A O     1 
HETATM 9373  O  O     . HOH Y  8 .   ? 18.004  -6.903  5.971   1.00 24.81 ? 734 HOH A O     1 
HETATM 9374  O  O     . HOH Y  8 .   ? 13.704  -44.082 -15.627 1.00 39.98 ? 735 HOH A O     1 
HETATM 9375  O  O     . HOH Y  8 .   ? 24.195  -27.385 21.691  1.00 41.37 ? 736 HOH A O     1 
HETATM 9376  O  O     . HOH Y  8 .   ? -1.410  -4.194  -8.405  1.00 38.68 ? 737 HOH A O     1 
HETATM 9377  O  O     . HOH Y  8 .   ? -9.401  -21.839 2.436   1.00 32.25 ? 738 HOH A O     1 
HETATM 9378  O  O     . HOH Y  8 .   ? 3.735   -12.009 -14.697 1.00 48.09 ? 739 HOH A O     1 
HETATM 9379  O  O     . HOH Y  8 .   ? -4.285  -12.867 -6.805  1.00 32.90 ? 740 HOH A O     1 
HETATM 9380  O  O     . HOH Y  8 .   ? 6.777   -6.072  17.671  1.00 40.33 ? 741 HOH A O     1 
HETATM 9381  O  O     . HOH Y  8 .   ? -1.964  -38.396 -2.876  1.00 38.23 ? 742 HOH A O     1 
HETATM 9382  O  O     . HOH Y  8 .   ? 16.177  -32.402 20.503  1.00 41.57 ? 743 HOH A O     1 
HETATM 9383  O  O     . HOH Y  8 .   ? 28.313  -13.109 -6.853  1.00 32.99 ? 744 HOH A O     1 
HETATM 9384  O  O     . HOH Y  8 .   ? 27.880  -28.855 -4.780  1.00 33.76 ? 745 HOH A O     1 
HETATM 9385  O  O     . HOH Y  8 .   ? 23.154  -7.170  10.939  1.00 49.01 ? 746 HOH A O     1 
HETATM 9386  O  O     . HOH Y  8 .   ? 2.126   5.085   -1.271  1.00 36.95 ? 747 HOH A O     1 
HETATM 9387  O  O     . HOH Y  8 .   ? 9.762   -8.175  16.518  1.00 37.31 ? 748 HOH A O     1 
HETATM 9388  O  O     . HOH Y  8 .   ? 6.006   -16.768 -24.924 1.00 38.33 ? 749 HOH A O     1 
HETATM 9389  O  O     . HOH Y  8 .   ? 19.858  -27.656 21.371  1.00 41.75 ? 750 HOH A O     1 
HETATM 9390  O  O     . HOH Y  8 .   ? 16.081  -12.086 -33.443 1.00 30.63 ? 751 HOH A O     1 
HETATM 9391  O  O     . HOH Y  8 .   ? 27.849  -14.024 11.367  1.00 35.20 ? 752 HOH A O     1 
HETATM 9392  O  O     . HOH Y  8 .   ? -5.491  -1.194  5.304   1.00 37.36 ? 753 HOH A O     1 
HETATM 9393  O  O     . HOH Y  8 .   ? -1.977  4.860   -2.659  1.00 36.39 ? 754 HOH A O     1 
HETATM 9394  O  O     . HOH Y  8 .   ? 18.645  -27.889 -31.370 1.00 45.36 ? 755 HOH A O     1 
HETATM 9395  O  O     . HOH Y  8 .   ? 5.775   -39.483 11.412  1.00 32.63 ? 756 HOH A O     1 
HETATM 9396  O  O     . HOH Y  8 .   ? 22.929  -25.349 22.310  1.00 40.95 ? 757 HOH A O     1 
HETATM 9397  O  O     . HOH Y  8 .   ? 24.716  -31.149 -24.394 1.00 46.85 ? 758 HOH A O     1 
HETATM 9398  O  O     . HOH Y  8 .   ? 10.381  4.885   -5.760  1.00 32.26 ? 759 HOH A O     1 
HETATM 9399  O  O     . HOH Y  8 .   ? -7.573  -1.015  -0.486  1.00 46.61 ? 760 HOH A O     1 
HETATM 9400  O  O     . HOH Y  8 .   ? 9.220   -14.647 20.072  1.00 41.63 ? 761 HOH A O     1 
HETATM 9401  O  O     . HOH Y  8 .   ? 32.219  -33.170 5.655   1.00 36.31 ? 762 HOH A O     1 
HETATM 9402  O  O     . HOH Y  8 .   ? 27.806  -35.538 -7.335  1.00 42.43 ? 763 HOH A O     1 
HETATM 9403  O  O     . HOH Y  8 .   ? 25.762  -10.908 -4.243  1.00 37.58 ? 764 HOH A O     1 
HETATM 9404  O  O     . HOH Y  8 .   ? 22.422  -39.620 -2.123  1.00 47.69 ? 765 HOH A O     1 
HETATM 9405  O  O     . HOH Y  8 .   ? 29.320  -24.554 -2.276  1.00 64.48 ? 766 HOH A O     1 
HETATM 9406  O  O     . HOH Y  8 .   ? 16.501  -45.295 -7.608  1.00 45.85 ? 767 HOH A O     1 
HETATM 9407  O  O     . HOH Y  8 .   ? -1.461  -40.612 -6.808  1.00 44.04 ? 768 HOH A O     1 
HETATM 9408  O  O     . HOH Y  8 .   ? 6.188   -6.783  -14.389 1.00 37.07 ? 769 HOH A O     1 
HETATM 9409  O  O     . HOH Y  8 .   ? -5.148  -15.507 -5.925  1.00 32.07 ? 770 HOH A O     1 
HETATM 9410  O  O     . HOH Y  8 .   ? 30.195  -21.605 -12.416 1.00 39.00 ? 771 HOH A O     1 
HETATM 9411  O  O     . HOH Y  8 .   ? 31.230  -33.590 17.171  1.00 32.09 ? 772 HOH A O     1 
HETATM 9412  O  O     . HOH Y  8 .   ? 24.330  -38.474 -5.575  1.00 42.44 ? 773 HOH A O     1 
HETATM 9413  O  O     . HOH Y  8 .   ? 15.628  -8.001  -27.222 1.00 37.70 ? 774 HOH A O     1 
HETATM 9414  O  O     . HOH Y  8 .   ? 21.850  -44.057 -17.535 1.00 39.23 ? 775 HOH A O     1 
HETATM 9415  O  O     . HOH Y  8 .   ? 12.585  -8.918  -21.174 1.00 40.89 ? 776 HOH A O     1 
HETATM 9416  O  O     . HOH Y  8 .   ? 7.119   -43.931 8.277   1.00 37.14 ? 777 HOH A O     1 
HETATM 9417  O  O     . HOH Y  8 .   ? 34.713  -12.289 -15.551 1.00 47.07 ? 778 HOH A O     1 
HETATM 9418  O  O     . HOH Y  8 .   ? 21.782  -3.077  -15.924 1.00 40.23 ? 779 HOH A O     1 
HETATM 9419  O  O     . HOH Y  8 .   ? -4.244  -22.420 15.099  1.00 48.97 ? 780 HOH A O     1 
HETATM 9420  O  O     . HOH Y  8 .   ? 12.627  -7.971  -26.345 1.00 44.65 ? 781 HOH A O     1 
HETATM 9421  O  O     . HOH Y  8 .   ? 27.357  -32.615 -10.722 1.00 43.33 ? 782 HOH A O     1 
HETATM 9422  O  O     . HOH Y  8 .   ? -0.221  -26.860 -18.912 1.00 45.13 ? 783 HOH A O     1 
HETATM 9423  O  O     . HOH Y  8 .   ? 17.527  -6.108  8.797   1.00 43.47 ? 784 HOH A O     1 
HETATM 9424  O  O     . HOH Y  8 .   ? 13.829  -43.956 12.771  1.00 45.24 ? 785 HOH A O     1 
HETATM 9425  O  O     . HOH Y  8 .   ? 20.223  -25.358 19.808  1.00 29.33 ? 786 HOH A O     1 
HETATM 9426  O  O     . HOH Y  8 .   ? -7.651  -15.729 -6.376  1.00 34.82 ? 787 HOH A O     1 
HETATM 9427  O  O     . HOH Y  8 .   ? -9.374  -10.282 1.525   1.00 40.04 ? 788 HOH A O     1 
HETATM 9428  O  O     . HOH Y  8 .   ? 35.478  -32.833 5.246   1.00 30.69 ? 789 HOH A O     1 
HETATM 9429  O  O     . HOH Y  8 .   ? 13.252  -30.946 21.077  1.00 35.43 ? 790 HOH A O     1 
HETATM 9430  O  O     . HOH Y  8 .   ? 18.490  -20.873 0.399   1.00 31.33 ? 791 HOH A O     1 
HETATM 9431  O  O     . HOH Y  8 .   ? 26.730  -25.300 -2.153  1.00 34.87 ? 792 HOH A O     1 
HETATM 9432  O  O     . HOH Y  8 .   ? 15.220  -10.264 -32.118 1.00 43.54 ? 793 HOH A O     1 
HETATM 9433  O  O     . HOH Y  8 .   ? 4.928   -40.012 6.011   1.00 33.80 ? 794 HOH A O     1 
HETATM 9434  O  O     . HOH Y  8 .   ? 10.699  -24.877 22.151  1.00 36.26 ? 795 HOH A O     1 
HETATM 9435  O  O     . HOH Y  8 .   ? 26.314  -37.672 -7.150  1.00 48.60 ? 796 HOH A O     1 
HETATM 9436  O  O     . HOH Y  8 .   ? 33.056  -22.022 2.623   1.00 51.05 ? 797 HOH A O     1 
HETATM 9437  O  O     . HOH Y  8 .   ? 28.620  -11.803 8.870   1.00 40.74 ? 798 HOH A O     1 
HETATM 9438  O  O     . HOH Y  8 .   ? -3.204  -6.100  -6.939  1.00 49.54 ? 799 HOH A O     1 
HETATM 9439  O  O     . HOH Y  8 .   ? -2.838  -0.123  -5.747  1.00 39.32 ? 800 HOH A O     1 
HETATM 9440  O  O     . HOH Y  8 .   ? -4.220  -13.900 -4.109  1.00 50.10 ? 801 HOH A O     1 
HETATM 9441  O  O     . HOH Y  8 .   ? 15.071  -15.583 22.190  1.00 31.04 ? 802 HOH A O     1 
HETATM 9442  O  O     . HOH Y  8 .   ? 21.462  -14.742 19.396  1.00 29.26 ? 803 HOH A O     1 
HETATM 9443  O  O     . HOH Y  8 .   ? 16.611  -8.824  -23.366 1.00 36.11 ? 804 HOH A O     1 
HETATM 9444  O  O     . HOH Y  8 .   ? 5.302   -27.499 -22.970 1.00 31.19 ? 805 HOH A O     1 
HETATM 9445  O  O     . HOH Y  8 .   ? -9.862  -18.676 -0.099  1.00 32.07 ? 806 HOH A O     1 
HETATM 9446  O  O     . HOH Y  8 .   ? 14.948  -27.830 22.157  1.00 50.10 ? 807 HOH A O     1 
HETATM 9447  O  O     . HOH Y  8 .   ? 21.738  -34.059 -23.541 1.00 40.74 ? 808 HOH A O     1 
HETATM 9448  O  O     . HOH Y  8 .   ? -4.185  0.472   -3.545  1.00 47.70 ? 809 HOH A O     1 
HETATM 9449  O  O     . HOH Z  8 .   ? 44.637  -9.335  -30.582 1.00 8.80  ? 501 HOH B O     1 
HETATM 9450  O  O     . HOH Z  8 .   ? 31.594  -14.155 -48.438 1.00 10.71 ? 502 HOH B O     1 
HETATM 9451  O  O     . HOH Z  8 .   ? 34.811  -6.189  -42.644 1.00 9.56  ? 503 HOH B O     1 
HETATM 9452  O  O     . HOH Z  8 .   ? 34.527  -8.832  -36.820 1.00 6.69  ? 504 HOH B O     1 
HETATM 9453  O  O     . HOH Z  8 .   ? 29.060  -8.856  -30.630 1.00 11.65 ? 505 HOH B O     1 
HETATM 9454  O  O     . HOH Z  8 .   ? 37.777  -2.089  -23.994 1.00 9.86  ? 506 HOH B O     1 
HETATM 9455  O  O     . HOH Z  8 .   ? 51.094  -5.644  -27.616 1.00 9.11  ? 507 HOH B O     1 
HETATM 9456  O  O     . HOH Z  8 .   ? 40.381  -12.926 -19.509 1.00 11.52 ? 508 HOH B O     1 
HETATM 9457  O  O     . HOH Z  8 .   ? 30.037  -8.732  -51.178 1.00 11.05 ? 509 HOH B O     1 
HETATM 9458  O  O     . HOH Z  8 .   ? 42.367  -8.630  -45.447 1.00 9.76  ? 510 HOH B O     1 
HETATM 9459  O  O     . HOH Z  8 .   ? 48.993  -13.563 -24.532 1.00 9.57  ? 511 HOH B O     1 
HETATM 9460  O  O     . HOH Z  8 .   ? 45.296  -14.946 -25.808 1.00 13.14 ? 512 HOH B O     1 
HETATM 9461  O  O     . HOH Z  8 .   ? 25.057  -13.810 -34.034 1.00 12.81 ? 513 HOH B O     1 
HETATM 9462  O  O     . HOH Z  8 .   ? 33.486  -3.134  -30.407 1.00 12.15 ? 514 HOH B O     1 
HETATM 9463  O  O     . HOH Z  8 .   ? 37.030  -5.408  -30.131 1.00 8.80  ? 515 HOH B O     1 
HETATM 9464  O  O     . HOH Z  8 .   ? 42.074  -6.970  -27.688 1.00 11.01 ? 516 HOH B O     1 
HETATM 9465  O  O     . HOH Z  8 .   ? 44.442  -0.136  -44.595 1.00 10.53 ? 517 HOH B O     1 
HETATM 9466  O  O     . HOH Z  8 .   ? 37.053  -3.588  -63.170 1.00 14.58 ? 518 HOH B O     1 
HETATM 9467  O  O     . HOH Z  8 .   ? 31.833  -9.146  -37.890 1.00 8.37  ? 519 HOH B O     1 
HETATM 9468  O  O     . HOH Z  8 .   ? 31.457  -18.769 -41.527 1.00 8.48  ? 520 HOH B O     1 
HETATM 9469  O  O     . HOH Z  8 .   ? 46.185  -13.714 -23.329 1.00 10.11 ? 521 HOH B O     1 
HETATM 9470  O  O     . HOH Z  8 .   ? 41.741  -1.509  -17.618 1.00 15.33 ? 522 HOH B O     1 
HETATM 9471  O  O     . HOH Z  8 .   ? 52.459  -5.796  -43.718 1.00 11.95 ? 523 HOH B O     1 
HETATM 9472  O  O     . HOH Z  8 .   ? 45.844  -17.658 -27.910 1.00 8.25  ? 524 HOH B O     1 
HETATM 9473  O  O     . HOH Z  8 .   ? 25.619  -20.732 -39.611 1.00 13.64 ? 525 HOH B O     1 
HETATM 9474  O  O     . HOH Z  8 .   ? 36.424  -4.713  -23.225 1.00 18.58 ? 526 HOH B O     1 
HETATM 9475  O  O     . HOH Z  8 .   ? 30.216  -6.344  -30.633 1.00 16.17 ? 527 HOH B O     1 
HETATM 9476  O  O     . HOH Z  8 .   ? 32.562  -25.934 -38.367 1.00 15.42 ? 528 HOH B O     1 
HETATM 9477  O  O     . HOH Z  8 .   ? 50.937  -14.312 -16.551 1.00 14.60 ? 529 HOH B O     1 
HETATM 9478  O  O     . HOH Z  8 .   ? 39.298  -17.099 -48.580 1.00 15.21 ? 530 HOH B O     1 
HETATM 9479  O  O     . HOH Z  8 .   ? 50.087  -3.131  -27.250 1.00 9.71  ? 531 HOH B O     1 
HETATM 9480  O  O     . HOH Z  8 .   ? 53.734  -5.286  -46.488 1.00 11.14 ? 532 HOH B O     1 
HETATM 9481  O  O     . HOH Z  8 .   ? 60.958  -5.014  -47.863 1.00 14.04 ? 533 HOH B O     1 
HETATM 9482  O  O     . HOH Z  8 .   ? 52.698  -12.680 -14.950 1.00 13.19 ? 534 HOH B O     1 
HETATM 9483  O  O     . HOH Z  8 .   ? 53.407  -4.304  -53.080 1.00 15.88 ? 535 HOH B O     1 
HETATM 9484  O  O     . HOH Z  8 .   ? 20.951  -13.615 -27.830 1.00 11.94 ? 536 HOH B O     1 
HETATM 9485  O  O     . HOH Z  8 .   ? 44.747  -7.826  -28.287 1.00 10.01 ? 537 HOH B O     1 
HETATM 9486  O  O     . HOH Z  8 .   ? 27.876  -28.338 -30.008 1.00 17.23 ? 538 HOH B O     1 
HETATM 9487  O  O     . HOH Z  8 .   ? 51.939  2.500   -17.113 1.00 20.66 ? 539 HOH B O     1 
HETATM 9488  O  O     . HOH Z  8 .   ? 48.060  2.728   -17.001 1.00 17.48 ? 540 HOH B O     1 
HETATM 9489  O  O     . HOH Z  8 .   ? 53.111  1.071   -47.335 1.00 16.39 ? 541 HOH B O     1 
HETATM 9490  O  O     . HOH Z  8 .   ? 46.104  5.956   -34.189 1.00 15.31 ? 542 HOH B O     1 
HETATM 9491  O  O     . HOH Z  8 .   ? 27.440  -13.529 -20.066 1.00 13.99 ? 543 HOH B O     1 
HETATM 9492  O  O     . HOH Z  8 .   ? 52.887  -23.821 -42.612 1.00 19.60 ? 544 HOH B O     1 
HETATM 9493  O  O     . HOH Z  8 .   ? 45.635  2.117   -45.949 1.00 14.66 ? 545 HOH B O     1 
HETATM 9494  O  O     . HOH Z  8 .   ? 54.992  -18.576 -19.518 1.00 13.68 ? 546 HOH B O     1 
HETATM 9495  O  O     . HOH Z  8 .   ? 53.902  -2.601  -57.531 1.00 18.13 ? 547 HOH B O     1 
HETATM 9496  O  O     . HOH Z  8 .   ? 30.302  -29.225 -29.059 1.00 22.49 ? 548 HOH B O     1 
HETATM 9497  O  O     . HOH Z  8 .   ? 58.747  -5.301  -45.227 1.00 14.99 ? 549 HOH B O     1 
HETATM 9498  O  O     . HOH Z  8 .   ? 56.782  -17.515 -21.214 1.00 13.92 ? 550 HOH B O     1 
HETATM 9499  O  O     . HOH Z  8 .   ? 29.228  -10.941 -52.493 1.00 19.57 ? 551 HOH B O     1 
HETATM 9500  O  O     . HOH Z  8 .   ? 30.397  -5.789  -43.658 1.00 15.33 ? 552 HOH B O     1 
HETATM 9501  O  O     . HOH Z  8 .   ? 44.092  3.755   -47.354 1.00 20.18 ? 553 HOH B O     1 
HETATM 9502  O  O     . HOH Z  8 .   ? 47.594  -27.683 -21.731 1.00 16.85 ? 554 HOH B O     1 
HETATM 9503  O  O     . HOH Z  8 .   ? 61.932  -9.501  -27.421 1.00 18.51 ? 555 HOH B O     1 
HETATM 9504  O  O     . HOH Z  8 .   ? 26.144  -19.783 -42.111 1.00 21.10 ? 556 HOH B O     1 
HETATM 9505  O  O     . HOH Z  8 .   ? 39.347  -16.776 -18.536 1.00 19.95 ? 557 HOH B O     1 
HETATM 9506  O  O     . HOH Z  8 .   ? 54.543  -6.462  -54.715 1.00 17.99 ? 558 HOH B O     1 
HETATM 9507  O  O     . HOH Z  8 .   ? 52.554  4.483   -60.689 1.00 19.93 ? 559 HOH B O     1 
HETATM 9508  O  O     . HOH Z  8 .   ? 22.880  -19.876 -39.330 1.00 15.41 ? 560 HOH B O     1 
HETATM 9509  O  O     . HOH Z  8 .   ? 43.475  8.594   -22.726 1.00 19.22 ? 561 HOH B O     1 
HETATM 9510  O  O     . HOH Z  8 .   ? 42.960  -16.602 -26.545 1.00 21.15 ? 562 HOH B O     1 
HETATM 9511  O  O     . HOH Z  8 .   ? 61.836  -23.654 -36.118 1.00 26.49 ? 563 HOH B O     1 
HETATM 9512  O  O     . HOH Z  8 .   ? 41.858  -17.832 -48.666 1.00 17.75 ? 564 HOH B O     1 
HETATM 9513  O  O     . HOH Z  8 .   ? 42.593  -19.241 -50.852 1.00 18.54 ? 565 HOH B O     1 
HETATM 9514  O  O     . HOH Z  8 .   ? 57.014  -6.702  -53.926 1.00 16.02 ? 566 HOH B O     1 
HETATM 9515  O  O     . HOH Z  8 .   ? 62.383  -10.475 -29.862 1.00 19.02 ? 567 HOH B O     1 
HETATM 9516  O  O     . HOH Z  8 .   ? 37.926  -5.778  -21.310 1.00 23.66 ? 568 HOH B O     1 
HETATM 9517  O  O     . HOH Z  8 .   ? 48.666  -30.265 -30.334 1.00 20.54 ? 569 HOH B O     1 
HETATM 9518  O  O     . HOH Z  8 .   ? 54.924  -21.117 -20.159 1.00 22.10 ? 570 HOH B O     1 
HETATM 9519  O  O     . HOH Z  8 .   ? 65.039  -10.414 -30.323 1.00 18.34 ? 571 HOH B O     1 
HETATM 9520  O  O     . HOH Z  8 .   ? 27.795  -5.837  -44.505 1.00 25.76 ? 572 HOH B O     1 
HETATM 9521  O  O     . HOH Z  8 .   ? 64.474  -3.137  -42.411 1.00 22.30 ? 573 HOH B O     1 
HETATM 9522  O  O     . HOH Z  8 .   ? 57.015  0.992   -56.818 1.00 23.57 ? 574 HOH B O     1 
HETATM 9523  O  O     . HOH Z  8 .   ? 59.580  -22.715 -47.983 1.00 21.82 ? 575 HOH B O     1 
HETATM 9524  O  O     . HOH Z  8 .   ? 57.976  9.384   -30.687 1.00 25.33 ? 576 HOH B O     1 
HETATM 9525  O  O     . HOH Z  8 .   ? 46.326  7.866   -29.501 1.00 17.36 ? 577 HOH B O     1 
HETATM 9526  O  O     . HOH Z  8 .   ? 26.894  -12.312 -36.246 1.00 22.21 ? 578 HOH B O     1 
HETATM 9527  O  O     . HOH Z  8 .   ? 50.230  -1.956  -16.122 1.00 19.49 ? 579 HOH B O     1 
HETATM 9528  O  O     . HOH Z  8 .   ? 65.132  -19.466 -43.828 1.00 24.06 ? 580 HOH B O     1 
HETATM 9529  O  O     . HOH Z  8 .   ? 26.496  -27.508 -25.167 1.00 20.46 ? 581 HOH B O     1 
HETATM 9530  O  O     . HOH Z  8 .   ? 50.097  0.719   -16.991 1.00 20.83 ? 582 HOH B O     1 
HETATM 9531  O  O     . HOH Z  8 .   ? 27.984  -12.804 -51.116 1.00 28.16 ? 583 HOH B O     1 
HETATM 9532  O  O     . HOH Z  8 .   ? 53.949  -4.592  -14.953 1.00 22.06 ? 584 HOH B O     1 
HETATM 9533  O  O     . HOH Z  8 .   ? 47.356  -29.897 -35.763 1.00 20.46 ? 585 HOH B O     1 
HETATM 9534  O  O     . HOH Z  8 .   ? 47.905  1.593   -14.640 1.00 21.18 ? 586 HOH B O     1 
HETATM 9535  O  O     . HOH Z  8 .   ? 26.898  -2.155  -50.755 1.00 27.73 ? 587 HOH B O     1 
HETATM 9536  O  O     . HOH Z  8 .   ? 29.763  -14.590 -50.374 1.00 18.63 ? 588 HOH B O     1 
HETATM 9537  O  O     . HOH Z  8 .   ? 60.443  8.194   -21.495 1.00 26.23 ? 589 HOH B O     1 
HETATM 9538  O  O     . HOH Z  8 .   ? 45.411  -27.134 -44.574 1.00 24.85 ? 590 HOH B O     1 
HETATM 9539  O  O     . HOH Z  8 .   ? 21.790  -17.234 -43.739 1.00 28.48 ? 591 HOH B O     1 
HETATM 9540  O  O     . HOH Z  8 .   ? 52.612  -2.166  -59.930 1.00 26.57 ? 592 HOH B O     1 
HETATM 9541  O  O     . HOH Z  8 .   ? 30.834  -29.270 -26.371 1.00 22.32 ? 593 HOH B O     1 
HETATM 9542  O  O     . HOH Z  8 .   ? 56.008  -0.963  -58.254 1.00 27.10 ? 594 HOH B O     1 
HETATM 9543  O  O     . HOH Z  8 .   ? 37.417  -18.371 -49.723 1.00 27.15 ? 595 HOH B O     1 
HETATM 9544  O  O     . HOH Z  8 .   ? 41.290  2.999   -16.860 1.00 19.38 ? 596 HOH B O     1 
HETATM 9545  O  O     . HOH Z  8 .   ? 25.506  -12.362 -50.208 1.00 24.62 ? 597 HOH B O     1 
HETATM 9546  O  O     . HOH Z  8 .   ? 31.399  -4.578  -29.101 1.00 26.89 ? 598 HOH B O     1 
HETATM 9547  O  O     . HOH Z  8 .   ? 47.963  5.980   -53.686 1.00 23.03 ? 599 HOH B O     1 
HETATM 9548  O  O     . HOH Z  8 .   ? 56.845  -25.594 -47.887 1.00 25.51 ? 600 HOH B O     1 
HETATM 9549  O  O     . HOH Z  8 .   ? 64.637  -23.985 -35.464 1.00 23.91 ? 601 HOH B O     1 
HETATM 9550  O  O     . HOH Z  8 .   ? 35.886  -4.813  -65.354 1.00 18.94 ? 602 HOH B O     1 
HETATM 9551  O  O     . HOH Z  8 .   ? 57.252  -0.211  -36.825 1.00 26.96 ? 603 HOH B O     1 
HETATM 9552  O  O     . HOH Z  8 .   ? 25.832  -16.769 -37.432 1.00 26.12 ? 604 HOH B O     1 
HETATM 9553  O  O     . HOH Z  8 .   ? 45.860  -19.864 -19.122 1.00 25.62 ? 605 HOH B O     1 
HETATM 9554  O  O     . HOH Z  8 .   ? 58.452  -20.091 -24.885 1.00 19.65 ? 606 HOH B O     1 
HETATM 9555  O  O     . HOH Z  8 .   ? 23.410  -11.601 -44.040 1.00 23.11 ? 607 HOH B O     1 
HETATM 9556  O  O     . HOH Z  8 .   ? 57.271  -2.875  -59.513 1.00 25.73 ? 608 HOH B O     1 
HETATM 9557  O  O     . HOH Z  8 .   ? 39.468  4.056   -41.533 1.00 20.60 ? 609 HOH B O     1 
HETATM 9558  O  O     . HOH Z  8 .   ? 32.155  -22.097 -19.305 1.00 22.70 ? 610 HOH B O     1 
HETATM 9559  O  O     . HOH Z  8 .   ? 37.508  -22.475 -44.337 1.00 21.07 ? 611 HOH B O     1 
HETATM 9560  O  O     . HOH Z  8 .   ? 16.215  -16.984 -32.790 1.00 25.74 ? 612 HOH B O     1 
HETATM 9561  O  O     . HOH Z  8 .   ? 37.311  -33.425 -37.353 1.00 24.09 ? 613 HOH B O     1 
HETATM 9562  O  O     . HOH Z  8 .   ? 24.081  -7.076  -53.536 1.00 26.39 ? 614 HOH B O     1 
HETATM 9563  O  O     . HOH Z  8 .   ? 44.941  -28.341 -22.370 1.00 21.81 ? 615 HOH B O     1 
HETATM 9564  O  O     . HOH Z  8 .   ? 61.499  -24.654 -40.991 1.00 25.46 ? 616 HOH B O     1 
HETATM 9565  O  O     . HOH Z  8 .   ? 26.488  -6.473  -42.203 1.00 32.42 ? 617 HOH B O     1 
HETATM 9566  O  O     . HOH Z  8 .   ? 64.280  -12.549 -22.368 1.00 25.70 ? 618 HOH B O     1 
HETATM 9567  O  O     . HOH Z  8 .   ? 21.143  -6.482  -54.202 1.00 34.36 ? 619 HOH B O     1 
HETATM 9568  O  O     . HOH Z  8 .   ? 58.439  2.685   -51.190 1.00 28.01 ? 620 HOH B O     1 
HETATM 9569  O  O     . HOH Z  8 .   ? 71.540  -18.310 -42.881 1.00 39.33 ? 621 HOH B O     1 
HETATM 9570  O  O     . HOH Z  8 .   ? 58.079  -9.235  -54.805 1.00 24.66 ? 622 HOH B O     1 
HETATM 9571  O  O     . HOH Z  8 .   ? 52.590  -28.009 -29.077 1.00 46.64 ? 623 HOH B O     1 
HETATM 9572  O  O     . HOH Z  8 .   ? 35.768  -24.458 -43.763 1.00 24.93 ? 624 HOH B O     1 
HETATM 9573  O  O     . HOH Z  8 .   ? 33.065  -30.134 -30.023 1.00 28.13 ? 625 HOH B O     1 
HETATM 9574  O  O     . HOH Z  8 .   ? 45.505  5.726   -48.847 1.00 24.28 ? 626 HOH B O     1 
HETATM 9575  O  O     . HOH Z  8 .   ? 57.154  -23.129 -48.603 1.00 27.89 ? 627 HOH B O     1 
HETATM 9576  O  O     . HOH Z  8 .   ? 58.502  5.422   -34.233 1.00 16.12 ? 628 HOH B O     1 
HETATM 9577  O  O     . HOH Z  8 .   ? 54.622  3.125   -42.582 1.00 33.32 ? 629 HOH B O     1 
HETATM 9578  O  O     . HOH Z  8 .   ? 65.227  0.770   -53.226 1.00 30.87 ? 630 HOH B O     1 
HETATM 9579  O  O     . HOH Z  8 .   ? 41.368  -12.617 -12.527 1.00 40.74 ? 631 HOH B O     1 
HETATM 9580  O  O     . HOH Z  8 .   ? 29.013  -11.255 -20.008 1.00 19.71 ? 632 HOH B O     1 
HETATM 9581  O  O     . HOH Z  8 .   ? 47.166  -25.546 -19.590 1.00 37.66 ? 633 HOH B O     1 
HETATM 9582  O  O     . HOH Z  8 .   ? 63.979  -10.709 -20.362 1.00 32.12 ? 634 HOH B O     1 
HETATM 9583  O  O     . HOH Z  8 .   ? 28.263  -7.457  -55.534 1.00 26.74 ? 635 HOH B O     1 
HETATM 9584  O  O     . HOH Z  8 .   ? 29.934  -2.089  -51.171 1.00 21.84 ? 636 HOH B O     1 
HETATM 9585  O  O     . HOH Z  8 .   ? 38.788  5.406   -24.508 1.00 30.82 ? 637 HOH B O     1 
HETATM 9586  O  O     . HOH Z  8 .   ? 47.537  -21.806 -18.747 1.00 28.42 ? 638 HOH B O     1 
HETATM 9587  O  O     . HOH Z  8 .   ? 30.419  -19.641 -43.928 1.00 28.09 ? 639 HOH B O     1 
HETATM 9588  O  O     . HOH Z  8 .   ? 64.950  -8.339  -17.873 1.00 26.62 ? 640 HOH B O     1 
HETATM 9589  O  O     . HOH Z  8 .   ? 55.832  -21.259 -22.938 1.00 29.18 ? 641 HOH B O     1 
HETATM 9590  O  O     . HOH Z  8 .   ? 35.636  0.525   -51.906 1.00 29.14 ? 642 HOH B O     1 
HETATM 9591  O  O     . HOH Z  8 .   ? 21.647  -12.712 -42.553 1.00 28.40 ? 643 HOH B O     1 
HETATM 9592  O  O     . HOH Z  8 .   ? 66.874  3.859   -27.285 1.00 21.00 ? 644 HOH B O     1 
HETATM 9593  O  O     . HOH Z  8 .   ? 17.985  -19.740 -32.190 1.00 25.15 ? 645 HOH B O     1 
HETATM 9594  O  O     . HOH Z  8 .   ? 52.843  4.347   -41.158 1.00 29.49 ? 646 HOH B O     1 
HETATM 9595  O  O     . HOH Z  8 .   ? 38.412  -14.345 -16.621 1.00 27.14 ? 647 HOH B O     1 
HETATM 9596  O  O     . HOH Z  8 .   ? 26.097  -6.038  -34.897 1.00 33.37 ? 648 HOH B O     1 
HETATM 9597  O  O     . HOH Z  8 .   ? 33.716  -4.739  -22.899 1.00 29.19 ? 649 HOH B O     1 
HETATM 9598  O  O     . HOH Z  8 .   ? 39.366  -27.681 -39.892 1.00 27.11 ? 650 HOH B O     1 
HETATM 9599  O  O     . HOH Z  8 .   ? 59.107  3.007   -36.358 1.00 25.07 ? 651 HOH B O     1 
HETATM 9600  O  O     . HOH Z  8 .   ? 69.884  -11.644 -52.835 1.00 60.47 ? 652 HOH B O     1 
HETATM 9601  O  O     . HOH Z  8 .   ? 45.722  -6.583  -68.348 1.00 34.72 ? 653 HOH B O     1 
HETATM 9602  O  O     . HOH Z  8 .   ? 40.710  -18.447 -16.979 1.00 31.41 ? 654 HOH B O     1 
HETATM 9603  O  O     . HOH Z  8 .   ? 34.771  -16.639 -18.875 1.00 23.25 ? 655 HOH B O     1 
HETATM 9604  O  O     . HOH Z  8 .   ? 55.203  16.078  -28.652 1.00 32.74 ? 656 HOH B O     1 
HETATM 9605  O  O     . HOH Z  8 .   ? 26.919  -9.286  -42.045 1.00 31.98 ? 657 HOH B O     1 
HETATM 9606  O  O     . HOH Z  8 .   ? 66.963  -11.186 -34.298 1.00 19.68 ? 658 HOH B O     1 
HETATM 9607  O  O     . HOH Z  8 .   ? 33.206  -7.424  -64.198 1.00 31.00 ? 659 HOH B O     1 
HETATM 9608  O  O     . HOH Z  8 .   ? 31.903  -29.313 -38.736 1.00 29.00 ? 660 HOH B O     1 
HETATM 9609  O  O     . HOH Z  8 .   ? 54.677  -27.989 -39.667 1.00 35.79 ? 661 HOH B O     1 
HETATM 9610  O  O     . HOH Z  8 .   ? 47.998  6.840   -36.005 1.00 27.92 ? 662 HOH B O     1 
HETATM 9611  O  O     . HOH Z  8 .   ? 54.374  -28.373 -22.659 1.00 31.48 ? 663 HOH B O     1 
HETATM 9612  O  O     . HOH Z  8 .   ? 65.114  -16.059 -51.673 1.00 44.97 ? 664 HOH B O     1 
HETATM 9613  O  O     . HOH Z  8 .   ? 39.619  7.001   -26.597 1.00 32.48 ? 665 HOH B O     1 
HETATM 9614  O  O     . HOH Z  8 .   ? 58.925  0.682   -52.756 1.00 24.20 ? 666 HOH B O     1 
HETATM 9615  O  O     . HOH Z  8 .   ? 67.607  -7.876  -52.311 1.00 40.10 ? 667 HOH B O     1 
HETATM 9616  O  O     . HOH Z  8 .   ? 22.421  -23.343 -32.377 1.00 41.71 ? 668 HOH B O     1 
HETATM 9617  O  O     . HOH Z  8 .   ? 69.561  -12.319 -37.150 1.00 30.93 ? 669 HOH B O     1 
HETATM 9618  O  O     . HOH Z  8 .   ? 25.061  -10.414 -21.440 1.00 24.70 ? 670 HOH B O     1 
HETATM 9619  O  O     . HOH Z  8 .   ? 37.771  3.322   -38.142 1.00 32.43 ? 671 HOH B O     1 
HETATM 9620  O  O     . HOH Z  8 .   ? 38.798  -25.232 -47.579 1.00 41.96 ? 672 HOH B O     1 
HETATM 9621  O  O     . HOH Z  8 .   ? 47.626  -30.181 -38.565 1.00 35.19 ? 673 HOH B O     1 
HETATM 9622  O  O     . HOH Z  8 .   ? 52.473  2.117   -14.229 1.00 34.27 ? 674 HOH B O     1 
HETATM 9623  O  O     . HOH Z  8 .   ? 51.712  -26.246 -40.873 1.00 42.48 ? 675 HOH B O     1 
HETATM 9624  O  O     . HOH Z  8 .   ? 66.252  -11.316 -27.889 1.00 31.98 ? 676 HOH B O     1 
HETATM 9625  O  O     . HOH Z  8 .   ? 58.708  8.799   -19.575 1.00 26.03 ? 677 HOH B O     1 
HETATM 9626  O  O     . HOH Z  8 .   ? 60.131  -17.727 -23.581 1.00 43.40 ? 678 HOH B O     1 
HETATM 9627  O  O     . HOH Z  8 .   ? 37.101  -18.134 -19.593 1.00 30.11 ? 679 HOH B O     1 
HETATM 9628  O  O     . HOH Z  8 .   ? 52.078  5.939   -37.172 1.00 36.69 ? 680 HOH B O     1 
HETATM 9629  O  O     . HOH Z  8 .   ? 32.340  -17.092 -25.727 1.00 24.56 ? 681 HOH B O     1 
HETATM 9630  O  O     . HOH Z  8 .   ? 19.928  -5.842  -51.960 1.00 32.01 ? 682 HOH B O     1 
HETATM 9631  O  O     . HOH Z  8 .   ? 31.773  -11.244 -55.805 1.00 30.95 ? 683 HOH B O     1 
HETATM 9632  O  O     . HOH Z  8 .   ? 26.223  -12.779 -40.440 1.00 38.36 ? 684 HOH B O     1 
HETATM 9633  O  O     . HOH Z  8 .   ? 26.942  -10.063 -29.000 1.00 21.53 ? 685 HOH B O     1 
HETATM 9634  O  O     . HOH Z  8 .   ? 39.160  1.614   -51.218 1.00 31.04 ? 686 HOH B O     1 
HETATM 9635  O  O     . HOH Z  8 .   ? 66.145  -20.206 -27.695 1.00 38.96 ? 687 HOH B O     1 
HETATM 9636  O  O     . HOH Z  8 .   ? 28.209  -10.789 -39.651 1.00 24.65 ? 688 HOH B O     1 
HETATM 9637  O  O     . HOH Z  8 .   ? 62.226  7.457   -28.814 1.00 35.81 ? 689 HOH B O     1 
HETATM 9638  O  O     . HOH Z  8 .   ? 67.650  -10.363 -52.061 1.00 32.57 ? 690 HOH B O     1 
HETATM 9639  O  O     . HOH Z  8 .   ? 50.732  3.846   -41.971 1.00 34.43 ? 691 HOH B O     1 
HETATM 9640  O  O     . HOH Z  8 .   ? 50.710  -29.854 -28.455 1.00 42.04 ? 692 HOH B O     1 
HETATM 9641  O  O     . HOH Z  8 .   ? 58.460  -9.251  -63.747 1.00 43.89 ? 693 HOH B O     1 
HETATM 9642  O  O     . HOH Z  8 .   ? 65.683  0.004   -28.914 1.00 34.52 ? 694 HOH B O     1 
HETATM 9643  O  O     . HOH Z  8 .   ? 48.739  15.316  -24.623 1.00 29.19 ? 695 HOH B O     1 
HETATM 9644  O  O     . HOH Z  8 .   ? 50.252  12.603  -31.010 1.00 24.46 ? 696 HOH B O     1 
HETATM 9645  O  O     . HOH Z  8 .   ? 45.508  -17.598 -16.871 1.00 25.85 ? 697 HOH B O     1 
HETATM 9646  O  O     . HOH Z  8 .   ? 68.649  -25.239 -33.496 1.00 46.07 ? 698 HOH B O     1 
HETATM 9647  O  O     . HOH Z  8 .   ? 46.190  2.989   -12.895 1.00 30.25 ? 699 HOH B O     1 
HETATM 9648  O  O     . HOH Z  8 .   ? 19.680  -25.782 -33.358 1.00 38.67 ? 700 HOH B O     1 
HETATM 9649  O  O     . HOH Z  8 .   ? 26.792  -9.483  -51.174 1.00 29.46 ? 701 HOH B O     1 
HETATM 9650  O  O     . HOH Z  8 .   ? 39.550  1.931   -18.647 1.00 34.38 ? 702 HOH B O     1 
HETATM 9651  O  O     . HOH Z  8 .   ? 25.952  -28.285 -28.161 1.00 27.55 ? 703 HOH B O     1 
HETATM 9652  O  O     . HOH Z  8 .   ? 31.952  -31.534 -36.062 1.00 34.60 ? 704 HOH B O     1 
HETATM 9653  O  O     . HOH Z  8 .   ? 71.096  -10.188 -41.031 1.00 42.15 ? 705 HOH B O     1 
HETATM 9654  O  O     . HOH Z  8 .   ? 67.041  -5.030  -24.929 1.00 29.04 ? 706 HOH B O     1 
HETATM 9655  O  O     . HOH Z  8 .   ? 38.366  -12.096 -13.976 1.00 35.39 ? 707 HOH B O     1 
HETATM 9656  O  O     . HOH Z  8 .   ? 58.628  8.461   -16.736 1.00 41.79 ? 708 HOH B O     1 
HETATM 9657  O  O     . HOH Z  8 .   ? 34.245  -20.138 -17.012 1.00 34.52 ? 709 HOH B O     1 
HETATM 9658  O  O     . HOH Z  8 .   ? 21.948  -14.248 -37.513 1.00 32.06 ? 710 HOH B O     1 
HETATM 9659  O  O     . HOH Z  8 .   ? 66.598  -26.768 -32.098 1.00 42.91 ? 711 HOH B O     1 
HETATM 9660  O  O     . HOH Z  8 .   ? 28.428  -16.471 -17.610 1.00 33.68 ? 712 HOH B O     1 
HETATM 9661  O  O     . HOH Z  8 .   ? 65.844  -18.578 -51.977 1.00 53.09 ? 713 HOH B O     1 
HETATM 9662  O  O     . HOH Z  8 .   ? 30.510  -15.489 -16.260 1.00 42.28 ? 714 HOH B O     1 
HETATM 9663  O  O     . HOH Z  8 .   ? 30.743  -33.163 -32.013 1.00 42.39 ? 715 HOH B O     1 
HETATM 9664  O  O     . HOH Z  8 .   ? 33.137  -12.418 -17.909 1.00 31.47 ? 716 HOH B O     1 
HETATM 9665  O  O     . HOH Z  8 .   ? 45.977  -17.532 -60.415 1.00 32.26 ? 717 HOH B O     1 
HETATM 9666  O  O     . HOH Z  8 .   ? 20.882  -28.172 -29.289 1.00 40.94 ? 718 HOH B O     1 
HETATM 9667  O  O     . HOH Z  8 .   ? 51.818  4.379   -49.140 1.00 36.65 ? 719 HOH B O     1 
HETATM 9668  O  O     . HOH Z  8 .   ? 19.691  -21.956 -32.688 1.00 40.87 ? 720 HOH B O     1 
HETATM 9669  O  O     . HOH Z  8 .   ? 49.886  11.450  -9.418  1.00 51.42 ? 721 HOH B O     1 
HETATM 9670  O  O     . HOH Z  8 .   ? 53.330  -25.990 -38.884 1.00 38.93 ? 722 HOH B O     1 
HETATM 9671  O  O     . HOH Z  8 .   ? 65.839  -6.878  -54.201 1.00 31.60 ? 723 HOH B O     1 
HETATM 9672  O  O     . HOH Z  8 .   ? 52.175  -10.253 -66.401 1.00 35.23 ? 724 HOH B O     1 
HETATM 9673  O  O     . HOH Z  8 .   ? 59.972  -27.223 -36.917 1.00 36.52 ? 725 HOH B O     1 
HETATM 9674  O  O     . HOH Z  8 .   ? 42.646  -27.894 -40.890 1.00 38.51 ? 726 HOH B O     1 
HETATM 9675  O  O     . HOH Z  8 .   ? 54.481  0.184   -60.514 1.00 40.33 ? 727 HOH B O     1 
HETATM 9676  O  O     . HOH Z  8 .   ? 50.797  -0.333  -60.324 1.00 35.06 ? 728 HOH B O     1 
HETATM 9677  O  O     . HOH Z  8 .   ? 54.647  0.796   -43.353 1.00 29.02 ? 729 HOH B O     1 
HETATM 9678  O  O     . HOH Z  8 .   ? 29.736  -32.961 -35.353 1.00 59.93 ? 730 HOH B O     1 
HETATM 9679  O  O     . HOH Z  8 .   ? 69.928  -6.455  -53.529 1.00 49.10 ? 731 HOH B O     1 
HETATM 9680  O  O     . HOH Z  8 .   ? 40.160  0.341   -13.770 1.00 41.26 ? 732 HOH B O     1 
HETATM 9681  O  O     . HOH Z  8 .   ? 27.954  -18.821 -47.178 1.00 41.39 ? 733 HOH B O     1 
HETATM 9682  O  O     . HOH Z  8 .   ? 44.076  -27.657 -47.211 1.00 41.93 ? 734 HOH B O     1 
HETATM 9683  O  O     . HOH Z  8 .   ? 31.858  1.075   -24.251 1.00 48.05 ? 735 HOH B O     1 
HETATM 9684  O  O     . HOH Z  8 .   ? 55.424  15.271  -20.447 1.00 32.61 ? 736 HOH B O     1 
HETATM 9685  O  O     . HOH Z  8 .   ? 27.881  -19.224 -43.953 1.00 34.20 ? 737 HOH B O     1 
HETATM 9686  O  O     . HOH Z  8 .   ? 49.423  5.347   -49.593 1.00 29.39 ? 738 HOH B O     1 
HETATM 9687  O  O     . HOH Z  8 .   ? 29.203  -22.128 -19.409 1.00 34.40 ? 739 HOH B O     1 
HETATM 9688  O  O     . HOH Z  8 .   ? 60.143  -22.133 -24.398 1.00 27.81 ? 740 HOH B O     1 
HETATM 9689  O  O     . HOH Z  8 .   ? 30.642  -3.851  -41.586 1.00 34.40 ? 741 HOH B O     1 
HETATM 9690  O  O     . HOH Z  8 .   ? 67.685  -9.784  -36.391 1.00 37.32 ? 742 HOH B O     1 
HETATM 9691  O  O     . HOH Z  8 .   ? 69.333  -12.578 -34.506 1.00 36.30 ? 743 HOH B O     1 
HETATM 9692  O  O     . HOH Z  8 .   ? 42.904  7.832   -36.754 1.00 36.85 ? 744 HOH B O     1 
HETATM 9693  O  O     . HOH Z  8 .   ? 27.047  -9.931  -37.840 1.00 42.81 ? 745 HOH B O     1 
HETATM 9694  O  O     . HOH Z  8 .   ? 24.415  -16.089 -39.986 1.00 36.11 ? 746 HOH B O     1 
HETATM 9695  O  O     . HOH Z  8 .   ? 64.615  0.052   -35.864 1.00 31.25 ? 747 HOH B O     1 
HETATM 9696  O  O     . HOH Z  8 .   ? 51.776  -11.507 -64.090 1.00 44.07 ? 748 HOH B O     1 
HETATM 9697  O  O     . HOH Z  8 .   ? 25.360  -5.374  -55.251 1.00 35.78 ? 749 HOH B O     1 
HETATM 9698  O  O     . HOH Z  8 .   ? 52.048  -2.419  -14.596 1.00 38.47 ? 750 HOH B O     1 
HETATM 9699  O  O     . HOH Z  8 .   ? 62.814  1.371   -21.134 1.00 27.12 ? 751 HOH B O     1 
HETATM 9700  O  O     . HOH Z  8 .   ? 37.464  3.577   -18.126 1.00 39.12 ? 752 HOH B O     1 
HETATM 9701  O  O     . HOH Z  8 .   ? 54.379  -30.842 -23.657 1.00 40.93 ? 753 HOH B O     1 
HETATM 9702  O  O     . HOH Z  8 .   ? 33.239  -32.284 -31.525 1.00 45.16 ? 754 HOH B O     1 
HETATM 9703  O  O     . HOH Z  8 .   ? 46.258  -5.312  -70.492 1.00 32.21 ? 755 HOH B O     1 
HETATM 9704  O  O     . HOH Z  8 .   ? 30.812  -4.853  -25.982 1.00 31.93 ? 756 HOH B O     1 
HETATM 9705  O  O     . HOH Z  8 .   ? 50.194  0.932   -13.245 1.00 32.38 ? 757 HOH B O     1 
HETATM 9706  O  O     . HOH Z  8 .   ? 70.181  -9.952  -45.784 1.00 43.68 ? 758 HOH B O     1 
HETATM 9707  O  O     . HOH Z  8 .   ? 54.075  -0.223  -14.906 1.00 34.91 ? 759 HOH B O     1 
HETATM 9708  O  O     . HOH Z  8 .   ? 61.877  -25.695 -38.052 1.00 35.80 ? 760 HOH B O     1 
HETATM 9709  O  O     . HOH Z  8 .   ? 53.821  -4.752  -61.163 1.00 39.68 ? 761 HOH B O     1 
HETATM 9710  O  O     . HOH Z  8 .   ? 30.460  -17.835 -48.576 1.00 58.90 ? 762 HOH B O     1 
HETATM 9711  O  O     . HOH Z  8 .   ? 56.839  -23.986 -52.434 1.00 42.24 ? 763 HOH B O     1 
HETATM 9712  O  O     . HOH Z  8 .   ? 70.834  -11.136 -49.364 1.00 42.47 ? 764 HOH B O     1 
HETATM 9713  O  O     . HOH Z  8 .   ? 44.656  -25.361 -49.783 1.00 43.52 ? 765 HOH B O     1 
HETATM 9714  O  O     . HOH Z  8 .   ? 61.763  1.183   -18.667 1.00 35.35 ? 766 HOH B O     1 
HETATM 9715  O  O     . HOH Z  8 .   ? 25.631  -13.957 -37.986 1.00 36.97 ? 767 HOH B O     1 
HETATM 9716  O  O     . HOH Z  8 .   ? 32.893  -19.910 -48.135 1.00 35.50 ? 768 HOH B O     1 
HETATM 9717  O  O     . HOH Z  8 .   ? 43.843  -2.878  -33.468 1.00 24.32 ? 769 HOH B O     1 
HETATM 9718  O  O     . HOH Z  8 .   ? 67.284  -20.518 -41.870 1.00 38.97 ? 770 HOH B O     1 
HETATM 9719  O  O     . HOH Z  8 .   ? 32.001  -6.399  -24.100 1.00 34.63 ? 771 HOH B O     1 
HETATM 9720  O  O     . HOH Z  8 .   ? 65.005  -0.111  -21.054 1.00 36.68 ? 772 HOH B O     1 
HETATM 9721  O  O     . HOH Z  8 .   ? 56.128  3.700   -57.780 1.00 38.09 ? 773 HOH B O     1 
HETATM 9722  O  O     . HOH Z  8 .   ? 27.063  -6.403  -37.608 1.00 33.27 ? 774 HOH B O     1 
HETATM 9723  O  O     . HOH Z  8 .   ? 49.643  -6.975  -65.774 1.00 41.49 ? 775 HOH B O     1 
HETATM 9724  O  O     . HOH Z  8 .   ? 45.442  -4.534  -34.943 1.00 30.58 ? 776 HOH B O     1 
HETATM 9725  O  O     . HOH Z  8 .   ? 69.046  -10.839 -27.797 1.00 40.98 ? 777 HOH B O     1 
HETATM 9726  O  O     . HOH Z  8 .   ? 68.941  -2.111  -47.418 1.00 28.88 ? 778 HOH B O     1 
HETATM 9727  O  O     . HOH Z  8 .   ? 49.255  -24.013 -53.139 1.00 42.47 ? 779 HOH B O     1 
HETATM 9728  O  O     . HOH Z  8 .   ? 35.334  -20.667 -48.142 1.00 38.56 ? 780 HOH B O     1 
HETATM 9729  O  O     . HOH Z  8 .   ? 67.033  -6.330  -31.882 1.00 35.06 ? 781 HOH B O     1 
HETATM 9730  O  O     . HOH Z  8 .   ? 66.875  2.482   -48.403 1.00 44.47 ? 782 HOH B O     1 
HETATM 9731  O  O     . HOH Z  8 .   ? 31.907  2.322   -51.394 1.00 49.29 ? 783 HOH B O     1 
HETATM 9732  O  O     . HOH Z  8 .   ? 48.470  17.779  -25.959 1.00 36.48 ? 784 HOH B O     1 
HETATM 9733  O  O     . HOH Z  8 .   ? 47.686  -29.084 -43.748 1.00 47.68 ? 785 HOH B O     1 
HETATM 9734  O  O     . HOH Z  8 .   ? 30.404  -0.566  -48.998 1.00 38.44 ? 786 HOH B O     1 
HETATM 9735  O  O     . HOH Z  8 .   ? 37.143  3.104   -52.357 1.00 55.48 ? 787 HOH B O     1 
HETATM 9736  O  O     . HOH Z  8 .   ? 35.832  5.016   -19.671 1.00 35.82 ? 788 HOH B O     1 
HETATM 9737  O  O     . HOH Z  8 .   ? 68.713  -15.604 -27.525 1.00 40.29 ? 789 HOH B O     1 
HETATM 9738  O  O     . HOH Z  8 .   ? 54.316  -22.987 -54.098 1.00 34.27 ? 790 HOH B O     1 
HETATM 9739  O  O     . HOH Z  8 .   ? 45.604  5.542   -12.143 1.00 34.52 ? 791 HOH B O     1 
HETATM 9740  O  O     . HOH Z  8 .   ? 46.675  15.595  -22.906 1.00 36.62 ? 792 HOH B O     1 
HETATM 9741  O  O     . HOH Z  8 .   ? 45.385  8.666   -31.953 1.00 49.98 ? 793 HOH B O     1 
HETATM 9742  O  O     . HOH Z  8 .   ? 38.678  -10.049 -11.854 1.00 44.60 ? 794 HOH B O     1 
HETATM 9743  O  O     . HOH Z  8 .   ? 61.922  3.663   -36.953 1.00 35.59 ? 795 HOH B O     1 
HETATM 9744  O  O     . HOH Z  8 .   ? 45.513  -24.202 -18.005 1.00 37.93 ? 796 HOH B O     1 
HETATM 9745  O  O     . HOH Z  8 .   ? 55.228  3.283   -60.227 1.00 47.70 ? 797 HOH B O     1 
HETATM 9746  O  O     . HOH Z  8 .   ? 27.740  -3.036  -45.124 1.00 38.19 ? 798 HOH B O     1 
HETATM 9747  O  O     . HOH Z  8 .   ? 53.384  11.024  -32.451 1.00 42.32 ? 799 HOH B O     1 
HETATM 9748  O  O     . HOH Z  8 .   ? 68.294  -3.699  -27.809 1.00 53.80 ? 800 HOH B O     1 
HETATM 9749  O  O     . HOH Z  8 .   ? 42.668  -24.730 -51.484 1.00 60.46 ? 801 HOH B O     1 
HETATM 9750  O  O     . HOH Z  8 .   ? 67.630  -0.045  -27.042 1.00 42.52 ? 802 HOH B O     1 
HETATM 9751  O  O     . HOH Z  8 .   ? 66.892  -9.195  -31.552 1.00 40.91 ? 803 HOH B O     1 
HETATM 9752  O  O     . HOH Z  8 .   ? 41.507  4.767   -12.877 1.00 43.04 ? 804 HOH B O     1 
HETATM 9753  O  O     . HOH Z  8 .   ? 54.834  -30.673 -39.893 1.00 58.13 ? 805 HOH B O     1 
HETATM 9754  O  O     . HOH Z  8 .   ? 48.844  -30.011 -20.721 1.00 51.69 ? 806 HOH B O     1 
HETATM 9755  O  O     . HOH Z  8 .   ? 68.343  0.727   -47.151 1.00 47.65 ? 807 HOH B O     1 
HETATM 9756  O  O     . HOH Z  8 .   ? 39.707  7.126   -22.207 1.00 42.08 ? 808 HOH B O     1 
HETATM 9757  O  O     . HOH Z  8 .   ? 22.934  -13.803 -40.105 1.00 38.78 ? 809 HOH B O     1 
HETATM 9758  O  O     . HOH Z  8 .   ? 56.731  6.764   -35.733 1.00 43.49 ? 810 HOH B O     1 
HETATM 9759  O  O     . HOH Z  8 .   ? 25.217  -8.143  -38.453 1.00 47.82 ? 811 HOH B O     1 
HETATM 9760  O  O     . HOH Z  8 .   ? 68.284  -10.123 -23.546 1.00 44.73 ? 812 HOH B O     1 
HETATM 9761  O  O     . HOH Z  8 .   ? 38.460  -26.338 -42.250 1.00 47.93 ? 813 HOH B O     1 
HETATM 9762  O  O     . HOH Z  8 .   ? 62.468  0.898   -53.705 1.00 43.44 ? 814 HOH B O     1 
HETATM 9763  O  O     . HOH Z  8 .   ? 68.919  -4.913  -23.005 1.00 49.50 ? 815 HOH B O     1 
HETATM 9764  O  O     . HOH Z  8 .   ? 30.000  -7.249  -22.645 1.00 48.50 ? 816 HOH B O     1 
HETATM 9765  O  O     . HOH Z  8 .   ? 58.702  -25.736 -35.147 1.00 27.29 ? 817 HOH B O     1 
HETATM 9766  O  O     . HOH Z  8 .   ? 37.484  -26.417 -44.758 1.00 37.52 ? 818 HOH B O     1 
HETATM 9767  O  O     . HOH Z  8 .   ? 39.837  -0.366  -16.158 1.00 29.94 ? 819 HOH B O     1 
HETATM 9768  O  O     . HOH Z  8 .   ? 38.239  -20.447 -51.827 1.00 31.01 ? 820 HOH B O     1 
HETATM 9769  O  O     . HOH Z  8 .   ? 31.358  0.255   -27.094 1.00 44.81 ? 821 HOH B O     1 
HETATM 9770  O  O     . HOH Z  8 .   ? 64.367  -11.141 -26.105 1.00 33.15 ? 822 HOH B O     1 
HETATM 9771  O  O     . HOH Z  8 .   ? 38.648  1.442   -39.931 1.00 19.49 ? 823 HOH B O     1 
HETATM 9772  O  O     . HOH Z  8 .   ? 35.839  -0.305  -24.679 1.00 13.20 ? 824 HOH B O     1 
HETATM 9773  O  O     . HOH Z  8 .   ? 22.552  -18.101 -41.303 1.00 47.05 ? 825 HOH B O     1 
HETATM 9774  O  O     . HOH Z  8 .   ? 65.620  -10.510 -23.802 1.00 51.57 ? 826 HOH B O     1 
HETATM 9775  O  O     . HOH Z  8 .   ? 40.732  4.864   -20.748 1.00 47.61 ? 827 HOH B O     1 
HETATM 9776  O  O     . HOH Z  8 .   ? 65.242  5.876   -26.322 1.00 16.95 ? 828 HOH B O     1 
HETATM 9777  O  O     . HOH Z  8 .   ? 64.773  7.817   -27.955 1.00 28.29 ? 829 HOH B O     1 
HETATM 9778  O  O     . HOH Z  8 .   ? 61.098  9.463   -30.083 1.00 41.38 ? 830 HOH B O     1 
HETATM 9779  O  O     . HOH Z  8 .   ? 61.615  10.572  -22.136 1.00 50.51 ? 831 HOH B O     1 
HETATM 9780  O  O     . HOH Z  8 .   ? 48.011  -24.501 -50.769 1.00 35.73 ? 832 HOH B O     1 
HETATM 9781  O  O     . HOH Z  8 .   ? 30.073  -1.925  -44.317 1.00 49.37 ? 833 HOH B O     1 
HETATM 9782  O  O     . HOH Z  8 .   ? 37.377  4.404   -48.881 1.00 50.78 ? 834 HOH B O     1 
HETATM 9783  O  O     . HOH Z  8 .   ? 19.738  -10.464 -31.699 1.00 39.93 ? 835 HOH B O     1 
HETATM 9784  O  O     . HOH Z  8 .   ? 38.726  -3.186  -15.970 1.00 43.30 ? 836 HOH B O     1 
HETATM 9785  O  O     . HOH Z  8 .   ? 46.220  -4.119  -13.493 1.00 40.10 ? 837 HOH B O     1 
HETATM 9786  O  O     . HOH AA 8 .   ? 2.246   -18.314 -36.991 1.00 13.47 ? 501 HOH C O     1 
HETATM 9787  O  O     . HOH AA 8 .   ? -2.232  -40.494 -49.411 1.00 14.31 ? 502 HOH C O     1 
HETATM 9788  O  O     . HOH AA 8 .   ? -9.443  -30.830 -45.852 1.00 17.31 ? 503 HOH C O     1 
HETATM 9789  O  O     . HOH AA 8 .   ? 19.586  -20.861 -45.643 1.00 12.55 ? 504 HOH C O     1 
HETATM 9790  O  O     . HOH AA 8 .   ? 7.018   -13.501 -33.849 1.00 11.43 ? 505 HOH C O     1 
HETATM 9791  O  O     . HOH AA 8 .   ? 24.359  -30.634 -32.659 1.00 10.44 ? 506 HOH C O     1 
HETATM 9792  O  O     . HOH AA 8 .   ? 12.137  -33.205 -44.955 1.00 13.75 ? 507 HOH C O     1 
HETATM 9793  O  O     . HOH AA 8 .   ? 5.640   -30.652 -50.596 1.00 14.05 ? 508 HOH C O     1 
HETATM 9794  O  O     . HOH AA 8 .   ? -3.224  -27.539 -36.732 1.00 15.61 ? 509 HOH C O     1 
HETATM 9795  O  O     . HOH AA 8 .   ? -5.777  -23.245 -43.905 1.00 14.33 ? 510 HOH C O     1 
HETATM 9796  O  O     . HOH AA 8 .   ? 1.830   -21.929 -31.366 1.00 13.87 ? 511 HOH C O     1 
HETATM 9797  O  O     . HOH AA 8 .   ? 7.337   -32.804 -50.401 1.00 13.85 ? 512 HOH C O     1 
HETATM 9798  O  O     . HOH AA 8 .   ? 11.577  -31.432 -56.876 1.00 18.56 ? 513 HOH C O     1 
HETATM 9799  O  O     . HOH AA 8 .   ? -2.915  -27.394 -33.848 1.00 15.96 ? 514 HOH C O     1 
HETATM 9800  O  O     . HOH AA 8 .   ? 23.959  -26.552 -36.248 1.00 17.28 ? 515 HOH C O     1 
HETATM 9801  O  O     . HOH AA 8 .   ? 13.015  -16.012 -33.689 1.00 15.52 ? 516 HOH C O     1 
HETATM 9802  O  O     . HOH AA 8 .   ? 12.641  -30.787 -46.583 1.00 14.09 ? 517 HOH C O     1 
HETATM 9803  O  O     . HOH AA 8 .   ? 23.529  -26.232 -50.262 1.00 20.66 ? 518 HOH C O     1 
HETATM 9804  O  O     . HOH AA 8 .   ? -6.166  -32.830 -50.848 1.00 17.00 ? 519 HOH C O     1 
HETATM 9805  O  O     . HOH AA 8 .   ? 7.013   -16.120 -35.945 1.00 18.55 ? 520 HOH C O     1 
HETATM 9806  O  O     . HOH AA 8 .   ? 13.616  -10.625 -29.492 1.00 14.79 ? 521 HOH C O     1 
HETATM 9807  O  O     . HOH AA 8 .   ? 0.442   -37.492 -50.196 1.00 13.62 ? 522 HOH C O     1 
HETATM 9808  O  O     . HOH AA 8 .   ? 14.163  -29.077 -31.741 1.00 19.04 ? 523 HOH C O     1 
HETATM 9809  O  O     . HOH AA 8 .   ? -0.222  -11.261 -33.393 1.00 17.32 ? 524 HOH C O     1 
HETATM 9810  O  O     . HOH AA 8 .   ? 14.282  -17.528 -30.842 1.00 18.31 ? 525 HOH C O     1 
HETATM 9811  O  O     . HOH AA 8 .   ? 13.413  -26.200 -32.448 1.00 20.94 ? 526 HOH C O     1 
HETATM 9812  O  O     . HOH AA 8 .   ? 5.805   -35.149 -50.759 1.00 15.16 ? 527 HOH C O     1 
HETATM 9813  O  O     . HOH AA 8 .   ? 12.773  -29.477 -55.261 1.00 17.31 ? 528 HOH C O     1 
HETATM 9814  O  O     . HOH AA 8 .   ? 25.859  -32.773 -48.150 1.00 19.81 ? 529 HOH C O     1 
HETATM 9815  O  O     . HOH AA 8 .   ? -4.477  -12.960 -29.365 1.00 19.53 ? 530 HOH C O     1 
HETATM 9816  O  O     . HOH AA 8 .   ? -6.000  -39.615 -55.492 1.00 23.11 ? 531 HOH C O     1 
HETATM 9817  O  O     . HOH AA 8 .   ? 21.221  -18.868 -46.061 1.00 19.04 ? 532 HOH C O     1 
HETATM 9818  O  O     . HOH AA 8 .   ? 18.849  -20.073 -57.668 1.00 17.56 ? 533 HOH C O     1 
HETATM 9819  O  O     . HOH AA 8 .   ? 26.815  -30.535 -31.648 1.00 18.72 ? 534 HOH C O     1 
HETATM 9820  O  O     . HOH AA 8 .   ? -8.732  -33.484 -51.542 1.00 14.40 ? 535 HOH C O     1 
HETATM 9821  O  O     . HOH AA 8 .   ? 3.080   -20.299 -38.954 1.00 14.49 ? 536 HOH C O     1 
HETATM 9822  O  O     . HOH AA 8 .   ? 25.927  -45.553 -39.588 1.00 27.75 ? 537 HOH C O     1 
HETATM 9823  O  O     . HOH AA 8 .   ? -4.441  -34.490 -39.545 1.00 25.11 ? 538 HOH C O     1 
HETATM 9824  O  O     . HOH AA 8 .   ? -12.087 -26.053 -57.826 1.00 24.12 ? 539 HOH C O     1 
HETATM 9825  O  O     . HOH AA 8 .   ? 19.222  -15.819 -37.938 1.00 24.38 ? 540 HOH C O     1 
HETATM 9826  O  O     . HOH AA 8 .   ? -5.084  -40.328 -53.117 1.00 26.33 ? 541 HOH C O     1 
HETATM 9827  O  O     . HOH AA 8 .   ? 24.900  -17.874 -46.296 1.00 21.44 ? 542 HOH C O     1 
HETATM 9828  O  O     . HOH AA 8 .   ? 28.136  -32.453 -32.886 1.00 26.45 ? 543 HOH C O     1 
HETATM 9829  O  O     . HOH AA 8 .   ? 4.913   -36.318 -35.859 1.00 17.59 ? 544 HOH C O     1 
HETATM 9830  O  O     . HOH AA 8 .   ? 12.371  -44.331 -51.092 1.00 24.01 ? 545 HOH C O     1 
HETATM 9831  O  O     . HOH AA 8 .   ? 9.458   -37.297 -60.134 1.00 21.43 ? 546 HOH C O     1 
HETATM 9832  O  O     . HOH AA 8 .   ? -2.309  -24.881 -28.135 1.00 24.36 ? 547 HOH C O     1 
HETATM 9833  O  O     . HOH AA 8 .   ? -11.412 -37.029 -59.765 1.00 24.05 ? 548 HOH C O     1 
HETATM 9834  O  O     . HOH AA 8 .   ? 17.661  -44.002 -45.101 1.00 22.25 ? 549 HOH C O     1 
HETATM 9835  O  O     . HOH AA 8 .   ? -15.644 -15.827 -42.833 1.00 23.33 ? 550 HOH C O     1 
HETATM 9836  O  O     . HOH AA 8 .   ? -5.015  -28.462 -32.514 1.00 19.84 ? 551 HOH C O     1 
HETATM 9837  O  O     . HOH AA 8 .   ? 5.297   -42.566 -50.012 1.00 19.48 ? 552 HOH C O     1 
HETATM 9838  O  O     . HOH AA 8 .   ? 7.902   -26.919 -58.313 1.00 17.18 ? 553 HOH C O     1 
HETATM 9839  O  O     . HOH AA 8 .   ? 3.666   -17.166 -26.417 1.00 25.06 ? 554 HOH C O     1 
HETATM 9840  O  O     . HOH AA 8 .   ? 20.130  -15.003 -42.799 1.00 29.67 ? 555 HOH C O     1 
HETATM 9841  O  O     . HOH AA 8 .   ? 4.964   -4.334  -48.601 1.00 23.96 ? 556 HOH C O     1 
HETATM 9842  O  O     . HOH AA 8 .   ? 10.559  -46.160 -39.659 1.00 21.85 ? 557 HOH C O     1 
HETATM 9843  O  O     . HOH AA 8 .   ? 8.850   -36.211 -64.242 1.00 30.11 ? 558 HOH C O     1 
HETATM 9844  O  O     . HOH AA 8 .   ? -4.804  -34.679 -36.419 1.00 22.43 ? 559 HOH C O     1 
HETATM 9845  O  O     . HOH AA 8 .   ? -18.768 -26.810 -45.470 1.00 26.28 ? 560 HOH C O     1 
HETATM 9846  O  O     . HOH AA 8 .   ? -8.686  -16.576 -50.077 1.00 23.29 ? 561 HOH C O     1 
HETATM 9847  O  O     . HOH AA 8 .   ? -12.926 -33.025 -60.063 1.00 27.01 ? 562 HOH C O     1 
HETATM 9848  O  O     . HOH AA 8 .   ? 25.076  -15.033 -50.156 1.00 20.73 ? 563 HOH C O     1 
HETATM 9849  O  O     . HOH AA 8 .   ? 16.850  -8.312  -53.807 1.00 23.59 ? 564 HOH C O     1 
HETATM 9850  O  O     . HOH AA 8 .   ? 11.567  -24.949 -35.565 1.00 22.85 ? 565 HOH C O     1 
HETATM 9851  O  O     . HOH AA 8 .   ? 20.465  -31.653 -31.118 1.00 24.19 ? 566 HOH C O     1 
HETATM 9852  O  O     . HOH AA 8 .   ? 15.316  -19.779 -33.999 1.00 19.47 ? 567 HOH C O     1 
HETATM 9853  O  O     . HOH AA 8 .   ? -2.356  -15.101 -33.053 1.00 22.23 ? 568 HOH C O     1 
HETATM 9854  O  O     . HOH AA 8 .   ? 22.394  -8.858  -45.339 1.00 22.83 ? 569 HOH C O     1 
HETATM 9855  O  O     . HOH AA 8 .   ? 15.184  -14.383 -33.516 1.00 18.03 ? 570 HOH C O     1 
HETATM 9856  O  O     . HOH AA 8 .   ? 6.377   -5.837  -30.595 1.00 23.10 ? 571 HOH C O     1 
HETATM 9857  O  O     . HOH AA 8 .   ? 9.080   -29.647 -56.973 1.00 21.76 ? 572 HOH C O     1 
HETATM 9858  O  O     . HOH AA 8 .   ? 3.365   -44.368 -48.999 1.00 20.19 ? 573 HOH C O     1 
HETATM 9859  O  O     . HOH AA 8 .   ? 22.914  -30.687 -30.401 1.00 31.31 ? 574 HOH C O     1 
HETATM 9860  O  O     . HOH AA 8 .   ? 19.781  -41.625 -44.131 1.00 32.48 ? 575 HOH C O     1 
HETATM 9861  O  O     . HOH AA 8 .   ? 18.866  -23.727 -59.844 1.00 29.89 ? 576 HOH C O     1 
HETATM 9862  O  O     . HOH AA 8 .   ? -3.054  -12.589 -26.901 1.00 29.96 ? 577 HOH C O     1 
HETATM 9863  O  O     . HOH AA 8 .   ? 5.726   -9.082  -58.748 1.00 40.50 ? 578 HOH C O     1 
HETATM 9864  O  O     . HOH AA 8 .   ? -9.630  -23.233 -64.999 1.00 27.41 ? 579 HOH C O     1 
HETATM 9865  O  O     . HOH AA 8 .   ? 3.049   -11.014 -57.594 1.00 32.68 ? 580 HOH C O     1 
HETATM 9866  O  O     . HOH AA 8 .   ? -13.295 -32.840 -46.440 1.00 36.76 ? 581 HOH C O     1 
HETATM 9867  O  O     . HOH AA 8 .   ? 9.052   -5.569  -31.694 1.00 30.27 ? 582 HOH C O     1 
HETATM 9868  O  O     . HOH AA 8 .   ? -15.902 -33.638 -47.019 1.00 43.22 ? 583 HOH C O     1 
HETATM 9869  O  O     . HOH AA 8 .   ? -3.155  -3.730  -47.796 1.00 33.74 ? 584 HOH C O     1 
HETATM 9870  O  O     . HOH AA 8 .   ? 5.089   -42.966 -62.971 1.00 37.14 ? 585 HOH C O     1 
HETATM 9871  O  O     . HOH AA 8 .   ? 23.958  -37.651 -34.438 1.00 28.98 ? 586 HOH C O     1 
HETATM 9872  O  O     . HOH AA 8 .   ? 27.725  -28.132 -39.682 1.00 26.31 ? 587 HOH C O     1 
HETATM 9873  O  O     . HOH AA 8 .   ? 23.531  -37.349 -50.459 1.00 33.03 ? 588 HOH C O     1 
HETATM 9874  O  O     . HOH AA 8 .   ? -6.454  -41.180 -57.913 1.00 33.97 ? 589 HOH C O     1 
HETATM 9875  O  O     . HOH AA 8 .   ? 18.821  -41.516 -46.533 1.00 34.71 ? 590 HOH C O     1 
HETATM 9876  O  O     . HOH AA 8 .   ? 2.470   -4.752  -49.319 1.00 29.51 ? 591 HOH C O     1 
HETATM 9877  O  O     . HOH AA 8 .   ? 18.490  -40.701 -53.592 1.00 27.47 ? 592 HOH C O     1 
HETATM 9878  O  O     . HOH AA 8 .   ? 7.761   -11.423 -24.883 1.00 30.27 ? 593 HOH C O     1 
HETATM 9879  O  O     . HOH AA 8 .   ? 19.540  -25.440 -61.562 1.00 34.84 ? 594 HOH C O     1 
HETATM 9880  O  O     . HOH AA 8 .   ? 5.458   -23.056 -32.884 1.00 23.12 ? 595 HOH C O     1 
HETATM 9881  O  O     . HOH AA 8 .   ? 4.656   -42.137 -53.111 1.00 30.24 ? 596 HOH C O     1 
HETATM 9882  O  O     . HOH AA 8 .   ? -16.433 -24.686 -50.235 1.00 19.28 ? 597 HOH C O     1 
HETATM 9883  O  O     . HOH AA 8 .   ? 18.963  -44.405 -47.459 1.00 24.02 ? 598 HOH C O     1 
HETATM 9884  O  O     . HOH AA 8 .   ? 18.397  -27.023 -64.381 1.00 40.19 ? 599 HOH C O     1 
HETATM 9885  O  O     . HOH AA 8 .   ? 2.440   -4.111  -51.924 1.00 36.78 ? 600 HOH C O     1 
HETATM 9886  O  O     . HOH AA 8 .   ? 29.319  -31.235 -37.638 1.00 32.25 ? 601 HOH C O     1 
HETATM 9887  O  O     . HOH AA 8 .   ? -14.792 -25.502 -58.123 1.00 33.67 ? 602 HOH C O     1 
HETATM 9888  O  O     . HOH AA 8 .   ? 7.623   -16.777 -66.638 1.00 24.96 ? 603 HOH C O     1 
HETATM 9889  O  O     . HOH AA 8 .   ? 19.171  -19.660 -62.037 1.00 35.06 ? 604 HOH C O     1 
HETATM 9890  O  O     . HOH AA 8 .   ? 13.343  -22.767 -30.442 1.00 39.26 ? 605 HOH C O     1 
HETATM 9891  O  O     . HOH AA 8 .   ? 13.667  -48.946 -51.588 1.00 37.32 ? 606 HOH C O     1 
HETATM 9892  O  O     . HOH AA 8 .   ? 12.757  -23.659 -68.744 1.00 30.88 ? 607 HOH C O     1 
HETATM 9893  O  O     . HOH AA 8 .   ? -9.716  -14.107 -50.145 1.00 24.71 ? 608 HOH C O     1 
HETATM 9894  O  O     . HOH AA 8 .   ? -8.262  -5.244  -44.080 1.00 42.37 ? 609 HOH C O     1 
HETATM 9895  O  O     . HOH AA 8 .   ? 12.264  -19.112 -31.220 1.00 31.43 ? 610 HOH C O     1 
HETATM 9896  O  O     . HOH AA 8 .   ? 23.065  -31.663 -56.519 1.00 37.66 ? 611 HOH C O     1 
HETATM 9897  O  O     . HOH AA 8 .   ? -9.933  -21.350 -30.781 1.00 43.01 ? 612 HOH C O     1 
HETATM 9898  O  O     . HOH AA 8 .   ? 5.042   -35.151 -33.502 1.00 27.66 ? 613 HOH C O     1 
HETATM 9899  O  O     . HOH AA 8 .   ? -1.574  -36.863 -34.360 1.00 35.16 ? 614 HOH C O     1 
HETATM 9900  O  O     . HOH AA 8 .   ? 17.956  -21.081 -60.041 1.00 26.53 ? 615 HOH C O     1 
HETATM 9901  O  O     . HOH AA 8 .   ? -12.063 -27.590 -33.750 1.00 34.04 ? 616 HOH C O     1 
HETATM 9902  O  O     . HOH AA 8 .   ? 12.349  -10.451 -57.307 1.00 42.01 ? 617 HOH C O     1 
HETATM 9903  O  O     . HOH AA 8 .   ? 5.953   -25.222 -31.494 1.00 29.24 ? 618 HOH C O     1 
HETATM 9904  O  O     . HOH AA 8 .   ? 9.055   -4.209  -34.201 1.00 31.19 ? 619 HOH C O     1 
HETATM 9905  O  O     . HOH AA 8 .   ? -0.932  -21.107 -26.050 1.00 40.15 ? 620 HOH C O     1 
HETATM 9906  O  O     . HOH AA 8 .   ? 14.952  -6.808  -35.636 1.00 30.05 ? 621 HOH C O     1 
HETATM 9907  O  O     . HOH AA 8 .   ? -18.508 -21.384 -50.116 1.00 28.44 ? 622 HOH C O     1 
HETATM 9908  O  O     . HOH AA 8 .   ? -20.583 -19.089 -31.892 1.00 31.70 ? 623 HOH C O     1 
HETATM 9909  O  O     . HOH AA 8 .   ? 21.197  -10.451 -60.705 1.00 49.88 ? 624 HOH C O     1 
HETATM 9910  O  O     . HOH AA 8 .   ? -22.808 -25.638 -42.828 1.00 37.11 ? 625 HOH C O     1 
HETATM 9911  O  O     . HOH AA 8 .   ? 28.401  -31.955 -47.703 1.00 34.24 ? 626 HOH C O     1 
HETATM 9912  O  O     . HOH AA 8 .   ? 19.463  -20.643 -37.258 1.00 27.18 ? 627 HOH C O     1 
HETATM 9913  O  O     . HOH AA 8 .   ? -8.576  -20.953 -65.692 1.00 36.55 ? 628 HOH C O     1 
HETATM 9914  O  O     . HOH AA 8 .   ? 6.944   -42.102 -54.469 1.00 36.86 ? 629 HOH C O     1 
HETATM 9915  O  O     . HOH AA 8 .   ? 25.029  -30.938 -53.079 1.00 45.62 ? 630 HOH C O     1 
HETATM 9916  O  O     . HOH AA 8 .   ? 21.299  -24.780 -50.660 1.00 39.05 ? 631 HOH C O     1 
HETATM 9917  O  O     . HOH AA 8 .   ? -12.552 -10.835 -30.347 1.00 28.60 ? 632 HOH C O     1 
HETATM 9918  O  O     . HOH AA 8 .   ? 13.463  -45.354 -30.151 1.00 42.26 ? 633 HOH C O     1 
HETATM 9919  O  O     . HOH AA 8 .   ? -6.481  -6.196  -50.692 1.00 35.87 ? 634 HOH C O     1 
HETATM 9920  O  O     . HOH AA 8 .   ? 17.078  -50.646 -47.546 1.00 43.14 ? 635 HOH C O     1 
HETATM 9921  O  O     . HOH AA 8 .   ? -10.857 -18.623 -50.718 1.00 30.57 ? 636 HOH C O     1 
HETATM 9922  O  O     . HOH AA 8 .   ? -2.394  -46.488 -43.623 1.00 43.14 ? 637 HOH C O     1 
HETATM 9923  O  O     . HOH AA 8 .   ? 2.786   -44.034 -54.053 1.00 33.75 ? 638 HOH C O     1 
HETATM 9924  O  O     . HOH AA 8 .   ? 25.507  -33.327 -50.757 1.00 31.81 ? 639 HOH C O     1 
HETATM 9925  O  O     . HOH AA 8 .   ? -15.604 -35.674 -49.013 1.00 38.57 ? 640 HOH C O     1 
HETATM 9926  O  O     . HOH AA 8 .   ? -3.829  -37.277 -39.227 1.00 34.16 ? 641 HOH C O     1 
HETATM 9927  O  O     . HOH AA 8 .   ? -1.046  -13.879 -25.691 1.00 45.09 ? 642 HOH C O     1 
HETATM 9928  O  O     . HOH AA 8 .   ? -14.730 -28.749 -35.475 1.00 37.51 ? 643 HOH C O     1 
HETATM 9929  O  O     . HOH AA 8 .   ? 17.753  -8.683  -31.246 1.00 37.97 ? 644 HOH C O     1 
HETATM 9930  O  O     . HOH AA 8 .   ? 21.775  -20.456 -49.136 1.00 34.25 ? 645 HOH C O     1 
HETATM 9931  O  O     . HOH AA 8 .   ? -4.948  -33.627 -74.165 1.00 36.95 ? 646 HOH C O     1 
HETATM 9932  O  O     . HOH AA 8 .   ? 14.353  -9.351  -54.113 1.00 34.15 ? 647 HOH C O     1 
HETATM 9933  O  O     . HOH AA 8 .   ? 27.571  -9.899  -54.500 1.00 37.64 ? 648 HOH C O     1 
HETATM 9934  O  O     . HOH AA 8 .   ? -16.102 -27.878 -67.891 1.00 37.17 ? 649 HOH C O     1 
HETATM 9935  O  O     . HOH AA 8 .   ? 12.655  -47.572 -47.641 1.00 29.78 ? 650 HOH C O     1 
HETATM 9936  O  O     . HOH AA 8 .   ? 10.889  -46.232 -54.588 1.00 35.78 ? 651 HOH C O     1 
HETATM 9937  O  O     . HOH AA 8 .   ? 10.490  -46.919 -49.019 1.00 37.68 ? 652 HOH C O     1 
HETATM 9938  O  O     . HOH AA 8 .   ? -10.669 -23.914 -33.035 1.00 26.94 ? 653 HOH C O     1 
HETATM 9939  O  O     . HOH AA 8 .   ? 1.068   -37.673 -34.164 1.00 32.59 ? 654 HOH C O     1 
HETATM 9940  O  O     . HOH AA 8 .   ? -11.861 -35.052 -45.562 1.00 44.96 ? 655 HOH C O     1 
HETATM 9941  O  O     . HOH AA 8 .   ? -7.204  -20.663 -30.052 1.00 31.75 ? 656 HOH C O     1 
HETATM 9942  O  O     . HOH AA 8 .   ? 2.859   -36.772 -70.644 1.00 33.68 ? 657 HOH C O     1 
HETATM 9943  O  O     . HOH AA 8 .   ? 11.998  -46.849 -52.037 1.00 37.50 ? 658 HOH C O     1 
HETATM 9944  O  O     . HOH AA 8 .   ? 5.658   -11.290 -57.713 1.00 40.43 ? 659 HOH C O     1 
HETATM 9945  O  O     . HOH AA 8 .   ? 3.315   -0.693  -38.724 1.00 37.42 ? 660 HOH C O     1 
HETATM 9946  O  O     . HOH AA 8 .   ? 16.869  -16.240 -65.451 1.00 45.48 ? 661 HOH C O     1 
HETATM 9947  O  O     . HOH AA 8 .   ? 19.012  -47.178 -47.807 1.00 30.97 ? 662 HOH C O     1 
HETATM 9948  O  O     . HOH AA 8 .   ? 6.976   -29.530 -58.891 1.00 27.50 ? 663 HOH C O     1 
HETATM 9949  O  O     . HOH AA 8 .   ? -4.622  -31.342 -30.240 1.00 45.80 ? 664 HOH C O     1 
HETATM 9950  O  O     . HOH AA 8 .   ? -0.175  -8.911  -34.738 1.00 27.85 ? 665 HOH C O     1 
HETATM 9951  O  O     . HOH AA 8 .   ? 25.823  -35.505 -47.678 1.00 38.99 ? 666 HOH C O     1 
HETATM 9952  O  O     . HOH AA 8 .   ? -10.759 -5.255  -34.210 1.00 34.41 ? 667 HOH C O     1 
HETATM 9953  O  O     . HOH AA 8 .   ? 19.222  -32.290 -58.312 1.00 32.17 ? 668 HOH C O     1 
HETATM 9954  O  O     . HOH AA 8 .   ? 1.111   -42.746 -55.561 1.00 37.87 ? 669 HOH C O     1 
HETATM 9955  O  O     . HOH AA 8 .   ? -17.279 -23.555 -53.212 1.00 38.80 ? 670 HOH C O     1 
HETATM 9956  O  O     . HOH AA 8 .   ? -18.544 -13.827 -39.647 1.00 33.51 ? 671 HOH C O     1 
HETATM 9957  O  O     . HOH AA 8 .   ? 2.558   -14.923 -27.286 1.00 30.72 ? 672 HOH C O     1 
HETATM 9958  O  O     . HOH AA 8 .   ? 15.258  -33.863 -63.160 1.00 41.20 ? 673 HOH C O     1 
HETATM 9959  O  O     . HOH AA 8 .   ? -2.674  -12.373 -33.715 1.00 18.77 ? 674 HOH C O     1 
HETATM 9960  O  O     . HOH AA 8 .   ? 8.279   -40.106 -36.078 1.00 23.45 ? 675 HOH C O     1 
HETATM 9961  O  O     . HOH AA 8 .   ? 5.967   -38.988 -34.918 1.00 30.10 ? 676 HOH C O     1 
HETATM 9962  O  O     . HOH AA 8 .   ? -12.464 -35.218 -53.731 1.00 47.18 ? 677 HOH C O     1 
HETATM 9963  O  O     . HOH AA 8 .   ? 25.076  -9.620  -53.430 1.00 33.36 ? 678 HOH C O     1 
HETATM 9964  O  O     . HOH AA 8 .   ? 10.991  -6.268  -52.612 1.00 33.24 ? 679 HOH C O     1 
HETATM 9965  O  O     . HOH AA 8 .   ? 11.841  -5.605  -46.166 1.00 38.44 ? 680 HOH C O     1 
HETATM 9966  O  O     . HOH AA 8 .   ? -17.958 -15.081 -43.740 1.00 36.70 ? 681 HOH C O     1 
HETATM 9967  O  O     . HOH AA 8 .   ? 22.754  -53.138 -33.144 1.00 34.45 ? 682 HOH C O     1 
HETATM 9968  O  O     . HOH AA 8 .   ? 7.430   -31.157 -32.737 1.00 35.53 ? 683 HOH C O     1 
HETATM 9969  O  O     . HOH AA 8 .   ? -3.074  -41.873 -52.096 1.00 34.93 ? 684 HOH C O     1 
HETATM 9970  O  O     . HOH AA 8 .   ? -18.917 -24.155 -50.693 1.00 39.82 ? 685 HOH C O     1 
HETATM 9971  O  O     . HOH AA 8 .   ? 25.599  -23.369 -47.805 1.00 37.57 ? 686 HOH C O     1 
HETATM 9972  O  O     . HOH AA 8 .   ? -1.770  -10.134 -59.856 1.00 36.18 ? 687 HOH C O     1 
HETATM 9973  O  O     . HOH AA 8 .   ? 13.650  -30.696 -64.035 1.00 30.94 ? 688 HOH C O     1 
HETATM 9974  O  O     . HOH AA 8 .   ? 5.346   -38.814 -65.343 1.00 35.80 ? 689 HOH C O     1 
HETATM 9975  O  O     . HOH AA 8 .   ? 7.908   -6.952  -27.331 1.00 33.19 ? 690 HOH C O     1 
HETATM 9976  O  O     . HOH AA 8 .   ? 19.163  -34.793 -25.907 1.00 47.79 ? 691 HOH C O     1 
HETATM 9977  O  O     . HOH AA 8 .   ? 18.467  -36.226 -58.673 1.00 45.10 ? 692 HOH C O     1 
HETATM 9978  O  O     . HOH AA 8 .   ? -6.970  -36.776 -39.775 1.00 38.15 ? 693 HOH C O     1 
HETATM 9979  O  O     . HOH AA 8 .   ? -3.740  -11.482 -58.647 1.00 41.55 ? 694 HOH C O     1 
HETATM 9980  O  O     . HOH AA 8 .   ? -15.906 -13.298 -40.658 1.00 44.48 ? 695 HOH C O     1 
HETATM 9981  O  O     . HOH AA 8 .   ? 20.233  -10.575 -41.953 1.00 29.73 ? 696 HOH C O     1 
HETATM 9982  O  O     . HOH AA 8 .   ? -18.591 -30.783 -40.208 1.00 36.17 ? 697 HOH C O     1 
HETATM 9983  O  O     . HOH AA 8 .   ? -23.405 -18.460 -28.960 1.00 36.43 ? 698 HOH C O     1 
HETATM 9984  O  O     . HOH AA 8 .   ? 10.393  -24.630 -69.797 1.00 38.26 ? 699 HOH C O     1 
HETATM 9985  O  O     . HOH AA 8 .   ? -11.494 -35.614 -56.785 1.00 35.03 ? 700 HOH C O     1 
HETATM 9986  O  O     . HOH AA 8 .   ? -3.497  -36.870 -35.992 1.00 49.80 ? 701 HOH C O     1 
HETATM 9987  O  O     . HOH AA 8 .   ? 9.554   -1.757  -34.698 1.00 38.15 ? 702 HOH C O     1 
HETATM 9988  O  O     . HOH AA 8 .   ? 22.535  -22.077 -51.380 1.00 34.13 ? 703 HOH C O     1 
HETATM 9989  O  O     . HOH AA 8 .   ? -2.334  -33.882 -73.433 1.00 42.46 ? 704 HOH C O     1 
HETATM 9990  O  O     . HOH AA 8 .   ? 18.642  -8.918  -62.749 1.00 41.09 ? 705 HOH C O     1 
HETATM 9991  O  O     . HOH AA 8 .   ? -20.400 -21.313 -44.424 1.00 49.08 ? 706 HOH C O     1 
HETATM 9992  O  O     . HOH AA 8 .   ? -6.445  -3.360  -44.752 1.00 43.79 ? 707 HOH C O     1 
HETATM 9993  O  O     . HOH AA 8 .   ? 25.052  -50.883 -39.336 1.00 55.94 ? 708 HOH C O     1 
HETATM 9994  O  O     . HOH AA 8 .   ? 15.030  -29.175 -65.875 1.00 39.60 ? 709 HOH C O     1 
HETATM 9995  O  O     . HOH AA 8 .   ? 14.371  -4.917  -47.331 1.00 41.27 ? 710 HOH C O     1 
HETATM 9996  O  O     . HOH AA 8 .   ? -20.474 -25.038 -46.516 1.00 40.78 ? 711 HOH C O     1 
HETATM 9997  O  O     . HOH AA 8 .   ? 20.777  -21.494 -56.660 1.00 35.32 ? 712 HOH C O     1 
HETATM 9998  O  O     . HOH AA 8 .   ? -15.499 -23.176 -57.045 1.00 43.63 ? 713 HOH C O     1 
HETATM 9999  O  O     . HOH AA 8 .   ? 20.176  -8.371  -55.967 1.00 54.49 ? 714 HOH C O     1 
HETATM 10000 O  O     . HOH AA 8 .   ? -10.387 -9.629  -28.419 1.00 48.51 ? 715 HOH C O     1 
HETATM 10001 O  O     . HOH AA 8 .   ? -9.525  -18.894 -57.562 1.00 31.83 ? 716 HOH C O     1 
HETATM 10002 O  O     . HOH AA 8 .   ? 21.135  -21.276 -63.676 1.00 42.76 ? 717 HOH C O     1 
HETATM 10003 O  O     . HOH AA 8 .   ? 19.196  -22.363 -35.131 1.00 51.23 ? 718 HOH C O     1 
HETATM 10004 O  O     . HOH AA 8 .   ? 23.950  -40.025 -35.718 1.00 31.84 ? 719 HOH C O     1 
HETATM 10005 O  O     . HOH AA 8 .   ? 20.797  -14.887 -52.542 1.00 42.08 ? 720 HOH C O     1 
HETATM 10006 O  O     . HOH AA 8 .   ? 23.190  -14.120 -54.005 1.00 45.63 ? 721 HOH C O     1 
HETATM 10007 O  O     . HOH AA 8 .   ? -1.194  -43.453 -54.001 1.00 32.09 ? 722 HOH C O     1 
HETATM 10008 O  O     . HOH AA 8 .   ? 0.531   -47.496 -49.704 1.00 35.93 ? 723 HOH C O     1 
HETATM 10009 O  O     . HOH AA 8 .   ? 16.741  -52.197 -38.768 1.00 42.32 ? 724 HOH C O     1 
HETATM 10010 O  O     . HOH AA 8 .   ? 14.578  -9.215  -34.489 1.00 40.05 ? 725 HOH C O     1 
HETATM 10011 O  O     . HOH AA 8 .   ? 27.371  -16.306 -50.486 1.00 32.99 ? 726 HOH C O     1 
HETATM 10012 O  O     . HOH AA 8 .   ? -11.292 -13.055 -52.193 1.00 38.67 ? 727 HOH C O     1 
HETATM 10013 O  O     . HOH AA 8 .   ? -12.827 -25.225 -69.752 1.00 40.45 ? 728 HOH C O     1 
HETATM 10014 O  O     . HOH AA 8 .   ? 5.781   -5.385  -27.880 1.00 49.23 ? 729 HOH C O     1 
HETATM 10015 O  O     . HOH AA 8 .   ? 1.743   -5.100  -25.724 1.00 40.09 ? 730 HOH C O     1 
HETATM 10016 O  O     . HOH AA 8 .   ? 27.310  -25.875 -48.505 1.00 36.76 ? 731 HOH C O     1 
HETATM 10017 O  O     . HOH AA 8 .   ? 2.712   -14.146 -64.334 1.00 36.19 ? 732 HOH C O     1 
HETATM 10018 O  O     . HOH AA 8 .   ? -5.202  -3.199  -30.265 1.00 39.98 ? 733 HOH C O     1 
HETATM 10019 O  O     . HOH AA 8 .   ? -0.648  -2.356  -48.391 1.00 51.19 ? 734 HOH C O     1 
HETATM 10020 O  O     . HOH AA 8 .   ? 18.048  -37.729 -56.253 1.00 40.25 ? 735 HOH C O     1 
HETATM 10021 O  O     . HOH AA 8 .   ? -15.268 -33.183 -51.984 1.00 45.81 ? 736 HOH C O     1 
HETATM 10022 O  O     . HOH AA 8 .   ? -3.365  -10.017 -27.662 1.00 40.60 ? 737 HOH C O     1 
HETATM 10023 O  O     . HOH AA 8 .   ? -0.875  -35.985 -63.527 1.00 32.61 ? 738 HOH C O     1 
HETATM 10024 O  O     . HOH AA 8 .   ? -19.786 -14.099 -42.016 1.00 41.82 ? 739 HOH C O     1 
HETATM 10025 O  O     . HOH AA 8 .   ? 12.169  -9.944  -62.293 1.00 64.76 ? 740 HOH C O     1 
HETATM 10026 O  O     . HOH AA 8 .   ? -5.180  -28.375 -72.506 1.00 39.77 ? 741 HOH C O     1 
HETATM 10027 O  O     . HOH AA 8 .   ? -1.856  1.242   -34.808 1.00 44.31 ? 742 HOH C O     1 
HETATM 10028 O  O     . HOH AA 8 .   ? 4.120   -12.911 -25.881 1.00 44.17 ? 743 HOH C O     1 
HETATM 10029 O  O     . HOH AA 8 .   ? -7.538  -29.620 -72.002 1.00 40.21 ? 744 HOH C O     1 
HETATM 10030 O  O     . HOH AA 8 .   ? 14.730  -6.242  -61.600 1.00 51.85 ? 745 HOH C O     1 
HETATM 10031 O  O     . HOH AA 8 .   ? 20.297  -18.088 -58.731 1.00 44.53 ? 746 HOH C O     1 
HETATM 10032 O  O     . HOH AA 8 .   ? 16.203  -8.025  -63.270 1.00 55.23 ? 747 HOH C O     1 
HETATM 10033 O  O     . HOH AA 8 .   ? -23.157 -24.460 -40.403 1.00 41.16 ? 748 HOH C O     1 
HETATM 10034 O  O     . HOH AA 8 .   ? 14.901  -5.244  -50.404 1.00 46.82 ? 749 HOH C O     1 
HETATM 10035 O  O     . HOH AA 8 .   ? -10.867 -40.194 -52.347 1.00 47.37 ? 750 HOH C O     1 
HETATM 10036 O  O     . HOH AA 8 .   ? 11.483  -29.806 -31.183 1.00 33.41 ? 751 HOH C O     1 
HETATM 10037 O  O     . HOH AA 8 .   ? 3.064   -10.560 -54.358 1.00 35.30 ? 752 HOH C O     1 
HETATM 10038 O  O     . HOH AA 8 .   ? 20.034  -24.549 -57.696 1.00 33.75 ? 753 HOH C O     1 
HETATM 10039 O  O     . HOH AA 8 .   ? -20.480 -32.585 -41.379 1.00 35.24 ? 754 HOH C O     1 
HETATM 10040 O  O     . HOH AA 8 .   ? 3.483   -30.280 -44.452 1.00 23.62 ? 755 HOH C O     1 
HETATM 10041 O  O     . HOH AA 8 .   ? 3.495   -33.007 -44.255 1.00 34.00 ? 756 HOH C O     1 
HETATM 10042 O  O     . HOH AA 8 .   ? 4.239   -32.152 -32.513 1.00 40.76 ? 757 HOH C O     1 
HETATM 10043 O  O     . HOH AA 8 .   ? -0.164  -23.439 -28.328 1.00 22.81 ? 758 HOH C O     1 
HETATM 10044 O  O     . HOH AA 8 .   ? 26.420  -32.287 -40.298 1.00 34.17 ? 759 HOH C O     1 
HETATM 10045 O  O     . HOH AA 8 .   ? 4.566   -30.640 -35.233 1.00 42.53 ? 760 HOH C O     1 
HETATM 10046 O  O     . HOH AA 8 .   ? 18.716  -50.171 -45.516 1.00 43.26 ? 761 HOH C O     1 
HETATM 10047 O  O     . HOH AA 8 .   ? 20.779  -15.707 -40.231 1.00 70.85 ? 762 HOH C O     1 
HETATM 10048 O  O     . HOH AA 8 .   ? -8.999  -3.219  -34.297 1.00 43.93 ? 763 HOH C O     1 
HETATM 10049 O  O     . HOH AA 8 .   ? 12.566  -8.042  -60.375 1.00 56.45 ? 764 HOH C O     1 
HETATM 10050 O  O     . HOH AA 8 .   ? 10.700  -5.556  -27.463 1.00 43.71 ? 765 HOH C O     1 
HETATM 10051 O  O     . HOH AA 8 .   ? 17.423  -6.403  -51.736 1.00 39.23 ? 766 HOH C O     1 
HETATM 10052 O  O     . HOH AA 8 .   ? 1.241   -18.391 -25.699 1.00 51.01 ? 767 HOH C O     1 
HETATM 10053 O  O     . HOH AA 8 .   ? 1.441   -13.015 -25.240 1.00 48.47 ? 768 HOH C O     1 
HETATM 10054 O  O     . HOH AA 8 .   ? -1.604  -8.471  -25.991 1.00 42.09 ? 769 HOH C O     1 
HETATM 10055 O  O     . HOH AA 8 .   ? -3.818  -25.317 -71.427 1.00 48.30 ? 770 HOH C O     1 
HETATM 10056 O  O     . HOH AA 8 .   ? 13.001  -32.993 -65.221 1.00 43.87 ? 771 HOH C O     1 
HETATM 10057 O  O     . HOH AA 8 .   ? 10.517  -31.894 -67.133 1.00 47.14 ? 772 HOH C O     1 
HETATM 10058 O  O     . HOH AA 8 .   ? -4.789  -28.097 -28.914 1.00 46.00 ? 773 HOH C O     1 
HETATM 10059 O  O     . HOH AA 8 .   ? 5.953   -39.180 -32.245 1.00 36.05 ? 774 HOH C O     1 
HETATM 10060 O  O     . HOH AA 8 .   ? 29.981  -33.460 -46.103 1.00 51.93 ? 775 HOH C O     1 
HETATM 10061 O  O     . HOH AA 8 .   ? 29.294  -32.113 -41.522 1.00 49.32 ? 776 HOH C O     1 
HETATM 10062 O  O     . HOH AA 8 .   ? 4.201   -27.808 -32.190 1.00 38.41 ? 777 HOH C O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   12  12  GLY GLY A . n 
A 1 2   LYS 2   13  13  LYS LYS A . n 
A 1 3   LYS 3   14  14  LYS LYS A . n 
A 1 4   LYS 4   15  15  LYS LYS A . n 
A 1 5   VAL 5   16  16  VAL VAL A . n 
A 1 6   CYS 6   17  17  CYS CYS A . n 
A 1 7   TYR 7   18  18  TYR TYR A . n 
A 1 8   TYR 8   19  19  TYR TYR A . n 
A 1 9   TYR 9   20  20  TYR TYR A . n 
A 1 10  ASP 10  21  21  ASP ASP A . n 
A 1 11  GLY 11  22  22  GLY GLY A . n 
A 1 12  ASP 12  23  23  ASP ASP A . n 
A 1 13  ILE 13  24  24  ILE ILE A . n 
A 1 14  GLY 14  25  25  GLY GLY A . n 
A 1 15  ASN 15  26  26  ASN ASN A . n 
A 1 16  TYR 16  27  27  TYR TYR A . n 
A 1 17  TYR 17  28  28  TYR TYR A . n 
A 1 18  TYR 18  29  29  TYR TYR A . n 
A 1 19  GLY 19  30  30  GLY GLY A . n 
A 1 20  GLN 20  31  31  GLN GLN A . n 
A 1 21  GLY 21  32  32  GLY GLY A . n 
A 1 22  HIS 22  33  33  HIS HIS A . n 
A 1 23  PRO 23  34  34  PRO PRO A . n 
A 1 24  MET 24  35  35  MET MET A . n 
A 1 25  LYS 25  36  36  LYS LYS A . n 
A 1 26  PRO 26  37  37  PRO PRO A . n 
A 1 27  HIS 27  38  38  HIS HIS A . n 
A 1 28  ARG 28  39  39  ARG ARG A . n 
A 1 29  ILE 29  40  40  ILE ILE A . n 
A 1 30  ARG 30  41  41  ARG ARG A . n 
A 1 31  MET 31  42  42  MET MET A . n 
A 1 32  THR 32  43  43  THR THR A . n 
A 1 33  HIS 33  44  44  HIS HIS A . n 
A 1 34  ASN 34  45  45  ASN ASN A . n 
A 1 35  LEU 35  46  46  LEU LEU A . n 
A 1 36  LEU 36  47  47  LEU LEU A . n 
A 1 37  LEU 37  48  48  LEU LEU A . n 
A 1 38  ASN 38  49  49  ASN ASN A . n 
A 1 39  TYR 39  50  50  TYR TYR A . n 
A 1 40  GLY 40  51  51  GLY GLY A . n 
A 1 41  LEU 41  52  52  LEU LEU A . n 
A 1 42  TYR 42  53  53  TYR TYR A . n 
A 1 43  ARG 43  54  54  ARG ARG A . n 
A 1 44  LYS 44  55  55  LYS LYS A . n 
A 1 45  MET 45  56  56  MET MET A . n 
A 1 46  GLU 46  57  57  GLU GLU A . n 
A 1 47  ILE 47  58  58  ILE ILE A . n 
A 1 48  TYR 48  59  59  TYR TYR A . n 
A 1 49  ARG 49  60  60  ARG ARG A . n 
A 1 50  PRO 50  61  61  PRO PRO A . n 
A 1 51  HIS 51  62  62  HIS HIS A . n 
A 1 52  LYS 52  63  63  LYS LYS A . n 
A 1 53  ALA 53  64  64  ALA ALA A . n 
A 1 54  THR 54  65  65  THR THR A . n 
A 1 55  ALA 55  66  66  ALA ALA A . n 
A 1 56  GLU 56  67  67  GLU GLU A . n 
A 1 57  GLU 57  68  68  GLU GLU A . n 
A 1 58  MET 58  69  69  MET MET A . n 
A 1 59  THR 59  70  70  THR THR A . n 
A 1 60  LYS 60  71  71  LYS LYS A . n 
A 1 61  TYR 61  72  72  TYR TYR A . n 
A 1 62  HIS 62  73  73  HIS HIS A . n 
A 1 63  SER 63  74  74  SER SER A . n 
A 1 64  ASP 64  75  75  ASP ASP A . n 
A 1 65  GLU 65  76  76  GLU GLU A . n 
A 1 66  TYR 66  77  77  TYR TYR A . n 
A 1 67  ILE 67  78  78  ILE ILE A . n 
A 1 68  LYS 68  79  79  LYS LYS A . n 
A 1 69  PHE 69  80  80  PHE PHE A . n 
A 1 70  LEU 70  81  81  LEU LEU A . n 
A 1 71  ARG 71  82  82  ARG ARG A . n 
A 1 72  SER 72  83  83  SER SER A . n 
A 1 73  ILE 73  84  84  ILE ILE A . n 
A 1 74  ARG 74  85  85  ARG ARG A . n 
A 1 75  PRO 75  86  86  PRO PRO A . n 
A 1 76  ASP 76  87  87  ASP ASP A . n 
A 1 77  ASN 77  88  88  ASN ASN A . n 
A 1 78  MET 78  89  89  MET MET A . n 
A 1 79  SER 79  90  90  SER SER A . n 
A 1 80  GLU 80  91  91  GLU GLU A . n 
A 1 81  TYR 81  92  92  TYR TYR A . n 
A 1 82  SER 82  93  93  SER SER A . n 
A 1 83  LYS 83  94  94  LYS LYS A . n 
A 1 84  GLN 84  95  95  GLN GLN A . n 
A 1 85  MET 85  96  96  MET MET A . n 
A 1 86  GLN 86  97  97  GLN GLN A . n 
A 1 87  ARG 87  98  98  ARG ARG A . n 
A 1 88  PHE 88  99  99  PHE PHE A . n 
A 1 89  ASN 89  100 100 ASN ASN A . n 
A 1 90  VAL 90  101 101 VAL VAL A . n 
A 1 91  GLY 91  102 102 GLY GLY A . n 
A 1 92  GLU 92  103 103 GLU GLU A . n 
A 1 93  ASP 93  104 104 ASP ASP A . n 
A 1 94  CYS 94  105 105 CYS CYS A . n 
A 1 95  PRO 95  106 106 PRO PRO A . n 
A 1 96  VAL 96  107 107 VAL VAL A . n 
A 1 97  PHE 97  108 108 PHE PHE A . n 
A 1 98  ASP 98  109 109 ASP ASP A . n 
A 1 99  GLY 99  110 110 GLY GLY A . n 
A 1 100 LEU 100 111 111 LEU LEU A . n 
A 1 101 PHE 101 112 112 PHE PHE A . n 
A 1 102 GLU 102 113 113 GLU GLU A . n 
A 1 103 PHE 103 114 114 PHE PHE A . n 
A 1 104 CYS 104 115 115 CYS CYS A . n 
A 1 105 GLN 105 116 116 GLN GLN A . n 
A 1 106 LEU 106 117 117 LEU LEU A . n 
A 1 107 SER 107 118 118 SER SER A . n 
A 1 108 THR 108 119 119 THR THR A . n 
A 1 109 GLY 109 120 120 GLY GLY A . n 
A 1 110 GLY 110 121 121 GLY GLY A . n 
A 1 111 SER 111 122 122 SER SER A . n 
A 1 112 VAL 112 123 123 VAL VAL A . n 
A 1 113 ALA 113 124 124 ALA ALA A . n 
A 1 114 GLY 114 125 125 GLY GLY A . n 
A 1 115 ALA 115 126 126 ALA ALA A . n 
A 1 116 VAL 116 127 127 VAL VAL A . n 
A 1 117 LYS 117 128 128 LYS LYS A . n 
A 1 118 LEU 118 129 129 LEU LEU A . n 
A 1 119 ASN 119 130 130 ASN ASN A . n 
A 1 120 ARG 120 131 131 ARG ARG A . n 
A 1 121 GLN 121 132 132 GLN GLN A . n 
A 1 122 GLN 122 133 133 GLN GLN A . n 
A 1 123 THR 123 134 134 THR THR A . n 
A 1 124 ASP 124 135 135 ASP ASP A . n 
A 1 125 MET 125 136 136 MET MET A . n 
A 1 126 ALA 126 137 137 ALA ALA A . n 
A 1 127 VAL 127 138 138 VAL VAL A . n 
A 1 128 ASN 128 139 139 ASN ASN A . n 
A 1 129 TRP 129 140 140 TRP TRP A . n 
A 1 130 ALA 130 141 141 ALA ALA A . n 
A 1 131 GLY 131 142 142 GLY GLY A . n 
A 1 132 GLY 132 143 143 GLY GLY A . n 
A 1 133 LEU 133 144 144 LEU LEU A . n 
A 1 134 HIS 134 145 145 HIS HIS A . n 
A 1 135 HIS 135 146 146 HIS HIS A . n 
A 1 136 ALA 136 147 147 ALA ALA A . n 
A 1 137 LYS 137 148 148 LYS LYS A . n 
A 1 138 LYS 138 149 149 LYS LYS A . n 
A 1 139 SER 139 150 150 SER SER A . n 
A 1 140 GLU 140 151 151 GLU GLU A . n 
A 1 141 ALA 141 152 152 ALA ALA A . n 
A 1 142 SER 142 153 153 SER SER A . n 
A 1 143 GLY 143 154 154 GLY GLY A . n 
A 1 144 PHE 144 155 155 PHE PHE A . n 
A 1 145 CYS 145 156 156 CYS CYS A . n 
A 1 146 TYR 146 157 157 TYR TYR A . n 
A 1 147 VAL 147 158 158 VAL VAL A . n 
A 1 148 ASN 148 159 159 ASN ASN A . n 
A 1 149 ASP 149 160 160 ASP ASP A . n 
A 1 150 ILE 150 161 161 ILE ILE A . n 
A 1 151 VAL 151 162 162 VAL VAL A . n 
A 1 152 LEU 152 163 163 LEU LEU A . n 
A 1 153 ALA 153 164 164 ALA ALA A . n 
A 1 154 ILE 154 165 165 ILE ILE A . n 
A 1 155 LEU 155 166 166 LEU LEU A . n 
A 1 156 GLU 156 167 167 GLU GLU A . n 
A 1 157 LEU 157 168 168 LEU LEU A . n 
A 1 158 LEU 158 169 169 LEU LEU A . n 
A 1 159 LYS 159 170 170 LYS LYS A . n 
A 1 160 TYR 160 171 171 TYR TYR A . n 
A 1 161 HIS 161 172 172 HIS HIS A . n 
A 1 162 GLN 162 173 173 GLN GLN A . n 
A 1 163 ARG 163 174 174 ARG ARG A . n 
A 1 164 VAL 164 175 175 VAL VAL A . n 
A 1 165 LEU 165 176 176 LEU LEU A . n 
A 1 166 TYR 166 177 177 TYR TYR A . n 
A 1 167 ILE 167 178 178 ILE ILE A . n 
A 1 168 ASP 168 179 179 ASP ASP A . n 
A 1 169 ILE 169 180 180 ILE ILE A . n 
A 1 170 ASP 170 181 181 ASP ASP A . n 
A 1 171 ILE 171 182 182 ILE ILE A . n 
A 1 172 HIS 172 183 183 HIS HIS A . n 
A 1 173 HIS 173 184 184 HIS HIS A . n 
A 1 174 GLY 174 185 185 GLY GLY A . n 
A 1 175 ASP 175 186 186 ASP ASP A . n 
A 1 176 GLY 176 187 187 GLY GLY A . n 
A 1 177 VAL 177 188 188 VAL VAL A . n 
A 1 178 GLU 178 189 189 GLU GLU A . n 
A 1 179 GLU 179 190 190 GLU GLU A . n 
A 1 180 ALA 180 191 191 ALA ALA A . n 
A 1 181 PHE 181 192 192 PHE PHE A . n 
A 1 182 TYR 182 193 193 TYR TYR A . n 
A 1 183 THR 183 194 194 THR THR A . n 
A 1 184 THR 184 195 195 THR THR A . n 
A 1 185 ASP 185 196 196 ASP ASP A . n 
A 1 186 ARG 186 197 197 ARG ARG A . n 
A 1 187 VAL 187 198 198 VAL VAL A . n 
A 1 188 MET 188 199 199 MET MET A . n 
A 1 189 THR 189 200 200 THR THR A . n 
A 1 190 VAL 190 201 201 VAL VAL A . n 
A 1 191 SER 191 202 202 SER SER A . n 
A 1 192 PHE 192 203 203 PHE PHE A . n 
A 1 193 HIS 193 204 204 HIS HIS A . n 
A 1 194 LYS 194 205 205 LYS LYS A . n 
A 1 195 TYR 195 206 206 TYR TYR A . n 
A 1 196 GLY 196 207 207 GLY GLY A . n 
A 1 197 GLU 197 208 208 GLU GLU A . n 
A 1 198 TYR 198 209 209 TYR TYR A . n 
A 1 199 PHE 199 210 210 PHE PHE A . n 
A 1 200 PRO 200 211 211 PRO PRO A . n 
A 1 201 GLY 201 212 212 GLY GLY A . n 
A 1 202 THR 202 213 213 THR THR A . n 
A 1 203 GLY 203 214 214 GLY GLY A . n 
A 1 204 ASP 204 215 215 ASP ASP A . n 
A 1 205 LEU 205 216 216 LEU LEU A . n 
A 1 206 ARG 206 217 217 ARG ARG A . n 
A 1 207 ASP 207 218 218 ASP ASP A . n 
A 1 208 ILE 208 219 219 ILE ILE A . n 
A 1 209 GLY 209 220 220 GLY GLY A . n 
A 1 210 ALA 210 221 221 ALA ALA A . n 
A 1 211 GLY 211 222 222 GLY GLY A . n 
A 1 212 LYS 212 223 223 LYS LYS A . n 
A 1 213 GLY 213 224 224 GLY GLY A . n 
A 1 214 LYS 214 225 225 LYS LYS A . n 
A 1 215 TYR 215 226 226 TYR TYR A . n 
A 1 216 TYR 216 227 227 TYR TYR A . n 
A 1 217 ALA 217 228 228 ALA ALA A . n 
A 1 218 VAL 218 229 229 VAL VAL A . n 
A 1 219 ASN 219 230 230 ASN ASN A . n 
A 1 220 PHE 220 231 231 PHE PHE A . n 
A 1 221 PRO 221 232 232 PRO PRO A . n 
A 1 222 MET 222 233 233 MET MET A . n 
A 1 223 ARG 223 234 234 ARG ARG A . n 
A 1 224 ASP 224 235 235 ASP ASP A . n 
A 1 225 GLY 225 236 236 GLY GLY A . n 
A 1 226 ILE 226 237 237 ILE ILE A . n 
A 1 227 ASP 227 238 238 ASP ASP A . n 
A 1 228 ASP 228 239 239 ASP ASP A . n 
A 1 229 GLU 229 240 240 GLU GLU A . n 
A 1 230 SER 230 241 241 SER SER A . n 
A 1 231 TYR 231 242 242 TYR TYR A . n 
A 1 232 GLY 232 243 243 GLY GLY A . n 
A 1 233 GLN 233 244 244 GLN GLN A . n 
A 1 234 ILE 234 245 245 ILE ILE A . n 
A 1 235 PHE 235 246 246 PHE PHE A . n 
A 1 236 LYS 236 247 247 LYS LYS A . n 
A 1 237 PRO 237 248 248 PRO PRO A . n 
A 1 238 ILE 238 249 249 ILE ILE A . n 
A 1 239 ILE 239 250 250 ILE ILE A . n 
A 1 240 SER 240 251 251 SER SER A . n 
A 1 241 LYS 241 252 252 LYS LYS A . n 
A 1 242 VAL 242 253 253 VAL VAL A . n 
A 1 243 MET 243 254 254 MET MET A . n 
A 1 244 GLU 244 255 255 GLU GLU A . n 
A 1 245 MET 245 256 256 MET MET A . n 
A 1 246 TYR 246 257 257 TYR TYR A . n 
A 1 247 GLN 247 258 258 GLN GLN A . n 
A 1 248 PRO 248 259 259 PRO PRO A . n 
A 1 249 SER 249 260 260 SER SER A . n 
A 1 250 ALA 250 261 261 ALA ALA A . n 
A 1 251 VAL 251 262 262 VAL VAL A . n 
A 1 252 VAL 252 263 263 VAL VAL A . n 
A 1 253 LEU 253 264 264 LEU LEU A . n 
A 1 254 GLN 254 265 265 GLN GLN A . n 
A 1 255 CYS 255 266 266 CYS CYS A . n 
A 1 256 GLY 256 267 267 GLY GLY A . n 
A 1 257 ALA 257 268 268 ALA ALA A . n 
A 1 258 ASP 258 269 269 ASP ASP A . n 
A 1 259 SER 259 270 270 SER SER A . n 
A 1 260 LEU 260 271 271 LEU LEU A . n 
A 1 261 SER 261 272 272 SER SER A . n 
A 1 262 GLY 262 273 273 GLY GLY A . n 
A 1 263 ASP 263 274 274 ASP ASP A . n 
A 1 264 ARG 264 275 275 ARG ARG A . n 
A 1 265 LEU 265 276 276 LEU LEU A . n 
A 1 266 GLY 266 277 277 GLY GLY A . n 
A 1 267 CYS 267 278 278 CYS CYS A . n 
A 1 268 PHE 268 279 279 PHE PHE A . n 
A 1 269 ASN 269 280 280 ASN ASN A . n 
A 1 270 LEU 270 281 281 LEU LEU A . n 
A 1 271 THR 271 282 282 THR THR A . n 
A 1 272 VAL 272 283 283 VAL VAL A . n 
A 1 273 LYS 273 284 284 LYS LYS A . n 
A 1 274 GLY 274 285 285 GLY GLY A . n 
A 1 275 HIS 275 286 286 HIS HIS A . n 
A 1 276 ALA 276 287 287 ALA ALA A . n 
A 1 277 LYS 277 288 288 LYS LYS A . n 
A 1 278 CYS 278 289 289 CYS CYS A . n 
A 1 279 VAL 279 290 290 VAL VAL A . n 
A 1 280 GLU 280 291 291 GLU GLU A . n 
A 1 281 VAL 281 292 292 VAL VAL A . n 
A 1 282 VAL 282 293 293 VAL VAL A . n 
A 1 283 LYS 283 294 294 LYS LYS A . n 
A 1 284 THR 284 295 295 THR THR A . n 
A 1 285 PHE 285 296 296 PHE PHE A . n 
A 1 286 ASN 286 297 297 ASN ASN A . n 
A 1 287 LEU 287 298 298 LEU LEU A . n 
A 1 288 PRO 288 299 299 PRO PRO A . n 
A 1 289 LEU 289 300 300 LEU LEU A . n 
A 1 290 LEU 290 301 301 LEU LEU A . n 
A 1 291 MET 291 302 302 MET MET A . n 
A 1 292 LEU 292 303 303 LEU LEU A . n 
A 1 293 GLY 293 304 304 GLY GLY A . n 
A 1 294 GLY 294 305 305 GLY GLY A . n 
A 1 295 GLY 295 306 306 GLY GLY A . n 
A 1 296 GLY 296 307 307 GLY GLY A . n 
A 1 297 TYR 297 308 308 TYR TYR A . n 
A 1 298 THR 298 309 309 THR THR A . n 
A 1 299 ILE 299 310 310 ILE ILE A . n 
A 1 300 ARG 300 311 311 ARG ARG A . n 
A 1 301 ASN 301 312 312 ASN ASN A . n 
A 1 302 VAL 302 313 313 VAL VAL A . n 
A 1 303 ALA 303 314 314 ALA ALA A . n 
A 1 304 ARG 304 315 315 ARG ARG A . n 
A 1 305 CYS 305 316 316 CYS CYS A . n 
A 1 306 TRP 306 317 317 TRP TRP A . n 
A 1 307 THR 307 318 318 THR THR A . n 
A 1 308 TYR 308 319 319 TYR TYR A . n 
A 1 309 GLU 309 320 320 GLU GLU A . n 
A 1 310 THR 310 321 321 THR THR A . n 
A 1 311 ALA 311 322 322 ALA ALA A . n 
A 1 312 VAL 312 323 323 VAL VAL A . n 
A 1 313 ALA 313 324 324 ALA ALA A . n 
A 1 314 LEU 314 325 325 LEU LEU A . n 
A 1 315 ASP 315 326 326 ASP ASP A . n 
A 1 316 CYS 316 327 327 CYS CYS A . n 
A 1 317 GLU 317 328 328 GLU GLU A . n 
A 1 318 ILE 318 329 329 ILE ILE A . n 
A 1 319 PRO 319 330 330 PRO PRO A . n 
A 1 320 ASN 320 331 331 ASN ASN A . n 
A 1 321 GLU 321 332 332 GLU GLU A . n 
A 1 322 LEU 322 333 333 LEU LEU A . n 
A 1 323 PRO 323 334 334 PRO PRO A . n 
A 1 324 TYR 324 335 335 TYR TYR A . n 
A 1 325 ASN 325 336 336 ASN ASN A . n 
A 1 326 ASP 326 337 337 ASP ASP A . n 
A 1 327 TYR 327 338 338 TYR TYR A . n 
A 1 328 PHE 328 339 339 PHE PHE A . n 
A 1 329 GLU 329 340 340 GLU GLU A . n 
A 1 330 TYR 330 341 341 TYR TYR A . n 
A 1 331 PHE 331 342 342 PHE PHE A . n 
A 1 332 GLY 332 343 343 GLY GLY A . n 
A 1 333 PRO 333 344 344 PRO PRO A . n 
A 1 334 ASP 334 345 345 ASP ASP A . n 
A 1 335 PHE 335 346 346 PHE PHE A . n 
A 1 336 LYS 336 347 347 LYS LYS A . n 
A 1 337 LEU 337 348 348 LEU LEU A . n 
A 1 338 HIS 338 349 349 HIS HIS A . n 
A 1 339 ILE 339 350 350 ILE ILE A . n 
A 1 340 SER 340 351 351 SER SER A . n 
A 1 341 PRO 341 352 352 PRO PRO A . n 
A 1 342 SER 342 353 353 SER SER A . n 
A 1 343 ASN 343 354 354 ASN ASN A . n 
A 1 344 MET 344 355 355 MET MET A . n 
A 1 345 THR 345 356 356 THR THR A . n 
A 1 346 ASN 346 357 357 ASN ASN A . n 
A 1 347 GLN 347 358 358 GLN GLN A . n 
A 1 348 ASN 348 359 359 ASN ASN A . n 
A 1 349 THR 349 360 360 THR THR A . n 
A 1 350 PRO 350 361 361 PRO PRO A . n 
A 1 351 GLU 351 362 362 GLU GLU A . n 
A 1 352 TYR 352 363 363 TYR TYR A . n 
A 1 353 MET 353 364 364 MET MET A . n 
A 1 354 GLU 354 365 365 GLU GLU A . n 
A 1 355 LYS 355 366 366 LYS LYS A . n 
A 1 356 ILE 356 367 367 ILE ILE A . n 
A 1 357 LYS 357 368 368 LYS LYS A . n 
A 1 358 GLN 358 369 369 GLN GLN A . n 
A 1 359 ARG 359 370 370 ARG ARG A . n 
A 1 360 LEU 360 371 371 LEU LEU A . n 
A 1 361 PHE 361 372 372 PHE PHE A . n 
A 1 362 GLU 362 373 373 GLU GLU A . n 
A 1 363 ASN 363 374 374 ASN ASN A . n 
A 1 364 LEU 364 375 375 LEU LEU A . n 
A 1 365 ARG 365 376 376 ARG ARG A . n 
A 1 366 MET 366 377 377 MET MET A . n 
A 1 367 LEU 367 378 378 LEU LEU A . n 
A 1 368 PRO 368 379 379 PRO PRO A . n 
A 1 369 HIS 369 380 ?   ?   ?   A . n 
B 1 1   GLY 1   12  ?   ?   ?   B . n 
B 1 2   LYS 2   13  13  LYS ALA B . n 
B 1 3   LYS 3   14  14  LYS LYS B . n 
B 1 4   LYS 4   15  15  LYS LYS B . n 
B 1 5   VAL 5   16  16  VAL VAL B . n 
B 1 6   CYS 6   17  17  CYS CYS B . n 
B 1 7   TYR 7   18  18  TYR TYR B . n 
B 1 8   TYR 8   19  19  TYR TYR B . n 
B 1 9   TYR 9   20  20  TYR TYR B . n 
B 1 10  ASP 10  21  21  ASP ASP B . n 
B 1 11  GLY 11  22  22  GLY GLY B . n 
B 1 12  ASP 12  23  23  ASP ASP B . n 
B 1 13  ILE 13  24  24  ILE ILE B . n 
B 1 14  GLY 14  25  25  GLY GLY B . n 
B 1 15  ASN 15  26  26  ASN ASN B . n 
B 1 16  TYR 16  27  27  TYR TYR B . n 
B 1 17  TYR 17  28  28  TYR TYR B . n 
B 1 18  TYR 18  29  29  TYR TYR B . n 
B 1 19  GLY 19  30  30  GLY GLY B . n 
B 1 20  GLN 20  31  31  GLN GLN B . n 
B 1 21  GLY 21  32  32  GLY GLY B . n 
B 1 22  HIS 22  33  33  HIS HIS B . n 
B 1 23  PRO 23  34  34  PRO PRO B . n 
B 1 24  MET 24  35  35  MET MET B . n 
B 1 25  LYS 25  36  36  LYS LYS B . n 
B 1 26  PRO 26  37  37  PRO PRO B . n 
B 1 27  HIS 27  38  38  HIS HIS B . n 
B 1 28  ARG 28  39  39  ARG ARG B . n 
B 1 29  ILE 29  40  40  ILE ILE B . n 
B 1 30  ARG 30  41  41  ARG ARG B . n 
B 1 31  MET 31  42  42  MET MET B . n 
B 1 32  THR 32  43  43  THR THR B . n 
B 1 33  HIS 33  44  44  HIS HIS B . n 
B 1 34  ASN 34  45  45  ASN ASN B . n 
B 1 35  LEU 35  46  46  LEU LEU B . n 
B 1 36  LEU 36  47  47  LEU LEU B . n 
B 1 37  LEU 37  48  48  LEU LEU B . n 
B 1 38  ASN 38  49  49  ASN ASN B . n 
B 1 39  TYR 39  50  50  TYR TYR B . n 
B 1 40  GLY 40  51  51  GLY GLY B . n 
B 1 41  LEU 41  52  52  LEU LEU B . n 
B 1 42  TYR 42  53  53  TYR TYR B . n 
B 1 43  ARG 43  54  54  ARG ARG B . n 
B 1 44  LYS 44  55  55  LYS LYS B . n 
B 1 45  MET 45  56  56  MET MET B . n 
B 1 46  GLU 46  57  57  GLU GLU B . n 
B 1 47  ILE 47  58  58  ILE ILE B . n 
B 1 48  TYR 48  59  59  TYR TYR B . n 
B 1 49  ARG 49  60  60  ARG ARG B . n 
B 1 50  PRO 50  61  61  PRO PRO B . n 
B 1 51  HIS 51  62  62  HIS HIS B . n 
B 1 52  LYS 52  63  63  LYS LYS B . n 
B 1 53  ALA 53  64  64  ALA ALA B . n 
B 1 54  THR 54  65  65  THR THR B . n 
B 1 55  ALA 55  66  66  ALA ALA B . n 
B 1 56  GLU 56  67  67  GLU GLU B . n 
B 1 57  GLU 57  68  68  GLU GLU B . n 
B 1 58  MET 58  69  69  MET MET B . n 
B 1 59  THR 59  70  70  THR THR B . n 
B 1 60  LYS 60  71  71  LYS LYS B . n 
B 1 61  TYR 61  72  72  TYR TYR B . n 
B 1 62  HIS 62  73  73  HIS HIS B . n 
B 1 63  SER 63  74  74  SER SER B . n 
B 1 64  ASP 64  75  75  ASP ASP B . n 
B 1 65  GLU 65  76  76  GLU GLU B . n 
B 1 66  TYR 66  77  77  TYR TYR B . n 
B 1 67  ILE 67  78  78  ILE ILE B . n 
B 1 68  LYS 68  79  79  LYS LYS B . n 
B 1 69  PHE 69  80  80  PHE PHE B . n 
B 1 70  LEU 70  81  81  LEU LEU B . n 
B 1 71  ARG 71  82  82  ARG ARG B . n 
B 1 72  SER 72  83  83  SER SER B . n 
B 1 73  ILE 73  84  84  ILE ILE B . n 
B 1 74  ARG 74  85  85  ARG ARG B . n 
B 1 75  PRO 75  86  86  PRO PRO B . n 
B 1 76  ASP 76  87  87  ASP ASP B . n 
B 1 77  ASN 77  88  88  ASN ASN B . n 
B 1 78  MET 78  89  89  MET MET B . n 
B 1 79  SER 79  90  90  SER SER B . n 
B 1 80  GLU 80  91  91  GLU GLU B . n 
B 1 81  TYR 81  92  92  TYR TYR B . n 
B 1 82  SER 82  93  93  SER SER B . n 
B 1 83  LYS 83  94  94  LYS LYS B . n 
B 1 84  GLN 84  95  95  GLN GLN B . n 
B 1 85  MET 85  96  96  MET MET B . n 
B 1 86  GLN 86  97  97  GLN GLN B . n 
B 1 87  ARG 87  98  98  ARG ARG B . n 
B 1 88  PHE 88  99  99  PHE PHE B . n 
B 1 89  ASN 89  100 100 ASN ASN B . n 
B 1 90  VAL 90  101 101 VAL VAL B . n 
B 1 91  GLY 91  102 102 GLY GLY B . n 
B 1 92  GLU 92  103 103 GLU GLU B . n 
B 1 93  ASP 93  104 104 ASP ASP B . n 
B 1 94  CYS 94  105 105 CYS CYS B . n 
B 1 95  PRO 95  106 106 PRO PRO B . n 
B 1 96  VAL 96  107 107 VAL VAL B . n 
B 1 97  PHE 97  108 108 PHE PHE B . n 
B 1 98  ASP 98  109 109 ASP ASP B . n 
B 1 99  GLY 99  110 110 GLY GLY B . n 
B 1 100 LEU 100 111 111 LEU LEU B . n 
B 1 101 PHE 101 112 112 PHE PHE B . n 
B 1 102 GLU 102 113 113 GLU GLU B . n 
B 1 103 PHE 103 114 114 PHE PHE B . n 
B 1 104 CYS 104 115 115 CYS CYS B . n 
B 1 105 GLN 105 116 116 GLN GLN B . n 
B 1 106 LEU 106 117 117 LEU LEU B . n 
B 1 107 SER 107 118 118 SER SER B . n 
B 1 108 THR 108 119 119 THR THR B . n 
B 1 109 GLY 109 120 120 GLY GLY B . n 
B 1 110 GLY 110 121 121 GLY GLY B . n 
B 1 111 SER 111 122 122 SER SER B . n 
B 1 112 VAL 112 123 123 VAL VAL B . n 
B 1 113 ALA 113 124 124 ALA ALA B . n 
B 1 114 GLY 114 125 125 GLY GLY B . n 
B 1 115 ALA 115 126 126 ALA ALA B . n 
B 1 116 VAL 116 127 127 VAL VAL B . n 
B 1 117 LYS 117 128 128 LYS LYS B . n 
B 1 118 LEU 118 129 129 LEU LEU B . n 
B 1 119 ASN 119 130 130 ASN ASN B . n 
B 1 120 ARG 120 131 131 ARG ARG B . n 
B 1 121 GLN 121 132 132 GLN GLN B . n 
B 1 122 GLN 122 133 133 GLN GLN B . n 
B 1 123 THR 123 134 134 THR THR B . n 
B 1 124 ASP 124 135 135 ASP ASP B . n 
B 1 125 MET 125 136 136 MET MET B . n 
B 1 126 ALA 126 137 137 ALA ALA B . n 
B 1 127 VAL 127 138 138 VAL VAL B . n 
B 1 128 ASN 128 139 139 ASN ASN B . n 
B 1 129 TRP 129 140 140 TRP TRP B . n 
B 1 130 ALA 130 141 141 ALA ALA B . n 
B 1 131 GLY 131 142 142 GLY GLY B . n 
B 1 132 GLY 132 143 143 GLY GLY B . n 
B 1 133 LEU 133 144 144 LEU LEU B . n 
B 1 134 HIS 134 145 145 HIS HIS B . n 
B 1 135 HIS 135 146 146 HIS HIS B . n 
B 1 136 ALA 136 147 147 ALA ALA B . n 
B 1 137 LYS 137 148 148 LYS LYS B . n 
B 1 138 LYS 138 149 149 LYS LYS B . n 
B 1 139 SER 139 150 150 SER SER B . n 
B 1 140 GLU 140 151 151 GLU GLU B . n 
B 1 141 ALA 141 152 152 ALA ALA B . n 
B 1 142 SER 142 153 153 SER SER B . n 
B 1 143 GLY 143 154 154 GLY GLY B . n 
B 1 144 PHE 144 155 155 PHE PHE B . n 
B 1 145 CYS 145 156 156 CYS CYS B . n 
B 1 146 TYR 146 157 157 TYR TYR B . n 
B 1 147 VAL 147 158 158 VAL VAL B . n 
B 1 148 ASN 148 159 159 ASN ASN B . n 
B 1 149 ASP 149 160 160 ASP ASP B . n 
B 1 150 ILE 150 161 161 ILE ILE B . n 
B 1 151 VAL 151 162 162 VAL VAL B . n 
B 1 152 LEU 152 163 163 LEU LEU B . n 
B 1 153 ALA 153 164 164 ALA ALA B . n 
B 1 154 ILE 154 165 165 ILE ILE B . n 
B 1 155 LEU 155 166 166 LEU LEU B . n 
B 1 156 GLU 156 167 167 GLU GLU B . n 
B 1 157 LEU 157 168 168 LEU LEU B . n 
B 1 158 LEU 158 169 169 LEU LEU B . n 
B 1 159 LYS 159 170 170 LYS LYS B . n 
B 1 160 TYR 160 171 171 TYR TYR B . n 
B 1 161 HIS 161 172 172 HIS HIS B . n 
B 1 162 GLN 162 173 173 GLN GLN B . n 
B 1 163 ARG 163 174 174 ARG ARG B . n 
B 1 164 VAL 164 175 175 VAL VAL B . n 
B 1 165 LEU 165 176 176 LEU LEU B . n 
B 1 166 TYR 166 177 177 TYR TYR B . n 
B 1 167 ILE 167 178 178 ILE ILE B . n 
B 1 168 ASP 168 179 179 ASP ASP B . n 
B 1 169 ILE 169 180 180 ILE ILE B . n 
B 1 170 ASP 170 181 181 ASP ASP B . n 
B 1 171 ILE 171 182 182 ILE ILE B . n 
B 1 172 HIS 172 183 183 HIS HIS B . n 
B 1 173 HIS 173 184 184 HIS HIS B . n 
B 1 174 GLY 174 185 185 GLY GLY B . n 
B 1 175 ASP 175 186 186 ASP ASP B . n 
B 1 176 GLY 176 187 187 GLY GLY B . n 
B 1 177 VAL 177 188 188 VAL VAL B . n 
B 1 178 GLU 178 189 189 GLU GLU B . n 
B 1 179 GLU 179 190 190 GLU GLU B . n 
B 1 180 ALA 180 191 191 ALA ALA B . n 
B 1 181 PHE 181 192 192 PHE PHE B . n 
B 1 182 TYR 182 193 193 TYR TYR B . n 
B 1 183 THR 183 194 194 THR THR B . n 
B 1 184 THR 184 195 195 THR THR B . n 
B 1 185 ASP 185 196 196 ASP ASP B . n 
B 1 186 ARG 186 197 197 ARG ARG B . n 
B 1 187 VAL 187 198 198 VAL VAL B . n 
B 1 188 MET 188 199 199 MET MET B . n 
B 1 189 THR 189 200 200 THR THR B . n 
B 1 190 VAL 190 201 201 VAL VAL B . n 
B 1 191 SER 191 202 202 SER SER B . n 
B 1 192 PHE 192 203 203 PHE PHE B . n 
B 1 193 HIS 193 204 204 HIS HIS B . n 
B 1 194 LYS 194 205 205 LYS LYS B . n 
B 1 195 TYR 195 206 206 TYR TYR B . n 
B 1 196 GLY 196 207 207 GLY GLY B . n 
B 1 197 GLU 197 208 208 GLU GLU B . n 
B 1 198 TYR 198 209 209 TYR TYR B . n 
B 1 199 PHE 199 210 210 PHE PHE B . n 
B 1 200 PRO 200 211 211 PRO PRO B . n 
B 1 201 GLY 201 212 212 GLY GLY B . n 
B 1 202 THR 202 213 213 THR THR B . n 
B 1 203 GLY 203 214 214 GLY GLY B . n 
B 1 204 ASP 204 215 215 ASP ASP B . n 
B 1 205 LEU 205 216 216 LEU LEU B . n 
B 1 206 ARG 206 217 217 ARG ARG B . n 
B 1 207 ASP 207 218 218 ASP ASP B . n 
B 1 208 ILE 208 219 219 ILE ILE B . n 
B 1 209 GLY 209 220 220 GLY GLY B . n 
B 1 210 ALA 210 221 221 ALA ALA B . n 
B 1 211 GLY 211 222 222 GLY GLY B . n 
B 1 212 LYS 212 223 223 LYS LYS B . n 
B 1 213 GLY 213 224 224 GLY GLY B . n 
B 1 214 LYS 214 225 225 LYS LYS B . n 
B 1 215 TYR 215 226 226 TYR TYR B . n 
B 1 216 TYR 216 227 227 TYR TYR B . n 
B 1 217 ALA 217 228 228 ALA ALA B . n 
B 1 218 VAL 218 229 229 VAL VAL B . n 
B 1 219 ASN 219 230 230 ASN ASN B . n 
B 1 220 PHE 220 231 231 PHE PHE B . n 
B 1 221 PRO 221 232 232 PRO PRO B . n 
B 1 222 MET 222 233 233 MET MET B . n 
B 1 223 ARG 223 234 234 ARG ARG B . n 
B 1 224 ASP 224 235 235 ASP ASP B . n 
B 1 225 GLY 225 236 236 GLY GLY B . n 
B 1 226 ILE 226 237 237 ILE ILE B . n 
B 1 227 ASP 227 238 238 ASP ASP B . n 
B 1 228 ASP 228 239 239 ASP ASP B . n 
B 1 229 GLU 229 240 240 GLU GLU B . n 
B 1 230 SER 230 241 241 SER SER B . n 
B 1 231 TYR 231 242 242 TYR TYR B . n 
B 1 232 GLY 232 243 243 GLY GLY B . n 
B 1 233 GLN 233 244 244 GLN GLN B . n 
B 1 234 ILE 234 245 245 ILE ILE B . n 
B 1 235 PHE 235 246 246 PHE PHE B . n 
B 1 236 LYS 236 247 247 LYS LYS B . n 
B 1 237 PRO 237 248 248 PRO PRO B . n 
B 1 238 ILE 238 249 249 ILE ILE B . n 
B 1 239 ILE 239 250 250 ILE ILE B . n 
B 1 240 SER 240 251 251 SER SER B . n 
B 1 241 LYS 241 252 252 LYS LYS B . n 
B 1 242 VAL 242 253 253 VAL VAL B . n 
B 1 243 MET 243 254 254 MET MET B . n 
B 1 244 GLU 244 255 255 GLU GLU B . n 
B 1 245 MET 245 256 256 MET MET B . n 
B 1 246 TYR 246 257 257 TYR TYR B . n 
B 1 247 GLN 247 258 258 GLN GLN B . n 
B 1 248 PRO 248 259 259 PRO PRO B . n 
B 1 249 SER 249 260 260 SER SER B . n 
B 1 250 ALA 250 261 261 ALA ALA B . n 
B 1 251 VAL 251 262 262 VAL VAL B . n 
B 1 252 VAL 252 263 263 VAL VAL B . n 
B 1 253 LEU 253 264 264 LEU LEU B . n 
B 1 254 GLN 254 265 265 GLN GLN B . n 
B 1 255 CYS 255 266 266 CYS CYS B . n 
B 1 256 GLY 256 267 267 GLY GLY B . n 
B 1 257 ALA 257 268 268 ALA ALA B . n 
B 1 258 ASP 258 269 269 ASP ASP B . n 
B 1 259 SER 259 270 270 SER SER B . n 
B 1 260 LEU 260 271 271 LEU LEU B . n 
B 1 261 SER 261 272 272 SER SER B . n 
B 1 262 GLY 262 273 273 GLY GLY B . n 
B 1 263 ASP 263 274 274 ASP ASP B . n 
B 1 264 ARG 264 275 275 ARG ARG B . n 
B 1 265 LEU 265 276 276 LEU LEU B . n 
B 1 266 GLY 266 277 277 GLY GLY B . n 
B 1 267 CYS 267 278 278 CYS CYS B . n 
B 1 268 PHE 268 279 279 PHE PHE B . n 
B 1 269 ASN 269 280 280 ASN ASN B . n 
B 1 270 LEU 270 281 281 LEU LEU B . n 
B 1 271 THR 271 282 282 THR THR B . n 
B 1 272 VAL 272 283 283 VAL VAL B . n 
B 1 273 LYS 273 284 284 LYS LYS B . n 
B 1 274 GLY 274 285 285 GLY GLY B . n 
B 1 275 HIS 275 286 286 HIS HIS B . n 
B 1 276 ALA 276 287 287 ALA ALA B . n 
B 1 277 LYS 277 288 288 LYS LYS B . n 
B 1 278 CYS 278 289 289 CYS CYS B . n 
B 1 279 VAL 279 290 290 VAL VAL B . n 
B 1 280 GLU 280 291 291 GLU GLU B . n 
B 1 281 VAL 281 292 292 VAL VAL B . n 
B 1 282 VAL 282 293 293 VAL VAL B . n 
B 1 283 LYS 283 294 294 LYS LYS B . n 
B 1 284 THR 284 295 295 THR THR B . n 
B 1 285 PHE 285 296 296 PHE PHE B . n 
B 1 286 ASN 286 297 297 ASN ASN B . n 
B 1 287 LEU 287 298 298 LEU LEU B . n 
B 1 288 PRO 288 299 299 PRO PRO B . n 
B 1 289 LEU 289 300 300 LEU LEU B . n 
B 1 290 LEU 290 301 301 LEU LEU B . n 
B 1 291 MET 291 302 302 MET MET B . n 
B 1 292 LEU 292 303 303 LEU LEU B . n 
B 1 293 GLY 293 304 304 GLY GLY B . n 
B 1 294 GLY 294 305 305 GLY GLY B . n 
B 1 295 GLY 295 306 306 GLY GLY B . n 
B 1 296 GLY 296 307 307 GLY GLY B . n 
B 1 297 TYR 297 308 308 TYR TYR B . n 
B 1 298 THR 298 309 309 THR THR B . n 
B 1 299 ILE 299 310 310 ILE ILE B . n 
B 1 300 ARG 300 311 311 ARG ARG B . n 
B 1 301 ASN 301 312 312 ASN ASN B . n 
B 1 302 VAL 302 313 313 VAL VAL B . n 
B 1 303 ALA 303 314 314 ALA ALA B . n 
B 1 304 ARG 304 315 315 ARG ARG B . n 
B 1 305 CYS 305 316 316 CYS CYS B . n 
B 1 306 TRP 306 317 317 TRP TRP B . n 
B 1 307 THR 307 318 318 THR THR B . n 
B 1 308 TYR 308 319 319 TYR TYR B . n 
B 1 309 GLU 309 320 320 GLU GLU B . n 
B 1 310 THR 310 321 321 THR THR B . n 
B 1 311 ALA 311 322 322 ALA ALA B . n 
B 1 312 VAL 312 323 323 VAL VAL B . n 
B 1 313 ALA 313 324 324 ALA ALA B . n 
B 1 314 LEU 314 325 325 LEU LEU B . n 
B 1 315 ASP 315 326 326 ASP ASP B . n 
B 1 316 CYS 316 327 327 CYS CYS B . n 
B 1 317 GLU 317 328 328 GLU GLU B . n 
B 1 318 ILE 318 329 329 ILE ILE B . n 
B 1 319 PRO 319 330 330 PRO PRO B . n 
B 1 320 ASN 320 331 331 ASN ASN B . n 
B 1 321 GLU 321 332 332 GLU GLU B . n 
B 1 322 LEU 322 333 333 LEU LEU B . n 
B 1 323 PRO 323 334 334 PRO PRO B . n 
B 1 324 TYR 324 335 335 TYR TYR B . n 
B 1 325 ASN 325 336 336 ASN ASN B . n 
B 1 326 ASP 326 337 337 ASP ASP B . n 
B 1 327 TYR 327 338 338 TYR TYR B . n 
B 1 328 PHE 328 339 339 PHE PHE B . n 
B 1 329 GLU 329 340 340 GLU GLU B . n 
B 1 330 TYR 330 341 341 TYR TYR B . n 
B 1 331 PHE 331 342 342 PHE PHE B . n 
B 1 332 GLY 332 343 343 GLY GLY B . n 
B 1 333 PRO 333 344 344 PRO PRO B . n 
B 1 334 ASP 334 345 345 ASP ASP B . n 
B 1 335 PHE 335 346 346 PHE PHE B . n 
B 1 336 LYS 336 347 347 LYS LYS B . n 
B 1 337 LEU 337 348 348 LEU LEU B . n 
B 1 338 HIS 338 349 349 HIS HIS B . n 
B 1 339 ILE 339 350 350 ILE ILE B . n 
B 1 340 SER 340 351 351 SER SER B . n 
B 1 341 PRO 341 352 352 PRO PRO B . n 
B 1 342 SER 342 353 353 SER SER B . n 
B 1 343 ASN 343 354 354 ASN ASN B . n 
B 1 344 MET 344 355 355 MET MET B . n 
B 1 345 THR 345 356 356 THR THR B . n 
B 1 346 ASN 346 357 357 ASN ASN B . n 
B 1 347 GLN 347 358 358 GLN GLN B . n 
B 1 348 ASN 348 359 359 ASN ASN B . n 
B 1 349 THR 349 360 360 THR THR B . n 
B 1 350 PRO 350 361 361 PRO PRO B . n 
B 1 351 GLU 351 362 362 GLU GLU B . n 
B 1 352 TYR 352 363 363 TYR TYR B . n 
B 1 353 MET 353 364 364 MET MET B . n 
B 1 354 GLU 354 365 365 GLU GLU B . n 
B 1 355 LYS 355 366 366 LYS LYS B . n 
B 1 356 ILE 356 367 367 ILE ILE B . n 
B 1 357 LYS 357 368 368 LYS LYS B . n 
B 1 358 GLN 358 369 369 GLN GLN B . n 
B 1 359 ARG 359 370 370 ARG ARG B . n 
B 1 360 LEU 360 371 371 LEU LEU B . n 
B 1 361 PHE 361 372 372 PHE PHE B . n 
B 1 362 GLU 362 373 373 GLU GLU B . n 
B 1 363 ASN 363 374 374 ASN ASN B . n 
B 1 364 LEU 364 375 375 LEU LEU B . n 
B 1 365 ARG 365 376 376 ARG ARG B . n 
B 1 366 MET 366 377 377 MET MET B . n 
B 1 367 LEU 367 378 378 LEU LEU B . n 
B 1 368 PRO 368 379 379 PRO PRO B . n 
B 1 369 HIS 369 380 ?   ?   ?   B . n 
C 1 1   GLY 1   12  ?   ?   ?   C . n 
C 1 2   LYS 2   13  13  LYS LYS C . n 
C 1 3   LYS 3   14  14  LYS LYS C . n 
C 1 4   LYS 4   15  15  LYS LYS C . n 
C 1 5   VAL 5   16  16  VAL VAL C . n 
C 1 6   CYS 6   17  17  CYS CYS C . n 
C 1 7   TYR 7   18  18  TYR TYR C . n 
C 1 8   TYR 8   19  19  TYR TYR C . n 
C 1 9   TYR 9   20  20  TYR TYR C . n 
C 1 10  ASP 10  21  21  ASP ASP C . n 
C 1 11  GLY 11  22  22  GLY GLY C . n 
C 1 12  ASP 12  23  23  ASP ASP C . n 
C 1 13  ILE 13  24  24  ILE ILE C . n 
C 1 14  GLY 14  25  25  GLY GLY C . n 
C 1 15  ASN 15  26  26  ASN ASN C . n 
C 1 16  TYR 16  27  27  TYR TYR C . n 
C 1 17  TYR 17  28  28  TYR TYR C . n 
C 1 18  TYR 18  29  29  TYR TYR C . n 
C 1 19  GLY 19  30  30  GLY GLY C . n 
C 1 20  GLN 20  31  31  GLN GLN C . n 
C 1 21  GLY 21  32  32  GLY GLY C . n 
C 1 22  HIS 22  33  33  HIS HIS C . n 
C 1 23  PRO 23  34  34  PRO PRO C . n 
C 1 24  MET 24  35  35  MET MET C . n 
C 1 25  LYS 25  36  36  LYS LYS C . n 
C 1 26  PRO 26  37  37  PRO PRO C . n 
C 1 27  HIS 27  38  38  HIS HIS C . n 
C 1 28  ARG 28  39  39  ARG ARG C . n 
C 1 29  ILE 29  40  40  ILE ILE C . n 
C 1 30  ARG 30  41  41  ARG ARG C . n 
C 1 31  MET 31  42  42  MET MET C . n 
C 1 32  THR 32  43  43  THR THR C . n 
C 1 33  HIS 33  44  44  HIS HIS C . n 
C 1 34  ASN 34  45  45  ASN ASN C . n 
C 1 35  LEU 35  46  46  LEU LEU C . n 
C 1 36  LEU 36  47  47  LEU LEU C . n 
C 1 37  LEU 37  48  48  LEU LEU C . n 
C 1 38  ASN 38  49  49  ASN ASN C . n 
C 1 39  TYR 39  50  50  TYR TYR C . n 
C 1 40  GLY 40  51  51  GLY GLY C . n 
C 1 41  LEU 41  52  52  LEU LEU C . n 
C 1 42  TYR 42  53  53  TYR TYR C . n 
C 1 43  ARG 43  54  54  ARG ARG C . n 
C 1 44  LYS 44  55  55  LYS LYS C . n 
C 1 45  MET 45  56  56  MET MET C . n 
C 1 46  GLU 46  57  57  GLU GLU C . n 
C 1 47  ILE 47  58  58  ILE ILE C . n 
C 1 48  TYR 48  59  59  TYR TYR C . n 
C 1 49  ARG 49  60  60  ARG ARG C . n 
C 1 50  PRO 50  61  61  PRO PRO C . n 
C 1 51  HIS 51  62  62  HIS HIS C . n 
C 1 52  LYS 52  63  63  LYS LYS C . n 
C 1 53  ALA 53  64  64  ALA ALA C . n 
C 1 54  THR 54  65  65  THR THR C . n 
C 1 55  ALA 55  66  66  ALA ALA C . n 
C 1 56  GLU 56  67  67  GLU GLU C . n 
C 1 57  GLU 57  68  68  GLU GLU C . n 
C 1 58  MET 58  69  69  MET MET C . n 
C 1 59  THR 59  70  70  THR THR C . n 
C 1 60  LYS 60  71  71  LYS LYS C . n 
C 1 61  TYR 61  72  72  TYR TYR C . n 
C 1 62  HIS 62  73  73  HIS HIS C . n 
C 1 63  SER 63  74  74  SER SER C . n 
C 1 64  ASP 64  75  75  ASP ASP C . n 
C 1 65  GLU 65  76  76  GLU GLU C . n 
C 1 66  TYR 66  77  77  TYR TYR C . n 
C 1 67  ILE 67  78  78  ILE ILE C . n 
C 1 68  LYS 68  79  79  LYS LYS C . n 
C 1 69  PHE 69  80  80  PHE PHE C . n 
C 1 70  LEU 70  81  81  LEU LEU C . n 
C 1 71  ARG 71  82  82  ARG ARG C . n 
C 1 72  SER 72  83  83  SER SER C . n 
C 1 73  ILE 73  84  84  ILE ILE C . n 
C 1 74  ARG 74  85  85  ARG ARG C . n 
C 1 75  PRO 75  86  86  PRO PRO C . n 
C 1 76  ASP 76  87  87  ASP ASP C . n 
C 1 77  ASN 77  88  88  ASN ASN C . n 
C 1 78  MET 78  89  89  MET MET C . n 
C 1 79  SER 79  90  90  SER SER C . n 
C 1 80  GLU 80  91  91  GLU GLU C . n 
C 1 81  TYR 81  92  92  TYR TYR C . n 
C 1 82  SER 82  93  93  SER SER C . n 
C 1 83  LYS 83  94  94  LYS LYS C . n 
C 1 84  GLN 84  95  95  GLN GLN C . n 
C 1 85  MET 85  96  96  MET MET C . n 
C 1 86  GLN 86  97  97  GLN GLN C . n 
C 1 87  ARG 87  98  98  ARG ARG C . n 
C 1 88  PHE 88  99  99  PHE PHE C . n 
C 1 89  ASN 89  100 100 ASN ASN C . n 
C 1 90  VAL 90  101 101 VAL VAL C . n 
C 1 91  GLY 91  102 102 GLY GLY C . n 
C 1 92  GLU 92  103 103 GLU GLU C . n 
C 1 93  ASP 93  104 104 ASP ASP C . n 
C 1 94  CYS 94  105 105 CYS CYS C . n 
C 1 95  PRO 95  106 106 PRO PRO C . n 
C 1 96  VAL 96  107 107 VAL VAL C . n 
C 1 97  PHE 97  108 108 PHE PHE C . n 
C 1 98  ASP 98  109 109 ASP ASP C . n 
C 1 99  GLY 99  110 110 GLY GLY C . n 
C 1 100 LEU 100 111 111 LEU LEU C . n 
C 1 101 PHE 101 112 112 PHE PHE C . n 
C 1 102 GLU 102 113 113 GLU GLU C . n 
C 1 103 PHE 103 114 114 PHE PHE C . n 
C 1 104 CYS 104 115 115 CYS CYS C . n 
C 1 105 GLN 105 116 116 GLN GLN C . n 
C 1 106 LEU 106 117 117 LEU LEU C . n 
C 1 107 SER 107 118 118 SER SER C . n 
C 1 108 THR 108 119 119 THR THR C . n 
C 1 109 GLY 109 120 120 GLY GLY C . n 
C 1 110 GLY 110 121 121 GLY GLY C . n 
C 1 111 SER 111 122 122 SER SER C . n 
C 1 112 VAL 112 123 123 VAL VAL C . n 
C 1 113 ALA 113 124 124 ALA ALA C . n 
C 1 114 GLY 114 125 125 GLY GLY C . n 
C 1 115 ALA 115 126 126 ALA ALA C . n 
C 1 116 VAL 116 127 127 VAL VAL C . n 
C 1 117 LYS 117 128 128 LYS LYS C . n 
C 1 118 LEU 118 129 129 LEU LEU C . n 
C 1 119 ASN 119 130 130 ASN ASN C . n 
C 1 120 ARG 120 131 131 ARG ARG C . n 
C 1 121 GLN 121 132 132 GLN GLN C . n 
C 1 122 GLN 122 133 133 GLN GLN C . n 
C 1 123 THR 123 134 134 THR THR C . n 
C 1 124 ASP 124 135 135 ASP ASP C . n 
C 1 125 MET 125 136 136 MET MET C . n 
C 1 126 ALA 126 137 137 ALA ALA C . n 
C 1 127 VAL 127 138 138 VAL VAL C . n 
C 1 128 ASN 128 139 139 ASN ASN C . n 
C 1 129 TRP 129 140 140 TRP TRP C . n 
C 1 130 ALA 130 141 141 ALA ALA C . n 
C 1 131 GLY 131 142 142 GLY GLY C . n 
C 1 132 GLY 132 143 143 GLY GLY C . n 
C 1 133 LEU 133 144 144 LEU LEU C . n 
C 1 134 HIS 134 145 145 HIS HIS C . n 
C 1 135 HIS 135 146 146 HIS HIS C . n 
C 1 136 ALA 136 147 147 ALA ALA C . n 
C 1 137 LYS 137 148 148 LYS LYS C . n 
C 1 138 LYS 138 149 149 LYS LYS C . n 
C 1 139 SER 139 150 150 SER SER C . n 
C 1 140 GLU 140 151 151 GLU GLU C . n 
C 1 141 ALA 141 152 152 ALA ALA C . n 
C 1 142 SER 142 153 153 SER SER C . n 
C 1 143 GLY 143 154 154 GLY GLY C . n 
C 1 144 PHE 144 155 155 PHE PHE C . n 
C 1 145 CYS 145 156 156 CYS CYS C . n 
C 1 146 TYR 146 157 157 TYR TYR C . n 
C 1 147 VAL 147 158 158 VAL VAL C . n 
C 1 148 ASN 148 159 159 ASN ASN C . n 
C 1 149 ASP 149 160 160 ASP ASP C . n 
C 1 150 ILE 150 161 161 ILE ILE C . n 
C 1 151 VAL 151 162 162 VAL VAL C . n 
C 1 152 LEU 152 163 163 LEU LEU C . n 
C 1 153 ALA 153 164 164 ALA ALA C . n 
C 1 154 ILE 154 165 165 ILE ILE C . n 
C 1 155 LEU 155 166 166 LEU LEU C . n 
C 1 156 GLU 156 167 167 GLU GLU C . n 
C 1 157 LEU 157 168 168 LEU LEU C . n 
C 1 158 LEU 158 169 169 LEU LEU C . n 
C 1 159 LYS 159 170 170 LYS LYS C . n 
C 1 160 TYR 160 171 171 TYR TYR C . n 
C 1 161 HIS 161 172 172 HIS HIS C . n 
C 1 162 GLN 162 173 173 GLN GLN C . n 
C 1 163 ARG 163 174 174 ARG ARG C . n 
C 1 164 VAL 164 175 175 VAL VAL C . n 
C 1 165 LEU 165 176 176 LEU LEU C . n 
C 1 166 TYR 166 177 177 TYR TYR C