data_4LZG
# 
_entry.id   4LZG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4LZG         
NDB   NA2649       
RCSB  RCSB081275   
WWPDB D_1000081275 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2IHM . unspecified 
PDB 4LZD . unspecified 
PDB 4M04 . unspecified 
PDB 4M0A . unspecified 
# 
_pdbx_database_status.entry_id                        4LZG 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-07-31 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Moon, A.F.'     1 
'Pryor, J.M.'    2 
'Ramsden, D.A.'  3 
'Kunkel, T.A.'   4 
'Bebenek, K.'    5 
'Pedersen, L.C.' 6 
# 
_citation.id                        primary 
_citation.title                     'Sustained active site rigidity during synthesis by human DNA polymerase mu.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            21 
_citation.page_first                253 
_citation.page_last                 260 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24487959 
_citation.pdbx_database_id_DOI      10.1038/nsmb.2766 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Moon, A.F.'     1 
primary 'Pryor, J.M.'    2 
primary 'Ramsden, D.A.'  3 
primary 'Kunkel, T.A.'   4 
primary 'Bebenek, K.'    5 
primary 'Pedersen, L.C.' 6 
# 
_cell.length_a           60.003 
_cell.length_b           68.514 
_cell.length_c           110.307 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4LZG 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         4LZG 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA-directed DNA/RNA polymerase mu' 40054.434 1   2.7.7.7 ? 
'Polymerase Mu Loop2 deletion variant, UNP residues 132-494' ? 
2 polymer     syn 'template strand'                    2740.812  1   ?       ? ? ? 
3 polymer     syn 'upstream primer strand'             1190.830  1   ?       ? ? ? 
4 polymer     syn 'downstream primer strand'           1191.818  1   ?       ? ? ? 
5 non-polymer syn GLYCEROL                             92.094    1   ?       ? ? ? 
6 non-polymer syn 'CHLORIDE ION'                       35.453    2   ?       ? ? ? 
7 non-polymer syn 'SODIUM ION'                         22.990    2   ?       ? ? ? 
8 water       nat water                                18.015    513 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol Mu, Terminal transferase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSAAAPLSPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFG
EHSSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDL
STPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQ
HSCCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNS
HGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
;GSAAAPLSPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFG
EHSSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDL
STPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQ
HSCCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNS
HGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DG)(DG)(DC)(DA)(DT)(DA)(DC)(DG)' CGGCATACG T ? 
3 polydeoxyribonucleotide no no '(DC)(DG)(DT)(DA)' CGTA P ? 
4 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DG)' GCCG D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ALA n 
1 4   ALA n 
1 5   ALA n 
1 6   PRO n 
1 7   LEU n 
1 8   SER n 
1 9   PRO n 
1 10  ALA n 
1 11  TRP n 
1 12  MET n 
1 13  PRO n 
1 14  ALA n 
1 15  TYR n 
1 16  ALA n 
1 17  CYS n 
1 18  GLN n 
1 19  ARG n 
1 20  PRO n 
1 21  THR n 
1 22  PRO n 
1 23  LEU n 
1 24  THR n 
1 25  HIS n 
1 26  HIS n 
1 27  ASN n 
1 28  THR n 
1 29  GLY n 
1 30  LEU n 
1 31  SER n 
1 32  GLU n 
1 33  ALA n 
1 34  LEU n 
1 35  GLU n 
1 36  ILE n 
1 37  LEU n 
1 38  ALA n 
1 39  GLU n 
1 40  ALA n 
1 41  ALA n 
1 42  GLY n 
1 43  PHE n 
1 44  GLU n 
1 45  GLY n 
1 46  SER n 
1 47  GLU n 
1 48  GLY n 
1 49  ARG n 
1 50  LEU n 
1 51  LEU n 
1 52  THR n 
1 53  PHE n 
1 54  CYS n 
1 55  ARG n 
1 56  ALA n 
1 57  ALA n 
1 58  SER n 
1 59  VAL n 
1 60  LEU n 
1 61  LYS n 
1 62  ALA n 
1 63  LEU n 
1 64  PRO n 
1 65  SER n 
1 66  PRO n 
1 67  VAL n 
1 68  THR n 
1 69  THR n 
1 70  LEU n 
1 71  SER n 
1 72  GLN n 
1 73  LEU n 
1 74  GLN n 
1 75  GLY n 
1 76  LEU n 
1 77  PRO n 
1 78  HIS n 
1 79  PHE n 
1 80  GLY n 
1 81  GLU n 
1 82  HIS n 
1 83  SER n 
1 84  SER n 
1 85  ARG n 
1 86  VAL n 
1 87  VAL n 
1 88  GLN n 
1 89  GLU n 
1 90  LEU n 
1 91  LEU n 
1 92  GLU n 
1 93  HIS n 
1 94  GLY n 
1 95  VAL n 
1 96  CYS n 
1 97  GLU n 
1 98  GLU n 
1 99  VAL n 
1 100 GLU n 
1 101 ARG n 
1 102 VAL n 
1 103 ARG n 
1 104 ARG n 
1 105 SER n 
1 106 GLU n 
1 107 ARG n 
1 108 TYR n 
1 109 GLN n 
1 110 THR n 
1 111 MET n 
1 112 LYS n 
1 113 LEU n 
1 114 PHE n 
1 115 THR n 
1 116 GLN n 
1 117 ILE n 
1 118 PHE n 
1 119 GLY n 
1 120 VAL n 
1 121 GLY n 
1 122 VAL n 
1 123 LYS n 
1 124 THR n 
1 125 ALA n 
1 126 ASP n 
1 127 ARG n 
1 128 TRP n 
1 129 TYR n 
1 130 ARG n 
1 131 GLU n 
1 132 GLY n 
1 133 LEU n 
1 134 ARG n 
1 135 THR n 
1 136 LEU n 
1 137 ASP n 
1 138 ASP n 
1 139 LEU n 
1 140 ARG n 
1 141 GLU n 
1 142 GLN n 
1 143 PRO n 
1 144 GLN n 
1 145 LYS n 
1 146 LEU n 
1 147 THR n 
1 148 GLN n 
1 149 GLN n 
1 150 GLN n 
1 151 LYS n 
1 152 ALA n 
1 153 GLY n 
1 154 LEU n 
1 155 GLN n 
1 156 HIS n 
1 157 HIS n 
1 158 GLN n 
1 159 ASP n 
1 160 LEU n 
1 161 SER n 
1 162 THR n 
1 163 PRO n 
1 164 VAL n 
1 165 LEU n 
1 166 ARG n 
1 167 SER n 
1 168 ASP n 
1 169 VAL n 
1 170 ASP n 
1 171 ALA n 
1 172 LEU n 
1 173 GLN n 
1 174 GLN n 
1 175 VAL n 
1 176 VAL n 
1 177 GLU n 
1 178 GLU n 
1 179 ALA n 
1 180 VAL n 
1 181 GLY n 
1 182 GLN n 
1 183 ALA n 
1 184 LEU n 
1 185 PRO n 
1 186 GLY n 
1 187 ALA n 
1 188 THR n 
1 189 VAL n 
1 190 THR n 
1 191 LEU n 
1 192 THR n 
1 193 GLY n 
1 194 GLY n 
1 195 PHE n 
1 196 ARG n 
1 197 ARG n 
1 198 GLY n 
1 199 LYS n 
1 200 LEU n 
1 201 GLN n 
1 202 GLY n 
1 203 HIS n 
1 204 ASP n 
1 205 VAL n 
1 206 ASP n 
1 207 PHE n 
1 208 LEU n 
1 209 ILE n 
1 210 THR n 
1 211 HIS n 
1 212 PRO n 
1 213 LYS n 
1 214 GLU n 
1 215 GLY n 
1 216 GLN n 
1 217 GLU n 
1 218 ALA n 
1 219 GLY n 
1 220 LEU n 
1 221 LEU n 
1 222 PRO n 
1 223 ARG n 
1 224 VAL n 
1 225 MET n 
1 226 CYS n 
1 227 ARG n 
1 228 LEU n 
1 229 GLN n 
1 230 ASP n 
1 231 GLN n 
1 232 GLY n 
1 233 LEU n 
1 234 ILE n 
1 235 LEU n 
1 236 TYR n 
1 237 HIS n 
1 238 GLN n 
1 239 HIS n 
1 240 GLN n 
1 241 HIS n 
1 242 SER n 
1 243 CYS n 
1 244 CYS n 
1 245 GLU n 
1 246 SER n 
1 247 PRO n 
1 248 THR n 
1 249 ARG n 
1 250 LEU n 
1 251 ALA n 
1 252 GLN n 
1 253 GLN n 
1 254 SER n 
1 255 HIS n 
1 256 MET n 
1 257 ASP n 
1 258 ALA n 
1 259 PHE n 
1 260 GLU n 
1 261 ARG n 
1 262 SER n 
1 263 PHE n 
1 264 CYS n 
1 265 ILE n 
1 266 PHE n 
1 267 ARG n 
1 268 LEU n 
1 269 PRO n 
1 270 GLN n 
1 271 PRO n 
1 272 GLY n 
1 273 SER n 
1 274 TRP n 
1 275 LYS n 
1 276 ALA n 
1 277 VAL n 
1 278 ARG n 
1 279 VAL n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 VAL n 
1 284 ALA n 
1 285 PRO n 
1 286 VAL n 
1 287 SER n 
1 288 GLN n 
1 289 PHE n 
1 290 PRO n 
1 291 PHE n 
1 292 ALA n 
1 293 LEU n 
1 294 LEU n 
1 295 GLY n 
1 296 TRP n 
1 297 THR n 
1 298 GLY n 
1 299 SER n 
1 300 LYS n 
1 301 LEU n 
1 302 PHE n 
1 303 GLN n 
1 304 ARG n 
1 305 GLU n 
1 306 LEU n 
1 307 ARG n 
1 308 ARG n 
1 309 PHE n 
1 310 SER n 
1 311 ARG n 
1 312 LYS n 
1 313 GLU n 
1 314 LYS n 
1 315 GLY n 
1 316 LEU n 
1 317 TRP n 
1 318 LEU n 
1 319 ASN n 
1 320 SER n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 PHE n 
1 325 ASP n 
1 326 PRO n 
1 327 GLU n 
1 328 GLN n 
1 329 LYS n 
1 330 THR n 
1 331 PHE n 
1 332 PHE n 
1 333 GLN n 
1 334 ALA n 
1 335 ALA n 
1 336 SER n 
1 337 GLU n 
1 338 GLU n 
1 339 ASP n 
1 340 ILE n 
1 341 PHE n 
1 342 ARG n 
1 343 HIS n 
1 344 LEU n 
1 345 GLY n 
1 346 LEU n 
1 347 GLU n 
1 348 TYR n 
1 349 LEU n 
1 350 PRO n 
1 351 PRO n 
1 352 GLU n 
1 353 GLN n 
1 354 ARG n 
1 355 ASN n 
1 356 ALA n 
2 1   DC  n 
2 2   DG  n 
2 3   DG  n 
2 4   DC  n 
2 5   DA  n 
2 6   DT  n 
2 7   DA  n 
2 8   DC  n 
2 9   DG  n 
3 1   DC  n 
3 2   DG  n 
3 3   DT  n 
3 4   DA  n 
4 1   DG  n 
4 2   DC  n 
4 3   DC  n 
4 4   DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLM, polmu' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   
;This vector is a modified version of the pGEXM vector backbone, where a TEV protease cleavage site has been inserted downstream of the thrombin cleavage site, and the sequence of the multicloning site has been replaced by that from the pMALX vector (Moon et al, 2010).  Three TGA stop codons have been inserted downstream of the multicloning site, each utilizing a different reading frame.
;
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEXM 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'synethesized by Oligos Etc' 
3 1 sample ? ? ? ? ? 'synthesized by Oligos Etc'  
4 1 sample ? ? ? ? ? 'synthesized by Oligos Etc'  
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOLM_HUMAN Q9NP87 1 
;PLSPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFGEHSSR
VVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLSTPVL
RSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQHSCCE
SPTRLAQQSHMDAFERSFCIFRLPQPPGAAVGGSTRPCPSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKE
KGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
132 ? 
2 PDB 4LZG        4LZG   2 CGGCATACG ?   ? 
3 PDB 4LZG        4LZG   3 CGTA ?   ? 
4 PDB 4LZG        4LZG   4 GCCG ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4LZG A 6 ? 356 ? Q9NP87 132 ? 494 ? 132 494 
2 2 4LZG T 1 ? 9   ? 4LZG   1   ? 9   ? 1   9   
3 3 4LZG P 1 ? 4   ? 4LZG   1   ? 4   ? 1   4   
4 4 4LZG D 1 ? 4   ? 4LZG   1   ? 4   ? 1   4   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4LZG GLY A 1   ? UNP Q9NP87 ?   ?   'EXPRESSION TAG' 127 1  
1 4LZG SER A 2   ? UNP Q9NP87 ?   ?   'EXPRESSION TAG' 128 2  
1 4LZG ALA A 3   ? UNP Q9NP87 ?   ?   'EXPRESSION TAG' 129 3  
1 4LZG ALA A 4   ? UNP Q9NP87 ?   ?   'EXPRESSION TAG' 130 4  
1 4LZG ALA A 5   ? UNP Q9NP87 ?   ?   'EXPRESSION TAG' 131 5  
1 4LZG ?   A ?   ? UNP Q9NP87 PRO 398 DELETION         ?   6  
1 4LZG ?   A ?   ? UNP Q9NP87 GLY 399 DELETION         ?   7  
1 4LZG ?   A ?   ? UNP Q9NP87 ALA 400 DELETION         ?   8  
1 4LZG ?   A ?   ? UNP Q9NP87 ALA 401 DELETION         ?   9  
1 4LZG ?   A ?   ? UNP Q9NP87 VAL 402 DELETION         ?   10 
1 4LZG ?   A ?   ? UNP Q9NP87 GLY 403 DELETION         ?   11 
1 4LZG ?   A ?   ? UNP Q9NP87 GLY 404 DELETION         ?   12 
1 4LZG ?   A ?   ? UNP Q9NP87 SER 405 DELETION         ?   13 
1 4LZG ?   A ?   ? UNP Q9NP87 THR 406 DELETION         ?   14 
1 4LZG ?   A ?   ? UNP Q9NP87 ARG 407 DELETION         ?   15 
1 4LZG ?   A ?   ? UNP Q9NP87 PRO 408 DELETION         ?   16 
1 4LZG ?   A ?   ? UNP Q9NP87 CYS 409 DELETION         ?   17 
1 4LZG ?   A ?   ? UNP Q9NP87 PRO 410 DELETION         ?   18 
1 4LZG GLY A 272 ? UNP Q9NP87 ?   ?   INSERTION        410 19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION'                       ?                               'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'   149.211 
NA  non-polymer         . 'SODIUM ION'                         ?                               'Na 1'            22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4LZG 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.51 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   50.98 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;Crystals were grown by mixing 1uL of the protein/DNA complex with 1uL of mother liquor (85mM MES pH 6.5, 85mMCaCl2, 42.5mM NaCl, 8.5% PEG3350, 11% glycerol), using the sitting drop vapor diffusion technique.  Crystals were transferred to a cryoprotectant solution containing 0.1M MES pH 6.5, 0.1M CaCl2, 50mM NaCl, 10mM MgCl2, 20% PEG3350, 15% glycerol in three steps.  , VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2012-10-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
# 
_reflns.entry_id                     4LZG 
_reflns.d_resolution_high            1.599 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   60033 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_netI_over_sigmaI        13.800 
_reflns.pdbx_chi_squared             1.202 
_reflns.pdbx_redundancy              6.200 
_reflns.percent_possible_obs         98.600 
_reflns.B_iso_Wilson_estimate        17.450 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.number_all                   60033 
_reflns.pdbx_Rsym_value              0.062 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.599 1.630  ? ? ? 0.272 ? ? 1.054 2.400 ? 2520 83.100  1  1 
1.630 1.660  ? ? ? 0.245 ? ? 1.060 3.100 ? 2785 93.800  2  1 
1.660 1.690  ? ? ? 0.245 ? ? 1.056 3.700 ? 2887 96.700  3  1 
1.690 1.720  ? ? ? 0.220 ? ? 1.099 4.400 ? 3003 99.200  4  1 
1.720 1.760  ? ? ? 0.212 ? ? 1.041 5.000 ? 2985 99.800  5  1 
1.760 1.800  ? ? ? 0.193 ? ? 1.090 5.700 ? 3005 100.000 6  1 
1.800 1.850  ? ? ? 0.186 ? ? 1.125 6.300 ? 3008 100.000 7  1 
1.850 1.900  ? ? ? 0.168 ? ? 1.127 6.600 ? 3022 100.000 8  1 
1.900 1.950  ? ? ? 0.175 ? ? 1.248 6.800 ? 2996 100.000 9  1 
1.950 2.020  ? ? ? 0.136 ? ? 1.137 7.100 ? 3033 100.000 10 1 
2.020 2.090  ? ? ? 0.126 ? ? 1.222 7.100 ? 3001 99.900  11 1 
2.090 2.170  ? ? ? 0.104 ? ? 1.122 7.300 ? 3055 100.000 12 1 
2.170 2.270  ? ? ? 0.102 ? ? 1.270 7.200 ? 3027 100.000 13 1 
2.270 2.390  ? ? ? 0.077 ? ? 1.089 7.400 ? 3028 100.000 14 1 
2.390 2.540  ? ? ? 0.068 ? ? 1.036 7.400 ? 3053 100.000 15 1 
2.540 2.740  ? ? ? 0.064 ? ? 1.282 7.400 ? 3063 100.000 16 1 
2.740 3.010  ? ? ? 0.060 ? ? 1.455 7.300 ? 3070 100.000 17 1 
3.010 3.450  ? ? ? 0.049 ? ? 1.406 7.300 ? 3084 100.000 18 1 
3.450 4.340  ? ? ? 0.044 ? ? 1.353 7.200 ? 3139 99.900  19 1 
4.340 50.000 ? ? ? 0.042 ? ? 1.301 6.800 ? 3269 99.700  20 1 
# 
_refine.entry_id                                 4LZG 
_refine.ls_d_res_high                            1.5990 
_refine.ls_d_res_low                             34.9320 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.5100 
_refine.ls_number_reflns_obs                     59953 
_refine.ls_number_reflns_all                     60033 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.details                                  ? 
_refine.ls_R_factor_all                          0.18 
_refine.ls_R_factor_obs                          0.175 
_refine.ls_R_factor_R_work                       0.1742 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2046 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.9900 
_refine.ls_number_reflns_R_free                  2991 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               14.6934 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.1900 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      
'hPol Mu Loop2 truncation variant in ternary complex with single-nucleotide gapped DNA' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8727 
_refine.B_iso_max                                64.560 
_refine.B_iso_min                                0.670 
_refine.pdbx_overall_phase_error                 19.4800 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.300 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2551 
_refine_hist.pdbx_number_atoms_nucleic_acid   344 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             513 
_refine_hist.number_atoms_total               3418 
_refine_hist.d_res_high                       1.5990 
_refine_hist.d_res_low                        34.9320 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           3122 0.011  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          4320 1.448  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     475  0.095  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      511  0.007  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 1039 13.129 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.5989 1.6252  21 81.0000  2229 . 0.2552 0.2557 . 108 . 2337 . . 'X-RAY DIFFRACTION' 
1.6252 1.6532  21 94.0000  2499 . 0.2243 0.2747 . 132 . 2631 . . 'X-RAY DIFFRACTION' 
1.6532 1.6832  21 96.0000  2639 . 0.2153 0.2433 . 139 . 2778 . . 'X-RAY DIFFRACTION' 
1.6832 1.7156  21 99.0000  2694 . 0.2124 0.2409 . 142 . 2836 . . 'X-RAY DIFFRACTION' 
1.7156 1.7506  21 100.0000 2700 . 0.1937 0.2526 . 141 . 2841 . . 'X-RAY DIFFRACTION' 
1.7506 1.7887  21 100.0000 2717 . 0.1957 0.2212 . 146 . 2863 . . 'X-RAY DIFFRACTION' 
1.7887 1.8303  21 100.0000 2711 . 0.1790 0.2193 . 140 . 2851 . . 'X-RAY DIFFRACTION' 
1.8303 1.8761  21 100.0000 2729 . 0.1822 0.2097 . 148 . 2877 . . 'X-RAY DIFFRACTION' 
1.8761 1.9268  21 100.0000 2717 . 0.1813 0.2266 . 141 . 2858 . . 'X-RAY DIFFRACTION' 
1.9268 1.9835  21 100.0000 2736 . 0.1786 0.2298 . 145 . 2881 . . 'X-RAY DIFFRACTION' 
1.9835 2.0475  21 100.0000 2728 . 0.1780 0.2227 . 142 . 2870 . . 'X-RAY DIFFRACTION' 
2.0475 2.1207  21 100.0000 2742 . 0.1749 0.1916 . 145 . 2887 . . 'X-RAY DIFFRACTION' 
2.1207 2.2056  21 100.0000 2748 . 0.1698 0.2075 . 143 . 2891 . . 'X-RAY DIFFRACTION' 
2.2056 2.3059  21 100.0000 2738 . 0.1744 0.2149 . 141 . 2879 . . 'X-RAY DIFFRACTION' 
2.3059 2.4275  21 100.0000 2738 . 0.1725 0.2066 . 149 . 2887 . . 'X-RAY DIFFRACTION' 
2.4275 2.5795  21 100.0000 2763 . 0.1753 0.2160 . 143 . 2906 . . 'X-RAY DIFFRACTION' 
2.5795 2.7786  21 100.0000 2772 . 0.1836 0.2049 . 146 . 2918 . . 'X-RAY DIFFRACTION' 
2.7786 3.0581  21 100.0000 2779 . 0.1796 0.1988 . 146 . 2925 . . 'X-RAY DIFFRACTION' 
3.0581 3.5002  21 100.0000 2806 . 0.1634 0.1891 . 149 . 2955 . . 'X-RAY DIFFRACTION' 
3.5002 4.4085  21 100.0000 2822 . 0.1432 0.1666 . 147 . 2969 . . 'X-RAY DIFFRACTION' 
4.4085 34.9400 21 100.0000 2955 . 0.1761 0.2049 . 158 . 3113 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4LZG 
_struct.title                     'Binary complex of human DNA Polymerase Mu with DNA' 
_struct.pdbx_descriptor           'DNA-directed DNA/RNA polymerase mu (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4LZG 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'polymerase, DNA break repair, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
I N N 6 ? 
J N N 8 ? 
K N N 8 ? 
L N N 8 ? 
M N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 15  ? ARG A 19  ? TYR A 141 ARG A 145 5 ? 5  
HELX_P HELX_P2  2  ASN A 27  ? GLU A 44  ? ASN A 153 GLU A 170 1 ? 18 
HELX_P HELX_P3  3  SER A 46  ? LEU A 63  ? SER A 172 LEU A 189 1 ? 18 
HELX_P HELX_P4  4  THR A 69  ? GLN A 74  ? THR A 195 GLN A 200 5 ? 6  
HELX_P HELX_P5  5  GLY A 80  ? GLY A 94  ? GLY A 206 GLY A 220 1 ? 15 
HELX_P HELX_P6  6  CYS A 96  ? SER A 105 ? CYS A 222 SER A 231 1 ? 10 
HELX_P HELX_P7  7  SER A 105 ? GLN A 116 ? SER A 231 GLN A 242 1 ? 12 
HELX_P HELX_P8  8  GLY A 121 ? GLU A 131 ? GLY A 247 GLU A 257 1 ? 11 
HELX_P HELX_P9  9  THR A 135 ? GLU A 141 ? THR A 261 GLU A 267 1 ? 7  
HELX_P HELX_P10 10 GLN A 142 ? LEU A 146 ? GLN A 268 LEU A 272 5 ? 5  
HELX_P HELX_P11 11 THR A 147 ? HIS A 156 ? THR A 273 HIS A 282 1 ? 10 
HELX_P HELX_P12 12 HIS A 156 ? SER A 161 ? HIS A 282 SER A 287 1 ? 6  
HELX_P HELX_P13 13 ARG A 166 ? LEU A 184 ? ARG A 292 LEU A 310 1 ? 19 
HELX_P HELX_P14 14 THR A 192 ? ARG A 197 ? THR A 318 ARG A 323 1 ? 6  
HELX_P HELX_P15 15 GLY A 219 ? GLN A 231 ? GLY A 345 GLN A 357 1 ? 13 
HELX_P HELX_P16 16 PRO A 285 ? SER A 287 ? PRO A 423 SER A 425 5 ? 3  
HELX_P HELX_P17 17 GLN A 288 ? GLY A 298 ? GLN A 426 GLY A 436 1 ? 11 
HELX_P HELX_P18 18 SER A 299 ? GLY A 315 ? SER A 437 GLY A 453 1 ? 17 
HELX_P HELX_P19 19 SER A 336 ? LEU A 344 ? SER A 474 LEU A 482 1 ? 9  
HELX_P HELX_P20 20 PRO A 350 ? ARG A 354 ? PRO A 488 ARG A 492 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A PHE 79  O   ? ? ? 1_555 H NA  . NA ? ? A PHE 205 A NA  504 1_555 ? ? ? ? ? ? ?            2.294 ? 
metalc2  metalc ? ? G NA  .   NA  ? ? ? 1_555 L HOH . O  ? ? A NA  503 P HOH 103 1_555 ? ? ? ? ? ? ?            2.310 ? 
metalc3  metalc ? ? A VAL 120 O   ? ? ? 1_555 G NA  . NA ? ? A VAL 246 A NA  503 1_555 ? ? ? ? ? ? ?            2.310 ? 
metalc4  metalc ? ? H NA  .   NA  ? ? ? 1_555 J HOH . O  ? ? A NA  504 A HOH 778 1_555 ? ? ? ? ? ? ?            2.320 ? 
metalc5  metalc ? ? G NA  .   NA  ? ? ? 1_555 J HOH . O  ? ? A NA  503 A HOH 900 1_555 ? ? ? ? ? ? ?            2.327 ? 
metalc6  metalc ? ? A THR 115 O   ? ? ? 1_555 G NA  . NA ? ? A THR 241 A NA  503 1_555 ? ? ? ? ? ? ?            2.363 ? 
metalc7  metalc ? ? H NA  .   NA  ? ? ? 1_555 M HOH . O  ? ? A NA  504 D HOH 106 1_555 ? ? ? ? ? ? ?            2.369 ? 
metalc8  metalc ? ? H NA  .   NA  ? ? ? 1_555 M HOH . O  ? ? A NA  504 D HOH 104 1_555 ? ? ? ? ? ? ?            2.436 ? 
metalc9  metalc ? ? G NA  .   NA  ? ? ? 1_555 J HOH . O  ? ? A NA  503 A HOH 901 1_555 ? ? ? ? ? ? ?            2.450 ? 
metalc10 metalc ? ? A ILE 117 O   ? ? ? 1_555 G NA  . NA ? ? A ILE 243 A NA  503 1_555 ? ? ? ? ? ? ?            2.454 ? 
metalc11 metalc ? ? H NA  .   NA  ? ? ? 1_555 J HOH . O  ? ? A NA  504 A HOH 852 1_555 ? ? ? ? ? ? ?            2.643 ? 
metalc12 metalc ? ? C DT  3   OP1 ? ? ? 1_555 G NA  . NA ? ? P DT  3   A NA  503 1_555 ? ? ? ? ? ? ?            2.805 ? 
hydrog1  hydrog ? ? B DC  1   N3  ? ? ? 1_555 D DG  4 N1 ? ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  1   N4  ? ? ? 1_555 D DG  4 O6 ? ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  1   O2  ? ? ? 1_555 D DG  4 N2 ? ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2   N1  ? ? ? 1_555 D DC  3 N3 ? ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2   N2  ? ? ? 1_555 D DC  3 O2 ? ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  2   O6  ? ? ? 1_555 D DC  3 N4 ? ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  3   N1  ? ? ? 1_555 D DC  2 N3 ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  3   N2  ? ? ? 1_555 D DC  2 O2 ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  3   O6  ? ? ? 1_555 D DC  2 N4 ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  4   N3  ? ? ? 1_555 D DG  1 N1 ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  4   N4  ? ? ? 1_555 D DG  1 O6 ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  4   O2  ? ? ? 1_555 D DG  1 N2 ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DT  6   N3  ? ? ? 1_555 C DA  4 N1 ? ? T DT  6   P DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DT  6   O4  ? ? ? 1_555 C DA  4 N6 ? ? T DT  6   P DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DA  7   N1  ? ? ? 1_555 C DT  3 N3 ? ? T DA  7   P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DA  7   N6  ? ? ? 1_555 C DT  3 O4 ? ? T DA  7   P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  8   N3  ? ? ? 1_555 C DG  2 N1 ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  8   N4  ? ? ? 1_555 C DG  2 O6 ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  8   O2  ? ? ? 1_555 C DG  2 N2 ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  9   N1  ? ? ? 1_555 C DC  1 N3 ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DG  9   N2  ? ? ? 1_555 C DC  1 O2 ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  9   O6  ? ? ? 1_555 C DC  1 N4 ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           298 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            436 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    299 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     437 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -6.21 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 164 ? LEU A 165 ? VAL A 290 LEU A 291 
A 2 GLN A 201 ? GLY A 202 ? GLN A 327 GLY A 328 
B 1 THR A 188 ? LEU A 191 ? THR A 314 LEU A 317 
B 2 VAL A 205 ? THR A 210 ? VAL A 331 THR A 336 
B 3 SER A 273 ? VAL A 283 ? SER A 411 VAL A 421 
B 4 ARG A 261 ? GLN A 270 ? ARG A 387 GLN A 396 
B 5 ILE A 234 ? TYR A 236 ? ILE A 360 TYR A 362 
C 1 TRP A 317 ? LEU A 318 ? TRP A 455 LEU A 456 
C 2 LEU A 323 ? ASP A 325 ? LEU A 461 ASP A 463 
C 3 THR A 330 ? PHE A 331 ? THR A 468 PHE A 469 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 164 ? N VAL A 290 O GLY A 202 ? O GLY A 328 
B 1 2 N THR A 190 ? N THR A 316 O LEU A 208 ? O LEU A 334 
B 2 3 N ILE A 209 ? N ILE A 335 O VAL A 282 ? O VAL A 420 
B 3 4 O VAL A 277 ? O VAL A 415 N PHE A 266 ? N PHE A 392 
B 4 5 O ILE A 265 ? O ILE A 391 N TYR A 236 ? N TYR A 362 
C 1 2 N TRP A 317 ? N TRP A 455 O PHE A 324 ? O PHE A 462 
C 2 3 N ASP A 325 ? N ASP A 463 O THR A 330 ? O THR A 468 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 501' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 502'  
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA A 503'  
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 504'  
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL A 505'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 ARG A 261 ? ARG A 387 . ? 1_555 ? 
2  AC1 7 GLY A 295 ? GLY A 433 . ? 1_555 ? 
3  AC1 7 ARG A 307 ? ARG A 445 . ? 1_555 ? 
4  AC1 7 SER A 320 ? SER A 458 . ? 1_555 ? 
5  AC1 7 CL  I .   ? CL  A 505 . ? 1_555 ? 
6  AC1 7 DA  C 4   ? DA  P 4   . ? 1_555 ? 
7  AC1 7 DT  B 6   ? DT  T 6   . ? 1_555 ? 
8  AC2 3 SER A 46  ? SER A 172 . ? 1_555 ? 
9  AC2 3 GLY A 48  ? GLY A 174 . ? 1_555 ? 
10 AC2 3 ARG A 49  ? ARG A 175 . ? 1_555 ? 
11 AC3 7 THR A 115 ? THR A 241 . ? 1_555 ? 
12 AC3 7 ILE A 117 ? ILE A 243 . ? 1_555 ? 
13 AC3 7 VAL A 120 ? VAL A 246 . ? 1_555 ? 
14 AC3 7 HOH J .   ? HOH A 900 . ? 1_555 ? 
15 AC3 7 HOH J .   ? HOH A 901 . ? 1_555 ? 
16 AC3 7 DT  C 3   ? DT  P 3   . ? 1_555 ? 
17 AC3 7 HOH L .   ? HOH P 103 . ? 1_555 ? 
18 AC4 5 PHE A 79  ? PHE A 205 . ? 1_555 ? 
19 AC4 5 HOH J .   ? HOH A 778 . ? 1_555 ? 
20 AC4 5 HOH J .   ? HOH A 852 . ? 1_555 ? 
21 AC4 5 HOH M .   ? HOH D 104 . ? 1_555 ? 
22 AC4 5 HOH M .   ? HOH D 106 . ? 1_555 ? 
23 AC5 4 ARG A 261 ? ARG A 387 . ? 1_555 ? 
24 AC5 4 SER A 320 ? SER A 458 . ? 1_555 ? 
25 AC5 4 GOL E .   ? GOL A 501 . ? 1_555 ? 
26 AC5 4 DA  B 7   ? DA  T 7   . ? 1_555 ? 
# 
_atom_sites.entry_id                    4LZG 
_atom_sites.fract_transf_matrix[1][1]   0.016666 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014596 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009066 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 12  ? 0.729   -28.585 -11.617 1.00 28.94 ?  138  MET A N     1 
ATOM   2    C  CA    . MET A 1 12  ? 0.888   -27.127 -11.583 1.00 22.33 ?  138  MET A CA    1 
ATOM   3    C  C     . MET A 1 12  ? 0.114   -26.464 -12.720 1.00 15.72 ?  138  MET A C     1 
ATOM   4    O  O     . MET A 1 12  ? 0.409   -26.654 -13.909 1.00 16.74 ?  138  MET A O     1 
ATOM   5    C  CB    . MET A 1 12  ? 2.384   -26.777 -11.571 1.00 19.86 ?  138  MET A CB    1 
ATOM   6    C  CG    . MET A 1 12  ? 2.784   -25.409 -12.047 1.00 25.62 ?  138  MET A CG    1 
ATOM   7    S  SD    . MET A 1 12  ? 2.942   -24.168 -10.751 1.00 25.15 ?  138  MET A SD    1 
ATOM   8    C  CE    . MET A 1 12  ? 3.968   -24.985 -9.520  1.00 18.20 ?  138  MET A CE    1 
ATOM   9    N  N     . PRO A 1 13  ? -0.917  -25.679 -12.360 1.00 15.81 ?  139  PRO A N     1 
ATOM   10   C  CA    . PRO A 1 13  ? -1.795  -25.085 -13.379 1.00 15.08 ?  139  PRO A CA    1 
ATOM   11   C  C     . PRO A 1 13  ? -1.084  -23.998 -14.173 1.00 13.17 ?  139  PRO A C     1 
ATOM   12   O  O     . PRO A 1 13  ? -0.064  -23.483 -13.711 1.00 15.69 ?  139  PRO A O     1 
ATOM   13   C  CB    . PRO A 1 13  ? -2.939  -24.492 -12.562 1.00 18.68 ?  139  PRO A CB    1 
ATOM   14   C  CG    . PRO A 1 13  ? -2.370  -24.262 -11.236 1.00 23.50 ?  139  PRO A CG    1 
ATOM   15   C  CD    . PRO A 1 13  ? -1.345  -25.349 -10.994 1.00 21.63 ?  139  PRO A CD    1 
ATOM   16   N  N     . ALA A 1 14  ? -1.609  -23.662 -15.340 1.00 12.38 ?  140  ALA A N     1 
ATOM   17   C  CA    . ALA A 1 14  ? -0.872  -22.857 -16.297 1.00 8.54  ?  140  ALA A CA    1 
ATOM   18   C  C     . ALA A 1 14  ? -0.888  -21.360 -16.020 1.00 12.17 ?  140  ALA A C     1 
ATOM   19   O  O     . ALA A 1 14  ? 0.063   -20.675 -16.357 1.00 13.66 ?  140  ALA A O     1 
ATOM   20   C  CB    . ALA A 1 14  ? -1.365  -23.126 -17.705 1.00 21.17 ?  140  ALA A CB    1 
ATOM   21   N  N     . TYR A 1 15  ? -1.962  -20.861 -15.405 1.00 8.46  ?  141  TYR A N     1 
ATOM   22   C  CA    . TYR A 1 15  ? -2.067  -19.435 -15.118 1.00 6.30  ?  141  TYR A CA    1 
ATOM   23   C  C     . TYR A 1 15  ? -1.681  -19.118 -13.678 1.00 5.68  ?  141  TYR A C     1 
ATOM   24   O  O     . TYR A 1 15  ? -2.017  -19.872 -12.771 1.00 7.84  ?  141  TYR A O     1 
ATOM   25   C  CB    . TYR A 1 15  ? -3.510  -19.005 -15.290 1.00 5.64  ?  141  TYR A CB    1 
ATOM   26   C  CG    . TYR A 1 15  ? -4.045  -18.992 -16.687 1.00 4.39  ?  141  TYR A CG    1 
ATOM   27   C  CD1   . TYR A 1 15  ? -4.545  -20.150 -17.281 1.00 10.05 ?  141  TYR A CD1   1 
ATOM   28   C  CD2   . TYR A 1 15  ? -4.140  -17.805 -17.390 1.00 7.04  ?  141  TYR A CD2   1 
ATOM   29   C  CE1   . TYR A 1 15  ? -5.108  -20.103 -18.552 1.00 10.64 ?  141  TYR A CE1   1 
ATOM   30   C  CE2   . TYR A 1 15  ? -4.693  -17.747 -18.657 1.00 8.28  ?  141  TYR A CE2   1 
ATOM   31   C  CZ    . TYR A 1 15  ? -5.172  -18.908 -19.237 1.00 8.42  ?  141  TYR A CZ    1 
ATOM   32   O  OH    . TYR A 1 15  ? -5.718  -18.807 -20.503 1.00 12.56 ?  141  TYR A OH    1 
ATOM   33   N  N     . ALA A 1 16  ? -0.976  -18.007 -13.455 1.00 5.74  ?  142  ALA A N     1 
ATOM   34   C  CA    . ALA A 1 16  ? -0.564  -17.664 -12.085 1.00 5.60  ?  142  ALA A CA    1 
ATOM   35   C  C     . ALA A 1 16  ? -1.722  -17.442 -11.126 1.00 7.51  ?  142  ALA A C     1 
ATOM   36   O  O     . ALA A 1 16  ? -1.578  -17.660 -9.933  1.00 7.75  ?  142  ALA A O     1 
ATOM   37   C  CB    . ALA A 1 16  ? 0.377   -16.464 -12.092 1.00 4.18  ?  142  ALA A CB    1 
ATOM   38   N  N     . CYS A 1 17  ? -2.889  -17.062 -11.648 1.00 6.26  ?  143  CYS A N     1 
ATOM   39   C  CA    . CYS A 1 17  ? -4.047  -16.828 -10.799 1.00 4.44  ?  143  CYS A CA    1 
ATOM   40   C  C     . CYS A 1 17  ? -4.711  -18.107 -10.312 1.00 6.59  ?  143  CYS A C     1 
ATOM   41   O  O     . CYS A 1 17  ? -5.635  -18.039 -9.509  1.00 7.72  ?  143  CYS A O     1 
ATOM   42   C  CB    . CYS A 1 17  ? -5.081  -15.923 -11.486 1.00 5.26  ?  143  CYS A CB    1 
ATOM   43   S  SG    . CYS A 1 17  ? -5.644  -16.639 -13.058 1.00 8.13  ?  143  CYS A SG    1 
ATOM   44   N  N     . GLN A 1 18  ? -4.214  -19.266 -10.759 1.00 5.73  ?  144  GLN A N     1 
ATOM   45   C  CA    . GLN A 1 18  ? -4.763  -20.560 -10.344 1.00 6.18  ?  144  GLN A CA    1 
ATOM   46   C  C     . GLN A 1 18  ? -3.933  -21.236 -9.263  1.00 8.62  ?  144  GLN A C     1 
ATOM   47   O  O     . GLN A 1 18  ? -4.215  -22.371 -8.869  1.00 11.11 ?  144  GLN A O     1 
ATOM   48   C  CB    . GLN A 1 18  ? -4.838  -21.509 -11.543 1.00 5.67  ?  144  GLN A CB    1 
ATOM   49   C  CG    . GLN A 1 18  ? -5.790  -21.078 -12.621 1.00 8.51  ?  144  GLN A CG    1 
ATOM   50   C  CD    . GLN A 1 18  ? -5.718  -22.023 -13.815 1.00 11.53 ?  144  GLN A CD    1 
ATOM   51   O  OE1   . GLN A 1 18  ? -4.704  -22.082 -14.486 1.00 11.91 ?  144  GLN A OE1   1 
ATOM   52   N  NE2   . GLN A 1 18  ? -6.781  -22.774 -14.054 1.00 17.16 ?  144  GLN A NE2   1 
ATOM   53   N  N     . ARG A 1 19  ? -2.921  -20.551 -8.762  1.00 8.36  ?  145  ARG A N     1 
ATOM   54   C  CA    . ARG A 1 19  ? -2.084  -21.168 -7.749  1.00 12.02 ?  145  ARG A CA    1 
ATOM   55   C  C     . ARG A 1 19  ? -1.614  -20.124 -6.755  1.00 9.46  ?  145  ARG A C     1 
ATOM   56   O  O     . ARG A 1 19  ? -1.408  -18.966 -7.111  1.00 9.64  ?  145  ARG A O     1 
ATOM   57   C  CB    . ARG A 1 19  ? -0.890  -21.846 -8.407  1.00 17.11 ?  145  ARG A CB    1 
ATOM   58   C  CG    . ARG A 1 19  ? -0.054  -20.865 -9.174  1.00 13.65 ?  145  ARG A CG    1 
ATOM   59   C  CD    . ARG A 1 19  ? 0.852   -21.514 -10.179 1.00 21.97 ?  145  ARG A CD    1 
ATOM   60   N  NE    . ARG A 1 19  ? 1.689   -20.480 -10.754 1.00 19.18 ?  145  ARG A NE    1 
ATOM   61   C  CZ    . ARG A 1 19  ? 1.859   -20.267 -12.049 1.00 12.03 ?  145  ARG A CZ    1 
ATOM   62   N  NH1   . ARG A 1 19  ? 1.276   -21.041 -12.967 1.00 16.14 ?  145  ARG A NH1   1 
ATOM   63   N  NH2   . ARG A 1 19  ? 2.629   -19.267 -12.422 1.00 18.01 ?  145  ARG A NH2   1 
ATOM   64   N  N     . PRO A 1 20  ? -1.466  -20.522 -5.493  1.00 6.22  ?  146  PRO A N     1 
ATOM   65   C  CA    . PRO A 1 20  ? -0.939  -19.575 -4.520  1.00 6.88  ?  146  PRO A CA    1 
ATOM   66   C  C     . PRO A 1 20  ? 0.525   -19.308 -4.779  1.00 7.75  ?  146  PRO A C     1 
ATOM   67   O  O     . PRO A 1 20  ? 1.334   -20.229 -5.064  1.00 10.42 ?  146  PRO A O     1 
ATOM   68   C  CB    . PRO A 1 20  ? -1.101  -20.300 -3.167  1.00 10.08 ?  146  PRO A CB    1 
ATOM   69   C  CG    . PRO A 1 20  ? -1.287  -21.668 -3.490  1.00 13.39 ?  146  PRO A CG    1 
ATOM   70   C  CD    . PRO A 1 20  ? -1.910  -21.763 -4.842  1.00 10.24 ?  146  PRO A CD    1 
ATOM   71   N  N     . THR A 1 21  ? 0.887   -18.032 -4.674  1.00 4.25  ?  147  THR A N     1 
ATOM   72   C  CA    . THR A 1 21  ? 2.285   -17.664 -4.780  1.00 4.22  ?  147  THR A CA    1 
ATOM   73   C  C     . THR A 1 21  ? 2.673   -16.783 -3.616  1.00 6.19  ?  147  THR A C     1 
ATOM   74   O  O     . THR A 1 21  ? 2.250   -15.628 -3.527  1.00 4.78  ?  147  THR A O     1 
ATOM   75   C  CB    . THR A 1 21  ? 2.605   -16.934 -6.095  1.00 3.68  ?  147  THR A CB    1 
ATOM   76   O  OG1   . THR A 1 21  ? 1.980   -17.613 -7.189  1.00 8.34  ?  147  THR A OG1   1 
ATOM   77   C  CG2   . THR A 1 21  ? 4.112   -16.928 -6.333  1.00 5.32  ?  147  THR A CG2   1 
ATOM   78   N  N     . PRO A 1 22  ? 3.456   -17.326 -2.689  1.00 5.29  ?  148  PRO A N     1 
ATOM   79   C  CA    . PRO A 1 22  ? 3.798   -16.562 -1.483  1.00 6.71  ?  148  PRO A CA    1 
ATOM   80   C  C     . PRO A 1 22  ? 4.906   -15.559 -1.753  1.00 4.85  ?  148  PRO A C     1 
ATOM   81   O  O     . PRO A 1 22  ? 5.611   -15.631 -2.760  1.00 7.13  ?  148  PRO A O     1 
ATOM   82   C  CB    . PRO A 1 22  ? 4.252   -17.641 -0.507  1.00 7.61  ?  148  PRO A CB    1 
ATOM   83   C  CG    . PRO A 1 22  ? 4.905   -18.679 -1.436  1.00 7.47  ?  148  PRO A CG    1 
ATOM   84   C  CD    . PRO A 1 22  ? 4.048   -18.685 -2.681  1.00 7.42  ?  148  PRO A CD    1 
ATOM   85   N  N     . LEU A 1 23  ? 5.086   -14.613 -0.833  1.00 4.78  ?  149  LEU A N     1 
ATOM   86   C  CA    . LEU A 1 23  ? 6.078   -13.582 -1.050  1.00 4.33  ?  149  LEU A CA    1 
ATOM   87   C  C     . LEU A 1 23  ? 7.501   -14.120 -1.020  1.00 5.09  ?  149  LEU A C     1 
ATOM   88   O  O     . LEU A 1 23  ? 8.344   -13.727 -1.853  1.00 8.45  ?  149  LEU A O     1 
ATOM   89   C  CB    . LEU A 1 23  ? 5.916   -12.490 0.012   1.00 7.20  ?  149  LEU A CB    1 
ATOM   90   C  CG    . LEU A 1 23  ? 6.942   -11.362 -0.049  1.00 7.55  ?  149  LEU A CG    1 
ATOM   91   C  CD1   . LEU A 1 23  ? 6.930   -10.599 -1.377  1.00 11.46 ?  149  LEU A CD1   1 
ATOM   92   C  CD2   . LEU A 1 23  ? 6.708   -10.428 1.130   1.00 13.17 ?  149  LEU A CD2   1 
ATOM   93   N  N     . THR A 1 24  ? 7.732   -15.051 -0.097  1.00 5.91  ?  150  THR A N     1 
ATOM   94   C  CA    . THR A 1 24  ? 9.039   -15.711 -0.035  1.00 8.21  ?  150  THR A CA    1 
ATOM   95   C  C     . THR A 1 24  ? 8.864   -17.197 -0.332  1.00 4.42  ?  150  THR A C     1 
ATOM   96   O  O     . THR A 1 24  ? 7.812   -17.790 -0.073  1.00 7.14  ?  150  THR A O     1 
ATOM   97   C  CB    . THR A 1 24  ? 9.726   -15.497 1.351   1.00 6.49  ?  150  THR A CB    1 
ATOM   98   O  OG1   . THR A 1 24  ? 8.926   -16.062 2.370   1.00 10.03 ?  150  THR A OG1   1 
ATOM   99   C  CG2   . THR A 1 24  ? 9.912   -13.994 1.623   1.00 12.67 ?  150  THR A CG2   1 
ATOM   100  N  N     . HIS A 1 25  ? 9.910   -17.811 -0.882  1.00 5.05  ?  151  HIS A N     1 
ATOM   101  C  CA    . HIS A 1 25  ? 9.712   -19.133 -1.452  1.00 3.51  ?  151  HIS A CA    1 
ATOM   102  C  C     . HIS A 1 25  ? 11.025  -19.913 -1.463  1.00 3.47  ?  151  HIS A C     1 
ATOM   103  O  O     . HIS A 1 25  ? 11.949  -19.599 -0.688  1.00 6.73  ?  151  HIS A O     1 
ATOM   104  C  CB    . HIS A 1 25  ? 9.083   -19.027 -2.848  1.00 4.31  ?  151  HIS A CB    1 
ATOM   105  C  CG    . HIS A 1 25  ? 9.886   -18.216 -3.814  1.00 6.63  ?  151  HIS A CG    1 
ATOM   106  N  ND1   . HIS A 1 25  ? 10.823  -18.771 -4.652  1.00 6.43  ?  151  HIS A ND1   1 
ATOM   107  C  CD2   . HIS A 1 25  ? 9.856   -16.892 -4.108  1.00 5.85  ?  151  HIS A CD2   1 
ATOM   108  C  CE1   . HIS A 1 25  ? 11.365  -17.822 -5.399  1.00 7.82  ?  151  HIS A CE1   1 
ATOM   109  N  NE2   . HIS A 1 25  ? 10.798  -16.668 -5.084  1.00 7.52  ?  151  HIS A NE2   1 
ATOM   110  N  N     . HIS A 1 26  ? 11.090  -20.953 -2.285  1.00 4.39  ?  152  HIS A N     1 
ATOM   111  C  CA    . HIS A 1 26  ? 12.189  -21.923 -2.149  1.00 4.57  ?  152  HIS A CA    1 
ATOM   112  C  C     . HIS A 1 26  ? 13.052  -22.003 -3.380  1.00 7.40  ?  152  HIS A C     1 
ATOM   113  O  O     . HIS A 1 26  ? 13.852  -22.943 -3.515  1.00 5.79  ?  152  HIS A O     1 
ATOM   114  C  CB    . HIS A 1 26  ? 11.575  -23.296 -1.882  1.00 4.16  ?  152  HIS A CB    1 
ATOM   115  C  CG    . HIS A 1 26  ? 10.519  -23.247 -0.839  1.00 6.88  ?  152  HIS A CG    1 
ATOM   116  N  ND1   . HIS A 1 26  ? 10.795  -23.013 0.489   1.00 6.52  ?  152  HIS A ND1   1 
ATOM   117  C  CD2   . HIS A 1 26  ? 9.169   -23.333 -0.938  1.00 5.21  ?  152  HIS A CD2   1 
ATOM   118  C  CE1   . HIS A 1 26  ? 9.658   -22.958 1.168   1.00 11.34 ?  152  HIS A CE1   1 
ATOM   119  N  NE2   . HIS A 1 26  ? 8.655   -23.149 0.324   1.00 9.83  ?  152  HIS A NE2   1 
ATOM   120  N  N     . ASN A 1 27  ? 12.896  -21.047 -4.289  1.00 4.32  ?  153  ASN A N     1 
ATOM   121  C  CA    . ASN A 1 27  ? 13.652  -21.049 -5.547  1.00 3.80  ?  153  ASN A CA    1 
ATOM   122  C  C     . ASN A 1 27  ? 14.115  -19.658 -5.918  1.00 6.47  ?  153  ASN A C     1 
ATOM   123  O  O     . ASN A 1 27  ? 14.115  -19.274 -7.080  1.00 7.17  ?  153  ASN A O     1 
ATOM   124  C  CB    . ASN A 1 27  ? 12.790  -21.694 -6.657  1.00 3.68  ?  153  ASN A CB    1 
ATOM   125  C  CG    . ASN A 1 27  ? 12.715  -23.181 -6.497  1.00 6.79  ?  153  ASN A CG    1 
ATOM   126  O  OD1   . ASN A 1 27  ? 13.731  -23.855 -6.728  1.00 7.49  ?  153  ASN A OD1   1 
ATOM   127  N  ND2   . ASN A 1 27  ? 11.579  -23.709 -6.033  1.00 4.92  ?  153  ASN A ND2   1 
ATOM   128  N  N     . THR A 1 28  ? 14.564  -18.925 -4.909  1.00 6.54  ?  154  THR A N     1 
ATOM   129  C  CA    . THR A 1 28  ? 14.833  -17.497 -5.048  1.00 4.17  ?  154  THR A CA    1 
ATOM   130  C  C     . THR A 1 28  ? 15.872  -17.189 -6.128  1.00 5.80  ?  154  THR A C     1 
ATOM   131  O  O     . THR A 1 28  ? 15.622  -16.371 -7.012  1.00 6.34  ?  154  THR A O     1 
ATOM   132  C  CB    . THR A 1 28  ? 15.202  -16.925 -3.690  1.00 5.08  ?  154  THR A CB    1 
ATOM   133  O  OG1   . THR A 1 28  ? 14.162  -17.251 -2.768  1.00 5.57  ?  154  THR A OG1   1 
ATOM   134  C  CG2   . THR A 1 28  ? 15.406  -15.404 -3.745  1.00 8.82  ?  154  THR A CG2   1 
ATOM   135  N  N     . GLY A 1 29  ? 17.001  -17.902 -6.098  1.00 6.89  ?  155  GLY A N     1 
ATOM   136  C  CA    . GLY A 1 29  ? 18.035  -17.631 -7.081  1.00 8.38  ?  155  GLY A CA    1 
ATOM   137  C  C     . GLY A 1 29  ? 17.618  -17.979 -8.501  1.00 6.71  ?  155  GLY A C     1 
ATOM   138  O  O     . GLY A 1 29  ? 17.942  -17.229 -9.452  1.00 8.23  ?  155  GLY A O     1 
ATOM   139  N  N     . LEU A 1 30  ? 16.913  -19.089 -8.669  1.00 6.77  ?  156  LEU A N     1 
ATOM   140  C  CA    . LEU A 1 30  ? 16.455  -19.467 -9.993  1.00 6.77  ?  156  LEU A CA    1 
ATOM   141  C  C     . LEU A 1 30  ? 15.458  -18.440 -10.565 1.00 6.32  ?  156  LEU A C     1 
ATOM   142  O  O     . LEU A 1 30  ? 15.544  -18.029 -11.737 1.00 6.14  ?  156  LEU A O     1 
ATOM   143  C  CB    . LEU A 1 30  ? 15.790  -20.847 -9.957  1.00 9.36  ?  156  LEU A CB    1 
ATOM   144  C  CG    . LEU A 1 30  ? 16.698  -22.024 -9.558  1.00 7.33  ?  156  LEU A CG    1 
ATOM   145  C  CD1   . LEU A 1 30  ? 15.892  -23.304 -9.651  1.00 8.10  ?  156  LEU A CD1   1 
ATOM   146  C  CD2   . LEU A 1 30  ? 17.929  -22.090 -10.481 1.00 9.75  ?  156  LEU A CD2   1 
ATOM   147  N  N     . SER A 1 31  ? 14.478  -18.045 -9.749  1.00 6.63  ?  157  SER A N     1 
ATOM   148  C  CA    A SER A 1 31  ? 13.507  -17.044 -10.202 0.60 4.83  ?  157  SER A CA    1 
ATOM   149  C  CA    B SER A 1 31  ? 13.510  -17.040 -10.193 0.40 4.86  ?  157  SER A CA    1 
ATOM   150  C  C     . SER A 1 31  ? 14.180  -15.702 -10.506 1.00 6.67  ?  157  SER A C     1 
ATOM   151  O  O     . SER A 1 31  ? 13.841  -15.061 -11.473 1.00 7.08  ?  157  SER A O     1 
ATOM   152  C  CB    A SER A 1 31  ? 12.335  -16.894 -9.213  0.60 5.54  ?  157  SER A CB    1 
ATOM   153  C  CB    B SER A 1 31  ? 12.411  -16.854 -9.151  0.40 5.58  ?  157  SER A CB    1 
ATOM   154  O  OG    A SER A 1 31  ? 12.734  -16.406 -7.934  0.60 5.58  ?  157  SER A OG    1 
ATOM   155  O  OG    B SER A 1 31  ? 11.707  -18.061 -8.940  0.40 11.49 ?  157  SER A OG    1 
ATOM   156  N  N     A GLU A 1 32  ? 15.141  -15.276 -9.686  0.50 6.20  ?  158  GLU A N     1 
ATOM   157  N  N     B GLU A 1 32  ? 15.145  -15.293 -9.689  0.50 6.19  ?  158  GLU A N     1 
ATOM   158  C  CA    A GLU A 1 32  ? 15.830  -14.007 -9.955  0.50 6.67  ?  158  GLU A CA    1 
ATOM   159  C  CA    B GLU A 1 32  ? 15.852  -14.040 -9.941  0.50 6.68  ?  158  GLU A CA    1 
ATOM   160  C  C     A GLU A 1 32  ? 16.538  -14.027 -11.315 0.50 7.60  ?  158  GLU A C     1 
ATOM   161  C  C     B GLU A 1 32  ? 16.510  -14.045 -11.321 0.50 7.59  ?  158  GLU A C     1 
ATOM   162  O  O     A GLU A 1 32  ? 16.531  -13.033 -12.044 0.50 7.66  ?  158  GLU A O     1 
ATOM   163  O  O     B GLU A 1 32  ? 16.449  -13.065 -12.064 0.50 7.62  ?  158  GLU A O     1 
ATOM   164  C  CB    A GLU A 1 32  ? 16.817  -13.648 -8.828  0.50 6.67  ?  158  GLU A CB    1 
ATOM   165  C  CB    B GLU A 1 32  ? 16.908  -13.810 -8.859  0.50 6.82  ?  158  GLU A CB    1 
ATOM   166  C  CG    A GLU A 1 32  ? 16.149  -13.368 -7.489  0.50 11.77 ?  158  GLU A CG    1 
ATOM   167  C  CG    B GLU A 1 32  ? 17.471  -12.414 -8.846  0.50 7.71  ?  158  GLU A CG    1 
ATOM   168  C  CD    A GLU A 1 32  ? 17.128  -12.990 -6.377  0.50 16.79 ?  158  GLU A CD    1 
ATOM   169  C  CD    B GLU A 1 32  ? 18.688  -12.236 -9.752  0.50 15.43 ?  158  GLU A CD    1 
ATOM   170  O  OE1   A GLU A 1 32  ? 18.320  -13.350 -6.453  0.50 19.32 ?  158  GLU A OE1   1 
ATOM   171  O  OE1   B GLU A 1 32  ? 19.328  -13.248 -10.139 0.50 14.50 ?  158  GLU A OE1   1 
ATOM   172  O  OE2   A GLU A 1 32  ? 16.678  -12.343 -5.407  0.50 23.48 ?  158  GLU A OE2   1 
ATOM   173  O  OE2   B GLU A 1 32  ? 19.005  -11.066 -10.074 0.50 17.72 ?  158  GLU A OE2   1 
ATOM   174  N  N     . ALA A 1 33  ? 17.133  -15.165 -11.663 1.00 5.66  ?  159  ALA A N     1 
ATOM   175  C  CA    . ALA A 1 33  ? 17.834  -15.271 -12.938 1.00 5.84  ?  159  ALA A CA    1 
ATOM   176  C  C     . ALA A 1 33  ? 16.887  -15.153 -14.110 1.00 5.16  ?  159  ALA A C     1 
ATOM   177  O  O     . ALA A 1 33  ? 17.149  -14.432 -15.069 1.00 5.63  ?  159  ALA A O     1 
ATOM   178  C  CB    . ALA A 1 33  ? 18.580  -16.589 -13.004 1.00 9.00  ?  159  ALA A CB    1 
ATOM   179  N  N     . LEU A 1 34  ? 15.774  -15.860 -14.024 1.00 6.21  ?  160  LEU A N     1 
ATOM   180  C  CA    . LEU A 1 34  ? 14.769  -15.784 -15.079 1.00 4.77  ?  160  LEU A CA    1 
ATOM   181  C  C     . LEU A 1 34  ? 14.224  -14.363 -15.204 1.00 5.62  ?  160  LEU A C     1 
ATOM   182  O  O     . LEU A 1 34  ? 13.938  -13.893 -16.308 1.00 6.44  ?  160  LEU A O     1 
ATOM   183  C  CB    . LEU A 1 34  ? 13.664  -16.826 -14.829 1.00 5.37  ?  160  LEU A CB    1 
ATOM   184  C  CG    . LEU A 1 34  ? 14.190  -18.260 -15.039 1.00 6.75  ?  160  LEU A CG    1 
ATOM   185  C  CD1   . LEU A 1 34  ? 13.228  -19.260 -14.450 1.00 8.01  ?  160  LEU A CD1   1 
ATOM   186  C  CD2   . LEU A 1 34  ? 14.419  -18.534 -16.539 1.00 8.25  ?  160  LEU A CD2   1 
ATOM   187  N  N     . GLU A 1 35  ? 14.049  -13.667 -14.076 1.00 4.45  ?  161  GLU A N     1 
ATOM   188  C  CA    . GLU A 1 35  ? 13.540  -12.309 -14.132 1.00 5.90  ?  161  GLU A CA    1 
ATOM   189  C  C     . GLU A 1 35  ? 14.527  -11.317 -14.746 1.00 6.45  ?  161  GLU A C     1 
ATOM   190  O  O     . GLU A 1 35  ? 14.115  -10.331 -15.349 1.00 8.91  ?  161  GLU A O     1 
ATOM   191  C  CB    . GLU A 1 35  ? 13.032  -11.877 -12.761 1.00 7.34  ?  161  GLU A CB    1 
ATOM   192  C  CG    . GLU A 1 35  ? 11.730  -12.588 -12.481 1.00 7.44  ?  161  GLU A CG    1 
ATOM   193  C  CD    . GLU A 1 35  ? 11.103  -12.345 -11.130 1.00 14.92 ?  161  GLU A CD    1 
ATOM   194  O  OE1   . GLU A 1 35  ? 11.764  -11.836 -10.201 1.00 14.94 ?  161  GLU A OE1   1 
ATOM   195  O  OE2   . GLU A 1 35  ? 9.921   -12.729 -11.000 1.00 13.08 ?  161  GLU A OE2   1 
ATOM   196  N  N     . ILE A 1 36  ? 15.836  -11.584 -14.634 1.00 6.04  ?  162  ILE A N     1 
ATOM   197  C  CA    . ILE A 1 36  ? 16.815  -10.774 -15.387 1.00 5.75  ?  162  ILE A CA    1 
ATOM   198  C  C     . ILE A 1 36  ? 16.564  -10.893 -16.879 1.00 8.63  ?  162  ILE A C     1 
ATOM   199  O  O     . ILE A 1 36  ? 16.524  -9.886  -17.585 1.00 7.52  ?  162  ILE A O     1 
ATOM   200  C  CB    . ILE A 1 36  ? 18.253  -11.213 -15.097 1.00 5.86  ?  162  ILE A CB    1 
ATOM   201  C  CG1   . ILE A 1 36  ? 18.604  -10.930 -13.640 1.00 11.00 ?  162  ILE A CG1   1 
ATOM   202  C  CG2   . ILE A 1 36  ? 19.228  -10.523 -16.084 1.00 9.14  ?  162  ILE A CG2   1 
ATOM   203  C  CD1   . ILE A 1 36  ? 18.814  -9.478  -13.324 1.00 14.26 ?  162  ILE A CD1   1 
ATOM   204  N  N     . LEU A 1 37  ? 16.347  -12.123 -17.356 1.00 5.00  ?  163  LEU A N     1 
ATOM   205  C  CA    . LEU A 1 37  ? 16.088  -12.304 -18.780 1.00 7.80  ?  163  LEU A CA    1 
ATOM   206  C  C     . LEU A 1 37  ? 14.747  -11.696 -19.201 1.00 6.36  ?  163  LEU A C     1 
ATOM   207  O  O     . LEU A 1 37  ? 14.645  -11.164 -20.302 1.00 6.96  ?  163  LEU A O     1 
ATOM   208  C  CB    . LEU A 1 37  ? 16.143  -13.760 -19.165 1.00 5.28  ?  163  LEU A CB    1 
ATOM   209  C  CG    . LEU A 1 37  ? 17.485  -14.487 -18.898 1.00 6.45  ?  163  LEU A CG    1 
ATOM   210  C  CD1   . LEU A 1 37  ? 17.398  -15.903 -19.399 1.00 10.75 ?  163  LEU A CD1   1 
ATOM   211  C  CD2   . LEU A 1 37  ? 18.700  -13.741 -19.525 1.00 11.08 ?  163  LEU A CD2   1 
ATOM   212  N  N     . ALA A 1 38  ? 13.747  -11.755 -18.325 1.00 5.78  ?  164  ALA A N     1 
ATOM   213  C  CA    . ALA A 1 38  ? 12.467  -11.091 -18.617 1.00 4.70  ?  164  ALA A CA    1 
ATOM   214  C  C     . ALA A 1 38  ? 12.651  -9.596  -18.775 1.00 7.08  ?  164  ALA A C     1 
ATOM   215  O  O     . ALA A 1 38  ? 12.160  -8.999  -19.735 1.00 7.37  ?  164  ALA A O     1 
ATOM   216  C  CB    . ALA A 1 38  ? 11.467  -11.382 -17.480 1.00 5.41  ?  164  ALA A CB    1 
ATOM   217  N  N     . GLU A 1 39  ? 13.358  -8.988  -17.823 1.00 6.23  ?  165  GLU A N     1 
ATOM   218  C  CA    . GLU A 1 39  ? 13.604  -7.558  -17.811 1.00 7.12  ?  165  GLU A CA    1 
ATOM   219  C  C     . GLU A 1 39  ? 14.363  -7.172  -19.076 1.00 10.58 ?  165  GLU A C     1 
ATOM   220  O  O     . GLU A 1 39  ? 14.003  -6.210  -19.754 1.00 8.98  ?  165  GLU A O     1 
ATOM   221  C  CB    . GLU A 1 39  ? 14.369  -7.222  -16.531 1.00 9.20  ?  165  GLU A CB    1 
ATOM   222  C  CG    . GLU A 1 39  ? 14.685  -5.778  -16.316 1.00 12.84 ?  165  GLU A CG    1 
ATOM   223  C  CD    . GLU A 1 39  ? 15.479  -5.556  -15.031 1.00 16.00 ?  165  GLU A CD    1 
ATOM   224  O  OE1   . GLU A 1 39  ? 16.182  -6.493  -14.545 1.00 15.15 ?  165  GLU A OE1   1 
ATOM   225  O  OE2   . GLU A 1 39  ? 15.425  -4.414  -14.533 1.00 19.57 ?  165  GLU A OE2   1 
ATOM   226  N  N     . ALA A 1 40  ? 15.390  -7.939  -19.421 1.00 8.56  ?  166  ALA A N     1 
ATOM   227  C  CA    . ALA A 1 40  ? 16.161  -7.624  -20.619 1.00 10.19 ?  166  ALA A CA    1 
ATOM   228  C  C     . ALA A 1 40  ? 15.323  -7.738  -21.897 1.00 12.33 ?  166  ALA A C     1 
ATOM   229  O  O     . ALA A 1 40  ? 15.479  -6.923  -22.817 1.00 12.00 ?  166  ALA A O     1 
ATOM   230  C  CB    . ALA A 1 40  ? 17.361  -8.527  -20.712 1.00 10.24 ?  166  ALA A CB    1 
ATOM   231  N  N     . ALA A 1 41  ? 14.434  -8.727  -21.964 1.00 8.13  ?  167  ALA A N     1 
ATOM   232  C  CA    . ALA A 1 41  ? 13.528  -8.825  -23.098 1.00 9.81  ?  167  ALA A CA    1 
ATOM   233  C  C     . ALA A 1 41  ? 12.658  -7.570  -23.222 1.00 10.46 ?  167  ALA A C     1 
ATOM   234  O  O     . ALA A 1 41  ? 12.433  -7.048  -24.318 1.00 11.35 ?  167  ALA A O     1 
ATOM   235  C  CB    . ALA A 1 41  ? 12.674  -10.046 -22.971 1.00 9.41  ?  167  ALA A CB    1 
ATOM   236  N  N     . GLY A 1 42  ? 12.192  -7.073  -22.085 1.00 7.77  ?  168  GLY A N     1 
ATOM   237  C  CA    . GLY A 1 42  ? 11.396  -5.850  -22.075 1.00 9.74  ?  168  GLY A CA    1 
ATOM   238  C  C     . GLY A 1 42  ? 12.191  -4.669  -22.609 1.00 11.10 ?  168  GLY A C     1 
ATOM   239  O  O     . GLY A 1 42  ? 11.657  -3.837  -23.353 1.00 9.78  ?  168  GLY A O     1 
ATOM   240  N  N     . PHE A 1 43  ? 13.455  -4.565  -22.225 1.00 10.02 ?  169  PHE A N     1 
ATOM   241  C  CA    . PHE A 1 43  ? 14.259  -3.438  -22.698 1.00 11.34 ?  169  PHE A CA    1 
ATOM   242  C  C     . PHE A 1 43  ? 14.426  -3.455  -24.219 1.00 12.50 ?  169  PHE A C     1 
ATOM   243  O  O     . PHE A 1 43  ? 14.713  -2.414  -24.841 1.00 13.25 ?  169  PHE A O     1 
ATOM   244  C  CB    . PHE A 1 43  ? 15.643  -3.441  -22.057 1.00 12.11 ?  169  PHE A CB    1 
ATOM   245  C  CG    . PHE A 1 43  ? 15.646  -3.194  -20.571 1.00 8.10  ?  169  PHE A CG    1 
ATOM   246  C  CD1   . PHE A 1 43  ? 14.586  -2.570  -19.920 1.00 10.31 ?  169  PHE A CD1   1 
ATOM   247  C  CD2   . PHE A 1 43  ? 16.756  -3.586  -19.817 1.00 9.53  ?  169  PHE A CD2   1 
ATOM   248  C  CE1   . PHE A 1 43  ? 14.628  -2.347  -18.547 1.00 10.47 ?  169  PHE A CE1   1 
ATOM   249  C  CE2   . PHE A 1 43  ? 16.817  -3.377  -18.458 1.00 13.09 ?  169  PHE A CE2   1 
ATOM   250  C  CZ    . PHE A 1 43  ? 15.753  -2.774  -17.803 1.00 9.67  ?  169  PHE A CZ    1 
ATOM   251  N  N     . GLU A 1 44  ? 14.279  -4.637  -24.807 1.00 11.17 ?  170  GLU A N     1 
ATOM   252  C  CA    . GLU A 1 44  ? 14.400  -4.797  -26.257 1.00 16.73 ?  170  GLU A CA    1 
ATOM   253  C  C     . GLU A 1 44  ? 13.045  -4.799  -26.951 1.00 17.62 ?  170  GLU A C     1 
ATOM   254  O  O     . GLU A 1 44  ? 12.956  -5.045  -28.154 1.00 21.87 ?  170  GLU A O     1 
ATOM   255  C  CB    . GLU A 1 44  ? 15.200  -6.053  -26.595 1.00 14.80 ?  170  GLU A CB    1 
ATOM   256  C  CG    . GLU A 1 44  ? 16.576  -6.092  -25.913 1.00 21.15 ?  170  GLU A CG    1 
ATOM   257  C  CD    . GLU A 1 44  ? 17.391  -4.798  -26.128 1.00 34.65 ?  170  GLU A CD    1 
ATOM   258  O  OE1   . GLU A 1 44  ? 17.588  -4.395  -27.300 1.00 30.57 ?  170  GLU A OE1   1 
ATOM   259  O  OE2   . GLU A 1 44  ? 17.830  -4.172  -25.127 1.00 16.51 ?  170  GLU A OE2   1 
ATOM   260  N  N     . GLY A 1 45  ? 11.985  -4.524  -26.203 1.00 13.32 ?  171  GLY A N     1 
ATOM   261  C  CA    . GLY A 1 45  ? 10.646  -4.491  -26.778 1.00 16.29 ?  171  GLY A CA    1 
ATOM   262  C  C     . GLY A 1 45  ? 10.036  -5.854  -27.063 1.00 15.71 ?  171  GLY A C     1 
ATOM   263  O  O     . GLY A 1 45  ? 9.044   -5.958  -27.787 1.00 18.27 ?  171  GLY A O     1 
ATOM   264  N  N     . SER A 1 46  ? 10.607  -6.908  -26.485 1.00 11.67 ?  172  SER A N     1 
ATOM   265  C  CA    A SER A 1 46  ? 10.136  -8.263  -26.726 0.70 12.10 ?  172  SER A CA    1 
ATOM   266  C  CA    B SER A 1 46  ? 10.113  -8.252  -26.728 0.30 12.21 ?  172  SER A CA    1 
ATOM   267  C  C     . SER A 1 46  ? 9.147   -8.654  -25.633 1.00 11.59 ?  172  SER A C     1 
ATOM   268  O  O     . SER A 1 46  ? 9.524   -9.360  -24.690 1.00 12.12 ?  172  SER A O     1 
ATOM   269  C  CB    A SER A 1 46  ? 11.311  -9.246  -26.711 0.70 16.68 ?  172  SER A CB    1 
ATOM   270  C  CB    B SER A 1 46  ? 11.261  -9.248  -26.769 0.30 16.63 ?  172  SER A CB    1 
ATOM   271  O  OG    A SER A 1 46  ? 12.310  -8.913  -27.680 0.70 22.42 ?  172  SER A OG    1 
ATOM   272  O  OG    B SER A 1 46  ? 10.760  -10.542 -27.029 0.30 18.31 ?  172  SER A OG    1 
ATOM   273  N  N     A GLU A 1 47  ? 7.896   -8.215  -25.757 0.70 11.29 ?  173  GLU A N     1 
ATOM   274  N  N     B GLU A 1 47  ? 7.904   -8.202  -25.756 0.30 11.40 ?  173  GLU A N     1 
ATOM   275  C  CA    A GLU A 1 47  ? 6.920   -8.420  -24.685 0.70 11.57 ?  173  GLU A CA    1 
ATOM   276  C  CA    B GLU A 1 47  ? 6.906   -8.391  -24.709 0.30 11.69 ?  173  GLU A CA    1 
ATOM   277  C  C     A GLU A 1 47  ? 6.510   -9.865  -24.495 0.70 10.70 ?  173  GLU A C     1 
ATOM   278  C  C     B GLU A 1 47  ? 6.526   -9.854  -24.500 0.30 10.73 ?  173  GLU A C     1 
ATOM   279  O  O     A GLU A 1 47  ? 6.138   -10.279 -23.388 0.70 9.26  ?  173  GLU A O     1 
ATOM   280  O  O     B GLU A 1 47  ? 6.232   -10.276 -23.379 0.30 9.33  ?  173  GLU A O     1 
ATOM   281  C  CB    A GLU A 1 47  ? 5.660   -7.576  -24.920 0.70 14.77 ?  173  GLU A CB    1 
ATOM   282  C  CB    B GLU A 1 47  ? 5.661   -7.552  -25.022 0.30 14.80 ?  173  GLU A CB    1 
ATOM   283  C  CG    A GLU A 1 47  ? 5.948   -6.086  -24.932 0.70 21.28 ?  173  GLU A CG    1 
ATOM   284  C  CG    B GLU A 1 47  ? 4.488   -7.767  -24.093 0.30 13.62 ?  173  GLU A CG    1 
ATOM   285  C  CD    A GLU A 1 47  ? 6.663   -5.616  -23.676 0.70 30.63 ?  173  GLU A CD    1 
ATOM   286  C  CD    B GLU A 1 47  ? 4.798   -7.482  -22.642 0.30 12.32 ?  173  GLU A CD    1 
ATOM   287  O  OE1   A GLU A 1 47  ? 6.217   -5.963  -22.553 0.70 14.09 ?  173  GLU A OE1   1 
ATOM   288  O  OE1   B GLU A 1 47  ? 4.901   -6.303  -22.258 0.30 22.43 ?  173  GLU A OE1   1 
ATOM   289  O  OE2   A GLU A 1 47  ? 7.676   -4.901  -23.821 0.70 27.67 ?  173  GLU A OE2   1 
ATOM   290  O  OE2   B GLU A 1 47  ? 4.921   -8.445  -21.873 0.30 9.87  ?  173  GLU A OE2   1 
ATOM   291  N  N     . GLY A 1 48  ? 6.524   -10.629 -25.580 1.00 10.97 ?  174  GLY A N     1 
ATOM   292  C  CA    . GLY A 1 48  ? 6.191   -12.033 -25.502 1.00 9.85  ?  174  GLY A CA    1 
ATOM   293  C  C     . GLY A 1 48  ? 7.206   -12.788 -24.666 1.00 7.12  ?  174  GLY A C     1 
ATOM   294  O  O     . GLY A 1 48  ? 6.857   -13.557 -23.776 1.00 7.40  ?  174  GLY A O     1 
ATOM   295  N  N     . ARG A 1 49  ? 8.478   -12.593 -24.994 1.00 8.86  ?  175  ARG A N     1 
ATOM   296  C  CA    . ARG A 1 49  ? 9.553   -13.246 -24.261 1.00 7.57  ?  175  ARG A CA    1 
ATOM   297  C  C     . ARG A 1 49  ? 9.584   -12.762 -22.811 1.00 5.98  ?  175  ARG A C     1 
ATOM   298  O  O     . ARG A 1 49  ? 9.794   -13.559 -21.924 1.00 8.26  ?  175  ARG A O     1 
ATOM   299  C  CB    . ARG A 1 49  ? 10.893  -13.008 -24.956 1.00 10.27 ?  175  ARG A CB    1 
ATOM   300  C  CG    . ARG A 1 49  ? 10.969  -13.750 -26.276 1.00 13.48 ?  175  ARG A CG    1 
ATOM   301  C  CD    . ARG A 1 49  ? 12.145  -13.317 -27.105 1.00 15.99 ?  175  ARG A CD    1 
ATOM   302  N  NE    . ARG A 1 49  ? 12.370  -14.281 -28.187 1.00 22.22 ?  175  ARG A NE    1 
ATOM   303  C  CZ    . ARG A 1 49  ? 11.664  -14.345 -29.318 1.00 34.99 ?  175  ARG A CZ    1 
ATOM   304  N  NH1   . ARG A 1 49  ? 10.674  -13.485 -29.563 1.00 24.14 ?  175  ARG A NH1   1 
ATOM   305  N  NH2   . ARG A 1 49  ? 11.952  -15.278 -30.215 1.00 25.02 ?  175  ARG A NH2   1 
ATOM   306  N  N     . LEU A 1 50  ? 9.312   -11.474 -22.585 1.00 8.75  ?  176  LEU A N     1 
ATOM   307  C  CA    . LEU A 1 50  ? 9.226   -10.973 -21.194 1.00 7.75  ?  176  LEU A CA    1 
ATOM   308  C  C     . LEU A 1 50  ? 8.184   -11.768 -20.437 1.00 6.33  ?  176  LEU A C     1 
ATOM   309  O  O     . LEU A 1 50  ? 8.420   -12.236 -19.321 1.00 5.84  ?  176  LEU A O     1 
ATOM   310  C  CB    . LEU A 1 50  ? 8.869   -9.479  -21.144 1.00 6.60  ?  176  LEU A CB    1 
ATOM   311  C  CG    . LEU A 1 50  ? 8.701   -8.865  -19.743 1.00 6.13  ?  176  LEU A CG    1 
ATOM   312  C  CD1   . LEU A 1 50  ? 9.147   -7.423  -19.741 1.00 8.09  ?  176  LEU A CD1   1 
ATOM   313  C  CD2   . LEU A 1 50  ? 7.212   -8.937  -19.343 1.00 7.85  ?  176  LEU A CD2   1 
ATOM   314  N  N     . LEU A 1 51  ? 7.002   -11.935 -21.035 1.00 5.71  ?  177  LEU A N     1 
ATOM   315  C  CA    . LEU A 1 51  ? 5.936   -12.669 -20.345 1.00 6.50  ?  177  LEU A CA    1 
ATOM   316  C  C     . LEU A 1 51  ? 6.306   -14.115 -20.049 1.00 4.74  ?  177  LEU A C     1 
ATOM   317  O  O     . LEU A 1 51  ? 6.058   -14.635 -18.972 1.00 5.64  ?  177  LEU A O     1 
ATOM   318  C  CB    . LEU A 1 51  ? 4.641   -12.618 -21.171 1.00 6.24  ?  177  LEU A CB    1 
ATOM   319  C  CG    . LEU A 1 51  ? 3.764   -11.417 -20.932 1.00 13.14 ?  177  LEU A CG    1 
ATOM   320  C  CD1   . LEU A 1 51  ? 2.675   -11.403 -22.006 1.00 11.08 ?  177  LEU A CD1   1 
ATOM   321  C  CD2   . LEU A 1 51  ? 3.154   -11.433 -19.513 1.00 10.16 ?  177  LEU A CD2   1 
ATOM   322  N  N     . THR A 1 52  ? 6.881   -14.799 -21.027 1.00 5.13  ?  178  THR A N     1 
ATOM   323  C  CA    . THR A 1 52  ? 7.296   -16.170 -20.762 1.00 5.18  ?  178  THR A CA    1 
ATOM   324  C  C     . THR A 1 52  ? 8.300   -16.306 -19.620 1.00 4.50  ?  178  THR A C     1 
ATOM   325  O  O     . THR A 1 52  ? 8.104   -17.157 -18.756 1.00 7.06  ?  178  THR A O     1 
ATOM   326  C  CB    . THR A 1 52  ? 7.764   -16.874 -22.049 1.00 7.97  ?  178  THR A CB    1 
ATOM   327  O  OG1   . THR A 1 52  ? 6.583   -17.220 -22.790 1.00 8.94  ?  178  THR A OG1   1 
ATOM   328  C  CG2   . THR A 1 52  ? 8.550   -18.152 -21.720 1.00 12.03 ?  178  THR A CG2   1 
ATOM   329  N  N     . PHE A 1 53  ? 9.334   -15.456 -19.602 1.00 5.56  ?  179  PHE A N     1 
ATOM   330  C  CA    . PHE A 1 53  ? 10.331  -15.562 -18.544 1.00 5.36  ?  179  PHE A CA    1 
ATOM   331  C  C     . PHE A 1 53  ? 9.702   -15.178 -17.202 1.00 4.83  ?  179  PHE A C     1 
ATOM   332  O  O     . PHE A 1 53  ? 10.005  -15.805 -16.183 1.00 5.44  ?  179  PHE A O     1 
ATOM   333  C  CB    . PHE A 1 53  ? 11.559  -14.706 -18.860 1.00 4.15  ?  179  PHE A CB    1 
ATOM   334  C  CG    . PHE A 1 53  ? 12.465  -15.312 -19.929 1.00 6.29  ?  179  PHE A CG    1 
ATOM   335  C  CD1   . PHE A 1 53  ? 12.929  -16.605 -19.807 1.00 9.40  ?  179  PHE A CD1   1 
ATOM   336  C  CD2   . PHE A 1 53  ? 12.848  -14.552 -21.022 1.00 10.08 ?  179  PHE A CD2   1 
ATOM   337  C  CE1   . PHE A 1 53  ? 13.806  -17.153 -20.791 1.00 12.22 ?  179  PHE A CE1   1 
ATOM   338  C  CE2   . PHE A 1 53  ? 13.719  -15.090 -22.004 1.00 11.22 ?  179  PHE A CE2   1 
ATOM   339  C  CZ    . PHE A 1 53  ? 14.174  -16.381 -21.876 1.00 7.93  ?  179  PHE A CZ    1 
ATOM   340  N  N     . CYS A 1 54  ? 8.807   -14.188 -17.212 1.00 4.63  ?  180  CYS A N     1 
ATOM   341  C  CA    . CYS A 1 54  ? 8.083   -13.848 -15.968 1.00 6.06  ?  180  CYS A CA    1 
ATOM   342  C  C     . CYS A 1 54  ? 7.266   -15.031 -15.491 1.00 6.42  ?  180  CYS A C     1 
ATOM   343  O  O     . CYS A 1 54  ? 7.243   -15.362 -14.284 1.00 5.24  ?  180  CYS A O     1 
ATOM   344  C  CB    . CYS A 1 54  ? 7.152   -12.646 -16.208 1.00 5.77  ?  180  CYS A CB    1 
ATOM   345  S  SG    . CYS A 1 54  ? 8.026   -11.054 -16.222 1.00 12.67 ?  180  CYS A SG    1 
ATOM   346  N  N     . ARG A 1 55  ? 6.537   -15.663 -16.415 1.00 4.60  ?  181  ARG A N     1 
ATOM   347  C  CA    . ARG A 1 55  ? 5.706   -16.785 -16.024 1.00 5.60  ?  181  ARG A CA    1 
ATOM   348  C  C     . ARG A 1 55  ? 6.534   -17.968 -15.497 1.00 4.23  ?  181  ARG A C     1 
ATOM   349  O  O     . ARG A 1 55  ? 6.131   -18.599 -14.513 1.00 5.99  ?  181  ARG A O     1 
ATOM   350  C  CB    . ARG A 1 55  ? 4.782   -17.240 -17.152 1.00 4.07  ?  181  ARG A CB    1 
ATOM   351  C  CG    . ARG A 1 55  ? 3.768   -16.196 -17.568 1.00 6.55  ?  181  ARG A CG    1 
ATOM   352  C  CD    . ARG A 1 55  ? 3.206   -16.612 -18.902 1.00 4.49  ?  181  ARG A CD    1 
ATOM   353  N  NE    . ARG A 1 55  ? 2.160   -15.705 -19.361 1.00 6.74  ?  181  ARG A NE    1 
ATOM   354  C  CZ    . ARG A 1 55  ? 1.736   -15.656 -20.619 1.00 8.74  ?  181  ARG A CZ    1 
ATOM   355  N  NH1   . ARG A 1 55  ? 2.304   -16.431 -21.532 1.00 8.25  ?  181  ARG A NH1   1 
ATOM   356  N  NH2   . ARG A 1 55  ? 0.775   -14.802 -20.974 1.00 8.72  ?  181  ARG A NH2   1 
ATOM   357  N  N     . ALA A 1 56  ? 7.647   -18.295 -16.164 1.00 4.59  ?  182  ALA A N     1 
ATOM   358  C  CA    . ALA A 1 56  ? 8.501   -19.385 -15.715 1.00 6.92  ?  182  ALA A CA    1 
ATOM   359  C  C     . ALA A 1 56  ? 9.070   -19.067 -14.319 1.00 5.45  ?  182  ALA A C     1 
ATOM   360  O  O     . ALA A 1 56  ? 9.042   -19.922 -13.416 1.00 5.20  ?  182  ALA A O     1 
ATOM   361  C  CB    . ALA A 1 56  ? 9.608   -19.600 -16.711 1.00 6.70  ?  182  ALA A CB    1 
ATOM   362  N  N     . ALA A 1 57  ? 9.494   -17.818 -14.113 1.00 5.27  ?  183  ALA A N     1 
ATOM   363  C  CA    . ALA A 1 57  ? 9.962   -17.429 -12.777 1.00 3.90  ?  183  ALA A CA    1 
ATOM   364  C  C     . ALA A 1 57  ? 8.859   -17.634 -11.745 1.00 4.94  ?  183  ALA A C     1 
ATOM   365  O  O     . ALA A 1 57  ? 9.101   -18.151 -10.639 1.00 5.95  ?  183  ALA A O     1 
ATOM   366  C  CB    . ALA A 1 57  ? 10.412  -15.968 -12.777 1.00 3.39  ?  183  ALA A CB    1 
ATOM   367  N  N     . SER A 1 58  ? 7.636   -17.250 -12.097 1.00 3.06  ?  184  SER A N     1 
ATOM   368  C  CA    A SER A 1 58  ? 6.519   -17.352 -11.152 0.60 3.78  ?  184  SER A CA    1 
ATOM   369  C  CA    B SER A 1 58  ? 6.533   -17.349 -11.132 0.40 3.81  ?  184  SER A CA    1 
ATOM   370  C  C     . SER A 1 58  ? 6.174   -18.796 -10.783 1.00 4.89  ?  184  SER A C     1 
ATOM   371  O  O     . SER A 1 58  ? 5.803   -19.090 -9.645  1.00 5.60  ?  184  SER A O     1 
ATOM   372  C  CB    A SER A 1 58  ? 5.304   -16.615 -11.719 0.60 5.86  ?  184  SER A CB    1 
ATOM   373  C  CB    B SER A 1 58  ? 5.306   -16.558 -11.611 0.40 5.84  ?  184  SER A CB    1 
ATOM   374  O  OG    A SER A 1 58  ? 4.326   -16.441 -10.719 0.60 6.57  ?  184  SER A OG    1 
ATOM   375  O  OG    B SER A 1 58  ? 4.548   -17.289 -12.557 0.40 6.42  ?  184  SER A OG    1 
ATOM   376  N  N     . VAL A 1 59  ? 6.270   -19.695 -11.754 1.00 3.50  ?  185  VAL A N     1 
ATOM   377  C  CA    . VAL A 1 59  ? 6.055   -21.122 -11.493 1.00 3.25  ?  185  VAL A CA    1 
ATOM   378  C  C     . VAL A 1 59  ? 7.006   -21.618 -10.395 1.00 3.40  ?  185  VAL A C     1 
ATOM   379  O  O     . VAL A 1 59  ? 6.587   -22.299 -9.455  1.00 7.00  ?  185  VAL A O     1 
ATOM   380  C  CB    . VAL A 1 59  ? 6.278   -21.916 -12.786 1.00 3.82  ?  185  VAL A CB    1 
ATOM   381  C  CG1   . VAL A 1 59  ? 6.415   -23.406 -12.483 1.00 8.81  ?  185  VAL A CG1   1 
ATOM   382  C  CG2   . VAL A 1 59  ? 5.093   -21.696 -13.730 1.00 8.73  ?  185  VAL A CG2   1 
ATOM   383  N  N     . LEU A 1 60  ? 8.252   -21.192 -10.476 1.00 4.42  ?  186  LEU A N     1 
ATOM   384  C  CA    . LEU A 1 60  ? 9.227   -21.609 -9.470  1.00 6.05  ?  186  LEU A CA    1 
ATOM   385  C  C     . LEU A 1 60  ? 8.878   -21.016 -8.123  1.00 5.33  ?  186  LEU A C     1 
ATOM   386  O  O     . LEU A 1 60  ? 9.059   -21.672 -7.086  1.00 6.69  ?  186  LEU A O     1 
ATOM   387  C  CB    . LEU A 1 60  ? 10.626  -21.194 -9.864  1.00 6.99  ?  186  LEU A CB    1 
ATOM   388  C  CG    . LEU A 1 60  ? 11.126  -21.799 -11.176 1.00 7.80  ?  186  LEU A CG    1 
ATOM   389  C  CD1   . LEU A 1 60  ? 12.552  -21.448 -11.383 1.00 10.13 ?  186  LEU A CD1   1 
ATOM   390  C  CD2   . LEU A 1 60  ? 10.945  -23.330 -11.136 1.00 11.85 ?  186  LEU A CD2   1 
ATOM   391  N  N     . LYS A 1 61  ? 8.354   -19.790 -8.114  1.00 5.12  ?  187  LYS A N     1 
ATOM   392  C  CA    . LYS A 1 61  ? 7.919   -19.217 -6.824  1.00 5.22  ?  187  LYS A CA    1 
ATOM   393  C  C     . LYS A 1 61  ? 6.799   -19.988 -6.146  1.00 3.72  ?  187  LYS A C     1 
ATOM   394  O  O     . LYS A 1 61  ? 6.649   -19.929 -4.925  1.00 6.16  ?  187  LYS A O     1 
ATOM   395  C  CB    . LYS A 1 61  ? 7.460   -17.763 -6.982  1.00 3.20  ?  187  LYS A CB    1 
ATOM   396  C  CG    . LYS A 1 61  ? 8.438   -16.874 -7.687  1.00 4.71  ?  187  LYS A CG    1 
ATOM   397  C  CD    . LYS A 1 61  ? 7.827   -15.443 -7.857  1.00 7.54  ?  187  LYS A CD    1 
ATOM   398  C  CE    . LYS A 1 61  ? 8.693   -14.632 -8.797  1.00 8.89  ?  187  LYS A CE    1 
ATOM   399  N  NZ    . LYS A 1 61  ? 8.100   -13.273 -9.047  1.00 9.16  ?  187  LYS A NZ    1 
ATOM   400  N  N     . ALA A 1 62  ? 5.994   -20.684 -6.947  1.00 4.32  ?  188  ALA A N     1 
ATOM   401  C  CA    . ALA A 1 62  ? 4.827   -21.408 -6.478  1.00 4.18  ?  188  ALA A CA    1 
ATOM   402  C  C     . ALA A 1 62  ? 5.119   -22.859 -6.043  1.00 7.16  ?  188  ALA A C     1 
ATOM   403  O  O     . ALA A 1 62  ? 4.257   -23.523 -5.479  1.00 8.79  ?  188  ALA A O     1 
ATOM   404  C  CB    . ALA A 1 62  ? 3.725   -21.376 -7.603  1.00 6.78  ?  188  ALA A CB    1 
ATOM   405  N  N     . LEU A 1 63  ? 6.362   -23.310 -6.257  1.00 7.11  ?  189  LEU A N     1 
ATOM   406  C  CA    . LEU A 1 63  ? 6.719   -24.684 -5.929  1.00 7.51  ?  189  LEU A CA    1 
ATOM   407  C  C     . LEU A 1 63  ? 6.889   -24.832 -4.423  1.00 7.73  ?  189  LEU A C     1 
ATOM   408  O  O     . LEU A 1 63  ? 7.299   -23.896 -3.744  1.00 7.61  ?  189  LEU A O     1 
ATOM   409  C  CB    . LEU A 1 63  ? 8.028   -25.068 -6.629  1.00 7.36  ?  189  LEU A CB    1 
ATOM   410  C  CG    . LEU A 1 63  ? 7.900   -25.314 -8.137  1.00 8.56  ?  189  LEU A CG    1 
ATOM   411  C  CD1   . LEU A 1 63  ? 9.267   -25.552 -8.759  1.00 9.20  ?  189  LEU A CD1   1 
ATOM   412  C  CD2   . LEU A 1 63  ? 6.958   -26.453 -8.420  1.00 12.28 ?  189  LEU A CD2   1 
ATOM   413  N  N     . PRO A 1 64  ? 6.595   -26.014 -3.883  1.00 8.00  ?  190  PRO A N     1 
ATOM   414  C  CA    . PRO A 1 64  ? 6.630   -26.233 -2.432  1.00 6.52  ?  190  PRO A CA    1 
ATOM   415  C  C     . PRO A 1 64  ? 8.031   -26.533 -1.900  1.00 6.71  ?  190  PRO A C     1 
ATOM   416  O  O     . PRO A 1 64  ? 8.193   -26.623 -0.691  1.00 8.18  ?  190  PRO A O     1 
ATOM   417  C  CB    . PRO A 1 64  ? 5.721   -27.462 -2.251  1.00 10.23 ?  190  PRO A CB    1 
ATOM   418  C  CG    . PRO A 1 64  ? 5.927   -28.239 -3.516  1.00 12.04 ?  190  PRO A CG    1 
ATOM   419  C  CD    . PRO A 1 64  ? 6.044   -27.177 -4.609  1.00 11.67 ?  190  PRO A CD    1 
ATOM   420  N  N     . SER A 1 65  ? 9.013   -26.673 -2.785  1.00 7.41  ?  191  SER A N     1 
ATOM   421  C  CA    . SER A 1 65  ? 10.381  -26.996 -2.350  1.00 7.97  ?  191  SER A CA    1 
ATOM   422  C  C     . SER A 1 65  ? 11.383  -26.618 -3.440  1.00 5.62  ?  191  SER A C     1 
ATOM   423  O  O     . SER A 1 65  ? 10.999  -26.259 -4.570  1.00 7.06  ?  191  SER A O     1 
ATOM   424  C  CB    . SER A 1 65  ? 10.486  -28.493 -2.010  1.00 10.35 ?  191  SER A CB    1 
ATOM   425  O  OG    . SER A 1 65  ? 10.427  -29.231 -3.193  1.00 16.30 ?  191  SER A OG    1 
ATOM   426  N  N     . PRO A 1 66  ? 12.686  -26.647 -3.115  1.00 6.38  ?  192  PRO A N     1 
ATOM   427  C  CA    . PRO A 1 66  ? 13.673  -26.260 -4.122  1.00 5.05  ?  192  PRO A CA    1 
ATOM   428  C  C     . PRO A 1 66  ? 13.793  -27.207 -5.321  1.00 8.97  ?  192  PRO A C     1 
ATOM   429  O  O     . PRO A 1 66  ? 13.715  -28.430 -5.159  1.00 10.10 ?  192  PRO A O     1 
ATOM   430  C  CB    . PRO A 1 66  ? 15.012  -26.255 -3.349  1.00 5.91  ?  192  PRO A CB    1 
ATOM   431  C  CG    . PRO A 1 66  ? 14.596  -26.039 -1.884  1.00 6.59  ?  192  PRO A CG    1 
ATOM   432  C  CD    . PRO A 1 66  ? 13.296  -26.852 -1.787  1.00 5.39  ?  192  PRO A CD    1 
ATOM   433  N  N     . VAL A 1 67  ? 13.986  -26.637 -6.503  1.00 6.89  ?  193  VAL A N     1 
ATOM   434  C  CA    . VAL A 1 67  ? 14.398  -27.434 -7.654  1.00 8.36  ?  193  VAL A CA    1 
ATOM   435  C  C     . VAL A 1 67  ? 15.894  -27.727 -7.500  1.00 7.83  ?  193  VAL A C     1 
ATOM   436  O  O     . VAL A 1 67  ? 16.688  -26.811 -7.448  1.00 10.73 ?  193  VAL A O     1 
ATOM   437  C  CB    . VAL A 1 67  ? 14.108  -26.690 -8.963  1.00 8.48  ?  193  VAL A CB    1 
ATOM   438  C  CG1   . VAL A 1 67  ? 14.761  -27.432 -10.163 1.00 9.90  ?  193  VAL A CG1   1 
ATOM   439  C  CG2   . VAL A 1 67  ? 12.598  -26.521 -9.170  1.00 9.41  ?  193  VAL A CG2   1 
ATOM   440  N  N     . THR A 1 68  ? 16.252  -29.023 -7.432  1.00 13.28 ?  194  THR A N     1 
ATOM   441  C  CA    . THR A 1 68  ? 17.650  -29.458 -7.311  1.00 13.64 ?  194  THR A CA    1 
ATOM   442  C  C     . THR A 1 68  ? 18.101  -30.259 -8.528  1.00 20.93 ?  194  THR A C     1 
ATOM   443  O  O     . THR A 1 68  ? 19.303  -30.408 -8.761  1.00 20.87 ?  194  THR A O     1 
ATOM   444  C  CB    . THR A 1 68  ? 17.823  -30.378 -6.078  1.00 13.16 ?  194  THR A CB    1 
ATOM   445  O  OG1   . THR A 1 68  ? 16.911  -31.465 -6.167  1.00 21.48 ?  194  THR A OG1   1 
ATOM   446  C  CG2   . THR A 1 68  ? 17.504  -29.603 -4.807  1.00 23.71 ?  194  THR A CG2   1 
ATOM   447  N  N     . THR A 1 69  ? 17.140  -30.777 -9.282  1.00 14.70 ?  195  THR A N     1 
ATOM   448  C  CA    . THR A 1 69  ? 17.441  -31.609 -10.444 1.00 22.55 ?  195  THR A CA    1 
ATOM   449  C  C     . THR A 1 69  ? 16.597  -31.190 -11.625 1.00 16.55 ?  195  THR A C     1 
ATOM   450  O  O     . THR A 1 69  ? 15.422  -30.828 -11.479 1.00 17.83 ?  195  THR A O     1 
ATOM   451  C  CB    . THR A 1 69  ? 17.143  -33.111 -10.175 1.00 21.33 ?  195  THR A CB    1 
ATOM   452  O  OG1   . THR A 1 69  ? 15.732  -33.343 -10.253 1.00 26.44 ?  195  THR A OG1   1 
ATOM   453  C  CG2   . THR A 1 69  ? 17.653  -33.540 -8.813  1.00 33.51 ?  195  THR A CG2   1 
ATOM   454  N  N     . LEU A 1 70  ? 17.182  -31.270 -12.812 1.00 16.84 ?  196  LEU A N     1 
ATOM   455  C  CA    . LEU A 1 70  ? 16.477  -30.836 -14.017 1.00 19.99 ?  196  LEU A CA    1 
ATOM   456  C  C     . LEU A 1 70  ? 15.158  -31.574 -14.257 1.00 22.61 ?  196  LEU A C     1 
ATOM   457  O  O     . LEU A 1 70  ? 14.208  -31.019 -14.813 1.00 21.33 ?  196  LEU A O     1 
ATOM   458  C  CB    . LEU A 1 70  ? 17.412  -30.946 -15.227 1.00 21.45 ?  196  LEU A CB    1 
ATOM   459  C  CG    . LEU A 1 70  ? 16.946  -30.215 -16.494 1.00 38.46 ?  196  LEU A CG    1 
ATOM   460  N  N     . SER A 1 71  ? 15.081  -32.828 -13.824 1.00 23.44 ?  197  SER A N     1 
ATOM   461  C  CA    . SER A 1 71  ? 13.858  -33.606 -13.990 1.00 21.51 ?  197  SER A CA    1 
ATOM   462  C  C     . SER A 1 71  ? 12.644  -33.006 -13.283 1.00 17.74 ?  197  SER A C     1 
ATOM   463  O  O     . SER A 1 71  ? 11.498  -33.323 -13.614 1.00 20.28 ?  197  SER A O     1 
ATOM   464  C  CB    . SER A 1 71  ? 14.071  -35.057 -13.526 1.00 29.64 ?  197  SER A CB    1 
ATOM   465  O  OG    . SER A 1 71  ? 14.299  -35.128 -12.129 1.00 30.56 ?  197  SER A OG    1 
ATOM   466  N  N     . GLN A 1 72  ? 12.890  -32.131 -12.311 1.00 18.93 ?  198  GLN A N     1 
ATOM   467  C  CA    . GLN A 1 72  ? 11.788  -31.492 -11.601 1.00 24.02 ?  198  GLN A CA    1 
ATOM   468  C  C     . GLN A 1 72  ? 11.053  -30.485 -12.479 1.00 16.74 ?  198  GLN A C     1 
ATOM   469  O  O     . GLN A 1 72  ? 9.960   -30.060 -12.138 1.00 19.00 ?  198  GLN A O     1 
ATOM   470  C  CB    . GLN A 1 72  ? 12.287  -30.812 -10.324 1.00 16.86 ?  198  GLN A CB    1 
ATOM   471  C  CG    . GLN A 1 72  ? 12.585  -31.792 -9.196  1.00 19.88 ?  198  GLN A CG    1 
ATOM   472  C  CD    . GLN A 1 72  ? 13.180  -31.080 -8.009  1.00 23.30 ?  198  GLN A CD    1 
ATOM   473  O  OE1   . GLN A 1 72  ? 14.391  -30.967 -7.902  1.00 19.62 ?  198  GLN A OE1   1 
ATOM   474  N  NE2   . GLN A 1 72  ? 12.320  -30.542 -7.133  1.00 32.07 ?  198  GLN A NE2   1 
ATOM   475  N  N     . LEU A 1 73  ? 11.647  -30.109 -13.610 1.00 14.20 ?  199  LEU A N     1 
ATOM   476  C  CA    . LEU A 1 73  ? 11.023  -29.124 -14.478 1.00 12.97 ?  199  LEU A CA    1 
ATOM   477  C  C     . LEU A 1 73  ? 10.062  -29.815 -15.416 1.00 19.90 ?  199  LEU A C     1 
ATOM   478  O  O     . LEU A 1 73  ? 9.243   -29.179 -16.065 1.00 16.32 ?  199  LEU A O     1 
ATOM   479  C  CB    . LEU A 1 73  ? 12.056  -28.366 -15.307 1.00 16.95 ?  199  LEU A CB    1 
ATOM   480  C  CG    . LEU A 1 73  ? 13.056  -27.504 -14.556 1.00 13.50 ?  199  LEU A CG    1 
ATOM   481  C  CD1   . LEU A 1 73  ? 13.937  -26.777 -15.546 1.00 16.46 ?  199  LEU A CD1   1 
ATOM   482  C  CD2   . LEU A 1 73  ? 12.296  -26.531 -13.614 1.00 13.33 ?  199  LEU A CD2   1 
ATOM   483  N  N     . GLN A 1 74  ? 10.194  -31.133 -15.525 1.00 23.73 ?  200  GLN A N     1 
ATOM   484  C  CA    . GLN A 1 74  ? 9.315   -31.874 -16.409 1.00 21.36 ?  200  GLN A CA    1 
ATOM   485  C  C     . GLN A 1 74  ? 7.883   -31.724 -15.916 1.00 23.55 ?  200  GLN A C     1 
ATOM   486  O  O     . GLN A 1 74  ? 7.588   -31.885 -14.724 1.00 30.20 ?  200  GLN A O     1 
ATOM   487  C  CB    . GLN A 1 74  ? 9.727   -33.352 -16.464 1.00 25.28 ?  200  GLN A CB    1 
ATOM   488  C  CG    . GLN A 1 74  ? 11.062  -33.591 -17.149 1.00 34.14 ?  200  GLN A CG    1 
ATOM   489  N  N     . GLY A 1 75  ? 6.992   -31.372 -16.829 1.00 20.44 ?  201  GLY A N     1 
ATOM   490  C  CA    . GLY A 1 75  ? 5.599   -31.262 -16.462 1.00 21.06 ?  201  GLY A CA    1 
ATOM   491  C  C     . GLY A 1 75  ? 5.222   -29.883 -15.961 1.00 27.95 ?  201  GLY A C     1 
ATOM   492  O  O     . GLY A 1 75  ? 4.035   -29.608 -15.755 1.00 28.40 ?  201  GLY A O     1 
ATOM   493  N  N     . LEU A 1 76  ? 6.217   -29.016 -15.758 1.00 22.28 ?  202  LEU A N     1 
ATOM   494  C  CA    . LEU A 1 76  ? 5.912   -27.643 -15.356 1.00 13.61 ?  202  LEU A CA    1 
ATOM   495  C  C     . LEU A 1 76  ? 5.626   -26.757 -16.566 1.00 10.42 ?  202  LEU A C     1 
ATOM   496  O  O     . LEU A 1 76  ? 6.367   -26.748 -17.540 1.00 15.28 ?  202  LEU A O     1 
ATOM   497  C  CB    . LEU A 1 76  ? 7.057   -27.024 -14.559 1.00 12.69 ?  202  LEU A CB    1 
ATOM   498  C  CG    . LEU A 1 76  ? 7.448   -27.658 -13.227 1.00 14.65 ?  202  LEU A CG    1 
ATOM   499  C  CD1   . LEU A 1 76  ? 8.529   -26.822 -12.546 1.00 14.03 ?  202  LEU A CD1   1 
ATOM   500  C  CD2   . LEU A 1 76  ? 6.232   -27.811 -12.353 1.00 17.37 ?  202  LEU A CD2   1 
ATOM   501  N  N     . PRO A 1 77  ? 4.561   -25.959 -16.476 1.00 11.02 ?  203  PRO A N     1 
ATOM   502  C  CA    . PRO A 1 77  ? 4.247   -25.046 -17.564 1.00 11.56 ?  203  PRO A CA    1 
ATOM   503  C  C     . PRO A 1 77  ? 5.268   -23.934 -17.659 1.00 10.51 ?  203  PRO A C     1 
ATOM   504  O  O     . PRO A 1 77  ? 5.828   -23.521 -16.655 1.00 10.43 ?  203  PRO A O     1 
ATOM   505  C  CB    . PRO A 1 77  ? 2.874   -24.488 -17.171 1.00 13.17 ?  203  PRO A CB    1 
ATOM   506  C  CG    . PRO A 1 77  ? 2.844   -24.585 -15.682 1.00 17.03 ?  203  PRO A CG    1 
ATOM   507  C  CD    . PRO A 1 77  ? 3.627   -25.847 -15.349 1.00 11.19 ?  203  PRO A CD    1 
ATOM   508  N  N     . HIS A 1 78  ? 5.509   -23.479 -18.881 1.00 8.35  ?  204  HIS A N     1 
ATOM   509  C  CA    . HIS A 1 78  ? 6.379   -22.345 -19.190 1.00 7.64  ?  204  HIS A CA    1 
ATOM   510  C  C     . HIS A 1 78  ? 7.852   -22.631 -19.174 1.00 10.20 ?  204  HIS A C     1 
ATOM   511  O  O     . HIS A 1 78  ? 8.648   -21.722 -19.312 1.00 12.55 ?  204  HIS A O     1 
ATOM   512  C  CB    . HIS A 1 78  ? 6.001   -21.073 -18.376 1.00 10.36 ?  204  HIS A CB    1 
ATOM   513  C  CG    . HIS A 1 78  ? 4.546   -20.785 -18.442 1.00 7.84  ?  204  HIS A CG    1 
ATOM   514  N  ND1   . HIS A 1 78  ? 3.933   -20.380 -19.611 1.00 9.57  ?  204  HIS A ND1   1 
ATOM   515  C  CD2   . HIS A 1 78  ? 3.553   -20.943 -17.532 1.00 8.40  ?  204  HIS A CD2   1 
ATOM   516  C  CE1   . HIS A 1 78  ? 2.635   -20.262 -19.405 1.00 10.53 ?  204  HIS A CE1   1 
ATOM   517  N  NE2   . HIS A 1 78  ? 2.376   -20.603 -18.156 1.00 12.70 ?  204  HIS A NE2   1 
ATOM   518  N  N     . PHE A 1 79  ? 8.200   -23.915 -19.037 1.00 11.46 ?  205  PHE A N     1 
ATOM   519  C  CA    . PHE A 1 79  ? 9.591   -24.321 -19.134 1.00 10.19 ?  205  PHE A CA    1 
ATOM   520  C  C     . PHE A 1 79  ? 9.836   -25.102 -20.412 1.00 15.23 ?  205  PHE A C     1 
ATOM   521  O  O     . PHE A 1 79  ? 9.534   -26.282 -20.483 1.00 23.86 ?  205  PHE A O     1 
ATOM   522  C  CB    . PHE A 1 79  ? 10.007  -25.134 -17.907 1.00 10.44 ?  205  PHE A CB    1 
ATOM   523  C  CG    . PHE A 1 79  ? 10.383  -24.260 -16.756 1.00 6.96  ?  205  PHE A CG    1 
ATOM   524  C  CD1   . PHE A 1 79  ? 11.678  -23.797 -16.637 1.00 9.51  ?  205  PHE A CD1   1 
ATOM   525  C  CD2   . PHE A 1 79  ? 9.409   -23.835 -15.856 1.00 7.72  ?  205  PHE A CD2   1 
ATOM   526  C  CE1   . PHE A 1 79  ? 12.033  -22.923 -15.620 1.00 10.02 ?  205  PHE A CE1   1 
ATOM   527  C  CE2   . PHE A 1 79  ? 9.750   -22.955 -14.828 1.00 8.03  ?  205  PHE A CE2   1 
ATOM   528  C  CZ    . PHE A 1 79  ? 11.051  -22.510 -14.709 1.00 8.50  ?  205  PHE A CZ    1 
ATOM   529  N  N     . GLY A 1 80  ? 10.362  -24.419 -21.413 1.00 9.83  ?  206  GLY A N     1 
ATOM   530  C  CA    . GLY A 1 80  ? 10.797  -25.057 -22.635 1.00 12.56 ?  206  GLY A CA    1 
ATOM   531  C  C     . GLY A 1 80  ? 12.304  -25.085 -22.685 1.00 12.68 ?  206  GLY A C     1 
ATOM   532  O  O     . GLY A 1 80  ? 12.997  -25.036 -21.647 1.00 12.41 ?  206  GLY A O     1 
ATOM   533  N  N     . GLU A 1 81  ? 12.835  -25.159 -23.903 1.00 12.99 ?  207  GLU A N     1 
ATOM   534  C  CA    . GLU A 1 81  ? 14.268  -25.335 -24.072 1.00 16.20 ?  207  GLU A CA    1 
ATOM   535  C  C     . GLU A 1 81  ? 15.063  -24.215 -23.393 1.00 15.17 ?  207  GLU A C     1 
ATOM   536  O  O     . GLU A 1 81  ? 16.045  -24.477 -22.699 1.00 15.34 ?  207  GLU A O     1 
ATOM   537  C  CB    . GLU A 1 81  ? 14.616  -25.420 -25.572 1.00 16.96 ?  207  GLU A CB    1 
ATOM   538  C  CG    . GLU A 1 81  ? 16.092  -25.601 -25.860 1.00 29.02 ?  207  GLU A CG    1 
ATOM   539  N  N     . HIS A 1 82  ? 14.618  -22.972 -23.547 1.00 11.85 ?  208  HIS A N     1 
ATOM   540  C  CA    . HIS A 1 82  ? 15.406  -21.839 -23.078 1.00 13.73 ?  208  HIS A CA    1 
ATOM   541  C  C     . HIS A 1 82  ? 15.420  -21.704 -21.541 1.00 13.66 ?  208  HIS A C     1 
ATOM   542  O  O     . HIS A 1 82  ? 16.495  -21.662 -20.915 1.00 9.44  ?  208  HIS A O     1 
ATOM   543  C  CB    . HIS A 1 82  ? 14.944  -20.544 -23.769 1.00 11.36 ?  208  HIS A CB    1 
ATOM   544  C  CG    . HIS A 1 82  ? 15.954  -19.439 -23.725 1.00 10.21 ?  208  HIS A CG    1 
ATOM   545  N  ND1   . HIS A 1 82  ? 16.044  -18.476 -24.701 1.00 10.18 ?  208  HIS A ND1   1 
ATOM   546  C  CD2   . HIS A 1 82  ? 16.919  -19.145 -22.822 1.00 10.64 ?  208  HIS A CD2   1 
ATOM   547  C  CE1   . HIS A 1 82  ? 17.015  -17.636 -24.406 1.00 12.68 ?  208  HIS A CE1   1 
ATOM   548  N  NE2   . HIS A 1 82  ? 17.564  -18.021 -23.269 1.00 12.85 ?  208  HIS A NE2   1 
ATOM   549  N  N     A SER A 1 83  ? 14.238  -21.648 -20.937 0.70 11.83 ?  209  SER A N     1 
ATOM   550  N  N     B SER A 1 83  ? 14.245  -21.638 -20.924 0.30 11.81 ?  209  SER A N     1 
ATOM   551  C  CA    A SER A 1 83  ? 14.162  -21.505 -19.486 0.70 8.26  ?  209  SER A CA    1 
ATOM   552  C  CA    B SER A 1 83  ? 14.192  -21.488 -19.470 0.30 8.37  ?  209  SER A CA    1 
ATOM   553  C  C     A SER A 1 83  ? 14.763  -22.697 -18.770 0.70 10.38 ?  209  SER A C     1 
ATOM   554  C  C     B SER A 1 83  ? 14.739  -22.710 -18.744 0.30 10.41 ?  209  SER A C     1 
ATOM   555  O  O     A SER A 1 83  ? 15.391  -22.546 -17.723 0.70 11.72 ?  209  SER A O     1 
ATOM   556  O  O     B SER A 1 83  ? 15.277  -22.595 -17.646 0.30 11.73 ?  209  SER A O     1 
ATOM   557  C  CB    A SER A 1 83  ? 12.717  -21.270 -19.034 0.70 8.78  ?  209  SER A CB    1 
ATOM   558  C  CB    B SER A 1 83  ? 12.773  -21.175 -18.990 0.30 8.89  ?  209  SER A CB    1 
ATOM   559  O  OG    A SER A 1 83  ? 12.209  -20.090 -19.643 0.70 10.08 ?  209  SER A OG    1 
ATOM   560  O  OG    B SER A 1 83  ? 11.859  -22.143 -19.457 0.30 10.21 ?  209  SER A OG    1 
ATOM   561  N  N     . SER A 1 84  ? 14.610  -23.881 -19.365 1.00 9.63  ?  210  SER A N     1 
ATOM   562  C  CA    . SER A 1 84  ? 15.184  -25.101 -18.800 1.00 14.14 ?  210  SER A CA    1 
ATOM   563  C  C     . SER A 1 84  ? 16.707  -25.070 -18.850 1.00 13.80 ?  210  SER A C     1 
ATOM   564  O  O     . SER A 1 84  ? 17.371  -25.516 -17.910 1.00 12.88 ?  210  SER A O     1 
ATOM   565  C  CB    . SER A 1 84  ? 14.639  -26.360 -19.493 1.00 11.57 ?  210  SER A CB    1 
ATOM   566  O  OG    . SER A 1 84  ? 13.238  -26.494 -19.331 1.00 13.30 ?  210  SER A OG    1 
ATOM   567  N  N     A ARG A 1 85  ? 17.267  -24.537 -19.933 0.60 13.38 ?  211  ARG A N     1 
ATOM   568  N  N     B ARG A 1 85  ? 17.264  -24.534 -19.931 0.40 13.38 ?  211  ARG A N     1 
ATOM   569  C  CA    A ARG A 1 85  ? 18.720  -24.429 -20.041 0.60 14.83 ?  211  ARG A CA    1 
ATOM   570  C  CA    B ARG A 1 85  ? 18.713  -24.428 -20.042 0.40 14.81 ?  211  ARG A CA    1 
ATOM   571  C  C     A ARG A 1 85  ? 19.273  -23.469 -18.988 0.60 13.65 ?  211  ARG A C     1 
ATOM   572  C  C     B ARG A 1 85  ? 19.278  -23.462 -19.000 0.40 13.66 ?  211  ARG A C     1 
ATOM   573  O  O     A ARG A 1 85  ? 20.318  -23.728 -18.391 0.60 13.38 ?  211  ARG A O     1 
ATOM   574  O  O     B ARG A 1 85  ? 20.334  -23.714 -18.419 0.40 13.41 ?  211  ARG A O     1 
ATOM   575  C  CB    A ARG A 1 85  ? 19.142  -23.990 -21.453 0.60 13.06 ?  211  ARG A CB    1 
ATOM   576  C  CB    B ARG A 1 85  ? 19.128  -24.007 -21.457 0.40 13.12 ?  211  ARG A CB    1 
ATOM   577  C  CG    A ARG A 1 85  ? 20.662  -23.916 -21.677 0.60 17.11 ?  211  ARG A CG    1 
ATOM   578  C  CG    B ARG A 1 85  ? 20.634  -23.831 -21.633 0.40 17.18 ?  211  ARG A CG    1 
ATOM   579  C  CD    A ARG A 1 85  ? 21.152  -22.462 -21.714 0.60 26.10 ?  211  ARG A CD    1 
ATOM   580  C  CD    B ARG A 1 85  ? 21.028  -23.611 -23.088 0.40 16.61 ?  211  ARG A CD    1 
ATOM   581  N  NE    A ARG A 1 85  ? 20.669  -21.742 -22.889 0.60 22.81 ?  211  ARG A NE    1 
ATOM   582  N  NE    B ARG A 1 85  ? 20.208  -22.619 -23.780 0.40 21.28 ?  211  ARG A NE    1 
ATOM   583  C  CZ    A ARG A 1 85  ? 20.617  -20.417 -23.009 0.60 21.90 ?  211  ARG A CZ    1 
ATOM   584  C  CZ    B ARG A 1 85  ? 19.259  -22.917 -24.665 0.40 15.57 ?  211  ARG A CZ    1 
ATOM   585  N  NH1   A ARG A 1 85  ? 21.026  -19.609 -22.022 0.60 12.50 ?  211  ARG A NH1   1 
ATOM   586  N  NH1   B ARG A 1 85  ? 19.005  -24.182 -24.970 0.40 31.22 ?  211  ARG A NH1   1 
ATOM   587  N  NH2   A ARG A 1 85  ? 20.146  -19.896 -24.134 0.60 28.69 ?  211  ARG A NH2   1 
ATOM   588  N  NH2   B ARG A 1 85  ? 18.564  -21.954 -25.248 0.40 22.24 ?  211  ARG A NH2   1 
ATOM   589  N  N     . VAL A 1 86  ? 18.576  -22.356 -18.758 1.00 11.41 ?  212  VAL A N     1 
ATOM   590  C  CA    . VAL A 1 86  ? 18.983  -21.418 -17.721 1.00 11.10 ?  212  VAL A CA    1 
ATOM   591  C  C     . VAL A 1 86  ? 19.065  -22.117 -16.356 1.00 11.23 ?  212  VAL A C     1 
ATOM   592  O  O     . VAL A 1 86  ? 20.057  -21.964 -15.625 1.00 11.34 ?  212  VAL A O     1 
ATOM   593  C  CB    . VAL A 1 86  ? 18.004  -20.209 -17.640 1.00 11.76 ?  212  VAL A CB    1 
ATOM   594  C  CG1   . VAL A 1 86  ? 18.321  -19.314 -16.433 1.00 10.94 ?  212  VAL A CG1   1 
ATOM   595  C  CG2   . VAL A 1 86  ? 18.031  -19.423 -18.945 1.00 15.22 ?  212  VAL A CG2   1 
ATOM   596  N  N     . VAL A 1 87  ? 18.014  -22.869 -16.023 1.00 8.82  ?  213  VAL A N     1 
ATOM   597  C  CA    . VAL A 1 87  ? 17.955  -23.567 -14.744 1.00 7.87  ?  213  VAL A CA    1 
ATOM   598  C  C     . VAL A 1 87  ? 19.051  -24.618 -14.697 1.00 12.24 ?  213  VAL A C     1 
ATOM   599  O  O     . VAL A 1 87  ? 19.750  -24.723 -13.699 1.00 11.54 ?  213  VAL A O     1 
ATOM   600  C  CB    . VAL A 1 87  ? 16.598  -24.192 -14.484 1.00 9.03  ?  213  VAL A CB    1 
ATOM   601  C  CG1   . VAL A 1 87  ? 16.655  -25.161 -13.309 1.00 12.53 ?  213  VAL A CG1   1 
ATOM   602  C  CG2   . VAL A 1 87  ? 15.593  -23.070 -14.199 1.00 11.71 ?  213  VAL A CG2   1 
ATOM   603  N  N     . GLN A 1 88  ? 19.194  -25.355 -15.791 1.00 12.88 ?  214  GLN A N     1 
ATOM   604  C  CA    . GLN A 1 88  ? 20.223  -26.393 -15.863 1.00 13.41 ?  214  GLN A CA    1 
ATOM   605  C  C     . GLN A 1 88  ? 21.613  -25.840 -15.561 1.00 15.80 ?  214  GLN A C     1 
ATOM   606  O  O     . GLN A 1 88  ? 22.355  -26.413 -14.756 1.00 15.39 ?  214  GLN A O     1 
ATOM   607  C  CB    . GLN A 1 88  ? 20.205  -27.070 -17.247 1.00 10.36 ?  214  GLN A CB    1 
ATOM   608  C  CG    . GLN A 1 88  ? 21.242  -28.210 -17.370 1.00 22.32 ?  214  GLN A CG    1 
ATOM   609  C  CD    . GLN A 1 88  ? 21.344  -28.772 -18.781 1.00 43.44 ?  214  GLN A CD    1 
ATOM   610  O  OE1   . GLN A 1 88  ? 20.540  -28.444 -19.654 1.00 22.87 ?  214  GLN A OE1   1 
ATOM   611  N  NE2   . GLN A 1 88  ? 22.346  -29.624 -19.011 1.00 49.00 ?  214  GLN A NE2   1 
ATOM   612  N  N     . GLU A 1 89  ? 21.969  -24.724 -16.194 1.00 9.89  ?  215  GLU A N     1 
ATOM   613  C  CA    . GLU A 1 89  ? 23.274  -24.119 -15.962 1.00 11.66 ?  215  GLU A CA    1 
ATOM   614  C  C     . GLU A 1 89  ? 23.452  -23.642 -14.529 1.00 15.83 ?  215  GLU A C     1 
ATOM   615  O  O     . GLU A 1 89  ? 24.507  -23.808 -13.930 1.00 14.11 ?  215  GLU A O     1 
ATOM   616  C  CB    . GLU A 1 89  ? 23.531  -22.995 -16.958 1.00 13.21 ?  215  GLU A CB    1 
ATOM   617  C  CG    . GLU A 1 89  ? 23.511  -23.507 -18.393 1.00 15.24 ?  215  GLU A CG    1 
ATOM   618  C  CD    . GLU A 1 89  ? 23.927  -22.460 -19.406 1.00 23.88 ?  215  GLU A CD    1 
ATOM   619  O  OE1   . GLU A 1 89  ? 24.305  -21.339 -19.007 1.00 22.33 ?  215  GLU A OE1   1 
ATOM   620  O  OE2   . GLU A 1 89  ? 23.883  -22.779 -20.610 1.00 27.84 ?  215  GLU A OE2   1 
ATOM   621  N  N     . LEU A 1 90  ? 22.401  -23.086 -13.941 1.00 10.29 ?  216  LEU A N     1 
ATOM   622  C  CA    . LEU A 1 90  ? 22.489  -22.660 -12.559 1.00 11.04 ?  216  LEU A CA    1 
ATOM   623  C  C     . LEU A 1 90  ? 22.680  -23.849 -11.610 1.00 14.86 ?  216  LEU A C     1 
ATOM   624  O  O     . LEU A 1 90  ? 23.435  -23.734 -10.651 1.00 15.41 ?  216  LEU A O     1 
ATOM   625  C  CB    . LEU A 1 90  ? 21.259  -21.828 -12.162 1.00 13.01 ?  216  LEU A CB    1 
ATOM   626  C  CG    . LEU A 1 90  ? 21.231  -20.439 -12.804 1.00 10.22 ?  216  LEU A CG    1 
ATOM   627  C  CD1   . LEU A 1 90  ? 19.805  -19.938 -12.800 1.00 9.76  ?  216  LEU A CD1   1 
ATOM   628  C  CD2   . LEU A 1 90  ? 22.110  -19.450 -12.057 1.00 14.40 ?  216  LEU A CD2   1 
ATOM   629  N  N     . LEU A 1 91  ? 21.987  -24.961 -11.880 1.00 12.32 ?  217  LEU A N     1 
ATOM   630  C  CA    . LEU A 1 91  ? 22.087  -26.175 -11.050 1.00 11.96 ?  217  LEU A CA    1 
ATOM   631  C  C     . LEU A 1 91  ? 23.477  -26.789 -11.146 1.00 18.48 ?  217  LEU A C     1 
ATOM   632  O  O     . LEU A 1 91  ? 24.056  -27.227 -10.144 1.00 21.90 ?  217  LEU A O     1 
ATOM   633  C  CB    . LEU A 1 91  ? 21.052  -27.211 -11.470 1.00 13.68 ?  217  LEU A CB    1 
ATOM   634  C  CG    . LEU A 1 91  ? 19.571  -26.870 -11.237 1.00 13.89 ?  217  LEU A CG    1 
ATOM   635  C  CD1   . LEU A 1 91  ? 18.669  -27.989 -11.784 1.00 15.00 ?  217  LEU A CD1   1 
ATOM   636  C  CD2   . LEU A 1 91  ? 19.291  -26.640 -9.757  1.00 18.82 ?  217  LEU A CD2   1 
ATOM   637  N  N     . GLU A 1 92  ? 24.019  -26.788 -12.353 1.00 15.09 ?  218  GLU A N     1 
ATOM   638  C  CA    . GLU A 1 92  ? 25.331  -27.410 -12.602 1.00 17.15 ?  218  GLU A CA    1 
ATOM   639  C  C     . GLU A 1 92  ? 26.529  -26.550 -12.187 1.00 27.37 ?  218  GLU A C     1 
ATOM   640  O  O     . GLU A 1 92  ? 27.509  -27.089 -11.666 1.00 26.19 ?  218  GLU A O     1 
ATOM   641  C  CB    . GLU A 1 92  ? 25.454  -27.860 -14.072 1.00 16.72 ?  218  GLU A CB    1 
ATOM   642  C  CG    . GLU A 1 92  ? 24.407  -28.932 -14.441 1.00 33.33 ?  218  GLU A CG    1 
ATOM   643  C  CD    . GLU A 1 92  ? 24.485  -29.418 -15.887 1.00 46.28 ?  218  GLU A CD    1 
ATOM   644  O  OE1   . GLU A 1 92  ? 25.340  -28.923 -16.650 1.00 38.10 ?  218  GLU A OE1   1 
ATOM   645  O  OE2   . GLU A 1 92  ? 23.677  -30.305 -16.260 1.00 40.26 ?  218  GLU A OE2   1 
ATOM   646  N  N     . HIS A 1 93  ? 26.455  -25.232 -12.392 1.00 20.34 ?  219  HIS A N     1 
ATOM   647  C  CA    . HIS A 1 93  ? 27.624  -24.358 -12.214 1.00 18.95 ?  219  HIS A CA    1 
ATOM   648  C  C     . HIS A 1 93  ? 27.446  -23.159 -11.289 1.00 24.88 ?  219  HIS A C     1 
ATOM   649  O  O     . HIS A 1 93  ? 28.398  -22.422 -11.035 1.00 28.83 ?  219  HIS A O     1 
ATOM   650  C  CB    . HIS A 1 93  ? 28.116  -23.869 -13.575 1.00 26.45 ?  219  HIS A CB    1 
ATOM   651  C  CG    . HIS A 1 93  ? 28.449  -24.980 -14.515 1.00 43.25 ?  219  HIS A CG    1 
ATOM   652  N  ND1   . HIS A 1 93  ? 27.678  -25.281 -15.618 1.00 44.87 ?  219  HIS A ND1   1 
ATOM   653  C  CD2   . HIS A 1 93  ? 29.452  -25.888 -14.497 1.00 34.52 ?  219  HIS A CD2   1 
ATOM   654  C  CE1   . HIS A 1 93  ? 28.203  -26.317 -16.248 1.00 43.38 ?  219  HIS A CE1   1 
ATOM   655  N  NE2   . HIS A 1 93  ? 29.281  -26.703 -15.589 1.00 42.92 ?  219  HIS A NE2   1 
ATOM   656  N  N     . GLY A 1 94  ? 26.224  -22.932 -10.822 1.00 18.38 ?  220  GLY A N     1 
ATOM   657  C  CA    . GLY A 1 94  ? 25.959  -21.817 -9.929  1.00 15.83 ?  220  GLY A CA    1 
ATOM   658  C  C     . GLY A 1 94  ? 25.732  -20.491 -10.639 1.00 16.28 ?  220  GLY A C     1 
ATOM   659  O  O     . GLY A 1 94  ? 25.423  -19.468 -10.018 1.00 20.61 ?  220  GLY A O     1 
ATOM   660  N  N     . VAL A 1 95  ? 25.841  -20.523 -11.959 1.00 15.82 ?  221  VAL A N     1 
ATOM   661  C  CA    . VAL A 1 95  ? 25.777  -19.316 -12.748 1.00 17.27 ?  221  VAL A CA    1 
ATOM   662  C  C     . VAL A 1 95  ? 25.322  -19.665 -14.170 1.00 14.64 ?  221  VAL A C     1 
ATOM   663  O  O     . VAL A 1 95  ? 25.553  -20.778 -14.648 1.00 18.52 ?  221  VAL A O     1 
ATOM   664  C  CB    . VAL A 1 95  ? 27.177  -18.631 -12.726 1.00 28.12 ?  221  VAL A CB    1 
ATOM   665  C  CG1   . VAL A 1 95  ? 28.099  -19.200 -13.805 1.00 29.34 ?  221  VAL A CG1   1 
ATOM   666  C  CG2   . VAL A 1 95  ? 27.057  -17.157 -12.845 1.00 31.20 ?  221  VAL A CG2   1 
ATOM   667  N  N     . CYS A 1 96  ? 24.603  -18.746 -14.814 1.00 14.76 ?  222  CYS A N     1 
ATOM   668  C  CA    . CYS A 1 96  ? 24.163  -18.956 -16.185 1.00 10.49 ?  222  CYS A CA    1 
ATOM   669  C  C     . CYS A 1 96  ? 24.828  -17.918 -17.066 1.00 11.02 ?  222  CYS A C     1 
ATOM   670  O  O     . CYS A 1 96  ? 24.677  -16.714 -16.830 1.00 12.34 ?  222  CYS A O     1 
ATOM   671  C  CB    . CYS A 1 96  ? 22.633  -18.860 -16.306 1.00 11.90 ?  222  CYS A CB    1 
ATOM   672  S  SG    . CYS A 1 96  ? 21.997  -18.761 -18.016 1.00 14.00 ?  222  CYS A SG    1 
ATOM   673  N  N     . GLU A 1 97  ? 25.605  -18.378 -18.051 1.00 12.73 ?  223  GLU A N     1 
ATOM   674  C  CA    . GLU A 1 97  ? 26.433  -17.480 -18.820 1.00 13.71 ?  223  GLU A CA    1 
ATOM   675  C  C     . GLU A 1 97  ? 25.636  -16.371 -19.509 1.00 12.21 ?  223  GLU A C     1 
ATOM   676  O  O     . GLU A 1 97  ? 26.040  -15.230 -19.463 1.00 12.70 ?  223  GLU A O     1 
ATOM   677  C  CB    . GLU A 1 97  ? 27.288  -18.273 -19.831 1.00 17.35 ?  223  GLU A CB    1 
ATOM   678  C  CG    . GLU A 1 97  ? 28.182  -17.419 -20.705 1.00 24.19 ?  223  GLU A CG    1 
ATOM   679  N  N     . GLU A 1 98  ? 24.462  -16.706 -20.050 1.00 12.15 ?  224  GLU A N     1 
ATOM   680  C  CA    . GLU A 1 98  ? 23.588  -15.707 -20.684 1.00 10.04 ?  224  GLU A CA    1 
ATOM   681  C  C     . GLU A 1 98  ? 23.146  -14.631 -19.696 1.00 6.65  ?  224  GLU A C     1 
ATOM   682  O  O     . GLU A 1 98  ? 23.184  -13.440 -19.989 1.00 10.49 ?  224  GLU A O     1 
ATOM   683  C  CB    . GLU A 1 98  ? 22.355  -16.375 -21.299 1.00 11.17 ?  224  GLU A CB    1 
ATOM   684  C  CG    . GLU A 1 98  ? 21.477  -15.368 -22.014 1.00 12.79 ?  224  GLU A CG    1 
ATOM   685  C  CD    . GLU A 1 98  ? 20.190  -15.948 -22.571 1.00 13.16 ?  224  GLU A CD    1 
ATOM   686  O  OE1   . GLU A 1 98  ? 19.834  -17.091 -22.211 1.00 16.15 ?  224  GLU A OE1   1 
ATOM   687  O  OE2   . GLU A 1 98  ? 19.510  -15.218 -23.339 1.00 17.12 ?  224  GLU A OE2   1 
ATOM   688  N  N     . VAL A 1 99  ? 22.746  -15.071 -18.510 1.00 10.70 ?  225  VAL A N     1 
ATOM   689  C  CA    . VAL A 1 99  ? 22.308  -14.125 -17.480 1.00 8.28  ?  225  VAL A CA    1 
ATOM   690  C  C     . VAL A 1 99  ? 23.454  -13.187 -17.077 1.00 9.20  ?  225  VAL A C     1 
ATOM   691  O  O     . VAL A 1 99  ? 23.266  -11.982 -16.949 1.00 11.23 ?  225  VAL A O     1 
ATOM   692  C  CB    . VAL A 1 99  ? 21.748  -14.871 -16.246 1.00 7.52  ?  225  VAL A CB    1 
ATOM   693  C  CG1   . VAL A 1 99  ? 21.503  -13.901 -15.074 1.00 9.35  ?  225  VAL A CG1   1 
ATOM   694  C  CG2   . VAL A 1 99  ? 20.463  -15.626 -16.592 1.00 9.26  ?  225  VAL A CG2   1 
ATOM   695  N  N     . GLU A 1 100 ? 24.659  -13.735 -16.889 1.00 11.26 ?  226  GLU A N     1 
ATOM   696  C  CA    . GLU A 1 100 ? 25.794  -12.889 -16.521 1.00 12.08 ?  226  GLU A CA    1 
ATOM   697  C  C     . GLU A 1 100 ? 26.209  -11.932 -17.616 1.00 7.86  ?  226  GLU A C     1 
ATOM   698  O  O     . GLU A 1 100 ? 26.581  -10.801 -17.341 1.00 11.83 ?  226  GLU A O     1 
ATOM   699  C  CB    . GLU A 1 100 ? 26.977  -13.760 -16.128 1.00 13.42 ?  226  GLU A CB    1 
ATOM   700  C  CG    . GLU A 1 100 ? 26.629  -14.650 -14.962 1.00 15.12 ?  226  GLU A CG    1 
ATOM   701  C  CD    . GLU A 1 100 ? 26.168  -13.851 -13.744 1.00 22.51 ?  226  GLU A CD    1 
ATOM   702  O  OE1   . GLU A 1 100 ? 26.931  -12.966 -13.293 1.00 24.51 ?  226  GLU A OE1   1 
ATOM   703  O  OE2   . GLU A 1 100 ? 25.030  -14.071 -13.264 1.00 21.35 ?  226  GLU A OE2   1 
ATOM   704  N  N     . ARG A 1 101 ? 26.119  -12.386 -18.857 1.00 11.93 ?  227  ARG A N     1 
ATOM   705  C  CA    . ARG A 1 101 ? 26.386  -11.510 -19.979 1.00 11.88 ?  227  ARG A CA    1 
ATOM   706  C  C     . ARG A 1 101 ? 25.401  -10.331 -20.004 1.00 14.83 ?  227  ARG A C     1 
ATOM   707  O  O     . ARG A 1 101 ? 25.788  -9.184  -20.221 1.00 15.46 ?  227  ARG A O     1 
ATOM   708  C  CB    . ARG A 1 101 ? 26.322  -12.298 -21.274 1.00 17.34 ?  227  ARG A CB    1 
ATOM   709  C  CG    . ARG A 1 101 ? 26.999  -11.609 -22.437 1.00 29.81 ?  227  ARG A CG    1 
ATOM   710  C  CD    . ARG A 1 101 ? 27.200  -12.577 -23.595 1.00 31.88 ?  227  ARG A CD    1 
ATOM   711  N  NE    . ARG A 1 101 ? 25.932  -13.083 -24.107 1.00 40.69 ?  227  ARG A NE    1 
ATOM   712  C  CZ    . ARG A 1 101 ? 25.507  -14.333 -23.955 1.00 30.05 ?  227  ARG A CZ    1 
ATOM   713  N  NH1   . ARG A 1 101 ? 26.260  -15.222 -23.310 1.00 35.34 ?  227  ARG A NH1   1 
ATOM   714  N  NH2   . ARG A 1 101 ? 24.332  -14.693 -24.461 1.00 37.08 ?  227  ARG A NH2   1 
ATOM   715  N  N     . VAL A 1 102 ? 24.126  -10.617 -19.769 1.00 11.48 ?  228  VAL A N     1 
ATOM   716  C  CA    . VAL A 1 102 ? 23.153  -9.524  -19.675 1.00 9.57  ?  228  VAL A CA    1 
ATOM   717  C  C     . VAL A 1 102 ? 23.491  -8.579  -18.522 1.00 11.47 ?  228  VAL A C     1 
ATOM   718  O  O     . VAL A 1 102 ? 23.534  -7.358  -18.711 1.00 12.38 ?  228  VAL A O     1 
ATOM   719  C  CB    . VAL A 1 102 ? 21.705  -10.086 -19.500 1.00 13.00 ?  228  VAL A CB    1 
ATOM   720  C  CG1   . VAL A 1 102 ? 20.716  -8.945  -19.174 1.00 14.83 ?  228  VAL A CG1   1 
ATOM   721  C  CG2   . VAL A 1 102 ? 21.275  -10.832 -20.744 1.00 16.21 ?  228  VAL A CG2   1 
ATOM   722  N  N     . ARG A 1 103 ? 23.738  -9.130  -17.334 1.00 10.61 ?  229  ARG A N     1 
ATOM   723  C  CA    . ARG A 1 103 ? 24.022  -8.311  -16.157 1.00 13.81 ?  229  ARG A CA    1 
ATOM   724  C  C     . ARG A 1 103 ? 25.155  -7.316  -16.373 1.00 14.42 ?  229  ARG A C     1 
ATOM   725  O  O     . ARG A 1 103 ? 25.070  -6.178  -15.942 1.00 18.05 ?  229  ARG A O     1 
ATOM   726  C  CB    . ARG A 1 103 ? 24.455  -9.173  -14.982 1.00 18.38 ?  229  ARG A CB    1 
ATOM   727  C  CG    . ARG A 1 103 ? 23.387  -9.917  -14.270 1.00 18.52 ?  229  ARG A CG    1 
ATOM   728  C  CD    . ARG A 1 103 ? 24.011  -10.448 -12.971 1.00 19.33 ?  229  ARG A CD    1 
ATOM   729  N  NE    . ARG A 1 103 ? 23.402  -11.688 -12.513 1.00 22.37 ?  229  ARG A NE    1 
ATOM   730  C  CZ    . ARG A 1 103 ? 22.307  -11.734 -11.767 1.00 27.81 ?  229  ARG A CZ    1 
ATOM   731  N  NH1   . ARG A 1 103 ? 21.707  -10.601 -11.397 1.00 23.35 ?  229  ARG A NH1   1 
ATOM   732  N  NH2   . ARG A 1 103 ? 21.818  -12.902 -11.392 1.00 25.04 ?  229  ARG A NH2   1 
ATOM   733  N  N     . ARG A 1 104 ? 26.224  -7.748  -17.032 1.00 12.73 ?  230  ARG A N     1 
ATOM   734  C  CA    . ARG A 1 104 ? 27.375  -6.852  -17.165 1.00 16.64 ?  230  ARG A CA    1 
ATOM   735  C  C     . ARG A 1 104 ? 27.302  -5.969  -18.420 1.00 22.45 ?  230  ARG A C     1 
ATOM   736  O  O     . ARG A 1 104 ? 28.133  -5.075  -18.605 1.00 25.01 ?  230  ARG A O     1 
ATOM   737  C  CB    . ARG A 1 104 ? 28.692  -7.625  -17.068 1.00 25.51 ?  230  ARG A CB    1 
ATOM   738  C  CG    . ARG A 1 104 ? 28.890  -8.675  -18.127 1.00 19.54 ?  230  ARG A CG    1 
ATOM   739  C  CD    . ARG A 1 104 ? 30.182  -9.486  -17.870 1.00 25.97 ?  230  ARG A CD    1 
ATOM   740  N  NE    . ARG A 1 104 ? 30.308  -10.474 -18.932 1.00 23.75 ?  230  ARG A NE    1 
ATOM   741  C  CZ    . ARG A 1 104 ? 30.126  -11.782 -18.774 1.00 18.06 ?  230  ARG A CZ    1 
ATOM   742  N  NH1   . ARG A 1 104 ? 29.902  -12.283 -17.571 1.00 26.80 ?  230  ARG A NH1   1 
ATOM   743  N  NH2   . ARG A 1 104 ? 30.225  -12.584 -19.820 1.00 34.17 ?  230  ARG A NH2   1 
ATOM   744  N  N     . SER A 1 105 ? 26.279  -6.177  -19.248 1.00 14.47 ?  231  SER A N     1 
ATOM   745  C  CA    . SER A 1 105 ? 26.168  -5.402  -20.482 1.00 11.74 ?  231  SER A CA    1 
ATOM   746  C  C     . SER A 1 105 ? 25.814  -3.921  -20.279 1.00 13.65 ?  231  SER A C     1 
ATOM   747  O  O     . SER A 1 105 ? 25.009  -3.541  -19.400 1.00 14.09 ?  231  SER A O     1 
ATOM   748  C  CB    . SER A 1 105 ? 25.212  -6.051  -21.478 1.00 16.26 ?  231  SER A CB    1 
ATOM   749  O  OG    . SER A 1 105 ? 23.875  -5.900  -21.059 1.00 14.84 ?  231  SER A OG    1 
ATOM   750  N  N     . GLU A 1 106 ? 26.432  -3.079  -21.101 1.00 13.95 ?  232  GLU A N     1 
ATOM   751  C  CA    . GLU A 1 106 ? 26.214  -1.645  -21.012 1.00 15.51 ?  232  GLU A CA    1 
ATOM   752  C  C     . GLU A 1 106 ? 24.735  -1.321  -21.287 1.00 16.03 ?  232  GLU A C     1 
ATOM   753  O  O     . GLU A 1 106 ? 24.125  -0.474  -20.615 1.00 13.44 ?  232  GLU A O     1 
ATOM   754  C  CB    . GLU A 1 106 ? 27.143  -0.929  -22.002 1.00 18.21 ?  232  GLU A CB    1 
ATOM   755  C  CG    . GLU A 1 106 ? 27.112  0.562   -21.878 1.00 26.11 ?  232  GLU A CG    1 
ATOM   756  C  CD    . GLU A 1 106 ? 28.153  1.245   -22.759 1.00 29.77 ?  232  GLU A CD    1 
ATOM   757  O  OE1   . GLU A 1 106 ? 28.670  0.590   -23.690 1.00 32.81 ?  232  GLU A OE1   1 
ATOM   758  O  OE2   . GLU A 1 106 ? 28.442  2.431   -22.507 1.00 28.13 ?  232  GLU A OE2   1 
ATOM   759  N  N     . ARG A 1 107 ? 24.164  -2.043  -22.237 1.00 14.97 ?  233  ARG A N     1 
ATOM   760  C  CA    . ARG A 1 107 ? 22.772  -1.861  -22.635 1.00 16.11 ?  233  ARG A CA    1 
ATOM   761  C  C     . ARG A 1 107 ? 21.843  -2.146  -21.463 1.00 12.07 ?  233  ARG A C     1 
ATOM   762  O  O     . ARG A 1 107 ? 20.990  -1.336  -21.151 1.00 12.17 ?  233  ARG A O     1 
ATOM   763  C  CB    . ARG A 1 107 ? 22.433  -2.776  -23.810 1.00 14.70 ?  233  ARG A CB    1 
ATOM   764  C  CG    . ARG A 1 107 ? 20.938  -2.837  -24.165 1.00 20.04 ?  233  ARG A CG    1 
ATOM   765  C  CD    . ARG A 1 107 ? 20.455  -1.522  -24.769 1.00 16.01 ?  233  ARG A CD    1 
ATOM   766  N  NE    . ARG A 1 107 ? 19.053  -1.640  -25.174 1.00 14.56 ?  233  ARG A NE    1 
ATOM   767  C  CZ    . ARG A 1 107 ? 18.346  -0.681  -25.763 1.00 11.53 ?  233  ARG A CZ    1 
ATOM   768  N  NH1   . ARG A 1 107 ? 18.916  0.482   -26.068 1.00 15.99 ?  233  ARG A NH1   1 
ATOM   769  N  NH2   . ARG A 1 107 ? 17.065  -0.887  -26.072 1.00 14.37 ?  233  ARG A NH2   1 
ATOM   770  N  N     . TYR A 1 108 ? 22.020  -3.288  -20.803 1.00 10.86 ?  234  TYR A N     1 
ATOM   771  C  CA    . TYR A 1 108 ? 21.130  -3.637  -19.699 1.00 9.27  ?  234  TYR A CA    1 
ATOM   772  C  C     . TYR A 1 108 ? 21.298  -2.647  -18.544 1.00 10.06 ?  234  TYR A C     1 
ATOM   773  O  O     . TYR A 1 108 ? 20.320  -2.131  -17.980 1.00 9.65  ?  234  TYR A O     1 
ATOM   774  C  CB    . TYR A 1 108 ? 21.421  -5.078  -19.229 1.00 10.42 ?  234  TYR A CB    1 
ATOM   775  C  CG    . TYR A 1 108 ? 20.701  -5.448  -17.952 1.00 7.24  ?  234  TYR A CG    1 
ATOM   776  C  CD1   . TYR A 1 108 ? 19.383  -5.898  -17.991 1.00 11.70 ?  234  TYR A CD1   1 
ATOM   777  C  CD2   . TYR A 1 108 ? 21.333  -5.351  -16.702 1.00 8.62  ?  234  TYR A CD2   1 
ATOM   778  C  CE1   . TYR A 1 108 ? 18.715  -6.214  -16.817 1.00 12.00 ?  234  TYR A CE1   1 
ATOM   779  C  CE2   . TYR A 1 108 ? 20.685  -5.666  -15.535 1.00 13.25 ?  234  TYR A CE2   1 
ATOM   780  C  CZ    . TYR A 1 108 ? 19.368  -6.100  -15.592 1.00 16.45 ?  234  TYR A CZ    1 
ATOM   781  O  OH    . TYR A 1 108 ? 18.723  -6.412  -14.415 1.00 15.62 ?  234  TYR A OH    1 
ATOM   782  N  N     . GLN A 1 109 ? 22.543  -2.356  -18.185 1.00 10.86 ?  235  GLN A N     1 
ATOM   783  C  CA    . GLN A 1 109 ? 22.775  -1.508  -17.028 1.00 10.98 ?  235  GLN A CA    1 
ATOM   784  C  C     . GLN A 1 109 ? 22.208  -0.115  -17.230 1.00 11.22 ?  235  GLN A C     1 
ATOM   785  O  O     . GLN A 1 109 ? 21.634  0.465   -16.319 1.00 11.03 ?  235  GLN A O     1 
ATOM   786  C  CB    . GLN A 1 109 ? 24.282  -1.431  -16.723 1.00 12.20 ?  235  GLN A CB    1 
ATOM   787  C  CG    . GLN A 1 109 ? 24.851  -2.786  -16.334 1.00 15.17 ?  235  GLN A CG    1 
ATOM   788  C  CD    . GLN A 1 109 ? 26.316  -2.707  -15.916 1.00 26.88 ?  235  GLN A CD    1 
ATOM   789  O  OE1   . GLN A 1 109 ? 27.016  -3.722  -15.853 1.00 31.27 ?  235  GLN A OE1   1 
ATOM   790  N  NE2   . GLN A 1 109 ? 26.782  -1.496  -15.625 1.00 26.67 ?  235  GLN A NE2   1 
ATOM   791  N  N     . THR A 1 110 ? 22.355  0.411   -18.434 1.00 11.03 ?  236  THR A N     1 
ATOM   792  C  CA    . THR A 1 110 ? 21.891  1.763   -18.703 1.00 8.87  ?  236  THR A CA    1 
ATOM   793  C  C     . THR A 1 110 ? 20.365  1.793   -18.831 1.00 8.12  ?  236  THR A C     1 
ATOM   794  O  O     . THR A 1 110 ? 19.715  2.720   -18.340 1.00 9.59  ?  236  THR A O     1 
ATOM   795  C  CB    . THR A 1 110 ? 22.540  2.317   -19.977 1.00 12.64 ?  236  THR A CB    1 
ATOM   796  O  OG1   . THR A 1 110 ? 23.973  2.273   -19.806 1.00 16.79 ?  236  THR A OG1   1 
ATOM   797  C  CG2   . THR A 1 110 ? 22.101  3.760   -20.234 1.00 15.16 ?  236  THR A CG2   1 
ATOM   798  N  N     . MET A 1 111 ? 19.794  0.824   -19.531 1.00 9.11  ?  237  MET A N     1 
ATOM   799  C  CA    . MET A 1 111 ? 18.335  0.790   -19.645 1.00 10.15 ?  237  MET A CA    1 
ATOM   800  C  C     . MET A 1 111 ? 17.702  0.584   -18.272 1.00 10.10 ?  237  MET A C     1 
ATOM   801  O  O     . MET A 1 111 ? 16.690  1.179   -17.968 1.00 10.49 ?  237  MET A O     1 
ATOM   802  C  CB    . MET A 1 111 ? 17.872  -0.321  -20.581 1.00 8.73  ?  237  MET A CB    1 
ATOM   803  C  CG    . MET A 1 111 ? 18.192  -0.065  -22.043 1.00 11.33 ?  237  MET A CG    1 
ATOM   804  S  SD    . MET A 1 111 ? 17.243  1.306   -22.716 1.00 11.27 ?  237  MET A SD    1 
ATOM   805  C  CE    . MET A 1 111 ? 15.591  0.572   -22.752 1.00 11.92 ?  237  MET A CE    1 
ATOM   806  N  N     . LYS A 1 112 ? 18.293  -0.267  -17.449 1.00 8.75  ?  238  LYS A N     1 
ATOM   807  C  CA    . LYS A 1 112 ? 17.796  -0.392  -16.085 1.00 10.03 ?  238  LYS A CA    1 
ATOM   808  C  C     . LYS A 1 112 ? 17.872  0.922   -15.318 1.00 12.85 ?  238  LYS A C     1 
ATOM   809  O  O     . LYS A 1 112 ? 16.900  1.318   -14.677 1.00 11.71 ?  238  LYS A O     1 
ATOM   810  C  CB    . LYS A 1 112 ? 18.548  -1.492  -15.325 1.00 11.17 ?  238  LYS A CB    1 
ATOM   811  C  CG    . LYS A 1 112 ? 17.997  -1.712  -13.919 1.00 16.11 ?  238  LYS A CG    1 
ATOM   812  C  CD    . LYS A 1 112 ? 18.527  -3.020  -13.354 1.00 21.32 ?  238  LYS A CD    1 
ATOM   813  C  CE    . LYS A 1 112 ? 17.808  -3.402  -12.056 1.00 19.82 ?  238  LYS A CE    1 
ATOM   814  N  NZ    . LYS A 1 112 ? 16.372  -3.777  -12.241 1.00 21.10 ?  238  LYS A NZ    1 
ATOM   815  N  N     . LEU A 1 113 ? 19.024  1.603   -15.372 1.00 9.29  ?  239  LEU A N     1 
ATOM   816  C  CA    . LEU A 1 113 ? 19.188  2.880   -14.693 1.00 13.18 ?  239  LEU A CA    1 
ATOM   817  C  C     . LEU A 1 113 ? 18.168  3.920   -15.153 1.00 15.11 ?  239  LEU A C     1 
ATOM   818  O  O     . LEU A 1 113 ? 17.510  4.571   -14.338 1.00 15.18 ?  239  LEU A O     1 
ATOM   819  C  CB    . LEU A 1 113 ? 20.587  3.421   -14.966 1.00 12.61 ?  239  LEU A CB    1 
ATOM   820  C  CG    . LEU A 1 113 ? 20.898  4.804   -14.404 1.00 16.40 ?  239  LEU A CG    1 
ATOM   821  C  CD1   . LEU A 1 113 ? 20.795  4.798   -12.869 1.00 19.73 ?  239  LEU A CD1   1 
ATOM   822  C  CD2   . LEU A 1 113 ? 22.291  5.215   -14.884 1.00 16.39 ?  239  LEU A CD2   1 
ATOM   823  N  N     . PHE A 1 114 ? 18.027  4.064   -16.462 1.00 8.48  ?  240  PHE A N     1 
ATOM   824  C  CA    . PHE A 1 114 ? 17.085  5.067   -16.998 1.00 7.68  ?  240  PHE A CA    1 
ATOM   825  C  C     . PHE A 1 114 ? 15.613  4.700   -16.734 1.00 10.31 ?  240  PHE A C     1 
ATOM   826  O  O     . PHE A 1 114 ? 14.859  5.568   -16.357 1.00 8.85  ?  240  PHE A O     1 
ATOM   827  C  CB    . PHE A 1 114 ? 17.296  5.287   -18.503 1.00 9.80  ?  240  PHE A CB    1 
ATOM   828  C  CG    . PHE A 1 114 ? 18.610  6.025   -18.874 1.00 9.11  ?  240  PHE A CG    1 
ATOM   829  C  CD1   . PHE A 1 114 ? 19.428  6.579   -17.910 1.00 10.07 ?  240  PHE A CD1   1 
ATOM   830  C  CD2   . PHE A 1 114 ? 18.982  6.143   -20.199 1.00 13.15 ?  240  PHE A CD2   1 
ATOM   831  C  CE1   . PHE A 1 114 ? 20.617  7.241   -18.265 1.00 15.55 ?  240  PHE A CE1   1 
ATOM   832  C  CE2   . PHE A 1 114 ? 20.169  6.801   -20.556 1.00 9.91  ?  240  PHE A CE2   1 
ATOM   833  C  CZ    . PHE A 1 114 ? 20.963  7.349   -19.586 1.00 10.56 ?  240  PHE A CZ    1 
ATOM   834  N  N     . THR A 1 115 ? 15.216  3.448   -16.948 1.00 9.14  ?  241  THR A N     1 
ATOM   835  C  CA    . THR A 1 115 ? 13.791  3.111   -16.746 1.00 11.08 ?  241  THR A CA    1 
ATOM   836  C  C     . THR A 1 115 ? 13.383  3.171   -15.276 1.00 9.82  ?  241  THR A C     1 
ATOM   837  O  O     . THR A 1 115 ? 12.194  3.274   -14.962 1.00 12.25 ?  241  THR A O     1 
ATOM   838  C  CB    . THR A 1 115 ? 13.422  1.749   -17.294 1.00 9.91  ?  241  THR A CB    1 
ATOM   839  O  OG1   . THR A 1 115 ? 14.260  0.742   -16.705 1.00 9.64  ?  241  THR A OG1   1 
ATOM   840  C  CG2   . THR A 1 115 ? 13.533  1.711   -18.835 1.00 12.52 ?  241  THR A CG2   1 
ATOM   841  N  N     . GLN A 1 116 ? 14.366  3.134   -14.375 1.00 12.04 ?  242  GLN A N     1 
ATOM   842  C  CA    . GLN A 1 116 ? 14.100  3.271   -12.957 1.00 13.32 ?  242  GLN A CA    1 
ATOM   843  C  C     . GLN A 1 116 ? 13.654  4.682   -12.608 1.00 12.03 ?  242  GLN A C     1 
ATOM   844  O  O     . GLN A 1 116 ? 13.088  4.909   -11.531 1.00 18.49 ?  242  GLN A O     1 
ATOM   845  C  CB    . GLN A 1 116 ? 15.368  2.961   -12.145 1.00 19.07 ?  242  GLN A CB    1 
ATOM   846  C  CG    . GLN A 1 116 ? 15.324  1.695   -11.338 1.00 35.22 ?  242  GLN A CG    1 
ATOM   847  C  CD    . GLN A 1 116 ? 16.714  1.126   -11.018 1.00 37.36 ?  242  GLN A CD    1 
ATOM   848  O  OE1   . GLN A 1 116 ? 16.851  -0.070  -10.777 1.00 38.37 ?  242  GLN A OE1   1 
ATOM   849  N  NE2   . GLN A 1 116 ? 17.739  1.980   -11.021 1.00 28.81 ?  242  GLN A NE2   1 
ATOM   850  N  N     . ILE A 1 117 ? 13.944  5.657   -13.479 1.00 9.04  ?  243  ILE A N     1 
ATOM   851  C  CA    . ILE A 1 117 ? 13.558  7.041   -13.212 1.00 10.53 ?  243  ILE A CA    1 
ATOM   852  C  C     . ILE A 1 117 ? 12.041  7.216   -13.377 1.00 11.91 ?  243  ILE A C     1 
ATOM   853  O  O     . ILE A 1 117 ? 11.471  6.776   -14.367 1.00 10.64 ?  243  ILE A O     1 
ATOM   854  C  CB    . ILE A 1 117 ? 14.266  8.026   -14.167 1.00 12.74 ?  243  ILE A CB    1 
ATOM   855  C  CG1   . ILE A 1 117 ? 15.779  7.792   -14.122 1.00 12.35 ?  243  ILE A CG1   1 
ATOM   856  C  CG2   . ILE A 1 117 ? 13.874  9.497   -13.848 1.00 12.24 ?  243  ILE A CG2   1 
ATOM   857  C  CD1   . ILE A 1 117 ? 16.490  8.472   -15.281 1.00 17.24 ?  243  ILE A CD1   1 
ATOM   858  N  N     . PHE A 1 118 ? 11.403  7.861   -12.403 1.00 9.04  ?  244  PHE A N     1 
ATOM   859  C  CA    . PHE A 1 118 ? 9.978   8.180   -12.520 1.00 9.25  ?  244  PHE A CA    1 
ATOM   860  C  C     . PHE A 1 118 ? 9.775   9.147   -13.682 1.00 10.14 ?  244  PHE A C     1 
ATOM   861  O  O     . PHE A 1 118 ? 10.386  10.208  -13.714 1.00 12.84 ?  244  PHE A O     1 
ATOM   862  C  CB    . PHE A 1 118 ? 9.517   8.801   -11.195 1.00 10.88 ?  244  PHE A CB    1 
ATOM   863  C  CG    . PHE A 1 118 ? 8.084   9.250   -11.180 1.00 8.58  ?  244  PHE A CG    1 
ATOM   864  C  CD1   . PHE A 1 118 ? 7.053   8.309   -11.238 1.00 10.42 ?  244  PHE A CD1   1 
ATOM   865  C  CD2   . PHE A 1 118 ? 7.772   10.593  -11.046 1.00 9.98  ?  244  PHE A CD2   1 
ATOM   866  C  CE1   . PHE A 1 118 ? 5.731   8.719   -11.199 1.00 9.02  ?  244  PHE A CE1   1 
ATOM   867  C  CE2   . PHE A 1 118 ? 6.451   11.004  -10.984 1.00 12.64 ?  244  PHE A CE2   1 
ATOM   868  C  CZ    . PHE A 1 118 ? 5.428   10.058  -11.069 1.00 14.74 ?  244  PHE A CZ    1 
ATOM   869  N  N     . GLY A 1 119 ? 8.952   8.764   -14.656 1.00 7.20  ?  245  GLY A N     1 
ATOM   870  C  CA    . GLY A 1 119 ? 8.702   9.590   -15.820 1.00 9.45  ?  245  GLY A CA    1 
ATOM   871  C  C     . GLY A 1 119 ? 9.391   9.048   -17.066 1.00 6.93  ?  245  GLY A C     1 
ATOM   872  O  O     . GLY A 1 119 ? 9.140   9.510   -18.171 1.00 8.80  ?  245  GLY A O     1 
ATOM   873  N  N     . VAL A 1 120 ? 10.223  8.025   -16.881 1.00 7.37  ?  246  VAL A N     1 
ATOM   874  C  CA    . VAL A 1 120 ? 10.979  7.425   -17.969 1.00 7.53  ?  246  VAL A CA    1 
ATOM   875  C  C     . VAL A 1 120 ? 10.615  5.962   -18.190 1.00 9.77  ?  246  VAL A C     1 
ATOM   876  O  O     . VAL A 1 120 ? 10.810  5.148   -17.285 1.00 9.36  ?  246  VAL A O     1 
ATOM   877  C  CB    . VAL A 1 120 ? 12.490  7.516   -17.667 1.00 6.56  ?  246  VAL A CB    1 
ATOM   878  C  CG1   . VAL A 1 120 ? 13.324  6.930   -18.861 1.00 7.30  ?  246  VAL A CG1   1 
ATOM   879  C  CG2   . VAL A 1 120 ? 12.869  8.977   -17.409 1.00 8.88  ?  246  VAL A CG2   1 
ATOM   880  N  N     . GLY A 1 121 ? 10.116  5.621   -19.381 1.00 7.59  ?  247  GLY A N     1 
ATOM   881  C  CA    . GLY A 1 121 ? 9.824   4.241   -19.725 1.00 6.97  ?  247  GLY A CA    1 
ATOM   882  C  C     . GLY A 1 121 ? 10.842  3.676   -20.702 1.00 9.76  ?  247  GLY A C     1 
ATOM   883  O  O     . GLY A 1 121 ? 11.834  4.338   -21.010 1.00 10.31 ?  247  GLY A O     1 
ATOM   884  N  N     . VAL A 1 122 ? 10.617  2.455   -21.185 1.00 10.46 ?  248  VAL A N     1 
ATOM   885  C  CA    . VAL A 1 122 ? 11.570  1.825   -22.117 1.00 9.84  ?  248  VAL A CA    1 
ATOM   886  C  C     . VAL A 1 122 ? 11.814  2.681   -23.371 1.00 11.36 ?  248  VAL A C     1 
ATOM   887  O  O     . VAL A 1 122 ? 12.966  2.868   -23.786 1.00 9.57  ?  248  VAL A O     1 
ATOM   888  C  CB    . VAL A 1 122 ? 11.109  0.423   -22.526 1.00 7.40  ?  248  VAL A CB    1 
ATOM   889  C  CG1   . VAL A 1 122 ? 11.941  -0.128  -23.691 1.00 11.91 ?  248  VAL A CG1   1 
ATOM   890  C  CG2   . VAL A 1 122 ? 11.200  -0.521  -21.304 1.00 12.74 ?  248  VAL A CG2   1 
ATOM   891  N  N     . LYS A 1 123 ? 10.746  3.198   -23.970 1.00 11.79 ?  249  LYS A N     1 
ATOM   892  C  CA    . LYS A 1 123 ? 10.910  3.984   -25.203 1.00 12.89 ?  249  LYS A CA    1 
ATOM   893  C  C     . LYS A 1 123 ? 11.784  5.218   -25.024 1.00 12.68 ?  249  LYS A C     1 
ATOM   894  O  O     . LYS A 1 123 ? 12.649  5.496   -25.862 1.00 13.16 ?  249  LYS A O     1 
ATOM   895  C  CB    . LYS A 1 123 ? 9.552   4.346   -25.796 1.00 14.31 ?  249  LYS A CB    1 
ATOM   896  C  CG    . LYS A 1 123 ? 8.886   3.132   -26.421 1.00 20.71 ?  249  LYS A CG    1 
ATOM   897  C  CD    . LYS A 1 123 ? 7.583   3.453   -27.125 1.00 30.96 ?  249  LYS A CD    1 
ATOM   898  C  CE    . LYS A 1 123 ? 7.119   2.235   -27.928 1.00 28.35 ?  249  LYS A CE    1 
ATOM   899  N  NZ    . LYS A 1 123 ? 5.697   2.344   -28.355 1.00 42.97 ?  249  LYS A NZ    1 
ATOM   900  N  N     . THR A 1 124 ? 11.578  5.958   -23.939 1.00 9.88  ?  250  THR A N     1 
ATOM   901  C  CA    . THR A 1 124 ? 12.410  7.125   -23.682 1.00 9.00  ?  250  THR A CA    1 
ATOM   902  C  C     . THR A 1 124 ? 13.854  6.731   -23.385 1.00 12.00 ?  250  THR A C     1 
ATOM   903  O  O     . THR A 1 124 ? 14.797  7.288   -23.955 1.00 13.95 ?  250  THR A O     1 
ATOM   904  C  CB    . THR A 1 124 ? 11.839  7.913   -22.537 1.00 13.12 ?  250  THR A CB    1 
ATOM   905  O  OG1   . THR A 1 124 ? 10.525  8.344   -22.913 1.00 11.46 ?  250  THR A OG1   1 
ATOM   906  C  CG2   . THR A 1 124 ? 12.730  9.109   -22.259 1.00 10.17 ?  250  THR A CG2   1 
ATOM   907  N  N     . ALA A 1 125 ? 14.017  5.749   -22.502 1.00 9.49  ?  251  ALA A N     1 
ATOM   908  C  CA    . ALA A 1 125 ? 15.324  5.213   -22.154 1.00 10.64 ?  251  ALA A CA    1 
ATOM   909  C  C     . ALA A 1 125 ? 16.101  4.779   -23.391 1.00 13.28 ?  251  ALA A C     1 
ATOM   910  O  O     . ALA A 1 125 ? 17.271  5.099   -23.527 1.00 12.62 ?  251  ALA A O     1 
ATOM   911  C  CB    . ALA A 1 125 ? 15.150  4.022   -21.197 1.00 8.77  ?  251  ALA A CB    1 
ATOM   912  N  N     . ASP A 1 126 ? 15.446  4.026   -24.265 1.00 10.44 ?  252  ASP A N     1 
ATOM   913  C  CA    . ASP A 1 126 ? 16.076  3.539   -25.484 1.00 15.68 ?  252  ASP A CA    1 
ATOM   914  C  C     . ASP A 1 126 ? 16.531  4.687   -26.392 1.00 18.37 ?  252  ASP A C     1 
ATOM   915  O  O     . ASP A 1 126 ? 17.624  4.633   -26.958 1.00 13.68 ?  252  ASP A O     1 
ATOM   916  C  CB    . ASP A 1 126 ? 15.127  2.613   -26.219 1.00 12.28 ?  252  ASP A CB    1 
ATOM   917  C  CG    . ASP A 1 126 ? 15.684  2.137   -27.556 1.00 15.63 ?  252  ASP A CG    1 
ATOM   918  O  OD1   . ASP A 1 126 ? 16.694  1.404   -27.550 1.00 14.68 ?  252  ASP A OD1   1 
ATOM   919  O  OD2   . ASP A 1 126 ? 15.108  2.499   -28.607 1.00 21.42 ?  252  ASP A OD2   1 
ATOM   920  N  N     A ARG A 1 127 ? 15.692  5.712   -26.508 0.50 13.97 ?  253  ARG A N     1 
ATOM   921  N  N     B ARG A 1 127 ? 15.709  5.723   -26.527 0.50 14.00 ?  253  ARG A N     1 
ATOM   922  C  CA    A ARG A 1 127 ? 16.016  6.903   -27.295 0.50 14.60 ?  253  ARG A CA    1 
ATOM   923  C  CA    B ARG A 1 127 ? 16.115  6.870   -27.343 0.50 14.53 ?  253  ARG A CA    1 
ATOM   924  C  C     A ARG A 1 127 ? 17.275  7.594   -26.776 0.50 16.38 ?  253  ARG A C     1 
ATOM   925  C  C     B ARG A 1 127 ? 17.345  7.554   -26.770 0.50 16.47 ?  253  ARG A C     1 
ATOM   926  O  O     A ARG A 1 127 ? 18.180  7.911   -27.539 0.50 16.07 ?  253  ARG A O     1 
ATOM   927  O  O     B ARG A 1 127 ? 18.297  7.838   -27.491 0.50 15.91 ?  253  ARG A O     1 
ATOM   928  C  CB    A ARG A 1 127 ? 14.831  7.874   -27.281 0.50 16.09 ?  253  ARG A CB    1 
ATOM   929  C  CB    B ARG A 1 127 ? 14.998  7.900   -27.493 0.50 16.49 ?  253  ARG A CB    1 
ATOM   930  C  CG    A ARG A 1 127 ? 15.076  9.176   -28.017 0.50 24.24 ?  253  ARG A CG    1 
ATOM   931  C  CG    B ARG A 1 127 ? 15.447  9.087   -28.341 0.50 22.42 ?  253  ARG A CG    1 
ATOM   932  C  CD    A ARG A 1 127 ? 13.761  9.899   -28.315 0.50 23.41 ?  253  ARG A CD    1 
ATOM   933  C  CD    B ARG A 1 127 ? 14.351  10.118  -28.523 0.50 23.26 ?  253  ARG A CD    1 
ATOM   934  N  NE    A ARG A 1 127 ? 12.981  10.196  -27.111 0.50 17.48 ?  253  ARG A NE    1 
ATOM   935  N  NE    B ARG A 1 127 ? 14.042  10.833  -27.286 0.50 15.00 ?  253  ARG A NE    1 
ATOM   936  C  CZ    A ARG A 1 127 ? 13.274  11.167  -26.248 0.50 23.77 ?  253  ARG A CZ    1 
ATOM   937  C  CZ    B ARG A 1 127 ? 12.919  10.665  -26.591 0.50 18.53 ?  253  ARG A CZ    1 
ATOM   938  N  NH1   A ARG A 1 127 ? 14.345  11.930  -26.436 0.50 31.30 ?  253  ARG A NH1   1 
ATOM   939  N  NH1   B ARG A 1 127 ? 12.009  9.794   -27.004 0.50 19.62 ?  253  ARG A NH1   1 
ATOM   940  N  NH2   A ARG A 1 127 ? 12.507  11.368  -25.183 0.50 19.34 ?  253  ARG A NH2   1 
ATOM   941  N  NH2   B ARG A 1 127 ? 12.707  11.363  -25.481 0.50 19.99 ?  253  ARG A NH2   1 
ATOM   942  N  N     . TRP A 1 128 ? 17.327  7.823   -25.468 1.00 12.13 ?  254  TRP A N     1 
ATOM   943  C  CA    . TRP A 1 128 ? 18.501  8.374   -24.812 1.00 13.39 ?  254  TRP A CA    1 
ATOM   944  C  C     . TRP A 1 128 ? 19.743  7.496   -24.977 1.00 17.52 ?  254  TRP A C     1 
ATOM   945  O  O     . TRP A 1 128 ? 20.855  8.013   -25.176 1.00 16.48 ?  254  TRP A O     1 
ATOM   946  C  CB    . TRP A 1 128 ? 18.213  8.609   -23.331 1.00 13.68 ?  254  TRP A CB    1 
ATOM   947  C  CG    . TRP A 1 128 ? 17.250  9.716   -23.101 1.00 14.53 ?  254  TRP A CG    1 
ATOM   948  C  CD1   . TRP A 1 128 ? 16.865  10.687  -23.990 1.00 15.17 ?  254  TRP A CD1   1 
ATOM   949  C  CD2   . TRP A 1 128 ? 16.526  9.968   -21.892 1.00 14.23 ?  254  TRP A CD2   1 
ATOM   950  N  NE1   . TRP A 1 128 ? 15.955  11.527  -23.401 1.00 14.44 ?  254  TRP A NE1   1 
ATOM   951  C  CE2   . TRP A 1 128 ? 15.735  11.116  -22.109 1.00 14.63 ?  254  TRP A CE2   1 
ATOM   952  C  CE3   . TRP A 1 128 ? 16.487  9.337   -20.643 1.00 11.45 ?  254  TRP A CE3   1 
ATOM   953  C  CZ2   . TRP A 1 128 ? 14.884  11.645  -21.120 1.00 14.04 ?  254  TRP A CZ2   1 
ATOM   954  C  CZ3   . TRP A 1 128 ? 15.646  9.862   -19.650 1.00 14.71 ?  254  TRP A CZ3   1 
ATOM   955  C  CH2   . TRP A 1 128 ? 14.868  11.015  -19.899 1.00 11.94 ?  254  TRP A CH2   1 
ATOM   956  N  N     . TYR A 1 129 ? 19.561  6.178   -24.871 1.00 12.26 ?  255  TYR A N     1 
ATOM   957  C  CA    . TYR A 1 129 ? 20.672  5.244   -25.015 1.00 12.28 ?  255  TYR A CA    1 
ATOM   958  C  C     . TYR A 1 129 ? 21.257  5.389   -26.409 1.00 20.53 ?  255  TYR A C     1 
ATOM   959  O  O     . TYR A 1 129 ? 22.478  5.434   -26.573 1.00 18.48 ?  255  TYR A O     1 
ATOM   960  C  CB    . TYR A 1 129 ? 20.215  3.783   -24.833 1.00 13.25 ?  255  TYR A CB    1 
ATOM   961  C  CG    . TYR A 1 129 ? 21.395  2.831   -24.789 1.00 14.21 ?  255  TYR A CG    1 
ATOM   962  C  CD1   . TYR A 1 129 ? 22.077  2.612   -23.602 1.00 11.90 ?  255  TYR A CD1   1 
ATOM   963  C  CD2   . TYR A 1 129 ? 21.840  2.179   -25.942 1.00 18.23 ?  255  TYR A CD2   1 
ATOM   964  C  CE1   . TYR A 1 129 ? 23.171  1.757   -23.546 1.00 20.17 ?  255  TYR A CE1   1 
ATOM   965  C  CE2   . TYR A 1 129 ? 22.935  1.329   -25.896 1.00 15.96 ?  255  TYR A CE2   1 
ATOM   966  C  CZ    . TYR A 1 129 ? 23.588  1.128   -24.703 1.00 20.85 ?  255  TYR A CZ    1 
ATOM   967  O  OH    . TYR A 1 129 ? 24.666  0.278   -24.657 1.00 21.34 ?  255  TYR A OH    1 
ATOM   968  N  N     . ARG A 1 130 ? 20.370  5.448   -27.401 1.00 15.03 ?  256  ARG A N     1 
ATOM   969  C  CA    . ARG A 1 130 ? 20.794  5.542   -28.807 1.00 20.76 ?  256  ARG A CA    1 
ATOM   970  C  C     . ARG A 1 130 ? 21.480  6.871   -29.098 1.00 26.56 ?  256  ARG A C     1 
ATOM   971  O  O     . ARG A 1 130 ? 22.283  6.980   -30.027 1.00 26.86 ?  256  ARG A O     1 
ATOM   972  C  CB    . ARG A 1 130 ? 19.600  5.346   -29.750 1.00 17.68 ?  256  ARG A CB    1 
ATOM   973  C  CG    . ARG A 1 130 ? 19.098  3.923   -29.804 1.00 20.09 ?  256  ARG A CG    1 
ATOM   974  C  CD    . ARG A 1 130 ? 17.986  3.759   -30.878 1.00 28.38 ?  256  ARG A CD    1 
ATOM   975  N  NE    . ARG A 1 130 ? 16.647  4.128   -30.417 1.00 30.44 ?  256  ARG A NE    1 
ATOM   976  C  CZ    . ARG A 1 130 ? 15.976  5.218   -30.792 1.00 36.62 ?  256  ARG A CZ    1 
ATOM   977  N  NH1   . ARG A 1 130 ? 16.507  6.080   -31.658 1.00 34.94 ?  256  ARG A NH1   1 
ATOM   978  N  NH2   . ARG A 1 130 ? 14.760  5.447   -30.301 1.00 41.98 ?  256  ARG A NH2   1 
ATOM   979  N  N     . GLU A 1 131 ? 21.155  7.890   -28.312 1.00 21.11 ?  257  GLU A N     1 
ATOM   980  C  CA    . GLU A 1 131 ? 21.784  9.200   -28.463 1.00 25.89 ?  257  GLU A CA    1 
ATOM   981  C  C     . GLU A 1 131 ? 23.138  9.240   -27.764 1.00 23.56 ?  257  GLU A C     1 
ATOM   982  O  O     . GLU A 1 131 ? 23.855  10.237  -27.831 1.00 32.75 ?  257  GLU A O     1 
ATOM   983  C  CB    . GLU A 1 131 ? 20.866  10.297  -27.918 1.00 19.67 ?  257  GLU A CB    1 
ATOM   984  C  CG    . GLU A 1 131 ? 19.623  10.491  -28.756 1.00 21.68 ?  257  GLU A CG    1 
ATOM   985  C  CD    . GLU A 1 131 ? 18.603  11.445  -28.138 1.00 33.71 ?  257  GLU A CD    1 
ATOM   986  O  OE1   . GLU A 1 131 ? 18.828  11.946  -27.020 1.00 28.94 ?  257  GLU A OE1   1 
ATOM   987  O  OE2   . GLU A 1 131 ? 17.564  11.696  -28.785 1.00 37.95 ?  257  GLU A OE2   1 
ATOM   988  N  N     . GLY A 1 132 ? 23.471  8.164   -27.065 1.00 17.56 ?  258  GLY A N     1 
ATOM   989  C  CA    . GLY A 1 132 ? 24.758  8.046   -26.427 1.00 16.33 ?  258  GLY A CA    1 
ATOM   990  C  C     . GLY A 1 132 ? 24.766  8.377   -24.955 1.00 24.10 ?  258  GLY A C     1 
ATOM   991  O  O     . GLY A 1 132 ? 25.822  8.343   -24.348 1.00 18.67 ?  258  GLY A O     1 
ATOM   992  N  N     . LEU A 1 133 ? 23.602  8.669   -24.365 1.00 14.80 ?  259  LEU A N     1 
ATOM   993  C  CA    . LEU A 1 133 ? 23.564  9.005   -22.948 1.00 16.02 ?  259  LEU A CA    1 
ATOM   994  C  C     . LEU A 1 133 ? 23.678  7.726   -22.122 1.00 14.25 ?  259  LEU A C     1 
ATOM   995  O  O     . LEU A 1 133 ? 23.197  6.678   -22.552 1.00 16.17 ?  259  LEU A O     1 
ATOM   996  C  CB    . LEU A 1 133 ? 22.263  9.745   -22.624 1.00 13.48 ?  259  LEU A CB    1 
ATOM   997  C  CG    . LEU A 1 133 ? 22.086  11.075  -23.387 1.00 18.84 ?  259  LEU A CG    1 
ATOM   998  C  CD1   . LEU A 1 133 ? 20.688  11.601  -23.213 1.00 23.19 ?  259  LEU A CD1   1 
ATOM   999  C  CD2   . LEU A 1 133 ? 23.095  12.105  -22.912 1.00 29.97 ?  259  LEU A CD2   1 
ATOM   1000 N  N     . ARG A 1 134 ? 24.323  7.817   -20.960 1.00 14.89 ?  260  ARG A N     1 
ATOM   1001 C  CA    . ARG A 1 134 ? 24.648  6.633   -20.161 1.00 14.14 ?  260  ARG A CA    1 
ATOM   1002 C  C     . ARG A 1 134 ? 24.409  6.794   -18.653 1.00 16.33 ?  260  ARG A C     1 
ATOM   1003 O  O     . ARG A 1 134 ? 24.158  5.809   -17.970 1.00 18.72 ?  260  ARG A O     1 
ATOM   1004 C  CB    . ARG A 1 134 ? 26.105  6.181   -20.401 1.00 17.92 ?  260  ARG A CB    1 
ATOM   1005 C  CG    . ARG A 1 134 ? 26.400  5.694   -21.822 1.00 16.53 ?  260  ARG A CG    1 
ATOM   1006 C  CD    . ARG A 1 134 ? 25.674  4.420   -22.147 1.00 21.28 ?  260  ARG A CD    1 
ATOM   1007 N  NE    . ARG A 1 134 ? 26.036  3.878   -23.455 1.00 16.96 ?  260  ARG A NE    1 
ATOM   1008 C  CZ    . ARG A 1 134 ? 25.427  4.190   -24.592 1.00 14.52 ?  260  ARG A CZ    1 
ATOM   1009 N  NH1   . ARG A 1 134 ? 24.412  5.041   -24.606 1.00 17.84 ?  260  ARG A NH1   1 
ATOM   1010 N  NH2   . ARG A 1 134 ? 25.811  3.633   -25.728 1.00 17.75 ?  260  ARG A NH2   1 
ATOM   1011 N  N     . THR A 1 135 ? 24.511  8.018   -18.136 1.00 16.20 ?  261  THR A N     1 
ATOM   1012 C  CA    . THR A 1 135 ? 24.474  8.242   -16.699 1.00 16.50 ?  261  THR A CA    1 
ATOM   1013 C  C     . THR A 1 135 ? 23.422  9.272   -16.317 1.00 10.51 ?  261  THR A C     1 
ATOM   1014 O  O     . THR A 1 135 ? 22.932  10.013  -17.165 1.00 16.40 ?  261  THR A O     1 
ATOM   1015 C  CB    . THR A 1 135 ? 25.830  8.763   -16.194 1.00 21.30 ?  261  THR A CB    1 
ATOM   1016 O  OG1   . THR A 1 135 ? 26.036  10.080  -16.713 1.00 19.86 ?  261  THR A OG1   1 
ATOM   1017 C  CG2   . THR A 1 135 ? 26.953  7.860   -16.659 1.00 22.41 ?  261  THR A CG2   1 
ATOM   1018 N  N     . LEU A 1 136 ? 23.066  9.317   -15.038 1.00 14.15 ?  262  LEU A N     1 
ATOM   1019 C  CA    . LEU A 1 136 ? 22.094  10.301  -14.598 1.00 17.12 ?  262  LEU A CA    1 
ATOM   1020 C  C     . LEU A 1 136 ? 22.650  11.710  -14.797 1.00 16.42 ?  262  LEU A C     1 
ATOM   1021 O  O     . LEU A 1 136 ? 21.915  12.618  -15.185 1.00 18.17 ?  262  LEU A O     1 
ATOM   1022 C  CB    . LEU A 1 136 ? 21.685  10.061  -13.144 1.00 17.16 ?  262  LEU A CB    1 
ATOM   1023 C  CG    . LEU A 1 136 ? 21.041  8.702   -12.824 1.00 20.34 ?  262  LEU A CG    1 
ATOM   1024 C  CD1   . LEU A 1 136 ? 20.612  8.692   -11.346 1.00 21.78 ?  262  LEU A CD1   1 
ATOM   1025 C  CD2   . LEU A 1 136 ? 19.867  8.412   -13.740 1.00 14.25 ?  262  LEU A CD2   1 
ATOM   1026 N  N     . ASP A 1 137 ? 23.949  11.881  -14.573 1.00 23.82 ?  263  ASP A N     1 
ATOM   1027 C  CA    . ASP A 1 137 ? 24.559  13.200  -14.805 1.00 20.66 ?  263  ASP A CA    1 
ATOM   1028 C  C     . ASP A 1 137 ? 24.524  13.617  -16.289 1.00 17.07 ?  263  ASP A C     1 
ATOM   1029 O  O     . ASP A 1 137 ? 24.392  14.804  -16.601 1.00 22.46 ?  263  ASP A O     1 
ATOM   1030 C  CB    . ASP A 1 137 ? 25.965  13.278  -14.195 1.00 24.73 ?  263  ASP A CB    1 
ATOM   1031 C  CG    . ASP A 1 137 ? 25.937  13.427  -12.666 1.00 37.18 ?  263  ASP A CG    1 
ATOM   1032 O  OD1   . ASP A 1 137 ? 24.857  13.747  -12.100 1.00 39.20 ?  263  ASP A OD1   1 
ATOM   1033 O  OD2   . ASP A 1 137 ? 26.993  13.225  -12.024 1.00 45.05 ?  263  ASP A OD2   1 
ATOM   1034 N  N     . ASP A 1 138 ? 24.600  12.645  -17.199 1.00 16.85 ?  264  ASP A N     1 
ATOM   1035 C  CA    . ASP A 1 138 ? 24.346  12.907  -18.615 1.00 14.08 ?  264  ASP A CA    1 
ATOM   1036 C  C     . ASP A 1 138 ? 22.976  13.541  -18.829 1.00 25.49 ?  264  ASP A C     1 
ATOM   1037 O  O     . ASP A 1 138 ? 22.821  14.437  -19.660 1.00 23.80 ?  264  ASP A O     1 
ATOM   1038 C  CB    . ASP A 1 138 ? 24.434  11.627  -19.441 1.00 18.43 ?  264  ASP A CB    1 
ATOM   1039 C  CG    . ASP A 1 138 ? 25.854  11.116  -19.577 1.00 28.26 ?  264  ASP A CG    1 
ATOM   1040 O  OD1   . ASP A 1 138 ? 26.811  11.903  -19.381 1.00 27.47 ?  264  ASP A OD1   1 
ATOM   1041 O  OD2   . ASP A 1 138 ? 26.011  9.924   -19.893 1.00 21.12 ?  264  ASP A OD2   1 
ATOM   1042 N  N     . LEU A 1 139 ? 21.974  13.060  -18.096 1.00 17.68 ?  265  LEU A N     1 
ATOM   1043 C  CA    . LEU A 1 139 ? 20.608  13.560  -18.280 1.00 18.61 ?  265  LEU A CA    1 
ATOM   1044 C  C     . LEU A 1 139 ? 20.473  14.930  -17.648 1.00 16.63 ?  265  LEU A C     1 
ATOM   1045 O  O     . LEU A 1 139 ? 19.795  15.808  -18.177 1.00 23.74 ?  265  LEU A O     1 
ATOM   1046 C  CB    . LEU A 1 139 ? 19.575  12.588  -17.673 1.00 15.09 ?  265  LEU A CB    1 
ATOM   1047 C  CG    . LEU A 1 139 ? 19.570  11.216  -18.318 1.00 14.08 ?  265  LEU A CG    1 
ATOM   1048 C  CD1   . LEU A 1 139 ? 18.584  10.320  -17.556 1.00 15.40 ?  265  LEU A CD1   1 
ATOM   1049 C  CD2   . LEU A 1 139 ? 19.215  11.294  -19.786 1.00 17.02 ?  265  LEU A CD2   1 
ATOM   1050 N  N     . ARG A 1 140 ? 21.132  15.108  -16.514 1.00 20.48 ?  266  ARG A N     1 
ATOM   1051 C  CA    . ARG A 1 140 ? 21.063  16.368  -15.796 1.00 26.10 ?  266  ARG A CA    1 
ATOM   1052 C  C     . ARG A 1 140 ? 21.681  17.493  -16.628 1.00 32.44 ?  266  ARG A C     1 
ATOM   1053 O  O     . ARG A 1 140 ? 21.144  18.604  -16.681 1.00 31.10 ?  266  ARG A O     1 
ATOM   1054 C  CB    . ARG A 1 140 ? 21.735  16.226  -14.434 1.00 20.37 ?  266  ARG A CB    1 
ATOM   1055 C  CG    . ARG A 1 140 ? 20.918  15.331  -13.487 1.00 26.14 ?  266  ARG A CG    1 
ATOM   1056 C  CD    . ARG A 1 140 ? 21.614  15.038  -12.170 1.00 26.22 ?  266  ARG A CD    1 
ATOM   1057 N  NE    . ARG A 1 140 ? 20.672  14.438  -11.220 1.00 32.12 ?  266  ARG A NE    1 
ATOM   1058 C  CZ    . ARG A 1 140 ? 20.953  13.395  -10.442 1.00 31.55 ?  266  ARG A CZ    1 
ATOM   1059 N  NH1   . ARG A 1 140 ? 22.147  12.822  -10.506 1.00 21.49 ?  266  ARG A NH1   1 
ATOM   1060 N  NH2   . ARG A 1 140 ? 20.038  12.909  -9.610  1.00 21.50 ?  266  ARG A NH2   1 
ATOM   1061 N  N     . GLU A 1 141 ? 22.769  17.177  -17.326 1.00 23.53 ?  267  GLU A N     1 
ATOM   1062 C  CA    . GLU A 1 141 ? 23.450  18.151  -18.188 1.00 34.92 ?  267  GLU A CA    1 
ATOM   1063 C  C     . GLU A 1 141 ? 22.598  18.593  -19.377 1.00 40.83 ?  267  GLU A C     1 
ATOM   1064 O  O     . GLU A 1 141 ? 22.927  19.569  -20.051 1.00 38.63 ?  267  GLU A O     1 
ATOM   1065 C  CB    . GLU A 1 141 ? 24.781  17.585  -18.707 1.00 25.94 ?  267  GLU A CB    1 
ATOM   1066 C  CG    . GLU A 1 141 ? 25.847  17.379  -17.638 1.00 40.16 ?  267  GLU A CG    1 
ATOM   1067 N  N     . GLN A 1 142 ? 21.506  17.880  -19.640 1.00 29.49 ?  268  GLN A N     1 
ATOM   1068 C  CA    . GLN A 1 142 ? 20.656  18.195  -20.788 1.00 32.91 ?  268  GLN A CA    1 
ATOM   1069 C  C     . GLN A 1 142 ? 19.178  18.390  -20.416 1.00 35.98 ?  268  GLN A C     1 
ATOM   1070 O  O     . GLN A 1 142 ? 18.310  17.704  -20.959 1.00 32.79 ?  268  GLN A O     1 
ATOM   1071 C  CB    . GLN A 1 142 ? 20.797  17.102  -21.853 1.00 35.80 ?  268  GLN A CB    1 
ATOM   1072 N  N     . PRO A 1 143 ? 18.881  19.359  -19.526 1.00 31.59 ?  269  PRO A N     1 
ATOM   1073 C  CA    . PRO A 1 143 ? 17.538  19.504  -18.945 1.00 27.71 ?  269  PRO A CA    1 
ATOM   1074 C  C     . PRO A 1 143 ? 16.482  19.852  -19.986 1.00 39.55 ?  269  PRO A C     1 
ATOM   1075 O  O     . PRO A 1 143 ? 15.292  19.723  -19.711 1.00 38.56 ?  269  PRO A O     1 
ATOM   1076 C  CB    . PRO A 1 143 ? 17.711  20.657  -17.964 1.00 42.63 ?  269  PRO A CB    1 
ATOM   1077 C  CG    . PRO A 1 143 ? 18.790  21.491  -18.580 1.00 32.82 ?  269  PRO A CG    1 
ATOM   1078 C  CD    . PRO A 1 143 ? 19.740  20.514  -19.207 1.00 39.97 ?  269  PRO A CD    1 
ATOM   1079 N  N     . GLN A 1 144 ? 16.916  20.272  -21.170 1.00 41.77 ?  270  GLN A N     1 
ATOM   1080 C  CA    . GLN A 1 144 ? 15.999  20.571  -22.263 1.00 43.58 ?  270  GLN A CA    1 
ATOM   1081 C  C     . GLN A 1 144 ? 15.380  19.280  -22.787 1.00 34.58 ?  270  GLN A C     1 
ATOM   1082 O  O     . GLN A 1 144 ? 14.359  19.294  -23.474 1.00 39.41 ?  270  GLN A O     1 
ATOM   1083 C  CB    . GLN A 1 144 ? 16.737  21.294  -23.397 1.00 38.52 ?  270  GLN A CB    1 
ATOM   1084 N  N     . LYS A 1 145 ? 16.012  18.158  -22.473 1.00 26.84 ?  271  LYS A N     1 
ATOM   1085 C  CA    . LYS A 1 145 ? 15.516  16.885  -22.940 1.00 21.58 ?  271  LYS A CA    1 
ATOM   1086 C  C     . LYS A 1 145 ? 14.440  16.332  -22.004 1.00 24.41 ?  271  LYS A C     1 
ATOM   1087 O  O     . LYS A 1 145 ? 13.905  15.257  -22.268 1.00 27.22 ?  271  LYS A O     1 
ATOM   1088 C  CB    . LYS A 1 145 ? 16.664  15.874  -23.055 1.00 32.08 ?  271  LYS A CB    1 
ATOM   1089 N  N     . LEU A 1 146 ? 14.126  17.042  -20.918 1.00 18.34 ?  272  LEU A N     1 
ATOM   1090 C  CA    . LEU A 1 146 ? 13.297  16.429  -19.861 1.00 18.87 ?  272  LEU A CA    1 
ATOM   1091 C  C     . LEU A 1 146 ? 11.944  17.057  -19.652 1.00 21.10 ?  272  LEU A C     1 
ATOM   1092 O  O     . LEU A 1 146 ? 11.807  18.272  -19.654 1.00 22.36 ?  272  LEU A O     1 
ATOM   1093 C  CB    . LEU A 1 146 ? 14.013  16.478  -18.511 1.00 19.03 ?  272  LEU A CB    1 
ATOM   1094 C  CG    . LEU A 1 146 ? 15.440  15.971  -18.540 1.00 21.46 ?  272  LEU A CG    1 
ATOM   1095 C  CD1   . LEU A 1 146 ? 16.144  16.348  -17.248 1.00 26.78 ?  272  LEU A CD1   1 
ATOM   1096 C  CD2   . LEU A 1 146 ? 15.432  14.459  -18.758 1.00 20.58 ?  272  LEU A CD2   1 
ATOM   1097 N  N     . THR A 1 147 ? 10.950  16.214  -19.393 1.00 15.52 ?  273  THR A N     1 
ATOM   1098 C  CA    . THR A 1 147 ? 9.653   16.697  -18.985 1.00 15.92 ?  273  THR A CA    1 
ATOM   1099 C  C     . THR A 1 147 ? 9.713   17.089  -17.523 1.00 14.56 ?  273  THR A C     1 
ATOM   1100 O  O     . THR A 1 147 ? 10.634  16.710  -16.828 1.00 13.43 ?  273  THR A O     1 
ATOM   1101 C  CB    . THR A 1 147 ? 8.601   15.634  -19.167 1.00 14.81 ?  273  THR A CB    1 
ATOM   1102 O  OG1   . THR A 1 147 ? 8.828   14.540  -18.258 1.00 13.82 ?  273  THR A OG1   1 
ATOM   1103 C  CG2   . THR A 1 147 ? 8.640   15.119  -20.595 1.00 17.93 ?  273  THR A CG2   1 
ATOM   1104 N  N     . GLN A 1 148 ? 8.740   17.860  -17.060 1.00 15.34 ?  274  GLN A N     1 
ATOM   1105 C  CA    . GLN A 1 148 ? 8.721   18.263  -15.658 1.00 15.23 ?  274  GLN A CA    1 
ATOM   1106 C  C     . GLN A 1 148 ? 8.623   17.025  -14.769 1.00 12.91 ?  274  GLN A C     1 
ATOM   1107 O  O     . GLN A 1 148 ? 9.193   16.986  -13.686 1.00 14.66 ?  274  GLN A O     1 
ATOM   1108 C  CB    . GLN A 1 148 ? 7.571   19.235  -15.399 1.00 24.16 ?  274  GLN A CB    1 
ATOM   1109 C  CG    . GLN A 1 148 ? 7.801   20.604  -16.047 1.00 29.79 ?  274  GLN A CG    1 
ATOM   1110 C  CD    . GLN A 1 148 ? 9.087   21.262  -15.577 1.00 41.85 ?  274  GLN A CD    1 
ATOM   1111 O  OE1   . GLN A 1 148 ? 9.992   21.542  -16.376 1.00 41.59 ?  274  GLN A OE1   1 
ATOM   1112 N  NE2   . GLN A 1 148 ? 9.180   21.507  -14.273 1.00 45.35 ?  274  GLN A NE2   1 
ATOM   1113 N  N     . GLN A 1 149 ? 7.910   16.011  -15.239 1.00 10.64 ?  275  GLN A N     1 
ATOM   1114 C  CA    . GLN A 1 149 ? 7.783   14.766  -14.475 1.00 11.46 ?  275  GLN A CA    1 
ATOM   1115 C  C     . GLN A 1 149 ? 9.142   14.089  -14.352 1.00 15.09 ?  275  GLN A C     1 
ATOM   1116 O  O     . GLN A 1 149 ? 9.518   13.623  -13.267 1.00 12.63 ?  275  GLN A O     1 
ATOM   1117 C  CB    . GLN A 1 149 ? 6.813   13.813  -15.154 1.00 10.35 ?  275  GLN A CB    1 
ATOM   1118 C  CG    . GLN A 1 149 ? 6.550   12.533  -14.378 1.00 11.07 ?  275  GLN A CG    1 
ATOM   1119 C  CD    . GLN A 1 149 ? 5.611   11.585  -15.147 1.00 11.96 ?  275  GLN A CD    1 
ATOM   1120 O  OE1   . GLN A 1 149 ? 5.785   11.363  -16.349 1.00 18.90 ?  275  GLN A OE1   1 
ATOM   1121 N  NE2   . GLN A 1 149 ? 4.605   11.051  -14.468 1.00 16.56 ?  275  GLN A NE2   1 
ATOM   1122 N  N     . GLN A 1 150 ? 9.867   14.020  -15.466 1.00 12.43 ?  276  GLN A N     1 
ATOM   1123 C  CA    . GLN A 1 150 ? 11.203  13.435  -15.461 1.00 9.54  ?  276  GLN A CA    1 
ATOM   1124 C  C     . GLN A 1 150 ? 12.173  14.255  -14.624 1.00 11.60 ?  276  GLN A C     1 
ATOM   1125 O  O     . GLN A 1 150 ? 13.049  13.702  -13.961 1.00 10.44 ?  276  GLN A O     1 
ATOM   1126 C  CB    . GLN A 1 150 ? 11.728  13.302  -16.894 1.00 8.30  ?  276  GLN A CB    1 
ATOM   1127 C  CG    . GLN A 1 150 ? 11.018  12.179  -17.698 1.00 7.61  ?  276  GLN A CG    1 
ATOM   1128 C  CD    . GLN A 1 150 ? 11.106  12.349  -19.204 1.00 10.84 ?  276  GLN A CD    1 
ATOM   1129 O  OE1   . GLN A 1 150 ? 11.709  13.305  -19.701 1.00 14.23 ?  276  GLN A OE1   1 
ATOM   1130 N  NE2   . GLN A 1 150 ? 10.484  11.439  -19.941 1.00 10.11 ?  276  GLN A NE2   1 
ATOM   1131 N  N     . LYS A 1 151 ? 12.057  15.580  -14.678 1.00 9.19  ?  277  LYS A N     1 
ATOM   1132 C  CA    . LYS A 1 151 ? 12.927  16.418  -13.848 1.00 12.70 ?  277  LYS A CA    1 
ATOM   1133 C  C     . LYS A 1 151 ? 12.732  16.078  -12.365 1.00 8.86  ?  277  LYS A C     1 
ATOM   1134 O  O     . LYS A 1 151 ? 13.709  15.985  -11.607 1.00 11.43 ?  277  LYS A O     1 
ATOM   1135 C  CB    . LYS A 1 151 ? 12.639  17.908  -14.093 1.00 13.07 ?  277  LYS A CB    1 
ATOM   1136 C  CG    . LYS A 1 151 ? 13.155  18.429  -15.439 1.00 21.97 ?  277  LYS A CG    1 
ATOM   1137 C  CD    . LYS A 1 151 ? 12.740  19.885  -15.704 1.00 21.23 ?  277  LYS A CD    1 
ATOM   1138 C  CE    . LYS A 1 151 ? 13.244  20.358  -17.081 1.00 31.00 ?  277  LYS A CE    1 
ATOM   1139 N  NZ    . LYS A 1 151 ? 13.090  21.832  -17.279 1.00 41.19 ?  277  LYS A NZ    1 
ATOM   1140 N  N     . ALA A 1 152 ? 11.475  15.916  -11.941 1.00 11.28 ?  278  ALA A N     1 
ATOM   1141 C  CA    . ALA A 1 152 ? 11.178  15.535  -10.548 1.00 10.44 ?  278  ALA A CA    1 
ATOM   1142 C  C     . ALA A 1 152 ? 11.697  14.127  -10.241 1.00 10.97 ?  278  ALA A C     1 
ATOM   1143 O  O     . ALA A 1 152 ? 12.291  13.871  -9.180  1.00 9.81  ?  278  ALA A O     1 
ATOM   1144 C  CB    . ALA A 1 152 ? 9.709   15.602  -10.280 1.00 11.92 ?  278  ALA A CB    1 
ATOM   1145 N  N     . GLY A 1 153 ? 11.488  13.208  -11.174 1.00 8.46  ?  279  GLY A N     1 
ATOM   1146 C  CA    . GLY A 1 153 ? 12.012  11.860  -11.015 1.00 10.23 ?  279  GLY A CA    1 
ATOM   1147 C  C     . GLY A 1 153 ? 13.525  11.845  -10.855 1.00 7.87  ?  279  GLY A C     1 
ATOM   1148 O  O     . GLY A 1 153 ? 14.070  11.057  -10.057 1.00 10.91 ?  279  GLY A O     1 
ATOM   1149 N  N     . LEU A 1 154 ? 14.219  12.708  -11.601 1.00 7.86  ?  280  LEU A N     1 
ATOM   1150 C  CA    . LEU A 1 154 ? 15.669  12.748  -11.553 1.00 9.28  ?  280  LEU A CA    1 
ATOM   1151 C  C     . LEU A 1 154 ? 16.183  13.427  -10.284 1.00 7.19  ?  280  LEU A C     1 
ATOM   1152 O  O     . LEU A 1 154 ? 17.114  12.938  -9.641  1.00 10.25 ?  280  LEU A O     1 
ATOM   1153 C  CB    . LEU A 1 154 ? 16.184  13.419  -12.828 1.00 12.31 ?  280  LEU A CB    1 
ATOM   1154 C  CG    . LEU A 1 154 ? 17.649  13.322  -13.238 1.00 25.12 ?  280  LEU A CG    1 
ATOM   1155 C  CD1   . LEU A 1 154 ? 18.119  11.871  -13.238 1.00 19.85 ?  280  LEU A CD1   1 
ATOM   1156 C  CD2   . LEU A 1 154 ? 17.813  13.943  -14.640 1.00 27.09 ?  280  LEU A CD2   1 
ATOM   1157 N  N     . GLN A 1 155 ? 15.548  14.537  -9.894  1.00 9.27  ?  281  GLN A N     1 
ATOM   1158 C  CA    . GLN A 1 155 ? 15.940  15.215  -8.656  1.00 10.53 ?  281  GLN A CA    1 
ATOM   1159 C  C     . GLN A 1 155 ? 15.770  14.318  -7.442  1.00 7.81  ?  281  GLN A C     1 
ATOM   1160 O  O     . GLN A 1 155 ? 16.628  14.262  -6.530  1.00 9.34  ?  281  GLN A O     1 
ATOM   1161 C  CB    . GLN A 1 155 ? 15.095  16.478  -8.433  1.00 13.33 ?  281  GLN A CB    1 
ATOM   1162 C  CG    . GLN A 1 155 ? 15.513  17.659  -9.287  1.00 17.32 ?  281  GLN A CG    1 
ATOM   1163 C  CD    . GLN A 1 155 ? 14.385  18.660  -9.438  1.00 24.53 ?  281  GLN A CD    1 
ATOM   1164 O  OE1   . GLN A 1 155 ? 13.197  18.289  -9.446  1.00 26.54 ?  281  GLN A OE1   1 
ATOM   1165 N  NE2   . GLN A 1 155 ? 14.740  19.939  -9.545  1.00 37.52 ?  281  GLN A NE2   1 
ATOM   1166 N  N     . HIS A 1 156 ? 14.677  13.550  -7.436  1.00 7.19  ?  282  HIS A N     1 
ATOM   1167 C  CA    . HIS A 1 156 ? 14.380  12.722  -6.282  1.00 6.29  ?  282  HIS A CA    1 
ATOM   1168 C  C     . HIS A 1 156 ? 14.864  11.282  -6.413  1.00 8.54  ?  282  HIS A C     1 
ATOM   1169 O  O     . HIS A 1 156 ? 14.536  10.444  -5.576  1.00 9.02  ?  282  HIS A O     1 
ATOM   1170 C  CB    . HIS A 1 156 ? 12.872  12.731  -6.005  1.00 8.17  ?  282  HIS A CB    1 
ATOM   1171 C  CG    . HIS A 1 156 ? 12.352  14.063  -5.564  1.00 5.23  ?  282  HIS A CG    1 
ATOM   1172 N  ND1   . HIS A 1 156 ? 12.742  14.655  -4.379  1.00 8.28  ?  282  HIS A ND1   1 
ATOM   1173 C  CD2   . HIS A 1 156 ? 11.523  14.938  -6.174  1.00 8.56  ?  282  HIS A CD2   1 
ATOM   1174 C  CE1   . HIS A 1 156 ? 12.120  15.811  -4.253  1.00 8.36  ?  282  HIS A CE1   1 
ATOM   1175 N  NE2   . HIS A 1 156 ? 11.377  16.009  -5.330  1.00 8.45  ?  282  HIS A NE2   1 
ATOM   1176 N  N     . HIS A 1 157 ? 15.631  10.998  -7.456  1.00 7.06  ?  283  HIS A N     1 
ATOM   1177 C  CA    . HIS A 1 157 ? 16.000  9.607   -7.762  1.00 9.44  ?  283  HIS A CA    1 
ATOM   1178 C  C     . HIS A 1 157 ? 16.670  8.874   -6.600  1.00 7.95  ?  283  HIS A C     1 
ATOM   1179 O  O     . HIS A 1 157 ? 16.353  7.709   -6.338  1.00 7.48  ?  283  HIS A O     1 
ATOM   1180 C  CB    . HIS A 1 157 ? 16.876  9.557   -9.015  1.00 10.57 ?  283  HIS A CB    1 
ATOM   1181 C  CG    . HIS A 1 157 ? 17.260  8.172   -9.419  1.00 15.80 ?  283  HIS A CG    1 
ATOM   1182 N  ND1   . HIS A 1 157 ? 18.379  7.540   -8.919  1.00 15.01 ?  283  HIS A ND1   1 
ATOM   1183 C  CD2   . HIS A 1 157 ? 16.685  7.303   -10.282 1.00 21.26 ?  283  HIS A CD2   1 
ATOM   1184 C  CE1   . HIS A 1 157 ? 18.470  6.334   -9.448  1.00 18.71 ?  283  HIS A CE1   1 
ATOM   1185 N  NE2   . HIS A 1 157 ? 17.461  6.169   -10.283 1.00 18.78 ?  283  HIS A NE2   1 
ATOM   1186 N  N     . GLN A 1 158 ? 17.574  9.546   -5.882  1.00 6.88  ?  284  GLN A N     1 
ATOM   1187 C  CA    . GLN A 1 158 ? 18.282  8.882   -4.803  1.00 9.88  ?  284  GLN A CA    1 
ATOM   1188 C  C     . GLN A 1 158 ? 17.294  8.429   -3.724  1.00 11.15 ?  284  GLN A C     1 
ATOM   1189 O  O     . GLN A 1 158 ? 17.313  7.270   -3.323  1.00 8.33  ?  284  GLN A O     1 
ATOM   1190 C  CB    . GLN A 1 158 ? 19.374  9.790   -4.220  1.00 9.25  ?  284  GLN A CB    1 
ATOM   1191 C  CG    . GLN A 1 158 ? 20.045  9.192   -3.007  1.00 13.38 ?  284  GLN A CG    1 
ATOM   1192 C  CD    . GLN A 1 158 ? 21.254  10.003  -2.512  1.00 35.83 ?  284  GLN A CD    1 
ATOM   1193 O  OE1   . GLN A 1 158 ? 21.633  11.021  -3.104  1.00 37.01 ?  284  GLN A OE1   1 
ATOM   1194 N  NE2   . GLN A 1 158 ? 21.859  9.544   -1.424  1.00 42.49 ?  284  GLN A NE2   1 
ATOM   1195 N  N     . ASP A 1 159 ? 16.414  9.317   -3.286  1.00 7.30  ?  285  ASP A N     1 
ATOM   1196 C  CA    . ASP A 1 159 ? 15.461  8.942   -2.238  1.00 6.99  ?  285  ASP A CA    1 
ATOM   1197 C  C     . ASP A 1 159 ? 14.538  7.859   -2.751  1.00 7.23  ?  285  ASP A C     1 
ATOM   1198 O  O     . ASP A 1 159 ? 14.197  6.940   -2.009  1.00 7.62  ?  285  ASP A O     1 
ATOM   1199 C  CB    . ASP A 1 159 ? 14.582  10.116  -1.810  1.00 10.80 ?  285  ASP A CB    1 
ATOM   1200 C  CG    . ASP A 1 159 ? 15.273  11.052  -0.783  1.00 8.63  ?  285  ASP A CG    1 
ATOM   1201 O  OD1   . ASP A 1 159 ? 16.430  10.792  -0.371  1.00 11.90 ?  285  ASP A OD1   1 
ATOM   1202 O  OD2   . ASP A 1 159 ? 14.618  12.015  -0.364  1.00 9.18  ?  285  ASP A OD2   1 
ATOM   1203 N  N     . LEU A 1 160 ? 14.150  7.974   -4.013  1.00 6.10  ?  286  LEU A N     1 
ATOM   1204 C  CA    . LEU A 1 160 ? 13.165  7.035   -4.556  1.00 6.53  ?  286  LEU A CA    1 
ATOM   1205 C  C     . LEU A 1 160 ? 13.771  5.653   -4.764  1.00 10.63 ?  286  LEU A C     1 
ATOM   1206 O  O     . LEU A 1 160 ? 13.025  4.680   -4.966  1.00 10.40 ?  286  LEU A O     1 
ATOM   1207 C  CB    . LEU A 1 160 ? 12.559  7.563   -5.857  1.00 6.05  ?  286  LEU A CB    1 
ATOM   1208 C  CG    . LEU A 1 160 ? 11.731  8.854   -5.677  1.00 8.83  ?  286  LEU A CG    1 
ATOM   1209 C  CD1   . LEU A 1 160 ? 11.094  9.272   -6.996  1.00 9.72  ?  286  LEU A CD1   1 
ATOM   1210 C  CD2   . LEU A 1 160 ? 10.675  8.758   -4.569  1.00 7.57  ?  286  LEU A CD2   1 
ATOM   1211 N  N     . SER A 1 161 ? 15.100  5.575   -4.737  1.00 9.02  ?  287  SER A N     1 
ATOM   1212 C  CA    A SER A 1 161 ? 15.811  4.302   -4.866  0.50 10.88 ?  287  SER A CA    1 
ATOM   1213 C  CA    B SER A 1 161 ? 15.840  4.317   -4.860  0.50 10.92 ?  287  SER A CA    1 
ATOM   1214 C  C     . SER A 1 161 ? 15.937  3.570   -3.537  1.00 11.07 ?  287  SER A C     1 
ATOM   1215 O  O     . SER A 1 161 ? 16.343  2.403   -3.510  1.00 16.54 ?  287  SER A O     1 
ATOM   1216 C  CB    A SER A 1 161 ? 17.213  4.525   -5.477  0.50 10.52 ?  287  SER A CB    1 
ATOM   1217 C  CB    B SER A 1 161 ? 17.275  4.569   -5.401  0.50 10.41 ?  287  SER A CB    1 
ATOM   1218 O  OG    A SER A 1 161 ? 17.099  5.071   -6.777  0.50 16.39 ?  287  SER A OG    1 
ATOM   1219 O  OG    B SER A 1 161 ? 18.173  4.950   -4.367  0.50 9.04  ?  287  SER A OG    1 
ATOM   1220 N  N     A THR A 1 162 ? 15.578  4.244   -2.448  0.60 11.77 ?  288  THR A N     1 
ATOM   1221 N  N     B THR A 1 162 ? 15.609  4.226   -2.424  0.40 11.77 ?  288  THR A N     1 
ATOM   1222 C  CA    A THR A 1 162 ? 15.695  3.728   -1.094  0.60 12.05 ?  288  THR A CA    1 
ATOM   1223 C  CA    B THR A 1 162 ? 15.759  3.593   -1.114  0.40 11.94 ?  288  THR A CA    1 
ATOM   1224 C  C     A THR A 1 162 ? 14.364  3.034   -0.811  0.60 12.02 ?  288  THR A C     1 
ATOM   1225 C  C     B THR A 1 162 ? 14.419  3.104   -0.604  0.40 12.11 ?  288  THR A C     1 
ATOM   1226 O  O     A THR A 1 162 ? 13.334  3.577   -1.175  0.60 10.31 ?  288  THR A O     1 
ATOM   1227 O  O     B THR A 1 162 ? 13.448  3.854   -0.572  0.40 6.95  ?  288  THR A O     1 
ATOM   1228 C  CB    A THR A 1 162 ? 15.817  4.911   -0.095  0.60 13.57 ?  288  THR A CB    1 
ATOM   1229 C  CB    B THR A 1 162 ? 16.353  4.529   -0.046  0.40 13.66 ?  288  THR A CB    1 
ATOM   1230 O  OG1   A THR A 1 162 ? 16.791  5.857   -0.554  0.60 19.79 ?  288  THR A OG1   1 
ATOM   1231 O  OG1   B THR A 1 162 ? 15.375  5.502   0.352   0.40 11.26 ?  288  THR A OG1   1 
ATOM   1232 C  CG2   A THR A 1 162 ? 16.187  4.438   1.290   0.60 18.46 ?  288  THR A CG2   1 
ATOM   1233 C  CG2   B THR A 1 162 ? 17.594  5.211   -0.574  0.40 14.34 ?  288  THR A CG2   1 
ATOM   1234 N  N     . PRO A 1 163 ? 14.380  1.842   -0.181  1.00 14.96 ?  289  PRO A N     1 
ATOM   1235 C  CA    . PRO A 1 163 ? 13.151  1.151   0.216   1.00 18.51 ?  289  PRO A CA    1 
ATOM   1236 C  C     . PRO A 1 163 ? 12.348  1.884   1.271   1.00 14.91 ?  289  PRO A C     1 
ATOM   1237 O  O     . PRO A 1 163 ? 12.883  2.455   2.208   1.00 13.21 ?  289  PRO A O     1 
ATOM   1238 C  CB    . PRO A 1 163 ? 13.660  -0.167  0.806   1.00 20.25 ?  289  PRO A CB    1 
ATOM   1239 C  CG    . PRO A 1 163 ? 15.001  -0.360  0.217   1.00 25.34 ?  289  PRO A CG    1 
ATOM   1240 C  CD    . PRO A 1 163 ? 15.575  1.005   0.033   1.00 19.72 ?  289  PRO A CD    1 
ATOM   1241 N  N     . VAL A 1 164 ? 11.039  1.882   1.060   1.00 12.46 ?  290  VAL A N     1 
ATOM   1242 C  CA    . VAL A 1 164 ? 10.050  2.359   1.979   1.00 13.30 ?  290  VAL A CA    1 
ATOM   1243 C  C     . VAL A 1 164 ? 9.764   1.248   2.985   1.00 12.18 ?  290  VAL A C     1 
ATOM   1244 O  O     . VAL A 1 164 ? 9.587   0.099   2.576   1.00 12.90 ?  290  VAL A O     1 
ATOM   1245 C  CB    . VAL A 1 164 ? 8.737   2.613   1.167   1.00 14.76 ?  290  VAL A CB    1 
ATOM   1246 C  CG1   . VAL A 1 164 ? 7.705   3.194   2.030   1.00 15.27 ?  290  VAL A CG1   1 
ATOM   1247 C  CG2   . VAL A 1 164 ? 9.035   3.521   -0.039  1.00 17.97 ?  290  VAL A CG2   1 
ATOM   1248 N  N     . LEU A 1 165 ? 9.718   1.560   4.281   1.00 11.63 ?  291  LEU A N     1 
ATOM   1249 C  CA    . LEU A 1 165 ? 9.385   0.528   5.289   1.00 13.76 ?  291  LEU A CA    1 
ATOM   1250 C  C     . LEU A 1 165 ? 7.908   0.517   5.674   1.00 10.45 ?  291  LEU A C     1 
ATOM   1251 O  O     . LEU A 1 165 ? 7.233   1.517   5.558   1.00 12.07 ?  291  LEU A O     1 
ATOM   1252 C  CB    . LEU A 1 165 ? 10.197  0.729   6.567   1.00 15.78 ?  291  LEU A CB    1 
ATOM   1253 C  CG    . LEU A 1 165 ? 11.709  0.878   6.400   1.00 26.98 ?  291  LEU A CG    1 
ATOM   1254 C  CD1   . LEU A 1 165 ? 12.360  0.857   7.774   1.00 30.58 ?  291  LEU A CD1   1 
ATOM   1255 C  CD2   . LEU A 1 165 ? 12.310  -0.178  5.491   1.00 26.19 ?  291  LEU A CD2   1 
ATOM   1256 N  N     . ARG A 1 166 ? 7.397   -0.608  6.178   1.00 15.09 ?  292  ARG A N     1 
ATOM   1257 C  CA    . ARG A 1 166 ? 5.983   -0.663  6.574   1.00 14.38 ?  292  ARG A CA    1 
ATOM   1258 C  C     . ARG A 1 166 ? 5.636   0.367   7.668   1.00 13.21 ?  292  ARG A C     1 
ATOM   1259 O  O     . ARG A 1 166 ? 4.534   0.930   7.684   1.00 19.18 ?  292  ARG A O     1 
ATOM   1260 C  CB    . ARG A 1 166 ? 5.573   -2.109  6.945   1.00 22.61 ?  292  ARG A CB    1 
ATOM   1261 C  CG    . ARG A 1 166 ? 4.112   -2.290  7.380   1.00 19.69 ?  292  ARG A CG    1 
ATOM   1262 C  CD    . ARG A 1 166 ? 3.065   -1.815  6.350   1.00 22.10 ?  292  ARG A CD    1 
ATOM   1263 N  NE    . ARG A 1 166 ? 1.720   -1.723  6.947   1.00 21.72 ?  292  ARG A NE    1 
ATOM   1264 C  CZ    . ARG A 1 166 ? 0.759   -2.623  6.774   1.00 31.03 ?  292  ARG A CZ    1 
ATOM   1265 N  NH1   . ARG A 1 166 ? 0.969   -3.690  6.009   1.00 24.80 ?  292  ARG A NH1   1 
ATOM   1266 N  NH2   . ARG A 1 166 ? -0.418  -2.458  7.367   1.00 22.81 ?  292  ARG A NH2   1 
ATOM   1267 N  N     . SER A 1 167 ? 6.606   0.692   8.529   1.00 24.82 ?  293  SER A N     1 
ATOM   1268 C  CA    . SER A 1 167 ? 6.421   1.775   9.506   1.00 25.15 ?  293  SER A CA    1 
ATOM   1269 C  C     . SER A 1 167 ? 6.174   3.136   8.839   1.00 19.30 ?  293  SER A C     1 
ATOM   1270 O  O     . SER A 1 167 ? 5.325   3.916   9.288   1.00 25.76 ?  293  SER A O     1 
ATOM   1271 C  CB    . SER A 1 167 ? 7.612   1.848   10.474  1.00 28.34 ?  293  SER A CB    1 
ATOM   1272 O  OG    . SER A 1 167 ? 8.855   1.872   9.787   1.00 38.40 ?  293  SER A OG    1 
ATOM   1273 N  N     . ASP A 1 168 ? 6.888   3.395   7.750   1.00 17.37 ?  294  ASP A N     1 
ATOM   1274 C  CA    . ASP A 1 168 ? 6.685   4.597   6.962   1.00 17.79 ?  294  ASP A CA    1 
ATOM   1275 C  C     . ASP A 1 168 ? 5.259   4.611   6.427   1.00 17.75 ?  294  ASP A C     1 
ATOM   1276 O  O     . ASP A 1 168 ? 4.587   5.650   6.450   1.00 20.34 ?  294  ASP A O     1 
ATOM   1277 C  CB    . ASP A 1 168 ? 7.625   4.656   5.757   1.00 19.54 ?  294  ASP A CB    1 
ATOM   1278 C  CG    . ASP A 1 168 ? 9.102   4.729   6.141   1.00 33.59 ?  294  ASP A CG    1 
ATOM   1279 O  OD1   . ASP A 1 168 ? 9.439   5.171   7.271   1.00 23.32 ?  294  ASP A OD1   1 
ATOM   1280 O  OD2   . ASP A 1 168 ? 9.924   4.354   5.275   1.00 25.07 ?  294  ASP A OD2   1 
ATOM   1281 N  N     . VAL A 1 169 ? 4.823   3.452   5.924   1.00 14.17 ?  295  VAL A N     1 
ATOM   1282 C  CA    . VAL A 1 169 ? 3.501   3.325   5.286   1.00 11.57 ?  295  VAL A CA    1 
ATOM   1283 C  C     . VAL A 1 169 ? 2.365   3.719   6.247   1.00 13.34 ?  295  VAL A C     1 
ATOM   1284 O  O     . VAL A 1 169 ? 1.409   4.432   5.868   1.00 13.37 ?  295  VAL A O     1 
ATOM   1285 C  CB    . VAL A 1 169 ? 3.311   1.872   4.707   1.00 9.45  ?  295  VAL A CB    1 
ATOM   1286 C  CG1   . VAL A 1 169 ? 1.878   1.660   4.222   1.00 14.68 ?  295  VAL A CG1   1 
ATOM   1287 C  CG2   . VAL A 1 169 ? 4.267   1.642   3.546   1.00 12.11 ?  295  VAL A CG2   1 
ATOM   1288 N  N     . ASP A 1 170 ? 2.463   3.257   7.483   1.00 13.43 ?  296  ASP A N     1 
ATOM   1289 C  CA    . ASP A 1 170 ? 1.432   3.530   8.474   1.00 15.75 ?  296  ASP A CA    1 
ATOM   1290 C  C     . ASP A 1 170 ? 1.348   5.027   8.824   1.00 14.74 ?  296  ASP A C     1 
ATOM   1291 O  O     . ASP A 1 170 ? 0.252   5.582   8.972   1.00 17.33 ?  296  ASP A O     1 
ATOM   1292 C  CB    . ASP A 1 170 ? 1.625   2.639   9.704   1.00 26.32 ?  296  ASP A CB    1 
ATOM   1293 C  CG    . ASP A 1 170 ? 1.477   1.145   9.380   1.00 29.43 ?  296  ASP A CG    1 
ATOM   1294 O  OD1   . ASP A 1 170 ? 0.777   0.793   8.387   1.00 23.54 ?  296  ASP A OD1   1 
ATOM   1295 O  OD2   . ASP A 1 170 ? 2.059   0.317   10.119  1.00 30.84 ?  296  ASP A OD2   1 
ATOM   1296 N  N     . ALA A 1 171 ? 2.495   5.692   8.905   1.00 20.35 ?  297  ALA A N     1 
ATOM   1297 C  CA    . ALA A 1 171 ? 2.514   7.130   9.176   1.00 23.58 ?  297  ALA A CA    1 
ATOM   1298 C  C     . ALA A 1 171 ? 1.877   7.891   8.016   1.00 13.53 ?  297  ALA A C     1 
ATOM   1299 O  O     . ALA A 1 171 ? 1.051   8.800   8.210   1.00 16.28 ?  297  ALA A O     1 
ATOM   1300 C  CB    . ALA A 1 171 ? 3.943   7.594   9.397   1.00 29.54 ?  297  ALA A CB    1 
ATOM   1301 N  N     . LEU A 1 172 ? 2.210   7.451   6.807   1.00 15.20 ?  298  LEU A N     1 
ATOM   1302 C  CA    A LEU A 1 172 ? 1.676   8.035   5.573   0.50 14.14 ?  298  LEU A CA    1 
ATOM   1303 C  CA    B LEU A 1 172 ? 1.674   7.987   5.573   0.50 14.15 ?  298  LEU A CA    1 
ATOM   1304 C  C     . LEU A 1 172 ? 0.158   7.830   5.496   1.00 15.07 ?  298  LEU A C     1 
ATOM   1305 O  O     . LEU A 1 172 ? -0.584  8.731   5.057   1.00 15.34 ?  298  LEU A O     1 
ATOM   1306 C  CB    A LEU A 1 172 ? 2.352   7.441   4.316   0.50 16.14 ?  298  LEU A CB    1 
ATOM   1307 C  CB    B LEU A 1 172 ? 2.288   7.196   4.438   0.50 16.40 ?  298  LEU A CB    1 
ATOM   1308 C  CG    A LEU A 1 172 ? 3.749   7.895   3.833   0.50 7.33  ?  298  LEU A CG    1 
ATOM   1309 C  CG    B LEU A 1 172 ? 2.128   7.786   3.066   0.50 15.57 ?  298  LEU A CG    1 
ATOM   1310 C  CD1   A LEU A 1 172 ? 4.399   6.891   2.882   0.50 9.71  ?  298  LEU A CD1   1 
ATOM   1311 C  CD1   B LEU A 1 172 ? 2.366   9.272   3.179   0.50 14.93 ?  298  LEU A CD1   1 
ATOM   1312 C  CD2   A LEU A 1 172 ? 3.674   9.256   3.149   0.50 11.55 ?  298  LEU A CD2   1 
ATOM   1313 C  CD2   B LEU A 1 172 ? 3.157   7.129   2.191   0.50 20.56 ?  298  LEU A CD2   1 
ATOM   1314 N  N     . GLN A 1 173 ? -0.307  6.661   5.894   1.00 9.90  ?  299  GLN A N     1 
ATOM   1315 C  CA    . GLN A 1 173 ? -1.743  6.422   5.819   1.00 8.37  ?  299  GLN A CA    1 
ATOM   1316 C  C     . GLN A 1 173 ? -2.534  7.359   6.721   1.00 12.16 ?  299  GLN A C     1 
ATOM   1317 O  O     . GLN A 1 173 ? -3.625  7.848   6.351   1.00 9.70  ?  299  GLN A O     1 
ATOM   1318 C  CB    . GLN A 1 173 ? -2.077  4.961   6.113   1.00 7.77  ?  299  GLN A CB    1 
ATOM   1319 C  CG    . GLN A 1 173 ? -3.541  4.683   5.795   1.00 9.62  ?  299  GLN A CG    1 
ATOM   1320 C  CD    . GLN A 1 173 ? -3.852  3.209   5.682   1.00 14.47 ?  299  GLN A CD    1 
ATOM   1321 O  OE1   . GLN A 1 173 ? -2.959  2.358   5.626   1.00 15.54 ?  299  GLN A OE1   1 
ATOM   1322 N  NE2   . GLN A 1 173 ? -5.140  2.898   5.665   1.00 16.10 ?  299  GLN A NE2   1 
ATOM   1323 N  N     . GLN A 1 174 ? -1.978  7.660   7.891   1.00 11.77 ?  300  GLN A N     1 
ATOM   1324 C  CA    . GLN A 1 174 ? -2.700  8.533   8.812   1.00 12.23 ?  300  GLN A CA    1 
ATOM   1325 C  C     . GLN A 1 174 ? -2.827  9.941   8.239   1.00 12.38 ?  300  GLN A C     1 
ATOM   1326 O  O     . GLN A 1 174 ? -3.876  10.593  8.363   1.00 14.78 ?  300  GLN A O     1 
ATOM   1327 C  CB    . GLN A 1 174 ? -2.019  8.538   10.190  1.00 19.83 ?  300  GLN A CB    1 
ATOM   1328 C  CG    . GLN A 1 174 ? -2.735  9.385   11.222  1.00 30.61 ?  300  GLN A CG    1 
ATOM   1329 N  N     . VAL A 1 175 ? -1.747  10.407  7.611   1.00 12.06 ?  301  VAL A N     1 
ATOM   1330 C  CA    . VAL A 1 175 ? -1.731  11.700  6.962   1.00 15.99 ?  301  VAL A CA    1 
ATOM   1331 C  C     . VAL A 1 175 ? -2.752  11.787  5.808   1.00 14.42 ?  301  VAL A C     1 
ATOM   1332 O  O     . VAL A 1 175 ? -3.513  12.781  5.692   1.00 14.50 ?  301  VAL A O     1 
ATOM   1333 C  CB    . VAL A 1 175 ? -0.307  12.032  6.524   1.00 24.02 ?  301  VAL A CB    1 
ATOM   1334 C  CG1   . VAL A 1 175 ? -0.332  12.948  5.376   1.00 28.34 ?  301  VAL A CG1   1 
ATOM   1335 C  CG2   . VAL A 1 175 ? 0.454   12.607  7.718   1.00 18.31 ?  301  VAL A CG2   1 
ATOM   1336 N  N     . VAL A 1 176 ? -2.818  10.734  4.996   1.00 10.46 ?  302  VAL A N     1 
ATOM   1337 C  CA    . VAL A 1 176 ? -3.763  10.681  3.891   1.00 8.96  ?  302  VAL A CA    1 
ATOM   1338 C  C     . VAL A 1 176 ? -5.213  10.654  4.406   1.00 9.66  ?  302  VAL A C     1 
ATOM   1339 O  O     . VAL A 1 176 ? -6.107  11.343  3.855   1.00 9.11  ?  302  VAL A O     1 
ATOM   1340 C  CB    . VAL A 1 176 ? -3.479  9.473   2.981   1.00 8.91  ?  302  VAL A CB    1 
ATOM   1341 C  CG1   . VAL A 1 176 ? -4.497  9.419   1.872   1.00 10.08 ?  302  VAL A CG1   1 
ATOM   1342 C  CG2   . VAL A 1 176 ? -2.063  9.617   2.378   1.00 8.56  ?  302  VAL A CG2   1 
ATOM   1343 N  N     . GLU A 1 177 ? -5.435  9.870   5.449   1.00 10.11 ?  303  GLU A N     1 
ATOM   1344 C  CA    . GLU A 1 177 ? -6.753  9.812   6.075   1.00 7.94  ?  303  GLU A CA    1 
ATOM   1345 C  C     . GLU A 1 177 ? -7.224  11.160  6.597   1.00 12.80 ?  303  GLU A C     1 
ATOM   1346 O  O     . GLU A 1 177 ? -8.403  11.470  6.503   1.00 10.65 ?  303  GLU A O     1 
ATOM   1347 C  CB    . GLU A 1 177 ? -6.750  8.774   7.181   1.00 8.96  ?  303  GLU A CB    1 
ATOM   1348 C  CG    . GLU A 1 177 ? -6.770  7.387   6.610   1.00 12.58 ?  303  GLU A CG    1 
ATOM   1349 C  CD    . GLU A 1 177 ? -6.584  6.287   7.619   1.00 19.73 ?  303  GLU A CD    1 
ATOM   1350 O  OE1   . GLU A 1 177 ? -6.185  6.546   8.777   1.00 19.53 ?  303  GLU A OE1   1 
ATOM   1351 O  OE2   . GLU A 1 177 ? -6.856  5.136   7.246   1.00 16.31 ?  303  GLU A OE2   1 
ATOM   1352 N  N     . GLU A 1 178 ? -6.301  11.941  7.156   1.00 11.24 ?  304  GLU A N     1 
ATOM   1353 C  CA    . GLU A 1 178 ? -6.682  13.255  7.668   1.00 17.52 ?  304  GLU A CA    1 
ATOM   1354 C  C     . GLU A 1 178 ? -7.183  14.131  6.527   1.00 12.10 ?  304  GLU A C     1 
ATOM   1355 O  O     . GLU A 1 178 ? -8.220  14.788  6.634   1.00 11.95 ?  304  GLU A O     1 
ATOM   1356 C  CB    . GLU A 1 178 ? -5.503  13.922  8.393   1.00 16.01 ?  304  GLU A CB    1 
ATOM   1357 C  CG    . GLU A 1 178 ? -5.919  15.226  9.095   1.00 23.18 ?  304  GLU A CG    1 
ATOM   1358 C  CD    . GLU A 1 178 ? -7.066  15.036  10.089  1.00 35.10 ?  304  GLU A CD    1 
ATOM   1359 N  N     . ALA A 1 179 ? -6.448  14.153  5.417   1.00 8.47  ?  305  ALA A N     1 
ATOM   1360 C  CA    . ALA A 1 179 ? -6.837  15.005  4.296   1.00 9.79  ?  305  ALA A CA    1 
ATOM   1361 C  C     . ALA A 1 179 ? -8.130  14.516  3.669   1.00 9.05  ?  305  ALA A C     1 
ATOM   1362 O  O     . ALA A 1 179 ? -8.987  15.302  3.277   1.00 9.44  ?  305  ALA A O     1 
ATOM   1363 C  CB    . ALA A 1 179 ? -5.726  15.066  3.251   1.00 9.74  ?  305  ALA A CB    1 
ATOM   1364 N  N     . VAL A 1 180 ? -8.275  13.194  3.611   1.00 9.31  ?  306  VAL A N     1 
ATOM   1365 C  CA    . VAL A 1 180 ? -9.436  12.573  2.988   1.00 7.08  ?  306  VAL A CA    1 
ATOM   1366 C  C     . VAL A 1 180 ? -10.675 12.863  3.836   1.00 7.96  ?  306  VAL A C     1 
ATOM   1367 O  O     . VAL A 1 180 ? -11.748 13.093  3.295   1.00 10.89 ?  306  VAL A O     1 
ATOM   1368 C  CB    . VAL A 1 180 ? -9.227  11.046  2.779   1.00 8.50  ?  306  VAL A CB    1 
ATOM   1369 C  CG1   . VAL A 1 180 ? -10.546 10.322  2.520   1.00 10.69 ?  306  VAL A CG1   1 
ATOM   1370 C  CG2   . VAL A 1 180 ? -8.263  10.770  1.595   1.00 8.32  ?  306  VAL A CG2   1 
ATOM   1371 N  N     . GLY A 1 181 ? -10.494 12.865  5.145   1.00 10.61 ?  307  GLY A N     1 
ATOM   1372 C  CA    . GLY A 1 181 ? -11.579 13.112  6.091   1.00 14.05 ?  307  GLY A CA    1 
ATOM   1373 C  C     . GLY A 1 181 ? -12.115 14.513  5.960   1.00 15.46 ?  307  GLY A C     1 
ATOM   1374 O  O     . GLY A 1 181 ? -13.316 14.727  6.139   1.00 15.33 ?  307  GLY A O     1 
ATOM   1375 N  N     . GLN A 1 182 ? -11.240 15.471  5.661   1.00 10.94 ?  308  GLN A N     1 
ATOM   1376 C  CA    . GLN A 1 182 ? -11.684 16.855  5.459   1.00 9.11  ?  308  GLN A CA    1 
ATOM   1377 C  C     . GLN A 1 182 ? -12.292 17.014  4.097   1.00 9.02  ?  308  GLN A C     1 
ATOM   1378 O  O     . GLN A 1 182 ? -13.285 17.718  3.930   1.00 14.36 ?  308  GLN A O     1 
ATOM   1379 C  CB    . GLN A 1 182 ? -10.523 17.831  5.659   1.00 13.49 ?  308  GLN A CB    1 
ATOM   1380 C  CG    . GLN A 1 182 ? -10.045 17.874  7.100   1.00 15.28 ?  308  GLN A CG    1 
ATOM   1381 C  CD    . GLN A 1 182 ? -8.731  18.604  7.274   1.00 12.62 ?  308  GLN A CD    1 
ATOM   1382 O  OE1   . GLN A 1 182 ? -8.342  19.437  6.460   1.00 17.88 ?  308  GLN A OE1   1 
ATOM   1383 N  NE2   . GLN A 1 182 ? -8.040  18.286  8.355   1.00 17.31 ?  308  GLN A NE2   1 
ATOM   1384 N  N     . ALA A 1 183 ? -11.715 16.340  3.103   1.00 11.62 ?  309  ALA A N     1 
ATOM   1385 C  CA    . ALA A 1 183 ? -12.224 16.434  1.743   1.00 10.24 ?  309  ALA A CA    1 
ATOM   1386 C  C     . ALA A 1 183 ? -13.647 15.884  1.656   1.00 8.69  ?  309  ALA A C     1 
ATOM   1387 O  O     . ALA A 1 183 ? -14.497 16.421  0.947   1.00 11.17 ?  309  ALA A O     1 
ATOM   1388 C  CB    . ALA A 1 183 ? -11.287 15.687  0.778   1.00 11.75 ?  309  ALA A CB    1 
ATOM   1389 N  N     . LEU A 1 184 ? -13.892 14.797  2.369   1.00 7.73  ?  310  LEU A N     1 
ATOM   1390 C  CA    . LEU A 1 184 ? -15.214 14.147  2.343   1.00 8.88  ?  310  LEU A CA    1 
ATOM   1391 C  C     . LEU A 1 184 ? -15.402 13.266  3.574   1.00 7.82  ?  310  LEU A C     1 
ATOM   1392 O  O     . LEU A 1 184 ? -14.975 12.103  3.635   1.00 8.81  ?  310  LEU A O     1 
ATOM   1393 C  CB    . LEU A 1 184 ? -15.390 13.324  1.070   1.00 9.27  ?  310  LEU A CB    1 
ATOM   1394 C  CG    . LEU A 1 184 ? -16.726 12.584  0.916   1.00 7.12  ?  310  LEU A CG    1 
ATOM   1395 C  CD1   . LEU A 1 184 ? -17.921 13.552  0.710   1.00 12.17 ?  310  LEU A CD1   1 
ATOM   1396 C  CD2   . LEU A 1 184 ? -16.578 11.630  -0.265  1.00 8.46  ?  310  LEU A CD2   1 
ATOM   1397 N  N     . PRO A 1 185 ? -16.042 13.806  4.614   1.00 9.50  ?  311  PRO A N     1 
ATOM   1398 C  CA    . PRO A 1 185 ? -16.264 12.965  5.799   1.00 7.39  ?  311  PRO A CA    1 
ATOM   1399 C  C     . PRO A 1 185 ? -16.960 11.621  5.462   1.00 8.00  ?  311  PRO A C     1 
ATOM   1400 O  O     . PRO A 1 185 ? -17.871 11.533  4.644   1.00 9.77  ?  311  PRO A O     1 
ATOM   1401 C  CB    . PRO A 1 185 ? -17.139 13.864  6.684   1.00 8.85  ?  311  PRO A CB    1 
ATOM   1402 C  CG    . PRO A 1 185 ? -16.700 15.266  6.281   1.00 9.04  ?  311  PRO A CG    1 
ATOM   1403 C  CD    . PRO A 1 185 ? -16.476 15.202  4.805   1.00 10.37 ?  311  PRO A CD    1 
ATOM   1404 N  N     . GLY A 1 186 ? -16.433 10.555  6.061   1.00 9.09  ?  312  GLY A N     1 
ATOM   1405 C  CA    . GLY A 1 186 ? -16.945 9.229   5.790   1.00 9.52  ?  312  GLY A CA    1 
ATOM   1406 C  C     . GLY A 1 186 ? -16.141 8.465   4.738   1.00 8.88  ?  312  GLY A C     1 
ATOM   1407 O  O     . GLY A 1 186 ? -16.312 7.250   4.602   1.00 9.63  ?  312  GLY A O     1 
ATOM   1408 N  N     . ALA A 1 187 ? -15.310 9.169   3.974   1.00 7.33  ?  313  ALA A N     1 
ATOM   1409 C  CA    . ALA A 1 187 ? -14.513 8.452   2.969   1.00 6.37  ?  313  ALA A CA    1 
ATOM   1410 C  C     . ALA A 1 187 ? -13.427 7.658   3.651   1.00 8.83  ?  313  ALA A C     1 
ATOM   1411 O  O     . ALA A 1 187 ? -12.913 8.062   4.702   1.00 13.54 ?  313  ALA A O     1 
ATOM   1412 C  CB    . ALA A 1 187 ? -13.936 9.415   1.948   1.00 6.37  ?  313  ALA A CB    1 
ATOM   1413 N  N     . THR A 1 188 ? -13.066 6.529   3.047   1.00 6.35  ?  314  THR A N     1 
ATOM   1414 C  CA    . THR A 1 188 ? -12.118 5.618   3.670   1.00 8.06  ?  314  THR A CA    1 
ATOM   1415 C  C     . THR A 1 188 ? -10.891 5.480   2.812   1.00 7.64  ?  314  THR A C     1 
ATOM   1416 O  O     . THR A 1 188 ? -10.924 5.778   1.615   1.00 7.91  ?  314  THR A O     1 
ATOM   1417 C  CB    . THR A 1 188 ? -12.712 4.229   3.830   1.00 5.60  ?  314  THR A CB    1 
ATOM   1418 O  OG1   . THR A 1 188 ? -13.134 3.684   2.569   1.00 9.42  ?  314  THR A OG1   1 
ATOM   1419 C  CG2   . THR A 1 188 ? -13.953 4.277   4.769   1.00 13.21 ?  314  THR A CG2   1 
ATOM   1420 N  N     . VAL A 1 189 ? -9.824  5.018   3.445   1.00 6.94  ?  315  VAL A N     1 
ATOM   1421 C  CA    . VAL A 1 189 ? -8.535  4.835   2.787   1.00 5.24  ?  315  VAL A CA    1 
ATOM   1422 C  C     . VAL A 1 189 ? -8.116  3.396   3.064   1.00 5.81  ?  315  VAL A C     1 
ATOM   1423 O  O     . VAL A 1 189 ? -8.046  3.000   4.235   1.00 7.71  ?  315  VAL A O     1 
ATOM   1424 C  CB    . VAL A 1 189 ? -7.451  5.755   3.376   1.00 5.57  ?  315  VAL A CB    1 
ATOM   1425 C  CG1   . VAL A 1 189 ? -6.086  5.446   2.728   1.00 6.27  ?  315  VAL A CG1   1 
ATOM   1426 C  CG2   . VAL A 1 189 ? -7.837  7.235   3.162   1.00 8.78  ?  315  VAL A CG2   1 
ATOM   1427 N  N     . THR A 1 190 ? -7.804  2.637   2.008   1.00 5.09  ?  316  THR A N     1 
ATOM   1428 C  CA    . THR A 1 190 ? -7.381  1.235   2.140   1.00 4.05  ?  316  THR A CA    1 
ATOM   1429 C  C     . THR A 1 190 ? -5.989  1.095   1.523   1.00 4.20  ?  316  THR A C     1 
ATOM   1430 O  O     . THR A 1 190 ? -5.764  1.527   0.396   1.00 4.42  ?  316  THR A O     1 
ATOM   1431 C  CB    . THR A 1 190 ? -8.355  0.331   1.380   1.00 4.74  ?  316  THR A CB    1 
ATOM   1432 O  OG1   . THR A 1 190 ? -9.671  0.449   1.965   1.00 6.44  ?  316  THR A OG1   1 
ATOM   1433 C  CG2   . THR A 1 190 ? -7.897  -1.139  1.432   1.00 6.79  ?  316  THR A CG2   1 
ATOM   1434 N  N     . LEU A 1 191 ? -5.057  0.474   2.246   1.00 3.76  ?  317  LEU A N     1 
ATOM   1435 C  CA    . LEU A 1 191 ? -3.714  0.198   1.727   1.00 3.12  ?  317  LEU A CA    1 
ATOM   1436 C  C     . LEU A 1 191 ? -3.787  -0.915  0.689   1.00 3.94  ?  317  LEU A C     1 
ATOM   1437 O  O     . LEU A 1 191 ? -4.412  -1.967  0.940   1.00 6.41  ?  317  LEU A O     1 
ATOM   1438 C  CB    . LEU A 1 191 ? -2.835  -0.256  2.905   1.00 5.87  ?  317  LEU A CB    1 
ATOM   1439 C  CG    . LEU A 1 191 ? -1.423  -0.644  2.549   1.00 5.85  ?  317  LEU A CG    1 
ATOM   1440 C  CD1   . LEU A 1 191 ? -0.677  0.537   1.982   1.00 4.47  ?  317  LEU A CD1   1 
ATOM   1441 C  CD2   . LEU A 1 191 ? -0.764  -1.133  3.862   1.00 11.45 ?  317  LEU A CD2   1 
ATOM   1442 N  N     . THR A 1 192 ? -3.211  -0.681  -0.486  1.00 2.39  ?  318  THR A N     1 
ATOM   1443 C  CA    A THR A 1 192 ? -3.235  -1.691  -1.534  0.40 3.16  ?  318  THR A CA    1 
ATOM   1444 C  CA    B THR A 1 192 ? -3.208  -1.723  -1.532  0.60 3.14  ?  318  THR A CA    1 
ATOM   1445 C  C     . THR A 1 192 ? -1.782  -2.008  -1.948  1.00 3.42  ?  318  THR A C     1 
ATOM   1446 O  O     . THR A 1 192 ? -0.866  -1.874  -1.150  1.00 3.87  ?  318  THR A O     1 
ATOM   1447 C  CB    A THR A 1 192 ? -4.131  -1.201  -2.703  0.40 2.21  ?  318  THR A CB    1 
ATOM   1448 C  CB    B THR A 1 192 ? -4.058  -1.337  -2.767  0.60 2.08  ?  318  THR A CB    1 
ATOM   1449 O  OG1   A THR A 1 192 ? -5.271  -0.500  -2.188  0.40 13.83 ?  318  THR A OG1   1 
ATOM   1450 O  OG1   B THR A 1 192 ? -3.528  -0.131  -3.378  0.60 0.67  ?  318  THR A OG1   1 
ATOM   1451 C  CG2   A THR A 1 192 ? -4.642  -2.313  -3.475  0.40 2.50  ?  318  THR A CG2   1 
ATOM   1452 C  CG2   B THR A 1 192 ? -5.523  -1.158  -2.377  0.60 4.14  ?  318  THR A CG2   1 
ATOM   1453 N  N     . GLY A 1 193 ? -1.573  -2.453  -3.185  1.00 3.14  ?  319  GLY A N     1 
ATOM   1454 C  CA    . GLY A 1 193 ? -0.228  -2.758  -3.654  1.00 4.73  ?  319  GLY A CA    1 
ATOM   1455 C  C     . GLY A 1 193 ? 0.562   -3.792  -2.880  1.00 3.41  ?  319  GLY A C     1 
ATOM   1456 O  O     . GLY A 1 193 ? -0.020  -4.655  -2.194  1.00 3.03  ?  319  GLY A O     1 
ATOM   1457 N  N     . GLY A 1 194 ? 1.890   -3.680  -2.978  1.00 3.89  ?  320  GLY A N     1 
ATOM   1458 C  CA    . GLY A 1 194 ? 2.783   -4.699  -2.437  1.00 4.06  ?  320  GLY A CA    1 
ATOM   1459 C  C     . GLY A 1 194 ? 2.655   -4.809  -0.934  1.00 2.80  ?  320  GLY A C     1 
ATOM   1460 O  O     . GLY A 1 194 ? 2.731   -5.906  -0.387  1.00 4.01  ?  320  GLY A O     1 
ATOM   1461 N  N     . PHE A 1 195 ? 2.404   -3.680  -0.250  1.00 3.73  ?  321  PHE A N     1 
ATOM   1462 C  CA    . PHE A 1 195 ? 2.257   -3.789  1.199   1.00 4.08  ?  321  PHE A CA    1 
ATOM   1463 C  C     . PHE A 1 195 ? 1.045   -4.613  1.609   1.00 2.39  ?  321  PHE A C     1 
ATOM   1464 O  O     . PHE A 1 195 ? 1.077   -5.343  2.612   1.00 3.89  ?  321  PHE A O     1 
ATOM   1465 C  CB    . PHE A 1 195 ? 2.298   -2.409  1.866   1.00 2.12  ?  321  PHE A CB    1 
ATOM   1466 C  CG    . PHE A 1 195 ? 3.670   -1.789  1.814   1.00 5.66  ?  321  PHE A CG    1 
ATOM   1467 C  CD1   . PHE A 1 195 ? 4.672   -2.213  2.668   1.00 8.70  ?  321  PHE A CD1   1 
ATOM   1468 C  CD2   . PHE A 1 195 ? 3.956   -0.796  0.898   1.00 6.02  ?  321  PHE A CD2   1 
ATOM   1469 C  CE1   . PHE A 1 195 ? 5.953   -1.664  2.617   1.00 9.65  ?  321  PHE A CE1   1 
ATOM   1470 C  CE2   . PHE A 1 195 ? 5.252   -0.226  0.828   1.00 9.64  ?  321  PHE A CE2   1 
ATOM   1471 C  CZ    . PHE A 1 195 ? 6.249   -0.667  1.710   1.00 7.71  ?  321  PHE A CZ    1 
ATOM   1472 N  N     . ARG A 1 196 ? -0.036  -4.504  0.848   1.00 1.97  ?  322  ARG A N     1 
ATOM   1473 C  CA    . ARG A 1 196 ? -1.192  -5.338  1.173   1.00 2.23  ?  322  ARG A CA    1 
ATOM   1474 C  C     . ARG A 1 196 ? -0.884  -6.835  0.956   1.00 3.01  ?  322  ARG A C     1 
ATOM   1475 O  O     . ARG A 1 196 ? -1.448  -7.673  1.655   1.00 5.01  ?  322  ARG A O     1 
ATOM   1476 C  CB    . ARG A 1 196 ? -2.427  -4.921  0.336   1.00 2.72  ?  322  ARG A CB    1 
ATOM   1477 C  CG    . ARG A 1 196 ? -3.667  -5.749  0.695   1.00 3.70  ?  322  ARG A CG    1 
ATOM   1478 C  CD    . ARG A 1 196 ? -4.964  -5.196  0.060   1.00 4.16  ?  322  ARG A CD    1 
ATOM   1479 N  NE    . ARG A 1 196 ? -6.103  -6.019  0.503   1.00 3.73  ?  322  ARG A NE    1 
ATOM   1480 C  CZ    . ARG A 1 196 ? -6.835  -6.801  -0.280  1.00 5.57  ?  322  ARG A CZ    1 
ATOM   1481 N  NH1   . ARG A 1 196 ? -6.623  -6.887  -1.590  1.00 2.95  ?  322  ARG A NH1   1 
ATOM   1482 N  NH2   . ARG A 1 196 ? -7.796  -7.540  0.275   1.00 5.59  ?  322  ARG A NH2   1 
ATOM   1483 N  N     . ARG A 1 197 ? 0.034   -7.140  0.036   1.00 1.93  ?  323  ARG A N     1 
ATOM   1484 C  CA    . ARG A 1 197 ? 0.469   -8.530  -0.222  1.00 3.13  ?  323  ARG A CA    1 
ATOM   1485 C  C     . ARG A 1 197 ? 1.439   -9.043  0.809   1.00 7.71  ?  323  ARG A C     1 
ATOM   1486 O  O     . ARG A 1 197 ? 1.922   -10.150 0.677   1.00 7.15  ?  323  ARG A O     1 
ATOM   1487 C  CB    . ARG A 1 197 ? 1.083   -8.692  -1.627  1.00 2.88  ?  323  ARG A CB    1 
ATOM   1488 C  CG    . ARG A 1 197 ? 0.094   -8.307  -2.745  1.00 2.68  ?  323  ARG A CG    1 
ATOM   1489 C  CD    . ARG A 1 197 ? 0.555   -8.822  -4.109  1.00 3.28  ?  323  ARG A CD    1 
ATOM   1490 N  NE    . ARG A 1 197 ? 1.965   -8.523  -4.401  1.00 4.55  ?  323  ARG A NE    1 
ATOM   1491 C  CZ    . ARG A 1 197 ? 2.375   -7.375  -4.942  1.00 4.74  ?  323  ARG A CZ    1 
ATOM   1492 N  NH1   . ARG A 1 197 ? 3.658   -7.169  -5.187  1.00 4.98  ?  323  ARG A NH1   1 
ATOM   1493 N  NH2   . ARG A 1 197 ? 1.494   -6.415  -5.262  1.00 4.94  ?  323  ARG A NH2   1 
ATOM   1494 N  N     . GLY A 1 198 ? 1.762   -8.211  1.794   1.00 4.85  ?  324  GLY A N     1 
ATOM   1495 C  CA    . GLY A 1 198 ? 2.603   -8.659  2.900   1.00 4.83  ?  324  GLY A CA    1 
ATOM   1496 C  C     . GLY A 1 198 ? 4.043   -8.159  2.836   1.00 6.75  ?  324  GLY A C     1 
ATOM   1497 O  O     . GLY A 1 198 ? 4.862   -8.543  3.690   1.00 8.11  ?  324  GLY A O     1 
ATOM   1498 N  N     . LYS A 1 199 ? 4.404   -7.357  1.837   1.00 5.35  ?  325  LYS A N     1 
ATOM   1499 C  CA    A LYS A 1 199 ? 5.789   -6.878  1.777   0.50 5.41  ?  325  LYS A CA    1 
ATOM   1500 C  CA    B LYS A 1 199 ? 5.790   -6.860  1.773   0.50 5.41  ?  325  LYS A CA    1 
ATOM   1501 C  C     . LYS A 1 199 ? 6.164   -6.049  3.007   1.00 6.52  ?  325  LYS A C     1 
ATOM   1502 O  O     . LYS A 1 199 ? 5.357   -5.310  3.540   1.00 7.77  ?  325  LYS A O     1 
ATOM   1503 C  CB    A LYS A 1 199 ? 6.064   -6.122  0.470   0.50 8.25  ?  325  LYS A CB    1 
ATOM   1504 C  CB    B LYS A 1 199 ? 6.047   -6.028  0.513   0.50 8.22  ?  325  LYS A CB    1 
ATOM   1505 C  CG    A LYS A 1 199 ? 5.863   -7.017  -0.741  0.50 8.19  ?  325  LYS A CG    1 
ATOM   1506 C  CG    B LYS A 1 199 ? 5.989   -6.835  -0.764  0.50 8.38  ?  325  LYS A CG    1 
ATOM   1507 C  CD    A LYS A 1 199 ? 6.022   -6.282  -2.075  0.50 16.37 ?  325  LYS A CD    1 
ATOM   1508 C  CD    B LYS A 1 199 ? 6.265   -5.957  -1.990  0.50 16.13 ?  325  LYS A CD    1 
ATOM   1509 C  CE    A LYS A 1 199 ? 7.421   -5.738  -2.286  0.50 24.62 ?  325  LYS A CE    1 
ATOM   1510 C  CE    B LYS A 1 199 ? 7.650   -6.189  -2.575  0.50 23.03 ?  325  LYS A CE    1 
ATOM   1511 N  NZ    A LYS A 1 199 ? 7.525   -5.084  -3.626  0.50 20.64 ?  325  LYS A NZ    1 
ATOM   1512 N  NZ    B LYS A 1 199 ? 8.748   -5.995  -1.606  0.50 24.99 ?  325  LYS A NZ    1 
ATOM   1513 N  N     . LEU A 1 200 ? 7.393   -6.218  3.479   1.00 8.42  ?  326  LEU A N     1 
ATOM   1514 C  CA    . LEU A 1 200 ? 7.830   -5.468  4.646   1.00 12.92 ?  326  LEU A CA    1 
ATOM   1515 C  C     . LEU A 1 200 ? 8.530   -4.188  4.202   1.00 10.48 ?  326  LEU A C     1 
ATOM   1516 O  O     . LEU A 1 200 ? 8.677   -3.251  4.996   1.00 13.90 ?  326  LEU A O     1 
ATOM   1517 C  CB    . LEU A 1 200 ? 8.777   -6.333  5.478   1.00 18.62 ?  326  LEU A CB    1 
ATOM   1518 C  CG    . LEU A 1 200 ? 8.072   -7.581  6.026   1.00 19.86 ?  326  LEU A CG    1 
ATOM   1519 C  CD1   . LEU A 1 200 ? 9.042   -8.384  6.873   1.00 29.64 ?  326  LEU A CD1   1 
ATOM   1520 C  CD2   . LEU A 1 200 ? 6.861   -7.158  6.838   1.00 22.93 ?  326  LEU A CD2   1 
ATOM   1521 N  N     . GLN A 1 201 ? 8.994   -4.197  2.952   1.00 13.64 ?  327  GLN A N     1 
ATOM   1522 C  CA    . GLN A 1 201 ? 9.627   -3.032  2.312   1.00 17.08 ?  327  GLN A CA    1 
ATOM   1523 C  C     . GLN A 1 201 ? 9.118   -2.910  0.918   1.00 18.32 ?  327  GLN A C     1 
ATOM   1524 O  O     . GLN A 1 201 ? 8.659   -3.885  0.334   1.00 22.00 ?  327  GLN A O     1 
ATOM   1525 C  CB    . GLN A 1 201 ? 11.143  -3.206  2.205   1.00 26.16 ?  327  GLN A CB    1 
ATOM   1526 C  CG    . GLN A 1 201 ? 11.878  -3.200  3.492   1.00 29.94 ?  327  GLN A CG    1 
ATOM   1527 C  CD    . GLN A 1 201 ? 13.386  -3.313  3.278   1.00 25.26 ?  327  GLN A CD    1 
ATOM   1528 O  OE1   . GLN A 1 201 ? 13.856  -3.595  2.164   1.00 28.91 ?  327  GLN A OE1   1 
ATOM   1529 N  NE2   . GLN A 1 201 ? 14.148  -3.096  4.342   1.00 40.20 ?  327  GLN A NE2   1 
ATOM   1530 N  N     . GLY A 1 202 ? 9.217   -1.715  0.353   1.00 12.69 ?  328  GLY A N     1 
ATOM   1531 C  CA    . GLY A 1 202 ? 8.728   -1.511  -0.994  1.00 11.19 ?  328  GLY A CA    1 
ATOM   1532 C  C     . GLY A 1 202 ? 9.292   -0.251  -1.601  1.00 15.13 ?  328  GLY A C     1 
ATOM   1533 O  O     . GLY A 1 202 ? 10.032  0.458   -0.933  1.00 21.90 ?  328  GLY A O     1 
ATOM   1534 N  N     . HIS A 1 203 ? 8.966   0.012   -2.858  1.00 9.85  ?  329  HIS A N     1 
ATOM   1535 C  CA    . HIS A 1 203 ? 9.426   1.240   -3.500  1.00 12.70 ?  329  HIS A CA    1 
ATOM   1536 C  C     . HIS A 1 203 ? 8.336   2.244   -3.769  1.00 13.43 ?  329  HIS A C     1 
ATOM   1537 O  O     . HIS A 1 203 ? 8.603   3.340   -4.297  1.00 14.74 ?  329  HIS A O     1 
ATOM   1538 C  CB    . HIS A 1 203 ? 10.188  0.919   -4.775  1.00 23.26 ?  329  HIS A CB    1 
ATOM   1539 C  CG    . HIS A 1 203 ? 11.480  0.216   -4.518  1.00 25.56 ?  329  HIS A CG    1 
ATOM   1540 N  ND1   . HIS A 1 203 ? 12.525  0.815   -3.847  1.00 36.04 ?  329  HIS A ND1   1 
ATOM   1541 C  CD2   . HIS A 1 203 ? 11.885  -1.043  -4.802  1.00 38.50 ?  329  HIS A CD2   1 
ATOM   1542 C  CE1   . HIS A 1 203 ? 13.524  -0.043  -3.739  1.00 32.06 ?  329  HIS A CE1   1 
ATOM   1543 N  NE2   . HIS A 1 203 ? 13.163  -1.176  -4.315  1.00 47.23 ?  329  HIS A NE2   1 
ATOM   1544 N  N     . ASP A 1 204 ? 7.098   1.875   -3.442  1.00 8.55  ?  330  ASP A N     1 
ATOM   1545 C  CA    . ASP A 1 204 ? 5.998   2.838   -3.527  1.00 12.98 ?  330  ASP A CA    1 
ATOM   1546 C  C     . ASP A 1 204 ? 4.878   2.384   -2.626  1.00 10.83 ?  330  ASP A C     1 
ATOM   1547 O  O     . ASP A 1 204 ? 4.918   1.289   -2.070  1.00 12.68 ?  330  ASP A O     1 
ATOM   1548 C  CB    . ASP A 1 204 ? 5.467   3.060   -4.946  1.00 16.64 ?  330  ASP A CB    1 
ATOM   1549 C  CG    . ASP A 1 204 ? 5.203   1.776   -5.677  1.00 30.48 ?  330  ASP A CG    1 
ATOM   1550 O  OD1   . ASP A 1 204 ? 4.782   0.791   -5.030  1.00 20.39 ?  330  ASP A OD1   1 
ATOM   1551 O  OD2   . ASP A 1 204 ? 5.422   1.755   -6.909  1.00 40.51 ?  330  ASP A OD2   1 
ATOM   1552 N  N     . VAL A 1 205 ? 3.915   3.263   -2.440  1.00 7.24  ?  331  VAL A N     1 
ATOM   1553 C  CA    . VAL A 1 205 ? 2.818   2.999   -1.515  1.00 4.68  ?  331  VAL A CA    1 
ATOM   1554 C  C     . VAL A 1 205 ? 1.554   3.325   -2.280  1.00 7.17  ?  331  VAL A C     1 
ATOM   1555 O  O     . VAL A 1 205 ? 1.494   4.361   -2.949  1.00 7.09  ?  331  VAL A O     1 
ATOM   1556 C  CB    . VAL A 1 205 ? 2.906   3.855   -0.234  1.00 9.56  ?  331  VAL A CB    1 
ATOM   1557 C  CG1   . VAL A 1 205 ? 1.885   3.371   0.818   1.00 11.03 ?  331  VAL A CG1   1 
ATOM   1558 C  CG2   . VAL A 1 205 ? 4.330   3.750   0.359   1.00 11.18 ?  331  VAL A CG2   1 
ATOM   1559 N  N     . ASP A 1 206 ? 0.570   2.423   -2.213  1.00 5.54  ?  332  ASP A N     1 
ATOM   1560 C  CA    . ASP A 1 206 ? -0.677  2.585   -2.963  1.00 3.47  ?  332  ASP A CA    1 
ATOM   1561 C  C     . ASP A 1 206 ? -1.879  2.611   -2.022  1.00 2.41  ?  332  ASP A C     1 
ATOM   1562 O  O     . ASP A 1 206 ? -1.997  1.760   -1.120  1.00 4.32  ?  332  ASP A O     1 
ATOM   1563 C  CB    . ASP A 1 206 ? -0.872  1.402   -3.923  1.00 3.55  ?  332  ASP A CB    1 
ATOM   1564 C  CG    . ASP A 1 206 ? 0.136   1.423   -5.058  1.00 13.61 ?  332  ASP A CG    1 
ATOM   1565 O  OD1   . ASP A 1 206 ? -0.109  2.117   -6.047  1.00 19.51 ?  332  ASP A OD1   1 
ATOM   1566 O  OD2   . ASP A 1 206 ? 1.167   0.764   -4.949  1.00 22.52 ?  332  ASP A OD2   1 
ATOM   1567 N  N     . PHE A 1 207 ? -2.741  3.596   -2.230  1.00 3.01  ?  333  PHE A N     1 
ATOM   1568 C  CA    . PHE A 1 207 ? -3.963  3.728   -1.430  1.00 2.73  ?  333  PHE A CA    1 
ATOM   1569 C  C     . PHE A 1 207 ? -5.178  3.809   -2.315  1.00 3.43  ?  333  PHE A C     1 
ATOM   1570 O  O     . PHE A 1 207 ? -5.155  4.444   -3.375  1.00 6.32  ?  333  PHE A O     1 
ATOM   1571 C  CB    . PHE A 1 207 ? -3.931  4.984   -0.545  1.00 3.79  ?  333  PHE A CB    1 
ATOM   1572 C  CG    . PHE A 1 207 ? -2.856  4.957   0.521   1.00 2.88  ?  333  PHE A CG    1 
ATOM   1573 C  CD1   . PHE A 1 207 ? -2.940  4.069   1.581   1.00 4.38  ?  333  PHE A CD1   1 
ATOM   1574 C  CD2   . PHE A 1 207 ? -1.809  5.858   0.481   1.00 6.21  ?  333  PHE A CD2   1 
ATOM   1575 C  CE1   . PHE A 1 207 ? -1.938  4.048   2.597   1.00 6.70  ?  333  PHE A CE1   1 
ATOM   1576 C  CE2   . PHE A 1 207 ? -0.808  5.847   1.482   1.00 9.82  ?  333  PHE A CE2   1 
ATOM   1577 C  CZ    . PHE A 1 207 ? -0.877  4.931   2.529   1.00 9.32  ?  333  PHE A CZ    1 
ATOM   1578 N  N     . LEU A 1 208 ? -6.261  3.164   -1.883  1.00 1.27  ?  334  LEU A N     1 
ATOM   1579 C  CA    . LEU A 1 208 ? -7.520  3.199   -2.609  1.00 2.42  ?  334  LEU A CA    1 
ATOM   1580 C  C     . LEU A 1 208 ? -8.538  3.885   -1.707  1.00 2.62  ?  334  LEU A C     1 
ATOM   1581 O  O     . LEU A 1 208 ? -8.704  3.501   -0.534  1.00 3.09  ?  334  LEU A O     1 
ATOM   1582 C  CB    . LEU A 1 208 ? -7.950  1.765   -2.903  1.00 2.42  ?  334  LEU A CB    1 
ATOM   1583 C  CG    . LEU A 1 208 ? -9.314  1.562   -3.535  1.00 3.18  ?  334  LEU A CG    1 
ATOM   1584 C  CD1   . LEU A 1 208 ? -9.413  2.239   -4.896  1.00 3.74  ?  334  LEU A CD1   1 
ATOM   1585 C  CD2   . LEU A 1 208 ? -9.549  0.051   -3.662  1.00 4.69  ?  334  LEU A CD2   1 
ATOM   1586 N  N     . ILE A 1 209 ? -9.249  4.865   -2.263  1.00 2.62  ?  335  ILE A N     1 
ATOM   1587 C  CA    . ILE A 1 209 ? -10.161 5.707   -1.484  1.00 2.45  ?  335  ILE A CA    1 
ATOM   1588 C  C     . ILE A 1 209 ? -11.589 5.546   -1.995  1.00 4.99  ?  335  ILE A C     1 
ATOM   1589 O  O     . ILE A 1 209 ? -11.798 5.515   -3.201  1.00 3.83  ?  335  ILE A O     1 
ATOM   1590 C  CB    . ILE A 1 209 ? -9.713  7.172   -1.680  1.00 3.47  ?  335  ILE A CB    1 
ATOM   1591 C  CG1   . ILE A 1 209 ? -8.298  7.375   -1.109  1.00 5.76  ?  335  ILE A CG1   1 
ATOM   1592 C  CG2   . ILE A 1 209 ? -10.680 8.126   -0.962  1.00 4.66  ?  335  ILE A CG2   1 
ATOM   1593 C  CD1   . ILE A 1 209 ? -7.669  8.662   -1.586  1.00 7.82  ?  335  ILE A CD1   1 
ATOM   1594 N  N     . THR A 1 210 ? -12.576 5.405   -1.100  1.00 3.13  ?  336  THR A N     1 
ATOM   1595 C  CA    . THR A 1 210 ? -13.958 5.302   -1.573  1.00 3.51  ?  336  THR A CA    1 
ATOM   1596 C  C     . THR A 1 210 ? -14.842 5.954   -0.518  1.00 4.66  ?  336  THR A C     1 
ATOM   1597 O  O     . THR A 1 210 ? -14.332 6.509   0.455   1.00 6.43  ?  336  THR A O     1 
ATOM   1598 C  CB    . THR A 1 210 ? -14.366 3.833   -1.870  1.00 5.11  ?  336  THR A CB    1 
ATOM   1599 O  OG1   . THR A 1 210 ? -15.607 3.783   -2.580  1.00 7.09  ?  336  THR A OG1   1 
ATOM   1600 C  CG2   . THR A 1 210 ? -14.501 3.006   -0.576  1.00 6.19  ?  336  THR A CG2   1 
ATOM   1601 N  N     . HIS A 1 211 ? -16.145 5.901   -0.726  1.00 5.02  ?  337  HIS A N     1 
ATOM   1602 C  CA    . HIS A 1 211 ? -17.091 6.412   0.266   1.00 6.20  ?  337  HIS A CA    1 
ATOM   1603 C  C     . HIS A 1 211 ? -18.277 5.456   0.224   1.00 8.97  ?  337  HIS A C     1 
ATOM   1604 O  O     . HIS A 1 211 ? -18.670 4.980   -0.847  1.00 8.06  ?  337  HIS A O     1 
ATOM   1605 C  CB    . HIS A 1 211 ? -17.522 7.842   -0.091  1.00 4.92  ?  337  HIS A CB    1 
ATOM   1606 C  CG    . HIS A 1 211 ? -18.372 8.476   0.965   1.00 8.45  ?  337  HIS A CG    1 
ATOM   1607 N  ND1   . HIS A 1 211 ? -19.719 8.204   1.087   1.00 13.04 ?  337  HIS A ND1   1 
ATOM   1608 C  CD2   . HIS A 1 211 ? -18.062 9.328   1.970   1.00 11.10 ?  337  HIS A CD2   1 
ATOM   1609 C  CE1   . HIS A 1 211 ? -20.204 8.870   2.121   1.00 10.71 ?  337  HIS A CE1   1 
ATOM   1610 N  NE2   . HIS A 1 211 ? -19.224 9.567   2.667   1.00 9.20  ?  337  HIS A NE2   1 
ATOM   1611 N  N     . PRO A 1 212 ? -18.871 5.177   1.397   1.00 8.28  ?  338  PRO A N     1 
ATOM   1612 C  CA    . PRO A 1 212 ? -19.956 4.179   1.404   1.00 11.11 ?  338  PRO A CA    1 
ATOM   1613 C  C     . PRO A 1 212 ? -21.233 4.582   0.651   1.00 12.52 ?  338  PRO A C     1 
ATOM   1614 O  O     . PRO A 1 212 ? -22.050 3.713   0.330   1.00 12.91 ?  338  PRO A O     1 
ATOM   1615 C  CB    . PRO A 1 212 ? -20.241 3.978   2.911   1.00 12.85 ?  338  PRO A CB    1 
ATOM   1616 C  CG    . PRO A 1 212 ? -19.654 5.156   3.598   1.00 14.61 ?  338  PRO A CG    1 
ATOM   1617 C  CD    . PRO A 1 212 ? -18.497 5.633   2.749   1.00 11.31 ?  338  PRO A CD    1 
ATOM   1618 N  N     . LYS A 1 213 ? -21.425 5.869   0.394   1.00 11.45 ?  339  LYS A N     1 
ATOM   1619 C  CA    . LYS A 1 213 ? -22.601 6.335   -0.351  1.00 10.41 ?  339  LYS A CA    1 
ATOM   1620 C  C     . LYS A 1 213 ? -22.244 6.545   -1.816  1.00 10.10 ?  339  LYS A C     1 
ATOM   1621 O  O     . LYS A 1 213 ? -21.503 7.470   -2.175  1.00 9.37  ?  339  LYS A O     1 
ATOM   1622 C  CB    . LYS A 1 213 ? -23.177 7.611   0.270   1.00 13.00 ?  339  LYS A CB    1 
ATOM   1623 C  CG    . LYS A 1 213 ? -24.418 8.139   -0.432  1.00 21.31 ?  339  LYS A CG    1 
ATOM   1624 N  N     . GLU A 1 214 ? -22.730 5.630   -2.653  1.00 11.10 ?  340  GLU A N     1 
ATOM   1625 C  CA    . GLU A 1 214 ? -22.456 5.664   -4.090  1.00 9.23  ?  340  GLU A CA    1 
ATOM   1626 C  C     . GLU A 1 214 ? -22.689 7.050   -4.698  1.00 12.78 ?  340  GLU A C     1 
ATOM   1627 O  O     . GLU A 1 214 ? -23.776 7.642   -4.552  1.00 13.77 ?  340  GLU A O     1 
ATOM   1628 C  CB    . GLU A 1 214 ? -23.319 4.635   -4.826  1.00 14.00 ?  340  GLU A CB    1 
ATOM   1629 C  CG    . GLU A 1 214 ? -23.035 4.559   -6.323  1.00 10.57 ?  340  GLU A CG    1 
ATOM   1630 C  CD    . GLU A 1 214 ? -21.852 3.635   -6.644  1.00 12.69 ?  340  GLU A CD    1 
ATOM   1631 O  OE1   . GLU A 1 214 ? -21.385 2.964   -5.712  1.00 15.84 ?  340  GLU A OE1   1 
ATOM   1632 O  OE2   . GLU A 1 214 ? -21.440 3.577   -7.815  1.00 13.66 ?  340  GLU A OE2   1 
ATOM   1633 N  N     . GLY A 1 215 ? -21.654 7.570   -5.345  1.00 9.63  ?  341  GLY A N     1 
ATOM   1634 C  CA    . GLY A 1 215 ? -21.703 8.852   -6.028  1.00 11.81 ?  341  GLY A CA    1 
ATOM   1635 C  C     . GLY A 1 215 ? -21.034 9.972   -5.240  1.00 13.33 ?  341  GLY A C     1 
ATOM   1636 O  O     . GLY A 1 215 ? -20.593 10.978  -5.819  1.00 12.53 ?  341  GLY A O     1 
ATOM   1637 N  N     . GLN A 1 216 ? -20.948 9.806   -3.920  1.00 8.84  ?  342  GLN A N     1 
ATOM   1638 C  CA    . GLN A 1 216 ? -20.311 10.815  -3.085  1.00 9.42  ?  342  GLN A CA    1 
ATOM   1639 C  C     . GLN A 1 216 ? -18.826 10.968  -3.420  1.00 8.60  ?  342  GLN A C     1 
ATOM   1640 O  O     . GLN A 1 216 ? -18.216 11.979  -3.114  1.00 10.78 ?  342  GLN A O     1 
ATOM   1641 C  CB    . GLN A 1 216 ? -20.510 10.500  -1.606  1.00 10.44 ?  342  GLN A CB    1 
ATOM   1642 C  CG    . GLN A 1 216 ? -21.965 10.796  -1.120  1.00 9.62  ?  342  GLN A CG    1 
ATOM   1643 C  CD    . GLN A 1 216 ? -22.344 12.262  -1.303  1.00 16.15 ?  342  GLN A CD    1 
ATOM   1644 O  OE1   . GLN A 1 216 ? -21.799 13.161  -0.639  1.00 15.87 ?  342  GLN A OE1   1 
ATOM   1645 N  NE2   . GLN A 1 216 ? -23.280 12.511  -2.211  1.00 15.63 ?  342  GLN A NE2   1 
ATOM   1646 N  N     . GLU A 1 217 ? -18.248 9.933   -4.037  1.00 9.80  ?  343  GLU A N     1 
ATOM   1647 C  CA    . GLU A 1 217 ? -16.813 9.965   -4.357  1.00 8.33  ?  343  GLU A CA    1 
ATOM   1648 C  C     . GLU A 1 217 ? -16.503 10.843  -5.551  1.00 9.05  ?  343  GLU A C     1 
ATOM   1649 O  O     . GLU A 1 217 ? -15.329 11.106  -5.807  1.00 8.28  ?  343  GLU A O     1 
ATOM   1650 C  CB    . GLU A 1 217 ? -16.275 8.532   -4.614  1.00 8.53  ?  343  GLU A CB    1 
ATOM   1651 C  CG    . GLU A 1 217 ? -16.570 7.978   -6.007  1.00 13.25 ?  343  GLU A CG    1 
ATOM   1652 C  CD    . GLU A 1 217 ? -18.038 7.748   -6.276  1.00 10.97 ?  343  GLU A CD    1 
ATOM   1653 O  OE1   . GLU A 1 217 ? -18.813 7.567   -5.317  1.00 9.38  ?  343  GLU A OE1   1 
ATOM   1654 O  OE2   . GLU A 1 217 ? -18.426 7.752   -7.463  1.00 18.45 ?  343  GLU A OE2   1 
ATOM   1655 N  N     . ALA A 1 218 ? -17.525 11.274  -6.288  1.00 10.07 ?  344  ALA A N     1 
ATOM   1656 C  CA    . ALA A 1 218 ? -17.315 12.104  -7.479  1.00 10.75 ?  344  ALA A CA    1 
ATOM   1657 C  C     . ALA A 1 218 ? -16.566 13.363  -7.122  1.00 9.75  ?  344  ALA A C     1 
ATOM   1658 O  O     . ALA A 1 218 ? -16.909 14.022  -6.160  1.00 11.78 ?  344  ALA A O     1 
ATOM   1659 C  CB    . ALA A 1 218 ? -18.649 12.474  -8.123  1.00 15.23 ?  344  ALA A CB    1 
ATOM   1660 N  N     . GLY A 1 219 ? -15.525 13.690  -7.883  1.00 10.91 ?  345  GLY A N     1 
ATOM   1661 C  CA    . GLY A 1 219 ? -14.746 14.898  -7.632  1.00 11.03 ?  345  GLY A CA    1 
ATOM   1662 C  C     . GLY A 1 219 ? -13.849 14.889  -6.407  1.00 10.42 ?  345  GLY A C     1 
ATOM   1663 O  O     . GLY A 1 219 ? -13.314 15.931  -6.004  1.00 9.31  ?  345  GLY A O     1 
ATOM   1664 N  N     . LEU A 1 220 ? -13.647 13.714  -5.810  1.00 7.10  ?  346  LEU A N     1 
ATOM   1665 C  CA    . LEU A 1 220 ? -12.944 13.646  -4.553  1.00 7.12  ?  346  LEU A CA    1 
ATOM   1666 C  C     . LEU A 1 220 ? -11.441 13.889  -4.678  1.00 7.38  ?  346  LEU A C     1 
ATOM   1667 O  O     . LEU A 1 220 ? -10.841 14.588  -3.873  1.00 8.05  ?  346  LEU A O     1 
ATOM   1668 C  CB    . LEU A 1 220 ? -13.180 12.290  -3.904  1.00 7.26  ?  346  LEU A CB    1 
ATOM   1669 C  CG    . LEU A 1 220 ? -12.535 12.088  -2.533  1.00 7.68  ?  346  LEU A CG    1 
ATOM   1670 C  CD1   . LEU A 1 220 ? -12.873 13.223  -1.587  1.00 9.08  ?  346  LEU A CD1   1 
ATOM   1671 C  CD2   . LEU A 1 220 ? -12.978 10.752  -1.946  1.00 9.39  ?  346  LEU A CD2   1 
ATOM   1672 N  N     . LEU A 1 221 ? -10.815 13.254  -5.654  1.00 7.03  ?  347  LEU A N     1 
ATOM   1673 C  CA    . LEU A 1 221 ? -9.359  13.310  -5.680  1.00 6.91  ?  347  LEU A CA    1 
ATOM   1674 C  C     . LEU A 1 221 ? -8.738  14.727  -5.749  1.00 6.92  ?  347  LEU A C     1 
ATOM   1675 O  O     . LEU A 1 221 ? -7.791  14.988  -5.063  1.00 8.42  ?  347  LEU A O     1 
ATOM   1676 C  CB    . LEU A 1 221 ? -8.795  12.332  -6.729  1.00 7.84  ?  347  LEU A CB    1 
ATOM   1677 C  CG    . LEU A 1 221 ? -7.297  12.063  -6.593  1.00 12.13 ?  347  LEU A CG    1 
ATOM   1678 C  CD1   . LEU A 1 221 ? -6.952  11.580  -5.182  1.00 11.19 ?  347  LEU A CD1   1 
ATOM   1679 C  CD2   . LEU A 1 221 ? -6.915  11.031  -7.633  1.00 14.62 ?  347  LEU A CD2   1 
ATOM   1680 N  N     . PRO A 1 222 ? -9.296  15.629  -6.561  1.00 7.66  ?  348  PRO A N     1 
ATOM   1681 C  CA    . PRO A 1 222 ? -8.753  16.996  -6.551  1.00 9.13  ?  348  PRO A CA    1 
ATOM   1682 C  C     . PRO A 1 222 ? -8.855  17.636  -5.178  1.00 9.31  ?  348  PRO A C     1 
ATOM   1683 O  O     . PRO A 1 222 ? -7.951  18.378  -4.778  1.00 10.17 ?  348  PRO A O     1 
ATOM   1684 C  CB    . PRO A 1 222 ? -9.629  17.730  -7.570  1.00 9.14  ?  348  PRO A CB    1 
ATOM   1685 C  CG    . PRO A 1 222 ? -10.194 16.658  -8.447  1.00 19.12 ?  348  PRO A CG    1 
ATOM   1686 C  CD    . PRO A 1 222 ? -10.302 15.421  -7.606  1.00 9.56  ?  348  PRO A CD    1 
ATOM   1687 N  N     . ARG A 1 223 ? -9.935  17.359  -4.442  1.00 8.62  ?  349  ARG A N     1 
ATOM   1688 C  CA    . ARG A 1 223 ? -10.055 17.917  -3.097  1.00 9.88  ?  349  ARG A CA    1 
ATOM   1689 C  C     . ARG A 1 223 ? -9.024  17.354  -2.130  1.00 8.17  ?  349  ARG A C     1 
ATOM   1690 O  O     . ARG A 1 223 ? -8.472  18.055  -1.294  1.00 9.07  ?  349  ARG A O     1 
ATOM   1691 C  CB    . ARG A 1 223 ? -11.470 17.728  -2.553  1.00 7.27  ?  349  ARG A CB    1 
ATOM   1692 C  CG    . ARG A 1 223 ? -12.526 18.422  -3.401  1.00 9.26  ?  349  ARG A CG    1 
ATOM   1693 C  CD    . ARG A 1 223 ? -13.950 18.066  -2.942  1.00 9.32  ?  349  ARG A CD    1 
ATOM   1694 N  NE    . ARG A 1 223 ? -14.119 18.130  -1.501  1.00 10.18 ?  349  ARG A NE    1 
ATOM   1695 C  CZ    . ARG A 1 223 ? -14.316 19.269  -0.826  1.00 9.69  ?  349  ARG A CZ    1 
ATOM   1696 N  NH1   . ARG A 1 223 ? -14.335 20.420  -1.484  1.00 9.83  ?  349  ARG A NH1   1 
ATOM   1697 N  NH2   . ARG A 1 223 ? -14.452 19.244  0.494   1.00 10.00 ?  349  ARG A NH2   1 
ATOM   1698 N  N     . VAL A 1 224 ? -8.723  16.061  -2.272  1.00 7.67  ?  350  VAL A N     1 
ATOM   1699 C  CA    . VAL A 1 224 ? -7.704  15.434  -1.471  1.00 7.66  ?  350  VAL A CA    1 
ATOM   1700 C  C     . VAL A 1 224 ? -6.315  15.995  -1.804  1.00 5.29  ?  350  VAL A C     1 
ATOM   1701 O  O     . VAL A 1 224 ? -5.540  16.314  -0.911  1.00 8.45  ?  350  VAL A O     1 
ATOM   1702 C  CB    . VAL A 1 224 ? -7.739  13.909  -1.686  1.00 4.74  ?  350  VAL A CB    1 
ATOM   1703 C  CG1   . VAL A 1 224 ? -6.561  13.249  -0.942  1.00 5.69  ?  350  VAL A CG1   1 
ATOM   1704 C  CG2   . VAL A 1 224 ? -9.099  13.367  -1.174  1.00 6.32  ?  350  VAL A CG2   1 
ATOM   1705 N  N     . MET A 1 225 ? -6.007  16.118  -3.089  1.00 7.25  ?  351  MET A N     1 
ATOM   1706 C  CA    . MET A 1 225 ? -4.659  16.570  -3.480  1.00 6.69  ?  351  MET A CA    1 
ATOM   1707 C  C     . MET A 1 225 ? -4.430  18.019  -3.055  1.00 9.28  ?  351  MET A C     1 
ATOM   1708 O  O     . MET A 1 225 ? -3.376  18.351  -2.548  1.00 12.90 ?  351  MET A O     1 
ATOM   1709 C  CB    . MET A 1 225 ? -4.451  16.420  -4.982  1.00 10.77 ?  351  MET A CB    1 
ATOM   1710 C  CG    . MET A 1 225 ? -4.447  14.989  -5.506  1.00 10.36 ?  351  MET A CG    1 
ATOM   1711 S  SD    . MET A 1 225 ? -3.300  13.957  -4.573  1.00 13.94 ?  351  MET A SD    1 
ATOM   1712 C  CE    . MET A 1 225 ? -1.758  14.848  -4.773  1.00 19.00 ?  351  MET A CE    1 
ATOM   1713 N  N     . CYS A 1 226 ? -5.455  18.853  -3.206  1.00 9.72  ?  352  CYS A N     1 
ATOM   1714 C  CA    . CYS A 1 226 ? -5.317  20.253  -2.779  1.00 15.09 ?  352  CYS A CA    1 
ATOM   1715 C  C     . CYS A 1 226 ? -4.985  20.358  -1.302  1.00 12.50 ?  352  CYS A C     1 
ATOM   1716 O  O     . CYS A 1 226 ? -4.152  21.181  -0.912  1.00 14.71 ?  352  CYS A O     1 
ATOM   1717 C  CB    . CYS A 1 226 ? -6.583  21.048  -3.109  1.00 17.54 ?  352  CYS A CB    1 
ATOM   1718 S  SG    . CYS A 1 226 ? -6.688  21.434  -4.861  1.00 34.25 ?  352  CYS A SG    1 
ATOM   1719 N  N     . ARG A 1 227 ? -5.613  19.518  -0.490  1.00 8.02  ?  353  ARG A N     1 
ATOM   1720 C  CA    . ARG A 1 227 ? -5.411  19.527  0.929   1.00 8.97  ?  353  ARG A CA    1 
ATOM   1721 C  C     . ARG A 1 227 ? -4.014  19.004  1.296   1.00 11.76 ?  353  ARG A C     1 
ATOM   1722 O  O     . ARG A 1 227 ? -3.341  19.574  2.141   1.00 14.24 ?  353  ARG A O     1 
ATOM   1723 C  CB    . ARG A 1 227 ? -6.527  18.759  1.646   1.00 9.57  ?  353  ARG A CB    1 
ATOM   1724 C  CG    . ARG A 1 227 ? -7.838  19.617  1.724   1.00 9.52  ?  353  ARG A CG    1 
ATOM   1725 C  CD    . ARG A 1 227 ? -9.125  18.803  1.867   1.00 10.81 ?  353  ARG A CD    1 
ATOM   1726 N  NE    . ARG A 1 227 ? -10.215 19.780  2.049   1.00 11.86 ?  353  ARG A NE    1 
ATOM   1727 C  CZ    . ARG A 1 227 ? -10.798 20.423  1.048   1.00 15.74 ?  353  ARG A CZ    1 
ATOM   1728 N  NH1   . ARG A 1 227 ? -10.470 20.137  -0.201  1.00 12.92 ?  353  ARG A NH1   1 
ATOM   1729 N  NH2   . ARG A 1 227 ? -11.741 21.350  1.296   1.00 10.82 ?  353  ARG A NH2   1 
ATOM   1730 N  N     . LEU A 1 228 ? -3.585  17.926  0.657   1.00 11.24 ?  354  LEU A N     1 
ATOM   1731 C  CA    . LEU A 1 228 ? -2.228  17.448  0.914   1.00 7.58  ?  354  LEU A CA    1 
ATOM   1732 C  C     . LEU A 1 228 ? -1.196  18.480  0.486   1.00 7.76  ?  354  LEU A C     1 
ATOM   1733 O  O     . LEU A 1 228 ? -0.130  18.632  1.132   1.00 12.27 ?  354  LEU A O     1 
ATOM   1734 C  CB    . LEU A 1 228 ? -1.988  16.130  0.165   1.00 8.16  ?  354  LEU A CB    1 
ATOM   1735 C  CG    . LEU A 1 228 ? -2.838  14.958  0.669   1.00 12.04 ?  354  LEU A CG    1 
ATOM   1736 C  CD1   . LEU A 1 228 ? -2.772  13.809  -0.334  1.00 10.39 ?  354  LEU A CD1   1 
ATOM   1737 C  CD2   . LEU A 1 228 ? -2.344  14.510  1.981   1.00 12.34 ?  354  LEU A CD2   1 
ATOM   1738 N  N     . GLN A 1 229 ? -1.474  19.168  -0.610  1.00 9.20  ?  355  GLN A N     1 
ATOM   1739 C  CA    . GLN A 1 229 ? -0.540  20.175  -1.096  1.00 14.58 ?  355  GLN A CA    1 
ATOM   1740 C  C     . GLN A 1 229 ? -0.482  21.327  -0.100  1.00 15.90 ?  355  GLN A C     1 
ATOM   1741 O  O     . GLN A 1 229 ? 0.589   21.822  0.219   1.00 16.38 ?  355  GLN A O     1 
ATOM   1742 C  CB    . GLN A 1 229 ? -0.928  20.676  -2.493  1.00 15.14 ?  355  GLN A CB    1 
ATOM   1743 C  CG    . GLN A 1 229 ? 0.031   21.743  -3.024  1.00 30.36 ?  355  GLN A CG    1 
ATOM   1744 C  CD    . GLN A 1 229 ? 0.923   21.213  -4.123  1.00 49.68 ?  355  GLN A CD    1 
ATOM   1745 O  OE1   . GLN A 1 229 ? 0.460   20.941  -5.236  1.00 64.56 ?  355  GLN A OE1   1 
ATOM   1746 N  NE2   . GLN A 1 229 ? 2.207   21.047  -3.819  1.00 37.67 ?  355  GLN A NE2   1 
ATOM   1747 N  N     . ASP A 1 230 ? -1.641  21.710  0.426   1.00 15.02 ?  356  ASP A N     1 
ATOM   1748 C  CA    . ASP A 1 230 ? -1.706  22.774  1.429   1.00 23.60 ?  356  ASP A CA    1 
ATOM   1749 C  C     . ASP A 1 230 ? -0.940  22.445  2.695   1.00 25.32 ?  356  ASP A C     1 
ATOM   1750 O  O     . ASP A 1 230 ? -0.470  23.356  3.382   1.00 27.22 ?  356  ASP A O     1 
ATOM   1751 C  CB    . ASP A 1 230 ? -3.158  23.107  1.765   1.00 19.38 ?  356  ASP A CB    1 
ATOM   1752 C  CG    . ASP A 1 230 ? -3.819  23.918  0.676   1.00 33.58 ?  356  ASP A CG    1 
ATOM   1753 O  OD1   . ASP A 1 230 ? -3.070  24.439  -0.187  1.00 43.27 ?  356  ASP A OD1   1 
ATOM   1754 O  OD2   . ASP A 1 230 ? -5.071  24.036  0.673   1.00 38.87 ?  356  ASP A OD2   1 
ATOM   1755 N  N     . GLN A 1 231 ? -0.819  21.155  3.002   1.00 16.54 ?  357  GLN A N     1 
ATOM   1756 C  CA    A GLN A 1 231 ? -0.103  20.725  4.190   0.70 14.13 ?  357  GLN A CA    1 
ATOM   1757 C  CA    B GLN A 1 231 ? -0.108  20.691  4.190   0.30 14.28 ?  357  GLN A CA    1 
ATOM   1758 C  C     . GLN A 1 231 ? 1.403   20.605  3.958   1.00 12.96 ?  357  GLN A C     1 
ATOM   1759 O  O     . GLN A 1 231 ? 2.151   20.288  4.874   1.00 15.93 ?  357  GLN A O     1 
ATOM   1760 C  CB    A GLN A 1 231 ? -0.655  19.405  4.686   0.70 19.30 ?  357  GLN A CB    1 
ATOM   1761 C  CB    B GLN A 1 231 ? -0.634  19.324  4.638   0.30 19.19 ?  357  GLN A CB    1 
ATOM   1762 C  CG    A GLN A 1 231 ? -2.073  19.536  5.223   0.70 20.58 ?  357  GLN A CG    1 
ATOM   1763 C  CG    B GLN A 1 231 ? -2.059  19.340  5.198   0.30 20.58 ?  357  GLN A CG    1 
ATOM   1764 C  CD    A GLN A 1 231 ? -2.620  18.212  5.647   0.70 30.12 ?  357  GLN A CD    1 
ATOM   1765 C  CD    B GLN A 1 231 ? -2.162  20.038  6.543   0.30 19.33 ?  357  GLN A CD    1 
ATOM   1766 O  OE1   A GLN A 1 231 ? -1.856  17.297  5.951   0.70 33.23 ?  357  GLN A OE1   1 
ATOM   1767 O  OE1   B GLN A 1 231 ? -1.383  19.769  7.460   0.30 17.06 ?  357  GLN A OE1   1 
ATOM   1768 N  NE2   A GLN A 1 231 ? -3.948  18.080  5.660   0.70 32.21 ?  357  GLN A NE2   1 
ATOM   1769 N  NE2   B GLN A 1 231 ? -3.127  20.942  6.665   0.30 17.97 ?  357  GLN A NE2   1 
ATOM   1770 N  N     . GLY A 1 232 ? 1.829   20.889  2.733   1.00 14.21 ?  358  GLY A N     1 
ATOM   1771 C  CA    . GLY A 1 232 ? 3.236   20.856  2.383   1.00 11.89 ?  358  GLY A CA    1 
ATOM   1772 C  C     . GLY A 1 232 ? 3.791   19.467  2.175   1.00 14.92 ?  358  GLY A C     1 
ATOM   1773 O  O     . GLY A 1 232 ? 5.004   19.252  2.217   1.00 13.30 ?  358  GLY A O     1 
ATOM   1774 N  N     . LEU A 1 233 ? 2.900   18.516  1.951   1.00 11.79 ?  359  LEU A N     1 
ATOM   1775 C  CA    . LEU A 1 233 ? 3.313   17.111  1.865   1.00 13.91 ?  359  LEU A CA    1 
ATOM   1776 C  C     . LEU A 1 233 ? 3.622   16.630  0.464   1.00 11.28 ?  359  LEU A C     1 
ATOM   1777 O  O     . LEU A 1 233 ? 4.133   15.528  0.281   1.00 11.47 ?  359  LEU A O     1 
ATOM   1778 C  CB    . LEU A 1 233 ? 2.181   16.243  2.410   1.00 11.10 ?  359  LEU A CB    1 
ATOM   1779 C  CG    . LEU A 1 233 ? 2.008   16.550  3.885   1.00 18.82 ?  359  LEU A CG    1 
ATOM   1780 C  CD1   . LEU A 1 233 ? 0.725   15.905  4.363   1.00 27.09 ?  359  LEU A CD1   1 
ATOM   1781 C  CD2   . LEU A 1 233 ? 3.214   16.073  4.677   1.00 30.14 ?  359  LEU A CD2   1 
ATOM   1782 N  N     . ILE A 1 234 ? 3.304   17.419  -0.535  1.00 8.12  ?  360  ILE A N     1 
ATOM   1783 C  CA    . ILE A 1 234 ? 3.437   16.980  -1.903  1.00 7.36  ?  360  ILE A CA    1 
ATOM   1784 C  C     . ILE A 1 234 ? 4.657   17.608  -2.579  1.00 11.43 ?  360  ILE A C     1 
ATOM   1785 O  O     . ILE A 1 234 ? 4.688   18.818  -2.825  1.00 12.76 ?  360  ILE A O     1 
ATOM   1786 C  CB    . ILE A 1 234 ? 2.170   17.249  -2.744  1.00 8.79  ?  360  ILE A CB    1 
ATOM   1787 C  CG1   . ILE A 1 234 ? 0.933   16.658  -2.062  1.00 7.53  ?  360  ILE A CG1   1 
ATOM   1788 C  CG2   . ILE A 1 234 ? 2.319   16.731  -4.183  1.00 12.02 ?  360  ILE A CG2   1 
ATOM   1789 C  CD1   . ILE A 1 234 ? 0.974   15.113  -1.918  1.00 11.74 ?  360  ILE A CD1   1 
ATOM   1790 N  N     . LEU A 1 235 ? 5.636   16.779  -2.904  1.00 7.41  ?  361  LEU A N     1 
ATOM   1791 C  CA    . LEU A 1 235 ? 6.825   17.275  -3.586  1.00 9.51  ?  361  LEU A CA    1 
ATOM   1792 C  C     . LEU A 1 235 ? 6.595   17.369  -5.084  1.00 11.12 ?  361  LEU A C     1 
ATOM   1793 O  O     . LEU A 1 235 ? 7.187   18.220  -5.771  1.00 14.64 ?  361  LEU A O     1 
ATOM   1794 C  CB    . LEU A 1 235 ? 8.011   16.369  -3.278  1.00 5.39  ?  361  LEU A CB    1 
ATOM   1795 C  CG    . LEU A 1 235 ? 8.530   16.472  -1.844  1.00 10.55 ?  361  LEU A CG    1 
ATOM   1796 C  CD1   . LEU A 1 235 ? 9.405   15.313  -1.439  1.00 9.70  ?  361  LEU A CD1   1 
ATOM   1797 C  CD2   . LEU A 1 235 ? 9.349   17.781  -1.698  1.00 10.43 ?  361  LEU A CD2   1 
ATOM   1798 N  N     . TYR A 1 236 ? 5.745   16.487  -5.606  1.00 7.97  ?  362  TYR A N     1 
ATOM   1799 C  CA    . TYR A 1 236 ? 5.410   16.480  -7.014  1.00 8.06  ?  362  TYR A CA    1 
ATOM   1800 C  C     . TYR A 1 236 ? 4.052   15.843  -7.239  1.00 12.35 ?  362  TYR A C     1 
ATOM   1801 O  O     . TYR A 1 236 ? 3.761   14.761  -6.710  1.00 10.88 ?  362  TYR A O     1 
ATOM   1802 C  CB    . TYR A 1 236 ? 6.454   15.714  -7.833  1.00 11.35 ?  362  TYR A CB    1 
ATOM   1803 C  CG    . TYR A 1 236 ? 5.986   15.554  -9.269  1.00 16.50 ?  362  TYR A CG    1 
ATOM   1804 C  CD1   . TYR A 1 236 ? 6.234   16.548  -10.205 1.00 26.48 ?  362  TYR A CD1   1 
ATOM   1805 C  CD2   . TYR A 1 236 ? 5.256   14.440  -9.669  1.00 13.11 ?  362  TYR A CD2   1 
ATOM   1806 C  CE1   . TYR A 1 236 ? 5.784   16.430  -11.511 1.00 19.80 ?  362  TYR A CE1   1 
ATOM   1807 C  CE2   . TYR A 1 236 ? 4.792   14.319  -10.964 1.00 22.48 ?  362  TYR A CE2   1 
ATOM   1808 C  CZ    . TYR A 1 236 ? 5.071   15.317  -11.875 1.00 18.93 ?  362  TYR A CZ    1 
ATOM   1809 O  OH    . TYR A 1 236 ? 4.618   15.183  -13.165 1.00 39.03 ?  362  TYR A OH    1 
ATOM   1810 N  N     . HIS A 1 237 ? 3.199   16.503  -8.025  1.00 11.02 ?  363  HIS A N     1 
ATOM   1811 C  CA    . HIS A 1 237 ? 2.023   15.835  -8.587  1.00 11.18 ?  363  HIS A CA    1 
ATOM   1812 C  C     . HIS A 1 237 ? 1.685   16.501  -9.907  1.00 17.35 ?  363  HIS A C     1 
ATOM   1813 O  O     . HIS A 1 237 ? 2.121   17.629  -10.158 1.00 17.35 ?  363  HIS A O     1 
ATOM   1814 C  CB    . HIS A 1 237 ? 0.819   15.821  -7.619  1.00 15.69 ?  363  HIS A CB    1 
ATOM   1815 C  CG    . HIS A 1 237 ? 0.276   17.172  -7.281  0.50 10.97 ?  363  HIS A CG    1 
ATOM   1816 N  ND1   . HIS A 1 237 ? -1.048  17.373  -6.948  0.50 28.63 ?  363  HIS A ND1   1 
ATOM   1817 C  CD2   . HIS A 1 237 ? 0.866   18.391  -7.225  0.50 29.08 ?  363  HIS A CD2   1 
ATOM   1818 C  CE1   . HIS A 1 237 ? -1.247  18.654  -6.689  0.50 20.74 ?  363  HIS A CE1   1 
ATOM   1819 N  NE2   . HIS A 1 237 ? -0.103  19.294  -6.854  0.50 32.20 ?  363  HIS A NE2   1 
ATOM   1820 N  N     . GLN A 1 238 ? 0.922   15.830  -10.756 1.00 21.27 ?  364  GLN A N     1 
ATOM   1821 C  CA    . GLN A 1 238 ? 0.564   16.450  -12.041 1.00 34.46 ?  364  GLN A CA    1 
ATOM   1822 C  C     . GLN A 1 238 ? -0.868  16.966  -12.095 1.00 42.73 ?  364  GLN A C     1 
ATOM   1823 O  O     . GLN A 1 238 ? -1.096  18.173  -12.001 1.00 43.20 ?  364  GLN A O     1 
ATOM   1824 C  CB    . GLN A 1 238 ? 0.853   15.519  -13.218 1.00 42.25 ?  364  GLN A CB    1 
ATOM   1825 C  CG    . GLN A 1 238 ? 0.387   14.105  -13.018 0.50 24.66 ?  364  GLN A CG    1 
ATOM   1826 C  CD    . GLN A 1 238 ? 0.812   13.185  -14.144 0.50 28.11 ?  364  GLN A CD    1 
ATOM   1827 O  OE1   . GLN A 1 238 ? 1.294   13.635  -15.191 0.50 30.29 ?  364  GLN A OE1   1 
ATOM   1828 N  NE2   . GLN A 1 238 ? 0.645   11.883  -13.933 0.50 19.05 ?  364  GLN A NE2   1 
ATOM   1829 N  N     . PHE A 1 259 ? -10.092 14.038  -12.060 1.00 18.20 ?  385  PHE A N     1 
ATOM   1830 C  CA    . PHE A 1 259 ? -9.216  12.859  -12.193 1.00 14.21 ?  385  PHE A CA    1 
ATOM   1831 C  C     . PHE A 1 259 ? -9.471  11.896  -11.053 1.00 19.19 ?  385  PHE A C     1 
ATOM   1832 O  O     . PHE A 1 259 ? -10.055 12.297  -10.043 1.00 17.75 ?  385  PHE A O     1 
ATOM   1833 C  CB    . PHE A 1 259 ? -7.735  13.271  -12.270 1.00 17.09 ?  385  PHE A CB    1 
ATOM   1834 C  CG    . PHE A 1 259 ? -7.263  14.138  -11.122 1.00 18.69 ?  385  PHE A CG    1 
ATOM   1835 C  CD1   . PHE A 1 259 ? -7.553  15.501  -11.084 1.00 31.93 ?  385  PHE A CD1   1 
ATOM   1836 C  CD2   . PHE A 1 259 ? -6.478  13.603  -10.105 1.00 19.20 ?  385  PHE A CD2   1 
ATOM   1837 C  CE1   . PHE A 1 259 ? -7.089  16.311  -10.028 1.00 33.29 ?  385  PHE A CE1   1 
ATOM   1838 C  CE2   . PHE A 1 259 ? -6.016  14.401  -9.053  1.00 17.51 ?  385  PHE A CE2   1 
ATOM   1839 C  CZ    . PHE A 1 259 ? -6.320  15.757  -9.010  1.00 21.01 ?  385  PHE A CZ    1 
ATOM   1840 N  N     . GLU A 1 260 ? -9.035  10.640  -11.208 1.00 12.12 ?  386  GLU A N     1 
ATOM   1841 C  CA    . GLU A 1 260 ? -9.289  9.612   -10.201 1.00 9.16  ?  386  GLU A CA    1 
ATOM   1842 C  C     . GLU A 1 260 ? -8.051  8.791   -9.803  1.00 11.69 ?  386  GLU A C     1 
ATOM   1843 O  O     . GLU A 1 260 ? -8.127  7.935   -8.924  1.00 8.31  ?  386  GLU A O     1 
ATOM   1844 C  CB    . GLU A 1 260 ? -10.373 8.663   -10.697 1.00 15.03 ?  386  GLU A CB    1 
ATOM   1845 C  CG    . GLU A 1 260 ? -9.945  7.817   -11.886 1.00 13.67 ?  386  GLU A CG    1 
ATOM   1846 C  CD    . GLU A 1 260 ? -11.112 7.456   -12.804 1.00 24.97 ?  386  GLU A CD    1 
ATOM   1847 O  OE1   . GLU A 1 260 ? -11.979 8.333   -13.021 1.00 38.37 ?  386  GLU A OE1   1 
ATOM   1848 O  OE2   . GLU A 1 260 ? -11.160 6.311   -13.323 1.00 18.87 ?  386  GLU A OE2   1 
ATOM   1849 N  N     . ARG A 1 261 ? -6.930  9.022   -10.485 1.00 8.36  ?  387  ARG A N     1 
ATOM   1850 C  CA    . ARG A 1 261 ? -5.639  8.399   -10.110 1.00 3.20  ?  387  ARG A CA    1 
ATOM   1851 C  C     . ARG A 1 261 ? -4.618  9.508   -10.035 1.00 6.32  ?  387  ARG A C     1 
ATOM   1852 O  O     . ARG A 1 261 ? -4.614  10.388  -10.916 1.00 8.87  ?  387  ARG A O     1 
ATOM   1853 C  CB    . ARG A 1 261 ? -5.169  7.408   -11.170 1.00 5.06  ?  387  ARG A CB    1 
ATOM   1854 C  CG    . ARG A 1 261 ? -6.094  6.235   -11.363 1.00 7.24  ?  387  ARG A CG    1 
ATOM   1855 C  CD    . ARG A 1 261 ? -5.649  5.372   -12.518 1.00 4.12  ?  387  ARG A CD    1 
ATOM   1856 N  NE    . ARG A 1 261 ? -6.629  4.326   -12.795 1.00 6.96  ?  387  ARG A NE    1 
ATOM   1857 C  CZ    . ARG A 1 261 ? -6.447  3.331   -13.643 1.00 9.27  ?  387  ARG A CZ    1 
ATOM   1858 N  NH1   . ARG A 1 261 ? -5.308  3.197   -14.320 1.00 8.88  ?  387  ARG A NH1   1 
ATOM   1859 N  NH2   . ARG A 1 261 ? -7.422  2.441   -13.800 1.00 9.48  ?  387  ARG A NH2   1 
ATOM   1860 N  N     . SER A 1 262 ? -3.784  9.480   -8.995  1.00 4.97  ?  388  SER A N     1 
ATOM   1861 C  CA    A SER A 1 262 ? -2.683  10.435  -8.846  0.50 6.48  ?  388  SER A CA    1 
ATOM   1862 C  CA    B SER A 1 262 ? -2.684  10.436  -8.853  0.50 6.48  ?  388  SER A CA    1 
ATOM   1863 C  C     . SER A 1 262 ? -1.395  9.687   -8.553  1.00 6.24  ?  388  SER A C     1 
ATOM   1864 O  O     . SER A 1 262 ? -1.342  8.898   -7.627  1.00 6.95  ?  388  SER A O     1 
ATOM   1865 C  CB    A SER A 1 262 ? -2.957  11.398  -7.687  0.50 11.03 ?  388  SER A CB    1 
ATOM   1866 C  CB    B SER A 1 262 ? -2.963  11.419  -7.712  0.50 11.05 ?  388  SER A CB    1 
ATOM   1867 O  OG    A SER A 1 262 ? -3.980  12.317  -8.019  0.50 23.92 ?  388  SER A OG    1 
ATOM   1868 O  OG    B SER A 1 262 ? -1.895  12.341  -7.564  0.50 10.69 ?  388  SER A OG    1 
ATOM   1869 N  N     . PHE A 1 263 ? -0.347  9.947   -9.340  1.00 6.09  ?  389  PHE A N     1 
ATOM   1870 C  CA    . PHE A 1 263 ? 0.943   9.318   -9.112  1.00 7.99  ?  389  PHE A CA    1 
ATOM   1871 C  C     . PHE A 1 263 ? 1.861   10.394  -8.602  1.00 10.12 ?  389  PHE A C     1 
ATOM   1872 O  O     . PHE A 1 263 ? 2.289   11.256  -9.367  1.00 12.14 ?  389  PHE A O     1 
ATOM   1873 C  CB    . PHE A 1 263 ? 1.445   8.778   -10.444 1.00 8.84  ?  389  PHE A CB    1 
ATOM   1874 C  CG    . PHE A 1 263 ? 0.445   7.900   -11.107 1.00 11.10 ?  389  PHE A CG    1 
ATOM   1875 C  CD1   . PHE A 1 263 ? 0.064   6.728   -10.482 1.00 13.10 ?  389  PHE A CD1   1 
ATOM   1876 C  CD2   . PHE A 1 263 ? -0.133  8.246   -12.314 1.00 14.93 ?  389  PHE A CD2   1 
ATOM   1877 C  CE1   . PHE A 1 263 ? -0.883  5.877   -11.051 1.00 15.44 ?  389  PHE A CE1   1 
ATOM   1878 C  CE2   . PHE A 1 263 ? -1.101  7.394   -12.886 1.00 11.91 ?  389  PHE A CE2   1 
ATOM   1879 C  CZ    . PHE A 1 263 ? -1.459  6.223   -12.245 1.00 16.67 ?  389  PHE A CZ    1 
ATOM   1880 N  N     . CYS A 1 264 ? 2.109   10.407  -7.303  1.00 6.25  ?  390  CYS A N     1 
ATOM   1881 C  CA    A CYS A 1 264 ? 2.758   11.531  -6.628  0.50 7.66  ?  390  CYS A CA    1 
ATOM   1882 C  CA    B CYS A 1 264 ? 2.829   11.548  -6.779  0.50 7.85  ?  390  CYS A CA    1 
ATOM   1883 C  C     . CYS A 1 264 ? 4.092   11.194  -6.011  1.00 6.93  ?  390  CYS A C     1 
ATOM   1884 O  O     . CYS A 1 264 ? 4.442   10.022  -5.839  1.00 6.86  ?  390  CYS A O     1 
ATOM   1885 C  CB    A CYS A 1 264 ? 1.935   11.987  -5.443  0.50 9.48  ?  390  CYS A CB    1 
ATOM   1886 C  CB    B CYS A 1 264 ? 1.906   12.416  -5.936  0.50 10.64 ?  390  CYS A CB    1 
ATOM   1887 S  SG    A CYS A 1 264 ? 0.186   12.172  -5.689  0.50 11.87 ?  390  CYS A SG    1 
ATOM   1888 S  SG    B CYS A 1 264 ? 1.516   11.724  -4.330  0.50 12.56 ?  390  CYS A SG    1 
ATOM   1889 N  N     . ILE A 1 265 ? 4.801   12.247  -5.603  1.00 6.72  ?  391  ILE A N     1 
ATOM   1890 C  CA    . ILE A 1 265 ? 5.959   12.093  -4.725  1.00 6.23  ?  391  ILE A CA    1 
ATOM   1891 C  C     . ILE A 1 265 ? 5.648   12.868  -3.459  1.00 7.96  ?  391  ILE A C     1 
ATOM   1892 O  O     . ILE A 1 265 ? 5.327   14.085  -3.522  1.00 8.29  ?  391  ILE A O     1 
ATOM   1893 C  CB    . ILE A 1 265 ? 7.255   12.636  -5.390  1.00 5.66  ?  391  ILE A CB    1 
ATOM   1894 C  CG1   . ILE A 1 265 ? 7.529   11.890  -6.692  1.00 6.45  ?  391  ILE A CG1   1 
ATOM   1895 C  CG2   . ILE A 1 265 ? 8.441   12.460  -4.450  1.00 8.84  ?  391  ILE A CG2   1 
ATOM   1896 C  CD1   . ILE A 1 265 ? 8.689   12.474  -7.528  1.00 9.26  ?  391  ILE A CD1   1 
ATOM   1897 N  N     . PHE A 1 266 ? 5.698   12.186  -2.323  1.00 7.18  ?  392  PHE A N     1 
ATOM   1898 C  CA    . PHE A 1 266 ? 5.313   12.737  -1.031  1.00 9.42  ?  392  PHE A CA    1 
ATOM   1899 C  C     . PHE A 1 266 ? 6.558   12.997  -0.201  1.00 9.30  ?  392  PHE A C     1 
ATOM   1900 O  O     . PHE A 1 266 ? 7.557   12.299  -0.323  1.00 6.55  ?  392  PHE A O     1 
ATOM   1901 C  CB    . PHE A 1 266 ? 4.545   11.691  -0.194  1.00 9.75  ?  392  PHE A CB    1 
ATOM   1902 C  CG    . PHE A 1 266 ? 3.049   11.812  -0.170  1.00 13.45 ?  392  PHE A CG    1 
ATOM   1903 C  CD1   . PHE A 1 266 ? 2.309   11.684  -1.303  1.00 15.70 ?  392  PHE A CD1   1 
ATOM   1904 C  CD2   . PHE A 1 266 ? 2.389   11.924  1.037   1.00 25.01 ?  392  PHE A CD2   1 
ATOM   1905 C  CE1   . PHE A 1 266 ? 0.891   11.710  -1.242  1.00 20.17 ?  392  PHE A CE1   1 
ATOM   1906 C  CE2   . PHE A 1 266 ? 1.002   11.962  1.108   1.00 21.91 ?  392  PHE A CE2   1 
ATOM   1907 C  CZ    . PHE A 1 266 ? 0.259   11.841  -0.033  1.00 18.17 ?  392  PHE A CZ    1 
ATOM   1908 N  N     . ARG A 1 267 ? 6.467   13.991  0.679   1.00 8.03  ?  393  ARG A N     1 
ATOM   1909 C  CA    . ARG A 1 267 ? 7.452   14.242  1.713   1.00 9.24  ?  393  ARG A CA    1 
ATOM   1910 C  C     . ARG A 1 267 ? 7.154   13.406  2.954   1.00 9.98  ?  393  ARG A C     1 
ATOM   1911 O  O     . ARG A 1 267 ? 6.166   13.632  3.651   1.00 13.75 ?  393  ARG A O     1 
ATOM   1912 C  CB    . ARG A 1 267 ? 7.365   15.725  2.047   1.00 12.61 ?  393  ARG A CB    1 
ATOM   1913 C  CG    . ARG A 1 267 ? 8.407   16.211  2.979   1.00 16.58 ?  393  ARG A CG    1 
ATOM   1914 C  CD    . ARG A 1 267 ? 8.420   17.721  2.869   1.00 19.00 ?  393  ARG A CD    1 
ATOM   1915 N  NE    . ARG A 1 267 ? 9.140   18.284  3.967   1.00 21.81 ?  393  ARG A NE    1 
ATOM   1916 C  CZ    . ARG A 1 267 ? 9.960   19.315  3.844   1.00 10.52 ?  393  ARG A CZ    1 
ATOM   1917 N  NH1   . ARG A 1 267 ? 10.100  19.902  2.668   1.00 9.34  ?  393  ARG A NH1   1 
ATOM   1918 N  NH2   . ARG A 1 267 ? 10.575  19.733  4.926   1.00 16.12 ?  393  ARG A NH2   1 
ATOM   1919 N  N     . LEU A 1 268 ? 7.998   12.446  3.238   1.00 9.10  ?  394  LEU A N     1 
ATOM   1920 C  CA    . LEU A 1 268 ? 7.802   11.588  4.406   1.00 14.64 ?  394  LEU A CA    1 
ATOM   1921 C  C     . LEU A 1 268 ? 8.813   11.918  5.503   1.00 18.39 ?  394  LEU A C     1 
ATOM   1922 O  O     . LEU A 1 268 ? 10.005  11.901  5.264   1.00 17.94 ?  394  LEU A O     1 
ATOM   1923 C  CB    . LEU A 1 268 ? 7.986   10.148  3.983   1.00 19.63 ?  394  LEU A CB    1 
ATOM   1924 C  CG    . LEU A 1 268 ? 8.025   9.116   5.102   1.00 30.82 ?  394  LEU A CG    1 
ATOM   1925 C  CD1   . LEU A 1 268 ? 6.647   8.915   5.693   1.00 35.14 ?  394  LEU A CD1   1 
ATOM   1926 C  CD2   . LEU A 1 268 ? 8.586   7.831   4.573   1.00 30.82 ?  394  LEU A CD2   1 
ATOM   1927 N  N     . PRO A 1 269 ? 8.336   12.178  6.722   1.00 22.16 ?  395  PRO A N     1 
ATOM   1928 C  CA    . PRO A 1 269 ? 9.263   12.445  7.835   1.00 22.80 ?  395  PRO A CA    1 
ATOM   1929 C  C     . PRO A 1 269 ? 10.264  11.330  8.114   1.00 25.31 ?  395  PRO A C     1 
ATOM   1930 O  O     . PRO A 1 269 ? 9.956   10.143  7.950   1.00 28.38 ?  395  PRO A O     1 
ATOM   1931 C  CB    . PRO A 1 269 ? 8.334   12.665  9.037   1.00 30.98 ?  395  PRO A CB    1 
ATOM   1932 C  CG    . PRO A 1 269 ? 6.958   12.276  8.571   1.00 37.92 ?  395  PRO A CG    1 
ATOM   1933 C  CD    . PRO A 1 269 ? 6.940   12.456  7.088   1.00 35.50 ?  395  PRO A CD    1 
ATOM   1934 N  N     . GLN A 1 270 ? 11.474  11.745  8.491   1.00 28.22 ?  396  GLN A N     1 
ATOM   1935 C  CA    . GLN A 1 270 ? 12.539  10.857  8.928   1.00 23.86 ?  396  GLN A CA    1 
ATOM   1936 C  C     . GLN A 1 270 ? 13.175  11.527  10.149  1.00 30.66 ?  396  GLN A C     1 
ATOM   1937 O  O     . GLN A 1 270 ? 13.005  12.734  10.349  1.00 28.44 ?  396  GLN A O     1 
ATOM   1938 C  CB    . GLN A 1 270 ? 13.579  10.650  7.819   1.00 37.61 ?  396  GLN A CB    1 
ATOM   1939 C  CG    . GLN A 1 270 ? 13.059  9.975   6.561   1.00 24.98 ?  396  GLN A CG    1 
ATOM   1940 C  CD    . GLN A 1 270 ? 12.767  8.497   6.750   1.00 35.27 ?  396  GLN A CD    1 
ATOM   1941 O  OE1   . GLN A 1 270 ? 13.640  7.654   6.554   1.00 43.61 ?  396  GLN A OE1   1 
ATOM   1942 N  NE2   . GLN A 1 270 ? 11.528  8.177   7.108   1.00 41.08 ?  396  GLN A NE2   1 
ATOM   1943 N  N     . PRO A 1 271 ? 13.881  10.752  10.986  1.00 40.28 ?  397  PRO A N     1 
ATOM   1944 C  CA    . PRO A 1 271 ? 14.501  11.372  12.163  1.00 36.12 ?  397  PRO A CA    1 
ATOM   1945 C  C     . PRO A 1 271 ? 15.349  12.601  11.799  1.00 32.13 ?  397  PRO A C     1 
ATOM   1946 O  O     . PRO A 1 271 ? 16.386  12.474  11.141  1.00 35.67 ?  397  PRO A O     1 
ATOM   1947 C  CB    . PRO A 1 271 ? 15.381  10.247  12.713  1.00 48.45 ?  397  PRO A CB    1 
ATOM   1948 C  CG    . PRO A 1 271 ? 14.652  8.996   12.325  1.00 46.03 ?  397  PRO A CG    1 
ATOM   1949 C  CD    . PRO A 1 271 ? 14.099  9.293   10.951  1.00 39.27 ?  397  PRO A CD    1 
ATOM   1950 N  N     . GLY A 1 272 ? 14.874  13.782  12.188  1.00 29.90 ?  410  GLY A N     1 
ATOM   1951 C  CA    . GLY A 1 272 ? 15.631  15.009  11.987  1.00 31.72 ?  410  GLY A CA    1 
ATOM   1952 C  C     . GLY A 1 272 ? 15.642  15.546  10.564  1.00 34.24 ?  410  GLY A C     1 
ATOM   1953 O  O     . GLY A 1 272 ? 16.312  16.537  10.256  1.00 29.27 ?  410  GLY A O     1 
ATOM   1954 N  N     . SER A 1 273 ? 14.901  14.889  9.684   1.00 28.21 ?  411  SER A N     1 
ATOM   1955 C  CA    . SER A 1 273 ? 14.800  15.345  8.312   1.00 11.77 ?  411  SER A CA    1 
ATOM   1956 C  C     . SER A 1 273 ? 13.562  14.703  7.641   1.00 20.68 ?  411  SER A C     1 
ATOM   1957 O  O     . SER A 1 273 ? 12.528  14.544  8.281   1.00 21.34 ?  411  SER A O     1 
ATOM   1958 C  CB    . SER A 1 273 ? 16.070  15.010  7.551   1.00 20.49 ?  411  SER A CB    1 
ATOM   1959 O  OG    . SER A 1 273 ? 16.048  15.622  6.296   1.00 20.03 ?  411  SER A OG    1 
ATOM   1960 N  N     . TRP A 1 274 ? 13.678  14.338  6.367   1.00 16.03 ?  412  TRP A N     1 
ATOM   1961 C  CA    . TRP A 1 274 ? 12.555  13.719  5.627   1.00 12.97 ?  412  TRP A CA    1 
ATOM   1962 C  C     . TRP A 1 274 ? 13.105  13.063  4.374   1.00 12.92 ?  412  TRP A C     1 
ATOM   1963 O  O     . TRP A 1 274 ? 14.266  13.239  4.032   1.00 11.86 ?  412  TRP A O     1 
ATOM   1964 C  CB    . TRP A 1 274 ? 11.510  14.760  5.223   1.00 12.67 ?  412  TRP A CB    1 
ATOM   1965 C  CG    . TRP A 1 274 ? 12.106  15.953  4.496   1.00 14.00 ?  412  TRP A CG    1 
ATOM   1966 C  CD1   . TRP A 1 274 ? 12.618  17.095  5.076   1.00 13.40 ?  412  TRP A CD1   1 
ATOM   1967 C  CD2   . TRP A 1 274 ? 12.249  16.122  3.089   1.00 9.54  ?  412  TRP A CD2   1 
ATOM   1968 N  NE1   . TRP A 1 274 ? 13.056  17.962  4.111   1.00 12.65 ?  412  TRP A NE1   1 
ATOM   1969 C  CE2   . TRP A 1 274 ? 12.841  17.406  2.880   1.00 11.30 ?  412  TRP A CE2   1 
ATOM   1970 C  CE3   . TRP A 1 274 ? 11.906  15.345  1.972   1.00 11.36 ?  412  TRP A CE3   1 
ATOM   1971 C  CZ2   . TRP A 1 274 ? 13.124  17.902  1.614   1.00 13.44 ?  412  TRP A CZ2   1 
ATOM   1972 C  CZ3   . TRP A 1 274 ? 12.192  15.847  0.696   1.00 12.03 ?  412  TRP A CZ3   1 
ATOM   1973 C  CH2   . TRP A 1 274 ? 12.804  17.123  0.538   1.00 9.14  ?  412  TRP A CH2   1 
ATOM   1974 N  N     . LYS A 1 275 ? 12.266  12.292  3.671   1.00 9.94  ?  413  LYS A N     1 
ATOM   1975 C  CA    . LYS A 1 275 ? 12.692  11.763  2.387   1.00 8.15  ?  413  LYS A CA    1 
ATOM   1976 C  C     . LYS A 1 275 ? 11.511  11.699  1.421   1.00 7.20  ?  413  LYS A C     1 
ATOM   1977 O  O     . LYS A 1 275 ? 10.353  11.669  1.846   1.00 9.08  ?  413  LYS A O     1 
ATOM   1978 C  CB    . LYS A 1 275 ? 13.302  10.362  2.527   1.00 14.02 ?  413  LYS A CB    1 
ATOM   1979 C  CG    . LYS A 1 275 ? 12.287  9.297   2.930   1.00 12.88 ?  413  LYS A CG    1 
ATOM   1980 C  CD    . LYS A 1 275 ? 12.871  7.892   2.946   1.00 16.74 ?  413  LYS A CD    1 
ATOM   1981 C  CE    . LYS A 1 275 ? 11.898  6.965   3.691   1.00 30.31 ?  413  LYS A CE    1 
ATOM   1982 N  NZ    . LYS A 1 275 ? 12.147  5.501   3.530   1.00 20.39 ?  413  LYS A NZ    1 
ATOM   1983 N  N     . ALA A 1 276 ? 11.818  11.706  0.132   1.00 6.86  ?  414  ALA A N     1 
ATOM   1984 C  CA    . ALA A 1 276 ? 10.800  11.611  -0.921  1.00 8.80  ?  414  ALA A CA    1 
ATOM   1985 C  C     . ALA A 1 276 ? 10.347  10.156  -1.054  1.00 6.96  ?  414  ALA A C     1 
ATOM   1986 O  O     . ALA A 1 276 ? 11.191  9.251   -1.021  1.00 7.89  ?  414  ALA A O     1 
ATOM   1987 C  CB    . ALA A 1 276 ? 11.371  12.092  -2.243  1.00 9.07  ?  414  ALA A CB    1 
ATOM   1988 N  N     . VAL A 1 277 ? 9.026   9.959   -1.167  1.00 7.51  ?  415  VAL A N     1 
ATOM   1989 C  CA    . VAL A 1 277 ? 8.443   8.615   -1.360  1.00 6.90  ?  415  VAL A CA    1 
ATOM   1990 C  C     . VAL A 1 277 ? 7.367   8.662   -2.461  1.00 4.85  ?  415  VAL A C     1 
ATOM   1991 O  O     . VAL A 1 277 ? 6.556   9.597   -2.533  1.00 7.85  ?  415  VAL A O     1 
ATOM   1992 C  CB    . VAL A 1 277 ? 7.845   8.060   -0.040  1.00 7.97  ?  415  VAL A CB    1 
ATOM   1993 C  CG1   . VAL A 1 277 ? 7.262   6.653   -0.275  1.00 10.07 ?  415  VAL A CG1   1 
ATOM   1994 C  CG2   . VAL A 1 277 ? 8.904   8.006   1.066   1.00 11.84 ?  415  VAL A CG2   1 
ATOM   1995 N  N     . ARG A 1 278 ? 7.373   7.670   -3.344  1.00 4.12  ?  416  ARG A N     1 
ATOM   1996 C  CA    . ARG A 1 278 ? 6.307   7.528   -4.345  1.00 4.19  ?  416  ARG A CA    1 
ATOM   1997 C  C     . ARG A 1 278 ? 5.012   7.001   -3.699  1.00 3.72  ?  416  ARG A C     1 
ATOM   1998 O  O     . ARG A 1 278 ? 5.020   5.978   -3.019  1.00 4.77  ?  416  ARG A O     1 
ATOM   1999 C  CB    . ARG A 1 278 ? 6.782   6.570   -5.433  1.00 4.43  ?  416  ARG A CB    1 
ATOM   2000 C  CG    . ARG A 1 278 ? 7.648   7.296   -6.499  1.00 7.19  ?  416  ARG A CG    1 
ATOM   2001 C  CD    . ARG A 1 278 ? 6.799   7.981   -7.576  1.00 8.02  ?  416  ARG A CD    1 
ATOM   2002 N  NE    . ARG A 1 278 ? 6.011   6.971   -8.272  1.00 6.89  ?  416  ARG A NE    1 
ATOM   2003 C  CZ    . ARG A 1 278 ? 4.691   6.819   -8.162  1.00 7.69  ?  416  ARG A CZ    1 
ATOM   2004 N  NH1   . ARG A 1 278 ? 3.953   7.631   -7.408  1.00 6.32  ?  416  ARG A NH1   1 
ATOM   2005 N  NH2   . ARG A 1 278 ? 4.120   5.807   -8.805  1.00 6.81  ?  416  ARG A NH2   1 
ATOM   2006 N  N     . VAL A 1 279 ? 3.936   7.751   -3.911  1.00 4.59  ?  417  VAL A N     1 
ATOM   2007 C  CA    . VAL A 1 279 ? 2.611   7.361   -3.383  1.00 3.29  ?  417  VAL A CA    1 
ATOM   2008 C  C     . VAL A 1 279 ? 1.603   7.455   -4.523  1.00 4.42  ?  417  VAL A C     1 
ATOM   2009 O  O     . VAL A 1 279 ? 1.583   8.427   -5.277  1.00 5.25  ?  417  VAL A O     1 
ATOM   2010 C  CB    . VAL A 1 279 ? 2.160   8.276   -2.230  1.00 3.99  ?  417  VAL A CB    1 
ATOM   2011 C  CG1   . VAL A 1 279 ? 0.746   7.878   -1.760  1.00 8.40  ?  417  VAL A CG1   1 
ATOM   2012 C  CG2   . VAL A 1 279 ? 3.173   8.208   -1.101  1.00 5.81  ?  417  VAL A CG2   1 
ATOM   2013 N  N     . ASP A 1 280 ? 0.769   6.429   -4.688  1.00 4.46  ?  418  ASP A N     1 
ATOM   2014 C  CA    . ASP A 1 280 ? -0.307  6.485   -5.658  1.00 3.98  ?  418  ASP A CA    1 
ATOM   2015 C  C     . ASP A 1 280 ? -1.628  6.536   -4.907  1.00 3.70  ?  418  ASP A C     1 
ATOM   2016 O  O     . ASP A 1 280 ? -1.832  5.767   -3.966  1.00 6.25  ?  418  ASP A O     1 
ATOM   2017 C  CB    . ASP A 1 280 ? -0.333  5.227   -6.531  1.00 4.46  ?  418  ASP A CB    1 
ATOM   2018 C  CG    . ASP A 1 280 ? 0.951   5.020   -7.314  1.00 9.32  ?  418  ASP A CG    1 
ATOM   2019 O  OD1   . ASP A 1 280 ? 1.528   6.041   -7.720  1.00 10.98 ?  418  ASP A OD1   1 
ATOM   2020 O  OD2   . ASP A 1 280 ? 1.317   3.849   -7.550  1.00 17.00 ?  418  ASP A OD2   1 
ATOM   2021 N  N     . LEU A 1 281 ? -2.525  7.408   -5.354  1.00 4.62  ?  419  LEU A N     1 
ATOM   2022 C  CA    . LEU A 1 281 ? -3.854  7.541   -4.760  1.00 4.64  ?  419  LEU A CA    1 
ATOM   2023 C  C     . LEU A 1 281 ? -4.856  7.273   -5.837  1.00 4.61  ?  419  LEU A C     1 
ATOM   2024 O  O     . LEU A 1 281 ? -4.728  7.779   -6.966  1.00 6.74  ?  419  LEU A O     1 
ATOM   2025 C  CB    . LEU A 1 281 ? -4.077  8.960   -4.202  1.00 5.92  ?  419  LEU A CB    1 
ATOM   2026 C  CG    . LEU A 1 281 ? -3.055  9.420   -3.162  1.00 7.79  ?  419  LEU A CG    1 
ATOM   2027 C  CD1   . LEU A 1 281 ? -3.453  10.835  -2.711  1.00 13.96 ?  419  LEU A CD1   1 
ATOM   2028 C  CD2   . LEU A 1 281 ? -3.064  8.497   -2.002  1.00 12.48 ?  419  LEU A CD2   1 
ATOM   2029 N  N     . VAL A 1 282 ? -5.858  6.452   -5.521  1.00 1.78  ?  420  VAL A N     1 
ATOM   2030 C  CA    . VAL A 1 282 ? -6.853  6.060   -6.510  1.00 1.90  ?  420  VAL A CA    1 
ATOM   2031 C  C     . VAL A 1 282 ? -8.213  6.173   -5.852  1.00 3.24  ?  420  VAL A C     1 
ATOM   2032 O  O     . VAL A 1 282 ? -8.365  5.778   -4.703  1.00 4.97  ?  420  VAL A O     1 
ATOM   2033 C  CB    . VAL A 1 282 ? -6.668  4.599   -6.946  1.00 6.34  ?  420  VAL A CB    1 
ATOM   2034 C  CG1   . VAL A 1 282 ? -7.756  4.205   -7.984  1.00 6.60  ?  420  VAL A CG1   1 
ATOM   2035 C  CG2   . VAL A 1 282 ? -5.261  4.409   -7.529  1.00 7.53  ?  420  VAL A CG2   1 
ATOM   2036 N  N     . VAL A 1 283 ? -9.185  6.736   -6.565  1.00 2.48  ?  421  VAL A N     1 
ATOM   2037 C  CA    . VAL A 1 283 ? -10.559 6.817   -6.039  1.00 5.37  ?  421  VAL A CA    1 
ATOM   2038 C  C     . VAL A 1 283 ? -11.448 5.893   -6.855  1.00 7.93  ?  421  VAL A C     1 
ATOM   2039 O  O     . VAL A 1 283 ? -11.349 5.856   -8.077  1.00 9.21  ?  421  VAL A O     1 
ATOM   2040 C  CB    . VAL A 1 283 ? -11.104 8.262   -6.118  1.00 5.33  ?  421  VAL A CB    1 
ATOM   2041 C  CG1   . VAL A 1 283 ? -12.600 8.267   -5.776  1.00 5.73  ?  421  VAL A CG1   1 
ATOM   2042 C  CG2   . VAL A 1 283 ? -10.348 9.175   -5.147  1.00 6.65  ?  421  VAL A CG2   1 
ATOM   2043 N  N     . ALA A 1 284 ? -12.330 5.150   -6.193  1.00 2.79  ?  422  ALA A N     1 
ATOM   2044 C  CA    . ALA A 1 284 ? -13.302 4.317   -6.899  1.00 4.19  ?  422  ALA A CA    1 
ATOM   2045 C  C     . ALA A 1 284 ? -14.661 4.468   -6.235  1.00 4.77  ?  422  ALA A C     1 
ATOM   2046 O  O     . ALA A 1 284 ? -14.738 4.641   -5.026  1.00 5.18  ?  422  ALA A O     1 
ATOM   2047 C  CB    . ALA A 1 284 ? -12.909 2.835   -6.864  1.00 5.59  ?  422  ALA A CB    1 
ATOM   2048 N  N     . PRO A 1 285 ? -15.732 4.364   -7.026  1.00 4.81  ?  423  PRO A N     1 
ATOM   2049 C  CA    . PRO A 1 285 ? -17.059 4.269   -6.394  1.00 4.86  ?  423  PRO A CA    1 
ATOM   2050 C  C     . PRO A 1 285 ? -17.211 2.973   -5.617  1.00 6.33  ?  423  PRO A C     1 
ATOM   2051 O  O     . PRO A 1 285 ? -16.628 1.948   -6.006  1.00 6.88  ?  423  PRO A O     1 
ATOM   2052 C  CB    . PRO A 1 285 ? -18.036 4.326   -7.579  1.00 8.42  ?  423  PRO A CB    1 
ATOM   2053 C  CG    . PRO A 1 285 ? -17.289 3.975   -8.754  1.00 12.23 ?  423  PRO A CG    1 
ATOM   2054 C  CD    . PRO A 1 285 ? -15.803 4.288   -8.487  1.00 6.07  ?  423  PRO A CD    1 
ATOM   2055 N  N     . VAL A 1 286 ? -18.000 2.995   -4.551  1.00 5.01  ?  424  VAL A N     1 
ATOM   2056 C  CA    . VAL A 1 286 ? -18.081 1.789   -3.722  1.00 7.05  ?  424  VAL A CA    1 
ATOM   2057 C  C     . VAL A 1 286 ? -18.590 0.581   -4.495  1.00 5.64  ?  424  VAL A C     1 
ATOM   2058 O  O     . VAL A 1 286 ? -18.137 -0.542  -4.236  1.00 8.74  ?  424  VAL A O     1 
ATOM   2059 C  CB    . VAL A 1 286 ? -18.830 2.031   -2.386  1.00 12.16 ?  424  VAL A CB    1 
ATOM   2060 C  CG1   . VAL A 1 286 ? -20.326 2.303   -2.621  1.00 9.50  ?  424  VAL A CG1   1 
ATOM   2061 C  CG2   . VAL A 1 286 ? -18.632 0.866   -1.457  1.00 15.68 ?  424  VAL A CG2   1 
ATOM   2062 N  N     . SER A 1 287 ? -19.477 0.797   -5.481  1.00 7.61  ?  425  SER A N     1 
ATOM   2063 C  CA    . SER A 1 287 ? -19.887 -0.303  -6.370  1.00 9.38  ?  425  SER A CA    1 
ATOM   2064 C  C     . SER A 1 287 ? -18.741 -1.049  -7.064  1.00 16.29 ?  425  SER A C     1 
ATOM   2065 O  O     . SER A 1 287 ? -18.845 -2.254  -7.371  1.00 15.80 ?  425  SER A O     1 
ATOM   2066 C  CB    . SER A 1 287 ? -20.864 0.223   -7.437  1.00 8.76  ?  425  SER A CB    1 
ATOM   2067 O  OG    . SER A 1 287 ? -20.261 1.185   -8.298  1.00 10.59 ?  425  SER A OG    1 
ATOM   2068 N  N     . GLN A 1 288 ? -17.647 -0.344  -7.314  1.00 6.84  ?  426  GLN A N     1 
ATOM   2069 C  CA    . GLN A 1 288 ? -16.511 -0.902  -8.044  1.00 5.71  ?  426  GLN A CA    1 
ATOM   2070 C  C     . GLN A 1 288 ? -15.378 -1.266  -7.078  1.00 7.13  ?  426  GLN A C     1 
ATOM   2071 O  O     . GLN A 1 288 ? -14.343 -1.762  -7.510  1.00 9.11  ?  426  GLN A O     1 
ATOM   2072 C  CB    . GLN A 1 288 ? -15.966 0.107   -9.045  1.00 10.57 ?  426  GLN A CB    1 
ATOM   2073 C  CG    . GLN A 1 288 ? -16.988 0.479   -10.122 1.00 9.41  ?  426  GLN A CG    1 
ATOM   2074 C  CD    . GLN A 1 288 ? -16.440 1.452   -11.129 1.00 12.00 ?  426  GLN A CD    1 
ATOM   2075 O  OE1   . GLN A 1 288 ? -15.267 1.832   -11.100 1.00 13.31 ?  426  GLN A OE1   1 
ATOM   2076 N  NE2   . GLN A 1 288 ? -17.319 1.897   -12.042 1.00 14.95 ?  426  GLN A NE2   1 
ATOM   2077 N  N     . PHE A 1 289 ? -15.547 -0.965  -5.796  1.00 7.87  ?  427  PHE A N     1 
ATOM   2078 C  CA    . PHE A 1 289 ? -14.441 -1.158  -4.846  1.00 7.05  ?  427  PHE A CA    1 
ATOM   2079 C  C     . PHE A 1 289 ? -13.760 -2.540  -4.895  1.00 6.72  ?  427  PHE A C     1 
ATOM   2080 O  O     . PHE A 1 289 ? -12.535 -2.595  -4.909  1.00 5.38  ?  427  PHE A O     1 
ATOM   2081 C  CB    . PHE A 1 289 ? -14.892 -0.789  -3.431  1.00 10.85 ?  427  PHE A CB    1 
ATOM   2082 C  CG    . PHE A 1 289 ? -13.823 -0.966  -2.389  1.00 5.72  ?  427  PHE A CG    1 
ATOM   2083 C  CD1   . PHE A 1 289 ? -12.939 0.066   -2.085  1.00 8.06  ?  427  PHE A CD1   1 
ATOM   2084 C  CD2   . PHE A 1 289 ? -13.710 -2.165  -1.721  1.00 5.48  ?  427  PHE A CD2   1 
ATOM   2085 C  CE1   . PHE A 1 289 ? -11.941 -0.116  -1.081  1.00 5.77  ?  427  PHE A CE1   1 
ATOM   2086 C  CE2   . PHE A 1 289 ? -12.726 -2.346  -0.763  1.00 8.90  ?  427  PHE A CE2   1 
ATOM   2087 C  CZ    . PHE A 1 289 ? -11.846 -1.321  -0.449  1.00 7.34  ?  427  PHE A CZ    1 
ATOM   2088 N  N     . PRO A 1 290 ? -14.535 -3.638  -4.916  1.00 6.13  ?  428  PRO A N     1 
ATOM   2089 C  CA    . PRO A 1 290 ? -13.835 -4.941  -4.976  1.00 4.35  ?  428  PRO A CA    1 
ATOM   2090 C  C     . PRO A 1 290 ? -12.988 -5.108  -6.226  1.00 5.06  ?  428  PRO A C     1 
ATOM   2091 O  O     . PRO A 1 290 ? -11.910 -5.707  -6.165  1.00 4.10  ?  428  PRO A O     1 
ATOM   2092 C  CB    . PRO A 1 290 ? -14.972 -5.970  -5.008  1.00 6.08  ?  428  PRO A CB    1 
ATOM   2093 C  CG    . PRO A 1 290 ? -16.169 -5.248  -4.413  1.00 10.62 ?  428  PRO A CG    1 
ATOM   2094 C  CD    . PRO A 1 290 ? -15.993 -3.789  -4.748  1.00 7.77  ?  428  PRO A CD    1 
ATOM   2095 N  N     . PHE A 1 291 ? -13.440 -4.567  -7.359  1.00 6.90  ?  429  PHE A N     1 
ATOM   2096 C  CA    . PHE A 1 291 ? -12.631 -4.644  -8.578  1.00 5.67  ?  429  PHE A CA    1 
ATOM   2097 C  C     . PHE A 1 291 ? -11.391 -3.773  -8.490  1.00 5.20  ?  429  PHE A C     1 
ATOM   2098 O  O     . PHE A 1 291 ? -10.335 -4.139  -8.973  1.00 4.87  ?  429  PHE A O     1 
ATOM   2099 C  CB    . PHE A 1 291 ? -13.450 -4.208  -9.796  1.00 5.40  ?  429  PHE A CB    1 
ATOM   2100 C  CG    . PHE A 1 291 ? -14.606 -5.095  -10.042 1.00 4.90  ?  429  PHE A CG    1 
ATOM   2101 C  CD1   . PHE A 1 291 ? -14.409 -6.343  -10.633 1.00 4.77  ?  429  PHE A CD1   1 
ATOM   2102 C  CD2   . PHE A 1 291 ? -15.872 -4.735  -9.626  1.00 10.66 ?  429  PHE A CD2   1 
ATOM   2103 C  CE1   . PHE A 1 291 ? -15.509 -7.207  -10.841 1.00 5.96  ?  429  PHE A CE1   1 
ATOM   2104 C  CE2   . PHE A 1 291 ? -16.939 -5.594  -9.818  1.00 7.12  ?  429  PHE A CE2   1 
ATOM   2105 C  CZ    . PHE A 1 291 ? -16.768 -6.797  -10.418 1.00 6.60  ?  429  PHE A CZ    1 
ATOM   2106 N  N     . ALA A 1 292 ? -11.519 -2.616  -7.846  1.00 5.20  ?  430  ALA A N     1 
ATOM   2107 C  CA    . ALA A 1 292 ? -10.375 -1.720  -7.739  1.00 4.92  ?  430  ALA A CA    1 
ATOM   2108 C  C     . ALA A 1 292 ? -9.359  -2.235  -6.739  1.00 3.46  ?  430  ALA A C     1 
ATOM   2109 O  O     . ALA A 1 292 ? -8.155  -2.176  -6.988  1.00 4.79  ?  430  ALA A O     1 
ATOM   2110 C  CB    . ALA A 1 292 ? -10.856 -0.341  -7.348  1.00 5.78  ?  430  ALA A CB    1 
ATOM   2111 N  N     . LEU A 1 293 ? -9.849  -2.776  -5.625  1.00 3.38  ?  431  LEU A N     1 
ATOM   2112 C  CA    . LEU A 1 293 ? -9.000  -3.417  -4.643  1.00 2.80  ?  431  LEU A CA    1 
ATOM   2113 C  C     . LEU A 1 293 ? -8.234  -4.569  -5.292  1.00 2.29  ?  431  LEU A C     1 
ATOM   2114 O  O     . LEU A 1 293 ? -7.014  -4.679  -5.121  1.00 3.98  ?  431  LEU A O     1 
ATOM   2115 C  CB    . LEU A 1 293 ? -9.877  -3.926  -3.499  1.00 2.71  ?  431  LEU A CB    1 
ATOM   2116 C  CG    . LEU A 1 293 ? -9.095  -4.555  -2.345  1.00 4.11  ?  431  LEU A CG    1 
ATOM   2117 C  CD1   . LEU A 1 293 ? -8.121  -3.540  -1.695  1.00 5.48  ?  431  LEU A CD1   1 
ATOM   2118 C  CD2   . LEU A 1 293 ? -10.089 -5.088  -1.328  1.00 2.48  ?  431  LEU A CD2   1 
ATOM   2119 N  N     . LEU A 1 294 ? -8.945  -5.411  -6.036  1.00 3.50  ?  432  LEU A N     1 
ATOM   2120 C  CA    . LEU A 1 294 ? -8.285  -6.555  -6.665  1.00 4.34  ?  432  LEU A CA    1 
ATOM   2121 C  C     . LEU A 1 294 ? -7.232  -6.072  -7.665  1.00 3.40  ?  432  LEU A C     1 
ATOM   2122 O  O     . LEU A 1 294 ? -6.086  -6.531  -7.646  1.00 6.12  ?  432  LEU A O     1 
ATOM   2123 C  CB    . LEU A 1 294 ? -9.357  -7.429  -7.324  1.00 3.11  ?  432  LEU A CB    1 
ATOM   2124 C  CG    . LEU A 1 294 ? -8.864  -8.635  -8.139  1.00 3.69  ?  432  LEU A CG    1 
ATOM   2125 C  CD1   . LEU A 1 294 ? -8.197  -9.649  -7.216  1.00 6.46  ?  432  LEU A CD1   1 
ATOM   2126 C  CD2   . LEU A 1 294 ? -10.080 -9.253  -8.841  1.00 3.85  ?  432  LEU A CD2   1 
ATOM   2127 N  N     . GLY A 1 295 ? -7.607  -5.091  -8.491  1.00 3.75  ?  433  GLY A N     1 
ATOM   2128 C  CA    . GLY A 1 295 ? -6.639  -4.604  -9.476  1.00 7.46  ?  433  GLY A CA    1 
ATOM   2129 C  C     . GLY A 1 295 ? -5.380  -4.002  -8.853  1.00 7.15  ?  433  GLY A C     1 
ATOM   2130 O  O     . GLY A 1 295 ? -4.211  -4.353  -9.204  1.00 10.29 ?  433  GLY A O     1 
ATOM   2131 N  N     . TRP A 1 296 ? -5.607  -3.141  -7.873  1.00 3.66  ?  434  TRP A N     1 
ATOM   2132 C  CA    . TRP A 1 296 ? -4.485  -2.360  -7.348  1.00 2.49  ?  434  TRP A CA    1 
ATOM   2133 C  C     . TRP A 1 296 ? -3.657  -3.122  -6.324  1.00 2.55  ?  434  TRP A C     1 
ATOM   2134 O  O     . TRP A 1 296 ? -2.595  -2.663  -5.912  1.00 5.61  ?  434  TRP A O     1 
ATOM   2135 C  CB    . TRP A 1 296 ? -4.987  -1.022  -6.743  1.00 4.09  ?  434  TRP A CB    1 
ATOM   2136 C  CG    . TRP A 1 296 ? -5.352  -0.054  -7.830  1.00 4.83  ?  434  TRP A CG    1 
ATOM   2137 C  CD1   . TRP A 1 296 ? -6.553  0.074   -8.428  1.00 6.67  ?  434  TRP A CD1   1 
ATOM   2138 C  CD2   . TRP A 1 296 ? -4.465  0.863   -8.475  1.00 8.37  ?  434  TRP A CD2   1 
ATOM   2139 N  NE1   . TRP A 1 296 ? -6.487  1.057   -9.414  1.00 7.60  ?  434  TRP A NE1   1 
ATOM   2140 C  CE2   . TRP A 1 296 ? -5.206  1.534   -9.462  1.00 7.62  ?  434  TRP A CE2   1 
ATOM   2141 C  CE3   . TRP A 1 296 ? -3.109  1.188   -8.298  1.00 13.34 ?  434  TRP A CE3   1 
ATOM   2142 C  CZ2   . TRP A 1 296 ? -4.636  2.526   -10.280 1.00 11.10 ?  434  TRP A CZ2   1 
ATOM   2143 C  CZ3   . TRP A 1 296 ? -2.549  2.179   -9.109  1.00 14.75 ?  434  TRP A CZ3   1 
ATOM   2144 C  CH2   . TRP A 1 296 ? -3.309  2.816   -10.089 1.00 12.08 ?  434  TRP A CH2   1 
ATOM   2145 N  N     . THR A 1 297 ? -4.122  -4.319  -5.947  1.00 1.17  ?  435  THR A N     1 
ATOM   2146 C  CA    . THR A 1 297 ? -3.349  -5.152  -5.020  1.00 3.34  ?  435  THR A CA    1 
ATOM   2147 C  C     . THR A 1 297 ? -2.242  -5.943  -5.720  1.00 3.92  ?  435  THR A C     1 
ATOM   2148 O  O     . THR A 1 297 ? -1.276  -6.337  -5.095  1.00 4.12  ?  435  THR A O     1 
ATOM   2149 C  CB    . THR A 1 297 ? -4.283  -6.035  -4.167  1.00 3.04  ?  435  THR A CB    1 
ATOM   2150 O  OG1   . THR A 1 297 ? -5.037  -5.178  -3.301  1.00 3.72  ?  435  THR A OG1   1 
ATOM   2151 C  CG2   . THR A 1 297 ? -3.502  -6.965  -3.266  1.00 3.00  ?  435  THR A CG2   1 
ATOM   2152 N  N     . GLY A 1 298 ? -2.386  -6.159  -7.027  1.00 4.08  ?  436  GLY A N     1 
ATOM   2153 C  CA    . GLY A 1 298 ? -1.309  -6.801  -7.778  1.00 3.41  ?  436  GLY A CA    1 
ATOM   2154 C  C     . GLY A 1 298 ? -1.181  -8.283  -7.413  1.00 2.92  ?  436  GLY A C     1 
ATOM   2155 O  O     . GLY A 1 298 ? -2.156  -8.887  -6.966  1.00 3.84  ?  436  GLY A O     1 
ATOM   2156 N  N     . SER A 1 299 ? -0.015  -8.894  -7.636  1.00 2.69  ?  437  SER A N     1 
ATOM   2157 C  CA    . SER A 1 299 ? 1.114   -8.290  -8.322  1.00 1.17  ?  437  SER A CA    1 
ATOM   2158 C  C     . SER A 1 299 ? 0.772   -7.977  -9.784  1.00 2.11  ?  437  SER A C     1 
ATOM   2159 O  O     . SER A 1 299 ? -0.287  -8.372  -10.274 1.00 2.49  ?  437  SER A O     1 
ATOM   2160 C  CB    . SER A 1 299 ? 2.299   -9.267  -8.298  1.00 3.61  ?  437  SER A CB    1 
ATOM   2161 O  OG    . SER A 1 299 ? 2.014   -10.404 -9.149  1.00 3.78  ?  437  SER A OG    1 
ATOM   2162 N  N     . LYS A 1 300 ? 1.671   -7.278  -10.469 1.00 3.85  ?  438  LYS A N     1 
ATOM   2163 C  CA    . LYS A 1 300 ? 1.405   -6.942  -11.871 1.00 3.49  ?  438  LYS A CA    1 
ATOM   2164 C  C     . LYS A 1 300 ? 1.197   -8.238  -12.687 1.00 3.44  ?  438  LYS A C     1 
ATOM   2165 O  O     . LYS A 1 300 ? 0.226   -8.360  -13.461 1.00 4.12  ?  438  LYS A O     1 
ATOM   2166 C  CB    . LYS A 1 300 ? 2.602   -6.189  -12.429 1.00 5.20  ?  438  LYS A CB    1 
ATOM   2167 C  CG    . LYS A 1 300 ? 2.464   -5.893  -13.934 1.00 7.33  ?  438  LYS A CG    1 
ATOM   2168 C  CD    . LYS A 1 300 ? 3.670   -5.070  -14.391 1.00 14.33 ?  438  LYS A CD    1 
ATOM   2169 C  CE    . LYS A 1 300 ? 3.545   -4.701  -15.852 1.00 16.67 ?  438  LYS A CE    1 
ATOM   2170 N  NZ    . LYS A 1 300 ? 4.705   -3.856  -16.281 1.00 19.60 ?  438  LYS A NZ    1 
ATOM   2171 N  N     . LEU A 1 301 ? 2.080   -9.213  -12.514 1.00 3.55  ?  439  LEU A N     1 
ATOM   2172 C  CA    . LEU A 1 301 ? 1.912   -10.467 -13.245 1.00 3.79  ?  439  LEU A CA    1 
ATOM   2173 C  C     . LEU A 1 301 ? 0.632   -11.175 -12.829 1.00 3.53  ?  439  LEU A C     1 
ATOM   2174 O  O     . LEU A 1 301 ? -0.080  -11.733 -13.678 1.00 3.17  ?  439  LEU A O     1 
ATOM   2175 C  CB    . LEU A 1 301 ? 3.117   -11.405 -13.059 1.00 3.53  ?  439  LEU A CB    1 
ATOM   2176 C  CG    . LEU A 1 301 ? 2.994   -12.723 -13.811 1.00 3.07  ?  439  LEU A CG    1 
ATOM   2177 C  CD1   . LEU A 1 301 ? 2.963   -12.484 -15.334 1.00 6.81  ?  439  LEU A CD1   1 
ATOM   2178 C  CD2   . LEU A 1 301 ? 4.141   -13.672 -13.440 1.00 5.64  ?  439  LEU A CD2   1 
ATOM   2179 N  N     . PHE A 1 302 ? 0.308   -11.155 -11.533 1.00 3.54  ?  440  PHE A N     1 
ATOM   2180 C  CA    . PHE A 1 302 ? -0.924  -11.791 -11.107 1.00 2.69  ?  440  PHE A CA    1 
ATOM   2181 C  C     . PHE A 1 302 ? -2.129  -11.220 -11.840 1.00 3.09  ?  440  PHE A C     1 
ATOM   2182 O  O     . PHE A 1 302 ? -2.999  -11.965 -12.294 1.00 3.80  ?  440  PHE A O     1 
ATOM   2183 C  CB    . PHE A 1 302 ? -1.140  -11.658 -9.585  1.00 3.66  ?  440  PHE A CB    1 
ATOM   2184 C  CG    . PHE A 1 302 ? -2.292  -12.454 -9.077  1.00 4.05  ?  440  PHE A CG    1 
ATOM   2185 C  CD1   . PHE A 1 302 ? -3.563  -11.923 -9.047  1.00 7.82  ?  440  PHE A CD1   1 
ATOM   2186 C  CD2   . PHE A 1 302 ? -2.111  -13.769 -8.638  1.00 6.54  ?  440  PHE A CD2   1 
ATOM   2187 C  CE1   . PHE A 1 302 ? -4.648  -12.716 -8.601  1.00 7.13  ?  440  PHE A CE1   1 
ATOM   2188 C  CE2   . PHE A 1 302 ? -3.190  -14.536 -8.178  1.00 9.50  ?  440  PHE A CE2   1 
ATOM   2189 C  CZ    . PHE A 1 302 ? -4.446  -13.998 -8.164  1.00 8.82  ?  440  PHE A CZ    1 
ATOM   2190 N  N     . GLN A 1 303 ? -2.189  -9.887  -11.929 1.00 3.00  ?  441  GLN A N     1 
ATOM   2191 C  CA    . GLN A 1 303 ? -3.344  -9.229  -12.533 1.00 4.57  ?  441  GLN A CA    1 
ATOM   2192 C  C     . GLN A 1 303 ? -3.424  -9.442  -14.055 1.00 3.11  ?  441  GLN A C     1 
ATOM   2193 O  O     . GLN A 1 303 ? -4.506  -9.666  -14.576 1.00 5.92  ?  441  GLN A O     1 
ATOM   2194 C  CB    . GLN A 1 303 ? -3.340  -7.743  -12.189 1.00 9.04  ?  441  GLN A CB    1 
ATOM   2195 C  CG    . GLN A 1 303 ? -3.596  -7.437  -10.686 1.00 11.29 ?  441  GLN A CG    1 
ATOM   2196 C  CD    . GLN A 1 303 ? -4.819  -8.142  -10.093 1.00 16.15 ?  441  GLN A CD    1 
ATOM   2197 O  OE1   . GLN A 1 303 ? -4.729  -8.810  -9.045  1.00 19.95 ?  441  GLN A OE1   1 
ATOM   2198 N  NE2   . GLN A 1 303 ? -5.948  -8.012  -10.742 1.00 10.42 ?  441  GLN A NE2   1 
ATOM   2199 N  N     . ARG A 1 304 ? -2.282  -9.439  -14.732 1.00 3.81  ?  442  ARG A N     1 
ATOM   2200 C  CA    . ARG A 1 304 ? -2.260  -9.741  -16.167 1.00 3.42  ?  442  ARG A CA    1 
ATOM   2201 C  C     . ARG A 1 304 ? -2.723  -11.170 -16.391 1.00 5.17  ?  442  ARG A C     1 
ATOM   2202 O  O     . ARG A 1 304 ? -3.510  -11.441 -17.297 1.00 5.42  ?  442  ARG A O     1 
ATOM   2203 C  CB    . ARG A 1 304 ? -0.825  -9.603  -16.717 1.00 4.68  ?  442  ARG A CB    1 
ATOM   2204 C  CG    . ARG A 1 304 ? -0.308  -8.199  -16.677 1.00 8.21  ?  442  ARG A CG    1 
ATOM   2205 C  CD    . ARG A 1 304 ? 1.178   -8.233  -17.041 1.00 12.25 ?  442  ARG A CD    1 
ATOM   2206 N  NE    . ARG A 1 304 ? 1.294   -8.417  -18.484 1.00 8.56  ?  442  ARG A NE    1 
ATOM   2207 C  CZ    . ARG A 1 304 ? 2.347   -8.050  -19.193 1.00 13.22 ?  442  ARG A CZ    1 
ATOM   2208 N  NH1   . ARG A 1 304 ? 3.419   -7.552  -18.585 1.00 14.24 ?  442  ARG A NH1   1 
ATOM   2209 N  NH2   . ARG A 1 304 ? 2.329   -8.188  -20.508 1.00 11.77 ?  442  ARG A NH2   1 
ATOM   2210 N  N     . GLU A 1 305 ? -2.266  -12.088 -15.549 1.00 3.36  ?  443  GLU A N     1 
ATOM   2211 C  CA    . GLU A 1 305 ? -2.682  -13.499 -15.664 1.00 4.03  ?  443  GLU A CA    1 
ATOM   2212 C  C     . GLU A 1 305 ? -4.169  -13.684 -15.379 1.00 5.42  ?  443  GLU A C     1 
ATOM   2213 O  O     . GLU A 1 305 ? -4.876  -14.460 -16.061 1.00 5.10  ?  443  GLU A O     1 
ATOM   2214 C  CB    . GLU A 1 305 ? -1.830  -14.341 -14.709 1.00 4.73  ?  443  GLU A CB    1 
ATOM   2215 C  CG    . GLU A 1 305 ? -0.404  -14.429 -15.205 1.00 4.91  ?  443  GLU A CG    1 
ATOM   2216 C  CD    . GLU A 1 305 ? -0.248  -15.463 -16.303 1.00 7.89  ?  443  GLU A CD    1 
ATOM   2217 O  OE1   . GLU A 1 305 ? -0.300  -16.664 -15.999 1.00 8.65  ?  443  GLU A OE1   1 
ATOM   2218 O  OE2   . GLU A 1 305 ? -0.025  -15.054 -17.445 1.00 9.01  ?  443  GLU A OE2   1 
ATOM   2219 N  N     . LEU A 1 306 ? -4.668  -12.964 -14.376 1.00 3.60  ?  444  LEU A N     1 
ATOM   2220 C  CA    . LEU A 1 306 ? -6.077  -13.059 -14.013 1.00 3.49  ?  444  LEU A CA    1 
ATOM   2221 C  C     . LEU A 1 306 ? -6.965  -12.511 -15.128 1.00 3.69  ?  444  LEU A C     1 
ATOM   2222 O  O     . LEU A 1 306 ? -8.008  -13.106 -15.453 1.00 5.56  ?  444  LEU A O     1 
ATOM   2223 C  CB    . LEU A 1 306 ? -6.298  -12.252 -12.725 1.00 4.96  ?  444  LEU A CB    1 
ATOM   2224 C  CG    . LEU A 1 306 ? -7.741  -12.329 -12.233 1.00 5.19  ?  444  LEU A CG    1 
ATOM   2225 C  CD1   . LEU A 1 306 ? -8.102  -13.724 -11.793 1.00 9.05  ?  444  LEU A CD1   1 
ATOM   2226 C  CD2   . LEU A 1 306 ? -7.912  -11.350 -11.066 1.00 7.42  ?  444  LEU A CD2   1 
ATOM   2227 N  N     . ARG A 1 307 ? -6.565  -11.384 -15.721 1.00 4.43  ?  445  ARG A N     1 
ATOM   2228 C  CA    . ARG A 1 307 ? -7.354  -10.810 -16.825 1.00 3.36  ?  445  ARG A CA    1 
ATOM   2229 C  C     . ARG A 1 307 ? -7.255  -11.698 -18.059 1.00 8.44  ?  445  ARG A C     1 
ATOM   2230 O  O     . ARG A 1 307 ? -8.244  -11.860 -18.790 1.00 6.20  ?  445  ARG A O     1 
ATOM   2231 C  CB    . ARG A 1 307 ? -6.937  -9.376  -17.114 1.00 5.96  ?  445  ARG A CB    1 
ATOM   2232 C  CG    . ARG A 1 307 ? -7.202  -8.466  -15.940 1.00 4.19  ?  445  ARG A CG    1 
ATOM   2233 C  CD    . ARG A 1 307 ? -6.581  -7.081  -16.163 1.00 7.18  ?  445  ARG A CD    1 
ATOM   2234 N  NE    . ARG A 1 307 ? -6.882  -6.298  -14.959 1.00 7.27  ?  445  ARG A NE    1 
ATOM   2235 C  CZ    . ARG A 1 307 ? -6.762  -4.986  -14.863 1.00 4.96  ?  445  ARG A CZ    1 
ATOM   2236 N  NH1   . ARG A 1 307 ? -6.327  -4.278  -15.891 1.00 7.74  ?  445  ARG A NH1   1 
ATOM   2237 N  NH2   . ARG A 1 307 ? -7.082  -4.391  -13.711 1.00 6.08  ?  445  ARG A NH2   1 
ATOM   2238 N  N     . ARG A 1 308 ? -6.096  -12.325 -18.268 1.00 4.14  ?  446  ARG A N     1 
ATOM   2239 C  CA    . ARG A 1 308 ? -5.939  -13.224 -19.423 1.00 4.76  ?  446  ARG A CA    1 
ATOM   2240 C  C     . ARG A 1 308 ? -6.814  -14.456 -19.216 1.00 6.07  ?  446  ARG A C     1 
ATOM   2241 O  O     . ARG A 1 308 ? -7.539  -14.885 -20.126 1.00 7.17  ?  446  ARG A O     1 
ATOM   2242 C  CB    . ARG A 1 308 ? -4.471  -13.626 -19.558 1.00 7.00  ?  446  ARG A CB    1 
ATOM   2243 C  CG    . ARG A 1 308 ? -4.186  -14.428 -20.816 1.00 7.82  ?  446  ARG A CG    1 
ATOM   2244 C  CD    . ARG A 1 308 ? -2.679  -14.628 -20.958 1.00 7.19  ?  446  ARG A CD    1 
ATOM   2245 N  NE    . ARG A 1 308 ? -2.024  -15.447 -19.945 1.00 7.90  ?  446  ARG A NE    1 
ATOM   2246 C  CZ    . ARG A 1 308 ? -1.693  -16.722 -20.110 1.00 10.94 ?  446  ARG A CZ    1 
ATOM   2247 N  NH1   . ARG A 1 308 ? -2.084  -17.364 -21.221 1.00 13.63 ?  446  ARG A NH1   1 
ATOM   2248 N  NH2   . ARG A 1 308 ? -1.020  -17.388 -19.167 1.00 9.46  ?  446  ARG A NH2   1 
ATOM   2249 N  N     . PHE A 1 309 ? -6.804  -15.001 -18.010 1.00 4.52  ?  447  PHE A N     1 
ATOM   2250 C  CA    . PHE A 1 309 ? -7.637  -16.146 -17.650 1.00 5.43  ?  447  PHE A CA    1 
ATOM   2251 C  C     . PHE A 1 309 ? -9.133  -15.827 -17.842 1.00 7.25  ?  447  PHE A C     1 
ATOM   2252 O  O     . PHE A 1 309 ? -9.885  -16.601 -18.460 1.00 7.90  ?  447  PHE A O     1 
ATOM   2253 C  CB    . PHE A 1 309 ? -7.394  -16.540 -16.204 1.00 4.68  ?  447  PHE A CB    1 
ATOM   2254 C  CG    . PHE A 1 309 ? -8.252  -17.687 -15.734 1.00 5.37  ?  447  PHE A CG    1 
ATOM   2255 C  CD1   . PHE A 1 309 ? -7.828  -18.997 -15.925 1.00 6.81  ?  447  PHE A CD1   1 
ATOM   2256 C  CD2   . PHE A 1 309 ? -9.477  -17.474 -15.092 1.00 6.61  ?  447  PHE A CD2   1 
ATOM   2257 C  CE1   . PHE A 1 309 ? -8.614  -20.076 -15.525 1.00 7.77  ?  447  PHE A CE1   1 
ATOM   2258 C  CE2   . PHE A 1 309 ? -10.244 -18.561 -14.667 1.00 9.10  ?  447  PHE A CE2   1 
ATOM   2259 C  CZ    . PHE A 1 309 ? -9.800  -19.867 -14.886 1.00 10.40 ?  447  PHE A CZ    1 
ATOM   2260 N  N     . SER A 1 310 ? -9.575  -14.692 -17.297 1.00 5.62  ?  448  SER A N     1 
ATOM   2261 C  CA    A SER A 1 310 ? -10.958 -14.287 -17.416 0.70 5.65  ?  448  SER A CA    1 
ATOM   2262 C  CA    B SER A 1 310 ? -10.983 -14.347 -17.408 0.30 5.64  ?  448  SER A CA    1 
ATOM   2263 C  C     . SER A 1 310 ? -11.403 -14.266 -18.873 1.00 7.40  ?  448  SER A C     1 
ATOM   2264 O  O     . SER A 1 310 ? -12.423 -14.871 -19.246 1.00 8.63  ?  448  SER A O     1 
ATOM   2265 C  CB    A SER A 1 310 ? -11.095 -12.898 -16.782 0.70 5.91  ?  448  SER A CB    1 
ATOM   2266 C  CB    B SER A 1 310 ? -11.318 -13.060 -16.637 0.30 5.91  ?  448  SER A CB    1 
ATOM   2267 O  OG    A SER A 1 310 ? -12.419 -12.460 -16.851 0.70 6.87  ?  448  SER A OG    1 
ATOM   2268 O  OG    B SER A 1 310 ? -10.780 -11.925 -17.273 0.30 6.02  ?  448  SER A OG    1 
ATOM   2269 N  N     . ARG A 1 311 ? -10.626 -13.583 -19.719 1.00 6.95  ?  449  ARG A N     1 
ATOM   2270 C  CA    . ARG A 1 311 ? -11.021 -13.443 -21.135 1.00 6.95  ?  449  ARG A CA    1 
ATOM   2271 C  C     . ARG A 1 311 ? -10.895 -14.752 -21.917 1.00 9.92  ?  449  ARG A C     1 
ATOM   2272 O  O     . ARG A 1 311 ? -11.838 -15.166 -22.631 1.00 11.71 ?  449  ARG A O     1 
ATOM   2273 C  CB    . ARG A 1 311 ? -10.197 -12.360 -21.791 1.00 7.62  ?  449  ARG A CB    1 
ATOM   2274 C  CG    . ARG A 1 311 ? -10.337 -12.241 -23.328 1.00 11.46 ?  449  ARG A CG    1 
ATOM   2275 C  CD    . ARG A 1 311 ? -9.548  -11.036 -23.876 1.00 12.02 ?  449  ARG A CD    1 
ATOM   2276 N  NE    . ARG A 1 311 ? -10.097 -9.756  -23.453 1.00 14.51 ?  449  ARG A NE    1 
ATOM   2277 C  CZ    . ARG A 1 311 ? -10.927 -9.020  -24.185 1.00 22.65 ?  449  ARG A CZ    1 
ATOM   2278 N  NH1   . ARG A 1 311 ? -11.321 -9.445  -25.378 1.00 29.34 ?  449  ARG A NH1   1 
ATOM   2279 N  NH2   . ARG A 1 311 ? -11.372 -7.869  -23.718 1.00 27.93 ?  449  ARG A NH2   1 
ATOM   2280 N  N     . LYS A 1 312 ? -9.756  -15.413 -21.795 1.00 7.74  ?  450  LYS A N     1 
ATOM   2281 C  CA    . LYS A 1 312 ? -9.493  -16.579 -22.646 1.00 11.25 ?  450  LYS A CA    1 
ATOM   2282 C  C     . LYS A 1 312 ? -10.205 -17.834 -22.167 1.00 12.06 ?  450  LYS A C     1 
ATOM   2283 O  O     . LYS A 1 312 ? -10.689 -18.625 -23.000 1.00 15.82 ?  450  LYS A O     1 
ATOM   2284 C  CB    . LYS A 1 312 ? -7.997  -16.826 -22.748 1.00 11.35 ?  450  LYS A CB    1 
ATOM   2285 C  CG    . LYS A 1 312 ? -7.273  -15.615 -23.237 1.00 11.85 ?  450  LYS A CG    1 
ATOM   2286 C  CD    . LYS A 1 312 ? -7.606  -15.208 -24.705 1.00 21.81 ?  450  LYS A CD    1 
ATOM   2287 C  CE    . LYS A 1 312 ? -6.810  -13.942 -25.115 1.00 20.35 ?  450  LYS A CE    1 
ATOM   2288 N  NZ    . LYS A 1 312 ? -7.075  -13.440 -26.519 1.00 21.01 ?  450  LYS A NZ    1 
ATOM   2289 N  N     . GLU A 1 313 ? -10.289 -18.041 -20.849 1.00 9.73  ?  451  GLU A N     1 
ATOM   2290 C  CA    . GLU A 1 313 ? -10.875 -19.276 -20.313 1.00 7.85  ?  451  GLU A CA    1 
ATOM   2291 C  C     . GLU A 1 313 ? -12.360 -19.134 -19.995 1.00 15.30 ?  451  GLU A C     1 
ATOM   2292 O  O     . GLU A 1 313 ? -13.111 -20.095 -20.134 1.00 17.10 ?  451  GLU A O     1 
ATOM   2293 C  CB    . GLU A 1 313 ? -10.160 -19.751 -19.053 1.00 7.92  ?  451  GLU A CB    1 
ATOM   2294 C  CG    . GLU A 1 313 ? -8.672  -19.969 -19.265 1.00 12.23 ?  451  GLU A CG    1 
ATOM   2295 C  CD    . GLU A 1 313 ? -8.378  -20.952 -20.386 1.00 14.61 ?  451  GLU A CD    1 
ATOM   2296 O  OE1   . GLU A 1 313 ? -7.341  -20.777 -21.061 1.00 16.43 ?  451  GLU A OE1   1 
ATOM   2297 O  OE2   . GLU A 1 313 ? -9.176  -21.904 -20.585 1.00 18.75 ?  451  GLU A OE2   1 
ATOM   2298 N  N     . LYS A 1 314 ? -12.777 -17.937 -19.574 1.00 11.82 ?  452  LYS A N     1 
ATOM   2299 C  CA    . LYS A 1 314 ? -14.170 -17.715 -19.155 1.00 11.11 ?  452  LYS A CA    1 
ATOM   2300 C  C     . LYS A 1 314 ? -15.005 -16.804 -20.058 1.00 10.33 ?  452  LYS A C     1 
ATOM   2301 O  O     . LYS A 1 314 ? -16.228 -16.681 -19.872 1.00 15.82 ?  452  LYS A O     1 
ATOM   2302 C  CB    . LYS A 1 314 ? -14.233 -17.193 -17.709 1.00 13.26 ?  452  LYS A CB    1 
ATOM   2303 C  CG    . LYS A 1 314 ? -13.502 -18.075 -16.710 1.00 9.67  ?  452  LYS A CG    1 
ATOM   2304 C  CD    . LYS A 1 314 ? -14.100 -19.469 -16.641 1.00 12.85 ?  452  LYS A CD    1 
ATOM   2305 C  CE    . LYS A 1 314 ? -13.330 -20.363 -15.704 1.00 15.46 ?  452  LYS A CE    1 
ATOM   2306 N  NZ    . LYS A 1 314 ? -13.987 -21.711 -15.611 1.00 21.17 ?  452  LYS A NZ    1 
ATOM   2307 N  N     . GLY A 1 315 ? -14.370 -16.140 -21.015 1.00 10.75 ?  453  GLY A N     1 
ATOM   2308 C  CA    . GLY A 1 315 ? -15.052 -15.226 -21.923 1.00 10.82 ?  453  GLY A CA    1 
ATOM   2309 C  C     . GLY A 1 315 ? -15.630 -13.973 -21.297 1.00 14.98 ?  453  GLY A C     1 
ATOM   2310 O  O     . GLY A 1 315 ? -16.563 -13.352 -21.844 1.00 12.94 ?  453  GLY A O     1 
ATOM   2311 N  N     . LEU A 1 316 ? -15.039 -13.568 -20.170 1.00 10.87 ?  454  LEU A N     1 
ATOM   2312 C  CA    . LEU A 1 316 ? -15.453 -12.388 -19.436 1.00 8.87  ?  454  LEU A CA    1 
ATOM   2313 C  C     . LEU A 1 316 ? -14.294 -11.391 -19.436 1.00 8.60  ?  454  LEU A C     1 
ATOM   2314 O  O     . LEU A 1 316 ? -13.121 -11.786 -19.429 1.00 9.81  ?  454  LEU A O     1 
ATOM   2315 C  CB    . LEU A 1 316 ? -15.810 -12.766 -17.997 1.00 9.72  ?  454  LEU A CB    1 
ATOM   2316 C  CG    . LEU A 1 316 ? -16.883 -13.853 -17.806 1.00 9.95  ?  454  LEU A CG    1 
ATOM   2317 C  CD1   . LEU A 1 316 ? -17.141 -14.117 -16.332 1.00 11.55 ?  454  LEU A CD1   1 
ATOM   2318 C  CD2   . LEU A 1 316 ? -18.163 -13.392 -18.511 1.00 13.26 ?  454  LEU A CD2   1 
ATOM   2319 N  N     . TRP A 1 317 ? -14.620 -10.108 -19.456 1.00 7.21  ?  455  TRP A N     1 
ATOM   2320 C  CA    . TRP A 1 317 ? -13.613 -9.073  -19.596 1.00 10.19 ?  455  TRP A CA    1 
ATOM   2321 C  C     . TRP A 1 317 ? -13.431 -8.341  -18.264 1.00 8.33  ?  455  TRP A C     1 
ATOM   2322 O  O     . TRP A 1 317 ? -14.362 -7.689  -17.782 1.00 7.68  ?  455  TRP A O     1 
ATOM   2323 C  CB    . TRP A 1 317 ? -14.018 -8.089  -20.691 1.00 13.87 ?  455  TRP A CB    1 
ATOM   2324 C  CG    . TRP A 1 317 ? -14.207 -8.734  -22.038 1.00 13.07 ?  455  TRP A CG    1 
ATOM   2325 C  CD1   . TRP A 1 317 ? -13.817 -9.982  -22.411 1.00 14.00 ?  455  TRP A CD1   1 
ATOM   2326 C  CD2   . TRP A 1 317 ? -14.822 -8.143  -23.178 1.00 15.21 ?  455  TRP A CD2   1 
ATOM   2327 N  NE1   . TRP A 1 317 ? -14.149 -10.215 -23.735 1.00 15.85 ?  455  TRP A NE1   1 
ATOM   2328 C  CE2   . TRP A 1 317 ? -14.764 -9.094  -24.225 1.00 12.92 ?  455  TRP A CE2   1 
ATOM   2329 C  CE3   . TRP A 1 317 ? -15.397 -6.901  -23.425 1.00 16.48 ?  455  TRP A CE3   1 
ATOM   2330 C  CZ2   . TRP A 1 317 ? -15.281 -8.836  -25.496 1.00 26.26 ?  455  TRP A CZ2   1 
ATOM   2331 C  CZ3   . TRP A 1 317 ? -15.908 -6.640  -24.695 1.00 20.77 ?  455  TRP A CZ3   1 
ATOM   2332 C  CH2   . TRP A 1 317 ? -15.840 -7.605  -25.711 1.00 18.66 ?  455  TRP A CH2   1 
ATOM   2333 N  N     . LEU A 1 318 ? -12.219 -8.436  -17.690 1.00 6.37  ?  456  LEU A N     1 
ATOM   2334 C  CA    . LEU A 1 318 ? -11.942 -7.916  -16.339 1.00 5.16  ?  456  LEU A CA    1 
ATOM   2335 C  C     . LEU A 1 318 ? -11.082 -6.668  -16.379 1.00 5.16  ?  456  LEU A C     1 
ATOM   2336 O  O     . LEU A 1 318 ? -10.079 -6.618  -17.084 1.00 7.51  ?  456  LEU A O     1 
ATOM   2337 C  CB    . LEU A 1 318 ? -11.240 -9.003  -15.503 1.00 5.44  ?  456  LEU A CB    1 
ATOM   2338 C  CG    . LEU A 1 318 ? -10.834 -8.587  -14.093 1.00 4.31  ?  456  LEU A CG    1 
ATOM   2339 C  CD1   . LEU A 1 318 ? -12.106 -8.407  -13.239 1.00 5.24  ?  456  LEU A CD1   1 
ATOM   2340 C  CD2   . LEU A 1 318 ? -9.966  -9.704  -13.516 1.00 5.75  ?  456  LEU A CD2   1 
ATOM   2341 N  N     . ASN A 1 319 ? -11.486 -5.655  -15.610 1.00 5.43  ?  457  ASN A N     1 
ATOM   2342 C  CA    . ASN A 1 319 ? -10.615 -4.510  -15.380 1.00 6.02  ?  457  ASN A CA    1 
ATOM   2343 C  C     . ASN A 1 319 ? -10.836 -4.006  -13.962 1.00 4.65  ?  457  ASN A C     1 
ATOM   2344 O  O     . ASN A 1 319 ? -11.489 -4.698  -13.165 1.00 5.78  ?  457  ASN A O     1 
ATOM   2345 C  CB    . ASN A 1 319 ? -10.761 -3.427  -16.461 1.00 6.89  ?  457  ASN A CB    1 
ATOM   2346 C  CG    . ASN A 1 319 ? -12.121 -2.732  -16.433 1.00 10.05 ?  457  ASN A CG    1 
ATOM   2347 O  OD1   . ASN A 1 319 ? -12.865 -2.794  -15.450 1.00 9.60  ?  457  ASN A OD1   1 
ATOM   2348 N  ND2   . ASN A 1 319 ? -12.466 -2.081  -17.554 1.00 13.76 ?  457  ASN A ND2   1 
ATOM   2349 N  N     . SER A 1 320 ? -10.253 -2.858  -13.603 1.00 6.68  ?  458  SER A N     1 
ATOM   2350 C  CA    . SER A 1 320 ? -10.361 -2.396  -12.229 1.00 4.62  ?  458  SER A CA    1 
ATOM   2351 C  C     . SER A 1 320 ? -11.688 -1.744  -11.906 1.00 7.35  ?  458  SER A C     1 
ATOM   2352 O  O     . SER A 1 320 ? -11.890 -1.323  -10.771 1.00 7.50  ?  458  SER A O     1 
ATOM   2353 C  CB    . SER A 1 320 ? -9.230  -1.441  -11.864 1.00 8.82  ?  458  SER A CB    1 
ATOM   2354 O  OG    . SER A 1 320 ? -9.481  -0.157  -12.433 1.00 10.77 ?  458  SER A OG    1 
ATOM   2355 N  N     . HIS A 1 321 ? -12.590 -1.708  -12.887 1.00 6.84  ?  459  HIS A N     1 
ATOM   2356 C  CA    . HIS A 1 321 ? -13.914 -1.135  -12.708 1.00 9.80  ?  459  HIS A CA    1 
ATOM   2357 C  C     . HIS A 1 321 ? -15.012 -2.202  -12.654 1.00 7.93  ?  459  HIS A C     1 
ATOM   2358 O  O     . HIS A 1 321 ? -16.114 -1.925  -12.185 1.00 11.50 ?  459  HIS A O     1 
ATOM   2359 C  CB    . HIS A 1 321 ? -14.257 -0.208  -13.893 1.00 9.67  ?  459  HIS A CB    1 
ATOM   2360 C  CG    . HIS A 1 321 ? -13.272 0.896   -14.112 1.00 16.61 ?  459  HIS A CG    1 
ATOM   2361 N  ND1   . HIS A 1 321 ? -12.936 1.349   -15.368 1.00 13.98 ?  459  HIS A ND1   1 
ATOM   2362 C  CD2   . HIS A 1 321 ? -12.558 1.645   -13.236 1.00 14.81 ?  459  HIS A CD2   1 
ATOM   2363 C  CE1   . HIS A 1 321 ? -12.050 2.325   -15.264 1.00 16.78 ?  459  HIS A CE1   1 
ATOM   2364 N  NE2   . HIS A 1 321 ? -11.804 2.528   -13.981 1.00 18.82 ?  459  HIS A NE2   1 
ATOM   2365 N  N     . GLY A 1 322 ? -14.757 -3.406  -13.173 1.00 6.32  ?  460  GLY A N     1 
ATOM   2366 C  CA    . GLY A 1 322 ? -15.806 -4.395  -13.250 1.00 7.61  ?  460  GLY A CA    1 
ATOM   2367 C  C     . GLY A 1 322 ? -15.454 -5.614  -14.078 1.00 7.54  ?  460  GLY A C     1 
ATOM   2368 O  O     . GLY A 1 322 ? -14.314 -5.771  -14.518 1.00 7.39  ?  460  GLY A O     1 
ATOM   2369 N  N     . LEU A 1 323 ? -16.444 -6.474  -14.290 1.00 8.06  ?  461  LEU A N     1 
ATOM   2370 C  CA    . LEU A 1 323 ? -16.245 -7.749  -14.987 1.00 6.70  ?  461  LEU A CA    1 
ATOM   2371 C  C     . LEU A 1 323 ? -17.444 -7.890  -15.918 1.00 10.06 ?  461  LEU A C     1 
ATOM   2372 O  O     . LEU A 1 323 ? -18.575 -8.043  -15.438 1.00 10.71 ?  461  LEU A O     1 
ATOM   2373 C  CB    . LEU A 1 323 ? -16.179 -8.900  -13.981 1.00 6.28  ?  461  LEU A CB    1 
ATOM   2374 C  CG    . LEU A 1 323 ? -16.029 -10.331 -14.501 1.00 8.13  ?  461  LEU A CG    1 
ATOM   2375 C  CD1   . LEU A 1 323 ? -14.760 -10.472 -15.315 1.00 9.30  ?  461  LEU A CD1   1 
ATOM   2376 C  CD2   . LEU A 1 323 ? -16.086 -11.364 -13.381 1.00 8.88  ?  461  LEU A CD2   1 
ATOM   2377 N  N     . PHE A 1 324 ? -17.173 -7.838  -17.224 1.00 7.65  ?  462  PHE A N     1 
ATOM   2378 C  CA    . PHE A 1 324 ? -18.221 -7.690  -18.248 1.00 9.61  ?  462  PHE A CA    1 
ATOM   2379 C  C     . PHE A 1 324 ? -18.432 -9.003  -18.991 1.00 12.52 ?  462  PHE A C     1 
ATOM   2380 O  O     . PHE A 1 324 ? -17.471 -9.656  -19.415 1.00 10.26 ?  462  PHE A O     1 
ATOM   2381 C  CB    . PHE A 1 324 ? -17.793 -6.600  -19.222 1.00 10.50 ?  462  PHE A CB    1 
ATOM   2382 C  CG    . PHE A 1 324 ? -18.820 -6.257  -20.259 1.00 15.42 ?  462  PHE A CG    1 
ATOM   2383 C  CD1   . PHE A 1 324 ? -19.987 -5.601  -19.913 1.00 17.39 ?  462  PHE A CD1   1 
ATOM   2384 C  CD2   . PHE A 1 324 ? -18.572 -6.540  -21.592 1.00 19.53 ?  462  PHE A CD2   1 
ATOM   2385 C  CE1   . PHE A 1 324 ? -20.922 -5.258  -20.892 1.00 19.53 ?  462  PHE A CE1   1 
ATOM   2386 C  CE2   . PHE A 1 324 ? -19.496 -6.205  -22.568 1.00 23.73 ?  462  PHE A CE2   1 
ATOM   2387 C  CZ    . PHE A 1 324 ? -20.661 -5.562  -22.207 1.00 16.75 ?  462  PHE A CZ    1 
ATOM   2388 N  N     . ASP A 1 325 ? -19.704 -9.385  -19.146 1.00 12.20 ?  463  ASP A N     1 
ATOM   2389 C  CA    . ASP A 1 325 ? -20.094 -10.514 -19.991 1.00 15.45 ?  463  ASP A CA    1 
ATOM   2390 C  C     . ASP A 1 325 ? -20.507 -9.915  -21.333 1.00 18.51 ?  463  ASP A C     1 
ATOM   2391 O  O     . ASP A 1 325 ? -21.535 -9.260  -21.429 1.00 19.44 ?  463  ASP A O     1 
ATOM   2392 C  CB    . ASP A 1 325 ? -21.258 -11.275 -19.338 1.00 16.67 ?  463  ASP A CB    1 
ATOM   2393 C  CG    . ASP A 1 325 ? -21.703 -12.490 -20.139 1.00 20.28 ?  463  ASP A CG    1 
ATOM   2394 O  OD1   . ASP A 1 325 ? -21.372 -12.560 -21.333 1.00 21.23 ?  463  ASP A OD1   1 
ATOM   2395 O  OD2   . ASP A 1 325 ? -22.374 -13.368 -19.560 1.00 26.16 ?  463  ASP A OD2   1 
ATOM   2396 N  N     . PRO A 1 326 ? -19.668 -10.092 -22.364 1.00 12.97 ?  464  PRO A N     1 
ATOM   2397 C  CA    . PRO A 1 326 ? -19.880 -9.444  -23.658 1.00 14.50 ?  464  PRO A CA    1 
ATOM   2398 C  C     . PRO A 1 326 ? -21.001 -10.082 -24.475 1.00 19.62 ?  464  PRO A C     1 
ATOM   2399 O  O     . PRO A 1 326 ? -21.435 -9.478  -25.452 1.00 27.72 ?  464  PRO A O     1 
ATOM   2400 C  CB    . PRO A 1 326 ? -18.519 -9.600  -24.347 1.00 20.14 ?  464  PRO A CB    1 
ATOM   2401 C  CG    . PRO A 1 326 ? -17.936 -10.828 -23.761 1.00 21.93 ?  464  PRO A CG    1 
ATOM   2402 C  CD    . PRO A 1 326 ? -18.451 -10.925 -22.344 1.00 18.93 ?  464  PRO A CD    1 
ATOM   2403 N  N     . GLU A 1 327 ? -21.474 -11.253 -24.067 1.00 20.59 ?  465  GLU A N     1 
ATOM   2404 C  CA    A GLU A 1 327 ? -22.616 -11.900 -24.719 0.50 25.81 ?  465  GLU A CA    1 
ATOM   2405 C  CA    B GLU A 1 327 ? -22.609 -11.865 -24.752 0.50 25.81 ?  465  GLU A CA    1 
ATOM   2406 C  C     . GLU A 1 327 ? -23.940 -11.369 -24.166 1.00 41.28 ?  465  GLU A C     1 
ATOM   2407 O  O     . GLU A 1 327 ? -24.851 -11.010 -24.919 1.00 31.95 ?  465  GLU A O     1 
ATOM   2408 C  CB    A GLU A 1 327 ? -22.545 -13.416 -24.529 0.50 23.33 ?  465  GLU A CB    1 
ATOM   2409 C  CB    B GLU A 1 327 ? -22.496 -13.399 -24.775 0.50 23.15 ?  465  GLU A CB    1 
ATOM   2410 C  CG    A GLU A 1 327 ? -21.462 -14.096 -25.338 0.50 24.77 ?  465  GLU A CG    1 
ATOM   2411 C  CG    B GLU A 1 327 ? -22.879 -14.115 -23.493 0.50 26.66 ?  465  GLU A CG    1 
ATOM   2412 N  N     . GLN A 1 328 ? -24.045 -11.319 -22.836 1.00 31.71 ?  466  GLN A N     1 
ATOM   2413 C  CA    . GLN A 1 328 ? -25.228 -10.783 -22.164 1.00 25.71 ?  466  GLN A CA    1 
ATOM   2414 C  C     . GLN A 1 328 ? -25.209 -9.262  -22.144 1.00 27.51 ?  466  GLN A C     1 
ATOM   2415 O  O     . GLN A 1 328 ? -26.234 -8.635  -21.900 1.00 25.62 ?  466  GLN A O     1 
ATOM   2416 C  CB    . GLN A 1 328 ? -25.300 -11.257 -20.719 1.00 30.63 ?  466  GLN A CB    1 
ATOM   2417 C  CG    . GLN A 1 328 ? -26.080 -12.518 -20.444 1.00 36.72 ?  466  GLN A CG    1 
ATOM   2418 C  CD    . GLN A 1 328 ? -26.346 -12.686 -18.949 1.00 38.28 ?  466  GLN A CD    1 
ATOM   2419 O  OE1   . GLN A 1 328 ? -26.163 -11.745 -18.158 1.00 35.43 ?  466  GLN A OE1   1 
ATOM   2420 N  NE2   . GLN A 1 328 ? -26.764 -13.883 -18.552 1.00 38.54 ?  466  GLN A NE2   1 
ATOM   2421 N  N     . LYS A 1 329 ? -24.041 -8.677  -22.390 1.00 17.17 ?  467  LYS A N     1 
ATOM   2422 C  CA    . LYS A 1 329 ? -23.833 -7.239  -22.257 1.00 16.85 ?  467  LYS A CA    1 
ATOM   2423 C  C     . LYS A 1 329 ? -24.185 -6.741  -20.858 1.00 23.74 ?  467  LYS A C     1 
ATOM   2424 O  O     . LYS A 1 329 ? -24.845 -5.708  -20.678 1.00 24.10 ?  467  LYS A O     1 
ATOM   2425 C  CB    . LYS A 1 329 ? -24.554 -6.457  -23.369 1.00 28.01 ?  467  LYS A CB    1 
ATOM   2426 C  CG    . LYS A 1 329 ? -24.074 -6.841  -24.769 1.00 32.22 ?  467  LYS A CG    1 
ATOM   2427 C  CD    . LYS A 1 329 ? -24.605 -5.893  -25.835 1.00 44.56 ?  467  LYS A CD    1 
ATOM   2428 N  N     . THR A 1 330 ? -23.694 -7.470  -19.858 1.00 21.82 ?  468  THR A N     1 
ATOM   2429 C  CA    . THR A 1 330 ? -23.919 -7.105  -18.472 1.00 15.38 ?  468  THR A CA    1 
ATOM   2430 C  C     . THR A 1 330 ? -22.652 -7.181  -17.632 1.00 12.21 ?  468  THR A C     1 
ATOM   2431 O  O     . THR A 1 330 ? -21.734 -7.931  -17.956 1.00 16.23 ?  468  THR A O     1 
ATOM   2432 C  CB    . THR A 1 330 ? -24.887 -8.045  -17.812 1.00 16.17 ?  468  THR A CB    1 
ATOM   2433 O  OG1   . THR A 1 330 ? -24.433 -9.387  -17.962 1.00 18.32 ?  468  THR A OG1   1 
ATOM   2434 C  CG2   . THR A 1 330 ? -26.286 -7.899  -18.443 1.00 23.26 ?  468  THR A CG2   1 
ATOM   2435 N  N     . PHE A 1 331 ? -22.688 -6.440  -16.534 1.00 9.86  ?  469  PHE A N     1 
ATOM   2436 C  CA    . PHE A 1 331 ? -21.628 -6.387  -15.526 1.00 12.03 ?  469  PHE A CA    1 
ATOM   2437 C  C     . PHE A 1 331 ? -22.000 -7.169  -14.276 1.00 18.15 ?  469  PHE A C     1 
ATOM   2438 O  O     . PHE A 1 331 ? -23.126 -7.086  -13.782 1.00 20.23 ?  469  PHE A O     1 
ATOM   2439 C  CB    . PHE A 1 331 ? -21.381 -4.926  -15.133 1.00 11.40 ?  469  PHE A CB    1 
ATOM   2440 C  CG    . PHE A 1 331 ? -20.712 -4.118  -16.193 1.00 14.94 ?  469  PHE A CG    1 
ATOM   2441 C  CD1   . PHE A 1 331 ? -19.325 -4.139  -16.324 1.00 14.27 ?  469  PHE A CD1   1 
ATOM   2442 C  CD2   . PHE A 1 331 ? -21.454 -3.349  -17.081 1.00 20.24 ?  469  PHE A CD2   1 
ATOM   2443 C  CE1   . PHE A 1 331 ? -18.688 -3.387  -17.302 1.00 14.29 ?  469  PHE A CE1   1 
ATOM   2444 C  CE2   . PHE A 1 331 ? -20.821 -2.603  -18.066 1.00 20.36 ?  469  PHE A CE2   1 
ATOM   2445 C  CZ    . PHE A 1 331 ? -19.437 -2.626  -18.180 1.00 21.89 ?  469  PHE A CZ    1 
ATOM   2446 N  N     . PHE A 1 332 ? -21.042 -7.916  -13.745 1.00 8.93  ?  470  PHE A N     1 
ATOM   2447 C  CA    . PHE A 1 332 ? -21.238 -8.703  -12.544 1.00 10.67 ?  470  PHE A CA    1 
ATOM   2448 C  C     . PHE A 1 332 ? -21.081 -7.809  -11.324 1.00 14.59 ?  470  PHE A C     1 
ATOM   2449 O  O     . PHE A 1 332 ? -20.038 -7.176  -11.133 1.00 15.45 ?  470  PHE A O     1 
ATOM   2450 C  CB    . PHE A 1 332 ? -20.200 -9.842  -12.494 1.00 11.55 ?  470  PHE A CB    1 
ATOM   2451 C  CG    . PHE A 1 332 ? -20.166 -10.593 -11.184 1.00 18.22 ?  470  PHE A CG    1 
ATOM   2452 C  CD1   . PHE A 1 332 ? -21.277 -11.272 -10.718 1.00 19.92 ?  470  PHE A CD1   1 
ATOM   2453 C  CD2   . PHE A 1 332 ? -19.008 -10.610 -10.414 1.00 18.56 ?  470  PHE A CD2   1 
ATOM   2454 C  CE1   . PHE A 1 332 ? -21.232 -11.963 -9.512  1.00 22.17 ?  470  PHE A CE1   1 
ATOM   2455 C  CE2   . PHE A 1 332 ? -18.957 -11.304 -9.228  1.00 17.59 ?  470  PHE A CE2   1 
ATOM   2456 C  CZ    . PHE A 1 332 ? -20.062 -11.977 -8.783  1.00 16.85 ?  470  PHE A CZ    1 
ATOM   2457 N  N     . GLN A 1 333 ? -22.108 -7.741  -10.486 1.00 10.41 ?  471  GLN A N     1 
ATOM   2458 C  CA    . GLN A 1 333 ? -22.038 -6.865  -9.329  1.00 12.01 ?  471  GLN A CA    1 
ATOM   2459 C  C     . GLN A 1 333 ? -21.406 -7.518  -8.098  1.00 18.70 ?  471  GLN A C     1 
ATOM   2460 O  O     . GLN A 1 333 ? -22.090 -8.051  -7.226  1.00 27.06 ?  471  GLN A O     1 
ATOM   2461 C  CB    . GLN A 1 333 ? -23.427 -6.311  -8.973  1.00 17.40 ?  471  GLN A CB    1 
ATOM   2462 C  CG    . GLN A 1 333 ? -24.080 -5.471  -10.101 1.00 22.98 ?  471  GLN A CG    1 
ATOM   2463 C  CD    . GLN A 1 333 ? -23.196 -4.319  -10.608 1.00 38.24 ?  471  GLN A CD    1 
ATOM   2464 O  OE1   . GLN A 1 333 ? -22.578 -3.588  -9.826  1.00 35.54 ?  471  GLN A OE1   1 
ATOM   2465 N  NE2   . GLN A 1 333 ? -23.140 -4.157  -11.929 1.00 32.61 ?  471  GLN A NE2   1 
ATOM   2466 N  N     . ALA A 1 334 ? -20.098 -7.423  -7.998  1.00 12.11 ?  472  ALA A N     1 
ATOM   2467 C  CA    . ALA A 1 334 ? -19.376 -8.046  -6.888  1.00 11.16 ?  472  ALA A CA    1 
ATOM   2468 C  C     . ALA A 1 334 ? -19.439 -7.236  -5.610  1.00 8.76  ?  472  ALA A C     1 
ATOM   2469 O  O     . ALA A 1 334 ? -19.346 -6.014  -5.630  1.00 10.62 ?  472  ALA A O     1 
ATOM   2470 C  CB    . ALA A 1 334 ? -17.911 -8.256  -7.281  1.00 8.97  ?  472  ALA A CB    1 
ATOM   2471 N  N     . ALA A 1 335 ? -19.543 -7.946  -4.482  1.00 9.62  ?  473  ALA A N     1 
ATOM   2472 C  CA    . ALA A 1 335 ? -19.565 -7.324  -3.174  1.00 11.98 ?  473  ALA A CA    1 
ATOM   2473 C  C     . ALA A 1 335 ? -18.243 -7.481  -2.440  1.00 9.13  ?  473  ALA A C     1 
ATOM   2474 O  O     . ALA A 1 335 ? -18.048 -6.884  -1.406  1.00 10.61 ?  473  ALA A O     1 
ATOM   2475 C  CB    . ALA A 1 335 ? -20.690 -7.953  -2.328  1.00 10.60 ?  473  ALA A CB    1 
ATOM   2476 N  N     . SER A 1 336 ? -17.339 -8.284  -3.011  1.00 5.36  ?  474  SER A N     1 
ATOM   2477 C  CA    . SER A 1 336 ? -16.070 -8.639  -2.373  1.00 4.69  ?  474  SER A CA    1 
ATOM   2478 C  C     . SER A 1 336 ? -15.129 -9.235  -3.407  1.00 3.93  ?  474  SER A C     1 
ATOM   2479 O  O     . SER A 1 336 ? -15.565 -9.696  -4.469  1.00 4.72  ?  474  SER A O     1 
ATOM   2480 C  CB    . SER A 1 336 ? -16.300 -9.696  -1.268  1.00 5.74  ?  474  SER A CB    1 
ATOM   2481 O  OG    . SER A 1 336 ? -16.804 -10.933 -1.823  1.00 5.37  ?  474  SER A OG    1 
ATOM   2482 N  N     . GLU A 1 337 ? -13.833 -9.255  -3.085  1.00 3.60  ?  475  GLU A N     1 
ATOM   2483 C  CA    . GLU A 1 337 ? -12.901 -10.023 -3.897  1.00 2.15  ?  475  GLU A CA    1 
ATOM   2484 C  C     . GLU A 1 337 ? -13.298 -11.513 -3.956  1.00 2.19  ?  475  GLU A C     1 
ATOM   2485 O  O     . GLU A 1 337 ? -13.182 -12.138 -5.012  1.00 4.01  ?  475  GLU A O     1 
ATOM   2486 C  CB    . GLU A 1 337 ? -11.457 -9.886  -3.403  1.00 3.18  ?  475  GLU A CB    1 
ATOM   2487 C  CG    . GLU A 1 337 ? -10.893 -8.466  -3.503  1.00 4.78  ?  475  GLU A CG    1 
ATOM   2488 C  CD    . GLU A 1 337 ? -9.462  -8.445  -2.989  1.00 3.58  ?  475  GLU A CD    1 
ATOM   2489 O  OE1   . GLU A 1 337 ? -9.158  -9.014  -1.902  1.00 4.70  ?  475  GLU A OE1   1 
ATOM   2490 O  OE2   . GLU A 1 337 ? -8.606  -7.854  -3.679  1.00 5.05  ?  475  GLU A OE2   1 
ATOM   2491 N  N     . GLU A 1 338 ? -13.779 -12.074 -2.835  1.00 3.34  ?  476  GLU A N     1 
ATOM   2492 C  CA    . GLU A 1 338 ? -14.224 -13.464 -2.866  1.00 5.36  ?  476  GLU A CA    1 
ATOM   2493 C  C     . GLU A 1 338 ? -15.266 -13.673 -3.946  1.00 5.29  ?  476  GLU A C     1 
ATOM   2494 O  O     . GLU A 1 338 ? -15.221 -14.706 -4.644  1.00 5.94  ?  476  GLU A O     1 
ATOM   2495 C  CB    . GLU A 1 338 ? -14.773 -13.895 -1.494  1.00 6.66  ?  476  GLU A CB    1 
ATOM   2496 C  CG    . GLU A 1 338 ? -13.682 -14.076 -0.427  1.00 5.37  ?  476  GLU A CG    1 
ATOM   2497 C  CD    . GLU A 1 338 ? -14.230 -14.741 0.825   1.00 8.08  ?  476  GLU A CD    1 
ATOM   2498 O  OE1   . GLU A 1 338 ? -14.168 -14.130 1.929   1.00 8.58  ?  476  GLU A OE1   1 
ATOM   2499 O  OE2   . GLU A 1 338 ? -14.752 -15.883 0.681   1.00 7.51  ?  476  GLU A OE2   1 
ATOM   2500 N  N     . ASP A 1 339 ? -16.193 -12.721 -4.086  1.00 5.33  ?  477  ASP A N     1 
ATOM   2501 C  CA    . ASP A 1 339 ? -17.223 -12.799 -5.146  1.00 7.54  ?  477  ASP A CA    1 
ATOM   2502 C  C     . ASP A 1 339 ? -16.564 -12.919 -6.514  1.00 6.79  ?  477  ASP A C     1 
ATOM   2503 O  O     . ASP A 1 339 ? -17.024 -13.695 -7.373  1.00 7.10  ?  477  ASP A O     1 
ATOM   2504 C  CB    . ASP A 1 339 ? -18.096 -11.551 -5.181  1.00 9.14  ?  477  ASP A CB    1 
ATOM   2505 C  CG    . ASP A 1 339 ? -19.486 -11.753 -4.578  1.00 9.10  ?  477  ASP A CG    1 
ATOM   2506 O  OD1   . ASP A 1 339 ? -19.792 -12.864 -4.131  1.00 11.97 ?  477  ASP A OD1   1 
ATOM   2507 O  OD2   . ASP A 1 339 ? -20.218 -10.744 -4.546  1.00 13.32 ?  477  ASP A OD2   1 
ATOM   2508 N  N     . ILE A 1 340 ? -15.517 -12.117 -6.754  1.00 4.04  ?  478  ILE A N     1 
ATOM   2509 C  CA    . ILE A 1 340 ? -14.905 -12.101 -8.072  1.00 4.34  ?  478  ILE A CA    1 
ATOM   2510 C  C     . ILE A 1 340 ? -14.239 -13.435 -8.392  1.00 5.12  ?  478  ILE A C     1 
ATOM   2511 O  O     . ILE A 1 340 ? -14.398 -13.982 -9.497  1.00 4.71  ?  478  ILE A O     1 
ATOM   2512 C  CB    . ILE A 1 340 ? -13.905 -10.928 -8.200  1.00 3.70  ?  478  ILE A CB    1 
ATOM   2513 C  CG1   . ILE A 1 340 ? -14.647 -9.614  -7.968  1.00 5.42  ?  478  ILE A CG1   1 
ATOM   2514 C  CG2   . ILE A 1 340 ? -13.233 -10.933 -9.594  1.00 5.98  ?  478  ILE A CG2   1 
ATOM   2515 C  CD1   . ILE A 1 340 ? -13.712 -8.384  -7.792  1.00 5.21  ?  478  ILE A CD1   1 
ATOM   2516 N  N     . PHE A 1 341 ? -13.477 -13.964 -7.440  1.00 3.78  ?  479  PHE A N     1 
ATOM   2517 C  CA    . PHE A 1 341 ? -12.857 -15.264 -7.635  1.00 2.83  ?  479  PHE A CA    1 
ATOM   2518 C  C     . PHE A 1 341 ? -13.933 -16.324 -7.914  1.00 4.70  ?  479  PHE A C     1 
ATOM   2519 O  O     . PHE A 1 341 ? -13.789 -17.128 -8.844  1.00 5.58  ?  479  PHE A O     1 
ATOM   2520 C  CB    . PHE A 1 341 ? -11.993 -15.648 -6.441  1.00 4.01  ?  479  PHE A CB    1 
ATOM   2521 C  CG    . PHE A 1 341 ? -10.651 -15.000 -6.447  1.00 4.96  ?  479  PHE A CG    1 
ATOM   2522 C  CD1   . PHE A 1 341 ? -10.456 -13.740 -5.881  1.00 6.14  ?  479  PHE A CD1   1 
ATOM   2523 C  CD2   . PHE A 1 341 ? -9.560  -15.671 -6.992  1.00 4.93  ?  479  PHE A CD2   1 
ATOM   2524 C  CE1   . PHE A 1 341 ? -9.167  -13.169 -5.871  1.00 5.04  ?  479  PHE A CE1   1 
ATOM   2525 C  CE2   . PHE A 1 341 ? -8.271  -15.087 -7.000  1.00 6.60  ?  479  PHE A CE2   1 
ATOM   2526 C  CZ    . PHE A 1 341 ? -8.086  -13.824 -6.419  1.00 5.50  ?  479  PHE A CZ    1 
ATOM   2527 N  N     . ARG A 1 342 ? -15.004 -16.313 -7.125  1.00 5.95  ?  480  ARG A N     1 
ATOM   2528 C  CA    . ARG A 1 342 ? -16.062 -17.306 -7.356  1.00 6.27  ?  480  ARG A CA    1 
ATOM   2529 C  C     . ARG A 1 342 ? -16.643 -17.194 -8.756  1.00 6.61  ?  480  ARG A C     1 
ATOM   2530 O  O     . ARG A 1 342 ? -16.908 -18.226 -9.405  1.00 10.43 ?  480  ARG A O     1 
ATOM   2531 C  CB    . ARG A 1 342 ? -17.182 -17.175 -6.319  1.00 6.97  ?  480  ARG A CB    1 
ATOM   2532 C  CG    . ARG A 1 342 ? -16.813 -17.742 -4.997  1.00 8.96  ?  480  ARG A CG    1 
ATOM   2533 C  CD    . ARG A 1 342 ? -18.016 -17.727 -4.031  1.00 11.27 ?  480  ARG A CD    1 
ATOM   2534 N  NE    . ARG A 1 342 ? -18.475 -16.391 -3.645  1.00 9.46  ?  480  ARG A NE    1 
ATOM   2535 C  CZ    . ARG A 1 342 ? -18.206 -15.813 -2.474  1.00 7.01  ?  480  ARG A CZ    1 
ATOM   2536 N  NH1   . ARG A 1 342 ? -17.455 -16.424 -1.565  1.00 6.66  ?  480  ARG A NH1   1 
ATOM   2537 N  NH2   . ARG A 1 342 ? -18.689 -14.594 -2.233  1.00 9.50  ?  480  ARG A NH2   1 
ATOM   2538 N  N     . HIS A 1 343 ? -16.872 -15.982 -9.223  1.00 7.51  ?  481  HIS A N     1 
ATOM   2539 C  CA    . HIS A 1 343 ? -17.547 -15.795 -10.489 1.00 9.45  ?  481  HIS A CA    1 
ATOM   2540 C  C     . HIS A 1 343 ? -16.656 -16.276 -11.640 1.00 11.42 ?  481  HIS A C     1 
ATOM   2541 O  O     . HIS A 1 343 ? -17.142 -16.684 -12.711 1.00 10.99 ?  481  HIS A O     1 
ATOM   2542 C  CB    . HIS A 1 343 ? -17.897 -14.345 -10.672 1.00 9.73  ?  481  HIS A CB    1 
ATOM   2543 C  CG    . HIS A 1 343 ? -18.893 -14.096 -11.764 1.00 19.29 ?  481  HIS A CG    1 
ATOM   2544 N  ND1   . HIS A 1 343 ? -20.249 -14.297 -11.594 1.00 28.38 ?  481  HIS A ND1   1 
ATOM   2545 C  CD2   . HIS A 1 343 ? -18.734 -13.661 -13.036 1.00 19.50 ?  481  HIS A CD2   1 
ATOM   2546 C  CE1   . HIS A 1 343 ? -20.880 -13.982 -12.713 1.00 24.07 ?  481  HIS A CE1   1 
ATOM   2547 N  NE2   . HIS A 1 343 ? -19.987 -13.590 -13.601 1.00 26.19 ?  481  HIS A NE2   1 
ATOM   2548 N  N     . LEU A 1 344 ? -15.347 -16.211 -11.420 1.00 8.13  ?  482  LEU A N     1 
ATOM   2549 C  CA    . LEU A 1 344 ? -14.379 -16.698 -12.408 1.00 6.54  ?  482  LEU A CA    1 
ATOM   2550 C  C     . LEU A 1 344 ? -14.051 -18.159 -12.244 1.00 8.40  ?  482  LEU A C     1 
ATOM   2551 O  O     . LEU A 1 344 ? -13.227 -18.693 -12.988 1.00 9.47  ?  482  LEU A O     1 
ATOM   2552 C  CB    . LEU A 1 344 ? -13.084 -15.888 -12.336 1.00 6.73  ?  482  LEU A CB    1 
ATOM   2553 C  CG    . LEU A 1 344 ? -13.239 -14.432 -12.744 1.00 7.95  ?  482  LEU A CG    1 
ATOM   2554 C  CD1   . LEU A 1 344 ? -11.985 -13.683 -12.440 1.00 7.73  ?  482  LEU A CD1   1 
ATOM   2555 C  CD2   . LEU A 1 344 ? -13.553 -14.365 -14.234 1.00 12.38 ?  482  LEU A CD2   1 
ATOM   2556 N  N     . GLY A 1 345 ? -14.667 -18.834 -11.275 1.00 8.06  ?  483  GLY A N     1 
ATOM   2557 C  CA    . GLY A 1 345 ? -14.398 -20.247 -11.075 1.00 7.14  ?  483  GLY A CA    1 
ATOM   2558 C  C     . GLY A 1 345 ? -13.006 -20.575 -10.537 1.00 12.21 ?  483  GLY A C     1 
ATOM   2559 O  O     . GLY A 1 345 ? -12.452 -21.646 -10.803 1.00 13.18 ?  483  GLY A O     1 
ATOM   2560 N  N     . LEU A 1 346 ? -12.430 -19.627 -9.794  1.00 6.78  ?  484  LEU A N     1 
ATOM   2561 C  CA    . LEU A 1 346 ? -11.103 -19.780 -9.212  1.00 7.51  ?  484  LEU A CA    1 
ATOM   2562 C  C     . LEU A 1 346 ? -11.205 -19.890 -7.707  1.00 6.78  ?  484  LEU A C     1 
ATOM   2563 O  O     . LEU A 1 346 ? -12.031 -19.213 -7.084  1.00 9.41  ?  484  LEU A O     1 
ATOM   2564 C  CB    . LEU A 1 346 ? -10.278 -18.528 -9.521  1.00 5.09  ?  484  LEU A CB    1 
ATOM   2565 C  CG    . LEU A 1 346 ? -9.908  -18.295 -10.981 1.00 7.08  ?  484  LEU A CG    1 
ATOM   2566 C  CD1   . LEU A 1 346 ? -9.317  -16.891 -11.141 1.00 6.90  ?  484  LEU A CD1   1 
ATOM   2567 C  CD2   . LEU A 1 346 ? -8.883  -19.338 -11.395 1.00 8.14  ?  484  LEU A CD2   1 
ATOM   2568 N  N     . GLU A 1 347 ? -10.394 -20.762 -7.123  1.00 8.03  ?  485  GLU A N     1 
ATOM   2569 C  CA    . GLU A 1 347 ? -10.243 -20.774 -5.666  1.00 7.36  ?  485  GLU A CA    1 
ATOM   2570 C  C     . GLU A 1 347 ? -9.734  -19.407 -5.191  1.00 9.10  ?  485  GLU A C     1 
ATOM   2571 O  O     . GLU A 1 347 ? -8.834  -18.823 -5.811  1.00 7.74  ?  485  GLU A O     1 
ATOM   2572 C  CB    . GLU A 1 347 ? -9.265  -21.863 -5.218  1.00 12.87 ?  485  GLU A CB    1 
ATOM   2573 N  N     . TYR A 1 348 ? -10.294 -18.909 -4.094  1.00 9.41  ?  486  TYR A N     1 
ATOM   2574 C  CA    . TYR A 1 348 ? -9.893  -17.611 -3.558  1.00 5.40  ?  486  TYR A CA    1 
ATOM   2575 C  C     . TYR A 1 348 ? -8.416  -17.616 -3.126  1.00 6.81  ?  486  TYR A C     1 
ATOM   2576 O  O     . TYR A 1 348 ? -7.925  -18.569 -2.511  1.00 6.52  ?  486  TYR A O     1 
ATOM   2577 C  CB    . TYR A 1 348 ? -10.761 -17.246 -2.346  1.00 5.23  ?  486  TYR A CB    1 
ATOM   2578 C  CG    . TYR A 1 348 ? -10.324 -15.923 -1.740  1.00 5.95  ?  486  TYR A CG    1 
ATOM   2579 C  CD1   . TYR A 1 348 ? -10.572 -14.729 -2.395  1.00 8.61  ?  486  TYR A CD1   1 
ATOM   2580 C  CD2   . TYR A 1 348 ? -9.654  -15.895 -0.538  1.00 9.34  ?  486  TYR A CD2   1 
ATOM   2581 C  CE1   . TYR A 1 348 ? -10.132 -13.508 -1.854  1.00 8.61  ?  486  TYR A CE1   1 
ATOM   2582 C  CE2   . TYR A 1 348 ? -9.255  -14.678 0.026   1.00 10.73 ?  486  TYR A CE2   1 
ATOM   2583 C  CZ    . TYR A 1 348 ? -9.504  -13.513 -0.635  1.00 10.99 ?  486  TYR A CZ    1 
ATOM   2584 O  OH    . TYR A 1 348 ? -9.048  -12.346 -0.046  1.00 13.41 ?  486  TYR A OH    1 
ATOM   2585 N  N     . LEU A 1 349 ? -7.703  -16.544 -3.470  1.00 5.68  ?  487  LEU A N     1 
ATOM   2586 C  CA    . LEU A 1 349 ? -6.336  -16.338 -2.980  1.00 3.93  ?  487  LEU A CA    1 
ATOM   2587 C  C     . LEU A 1 349 ? -6.287  -15.045 -2.185  1.00 3.14  ?  487  LEU A C     1 
ATOM   2588 O  O     . LEU A 1 349 ? -6.634  -13.987 -2.698  1.00 5.24  ?  487  LEU A O     1 
ATOM   2589 C  CB    . LEU A 1 349 ? -5.354  -16.229 -4.165  1.00 5.45  ?  487  LEU A CB    1 
ATOM   2590 C  CG    . LEU A 1 349 ? -5.189  -17.573 -4.904  1.00 8.11  ?  487  LEU A CG    1 
ATOM   2591 C  CD1   . LEU A 1 349 ? -4.470  -17.337 -6.213  1.00 9.10  ?  487  LEU A CD1   1 
ATOM   2592 C  CD2   . LEU A 1 349 ? -4.429  -18.604 -4.049  1.00 10.72 ?  487  LEU A CD2   1 
ATOM   2593 N  N     . PRO A 1 350 ? -5.865  -15.115 -0.929  1.00 5.75  ?  488  PRO A N     1 
ATOM   2594 C  CA    . PRO A 1 350 ? -5.692  -13.864 -0.192  1.00 5.06  ?  488  PRO A CA    1 
ATOM   2595 C  C     . PRO A 1 350 ? -4.537  -13.078 -0.814  1.00 4.31  ?  488  PRO A C     1 
ATOM   2596 O  O     . PRO A 1 350 ? -3.755  -13.635 -1.584  1.00 4.34  ?  488  PRO A O     1 
ATOM   2597 C  CB    . PRO A 1 350 ? -5.320  -14.321 1.225   1.00 7.69  ?  488  PRO A CB    1 
ATOM   2598 C  CG    . PRO A 1 350 ? -4.674  -15.695 1.013   1.00 10.15 ?  488  PRO A CG    1 
ATOM   2599 C  CD    . PRO A 1 350 ? -5.479  -16.302 -0.134  1.00 8.17  ?  488  PRO A CD    1 
ATOM   2600 N  N     . PRO A 1 351 ? -4.431  -11.785 -0.476  1.00 2.69  ?  489  PRO A N     1 
ATOM   2601 C  CA    . PRO A 1 351 ? -3.396  -10.947 -1.093  1.00 3.32  ?  489  PRO A CA    1 
ATOM   2602 C  C     . PRO A 1 351 ? -1.984  -11.495 -0.929  1.00 3.10  ?  489  PRO A C     1 
ATOM   2603 O  O     . PRO A 1 351 ? -1.170  -11.350 -1.849  1.00 3.56  ?  489  PRO A O     1 
ATOM   2604 C  CB    . PRO A 1 351 ? -3.553  -9.604  -0.356  1.00 4.02  ?  489  PRO A CB    1 
ATOM   2605 C  CG    . PRO A 1 351 ? -4.936  -9.585  0.129   1.00 10.33 ?  489  PRO A CG    1 
ATOM   2606 C  CD    . PRO A 1 351 ? -5.409  -11.007 0.313   1.00 5.46  ?  489  PRO A CD    1 
ATOM   2607 N  N     . GLU A 1 352 ? -1.711  -12.138 0.206   1.00 4.66  ?  490  GLU A N     1 
ATOM   2608 C  CA    A GLU A 1 352 ? -0.361  -12.621 0.428   0.40 6.26  ?  490  GLU A CA    1 
ATOM   2609 C  CA    B GLU A 1 352 ? -0.427  -12.736 0.539   0.60 6.15  ?  490  GLU A CA    1 
ATOM   2610 C  C     . GLU A 1 352 ? -0.024  -13.851 -0.418  1.00 4.99  ?  490  GLU A C     1 
ATOM   2611 O  O     . GLU A 1 352 ? 1.148   -14.244 -0.461  1.00 5.97  ?  490  GLU A O     1 
ATOM   2612 C  CB    A GLU A 1 352 ? -0.053  -12.834 1.913   0.40 8.27  ?  490  GLU A CB    1 
ATOM   2613 C  CB    B GLU A 1 352 ? -0.477  -13.270 1.975   0.60 6.97  ?  490  GLU A CB    1 
ATOM   2614 C  CG    A GLU A 1 352 ? -0.751  -14.011 2.536   0.40 8.60  ?  490  GLU A CG    1 
ATOM   2615 C  CG    B GLU A 1 352 ? -0.607  -12.166 3.026   0.60 8.19  ?  490  GLU A CG    1 
ATOM   2616 C  CD    A GLU A 1 352 ? -2.176  -13.734 2.969   0.40 11.03 ?  490  GLU A CD    1 
ATOM   2617 C  CD    B GLU A 1 352 ? -2.035  -11.667 3.275   0.60 8.81  ?  490  GLU A CD    1 
ATOM   2618 O  OE1   A GLU A 1 352 ? -2.680  -12.605 2.769   0.40 9.48  ?  490  GLU A OE1   1 
ATOM   2619 O  OE1   B GLU A 1 352 ? -3.047  -12.201 2.717   0.60 5.88  ?  490  GLU A OE1   1 
ATOM   2620 O  OE2   A GLU A 1 352 ? -2.801  -14.662 3.528   0.40 20.07 ?  490  GLU A OE2   1 
ATOM   2621 O  OE2   B GLU A 1 352 ? -2.140  -10.712 4.080   0.60 10.99 ?  490  GLU A OE2   1 
ATOM   2622 N  N     . GLN A 1 353 ? -1.003  -14.397 -1.156  1.00 4.14  ?  491  GLN A N     1 
ATOM   2623 C  CA    . GLN A 1 353 ? -0.717  -15.471 -2.110  1.00 3.43  ?  491  GLN A CA    1 
ATOM   2624 C  C     . GLN A 1 353 ? -0.848  -15.026 -3.554  1.00 3.41  ?  491  GLN A C     1 
ATOM   2625 O  O     . GLN A 1 353 ? -0.963  -15.868 -4.464  1.00 5.01  ?  491  GLN A O     1 
ATOM   2626 C  CB    . GLN A 1 353 ? -1.622  -16.683 -1.847  1.00 5.64  ?  491  GLN A CB    1 
ATOM   2627 C  CG    . GLN A 1 353 ? -1.493  -17.213 -0.432  1.00 7.41  ?  491  GLN A CG    1 
ATOM   2628 C  CD    . GLN A 1 353 ? -0.130  -17.740 -0.117  1.00 8.37  ?  491  GLN A CD    1 
ATOM   2629 O  OE1   . GLN A 1 353 ? 0.616   -18.191 -1.005  1.00 11.23 ?  491  GLN A OE1   1 
ATOM   2630 N  NE2   . GLN A 1 353 ? 0.223   -17.702 1.164   1.00 14.12 ?  491  GLN A NE2   1 
ATOM   2631 N  N     . ARG A 1 354 ? -0.825  -13.699 -3.762  1.00 3.01  ?  492  ARG A N     1 
ATOM   2632 C  CA    . ARG A 1 354 ? -0.872  -13.130 -5.111  1.00 1.61  ?  492  ARG A CA    1 
ATOM   2633 C  C     . ARG A 1 354 ? 0.467   -12.562 -5.560  1.00 3.22  ?  492  ARG A C     1 
ATOM   2634 O  O     . ARG A 1 354 ? 0.537   -11.710 -6.460  1.00 3.39  ?  492  ARG A O     1 
ATOM   2635 C  CB    . ARG A 1 354 ? -1.971  -12.053 -5.221  1.00 2.20  ?  492  ARG A CB    1 
ATOM   2636 C  CG    . ARG A 1 354 ? -3.356  -12.548 -4.805  1.00 4.78  ?  492  ARG A CG    1 
ATOM   2637 C  CD    . ARG A 1 354 ? -4.359  -11.415 -4.902  1.00 1.67  ?  492  ARG A CD    1 
ATOM   2638 N  NE    . ARG A 1 354 ? -5.542  -11.758 -4.092  1.00 3.03  ?  492  ARG A NE    1 
ATOM   2639 C  CZ    . ARG A 1 354 ? -6.442  -10.867 -3.690  1.00 5.88  ?  492  ARG A CZ    1 
ATOM   2640 N  NH1   . ARG A 1 354 ? -6.339  -9.589  -4.065  1.00 4.04  ?  492  ARG A NH1   1 
ATOM   2641 N  NH2   . ARG A 1 354 ? -7.438  -11.259 -2.908  1.00 3.98  ?  492  ARG A NH2   1 
ATOM   2642 N  N     . ASN A 1 355 ? 1.550   -13.038 -4.951  1.00 3.26  ?  493  ASN A N     1 
ATOM   2643 C  CA    . ASN A 1 355 ? 2.883   -12.538 -5.260  1.00 2.92  ?  493  ASN A CA    1 
ATOM   2644 C  C     . ASN A 1 355 ? 3.504   -13.231 -6.471  1.00 4.02  ?  493  ASN A C     1 
ATOM   2645 O  O     . ASN A 1 355 ? 4.650   -13.717 -6.410  1.00 6.63  ?  493  ASN A O     1 
ATOM   2646 C  CB    . ASN A 1 355 ? 3.745   -12.699 -3.995  1.00 3.75  ?  493  ASN A CB    1 
ATOM   2647 C  CG    . ASN A 1 355 ? 3.387   -11.662 -2.945  1.00 4.85  ?  493  ASN A CG    1 
ATOM   2648 O  OD1   . ASN A 1 355 ? 3.608   -10.474 -3.138  1.00 6.07  ?  493  ASN A OD1   1 
ATOM   2649 N  ND2   . ASN A 1 355 ? 2.801   -12.112 -1.837  1.00 5.13  ?  493  ASN A ND2   1 
ATOM   2650 N  N     . ALA A 1 356 ? 2.740   -13.307 -7.545  1.00 5.00  ?  494  ALA A N     1 
ATOM   2651 C  CA    . ALA A 1 356 ? 3.231   -13.943 -8.762  1.00 7.26  ?  494  ALA A CA    1 
ATOM   2652 C  C     . ALA A 1 356 ? 4.361   -13.140 -9.349  1.00 6.92  ?  494  ALA A C     1 
ATOM   2653 O  O     . ALA A 1 356 ? 4.346   -11.873 -9.346  1.00 6.66  ?  494  ALA A O     1 
ATOM   2654 C  CB    . ALA A 1 356 ? 2.095   -14.080 -9.804  1.00 7.98  ?  494  ALA A CB    1 
ATOM   2655 O  OXT   . ALA A 1 356 ? 5.334   -13.761 -9.855  1.00 11.32 ?  494  ALA A OXT   1 
ATOM   2656 O  "O5'" . DC  B 2 1   ? 3.555   -18.547 -38.340 1.00 22.14 ?  1    DC  T "O5'" 1 
ATOM   2657 C  "C5'" . DC  B 2 1   ? 2.421   -18.526 -39.221 1.00 17.11 ?  1    DC  T "C5'" 1 
ATOM   2658 C  "C4'" . DC  B 2 1   ? 1.110   -18.818 -38.524 1.00 16.96 ?  1    DC  T "C4'" 1 
ATOM   2659 O  "O4'" . DC  B 2 1   ? 1.227   -20.024 -37.731 1.00 20.00 ?  1    DC  T "O4'" 1 
ATOM   2660 C  "C3'" . DC  B 2 1   ? 0.747   -17.748 -37.506 1.00 16.87 ?  1    DC  T "C3'" 1 
ATOM   2661 O  "O3'" . DC  B 2 1   ? -0.074  -16.805 -38.112 1.00 16.70 ?  1    DC  T "O3'" 1 
ATOM   2662 C  "C2'" . DC  B 2 1   ? -0.009  -18.446 -36.394 1.00 21.56 ?  1    DC  T "C2'" 1 
ATOM   2663 C  "C1'" . DC  B 2 1   ? 0.500   -19.863 -36.522 1.00 25.68 ?  1    DC  T "C1'" 1 
ATOM   2664 N  N1    . DC  B 2 1   ? 1.362   -20.481 -35.489 1.00 11.88 ?  1    DC  T N1    1 
ATOM   2665 C  C2    . DC  B 2 1   ? 0.743   -20.900 -34.303 1.00 14.09 ?  1    DC  T C2    1 
ATOM   2666 O  O2    . DC  B 2 1   ? -0.456  -20.680 -34.170 1.00 14.02 ?  1    DC  T O2    1 
ATOM   2667 N  N3    . DC  B 2 1   ? 1.469   -21.547 -33.380 1.00 9.00  ?  1    DC  T N3    1 
ATOM   2668 C  C4    . DC  B 2 1   ? 2.745   -21.776 -33.603 1.00 10.45 ?  1    DC  T C4    1 
ATOM   2669 N  N4    . DC  B 2 1   ? 3.441   -22.431 -32.675 1.00 11.89 ?  1    DC  T N4    1 
ATOM   2670 C  C5    . DC  B 2 1   ? 3.421   -21.330 -34.787 1.00 11.96 ?  1    DC  T C5    1 
ATOM   2671 C  C6    . DC  B 2 1   ? 2.682   -20.692 -35.702 1.00 13.95 ?  1    DC  T C6    1 
ATOM   2672 P  P     . DG  B 2 2   ? -0.112  -15.322 -37.493 1.00 21.49 ?  2    DG  T P     1 
ATOM   2673 O  OP1   . DG  B 2 2   ? -0.769  -14.498 -38.539 1.00 24.01 ?  2    DG  T OP1   1 
ATOM   2674 O  OP2   . DG  B 2 2   ? 1.218   -14.938 -36.943 1.00 18.27 ?  2    DG  T OP2   1 
ATOM   2675 O  "O5'" . DG  B 2 2   ? -1.117  -15.512 -36.264 1.00 15.62 ?  2    DG  T "O5'" 1 
ATOM   2676 C  "C5'" . DG  B 2 2   ? -2.468  -15.956 -36.392 1.00 16.24 ?  2    DG  T "C5'" 1 
ATOM   2677 C  "C4'" . DG  B 2 2   ? -3.099  -15.818 -35.016 1.00 12.94 ?  2    DG  T "C4'" 1 
ATOM   2678 O  "O4'" . DG  B 2 2   ? -2.393  -16.683 -34.078 1.00 15.64 ?  2    DG  T "O4'" 1 
ATOM   2679 C  "C3'" . DG  B 2 2   ? -3.012  -14.420 -34.423 1.00 14.81 ?  2    DG  T "C3'" 1 
ATOM   2680 O  "O3'" . DG  B 2 2   ? -4.203  -14.282 -33.692 1.00 14.29 ?  2    DG  T "O3'" 1 
ATOM   2681 C  "C2'" . DG  B 2 2   ? -1.760  -14.460 -33.546 1.00 15.03 ?  2    DG  T "C2'" 1 
ATOM   2682 C  "C1'" . DG  B 2 2   ? -1.758  -15.906 -33.067 1.00 16.99 ?  2    DG  T "C1'" 1 
ATOM   2683 N  N9    . DG  B 2 2   ? -0.444  -16.519 -32.896 1.00 12.39 ?  2    DG  T N9    1 
ATOM   2684 C  C8    . DG  B 2 2   ? 0.690   -16.393 -33.682 1.00 12.43 ?  2    DG  T C8    1 
ATOM   2685 N  N7    . DG  B 2 2   ? 1.694   -17.132 -33.265 1.00 14.60 ?  2    DG  T N7    1 
ATOM   2686 C  C5    . DG  B 2 2   ? 1.196   -17.779 -32.136 1.00 12.52 ?  2    DG  T C5    1 
ATOM   2687 C  C6    . DG  B 2 2   ? 1.811   -18.700 -31.235 1.00 6.80  ?  2    DG  T C6    1 
ATOM   2688 O  O6    . DG  B 2 2   ? 2.943   -19.140 -31.299 1.00 11.17 ?  2    DG  T O6    1 
ATOM   2689 N  N1    . DG  B 2 2   ? 0.950   -19.145 -30.231 1.00 8.43  ?  2    DG  T N1    1 
ATOM   2690 C  C2    . DG  B 2 2   ? -0.339  -18.730 -30.086 1.00 8.75  ?  2    DG  T C2    1 
ATOM   2691 N  N2    . DG  B 2 2   ? -1.043  -19.201 -29.042 1.00 10.17 ?  2    DG  T N2    1 
ATOM   2692 N  N3    . DG  B 2 2   ? -0.918  -17.853 -30.913 1.00 14.09 ?  2    DG  T N3    1 
ATOM   2693 C  C4    . DG  B 2 2   ? -0.104  -17.424 -31.899 1.00 12.48 ?  2    DG  T C4    1 
ATOM   2694 P  P     . DG  B 2 3   ? -4.561  -12.886 -32.975 1.00 19.20 ?  3    DG  T P     1 
ATOM   2695 O  OP1   . DG  B 2 3   ? -6.023  -12.903 -32.879 1.00 20.49 ?  3    DG  T OP1   1 
ATOM   2696 O  OP2   . DG  B 2 3   ? -3.702  -11.810 -33.500 1.00 18.95 ?  3    DG  T OP2   1 
ATOM   2697 O  "O5'" . DG  B 2 3   ? -3.966  -13.120 -31.497 1.00 13.03 ?  3    DG  T "O5'" 1 
ATOM   2698 C  "C5'" . DG  B 2 3   ? -4.599  -14.086 -30.730 1.00 12.51 ?  3    DG  T "C5'" 1 
ATOM   2699 C  "C4'" . DG  B 2 3   ? -3.820  -14.139 -29.423 1.00 10.65 ?  3    DG  T "C4'" 1 
ATOM   2700 O  "O4'" . DG  B 2 3   ? -2.533  -14.707 -29.730 1.00 12.94 ?  3    DG  T "O4'" 1 
ATOM   2701 C  "C3'" . DG  B 2 3   ? -3.483  -12.758 -28.873 1.00 12.35 ?  3    DG  T "C3'" 1 
ATOM   2702 O  "O3'" . DG  B 2 3   ? -4.258  -12.567 -27.658 1.00 12.04 ?  3    DG  T "O3'" 1 
ATOM   2703 C  "C2'" . DG  B 2 3   ? -1.973  -12.737 -28.600 1.00 17.78 ?  3    DG  T "C2'" 1 
ATOM   2704 C  "C1'" . DG  B 2 3   ? -1.616  -14.207 -28.770 1.00 13.36 ?  3    DG  T "C1'" 1 
ATOM   2705 N  N9    . DG  B 2 3   ? -0.283  -14.499 -29.297 1.00 10.97 ?  3    DG  T N9    1 
ATOM   2706 C  C8    . DG  B 2 3   ? 0.269   -13.994 -30.443 1.00 15.94 ?  3    DG  T C8    1 
ATOM   2707 N  N7    . DG  B 2 3   ? 1.462   -14.458 -30.668 1.00 14.78 ?  3    DG  T N7    1 
ATOM   2708 C  C5    . DG  B 2 3   ? 1.701   -15.337 -29.610 1.00 10.45 ?  3    DG  T C5    1 
ATOM   2709 C  C6    . DG  B 2 3   ? 2.841   -16.124 -29.339 1.00 10.06 ?  3    DG  T C6    1 
ATOM   2710 O  O6    . DG  B 2 3   ? 3.871   -16.190 -30.021 1.00 11.45 ?  3    DG  T O6    1 
ATOM   2711 N  N1    . DG  B 2 3   ? 2.706   -16.874 -28.184 1.00 9.48  ?  3    DG  T N1    1 
ATOM   2712 C  C2    . DG  B 2 3   ? 1.608   -16.842 -27.384 1.00 8.24  ?  3    DG  T C2    1 
ATOM   2713 N  N2    . DG  B 2 3   ? 1.686   -17.639 -26.319 1.00 9.00  ?  3    DG  T N2    1 
ATOM   2714 N  N3    . DG  B 2 3   ? 0.506   -16.126 -27.631 1.00 11.48 ?  3    DG  T N3    1 
ATOM   2715 C  C4    . DG  B 2 3   ? 0.633   -15.380 -28.752 1.00 13.18 ?  3    DG  T C4    1 
ATOM   2716 P  P     . DC  B 2 4   ? -4.289  -11.140 -26.922 1.00 11.76 ?  4    DC  T P     1 
ATOM   2717 O  OP1   . DC  B 2 4   ? -5.557  -11.146 -26.162 1.00 15.76 ?  4    DC  T OP1   1 
ATOM   2718 O  OP2   . DC  B 2 4   ? -3.936  -10.019 -27.802 1.00 13.51 ?  4    DC  T OP2   1 
ATOM   2719 O  "O5'" . DC  B 2 4   ? -3.051  -11.255 -25.867 1.00 9.24  ?  4    DC  T "O5'" 1 
ATOM   2720 C  "C5'" . DC  B 2 4   ? -3.143  -12.234 -24.870 1.00 5.77  ?  4    DC  T "C5'" 1 
ATOM   2721 C  "C4'" . DC  B 2 4   ? -1.784  -12.316 -24.190 1.00 6.94  ?  4    DC  T "C4'" 1 
ATOM   2722 O  "O4'" . DC  B 2 4   ? -0.823  -12.833 -25.152 1.00 10.09 ?  4    DC  T "O4'" 1 
ATOM   2723 C  "C3'" . DC  B 2 4   ? -1.210  -10.993 -23.675 1.00 7.80  ?  4    DC  T "C3'" 1 
ATOM   2724 O  "O3'" . DC  B 2 4   ? -0.878  -11.119 -22.274 1.00 8.42  ?  4    DC  T "O3'" 1 
ATOM   2725 C  "C2'" . DC  B 2 4   ? 0.022   -10.750 -24.554 1.00 8.47  ?  4    DC  T "C2'" 1 
ATOM   2726 C  "C1'" . DC  B 2 4   ? 0.399   -12.196 -24.885 1.00 8.09  ?  4    DC  T "C1'" 1 
ATOM   2727 N  N1    . DC  B 2 4   ? 1.309   -12.313 -26.078 1.00 9.12  ?  4    DC  T N1    1 
ATOM   2728 C  C2    . DC  B 2 4   ? 2.310   -13.266 -26.048 1.00 7.74  ?  4    DC  T C2    1 
ATOM   2729 O  O2    . DC  B 2 4   ? 2.461   -13.998 -25.067 1.00 8.66  ?  4    DC  T O2    1 
ATOM   2730 N  N3    . DC  B 2 4   ? 3.135   -13.370 -27.109 1.00 8.77  ?  4    DC  T N3    1 
ATOM   2731 C  C4    . DC  B 2 4   ? 2.974   -12.575 -28.156 1.00 12.00 ?  4    DC  T C4    1 
ATOM   2732 N  N4    . DC  B 2 4   ? 3.874   -12.755 -29.135 1.00 12.04 ?  4    DC  T N4    1 
ATOM   2733 C  C5    . DC  B 2 4   ? 1.944   -11.586 -28.235 1.00 13.95 ?  4    DC  T C5    1 
ATOM   2734 C  C6    . DC  B 2 4   ? 1.123   -11.495 -27.161 1.00 13.30 ?  4    DC  T C6    1 
ATOM   2735 P  P     . DA  B 2 5   ? -0.771  -9.811  -21.355 1.00 7.18  ?  5    DA  T P     1 
ATOM   2736 O  OP1   . DA  B 2 5   ? -0.111  -8.693  -22.008 1.00 9.01  ?  5    DA  T OP1   1 
ATOM   2737 O  OP2   . DA  B 2 5   ? -0.278  -10.325 -20.055 1.00 5.89  ?  5    DA  T OP2   1 
ATOM   2738 O  "O5'" . DA  B 2 5   ? -2.308  -9.349  -21.265 1.00 6.66  ?  5    DA  T "O5'" 1 
ATOM   2739 C  "C5'" . DA  B 2 5   ? -3.207  -10.174 -20.512 1.00 5.74  ?  5    DA  T "C5'" 1 
ATOM   2740 C  "C4'" . DA  B 2 5   ? -4.346  -9.336  -19.938 1.00 6.52  ?  5    DA  T "C4'" 1 
ATOM   2741 O  "O4'" . DA  B 2 5   ? -3.812  -8.408  -18.976 1.00 7.25  ?  5    DA  T "O4'" 1 
ATOM   2742 C  "C3'" . DA  B 2 5   ? -5.084  -8.466  -20.959 1.00 6.84  ?  5    DA  T "C3'" 1 
ATOM   2743 O  "O3'" . DA  B 2 5   ? -6.465  -8.489  -20.589 1.00 6.48  ?  5    DA  T "O3'" 1 
ATOM   2744 C  "C2'" . DA  B 2 5   ? -4.460  -7.073  -20.833 1.00 6.39  ?  5    DA  T "C2'" 1 
ATOM   2745 C  "C1'" . DA  B 2 5   ? -4.065  -7.063  -19.355 1.00 5.69  ?  5    DA  T "C1'" 1 
ATOM   2746 N  N9    . DA  B 2 5   ? -2.853  -6.304  -19.038 1.00 6.90  ?  5    DA  T N9    1 
ATOM   2747 C  C8    . DA  B 2 5   ? -1.678  -6.253  -19.738 1.00 7.67  ?  5    DA  T C8    1 
ATOM   2748 N  N7    . DA  B 2 5   ? -0.750  -5.517  -19.152 1.00 10.30 ?  5    DA  T N7    1 
ATOM   2749 C  C5    . DA  B 2 5   ? -1.370  -5.078  -17.995 1.00 8.29  ?  5    DA  T C5    1 
ATOM   2750 C  C6    . DA  B 2 5   ? -0.931  -4.288  -16.929 1.00 7.07  ?  5    DA  T C6    1 
ATOM   2751 N  N6    . DA  B 2 5   ? 0.310   -3.759  -16.896 1.00 13.21 ?  5    DA  T N6    1 
ATOM   2752 N  N1    . DA  B 2 5   ? -1.775  -4.092  -15.922 1.00 10.74 ?  5    DA  T N1    1 
ATOM   2753 C  C2    . DA  B 2 5   ? -3.004  -4.607  -15.940 1.00 10.66 ?  5    DA  T C2    1 
ATOM   2754 N  N3    . DA  B 2 5   ? -3.526  -5.391  -16.885 1.00 7.79  ?  5    DA  T N3    1 
ATOM   2755 C  C4    . DA  B 2 5   ? -2.659  -5.563  -17.888 1.00 5.03  ?  5    DA  T C4    1 
ATOM   2756 P  P     . DT  B 2 6   ? -7.563  -7.777  -21.533 1.00 7.95  ?  6    DT  T P     1 
ATOM   2757 O  OP1   . DT  B 2 6   ? -8.851  -8.458  -21.334 1.00 9.01  ?  6    DT  T OP1   1 
ATOM   2758 O  OP2   . DT  B 2 6   ? -6.986  -7.700  -22.912 1.00 10.67 ?  6    DT  T OP2   1 
ATOM   2759 O  "O5'" . DT  B 2 6   ? -7.625  -6.288  -21.015 1.00 8.23  ?  6    DT  T "O5'" 1 
ATOM   2760 C  "C5'" . DT  B 2 6   ? -8.220  -6.128  -19.721 1.00 8.68  ?  6    DT  T "C5'" 1 
ATOM   2761 C  "C4'" . DT  B 2 6   ? -8.021  -4.685  -19.320 1.00 6.80  ?  6    DT  T "C4'" 1 
ATOM   2762 O  "O4'" . DT  B 2 6   ? -6.628  -4.487  -19.074 1.00 7.99  ?  6    DT  T "O4'" 1 
ATOM   2763 C  "C3'" . DT  B 2 6   ? -8.398  -3.687  -20.417 1.00 10.23 ?  6    DT  T "C3'" 1 
ATOM   2764 O  "O3'" . DT  B 2 6   ? -9.296  -2.781  -19.831 1.00 9.67  ?  6    DT  T "O3'" 1 
ATOM   2765 C  "C2'" . DT  B 2 6   ? -7.094  -2.991  -20.755 1.00 11.28 ?  6    DT  T "C2'" 1 
ATOM   2766 C  "C1'" . DT  B 2 6   ? -6.354  -3.158  -19.428 1.00 10.63 ?  6    DT  T "C1'" 1 
ATOM   2767 N  N1    . DT  B 2 6   ? -4.894  -2.897  -19.581 1.00 9.34  ?  6    DT  T N1    1 
ATOM   2768 C  C2    . DT  B 2 6   ? -4.258  -2.243  -18.569 1.00 10.29 ?  6    DT  T C2    1 
ATOM   2769 O  O2    . DT  B 2 6   ? -4.837  -1.907  -17.566 1.00 10.55 ?  6    DT  T O2    1 
ATOM   2770 N  N3    . DT  B 2 6   ? -2.931  -1.964  -18.757 1.00 9.98  ?  6    DT  T N3    1 
ATOM   2771 C  C4    . DT  B 2 6   ? -2.153  -2.290  -19.874 1.00 8.46  ?  6    DT  T C4    1 
ATOM   2772 O  O4    . DT  B 2 6   ? -0.956  -2.007  -19.935 1.00 11.27 ?  6    DT  T O4    1 
ATOM   2773 C  C5    . DT  B 2 6   ? -2.887  -3.011  -20.913 1.00 9.84  ?  6    DT  T C5    1 
ATOM   2774 C  C7    . DT  B 2 6   ? -2.212  -3.436  -22.180 1.00 14.18 ?  6    DT  T C7    1 
ATOM   2775 C  C6    . DT  B 2 6   ? -4.199  -3.265  -20.729 1.00 9.18  ?  6    DT  T C6    1 
ATOM   2776 P  P     . DA  B 2 7   ? -10.341 -1.952  -20.732 1.00 11.65 ?  7    DA  T P     1 
ATOM   2777 O  OP1   . DA  B 2 7   ? -11.591 -2.730  -20.635 1.00 23.20 ?  7    DA  T OP1   1 
ATOM   2778 O  OP2   . DA  B 2 7   ? -9.799  -1.683  -22.055 1.00 15.34 ?  7    DA  T OP2   1 
ATOM   2779 O  "O5'" . DA  B 2 7   ? -10.689 -0.677  -19.911 1.00 20.61 ?  7    DA  T "O5'" 1 
ATOM   2780 C  "C5'" . DA  B 2 7   ? -9.814  0.393   -20.028 1.00 17.16 ?  7    DA  T "C5'" 1 
ATOM   2781 C  "C4'" . DA  B 2 7   ? -9.302  0.696   -18.649 1.00 13.50 ?  7    DA  T "C4'" 1 
ATOM   2782 O  "O4'" . DA  B 2 7   ? -8.017  0.071   -18.642 1.00 13.88 ?  7    DA  T "O4'" 1 
ATOM   2783 C  "C3'" . DA  B 2 7   ? -9.011  2.155   -18.441 1.00 15.35 ?  7    DA  T "C3'" 1 
ATOM   2784 O  "O3'" . DA  B 2 7   ? -10.163 2.763   -17.887 1.00 16.94 ?  7    DA  T "O3'" 1 
ATOM   2785 C  "C2'" . DA  B 2 7   ? -7.801  2.140   -17.489 1.00 12.53 ?  7    DA  T "C2'" 1 
ATOM   2786 C  "C1'" . DA  B 2 7   ? -7.111  0.866   -17.937 1.00 10.37 ?  7    DA  T "C1'" 1 
ATOM   2787 N  N9    . DA  B 2 7   ? -5.878  0.984   -18.726 1.00 14.89 ?  7    DA  T N9    1 
ATOM   2788 C  C8    . DA  B 2 7   ? -5.657  0.533   -20.003 1.00 12.68 ?  7    DA  T C8    1 
ATOM   2789 N  N7    . DA  B 2 7   ? -4.438  0.727   -20.435 1.00 15.59 ?  7    DA  T N7    1 
ATOM   2790 C  C5    . DA  B 2 7   ? -3.810  1.352   -19.351 1.00 10.61 ?  7    DA  T C5    1 
ATOM   2791 C  C6    . DA  B 2 7   ? -2.492  1.819   -19.151 1.00 10.64 ?  7    DA  T C6    1 
ATOM   2792 N  N6    . DA  B 2 7   ? -1.508  1.743   -20.049 1.00 10.35 ?  7    DA  T N6    1 
ATOM   2793 N  N1    . DA  B 2 7   ? -2.220  2.413   -17.971 1.00 7.52  ?  7    DA  T N1    1 
ATOM   2794 C  C2    . DA  B 2 7   ? -3.150  2.482   -17.017 1.00 8.89  ?  7    DA  T C2    1 
ATOM   2795 N  N3    . DA  B 2 7   ? -4.431  2.076   -17.091 1.00 15.33 ?  7    DA  T N3    1 
ATOM   2796 C  C4    . DA  B 2 7   ? -4.682  1.514   -18.296 1.00 13.83 ?  7    DA  T C4    1 
ATOM   2797 P  P     . DC  B 2 8   ? -10.447 4.316   -18.198 1.00 13.34 ?  8    DC  T P     1 
ATOM   2798 O  OP1   . DC  B 2 8   ? -11.715 4.540   -17.475 1.00 23.71 ?  8    DC  T OP1   1 
ATOM   2799 O  OP2   . DC  B 2 8   ? -10.275 4.676   -19.612 1.00 17.34 ?  8    DC  T OP2   1 
ATOM   2800 O  "O5'" . DC  B 2 8   ? -9.393  5.155   -17.375 1.00 11.41 ?  8    DC  T "O5'" 1 
ATOM   2801 C  "C5'" . DC  B 2 8   ? -9.310  5.064   -15.953 1.00 9.13  ?  8    DC  T "C5'" 1 
ATOM   2802 C  "C4'" . DC  B 2 8   ? -8.126  5.902   -15.510 1.00 9.19  ?  8    DC  T "C4'" 1 
ATOM   2803 O  "O4'" . DC  B 2 8   ? -6.966  5.357   -16.167 1.00 6.82  ?  8    DC  T "O4'" 1 
ATOM   2804 C  "C3'" . DC  B 2 8   ? -8.184  7.379   -15.884 1.00 6.60  ?  8    DC  T "C3'" 1 
ATOM   2805 O  "O3'" . DC  B 2 8   ? -7.624  8.030   -14.754 1.00 7.77  ?  8    DC  T "O3'" 1 
ATOM   2806 C  "C2'" . DC  B 2 8   ? -7.236  7.468   -17.070 1.00 7.82  ?  8    DC  T "C2'" 1 
ATOM   2807 C  "C1'" . DC  B 2 8   ? -6.195  6.428   -16.675 1.00 7.98  ?  8    DC  T "C1'" 1 
ATOM   2808 N  N1    . DC  B 2 8   ? -5.466  5.913   -17.824 1.00 8.30  ?  8    DC  T N1    1 
ATOM   2809 C  C2    . DC  B 2 8   ? -4.071  6.052   -17.877 1.00 5.57  ?  8    DC  T C2    1 
ATOM   2810 O  O2    . DC  B 2 8   ? -3.471  6.609   -16.956 1.00 6.63  ?  8    DC  T O2    1 
ATOM   2811 N  N3    . DC  B 2 8   ? -3.405  5.586   -18.944 1.00 6.18  ?  8    DC  T N3    1 
ATOM   2812 C  C4    . DC  B 2 8   ? -4.064  4.964   -19.934 1.00 6.05  ?  8    DC  T C4    1 
ATOM   2813 N  N4    . DC  B 2 8   ? -3.360  4.506   -20.979 1.00 10.01 ?  8    DC  T N4    1 
ATOM   2814 C  C5    . DC  B 2 8   ? -5.473  4.781   -19.895 1.00 10.66 ?  8    DC  T C5    1 
ATOM   2815 C  C6    . DC  B 2 8   ? -6.137  5.262   -18.825 1.00 11.46 ?  8    DC  T C6    1 
ATOM   2816 P  P     . DG  B 2 9   ? -7.359  9.619   -14.695 1.00 8.61  ?  9    DG  T P     1 
ATOM   2817 O  OP1   . DG  B 2 9   ? -7.418  10.039  -13.279 1.00 10.44 ?  9    DG  T OP1   1 
ATOM   2818 O  OP2   . DG  B 2 9   ? -8.192  10.313  -15.733 1.00 10.78 ?  9    DG  T OP2   1 
ATOM   2819 O  "O5'" . DG  B 2 9   ? -5.848  9.749   -15.223 1.00 8.10  ?  9    DG  T "O5'" 1 
ATOM   2820 C  "C5'" . DG  B 2 9   ? -4.785  9.547   -14.270 1.00 6.49  ?  9    DG  T "C5'" 1 
ATOM   2821 C  "C4'" . DG  B 2 9   ? -3.648  10.529  -14.509 1.00 6.28  ?  9    DG  T "C4'" 1 
ATOM   2822 O  "O4'" . DG  B 2 9   ? -2.903  10.098  -15.677 1.00 10.43 ?  9    DG  T "O4'" 1 
ATOM   2823 C  "C3'" . DG  B 2 9   ? -4.047  11.989  -14.773 1.00 12.28 ?  9    DG  T "C3'" 1 
ATOM   2824 O  "O3'" . DG  B 2 9   ? -3.059  12.839  -14.200 1.00 12.90 ?  9    DG  T "O3'" 1 
ATOM   2825 C  "C2'" . DG  B 2 9   ? -4.095  12.087  -16.305 1.00 12.08 ?  9    DG  T "C2'" 1 
ATOM   2826 C  "C1'" . DG  B 2 9   ? -2.943  11.157  -16.684 1.00 10.12 ?  9    DG  T "C1'" 1 
ATOM   2827 N  N9    . DG  B 2 9   ? -3.107  10.410  -17.913 1.00 6.42  ?  9    DG  T N9    1 
ATOM   2828 C  C8    . DG  B 2 9   ? -4.215  9.706   -18.329 1.00 7.55  ?  9    DG  T C8    1 
ATOM   2829 N  N7    . DG  B 2 9   ? -4.060  9.037   -19.431 1.00 9.43  ?  9    DG  T N7    1 
ATOM   2830 C  C5    . DG  B 2 9   ? -2.722  9.307   -19.776 1.00 6.00  ?  9    DG  T C5    1 
ATOM   2831 C  C6    . DG  B 2 9   ? -1.949  8.857   -20.889 1.00 6.58  ?  9    DG  T C6    1 
ATOM   2832 O  O6    . DG  B 2 9   ? -2.316  8.107   -21.807 1.00 9.30  ?  9    DG  T O6    1 
ATOM   2833 N  N1    . DG  B 2 9   ? -0.640  9.384   -20.855 1.00 6.08  ?  9    DG  T N1    1 
ATOM   2834 C  C2    . DG  B 2 9   ? -0.137  10.209  -19.889 1.00 7.51  ?  9    DG  T C2    1 
ATOM   2835 N  N2    . DG  B 2 9   ? 1.144   10.617  -20.018 1.00 9.49  ?  9    DG  T N2    1 
ATOM   2836 N  N3    . DG  B 2 9   ? -0.858  10.612  -18.836 1.00 5.45  ?  9    DG  T N3    1 
ATOM   2837 C  C4    . DG  B 2 9   ? -2.119  10.133  -18.863 1.00 4.92  ?  9    DG  T C4    1 
ATOM   2838 O  "O5'" . DC  C 3 1   ? 5.562   6.403   -26.433 1.00 19.07 ?  1    DC  P "O5'" 1 
ATOM   2839 C  "C5'" . DC  C 3 1   ? 6.576   7.412   -26.366 1.00 15.26 ?  1    DC  P "C5'" 1 
ATOM   2840 C  "C4'" . DC  C 3 1   ? 6.298   8.397   -25.241 1.00 12.91 ?  1    DC  P "C4'" 1 
ATOM   2841 O  "O4'" . DC  C 3 1   ? 5.016   9.048   -25.463 1.00 12.97 ?  1    DC  P "O4'" 1 
ATOM   2842 C  "C3'" . DC  C 3 1   ? 6.137   7.751   -23.874 1.00 10.85 ?  1    DC  P "C3'" 1 
ATOM   2843 O  "O3'" . DC  C 3 1   ? 7.439   7.503   -23.303 1.00 9.96  ?  1    DC  P "O3'" 1 
ATOM   2844 C  "C2'" . DC  C 3 1   ? 5.455   8.886   -23.132 1.00 8.05  ?  1    DC  P "C2'" 1 
ATOM   2845 C  "C1'" . DC  C 3 1   ? 4.461   9.358   -24.181 1.00 9.43  ?  1    DC  P "C1'" 1 
ATOM   2846 N  N1    . DC  C 3 1   ? 3.172   8.678   -24.096 1.00 7.03  ?  1    DC  P N1    1 
ATOM   2847 C  C2    . DC  C 3 1   ? 2.290   9.099   -23.107 1.00 4.61  ?  1    DC  P C2    1 
ATOM   2848 O  O2    . DC  C 3 1   ? 2.652   9.994   -22.349 1.00 9.23  ?  1    DC  P O2    1 
ATOM   2849 N  N3    . DC  C 3 1   ? 1.087   8.540   -22.987 1.00 6.75  ?  1    DC  P N3    1 
ATOM   2850 C  C4    . DC  C 3 1   ? 0.747   7.561   -23.829 1.00 8.45  ?  1    DC  P C4    1 
ATOM   2851 N  N4    . DC  C 3 1   ? -0.469  7.031   -23.695 1.00 10.57 ?  1    DC  P N4    1 
ATOM   2852 C  C5    . DC  C 3 1   ? 1.642   7.096   -24.844 1.00 9.84  ?  1    DC  P C5    1 
ATOM   2853 C  C6    . DC  C 3 1   ? 2.834   7.678   -24.950 1.00 8.47  ?  1    DC  P C6    1 
ATOM   2854 P  P     . DG  C 3 2   ? 7.675   6.324   -22.235 1.00 9.41  ?  2    DG  P P     1 
ATOM   2855 O  OP1   . DG  C 3 2   ? 9.128   6.293   -21.965 1.00 10.34 ?  2    DG  P OP1   1 
ATOM   2856 O  OP2   . DG  C 3 2   ? 6.995   5.127   -22.745 1.00 9.95  ?  2    DG  P OP2   1 
ATOM   2857 O  "O5'" . DG  C 3 2   ? 6.862   6.784   -20.944 1.00 8.15  ?  2    DG  P "O5'" 1 
ATOM   2858 C  "C5'" . DG  C 3 2   ? 7.332   7.866   -20.177 1.00 9.77  ?  2    DG  P "C5'" 1 
ATOM   2859 C  "C4'" . DG  C 3 2   ? 6.296   8.321   -19.168 1.00 6.61  ?  2    DG  P "C4'" 1 
ATOM   2860 O  "O4'" . DG  C 3 2   ? 5.080   8.700   -19.843 1.00 7.61  ?  2    DG  P "O4'" 1 
ATOM   2861 C  "C3'" . DG  C 3 2   ? 5.880   7.259   -18.175 1.00 8.43  ?  2    DG  P "C3'" 1 
ATOM   2862 O  "O3'" . DG  C 3 2   ? 6.819   7.196   -17.126 1.00 7.63  ?  2    DG  P "O3'" 1 
ATOM   2863 C  "C2'" . DG  C 3 2   ? 4.566   7.855   -17.691 1.00 7.00  ?  2    DG  P "C2'" 1 
ATOM   2864 C  "C1'" . DG  C 3 2   ? 3.985   8.369   -19.002 1.00 7.53  ?  2    DG  P "C1'" 1 
ATOM   2865 N  N9    . DG  C 3 2   ? 3.149   7.419   -19.708 1.00 8.55  ?  2    DG  P N9    1 
ATOM   2866 C  C8    . DG  C 3 2   ? 3.408   6.675   -20.834 1.00 6.99  ?  2    DG  P C8    1 
ATOM   2867 N  N7    . DG  C 3 2   ? 2.415   5.952   -21.205 1.00 6.98  ?  2    DG  P N7    1 
ATOM   2868 C  C5    . DG  C 3 2   ? 1.403   6.224   -20.294 1.00 4.48  ?  2    DG  P C5    1 
ATOM   2869 C  C6    . DG  C 3 2   ? 0.067   5.721   -20.190 1.00 7.75  ?  2    DG  P C6    1 
ATOM   2870 O  O6    . DG  C 3 2   ? -0.507  4.914   -20.923 1.00 9.55  ?  2    DG  P O6    1 
ATOM   2871 N  N1    . DG  C 3 2   ? -0.621  6.256   -19.085 1.00 5.97  ?  2    DG  P N1    1 
ATOM   2872 C  C2    . DG  C 3 2   ? -0.064  7.158   -18.228 1.00 6.57  ?  2    DG  P C2    1 
ATOM   2873 N  N2    . DG  C 3 2   ? -0.887  7.546   -17.234 1.00 6.66  ?  2    DG  P N2    1 
ATOM   2874 N  N3    . DG  C 3 2   ? 1.194   7.624   -18.311 1.00 6.05  ?  2    DG  P N3    1 
ATOM   2875 C  C4    . DG  C 3 2   ? 1.855   7.108   -19.361 1.00 5.09  ?  2    DG  P C4    1 
ATOM   2876 P  P     . DT  C 3 3   ? 6.860   5.887   -16.189 1.00 8.27  ?  3    DT  P P     1 
ATOM   2877 O  OP1   . DT  C 3 3   ? 7.903   6.125   -15.176 1.00 8.94  ?  3    DT  P OP1   1 
ATOM   2878 O  OP2   . DT  C 3 3   ? 6.903   4.670   -17.023 1.00 8.01  ?  3    DT  P OP2   1 
ATOM   2879 O  "O5'" . DT  C 3 3   ? 5.421   5.869   -15.451 1.00 7.48  ?  3    DT  P "O5'" 1 
ATOM   2880 C  "C5'" . DT  C 3 3   ? 5.126   6.799   -14.398 1.00 8.62  ?  3    DT  P "C5'" 1 
ATOM   2881 C  "C4'" . DT  C 3 3   ? 3.718   6.539   -13.890 1.00 8.21  ?  3    DT  P "C4'" 1 
ATOM   2882 O  "O4'" . DT  C 3 3   ? 2.741   6.734   -14.941 1.00 7.94  ?  3    DT  P "O4'" 1 
ATOM   2883 C  "C3'" . DT  C 3 3   ? 3.458   5.110   -13.489 1.00 6.28  ?  3    DT  P "C3'" 1 
ATOM   2884 O  "O3'" . DT  C 3 3   ? 4.005   4.909   -12.188 1.00 8.42  ?  3    DT  P "O3'" 1 
ATOM   2885 C  "C2'" . DT  C 3 3   ? 1.936   5.121   -13.449 1.00 5.11  ?  3    DT  P "C2'" 1 
ATOM   2886 C  "C1'" . DT  C 3 3   ? 1.648   5.827   -14.765 1.00 6.50  ?  3    DT  P "C1'" 1 
ATOM   2887 N  N1    . DT  C 3 3   ? 1.562   4.916   -15.944 1.00 5.60  ?  3    DT  P N1    1 
ATOM   2888 C  C2    . DT  C 3 3   ? 0.367   4.289   -16.154 1.00 4.04  ?  3    DT  P C2    1 
ATOM   2889 O  O2    . DT  C 3 3   ? -0.576  4.425   -15.404 1.00 7.57  ?  3    DT  P O2    1 
ATOM   2890 N  N3    . DT  C 3 3   ? 0.290   3.504   -17.249 1.00 6.35  ?  3    DT  P N3    1 
ATOM   2891 C  C4    . DT  C 3 3   ? 1.323   3.264   -18.120 1.00 6.46  ?  3    DT  P C4    1 
ATOM   2892 O  O4    . DT  C 3 3   ? 1.151   2.525   -19.073 1.00 11.92 ?  3    DT  P O4    1 
ATOM   2893 C  C5    . DT  C 3 3   ? 2.588   3.913   -17.851 1.00 6.60  ?  3    DT  P C5    1 
ATOM   2894 C  C7    . DT  C 3 3   ? 3.768   3.746   -18.760 1.00 9.70  ?  3    DT  P C7    1 
ATOM   2895 C  C6    . DT  C 3 3   ? 2.650   4.716   -16.791 1.00 6.94  ?  3    DT  P C6    1 
ATOM   2896 P  P     . DA  C 3 4   ? 4.470   3.444   -11.751 1.00 8.89  ?  4    DA  P P     1 
ATOM   2897 O  OP1   . DA  C 3 4   ? 5.180   3.606   -10.459 1.00 9.89  ?  4    DA  P OP1   1 
ATOM   2898 O  OP2   . DA  C 3 4   ? 5.216   2.803   -12.873 1.00 10.08 ?  4    DA  P OP2   1 
ATOM   2899 O  "O5'" . DA  C 3 4   ? 3.123   2.628   -11.520 1.00 9.43  ?  4    DA  P "O5'" 1 
ATOM   2900 C  "C5'" . DA  C 3 4   ? 2.271   2.990   -10.445 1.00 9.61  ?  4    DA  P "C5'" 1 
ATOM   2901 C  "C4'" . DA  C 3 4   ? 0.980   2.191   -10.554 1.00 7.78  ?  4    DA  P "C4'" 1 
ATOM   2902 O  "O4'" . DA  C 3 4   ? 0.265   2.645   -11.726 1.00 10.27 ?  4    DA  P "O4'" 1 
ATOM   2903 C  "C3'" . DA  C 3 4   ? 1.126   0.693   -10.731 1.00 13.78 ?  4    DA  P "C3'" 1 
ATOM   2904 O  "O3'" . DA  C 3 4   ? 1.160   0.124   -9.446  1.00 22.99 ?  4    DA  P "O3'" 1 
ATOM   2905 C  "C2'" . DA  C 3 4   ? -0.246  0.376   -11.329 1.00 17.61 ?  4    DA  P "C2'" 1 
ATOM   2906 C  "C1'" . DA  C 3 4   ? -0.453  1.556   -12.273 1.00 14.88 ?  4    DA  P "C1'" 1 
ATOM   2907 N  N9    . DA  C 3 4   ? 0.035   1.213   -13.598 1.00 11.21 ?  4    DA  P N9    1 
ATOM   2908 C  C8    . DA  C 3 4   ? 1.269   1.417   -14.130 1.00 9.36  ?  4    DA  P C8    1 
ATOM   2909 N  N7    . DA  C 3 4   ? 1.408   0.960   -15.345 1.00 10.67 ?  4    DA  P N7    1 
ATOM   2910 C  C5    . DA  C 3 4   ? 0.151   0.444   -15.626 1.00 8.00  ?  4    DA  P C5    1 
ATOM   2911 C  C6    . DA  C 3 4   ? -0.368  -0.202  -16.766 1.00 8.61  ?  4    DA  P C6    1 
ATOM   2912 N  N6    . DA  C 3 4   ? 0.350   -0.438  -17.872 1.00 8.86  ?  4    DA  P N6    1 
ATOM   2913 N  N1    . DA  C 3 4   ? -1.643  -0.621  -16.712 1.00 8.57  ?  4    DA  P N1    1 
ATOM   2914 C  C2    . DA  C 3 4   ? -2.378  -0.408  -15.611 1.00 10.98 ?  4    DA  P C2    1 
ATOM   2915 N  N3    . DA  C 3 4   ? -1.991  0.192   -14.474 1.00 10.30 ?  4    DA  P N3    1 
ATOM   2916 C  C4    . DA  C 3 4   ? -0.704  0.585   -14.572 1.00 8.90  ?  4    DA  P C4    1 
ATOM   2917 O  OP3   . DG  D 4 1   ? 14.447  -18.535 -26.782 1.00 17.58 ?  1    DG  D OP3   1 
ATOM   2918 P  P     . DG  D 4 1   ? 13.710  -17.368 -27.335 1.00 13.90 ?  1    DG  D P     1 
ATOM   2919 O  OP1   . DG  D 4 1   ? 14.525  -16.166 -27.259 1.00 13.10 ?  1    DG  D OP1   1 
ATOM   2920 O  OP2   . DG  D 4 1   ? 13.064  -17.718 -28.640 1.00 15.76 ?  1    DG  D OP2   1 
ATOM   2921 O  "O5'" . DG  D 4 1   ? 12.420  -17.134 -26.403 1.00 13.62 ?  1    DG  D "O5'" 1 
ATOM   2922 C  "C5'" . DG  D 4 1   ? 12.589  -16.866 -25.007 1.00 13.84 ?  1    DG  D "C5'" 1 
ATOM   2923 C  "C4'" . DG  D 4 1   ? 11.501  -17.634 -24.267 1.00 9.82  ?  1    DG  D "C4'" 1 
ATOM   2924 O  "O4'" . DG  D 4 1   ? 10.184  -17.077 -24.553 1.00 9.66  ?  1    DG  D "O4'" 1 
ATOM   2925 C  "C3'" . DG  D 4 1   ? 11.402  -19.100 -24.670 1.00 9.07  ?  1    DG  D "C3'" 1 
ATOM   2926 O  "O3'" . DG  D 4 1   ? 11.145  -19.852 -23.495 1.00 11.39 ?  1    DG  D "O3'" 1 
ATOM   2927 C  "C2'" . DG  D 4 1   ? 10.245  -19.165 -25.663 1.00 9.75  ?  1    DG  D "C2'" 1 
ATOM   2928 C  "C1'" . DG  D 4 1   ? 9.345   -17.999 -25.255 1.00 9.59  ?  1    DG  D "C1'" 1 
ATOM   2929 N  N9    . DG  D 4 1   ? 8.834   -17.186 -26.345 1.00 9.61  ?  1    DG  D N9    1 
ATOM   2930 C  C8    . DG  D 4 1   ? 9.427   -16.831 -27.542 1.00 10.76 ?  1    DG  D C8    1 
ATOM   2931 N  N7    . DG  D 4 1   ? 8.705   -16.018 -28.302 1.00 12.34 ?  1    DG  D N7    1 
ATOM   2932 C  C5    . DG  D 4 1   ? 7.542   -15.823 -27.532 1.00 11.44 ?  1    DG  D C5    1 
ATOM   2933 C  C6    . DG  D 4 1   ? 6.393   -15.058 -27.819 1.00 11.94 ?  1    DG  D C6    1 
ATOM   2934 O  O6    . DG  D 4 1   ? 6.150   -14.350 -28.816 1.00 11.45 ?  1    DG  D O6    1 
ATOM   2935 N  N1    . DG  D 4 1   ? 5.456   -15.123 -26.792 1.00 7.15  ?  1    DG  D N1    1 
ATOM   2936 C  C2    . DG  D 4 1   ? 5.632   -15.869 -25.631 1.00 8.02  ?  1    DG  D C2    1 
ATOM   2937 N  N2    . DG  D 4 1   ? 4.613   -15.808 -24.757 1.00 6.98  ?  1    DG  D N2    1 
ATOM   2938 N  N3    . DG  D 4 1   ? 6.696   -16.618 -25.351 1.00 9.43  ?  1    DG  D N3    1 
ATOM   2939 C  C4    . DG  D 4 1   ? 7.622   -16.534 -26.339 1.00 7.55  ?  1    DG  D C4    1 
ATOM   2940 P  P     . DC  D 4 2   ? 11.223  -21.463 -23.462 1.00 12.17 ?  2    DC  D P     1 
ATOM   2941 O  OP1   . DC  D 4 2   ? 11.648  -21.837 -22.091 1.00 13.62 ?  2    DC  D OP1   1 
ATOM   2942 O  OP2   . DC  D 4 2   ? 12.010  -21.939 -24.636 1.00 13.56 ?  2    DC  D OP2   1 
ATOM   2943 O  "O5'" . DC  D 4 2   ? 9.750   -21.952 -23.622 1.00 10.22 ?  2    DC  D "O5'" 1 
ATOM   2944 C  "C5'" . DC  D 4 2   ? 8.789   -21.661 -22.571 1.00 9.34  ?  2    DC  D "C5'" 1 
ATOM   2945 C  "C4'" . DC  D 4 2   ? 7.388   -21.450 -23.120 1.00 9.12  ?  2    DC  D "C4'" 1 
ATOM   2946 O  "O4'" . DC  D 4 2   ? 7.387   -20.534 -24.222 1.00 7.98  ?  2    DC  D "O4'" 1 
ATOM   2947 C  "C3'" . DC  D 4 2   ? 6.678   -22.708 -23.614 1.00 9.86  ?  2    DC  D "C3'" 1 
ATOM   2948 O  "O3'" . DC  D 4 2   ? 5.955   -23.194 -22.476 1.00 10.01 ?  2    DC  D "O3'" 1 
ATOM   2949 C  "C2'" . DC  D 4 2   ? 5.757   -22.149 -24.690 1.00 9.04  ?  2    DC  D "C2'" 1 
ATOM   2950 C  "C1'" . DC  D 4 2   ? 6.075   -20.665 -24.749 1.00 10.15 ?  2    DC  D "C1'" 1 
ATOM   2951 N  N1    . DC  D 4 2   ? 6.046   -20.012 -26.081 1.00 12.19 ?  2    DC  D N1    1 
ATOM   2952 C  C2    . DC  D 4 2   ? 4.968   -19.194 -26.431 1.00 7.51  ?  2    DC  D C2    1 
ATOM   2953 O  O2    . DC  D 4 2   ? 4.052   -19.085 -25.620 1.00 8.50  ?  2    DC  D O2    1 
ATOM   2954 N  N3    . DC  D 4 2   ? 4.938   -18.555 -27.616 1.00 9.92  ?  2    DC  D N3    1 
ATOM   2955 C  C4    . DC  D 4 2   ? 5.948   -18.747 -28.463 1.00 12.59 ?  2    DC  D C4    1 
ATOM   2956 N  N4    . DC  D 4 2   ? 5.897   -18.111 -29.640 1.00 13.56 ?  2    DC  D N4    1 
ATOM   2957 C  C5    . DC  D 4 2   ? 7.068   -19.581 -28.141 1.00 10.77 ?  2    DC  D C5    1 
ATOM   2958 C  C6    . DC  D 4 2   ? 7.082   -20.206 -26.958 1.00 10.16 ?  2    DC  D C6    1 
ATOM   2959 P  P     . DC  D 4 3   ? 4.978   -24.473 -22.533 1.00 10.99 ?  3    DC  D P     1 
ATOM   2960 O  OP1   . DC  D 4 3   ? 4.772   -25.057 -21.216 1.00 10.35 ?  3    DC  D OP1   1 
ATOM   2961 O  OP2   . DC  D 4 3   ? 5.483   -25.369 -23.635 1.00 14.54 ?  3    DC  D OP2   1 
ATOM   2962 O  "O5'" . DC  D 4 3   ? 3.630   -23.864 -23.065 1.00 10.08 ?  3    DC  D "O5'" 1 
ATOM   2963 C  "C5'" . DC  D 4 3   ? 2.963   -22.886 -22.248 1.00 10.67 ?  3    DC  D "C5'" 1 
ATOM   2964 C  "C4'" . DC  D 4 3   ? 1.592   -22.631 -22.829 1.00 13.96 ?  3    DC  D "C4'" 1 
ATOM   2965 O  "O4'" . DC  D 4 3   ? 1.798   -22.016 -24.120 1.00 15.41 ?  3    DC  D "O4'" 1 
ATOM   2966 C  "C3'" . DC  D 4 3   ? 0.829   -23.926 -23.090 1.00 19.17 ?  3    DC  D "C3'" 1 
ATOM   2967 O  "O3'" . DC  D 4 3   ? -0.435  -23.829 -22.502 1.00 29.07 ?  3    DC  D "O3'" 1 
ATOM   2968 C  "C2'" . DC  D 4 3   ? 0.779   -24.057 -24.615 1.00 19.30 ?  3    DC  D "C2'" 1 
ATOM   2969 C  "C1'" . DC  D 4 3   ? 0.906   -22.611 -25.081 1.00 18.13 ?  3    DC  D "C1'" 1 
ATOM   2970 N  N1    . DC  D 4 3   ? 1.676   -22.301 -26.316 1.00 13.23 ?  3    DC  D N1    1 
ATOM   2971 C  C2    . DC  D 4 3   ? 1.196   -21.340 -27.235 1.00 8.24  ?  3    DC  D C2    1 
ATOM   2972 O  O2    . DC  D 4 3   ? 0.108   -20.805 -27.007 1.00 12.21 ?  3    DC  D O2    1 
ATOM   2973 N  N3    . DC  D 4 3   ? 1.950   -21.028 -28.311 1.00 11.03 ?  3    DC  D N3    1 
ATOM   2974 C  C4    . DC  D 4 3   ? 3.127   -21.625 -28.490 1.00 8.63  ?  3    DC  D C4    1 
ATOM   2975 N  N4    . DC  D 4 3   ? 3.867   -21.280 -29.537 1.00 8.43  ?  3    DC  D N4    1 
ATOM   2976 C  C5    . DC  D 4 3   ? 3.646   -22.614 -27.579 1.00 7.59  ?  3    DC  D C5    1 
ATOM   2977 C  C6    . DC  D 4 3   ? 2.883   -22.911 -26.530 1.00 9.80  ?  3    DC  D C6    1 
ATOM   2978 P  P     . DG  D 4 4   ? -1.463  -25.061 -22.608 1.00 31.73 ?  4    DG  D P     1 
ATOM   2979 O  OP1   . DG  D 4 4   ? -2.261  -24.953 -21.387 1.00 26.28 ?  4    DG  D OP1   1 
ATOM   2980 O  OP2   . DG  D 4 4   ? -0.793  -26.335 -22.985 1.00 35.12 ?  4    DG  D OP2   1 
ATOM   2981 O  "O5'" . DG  D 4 4   ? -2.398  -24.681 -23.856 1.00 20.65 ?  4    DG  D "O5'" 1 
ATOM   2982 C  "C5'" . DG  D 4 4   ? -3.169  -23.509 -23.884 1.00 16.22 ?  4    DG  D "C5'" 1 
ATOM   2983 C  "C4'" . DG  D 4 4   ? -3.853  -23.475 -25.256 1.00 17.14 ?  4    DG  D "C4'" 1 
ATOM   2984 O  "O4'" . DG  D 4 4   ? -2.841  -23.230 -26.277 1.00 15.38 ?  4    DG  D "O4'" 1 
ATOM   2985 C  "C3'" . DG  D 4 4   ? -4.516  -24.793 -25.642 1.00 19.44 ?  4    DG  D "C3'" 1 
ATOM   2986 O  "O3'" . DG  D 4 4   ? -5.797  -24.530 -26.204 1.00 21.54 ?  4    DG  D "O3'" 1 
ATOM   2987 C  "C2'" . DG  D 4 4   ? -3.559  -25.404 -26.672 1.00 16.56 ?  4    DG  D "C2'" 1 
ATOM   2988 C  "C1'" . DG  D 4 4   ? -2.963  -24.164 -27.330 1.00 15.06 ?  4    DG  D "C1'" 1 
ATOM   2989 N  N9    . DG  D 4 4   ? -1.618  -24.340 -27.921 1.00 11.85 ?  4    DG  D N9    1 
ATOM   2990 C  C8    . DG  D 4 4   ? -0.626  -25.193 -27.517 1.00 9.80  ?  4    DG  D C8    1 
ATOM   2991 N  N7    . DG  D 4 4   ? 0.465   -25.115 -28.240 1.00 11.74 ?  4    DG  D N7    1 
ATOM   2992 C  C5    . DG  D 4 4   ? 0.146   -24.163 -29.210 1.00 11.39 ?  4    DG  D C5    1 
ATOM   2993 C  C6    . DG  D 4 4   ? 0.892   -23.642 -30.306 1.00 7.92  ?  4    DG  D C6    1 
ATOM   2994 O  O6    . DG  D 4 4   ? 2.021   -23.904 -30.662 1.00 11.79 ?  4    DG  D O6    1 
ATOM   2995 N  N1    . DG  D 4 4   ? 0.193   -22.693 -31.032 1.00 7.61  ?  4    DG  D N1    1 
ATOM   2996 C  C2    . DG  D 4 4   ? -1.074  -22.285 -30.760 1.00 6.15  ?  4    DG  D C2    1 
ATOM   2997 N  N2    . DG  D 4 4   ? -1.586  -21.357 -31.587 1.00 12.52 ?  4    DG  D N2    1 
ATOM   2998 N  N3    . DG  D 4 4   ? -1.812  -22.754 -29.754 1.00 9.22  ?  4    DG  D N3    1 
ATOM   2999 C  C4    . DG  D 4 4   ? -1.128  -23.670 -29.021 1.00 8.96  ?  4    DG  D C4    1 
HETATM 3000 C  C1    . GOL E 5 .   ? -3.566  -1.527  -12.407 1.00 27.27 ?  501  GOL A C1    1 
HETATM 3001 O  O1    . GOL E 5 .   ? -2.976  -1.689  -11.139 1.00 33.56 ?  501  GOL A O1    1 
HETATM 3002 C  C2    . GOL E 5 .   ? -5.015  -1.080  -12.289 1.00 34.52 ?  501  GOL A C2    1 
HETATM 3003 O  O2    . GOL E 5 .   ? -5.819  -2.187  -11.919 1.00 26.99 ?  501  GOL A O2    1 
HETATM 3004 C  C3    . GOL E 5 .   ? -5.484  -0.542  -13.636 1.00 28.01 ?  501  GOL A C3    1 
HETATM 3005 O  O3    . GOL E 5 .   ? -6.083  -1.595  -14.371 1.00 25.24 ?  501  GOL A O3    1 
HETATM 3006 CL CL    . CL  F 6 .   ? 8.765   -11.201 -27.955 1.00 23.52 -1 502  CL  A CL    1 
HETATM 3007 NA NA    . NA  G 7 .   ? 10.328  4.720   -15.067 1.00 10.57 1  503  NA  A NA    1 
HETATM 3008 NA NA    . NA  H 7 .   ? 8.345   -28.187 -20.953 1.00 17.44 1  504  NA  A NA    1 
HETATM 3009 CL CL    . CL  I 6 .   ? -8.849  -0.437  -15.257 1.00 19.10 -1 505  CL  A CL    1 
HETATM 3010 O  O     . HOH J 8 .   ? 9.408   -22.139 -4.339  1.00 5.61  ?  601  HOH A O     1 
HETATM 3011 O  O     . HOH J 8 .   ? -11.012 2.666   0.980   1.00 6.29  ?  602  HOH A O     1 
HETATM 3012 O  O     . HOH J 8 .   ? -4.787  -8.568  -6.331  1.00 5.12  ?  603  HOH A O     1 
HETATM 3013 O  O     . HOH J 8 .   ? 5.872   -21.656 -2.894  1.00 8.30  ?  604  HOH A O     1 
HETATM 3014 O  O     . HOH J 8 .   ? -13.112 -10.589 -0.266  1.00 7.63  ?  605  HOH A O     1 
HETATM 3015 O  O     . HOH J 8 .   ? -13.714 -11.535 2.264   1.00 8.76  ?  606  HOH A O     1 
HETATM 3016 O  O     . HOH J 8 .   ? -0.496  -16.330 -7.451  1.00 8.10  ?  607  HOH A O     1 
HETATM 3017 O  O     . HOH J 8 .   ? 3.126   -14.501 1.300   1.00 8.26  ?  608  HOH A O     1 
HETATM 3018 O  O     . HOH J 8 .   ? 12.155  -15.859 -1.483  1.00 8.93  ?  609  HOH A O     1 
HETATM 3019 O  O     . HOH J 8 .   ? 4.337   -18.540 -21.729 1.00 10.16 ?  610  HOH A O     1 
HETATM 3020 O  O     . HOH J 8 .   ? 1.340   -0.265  -1.157  1.00 8.34  ?  611  HOH A O     1 
HETATM 3021 O  O     . HOH J 8 .   ? -6.881  -19.726 -7.549  1.00 9.16  ?  612  HOH A O     1 
HETATM 3022 O  O     . HOH J 8 .   ? 4.734   -8.928  -11.245 1.00 9.73  ?  613  HOH A O     1 
HETATM 3023 O  O     . HOH J 8 .   ? 3.836   -6.068  -8.948  1.00 11.69 ?  614  HOH A O     1 
HETATM 3024 O  O     . HOH J 8 .   ? -10.403 -6.158  -11.035 1.00 9.30  ?  615  HOH A O     1 
HETATM 3025 O  O     . HOH J 8 .   ? -18.789 -5.495  -12.983 1.00 8.71  ?  616  HOH A O     1 
HETATM 3026 O  O     . HOH J 8 .   ? 15.210  14.278  -3.145  1.00 12.83 ?  617  HOH A O     1 
HETATM 3027 O  O     . HOH J 8 .   ? 7.710   -13.178 -12.460 1.00 11.82 ?  618  HOH A O     1 
HETATM 3028 O  O     . HOH J 8 .   ? 17.165  -21.093 -6.326  1.00 12.46 ?  619  HOH A O     1 
HETATM 3029 O  O     . HOH J 8 .   ? -7.918  -6.667  -12.229 1.00 10.43 ?  620  HOH A O     1 
HETATM 3030 O  O     . HOH J 8 .   ? -8.820  1.900   -10.864 1.00 11.21 ?  621  HOH A O     1 
HETATM 3031 O  O     . HOH J 8 .   ? -18.873 5.478   -3.545  1.00 11.95 ?  622  HOH A O     1 
HETATM 3032 O  O     . HOH J 8 .   ? 6.960   -14.165 -4.714  1.00 8.68  ?  623  HOH A O     1 
HETATM 3033 O  O     . HOH J 8 .   ? -13.165 21.999  3.695   1.00 9.09  ?  624  HOH A O     1 
HETATM 3034 O  O     . HOH J 8 .   ? -12.251 -14.601 3.876   1.00 12.25 ?  625  HOH A O     1 
HETATM 3035 O  O     . HOH J 8 .   ? 11.208  -13.944 -5.797  1.00 14.74 ?  626  HOH A O     1 
HETATM 3036 O  O     . HOH J 8 .   ? 5.452   -9.477  -4.809  1.00 11.87 ?  627  HOH A O     1 
HETATM 3037 O  O     . HOH J 8 .   ? -12.780 1.346   -10.051 1.00 11.88 ?  628  HOH A O     1 
HETATM 3038 O  O     . HOH J 8 .   ? 16.067  -10.399 -11.120 1.00 12.23 ?  629  HOH A O     1 
HETATM 3039 O  O     . HOH J 8 .   ? 9.468   5.639   -3.129  1.00 10.18 ?  630  HOH A O     1 
HETATM 3040 O  O     . HOH J 8 .   ? 12.972  8.585   -10.064 1.00 12.84 ?  631  HOH A O     1 
HETATM 3041 O  O     . HOH J 8 .   ? 11.476  6.453   -1.290  1.00 9.45  ?  632  HOH A O     1 
HETATM 3042 O  O     . HOH J 8 .   ? -5.272  -3.171  3.153   1.00 14.67 ?  633  HOH A O     1 
HETATM 3043 O  O     . HOH J 8 .   ? 5.539   -10.449 -7.293  1.00 12.50 ?  634  HOH A O     1 
HETATM 3044 O  O     . HOH J 8 .   ? 16.162  -11.785 -22.539 1.00 11.94 ?  635  HOH A O     1 
HETATM 3045 O  O     . HOH J 8 .   ? 18.504  12.253  -6.312  1.00 13.74 ?  636  HOH A O     1 
HETATM 3046 O  O     . HOH J 8 .   ? -9.604  4.455   -12.340 1.00 11.28 ?  637  HOH A O     1 
HETATM 3047 O  O     . HOH J 8 .   ? -5.858  -0.532  4.870   1.00 12.86 ?  638  HOH A O     1 
HETATM 3048 O  O     . HOH J 8 .   ? -14.175 -17.802 -1.014  1.00 12.01 ?  639  HOH A O     1 
HETATM 3049 O  O     . HOH J 8 .   ? 2.957   -5.237  4.768   1.00 13.57 ?  640  HOH A O     1 
HETATM 3050 O  O     . HOH J 8 .   ? -18.643 -2.877  -12.010 1.00 15.15 ?  641  HOH A O     1 
HETATM 3051 O  O     . HOH J 8 .   ? 1.613   -22.876 -5.169  1.00 13.61 ?  642  HOH A O     1 
HETATM 3052 O  O     . HOH J 8 .   ? 20.478  13.233  -4.606  1.00 14.79 ?  643  HOH A O     1 
HETATM 3053 O  O     . HOH J 8 .   ? 6.312   -11.091 -11.077 1.00 12.25 ?  644  HOH A O     1 
HETATM 3054 O  O     . HOH J 8 .   ? 2.893   20.347  -0.857  1.00 13.98 ?  645  HOH A O     1 
HETATM 3055 O  O     . HOH J 8 .   ? 24.433  7.399   -13.052 1.00 17.91 ?  646  HOH A O     1 
HETATM 3056 O  O     . HOH J 8 .   ? -17.301 5.451   6.395   1.00 15.84 ?  647  HOH A O     1 
HETATM 3057 O  O     . HOH J 8 .   ? -9.807  5.052   6.361   1.00 11.58 ?  648  HOH A O     1 
HETATM 3058 O  O     . HOH J 8 .   ? -8.218  -21.974 -8.691  1.00 15.52 ?  649  HOH A O     1 
HETATM 3059 O  O     . HOH J 8 .   ? 17.006  -14.443 -23.137 1.00 16.28 ?  650  HOH A O     1 
HETATM 3060 O  O     . HOH J 8 .   ? 1.791   -20.553 -0.605  1.00 14.45 ?  651  HOH A O     1 
HETATM 3061 O  O     . HOH J 8 .   ? 23.571  -16.463 -13.468 1.00 14.61 ?  652  HOH A O     1 
HETATM 3062 O  O     . HOH J 8 .   ? 2.183   1.603   -7.318  1.00 17.30 ?  653  HOH A O     1 
HETATM 3063 O  O     . HOH J 8 .   ? 15.006  -1.258  -11.769 1.00 22.70 ?  654  HOH A O     1 
HETATM 3064 O  O     . HOH J 8 .   ? -17.445 2.910   5.420   1.00 20.77 ?  655  HOH A O     1 
HETATM 3065 O  O     . HOH J 8 .   ? -10.826 3.565   -9.895  1.00 15.76 ?  656  HOH A O     1 
HETATM 3066 O  O     . HOH J 8 .   ? 7.939   -8.476  -4.456  1.00 21.37 ?  657  HOH A O     1 
HETATM 3067 O  O     . HOH J 8 .   ? -11.814 11.768  -7.835  1.00 15.19 ?  658  HOH A O     1 
HETATM 3068 O  O     . HOH J 8 .   ? 13.938  -0.681  -26.835 1.00 17.78 ?  659  HOH A O     1 
HETATM 3069 O  O     . HOH J 8 .   ? 11.690  -4.638  -18.836 1.00 15.83 ?  660  HOH A O     1 
HETATM 3070 O  O     . HOH J 8 .   ? -15.357 -3.177  -16.349 1.00 15.63 ?  661  HOH A O     1 
HETATM 3071 O  O     . HOH J 8 .   ? -16.562 -19.148 -1.054  1.00 14.69 ?  662  HOH A O     1 
HETATM 3072 O  O     . HOH J 8 .   ? -14.704 -4.859  -18.226 1.00 16.82 ?  663  HOH A O     1 
HETATM 3073 O  O     . HOH J 8 .   ? 8.273   1.191   -20.209 1.00 19.64 ?  664  HOH A O     1 
HETATM 3074 O  O     . HOH J 8 .   ? 16.438  -23.809 -6.055  1.00 16.19 ?  665  HOH A O     1 
HETATM 3075 O  O     . HOH J 8 .   ? 5.982   -7.918  -8.178  1.00 19.26 ?  666  HOH A O     1 
HETATM 3076 O  O     . HOH J 8 .   ? 5.606   16.442  -17.229 1.00 14.60 ?  667  HOH A O     1 
HETATM 3077 O  O     . HOH J 8 .   ? 1.567   -18.445 -15.820 1.00 16.95 ?  668  HOH A O     1 
HETATM 3078 O  O     . HOH J 8 .   ? 17.167  -27.018 -22.686 1.00 22.61 ?  669  HOH A O     1 
HETATM 3079 O  O     . HOH J 8 .   ? -13.711 -19.155 -5.054  1.00 15.13 ?  670  HOH A O     1 
HETATM 3080 O  O     . HOH J 8 .   ? 9.954   18.488  -5.525  1.00 13.21 ?  671  HOH A O     1 
HETATM 3081 O  O     . HOH J 8 .   ? 13.842  -10.302 -9.638  1.00 18.34 ?  672  HOH A O     1 
HETATM 3082 O  O     . HOH J 8 .   ? 6.121   -26.038 1.022   1.00 16.27 ?  673  HOH A O     1 
HETATM 3083 O  O     . HOH J 8 .   ? 22.511  -15.920 -11.048 1.00 19.21 ?  674  HOH A O     1 
HETATM 3084 O  O     . HOH J 8 .   ? -25.126 -4.666  -16.187 1.00 20.40 ?  675  HOH A O     1 
HETATM 3085 O  O     . HOH J 8 .   ? -10.971 -1.481  3.176   1.00 17.70 ?  676  HOH A O     1 
HETATM 3086 O  O     . HOH J 8 .   ? -10.368 -10.022 0.064   1.00 19.92 ?  677  HOH A O     1 
HETATM 3087 O  O     . HOH J 8 .   ? -21.345 12.710  2.097   1.00 19.95 ?  678  HOH A O     1 
HETATM 3088 O  O     . HOH J 8 .   ? 19.653  -30.450 -2.073  1.00 16.93 ?  679  HOH A O     1 
HETATM 3089 O  O     . HOH J 8 .   ? -13.746 -16.795 -3.617  1.00 12.21 ?  680  HOH A O     1 
HETATM 3090 O  O     . HOH J 8 .   ? -16.587 -18.146 -14.967 1.00 20.32 ?  681  HOH A O     1 
HETATM 3091 O  O     . HOH J 8 .   ? 11.855  13.756  -22.417 1.00 20.84 ?  682  HOH A O     1 
HETATM 3092 O  O     . HOH J 8 .   ? 20.303  -12.557 -23.977 1.00 22.16 ?  683  HOH A O     1 
HETATM 3093 O  O     . HOH J 8 .   ? 8.026   -11.595 -7.020  1.00 26.24 ?  684  HOH A O     1 
HETATM 3094 O  O     . HOH J 8 .   ? -5.318  -21.449 -5.896  1.00 12.86 ?  685  HOH A O     1 
HETATM 3095 O  O     . HOH J 8 .   ? 12.550  -13.514 -8.092  1.00 18.22 ?  686  HOH A O     1 
HETATM 3096 O  O     . HOH J 8 .   ? 23.831  -19.375 -20.996 1.00 19.14 ?  687  HOH A O     1 
HETATM 3097 O  O     . HOH J 8 .   ? -4.430  -17.693 -22.755 1.00 19.45 ?  688  HOH A O     1 
HETATM 3098 O  O     . HOH J 8 .   ? -3.010  15.418  6.111   1.00 22.90 ?  689  HOH A O     1 
HETATM 3099 O  O     . HOH J 8 .   ? -0.324  -19.603 -22.543 1.00 23.83 ?  690  HOH A O     1 
HETATM 3100 O  O     . HOH J 8 .   ? 11.532  -8.986  -14.487 1.00 20.87 ?  691  HOH A O     1 
HETATM 3101 O  O     . HOH J 8 .   ? 7.256   12.384  -18.460 1.00 21.14 ?  692  HOH A O     1 
HETATM 3102 O  O     . HOH J 8 .   ? 4.907   -4.458  -5.503  1.00 19.19 ?  693  HOH A O     1 
HETATM 3103 O  O     . HOH J 8 .   ? 18.298  16.322  -10.710 1.00 20.59 ?  694  HOH A O     1 
HETATM 3104 O  O     . HOH J 8 .   ? 2.052   -4.535  -7.283  1.00 18.30 ?  695  HOH A O     1 
HETATM 3105 O  O     . HOH J 8 .   ? 18.050  4.104   -11.534 1.00 31.43 ?  696  HOH A O     1 
HETATM 3106 O  O     . HOH J 8 .   ? 7.567   4.976   -9.586  1.00 16.06 ?  697  HOH A O     1 
HETATM 3107 O  O     . HOH J 8 .   ? 5.958   -21.996 -0.109  1.00 17.99 ?  698  HOH A O     1 
HETATM 3108 O  O     . HOH J 8 .   ? -24.270 3.337   -1.608  1.00 20.26 ?  699  HOH A O     1 
HETATM 3109 O  O     . HOH J 8 .   ? -19.169 -2.990  -3.600  1.00 21.51 ?  700  HOH A O     1 
HETATM 3110 O  O     . HOH J 8 .   ? 12.159  -13.449 -2.931  1.00 22.42 ?  701  HOH A O     1 
HETATM 3111 O  O     . HOH J 8 .   ? -24.510 10.418  -3.855  1.00 20.94 ?  702  HOH A O     1 
HETATM 3112 O  O     . HOH J 8 .   ? 19.982  -6.354  -11.830 1.00 18.48 ?  703  HOH A O     1 
HETATM 3113 O  O     . HOH J 8 .   ? -24.574 -9.256  -11.004 1.00 23.37 ?  704  HOH A O     1 
HETATM 3114 O  O     . HOH J 8 .   ? -19.567 13.612  3.810   1.00 16.56 ?  705  HOH A O     1 
HETATM 3115 O  O     . HOH J 8 .   ? 20.700  8.275   -7.368  1.00 22.90 ?  706  HOH A O     1 
HETATM 3116 O  O     . HOH J 8 .   ? 11.946  5.159   1.091   1.00 22.40 ?  707  HOH A O     1 
HETATM 3117 O  O     . HOH J 8 .   ? 9.063   -3.013  -23.843 1.00 23.63 ?  708  HOH A O     1 
HETATM 3118 O  O     . HOH J 8 .   ? 9.466   10.930  -22.556 1.00 22.88 ?  709  HOH A O     1 
HETATM 3119 O  O     . HOH J 8 .   ? -1.666  -16.874 3.207   1.00 19.95 ?  710  HOH A O     1 
HETATM 3120 O  O     . HOH J 8 .   ? 21.983  -0.164  -13.740 1.00 17.83 ?  711  HOH A O     1 
HETATM 3121 O  O     . HOH J 8 .   ? 18.313  -5.658  -22.862 1.00 19.59 ?  712  HOH A O     1 
HETATM 3122 O  O     . HOH J 8 .   ? 20.170  -15.717 -9.550  1.00 17.03 ?  713  HOH A O     1 
HETATM 3123 O  O     . HOH J 8 .   ? 27.958  -8.273  -21.685 1.00 23.58 ?  714  HOH A O     1 
HETATM 3124 O  O     . HOH J 8 .   ? -15.801 -5.049  -0.834  1.00 18.64 ?  715  HOH A O     1 
HETATM 3125 O  O     . HOH J 8 .   ? 25.751  -3.667  -24.350 1.00 19.15 ?  716  HOH A O     1 
HETATM 3126 O  O     . HOH J 8 .   ? 6.686   -19.771 1.555   1.00 20.49 ?  717  HOH A O     1 
HETATM 3127 O  O     . HOH J 8 .   ? 17.449  -28.561 -1.506  1.00 21.54 ?  718  HOH A O     1 
HETATM 3128 O  O     . HOH J 8 .   ? 3.809   14.328  7.575   1.00 26.67 ?  719  HOH A O     1 
HETATM 3129 O  O     . HOH J 8 .   ? -14.007 10.348  -8.357  1.00 19.13 ?  720  HOH A O     1 
HETATM 3130 O  O     . HOH J 8 .   ? 10.452  4.472   -6.077  1.00 19.65 ?  721  HOH A O     1 
HETATM 3131 O  O     . HOH J 8 .   ? 12.794  4.799   -28.527 1.00 24.89 ?  722  HOH A O     1 
HETATM 3132 O  O     . HOH J 8 .   ? -0.769  11.698  -11.656 1.00 19.17 ?  723  HOH A O     1 
HETATM 3133 O  O     . HOH J 8 .   ? 10.252  -10.334 -8.307  1.00 24.46 ?  724  HOH A O     1 
HETATM 3134 O  O     . HOH J 8 .   ? 6.446   18.750  -18.820 1.00 18.32 ?  725  HOH A O     1 
HETATM 3135 O  O     . HOH J 8 .   ? 6.221   -15.676 2.344   1.00 20.60 ?  726  HOH A O     1 
HETATM 3136 O  O     . HOH J 8 .   ? -12.208 -20.606 -2.683  1.00 22.18 ?  727  HOH A O     1 
HETATM 3137 O  O     A HOH J 8 .   ? 3.460   -1.019  -2.317  0.40 10.69 ?  728  HOH A O     1 
HETATM 3138 O  O     B HOH J 8 .   ? 2.631   -0.585  -3.585  0.60 10.40 ?  728  HOH A O     1 
HETATM 3139 O  O     . HOH J 8 .   ? -2.349  14.817  -9.209  1.00 18.60 ?  729  HOH A O     1 
HETATM 3140 O  O     . HOH J 8 .   ? -23.245 0.990   -4.581  1.00 23.24 ?  730  HOH A O     1 
HETATM 3141 O  O     . HOH J 8 .   ? 20.928  10.985  -7.907  1.00 26.07 ?  731  HOH A O     1 
HETATM 3142 O  O     . HOH J 8 .   ? 11.109  -25.143 -26.229 1.00 23.89 ?  732  HOH A O     1 
HETATM 3143 O  O     . HOH J 8 .   ? 14.913  -9.673  -26.911 1.00 23.42 ?  733  HOH A O     1 
HETATM 3144 O  O     . HOH J 8 .   ? -16.606 -20.641 -14.147 1.00 27.67 ?  734  HOH A O     1 
HETATM 3145 O  O     . HOH J 8 .   ? 9.942   18.133  7.375   1.00 26.41 ?  735  HOH A O     1 
HETATM 3146 O  O     . HOH J 8 .   ? 15.120  5.516   -7.849  1.00 25.66 ?  736  HOH A O     1 
HETATM 3147 O  O     . HOH J 8 .   ? 17.853  -9.247  -9.411  1.00 28.01 ?  737  HOH A O     1 
HETATM 3148 O  O     . HOH J 8 .   ? -4.177  -24.736 -16.030 1.00 28.59 ?  738  HOH A O     1 
HETATM 3149 O  O     . HOH J 8 .   ? -7.272  -4.900  2.975   1.00 24.80 ?  739  HOH A O     1 
HETATM 3150 O  O     . HOH J 8 .   ? 12.169  17.649  8.767   1.00 28.35 ?  740  HOH A O     1 
HETATM 3151 O  O     . HOH J 8 .   ? 4.023   -1.415  -14.835 1.00 23.58 ?  741  HOH A O     1 
HETATM 3152 O  O     . HOH J 8 .   ? 5.497   -5.375  -19.622 1.00 25.76 ?  742  HOH A O     1 
HETATM 3153 O  O     . HOH J 8 .   ? 4.768   -8.703  -16.005 1.00 21.47 ?  743  HOH A O     1 
HETATM 3154 O  O     . HOH J 8 .   ? 4.177   19.475  -8.110  1.00 26.13 ?  744  HOH A O     1 
HETATM 3155 O  O     . HOH J 8 .   ? 16.106  17.056  -12.735 1.00 29.10 ?  745  HOH A O     1 
HETATM 3156 O  O     . HOH J 8 .   ? -3.197  -4.411  4.592   1.00 23.55 ?  746  HOH A O     1 
HETATM 3157 O  O     . HOH J 8 .   ? 15.201  -8.181  -12.501 1.00 21.77 ?  747  HOH A O     1 
HETATM 3158 O  O     . HOH J 8 .   ? 28.225  1.875   -26.034 1.00 35.27 ?  748  HOH A O     1 
HETATM 3159 O  O     . HOH J 8 .   ? 20.413  0.510   -11.509 1.00 28.14 ?  749  HOH A O     1 
HETATM 3160 O  O     . HOH J 8 .   ? -10.956 -6.402  -21.905 1.00 26.85 ?  750  HOH A O     1 
HETATM 3161 O  O     . HOH J 8 .   ? 10.318  -11.810 -1.868  1.00 20.99 ?  751  HOH A O     1 
HETATM 3162 O  O     . HOH J 8 .   ? 28.156  7.134   -25.174 1.00 27.76 ?  752  HOH A O     1 
HETATM 3163 O  O     . HOH J 8 .   ? -21.736 1.093   1.249   1.00 22.57 ?  753  HOH A O     1 
HETATM 3164 O  O     . HOH J 8 .   ? 28.717  -4.066  -22.705 1.00 22.47 ?  754  HOH A O     1 
HETATM 3165 O  O     . HOH J 8 .   ? 22.623  -2.942  -13.255 1.00 28.82 ?  755  HOH A O     1 
HETATM 3166 O  O     A HOH J 8 .   ? 19.645  -11.016 -9.605  0.50 19.63 ?  756  HOH A O     1 
HETATM 3167 O  O     . HOH J 8 .   ? 3.268   -12.155 2.617   1.00 18.24 ?  757  HOH A O     1 
HETATM 3168 O  O     A HOH J 8 .   ? -14.466 10.660  8.204   0.70 21.00 ?  758  HOH A O     1 
HETATM 3169 O  O     B HOH J 8 .   ? -13.880 9.606   6.813   0.30 13.52 ?  758  HOH A O     1 
HETATM 3170 O  O     . HOH J 8 .   ? -12.569 -22.879 -13.413 1.00 29.24 ?  759  HOH A O     1 
HETATM 3171 O  O     . HOH J 8 .   ? 10.904  -0.208  -27.425 1.00 32.87 ?  760  HOH A O     1 
HETATM 3172 O  O     . HOH J 8 .   ? -16.054 13.672  -3.513  1.00 22.37 ?  761  HOH A O     1 
HETATM 3173 O  O     . HOH J 8 .   ? -5.700  10.565  10.493  1.00 30.69 ?  762  HOH A O     1 
HETATM 3174 O  O     . HOH J 8 .   ? 17.468  -34.712 -13.651 1.00 28.98 ?  763  HOH A O     1 
HETATM 3175 O  O     . HOH J 8 .   ? 13.255  -30.421 -3.297  1.00 25.00 ?  764  HOH A O     1 
HETATM 3176 O  O     . HOH J 8 .   ? -17.764 -17.785 -17.677 1.00 32.01 ?  765  HOH A O     1 
HETATM 3177 O  O     . HOH J 8 .   ? -0.966  16.386  7.846   1.00 30.32 ?  766  HOH A O     1 
HETATM 3178 O  O     . HOH J 8 .   ? -14.597 1.469   2.713   1.00 25.69 ?  767  HOH A O     1 
HETATM 3179 O  O     . HOH J 8 .   ? 8.868   -1.082  -25.900 1.00 25.03 ?  768  HOH A O     1 
HETATM 3180 O  O     . HOH J 8 .   ? 10.597  -5.447  -16.680 1.00 32.78 ?  769  HOH A O     1 
HETATM 3181 O  O     . HOH J 8 .   ? -20.468 -4.165  -7.842  1.00 22.43 ?  770  HOH A O     1 
HETATM 3182 O  O     . HOH J 8 .   ? -14.758 12.353  -10.385 1.00 34.12 ?  771  HOH A O     1 
HETATM 3183 O  O     . HOH J 8 .   ? -20.112 1.427   -11.211 1.00 22.67 ?  772  HOH A O     1 
HETATM 3184 O  O     . HOH J 8 .   ? -5.274  -11.876 3.957   1.00 23.23 ?  773  HOH A O     1 
HETATM 3185 O  O     . HOH J 8 .   ? -10.839 21.784  -2.397  1.00 24.99 ?  774  HOH A O     1 
HETATM 3186 O  O     . HOH J 8 .   ? 9.866   -8.067  -16.209 1.00 22.54 ?  775  HOH A O     1 
HETATM 3187 O  O     . HOH J 8 .   ? 3.172   -16.825 2.960   1.00 25.12 ?  776  HOH A O     1 
HETATM 3188 O  O     . HOH J 8 .   ? 5.862   -8.290  -13.707 1.00 33.26 ?  777  HOH A O     1 
HETATM 3189 O  O     . HOH J 8 .   ? 8.471   -28.450 -18.651 1.00 28.55 ?  778  HOH A O     1 
HETATM 3190 O  O     . HOH J 8 .   ? -22.209 12.030  -7.938  1.00 27.43 ?  779  HOH A O     1 
HETATM 3191 O  O     . HOH J 8 .   ? 12.864  6.097   -9.332  1.00 22.82 ?  780  HOH A O     1 
HETATM 3192 O  O     . HOH J 8 .   ? -20.121 -6.866  -26.317 1.00 31.28 ?  781  HOH A O     1 
HETATM 3193 O  O     . HOH J 8 .   ? -10.267 8.485   5.857   1.00 21.84 ?  782  HOH A O     1 
HETATM 3194 O  O     . HOH J 8 .   ? -3.960  17.496  9.359   1.00 40.79 ?  783  HOH A O     1 
HETATM 3195 O  O     . HOH J 8 .   ? -12.630 -19.733 -0.133  1.00 22.87 ?  784  HOH A O     1 
HETATM 3196 O  O     . HOH J 8 .   ? -22.854 -10.341 -15.860 1.00 23.39 ?  785  HOH A O     1 
HETATM 3197 O  O     . HOH J 8 .   ? -19.199 0.328   2.222   1.00 26.75 ?  786  HOH A O     1 
HETATM 3198 O  O     . HOH J 8 .   ? 3.088   15.927  -15.488 1.00 33.12 ?  787  HOH A O     1 
HETATM 3199 O  O     . HOH J 8 .   ? -8.372  -23.125 -11.237 1.00 21.73 ?  788  HOH A O     1 
HETATM 3200 O  O     . HOH J 8 .   ? 13.514  -2.927  -14.569 1.00 28.70 ?  789  HOH A O     1 
HETATM 3201 O  O     . HOH J 8 .   ? -1.567  -4.714  -10.735 1.00 22.93 ?  790  HOH A O     1 
HETATM 3202 O  O     . HOH J 8 .   ? 0.080   -9.748  5.209   1.00 26.17 ?  791  HOH A O     1 
HETATM 3203 O  O     . HOH J 8 .   ? -0.138  13.093  -10.083 1.00 26.89 ?  792  HOH A O     1 
HETATM 3204 O  O     . HOH J 8 .   ? -8.470  -7.499  3.115   1.00 27.38 ?  793  HOH A O     1 
HETATM 3205 O  O     . HOH J 8 .   ? 14.015  0.013   -13.763 1.00 25.63 ?  794  HOH A O     1 
HETATM 3206 O  O     . HOH J 8 .   ? 6.974   -1.542  -4.386  1.00 27.42 ?  795  HOH A O     1 
HETATM 3207 O  O     . HOH J 8 .   ? 4.972   14.430  -18.898 1.00 38.87 ?  796  HOH A O     1 
HETATM 3208 O  O     . HOH J 8 .   ? 19.997  -21.061 -7.265  1.00 24.91 ?  797  HOH A O     1 
HETATM 3209 O  O     . HOH J 8 .   ? -23.246 15.165  -0.215  1.00 29.43 ?  798  HOH A O     1 
HETATM 3210 O  O     . HOH J 8 .   ? 9.820   -10.461 2.998   1.00 20.96 ?  799  HOH A O     1 
HETATM 3211 O  O     . HOH J 8 .   ? -8.190  -12.246 2.530   1.00 29.04 ?  800  HOH A O     1 
HETATM 3212 O  O     . HOH J 8 .   ? -26.145 6.933   -3.673  1.00 24.22 ?  801  HOH A O     1 
HETATM 3213 O  O     . HOH J 8 .   ? 23.754  -5.339  -13.681 1.00 28.11 ?  802  HOH A O     1 
HETATM 3214 O  O     . HOH J 8 .   ? 8.940   -12.564 -5.230  1.00 32.66 ?  803  HOH A O     1 
HETATM 3215 O  O     . HOH J 8 .   ? -15.899 -0.686  -17.437 1.00 27.31 ?  804  HOH A O     1 
HETATM 3216 O  O     A HOH J 8 .   ? -20.496 7.136   -8.614  0.60 23.00 ?  805  HOH A O     1 
HETATM 3217 O  O     B HOH J 8 .   ? -20.990 6.033   -9.021  0.40 13.00 ?  805  HOH A O     1 
HETATM 3218 O  O     . HOH J 8 .   ? -19.665 6.362   7.246   1.00 30.09 ?  806  HOH A O     1 
HETATM 3219 O  O     . HOH J 8 .   ? 22.353  -7.637  -11.845 1.00 31.89 ?  807  HOH A O     1 
HETATM 3220 O  O     . HOH J 8 .   ? 3.022   11.950  -11.992 1.00 38.81 ?  808  HOH A O     1 
HETATM 3221 O  O     . HOH J 8 .   ? 19.751  -7.873  -23.499 1.00 27.56 ?  809  HOH A O     1 
HETATM 3222 O  O     . HOH J 8 .   ? 7.899   -11.884 4.338   1.00 26.18 ?  810  HOH A O     1 
HETATM 3223 O  O     . HOH J 8 .   ? 15.894  -6.083  -10.556 1.00 33.04 ?  811  HOH A O     1 
HETATM 3224 O  O     . HOH J 8 .   ? -20.389 -15.622 -5.484  1.00 25.17 ?  812  HOH A O     1 
HETATM 3225 O  O     A HOH J 8 .   ? -23.898 -10.811 -2.811  0.50 24.44 ?  813  HOH A O     1 
HETATM 3226 O  O     B HOH J 8 .   ? -22.739 -10.419 -4.280  0.50 20.61 ?  813  HOH A O     1 
HETATM 3227 O  O     . HOH J 8 .   ? 18.763  -26.398 -2.587  1.00 28.53 ?  814  HOH A O     1 
HETATM 3228 O  O     . HOH J 8 .   ? 23.743  -9.629  -23.734 1.00 27.94 ?  815  HOH A O     1 
HETATM 3229 O  O     . HOH J 8 .   ? 0.149   -24.769 -4.054  1.00 38.97 ?  816  HOH A O     1 
HETATM 3230 O  O     . HOH J 8 .   ? 8.981   -28.631 -5.640  1.00 21.64 ?  817  HOH A O     1 
HETATM 3231 O  O     . HOH J 8 .   ? 4.505   -9.833  6.092   1.00 28.55 ?  818  HOH A O     1 
HETATM 3232 O  O     . HOH J 8 .   ? -10.129 -12.977 -26.676 1.00 22.85 ?  819  HOH A O     1 
HETATM 3233 O  O     . HOH J 8 .   ? -12.401 14.538  -10.348 1.00 20.81 ?  820  HOH A O     1 
HETATM 3234 O  O     . HOH J 8 .   ? 8.398   -31.367 -2.368  1.00 37.03 ?  821  HOH A O     1 
HETATM 3235 O  O     . HOH J 8 .   ? 25.281  -18.800 -23.363 1.00 37.06 ?  822  HOH A O     1 
HETATM 3236 O  O     . HOH J 8 .   ? 0.346   -3.850  -9.483  1.00 25.98 ?  823  HOH A O     1 
HETATM 3237 O  O     . HOH J 8 .   ? 18.377  -6.827  -10.036 1.00 30.89 ?  824  HOH A O     1 
HETATM 3238 O  O     . HOH J 8 .   ? 19.895  -32.052 -12.779 1.00 30.23 ?  825  HOH A O     1 
HETATM 3239 O  O     . HOH J 8 .   ? -5.548  19.369  8.814   1.00 30.27 ?  826  HOH A O     1 
HETATM 3240 O  O     . HOH J 8 .   ? -8.262  1.111   6.044   1.00 32.30 ?  827  HOH A O     1 
HETATM 3241 O  O     A HOH J 8 .   ? 11.133  19.271  -9.879  0.50 18.37 ?  828  HOH A O     1 
HETATM 3242 O  O     B HOH J 8 .   ? 9.985   18.655  -8.419  0.50 21.62 ?  828  HOH A O     1 
HETATM 3243 O  O     . HOH J 8 .   ? 25.153  3.416   -17.429 1.00 39.05 ?  829  HOH A O     1 
HETATM 3244 O  O     . HOH J 8 .   ? -10.167 -18.107 -25.729 1.00 37.62 ?  830  HOH A O     1 
HETATM 3245 O  O     . HOH J 8 .   ? -10.612 7.204   7.648   1.00 27.67 ?  831  HOH A O     1 
HETATM 3246 O  O     . HOH J 8 .   ? -19.748 -17.419 -13.117 1.00 31.61 ?  832  HOH A O     1 
HETATM 3247 O  O     . HOH J 8 .   ? -24.598 11.342  -6.664  1.00 37.32 ?  833  HOH A O     1 
HETATM 3248 O  O     . HOH J 8 .   ? -0.030  -28.515 -9.035  1.00 34.98 ?  834  HOH A O     1 
HETATM 3249 O  O     . HOH J 8 .   ? 10.531  5.781   -8.506  1.00 26.20 ?  835  HOH A O     1 
HETATM 3250 O  O     . HOH J 8 .   ? 2.460   -19.716 2.044   1.00 28.82 ?  836  HOH A O     1 
HETATM 3251 O  O     . HOH J 8 .   ? 9.361   -30.428 -7.567  1.00 35.04 ?  837  HOH A O     1 
HETATM 3252 O  O     . HOH J 8 .   ? 27.231  -21.697 -16.585 1.00 29.40 ?  838  HOH A O     1 
HETATM 3253 O  O     . HOH J 8 .   ? 5.148   20.942  -17.848 1.00 30.31 ?  839  HOH A O     1 
HETATM 3254 O  O     . HOH J 8 .   ? 18.606  -10.339 -23.456 1.00 20.34 ?  840  HOH A O     1 
HETATM 3255 O  O     . HOH J 8 .   ? -13.905 0.535   -17.886 1.00 29.20 ?  841  HOH A O     1 
HETATM 3256 O  O     . HOH J 8 .   ? 24.881  -26.845 -17.674 1.00 31.87 ?  842  HOH A O     1 
HETATM 3257 O  O     . HOH J 8 .   ? -15.043 -0.285  1.336   1.00 31.27 ?  843  HOH A O     1 
HETATM 3258 O  O     . HOH J 8 .   ? 13.447  -31.195 -17.487 1.00 29.77 ?  844  HOH A O     1 
HETATM 3259 O  O     . HOH J 8 .   ? 26.053  5.356   -14.266 1.00 32.30 ?  845  HOH A O     1 
HETATM 3260 O  O     . HOH J 8 .   ? -3.416  -8.309  3.524   1.00 24.57 ?  846  HOH A O     1 
HETATM 3261 O  O     . HOH J 8 .   ? 7.507   -4.075  -28.668 1.00 32.41 ?  847  HOH A O     1 
HETATM 3262 O  O     . HOH J 8 .   ? -12.251 -5.068  -24.098 1.00 38.72 ?  848  HOH A O     1 
HETATM 3263 O  O     . HOH J 8 .   ? 30.898  -5.544  -18.709 1.00 27.22 ?  849  HOH A O     1 
HETATM 3264 O  O     . HOH J 8 .   ? -0.493  -21.937 0.434   1.00 31.91 ?  850  HOH A O     1 
HETATM 3265 O  O     . HOH J 8 .   ? -26.742 9.742   -2.494  1.00 29.70 ?  851  HOH A O     1 
HETATM 3266 O  O     . HOH J 8 .   ? 7.900   -30.739 -20.429 1.00 38.23 ?  852  HOH A O     1 
HETATM 3267 O  O     . HOH J 8 .   ? 9.522   19.225  -11.931 1.00 21.87 ?  853  HOH A O     1 
HETATM 3268 O  O     . HOH J 8 .   ? 14.465  -12.028 -2.843  1.00 28.63 ?  854  HOH A O     1 
HETATM 3269 O  O     . HOH J 8 .   ? 17.998  -24.015 -3.940  1.00 26.33 ?  855  HOH A O     1 
HETATM 3270 O  O     . HOH J 8 .   ? 14.366  13.719  -24.610 1.00 25.11 ?  856  HOH A O     1 
HETATM 3271 O  O     . HOH J 8 .   ? -3.788  -19.670 -0.346  1.00 31.02 ?  857  HOH A O     1 
HETATM 3272 O  O     . HOH J 8 .   ? -3.873  -0.701  6.645   1.00 26.63 ?  858  HOH A O     1 
HETATM 3273 O  O     . HOH J 8 .   ? -6.835  8.101   10.681  1.00 31.49 ?  859  HOH A O     1 
HETATM 3274 O  O     . HOH J 8 .   ? 13.406  -3.718  -0.264  1.00 34.53 ?  860  HOH A O     1 
HETATM 3275 O  O     . HOH J 8 .   ? -20.964 -15.812 -9.000  1.00 30.10 ?  861  HOH A O     1 
HETATM 3276 O  O     . HOH J 8 .   ? -6.008  19.102  -7.186  1.00 27.48 ?  862  HOH A O     1 
HETATM 3277 O  O     . HOH J 8 .   ? 7.565   -6.803  -16.008 1.00 39.99 ?  863  HOH A O     1 
HETATM 3278 O  O     . HOH J 8 .   ? 20.590  -23.911 -6.886  1.00 34.32 ?  864  HOH A O     1 
HETATM 3279 O  O     . HOH J 8 .   ? 8.629   16.244  7.036   1.00 31.24 ?  865  HOH A O     1 
HETATM 3280 O  O     . HOH J 8 .   ? -14.312 -12.428 -25.397 1.00 28.24 ?  866  HOH A O     1 
HETATM 3281 O  O     . HOH J 8 .   ? 23.504  6.038   -10.474 1.00 35.14 ?  867  HOH A O     1 
HETATM 3282 O  O     . HOH J 8 .   ? 24.641  4.461   -28.075 1.00 28.02 ?  868  HOH A O     1 
HETATM 3283 O  O     . HOH J 8 .   ? -20.251 11.430  7.414   1.00 42.20 ?  869  HOH A O     1 
HETATM 3284 O  O     . HOH J 8 .   ? 18.481  -25.394 -6.157  1.00 29.83 ?  870  HOH A O     1 
HETATM 3285 O  O     . HOH J 8 .   ? -20.762 9.692   5.471   1.00 28.08 ?  871  HOH A O     1 
HETATM 3286 O  O     . HOH J 8 .   ? 25.037  14.786  -21.472 1.00 34.62 ?  872  HOH A O     1 
HETATM 3287 O  O     . HOH J 8 .   ? -23.045 -13.011 -17.009 1.00 31.83 ?  873  HOH A O     1 
HETATM 3288 O  O     . HOH J 8 .   ? -20.181 -2.909  -10.093 1.00 36.34 ?  874  HOH A O     1 
HETATM 3289 O  O     . HOH J 8 .   ? -13.342 6.312   -9.906  1.00 29.23 ?  875  HOH A O     1 
HETATM 3290 O  O     . HOH J 8 .   ? 12.140  -28.980 -18.748 1.00 25.94 ?  876  HOH A O     1 
HETATM 3291 O  O     . HOH J 8 .   ? -23.373 3.271   -9.452  1.00 31.05 ?  877  HOH A O     1 
HETATM 3292 O  O     . HOH J 8 .   ? 22.367  -7.442  -23.044 1.00 24.85 ?  878  HOH A O     1 
HETATM 3293 O  O     . HOH J 8 .   ? 2.147   -11.613 5.170   1.00 23.36 ?  879  HOH A O     1 
HETATM 3294 O  O     . HOH J 8 .   ? -17.038 -20.752 -8.209  1.00 29.34 ?  880  HOH A O     1 
HETATM 3295 O  O     . HOH J 8 .   ? -15.254 5.422   8.070   1.00 31.88 ?  881  HOH A O     1 
HETATM 3296 O  O     . HOH J 8 .   ? -11.001 -19.078 1.585   1.00 38.16 ?  882  HOH A O     1 
HETATM 3297 O  O     . HOH J 8 .   ? -13.903 7.501   7.731   1.00 39.07 ?  883  HOH A O     1 
HETATM 3298 O  O     . HOH J 8 .   ? -12.704 -6.387  -26.095 1.00 34.93 ?  884  HOH A O     1 
HETATM 3299 O  O     . HOH J 8 .   ? 22.871  -30.651 -11.871 1.00 34.84 ?  885  HOH A O     1 
HETATM 3300 O  O     . HOH J 8 .   ? 1.728   16.219  8.071   1.00 33.71 ?  886  HOH A O     1 
HETATM 3301 O  O     . HOH J 8 .   ? 16.585  11.767  4.604   1.00 32.90 ?  887  HOH A O     1 
HETATM 3302 O  O     . HOH J 8 .   ? -12.979 -14.941 -24.997 1.00 29.51 ?  888  HOH A O     1 
HETATM 3303 O  O     . HOH J 8 .   ? -3.439  -19.194 2.489   1.00 31.55 ?  889  HOH A O     1 
HETATM 3304 O  O     . HOH J 8 .   ? 14.007  15.658  -26.246 1.00 33.61 ?  890  HOH A O     1 
HETATM 3305 O  O     . HOH J 8 .   ? 22.954  4.693   -31.942 1.00 32.67 ?  891  HOH A O     1 
HETATM 3306 O  O     . HOH J 8 .   ? 1.438   10.021  10.798  1.00 31.92 ?  892  HOH A O     1 
HETATM 3307 O  O     . HOH J 8 .   ? -24.958 -3.616  -19.411 1.00 34.99 ?  893  HOH A O     1 
HETATM 3308 O  O     . HOH J 8 .   ? -9.310  8.016   10.249  1.00 36.96 ?  894  HOH A O     1 
HETATM 3309 O  O     . HOH J 8 .   ? -8.739  -19.775 -0.050  1.00 31.14 ?  895  HOH A O     1 
HETATM 3310 O  O     . HOH J 8 .   ? 10.026  -9.751  -3.642  1.00 30.79 ?  896  HOH A O     1 
HETATM 3311 O  O     . HOH J 8 .   ? -16.406 3.268   -14.606 1.00 36.21 ?  897  HOH A O     1 
HETATM 3312 O  O     . HOH J 8 .   ? -10.804 -17.190 3.197   1.00 26.70 ?  898  HOH A O     1 
HETATM 3313 O  O     . HOH J 8 .   ? 9.212   -3.792  -19.953 1.00 31.71 ?  899  HOH A O     1 
HETATM 3314 O  O     . HOH J 8 .   ? 9.898   4.350   -12.810 1.00 25.45 ?  900  HOH A O     1 
HETATM 3315 O  O     . HOH J 8 .   ? 9.897   2.560   -13.994 1.00 20.02 ?  901  HOH A O     1 
HETATM 3316 O  O     . HOH J 8 .   ? 7.253   18.566  -21.479 1.00 21.05 ?  902  HOH A O     1 
HETATM 3317 O  O     . HOH J 8 .   ? 3.088   -22.103 -2.533  1.00 20.33 ?  903  HOH A O     1 
HETATM 3318 O  O     . HOH J 8 .   ? 17.694  -28.152 -20.111 1.00 23.46 ?  904  HOH A O     1 
HETATM 3319 O  O     . HOH J 8 .   ? -16.475 -21.511 -2.093  1.00 23.37 ?  905  HOH A O     1 
HETATM 3320 O  O     . HOH J 8 .   ? 5.201   -18.288 3.137   1.00 31.91 ?  906  HOH A O     1 
HETATM 3321 O  O     . HOH J 8 .   ? 6.539   -7.335  -28.466 1.00 26.88 ?  907  HOH A O     1 
HETATM 3322 O  O     . HOH J 8 .   ? 8.479   3.202   -7.447  1.00 27.56 ?  908  HOH A O     1 
HETATM 3323 O  O     . HOH J 8 .   ? 11.792  -3.152  -2.432  1.00 42.40 ?  909  HOH A O     1 
HETATM 3324 O  O     . HOH J 8 .   ? 15.794  -12.539 -0.817  1.00 32.52 ?  910  HOH A O     1 
HETATM 3325 O  O     . HOH J 8 .   ? 30.680  -9.326  -21.081 1.00 33.04 ?  911  HOH A O     1 
HETATM 3326 O  O     . HOH J 8 .   ? 4.855   2.066   -25.944 1.00 30.76 ?  912  HOH A O     1 
HETATM 3327 O  O     . HOH J 8 .   ? 17.820  0.478   -29.701 1.00 33.16 ?  913  HOH A O     1 
HETATM 3328 O  O     . HOH J 8 .   ? -11.166 2.814   7.392   1.00 28.74 ?  914  HOH A O     1 
HETATM 3329 O  O     . HOH J 8 .   ? -1.725  0.903   7.082   1.00 34.95 ?  915  HOH A O     1 
HETATM 3330 O  O     A HOH J 8 .   ? -10.489 21.042  -5.204  0.60 22.26 ?  916  HOH A O     1 
HETATM 3331 O  O     B HOH J 8 .   ? -9.461  21.536  -6.471  0.40 22.56 ?  916  HOH A O     1 
HETATM 3332 O  O     . HOH J 8 .   ? 24.657  -16.905 -9.879  1.00 34.50 ?  917  HOH A O     1 
HETATM 3333 O  O     . HOH J 8 .   ? 5.036   -4.145  -10.503 1.00 26.67 ?  918  HOH A O     1 
HETATM 3334 O  O     . HOH J 8 .   ? 9.384   -3.161  7.671   1.00 30.41 ?  919  HOH A O     1 
HETATM 3335 O  O     . HOH J 8 .   ? 15.191  -30.086 -1.891  1.00 23.78 ?  920  HOH A O     1 
HETATM 3336 O  O     . HOH J 8 .   ? -13.988 4.710   -11.613 1.00 33.65 ?  921  HOH A O     1 
HETATM 3337 O  O     . HOH J 8 .   ? 6.100   -9.581  -28.541 1.00 33.88 ?  922  HOH A O     1 
HETATM 3338 O  O     . HOH J 8 .   ? 7.428   -2.023  -27.630 1.00 36.92 ?  923  HOH A O     1 
HETATM 3339 O  O     . HOH J 8 .   ? 28.444  9.118   -21.354 1.00 40.79 ?  924  HOH A O     1 
HETATM 3340 O  O     . HOH J 8 .   ? 2.455   -26.954 -4.015  1.00 34.78 ?  925  HOH A O     1 
HETATM 3341 O  O     . HOH J 8 .   ? -8.729  -1.280  5.578   1.00 40.69 ?  926  HOH A O     1 
HETATM 3342 O  O     . HOH J 8 .   ? 15.009  -1.531  -29.141 1.00 37.44 ?  927  HOH A O     1 
HETATM 3343 O  O     . HOH J 8 .   ? -1.875  -25.500 -3.693  1.00 30.34 ?  928  HOH A O     1 
HETATM 3344 O  O     A HOH J 8 .   ? -22.748 14.613  -7.143  0.50 28.73 ?  929  HOH A O     1 
HETATM 3345 O  O     B HOH J 8 .   ? -24.232 14.604  -5.601  0.50 24.48 ?  929  HOH A O     1 
HETATM 3346 O  O     . HOH J 8 .   ? -26.497 -10.822 -15.151 1.00 35.27 ?  930  HOH A O     1 
HETATM 3347 O  O     . HOH J 8 .   ? -1.523  -13.760 6.952   1.00 30.04 ?  931  HOH A O     1 
HETATM 3348 O  O     . HOH J 8 .   ? -24.314 -10.633 -13.655 1.00 34.95 ?  932  HOH A O     1 
HETATM 3349 O  O     A HOH J 8 .   ? 10.341  16.425  -23.339 0.50 26.26 ?  933  HOH A O     1 
HETATM 3350 O  O     B HOH J 8 .   ? 9.755   18.494  -22.361 0.50 25.77 ?  933  HOH A O     1 
HETATM 3351 O  O     . HOH J 8 .   ? 10.955  0.657   -13.901 1.00 29.21 ?  934  HOH A O     1 
HETATM 3352 O  O     . HOH J 8 .   ? -18.169 -21.116 -5.547  1.00 32.69 ?  935  HOH A O     1 
HETATM 3353 O  O     . HOH J 8 .   ? 3.425   -24.993 -2.647  1.00 34.23 ?  936  HOH A O     1 
HETATM 3354 O  O     . HOH J 8 .   ? 19.260  -14.979 -5.093  1.00 31.64 ?  937  HOH A O     1 
HETATM 3355 O  O     . HOH J 8 .   ? -4.639  4.342   9.937   1.00 31.66 ?  938  HOH A O     1 
HETATM 3356 O  O     . HOH J 8 .   ? 32.348  -8.191  -14.922 1.00 38.62 ?  939  HOH A O     1 
HETATM 3357 O  O     . HOH J 8 .   ? 8.289   -9.535  -10.084 1.00 37.63 ?  940  HOH A O     1 
HETATM 3358 O  O     . HOH J 8 .   ? -9.905  14.208  8.928   1.00 25.12 ?  941  HOH A O     1 
HETATM 3359 O  O     . HOH J 8 .   ? -17.181 8.353   -9.525  1.00 34.14 ?  942  HOH A O     1 
HETATM 3360 O  O     . HOH J 8 .   ? 16.680  -22.004 -26.507 1.00 35.37 ?  943  HOH A O     1 
HETATM 3361 O  O     . HOH J 8 .   ? -23.489 7.132   -8.979  1.00 32.78 ?  944  HOH A O     1 
HETATM 3362 O  O     . HOH J 8 .   ? -26.894 4.373   -2.241  1.00 44.55 ?  945  HOH A O     1 
HETATM 3363 O  O     . HOH J 8 .   ? -17.450 6.164   -11.685 1.00 33.93 ?  946  HOH A O     1 
HETATM 3364 O  O     . HOH J 8 .   ? 31.815  -5.899  -16.235 1.00 32.32 ?  947  HOH A O     1 
HETATM 3365 O  O     . HOH J 8 .   ? 16.413  -37.342 -11.265 1.00 36.80 ?  948  HOH A O     1 
HETATM 3366 O  O     . HOH J 8 .   ? 23.137  2.448   -29.667 1.00 36.73 ?  949  HOH A O     1 
HETATM 3367 O  O     . HOH J 8 .   ? -7.339  -9.449  3.467   1.00 36.14 ?  950  HOH A O     1 
HETATM 3368 O  O     . HOH J 8 .   ? 28.103  -8.352  -13.110 1.00 37.29 ?  951  HOH A O     1 
HETATM 3369 O  O     . HOH J 8 .   ? -0.690  -1.532  -7.565  1.00 28.19 ?  952  HOH A O     1 
HETATM 3370 O  O     . HOH J 8 .   ? -3.986  -24.482 -2.904  1.00 33.49 ?  953  HOH A O     1 
HETATM 3371 O  O     . HOH J 8 .   ? 8.177   -30.352 -9.885  1.00 36.57 ?  954  HOH A O     1 
HETATM 3372 O  O     . HOH J 8 .   ? -2.648  -24.727 -7.456  1.00 35.96 ?  955  HOH A O     1 
HETATM 3373 O  O     . HOH J 8 .   ? 6.136   15.359  5.957   1.00 36.76 ?  956  HOH A O     1 
HETATM 3374 O  O     . HOH J 8 .   ? 20.972  -3.916  -11.128 1.00 36.26 ?  957  HOH A O     1 
HETATM 3375 O  O     . HOH J 8 .   ? 23.337  -24.326 -8.014  1.00 33.82 ?  958  HOH A O     1 
HETATM 3376 O  O     . HOH J 8 .   ? 24.986  -22.300 -23.173 1.00 41.73 ?  959  HOH A O     1 
HETATM 3377 O  O     . HOH J 8 .   ? 3.628   11.600  9.577   1.00 34.14 ?  960  HOH A O     1 
HETATM 3378 O  O     . HOH J 8 .   ? 9.743   5.153   -10.732 1.00 31.57 ?  961  HOH A O     1 
HETATM 3379 O  O     . HOH J 8 .   ? 27.739  -10.502 -14.670 1.00 34.31 ?  962  HOH A O     1 
HETATM 3380 O  O     . HOH J 8 .   ? -14.979 -17.232 -24.862 1.00 36.20 ?  963  HOH A O     1 
HETATM 3381 O  O     . HOH J 8 .   ? 18.755  9.039   0.016   1.00 38.52 ?  964  HOH A O     1 
HETATM 3382 O  O     . HOH J 8 .   ? 25.465  -1.152  -26.314 1.00 42.14 ?  965  HOH A O     1 
HETATM 3383 O  O     . HOH J 8 .   ? -7.683  -16.993 2.793   1.00 33.66 ?  966  HOH A O     1 
HETATM 3384 O  O     . HOH J 8 .   ? 18.625  1.762   -7.605  1.00 39.92 ?  967  HOH A O     1 
HETATM 3385 O  O     . HOH J 8 .   ? -15.734 1.665   7.303   1.00 33.84 ?  968  HOH A O     1 
HETATM 3386 O  O     . HOH J 8 .   ? 7.654   -1.123  -21.373 1.00 36.12 ?  969  HOH A O     1 
HETATM 3387 O  O     . HOH J 8 .   ? 12.581  -7.802  -12.321 1.00 30.49 ?  970  HOH A O     1 
HETATM 3388 O  O     . HOH J 8 .   ? 24.487  1.446   -13.471 1.00 40.17 ?  971  HOH A O     1 
HETATM 3389 O  O     . HOH J 8 .   ? -6.722  -25.349 -11.229 1.00 36.15 ?  972  HOH A O     1 
HETATM 3390 O  O     . HOH J 8 .   ? -0.015  22.913  -7.684  1.00 44.08 ?  973  HOH A O     1 
HETATM 3391 O  O     . HOH J 8 .   ? 8.383   -1.267  9.524   1.00 31.21 ?  974  HOH A O     1 
HETATM 3392 O  O     . HOH J 8 .   ? 3.981   12.576  5.305   1.00 25.91 ?  975  HOH A O     1 
HETATM 3393 O  O     . HOH J 8 .   ? -23.576 -15.537 -20.603 1.00 33.67 ?  976  HOH A O     1 
HETATM 3394 O  O     . HOH J 8 .   ? 19.578  3.114   -3.024  1.00 34.16 ?  977  HOH A O     1 
HETATM 3395 O  O     . HOH J 8 .   ? 14.908  2.526   3.993   1.00 35.60 ?  978  HOH A O     1 
HETATM 3396 O  O     . HOH J 8 .   ? -6.850  -15.876 -28.117 1.00 34.94 ?  979  HOH A O     1 
HETATM 3397 O  O     . HOH J 8 .   ? 11.724  2.033   -28.619 1.00 41.53 ?  980  HOH A O     1 
HETATM 3398 O  O     . HOH J 8 .   ? 10.457  1.904   -11.262 1.00 40.82 ?  981  HOH A O     1 
HETATM 3399 O  O     . HOH J 8 .   ? 24.888  -14.553 -9.726  1.00 40.30 ?  982  HOH A O     1 
HETATM 3400 O  O     . HOH J 8 .   ? 9.787   20.077  11.514  1.00 45.90 ?  983  HOH A O     1 
HETATM 3401 O  O     . HOH J 8 .   ? 10.974  -10.451 0.082   1.00 39.88 ?  984  HOH A O     1 
HETATM 3402 O  O     . HOH J 8 .   ? -9.572  -15.143 3.863   1.00 41.69 ?  985  HOH A O     1 
HETATM 3403 O  O     . HOH J 8 .   ? -2.455  -11.453 6.703   1.00 32.07 ?  986  HOH A O     1 
HETATM 3404 O  O     . HOH J 8 .   ? -20.092 -14.902 -22.132 1.00 40.09 ?  987  HOH A O     1 
HETATM 3405 O  O     . HOH J 8 .   ? -12.315 10.734  -13.077 1.00 42.49 ?  988  HOH A O     1 
HETATM 3406 O  O     . HOH J 8 .   ? 14.543  0.743   -30.766 1.00 38.93 ?  989  HOH A O     1 
HETATM 3407 O  O     . HOH J 8 .   ? -7.392  21.208  -8.279  1.00 39.91 ?  990  HOH A O     1 
HETATM 3408 O  O     . HOH J 8 .   ? -5.612  -26.398 -13.619 1.00 38.61 ?  991  HOH A O     1 
HETATM 3409 O  O     . HOH J 8 .   ? 9.387   -26.355 -25.473 1.00 43.93 ?  992  HOH A O     1 
HETATM 3410 O  O     . HOH J 8 .   ? 12.773  19.288  10.907  1.00 39.50 ?  993  HOH A O     1 
HETATM 3411 O  O     . HOH J 8 .   ? -22.259 -4.519  -1.265  1.00 44.90 ?  994  HOH A O     1 
HETATM 3412 O  O     . HOH J 8 .   ? 10.078  9.178   -25.840 1.00 26.50 ?  995  HOH A O     1 
HETATM 3413 O  O     . HOH J 8 .   ? 9.852   7.701   -27.944 1.00 30.29 ?  996  HOH A O     1 
HETATM 3414 O  O     . HOH J 8 .   ? 25.502  10.111  -12.750 1.00 25.29 ?  997  HOH A O     1 
HETATM 3415 O  O     . HOH J 8 .   ? 28.309  3.389   -19.503 0.50 20.28 ?  998  HOH A O     1 
HETATM 3416 O  O     A HOH J 8 .   ? 9.595   -7.588  0.968   0.50 6.50  ?  999  HOH A O     1 
HETATM 3417 O  O     B HOH J 8 .   ? 9.388   -7.773  2.418   0.50 7.62  ?  999  HOH A O     1 
HETATM 3418 O  O     . HOH J 8 .   ? 12.191  2.876   -2.835  1.00 24.17 ?  1000 HOH A O     1 
HETATM 3419 O  O     A HOH J 8 .   ? -20.797 -12.815 -15.659 0.50 16.11 ?  1001 HOH A O     1 
HETATM 3420 O  O     B HOH J 8 .   ? -19.940 -10.721 -15.845 0.50 13.41 ?  1001 HOH A O     1 
HETATM 3421 O  O     . HOH J 8 .   ? -4.928  1.808   -4.996  1.00 11.53 ?  1002 HOH A O     1 
HETATM 3422 O  O     . HOH J 8 .   ? 3.225   -18.463 -14.119 1.00 21.01 ?  1003 HOH A O     1 
HETATM 3423 O  O     . HOH J 8 .   ? 19.515  -18.895 -26.120 1.00 36.16 ?  1004 HOH A O     1 
HETATM 3424 O  O     . HOH J 8 .   ? -13.018 0.950   5.879   1.00 37.03 ?  1005 HOH A O     1 
HETATM 3425 O  O     . HOH J 8 .   ? 5.604   -2.967  -1.185  0.50 12.93 ?  1006 HOH A O     1 
HETATM 3426 O  O     . HOH J 8 .   ? -13.984 -1.113  3.041   1.00 39.01 ?  1007 HOH A O     1 
HETATM 3427 O  O     A HOH J 8 .   ? -3.377  -15.834 -24.185 0.70 17.16 ?  1008 HOH A O     1 
HETATM 3428 O  O     B HOH J 8 .   ? -3.864  -15.695 -25.935 0.30 12.72 ?  1008 HOH A O     1 
HETATM 3429 O  O     A HOH J 8 .   ? -20.351 -1.247  -13.744 0.70 25.61 ?  1009 HOH A O     1 
HETATM 3430 O  O     B HOH J 8 .   ? -19.571 -0.374  -14.989 0.30 17.55 ?  1009 HOH A O     1 
HETATM 3431 O  O     . HOH J 8 .   ? -22.263 -13.645 -3.784  1.00 22.33 ?  1010 HOH A O     1 
HETATM 3432 O  O     . HOH J 8 .   ? -4.982  -15.028 4.989   1.00 38.27 ?  1011 HOH A O     1 
HETATM 3433 O  O     . HOH J 8 .   ? 2.896   -18.440 -9.557  1.00 11.63 ?  1012 HOH A O     1 
HETATM 3434 O  O     . HOH J 8 .   ? -13.291 -6.920  -1.056  1.00 6.99  ?  1013 HOH A O     1 
HETATM 3435 O  O     . HOH J 8 .   ? 15.943  -3.468  -29.601 1.00 37.96 ?  1014 HOH A O     1 
HETATM 3436 O  O     . HOH J 8 .   ? 31.585  -6.048  -20.942 1.00 44.03 ?  1015 HOH A O     1 
HETATM 3437 O  O     . HOH J 8 .   ? 11.299  -28.665 -22.580 1.00 36.61 ?  1016 HOH A O     1 
HETATM 3438 O  O     . HOH J 8 .   ? 28.968  -14.710 -19.219 1.00 33.56 ?  1017 HOH A O     1 
HETATM 3439 O  O     . HOH J 8 .   ? 28.776  -15.205 -22.892 1.00 45.32 ?  1018 HOH A O     1 
HETATM 3440 O  O     . HOH J 8 .   ? 23.076  -13.024 -7.577  1.00 36.05 ?  1019 HOH A O     1 
HETATM 3441 O  O     B HOH J 8 .   ? -2.919  -14.889 4.016   0.60 23.46 ?  1020 HOH A O     1 
HETATM 3442 O  O     . HOH K 8 .   ? -3.226  5.087   -14.789 1.00 7.52  ?  101  HOH T O     1 
HETATM 3443 O  O     . HOH K 8 .   ? -10.088 -9.667  -19.118 1.00 8.21  ?  102  HOH T O     1 
HETATM 3444 O  O     . HOH K 8 .   ? -0.546  -12.933 -19.217 1.00 8.83  ?  103  HOH T O     1 
HETATM 3445 O  O     . HOH K 8 .   ? 0.584   -15.483 -23.696 1.00 11.29 ?  104  HOH T O     1 
HETATM 3446 O  O     . HOH K 8 .   ? -3.319  12.791  -11.518 1.00 14.75 ?  105  HOH T O     1 
HETATM 3447 O  O     . HOH K 8 .   ? 1.275   -2.268  -13.818 1.00 19.42 ?  106  HOH T O     1 
HETATM 3448 O  O     . HOH K 8 .   ? -1.324  -9.278  -28.039 1.00 22.58 ?  107  HOH T O     1 
HETATM 3449 O  O     . HOH K 8 .   ? -4.658  7.232   -23.027 1.00 18.42 ?  108  HOH T O     1 
HETATM 3450 O  O     . HOH K 8 .   ? -5.582  -4.999  -23.502 1.00 16.15 ?  109  HOH T O     1 
HETATM 3451 O  O     . HOH K 8 .   ? -3.764  -17.916 -31.010 1.00 19.64 ?  110  HOH T O     1 
HETATM 3452 O  O     . HOH K 8 .   ? -6.286  8.381   -20.929 1.00 21.65 ?  111  HOH T O     1 
HETATM 3453 O  O     . HOH K 8 .   ? 4.954   -18.521 -32.875 1.00 26.08 ?  112  HOH T O     1 
HETATM 3454 O  O     . HOH K 8 .   ? -4.576  -7.337  -26.779 1.00 28.08 ?  113  HOH T O     1 
HETATM 3455 O  O     . HOH K 8 .   ? 3.589   -10.996 -31.611 1.00 26.88 ?  114  HOH T O     1 
HETATM 3456 O  O     . HOH K 8 .   ? -1.288  -16.689 -25.477 1.00 20.33 ?  115  HOH T O     1 
HETATM 3457 O  O     . HOH K 8 .   ? -7.543  10.937  -18.424 1.00 25.05 ?  116  HOH T O     1 
HETATM 3458 O  O     . HOH K 8 .   ? -3.736  0.354   -22.951 1.00 26.80 ?  117  HOH T O     1 
HETATM 3459 O  O     . HOH K 8 .   ? 5.672   -15.148 -31.770 1.00 33.09 ?  118  HOH T O     1 
HETATM 3460 O  O     . HOH K 8 .   ? -3.667  -7.201  -24.481 1.00 27.06 ?  119  HOH T O     1 
HETATM 3461 O  O     . HOH K 8 .   ? 5.903   -19.038 -39.663 1.00 27.14 ?  120  HOH T O     1 
HETATM 3462 O  O     . HOH K 8 .   ? -1.220  -6.865  -23.494 1.00 26.54 ?  121  HOH T O     1 
HETATM 3463 O  O     . HOH K 8 .   ? -0.989  -11.232 -31.865 1.00 29.74 ?  122  HOH T O     1 
HETATM 3464 O  O     . HOH K 8 .   ? 2.760   -13.582 -32.806 1.00 25.14 ?  123  HOH T O     1 
HETATM 3465 O  O     . HOH K 8 .   ? -2.965  -19.775 -34.412 1.00 26.27 ?  124  HOH T O     1 
HETATM 3466 O  O     . HOH K 8 .   ? -5.467  -9.695  -24.043 1.00 24.98 ?  125  HOH T O     1 
HETATM 3467 O  O     . HOH K 8 .   ? -1.077  -3.577  -13.102 1.00 27.84 ?  126  HOH T O     1 
HETATM 3468 O  O     . HOH K 8 .   ? -5.137  -9.250  -30.044 1.00 32.82 ?  127  HOH T O     1 
HETATM 3469 O  O     . HOH K 8 .   ? -7.647  -0.142  -22.956 1.00 21.15 ?  128  HOH T O     1 
HETATM 3470 O  O     . HOH K 8 .   ? -3.940  -17.593 -28.188 1.00 28.81 ?  129  HOH T O     1 
HETATM 3471 O  O     . HOH K 8 .   ? -8.084  -7.581  -25.470 1.00 27.91 ?  130  HOH T O     1 
HETATM 3472 O  O     . HOH K 8 .   ? -7.878  13.294  -15.642 1.00 30.79 ?  131  HOH T O     1 
HETATM 3473 O  O     . HOH K 8 .   ? -7.955  -9.767  -27.050 1.00 26.60 ?  132  HOH T O     1 
HETATM 3474 O  O     . HOH K 8 .   ? -8.576  7.411   -20.527 1.00 24.70 ?  133  HOH T O     1 
HETATM 3475 O  O     . HOH K 8 .   ? -4.672  3.238   -23.097 1.00 26.41 ?  134  HOH T O     1 
HETATM 3476 O  O     . HOH K 8 .   ? 6.359   -23.049 -33.190 1.00 28.99 ?  135  HOH T O     1 
HETATM 3477 O  O     . HOH K 8 .   ? -5.535  -17.736 -32.853 1.00 25.64 ?  136  HOH T O     1 
HETATM 3478 O  O     . HOH K 8 .   ? 5.128   -13.863 -33.890 1.00 35.73 ?  137  HOH T O     1 
HETATM 3479 O  O     . HOH K 8 .   ? -11.789 -5.093  -19.666 1.00 25.83 ?  138  HOH T O     1 
HETATM 3480 O  O     . HOH K 8 .   ? -15.484 -4.176  -20.779 1.00 33.66 ?  139  HOH T O     1 
HETATM 3481 O  O     . HOH K 8 .   ? -10.782 11.150  -15.047 1.00 28.32 ?  140  HOH T O     1 
HETATM 3482 O  O     . HOH K 8 .   ? -6.251  -11.249 -22.716 1.00 26.94 ?  141  HOH T O     1 
HETATM 3483 O  O     . HOH K 8 .   ? 2.187   -8.135  -26.286 1.00 30.45 ?  142  HOH T O     1 
HETATM 3484 O  O     . HOH K 8 .   ? -0.949  0.833   -22.938 1.00 30.47 ?  143  HOH T O     1 
HETATM 3485 O  O     . HOH K 8 .   ? 0.505   -1.152  -22.024 1.00 32.51 ?  144  HOH T O     1 
HETATM 3486 O  O     . HOH K 8 .   ? -3.676  -9.783  -32.210 1.00 37.01 ?  145  HOH T O     1 
HETATM 3487 O  O     A HOH K 8 .   ? 3.929   -18.183 -43.487 0.50 21.38 ?  146  HOH T O     1 
HETATM 3488 O  O     B HOH K 8 .   ? 4.912   -17.855 -41.998 0.50 20.95 ?  146  HOH T O     1 
HETATM 3489 O  O     . HOH K 8 .   ? 0.091   -7.423  -26.559 1.00 34.48 ?  147  HOH T O     1 
HETATM 3490 O  O     . HOH K 8 .   ? -17.672 -3.114  -21.726 1.00 39.09 ?  148  HOH T O     1 
HETATM 3491 O  O     . HOH K 8 .   ? 1.633   -4.235  -20.471 1.00 30.23 ?  149  HOH T O     1 
HETATM 3492 O  O     . HOH K 8 .   ? -4.820  -1.326  -24.135 1.00 37.63 ?  150  HOH T O     1 
HETATM 3493 O  O     . HOH K 8 .   ? -13.655 5.953   -16.649 1.00 22.10 ?  151  HOH T O     1 
HETATM 3494 O  O     . HOH K 8 .   ? -13.872 -3.797  -22.311 0.50 27.02 ?  152  HOH T O     1 
HETATM 3495 O  O     . HOH L 8 .   ? 5.420   2.526   -15.629 1.00 13.68 ?  101  HOH P O     1 
HETATM 3496 O  O     . HOH L 8 .   ? 8.062   2.619   -23.167 1.00 16.32 ?  102  HOH P O     1 
HETATM 3497 O  O     . HOH L 8 .   ? 9.057   2.968   -15.873 1.00 16.17 ?  103  HOH P O     1 
HETATM 3498 O  O     . HOH L 8 .   ? 3.841   0.555   -16.699 1.00 16.92 ?  104  HOH P O     1 
HETATM 3499 O  O     . HOH L 8 .   ? 7.111   11.431  -20.994 1.00 14.11 ?  105  HOH P O     1 
HETATM 3500 O  O     . HOH L 8 .   ? 4.492   11.855  -21.336 1.00 14.58 ?  106  HOH P O     1 
HETATM 3501 O  O     . HOH L 8 .   ? 2.233   9.587   -15.895 1.00 24.04 ?  107  HOH P O     1 
HETATM 3502 O  O     . HOH L 8 .   ? -1.510  4.938   -25.545 1.00 25.58 ?  108  HOH P O     1 
HETATM 3503 O  O     . HOH L 8 .   ? 2.712   3.954   -23.187 1.00 17.57 ?  109  HOH P O     1 
HETATM 3504 O  O     . HOH L 8 .   ? 5.019   4.476   -24.537 1.00 19.56 ?  110  HOH P O     1 
HETATM 3505 O  O     . HOH L 8 .   ? 2.480   -2.551  -10.896 1.00 23.76 ?  111  HOH P O     1 
HETATM 3506 O  O     . HOH L 8 .   ? -0.066  3.435   -23.249 1.00 21.85 ?  112  HOH P O     1 
HETATM 3507 O  O     . HOH L 8 .   ? 9.776   1.089   -17.635 1.00 25.25 ?  113  HOH P O     1 
HETATM 3508 O  O     . HOH L 8 .   ? 4.791   -0.198  -12.714 1.00 25.86 ?  114  HOH P O     1 
HETATM 3509 O  O     . HOH L 8 .   ? 2.333   0.943   -20.751 1.00 27.16 ?  115  HOH P O     1 
HETATM 3510 O  O     . HOH L 8 .   ? 4.045   1.732   -22.319 1.00 31.32 ?  116  HOH P O     1 
HETATM 3511 O  O     . HOH L 8 .   ? 5.725   3.224   -21.182 1.00 27.33 ?  117  HOH P O     1 
HETATM 3512 O  O     . HOH L 8 .   ? 7.004   0.569   -24.586 1.00 30.98 ?  118  HOH P O     1 
HETATM 3513 O  O     . HOH L 8 .   ? 3.753   -0.860  -18.889 1.00 26.93 ?  119  HOH P O     1 
HETATM 3514 O  O     . HOH L 8 .   ? 7.675   4.776   -12.615 1.00 27.92 ?  120  HOH P O     1 
HETATM 3515 O  O     . HOH L 8 .   ? 7.804   2.152   -12.975 1.00 31.14 ?  121  HOH P O     1 
HETATM 3516 O  O     . HOH M 8 .   ? 6.246   -23.131 -29.846 1.00 17.75 ?  101  HOH D O     1 
HETATM 3517 O  O     . HOH M 8 .   ? -6.228  -22.379 -27.858 1.00 23.13 ?  102  HOH D O     1 
HETATM 3518 O  O     . HOH M 8 .   ? 2.184   -19.146 -23.234 1.00 17.24 ?  103  HOH D O     1 
HETATM 3519 O  O     . HOH M 8 .   ? 6.466   -26.804 -20.254 1.00 23.37 ?  104  HOH D O     1 
HETATM 3520 O  O     . HOH M 8 .   ? 4.246   -25.419 -29.992 1.00 20.57 ?  105  HOH D O     1 
HETATM 3521 O  O     . HOH M 8 .   ? 7.673   -26.989 -22.883 1.00 24.53 ?  106  HOH D O     1 
HETATM 3522 O  O     . HOH M 8 .   ? 2.471   -26.424 -20.682 1.00 24.15 ?  107  HOH D O     1 
HETATM 3523 O  O     . HOH M 8 .   ? 2.688   -26.683 -27.692 1.00 23.86 ?  108  HOH D O     1 
HETATM 3524 O  O     . HOH M 8 .   ? 13.125  -21.470 -27.091 1.00 30.99 ?  109  HOH D O     1 
HETATM 3525 O  O     . HOH M 8 .   ? -4.074  -21.355 -28.987 1.00 23.66 ?  110  HOH D O     1 
HETATM 3526 O  O     . HOH M 8 .   ? 5.429   -25.279 -26.419 1.00 26.57 ?  111  HOH D O     1 
HETATM 3527 O  O     . HOH M 8 .   ? -1.504  -19.534 -25.234 1.00 24.56 ?  112  HOH D O     1 
HETATM 3528 O  O     . HOH M 8 .   ? -4.412  -20.690 -31.496 1.00 29.87 ?  113  HOH D O     1 
HETATM 3529 O  O     . HOH M 8 .   ? 11.150  -19.717 -29.223 1.00 30.45 ?  114  HOH D O     1 
HETATM 3530 O  O     . HOH M 8 .   ? 1.602   -27.661 -23.118 1.00 34.30 ?  115  HOH D O     1 
HETATM 3531 O  O     . HOH M 8 .   ? 14.314  -18.605 -30.920 1.00 36.99 ?  116  HOH D O     1 
HETATM 3532 O  O     . HOH M 8 .   ? 15.605  -14.552 -25.605 1.00 22.29 ?  117  HOH D O     1 
HETATM 3533 O  O     . HOH M 8 .   ? 14.760  -12.025 -25.011 1.00 20.21 ?  118  HOH D O     1 
HETATM 3534 O  O     . HOH M 8 .   ? -2.879  -22.341 -20.875 1.00 33.38 ?  119  HOH D O     1 
HETATM 3535 O  O     . HOH M 8 .   ? 7.805   -23.495 -27.376 1.00 33.89 ?  120  HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   127 ?   ?   ?   A . n 
A 1 2   SER 2   128 ?   ?   ?   A . n 
A 1 3   ALA 3   129 ?   ?   ?   A . n 
A 1 4   ALA 4   130 ?   ?   ?   A . n 
A 1 5   ALA 5   131 ?   ?   ?   A . n 
A 1 6   PRO 6   132 ?   ?   ?   A . n 
A 1 7   LEU 7   133 ?   ?   ?   A . n 
A 1 8   SER 8   134 ?   ?   ?   A . n 
A 1 9   PRO 9   135 ?   ?   ?   A . n 
A 1 10  ALA 10  136 ?   ?   ?   A . n 
A 1 11  TRP 11  137 ?   ?   ?   A . n 
A 1 12  MET 12  138 138 MET MET A . n 
A 1 13  PRO 13  139 139 PRO PRO A . n 
A 1 14  ALA 14  140 140 ALA ALA A . n 
A 1 15  TYR 15  141 141 TYR TYR A . n 
A 1 16  ALA 16  142 142 ALA ALA A . n 
A 1 17  CYS 17  143 143 CYS CYS A . n 
A 1 18  GLN 18  144 144 GLN GLN A . n 
A 1 19  ARG 19  145 145 ARG ARG A . n 
A 1 20  PRO 20  146 146 PRO PRO A . n 
A 1 21  THR 21  147 147 THR THR A . n 
A 1 22  PRO 22  148 148 PRO PRO A . n 
A 1 23  LEU 23  149 149 LEU LEU A . n 
A 1 24  THR 24  150 150 THR THR A . n 
A 1 25  HIS 25  151 151 HIS HIS A . n 
A 1 26  HIS 26  152 152 HIS HIS A . n 
A 1 27  ASN 27  153 153 ASN ASN A . n 
A 1 28  THR 28  154 154 THR THR A . n 
A 1 29  GLY 29  155 155 GLY GLY A . n 
A 1 30  LEU 30  156 156 LEU LEU A . n 
A 1 31  SER 31  157 157 SER SER A . n 
A 1 32  GLU 32  158 158 GLU GLU A . n 
A 1 33  ALA 33  159 159 ALA ALA A . n 
A 1 34  LEU 34  160 160 LEU LEU A . n 
A 1 35  GLU 35  161 161 GLU GLU A . n 
A 1 36  ILE 36  162 162 ILE ILE A . n 
A 1 37  LEU 37  163 163 LEU LEU A . n 
A 1 38  ALA 38  164 164 ALA ALA A . n 
A 1 39  GLU 39  165 165 GLU GLU A . n 
A 1 40  ALA 40  166 166 ALA ALA A . n 
A 1 41  ALA 41  167 167 ALA ALA A . n 
A 1 42  GLY 42  168 168 GLY GLY A . n 
A 1 43  PHE 43  169 169 PHE PHE A . n 
A 1 44  GLU 44  170 170 GLU GLU A . n 
A 1 45  GLY 45  171 171 GLY GLY A . n 
A 1 46  SER 46  172 172 SER SER A . n 
A 1 47  GLU 47  173 173 GLU GLU A . n 
A 1 48  GLY 48  174 174 GLY GLY A . n 
A 1 49  ARG 49  175 175 ARG ARG A . n 
A 1 50  LEU 50  176 176 LEU LEU A . n 
A 1 51  LEU 51  177 177 LEU LEU A . n 
A 1 52  THR 52  178 178 THR THR A . n 
A 1 53  PHE 53  179 179 PHE PHE A . n 
A 1 54  CYS 54  180 180 CYS CYS A . n 
A 1 55  ARG 55  181 181 ARG ARG A . n 
A 1 56  ALA 56  182 182 ALA ALA A . n 
A 1 57  ALA 57  183 183 ALA ALA A . n 
A 1 58  SER 58  184 184 SER SER A . n 
A 1 59  VAL 59  185 185 VAL VAL A . n 
A 1 60  LEU 60  186 186 LEU LEU A . n 
A 1 61  LYS 61  187 187 LYS LYS A . n 
A 1 62  ALA 62  188 188 ALA ALA A . n 
A 1 63  LEU 63  189 189 LEU LEU A . n 
A 1 64  PRO 64  190 190 PRO PRO A . n 
A 1 65  SER 65  191 191 SER SER A . n 
A 1 66  PRO 66  192 192 PRO PRO A . n 
A 1 67  VAL 67  193 193 VAL VAL A . n 
A 1 68  THR 68  194 194 THR THR A . n 
A 1 69  THR 69  195 195 THR THR A . n 
A 1 70  LEU 70  196 196 LEU LEU A . n 
A 1 71  SER 71  197 197 SER SER A . n 
A 1 72  GLN 72  198 198 GLN GLN A . n 
A 1 73  LEU 73  199 199 LEU LEU A . n 
A 1 74  GLN 74  200 200 GLN GLN A . n 
A 1 75  GLY 75  201 201 GLY GLY A . n 
A 1 76  LEU 76  202 202 LEU LEU A . n 
A 1 77  PRO 77  203 203 PRO PRO A . n 
A 1 78  HIS 78  204 204 HIS HIS A . n 
A 1 79  PHE 79  205 205 PHE PHE A . n 
A 1 80  GLY 80  206 206 GLY GLY A . n 
A 1 81  GLU 81  207 207 GLU GLU A . n 
A 1 82  HIS 82  208 208 HIS HIS A . n 
A 1 83  SER 83  209 209 SER SER A . n 
A 1 84  SER 84  210 210 SER SER A . n 
A 1 85  ARG 85  211 211 ARG ARG A . n 
A 1 86  VAL 86  212 212 VAL VAL A . n 
A 1 87  VAL 87  213 213 VAL VAL A . n 
A 1 88  GLN 88  214 214 GLN GLN A . n 
A 1 89  GLU 89  215 215 GLU GLU A . n 
A 1 90  LEU 90  216 216 LEU LEU A . n 
A 1 91  LEU 91  217 217 LEU LEU A . n 
A 1 92  GLU 92  218 218 GLU GLU A . n 
A 1 93  HIS 93  219 219 HIS HIS A . n 
A 1 94  GLY 94  220 220 GLY GLY A . n 
A 1 95  VAL 95  221 221 VAL VAL A . n 
A 1 96  CYS 96  222 222 CYS CYS A . n 
A 1 97  GLU 97  223 223 GLU GLU A . n 
A 1 98  GLU 98  224 224 GLU GLU A . n 
A 1 99  VAL 99  225 225 VAL VAL A . n 
A 1 100 GLU 100 226 226 GLU GLU A . n 
A 1 101 ARG 101 227 227 ARG ARG A . n 
A 1 102 VAL 102 228 228 VAL VAL A . n 
A 1 103 ARG 103 229 229 ARG ARG A . n 
A 1 104 ARG 104 230 230 ARG ARG A . n 
A 1 105 SER 105 231 231 SER SER A . n 
A 1 106 GLU 106 232 232 GLU GLU A . n 
A 1 107 ARG 107 233 233 ARG ARG A . n 
A 1 108 TYR 108 234 234 TYR TYR A . n 
A 1 109 GLN 109 235 235 GLN GLN A . n 
A 1 110 THR 110 236 236 THR THR A . n 
A 1 111 MET 111 237 237 MET MET A . n 
A 1 112 LYS 112 238 238 LYS LYS A . n 
A 1 113 LEU 113 239 239 LEU LEU A . n 
A 1 114 PHE 114 240 240 PHE PHE A . n 
A 1 115 THR 115 241 241 THR THR A . n 
A 1 116 GLN 116 242 242 GLN GLN A . n 
A 1 117 ILE 117 243 243 ILE ILE A . n 
A 1 118 PHE 118 244 244 PHE PHE A . n 
A 1 119 GLY 119 245 245 GLY GLY A . n 
A 1 120 VAL 120 246 246 VAL VAL A . n 
A 1 121 GLY 121 247 247 GLY GLY A . n 
A 1 122 VAL 122 248 248 VAL VAL A . n 
A 1 123 LYS 123 249 249 LYS LYS A . n 
A 1 124 THR 124 250 250 THR THR A . n 
A 1 125 ALA 125 251 251 ALA ALA A . n 
A 1 126 ASP 126 252 252 ASP ASP A . n 
A 1 127 ARG 127 253 253 ARG ARG A . n 
A 1 128 TRP 128 254 254 TRP TRP A . n 
A 1 129 TYR 129 255 255 TYR TYR A . n 
A 1 130 ARG 130 256 256 ARG ARG A . n 
A 1 131 GLU 131 257 257 GLU GLU A . n 
A 1 132 GLY 132 258 258 GLY GLY A . n 
A 1 133 LEU 133 259 259 LEU LEU A . n 
A 1 134 ARG 134 260 260 ARG ARG A . n 
A 1 135 THR 135 261 261 THR THR A . n 
A 1 136 LEU 136 262 262 LEU LEU A . n 
A 1 137 ASP 137 263 263 ASP ASP A . n 
A 1 138 ASP 138 264 264 ASP ASP A . n 
A 1 139 LEU 139 265 265 LEU LEU A . n 
A 1 140 ARG 140 266 266 ARG ARG A . n 
A 1 141 GLU 141 267 267 GLU GLU A . n 
A 1 142 GLN 142 268 268 GLN GLN A . n 
A 1 143 PRO 143 269 269 PRO PRO A . n 
A 1 144 GLN 144 270 270 GLN GLN A . n 
A 1 145 LYS 145 271 271 LYS LYS A . n 
A 1 146 LEU 146 272 272 LEU LEU A . n 
A 1 147 THR 147 273 273 THR THR A . n 
A 1 148 GLN 148 274 274 GLN GLN A . n 
A 1 149 GLN 149 275 275 GLN GLN A . n 
A 1 150 GLN 150 276 276 GLN GLN A . n 
A 1 151 LYS 151 277 277 LYS LYS A . n 
A 1 152 ALA 152 278 278 ALA ALA A . n 
A 1 153 GLY 153 279 279 GLY GLY A . n 
A 1 154 LEU 154 280 280 LEU LEU A . n 
A 1 155 GLN 155 281 281 GLN GLN A . n 
A 1 156 HIS 156 282 282 HIS HIS A . n 
A 1 157 HIS 157 283 283 HIS HIS A . n 
A 1 158 GLN 158 284 284 GLN GLN A . n 
A 1 159 ASP 159 285 285 ASP ASP A . n 
A 1 160 LEU 160 286 286 LEU LEU A . n 
A 1 161 SER 161 287 287 SER SER A . n 
A 1 162 THR 162 288 288 THR THR A . n 
A 1 163 PRO 163 289 289 PRO PRO A . n 
A 1 164 VAL 164 290 290 VAL VAL A . n 
A 1 165 LEU 165 291 291 LEU LEU A . n 
A 1 166 ARG 166 292 292 ARG ARG A . n 
A 1 167 SER 167 293 293 SER SER A . n 
A 1 168 ASP 168 294 294 ASP ASP A . n 
A 1 169 VAL 169 295 295 VAL VAL A . n 
A 1 170 ASP 170 296 296 ASP ASP A . n 
A 1 171 ALA 171 297 297 ALA ALA A . n 
A 1 172 LEU 172 298 298 LEU LEU A . n 
A 1 173 GLN 173 299 299 GLN GLN A . n 
A 1 174 GLN 174 300 300 GLN GLN A . n 
A 1 175 VAL 175 301 301 VAL VAL A . n 
A 1 176 VAL 176 302 302 VAL VAL A . n 
A 1 177 GLU 177 303 303 GLU GLU A . n 
A 1 178 GLU 178 304 304 GLU GLU A . n 
A 1 179 ALA 179 305 305 ALA ALA A . n 
A 1 180 VAL 180 306 306 VAL VAL A . n 
A 1 181 GLY 181 307 307 GLY GLY A . n 
A 1 182 GLN 182 308 308 GLN GLN A . n 
A 1 183 ALA 183 309 309 ALA ALA A . n 
A 1 184 LEU 184 310 310 LEU LEU A . n 
A 1 185 PRO 185 311 311 PRO PRO A . n 
A 1 186 GLY 186 312 312 GLY GLY A . n 
A 1 187 ALA 187 313 313 ALA ALA A . n 
A 1 188 THR 188 314 314 THR THR A . n 
A 1 189 VAL 189 315 315 VAL VAL A . n 
A 1 190 THR 190 316 316 THR THR A . n 
A 1 191 LEU 191 317 317 LEU LEU A . n 
A 1 192 THR 192 318 318 THR THR A . n 
A 1 193 GLY 193 319 319 GLY GLY A . n 
A 1 194 GLY 194 320 320 GLY GLY A . n 
A 1 195 PHE 195 321 321 PHE PHE A . n 
A 1 196 ARG 196 322 322 ARG ARG A . n 
A 1 197 ARG 197 323 323 ARG ARG A . n 
A 1 198 GLY 198 324 324 GLY GLY A . n 
A 1 199 LYS 199 325 325 LYS LYS A . n 
A 1 200 LEU 200 326 326 LEU LEU A . n 
A 1 201 GLN 201 327 327 GLN GLN A . n 
A 1 202 GLY 202 328 328 GLY GLY A . n 
A 1 203 HIS 203 329 329 HIS HIS A . n 
A 1 204 ASP 204 330 330 ASP ASP A . n 
A 1 205 VAL 205 331 331 VAL VAL A . n 
A 1 206 ASP 206 332 332 ASP ASP A . n 
A 1 207 PHE 207 333 333 PHE PHE A . n 
A 1 208 LEU 208 334 334 LEU LEU A . n 
A 1 209 ILE 209 335 335 ILE ILE A . n 
A 1 210 THR 210 336 336 THR THR A . n 
A 1 211 HIS 211 337 337 HIS HIS A . n 
A 1 212 PRO 212 338 338 PRO PRO A . n 
A 1 213 LYS 213 339 339 LYS LYS A . n 
A 1 214 GLU 214 340 340 GLU GLU A . n 
A 1 215 GLY 215 341 341 GLY GLY A . n 
A 1 216 GLN 216 342 342 GLN GLN A . n 
A 1 217 GLU 217 343 343 GLU GLU A . n 
A 1 218 ALA 218 344 344 ALA ALA A . n 
A 1 219 GLY 219 345 345 GLY GLY A . n 
A 1 220 LEU 220 346 346 LEU LEU A . n 
A 1 221 LEU 221 347 347 LEU LEU A . n 
A 1 222 PRO 222 348 348 PRO PRO A . n 
A 1 223 ARG 223 349 349 ARG ARG A . n 
A 1 224 VAL 224 350 350 VAL VAL A . n 
A 1 225 MET 225 351 351 MET MET A . n 
A 1 226 CYS 226 352 352 CYS CYS A . n 
A 1 227 ARG 227 353 353 ARG ARG A . n 
A 1 228 LEU 228 354 354 LEU LEU A . n 
A 1 229 GLN 229 355 355 GLN GLN A . n 
A 1 230 ASP 230 356 356 ASP ASP A . n 
A 1 231 GLN 231 357 357 GLN GLN A . n 
A 1 232 GLY 232 358 358 GLY GLY A . n 
A 1 233 LEU 233 359 359 LEU LEU A . n 
A 1 234 ILE 234 360 360 ILE ILE A . n 
A 1 235 LEU 235 361 361 LEU LEU A . n 
A 1 236 TYR 236 362 362 TYR TYR A . n 
A 1 237 HIS 237 363 363 HIS HIS A . n 
A 1 238 GLN 238 364 364 GLN GLN A . n 
A 1 239 HIS 239 365 ?   ?   ?   A . n 
A 1 240 GLN 240 366 ?   ?   ?   A . n 
A 1 241 HIS 241 367 ?   ?   ?   A . n 
A 1 242 SER 242 368 ?   ?   ?   A . n 
A 1 243 CYS 243 369 ?   ?   ?   A . n 
A 1 244 CYS 244 370 ?   ?   ?   A . n 
A 1 245 GLU 245 371 ?   ?   ?   A . n 
A 1 246 SER 246 372 ?   ?   ?   A . n 
A 1 247 PRO 247 373 ?   ?   ?   A . n 
A 1 248 THR 248 374 ?   ?   ?   A . n 
A 1 249 ARG 249 375 ?   ?   ?   A . n 
A 1 250 LEU 250 376 ?   ?   ?   A . n 
A 1 251 ALA 251 377 ?   ?   ?   A . n 
A 1 252 GLN 252 378 ?   ?   ?   A . n 
A 1 253 GLN 253 379 ?   ?   ?   A . n 
A 1 254 SER 254 380 ?   ?   ?   A . n 
A 1 255 HIS 255 381 ?   ?   ?   A . n 
A 1 256 MET 256 382 ?   ?   ?   A . n 
A 1 257 ASP 257 383 ?   ?   ?   A . n 
A 1 258 ALA 258 384 ?   ?   ?   A . n 
A 1 259 PHE 259 385 385 PHE PHE A . n 
A 1 260 GLU 260 386 386 GLU GLU A . n 
A 1 261 ARG 261 387 387 ARG ARG A . n 
A 1 262 SER 262 388 388 SER SER A . n 
A 1 263 PHE 263 389 389 PHE PHE A . n 
A 1 264 CYS 264 390 390 CYS CYS A . n 
A 1 265 ILE 265 391 391 ILE ILE A . n 
A 1 266 PHE 266 392 392 PHE PHE A . n 
A 1 267 ARG 267 393 393 ARG ARG A . n 
A 1 268 LEU 268 394 394 LEU LEU A . n 
A 1 269 PRO 269 395 395 PRO PRO A . n 
A 1 270 GLN 270 396 396 GLN GLN A . n 
A 1 271 PRO 271 397 397 PRO PRO A . n 
A 1 272 GLY 272 410 410 GLY GLY A . n 
A 1 273 SER 273 411 411 SER SER A . n 
A 1 274 TRP 274 412 412 TRP TRP A . n 
A 1 275 LYS 275 413 413 LYS LYS A . n 
A 1 276 ALA 276 414 414 ALA ALA A . n 
A 1 277 VAL 277 415 415 VAL VAL A . n 
A 1 278 ARG 278 416 416 ARG ARG A . n 
A 1 279 VAL 279 417 417 VAL VAL A . n 
A 1 280 ASP 280 418 418 ASP ASP A . n 
A 1 281 LEU 281 419 419 LEU LEU A . n 
A 1 282 VAL 282 420 420 VAL VAL A . n 
A 1 283 VAL 283 421 421 VAL VAL A . n 
A 1 284 ALA 284 422 422 ALA ALA A . n 
A 1 285 PRO 285 423 423 PRO PRO A . n 
A 1 286 VAL 286 424 424 VAL VAL A . n 
A 1 287 SER 287 425 425 SER SER A . n 
A 1 288 GLN 288 426 426 GLN GLN A . n 
A 1 289 PHE 289 427 427 PHE PHE A . n 
A 1 290 PRO 290 428 428 PRO PRO A . n 
A 1 291 PHE 291 429 429 PHE PHE A . n 
A 1 292 ALA 292 430 430 ALA ALA A . n 
A 1 293 LEU 293 431 431 LEU LEU A . n 
A 1 294 LEU 294 432 432 LEU LEU A . n 
A 1 295 GLY 295 433 433 GLY GLY A . n 
A 1 296 TRP 296 434 434 TRP TRP A . n 
A 1 297 THR 297 435 435 THR THR A . n 
A 1 298 GLY 298 436 436 GLY GLY A . n 
A 1 299 SER 299 437 437 SER SER A . n 
A 1 300 LYS 300 438 438 LYS LYS A . n 
A 1 301 LEU 301 439 439 LEU LEU A . n 
A 1 302 PHE 302 440 440 PHE PHE A . n 
A 1 303 GLN 303 441 441 GLN GLN A . n 
A 1 304 ARG 304 442 442 ARG ARG A . n 
A 1 305 GLU 305 443 443 GLU GLU A . n 
A 1 306 LEU 306 444 444 LEU LEU A . n 
A 1 307 ARG 307 445 445 ARG ARG A . n 
A 1 308 ARG 308 446 446 ARG ARG A . n 
A 1 309 PHE 309 447 447 PHE PHE A . n 
A 1 310 SER 310 448 448 SER SER A . n 
A 1 311 ARG 311 449 449 ARG ARG A . n 
A 1 312 LYS 312 450 450 LYS LYS A . n 
A 1 313 GLU 313 451 451 GLU GLU A . n 
A 1 314 LYS 314 452 452 LYS LYS A . n 
A 1 315 GLY 315 453 453 GLY GLY A . n 
A 1 316 LEU 316 454 454 LEU LEU A . n 
A 1 317 TRP 317 455 455 TRP TRP A . n 
A 1 318 LEU 318 456 456 LEU LEU A . n 
A 1 319 ASN 319 457 457 ASN ASN A . n 
A 1 320 SER 320 458 458 SER SER A . n 
A 1 321 HIS 321 459 459 HIS HIS A . n 
A 1 322 GLY 322 460 460 GLY GLY A . n 
A 1 323 LEU 323 461 461 LEU LEU A . n 
A 1 324 PHE 324 462 462 PHE PHE A . n 
A 1 325 ASP 325 463 463 ASP ASP A . n 
A 1 326 PRO 326 464 464 PRO PRO A . n 
A 1 327 GLU 327 465 465 GLU GLU A . n 
A 1 328 GLN 328 466 466 GLN GLN A . n 
A 1 329 LYS 329 467 467 LYS LYS A . n 
A 1 330 THR 330 468 468 THR THR A . n 
A 1 331 PHE 331 469 469 PHE PHE A . n 
A 1 332 PHE 332 470 470 PHE PHE A . n 
A 1 333 GLN 333 471 471 GLN GLN A . n 
A 1 334 ALA 334 472 472 ALA ALA A . n 
A 1 335 ALA 335 473 473 ALA ALA A . n 
A 1 336 SER 336 474 474 SER SER A . n 
A 1 337 GLU 337 475 475 GLU GLU A . n 
A 1 338 GLU 338 476 476 GLU GLU A . n 
A 1 339 ASP 339 477 477 ASP ASP A . n 
A 1 340 ILE 340 478 478 ILE ILE A . n 
A 1 341 PHE 341 479 479 PHE PHE A . n 
A 1 342 ARG 342 480 480 ARG ARG A . n 
A 1 343 HIS 343 481 481 HIS HIS A . n 
A 1 344 LEU 344 482 482 LEU LEU A . n 
A 1 345 GLY 345 483 483 GLY GLY A . n 
A 1 346 LEU 346 484 484 LEU LEU A . n 
A 1 347 GLU 347 485 485 GLU GLU A . n 
A 1 348 TYR 348 486 486 TYR TYR A . n 
A 1 349 LEU 349 487 487 LEU LEU A . n 
A 1 350 PRO 350 488 488 PRO PRO A . n 
A 1 351 PRO 351 489 489 PRO PRO A . n 
A 1 352 GLU 352 490 490 GLU GLU A . n 
A 1 353 GLN 353 491 491 GLN GLN A . n 
A 1 354 ARG 354 492 492 ARG ARG A . n 
A 1 355 ASN 355 493 493 ASN ASN A . n 
A 1 356 ALA 356 494 494 ALA ALA A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DG  2   2   2   DG  DG  T . n 
B 2 3   DG  3   3   3   DG  DG  T . n 
B 2 4   DC  4   4   4   DC  DC  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DA  7   7   7   DA  DA  T . n 
B 2 8   DC  8   8   8   DC  DC  T . n 
B 2 9   DG  9   9   9   DG  DG  T . n 
C 3 1   DC  1   1   1   DC  DC  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DT  3   3   3   DT  DT  P . n 
C 3 4   DA  4   4   4   DA  DA  P . n 
D 4 1   DG  1   1   1   DG  DG  D . n 
D 4 2   DC  2   2   2   DC  DC  D . n 
D 4 3   DC  3   3   3   DC  DC  D . n 
D 4 4   DG  4   4   4   DG  DG  D . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? A PHE 79  ? A PHE 205 ? 1_555 NA ? H NA . ? A NA 504 ? 1_555 O   ? J HOH .   ? A HOH 778 ? 1_555 82.1  ? 
2  O ? A PHE 79  ? A PHE 205 ? 1_555 NA ? H NA . ? A NA 504 ? 1_555 O   ? M HOH .   ? D HOH 106 ? 1_555 83.9  ? 
3  O ? J HOH .   ? A HOH 778 ? 1_555 NA ? H NA . ? A NA 504 ? 1_555 O   ? M HOH .   ? D HOH 106 ? 1_555 151.8 ? 
4  O ? A PHE 79  ? A PHE 205 ? 1_555 NA ? H NA . ? A NA 504 ? 1_555 O   ? M HOH .   ? D HOH 104 ? 1_555 82.5  ? 
5  O ? J HOH .   ? A HOH 778 ? 1_555 NA ? H NA . ? A NA 504 ? 1_555 O   ? M HOH .   ? D HOH 104 ? 1_555 79.7  ? 
6  O ? M HOH .   ? D HOH 106 ? 1_555 NA ? H NA . ? A NA 504 ? 1_555 O   ? M HOH .   ? D HOH 104 ? 1_555 74.2  ? 
7  O ? A PHE 79  ? A PHE 205 ? 1_555 NA ? H NA . ? A NA 504 ? 1_555 O   ? J HOH .   ? A HOH 852 ? 1_555 148.0 ? 
8  O ? J HOH .   ? A HOH 778 ? 1_555 NA ? H NA . ? A NA 504 ? 1_555 O   ? J HOH .   ? A HOH 852 ? 1_555 72.7  ? 
9  O ? M HOH .   ? D HOH 106 ? 1_555 NA ? H NA . ? A NA 504 ? 1_555 O   ? J HOH .   ? A HOH 852 ? 1_555 127.0 ? 
10 O ? M HOH .   ? D HOH 104 ? 1_555 NA ? H NA . ? A NA 504 ? 1_555 O   ? J HOH .   ? A HOH 852 ? 1_555 111.2 ? 
11 O ? L HOH .   ? P HOH 103 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? A VAL 120 ? A VAL 246 ? 1_555 85.4  ? 
12 O ? L HOH .   ? P HOH 103 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? J HOH .   ? A HOH 900 ? 1_555 96.7  ? 
13 O ? A VAL 120 ? A VAL 246 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? J HOH .   ? A HOH 900 ? 1_555 177.9 ? 
14 O ? L HOH .   ? P HOH 103 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? A THR 115 ? A THR 241 ? 1_555 89.2  ? 
15 O ? A VAL 120 ? A VAL 246 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? A THR 115 ? A THR 241 ? 1_555 89.5  ? 
16 O ? J HOH .   ? A HOH 900 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? A THR 115 ? A THR 241 ? 1_555 90.3  ? 
17 O ? L HOH .   ? P HOH 103 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? J HOH .   ? A HOH 901 ? 1_555 52.2  ? 
18 O ? A VAL 120 ? A VAL 246 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? J HOH .   ? A HOH 901 ? 1_555 128.4 ? 
19 O ? J HOH .   ? A HOH 900 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? J HOH .   ? A HOH 901 ? 1_555 53.3  ? 
20 O ? A THR 115 ? A THR 241 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? J HOH .   ? A HOH 901 ? 1_555 65.2  ? 
21 O ? L HOH .   ? P HOH 103 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? A ILE 117 ? A ILE 243 ? 1_555 172.4 ? 
22 O ? A VAL 120 ? A VAL 246 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? A ILE 117 ? A ILE 243 ? 1_555 91.2  ? 
23 O ? J HOH .   ? A HOH 900 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? A ILE 117 ? A ILE 243 ? 1_555 86.7  ? 
24 O ? A THR 115 ? A THR 241 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? A ILE 117 ? A ILE 243 ? 1_555 97.6  ? 
25 O ? J HOH .   ? A HOH 901 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 O   ? A ILE 117 ? A ILE 243 ? 1_555 134.1 ? 
26 O ? L HOH .   ? P HOH 103 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 83.7  ? 
27 O ? A VAL 120 ? A VAL 246 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 92.9  ? 
28 O ? J HOH .   ? A HOH 900 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 87.6  ? 
29 O ? A THR 115 ? A THR 241 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 172.3 ? 
30 O ? J HOH .   ? A HOH 901 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 107.9 ? 
31 O ? A ILE 117 ? A ILE 243 ? 1_555 NA ? G NA . ? A NA 503 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 89.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-02-05 
2 'Structure model' 1 1 2014-03-05 
3 'Structure model' 1 2 2014-03-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALEPACK       .        ?                program 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data scaling'    
http://www.hkl-xray.com/                    ?   ? 
2 PHASER          .        ?                program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/ ?   ? 
3 PHENIX          1.8_1069 ?                package 'Paul D. Adams'      PDAdams@lbl.gov             refinement        
http://www.phenix-online.org/               C++ ? 
4 PDB_EXTRACT     3.11     'April 22, 2011' package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/   C++ ? 
5 StructureStudio .        ?                ?       ?                    ?                           'data collection' ? ?   ? 
6 HKL-2000        .        ?                ?       ?                    ?                           'data reduction'  ? ?   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NH2 A ARG 145 ? ? O A HOH 1003 ? ? 1.97 
2 1 O   A HOH 901 ? ? O P HOH 103  ? ? 2.10 
3 1 O   A THR 288 ? A O A HOH 1000 ? ? 2.13 
4 1 O   A HOH 900 ? ? O A HOH 901  ? ? 2.15 
5 1 O   A HOH 843 ? ? O A HOH 1007 ? ? 2.17 
6 1 O   A HOH 901 ? ? O A HOH 934  ? ? 2.18 
7 1 O   A HOH 816 ? ? O A HOH 928  ? ? 2.18 
8 1 O   T HOH 125 ? ? O T HOH 141  ? ? 2.19 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            P 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OP3 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.487 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.120 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DC 1 ? ? "C1'" T DC 1 ? ? "C2'" T DC 1 ? ? 110.54 106.80 3.74  0.50 N 
2 1 "O4'" T DT 6 ? ? "C1'" T DT 6 ? ? N1    T DT 6 ? ? 112.53 108.30 4.23  0.30 N 
3 1 "O4'" T DG 9 ? ? "C1'" T DG 9 ? ? N9    T DG 9 ? ? 102.36 108.00 -5.64 0.70 N 
4 1 "O4'" P DT 3 ? ? "C4'" P DT 3 ? ? "C3'" P DT 3 ? ? 101.80 104.50 -2.70 0.40 N 
5 1 "O4'" P DA 4 ? ? "C1'" P DA 4 ? ? N9    P DA 4 ? ? 111.34 108.30 3.04  0.30 N 
6 1 "O4'" D DG 1 ? ? "C1'" D DG 1 ? ? N9    D DG 1 ? ? 102.34 108.00 -5.66 0.70 N 
7 1 "C1'" D DC 2 ? ? "O4'" D DC 2 ? ? "C4'" D DC 2 ? ? 103.13 110.10 -6.97 1.00 N 
8 1 "O4'" D DC 3 ? ? "C1'" D DC 3 ? ? N1    D DC 3 ? ? 98.47  108.00 -9.53 0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 318 ? ? -123.14 -153.35 
2 1 THR A 318 ? ? -123.69 -152.52 
3 1 SER A 411 ? ? -161.93 -142.07 
4 1 ASN A 493 ? ? -84.78  49.07   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 196 ? CD1 ? A LEU 70  CD1 
2  1 Y 1 A LEU 196 ? CD2 ? A LEU 70  CD2 
3  1 Y 1 A GLN 200 ? CD  ? A GLN 74  CD  
4  1 Y 1 A GLN 200 ? OE1 ? A GLN 74  OE1 
5  1 Y 1 A GLN 200 ? NE2 ? A GLN 74  NE2 
6  1 Y 1 A GLU 207 ? CD  ? A GLU 81  CD  
7  1 Y 1 A GLU 207 ? OE1 ? A GLU 81  OE1 
8  1 Y 1 A GLU 207 ? OE2 ? A GLU 81  OE2 
9  1 Y 1 A GLU 223 ? CD  ? A GLU 97  CD  
10 1 Y 1 A GLU 223 ? OE1 ? A GLU 97  OE1 
11 1 Y 1 A GLU 223 ? OE2 ? A GLU 97  OE2 
12 1 Y 1 A GLU 267 ? CD  ? A GLU 141 CD  
13 1 Y 1 A GLU 267 ? OE1 ? A GLU 141 OE1 
14 1 Y 1 A GLU 267 ? OE2 ? A GLU 141 OE2 
15 1 Y 1 A GLN 268 ? CG  ? A GLN 142 CG  
16 1 Y 1 A GLN 268 ? CD  ? A GLN 142 CD  
17 1 Y 1 A GLN 268 ? OE1 ? A GLN 142 OE1 
18 1 Y 1 A GLN 268 ? NE2 ? A GLN 142 NE2 
19 1 Y 1 A GLN 270 ? CG  ? A GLN 144 CG  
20 1 Y 1 A GLN 270 ? CD  ? A GLN 144 CD  
21 1 Y 1 A GLN 270 ? OE1 ? A GLN 144 OE1 
22 1 Y 1 A GLN 270 ? NE2 ? A GLN 144 NE2 
23 1 Y 1 A LYS 271 ? CG  ? A LYS 145 CG  
24 1 Y 1 A LYS 271 ? CD  ? A LYS 145 CD  
25 1 Y 1 A LYS 271 ? CE  ? A LYS 145 CE  
26 1 Y 1 A LYS 271 ? NZ  ? A LYS 145 NZ  
27 1 Y 1 A GLN 300 ? CD  ? A GLN 174 CD  
28 1 Y 1 A GLN 300 ? OE1 ? A GLN 174 OE1 
29 1 Y 1 A GLN 300 ? NE2 ? A GLN 174 NE2 
30 1 Y 1 A GLU 304 ? OE1 ? A GLU 178 OE1 
31 1 Y 1 A GLU 304 ? OE2 ? A GLU 178 OE2 
32 1 Y 1 A LYS 339 ? CD  ? A LYS 213 CD  
33 1 Y 1 A LYS 339 ? CE  ? A LYS 213 CE  
34 1 Y 1 A LYS 339 ? NZ  ? A LYS 213 NZ  
35 1 Y 1 A GLU 465 ? CD  ? A GLU 327 CD  
36 1 Y 1 A GLU 465 ? OE1 ? A GLU 327 OE1 
37 1 Y 1 A GLU 465 ? OE2 ? A GLU 327 OE2 
38 1 Y 1 A LYS 467 ? CE  ? A LYS 329 CE  
39 1 Y 1 A LYS 467 ? NZ  ? A LYS 329 NZ  
40 1 Y 1 A GLU 485 ? CG  ? A GLU 347 CG  
41 1 Y 1 A GLU 485 ? CD  ? A GLU 347 CD  
42 1 Y 1 A GLU 485 ? OE1 ? A GLU 347 OE1 
43 1 Y 1 A GLU 485 ? OE2 ? A GLU 347 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 127 ? A GLY 1   
2  1 Y 1 A SER 128 ? A SER 2   
3  1 Y 1 A ALA 129 ? A ALA 3   
4  1 Y 1 A ALA 130 ? A ALA 4   
5  1 Y 1 A ALA 131 ? A ALA 5   
6  1 Y 1 A PRO 132 ? A PRO 6   
7  1 Y 1 A LEU 133 ? A LEU 7   
8  1 Y 1 A SER 134 ? A SER 8   
9  1 Y 1 A PRO 135 ? A PRO 9   
10 1 Y 1 A ALA 136 ? A ALA 10  
11 1 Y 1 A TRP 137 ? A TRP 11  
12 1 Y 1 A HIS 365 ? A HIS 239 
13 1 Y 1 A GLN 366 ? A GLN 240 
14 1 Y 1 A HIS 367 ? A HIS 241 
15 1 Y 1 A SER 368 ? A SER 242 
16 1 Y 1 A CYS 369 ? A CYS 243 
17 1 Y 1 A CYS 370 ? A CYS 244 
18 1 Y 1 A GLU 371 ? A GLU 245 
19 1 Y 1 A SER 372 ? A SER 246 
20 1 Y 1 A PRO 373 ? A PRO 247 
21 1 Y 1 A THR 374 ? A THR 248 
22 1 Y 1 A ARG 375 ? A ARG 249 
23 1 Y 1 A LEU 376 ? A LEU 250 
24 1 Y 1 A ALA 377 ? A ALA 251 
25 1 Y 1 A GLN 378 ? A GLN 252 
26 1 Y 1 A GLN 379 ? A GLN 253 
27 1 Y 1 A SER 380 ? A SER 254 
28 1 Y 1 A HIS 381 ? A HIS 255 
29 1 Y 1 A MET 382 ? A MET 256 
30 1 Y 1 A ASP 383 ? A ASP 257 
31 1 Y 1 A ALA 384 ? A ALA 258 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4LZG 'double helix'        
4LZG 'a-form double helix' 
4LZG 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1 1_555 D DG 4 1_555 -0.004 -0.106 0.307  -8.669 -12.051 -1.986 1 T_DC1:DG4_D T 1 ? D 4 ? 19 1 
1 B DG 2 1_555 D DC 3 1_555 -0.068 -0.123 0.026  -0.888 -8.851  -0.764 2 T_DG2:DC3_D T 2 ? D 3 ? 19 1 
1 B DG 3 1_555 D DC 2 1_555 -0.219 -0.196 0.151  0.778  -8.975  -3.378 3 T_DG3:DC2_D T 3 ? D 2 ? 19 1 
1 B DC 4 1_555 D DG 1 1_555 0.222  -0.095 -0.265 13.131 1.179   -1.409 4 T_DC4:DG1_D T 4 ? D 1 ? 19 1 
1 B DT 6 1_555 C DA 4 1_555 -0.064 -0.190 -0.071 -0.971 4.828   0.994  5 T_DT6:DA4_P T 6 ? P 4 ? 20 1 
1 B DA 7 1_555 C DT 3 1_555 0.183  -0.116 0.325  7.387  -10.891 -0.710 6 T_DA7:DT3_P T 7 ? P 3 ? 20 1 
1 B DC 8 1_555 C DG 2 1_555 0.249  -0.135 -0.075 10.975 -9.932  -0.673 7 T_DC8:DG2_P T 8 ? P 2 ? 19 1 
1 B DG 9 1_555 C DC 1 1_555 -0.150 -0.154 0.027  -2.134 -10.315 -1.382 8 T_DG9:DC1_P T 9 ? P 1 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1 1_555 D DG 4 1_555 B DG 2 1_555 D DC 3 1_555 -0.451 0.663  3.270 3.393  5.556 34.932 0.267  1.241  3.277 9.156  -5.592  
35.515 1 TT_DC1DG2:DC3DG4_DD T 1 ? D 4 ? T 2 ? D 3 ? 
1 B DG 2 1_555 D DC 3 1_555 B DG 3 1_555 D DC 2 1_555 0.454  -0.099 3.354 -2.403 5.630 33.993 -1.055 -1.144 3.258 9.533  4.069   
34.524 2 TT_DG2DG3:DC2DC3_DD T 2 ? D 3 ? T 3 ? D 2 ? 
1 B DG 3 1_555 D DC 2 1_555 B DC 4 1_555 D DG 1 1_555 0.327  0.139  3.055 4.735  3.250 26.751 -0.468 0.419  3.061 6.924  -10.087 
27.350 3 TT_DG3DC4:DG1DC2_DD T 3 ? D 2 ? T 4 ? D 1 ? 
1 B DT 6 1_555 C DA 4 1_555 B DA 7 1_555 C DT 3 1_555 0.015  -1.025 3.117 -3.708 2.712 28.004 -2.678 -0.833 2.980 5.557  7.598   
28.371 4 TT_DT6DA7:DT3DA4_PP T 6 ? P 4 ? T 7 ? P 3 ? 
1 B DA 7 1_555 C DT 3 1_555 B DC 8 1_555 C DG 2 1_555 -0.297 -1.260 3.303 2.670  4.331 35.656 -2.645 0.853  3.104 7.029  -4.332  
36.005 5 TT_DA7DC8:DG2DT3_PP T 7 ? P 3 ? T 8 ? P 2 ? 
1 B DC 8 1_555 C DG 2 1_555 B DG 9 1_555 C DC 1 1_555 -0.775 -1.333 3.518 -4.177 7.719 35.481 -3.244 0.633  3.234 12.433 6.727   
36.516 6 TT_DC8DG9:DC1DG2_PP T 8 ? P 2 ? T 9 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 GLYCEROL       GOL 
6 'CHLORIDE ION' CL  
7 'SODIUM ION'   NA  
8 water          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 GOL 1   501  1   GOL GOL A . 
F 6 CL  1   502  5   CL  CL  A . 
G 7 NA  1   503  2   NA  NA  A . 
H 7 NA  1   504  3   NA  NA  A . 
I 6 CL  1   505  4   CL  CL  A . 
J 8 HOH 1   601  2   HOH HOH A . 
J 8 HOH 2   602  3   HOH HOH A . 
J 8 HOH 3   603  4   HOH HOH A . 
J 8 HOH 4   604  7   HOH HOH A . 
J 8 HOH 5   605  10  HOH HOH A . 
J 8 HOH 6   606  11  HOH HOH A . 
J 8 HOH 7   607  13  HOH HOH A . 
J 8 HOH 8   608  14  HOH HOH A . 
J 8 HOH 9   609  15  HOH HOH A . 
J 8 HOH 10  610  16  HOH HOH A . 
J 8 HOH 11  611  17  HOH HOH A . 
J 8 HOH 12  612  18  HOH HOH A . 
J 8 HOH 13  613  20  HOH HOH A . 
J 8 HOH 14  614  21  HOH HOH A . 
J 8 HOH 15  615  24  HOH HOH A . 
J 8 HOH 16  616  25  HOH HOH A . 
J 8 HOH 17  617  26  HOH HOH A . 
J 8 HOH 18  618  27  HOH HOH A . 
J 8 HOH 19  619  28  HOH HOH A . 
J 8 HOH 20  620  29  HOH HOH A . 
J 8 HOH 21  621  31  HOH HOH A . 
J 8 HOH 22  622  32  HOH HOH A . 
J 8 HOH 23  623  33  HOH HOH A . 
J 8 HOH 24  624  35  HOH HOH A . 
J 8 HOH 25  625  36  HOH HOH A . 
J 8 HOH 26  626  37  HOH HOH A . 
J 8 HOH 27  627  38  HOH HOH A . 
J 8 HOH 28  628  39  HOH HOH A . 
J 8 HOH 29  629  40  HOH HOH A . 
J 8 HOH 30  630  41  HOH HOH A . 
J 8 HOH 31  631  42  HOH HOH A . 
J 8 HOH 32  632  43  HOH HOH A . 
J 8 HOH 33  633  44  HOH HOH A . 
J 8 HOH 34  634  45  HOH HOH A . 
J 8 HOH 35  635  46  HOH HOH A . 
J 8 HOH 36  636  47  HOH HOH A . 
J 8 HOH 37  637  48  HOH HOH A . 
J 8 HOH 38  638  49  HOH HOH A . 
J 8 HOH 39  639  50  HOH HOH A . 
J 8 HOH 40  640  51  HOH HOH A . 
J 8 HOH 41  641  52  HOH HOH A . 
J 8 HOH 42  642  53  HOH HOH A . 
J 8 HOH 43  643  54  HOH HOH A . 
J 8 HOH 44  644  55  HOH HOH A . 
J 8 HOH 45  645  56  HOH HOH A . 
J 8 HOH 46  646  57  HOH HOH A . 
J 8 HOH 47  647  58  HOH HOH A . 
J 8 HOH 48  648  60  HOH HOH A . 
J 8 HOH 49  649  62  HOH HOH A . 
J 8 HOH 50  650  63  HOH HOH A . 
J 8 HOH 51  651  64  HOH HOH A . 
J 8 HOH 52  652  66  HOH HOH A . 
J 8 HOH 53  653  67  HOH HOH A . 
J 8 HOH 54  654  68  HOH HOH A . 
J 8 HOH 55  655  71  HOH HOH A . 
J 8 HOH 56  656  72  HOH HOH A . 
J 8 HOH 57  657  73  HOH HOH A . 
J 8 HOH 58  658  74  HOH HOH A . 
J 8 HOH 59  659  75  HOH HOH A . 
J 8 HOH 60  660  76  HOH HOH A . 
J 8 HOH 61  661  77  HOH HOH A . 
J 8 HOH 62  662  79  HOH HOH A . 
J 8 HOH 63  663  80  HOH HOH A . 
J 8 HOH 64  664  81  HOH HOH A . 
J 8 HOH 65  665  82  HOH HOH A . 
J 8 HOH 66  666  83  HOH HOH A . 
J 8 HOH 67  667  84  HOH HOH A . 
J 8 HOH 68  668  86  HOH HOH A . 
J 8 HOH 69  669  87  HOH HOH A . 
J 8 HOH 70  670  88  HOH HOH A . 
J 8 HOH 71  671  89  HOH HOH A . 
J 8 HOH 72  672  90  HOH HOH A . 
J 8 HOH 73  673  91  HOH HOH A . 
J 8 HOH 74  674  92  HOH HOH A . 
J 8 HOH 75  675  93  HOH HOH A . 
J 8 HOH 76  676  94  HOH HOH A . 
J 8 HOH 77  677  95  HOH HOH A . 
J 8 HOH 78  678  97  HOH HOH A . 
J 8 HOH 79  679  99  HOH HOH A . 
J 8 HOH 80  680  100 HOH HOH A . 
J 8 HOH 81  681  101 HOH HOH A . 
J 8 HOH 82  682  102 HOH HOH A . 
J 8 HOH 83  683  103 HOH HOH A . 
J 8 HOH 84  684  104 HOH HOH A . 
J 8 HOH 85  685  105 HOH HOH A . 
J 8 HOH 86  686  107 HOH HOH A . 
J 8 HOH 87  687  108 HOH HOH A . 
J 8 HOH 88  688  112 HOH HOH A . 
J 8 HOH 89  689  113 HOH HOH A . 
J 8 HOH 90  690  114 HOH HOH A . 
J 8 HOH 91  691  117 HOH HOH A . 
J 8 HOH 92  692  119 HOH HOH A . 
J 8 HOH 93  693  120 HOH HOH A . 
J 8 HOH 94  694  122 HOH HOH A . 
J 8 HOH 95  695  123 HOH HOH A . 
J 8 HOH 96  696  124 HOH HOH A . 
J 8 HOH 97  697  125 HOH HOH A . 
J 8 HOH 98  698  126 HOH HOH A . 
J 8 HOH 99  699  127 HOH HOH A . 
J 8 HOH 100 700  128 HOH HOH A . 
J 8 HOH 101 701  129 HOH HOH A . 
J 8 HOH 102 702  130 HOH HOH A . 
J 8 HOH 103 703  131 HOH HOH A . 
J 8 HOH 104 704  133 HOH HOH A . 
J 8 HOH 105 705  135 HOH HOH A . 
J 8 HOH 106 706  136 HOH HOH A . 
J 8 HOH 107 707  137 HOH HOH A . 
J 8 HOH 108 708  138 HOH HOH A . 
J 8 HOH 109 709  139 HOH HOH A . 
J 8 HOH 110 710  141 HOH HOH A . 
J 8 HOH 111 711  142 HOH HOH A . 
J 8 HOH 112 712  143 HOH HOH A . 
J 8 HOH 113 713  145 HOH HOH A . 
J 8 HOH 114 714  146 HOH HOH A . 
J 8 HOH 115 715  147 HOH HOH A . 
J 8 HOH 116 716  148 HOH HOH A . 
J 8 HOH 117 717  151 HOH HOH A . 
J 8 HOH 118 718  152 HOH HOH A . 
J 8 HOH 119 719  153 HOH HOH A . 
J 8 HOH 120 720  154 HOH HOH A . 
J 8 HOH 121 721  156 HOH HOH A . 
J 8 HOH 122 722  157 HOH HOH A . 
J 8 HOH 123 723  158 HOH HOH A . 
J 8 HOH 124 724  159 HOH HOH A . 
J 8 HOH 125 725  160 HOH HOH A . 
J 8 HOH 126 726  161 HOH HOH A . 
J 8 HOH 127 727  162 HOH HOH A . 
J 8 HOH 128 728  163 HOH HOH A . 
J 8 HOH 129 729  164 HOH HOH A . 
J 8 HOH 130 730  165 HOH HOH A . 
J 8 HOH 131 731  166 HOH HOH A . 
J 8 HOH 132 732  167 HOH HOH A . 
J 8 HOH 133 733  168 HOH HOH A . 
J 8 HOH 134 734  170 HOH HOH A . 
J 8 HOH 135 735  171 HOH HOH A . 
J 8 HOH 136 736  174 HOH HOH A . 
J 8 HOH 137 737  176 HOH HOH A . 
J 8 HOH 138 738  177 HOH HOH A . 
J 8 HOH 139 739  179 HOH HOH A . 
J 8 HOH 140 740  182 HOH HOH A . 
J 8 HOH 141 741  183 HOH HOH A . 
J 8 HOH 142 742  184 HOH HOH A . 
J 8 HOH 143 743  185 HOH HOH A . 
J 8 HOH 144 744  186 HOH HOH A . 
J 8 HOH 145 745  188 HOH HOH A . 
J 8 HOH 146 746  189 HOH HOH A . 
J 8 HOH 147 747  191 HOH HOH A . 
J 8 HOH 148 748  192 HOH HOH A . 
J 8 HOH 149 749  194 HOH HOH A . 
J 8 HOH 150 750  195 HOH HOH A . 
J 8 HOH 151 751  197 HOH HOH A . 
J 8 HOH 152 752  198 HOH HOH A . 
J 8 HOH 153 753  199 HOH HOH A . 
J 8 HOH 154 754  200 HOH HOH A . 
J 8 HOH 155 755  201 HOH HOH A . 
J 8 HOH 156 756  203 HOH HOH A . 
J 8 HOH 157 757  204 HOH HOH A . 
J 8 HOH 158 758  205 HOH HOH A . 
J 8 HOH 159 759  207 HOH HOH A . 
J 8 HOH 160 760  209 HOH HOH A . 
J 8 HOH 161 761  210 HOH HOH A . 
J 8 HOH 162 762  214 HOH HOH A . 
J 8 HOH 163 763  215 HOH HOH A . 
J 8 HOH 164 764  216 HOH HOH A . 
J 8 HOH 165 765  217 HOH HOH A . 
J 8 HOH 166 766  218 HOH HOH A . 
J 8 HOH 167 767  219 HOH HOH A . 
J 8 HOH 168 768  220 HOH HOH A . 
J 8 HOH 169 769  221 HOH HOH A . 
J 8 HOH 170 770  222 HOH HOH A . 
J 8 HOH 171 771  223 HOH HOH A . 
J 8 HOH 172 772  225 HOH HOH A . 
J 8 HOH 173 773  226 HOH HOH A . 
J 8 HOH 174 774  227 HOH HOH A . 
J 8 HOH 175 775  228 HOH HOH A . 
J 8 HOH 176 776  229 HOH HOH A . 
J 8 HOH 177 777  230 HOH HOH A . 
J 8 HOH 178 778  231 HOH HOH A . 
J 8 HOH 179 779  232 HOH HOH A . 
J 8 HOH 180 780  234 HOH HOH A . 
J 8 HOH 181 781  235 HOH HOH A . 
J 8 HOH 182 782  236 HOH HOH A . 
J 8 HOH 183 783  237 HOH HOH A . 
J 8 HOH 184 784  238 HOH HOH A . 
J 8 HOH 185 785  242 HOH HOH A . 
J 8 HOH 186 786  243 HOH HOH A . 
J 8 HOH 187 787  245 HOH HOH A . 
J 8 HOH 188 788  246 HOH HOH A . 
J 8 HOH 189 789  247 HOH HOH A . 
J 8 HOH 190 790  249 HOH HOH A . 
J 8 HOH 191 791  253 HOH HOH A . 
J 8 HOH 192 792  254 HOH HOH A . 
J 8 HOH 193 793  255 HOH HOH A . 
J 8 HOH 194 794  256 HOH HOH A . 
J 8 HOH 195 795  257 HOH HOH A . 
J 8 HOH 196 796  258 HOH HOH A . 
J 8 HOH 197 797  259 HOH HOH A . 
J 8 HOH 198 798  260 HOH HOH A . 
J 8 HOH 199 799  261 HOH HOH A . 
J 8 HOH 200 800  263 HOH HOH A . 
J 8 HOH 201 801  264 HOH HOH A . 
J 8 HOH 202 802  265 HOH HOH A . 
J 8 HOH 203 803  266 HOH HOH A . 
J 8 HOH 204 804  267 HOH HOH A . 
J 8 HOH 205 805  268 HOH HOH A . 
J 8 HOH 206 806  270 HOH HOH A . 
J 8 HOH 207 807  271 HOH HOH A . 
J 8 HOH 208 808  273 HOH HOH A . 
J 8 HOH 209 809  274 HOH HOH A . 
J 8 HOH 210 810  275 HOH HOH A . 
J 8 HOH 211 811  278 HOH HOH A . 
J 8 HOH 212 812  279 HOH HOH A . 
J 8 HOH 213 813  281 HOH HOH A . 
J 8 HOH 214 814  282 HOH HOH A . 
J 8 HOH 215 815  283 HOH HOH A . 
J 8 HOH 216 816  284 HOH HOH A . 
J 8 HOH 217 817  285 HOH HOH A . 
J 8 HOH 218 818  286 HOH HOH A . 
J 8 HOH 219 819  287 HOH HOH A . 
J 8 HOH 220 820  288 HOH HOH A . 
J 8 HOH 221 821  289 HOH HOH A . 
J 8 HOH 222 822  290 HOH HOH A . 
J 8 HOH 223 823  291 HOH HOH A . 
J 8 HOH 224 824  293 HOH HOH A . 
J 8 HOH 225 825  294 HOH HOH A . 
J 8 HOH 226 826  295 HOH HOH A . 
J 8 HOH 227 827  296 HOH HOH A . 
J 8 HOH 228 828  297 HOH HOH A . 
J 8 HOH 229 829  298 HOH HOH A . 
J 8 HOH 230 830  299 HOH HOH A . 
J 8 HOH 231 831  303 HOH HOH A . 
J 8 HOH 232 832  304 HOH HOH A . 
J 8 HOH 233 833  307 HOH HOH A . 
J 8 HOH 234 834  308 HOH HOH A . 
J 8 HOH 235 835  310 HOH HOH A . 
J 8 HOH 236 836  311 HOH HOH A . 
J 8 HOH 237 837  313 HOH HOH A . 
J 8 HOH 238 838  316 HOH HOH A . 
J 8 HOH 239 839  319 HOH HOH A . 
J 8 HOH 240 840  320 HOH HOH A . 
J 8 HOH 241 841  321 HOH HOH A . 
J 8 HOH 242 842  322 HOH HOH A . 
J 8 HOH 243 843  323 HOH HOH A . 
J 8 HOH 244 844  325 HOH HOH A . 
J 8 HOH 245 845  326 HOH HOH A . 
J 8 HOH 246 846  327 HOH HOH A . 
J 8 HOH 247 847  328 HOH HOH A . 
J 8 HOH 248 848  329 HOH HOH A . 
J 8 HOH 249 849  331 HOH HOH A . 
J 8 HOH 250 850  332 HOH HOH A . 
J 8 HOH 251 851  334 HOH HOH A . 
J 8 HOH 252 852  335 HOH HOH A . 
J 8 HOH 253 853  336 HOH HOH A . 
J 8 HOH 254 854  337 HOH HOH A . 
J 8 HOH 255 855  338 HOH HOH A . 
J 8 HOH 256 856  339 HOH HOH A . 
J 8 HOH 257 857  340 HOH HOH A . 
J 8 HOH 258 858  341 HOH HOH A . 
J 8 HOH 259 859  342 HOH HOH A . 
J 8 HOH 260 860  343 HOH HOH A . 
J 8 HOH 261 861  344 HOH HOH A . 
J 8 HOH 262 862  345 HOH HOH A . 
J 8 HOH 263 863  346 HOH HOH A . 
J 8 HOH 264 864  349 HOH HOH A . 
J 8 HOH 265 865  350 HOH HOH A . 
J 8 HOH 266 866  352 HOH HOH A . 
J 8 HOH 267 867  353 HOH HOH A . 
J 8 HOH 268 868  354 HOH HOH A . 
J 8 HOH 269 869  355 HOH HOH A . 
J 8 HOH 270 870  357 HOH HOH A . 
J 8 HOH 271 871  358 HOH HOH A . 
J 8 HOH 272 872  359 HOH HOH A . 
J 8 HOH 273 873  361 HOH HOH A . 
J 8 HOH 274 874  363 HOH HOH A . 
J 8 HOH 275 875  364 HOH HOH A . 
J 8 HOH 276 876  365 HOH HOH A . 
J 8 HOH 277 877  367 HOH HOH A . 
J 8 HOH 278 878  369 HOH HOH A . 
J 8 HOH 279 879  370 HOH HOH A . 
J 8 HOH 280 880  371 HOH HOH A . 
J 8 HOH 281 881  373 HOH HOH A . 
J 8 HOH 282 882  374 HOH HOH A . 
J 8 HOH 283 883  375 HOH HOH A . 
J 8 HOH 284 884  376 HOH HOH A . 
J 8 HOH 285 885  377 HOH HOH A . 
J 8 HOH 286 886  381 HOH HOH A . 
J 8 HOH 287 887  382 HOH HOH A . 
J 8 HOH 288 888  383 HOH HOH A . 
J 8 HOH 289 889  384 HOH HOH A . 
J 8 HOH 290 890  385 HOH HOH A . 
J 8 HOH 291 891  386 HOH HOH A . 
J 8 HOH 292 892  387 HOH HOH A . 
J 8 HOH 293 893  389 HOH HOH A . 
J 8 HOH 294 894  390 HOH HOH A . 
J 8 HOH 295 895  391 HOH HOH A . 
J 8 HOH 296 896  392 HOH HOH A . 
J 8 HOH 297 897  393 HOH HOH A . 
J 8 HOH 298 898  395 HOH HOH A . 
J 8 HOH 299 899  396 HOH HOH A . 
J 8 HOH 300 900  397 HOH HOH A . 
J 8 HOH 301 901  398 HOH HOH A . 
J 8 HOH 302 902  399 HOH HOH A . 
J 8 HOH 303 903  400 HOH HOH A . 
J 8 HOH 304 904  402 HOH HOH A . 
J 8 HOH 305 905  403 HOH HOH A . 
J 8 HOH 306 906  404 HOH HOH A . 
J 8 HOH 307 907  405 HOH HOH A . 
J 8 HOH 308 908  409 HOH HOH A . 
J 8 HOH 309 909  410 HOH HOH A . 
J 8 HOH 310 910  412 HOH HOH A . 
J 8 HOH 311 911  413 HOH HOH A . 
J 8 HOH 312 912  417 HOH HOH A . 
J 8 HOH 313 913  418 HOH HOH A . 
J 8 HOH 314 914  419 HOH HOH A . 
J 8 HOH 315 915  421 HOH HOH A . 
J 8 HOH 316 916  422 HOH HOH A . 
J 8 HOH 317 917  425 HOH HOH A . 
J 8 HOH 318 918  426 HOH HOH A . 
J 8 HOH 319 919  427 HOH HOH A . 
J 8 HOH 320 920  429 HOH HOH A . 
J 8 HOH 321 921  431 HOH HOH A . 
J 8 HOH 322 922  438 HOH HOH A . 
J 8 HOH 323 923  440 HOH HOH A . 
J 8 HOH 324 924  441 HOH HOH A . 
J 8 HOH 325 925  442 HOH HOH A . 
J 8 HOH 326 926  446 HOH HOH A . 
J 8 HOH 327 927  447 HOH HOH A . 
J 8 HOH 328 928  448 HOH HOH A . 
J 8 HOH 329 929  452 HOH HOH A . 
J 8 HOH 330 930  454 HOH HOH A . 
J 8 HOH 331 931  455 HOH HOH A . 
J 8 HOH 332 932  456 HOH HOH A . 
J 8 HOH 333 933  459 HOH HOH A . 
J 8 HOH 334 934  460 HOH HOH A . 
J 8 HOH 335 935  462 HOH HOH A . 
J 8 HOH 336 936  464 HOH HOH A . 
J 8 HOH 337 937  466 HOH HOH A . 
J 8 HOH 338 938  467 HOH HOH A . 
J 8 HOH 339 939  468 HOH HOH A . 
J 8 HOH 340 940  469 HOH HOH A . 
J 8 HOH 341 941  473 HOH HOH A . 
J 8 HOH 342 942  474 HOH HOH A . 
J 8 HOH 343 943  475 HOH HOH A . 
J 8 HOH 344 944  477 HOH HOH A . 
J 8 HOH 345 945  479 HOH HOH A . 
J 8 HOH 346 946  480 HOH HOH A . 
J 8 HOH 347 947  481 HOH HOH A . 
J 8 HOH 348 948  482 HOH HOH A . 
J 8 HOH 349 949  483 HOH HOH A . 
J 8 HOH 350 950  484 HOH HOH A . 
J 8 HOH 351 951  485 HOH HOH A . 
J 8 HOH 352 952  486 HOH HOH A . 
J 8 HOH 353 953  487 HOH HOH A . 
J 8 HOH 354 954  488 HOH HOH A . 
J 8 HOH 355 955  491 HOH HOH A . 
J 8 HOH 356 956  492 HOH HOH A . 
J 8 HOH 357 957  493 HOH HOH A . 
J 8 HOH 358 958  494 HOH HOH A . 
J 8 HOH 359 959  497 HOH HOH A . 
J 8 HOH 360 960  498 HOH HOH A . 
J 8 HOH 361 961  501 HOH HOH A . 
J 8 HOH 362 962  502 HOH HOH A . 
J 8 HOH 363 963  504 HOH HOH A . 
J 8 HOH 364 964  508 HOH HOH A . 
J 8 HOH 365 965  509 HOH HOH A . 
J 8 HOH 366 966  510 HOH HOH A . 
J 8 HOH 367 967  511 HOH HOH A . 
J 8 HOH 368 968  512 HOH HOH A . 
J 8 HOH 369 969  514 HOH HOH A . 
J 8 HOH 370 970  517 HOH HOH A . 
J 8 HOH 371 971  518 HOH HOH A . 
J 8 HOH 372 972  519 HOH HOH A . 
J 8 HOH 373 973  520 HOH HOH A . 
J 8 HOH 374 974  522 HOH HOH A . 
J 8 HOH 375 975  523 HOH HOH A . 
J 8 HOH 376 976  524 HOH HOH A . 
J 8 HOH 377 977  525 HOH HOH A . 
J 8 HOH 378 978  526 HOH HOH A . 
J 8 HOH 379 979  527 HOH HOH A . 
J 8 HOH 380 980  528 HOH HOH A . 
J 8 HOH 381 981  529 HOH HOH A . 
J 8 HOH 382 982  531 HOH HOH A . 
J 8 HOH 383 983  536 HOH HOH A . 
J 8 HOH 384 984  538 HOH HOH A . 
J 8 HOH 385 985  539 HOH HOH A . 
J 8 HOH 386 986  541 HOH HOH A . 
J 8 HOH 387 987  543 HOH HOH A . 
J 8 HOH 388 988  545 HOH HOH A . 
J 8 HOH 389 989  546 HOH HOH A . 
J 8 HOH 390 990  547 HOH HOH A . 
J 8 HOH 391 991  550 HOH HOH A . 
J 8 HOH 392 992  551 HOH HOH A . 
J 8 HOH 393 993  552 HOH HOH A . 
J 8 HOH 394 994  556 HOH HOH A . 
J 8 HOH 395 995  559 HOH HOH A . 
J 8 HOH 396 996  560 HOH HOH A . 
J 8 HOH 397 997  561 HOH HOH A . 
J 8 HOH 398 998  562 HOH HOH A . 
J 8 HOH 399 999  563 HOH HOH A . 
J 8 HOH 400 1000 564 HOH HOH A . 
J 8 HOH 401 1001 565 HOH HOH A . 
J 8 HOH 402 1002 567 HOH HOH A . 
J 8 HOH 403 1003 568 HOH HOH A . 
J 8 HOH 404 1004 569 HOH HOH A . 
J 8 HOH 405 1005 570 HOH HOH A . 
J 8 HOH 406 1006 571 HOH HOH A . 
J 8 HOH 407 1007 573 HOH HOH A . 
J 8 HOH 408 1008 574 HOH HOH A . 
J 8 HOH 409 1009 576 HOH HOH A . 
J 8 HOH 410 1010 577 HOH HOH A . 
J 8 HOH 411 1011 578 HOH HOH A . 
J 8 HOH 412 1012 579 HOH HOH A . 
J 8 HOH 413 1013 582 HOH HOH A . 
J 8 HOH 414 1014 584 HOH HOH A . 
J 8 HOH 415 1015 586 HOH HOH A . 
J 8 HOH 416 1016 587 HOH HOH A . 
J 8 HOH 417 1017 588 HOH HOH A . 
J 8 HOH 418 1018 589 HOH HOH A . 
J 8 HOH 419 1019 590 HOH HOH A . 
J 8 HOH 420 1020 593 HOH HOH A . 
K 8 HOH 1   101  9   HOH HOH T . 
K 8 HOH 2   102  19  HOH HOH T . 
K 8 HOH 3   103  23  HOH HOH T . 
K 8 HOH 4   104  34  HOH HOH T . 
K 8 HOH 5   105  69  HOH HOH T . 
K 8 HOH 6   106  109 HOH HOH T . 
K 8 HOH 7   107  110 HOH HOH T . 
K 8 HOH 8   108  111 HOH HOH T . 
K 8 HOH 9   109  115 HOH HOH T . 
K 8 HOH 10  110  116 HOH HOH T . 
K 8 HOH 11  111  121 HOH HOH T . 
K 8 HOH 12  112  169 HOH HOH T . 
K 8 HOH 13  113  172 HOH HOH T . 
K 8 HOH 14  114  173 HOH HOH T . 
K 8 HOH 15  115  175 HOH HOH T . 
K 8 HOH 16  116  181 HOH HOH T . 
K 8 HOH 17  117  187 HOH HOH T . 
K 8 HOH 18  118  193 HOH HOH T . 
K 8 HOH 19  119  196 HOH HOH T . 
K 8 HOH 20  120  208 HOH HOH T . 
K 8 HOH 21  121  211 HOH HOH T . 
K 8 HOH 22  122  212 HOH HOH T . 
K 8 HOH 23  123  213 HOH HOH T . 
K 8 HOH 24  124  224 HOH HOH T . 
K 8 HOH 25  125  239 HOH HOH T . 
K 8 HOH 26  126  244 HOH HOH T . 
K 8 HOH 27  127  262 HOH HOH T . 
K 8 HOH 28  128  280 HOH HOH T . 
K 8 HOH 29  129  292 HOH HOH T . 
K 8 HOH 30  130  305 HOH HOH T . 
K 8 HOH 31  131  306 HOH HOH T . 
K 8 HOH 32  132  317 HOH HOH T . 
K 8 HOH 33  133  348 HOH HOH T . 
K 8 HOH 34  134  356 HOH HOH T . 
K 8 HOH 35  135  368 HOH HOH T . 
K 8 HOH 36  136  401 HOH HOH T . 
K 8 HOH 37  137  407 HOH HOH T . 
K 8 HOH 38  138  411 HOH HOH T . 
K 8 HOH 39  139  415 HOH HOH T . 
K 8 HOH 40  140  420 HOH HOH T . 
K 8 HOH 41  141  424 HOH HOH T . 
K 8 HOH 42  142  433 HOH HOH T . 
K 8 HOH 43  143  434 HOH HOH T . 
K 8 HOH 44  144  449 HOH HOH T . 
K 8 HOH 45  145  453 HOH HOH T . 
K 8 HOH 46  146  457 HOH HOH T . 
K 8 HOH 47  147  465 HOH HOH T . 
K 8 HOH 48  148  506 HOH HOH T . 
K 8 HOH 49  149  534 HOH HOH T . 
K 8 HOH 50  150  555 HOH HOH T . 
K 8 HOH 51  151  566 HOH HOH T . 
K 8 HOH 52  152  575 HOH HOH T . 
L 8 HOH 1   101  30  HOH HOH P . 
L 8 HOH 2   102  59  HOH HOH P . 
L 8 HOH 3   103  61  HOH HOH P . 
L 8 HOH 4   104  65  HOH HOH P . 
L 8 HOH 5   105  70  HOH HOH P . 
L 8 HOH 6   106  78  HOH HOH P . 
L 8 HOH 7   107  132 HOH HOH P . 
L 8 HOH 8   108  144 HOH HOH P . 
L 8 HOH 9   109  150 HOH HOH P . 
L 8 HOH 10  110  155 HOH HOH P . 
L 8 HOH 11  111  180 HOH HOH P . 
L 8 HOH 12  112  202 HOH HOH P . 
L 8 HOH 13  113  276 HOH HOH P . 
L 8 HOH 14  114  300 HOH HOH P . 
L 8 HOH 15  115  309 HOH HOH P . 
L 8 HOH 16  116  347 HOH HOH P . 
L 8 HOH 17  117  378 HOH HOH P . 
L 8 HOH 18  118  414 HOH HOH P . 
L 8 HOH 19  119  423 HOH HOH P . 
L 8 HOH 20  120  435 HOH HOH P . 
L 8 HOH 21  121  505 HOH HOH P . 
M 8 HOH 1   101  85  HOH HOH D . 
M 8 HOH 2   102  106 HOH HOH D . 
M 8 HOH 3   103  118 HOH HOH D . 
M 8 HOH 4   104  134 HOH HOH D . 
M 8 HOH 5   105  140 HOH HOH D . 
M 8 HOH 6   106  178 HOH HOH D . 
M 8 HOH 7   107  190 HOH HOH D . 
M 8 HOH 8   108  233 HOH HOH D . 
M 8 HOH 9   109  250 HOH HOH D . 
M 8 HOH 10  110  252 HOH HOH D . 
M 8 HOH 11  111  272 HOH HOH D . 
M 8 HOH 12  112  301 HOH HOH D . 
M 8 HOH 13  113  315 HOH HOH D . 
M 8 HOH 14  114  324 HOH HOH D . 
M 8 HOH 15  115  461 HOH HOH D . 
M 8 HOH 16  116  507 HOH HOH D . 
M 8 HOH 17  117  580 HOH HOH D . 
M 8 HOH 18  118  581 HOH HOH D . 
M 8 HOH 19  119  585 HOH HOH D . 
M 8 HOH 20  120  591 HOH HOH D . 
#