data_4M04
# 
_entry.id   4M04 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4M04         
NDB   NA2650       
RCSB  RCSB081297   
WWPDB D_1000081297 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2IHM . unspecified 
PDB 4LZD . unspecified 
PDB 4LZG . unspecified 
PDB 4M0A . unspecified 
# 
_pdbx_database_status.entry_id                        4M04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-08-01 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Moon, A.F.'     1 
'Pryor, J.M.'    2 
'Ramsden, D.A.'  3 
'Kunkel, T.A.'   4 
'Bebenek, K.'    5 
'Pedersen, L.C.' 6 
# 
_citation.id                        primary 
_citation.title                     'Sustained active site rigidity during synthesis by human DNA polymerase mu.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            21 
_citation.page_first                253 
_citation.page_last                 260 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24487959 
_citation.pdbx_database_id_DOI      10.1038/nsmb.2766 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Moon, A.F.'     1 
primary 'Pryor, J.M.'    2 
primary 'Ramsden, D.A.'  3 
primary 'Kunkel, T.A.'   4 
primary 'Bebenek, K.'    5 
primary 'Pedersen, L.C.' 6 
# 
_cell.length_a           59.892 
_cell.length_b           68.467 
_cell.length_c           109.773 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4M04 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         4M04 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA-directed DNA/RNA polymerase mu'                  40054.434 1   2.7.7.7 ? 
'Polymerase Mu Loop2 deletion variant, UNP residues 132-494' ? 
2  polymer     syn 'template strand'                                     2740.812  1   ?       ? ? ? 
3  polymer     syn 'upstream primer strand'                              1190.830  1   ?       ? ? ? 
4  polymer     syn 'downstream primer strand'                            1191.818  1   ?       ? ? ? 
5  non-polymer syn 
;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE
;
467.157   1   ?       ? ?                                                            ? 
6  non-polymer syn 'MAGNESIUM ION'                                       24.305    2   ?       ? ? ? 
7  non-polymer syn 1,2-ETHANEDIOL                                        62.068    3   ?       ? ? ? 
8  non-polymer syn 'CHLORIDE ION'                                        35.453    1   ?       ? ? ? 
9  non-polymer syn 'SODIUM ION'                                          22.990    1   ?       ? ? ? 
10 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305   1   ?       ? ? ? 
11 water       nat water                                                 18.015    381 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol Mu, Terminal transferase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSAAAPLSPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFG
EHSSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDL
STPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQ
HSCCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNS
HGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
;GSAAAPLSPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFG
EHSSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDL
STPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQ
HSCCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNS
HGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DG)(DG)(DC)(DA)(DT)(DA)(DC)(DG)' CGGCATACG T ? 
3 polydeoxyribonucleotide no no '(DC)(DG)(DT)(DA)' CGTA P ? 
4 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DG)' GCCG D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ALA n 
1 4   ALA n 
1 5   ALA n 
1 6   PRO n 
1 7   LEU n 
1 8   SER n 
1 9   PRO n 
1 10  ALA n 
1 11  TRP n 
1 12  MET n 
1 13  PRO n 
1 14  ALA n 
1 15  TYR n 
1 16  ALA n 
1 17  CYS n 
1 18  GLN n 
1 19  ARG n 
1 20  PRO n 
1 21  THR n 
1 22  PRO n 
1 23  LEU n 
1 24  THR n 
1 25  HIS n 
1 26  HIS n 
1 27  ASN n 
1 28  THR n 
1 29  GLY n 
1 30  LEU n 
1 31  SER n 
1 32  GLU n 
1 33  ALA n 
1 34  LEU n 
1 35  GLU n 
1 36  ILE n 
1 37  LEU n 
1 38  ALA n 
1 39  GLU n 
1 40  ALA n 
1 41  ALA n 
1 42  GLY n 
1 43  PHE n 
1 44  GLU n 
1 45  GLY n 
1 46  SER n 
1 47  GLU n 
1 48  GLY n 
1 49  ARG n 
1 50  LEU n 
1 51  LEU n 
1 52  THR n 
1 53  PHE n 
1 54  CYS n 
1 55  ARG n 
1 56  ALA n 
1 57  ALA n 
1 58  SER n 
1 59  VAL n 
1 60  LEU n 
1 61  LYS n 
1 62  ALA n 
1 63  LEU n 
1 64  PRO n 
1 65  SER n 
1 66  PRO n 
1 67  VAL n 
1 68  THR n 
1 69  THR n 
1 70  LEU n 
1 71  SER n 
1 72  GLN n 
1 73  LEU n 
1 74  GLN n 
1 75  GLY n 
1 76  LEU n 
1 77  PRO n 
1 78  HIS n 
1 79  PHE n 
1 80  GLY n 
1 81  GLU n 
1 82  HIS n 
1 83  SER n 
1 84  SER n 
1 85  ARG n 
1 86  VAL n 
1 87  VAL n 
1 88  GLN n 
1 89  GLU n 
1 90  LEU n 
1 91  LEU n 
1 92  GLU n 
1 93  HIS n 
1 94  GLY n 
1 95  VAL n 
1 96  CYS n 
1 97  GLU n 
1 98  GLU n 
1 99  VAL n 
1 100 GLU n 
1 101 ARG n 
1 102 VAL n 
1 103 ARG n 
1 104 ARG n 
1 105 SER n 
1 106 GLU n 
1 107 ARG n 
1 108 TYR n 
1 109 GLN n 
1 110 THR n 
1 111 MET n 
1 112 LYS n 
1 113 LEU n 
1 114 PHE n 
1 115 THR n 
1 116 GLN n 
1 117 ILE n 
1 118 PHE n 
1 119 GLY n 
1 120 VAL n 
1 121 GLY n 
1 122 VAL n 
1 123 LYS n 
1 124 THR n 
1 125 ALA n 
1 126 ASP n 
1 127 ARG n 
1 128 TRP n 
1 129 TYR n 
1 130 ARG n 
1 131 GLU n 
1 132 GLY n 
1 133 LEU n 
1 134 ARG n 
1 135 THR n 
1 136 LEU n 
1 137 ASP n 
1 138 ASP n 
1 139 LEU n 
1 140 ARG n 
1 141 GLU n 
1 142 GLN n 
1 143 PRO n 
1 144 GLN n 
1 145 LYS n 
1 146 LEU n 
1 147 THR n 
1 148 GLN n 
1 149 GLN n 
1 150 GLN n 
1 151 LYS n 
1 152 ALA n 
1 153 GLY n 
1 154 LEU n 
1 155 GLN n 
1 156 HIS n 
1 157 HIS n 
1 158 GLN n 
1 159 ASP n 
1 160 LEU n 
1 161 SER n 
1 162 THR n 
1 163 PRO n 
1 164 VAL n 
1 165 LEU n 
1 166 ARG n 
1 167 SER n 
1 168 ASP n 
1 169 VAL n 
1 170 ASP n 
1 171 ALA n 
1 172 LEU n 
1 173 GLN n 
1 174 GLN n 
1 175 VAL n 
1 176 VAL n 
1 177 GLU n 
1 178 GLU n 
1 179 ALA n 
1 180 VAL n 
1 181 GLY n 
1 182 GLN n 
1 183 ALA n 
1 184 LEU n 
1 185 PRO n 
1 186 GLY n 
1 187 ALA n 
1 188 THR n 
1 189 VAL n 
1 190 THR n 
1 191 LEU n 
1 192 THR n 
1 193 GLY n 
1 194 GLY n 
1 195 PHE n 
1 196 ARG n 
1 197 ARG n 
1 198 GLY n 
1 199 LYS n 
1 200 LEU n 
1 201 GLN n 
1 202 GLY n 
1 203 HIS n 
1 204 ASP n 
1 205 VAL n 
1 206 ASP n 
1 207 PHE n 
1 208 LEU n 
1 209 ILE n 
1 210 THR n 
1 211 HIS n 
1 212 PRO n 
1 213 LYS n 
1 214 GLU n 
1 215 GLY n 
1 216 GLN n 
1 217 GLU n 
1 218 ALA n 
1 219 GLY n 
1 220 LEU n 
1 221 LEU n 
1 222 PRO n 
1 223 ARG n 
1 224 VAL n 
1 225 MET n 
1 226 CYS n 
1 227 ARG n 
1 228 LEU n 
1 229 GLN n 
1 230 ASP n 
1 231 GLN n 
1 232 GLY n 
1 233 LEU n 
1 234 ILE n 
1 235 LEU n 
1 236 TYR n 
1 237 HIS n 
1 238 GLN n 
1 239 HIS n 
1 240 GLN n 
1 241 HIS n 
1 242 SER n 
1 243 CYS n 
1 244 CYS n 
1 245 GLU n 
1 246 SER n 
1 247 PRO n 
1 248 THR n 
1 249 ARG n 
1 250 LEU n 
1 251 ALA n 
1 252 GLN n 
1 253 GLN n 
1 254 SER n 
1 255 HIS n 
1 256 MET n 
1 257 ASP n 
1 258 ALA n 
1 259 PHE n 
1 260 GLU n 
1 261 ARG n 
1 262 SER n 
1 263 PHE n 
1 264 CYS n 
1 265 ILE n 
1 266 PHE n 
1 267 ARG n 
1 268 LEU n 
1 269 PRO n 
1 270 GLN n 
1 271 PRO n 
1 272 GLY n 
1 273 SER n 
1 274 TRP n 
1 275 LYS n 
1 276 ALA n 
1 277 VAL n 
1 278 ARG n 
1 279 VAL n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 VAL n 
1 284 ALA n 
1 285 PRO n 
1 286 VAL n 
1 287 SER n 
1 288 GLN n 
1 289 PHE n 
1 290 PRO n 
1 291 PHE n 
1 292 ALA n 
1 293 LEU n 
1 294 LEU n 
1 295 GLY n 
1 296 TRP n 
1 297 THR n 
1 298 GLY n 
1 299 SER n 
1 300 LYS n 
1 301 LEU n 
1 302 PHE n 
1 303 GLN n 
1 304 ARG n 
1 305 GLU n 
1 306 LEU n 
1 307 ARG n 
1 308 ARG n 
1 309 PHE n 
1 310 SER n 
1 311 ARG n 
1 312 LYS n 
1 313 GLU n 
1 314 LYS n 
1 315 GLY n 
1 316 LEU n 
1 317 TRP n 
1 318 LEU n 
1 319 ASN n 
1 320 SER n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 PHE n 
1 325 ASP n 
1 326 PRO n 
1 327 GLU n 
1 328 GLN n 
1 329 LYS n 
1 330 THR n 
1 331 PHE n 
1 332 PHE n 
1 333 GLN n 
1 334 ALA n 
1 335 ALA n 
1 336 SER n 
1 337 GLU n 
1 338 GLU n 
1 339 ASP n 
1 340 ILE n 
1 341 PHE n 
1 342 ARG n 
1 343 HIS n 
1 344 LEU n 
1 345 GLY n 
1 346 LEU n 
1 347 GLU n 
1 348 TYR n 
1 349 LEU n 
1 350 PRO n 
1 351 PRO n 
1 352 GLU n 
1 353 GLN n 
1 354 ARG n 
1 355 ASN n 
1 356 ALA n 
2 1   DC  n 
2 2   DG  n 
2 3   DG  n 
2 4   DC  n 
2 5   DA  n 
2 6   DT  n 
2 7   DA  n 
2 8   DC  n 
2 9   DG  n 
3 1   DC  n 
3 2   DG  n 
3 3   DT  n 
3 4   DA  n 
4 1   DG  n 
4 2   DC  n 
4 3   DC  n 
4 4   DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLM, polmu' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   
;Modified version of the pGEX4T3 vector backbone, where a TEV protease cleavage site has been inserted downstream of the thrombin cleavage site, and the sequence of the multicloning site has been replaced by that from the pMALX vector (Moon et al, 2010).  Three TGA stop codons have been inserted downstream of the MCS, each utilizing a different reading frame.
;
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEXM 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'synthesized by Oligos Etc' 
3 1 sample ? ? ? ? ? 'synthesized by Oligos Etc' 
4 1 sample ? ? ? ? ? 'synthesized by Oligos Etc' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOLM_HUMAN Q9NP87 1 
;PLSPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFGEHSSR
VVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLSTPVL
RSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQHSCCE
SPTRLAQQSHMDAFERSFCIFRLPQPPGAAVGGSTRPCPSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKE
KGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
132 ? 
2 PDB 4M04        4M04   2 CGGCATACG ?   ? 
3 PDB 4M04        4M04   3 CGTA ?   ? 
4 PDB 4M04        4M04   4 GCCG ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4M04 A 6 ? 356 ? Q9NP87 132 ? 494 ? 132 494 
2 2 4M04 T 1 ? 9   ? 4M04   1   ? 9   ? 1   9   
3 3 4M04 P 1 ? 4   ? 4M04   1   ? 4   ? 1   4   
4 4 4M04 D 1 ? 4   ? 4M04   1   ? 4   ? 1   4   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4M04 GLY A 1   ? UNP Q9NP87 ?   ?   'EXPRESSION TAG' 127 1  
1 4M04 SER A 2   ? UNP Q9NP87 ?   ?   'EXPRESSION TAG' 128 2  
1 4M04 ALA A 3   ? UNP Q9NP87 ?   ?   'EXPRESSION TAG' 129 3  
1 4M04 ALA A 4   ? UNP Q9NP87 ?   ?   'EXPRESSION TAG' 130 4  
1 4M04 ALA A 5   ? UNP Q9NP87 ?   ?   'EXPRESSION TAG' 131 5  
1 4M04 ?   A ?   ? UNP Q9NP87 PRO 398 DELETION         ?   6  
1 4M04 ?   A ?   ? UNP Q9NP87 GLY 399 DELETION         ?   7  
1 4M04 ?   A ?   ? UNP Q9NP87 ALA 400 DELETION         ?   8  
1 4M04 ?   A ?   ? UNP Q9NP87 ALA 401 DELETION         ?   9  
1 4M04 ?   A ?   ? UNP Q9NP87 VAL 402 DELETION         ?   10 
1 4M04 ?   A ?   ? UNP Q9NP87 GLY 403 DELETION         ?   11 
1 4M04 ?   A ?   ? UNP Q9NP87 GLY 404 DELETION         ?   12 
1 4M04 ?   A ?   ? UNP Q9NP87 SER 405 DELETION         ?   13 
1 4M04 ?   A ?   ? UNP Q9NP87 THR 406 DELETION         ?   14 
1 4M04 ?   A ?   ? UNP Q9NP87 ARG 407 DELETION         ?   15 
1 4M04 ?   A ?   ? UNP Q9NP87 PRO 408 DELETION         ?   16 
1 4M04 ?   A ?   ? UNP Q9NP87 CYS 409 DELETION         ?   17 
1 4M04 ?   A ?   ? UNP Q9NP87 PRO 410 DELETION         ?   18 
1 4M04 GLY A 272 ? UNP Q9NP87 ?   ?   INSERTION        410 19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                               ?                 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                              ?                 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                            ?                 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                       ?                 'C4 H7 N O4'       133.103 
CL  non-polymer         . 'CHLORIDE ION'                                        ?                 'Cl -1'            35.453  
CYS 'L-peptide linking' y CYSTEINE                                              ?                 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                  ?                 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                   ?                 'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                  ?                 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                          ?                 'C10 H15 N2 O8 P'  322.208 
DUP non-polymer         . 
;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE
;
?                 'C9 H16 N3 O13 P3' 467.157 
EDO non-polymer         . 1,2-ETHANEDIOL                                        'ETHYLENE GLYCOL' 'C2 H6 O2'         62.068  
EPE non-polymer         . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES             'C8 H18 N2 O4 S'   238.305 
GLN 'L-peptide linking' y GLUTAMINE                                             ?                 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                       ?                 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                               ?                 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                             ?                 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                 ?                 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                            ?                 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                               ?                 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                ?                 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                            ?                 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                       ?                 'Mg 2'             24.305  
NA  non-polymer         . 'SODIUM ION'                                          ?                 'Na 1'             22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                         ?                 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                               ?                 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                ?                 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                             ?                 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                            ?                 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                              ?                 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                ?                 'C5 H11 N O2'      117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4M04 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.49 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   50.62 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;Crystals were grown by mixing 1uL of protein/DNA mixture with 1uL mother liquor (85-90mM HEPES pH 7.5, 17-18% PEG4000), using the sitting drop vapor diffusion technique.  Crystals were then transferred to a cryoprotectant solution containing 0.1M HEPES pH 7.5, 10mM MgCl2, 50mM NaCl, 20% PEG4000, 5% glycerol, 1mM dUMPNPP in two steps.  , VAPOR DIFFUSION, SITTING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RIGAKU SATURN 92' 
_diffrn_detector.pdbx_collection_date   2012-10-08 
_diffrn_detector.details                'VariMaxHF mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     4M04 
_reflns.d_resolution_high            1.898 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   36290 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_netI_over_sigmaI        13.600 
_reflns.pdbx_chi_squared             1.023 
_reflns.pdbx_redundancy              6.200 
_reflns.percent_possible_obs         99.700 
_reflns.B_iso_Wilson_estimate        24.040 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.number_all                   36290 
_reflns.pdbx_Rsym_value              0.064 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.898 1.970  ? ? ? 0.316 ? ? 0.982 3.500 ? 3490 98.100  1  1 
1.970 2.050  ? ? ? 0.256 ? ? 1.096 3.900 ? 3558 99.400  2  1 
2.050 2.140  ? ? ? 0.197 ? ? 1.038 4.500 ? 3588 100.000 3  1 
2.140 2.250  ? ? ? 0.172 ? ? 1.071 5.300 ? 3575 100.000 4  1 
2.250 2.390  ? ? ? 0.144 ? ? 1.040 5.900 ? 3640 100.000 5  1 
2.390 2.580  ? ? ? 0.123 ? ? 1.054 6.600 ? 3604 100.000 6  1 
2.580 2.840  ? ? ? 0.104 ? ? 1.060 8.000 ? 3645 100.000 7  1 
2.840 3.250  ? ? ? 0.069 ? ? 0.980 8.200 ? 3653 100.000 8  1 
3.250 4.090  ? ? ? 0.048 ? ? 0.981 8.100 ? 3692 100.000 9  1 
4.090 50.000 ? ? ? 0.042 ? ? 0.989 7.700 ? 3845 99.300  10 1 
# 
_refine.entry_id                                 4M04 
_refine.ls_d_res_high                            1.8980 
_refine.ls_d_res_low                             23.1740 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.5200 
_refine.ls_number_reflns_obs                     36188 
_refine.ls_number_reflns_all                     36290 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1654 
_refine.ls_R_factor_R_work                       0.1639 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.1959 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.9900 
_refine.ls_number_reflns_R_free                  1805 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               15.4651 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.1800 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2IHM (molecule B)' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8651 
_refine.B_iso_max                                69.430 
_refine.B_iso_min                                1.950 
_refine.pdbx_overall_phase_error                 19.7600 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.300 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2564 
_refine_hist.pdbx_number_atoms_nucleic_acid   344 
_refine_hist.pdbx_number_atoms_ligand         56 
_refine_hist.number_atoms_solvent             381 
_refine_hist.number_atoms_total               3345 
_refine_hist.d_res_high                       1.8980 
_refine_hist.d_res_low                        23.1740 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           3232 0.010  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          4483 1.325  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     491  0.085  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      520  0.006  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 1036 12.772 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.8983 1.9496  13 97.0000  2517 . 0.2058 0.2647 . 132 . 2649 . . 'X-RAY DIFFRACTION' 
1.9496 2.0070  13 99.0000  2589 . 0.2040 0.2531 . 134 . 2723 . . 'X-RAY DIFFRACTION' 
2.0070 2.0717  13 100.0000 2621 . 0.1845 0.2657 . 139 . 2760 . . 'X-RAY DIFFRACTION' 
2.0717 2.1457  13 100.0000 2621 . 0.1677 0.2165 . 137 . 2758 . . 'X-RAY DIFFRACTION' 
2.1457 2.2316  13 100.0000 2637 . 0.1682 0.2191 . 138 . 2775 . . 'X-RAY DIFFRACTION' 
2.2316 2.3330  13 100.0000 2612 . 0.1683 0.2346 . 138 . 2750 . . 'X-RAY DIFFRACTION' 
2.3330 2.4559  13 100.0000 2641 . 0.1684 0.2141 . 139 . 2780 . . 'X-RAY DIFFRACTION' 
2.4559 2.6096  13 100.0000 2634 . 0.1786 0.1908 . 139 . 2773 . . 'X-RAY DIFFRACTION' 
2.6096 2.8108  13 100.0000 2635 . 0.1793 0.2310 . 137 . 2772 . . 'X-RAY DIFFRACTION' 
2.8108 3.0930  13 100.0000 2659 . 0.1835 0.2157 . 140 . 2799 . . 'X-RAY DIFFRACTION' 
3.0930 3.5392  13 100.0000 2687 . 0.1545 0.1574 . 140 . 2827 . . 'X-RAY DIFFRACTION' 
3.5392 4.4539  13 100.0000 2693 . 0.1331 0.1381 . 143 . 2836 . . 'X-RAY DIFFRACTION' 
4.4539 23.1762 13 100.0000 2837 . 0.1595 0.1972 . 149 . 2986 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4M04 
_struct.title                     'Human DNA Polymerase Mu ternary complex' 
_struct.pdbx_descriptor           'DNA-directed DNA/RNA polymerase mu (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4M04 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'polymerase, DNA break repair, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 6  ? 
H N N 7  ? 
I N N 7  ? 
J N N 8  ? 
K N N 9  ? 
L N N 7  ? 
M N N 10 ? 
N N N 11 ? 
O N N 11 ? 
P N N 11 ? 
Q N N 11 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 15  ? ARG A 19  ? TYR A 141 ARG A 145 5 ? 5  
HELX_P HELX_P2  2  ASN A 27  ? GLU A 44  ? ASN A 153 GLU A 170 1 ? 18 
HELX_P HELX_P3  3  SER A 46  ? ALA A 62  ? SER A 172 ALA A 188 1 ? 17 
HELX_P HELX_P4  4  THR A 69  ? GLN A 74  ? THR A 195 GLN A 200 5 ? 6  
HELX_P HELX_P5  5  GLY A 80  ? GLY A 94  ? GLY A 206 GLY A 220 1 ? 15 
HELX_P HELX_P6  6  CYS A 96  ? SER A 105 ? CYS A 222 SER A 231 1 ? 10 
HELX_P HELX_P7  7  SER A 105 ? GLN A 116 ? SER A 231 GLN A 242 1 ? 12 
HELX_P HELX_P8  8  GLY A 121 ? GLU A 131 ? GLY A 247 GLU A 257 1 ? 11 
HELX_P HELX_P9  9  THR A 135 ? GLN A 142 ? THR A 261 GLN A 268 1 ? 8  
HELX_P HELX_P10 10 PRO A 143 ? LEU A 146 ? PRO A 269 LEU A 272 5 ? 4  
HELX_P HELX_P11 11 THR A 147 ? HIS A 156 ? THR A 273 HIS A 282 1 ? 10 
HELX_P HELX_P12 12 HIS A 156 ? SER A 161 ? HIS A 282 SER A 287 1 ? 6  
HELX_P HELX_P13 13 ARG A 166 ? LEU A 184 ? ARG A 292 LEU A 310 1 ? 19 
HELX_P HELX_P14 14 THR A 192 ? ARG A 197 ? THR A 318 ARG A 323 1 ? 6  
HELX_P HELX_P15 15 GLY A 219 ? GLN A 231 ? GLY A 345 GLN A 357 1 ? 13 
HELX_P HELX_P16 16 PRO A 285 ? SER A 287 ? PRO A 423 SER A 425 5 ? 3  
HELX_P HELX_P17 17 GLN A 288 ? GLY A 298 ? GLN A 426 GLY A 436 1 ? 11 
HELX_P HELX_P18 18 SER A 299 ? GLY A 315 ? SER A 437 GLY A 453 1 ? 17 
HELX_P HELX_P19 19 SER A 336 ? LEU A 344 ? SER A 474 LEU A 482 1 ? 9  
HELX_P HELX_P20 20 PRO A 350 ? ARG A 354 ? PRO A 488 ARG A 492 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 204 OD1   ? ? ? 1_555 G MG  . MG ? ? A ASP 330 A MG  703 1_555 ? ? ? ? ? ? ?            2.025 ? 
metalc2  metalc ? ? A ASP 204 OD2   ? ? ? 1_555 F MG  . MG ? ? A ASP 330 A MG  702 1_555 ? ? ? ? ? ? ?            2.028 ? 
metalc3  metalc ? ? E DUP .   O2B   ? ? ? 1_555 G MG  . MG ? ? A DUP 701 A MG  703 1_555 ? ? ? ? ? ? ?            2.041 ? 
metalc4  metalc ? ? A ASP 206 OD1   ? ? ? 1_555 F MG  . MG ? ? A ASP 332 A MG  702 1_555 ? ? ? ? ? ? ?            2.043 ? 
metalc5  metalc ? ? A ASP 206 OD2   ? ? ? 1_555 G MG  . MG ? ? A ASP 332 A MG  703 1_555 ? ? ? ? ? ? ?            2.043 ? 
metalc6  metalc ? ? A ASP 280 OD1   ? ? ? 1_555 F MG  . MG ? ? A ASP 418 A MG  702 1_555 ? ? ? ? ? ? ?            2.048 ? 
metalc7  metalc ? ? E DUP .   O3G   ? ? ? 1_555 G MG  . MG ? ? A DUP 701 A MG  703 1_555 ? ? ? ? ? ? ?            2.075 ? 
metalc8  metalc ? ? E DUP .   O1A   ? ? ? 1_555 G MG  . MG ? ? A DUP 701 A MG  703 1_555 ? ? ? ? ? ? ?            2.126 ? 
metalc9  metalc ? ? C DA  4   "O3'" ? ? ? 1_555 F MG  . MG ? ? P DA  4   A MG  702 1_555 ? ? ? ? ? ? ?            2.132 ? 
metalc10 metalc ? ? E DUP .   O1A   ? ? ? 1_555 F MG  . MG ? ? A DUP 701 A MG  702 1_555 ? ? ? ? ? ? ?            2.301 ? 
metalc11 metalc ? ? A VAL 120 O     ? ? ? 1_555 K NA  . NA ? ? A VAL 246 A NA  707 1_555 ? ? ? ? ? ? ?            2.338 ? 
metalc12 metalc ? ? A THR 115 O     ? ? ? 1_555 K NA  . NA ? ? A THR 241 A NA  707 1_555 ? ? ? ? ? ? ?            2.349 ? 
metalc13 metalc ? ? A ILE 117 O     ? ? ? 1_555 K NA  . NA ? ? A ILE 243 A NA  707 1_555 ? ? ? ? ? ? ?            2.376 ? 
metalc14 metalc ? ? C DT  3   OP1   ? ? ? 1_555 K NA  . NA ? ? P DT  3   A NA  707 1_555 ? ? ? ? ? ? ?            2.681 ? 
metalc15 metalc ? ? F MG  .   MG    ? ? ? 1_555 N HOH . O  ? ? A MG  702 A HOH 807 1_555 ? ? ? ? ? ? ?            2.070 ? 
metalc16 metalc ? ? G MG  .   MG    ? ? ? 1_555 N HOH . O  ? ? A MG  703 A HOH 821 1_555 ? ? ? ? ? ? ?            2.137 ? 
metalc17 metalc ? ? K NA  .   NA    ? ? ? 1_555 P HOH . O  ? ? A NA  707 P HOH 105 1_555 ? ? ? ? ? ? ?            2.362 ? 
metalc18 metalc ? ? K NA  .   NA    ? ? ? 1_555 N HOH . O  ? ? A NA  707 A HOH 986 1_555 ? ? ? ? ? ? ?            2.551 ? 
hydrog1  hydrog ? ? B DC  1   N3    ? ? ? 1_555 D DG  4 N1 A ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  1   N4    ? ? ? 1_555 D DG  4 O6 A ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  1   O2    ? ? ? 1_555 D DG  4 N2 A ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2   N1    ? ? ? 1_555 D DC  3 N3 A ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2   N2    ? ? ? 1_555 D DC  3 O2 A ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  2   O6    ? ? ? 1_555 D DC  3 N4 A ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  3   N1    ? ? ? 1_555 D DC  2 N3 ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  3   N2    ? ? ? 1_555 D DC  2 O2 ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  3   O6    ? ? ? 1_555 D DC  2 N4 ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  4   N3    ? ? ? 1_555 D DG  1 N1 ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  4   N4    ? ? ? 1_555 D DG  1 O6 ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  4   O2    ? ? ? 1_555 D DG  1 N2 ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  4 N1 ? ? T DT  6   P DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  4 N6 ? ? T DT  6   P DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DA  7   N1    ? ? ? 1_555 C DT  3 N3 ? ? T DA  7   P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DA  7   N6    ? ? ? 1_555 C DT  3 O4 ? ? T DA  7   P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  8   N3    ? ? ? 1_555 C DG  2 N1 ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  8   N4    ? ? ? 1_555 C DG  2 O6 ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  8   O2    ? ? ? 1_555 C DG  2 N2 ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  9   N1    ? ? ? 1_555 C DC  1 N3 ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DG  9   N2    ? ? ? 1_555 C DC  1 O2 ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  9   O6    ? ? ? 1_555 C DC  1 N4 ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           298 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            436 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    299 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     437 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -3.94 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 164 ? LEU A 165 ? VAL A 290 LEU A 291 
A 2 GLN A 201 ? GLY A 202 ? GLN A 327 GLY A 328 
B 1 THR A 188 ? LEU A 191 ? THR A 314 LEU A 317 
B 2 VAL A 205 ? THR A 210 ? VAL A 331 THR A 336 
B 3 SER A 273 ? VAL A 283 ? SER A 411 VAL A 421 
B 4 ARG A 261 ? GLN A 270 ? ARG A 387 GLN A 396 
B 5 ILE A 234 ? TYR A 236 ? ILE A 360 TYR A 362 
C 1 TRP A 317 ? LEU A 318 ? TRP A 455 LEU A 456 
C 2 LEU A 323 ? ASP A 325 ? LEU A 461 ASP A 463 
C 3 THR A 330 ? PHE A 331 ? THR A 468 PHE A 469 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 164 ? N VAL A 290 O GLY A 202 ? O GLY A 328 
B 1 2 N THR A 190 ? N THR A 316 O LEU A 208 ? O LEU A 334 
B 2 3 N ILE A 209 ? N ILE A 335 O VAL A 282 ? O VAL A 420 
B 3 4 O VAL A 277 ? O VAL A 415 N PHE A 266 ? N PHE A 392 
B 4 5 O ILE A 265 ? O ILE A 391 N LEU A 235 ? N LEU A 361 
C 1 2 N TRP A 317 ? N TRP A 455 O PHE A 324 ? O PHE A 462 
C 2 3 N ASP A 325 ? N ASP A 463 O THR A 330 ? O THR A 468 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE DUP A 701' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 702'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 703'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO A 704' 
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EDO A 705' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL A 706'  
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 707'  
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 708' 
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EPE A 709' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 25 GLY A 193 ? GLY A 319  . ? 1_555 ? 
2  AC1 25 GLY A 194 ? GLY A 320  . ? 1_555 ? 
3  AC1 25 ARG A 197 ? ARG A 323  . ? 1_555 ? 
4  AC1 25 LYS A 199 ? LYS A 325  . ? 1_555 ? 
5  AC1 25 GLY A 202 ? GLY A 328  . ? 1_555 ? 
6  AC1 25 HIS A 203 ? HIS A 329  . ? 1_555 ? 
7  AC1 25 ASP A 204 ? ASP A 330  . ? 1_555 ? 
8  AC1 25 ASP A 206 ? ASP A 332  . ? 1_555 ? 
9  AC1 25 GLY A 295 ? GLY A 433  . ? 1_555 ? 
10 AC1 25 TRP A 296 ? TRP A 434  . ? 1_555 ? 
11 AC1 25 GLY A 298 ? GLY A 436  . ? 1_555 ? 
12 AC1 25 LYS A 300 ? LYS A 438  . ? 1_555 ? 
13 AC1 25 MG  F .   ? MG  A 702  . ? 1_555 ? 
14 AC1 25 MG  G .   ? MG  A 703  . ? 1_555 ? 
15 AC1 25 EDO I .   ? EDO A 705  . ? 1_555 ? 
16 AC1 25 HOH N .   ? HOH A 805  . ? 1_555 ? 
17 AC1 25 HOH N .   ? HOH A 807  . ? 1_555 ? 
18 AC1 25 HOH N .   ? HOH A 821  . ? 1_555 ? 
19 AC1 25 HOH N .   ? HOH A 828  . ? 1_555 ? 
20 AC1 25 HOH N .   ? HOH A 853  . ? 1_555 ? 
21 AC1 25 HOH N .   ? HOH A 876  . ? 1_555 ? 
22 AC1 25 HOH N .   ? HOH A 927  . ? 1_555 ? 
23 AC1 25 HOH N .   ? HOH A 1007 . ? 1_555 ? 
24 AC1 25 DA  C 4   ? DA  P 4    . ? 1_555 ? 
25 AC1 25 DA  B 5   ? DA  T 5    . ? 1_555 ? 
26 AC2 7  ASP A 204 ? ASP A 330  . ? 1_555 ? 
27 AC2 7  ASP A 206 ? ASP A 332  . ? 1_555 ? 
28 AC2 7  ASP A 280 ? ASP A 418  . ? 1_555 ? 
29 AC2 7  DUP E .   ? DUP A 701  . ? 1_555 ? 
30 AC2 7  MG  G .   ? MG  A 703  . ? 1_555 ? 
31 AC2 7  HOH N .   ? HOH A 807  . ? 1_555 ? 
32 AC2 7  DA  C 4   ? DA  P 4    . ? 1_555 ? 
33 AC3 5  ASP A 204 ? ASP A 330  . ? 1_555 ? 
34 AC3 5  ASP A 206 ? ASP A 332  . ? 1_555 ? 
35 AC3 5  DUP E .   ? DUP A 701  . ? 1_555 ? 
36 AC3 5  MG  F .   ? MG  A 702  . ? 1_555 ? 
37 AC3 5  HOH N .   ? HOH A 821  . ? 1_555 ? 
38 AC4 4  GLU A 81  ? GLU A 207  . ? 1_555 ? 
39 AC4 4  HIS A 82  ? HIS A 208  . ? 1_555 ? 
40 AC4 4  ARG A 85  ? ARG A 211  . ? 1_555 ? 
41 AC4 4  DG  D 1   ? DG  D 1    . ? 1_555 ? 
42 AC5 7  ARG A 261 ? ARG A 387  . ? 1_555 ? 
43 AC5 7  GLY A 295 ? GLY A 433  . ? 1_555 ? 
44 AC5 7  TRP A 296 ? TRP A 434  . ? 1_555 ? 
45 AC5 7  ARG A 307 ? ARG A 445  . ? 1_555 ? 
46 AC5 7  DUP E .   ? DUP A 701  . ? 1_555 ? 
47 AC5 7  HOH N .   ? HOH A 993  . ? 1_555 ? 
48 AC5 7  DA  C 4   ? DA  P 4    . ? 1_555 ? 
49 AC6 5  SER A 46  ? SER A 172  . ? 1_555 ? 
50 AC6 5  GLY A 48  ? GLY A 174  . ? 1_555 ? 
51 AC6 5  ARG A 49  ? ARG A 175  . ? 1_555 ? 
52 AC6 5  HOH N .   ? HOH A 1094 . ? 1_555 ? 
53 AC6 5  HOH N .   ? HOH A 1095 . ? 1_555 ? 
54 AC7 6  THR A 115 ? THR A 241  . ? 1_555 ? 
55 AC7 6  ILE A 117 ? ILE A 243  . ? 1_555 ? 
56 AC7 6  VAL A 120 ? VAL A 246  . ? 1_555 ? 
57 AC7 6  HOH N .   ? HOH A 986  . ? 1_555 ? 
58 AC7 6  DT  C 3   ? DT  P 3    . ? 1_555 ? 
59 AC7 6  HOH P .   ? HOH P 105  . ? 1_555 ? 
60 AC8 5  GLN A 288 ? GLN A 426  . ? 1_555 ? 
61 AC8 5  HIS A 321 ? HIS A 459  . ? 1_555 ? 
62 AC8 5  PHE A 331 ? PHE A 469  . ? 1_555 ? 
63 AC8 5  HOH N .   ? HOH A 989  . ? 1_555 ? 
64 AC8 5  HOH N .   ? HOH A 1116 . ? 1_555 ? 
65 AC9 4  LYS A 199 ? LYS A 325  . ? 1_555 ? 
66 AC9 4  LEU A 200 ? LEU A 326  . ? 1_555 ? 
67 AC9 4  GLN A 201 ? GLN A 327  . ? 1_555 ? 
68 AC9 4  HOH N .   ? HOH A 995  . ? 1_555 ? 
# 
_atom_sites.entry_id                    4M04 
_atom_sites.fract_transf_matrix[1][1]   0.016697 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014606 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009110 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . TRP A 1  11  ? 0.034   -31.156 -11.860 0.50 22.93 ? 137  TRP A N     1 
ATOM   2    C  CA    . TRP A 1  11  ? -0.226  -30.566 -10.549 0.50 28.47 ? 137  TRP A CA    1 
ATOM   3    C  C     . TRP A 1  11  ? 0.064   -29.066 -10.514 0.50 29.21 ? 137  TRP A C     1 
ATOM   4    O  O     . TRP A 1  11  ? -0.119  -28.417 -9.481  0.50 25.01 ? 137  TRP A O     1 
ATOM   5    C  CB    . TRP A 1  11  ? 0.590   -31.276 -9.468  0.50 30.95 ? 137  TRP A CB    1 
ATOM   6    N  N     . MET A 1  12  ? 0.520   -28.521 -11.639 1.00 31.20 ? 138  MET A N     1 
ATOM   7    C  CA    . MET A 1  12  ? 0.787   -27.080 -11.745 1.00 21.29 ? 138  MET A CA    1 
ATOM   8    C  C     . MET A 1  12  ? -0.026  -26.431 -12.878 1.00 18.80 ? 138  MET A C     1 
ATOM   9    O  O     . MET A 1  12  ? 0.269   -26.617 -14.053 1.00 16.90 ? 138  MET A O     1 
ATOM   10   C  CB    . MET A 1  12  ? 2.291   -26.854 -11.937 1.00 19.55 ? 138  MET A CB    1 
ATOM   11   C  CG    . MET A 1  12  ? 2.721   -25.421 -12.250 1.00 27.97 ? 138  MET A CG    1 
ATOM   12   S  SD    . MET A 1  12  ? 2.885   -24.291 -10.859 1.00 26.13 ? 138  MET A SD    1 
ATOM   13   C  CE    . MET A 1  12  ? 3.888   -25.196 -9.689  1.00 16.88 ? 138  MET A CE    1 
ATOM   14   N  N     . PRO A 1  13  ? -1.068  -25.663 -12.528 1.00 17.21 ? 139  PRO A N     1 
ATOM   15   C  CA    . PRO A 1  13  ? -1.870  -25.015 -13.576 1.00 19.20 ? 139  PRO A CA    1 
ATOM   16   C  C     . PRO A 1  13  ? -1.072  -23.962 -14.374 1.00 16.60 ? 139  PRO A C     1 
ATOM   17   O  O     . PRO A 1  13  ? -0.050  -23.456 -13.913 1.00 15.08 ? 139  PRO A O     1 
ATOM   18   C  CB    . PRO A 1  13  ? -3.029  -24.380 -12.792 1.00 19.38 ? 139  PRO A CB    1 
ATOM   19   C  CG    . PRO A 1  13  ? -2.515  -24.210 -11.405 1.00 18.21 ? 139  PRO A CG    1 
ATOM   20   C  CD    . PRO A 1  13  ? -1.578  -25.383 -11.175 1.00 18.65 ? 139  PRO A CD    1 
ATOM   21   N  N     . ALA A 1  14  ? -1.521  -23.655 -15.585 1.00 12.16 ? 140  ALA A N     1 
ATOM   22   C  CA    . ALA A 1  14  ? -0.731  -22.819 -16.467 1.00 12.26 ? 140  ALA A CA    1 
ATOM   23   C  C     . ALA A 1  14  ? -0.822  -21.333 -16.136 1.00 12.25 ? 140  ALA A C     1 
ATOM   24   O  O     . ALA A 1  14  ? 0.085   -20.593 -16.482 1.00 16.99 ? 140  ALA A O     1 
ATOM   25   C  CB    . ALA A 1  14  ? -1.124  -23.043 -17.897 1.00 15.93 ? 140  ALA A CB    1 
ATOM   26   N  N     . TYR A 1  15  ? -1.921  -20.898 -15.508 1.00 11.11 ? 141  TYR A N     1 
ATOM   27   C  CA    . TYR A 1  15  ? -2.100  -19.469 -15.169 1.00 8.39  ? 141  TYR A CA    1 
ATOM   28   C  C     . TYR A 1  15  ? -1.678  -19.214 -13.720 1.00 8.96  ? 141  TYR A C     1 
ATOM   29   O  O     . TYR A 1  15  ? -1.991  -20.008 -12.827 1.00 11.05 ? 141  TYR A O     1 
ATOM   30   C  CB    . TYR A 1  15  ? -3.564  -19.054 -15.322 1.00 8.59  ? 141  TYR A CB    1 
ATOM   31   C  CG    . TYR A 1  15  ? -4.112  -18.993 -16.729 1.00 7.12  ? 141  TYR A CG    1 
ATOM   32   C  CD1   . TYR A 1  15  ? -4.634  -20.133 -17.340 1.00 13.57 ? 141  TYR A CD1   1 
ATOM   33   C  CD2   . TYR A 1  15  ? -4.146  -17.797 -17.437 1.00 9.71  ? 141  TYR A CD2   1 
ATOM   34   C  CE1   . TYR A 1  15  ? -5.173  -20.084 -18.618 1.00 12.16 ? 141  TYR A CE1   1 
ATOM   35   C  CE2   . TYR A 1  15  ? -4.682  -17.732 -18.730 1.00 12.05 ? 141  TYR A CE2   1 
ATOM   36   C  CZ    . TYR A 1  15  ? -5.196  -18.888 -19.309 1.00 12.40 ? 141  TYR A CZ    1 
ATOM   37   O  OH    . TYR A 1  15  ? -5.727  -18.846 -20.569 1.00 16.60 ? 141  TYR A OH    1 
ATOM   38   N  N     . ALA A 1  16  ? -1.002  -18.091 -13.471 1.00 7.95  ? 142  ALA A N     1 
ATOM   39   C  CA    . ALA A 1  16  ? -0.524  -17.787 -12.136 1.00 9.45  ? 142  ALA A CA    1 
ATOM   40   C  C     . ALA A 1  16  ? -1.663  -17.569 -11.158 1.00 7.90  ? 142  ALA A C     1 
ATOM   41   O  O     . ALA A 1  16  ? -1.502  -17.800 -9.962  1.00 9.70  ? 142  ALA A O     1 
ATOM   42   C  CB    . ALA A 1  16  ? 0.435   -16.557 -12.147 1.00 8.04  ? 142  ALA A CB    1 
ATOM   43   N  N     . CYS A 1  17  ? -2.823  -17.150 -11.649 1.00 7.73  ? 143  CYS A N     1 
ATOM   44   C  CA    . CYS A 1  17  ? -3.969  -16.904 -10.778 1.00 5.86  ? 143  CYS A CA    1 
ATOM   45   C  C     . CYS A 1  17  ? -4.663  -18.172 -10.303 1.00 9.34  ? 143  CYS A C     1 
ATOM   46   O  O     . CYS A 1  17  ? -5.609  -18.125 -9.508  1.00 8.90  ? 143  CYS A O     1 
ATOM   47   C  CB    . CYS A 1  17  ? -4.980  -16.010 -11.494 1.00 7.01  ? 143  CYS A CB    1 
ATOM   48   S  SG    . CYS A 1  17  ? -5.620  -16.699 -13.058 1.00 9.06  ? 143  CYS A SG    1 
ATOM   49   N  N     . GLN A 1  18  ? -4.196  -19.312 -10.801 1.00 7.96  ? 144  GLN A N     1 
ATOM   50   C  CA    . GLN A 1  18  ? -4.759  -20.609 -10.450 1.00 9.87  ? 144  GLN A CA    1 
ATOM   51   C  C     . GLN A 1  18  ? -3.973  -21.310 -9.372  1.00 13.16 ? 144  GLN A C     1 
ATOM   52   O  O     . GLN A 1  18  ? -4.268  -22.454 -9.033  1.00 11.41 ? 144  GLN A O     1 
ATOM   53   C  CB    . GLN A 1  18  ? -4.787  -21.527 -11.682 1.00 7.75  ? 144  GLN A CB    1 
ATOM   54   C  CG    . GLN A 1  18  ? -5.747  -21.063 -12.747 1.00 9.78  ? 144  GLN A CG    1 
ATOM   55   C  CD    . GLN A 1  18  ? -5.750  -22.010 -13.939 1.00 14.86 ? 144  GLN A CD    1 
ATOM   56   O  OE1   . GLN A 1  18  ? -4.752  -22.144 -14.634 1.00 12.88 ? 144  GLN A OE1   1 
ATOM   57   N  NE2   . GLN A 1  18  ? -6.867  -22.682 -14.153 1.00 15.69 ? 144  GLN A NE2   1 
ATOM   58   N  N     . ARG A 1  19  ? -2.958  -20.647 -8.835  1.00 10.13 ? 145  ARG A N     1 
ATOM   59   C  CA    . ARG A 1  19  ? -2.150  -21.277 -7.809  1.00 13.58 ? 145  ARG A CA    1 
ATOM   60   C  C     . ARG A 1  19  ? -1.681  -20.237 -6.791  1.00 9.28  ? 145  ARG A C     1 
ATOM   61   O  O     . ARG A 1  19  ? -1.484  -19.067 -7.134  1.00 10.50 ? 145  ARG A O     1 
ATOM   62   C  CB    . ARG A 1  19  ? -0.956  -21.956 -8.471  1.00 15.11 ? 145  ARG A CB    1 
ATOM   63   C  CG    . ARG A 1  19  ? -0.085  -20.957 -9.183  1.00 12.99 ? 145  ARG A CG    1 
ATOM   64   C  CD    . ARG A 1  19  ? 0.730   -21.559 -10.287 1.00 20.23 ? 145  ARG A CD    1 
ATOM   65   N  NE    . ARG A 1  19  ? 1.669   -20.545 -10.741 1.00 19.94 ? 145  ARG A NE    1 
ATOM   66   C  CZ    . ARG A 1  19  ? 1.936   -20.277 -12.010 1.00 18.38 ? 145  ARG A CZ    1 
ATOM   67   N  NH1   . ARG A 1  19  ? 1.340   -20.965 -12.997 1.00 18.37 ? 145  ARG A NH1   1 
ATOM   68   N  NH2   . ARG A 1  19  ? 2.794   -19.309 -12.277 1.00 16.15 ? 145  ARG A NH2   1 
ATOM   69   N  N     . PRO A 1  20  ? -1.519  -20.658 -5.531  1.00 9.70  ? 146  PRO A N     1 
ATOM   70   C  CA    . PRO A 1  20  ? -0.972  -19.764 -4.509  1.00 7.43  ? 146  PRO A CA    1 
ATOM   71   C  C     . PRO A 1  20  ? 0.486   -19.466 -4.819  1.00 9.55  ? 146  PRO A C     1 
ATOM   72   O  O     . PRO A 1  20  ? 1.264   -20.390 -5.171  1.00 8.03  ? 146  PRO A O     1 
ATOM   73   C  CB    . PRO A 1  20  ? -1.057  -20.590 -3.221  1.00 13.50 ? 146  PRO A CB    1 
ATOM   74   C  CG    . PRO A 1  20  ? -1.856  -21.831 -3.572  1.00 14.32 ? 146  PRO A CG    1 
ATOM   75   C  CD    . PRO A 1  20  ? -1.733  -22.026 -5.028  1.00 15.01 ? 146  PRO A CD    1 
ATOM   76   N  N     . THR A 1  21  ? 0.864   -18.192 -4.729  1.00 5.36  ? 147  THR A N     1 
ATOM   77   C  CA    . THR A 1  21  ? 2.284   -17.840 -4.811  1.00 6.08  ? 147  THR A CA    1 
ATOM   78   C  C     . THR A 1  21  ? 2.676   -16.999 -3.615  1.00 7.69  ? 147  THR A C     1 
ATOM   79   O  O     . THR A 1  21  ? 2.275   -15.830 -3.503  1.00 6.61  ? 147  THR A O     1 
ATOM   80   C  CB    . THR A 1  21  ? 2.618   -17.071 -6.100  1.00 6.13  ? 147  THR A CB    1 
ATOM   81   O  OG1   . THR A 1  21  ? 1.947   -17.665 -7.215  1.00 7.03  ? 147  THR A OG1   1 
ATOM   82   C  CG2   . THR A 1  21  ? 4.107   -17.121 -6.344  1.00 6.23  ? 147  THR A CG2   1 
ATOM   83   N  N     . PRO A 1  22  ? 3.450   -17.583 -2.704  1.00 6.01  ? 148  PRO A N     1 
ATOM   84   C  CA    . PRO A 1  22  ? 3.769   -16.826 -1.499  1.00 6.99  ? 148  PRO A CA    1 
ATOM   85   C  C     . PRO A 1  22  ? 4.884   -15.848 -1.793  1.00 6.64  ? 148  PRO A C     1 
ATOM   86   O  O     . PRO A 1  22  ? 5.551   -15.906 -2.843  1.00 6.96  ? 148  PRO A O     1 
ATOM   87   C  CB    . PRO A 1  22  ? 4.247   -17.902 -0.522  1.00 7.38  ? 148  PRO A CB    1 
ATOM   88   C  CG    . PRO A 1  22  ? 4.922   -18.953 -1.474  1.00 8.24  ? 148  PRO A CG    1 
ATOM   89   C  CD    . PRO A 1  22  ? 4.034   -18.944 -2.700  1.00 6.54  ? 148  PRO A CD    1 
ATOM   90   N  N     . LEU A 1  23  ? 5.096   -14.956 -0.845  1.00 5.95  ? 149  LEU A N     1 
ATOM   91   C  CA    . LEU A 1  23  ? 6.087   -13.899 -1.021  1.00 6.36  ? 149  LEU A CA    1 
ATOM   92   C  C     . LEU A 1  23  ? 7.494   -14.469 -1.009  1.00 10.50 ? 149  LEU A C     1 
ATOM   93   O  O     . LEU A 1  23  ? 8.314   -14.147 -1.870  1.00 11.74 ? 149  LEU A O     1 
ATOM   94   C  CB    . LEU A 1  23  ? 5.940   -12.866 0.076   1.00 8.08  ? 149  LEU A CB    1 
ATOM   95   C  CG    . LEU A 1  23  ? 6.955   -11.711 -0.018  1.00 11.38 ? 149  LEU A CG    1 
ATOM   96   C  CD1   . LEU A 1  23  ? 6.933   -11.015 -1.411  1.00 9.86  ? 149  LEU A CD1   1 
ATOM   97   C  CD2   . LEU A 1  23  ? 6.699   -10.714 1.086   1.00 10.22 ? 149  LEU A CD2   1 
ATOM   98   N  N     . THR A 1  24  ? 7.774   -15.323 -0.035  1.00 7.69  ? 150  THR A N     1 
ATOM   99   C  CA    . THR A 1  24  ? 9.079   -15.971 0.023   1.00 8.19  ? 150  THR A CA    1 
ATOM   100  C  C     . THR A 1  24  ? 8.884   -17.451 -0.317  1.00 8.37  ? 150  THR A C     1 
ATOM   101  O  O     . THR A 1  24  ? 7.820   -18.032 -0.066  1.00 6.78  ? 150  THR A O     1 
ATOM   102  C  CB    . THR A 1  24  ? 9.735   -15.820 1.418   1.00 8.75  ? 150  THR A CB    1 
ATOM   103  O  OG1   . THR A 1  24  ? 8.907   -16.457 2.392   1.00 10.90 ? 150  THR A OG1   1 
ATOM   104  C  CG2   . THR A 1  24  ? 9.900   -14.334 1.796   1.00 12.52 ? 150  THR A CG2   1 
ATOM   105  N  N     . HIS A 1  25  ? 9.896   -18.054 -0.922  1.00 6.91  ? 151  HIS A N     1 
ATOM   106  C  CA    . HIS A 1  25  ? 9.718   -19.378 -1.476  1.00 6.88  ? 151  HIS A CA    1 
ATOM   107  C  C     . HIS A 1  25  ? 11.020  -20.168 -1.490  1.00 7.70  ? 151  HIS A C     1 
ATOM   108  O  O     . HIS A 1  25  ? 11.947  -19.854 -0.737  1.00 8.31  ? 151  HIS A O     1 
ATOM   109  C  CB    . HIS A 1  25  ? 9.070   -19.298 -2.878  1.00 4.95  ? 151  HIS A CB    1 
ATOM   110  C  CG    . HIS A 1  25  ? 9.846   -18.479 -3.862  1.00 7.25  ? 151  HIS A CG    1 
ATOM   111  N  ND1   . HIS A 1  25  ? 10.806  -19.018 -4.699  1.00 5.78  ? 151  HIS A ND1   1 
ATOM   112  C  CD2   . HIS A 1  25  ? 9.819   -17.151 -4.120  1.00 7.74  ? 151  HIS A CD2   1 
ATOM   113  C  CE1   . HIS A 1  25  ? 11.317  -18.055 -5.447  1.00 13.07 ? 151  HIS A CE1   1 
ATOM   114  N  NE2   . HIS A 1  25  ? 10.752  -16.909 -5.105  1.00 8.86  ? 151  HIS A NE2   1 
ATOM   115  N  N     . HIS A 1  26  ? 11.073  -21.212 -2.321  1.00 8.34  ? 152  HIS A N     1 
ATOM   116  C  CA    . HIS A 1  26  ? 12.177  -22.188 -2.271  1.00 8.28  ? 152  HIS A CA    1 
ATOM   117  C  C     . HIS A 1  26  ? 13.053  -22.223 -3.504  1.00 10.83 ? 152  HIS A C     1 
ATOM   118  O  O     . HIS A 1  26  ? 13.882  -23.133 -3.674  1.00 9.23  ? 152  HIS A O     1 
ATOM   119  C  CB    . HIS A 1  26  ? 11.598  -23.579 -2.000  1.00 6.38  ? 152  HIS A CB    1 
ATOM   120  C  CG    . HIS A 1  26  ? 10.540  -23.549 -0.961  1.00 6.36  ? 152  HIS A CG    1 
ATOM   121  N  ND1   . HIS A 1  26  ? 10.822  -23.366 0.383   1.00 7.81  ? 152  HIS A ND1   1 
ATOM   122  C  CD2   . HIS A 1  26  ? 9.194   -23.564 -1.071  1.00 6.75  ? 152  HIS A CD2   1 
ATOM   123  C  CE1   . HIS A 1  26  ? 9.688   -23.334 1.056   1.00 11.67 ? 152  HIS A CE1   1 
ATOM   124  N  NE2   . HIS A 1  26  ? 8.684   -23.419 0.198   1.00 7.69  ? 152  HIS A NE2   1 
ATOM   125  N  N     . ASN A 1  27  ? 12.885  -21.227 -4.362  1.00 8.38  ? 153  ASN A N     1 
ATOM   126  C  CA    . ASN A 1  27  ? 13.638  -21.202 -5.614  1.00 7.78  ? 153  ASN A CA    1 
ATOM   127  C  C     . ASN A 1  27  ? 14.076  -19.794 -5.995  1.00 7.43  ? 153  ASN A C     1 
ATOM   128  O  O     . ASN A 1  27  ? 14.101  -19.430 -7.170  1.00 8.21  ? 153  ASN A O     1 
ATOM   129  C  CB    . ASN A 1  27  ? 12.794  -21.822 -6.712  1.00 5.94  ? 153  ASN A CB    1 
ATOM   130  C  CG    . ASN A 1  27  ? 12.711  -23.324 -6.567  1.00 10.66 ? 153  ASN A CG    1 
ATOM   131  O  OD1   . ASN A 1  27  ? 13.715  -24.013 -6.754  1.00 7.41  ? 153  ASN A OD1   1 
ATOM   132  N  ND2   . ASN A 1  27  ? 11.532  -23.840 -6.203  1.00 6.82  ? 153  ASN A ND2   1 
ATOM   133  N  N     . THR A 1  28  ? 14.453  -19.032 -4.985  1.00 7.34  ? 154  THR A N     1 
ATOM   134  C  CA    . THR A 1  28  ? 14.745  -17.608 -5.152  1.00 7.97  ? 154  THR A CA    1 
ATOM   135  C  C     . THR A 1  28  ? 15.790  -17.309 -6.213  1.00 10.45 ? 154  THR A C     1 
ATOM   136  O  O     . THR A 1  28  ? 15.566  -16.474 -7.088  1.00 7.70  ? 154  THR A O     1 
ATOM   137  C  CB    . THR A 1  28  ? 15.181  -17.014 -3.815  1.00 8.46  ? 154  THR A CB    1 
ATOM   138  O  OG1   . THR A 1  28  ? 14.246  -17.427 -2.808  1.00 10.38 ? 154  THR A OG1   1 
ATOM   139  C  CG2   . THR A 1  28  ? 15.219  -15.486 -3.893  1.00 10.91 ? 154  THR A CG2   1 
ATOM   140  N  N     . GLY A 1  29  ? 16.931  -17.995 -6.139  1.00 9.87  ? 155  GLY A N     1 
ATOM   141  C  CA    . GLY A 1  29  ? 17.997  -17.746 -7.089  1.00 12.40 ? 155  GLY A CA    1 
ATOM   142  C  C     . GLY A 1  29  ? 17.590  -18.053 -8.519  1.00 12.55 ? 155  GLY A C     1 
ATOM   143  O  O     . GLY A 1  29  ? 17.920  -17.295 -9.439  1.00 10.34 ? 155  GLY A O     1 
ATOM   144  N  N     . LEU A 1  30  ? 16.864  -19.150 -8.707  1.00 8.11  ? 156  LEU A N     1 
ATOM   145  C  CA    . LEU A 1  30  ? 16.412  -19.538 -10.038 1.00 11.86 ? 156  LEU A CA    1 
ATOM   146  C  C     . LEU A 1  30  ? 15.411  -18.513 -10.604 1.00 9.06  ? 156  LEU A C     1 
ATOM   147  O  O     . LEU A 1  30  ? 15.500  -18.115 -11.769 1.00 5.91  ? 156  LEU A O     1 
ATOM   148  C  CB    . LEU A 1  30  ? 15.764  -20.916 -9.979  1.00 8.32  ? 156  LEU A CB    1 
ATOM   149  C  CG    . LEU A 1  30  ? 16.661  -22.103 -9.585  1.00 8.78  ? 156  LEU A CG    1 
ATOM   150  C  CD1   . LEU A 1  30  ? 15.853  -23.424 -9.667  1.00 9.77  ? 156  LEU A CD1   1 
ATOM   151  C  CD2   . LEU A 1  30  ? 17.870  -22.157 -10.523 1.00 10.14 ? 156  LEU A CD2   1 
ATOM   152  N  N     . SER A 1  31  ? 14.452  -18.090 -9.791  1.00 7.34  ? 157  SER A N     1 
ATOM   153  C  CA    A SER A 1  31  ? 13.464  -17.123 -10.260 0.50 8.93  ? 157  SER A CA    1 
ATOM   154  C  CA    B SER A 1  31  ? 13.463  -17.113 -10.246 0.50 8.93  ? 157  SER A CA    1 
ATOM   155  C  C     . SER A 1  31  ? 14.128  -15.786 -10.572 1.00 9.11  ? 157  SER A C     1 
ATOM   156  O  O     . SER A 1  31  ? 13.780  -15.129 -11.556 1.00 8.59  ? 157  SER A O     1 
ATOM   157  C  CB    A SER A 1  31  ? 12.325  -16.943 -9.247  0.50 9.58  ? 157  SER A CB    1 
ATOM   158  C  CB    B SER A 1  31  ? 12.361  -16.902 -9.201  0.50 9.59  ? 157  SER A CB    1 
ATOM   159  O  OG    A SER A 1  31  ? 12.833  -16.714 -7.945  0.50 6.87  ? 157  SER A OG    1 
ATOM   160  O  OG    B SER A 1  31  ? 11.620  -18.090 -9.018  0.50 10.52 ? 157  SER A OG    1 
ATOM   161  N  N     . GLU A 1  32  ? 15.091  -15.379 -9.747  1.00 9.71  ? 158  GLU A N     1 
ATOM   162  C  CA    A GLU A 1  32  ? 15.758  -14.101 -9.986  0.70 10.67 ? 158  GLU A CA    1 
ATOM   163  C  CA    B GLU A 1  32  ? 15.811  -14.116 -9.975  0.30 10.68 ? 158  GLU A CA    1 
ATOM   164  C  C     . GLU A 1  32  ? 16.503  -14.103 -11.335 1.00 8.30  ? 158  GLU A C     1 
ATOM   165  O  O     . GLU A 1  32  ? 16.491  -13.099 -12.058 1.00 8.23  ? 158  GLU A O     1 
ATOM   166  C  CB    A GLU A 1  32  ? 16.644  -13.714 -8.791  0.70 12.10 ? 158  GLU A CB    1 
ATOM   167  C  CB    B GLU A 1  32  ? 16.854  -13.877 -8.879  0.30 11.95 ? 158  GLU A CB    1 
ATOM   168  C  CG    A GLU A 1  32  ? 15.804  -13.250 -7.576  0.70 15.01 ? 158  GLU A CG    1 
ATOM   169  C  CG    B GLU A 1  32  ? 17.410  -12.448 -8.838  0.30 11.77 ? 158  GLU A CG    1 
ATOM   170  C  CD    A GLU A 1  32  ? 16.607  -12.957 -6.294  0.70 20.78 ? 158  GLU A CD    1 
ATOM   171  C  CD    B GLU A 1  32  ? 18.690  -12.256 -9.650  0.30 13.73 ? 158  GLU A CD    1 
ATOM   172  O  OE1   A GLU A 1  32  ? 17.825  -13.217 -6.227  0.70 18.09 ? 158  GLU A OE1   1 
ATOM   173  O  OE1   B GLU A 1  32  ? 19.242  -13.251 -10.166 0.30 13.34 ? 158  GLU A OE1   1 
ATOM   174  O  OE2   A GLU A 1  32  ? 15.993  -12.456 -5.335  0.70 20.31 ? 158  GLU A OE2   1 
ATOM   175  O  OE2   B GLU A 1  32  ? 19.150  -11.096 -9.765  0.30 9.66  ? 158  GLU A OE2   1 
ATOM   176  N  N     . ALA A 1  33  ? 17.106  -15.234 -11.686 1.00 7.86  ? 159  ALA A N     1 
ATOM   177  C  CA    . ALA A 1  33  ? 17.837  -15.348 -12.953 1.00 11.16 ? 159  ALA A CA    1 
ATOM   178  C  C     . ALA A 1  33  ? 16.893  -15.234 -14.141 1.00 10.52 ? 159  ALA A C     1 
ATOM   179  O  O     . ALA A 1  33  ? 17.164  -14.509 -15.091 1.00 11.18 ? 159  ALA A O     1 
ATOM   180  C  CB    . ALA A 1  33  ? 18.617  -16.663 -13.009 1.00 11.06 ? 159  ALA A CB    1 
ATOM   181  N  N     . LEU A 1  34  ? 15.771  -15.931 -14.088 1.00 7.00  ? 160  LEU A N     1 
ATOM   182  C  CA    . LEU A 1  34  ? 14.798  -15.817 -15.159 1.00 7.28  ? 160  LEU A CA    1 
ATOM   183  C  C     . LEU A 1  34  ? 14.213  -14.423 -15.267 1.00 9.11  ? 160  LEU A C     1 
ATOM   184  O  O     . LEU A 1  34  ? 13.922  -13.946 -16.370 1.00 10.10 ? 160  LEU A O     1 
ATOM   185  C  CB    . LEU A 1  34  ? 13.691  -16.859 -14.987 1.00 6.42  ? 160  LEU A CB    1 
ATOM   186  C  CG    . LEU A 1  34  ? 14.227  -18.299 -15.079 1.00 6.27  ? 160  LEU A CG    1 
ATOM   187  C  CD1   . LEU A 1  34  ? 13.251  -19.261 -14.414 1.00 5.63  ? 160  LEU A CD1   1 
ATOM   188  C  CD2   . LEU A 1  34  ? 14.448  -18.677 -16.526 1.00 9.01  ? 160  LEU A CD2   1 
ATOM   189  N  N     . GLU A 1  35  ? 14.034  -13.757 -14.130 1.00 7.93  ? 161  GLU A N     1 
ATOM   190  C  CA    . GLU A 1  35  ? 13.519  -12.390 -14.161 1.00 7.66  ? 161  GLU A CA    1 
ATOM   191  C  C     . GLU A 1  35  ? 14.510  -11.379 -14.752 1.00 10.19 ? 161  GLU A C     1 
ATOM   192  O  O     . GLU A 1  35  ? 14.111  -10.374 -15.349 1.00 8.18  ? 161  GLU A O     1 
ATOM   193  C  CB    . GLU A 1  35  ? 13.003  -11.997 -12.767 1.00 6.63  ? 161  GLU A CB    1 
ATOM   194  C  CG    . GLU A 1  35  ? 11.716  -12.758 -12.513 1.00 8.86  ? 161  GLU A CG    1 
ATOM   195  C  CD    . GLU A 1  35  ? 11.082  -12.493 -11.159 1.00 13.86 ? 161  GLU A CD    1 
ATOM   196  O  OE1   . GLU A 1  35  ? 11.761  -11.967 -10.257 1.00 14.96 ? 161  GLU A OE1   1 
ATOM   197  O  OE2   . GLU A 1  35  ? 9.883   -12.829 -11.015 1.00 15.21 ? 161  GLU A OE2   1 
ATOM   198  N  N     . ILE A 1  36  ? 15.802  -11.665 -14.655 1.00 7.99  ? 162  ILE A N     1 
ATOM   199  C  CA    . ILE A 1  36  ? 16.767  -10.827 -15.364 1.00 8.57  ? 162  ILE A CA    1 
ATOM   200  C  C     . ILE A 1  36  ? 16.524  -10.929 -16.871 1.00 10.88 ? 162  ILE A C     1 
ATOM   201  O  O     . ILE A 1  36  ? 16.527  -9.922  -17.594 1.00 9.46  ? 162  ILE A O     1 
ATOM   202  C  CB    . ILE A 1  36  ? 18.232  -11.286 -15.109 1.00 11.22 ? 162  ILE A CB    1 
ATOM   203  C  CG1   . ILE A 1  36  ? 18.628  -11.058 -13.661 1.00 10.28 ? 162  ILE A CG1   1 
ATOM   204  C  CG2   . ILE A 1  36  ? 19.186  -10.559 -16.050 1.00 10.08 ? 162  ILE A CG2   1 
ATOM   205  C  CD1   . ILE A 1  36  ? 18.703  -9.618  -13.298 1.00 11.30 ? 162  ILE A CD1   1 
ATOM   206  N  N     . LEU A 1  37  ? 16.321  -12.149 -17.349 1.00 5.62  ? 163  LEU A N     1 
ATOM   207  C  CA    . LEU A 1  37  ? 16.108  -12.348 -18.776 1.00 10.89 ? 163  LEU A CA    1 
ATOM   208  C  C     . LEU A 1  37  ? 14.787  -11.718 -19.202 1.00 8.93  ? 163  LEU A C     1 
ATOM   209  O  O     . LEU A 1  37  ? 14.692  -11.155 -20.288 1.00 8.51  ? 163  LEU A O     1 
ATOM   210  C  CB    . LEU A 1  37  ? 16.133  -13.840 -19.139 1.00 5.61  ? 163  LEU A CB    1 
ATOM   211  C  CG    . LEU A 1  37  ? 17.495  -14.509 -18.905 1.00 12.42 ? 163  LEU A CG    1 
ATOM   212  C  CD1   . LEU A 1  37  ? 17.444  -15.983 -19.320 1.00 11.93 ? 163  LEU A CD1   1 
ATOM   213  C  CD2   . LEU A 1  37  ? 18.595  -13.752 -19.656 1.00 14.45 ? 163  LEU A CD2   1 
ATOM   214  N  N     . ALA A 1  38  ? 13.777  -11.811 -18.342 1.00 7.39  ? 164  ALA A N     1 
ATOM   215  C  CA    . ALA A 1  38  ? 12.474  -11.180 -18.619 1.00 7.93  ? 164  ALA A CA    1 
ATOM   216  C  C     . ALA A 1  38  ? 12.651  -9.688  -18.779 1.00 11.13 ? 164  ALA A C     1 
ATOM   217  O  O     . ALA A 1  38  ? 12.167  -9.083  -19.737 1.00 7.77  ? 164  ALA A O     1 
ATOM   218  C  CB    . ALA A 1  38  ? 11.515  -11.454 -17.474 1.00 8.36  ? 164  ALA A CB    1 
ATOM   219  N  N     . GLU A 1  39  ? 13.341  -9.094  -17.814 1.00 8.21  ? 165  GLU A N     1 
ATOM   220  C  CA    . GLU A 1  39  ? 13.590  -7.663  -17.812 1.00 9.48  ? 165  GLU A CA    1 
ATOM   221  C  C     . GLU A 1  39  ? 14.338  -7.234  -19.099 1.00 14.00 ? 165  GLU A C     1 
ATOM   222  O  O     . GLU A 1  39  ? 13.974  -6.236  -19.744 1.00 9.83  ? 165  GLU A O     1 
ATOM   223  C  CB    . GLU A 1  39  ? 14.354  -7.289  -16.526 1.00 10.90 ? 165  GLU A CB    1 
ATOM   224  C  CG    . GLU A 1  39  ? 14.651  -5.840  -16.340 1.00 15.13 ? 165  GLU A CG    1 
ATOM   225  C  CD    . GLU A 1  39  ? 15.478  -5.576  -15.085 1.00 20.33 ? 165  GLU A CD    1 
ATOM   226  O  OE1   . GLU A 1  39  ? 16.149  -6.514  -14.588 1.00 19.00 ? 165  GLU A OE1   1 
ATOM   227  O  OE2   . GLU A 1  39  ? 15.458  -4.422  -14.604 1.00 23.53 ? 165  GLU A OE2   1 
ATOM   228  N  N     . ALA A 1  40  ? 15.351  -7.999  -19.493 1.00 11.74 ? 166  ALA A N     1 
ATOM   229  C  CA    . ALA A 1  40  ? 16.124  -7.659  -20.697 1.00 14.61 ? 166  ALA A CA    1 
ATOM   230  C  C     . ALA A 1  40  ? 15.275  -7.780  -21.964 1.00 13.53 ? 166  ALA A C     1 
ATOM   231  O  O     . ALA A 1  40  ? 15.409  -6.985  -22.896 1.00 12.86 ? 166  ALA A O     1 
ATOM   232  C  CB    . ALA A 1  40  ? 17.382  -8.550  -20.801 1.00 16.50 ? 166  ALA A CB    1 
ATOM   233  N  N     . ALA A 1  41  ? 14.384  -8.762  -21.994 1.00 11.69 ? 167  ALA A N     1 
ATOM   234  C  CA    . ALA A 1  41  ? 13.460  -8.891  -23.112 1.00 10.68 ? 167  ALA A CA    1 
ATOM   235  C  C     . ALA A 1  41  ? 12.601  -7.633  -23.208 1.00 14.43 ? 167  ALA A C     1 
ATOM   236  O  O     . ALA A 1  41  ? 12.402  -7.064  -24.283 1.00 15.29 ? 167  ALA A O     1 
ATOM   237  C  CB    . ALA A 1  41  ? 12.599  -10.117 -22.926 1.00 11.99 ? 167  ALA A CB    1 
ATOM   238  N  N     . GLY A 1  42  ? 12.114  -7.178  -22.064 1.00 12.37 ? 168  GLY A N     1 
ATOM   239  C  CA    . GLY A 1  42  ? 11.358  -5.934  -22.017 1.00 11.15 ? 168  GLY A CA    1 
ATOM   240  C  C     . GLY A 1  42  ? 12.144  -4.750  -22.541 1.00 12.48 ? 168  GLY A C     1 
ATOM   241  O  O     . GLY A 1  42  ? 11.588  -3.896  -23.233 1.00 14.02 ? 168  GLY A O     1 
ATOM   242  N  N     . PHE A 1  43  ? 13.433  -4.677  -22.214 1.00 14.25 ? 169  PHE A N     1 
ATOM   243  C  CA    . PHE A 1  43  ? 14.257  -3.562  -22.679 1.00 15.05 ? 169  PHE A CA    1 
ATOM   244  C  C     . PHE A 1  43  ? 14.403  -3.577  -24.194 1.00 15.14 ? 169  PHE A C     1 
ATOM   245  O  O     . PHE A 1  43  ? 14.612  -2.531  -24.812 1.00 14.84 ? 169  PHE A O     1 
ATOM   246  C  CB    . PHE A 1  43  ? 15.646  -3.569  -22.041 1.00 11.63 ? 169  PHE A CB    1 
ATOM   247  C  CG    . PHE A 1  43  ? 15.646  -3.277  -20.564 1.00 13.30 ? 169  PHE A CG    1 
ATOM   248  C  CD1   . PHE A 1  43  ? 14.572  -2.637  -19.957 1.00 11.88 ? 169  PHE A CD1   1 
ATOM   249  C  CD2   . PHE A 1  43  ? 16.727  -3.656  -19.780 1.00 14.77 ? 169  PHE A CD2   1 
ATOM   250  C  CE1   . PHE A 1  43  ? 14.582  -2.364  -18.587 1.00 12.71 ? 169  PHE A CE1   1 
ATOM   251  C  CE2   . PHE A 1  43  ? 16.754  -3.388  -18.420 1.00 12.82 ? 169  PHE A CE2   1 
ATOM   252  C  CZ    . PHE A 1  43  ? 15.681  -2.749  -17.817 1.00 13.27 ? 169  PHE A CZ    1 
ATOM   253  N  N     . GLU A 1  44  ? 14.281  -4.752  -24.796 1.00 12.59 ? 170  GLU A N     1 
ATOM   254  C  CA    . GLU A 1  44  ? 14.365  -4.845  -26.251 1.00 19.90 ? 170  GLU A CA    1 
ATOM   255  C  C     . GLU A 1  44  ? 12.999  -4.837  -26.947 1.00 20.31 ? 170  GLU A C     1 
ATOM   256  O  O     . GLU A 1  44  ? 12.908  -5.062  -28.140 1.00 25.76 ? 170  GLU A O     1 
ATOM   257  C  CB    . GLU A 1  44  ? 15.192  -6.062  -26.668 1.00 18.88 ? 170  GLU A CB    1 
ATOM   258  C  CG    . GLU A 1  44  ? 16.567  -6.125  -26.004 1.00 18.48 ? 170  GLU A CG    1 
ATOM   259  C  CD    . GLU A 1  44  ? 17.386  -4.843  -26.206 1.00 27.78 ? 170  GLU A CD    1 
ATOM   260  O  OE1   . GLU A 1  44  ? 17.521  -4.393  -27.368 1.00 31.77 ? 170  GLU A OE1   1 
ATOM   261  O  OE2   . GLU A 1  44  ? 17.886  -4.272  -25.202 1.00 18.34 ? 170  GLU A OE2   1 
ATOM   262  N  N     . GLY A 1  45  ? 11.937  -4.561  -26.203 1.00 18.49 ? 171  GLY A N     1 
ATOM   263  C  CA    . GLY A 1  45  ? 10.616  -4.482  -26.793 1.00 20.93 ? 171  GLY A CA    1 
ATOM   264  C  C     . GLY A 1  45  ? 9.953   -5.820  -27.065 1.00 18.05 ? 171  GLY A C     1 
ATOM   265  O  O     . GLY A 1  45  ? 8.958   -5.897  -27.786 1.00 22.83 ? 171  GLY A O     1 
ATOM   266  N  N     A SER A 1  46  ? 10.495  -6.895  -26.503 0.50 15.57 ? 172  SER A N     1 
ATOM   267  N  N     B SER A 1  46  ? 10.496  -6.876  -26.470 0.50 15.56 ? 172  SER A N     1 
ATOM   268  C  CA    A SER A 1  46  ? 9.900   -8.207  -26.739 0.50 16.80 ? 172  SER A CA    1 
ATOM   269  C  CA    B SER A 1  46  ? 9.963   -8.214  -26.678 0.50 16.81 ? 172  SER A CA    1 
ATOM   270  C  C     A SER A 1  46  ? 8.997   -8.624  -25.587 0.50 16.58 ? 172  SER A C     1 
ATOM   271  C  C     B SER A 1  46  ? 9.007   -8.610  -25.552 0.50 16.58 ? 172  SER A C     1 
ATOM   272  O  O     A SER A 1  46  ? 9.410   -9.380  -24.700 0.50 13.21 ? 172  SER A O     1 
ATOM   273  O  O     B SER A 1  46  ? 9.398   -9.349  -24.643 0.50 13.21 ? 172  SER A O     1 
ATOM   274  C  CB    A SER A 1  46  ? 10.969  -9.274  -26.979 0.50 19.33 ? 172  SER A CB    1 
ATOM   275  C  CB    B SER A 1  46  ? 11.112  -9.228  -26.761 0.50 19.47 ? 172  SER A CB    1 
ATOM   276  O  OG    A SER A 1  46  ? 10.369  -10.482 -27.402 0.50 18.04 ? 172  SER A OG    1 
ATOM   277  O  OG    B SER A 1  46  ? 12.006  -8.907  -27.811 0.50 21.87 ? 172  SER A OG    1 
ATOM   278  N  N     . GLU A 1  47  ? 7.763   -8.130  -25.611 1.00 13.94 ? 173  GLU A N     1 
ATOM   279  C  CA    . GLU A 1  47  ? 6.764   -8.452  -24.560 1.00 12.08 ? 173  GLU A CA    1 
ATOM   280  C  C     . GLU A 1  47  ? 6.489   -9.923  -24.383 1.00 11.42 ? 173  GLU A C     1 
ATOM   281  O  O     . GLU A 1  47  ? 6.257   -10.374 -23.261 1.00 10.05 ? 173  GLU A O     1 
ATOM   282  C  CB    . GLU A 1  47  ? 5.415   -7.774  -24.810 1.00 16.54 ? 173  GLU A CB    1 
ATOM   283  C  CG    . GLU A 1  47  ? 5.261   -6.384  -24.213 1.00 38.44 ? 173  GLU A CG    1 
ATOM   284  C  CD    . GLU A 1  47  ? 5.548   -6.333  -22.720 1.00 27.64 ? 173  GLU A CD    1 
ATOM   285  O  OE1   . GLU A 1  47  ? 4.753   -6.861  -21.902 1.00 33.29 ? 173  GLU A OE1   1 
ATOM   286  O  OE2   . GLU A 1  47  ? 6.579   -5.751  -22.369 1.00 28.66 ? 173  GLU A OE2   1 
ATOM   287  N  N     . GLY A 1  48  ? 6.449   -10.674 -25.483 1.00 11.92 ? 174  GLY A N     1 
ATOM   288  C  CA    . GLY A 1  48  ? 6.101   -12.085 -25.383 1.00 9.63  ? 174  GLY A CA    1 
ATOM   289  C  C     . GLY A 1  48  ? 7.161   -12.867 -24.634 1.00 9.94  ? 174  GLY A C     1 
ATOM   290  O  O     . GLY A 1  48  ? 6.856   -13.713 -23.780 1.00 12.43 ? 174  GLY A O     1 
ATOM   291  N  N     A ARG A 1  49  ? 8.421   -12.610 -24.964 0.50 11.47 ? 175  ARG A N     1 
ATOM   292  N  N     B ARG A 1  49  ? 8.422   -12.608 -24.964 0.50 11.47 ? 175  ARG A N     1 
ATOM   293  C  CA    A ARG A 1  49  ? 9.522   -13.260 -24.267 0.50 11.37 ? 175  ARG A CA    1 
ATOM   294  C  CA    B ARG A 1  49  ? 9.524   -13.258 -24.268 0.50 11.37 ? 175  ARG A CA    1 
ATOM   295  C  C     A ARG A 1  49  ? 9.554   -12.839 -22.799 0.50 10.18 ? 175  ARG A C     1 
ATOM   296  C  C     B ARG A 1  49  ? 9.560   -12.837 -22.800 0.50 10.18 ? 175  ARG A C     1 
ATOM   297  O  O     A ARG A 1  49  ? 9.797   -13.668 -21.912 0.50 9.78  ? 175  ARG A O     1 
ATOM   298  O  O     B ARG A 1  49  ? 9.812   -13.665 -21.913 0.50 9.79  ? 175  ARG A O     1 
ATOM   299  C  CB    A ARG A 1  49  ? 10.858  -12.950 -24.953 0.50 14.33 ? 175  ARG A CB    1 
ATOM   300  C  CB    B ARG A 1  49  ? 10.858  -12.946 -24.956 0.50 14.33 ? 175  ARG A CB    1 
ATOM   301  C  CG    A ARG A 1  49  ? 11.043  -13.636 -26.321 0.50 14.31 ? 175  ARG A CG    1 
ATOM   302  C  CG    B ARG A 1  49  ? 11.042  -13.632 -26.323 0.50 14.31 ? 175  ARG A CG    1 
ATOM   303  C  CD    A ARG A 1  49  ? 12.327  -13.169 -27.023 0.50 17.92 ? 175  ARG A CD    1 
ATOM   304  C  CD    B ARG A 1  49  ? 12.328  -13.167 -27.023 0.50 17.92 ? 175  ARG A CD    1 
ATOM   305  N  NE    A ARG A 1  49  ? 13.481  -13.982 -26.649 0.50 28.05 ? 175  ARG A NE    1 
ATOM   306  N  NE    B ARG A 1  49  ? 13.481  -13.982 -26.650 0.50 28.06 ? 175  ARG A NE    1 
ATOM   307  C  CZ    . ARG A 1  49  ? 14.522  -13.561 -25.925 1.00 37.87 ? 175  ARG A CZ    1 
ATOM   308  N  NH1   . ARG A 1  49  ? 14.588  -12.294 -25.491 1.00 28.61 ? 175  ARG A NH1   1 
ATOM   309  N  NH2   . ARG A 1  49  ? 15.521  -14.413 -25.639 1.00 20.87 ? 175  ARG A NH2   1 
ATOM   310  N  N     . LEU A 1  50  ? 9.297   -11.556 -22.546 1.00 9.79  ? 176  LEU A N     1 
ATOM   311  C  CA    . LEU A 1  50  ? 9.250   -11.039 -21.166 1.00 9.76  ? 176  LEU A CA    1 
ATOM   312  C  C     . LEU A 1  50  ? 8.226   -11.839 -20.391 1.00 9.48  ? 176  LEU A C     1 
ATOM   313  O  O     . LEU A 1  50  ? 8.498   -12.318 -19.286 1.00 8.32  ? 176  LEU A O     1 
ATOM   314  C  CB    . LEU A 1  50  ? 8.858   -9.545  -21.119 1.00 8.75  ? 176  LEU A CB    1 
ATOM   315  C  CG    . LEU A 1  50  ? 8.630   -8.921  -19.722 1.00 10.78 ? 176  LEU A CG    1 
ATOM   316  C  CD1   . LEU A 1  50  ? 9.100   -7.459  -19.721 1.00 12.68 ? 176  LEU A CD1   1 
ATOM   317  C  CD2   . LEU A 1  50  ? 7.146   -8.999  -19.235 1.00 9.39  ? 176  LEU A CD2   1 
ATOM   318  N  N     . LEU A 1  51  ? 7.053   -12.010 -20.993 1.00 8.23  ? 177  LEU A N     1 
ATOM   319  C  CA    . LEU A 1  51  ? 5.976   -12.760 -20.341 1.00 9.28  ? 177  LEU A CA    1 
ATOM   320  C  C     . LEU A 1  51  ? 6.359   -14.203 -20.052 1.00 7.95  ? 177  LEU A C     1 
ATOM   321  O  O     . LEU A 1  51  ? 6.103   -14.714 -18.960 1.00 5.63  ? 177  LEU A O     1 
ATOM   322  C  CB    . LEU A 1  51  ? 4.670   -12.717 -21.160 1.00 8.66  ? 177  LEU A CB    1 
ATOM   323  C  CG    . LEU A 1  51  ? 3.835   -11.450 -20.999 1.00 14.57 ? 177  LEU A CG    1 
ATOM   324  C  CD1   . LEU A 1  51  ? 2.671   -11.482 -22.007 1.00 11.15 ? 177  LEU A CD1   1 
ATOM   325  C  CD2   . LEU A 1  51  ? 3.303   -11.334 -19.546 1.00 10.06 ? 177  LEU A CD2   1 
ATOM   326  N  N     . THR A 1  52  ? 6.965   -14.871 -21.024 1.00 8.10  ? 178  THR A N     1 
ATOM   327  C  CA    . THR A 1  52  ? 7.327   -16.262 -20.790 1.00 7.42  ? 178  THR A CA    1 
ATOM   328  C  C     . THR A 1  52  ? 8.333   -16.413 -19.648 1.00 8.31  ? 178  THR A C     1 
ATOM   329  O  O     . THR A 1  52  ? 8.152   -17.256 -18.758 1.00 8.45  ? 178  THR A O     1 
ATOM   330  C  CB    . THR A 1  52  ? 7.808   -16.943 -22.082 1.00 11.53 ? 178  THR A CB    1 
ATOM   331  O  OG1   . THR A 1  52  ? 6.662   -17.210 -22.910 1.00 10.52 ? 178  THR A OG1   1 
ATOM   332  C  CG2   . THR A 1  52  ? 8.539   -18.286 -21.766 1.00 9.80  ? 178  THR A CG2   1 
ATOM   333  N  N     . PHE A 1  53  ? 9.368   -15.579 -19.646 1.00 7.24  ? 179  PHE A N     1 
ATOM   334  C  CA    . PHE A 1  53  ? 10.367  -15.641 -18.585 1.00 9.58  ? 179  PHE A CA    1 
ATOM   335  C  C     . PHE A 1  53  ? 9.748   -15.274 -17.226 1.00 7.96  ? 179  PHE A C     1 
ATOM   336  O  O     . PHE A 1  53  ? 10.053  -15.928 -16.222 1.00 8.01  ? 179  PHE A O     1 
ATOM   337  C  CB    . PHE A 1  53  ? 11.569  -14.738 -18.909 1.00 7.52  ? 179  PHE A CB    1 
ATOM   338  C  CG    . PHE A 1  53  ? 12.494  -15.303 -19.953 1.00 8.49  ? 179  PHE A CG    1 
ATOM   339  C  CD1   . PHE A 1  53  ? 12.959  -16.608 -19.848 1.00 8.63  ? 179  PHE A CD1   1 
ATOM   340  C  CD2   . PHE A 1  53  ? 12.885  -14.535 -21.044 1.00 9.51  ? 179  PHE A CD2   1 
ATOM   341  C  CE1   . PHE A 1  53  ? 13.812  -17.150 -20.814 1.00 12.16 ? 179  PHE A CE1   1 
ATOM   342  C  CE2   . PHE A 1  53  ? 13.755  -15.063 -22.022 1.00 11.22 ? 179  PHE A CE2   1 
ATOM   343  C  CZ    . PHE A 1  53  ? 14.226  -16.377 -21.894 1.00 9.88  ? 179  PHE A CZ    1 
ATOM   344  N  N     . CYS A 1  54  ? 8.861   -14.279 -17.196 1.00 5.82  ? 180  CYS A N     1 
ATOM   345  C  CA    . CYS A 1  54  ? 8.148   -13.956 -15.940 1.00 7.05  ? 180  CYS A CA    1 
ATOM   346  C  C     . CYS A 1  54  ? 7.284   -15.113 -15.467 1.00 8.29  ? 180  CYS A C     1 
ATOM   347  O  O     . CYS A 1  54  ? 7.271   -15.426 -14.272 1.00 6.93  ? 180  CYS A O     1 
ATOM   348  C  CB    . CYS A 1  54  ? 7.251   -12.713 -16.083 1.00 7.33  ? 180  CYS A CB    1 
ATOM   349  S  SG    . CYS A 1  54  ? 8.134   -11.142 -16.125 1.00 14.63 ? 180  CYS A SG    1 
ATOM   350  N  N     . ARG A 1  55  ? 6.549   -15.742 -16.394 1.00 6.64  ? 181  ARG A N     1 
ATOM   351  C  CA    . ARG A 1  55  ? 5.704   -16.875 -16.033 1.00 6.61  ? 181  ARG A CA    1 
ATOM   352  C  C     . ARG A 1  55  ? 6.514   -18.061 -15.536 1.00 7.67  ? 181  ARG A C     1 
ATOM   353  O  O     . ARG A 1  55  ? 6.109   -18.725 -14.588 1.00 7.54  ? 181  ARG A O     1 
ATOM   354  C  CB    . ARG A 1  55  ? 4.809   -17.318 -17.190 1.00 5.19  ? 181  ARG A CB    1 
ATOM   355  C  CG    . ARG A 1  55  ? 3.753   -16.288 -17.571 1.00 6.86  ? 181  ARG A CG    1 
ATOM   356  C  CD    . ARG A 1  55  ? 3.238   -16.586 -18.988 1.00 7.93  ? 181  ARG A CD    1 
ATOM   357  N  NE    . ARG A 1  55  ? 2.220   -15.626 -19.421 1.00 8.83  ? 181  ARG A NE    1 
ATOM   358  C  CZ    . ARG A 1  55  ? 1.767   -15.536 -20.667 1.00 10.96 ? 181  ARG A CZ    1 
ATOM   359  N  NH1   . ARG A 1  55  ? 2.241   -16.347 -21.609 1.00 9.31  ? 181  ARG A NH1   1 
ATOM   360  N  NH2   . ARG A 1  55  ? 0.845   -14.630 -20.971 1.00 10.25 ? 181  ARG A NH2   1 
ATOM   361  N  N     . ALA A 1  56  ? 7.635   -18.347 -16.202 1.00 7.38  ? 182  ALA A N     1 
ATOM   362  C  CA    . ALA A 1  56  ? 8.491   -19.451 -15.792 1.00 8.79  ? 182  ALA A CA    1 
ATOM   363  C  C     . ALA A 1  56  ? 9.054   -19.180 -14.394 1.00 9.27  ? 182  ALA A C     1 
ATOM   364  O  O     . ALA A 1  56  ? 9.068   -20.054 -13.527 1.00 7.67  ? 182  ALA A O     1 
ATOM   365  C  CB    . ALA A 1  56  ? 9.622   -19.641 -16.798 1.00 9.63  ? 182  ALA A CB    1 
ATOM   366  N  N     . ALA A 1  57  ? 9.519   -17.953 -14.184 1.00 7.17  ? 183  ALA A N     1 
ATOM   367  C  CA    . ALA A 1  57  ? 9.986   -17.556 -12.866 1.00 8.45  ? 183  ALA A CA    1 
ATOM   368  C  C     . ALA A 1  57  ? 8.893   -17.789 -11.825 1.00 7.85  ? 183  ALA A C     1 
ATOM   369  O  O     . ALA A 1  57  ? 9.154   -18.306 -10.726 1.00 6.68  ? 183  ALA A O     1 
ATOM   370  C  CB    . ALA A 1  57  ? 10.381  -16.082 -12.886 1.00 9.40  ? 183  ALA A CB    1 
ATOM   371  N  N     . SER A 1  58  ? 7.664   -17.397 -12.172 1.00 6.03  ? 184  SER A N     1 
ATOM   372  C  CA    A SER A 1  58  ? 6.552   -17.438 -11.230 0.60 7.40  ? 184  SER A CA    1 
ATOM   373  C  CA    B SER A 1  58  ? 6.566   -17.440 -11.204 0.40 7.41  ? 184  SER A CA    1 
ATOM   374  C  C     . SER A 1  58  ? 6.189   -18.880 -10.856 1.00 8.59  ? 184  SER A C     1 
ATOM   375  O  O     . SER A 1  58  ? 5.832   -19.184 -9.709  1.00 6.16  ? 184  SER A O     1 
ATOM   376  C  CB    A SER A 1  58  ? 5.346   -16.736 -11.846 0.60 7.47  ? 184  SER A CB    1 
ATOM   377  C  CB    B SER A 1  58  ? 5.345   -16.666 -11.716 0.40 7.48  ? 184  SER A CB    1 
ATOM   378  O  OG    A SER A 1  58  ? 4.335   -16.573 -10.881 0.60 7.00  ? 184  SER A OG    1 
ATOM   379  O  OG    B SER A 1  58  ? 4.672   -17.376 -12.738 0.40 8.36  ? 184  SER A OG    1 
ATOM   380  N  N     . VAL A 1  59  ? 6.263   -19.763 -11.841 1.00 6.86  ? 185  VAL A N     1 
ATOM   381  C  CA    . VAL A 1  59  ? 6.015   -21.190 -11.602 1.00 6.81  ? 185  VAL A CA    1 
ATOM   382  C  C     . VAL A 1  59  ? 6.964   -21.710 -10.514 1.00 7.37  ? 185  VAL A C     1 
ATOM   383  O  O     . VAL A 1  59  ? 6.555   -22.413 -9.582  1.00 7.09  ? 185  VAL A O     1 
ATOM   384  C  CB    . VAL A 1  59  ? 6.216   -22.010 -12.892 1.00 7.61  ? 185  VAL A CB    1 
ATOM   385  C  CG1   . VAL A 1  59  ? 6.323   -23.523 -12.576 1.00 8.67  ? 185  VAL A CG1   1 
ATOM   386  C  CG2   . VAL A 1  59  ? 5.090   -21.764 -13.874 1.00 8.62  ? 185  VAL A CG2   1 
ATOM   387  N  N     . LEU A 1  60  ? 8.228   -21.331 -10.605 1.00 5.21  ? 186  LEU A N     1 
ATOM   388  C  CA    . LEU A 1  60  ? 9.184   -21.737 -9.573  1.00 6.50  ? 186  LEU A CA    1 
ATOM   389  C  C     . LEU A 1  60  ? 8.858   -21.207 -8.178  1.00 9.92  ? 186  LEU A C     1 
ATOM   390  O  O     . LEU A 1  60  ? 9.108   -21.896 -7.182  1.00 7.32  ? 186  LEU A O     1 
ATOM   391  C  CB    . LEU A 1  60  ? 10.613  -21.343 -9.949  1.00 7.67  ? 186  LEU A CB    1 
ATOM   392  C  CG    . LEU A 1  60  ? 11.140  -21.930 -11.264 1.00 9.92  ? 186  LEU A CG    1 
ATOM   393  C  CD1   . LEU A 1  60  ? 12.596  -21.550 -11.444 1.00 11.08 ? 186  LEU A CD1   1 
ATOM   394  C  CD2   . LEU A 1  60  ? 10.968  -23.425 -11.224 1.00 11.33 ? 186  LEU A CD2   1 
ATOM   395  N  N     . LYS A 1  61  ? 8.331   -19.984 -8.099  1.00 7.10  ? 187  LYS A N     1 
ATOM   396  C  CA    . LYS A 1  61  ? 7.947   -19.411 -6.816  1.00 6.53  ? 187  LYS A CA    1 
ATOM   397  C  C     . LYS A 1  61  ? 6.801   -20.197 -6.184  1.00 5.33  ? 187  LYS A C     1 
ATOM   398  O  O     . LYS A 1  61  ? 6.641   -20.228 -4.959  1.00 6.54  ? 187  LYS A O     1 
ATOM   399  C  CB    . LYS A 1  61  ? 7.469   -17.957 -6.991  1.00 8.19  ? 187  LYS A CB    1 
ATOM   400  C  CG    . LYS A 1  61  ? 8.421   -17.029 -7.705  1.00 6.02  ? 187  LYS A CG    1 
ATOM   401  C  CD    . LYS A 1  61  ? 7.834   -15.597 -7.815  1.00 7.96  ? 187  LYS A CD    1 
ATOM   402  C  CE    . LYS A 1  61  ? 8.646   -14.773 -8.808  1.00 7.22  ? 187  LYS A CE    1 
ATOM   403  N  NZ    . LYS A 1  61  ? 8.086   -13.365 -8.960  1.00 10.75 ? 187  LYS A NZ    1 
ATOM   404  N  N     . ALA A 1  62  ? 5.999   -20.831 -7.030  1.00 7.34  ? 188  ALA A N     1 
ATOM   405  C  CA    . ALA A 1  62  ? 4.825   -21.556 -6.563  1.00 7.38  ? 188  ALA A CA    1 
ATOM   406  C  C     . ALA A 1  62  ? 5.129   -23.003 -6.143  1.00 9.86  ? 188  ALA A C     1 
ATOM   407  O  O     . ALA A 1  62  ? 4.252   -23.691 -5.610  1.00 8.71  ? 188  ALA A O     1 
ATOM   408  C  CB    . ALA A 1  62  ? 3.736   -21.541 -7.644  1.00 9.20  ? 188  ALA A CB    1 
ATOM   409  N  N     . LEU A 1  63  ? 6.347   -23.462 -6.409  1.00 8.85  ? 189  LEU A N     1 
ATOM   410  C  CA    . LEU A 1  63  ? 6.721   -24.842 -6.064  1.00 9.07  ? 189  LEU A CA    1 
ATOM   411  C  C     . LEU A 1  63  ? 6.898   -25.025 -4.567  1.00 11.06 ? 189  LEU A C     1 
ATOM   412  O  O     . LEU A 1  63  ? 7.266   -24.101 -3.883  1.00 7.43  ? 189  LEU A O     1 
ATOM   413  C  CB    . LEU A 1  63  ? 8.010   -25.240 -6.783  1.00 9.86  ? 189  LEU A CB    1 
ATOM   414  C  CG    . LEU A 1  63  ? 7.908   -25.441 -8.294  1.00 10.87 ? 189  LEU A CG    1 
ATOM   415  C  CD1   . LEU A 1  63  ? 9.281   -25.756 -8.839  1.00 10.97 ? 189  LEU A CD1   1 
ATOM   416  C  CD2   . LEU A 1  63  ? 6.927   -26.550 -8.640  1.00 12.66 ? 189  LEU A CD2   1 
ATOM   417  N  N     . PRO A 1  64  ? 6.654   -26.249 -4.057  1.00 9.15  ? 190  PRO A N     1 
ATOM   418  C  CA    . PRO A 1  64  ? 6.665   -26.479 -2.614  1.00 8.93  ? 190  PRO A CA    1 
ATOM   419  C  C     . PRO A 1  64  ? 8.062   -26.769 -2.053  1.00 7.28  ? 190  PRO A C     1 
ATOM   420  O  O     . PRO A 1  64  ? 8.203   -26.857 -0.837  1.00 7.75  ? 190  PRO A O     1 
ATOM   421  C  CB    . PRO A 1  64  ? 5.772   -27.719 -2.460  1.00 13.43 ? 190  PRO A CB    1 
ATOM   422  C  CG    . PRO A 1  64  ? 6.026   -28.496 -3.718  1.00 13.44 ? 190  PRO A CG    1 
ATOM   423  C  CD    . PRO A 1  64  ? 6.185   -27.432 -4.803  1.00 9.54  ? 190  PRO A CD    1 
ATOM   424  N  N     . SER A 1  65  ? 9.070   -26.903 -2.909  1.00 9.62  ? 191  SER A N     1 
ATOM   425  C  CA    . SER A 1  65  ? 10.429  -27.186 -2.436  1.00 9.69  ? 191  SER A CA    1 
ATOM   426  C  C     . SER A 1  65  ? 11.433  -26.797 -3.521  1.00 10.08 ? 191  SER A C     1 
ATOM   427  O  O     . SER A 1  65  ? 11.022  -26.442 -4.621  1.00 8.04  ? 191  SER A O     1 
ATOM   428  C  CB    . SER A 1  65  ? 10.539  -28.682 -2.105  1.00 10.84 ? 191  SER A CB    1 
ATOM   429  O  OG    . SER A 1  65  ? 10.463  -29.394 -3.310  1.00 13.27 ? 191  SER A OG    1 
ATOM   430  N  N     . PRO A 1  66  ? 12.757  -26.864 -3.227  1.00 8.68  ? 192  PRO A N     1 
ATOM   431  C  CA    . PRO A 1  66  ? 13.709  -26.431 -4.251  1.00 8.44  ? 192  PRO A CA    1 
ATOM   432  C  C     . PRO A 1  66  ? 13.765  -27.366 -5.456  1.00 12.35 ? 192  PRO A C     1 
ATOM   433  O  O     . PRO A 1  66  ? 13.592  -28.593 -5.336  1.00 10.58 ? 192  PRO A O     1 
ATOM   434  C  CB    . PRO A 1  66  ? 15.057  -26.434 -3.510  1.00 8.63  ? 192  PRO A CB    1 
ATOM   435  C  CG    . PRO A 1  66  ? 14.697  -26.279 -2.056  1.00 7.45  ? 192  PRO A CG    1 
ATOM   436  C  CD    . PRO A 1  66  ? 13.431  -27.113 -1.939  1.00 9.71  ? 192  PRO A CD    1 
ATOM   437  N  N     . VAL A 1  67  ? 13.981  -26.784 -6.631  1.00 9.87  ? 193  VAL A N     1 
ATOM   438  C  CA    . VAL A 1  67  ? 14.347  -27.603 -7.776  1.00 10.80 ? 193  VAL A CA    1 
ATOM   439  C  C     . VAL A 1  67  ? 15.827  -27.974 -7.641  1.00 13.64 ? 193  VAL A C     1 
ATOM   440  O  O     . VAL A 1  67  ? 16.679  -27.096 -7.546  1.00 10.61 ? 193  VAL A O     1 
ATOM   441  C  CB    . VAL A 1  67  ? 14.137  -26.851 -9.088  1.00 13.82 ? 193  VAL A CB    1 
ATOM   442  C  CG1   . VAL A 1  67  ? 14.719  -27.646 -10.281 1.00 11.31 ? 193  VAL A CG1   1 
ATOM   443  C  CG2   . VAL A 1  67  ? 12.658  -26.544 -9.275  1.00 7.99  ? 193  VAL A CG2   1 
ATOM   444  N  N     . THR A 1  68  ? 16.131  -29.268 -7.645  1.00 15.75 ? 194  THR A N     1 
ATOM   445  C  CA    . THR A 1  68  ? 17.516  -29.707 -7.492  1.00 15.47 ? 194  THR A CA    1 
ATOM   446  C  C     . THR A 1  68  ? 18.025  -30.444 -8.729  1.00 19.67 ? 194  THR A C     1 
ATOM   447  O  O     . THR A 1  68  ? 19.225  -30.576 -8.937  1.00 18.31 ? 194  THR A O     1 
ATOM   448  C  CB    . THR A 1  68  ? 17.677  -30.628 -6.276  1.00 15.05 ? 194  THR A CB    1 
ATOM   449  O  OG1   . THR A 1  68  ? 16.801  -31.750 -6.418  1.00 17.93 ? 194  THR A OG1   1 
ATOM   450  C  CG2   . THR A 1  68  ? 17.303  -29.874 -4.998  1.00 22.32 ? 194  THR A CG2   1 
ATOM   451  N  N     . THR A 1  69  ? 17.108  -30.932 -9.545  1.00 19.22 ? 195  THR A N     1 
ATOM   452  C  CA    . THR A 1  69  ? 17.501  -31.663 -10.741 1.00 21.48 ? 195  THR A CA    1 
ATOM   453  C  C     . THR A 1  69  ? 16.621  -31.246 -11.900 1.00 20.66 ? 195  THR A C     1 
ATOM   454  O  O     . THR A 1  69  ? 15.456  -30.913 -11.707 1.00 17.55 ? 195  THR A O     1 
ATOM   455  C  CB    . THR A 1  69  ? 17.359  -33.188 -10.532 1.00 24.38 ? 195  THR A CB    1 
ATOM   456  O  OG1   . THR A 1  69  ? 15.972  -33.538 -10.473 1.00 25.31 ? 195  THR A OG1   1 
ATOM   457  C  CG2   . THR A 1  69  ? 18.030  -33.618 -9.238  1.00 28.54 ? 195  THR A CG2   1 
ATOM   458  N  N     . LEU A 1  70  ? 17.180  -31.295 -13.104 1.00 21.91 ? 196  LEU A N     1 
ATOM   459  C  CA    . LEU A 1  70  ? 16.482  -30.867 -14.307 1.00 23.57 ? 196  LEU A CA    1 
ATOM   460  C  C     . LEU A 1  70  ? 15.174  -31.616 -14.548 1.00 22.42 ? 196  LEU A C     1 
ATOM   461  O  O     . LEU A 1  70  ? 14.212  -31.050 -15.067 1.00 24.51 ? 196  LEU A O     1 
ATOM   462  C  CB    . LEU A 1  70  ? 17.407  -31.004 -15.519 1.00 22.58 ? 196  LEU A CB    1 
ATOM   463  C  CG    . LEU A 1  70  ? 17.028  -30.201 -16.757 1.00 33.64 ? 196  LEU A CG    1 
ATOM   464  C  CD1   . LEU A 1  70  ? 17.033  -28.715 -16.389 1.00 22.97 ? 196  LEU A CD1   1 
ATOM   465  C  CD2   . LEU A 1  70  ? 17.969  -30.489 -17.930 1.00 30.17 ? 196  LEU A CD2   1 
ATOM   466  N  N     . SER A 1  71  ? 15.121  -32.888 -14.164 1.00 20.45 ? 197  SER A N     1 
ATOM   467  C  CA    . SER A 1  71  ? 13.917  -33.688 -14.416 1.00 27.73 ? 197  SER A CA    1 
ATOM   468  C  C     . SER A 1  71  ? 12.675  -33.141 -13.705 1.00 26.23 ? 197  SER A C     1 
ATOM   469  O  O     . SER A 1  71  ? 11.541  -33.397 -14.136 1.00 23.15 ? 197  SER A O     1 
ATOM   470  C  CB    . SER A 1  71  ? 14.142  -35.164 -14.048 1.00 23.89 ? 197  SER A CB    1 
ATOM   471  O  OG    . SER A 1  71  ? 14.418  -35.294 -12.665 1.00 28.48 ? 197  SER A OG    1 
ATOM   472  N  N     . GLN A 1  72  ? 12.887  -32.379 -12.631 1.00 22.37 ? 198  GLN A N     1 
ATOM   473  C  CA    . GLN A 1  72  ? 11.780  -31.780 -11.890 1.00 22.52 ? 198  GLN A CA    1 
ATOM   474  C  C     . GLN A 1  72  ? 11.075  -30.666 -12.680 1.00 15.15 ? 198  GLN A C     1 
ATOM   475  O  O     . GLN A 1  72  ? 10.008  -30.219 -12.275 1.00 18.49 ? 198  GLN A O     1 
ATOM   476  C  CB    . GLN A 1  72  ? 12.245  -31.272 -10.516 1.00 23.86 ? 198  GLN A CB    1 
ATOM   477  C  CG    . GLN A 1  72  ? 12.773  -32.389 -9.619  1.00 21.27 ? 198  GLN A CG    1 
ATOM   478  C  CD    . GLN A 1  72  ? 13.498  -31.897 -8.377  1.00 25.40 ? 198  GLN A CD    1 
ATOM   479  O  OE1   . GLN A 1  72  ? 14.150  -30.846 -8.384  1.00 20.32 ? 198  GLN A OE1   1 
ATOM   480  N  NE2   . GLN A 1  72  ? 13.407  -32.677 -7.302  1.00 30.37 ? 198  GLN A NE2   1 
ATOM   481  N  N     . LEU A 1  73  ? 11.660  -30.231 -13.799 1.00 16.09 ? 199  LEU A N     1 
ATOM   482  C  CA    . LEU A 1  73  ? 11.017  -29.236 -14.677 1.00 14.07 ? 199  LEU A CA    1 
ATOM   483  C  C     . LEU A 1  73  ? 10.029  -29.871 -15.666 1.00 22.37 ? 199  LEU A C     1 
ATOM   484  O  O     . LEU A 1  73  ? 9.166   -29.196 -16.236 1.00 18.16 ? 199  LEU A O     1 
ATOM   485  C  CB    . LEU A 1  73  ? 12.063  -28.443 -15.457 1.00 17.04 ? 199  LEU A CB    1 
ATOM   486  C  CG    . LEU A 1  73  ? 12.995  -27.553 -14.644 1.00 17.10 ? 199  LEU A CG    1 
ATOM   487  C  CD1   . LEU A 1  73  ? 13.886  -26.795 -15.573 1.00 12.93 ? 199  LEU A CD1   1 
ATOM   488  C  CD2   . LEU A 1  73  ? 12.202  -26.593 -13.726 1.00 12.38 ? 199  LEU A CD2   1 
ATOM   489  N  N     . GLN A 1  74  ? 10.164  -31.178 -15.870 1.00 25.78 ? 200  GLN A N     1 
ATOM   490  C  CA    . GLN A 1  74  ? 9.283   -31.911 -16.779 1.00 19.46 ? 200  GLN A CA    1 
ATOM   491  C  C     . GLN A 1  74  ? 7.815   -31.701 -16.441 1.00 16.21 ? 200  GLN A C     1 
ATOM   492  O  O     . GLN A 1  74  ? 7.394   -31.829 -15.291 1.00 22.62 ? 200  GLN A O     1 
ATOM   493  C  CB    . GLN A 1  74  ? 9.619   -33.410 -16.751 1.00 26.71 ? 200  GLN A CB    1 
ATOM   494  C  CG    . GLN A 1  74  ? 10.918  -33.758 -17.447 1.00 28.81 ? 200  GLN A CG    1 
ATOM   495  N  N     . GLY A 1  75  ? 7.031   -31.358 -17.449 1.00 24.69 ? 201  GLY A N     1 
ATOM   496  C  CA    . GLY A 1  75  ? 5.617   -31.143 -17.225 1.00 28.60 ? 201  GLY A CA    1 
ATOM   497  C  C     . GLY A 1  75  ? 5.243   -29.819 -16.558 1.00 29.67 ? 201  GLY A C     1 
ATOM   498  O  O     . GLY A 1  75  ? 4.060   -29.556 -16.355 1.00 25.04 ? 201  GLY A O     1 
ATOM   499  N  N     . LEU A 1  76  ? 6.224   -28.994 -16.187 1.00 22.19 ? 202  LEU A N     1 
ATOM   500  C  CA    . LEU A 1  76  ? 5.895   -27.668 -15.645 1.00 17.86 ? 202  LEU A CA    1 
ATOM   501  C  C     . LEU A 1  76  ? 5.581   -26.718 -16.785 1.00 12.34 ? 202  LEU A C     1 
ATOM   502  O  O     . LEU A 1  76  ? 6.328   -26.638 -17.756 1.00 14.25 ? 202  LEU A O     1 
ATOM   503  C  CB    . LEU A 1  76  ? 7.044   -27.091 -14.802 1.00 16.02 ? 202  LEU A CB    1 
ATOM   504  C  CG    . LEU A 1  76  ? 7.355   -27.840 -13.508 1.00 14.54 ? 202  LEU A CG    1 
ATOM   505  C  CD1   . LEU A 1  76  ? 8.491   -27.139 -12.753 1.00 16.70 ? 202  LEU A CD1   1 
ATOM   506  C  CD2   . LEU A 1  76  ? 6.110   -27.969 -12.636 1.00 15.43 ? 202  LEU A CD2   1 
ATOM   507  N  N     . PRO A 1  77  ? 4.489   -25.960 -16.661 1.00 13.23 ? 203  PRO A N     1 
ATOM   508  C  CA    . PRO A 1  77  ? 4.163   -25.028 -17.735 1.00 12.11 ? 203  PRO A CA    1 
ATOM   509  C  C     . PRO A 1  77  ? 5.202   -23.911 -17.836 1.00 15.87 ? 203  PRO A C     1 
ATOM   510  O  O     . PRO A 1  77  ? 5.800   -23.551 -16.817 1.00 10.96 ? 203  PRO A O     1 
ATOM   511  C  CB    . PRO A 1  77  ? 2.800   -24.477 -17.315 1.00 11.71 ? 203  PRO A CB    1 
ATOM   512  C  CG    . PRO A 1  77  ? 2.769   -24.647 -15.845 1.00 16.06 ? 203  PRO A CG    1 
ATOM   513  C  CD    . PRO A 1  77  ? 3.521   -25.906 -15.559 1.00 12.11 ? 203  PRO A CD    1 
ATOM   514  N  N     . HIS A 1  78  ? 5.419   -23.427 -19.064 1.00 11.80 ? 204  HIS A N     1 
ATOM   515  C  CA    . HIS A 1  78  ? 6.319   -22.318 -19.387 1.00 11.29 ? 204  HIS A CA    1 
ATOM   516  C  C     . HIS A 1  78  ? 7.803   -22.638 -19.348 1.00 13.40 ? 204  HIS A C     1 
ATOM   517  O  O     . HIS A 1  78  ? 8.632   -21.743 -19.494 1.00 13.48 ? 204  HIS A O     1 
ATOM   518  C  CB    . HIS A 1  78  ? 5.966   -21.078 -18.554 1.00 9.24  ? 204  HIS A CB    1 
ATOM   519  C  CG    . HIS A 1  78  ? 4.507   -20.776 -18.579 1.00 11.75 ? 204  HIS A CG    1 
ATOM   520  N  ND1   . HIS A 1  78  ? 3.869   -20.294 -19.695 1.00 13.13 ? 204  HIS A ND1   1 
ATOM   521  C  CD2   . HIS A 1  78  ? 3.538   -20.954 -17.643 1.00 13.27 ? 204  HIS A CD2   1 
ATOM   522  C  CE1   . HIS A 1  78  ? 2.575   -20.158 -19.447 1.00 12.29 ? 204  HIS A CE1   1 
ATOM   523  N  NE2   . HIS A 1  78  ? 2.355   -20.555 -18.204 1.00 13.30 ? 204  HIS A NE2   1 
ATOM   524  N  N     . PHE A 1  79  ? 8.141   -23.913 -19.171 1.00 13.01 ? 205  PHE A N     1 
ATOM   525  C  CA    . PHE A 1  79  ? 9.531   -24.330 -19.277 1.00 12.20 ? 205  PHE A CA    1 
ATOM   526  C  C     . PHE A 1  79  ? 9.801   -25.107 -20.546 1.00 14.88 ? 205  PHE A C     1 
ATOM   527  O  O     . PHE A 1  79  ? 9.515   -26.294 -20.620 1.00 24.56 ? 205  PHE A O     1 
ATOM   528  C  CB    . PHE A 1  79  ? 9.970   -25.135 -18.061 1.00 9.21  ? 205  PHE A CB    1 
ATOM   529  C  CG    . PHE A 1  79  ? 10.343  -24.261 -16.898 1.00 13.99 ? 205  PHE A CG    1 
ATOM   530  C  CD1   . PHE A 1  79  ? 11.652  -23.830 -16.739 1.00 10.47 ? 205  PHE A CD1   1 
ATOM   531  C  CD2   . PHE A 1  79  ? 9.372   -23.811 -16.017 1.00 12.25 ? 205  PHE A CD2   1 
ATOM   532  C  CE1   . PHE A 1  79  ? 11.999  -23.007 -15.695 1.00 9.60  ? 205  PHE A CE1   1 
ATOM   533  C  CE2   . PHE A 1  79  ? 9.713   -22.962 -14.967 1.00 11.09 ? 205  PHE A CE2   1 
ATOM   534  C  CZ    . PHE A 1  79  ? 11.026  -22.567 -14.810 1.00 11.40 ? 205  PHE A CZ    1 
ATOM   535  N  N     . GLY A 1  80  ? 10.355  -24.419 -21.534 1.00 15.18 ? 206  GLY A N     1 
ATOM   536  C  CA    . GLY A 1  80  ? 10.757  -25.059 -22.773 1.00 19.03 ? 206  GLY A CA    1 
ATOM   537  C  C     . GLY A 1  80  ? 12.266  -25.142 -22.825 1.00 16.57 ? 206  GLY A C     1 
ATOM   538  O  O     . GLY A 1  80  ? 12.934  -25.167 -21.784 1.00 17.21 ? 206  GLY A O     1 
ATOM   539  N  N     . GLU A 1  81  ? 12.816  -25.156 -24.033 1.00 12.49 ? 207  GLU A N     1 
ATOM   540  C  CA    . GLU A 1  81  ? 14.251  -25.341 -24.173 1.00 17.15 ? 207  GLU A CA    1 
ATOM   541  C  C     . GLU A 1  81  ? 15.063  -24.222 -23.521 1.00 16.15 ? 207  GLU A C     1 
ATOM   542  O  O     . GLU A 1  81  ? 16.078  -24.483 -22.863 1.00 18.48 ? 207  GLU A O     1 
ATOM   543  C  CB    . GLU A 1  81  ? 14.637  -25.483 -25.656 1.00 22.53 ? 207  GLU A CB    1 
ATOM   544  C  CG    . GLU A 1  81  ? 16.142  -25.651 -25.884 1.00 31.40 ? 207  GLU A CG    1 
ATOM   545  C  CD    . GLU A 1  81  ? 16.545  -25.670 -27.365 1.00 47.95 ? 207  GLU A CD    1 
ATOM   546  O  OE1   . GLU A 1  81  ? 15.667  -25.545 -28.254 1.00 46.86 ? 207  GLU A OE1   1 
ATOM   547  O  OE2   . GLU A 1  81  ? 17.756  -25.816 -27.638 1.00 61.12 ? 207  GLU A OE2   1 
ATOM   548  N  N     . HIS A 1  82  ? 14.631  -22.981 -23.697 1.00 15.04 ? 208  HIS A N     1 
ATOM   549  C  CA    . HIS A 1  82  ? 15.413  -21.842 -23.207 1.00 12.96 ? 208  HIS A CA    1 
ATOM   550  C  C     . HIS A 1  82  ? 15.426  -21.748 -21.669 1.00 13.88 ? 208  HIS A C     1 
ATOM   551  O  O     . HIS A 1  82  ? 16.499  -21.743 -21.047 1.00 14.33 ? 208  HIS A O     1 
ATOM   552  C  CB    . HIS A 1  82  ? 14.941  -20.539 -23.870 1.00 12.57 ? 208  HIS A CB    1 
ATOM   553  C  CG    . HIS A 1  82  ? 15.958  -19.440 -23.860 1.00 14.44 ? 208  HIS A CG    1 
ATOM   554  N  ND1   . HIS A 1  82  ? 16.013  -18.472 -24.838 1.00 13.25 ? 208  HIS A ND1   1 
ATOM   555  C  CD2   . HIS A 1  82  ? 16.943  -19.137 -22.979 1.00 14.96 ? 208  HIS A CD2   1 
ATOM   556  C  CE1   . HIS A 1  82  ? 16.994  -17.630 -24.574 1.00 11.32 ? 208  HIS A CE1   1 
ATOM   557  N  NE2   . HIS A 1  82  ? 17.571  -18.008 -23.445 1.00 16.31 ? 208  HIS A NE2   1 
ATOM   558  N  N     . SER A 1  83  ? 14.253  -21.695 -21.034 1.00 10.89 ? 209  SER A N     1 
ATOM   559  C  CA    A SER A 1  83  ? 14.196  -21.557 -19.580 0.60 12.68 ? 209  SER A CA    1 
ATOM   560  C  CA    B SER A 1  83  ? 14.215  -21.541 -19.581 0.40 12.68 ? 209  SER A CA    1 
ATOM   561  C  C     . SER A 1  83  ? 14.778  -22.768 -18.876 1.00 13.43 ? 209  SER A C     1 
ATOM   562  O  O     . SER A 1  83  ? 15.373  -22.652 -17.803 1.00 11.41 ? 209  SER A O     1 
ATOM   563  C  CB    A SER A 1  83  ? 12.758  -21.336 -19.129 0.60 11.84 ? 209  SER A CB    1 
ATOM   564  C  CB    B SER A 1  83  ? 12.801  -21.226 -19.083 0.40 11.86 ? 209  SER A CB    1 
ATOM   565  O  OG    A SER A 1  83  ? 12.237  -20.191 -19.771 0.60 10.97 ? 209  SER A OG    1 
ATOM   566  O  OG    B SER A 1  83  ? 11.890  -22.246 -19.436 0.40 11.51 ? 209  SER A OG    1 
ATOM   567  N  N     . SER A 1  84  ? 14.601  -23.940 -19.481 1.00 10.86 ? 210  SER A N     1 
ATOM   568  C  CA    . SER A 1  84  ? 15.168  -25.160 -18.894 1.00 11.60 ? 210  SER A CA    1 
ATOM   569  C  C     . SER A 1  84  ? 16.680  -25.133 -18.928 1.00 14.04 ? 210  SER A C     1 
ATOM   570  O  O     . SER A 1  84  ? 17.330  -25.591 -17.982 1.00 16.62 ? 210  SER A O     1 
ATOM   571  C  CB    . SER A 1  84  ? 14.655  -26.426 -19.586 1.00 15.25 ? 210  SER A CB    1 
ATOM   572  O  OG    . SER A 1  84  ? 13.278  -26.572 -19.314 1.00 16.12 ? 210  SER A OG    1 
ATOM   573  N  N     . ARG A 1  85  ? 17.236  -24.584 -20.006 1.00 16.90 ? 211  ARG A N     1 
ATOM   574  C  CA    . ARG A 1  85  ? 18.687  -24.500 -20.139 1.00 17.23 ? 211  ARG A CA    1 
ATOM   575  C  C     . ARG A 1  85  ? 19.271  -23.520 -19.116 1.00 16.86 ? 211  ARG A C     1 
ATOM   576  O  O     . ARG A 1  85  ? 20.342  -23.753 -18.533 1.00 14.12 ? 211  ARG A O     1 
ATOM   577  C  CB    . ARG A 1  85  ? 19.077  -24.125 -21.573 1.00 15.19 ? 211  ARG A CB    1 
ATOM   578  C  CG    . ARG A 1  85  ? 20.579  -24.189 -21.839 1.00 22.33 ? 211  ARG A CG    1 
ATOM   579  C  CD    . ARG A 1  85  ? 21.196  -22.806 -21.977 1.00 34.48 ? 211  ARG A CD    1 
ATOM   580  N  NE    . ARG A 1  85  ? 20.626  -22.030 -23.078 1.00 36.72 ? 211  ARG A NE    1 
ATOM   581  C  CZ    . ARG A 1  85  ? 20.496  -20.703 -23.068 1.00 39.26 ? 211  ARG A CZ    1 
ATOM   582  N  NH1   . ARG A 1  85  ? 20.895  -19.992 -22.005 1.00 28.68 ? 211  ARG A NH1   1 
ATOM   583  N  NH2   . ARG A 1  85  ? 19.956  -20.088 -24.118 1.00 37.88 ? 211  ARG A NH2   1 
ATOM   584  N  N     . VAL A 1  86  ? 18.564  -22.422 -18.879 1.00 11.70 ? 212  VAL A N     1 
ATOM   585  C  CA    . VAL A 1  86  ? 18.966  -21.486 -17.837 1.00 13.96 ? 212  VAL A CA    1 
ATOM   586  C  C     . VAL A 1  86  ? 19.041  -22.181 -16.472 1.00 12.05 ? 212  VAL A C     1 
ATOM   587  O  O     . VAL A 1  86  ? 20.035  -22.052 -15.755 1.00 13.88 ? 212  VAL A O     1 
ATOM   588  C  CB    . VAL A 1  86  ? 17.999  -20.291 -17.748 1.00 10.64 ? 212  VAL A CB    1 
ATOM   589  C  CG1   . VAL A 1  86  ? 18.341  -19.422 -16.552 1.00 11.92 ? 212  VAL A CG1   1 
ATOM   590  C  CG2   . VAL A 1  86  ? 18.064  -19.469 -19.026 1.00 16.30 ? 212  VAL A CG2   1 
ATOM   591  N  N     . VAL A 1  87  ? 17.996  -22.922 -16.122 1.00 9.17  ? 213  VAL A N     1 
ATOM   592  C  CA    . VAL A 1  87  ? 17.958  -23.612 -14.836 1.00 9.18  ? 213  VAL A CA    1 
ATOM   593  C  C     . VAL A 1  87  ? 19.046  -24.682 -14.764 1.00 14.83 ? 213  VAL A C     1 
ATOM   594  O  O     . VAL A 1  87  ? 19.690  -24.826 -13.738 1.00 11.47 ? 213  VAL A O     1 
ATOM   595  C  CB    . VAL A 1  87  ? 16.587  -24.237 -14.585 1.00 11.77 ? 213  VAL A CB    1 
ATOM   596  C  CG1   . VAL A 1  87  ? 16.625  -25.205 -13.420 1.00 13.29 ? 213  VAL A CG1   1 
ATOM   597  C  CG2   . VAL A 1  87  ? 15.563  -23.144 -14.317 1.00 11.12 ? 213  VAL A CG2   1 
ATOM   598  N  N     . GLN A 1  88  ? 19.254  -25.401 -15.865 1.00 14.06 ? 214  GLN A N     1 
ATOM   599  C  CA    . GLN A 1  88  ? 20.268  -26.457 -15.917 1.00 14.09 ? 214  GLN A CA    1 
ATOM   600  C  C     . GLN A 1  88  ? 21.665  -25.911 -15.597 1.00 16.87 ? 214  GLN A C     1 
ATOM   601  O  O     . GLN A 1  88  ? 22.418  -26.514 -14.815 1.00 17.69 ? 214  GLN A O     1 
ATOM   602  C  CB    . GLN A 1  88  ? 20.245  -27.157 -17.287 1.00 16.49 ? 214  GLN A CB    1 
ATOM   603  C  CG    . GLN A 1  88  ? 21.311  -28.267 -17.454 1.00 21.07 ? 214  GLN A CG    1 
ATOM   604  C  CD    . GLN A 1  88  ? 21.435  -28.764 -18.898 1.00 42.99 ? 214  GLN A CD    1 
ATOM   605  O  OE1   . GLN A 1  88  ? 20.632  -28.408 -19.770 1.00 30.41 ? 214  GLN A OE1   1 
ATOM   606  N  NE2   . GLN A 1  88  ? 22.453  -29.592 -19.156 1.00 43.52 ? 214  GLN A NE2   1 
ATOM   607  N  N     . GLU A 1  89  ? 22.017  -24.769 -16.183 1.00 13.78 ? 215  GLU A N     1 
ATOM   608  C  CA    . GLU A 1  89  ? 23.337  -24.189 -15.960 1.00 14.91 ? 215  GLU A CA    1 
ATOM   609  C  C     . GLU A 1  89  ? 23.502  -23.684 -14.531 1.00 17.93 ? 215  GLU A C     1 
ATOM   610  O  O     . GLU A 1  89  ? 24.572  -23.829 -13.945 1.00 18.54 ? 215  GLU A O     1 
ATOM   611  C  CB    . GLU A 1  89  ? 23.654  -23.075 -16.975 1.00 17.51 ? 215  GLU A CB    1 
ATOM   612  C  CG    . GLU A 1  89  ? 23.635  -23.573 -18.399 1.00 18.29 ? 215  GLU A CG    1 
ATOM   613  C  CD    . GLU A 1  89  ? 23.997  -22.516 -19.425 1.00 24.42 ? 215  GLU A CD    1 
ATOM   614  O  OE1   . GLU A 1  89  ? 24.366  -21.384 -19.050 1.00 21.54 ? 215  GLU A OE1   1 
ATOM   615  O  OE2   . GLU A 1  89  ? 23.911  -22.840 -20.629 1.00 29.46 ? 215  GLU A OE2   1 
ATOM   616  N  N     . LEU A 1  90  ? 22.446  -23.099 -13.966 1.00 13.45 ? 216  LEU A N     1 
ATOM   617  C  CA    . LEU A 1  90  ? 22.491  -22.676 -12.573 1.00 13.92 ? 216  LEU A CA    1 
ATOM   618  C  C     . LEU A 1  90  ? 22.661  -23.877 -11.649 1.00 14.19 ? 216  LEU A C     1 
ATOM   619  O  O     . LEU A 1  90  ? 23.433  -23.812 -10.704 1.00 17.41 ? 216  LEU A O     1 
ATOM   620  C  CB    . LEU A 1  90  ? 21.228  -21.886 -12.201 1.00 11.49 ? 216  LEU A CB    1 
ATOM   621  C  CG    . LEU A 1  90  ? 21.141  -20.508 -12.860 1.00 11.77 ? 216  LEU A CG    1 
ATOM   622  C  CD1   . LEU A 1  90  ? 19.695  -20.013 -12.922 1.00 10.47 ? 216  LEU A CD1   1 
ATOM   623  C  CD2   . LEU A 1  90  ? 22.003  -19.500 -12.085 1.00 16.16 ? 216  LEU A CD2   1 
ATOM   624  N  N     . LEU A 1  91  ? 21.939  -24.961 -11.932 1.00 12.90 ? 217  LEU A N     1 
ATOM   625  C  CA    . LEU A 1  91  ? 22.026  -26.187 -11.129 1.00 17.07 ? 217  LEU A CA    1 
ATOM   626  C  C     . LEU A 1  91  ? 23.414  -26.827 -11.221 1.00 19.08 ? 217  LEU A C     1 
ATOM   627  O  O     . LEU A 1  91  ? 23.952  -27.290 -10.220 1.00 20.66 ? 217  LEU A O     1 
ATOM   628  C  CB    . LEU A 1  91  ? 20.956  -27.206 -11.540 1.00 17.91 ? 217  LEU A CB    1 
ATOM   629  C  CG    . LEU A 1  91  ? 19.486  -26.882 -11.286 1.00 18.81 ? 217  LEU A CG    1 
ATOM   630  C  CD1   . LEU A 1  91  ? 18.599  -28.000 -11.846 1.00 13.95 ? 217  LEU A CD1   1 
ATOM   631  C  CD2   . LEU A 1  91  ? 19.204  -26.637 -9.796  1.00 16.20 ? 217  LEU A CD2   1 
ATOM   632  N  N     . GLU A 1  92  ? 23.986  -26.819 -12.422 1.00 20.11 ? 218  GLU A N     1 
ATOM   633  C  CA    . GLU A 1  92  ? 25.301  -27.409 -12.685 1.00 21.25 ? 218  GLU A CA    1 
ATOM   634  C  C     . GLU A 1  92  ? 26.499  -26.550 -12.273 1.00 28.83 ? 218  GLU A C     1 
ATOM   635  O  O     . GLU A 1  92  ? 27.502  -27.091 -11.821 1.00 27.77 ? 218  GLU A O     1 
ATOM   636  C  CB    . GLU A 1  92  ? 25.422  -27.743 -14.170 1.00 29.91 ? 218  GLU A CB    1 
ATOM   637  C  CG    . GLU A 1  92  ? 26.445  -28.810 -14.514 1.00 38.85 ? 218  GLU A CG    1 
ATOM   638  C  CD    . GLU A 1  92  ? 26.329  -29.243 -15.963 1.00 51.46 ? 218  GLU A CD    1 
ATOM   639  O  OE1   . GLU A 1  92  ? 27.334  -29.732 -16.527 1.00 63.02 ? 218  GLU A OE1   1 
ATOM   640  O  OE2   . GLU A 1  92  ? 25.225  -29.087 -16.542 1.00 45.25 ? 218  GLU A OE2   1 
ATOM   641  N  N     . HIS A 1  93  ? 26.399  -25.226 -12.416 1.00 19.91 ? 219  HIS A N     1 
ATOM   642  C  CA    . HIS A 1  93  ? 27.555  -24.351 -12.237 1.00 20.77 ? 219  HIS A CA    1 
ATOM   643  C  C     . HIS A 1  93  ? 27.351  -23.189 -11.276 1.00 21.95 ? 219  HIS A C     1 
ATOM   644  O  O     . HIS A 1  93  ? 28.301  -22.463 -10.960 1.00 28.99 ? 219  HIS A O     1 
ATOM   645  C  CB    . HIS A 1  93  ? 28.015  -23.813 -13.600 1.00 24.18 ? 219  HIS A CB    1 
ATOM   646  C  CG    . HIS A 1  93  ? 28.342  -24.892 -14.587 1.00 32.90 ? 219  HIS A CG    1 
ATOM   647  N  ND1   . HIS A 1  93  ? 27.554  -25.166 -15.685 1.00 34.07 ? 219  HIS A ND1   1 
ATOM   648  C  CD2   . HIS A 1  93  ? 29.360  -25.783 -14.623 1.00 37.35 ? 219  HIS A CD2   1 
ATOM   649  C  CE1   . HIS A 1  93  ? 28.077  -26.173 -16.359 1.00 37.61 ? 219  HIS A CE1   1 
ATOM   650  N  NE2   . HIS A 1  93  ? 29.174  -26.565 -15.737 1.00 41.49 ? 219  HIS A NE2   1 
ATOM   651  N  N     . GLY A 1  94  ? 26.116  -22.987 -10.832 1.00 18.96 ? 220  GLY A N     1 
ATOM   652  C  CA    . GLY A 1  94  ? 25.808  -21.911 -9.908  1.00 17.37 ? 220  GLY A CA    1 
ATOM   653  C  C     . GLY A 1  94  ? 25.661  -20.587 -10.626 1.00 20.48 ? 220  GLY A C     1 
ATOM   654  O  O     . GLY A 1  94  ? 25.403  -19.565 -10.006 1.00 17.78 ? 220  GLY A O     1 
ATOM   655  N  N     . VAL A 1  95  ? 25.812  -20.621 -11.946 1.00 18.44 ? 221  VAL A N     1 
ATOM   656  C  CA    . VAL A 1  95  ? 25.810  -19.422 -12.771 1.00 19.54 ? 221  VAL A CA    1 
ATOM   657  C  C     . VAL A 1  95  ? 25.298  -19.772 -14.171 1.00 17.56 ? 221  VAL A C     1 
ATOM   658  O  O     . VAL A 1  95  ? 25.565  -20.868 -14.671 1.00 19.08 ? 221  VAL A O     1 
ATOM   659  C  CB    . VAL A 1  95  ? 27.257  -18.838 -12.853 1.00 26.35 ? 221  VAL A CB    1 
ATOM   660  C  CG1   . VAL A 1  95  ? 27.438  -17.971 -14.059 1.00 30.50 ? 221  VAL A CG1   1 
ATOM   661  C  CG2   . VAL A 1  95  ? 27.597  -18.052 -11.597 1.00 32.53 ? 221  VAL A CG2   1 
ATOM   662  N  N     . CYS A 1  96  ? 24.536  -18.863 -14.788 1.00 13.95 ? 222  CYS A N     1 
ATOM   663  C  CA    . CYS A 1  96  ? 24.095  -19.022 -16.172 1.00 14.44 ? 222  CYS A CA    1 
ATOM   664  C  C     . CYS A 1  96  ? 24.782  -17.972 -17.037 1.00 18.16 ? 222  CYS A C     1 
ATOM   665  O  O     . CYS A 1  96  ? 24.657  -16.770 -16.784 1.00 15.67 ? 222  CYS A O     1 
ATOM   666  C  CB    . CYS A 1  96  ? 22.577  -18.883 -16.293 1.00 13.80 ? 222  CYS A CB    1 
ATOM   667  S  SG    . CYS A 1  96  ? 21.998  -18.789 -17.985 1.00 18.20 ? 222  CYS A SG    1 
ATOM   668  N  N     . GLU A 1  97  ? 25.533  -18.428 -18.035 1.00 13.85 ? 223  GLU A N     1 
ATOM   669  C  CA    . GLU A 1  97  ? 26.376  -17.528 -18.806 1.00 16.62 ? 223  GLU A CA    1 
ATOM   670  C  C     . GLU A 1  97  ? 25.564  -16.424 -19.455 1.00 14.59 ? 223  GLU A C     1 
ATOM   671  O  O     . GLU A 1  97  ? 25.978  -15.261 -19.455 1.00 14.71 ? 223  GLU A O     1 
ATOM   672  C  CB    . GLU A 1  97  ? 27.156  -18.293 -19.882 1.00 17.56 ? 223  GLU A CB    1 
ATOM   673  C  CG    . GLU A 1  97  ? 28.057  -17.392 -20.722 1.00 23.11 ? 223  GLU A CG    1 
ATOM   674  N  N     . GLU A 1  98  ? 24.405  -16.786 -19.999 1.00 14.50 ? 224  GLU A N     1 
ATOM   675  C  CA    . GLU A 1  98  ? 23.576  -15.803 -20.686 1.00 12.91 ? 224  GLU A CA    1 
ATOM   676  C  C     . GLU A 1  98  ? 23.162  -14.702 -19.718 1.00 9.71  ? 224  GLU A C     1 
ATOM   677  O  O     . GLU A 1  98  ? 23.273  -13.506 -20.022 1.00 11.55 ? 224  GLU A O     1 
ATOM   678  C  CB    . GLU A 1  98  ? 22.344  -16.462 -21.312 1.00 13.90 ? 224  GLU A CB    1 
ATOM   679  C  CG    . GLU A 1  98  ? 21.554  -15.453 -22.142 1.00 16.23 ? 224  GLU A CG    1 
ATOM   680  C  CD    . GLU A 1  98  ? 20.208  -15.959 -22.615 1.00 13.94 ? 224  GLU A CD    1 
ATOM   681  O  OE1   . GLU A 1  98  ? 19.847  -17.108 -22.289 1.00 16.03 ? 224  GLU A OE1   1 
ATOM   682  O  OE2   . GLU A 1  98  ? 19.514  -15.182 -23.303 1.00 17.31 ? 224  GLU A OE2   1 
ATOM   683  N  N     . VAL A 1  99  ? 22.743  -15.111 -18.524 1.00 14.60 ? 225  VAL A N     1 
ATOM   684  C  CA    . VAL A 1  99  ? 22.309  -14.168 -17.494 1.00 10.05 ? 225  VAL A CA    1 
ATOM   685  C  C     . VAL A 1  99  ? 23.434  -13.225 -17.061 1.00 11.63 ? 225  VAL A C     1 
ATOM   686  O  O     . VAL A 1  99  ? 23.227  -12.026 -16.908 1.00 13.53 ? 225  VAL A O     1 
ATOM   687  C  CB    . VAL A 1  99  ? 21.725  -14.928 -16.272 1.00 13.73 ? 225  VAL A CB    1 
ATOM   688  C  CG1   . VAL A 1  99  ? 21.428  -13.970 -15.120 1.00 12.37 ? 225  VAL A CG1   1 
ATOM   689  C  CG2   . VAL A 1  99  ? 20.458  -15.701 -16.670 1.00 10.57 ? 225  VAL A CG2   1 
ATOM   690  N  N     . GLU A 1  100 ? 24.636  -13.769 -16.876 1.00 13.70 ? 226  GLU A N     1 
ATOM   691  C  CA    . GLU A 1  100 ? 25.776  -12.953 -16.456 1.00 15.03 ? 226  GLU A CA    1 
ATOM   692  C  C     . GLU A 1  100 ? 26.144  -11.974 -17.550 1.00 12.93 ? 226  GLU A C     1 
ATOM   693  O  O     . GLU A 1  100 ? 26.470  -10.821 -17.283 1.00 15.49 ? 226  GLU A O     1 
ATOM   694  C  CB    . GLU A 1  100 ? 26.964  -13.850 -16.105 1.00 18.04 ? 226  GLU A CB    1 
ATOM   695  C  CG    . GLU A 1  100 ? 26.673  -14.717 -14.893 1.00 16.07 ? 226  GLU A CG    1 
ATOM   696  C  CD    . GLU A 1  100 ? 26.108  -13.884 -13.745 1.00 25.16 ? 226  GLU A CD    1 
ATOM   697  O  OE1   . GLU A 1  100 ? 26.794  -12.921 -13.332 1.00 24.56 ? 226  GLU A OE1   1 
ATOM   698  O  OE2   . GLU A 1  100 ? 24.969  -14.151 -13.282 1.00 19.59 ? 226  GLU A OE2   1 
ATOM   699  N  N     . ARG A 1  101 ? 26.067  -12.438 -18.790 1.00 14.16 ? 227  ARG A N     1 
ATOM   700  C  CA    . ARG A 1  101 ? 26.378  -11.588 -19.930 1.00 15.25 ? 227  ARG A CA    1 
ATOM   701  C  C     . ARG A 1  101 ? 25.395  -10.416 -19.980 1.00 19.00 ? 227  ARG A C     1 
ATOM   702  O  O     . ARG A 1  101 ? 25.789  -9.280  -20.216 1.00 17.92 ? 227  ARG A O     1 
ATOM   703  C  CB    . ARG A 1  101 ? 26.311  -12.409 -21.220 1.00 20.30 ? 227  ARG A CB    1 
ATOM   704  C  CG    . ARG A 1  101 ? 26.746  -11.667 -22.476 1.00 30.63 ? 227  ARG A CG    1 
ATOM   705  C  CD    . ARG A 1  101 ? 27.100  -12.643 -23.607 1.00 35.17 ? 227  ARG A CD    1 
ATOM   706  N  NE    . ARG A 1  101 ? 25.928  -13.328 -24.150 1.00 37.11 ? 227  ARG A NE    1 
ATOM   707  C  CZ    . ARG A 1  101 ? 25.618  -14.599 -23.913 1.00 34.02 ? 227  ARG A CZ    1 
ATOM   708  N  NH1   . ARG A 1  101 ? 26.402  -15.345 -23.146 1.00 38.81 ? 227  ARG A NH1   1 
ATOM   709  N  NH2   . ARG A 1  101 ? 24.528  -15.131 -24.456 1.00 42.21 ? 227  ARG A NH2   1 
ATOM   710  N  N     . VAL A 1  102 ? 24.115  -10.695 -19.760 1.00 13.17 ? 228  VAL A N     1 
ATOM   711  C  CA    . VAL A 1  102 ? 23.129  -9.618  -19.684 1.00 12.59 ? 228  VAL A CA    1 
ATOM   712  C  C     . VAL A 1  102 ? 23.469  -8.651  -18.555 1.00 11.31 ? 228  VAL A C     1 
ATOM   713  O  O     . VAL A 1  102 ? 23.527  -7.443  -18.773 1.00 16.89 ? 228  VAL A O     1 
ATOM   714  C  CB    . VAL A 1  102 ? 21.693  -10.164 -19.484 1.00 12.66 ? 228  VAL A CB    1 
ATOM   715  C  CG1   . VAL A 1  102 ? 20.715  -9.011  -19.155 1.00 12.85 ? 228  VAL A CG1   1 
ATOM   716  C  CG2   . VAL A 1  102 ? 21.243  -10.942 -20.728 1.00 13.20 ? 228  VAL A CG2   1 
ATOM   717  N  N     . ARG A 1  103 ? 23.694  -9.175  -17.351 1.00 13.78 ? 229  ARG A N     1 
ATOM   718  C  CA    . ARG A 1  103 ? 23.965  -8.343  -16.177 1.00 15.15 ? 229  ARG A CA    1 
ATOM   719  C  C     . ARG A 1  103 ? 25.090  -7.343  -16.398 1.00 16.55 ? 229  ARG A C     1 
ATOM   720  O  O     . ARG A 1  103 ? 25.023  -6.198  -15.946 1.00 16.99 ? 229  ARG A O     1 
ATOM   721  C  CB    . ARG A 1  103 ? 24.401  -9.203  -14.988 1.00 14.87 ? 229  ARG A CB    1 
ATOM   722  C  CG    . ARG A 1  103 ? 23.338  -10.025 -14.320 1.00 20.85 ? 229  ARG A CG    1 
ATOM   723  C  CD    . ARG A 1  103 ? 23.917  -10.562 -13.017 1.00 23.45 ? 229  ARG A CD    1 
ATOM   724  N  NE    . ARG A 1  103 ? 23.270  -11.797 -12.581 1.00 33.45 ? 229  ARG A NE    1 
ATOM   725  C  CZ    . ARG A 1  103 ? 22.219  -11.834 -11.771 1.00 32.35 ? 229  ARG A CZ    1 
ATOM   726  N  NH1   . ARG A 1  103 ? 21.694  -10.698 -11.314 1.00 27.04 ? 229  ARG A NH1   1 
ATOM   727  N  NH2   . ARG A 1  103 ? 21.693  -12.998 -11.425 1.00 26.79 ? 229  ARG A NH2   1 
ATOM   728  N  N     . ARG A 1  104 ? 26.146  -7.777  -17.075 1.00 19.00 ? 230  ARG A N     1 
ATOM   729  C  CA    . ARG A 1  104 ? 27.278  -6.866  -17.239 1.00 20.03 ? 230  ARG A CA    1 
ATOM   730  C  C     . ARG A 1  104 ? 27.254  -6.055  -18.539 1.00 27.68 ? 230  ARG A C     1 
ATOM   731  O  O     . ARG A 1  104 ? 28.146  -5.241  -18.777 1.00 25.82 ? 230  ARG A O     1 
ATOM   732  C  CB    . ARG A 1  104 ? 28.608  -7.598  -17.067 1.00 22.50 ? 230  ARG A CB    1 
ATOM   733  C  CG    . ARG A 1  104 ? 28.806  -8.727  -18.007 1.00 22.94 ? 230  ARG A CG    1 
ATOM   734  C  CD    . ARG A 1  104 ? 30.095  -9.500  -17.706 1.00 27.28 ? 230  ARG A CD    1 
ATOM   735  N  NE    . ARG A 1  104 ? 30.297  -10.459 -18.778 1.00 32.64 ? 230  ARG A NE    1 
ATOM   736  C  CZ    . ARG A 1  104 ? 30.193  -11.772 -18.636 1.00 31.31 ? 230  ARG A CZ    1 
ATOM   737  N  NH1   . ARG A 1  104 ? 29.961  -12.299 -17.437 1.00 29.97 ? 230  ARG A NH1   1 
ATOM   738  N  NH2   . ARG A 1  104 ? 30.364  -12.551 -19.690 1.00 39.29 ? 230  ARG A NH2   1 
ATOM   739  N  N     . SER A 1  105 ? 26.236  -6.247  -19.370 1.00 16.45 ? 231  SER A N     1 
ATOM   740  C  CA    . SER A 1  105 ? 26.183  -5.488  -20.609 1.00 21.48 ? 231  SER A CA    1 
ATOM   741  C  C     . SER A 1  105 ? 25.879  -4.019  -20.346 1.00 22.47 ? 231  SER A C     1 
ATOM   742  O  O     . SER A 1  105 ? 25.195  -3.655  -19.381 1.00 17.96 ? 231  SER A O     1 
ATOM   743  C  CB    . SER A 1  105 ? 25.150  -6.070  -21.568 1.00 22.97 ? 231  SER A CB    1 
ATOM   744  O  OG    . SER A 1  105 ? 23.854  -5.910  -21.049 1.00 20.19 ? 231  SER A OG    1 
ATOM   745  N  N     . GLU A 1  106 ? 26.396  -3.159  -21.208 1.00 14.01 ? 232  GLU A N     1 
ATOM   746  C  CA    . GLU A 1  106 ? 26.215  -1.745  -21.006 1.00 18.18 ? 232  GLU A CA    1 
ATOM   747  C  C     . GLU A 1  106 ? 24.760  -1.387  -21.294 1.00 15.30 ? 232  GLU A C     1 
ATOM   748  O  O     . GLU A 1  106 ? 24.170  -0.561  -20.616 1.00 17.22 ? 232  GLU A O     1 
ATOM   749  C  CB    . GLU A 1  106 ? 27.177  -0.977  -21.909 1.00 19.13 ? 232  GLU A CB    1 
ATOM   750  C  CG    . GLU A 1  106 ? 27.153  0.514   -21.690 1.00 23.85 ? 232  GLU A CG    1 
ATOM   751  C  CD    . GLU A 1  106 ? 28.158  1.236   -22.577 1.00 34.47 ? 232  GLU A CD    1 
ATOM   752  O  OE1   . GLU A 1  106 ? 28.640  0.608   -23.551 1.00 31.87 ? 232  GLU A OE1   1 
ATOM   753  O  OE2   . GLU A 1  106 ? 28.460  2.420   -22.291 1.00 30.61 ? 232  GLU A OE2   1 
ATOM   754  N  N     . ARG A 1  107 ? 24.192  -2.044  -22.295 1.00 15.70 ? 233  ARG A N     1 
ATOM   755  C  CA    . ARG A 1  107 ? 22.800  -1.886  -22.665 1.00 17.66 ? 233  ARG A CA    1 
ATOM   756  C  C     . ARG A 1  107 ? 21.863  -2.198  -21.492 1.00 19.47 ? 233  ARG A C     1 
ATOM   757  O  O     . ARG A 1  107 ? 21.014  -1.379  -21.155 1.00 15.33 ? 233  ARG A O     1 
ATOM   758  C  CB    . ARG A 1  107 ? 22.479  -2.778  -23.865 1.00 16.54 ? 233  ARG A CB    1 
ATOM   759  C  CG    . ARG A 1  107 ? 20.993  -2.897  -24.226 1.00 22.74 ? 233  ARG A CG    1 
ATOM   760  C  CD    . ARG A 1  107 ? 20.457  -1.622  -24.859 1.00 17.87 ? 233  ARG A CD    1 
ATOM   761  N  NE    . ARG A 1  107 ? 19.036  -1.746  -25.214 1.00 21.81 ? 233  ARG A NE    1 
ATOM   762  C  CZ    . ARG A 1  107 ? 18.333  -0.797  -25.824 1.00 17.66 ? 233  ARG A CZ    1 
ATOM   763  N  NH1   . ARG A 1  107 ? 18.924  0.340   -26.179 1.00 19.78 ? 233  ARG A NH1   1 
ATOM   764  N  NH2   . ARG A 1  107 ? 17.045  -0.982  -26.099 1.00 14.13 ? 233  ARG A NH2   1 
ATOM   765  N  N     . TYR A 1  108 ? 22.016  -3.367  -20.868 1.00 16.50 ? 234  TYR A N     1 
ATOM   766  C  CA    . TYR A 1  108 ? 21.153  -3.717  -19.743 1.00 13.71 ? 234  TYR A CA    1 
ATOM   767  C  C     . TYR A 1  108 ? 21.295  -2.720  -18.599 1.00 12.85 ? 234  TYR A C     1 
ATOM   768  O  O     . TYR A 1  108 ? 20.304  -2.200  -18.077 1.00 12.35 ? 234  TYR A O     1 
ATOM   769  C  CB    . TYR A 1  108 ? 21.427  -5.155  -19.253 1.00 13.18 ? 234  TYR A CB    1 
ATOM   770  C  CG    . TYR A 1  108 ? 20.707  -5.513  -17.975 1.00 13.54 ? 234  TYR A CG    1 
ATOM   771  C  CD1   . TYR A 1  108 ? 19.389  -6.000  -18.003 1.00 13.28 ? 234  TYR A CD1   1 
ATOM   772  C  CD2   . TYR A 1  108 ? 21.328  -5.362  -16.740 1.00 11.09 ? 234  TYR A CD2   1 
ATOM   773  C  CE1   . TYR A 1  108 ? 18.723  -6.336  -16.822 1.00 17.18 ? 234  TYR A CE1   1 
ATOM   774  C  CE2   . TYR A 1  108 ? 20.673  -5.681  -15.557 1.00 14.77 ? 234  TYR A CE2   1 
ATOM   775  C  CZ    . TYR A 1  108 ? 19.372  -6.172  -15.604 1.00 19.36 ? 234  TYR A CZ    1 
ATOM   776  O  OH    . TYR A 1  108 ? 18.729  -6.482  -14.428 1.00 16.62 ? 234  TYR A OH    1 
ATOM   777  N  N     . GLN A 1  109 ? 22.531  -2.448  -18.209 1.00 12.67 ? 235  GLN A N     1 
ATOM   778  C  CA    . GLN A 1  109 ? 22.790  -1.591  -17.060 1.00 13.37 ? 235  GLN A CA    1 
ATOM   779  C  C     . GLN A 1  109 ? 22.238  -0.180  -17.242 1.00 13.84 ? 235  GLN A C     1 
ATOM   780  O  O     . GLN A 1  109 ? 21.723  0.424   -16.305 1.00 11.39 ? 235  GLN A O     1 
ATOM   781  C  CB    . GLN A 1  109 ? 24.292  -1.551  -16.759 1.00 13.80 ? 235  GLN A CB    1 
ATOM   782  C  CG    . GLN A 1  109 ? 24.810  -2.853  -16.184 1.00 18.05 ? 235  GLN A CG    1 
ATOM   783  C  CD    . GLN A 1  109 ? 26.320  -2.844  -15.906 1.00 34.44 ? 235  GLN A CD    1 
ATOM   784  O  OE1   . GLN A 1  109 ? 26.939  -3.900  -15.771 1.00 32.86 ? 235  GLN A OE1   1 
ATOM   785  N  NE2   . GLN A 1  109 ? 26.906  -1.656  -15.806 1.00 31.36 ? 235  GLN A NE2   1 
ATOM   786  N  N     . THR A 1  110 ? 22.339  0.338   -18.459 1.00 15.04 ? 236  THR A N     1 
ATOM   787  C  CA    . THR A 1  110 ? 21.877  1.694   -18.737 1.00 13.68 ? 236  THR A CA    1 
ATOM   788  C  C     . THR A 1  110 ? 20.351  1.799   -18.887 1.00 12.68 ? 236  THR A C     1 
ATOM   789  O  O     . THR A 1  110 ? 19.727  2.740   -18.378 1.00 10.48 ? 236  THR A O     1 
ATOM   790  C  CB    . THR A 1  110 ? 22.561  2.242   -19.994 1.00 19.30 ? 236  THR A CB    1 
ATOM   791  O  OG1   . THR A 1  110 ? 23.986  2.185   -19.808 1.00 20.67 ? 236  THR A OG1   1 
ATOM   792  C  CG2   . THR A 1  110 ? 22.124  3.692   -20.240 1.00 18.14 ? 236  THR A CG2   1 
ATOM   793  N  N     . MET A 1  111 ? 19.758  0.848   -19.597 1.00 12.54 ? 237  MET A N     1 
ATOM   794  C  CA    . MET A 1  111 ? 18.291  0.775   -19.678 1.00 12.65 ? 237  MET A CA    1 
ATOM   795  C  C     . MET A 1  111 ? 17.699  0.594   -18.285 1.00 15.35 ? 237  MET A C     1 
ATOM   796  O  O     . MET A 1  111 ? 16.673  1.192   -17.951 1.00 15.38 ? 237  MET A O     1 
ATOM   797  C  CB    . MET A 1  111 ? 17.863  -0.382  -20.593 1.00 10.49 ? 237  MET A CB    1 
ATOM   798  C  CG    . MET A 1  111 ? 18.147  -0.144  -22.079 1.00 12.45 ? 237  MET A CG    1 
ATOM   799  S  SD    . MET A 1  111 ? 17.193  1.219   -22.786 1.00 14.76 ? 237  MET A SD    1 
ATOM   800  C  CE    . MET A 1  111 ? 15.593  0.436   -22.929 1.00 11.96 ? 237  MET A CE    1 
ATOM   801  N  N     . LYS A 1  112 ? 18.347  -0.221  -17.454 1.00 12.71 ? 238  LYS A N     1 
ATOM   802  C  CA    . LYS A 1  112 ? 17.874  -0.370  -16.079 1.00 11.53 ? 238  LYS A CA    1 
ATOM   803  C  C     . LYS A 1  112 ? 17.943  0.939   -15.321 1.00 16.65 ? 238  LYS A C     1 
ATOM   804  O  O     . LYS A 1  112 ? 16.966  1.358   -14.707 1.00 14.84 ? 238  LYS A O     1 
ATOM   805  C  CB    . LYS A 1  112 ? 18.628  -1.466  -15.318 1.00 10.70 ? 238  LYS A CB    1 
ATOM   806  C  CG    . LYS A 1  112 ? 18.008  -1.736  -13.938 1.00 19.04 ? 238  LYS A CG    1 
ATOM   807  C  CD    . LYS A 1  112 ? 18.465  -3.089  -13.370 1.00 22.16 ? 238  LYS A CD    1 
ATOM   808  C  CE    . LYS A 1  112 ? 17.813  -3.401  -12.024 1.00 22.98 ? 238  LYS A CE    1 
ATOM   809  N  NZ    . LYS A 1  112 ? 16.415  -3.932  -12.169 1.00 18.88 ? 238  LYS A NZ    1 
ATOM   810  N  N     . LEU A 1  113 ? 19.096  1.597   -15.385 1.00 11.84 ? 239  LEU A N     1 
ATOM   811  C  CA    . LEU A 1  113 ? 19.275  2.872   -14.709 1.00 14.51 ? 239  LEU A CA    1 
ATOM   812  C  C     . LEU A 1  113 ? 18.261  3.900   -15.198 1.00 15.95 ? 239  LEU A C     1 
ATOM   813  O  O     . LEU A 1  113 ? 17.656  4.613   -14.396 1.00 15.48 ? 239  LEU A O     1 
ATOM   814  C  CB    . LEU A 1  113 ? 20.702  3.380   -14.953 1.00 13.75 ? 239  LEU A CB    1 
ATOM   815  C  CG    . LEU A 1  113 ? 21.054  4.738   -14.375 1.00 21.16 ? 239  LEU A CG    1 
ATOM   816  C  CD1   . LEU A 1  113 ? 21.088  4.659   -12.860 1.00 27.75 ? 239  LEU A CD1   1 
ATOM   817  C  CD2   . LEU A 1  113 ? 22.388  5.207   -14.950 1.00 23.67 ? 239  LEU A CD2   1 
ATOM   818  N  N     . PHE A 1  114 ? 18.056  3.973   -16.510 1.00 12.48 ? 240  PHE A N     1 
ATOM   819  C  CA    . PHE A 1  114 ? 17.187  5.023   -17.057 1.00 12.01 ? 240  PHE A CA    1 
ATOM   820  C  C     . PHE A 1  114 ? 15.699  4.741   -16.752 1.00 12.87 ? 240  PHE A C     1 
ATOM   821  O  O     . PHE A 1  114 ? 14.961  5.624   -16.325 1.00 9.16  ? 240  PHE A O     1 
ATOM   822  C  CB    . PHE A 1  114 ? 17.416  5.187   -18.573 1.00 10.65 ? 240  PHE A CB    1 
ATOM   823  C  CG    . PHE A 1  114 ? 18.694  5.938   -18.934 1.00 11.62 ? 240  PHE A CG    1 
ATOM   824  C  CD1   . PHE A 1  114 ? 19.078  6.080   -20.250 1.00 15.80 ? 240  PHE A CD1   1 
ATOM   825  C  CD2   . PHE A 1  114 ? 19.477  6.513   -17.958 1.00 13.09 ? 240  PHE A CD2   1 
ATOM   826  C  CE1   . PHE A 1  114 ? 20.249  6.773   -20.590 1.00 16.94 ? 240  PHE A CE1   1 
ATOM   827  C  CE2   . PHE A 1  114 ? 20.645  7.212   -18.282 1.00 16.27 ? 240  PHE A CE2   1 
ATOM   828  C  CZ    . PHE A 1  114 ? 21.024  7.334   -19.604 1.00 16.41 ? 240  PHE A CZ    1 
ATOM   829  N  N     . THR A 1  115 ? 15.262  3.510   -16.974 1.00 13.56 ? 241  THR A N     1 
ATOM   830  C  CA    . THR A 1  115 ? 13.858  3.181   -16.732 1.00 14.28 ? 241  THR A CA    1 
ATOM   831  C  C     . THR A 1  115 ? 13.447  3.282   -15.251 1.00 15.16 ? 241  THR A C     1 
ATOM   832  O  O     . THR A 1  115 ? 12.259  3.387   -14.949 1.00 14.65 ? 241  THR A O     1 
ATOM   833  C  CB    . THR A 1  115 ? 13.491  1.802   -17.270 1.00 11.63 ? 241  THR A CB    1 
ATOM   834  O  OG1   . THR A 1  115 ? 14.326  0.814   -16.658 1.00 11.17 ? 241  THR A OG1   1 
ATOM   835  C  CG2   . THR A 1  115 ? 13.655  1.753   -18.804 1.00 13.24 ? 241  THR A CG2   1 
ATOM   836  N  N     . GLN A 1  116 ? 14.426  3.242   -14.344 1.00 12.65 ? 242  GLN A N     1 
ATOM   837  C  CA    . GLN A 1  116 ? 14.192  3.415   -12.911 1.00 12.74 ? 242  GLN A CA    1 
ATOM   838  C  C     . GLN A 1  116 ? 13.753  4.834   -12.580 1.00 16.06 ? 242  GLN A C     1 
ATOM   839  O  O     . GLN A 1  116 ? 13.183  5.096   -11.516 1.00 16.07 ? 242  GLN A O     1 
ATOM   840  C  CB    . GLN A 1  116 ? 15.477  3.114   -12.115 1.00 19.68 ? 242  GLN A CB    1 
ATOM   841  C  CG    . GLN A 1  116 ? 15.659  1.669   -11.719 1.00 30.88 ? 242  GLN A CG    1 
ATOM   842  C  CD    . GLN A 1  116 ? 17.067  1.345   -11.193 1.00 27.43 ? 242  GLN A CD    1 
ATOM   843  O  OE1   . GLN A 1  116 ? 17.945  2.213   -11.106 1.00 31.03 ? 242  GLN A OE1   1 
ATOM   844  N  NE2   . GLN A 1  116 ? 17.277  0.083   -10.848 1.00 28.61 ? 242  GLN A NE2   1 
ATOM   845  N  N     . ILE A 1  117 ? 14.063  5.773   -13.467 1.00 13.10 ? 243  ILE A N     1 
ATOM   846  C  CA    . ILE A 1  117 ? 13.703  7.157   -13.210 1.00 10.00 ? 243  ILE A CA    1 
ATOM   847  C  C     . ILE A 1  117 ? 12.202  7.302   -13.398 1.00 12.68 ? 243  ILE A C     1 
ATOM   848  O  O     . ILE A 1  117 ? 11.669  6.838   -14.395 1.00 8.93  ? 243  ILE A O     1 
ATOM   849  C  CB    . ILE A 1  117 ? 14.415  8.099   -14.190 1.00 12.98 ? 243  ILE A CB    1 
ATOM   850  C  CG1   . ILE A 1  117 ? 15.935  7.867   -14.115 1.00 11.16 ? 243  ILE A CG1   1 
ATOM   851  C  CG2   . ILE A 1  117 ? 14.019  9.563   -13.911 1.00 11.14 ? 243  ILE A CG2   1 
ATOM   852  C  CD1   . ILE A 1  117 ? 16.711  8.530   -15.248 1.00 16.13 ? 243  ILE A CD1   1 
ATOM   853  N  N     . PHE A 1  118 ? 11.535  7.935   -12.430 1.00 9.78  ? 244  PHE A N     1 
ATOM   854  C  CA    . PHE A 1  118 ? 10.126  8.281   -12.535 1.00 8.50  ? 244  PHE A CA    1 
ATOM   855  C  C     . PHE A 1  118 ? 9.914   9.276   -13.690 1.00 11.42 ? 244  PHE A C     1 
ATOM   856  O  O     . PHE A 1  118 ? 10.489  10.352  -13.691 1.00 12.53 ? 244  PHE A O     1 
ATOM   857  C  CB    . PHE A 1  118 ? 9.666   8.861   -11.200 1.00 10.32 ? 244  PHE A CB    1 
ATOM   858  C  CG    . PHE A 1  118 ? 8.219   9.284   -11.170 1.00 10.58 ? 244  PHE A CG    1 
ATOM   859  C  CD1   . PHE A 1  118 ? 7.208   8.337   -11.305 1.00 10.21 ? 244  PHE A CD1   1 
ATOM   860  C  CD2   . PHE A 1  118 ? 7.878   10.616  -10.959 1.00 10.90 ? 244  PHE A CD2   1 
ATOM   861  C  CE1   . PHE A 1  118 ? 5.884   8.705   -11.264 1.00 10.05 ? 244  PHE A CE1   1 
ATOM   862  C  CE2   . PHE A 1  118 ? 6.546   10.996  -10.905 1.00 17.81 ? 244  PHE A CE2   1 
ATOM   863  C  CZ    . PHE A 1  118 ? 5.546   10.035  -11.062 1.00 12.05 ? 244  PHE A CZ    1 
ATOM   864  N  N     . GLY A 1  119 ? 9.115   8.886   -14.687 1.00 10.90 ? 245  GLY A N     1 
ATOM   865  C  CA    . GLY A 1  119 ? 8.915   9.696   -15.885 1.00 11.30 ? 245  GLY A CA    1 
ATOM   866  C  C     . GLY A 1  119 ? 9.604   9.151   -17.136 1.00 11.82 ? 245  GLY A C     1 
ATOM   867  O  O     . GLY A 1  119 ? 9.417   9.659   -18.243 1.00 11.27 ? 245  GLY A O     1 
ATOM   868  N  N     . VAL A 1  120 ? 10.416  8.113   -16.959 1.00 13.32 ? 246  VAL A N     1 
ATOM   869  C  CA    . VAL A 1  120 ? 11.144  7.500   -18.064 1.00 12.86 ? 246  VAL A CA    1 
ATOM   870  C  C     . VAL A 1  120 ? 10.740  6.046   -18.268 1.00 13.05 ? 246  VAL A C     1 
ATOM   871  O  O     . VAL A 1  120 ? 10.860  5.241   -17.357 1.00 11.45 ? 246  VAL A O     1 
ATOM   872  C  CB    . VAL A 1  120 ? 12.659  7.518   -17.799 1.00 9.16  ? 246  VAL A CB    1 
ATOM   873  C  CG1   . VAL A 1  120 ? 13.406  7.006   -19.011 1.00 11.07 ? 246  VAL A CG1   1 
ATOM   874  C  CG2   . VAL A 1  120 ? 13.118  8.929   -17.448 1.00 9.56  ? 246  VAL A CG2   1 
ATOM   875  N  N     . GLY A 1  121 ? 10.281  5.697   -19.467 1.00 9.91  ? 247  GLY A N     1 
ATOM   876  C  CA    . GLY A 1  121 ? 9.905   4.321   -19.725 1.00 11.22 ? 247  GLY A CA    1 
ATOM   877  C  C     . GLY A 1  121 ? 10.896  3.709   -20.677 1.00 12.36 ? 247  GLY A C     1 
ATOM   878  O  O     . GLY A 1  121 ? 11.905  4.330   -20.995 1.00 10.87 ? 247  GLY A O     1 
ATOM   879  N  N     . VAL A 1  122 ? 10.619  2.494   -21.139 1.00 12.90 ? 248  VAL A N     1 
ATOM   880  C  CA    . VAL A 1  122 ? 11.530  1.811   -22.059 1.00 12.68 ? 248  VAL A CA    1 
ATOM   881  C  C     . VAL A 1  122 ? 11.814  2.628   -23.321 1.00 15.39 ? 248  VAL A C     1 
ATOM   882  O  O     . VAL A 1  122 ? 12.970  2.770   -23.726 1.00 13.45 ? 248  VAL A O     1 
ATOM   883  C  CB    . VAL A 1  122 ? 11.004  0.413   -22.457 1.00 13.30 ? 248  VAL A CB    1 
ATOM   884  C  CG1   . VAL A 1  122 ? 11.853  -0.183  -23.593 1.00 18.62 ? 248  VAL A CG1   1 
ATOM   885  C  CG2   . VAL A 1  122 ? 11.019  -0.525  -21.248 1.00 16.88 ? 248  VAL A CG2   1 
ATOM   886  N  N     . LYS A 1  123 ? 10.766  3.173   -23.932 1.00 14.22 ? 249  LYS A N     1 
ATOM   887  C  CA    . LYS A 1  123 ? 10.936  3.921   -25.177 1.00 16.63 ? 249  LYS A CA    1 
ATOM   888  C  C     . LYS A 1  123 ? 11.840  5.134   -25.022 1.00 15.25 ? 249  LYS A C     1 
ATOM   889  O  O     . LYS A 1  123 ? 12.695  5.373   -25.875 1.00 17.21 ? 249  LYS A O     1 
ATOM   890  C  CB    . LYS A 1  123 ? 9.591   4.314   -25.787 1.00 14.65 ? 249  LYS A CB    1 
ATOM   891  C  CG    . LYS A 1  123 ? 8.852   3.122   -26.337 1.00 26.51 ? 249  LYS A CG    1 
ATOM   892  C  CD    . LYS A 1  123 ? 7.514   3.479   -26.960 1.00 29.87 ? 249  LYS A CD    1 
ATOM   893  C  CE    . LYS A 1  123 ? 6.777   2.198   -27.372 1.00 27.53 ? 249  LYS A CE    1 
ATOM   894  N  NZ    . LYS A 1  123 ? 5.357   2.452   -27.758 1.00 49.61 ? 249  LYS A NZ    1 
ATOM   895  N  N     . THR A 1  124 ? 11.668  5.887   -23.937 1.00 11.30 ? 250  THR A N     1 
ATOM   896  C  CA    . THR A 1  124 ? 12.521  7.046   -23.704 1.00 12.71 ? 250  THR A CA    1 
ATOM   897  C  C     . THR A 1  124 ? 13.966  6.638   -23.393 1.00 16.50 ? 250  THR A C     1 
ATOM   898  O  O     . THR A 1  124 ? 14.904  7.196   -23.979 1.00 14.12 ? 250  THR A O     1 
ATOM   899  C  CB    . THR A 1  124 ? 11.971  7.936   -22.587 1.00 13.10 ? 250  THR A CB    1 
ATOM   900  O  OG1   . THR A 1  124 ? 10.645  8.352   -22.931 1.00 13.67 ? 250  THR A OG1   1 
ATOM   901  C  CG2   . THR A 1  124 ? 12.845  9.159   -22.398 1.00 14.44 ? 250  THR A CG2   1 
ATOM   902  N  N     . ALA A 1  125 ? 14.142  5.678   -22.477 1.00 12.66 ? 251  ALA A N     1 
ATOM   903  C  CA    . ALA A 1  125 ? 15.475  5.156   -22.138 1.00 10.58 ? 251  ALA A CA    1 
ATOM   904  C  C     . ALA A 1  125 ? 16.238  4.719   -23.384 1.00 13.68 ? 251  ALA A C     1 
ATOM   905  O  O     . ALA A 1  125 ? 17.426  5.030   -23.543 1.00 12.88 ? 251  ALA A O     1 
ATOM   906  C  CB    . ALA A 1  125 ? 15.360  3.972   -21.179 1.00 11.81 ? 251  ALA A CB    1 
ATOM   907  N  N     . ASP A 1  126 ? 15.542  3.984   -24.248 1.00 14.15 ? 252  ASP A N     1 
ATOM   908  C  CA    . ASP A 1  126 ? 16.118  3.455   -25.475 1.00 19.08 ? 252  ASP A CA    1 
ATOM   909  C  C     . ASP A 1  126 ? 16.572  4.569   -26.418 1.00 19.91 ? 252  ASP A C     1 
ATOM   910  O  O     . ASP A 1  126 ? 17.638  4.476   -27.008 1.00 18.30 ? 252  ASP A O     1 
ATOM   911  C  CB    . ASP A 1  126 ? 15.122  2.544   -26.196 1.00 12.78 ? 252  ASP A CB    1 
ATOM   912  C  CG    . ASP A 1  126 ? 15.629  2.107   -27.568 1.00 24.12 ? 252  ASP A CG    1 
ATOM   913  O  OD1   . ASP A 1  126 ? 16.643  1.379   -27.633 1.00 17.37 ? 252  ASP A OD1   1 
ATOM   914  O  OD2   . ASP A 1  126 ? 15.022  2.514   -28.582 1.00 25.26 ? 252  ASP A OD2   1 
ATOM   915  N  N     A ARG A 1  127 ? 15.760  5.615   -26.550 0.50 15.27 ? 253  ARG A N     1 
ATOM   916  N  N     B ARG A 1  127 ? 15.764  5.619   -26.567 0.50 15.28 ? 253  ARG A N     1 
ATOM   917  C  CA    A ARG A 1  127 ? 16.117  6.734   -27.408 0.50 18.62 ? 253  ARG A CA    1 
ATOM   918  C  CA    B ARG A 1  127 ? 16.171  6.719   -27.431 0.50 18.61 ? 253  ARG A CA    1 
ATOM   919  C  C     A ARG A 1  127 ? 17.374  7.414   -26.883 0.50 17.61 ? 253  ARG A C     1 
ATOM   920  C  C     B ARG A 1  127 ? 17.418  7.376   -26.874 0.50 17.60 ? 253  ARG A C     1 
ATOM   921  O  O     A ARG A 1  127 ? 18.319  7.648   -27.629 0.50 18.96 ? 253  ARG A O     1 
ATOM   922  O  O     B ARG A 1  127 ? 18.396  7.567   -27.592 0.50 18.97 ? 253  ARG A O     1 
ATOM   923  C  CB    A ARG A 1  127 ? 14.964  7.733   -27.498 0.50 21.51 ? 253  ARG A CB    1 
ATOM   924  C  CB    B ARG A 1  127 ? 15.080  7.773   -27.591 0.50 21.56 ? 253  ARG A CB    1 
ATOM   925  C  CG    A ARG A 1  127 ? 15.292  8.981   -28.298 0.50 22.23 ? 253  ARG A CG    1 
ATOM   926  C  CG    B ARG A 1  127 ? 15.587  8.983   -28.371 0.50 21.92 ? 253  ARG A CG    1 
ATOM   927  C  CD    A ARG A 1  127 ? 14.032  9.778   -28.595 0.50 22.93 ? 253  ARG A CD    1 
ATOM   928  C  CD    B ARG A 1  127 ? 14.512  10.014  -28.620 0.50 23.63 ? 253  ARG A CD    1 
ATOM   929  N  NE    A ARG A 1  127 ? 13.291  10.139  -27.387 0.50 19.83 ? 253  ARG A NE    1 
ATOM   930  N  NE    B ARG A 1  127 ? 14.189  10.781  -27.423 0.50 22.49 ? 253  ARG A NE    1 
ATOM   931  C  CZ    A ARG A 1  127 ? 13.648  11.109  -26.547 0.50 24.40 ? 253  ARG A CZ    1 
ATOM   932  C  CZ    B ARG A 1  127 ? 13.058  10.646  -26.741 0.50 23.09 ? 253  ARG A CZ    1 
ATOM   933  N  NH1   A ARG A 1  127 ? 14.753  11.815  -26.768 0.50 21.43 ? 253  ARG A NH1   1 
ATOM   934  N  NH1   B ARG A 1  127 ? 12.150  9.770   -27.147 0.50 23.36 ? 253  ARG A NH1   1 
ATOM   935  N  NH2   A ARG A 1  127 ? 12.901  11.374  -25.478 0.50 26.11 ? 253  ARG A NH2   1 
ATOM   936  N  NH2   B ARG A 1  127 ? 12.832  11.392  -25.661 0.50 26.17 ? 253  ARG A NH2   1 
ATOM   937  N  N     . TRP A 1  128 ? 17.376  7.715   -25.587 1.00 16.92 ? 254  TRP A N     1 
ATOM   938  C  CA    . TRP A 1  128 ? 18.547  8.252   -24.910 1.00 18.22 ? 254  TRP A CA    1 
ATOM   939  C  C     . TRP A 1  128 ? 19.778  7.354   -25.088 1.00 19.02 ? 254  TRP A C     1 
ATOM   940  O  O     . TRP A 1  128 ? 20.882  7.842   -25.364 1.00 16.56 ? 254  TRP A O     1 
ATOM   941  C  CB    . TRP A 1  128 ? 18.252  8.470   -23.422 1.00 13.14 ? 254  TRP A CB    1 
ATOM   942  C  CG    . TRP A 1  128 ? 17.287  9.605   -23.178 1.00 16.02 ? 254  TRP A CG    1 
ATOM   943  C  CD1   . TRP A 1  128 ? 16.867  10.540  -24.088 1.00 19.45 ? 254  TRP A CD1   1 
ATOM   944  C  CD2   . TRP A 1  128 ? 16.629  9.923   -21.943 1.00 16.47 ? 254  TRP A CD2   1 
ATOM   945  N  NE1   . TRP A 1  128 ? 16.003  11.428  -23.486 1.00 17.33 ? 254  TRP A NE1   1 
ATOM   946  C  CE2   . TRP A 1  128 ? 15.840  11.068  -22.171 1.00 18.84 ? 254  TRP A CE2   1 
ATOM   947  C  CE3   . TRP A 1  128 ? 16.636  9.352   -20.664 1.00 14.97 ? 254  TRP A CE3   1 
ATOM   948  C  CZ2   . TRP A 1  128 ? 15.050  11.644  -21.171 1.00 18.72 ? 254  TRP A CZ2   1 
ATOM   949  C  CZ3   . TRP A 1  128 ? 15.857  9.932   -19.671 1.00 13.42 ? 254  TRP A CZ3   1 
ATOM   950  C  CH2   . TRP A 1  128 ? 15.086  11.071  -19.930 1.00 16.04 ? 254  TRP A CH2   1 
ATOM   951  N  N     . TYR A 1  129 ? 19.589  6.048   -24.934 1.00 15.29 ? 255  TYR A N     1 
ATOM   952  C  CA    . TYR A 1  129 ? 20.690  5.098   -25.143 1.00 17.39 ? 255  TYR A CA    1 
ATOM   953  C  C     . TYR A 1  129 ? 21.272  5.232   -26.553 1.00 19.40 ? 255  TYR A C     1 
ATOM   954  O  O     . TYR A 1  129 ? 22.490  5.278   -26.732 1.00 19.94 ? 255  TYR A O     1 
ATOM   955  C  CB    . TYR A 1  129 ? 20.240  3.642   -24.924 1.00 12.12 ? 255  TYR A CB    1 
ATOM   956  C  CG    . TYR A 1  129 ? 21.420  2.688   -24.872 1.00 15.85 ? 255  TYR A CG    1 
ATOM   957  C  CD1   . TYR A 1  129 ? 22.106  2.485   -23.680 1.00 15.23 ? 255  TYR A CD1   1 
ATOM   958  C  CD2   . TYR A 1  129 ? 21.868  2.024   -26.015 1.00 16.01 ? 255  TYR A CD2   1 
ATOM   959  C  CE1   . TYR A 1  129 ? 23.200  1.643   -23.615 1.00 16.73 ? 255  TYR A CE1   1 
ATOM   960  C  CE2   . TYR A 1  129 ? 22.976  1.163   -25.962 1.00 15.16 ? 255  TYR A CE2   1 
ATOM   961  C  CZ    . TYR A 1  129 ? 23.628  0.987   -24.755 1.00 17.47 ? 255  TYR A CZ    1 
ATOM   962  O  OH    . TYR A 1  129 ? 24.712  0.156   -24.646 1.00 20.92 ? 255  TYR A OH    1 
ATOM   963  N  N     . ARG A 1  130 ? 20.389  5.274   -27.547 1.00 17.39 ? 256  ARG A N     1 
ATOM   964  C  CA    . ARG A 1  130 ? 20.825  5.430   -28.933 1.00 21.50 ? 256  ARG A CA    1 
ATOM   965  C  C     . ARG A 1  130 ? 21.517  6.784   -29.156 1.00 26.14 ? 256  ARG A C     1 
ATOM   966  O  O     . ARG A 1  130 ? 22.406  6.899   -29.997 1.00 28.03 ? 256  ARG A O     1 
ATOM   967  C  CB    . ARG A 1  130 ? 19.653  5.245   -29.899 1.00 21.79 ? 256  ARG A CB    1 
ATOM   968  C  CG    . ARG A 1  130 ? 19.081  3.839   -29.917 1.00 27.30 ? 256  ARG A CG    1 
ATOM   969  C  CD    . ARG A 1  130 ? 18.014  3.679   -31.003 1.00 28.39 ? 256  ARG A CD    1 
ATOM   970  N  NE    . ARG A 1  130 ? 16.667  4.046   -30.564 1.00 28.14 ? 256  ARG A NE    1 
ATOM   971  C  CZ    . ARG A 1  130 ? 16.045  5.184   -30.883 1.00 37.20 ? 256  ARG A CZ    1 
ATOM   972  N  NH1   . ARG A 1  130 ? 16.646  6.092   -31.650 1.00 32.44 ? 256  ARG A NH1   1 
ATOM   973  N  NH2   . ARG A 1  130 ? 14.815  5.422   -30.434 1.00 33.21 ? 256  ARG A NH2   1 
ATOM   974  N  N     . GLU A 1  131 ? 21.141  7.799   -28.383 1.00 18.91 ? 257  GLU A N     1 
ATOM   975  C  CA    . GLU A 1  131 ? 21.786  9.100   -28.494 1.00 20.24 ? 257  GLU A CA    1 
ATOM   976  C  C     . GLU A 1  131 ? 23.161  9.136   -27.823 1.00 23.51 ? 257  GLU A C     1 
ATOM   977  O  O     . GLU A 1  131 ? 23.872  10.133  -27.901 1.00 26.33 ? 257  GLU A O     1 
ATOM   978  C  CB    . GLU A 1  131 ? 20.867  10.216  -27.951 1.00 20.40 ? 257  GLU A CB    1 
ATOM   979  C  CG    . GLU A 1  131 ? 19.579  10.382  -28.761 1.00 18.68 ? 257  GLU A CG    1 
ATOM   980  C  CD    . GLU A 1  131 ? 18.592  11.352  -28.123 1.00 25.59 ? 257  GLU A CD    1 
ATOM   981  O  OE1   . GLU A 1  131 ? 18.912  11.901  -27.055 1.00 22.35 ? 257  GLU A OE1   1 
ATOM   982  O  OE2   . GLU A 1  131 ? 17.492  11.562  -28.682 1.00 30.04 ? 257  GLU A OE2   1 
ATOM   983  N  N     . GLY A 1  132 ? 23.537  8.052   -27.158 1.00 16.44 ? 258  GLY A N     1 
ATOM   984  C  CA    . GLY A 1  132 ? 24.832  7.981   -26.517 1.00 18.94 ? 258  GLY A CA    1 
ATOM   985  C  C     . GLY A 1  132 ? 24.830  8.272   -25.031 1.00 23.00 ? 258  GLY A C     1 
ATOM   986  O  O     . GLY A 1  132 ? 25.876  8.204   -24.389 1.00 26.29 ? 258  GLY A O     1 
ATOM   987  N  N     . LEU A 1  133 ? 23.669  8.581   -24.464 1.00 18.07 ? 259  LEU A N     1 
ATOM   988  C  CA    . LEU A 1  133 ? 23.623  8.907   -23.046 1.00 16.25 ? 259  LEU A CA    1 
ATOM   989  C  C     . LEU A 1  133 ? 23.782  7.627   -22.231 1.00 19.82 ? 259  LEU A C     1 
ATOM   990  O  O     . LEU A 1  133 ? 23.284  6.571   -22.622 1.00 21.24 ? 259  LEU A O     1 
ATOM   991  C  CB    . LEU A 1  133 ? 22.306  9.620   -22.709 1.00 20.07 ? 259  LEU A CB    1 
ATOM   992  C  CG    . LEU A 1  133 ? 22.088  10.929  -23.484 1.00 20.33 ? 259  LEU A CG    1 
ATOM   993  C  CD1   . LEU A 1  133 ? 20.665  11.415  -23.375 1.00 22.85 ? 259  LEU A CD1   1 
ATOM   994  C  CD2   . LEU A 1  133 ? 23.045  11.993  -22.983 1.00 22.11 ? 259  LEU A CD2   1 
ATOM   995  N  N     . ARG A 1  134 ? 24.473  7.713   -21.098 1.00 21.54 ? 260  ARG A N     1 
ATOM   996  C  CA    . ARG A 1  134 ? 24.768  6.523   -20.316 1.00 19.44 ? 260  ARG A CA    1 
ATOM   997  C  C     . ARG A 1  134 ? 24.515  6.695   -18.814 1.00 22.57 ? 260  ARG A C     1 
ATOM   998  O  O     . ARG A 1  134 ? 24.242  5.713   -18.132 1.00 20.04 ? 260  ARG A O     1 
ATOM   999  C  CB    . ARG A 1  134 ? 26.217  6.071   -20.543 1.00 20.41 ? 260  ARG A CB    1 
ATOM   1000 C  CG    . ARG A 1  134 ? 26.523  5.557   -21.947 1.00 19.31 ? 260  ARG A CG    1 
ATOM   1001 C  CD    . ARG A 1  134 ? 25.744  4.301   -22.303 1.00 22.75 ? 260  ARG A CD    1 
ATOM   1002 N  NE    . ARG A 1  134 ? 26.078  3.800   -23.639 1.00 20.66 ? 260  ARG A NE    1 
ATOM   1003 C  CZ    . ARG A 1  134 ? 25.434  4.128   -24.752 1.00 17.74 ? 260  ARG A CZ    1 
ATOM   1004 N  NH1   . ARG A 1  134 ? 24.405  4.967   -24.714 1.00 21.03 ? 260  ARG A NH1   1 
ATOM   1005 N  NH2   . ARG A 1  134 ? 25.810  3.599   -25.912 1.00 20.73 ? 260  ARG A NH2   1 
ATOM   1006 N  N     . THR A 1  135 ? 24.624  7.918   -18.295 1.00 16.42 ? 261  THR A N     1 
ATOM   1007 C  CA    . THR A 1  135 ? 24.577  8.133   -16.847 1.00 18.70 ? 261  THR A CA    1 
ATOM   1008 C  C     . THR A 1  135 ? 23.559  9.193   -16.425 1.00 19.07 ? 261  THR A C     1 
ATOM   1009 O  O     . THR A 1  135 ? 23.099  9.985   -17.250 1.00 19.01 ? 261  THR A O     1 
ATOM   1010 C  CB    . THR A 1  135 ? 25.957  8.580   -16.298 1.00 27.47 ? 261  THR A CB    1 
ATOM   1011 O  OG1   . THR A 1  135 ? 26.221  9.919   -16.724 1.00 26.37 ? 261  THR A OG1   1 
ATOM   1012 C  CG2   . THR A 1  135 ? 27.051  7.688   -16.811 1.00 20.34 ? 261  THR A CG2   1 
ATOM   1013 N  N     . LEU A 1  136 ? 23.241  9.241   -15.130 1.00 18.34 ? 262  LEU A N     1 
ATOM   1014 C  CA    . LEU A 1  136 ? 22.286  10.240  -14.650 1.00 20.58 ? 262  LEU A CA    1 
ATOM   1015 C  C     . LEU A 1  136 ? 22.867  11.626  -14.850 1.00 21.30 ? 262  LEU A C     1 
ATOM   1016 O  O     . LEU A 1  136 ? 22.153  12.560  -15.200 1.00 24.35 ? 262  LEU A O     1 
ATOM   1017 C  CB    . LEU A 1  136 ? 21.938  10.023  -13.178 1.00 17.61 ? 262  LEU A CB    1 
ATOM   1018 C  CG    . LEU A 1  136 ? 21.259  8.691   -12.850 1.00 22.39 ? 262  LEU A CG    1 
ATOM   1019 C  CD1   . LEU A 1  136 ? 20.764  8.692   -11.407 1.00 23.83 ? 262  LEU A CD1   1 
ATOM   1020 C  CD2   . LEU A 1  136 ? 20.120  8.429   -13.825 1.00 18.78 ? 262  LEU A CD2   1 
ATOM   1021 N  N     . ASP A 1  137 ? 24.167  11.759  -14.646 1.00 23.58 ? 263  ASP A N     1 
ATOM   1022 C  CA    . ASP A 1  137 ? 24.815  13.044  -14.926 1.00 27.52 ? 263  ASP A CA    1 
ATOM   1023 C  C     . ASP A 1  137 ? 24.693  13.475  -16.391 1.00 23.15 ? 263  ASP A C     1 
ATOM   1024 O  O     . ASP A 1  137 ? 24.547  14.667  -16.681 1.00 27.43 ? 263  ASP A O     1 
ATOM   1025 C  CB    . ASP A 1  137 ? 26.258  13.059  -14.413 1.00 18.98 ? 263  ASP A CB    1 
ATOM   1026 C  CG    . ASP A 1  137 ? 26.314  13.189  -12.895 1.00 37.50 ? 263  ASP A CG    1 
ATOM   1027 O  OD1   . ASP A 1  137 ? 25.292  13.627  -12.310 1.00 43.68 ? 263  ASP A OD1   1 
ATOM   1028 O  OD2   . ASP A 1  137 ? 27.348  12.839  -12.283 1.00 46.64 ? 263  ASP A OD2   1 
ATOM   1029 N  N     . ASP A 1  138 ? 24.717  12.520  -17.317 1.00 23.54 ? 264  ASP A N     1 
ATOM   1030 C  CA    . ASP A 1  138 ? 24.496  12.863  -18.722 1.00 20.00 ? 264  ASP A CA    1 
ATOM   1031 C  C     . ASP A 1  138 ? 23.137  13.543  -18.913 1.00 27.52 ? 264  ASP A C     1 
ATOM   1032 O  O     . ASP A 1  138 ? 22.989  14.465  -19.713 1.00 27.61 ? 264  ASP A O     1 
ATOM   1033 C  CB    . ASP A 1  138 ? 24.577  11.626  -19.616 1.00 21.17 ? 264  ASP A CB    1 
ATOM   1034 C  CG    . ASP A 1  138 ? 25.983  11.047  -19.702 1.00 29.83 ? 264  ASP A CG    1 
ATOM   1035 O  OD1   . ASP A 1  138 ? 26.957  11.769  -19.396 1.00 29.33 ? 264  ASP A OD1   1 
ATOM   1036 O  OD2   . ASP A 1  138 ? 26.109  9.862   -20.089 1.00 25.13 ? 264  ASP A OD2   1 
ATOM   1037 N  N     . LEU A 1  139 ? 22.144  13.092  -18.159 1.00 19.10 ? 265  LEU A N     1 
ATOM   1038 C  CA    . LEU A 1  139 ? 20.797  13.608  -18.309 1.00 24.02 ? 265  LEU A CA    1 
ATOM   1039 C  C     . LEU A 1  139 ? 20.674  14.975  -17.669 1.00 23.25 ? 265  LEU A C     1 
ATOM   1040 O  O     . LEU A 1  139 ? 19.997  15.859  -18.183 1.00 30.24 ? 265  LEU A O     1 
ATOM   1041 C  CB    . LEU A 1  139 ? 19.783  12.649  -17.668 1.00 17.07 ? 265  LEU A CB    1 
ATOM   1042 C  CG    . LEU A 1  139 ? 19.791  11.206  -18.156 1.00 16.02 ? 265  LEU A CG    1 
ATOM   1043 C  CD1   . LEU A 1  139 ? 18.795  10.407  -17.334 1.00 18.21 ? 265  LEU A CD1   1 
ATOM   1044 C  CD2   . LEU A 1  139 ? 19.418  11.147  -19.631 1.00 22.32 ? 265  LEU A CD2   1 
ATOM   1045 N  N     . ARG A 1  140 ? 21.308  15.128  -16.519 1.00 24.90 ? 266  ARG A N     1 
ATOM   1046 C  CA    . ARG A 1  140 ? 21.290  16.391  -15.812 1.00 26.87 ? 266  ARG A CA    1 
ATOM   1047 C  C     . ARG A 1  140 ? 21.919  17.525  -16.632 1.00 32.88 ? 266  ARG A C     1 
ATOM   1048 O  O     . ARG A 1  140 ? 21.390  18.633  -16.651 1.00 34.76 ? 266  ARG A O     1 
ATOM   1049 C  CB    . ARG A 1  140 ? 21.976  16.215  -14.469 1.00 20.07 ? 266  ARG A CB    1 
ATOM   1050 C  CG    . ARG A 1  140 ? 21.242  15.186  -13.600 1.00 26.94 ? 266  ARG A CG    1 
ATOM   1051 C  CD    . ARG A 1  140 ? 21.778  15.140  -12.200 1.00 27.36 ? 266  ARG A CD    1 
ATOM   1052 N  NE    . ARG A 1  140 ? 20.857  14.482  -11.272 1.00 34.38 ? 266  ARG A NE    1 
ATOM   1053 C  CZ    . ARG A 1  140 ? 21.182  13.408  -10.565 1.00 29.76 ? 266  ARG A CZ    1 
ATOM   1054 N  NH1   . ARG A 1  140 ? 22.389  12.895  -10.711 1.00 22.51 ? 266  ARG A NH1   1 
ATOM   1055 N  NH2   . ARG A 1  140 ? 20.313  12.842  -9.727  1.00 25.36 ? 266  ARG A NH2   1 
ATOM   1056 N  N     . GLU A 1  141 ? 23.012  17.231  -17.339 1.00 33.43 ? 267  GLU A N     1 
ATOM   1057 C  CA    . GLU A 1  141 ? 23.715  18.229  -18.171 1.00 37.68 ? 267  GLU A CA    1 
ATOM   1058 C  C     . GLU A 1  141 ? 22.885  18.769  -19.332 1.00 43.31 ? 267  GLU A C     1 
ATOM   1059 O  O     . GLU A 1  141 ? 23.147  19.857  -19.838 1.00 51.25 ? 267  GLU A O     1 
ATOM   1060 C  CB    . GLU A 1  141 ? 25.012  17.653  -18.748 1.00 33.19 ? 267  GLU A CB    1 
ATOM   1061 C  CG    . GLU A 1  141 ? 26.110  17.357  -17.735 1.00 45.09 ? 267  GLU A CG    1 
ATOM   1062 C  CD    . GLU A 1  141 ? 27.296  16.630  -18.369 1.00 54.92 ? 267  GLU A CD    1 
ATOM   1063 O  OE1   . GLU A 1  141 ? 27.239  16.201  -19.529 1.00 49.57 ? 267  GLU A OE1   1 
ATOM   1064 O  OE2   . GLU A 1  141 ? 28.375  16.492  -17.609 1.00 60.54 ? 267  GLU A OE2   1 
ATOM   1065 N  N     . GLN A 1  142 ? 21.894  18.003  -19.772 1.00 44.55 ? 268  GLN A N     1 
ATOM   1066 C  CA    . GLN A 1  142 ? 21.030  18.451  -20.860 1.00 41.12 ? 268  GLN A CA    1 
ATOM   1067 C  C     . GLN A 1  142 ? 19.559  18.460  -20.431 1.00 47.25 ? 268  GLN A C     1 
ATOM   1068 O  O     . GLN A 1  142 ? 18.750  17.700  -20.974 1.00 41.13 ? 268  GLN A O     1 
ATOM   1069 C  CB    . GLN A 1  142 ? 21.222  17.556  -22.082 1.00 42.87 ? 268  GLN A CB    1 
ATOM   1070 N  N     . PRO A 1  143 ? 19.204  19.334  -19.468 1.00 35.61 ? 269  PRO A N     1 
ATOM   1071 C  CA    . PRO A 1  143 ? 17.868  19.315  -18.863 1.00 42.10 ? 269  PRO A CA    1 
ATOM   1072 C  C     . PRO A 1  143 ? 16.814  19.881  -19.804 1.00 47.24 ? 269  PRO A C     1 
ATOM   1073 O  O     . PRO A 1  143 ? 15.634  19.914  -19.459 1.00 47.73 ? 269  PRO A O     1 
ATOM   1074 C  CB    . PRO A 1  143 ? 18.033  20.216  -17.644 1.00 40.74 ? 269  PRO A CB    1 
ATOM   1075 C  CG    . PRO A 1  143 ? 19.061  21.207  -18.075 1.00 43.24 ? 269  PRO A CG    1 
ATOM   1076 C  CD    . PRO A 1  143 ? 20.009  20.467  -18.978 1.00 37.59 ? 269  PRO A CD    1 
ATOM   1077 N  N     . GLN A 1  144 ? 17.246  20.315  -20.983 1.00 42.63 ? 270  GLN A N     1 
ATOM   1078 C  CA    . GLN A 1  144 ? 16.335  20.797  -22.006 1.00 45.17 ? 270  GLN A CA    1 
ATOM   1079 C  C     . GLN A 1  144 ? 15.517  19.633  -22.546 1.00 42.08 ? 270  GLN A C     1 
ATOM   1080 O  O     . GLN A 1  144 ? 14.371  19.800  -22.954 1.00 51.16 ? 270  GLN A O     1 
ATOM   1081 C  CB    . GLN A 1  144 ? 17.124  21.449  -23.148 1.00 43.79 ? 270  GLN A CB    1 
ATOM   1082 N  N     . LYS A 1  145 ? 16.112  18.448  -22.544 1.00 37.24 ? 271  LYS A N     1 
ATOM   1083 C  CA    . LYS A 1  145 ? 15.451  17.281  -23.094 1.00 29.21 ? 271  LYS A CA    1 
ATOM   1084 C  C     . LYS A 1  145 ? 14.523  16.572  -22.094 1.00 35.40 ? 271  LYS A C     1 
ATOM   1085 O  O     . LYS A 1  145 ? 14.062  15.465  -22.372 1.00 38.41 ? 271  LYS A O     1 
ATOM   1086 C  CB    . LYS A 1  145 ? 16.488  16.289  -23.631 1.00 41.27 ? 271  LYS A CB    1 
ATOM   1087 N  N     . LEU A 1  146 ? 14.246  17.189  -20.945 1.00 24.72 ? 272  LEU A N     1 
ATOM   1088 C  CA    . LEU A 1  146 ? 13.493  16.491  -19.895 1.00 24.88 ? 272  LEU A CA    1 
ATOM   1089 C  C     . LEU A 1  146 ? 12.128  17.107  -19.646 1.00 25.49 ? 272  LEU A C     1 
ATOM   1090 O  O     . LEU A 1  146 ? 11.994  18.322  -19.585 1.00 22.27 ? 272  LEU A O     1 
ATOM   1091 C  CB    . LEU A 1  146 ? 14.267  16.485  -18.574 1.00 20.73 ? 272  LEU A CB    1 
ATOM   1092 C  CG    . LEU A 1  146 ? 15.689  15.948  -18.552 1.00 24.04 ? 272  LEU A CG    1 
ATOM   1093 C  CD1   . LEU A 1  146 ? 16.322  16.194  -17.194 1.00 26.57 ? 272  LEU A CD1   1 
ATOM   1094 C  CD2   . LEU A 1  146 ? 15.705  14.473  -18.892 1.00 20.67 ? 272  LEU A CD2   1 
ATOM   1095 N  N     . THR A 1  147 ? 11.122  16.264  -19.455 1.00 22.07 ? 273  THR A N     1 
ATOM   1096 C  CA    . THR A 1  147 ? 9.818   16.751  -19.056 1.00 16.87 ? 273  THR A CA    1 
ATOM   1097 C  C     . THR A 1  147 ? 9.886   17.152  -17.579 1.00 17.72 ? 273  THR A C     1 
ATOM   1098 O  O     . THR A 1  147 ? 10.845  16.810  -16.889 1.00 20.97 ? 273  THR A O     1 
ATOM   1099 C  CB    . THR A 1  147 ? 8.760   15.689  -19.248 1.00 19.11 ? 273  THR A CB    1 
ATOM   1100 O  OG1   . THR A 1  147 ? 9.028   14.605  -18.353 1.00 15.00 ? 273  THR A OG1   1 
ATOM   1101 C  CG2   . THR A 1  147 ? 8.770   15.165  -20.683 1.00 18.45 ? 273  THR A CG2   1 
ATOM   1102 N  N     . GLN A 1  148 ? 8.903   17.925  -17.115 1.00 17.59 ? 274  GLN A N     1 
ATOM   1103 C  CA    . GLN A 1  148 ? 8.832   18.328  -15.712 1.00 16.58 ? 274  GLN A CA    1 
ATOM   1104 C  C     . GLN A 1  148 ? 8.755   17.093  -14.817 1.00 14.78 ? 274  GLN A C     1 
ATOM   1105 O  O     . GLN A 1  148 ? 9.329   17.063  -13.741 1.00 16.71 ? 274  GLN A O     1 
ATOM   1106 C  CB    . GLN A 1  148 ? 7.619   19.227  -15.456 1.00 21.63 ? 274  GLN A CB    1 
ATOM   1107 N  N     . GLN A 1  149 ? 8.034   16.077  -15.271 1.00 12.31 ? 275  GLN A N     1 
ATOM   1108 C  CA    . GLN A 1  149 ? 7.954   14.822  -14.528 1.00 14.33 ? 275  GLN A CA    1 
ATOM   1109 C  C     . GLN A 1  149 ? 9.341   14.191  -14.380 1.00 17.56 ? 275  GLN A C     1 
ATOM   1110 O  O     . GLN A 1  149 ? 9.756   13.806  -13.275 1.00 16.42 ? 275  GLN A O     1 
ATOM   1111 C  CB    . GLN A 1  149 ? 6.999   13.863  -15.228 1.00 17.20 ? 275  GLN A CB    1 
ATOM   1112 C  CG    . GLN A 1  149 ? 6.697   12.592  -14.461 1.00 14.59 ? 275  GLN A CG    1 
ATOM   1113 C  CD    . GLN A 1  149 ? 5.774   11.661  -15.241 1.00 22.45 ? 275  GLN A CD    1 
ATOM   1114 O  OE1   . GLN A 1  149 ? 5.968   11.440  -16.431 1.00 17.23 ? 275  GLN A OE1   1 
ATOM   1115 N  NE2   . GLN A 1  149 ? 4.755   11.140  -14.579 1.00 20.23 ? 275  GLN A NE2   1 
ATOM   1116 N  N     . GLN A 1  150 ? 10.060  14.093  -15.494 1.00 14.17 ? 276  GLN A N     1 
ATOM   1117 C  CA    . GLN A 1  150 ? 11.397  13.531  -15.479 1.00 10.59 ? 276  GLN A CA    1 
ATOM   1118 C  C     . GLN A 1  150 ? 12.366  14.352  -14.653 1.00 10.59 ? 276  GLN A C     1 
ATOM   1119 O  O     . GLN A 1  150 ? 13.264  13.798  -14.030 1.00 11.17 ? 276  GLN A O     1 
ATOM   1120 C  CB    . GLN A 1  150 ? 11.901  13.361  -16.905 1.00 12.67 ? 276  GLN A CB    1 
ATOM   1121 C  CG    . GLN A 1  150 ? 11.133  12.299  -17.671 1.00 10.76 ? 276  GLN A CG    1 
ATOM   1122 C  CD    . GLN A 1  150 ? 11.293  12.411  -19.170 1.00 17.66 ? 276  GLN A CD    1 
ATOM   1123 O  OE1   . GLN A 1  150 ? 11.867  13.378  -19.683 1.00 14.76 ? 276  GLN A OE1   1 
ATOM   1124 N  NE2   . GLN A 1  150 ? 10.762  11.434  -19.889 1.00 11.99 ? 276  GLN A NE2   1 
ATOM   1125 N  N     . LYS A 1  151 ? 12.200  15.671  -14.638 1.00 11.66 ? 277  LYS A N     1 
ATOM   1126 C  CA    . LYS A 1  151 ? 13.089  16.504  -13.830 1.00 13.98 ? 277  LYS A CA    1 
ATOM   1127 C  C     . LYS A 1  151 ? 12.891  16.150  -12.368 1.00 10.72 ? 277  LYS A C     1 
ATOM   1128 O  O     . LYS A 1  151 ? 13.844  16.014  -11.624 1.00 12.06 ? 277  LYS A O     1 
ATOM   1129 C  CB    . LYS A 1  151 ? 12.815  18.009  -14.058 1.00 16.68 ? 277  LYS A CB    1 
ATOM   1130 C  CG    . LYS A 1  151 ? 13.225  18.476  -15.432 1.00 17.87 ? 277  LYS A CG    1 
ATOM   1131 C  CD    . LYS A 1  151 ? 12.832  19.931  -15.692 1.00 29.85 ? 277  LYS A CD    1 
ATOM   1132 C  CE    . LYS A 1  151 ? 13.312  20.383  -17.079 1.00 28.88 ? 277  LYS A CE    1 
ATOM   1133 N  NZ    . LYS A 1  151 ? 12.837  21.750  -17.444 1.00 40.12 ? 277  LYS A NZ    1 
ATOM   1134 N  N     . ALA A 1  152 ? 11.635  16.009  -11.962 1.00 12.40 ? 278  ALA A N     1 
ATOM   1135 C  CA    . ALA A 1  152 ? 11.338  15.611  -10.601 1.00 13.10 ? 278  ALA A CA    1 
ATOM   1136 C  C     . ALA A 1  152 ? 11.861  14.209  -10.318 1.00 11.72 ? 278  ALA A C     1 
ATOM   1137 O  O     . ALA A 1  152 ? 12.416  13.961  -9.247  1.00 11.88 ? 278  ALA A O     1 
ATOM   1138 C  CB    . ALA A 1  152 ? 9.843   15.670  -10.345 1.00 15.69 ? 278  ALA A CB    1 
ATOM   1139 N  N     . GLY A 1  153 ? 11.677  13.291  -11.263 1.00 9.21  ? 279  GLY A N     1 
ATOM   1140 C  CA    . GLY A 1  153 ? 12.156  11.935  -11.069 1.00 9.84  ? 279  GLY A CA    1 
ATOM   1141 C  C     . GLY A 1  153 ? 13.668  11.903  -10.883 1.00 13.51 ? 279  GLY A C     1 
ATOM   1142 O  O     . GLY A 1  153 ? 14.202  11.144  -10.061 1.00 10.46 ? 279  GLY A O     1 
ATOM   1143 N  N     . LEU A 1  154 ? 14.360  12.739  -11.649 1.00 10.10 ? 280  LEU A N     1 
ATOM   1144 C  CA    . LEU A 1  154 ? 15.815  12.781  -11.616 1.00 11.84 ? 280  LEU A CA    1 
ATOM   1145 C  C     . LEU A 1  154 ? 16.341  13.453  -10.337 1.00 11.56 ? 280  LEU A C     1 
ATOM   1146 O  O     . LEU A 1  154 ? 17.258  12.957  -9.702  1.00 10.13 ? 280  LEU A O     1 
ATOM   1147 C  CB    . LEU A 1  154 ? 16.320  13.506  -12.879 1.00 11.10 ? 280  LEU A CB    1 
ATOM   1148 C  CG    . LEU A 1  154 ? 17.793  13.417  -13.306 1.00 25.54 ? 280  LEU A CG    1 
ATOM   1149 C  CD1   . LEU A 1  154 ? 18.294  11.982  -13.372 1.00 20.26 ? 280  LEU A CD1   1 
ATOM   1150 C  CD2   . LEU A 1  154 ? 17.952  14.085  -14.686 1.00 27.08 ? 280  LEU A CD2   1 
ATOM   1151 N  N     . GLN A 1  155 ? 15.755  14.587  -9.966  1.00 9.42  ? 281  GLN A N     1 
ATOM   1152 C  CA    . GLN A 1  155 ? 16.134  15.247  -8.725  1.00 11.47 ? 281  GLN A CA    1 
ATOM   1153 C  C     . GLN A 1  155 ? 15.957  14.339  -7.529  1.00 11.75 ? 281  GLN A C     1 
ATOM   1154 O  O     . GLN A 1  155 ? 16.808  14.301  -6.638  1.00 10.22 ? 281  GLN A O     1 
ATOM   1155 C  CB    . GLN A 1  155 ? 15.300  16.516  -8.532  1.00 14.23 ? 281  GLN A CB    1 
ATOM   1156 C  CG    . GLN A 1  155 ? 15.841  17.707  -9.288  1.00 15.30 ? 281  GLN A CG    1 
ATOM   1157 C  CD    . GLN A 1  155 ? 14.783  18.775  -9.536  1.00 26.86 ? 281  GLN A CD    1 
ATOM   1158 O  OE1   . GLN A 1  155 ? 13.590  18.469  -9.683  1.00 29.54 ? 281  GLN A OE1   1 
ATOM   1159 N  NE2   . GLN A 1  155 ? 15.212  20.036  -9.585  1.00 37.46 ? 281  GLN A NE2   1 
ATOM   1160 N  N     . HIS A 1  156 ? 14.848  13.599  -7.512  1.00 8.14  ? 282  HIS A N     1 
ATOM   1161 C  CA    . HIS A 1  156 ? 14.526  12.768  -6.356  1.00 7.94  ? 282  HIS A CA    1 
ATOM   1162 C  C     . HIS A 1  156 ? 15.009  11.340  -6.466  1.00 9.54  ? 282  HIS A C     1 
ATOM   1163 O  O     . HIS A 1  156 ? 14.711  10.516  -5.592  1.00 8.74  ? 282  HIS A O     1 
ATOM   1164 C  CB    . HIS A 1  156 ? 13.010  12.776  -6.116  1.00 6.71  ? 282  HIS A CB    1 
ATOM   1165 C  CG    . HIS A 1  156 ? 12.507  14.110  -5.667  1.00 7.24  ? 282  HIS A CG    1 
ATOM   1166 N  ND1   . HIS A 1  156 ? 12.851  14.640  -4.449  1.00 9.48  ? 282  HIS A ND1   1 
ATOM   1167 C  CD2   . HIS A 1  156 ? 11.735  15.031  -6.286  1.00 6.67  ? 282  HIS A CD2   1 
ATOM   1168 C  CE1   . HIS A 1  156 ? 12.275  15.824  -4.314  1.00 10.84 ? 282  HIS A CE1   1 
ATOM   1169 N  NE2   . HIS A 1  156 ? 11.594  16.084  -5.411  1.00 11.58 ? 282  HIS A NE2   1 
ATOM   1170 N  N     . HIS A 1  157 ? 15.744  11.048  -7.533  1.00 11.64 ? 283  HIS A N     1 
ATOM   1171 C  CA    . HIS A 1  157 ? 16.117  9.655   -7.848  1.00 11.22 ? 283  HIS A CA    1 
ATOM   1172 C  C     . HIS A 1  157 ? 16.790  8.917   -6.699  1.00 10.97 ? 283  HIS A C     1 
ATOM   1173 O  O     . HIS A 1  157 ? 16.504  7.745   -6.455  1.00 7.28  ? 283  HIS A O     1 
ATOM   1174 C  CB    . HIS A 1  157 ? 17.023  9.611   -9.084  1.00 11.33 ? 283  HIS A CB    1 
ATOM   1175 C  CG    . HIS A 1  157 ? 17.335  8.220   -9.551  1.00 15.12 ? 283  HIS A CG    1 
ATOM   1176 N  ND1   . HIS A 1  157 ? 18.470  7.538   -9.157  1.00 14.33 ? 283  HIS A ND1   1 
ATOM   1177 C  CD2   . HIS A 1  157 ? 16.653  7.382   -10.365 1.00 19.63 ? 283  HIS A CD2   1 
ATOM   1178 C  CE1   . HIS A 1  157 ? 18.470  6.340   -9.715  1.00 20.24 ? 283  HIS A CE1   1 
ATOM   1179 N  NE2   . HIS A 1  157 ? 17.385  6.222   -10.458 1.00 17.52 ? 283  HIS A NE2   1 
ATOM   1180 N  N     . GLN A 1  158 ? 17.705  9.589   -5.997  1.00 9.78  ? 284  GLN A N     1 
ATOM   1181 C  CA    . GLN A 1  158 ? 18.429  8.916   -4.925  1.00 12.38 ? 284  GLN A CA    1 
ATOM   1182 C  C     . GLN A 1  158 ? 17.485  8.461   -3.805  1.00 10.49 ? 284  GLN A C     1 
ATOM   1183 O  O     . GLN A 1  158 ? 17.515  7.299   -3.390  1.00 9.26  ? 284  GLN A O     1 
ATOM   1184 C  CB    . GLN A 1  158 ? 19.551  9.815   -4.371  1.00 10.46 ? 284  GLN A CB    1 
ATOM   1185 C  CG    . GLN A 1  158 ? 20.298  9.198   -3.218  1.00 15.50 ? 284  GLN A CG    1 
ATOM   1186 C  CD    . GLN A 1  158 ? 21.625  9.909   -2.942  1.00 29.33 ? 284  GLN A CD    1 
ATOM   1187 O  OE1   . GLN A 1  158 ? 21.801  11.086  -3.283  1.00 26.28 ? 284  GLN A OE1   1 
ATOM   1188 N  NE2   . GLN A 1  158 ? 22.565  9.193   -2.330  1.00 31.53 ? 284  GLN A NE2   1 
ATOM   1189 N  N     . ASP A 1  159 ? 16.641  9.366   -3.318  1.00 8.60  ? 285  ASP A N     1 
ATOM   1190 C  CA    . ASP A 1  159 ? 15.680  8.984   -2.287  1.00 10.04 ? 285  ASP A CA    1 
ATOM   1191 C  C     . ASP A 1  159 ? 14.720  7.922   -2.812  1.00 8.23  ? 285  ASP A C     1 
ATOM   1192 O  O     . ASP A 1  159 ? 14.351  7.004   -2.086  1.00 9.71  ? 285  ASP A O     1 
ATOM   1193 C  CB    . ASP A 1  159 ? 14.836  10.169  -1.821  1.00 9.40  ? 285  ASP A CB    1 
ATOM   1194 C  CG    . ASP A 1  159 ? 15.570  11.063  -0.823  1.00 9.91  ? 285  ASP A CG    1 
ATOM   1195 O  OD1   . ASP A 1  159 ? 16.712  10.758  -0.476  1.00 12.63 ? 285  ASP A OD1   1 
ATOM   1196 O  OD2   . ASP A 1  159 ? 14.990  12.055  -0.370  1.00 9.58  ? 285  ASP A OD2   1 
ATOM   1197 N  N     . LEU A 1  160 ? 14.292  8.065   -4.061  1.00 7.72  ? 286  LEU A N     1 
ATOM   1198 C  CA    . LEU A 1  160 ? 13.314  7.111   -4.613  1.00 6.94  ? 286  LEU A CA    1 
ATOM   1199 C  C     . LEU A 1  160 ? 13.918  5.714   -4.822  1.00 10.84 ? 286  LEU A C     1 
ATOM   1200 O  O     . LEU A 1  160 ? 13.186  4.729   -4.982  1.00 10.48 ? 286  LEU A O     1 
ATOM   1201 C  CB    . LEU A 1  160 ? 12.698  7.637   -5.907  1.00 7.95  ? 286  LEU A CB    1 
ATOM   1202 C  CG    . LEU A 1  160 ? 11.914  8.945   -5.726  1.00 9.27  ? 286  LEU A CG    1 
ATOM   1203 C  CD1   . LEU A 1  160 ? 11.103  9.344   -6.971  1.00 9.75  ? 286  LEU A CD1   1 
ATOM   1204 C  CD2   . LEU A 1  160 ? 11.034  8.883   -4.497  1.00 6.28  ? 286  LEU A CD2   1 
ATOM   1205 N  N     . SER A 1  161 ? 15.243  5.622   -4.800  1.00 9.67  ? 287  SER A N     1 
ATOM   1206 C  CA    A SER A 1  161 ? 15.912  4.334   -4.953  0.50 11.44 ? 287  SER A CA    1 
ATOM   1207 C  CA    B SER A 1  161 ? 15.914  4.333   -4.956  0.50 11.44 ? 287  SER A CA    1 
ATOM   1208 C  C     . SER A 1  161 ? 16.077  3.623   -3.618  1.00 11.13 ? 287  SER A C     1 
ATOM   1209 O  O     . SER A 1  161 ? 16.535  2.489   -3.566  1.00 14.52 ? 287  SER A O     1 
ATOM   1210 C  CB    A SER A 1  161 ? 17.279  4.513   -5.621  0.50 11.84 ? 287  SER A CB    1 
ATOM   1211 C  CB    B SER A 1  161 ? 17.293  4.504   -5.606  0.50 11.84 ? 287  SER A CB    1 
ATOM   1212 O  OG    A SER A 1  161 ? 17.131  5.221   -6.835  0.50 15.08 ? 287  SER A OG    1 
ATOM   1213 O  OG    B SER A 1  161 ? 18.242  4.933   -4.648  0.50 6.97  ? 287  SER A OG    1 
ATOM   1214 N  N     . THR A 1  162 ? 15.711  4.288   -2.533  1.00 10.05 ? 288  THR A N     1 
ATOM   1215 C  CA    A THR A 1  162 ? 15.752  3.695   -1.199  0.50 12.09 ? 288  THR A CA    1 
ATOM   1216 C  CA    B THR A 1  162 ? 15.770  3.639   -1.236  0.50 12.08 ? 288  THR A CA    1 
ATOM   1217 C  C     . THR A 1  162 ? 14.407  3.014   -0.921  1.00 14.10 ? 288  THR A C     1 
ATOM   1218 O  O     . THR A 1  162 ? 13.366  3.610   -1.150  1.00 12.80 ? 288  THR A O     1 
ATOM   1219 C  CB    A THR A 1  162 ? 15.950  4.792   -0.134  0.50 12.75 ? 288  THR A CB    1 
ATOM   1220 C  CB    B THR A 1  162 ? 16.224  4.602   -0.122  0.50 12.75 ? 288  THR A CB    1 
ATOM   1221 O  OG1   A THR A 1  162 ? 17.039  5.638   -0.507  0.50 15.91 ? 288  THR A OG1   1 
ATOM   1222 O  OG1   B THR A 1  162 ? 15.254  5.639   0.058   0.50 13.92 ? 288  THR A OG1   1 
ATOM   1223 C  CG2   A THR A 1  162 ? 16.224  4.190   1.230   0.50 16.95 ? 288  THR A CG2   1 
ATOM   1224 C  CG2   B THR A 1  162 ? 17.554  5.220   -0.477  0.50 16.11 ? 288  THR A CG2   1 
ATOM   1225 N  N     . PRO A 1  163 ? 14.420  1.777   -0.419  1.00 13.51 ? 289  PRO A N     1 
ATOM   1226 C  CA    . PRO A 1  163 ? 13.154  1.070   -0.172  1.00 14.02 ? 289  PRO A CA    1 
ATOM   1227 C  C     . PRO A 1  163 ? 12.285  1.806   0.830   1.00 13.59 ? 289  PRO A C     1 
ATOM   1228 O  O     . PRO A 1  163 ? 12.784  2.255   1.846   1.00 10.73 ? 289  PRO A O     1 
ATOM   1229 C  CB    . PRO A 1  163 ? 13.606  -0.253  0.465   1.00 15.07 ? 289  PRO A CB    1 
ATOM   1230 C  CG    . PRO A 1  163 ? 15.024  -0.426  0.057   1.00 19.15 ? 289  PRO A CG    1 
ATOM   1231 C  CD    . PRO A 1  163 ? 15.602  0.934   -0.161  1.00 15.85 ? 289  PRO A CD    1 
ATOM   1232 N  N     . VAL A 1  164 ? 10.995  1.915   0.551   1.00 11.00 ? 290  VAL A N     1 
ATOM   1233 C  CA    . VAL A 1  164 ? 10.046  2.347   1.560   1.00 10.99 ? 290  VAL A CA    1 
ATOM   1234 C  C     . VAL A 1  164 ? 9.841   1.195   2.531   1.00 9.62  ? 290  VAL A C     1 
ATOM   1235 O  O     . VAL A 1  164 ? 9.668   0.055   2.105   1.00 9.60  ? 290  VAL A O     1 
ATOM   1236 C  CB    . VAL A 1  164 ? 8.688   2.662   0.943   1.00 11.08 ? 290  VAL A CB    1 
ATOM   1237 C  CG1   . VAL A 1  164 ? 7.776   3.240   1.987   1.00 10.23 ? 290  VAL A CG1   1 
ATOM   1238 C  CG2   . VAL A 1  164 ? 8.852   3.624   -0.222  1.00 15.24 ? 290  VAL A CG2   1 
ATOM   1239 N  N     . LEU A 1  165 ? 9.831   1.492   3.831   1.00 9.90  ? 291  LEU A N     1 
ATOM   1240 C  CA    . LEU A 1  165 ? 9.717   0.445   4.841   1.00 14.94 ? 291  LEU A CA    1 
ATOM   1241 C  C     . LEU A 1  165 ? 8.287   0.341   5.338   1.00 13.72 ? 291  LEU A C     1 
ATOM   1242 O  O     . LEU A 1  165 ? 7.573   1.342   5.424   1.00 10.22 ? 291  LEU A O     1 
ATOM   1243 C  CB    . LEU A 1  165 ? 10.670  0.717   6.019   1.00 14.82 ? 291  LEU A CB    1 
ATOM   1244 C  CG    . LEU A 1  165 ? 12.164  0.835   5.657   1.00 13.09 ? 291  LEU A CG    1 
ATOM   1245 C  CD1   . LEU A 1  165 ? 12.985  1.106   6.914   1.00 23.01 ? 291  LEU A CD1   1 
ATOM   1246 C  CD2   . LEU A 1  165 ? 12.691  -0.414  4.949   1.00 15.25 ? 291  LEU A CD2   1 
ATOM   1247 N  N     . ARG A 1  166 ? 7.885   -0.869  5.716   1.00 12.46 ? 292  ARG A N     1 
ATOM   1248 C  CA    . ARG A 1  166 ? 6.528   -1.079  6.187   1.00 17.66 ? 292  ARG A CA    1 
ATOM   1249 C  C     . ARG A 1  166 ? 6.354   -0.222  7.405   1.00 18.58 ? 292  ARG A C     1 
ATOM   1250 O  O     . ARG A 1  166 ? 5.277   0.273   7.698   1.00 20.26 ? 292  ARG A O     1 
ATOM   1251 C  CB    . ARG A 1  166 ? 6.277   -2.553  6.540   1.00 15.69 ? 292  ARG A CB    1 
ATOM   1252 C  CG    . ARG A 1  166 ? 4.864   -2.830  7.092   1.00 20.17 ? 292  ARG A CG    1 
ATOM   1253 C  CD    . ARG A 1  166 ? 3.820   -2.512  6.024   1.00 23.45 ? 292  ARG A CD    1 
ATOM   1254 N  NE    . ARG A 1  166 ? 2.435   -2.832  6.409   1.00 27.81 ? 292  ARG A NE    1 
ATOM   1255 C  CZ    . ARG A 1  166 ? 1.685   -2.060  7.191   1.00 25.68 ? 292  ARG A CZ    1 
ATOM   1256 N  NH1   . ARG A 1  166 ? 2.191   -0.946  7.698   1.00 24.21 ? 292  ARG A NH1   1 
ATOM   1257 N  NH2   . ARG A 1  166 ? 0.435   -2.402  7.473   1.00 31.78 ? 292  ARG A NH2   1 
ATOM   1258 N  N     . SER A 1  167 ? 7.448   -0.007  8.113   1.00 23.66 ? 293  SER A N     1 
ATOM   1259 C  CA    . SER A 1  167 ? 7.360   0.737   9.343   1.00 23.62 ? 293  SER A CA    1 
ATOM   1260 C  C     . SER A 1  167 ? 7.173   2.235   9.080   1.00 20.29 ? 293  SER A C     1 
ATOM   1261 O  O     . SER A 1  167 ? 6.902   2.980   10.012  1.00 27.23 ? 293  SER A O     1 
ATOM   1262 C  CB    . SER A 1  167 ? 8.577   0.433   10.229  1.00 23.34 ? 293  SER A CB    1 
ATOM   1263 O  OG    . SER A 1  167 ? 9.773   0.657   9.508   1.00 22.56 ? 293  SER A OG    1 
ATOM   1264 N  N     . ASP A 1  168 ? 7.321   2.664   7.816   1.00 20.11 ? 294  ASP A N     1 
ATOM   1265 C  CA    . ASP A 1  168 ? 7.053   4.051   7.383   1.00 16.54 ? 294  ASP A CA    1 
ATOM   1266 C  C     . ASP A 1  168 ? 5.576   4.250   7.048   1.00 24.04 ? 294  ASP A C     1 
ATOM   1267 O  O     . ASP A 1  168 ? 5.063   5.383   6.999   1.00 20.60 ? 294  ASP A O     1 
ATOM   1268 C  CB    . ASP A 1  168 ? 7.767   4.372   6.051   1.00 20.84 ? 294  ASP A CB    1 
ATOM   1269 C  CG    . ASP A 1  168 ? 9.287   4.470   6.172   1.00 32.97 ? 294  ASP A CG    1 
ATOM   1270 O  OD1   . ASP A 1  168 ? 9.774   4.743   7.294   1.00 24.26 ? 294  ASP A OD1   1 
ATOM   1271 O  OD2   . ASP A 1  168 ? 9.983   4.290   5.125   1.00 19.72 ? 294  ASP A OD2   1 
ATOM   1272 N  N     . VAL A 1  169 ? 4.915   3.143   6.727   1.00 22.42 ? 295  VAL A N     1 
ATOM   1273 C  CA    . VAL A 1  169 ? 3.662   3.202   5.994   1.00 18.06 ? 295  VAL A CA    1 
ATOM   1274 C  C     . VAL A 1  169 ? 2.539   3.738   6.861   1.00 17.39 ? 295  VAL A C     1 
ATOM   1275 O  O     . VAL A 1  169 ? 1.722   4.545   6.399   1.00 15.57 ? 295  VAL A O     1 
ATOM   1276 C  CB    . VAL A 1  169 ? 3.307   1.807   5.392   1.00 15.66 ? 295  VAL A CB    1 
ATOM   1277 C  CG1   . VAL A 1  169 ? 1.853   1.763   4.932   1.00 11.76 ? 295  VAL A CG1   1 
ATOM   1278 C  CG2   . VAL A 1  169 ? 4.264   1.468   4.233   1.00 12.16 ? 295  VAL A CG2   1 
ATOM   1279 N  N     . ASP A 1  170 ? 2.507   3.318   8.124   1.00 13.90 ? 296  ASP A N     1 
ATOM   1280 C  CA    . ASP A 1  170 ? 1.437   3.752   9.016   1.00 18.97 ? 296  ASP A CA    1 
ATOM   1281 C  C     . ASP A 1  170 ? 1.408   5.269   9.200   1.00 18.82 ? 296  ASP A C     1 
ATOM   1282 O  O     . ASP A 1  170 ? 0.338   5.872   9.202   1.00 20.49 ? 296  ASP A O     1 
ATOM   1283 C  CB    . ASP A 1  170 ? 1.493   3.029   10.371  1.00 31.31 ? 296  ASP A CB    1 
ATOM   1284 C  CG    . ASP A 1  170 ? 1.028   1.570   10.284  1.00 34.90 ? 296  ASP A CG    1 
ATOM   1285 N  N     . ALA A 1  171 ? 2.579   5.887   9.315   1.00 25.56 ? 297  ALA A N     1 
ATOM   1286 C  CA    . ALA A 1  171 ? 2.652   7.338   9.442   1.00 25.16 ? 297  ALA A CA    1 
ATOM   1287 C  C     . ALA A 1  171 ? 2.076   8.031   8.213   1.00 18.20 ? 297  ALA A C     1 
ATOM   1288 O  O     . ALA A 1  171 ? 1.326   8.995   8.328   1.00 18.45 ? 297  ALA A O     1 
ATOM   1289 C  CB    . ALA A 1  171 ? 4.097   7.790   9.674   1.00 31.41 ? 297  ALA A CB    1 
ATOM   1290 N  N     A LEU A 1  172 ? 2.449   7.557   7.024   0.50 17.27 ? 298  LEU A N     1 
ATOM   1291 N  N     B LEU A 1  172 ? 2.431   7.521   7.049   0.50 17.27 ? 298  LEU A N     1 
ATOM   1292 C  CA    A LEU A 1  172 ? 1.920   8.116   5.777   0.50 16.86 ? 298  LEU A CA    1 
ATOM   1293 C  CA    B LEU A 1  172 ? 1.952   8.065   5.798   0.50 16.86 ? 298  LEU A CA    1 
ATOM   1294 C  C     A LEU A 1  172 ? 0.411   7.930   5.674   0.50 15.36 ? 298  LEU A C     1 
ATOM   1295 C  C     B LEU A 1  172 ? 0.442   7.902   5.635   0.50 15.37 ? 298  LEU A C     1 
ATOM   1296 O  O     A LEU A 1  172 ? -0.304  8.851   5.268   0.50 15.68 ? 298  LEU A O     1 
ATOM   1297 O  O     B LEU A 1  172 ? -0.242  8.809   5.154   0.50 15.71 ? 298  LEU A O     1 
ATOM   1298 C  CB    A LEU A 1  172 ? 2.583   7.494   4.544   0.50 16.78 ? 298  LEU A CB    1 
ATOM   1299 C  CB    B LEU A 1  172 ? 2.660   7.351   4.671   0.50 17.03 ? 298  LEU A CB    1 
ATOM   1300 C  CG    A LEU A 1  172 ? 3.961   7.992   4.095   0.50 18.39 ? 298  LEU A CG    1 
ATOM   1301 C  CG    B LEU A 1  172 ? 2.320   7.817   3.278   0.50 13.71 ? 298  LEU A CG    1 
ATOM   1302 C  CD1   A LEU A 1  172 ? 4.574   7.032   3.085   0.50 11.01 ? 298  LEU A CD1   1 
ATOM   1303 C  CD1   B LEU A 1  172 ? 2.579   9.305   3.163   0.50 20.15 ? 298  LEU A CD1   1 
ATOM   1304 C  CD2   A LEU A 1  172 ? 3.903   9.422   3.529   0.50 15.90 ? 298  LEU A CD2   1 
ATOM   1305 C  CD2   B LEU A 1  172 ? 3.193   7.040   2.354   0.50 13.55 ? 298  LEU A CD2   1 
ATOM   1306 N  N     . GLN A 1  173 ? -0.075  6.742   6.025   1.00 11.20 ? 299  GLN A N     1 
ATOM   1307 C  CA    . GLN A 1  173 ? -1.508  6.488   5.921   1.00 11.42 ? 299  GLN A CA    1 
ATOM   1308 C  C     . GLN A 1  173 ? -2.289  7.449   6.802   1.00 13.28 ? 299  GLN A C     1 
ATOM   1309 O  O     . GLN A 1  173 ? -3.337  7.968   6.401   1.00 11.90 ? 299  GLN A O     1 
ATOM   1310 C  CB    . GLN A 1  173 ? -1.873  5.052   6.275   1.00 13.03 ? 299  GLN A CB    1 
ATOM   1311 C  CG    . GLN A 1  173 ? -3.366  4.780   5.992   1.00 8.95  ? 299  GLN A CG    1 
ATOM   1312 C  CD    . GLN A 1  173 ? -3.672  3.300   5.849   1.00 14.38 ? 299  GLN A CD    1 
ATOM   1313 O  OE1   . GLN A 1  173 ? -2.772  2.486   5.723   1.00 10.71 ? 299  GLN A OE1   1 
ATOM   1314 N  NE2   . GLN A 1  173 ? -4.961  2.953   5.873   1.00 15.30 ? 299  GLN A NE2   1 
ATOM   1315 N  N     . GLN A 1  174 ? -1.759  7.724   7.993   1.00 15.45 ? 300  GLN A N     1 
ATOM   1316 C  CA    . GLN A 1  174 ? -2.464  8.626   8.908   1.00 13.90 ? 300  GLN A CA    1 
ATOM   1317 C  C     . GLN A 1  174 ? -2.584  10.015  8.311   1.00 15.16 ? 300  GLN A C     1 
ATOM   1318 O  O     . GLN A 1  174 ? -3.643  10.658  8.363   1.00 13.75 ? 300  GLN A O     1 
ATOM   1319 C  CB    . GLN A 1  174 ? -1.794  8.650   10.284  1.00 19.66 ? 300  GLN A CB    1 
ATOM   1320 C  CG    . GLN A 1  174 ? -2.117  7.414   11.126  1.00 26.72 ? 300  GLN A CG    1 
ATOM   1321 N  N     . VAL A 1  175 ? -1.505  10.453  7.693   1.00 13.11 ? 301  VAL A N     1 
ATOM   1322 C  CA    . VAL A 1  175 ? -1.455  11.759  7.084   1.00 14.01 ? 301  VAL A CA    1 
ATOM   1323 C  C     . VAL A 1  175 ? -2.438  11.850  5.908   1.00 17.67 ? 301  VAL A C     1 
ATOM   1324 O  O     . VAL A 1  175 ? -3.137  12.863  5.742   1.00 12.82 ? 301  VAL A O     1 
ATOM   1325 C  CB    . VAL A 1  175 ? 0.002   12.060  6.670   1.00 22.44 ? 301  VAL A CB    1 
ATOM   1326 C  CG1   . VAL A 1  175 ? 0.062   12.827  5.401   1.00 27.57 ? 301  VAL A CG1   1 
ATOM   1327 C  CG2   . VAL A 1  175 ? 0.725   12.784  7.793   1.00 20.08 ? 301  VAL A CG2   1 
ATOM   1328 N  N     . VAL A 1  176 ? -2.513  10.788  5.106   1.00 13.02 ? 302  VAL A N     1 
ATOM   1329 C  CA    . VAL A 1  176 ? -3.477  10.734  3.997   1.00 10.50 ? 302  VAL A CA    1 
ATOM   1330 C  C     . VAL A 1  176 ? -4.926  10.698  4.516   1.00 11.83 ? 302  VAL A C     1 
ATOM   1331 O  O     . VAL A 1  176 ? -5.814  11.392  3.999   1.00 13.12 ? 302  VAL A O     1 
ATOM   1332 C  CB    . VAL A 1  176 ? -3.188  9.529   3.063   1.00 11.43 ? 302  VAL A CB    1 
ATOM   1333 C  CG1   . VAL A 1  176 ? -4.293  9.332   2.032   1.00 11.00 ? 302  VAL A CG1   1 
ATOM   1334 C  CG2   . VAL A 1  176 ? -1.839  9.716   2.377   1.00 13.93 ? 302  VAL A CG2   1 
ATOM   1335 N  N     . GLU A 1  177 ? -5.159  9.913   5.556   1.00 11.69 ? 303  GLU A N     1 
ATOM   1336 C  CA    . GLU A 1  177 ? -6.493  9.833   6.131   1.00 10.67 ? 303  GLU A CA    1 
ATOM   1337 C  C     . GLU A 1  177 ? -6.968  11.191  6.638   1.00 14.15 ? 303  GLU A C     1 
ATOM   1338 O  O     . GLU A 1  177 ? -8.139  11.542  6.493   1.00 13.12 ? 303  GLU A O     1 
ATOM   1339 C  CB    . GLU A 1  177 ? -6.546  8.780   7.232   1.00 10.96 ? 303  GLU A CB    1 
ATOM   1340 C  CG    . GLU A 1  177 ? -6.434  7.388   6.664   1.00 8.39  ? 303  GLU A CG    1 
ATOM   1341 C  CD    . GLU A 1  177 ? -6.300  6.302   7.711   1.00 14.90 ? 303  GLU A CD    1 
ATOM   1342 O  OE1   . GLU A 1  177 ? -5.946  6.608   8.857   1.00 17.88 ? 303  GLU A OE1   1 
ATOM   1343 O  OE2   . GLU A 1  177 ? -6.554  5.130   7.386   1.00 20.92 ? 303  GLU A OE2   1 
ATOM   1344 N  N     . GLU A 1  178 ? -6.052  11.966  7.208   1.00 13.46 ? 304  GLU A N     1 
ATOM   1345 C  CA    . GLU A 1  178 ? -6.431  13.283  7.728   1.00 16.16 ? 304  GLU A CA    1 
ATOM   1346 C  C     . GLU A 1  178 ? -6.906  14.185  6.592   1.00 16.65 ? 304  GLU A C     1 
ATOM   1347 O  O     . GLU A 1  178 ? -7.987  14.773  6.684   1.00 14.51 ? 304  GLU A O     1 
ATOM   1348 C  CB    . GLU A 1  178 ? -5.296  13.939  8.530   1.00 16.41 ? 304  GLU A CB    1 
ATOM   1349 C  CG    . GLU A 1  178 ? -5.682  15.327  9.135   1.00 21.50 ? 304  GLU A CG    1 
ATOM   1350 C  CD    . GLU A 1  178 ? -6.917  15.280  10.078  1.00 37.55 ? 304  GLU A CD    1 
ATOM   1351 O  OE1   . GLU A 1  178 ? -6.925  14.460  11.020  1.00 42.45 ? 304  GLU A OE1   1 
ATOM   1352 O  OE2   . GLU A 1  178 ? -7.886  16.067  9.883   1.00 39.98 ? 304  GLU A OE2   1 
ATOM   1353 N  N     . ALA A 1  179 ? -6.126  14.268  5.510   1.00 11.95 ? 305  ALA A N     1 
ATOM   1354 C  CA    . ALA A 1  179 ? -6.526  15.068  4.356   1.00 10.65 ? 305  ALA A CA    1 
ATOM   1355 C  C     . ALA A 1  179 ? -7.811  14.526  3.718   1.00 13.03 ? 305  ALA A C     1 
ATOM   1356 O  O     . ALA A 1  179 ? -8.701  15.294  3.347   1.00 13.32 ? 305  ALA A O     1 
ATOM   1357 C  CB    . ALA A 1  179 ? -5.391  15.154  3.304   1.00 10.99 ? 305  ALA A CB    1 
ATOM   1358 N  N     . VAL A 1  180 ? -7.907  13.208  3.592   1.00 12.04 ? 306  VAL A N     1 
ATOM   1359 C  CA    . VAL A 1  180 ? -9.109  12.580  3.042   1.00 11.04 ? 306  VAL A CA    1 
ATOM   1360 C  C     . VAL A 1  180 ? -10.367 12.885  3.895   1.00 12.00 ? 306  VAL A C     1 
ATOM   1361 O  O     . VAL A 1  180 ? -11.437 13.159  3.353   1.00 10.81 ? 306  VAL A O     1 
ATOM   1362 C  CB    . VAL A 1  180 ? -8.920  11.048  2.909   1.00 10.57 ? 306  VAL A CB    1 
ATOM   1363 C  CG1   . VAL A 1  180 ? -10.252 10.374  2.666   1.00 10.26 ? 306  VAL A CG1   1 
ATOM   1364 C  CG2   . VAL A 1  180 ? -7.955  10.732  1.772   1.00 4.83  ? 306  VAL A CG2   1 
ATOM   1365 N  N     . GLY A 1  181 ? -10.216 12.847  5.223   1.00 12.36 ? 307  GLY A N     1 
ATOM   1366 C  CA    . GLY A 1  181 ? -11.327 13.092  6.137   1.00 15.68 ? 307  GLY A CA    1 
ATOM   1367 C  C     . GLY A 1  181 ? -11.885 14.500  6.046   1.00 19.10 ? 307  GLY A C     1 
ATOM   1368 O  O     . GLY A 1  181 ? -13.092 14.716  6.198   1.00 15.51 ? 307  GLY A O     1 
ATOM   1369 N  N     . GLN A 1  182 ? -11.007 15.466  5.797   1.00 14.25 ? 308  GLN A N     1 
ATOM   1370 C  CA    . GLN A 1  182 ? -11.428 16.840  5.585   1.00 10.66 ? 308  GLN A CA    1 
ATOM   1371 C  C     . GLN A 1  182 ? -12.042 17.005  4.213   1.00 12.15 ? 308  GLN A C     1 
ATOM   1372 O  O     . GLN A 1  182 ? -13.046 17.718  4.041   1.00 13.88 ? 308  GLN A O     1 
ATOM   1373 C  CB    . GLN A 1  182 ? -10.227 17.775  5.740   1.00 10.46 ? 308  GLN A CB    1 
ATOM   1374 C  CG    . GLN A 1  182 ? -9.685  17.785  7.171   1.00 13.76 ? 308  GLN A CG    1 
ATOM   1375 C  CD    . GLN A 1  182 ? -8.453  18.637  7.300   1.00 22.39 ? 308  GLN A CD    1 
ATOM   1376 O  OE1   . GLN A 1  182 ? -8.224  19.540  6.489   1.00 17.96 ? 308  GLN A OE1   1 
ATOM   1377 N  NE2   . GLN A 1  182 ? -7.642  18.358  8.318   1.00 18.06 ? 308  GLN A NE2   1 
ATOM   1378 N  N     . ALA A 1  183 ? -11.455 16.330  3.227   1.00 12.14 ? 309  ALA A N     1 
ATOM   1379 C  CA    . ALA A 1  183 ? -11.960 16.428  1.857   1.00 11.67 ? 309  ALA A CA    1 
ATOM   1380 C  C     . ALA A 1  183 ? -13.369 15.856  1.737   1.00 10.03 ? 309  ALA A C     1 
ATOM   1381 O  O     . ALA A 1  183 ? -14.207 16.365  0.978   1.00 13.96 ? 309  ALA A O     1 
ATOM   1382 C  CB    . ALA A 1  183 ? -10.999 15.728  0.874   1.00 10.90 ? 309  ALA A CB    1 
ATOM   1383 N  N     . LEU A 1  184 ? -13.631 14.778  2.463   1.00 8.37  ? 310  LEU A N     1 
ATOM   1384 C  CA    . LEU A 1  184 ? -14.940 14.120  2.389   1.00 8.25  ? 310  LEU A CA    1 
ATOM   1385 C  C     . LEU A 1  184 ? -15.109 13.234  3.607   1.00 10.67 ? 310  LEU A C     1 
ATOM   1386 O  O     . LEU A 1  184 ? -14.625 12.100  3.638   1.00 11.17 ? 310  LEU A O     1 
ATOM   1387 C  CB    . LEU A 1  184 ? -15.066 13.286  1.099   1.00 10.93 ? 310  LEU A CB    1 
ATOM   1388 C  CG    . LEU A 1  184 ? -16.381 12.498  0.960   1.00 9.91  ? 310  LEU A CG    1 
ATOM   1389 C  CD1   . LEU A 1  184 ? -17.579 13.415  0.833   1.00 9.47  ? 310  LEU A CD1   1 
ATOM   1390 C  CD2   . LEU A 1  184 ? -16.315 11.520  -0.213  1.00 7.68  ? 310  LEU A CD2   1 
ATOM   1391 N  N     . PRO A 1  185 ? -15.779 13.753  4.639   1.00 11.70 ? 311  PRO A N     1 
ATOM   1392 C  CA    . PRO A 1  185 ? -15.981 12.937  5.840   1.00 10.79 ? 311  PRO A CA    1 
ATOM   1393 C  C     . PRO A 1  185 ? -16.604 11.578  5.528   1.00 12.29 ? 311  PRO A C     1 
ATOM   1394 O  O     . PRO A 1  185 ? -17.542 11.454  4.742   1.00 10.62 ? 311  PRO A O     1 
ATOM   1395 C  CB    . PRO A 1  185 ? -16.899 13.812  6.708   1.00 13.06 ? 311  PRO A CB    1 
ATOM   1396 C  CG    . PRO A 1  185 ? -16.432 15.261  6.323   1.00 11.83 ? 311  PRO A CG    1 
ATOM   1397 C  CD    . PRO A 1  185 ? -16.186 15.168  4.826   1.00 11.03 ? 311  PRO A CD    1 
ATOM   1398 N  N     . GLY A 1  186 ? -16.030 10.538  6.108   1.00 11.20 ? 312  GLY A N     1 
ATOM   1399 C  CA    . GLY A 1  186 ? -16.569 9.218   5.897   1.00 9.22  ? 312  GLY A CA    1 
ATOM   1400 C  C     . GLY A 1  186 ? -15.815 8.459   4.822   1.00 11.31 ? 312  GLY A C     1 
ATOM   1401 O  O     . GLY A 1  186 ? -15.998 7.247   4.692   1.00 9.90  ? 312  GLY A O     1 
ATOM   1402 N  N     . ALA A 1  187 ? -14.987 9.152   4.049   1.00 8.08  ? 313  ALA A N     1 
ATOM   1403 C  CA    . ALA A 1  187 ? -14.187 8.486   3.007   1.00 9.07  ? 313  ALA A CA    1 
ATOM   1404 C  C     . ALA A 1  187 ? -13.120 7.659   3.690   1.00 10.00 ? 313  ALA A C     1 
ATOM   1405 O  O     . ALA A 1  187 ? -12.619 8.060   4.736   1.00 14.36 ? 313  ALA A O     1 
ATOM   1406 C  CB    . ALA A 1  187 ? -13.562 9.499   2.059   1.00 6.13  ? 313  ALA A CB    1 
ATOM   1407 N  N     . THR A 1  188 ? -12.765 6.517   3.105   1.00 8.24  ? 314  THR A N     1 
ATOM   1408 C  CA    . THR A 1  188 ? -11.799 5.610   3.739   1.00 7.73  ? 314  THR A CA    1 
ATOM   1409 C  C     . THR A 1  188 ? -10.532 5.471   2.914   1.00 9.23  ? 314  THR A C     1 
ATOM   1410 O  O     . THR A 1  188 ? -10.519 5.745   1.710   1.00 7.08  ? 314  THR A O     1 
ATOM   1411 C  CB    . THR A 1  188 ? -12.386 4.224   3.925   1.00 8.65  ? 314  THR A CB    1 
ATOM   1412 O  OG1   . THR A 1  188 ? -12.763 3.702   2.639   1.00 8.31  ? 314  THR A OG1   1 
ATOM   1413 C  CG2   . THR A 1  188 ? -13.637 4.292   4.847   1.00 13.31 ? 314  THR A CG2   1 
ATOM   1414 N  N     . VAL A 1  189 ? -9.461  5.054   3.573   1.00 5.54  ? 315  VAL A N     1 
ATOM   1415 C  CA    . VAL A 1  189 ? -8.206  4.848   2.876   1.00 8.07  ? 315  VAL A CA    1 
ATOM   1416 C  C     . VAL A 1  189 ? -7.818  3.417   3.119   1.00 9.04  ? 315  VAL A C     1 
ATOM   1417 O  O     . VAL A 1  189 ? -7.808  2.981   4.275   1.00 7.82  ? 315  VAL A O     1 
ATOM   1418 C  CB    . VAL A 1  189 ? -7.098  5.762   3.439   1.00 6.43  ? 315  VAL A CB    1 
ATOM   1419 C  CG1   . VAL A 1  189 ? -5.770  5.453   2.761   1.00 5.78  ? 315  VAL A CG1   1 
ATOM   1420 C  CG2   . VAL A 1  189 ? -7.478  7.230   3.221   1.00 6.95  ? 315  VAL A CG2   1 
ATOM   1421 N  N     . THR A 1  190 ? -7.483  2.691   2.050   1.00 6.54  ? 316  THR A N     1 
ATOM   1422 C  CA    . THR A 1  190 ? -7.081  1.294   2.197   1.00 6.27  ? 316  THR A CA    1 
ATOM   1423 C  C     . THR A 1  190 ? -5.689  1.087   1.616   1.00 5.52  ? 316  THR A C     1 
ATOM   1424 O  O     . THR A 1  190 ? -5.422  1.487   0.482   1.00 4.64  ? 316  THR A O     1 
ATOM   1425 C  CB    . THR A 1  190 ? -8.080  0.349   1.503   1.00 7.92  ? 316  THR A CB    1 
ATOM   1426 O  OG1   . THR A 1  190 ? -9.361  0.490   2.132   1.00 6.66  ? 316  THR A OG1   1 
ATOM   1427 C  CG2   . THR A 1  190 ? -7.620  -1.132  1.627   1.00 7.59  ? 316  THR A CG2   1 
ATOM   1428 N  N     . LEU A 1  191 ? -4.800  0.483   2.392   1.00 5.77  ? 317  LEU A N     1 
ATOM   1429 C  CA    . LEU A 1  191 ? -3.448  0.199   1.908   1.00 5.07  ? 317  LEU A CA    1 
ATOM   1430 C  C     . LEU A 1  191 ? -3.535  -0.930  0.879   1.00 5.99  ? 317  LEU A C     1 
ATOM   1431 O  O     . LEU A 1  191 ? -4.121  -1.984  1.151   1.00 6.48  ? 317  LEU A O     1 
ATOM   1432 C  CB    . LEU A 1  191 ? -2.564  -0.241  3.074   1.00 5.30  ? 317  LEU A CB    1 
ATOM   1433 C  CG    . LEU A 1  191 ? -1.162  -0.693  2.694   1.00 7.13  ? 317  LEU A CG    1 
ATOM   1434 C  CD1   . LEU A 1  191 ? -0.376  0.487   2.070   1.00 4.19  ? 317  LEU A CD1   1 
ATOM   1435 C  CD2   . LEU A 1  191 ? -0.466  -1.264  3.941   1.00 10.71 ? 317  LEU A CD2   1 
ATOM   1436 N  N     A THR A 1  192 ? -2.957  -0.717  -0.297  0.50 4.42  ? 318  THR A N     1 
ATOM   1437 N  N     B THR A 1  192 ? -2.967  -0.714  -0.297  0.50 4.43  ? 318  THR A N     1 
ATOM   1438 C  CA    A THR A 1  192 ? -2.994  -1.737  -1.341  0.50 4.49  ? 318  THR A CA    1 
ATOM   1439 C  CA    B THR A 1  192 ? -2.991  -1.749  -1.319  0.50 4.59  ? 318  THR A CA    1 
ATOM   1440 C  C     A THR A 1  192 ? -1.563  -2.036  -1.791  0.50 4.87  ? 318  THR A C     1 
ATOM   1441 C  C     B THR A 1  192 ? -1.555  -1.933  -1.828  0.50 4.88  ? 318  THR A C     1 
ATOM   1442 O  O     A THR A 1  192 ? -0.631  -1.965  -0.973  0.50 5.01  ? 318  THR A O     1 
ATOM   1443 O  O     B THR A 1  192 ? -0.601  -1.688  -1.075  0.50 5.23  ? 318  THR A O     1 
ATOM   1444 C  CB    A THR A 1  192 ? -3.895  -1.304  -2.521  0.50 3.90  ? 318  THR A CB    1 
ATOM   1445 C  CB    B THR A 1  192 ? -4.075  -1.449  -2.411  0.50 3.86  ? 318  THR A CB    1 
ATOM   1446 O  OG1   A THR A 1  192 ? -3.353  -0.129  -3.136  0.50 6.40  ? 318  THR A OG1   1 
ATOM   1447 O  OG1   B THR A 1  192 ? -4.126  -2.499  -3.380  0.50 2.77  ? 318  THR A OG1   1 
ATOM   1448 C  CG2   A THR A 1  192 ? -5.285  -0.972  -2.021  0.50 5.10  ? 318  THR A CG2   1 
ATOM   1449 C  CG2   B THR A 1  192 ? -3.839  -0.107  -3.099  0.50 5.49  ? 318  THR A CG2   1 
ATOM   1450 N  N     . GLY A 1  193 ? -1.385  -2.390  -3.062  1.00 3.41  ? 319  GLY A N     1 
ATOM   1451 C  CA    . GLY A 1  193 ? -0.053  -2.635  -3.601  1.00 5.65  ? 319  GLY A CA    1 
ATOM   1452 C  C     . GLY A 1  193 ? 0.726   -3.733  -2.877  1.00 6.03  ? 319  GLY A C     1 
ATOM   1453 O  O     . GLY A 1  193 ? 0.139   -4.597  -2.231  1.00 4.35  ? 319  GLY A O     1 
ATOM   1454 N  N     . GLY A 1  194 ? 2.048   -3.700  -2.999  1.00 3.91  ? 320  GLY A N     1 
ATOM   1455 C  CA    . GLY A 1  194 ? 2.898   -4.755  -2.461  1.00 3.82  ? 320  GLY A CA    1 
ATOM   1456 C  C     . GLY A 1  194 ? 2.773   -4.948  -0.955  1.00 4.83  ? 320  GLY A C     1 
ATOM   1457 O  O     . GLY A 1  194 ? 2.789   -6.085  -0.473  1.00 5.02  ? 320  GLY A O     1 
ATOM   1458 N  N     . PHE A 1  195 ? 2.586   -3.854  -0.205  1.00 3.67  ? 321  PHE A N     1 
ATOM   1459 C  CA    . PHE A 1  195 ? 2.480   -3.983  1.248   1.00 4.15  ? 321  PHE A CA    1 
ATOM   1460 C  C     . PHE A 1  195 ? 1.258   -4.791  1.660   1.00 4.93  ? 321  PHE A C     1 
ATOM   1461 O  O     . PHE A 1  195 ? 1.305   -5.535  2.648   1.00 4.75  ? 321  PHE A O     1 
ATOM   1462 C  CB    . PHE A 1  195 ? 2.501   -2.618  1.967   1.00 3.77  ? 321  PHE A CB    1 
ATOM   1463 C  CG    . PHE A 1  195 ? 3.845   -1.941  1.917   1.00 7.81  ? 321  PHE A CG    1 
ATOM   1464 C  CD1   . PHE A 1  195 ? 4.056   -0.863  1.073   1.00 6.27  ? 321  PHE A CD1   1 
ATOM   1465 C  CD2   . PHE A 1  195 ? 4.906   -2.403  2.695   1.00 8.19  ? 321  PHE A CD2   1 
ATOM   1466 C  CE1   . PHE A 1  195 ? 5.305   -0.238  1.008   1.00 9.66  ? 321  PHE A CE1   1 
ATOM   1467 C  CE2   . PHE A 1  195 ? 6.163   -1.777  2.647   1.00 6.90  ? 321  PHE A CE2   1 
ATOM   1468 C  CZ    . PHE A 1  195 ? 6.362   -0.699  1.787   1.00 9.13  ? 321  PHE A CZ    1 
ATOM   1469 N  N     . ARG A 1  196 ? 0.177   -4.679  0.901   1.00 4.05  ? 322  ARG A N     1 
ATOM   1470 C  CA    . ARG A 1  196 ? -0.990  -5.518  1.205   1.00 4.21  ? 322  ARG A CA    1 
ATOM   1471 C  C     . ARG A 1  196 ? -0.712  -7.024  0.956   1.00 5.14  ? 322  ARG A C     1 
ATOM   1472 O  O     . ARG A 1  196 ? -1.313  -7.887  1.594   1.00 5.49  ? 322  ARG A O     1 
ATOM   1473 C  CB    . ARG A 1  196 ? -2.226  -5.073  0.417   1.00 5.03  ? 322  ARG A CB    1 
ATOM   1474 C  CG    . ARG A 1  196 ? -3.506  -5.852  0.828   1.00 4.10  ? 322  ARG A CG    1 
ATOM   1475 C  CD    . ARG A 1  196 ? -4.795  -5.171  0.316   1.00 3.61  ? 322  ARG A CD    1 
ATOM   1476 N  NE    . ARG A 1  196 ? -5.957  -5.974  0.735   1.00 7.62  ? 322  ARG A NE    1 
ATOM   1477 C  CZ    . ARG A 1  196 ? -6.690  -6.759  -0.049  1.00 6.53  ? 322  ARG A CZ    1 
ATOM   1478 N  NH1   . ARG A 1  196 ? -6.468  -6.825  -1.351  1.00 2.80  ? 322  ARG A NH1   1 
ATOM   1479 N  NH2   . ARG A 1  196 ? -7.692  -7.458  0.475   1.00 4.75  ? 322  ARG A NH2   1 
ATOM   1480 N  N     . ARG A 1  197 ? 0.212   -7.335  0.052   1.00 3.56  ? 323  ARG A N     1 
ATOM   1481 C  CA    . ARG A 1  197 ? 0.588   -8.735  -0.195  1.00 5.05  ? 323  ARG A CA    1 
ATOM   1482 C  C     . ARG A 1  197 ? 1.595   -9.233  0.829   1.00 6.40  ? 323  ARG A C     1 
ATOM   1483 O  O     . ARG A 1  197 ? 2.100   -10.351 0.711   1.00 7.58  ? 323  ARG A O     1 
ATOM   1484 C  CB    . ARG A 1  197 ? 1.159   -8.914  -1.609  1.00 5.80  ? 323  ARG A CB    1 
ATOM   1485 C  CG    . ARG A 1  197 ? 0.198   -8.511  -2.740  1.00 4.30  ? 323  ARG A CG    1 
ATOM   1486 C  CD    . ARG A 1  197 ? 0.728   -9.043  -4.110  1.00 4.10  ? 323  ARG A CD    1 
ATOM   1487 N  NE    . ARG A 1  197 ? 2.139   -8.675  -4.360  1.00 4.61  ? 323  ARG A NE    1 
ATOM   1488 C  CZ    . ARG A 1  197 ? 2.550   -7.508  -4.872  1.00 5.19  ? 323  ARG A CZ    1 
ATOM   1489 N  NH1   . ARG A 1  197 ? 3.857   -7.296  -5.057  1.00 3.48  ? 323  ARG A NH1   1 
ATOM   1490 N  NH2   . ARG A 1  197 ? 1.655   -6.562  -5.231  1.00 2.78  ? 323  ARG A NH2   1 
ATOM   1491 N  N     . GLY A 1  198 ? 1.920   -8.393  1.810   1.00 5.52  ? 324  GLY A N     1 
ATOM   1492 C  CA    . GLY A 1  198 ? 2.838   -8.795  2.876   1.00 7.30  ? 324  GLY A CA    1 
ATOM   1493 C  C     . GLY A 1  198 ? 4.289   -8.350  2.707   1.00 9.04  ? 324  GLY A C     1 
ATOM   1494 O  O     . GLY A 1  198 ? 5.154   -8.691  3.515   1.00 8.66  ? 324  GLY A O     1 
ATOM   1495 N  N     . LYS A 1  199 ? 4.582   -7.580  1.670   1.00 5.63  ? 325  LYS A N     1 
ATOM   1496 C  CA    . LYS A 1  199 ? 5.955   -7.133  1.482   1.00 5.57  ? 325  LYS A CA    1 
ATOM   1497 C  C     . LYS A 1  199 ? 6.393   -6.270  2.651   1.00 8.04  ? 325  LYS A C     1 
ATOM   1498 O  O     . LYS A 1  199 ? 5.583   -5.518  3.203   1.00 7.72  ? 325  LYS A O     1 
ATOM   1499 C  CB    . LYS A 1  199 ? 6.111   -6.370  0.163   1.00 8.78  ? 325  LYS A CB    1 
ATOM   1500 C  CG    . LYS A 1  199 ? 5.985   -7.249  -1.102  1.00 7.65  ? 325  LYS A CG    1 
ATOM   1501 C  CD    . LYS A 1  199 ? 6.268   -6.385  -2.383  1.00 6.97  ? 325  LYS A CD    1 
ATOM   1502 C  CE    . LYS A 1  199 ? 7.768   -6.068  -2.551  1.00 14.79 ? 325  LYS A CE    1 
ATOM   1503 N  NZ    . LYS A 1  199 ? 7.983   -5.198  -3.747  1.00 19.20 ? 325  LYS A NZ    1 
ATOM   1504 N  N     . LEU A 1  200 ? 7.662   -6.390  3.040   1.00 7.05  ? 326  LEU A N     1 
ATOM   1505 C  CA    . LEU A 1  200 ? 8.197   -5.556  4.122   1.00 10.70 ? 326  LEU A CA    1 
ATOM   1506 C  C     . LEU A 1  200 ? 8.834   -4.273  3.592   1.00 14.21 ? 326  LEU A C     1 
ATOM   1507 O  O     . LEU A 1  200 ? 9.161   -3.362  4.362   1.00 12.22 ? 326  LEU A O     1 
ATOM   1508 C  CB    . LEU A 1  200 ? 9.254   -6.323  4.917   1.00 12.82 ? 326  LEU A CB    1 
ATOM   1509 C  CG    . LEU A 1  200 ? 8.719   -7.607  5.560   1.00 13.37 ? 326  LEU A CG    1 
ATOM   1510 C  CD1   . LEU A 1  200 ? 9.815   -8.258  6.387   1.00 21.91 ? 326  LEU A CD1   1 
ATOM   1511 C  CD2   . LEU A 1  200 ? 7.477   -7.336  6.401   1.00 18.30 ? 326  LEU A CD2   1 
ATOM   1512 N  N     . GLN A 1  201 ? 9.048   -4.224  2.284   1.00 8.50  ? 327  GLN A N     1 
ATOM   1513 C  CA    . GLN A 1  201 ? 9.592   -3.036  1.626   1.00 11.87 ? 327  GLN A CA    1 
ATOM   1514 C  C     . GLN A 1  201 ? 8.827   -2.782  0.337   1.00 17.44 ? 327  GLN A C     1 
ATOM   1515 O  O     . GLN A 1  201 ? 8.108   -3.655  -0.149  1.00 11.13 ? 327  GLN A O     1 
ATOM   1516 C  CB    . GLN A 1  201 ? 11.074  -3.216  1.287   1.00 13.99 ? 327  GLN A CB    1 
ATOM   1517 C  CG    . GLN A 1  201 ? 11.979  -3.406  2.496   1.00 22.03 ? 327  GLN A CG    1 
ATOM   1518 C  CD    . GLN A 1  201 ? 13.451  -3.551  2.119   1.00 23.09 ? 327  GLN A CD    1 
ATOM   1519 O  OE1   . GLN A 1  201 ? 14.328  -3.488  2.981   1.00 33.58 ? 327  GLN A OE1   1 
ATOM   1520 N  NE2   . GLN A 1  201 ? 13.723  -3.743  0.831   1.00 20.91 ? 327  GLN A NE2   1 
ATOM   1521 N  N     . GLY A 1  202 ? 8.991   -1.591  -0.227  1.00 10.71 ? 328  GLY A N     1 
ATOM   1522 C  CA    . GLY A 1  202 ? 8.313   -1.263  -1.460  1.00 6.55  ? 328  GLY A CA    1 
ATOM   1523 C  C     . GLY A 1  202 ? 8.993   -0.137  -2.196  1.00 10.70 ? 328  GLY A C     1 
ATOM   1524 O  O     . GLY A 1  202 ? 9.828   0.596   -1.633  1.00 11.59 ? 328  GLY A O     1 
ATOM   1525 N  N     . HIS A 1  203 ? 8.667   -0.005  -3.472  1.00 7.60  ? 329  HIS A N     1 
ATOM   1526 C  CA    . HIS A 1  203 ? 9.167   1.124   -4.250  1.00 6.38  ? 329  HIS A CA    1 
ATOM   1527 C  C     . HIS A 1  203 ? 8.299   2.367   -4.005  1.00 10.14 ? 329  HIS A C     1 
ATOM   1528 O  O     . HIS A 1  203 ? 8.708   3.508   -4.292  1.00 6.07  ? 329  HIS A O     1 
ATOM   1529 C  CB    . HIS A 1  203 ? 9.244   0.744   -5.750  1.00 9.95  ? 329  HIS A CB    1 
ATOM   1530 C  CG    . HIS A 1  203 ? 8.281   1.476   -6.632  0.75 8.34  ? 329  HIS A CG    1 
ATOM   1531 N  ND1   . HIS A 1  203 ? 6.936   1.164   -6.699  0.75 6.02  ? 329  HIS A ND1   1 
ATOM   1532 C  CD2   . HIS A 1  203 ? 8.475   2.493   -7.509  0.75 10.30 ? 329  HIS A CD2   1 
ATOM   1533 C  CE1   . HIS A 1  203 ? 6.345   1.963   -7.568  0.75 4.64  ? 329  HIS A CE1   1 
ATOM   1534 N  NE2   . HIS A 1  203 ? 7.256   2.775   -8.076  0.75 9.64  ? 329  HIS A NE2   1 
ATOM   1535 N  N     . ASP A 1  204 ? 7.109   2.145   -3.457  1.00 5.47  ? 330  ASP A N     1 
ATOM   1536 C  CA    . ASP A 1  204 ? 6.148   3.238   -3.225  1.00 5.69  ? 330  ASP A CA    1 
ATOM   1537 C  C     . ASP A 1  204 ? 5.112   2.776   -2.206  1.00 7.18  ? 330  ASP A C     1 
ATOM   1538 O  O     . ASP A 1  204 ? 5.198   1.656   -1.698  1.00 5.27  ? 330  ASP A O     1 
ATOM   1539 C  CB    . ASP A 1  204 ? 5.475   3.676   -4.554  1.00 3.79  ? 330  ASP A CB    1 
ATOM   1540 C  CG    . ASP A 1  204 ? 4.418   2.688   -5.056  1.00 5.85  ? 330  ASP A CG    1 
ATOM   1541 O  OD1   . ASP A 1  204 ? 4.279   1.598   -4.469  1.00 5.51  ? 330  ASP A OD1   1 
ATOM   1542 O  OD2   . ASP A 1  204 ? 3.712   3.008   -6.046  1.00 6.00  ? 330  ASP A OD2   1 
ATOM   1543 N  N     . VAL A 1  205 ? 4.140   3.629   -1.907  1.00 3.42  ? 331  VAL A N     1 
ATOM   1544 C  CA    . VAL A 1  205 ? 2.985   3.198   -1.137  1.00 5.39  ? 331  VAL A CA    1 
ATOM   1545 C  C     . VAL A 1  205 ? 1.740   3.465   -1.983  1.00 5.44  ? 331  VAL A C     1 
ATOM   1546 O  O     . VAL A 1  205 ? 1.606   4.547   -2.541  1.00 5.02  ? 331  VAL A O     1 
ATOM   1547 C  CB    . VAL A 1  205 ? 2.882   3.950   0.208   1.00 8.62  ? 331  VAL A CB    1 
ATOM   1548 C  CG1   . VAL A 1  205 ? 1.826   3.296   1.083   1.00 4.43  ? 331  VAL A CG1   1 
ATOM   1549 C  CG2   . VAL A 1  205 ? 4.229   3.907   0.918   1.00 9.11  ? 331  VAL A CG2   1 
ATOM   1550 N  N     . ASP A 1  206 ? 0.859   2.468   -2.091  1.00 5.34  ? 332  ASP A N     1 
ATOM   1551 C  CA    . ASP A 1  206 ? -0.360  2.584   -2.893  1.00 3.03  ? 332  ASP A CA    1 
ATOM   1552 C  C     . ASP A 1  206 ? -1.607  2.612   -1.998  1.00 4.01  ? 332  ASP A C     1 
ATOM   1553 O  O     . ASP A 1  206 ? -1.838  1.691   -1.215  1.00 5.26  ? 332  ASP A O     1 
ATOM   1554 C  CB    . ASP A 1  206 ? -0.467  1.398   -3.890  1.00 2.46  ? 332  ASP A CB    1 
ATOM   1555 C  CG    . ASP A 1  206 ? 0.787   1.229   -4.711  1.00 5.42  ? 332  ASP A CG    1 
ATOM   1556 O  OD1   . ASP A 1  206 ? 0.944   1.985   -5.698  1.00 4.75  ? 332  ASP A OD1   1 
ATOM   1557 O  OD2   . ASP A 1  206 ? 1.635   0.370   -4.367  1.00 3.27  ? 332  ASP A OD2   1 
ATOM   1558 N  N     . PHE A 1  207 ? -2.433  3.637   -2.150  1.00 3.05  ? 333  PHE A N     1 
ATOM   1559 C  CA    . PHE A 1  207 ? -3.633  3.771   -1.311  1.00 3.79  ? 333  PHE A CA    1 
ATOM   1560 C  C     . PHE A 1  207 ? -4.868  3.817   -2.200  1.00 6.25  ? 333  PHE A C     1 
ATOM   1561 O  O     . PHE A 1  207 ? -4.878  4.528   -3.199  1.00 5.46  ? 333  PHE A O     1 
ATOM   1562 C  CB    . PHE A 1  207 ? -3.589  5.067   -0.480  1.00 7.54  ? 333  PHE A CB    1 
ATOM   1563 C  CG    . PHE A 1  207 ? -2.540  5.065   0.633   1.00 9.84  ? 333  PHE A CG    1 
ATOM   1564 C  CD1   . PHE A 1  207 ? -1.498  5.974   0.620   1.00 7.14  ? 333  PHE A CD1   1 
ATOM   1565 C  CD2   . PHE A 1  207 ? -2.618  4.153   1.693   1.00 6.14  ? 333  PHE A CD2   1 
ATOM   1566 C  CE1   . PHE A 1  207 ? -0.529  5.999   1.651   1.00 12.42 ? 333  PHE A CE1   1 
ATOM   1567 C  CE2   . PHE A 1  207 ? -1.662  4.164   2.728   1.00 9.54  ? 333  PHE A CE2   1 
ATOM   1568 C  CZ    . PHE A 1  207 ? -0.616  5.080   2.704   1.00 9.98  ? 333  PHE A CZ    1 
ATOM   1569 N  N     . LEU A 1  208 ? -5.913  3.082   -1.829  1.00 4.20  ? 334  LEU A N     1 
ATOM   1570 C  CA    . LEU A 1  208 ? -7.182  3.124   -2.552  1.00 4.23  ? 334  LEU A CA    1 
ATOM   1571 C  C     . LEU A 1  208 ? -8.206  3.839   -1.668  1.00 4.37  ? 334  LEU A C     1 
ATOM   1572 O  O     . LEU A 1  208 ? -8.336  3.522   -0.485  1.00 4.48  ? 334  LEU A O     1 
ATOM   1573 C  CB    . LEU A 1  208 ? -7.657  1.692   -2.835  1.00 3.94  ? 334  LEU A CB    1 
ATOM   1574 C  CG    . LEU A 1  208 ? -9.074  1.486   -3.418  1.00 4.71  ? 334  LEU A CG    1 
ATOM   1575 C  CD1   . LEU A 1  208 ? -9.246  2.176   -4.771  1.00 5.71  ? 334  LEU A CD1   1 
ATOM   1576 C  CD2   . LEU A 1  208 ? -9.290  -0.024  -3.622  1.00 4.88  ? 334  LEU A CD2   1 
ATOM   1577 N  N     . ILE A 1  209 ? -8.912  4.807   -2.238  1.00 4.32  ? 335  ILE A N     1 
ATOM   1578 C  CA    . ILE A 1  209 ? -9.814  5.663   -1.472  1.00 4.44  ? 335  ILE A CA    1 
ATOM   1579 C  C     . ILE A 1  209 ? -11.223 5.471   -2.005  1.00 5.80  ? 335  ILE A C     1 
ATOM   1580 O  O     . ILE A 1  209 ? -11.426 5.422   -3.222  1.00 3.91  ? 335  ILE A O     1 
ATOM   1581 C  CB    . ILE A 1  209 ? -9.419  7.170   -1.636  1.00 3.37  ? 335  ILE A CB    1 
ATOM   1582 C  CG1   . ILE A 1  209 ? -7.995  7.390   -1.078  1.00 4.75  ? 335  ILE A CG1   1 
ATOM   1583 C  CG2   . ILE A 1  209 ? -10.425 8.078   -0.906  1.00 6.21  ? 335  ILE A CG2   1 
ATOM   1584 C  CD1   . ILE A 1  209 ? -7.367  8.754   -1.479  1.00 7.73  ? 335  ILE A CD1   1 
ATOM   1585 N  N     . THR A 1  210 ? -12.200 5.368   -1.102  1.00 5.45  ? 336  THR A N     1 
ATOM   1586 C  CA    . THR A 1  210 ? -13.591 5.274   -1.529  1.00 6.54  ? 336  THR A CA    1 
ATOM   1587 C  C     . THR A 1  210 ? -14.484 5.892   -0.462  1.00 7.08  ? 336  THR A C     1 
ATOM   1588 O  O     . THR A 1  210 ? -13.981 6.411   0.528   1.00 5.90  ? 336  THR A O     1 
ATOM   1589 C  CB    . THR A 1  210 ? -14.014 3.815   -1.824  1.00 6.39  ? 336  THR A CB    1 
ATOM   1590 O  OG1   . THR A 1  210 ? -15.289 3.808   -2.465  1.00 8.85  ? 336  THR A OG1   1 
ATOM   1591 C  CG2   . THR A 1  210 ? -14.081 2.974   -0.540  1.00 8.44  ? 336  THR A CG2   1 
ATOM   1592 N  N     . HIS A 1  211 ? -15.800 5.822   -0.660  1.00 5.31  ? 337  HIS A N     1 
ATOM   1593 C  CA    . HIS A 1  211 ? -16.758 6.326   0.329   1.00 6.88  ? 337  HIS A CA    1 
ATOM   1594 C  C     . HIS A 1  211 ? -17.957 5.379   0.286   1.00 11.30 ? 337  HIS A C     1 
ATOM   1595 O  O     . HIS A 1  211 ? -18.338 4.932   -0.795  1.00 7.40  ? 337  HIS A O     1 
ATOM   1596 C  CB    . HIS A 1  211 ? -17.214 7.760   -0.013  1.00 8.99  ? 337  HIS A CB    1 
ATOM   1597 C  CG    . HIS A 1  211 ? -18.064 8.377   1.056   1.00 8.45  ? 337  HIS A CG    1 
ATOM   1598 N  ND1   . HIS A 1  211 ? -19.390 8.051   1.241   1.00 11.26 ? 337  HIS A ND1   1 
ATOM   1599 C  CD2   . HIS A 1  211 ? -17.759 9.284   2.021   1.00 8.07  ? 337  HIS A CD2   1 
ATOM   1600 C  CE1   . HIS A 1  211 ? -19.869 8.730   2.272   1.00 11.25 ? 337  HIS A CE1   1 
ATOM   1601 N  NE2   . HIS A 1  211 ? -18.897 9.487   2.759   1.00 10.54 ? 337  HIS A NE2   1 
ATOM   1602 N  N     . PRO A 1  212 ? -18.535 5.040   1.462   1.00 11.64 ? 338  PRO A N     1 
ATOM   1603 C  CA    . PRO A 1  212 ? -19.610 4.031   1.489   1.00 11.60 ? 338  PRO A CA    1 
ATOM   1604 C  C     . PRO A 1  212 ? -20.889 4.421   0.739   1.00 13.94 ? 338  PRO A C     1 
ATOM   1605 O  O     . PRO A 1  212 ? -21.701 3.557   0.428   1.00 10.90 ? 338  PRO A O     1 
ATOM   1606 C  CB    . PRO A 1  212 ? -19.886 3.851   2.994   1.00 13.18 ? 338  PRO A CB    1 
ATOM   1607 C  CG    . PRO A 1  212 ? -19.391 5.098   3.625   1.00 13.79 ? 338  PRO A CG    1 
ATOM   1608 C  CD    . PRO A 1  212 ? -18.153 5.449   2.822   1.00 9.09  ? 338  PRO A CD    1 
ATOM   1609 N  N     . LYS A 1  213 ? -21.079 5.702   0.454   1.00 10.22 ? 339  LYS A N     1 
ATOM   1610 C  CA    . LYS A 1  213 ? -22.248 6.139   -0.296  1.00 12.95 ? 339  LYS A CA    1 
ATOM   1611 C  C     . LYS A 1  213 ? -21.881 6.367   -1.761  1.00 16.07 ? 339  LYS A C     1 
ATOM   1612 O  O     . LYS A 1  213 ? -21.176 7.334   -2.089  1.00 9.87  ? 339  LYS A O     1 
ATOM   1613 C  CB    . LYS A 1  213 ? -22.843 7.412   0.331   1.00 11.73 ? 339  LYS A CB    1 
ATOM   1614 C  CG    . LYS A 1  213 ? -24.104 7.930   -0.360  1.00 20.66 ? 339  LYS A CG    1 
ATOM   1615 N  N     . GLU A 1  214 ? -22.346 5.463   -2.631  1.00 7.77  ? 340  GLU A N     1 
ATOM   1616 C  CA    . GLU A 1  214 ? -22.081 5.539   -4.063  1.00 10.48 ? 340  GLU A CA    1 
ATOM   1617 C  C     . GLU A 1  214 ? -22.302 6.942   -4.617  1.00 14.41 ? 340  GLU A C     1 
ATOM   1618 O  O     . GLU A 1  214 ? -23.364 7.544   -4.419  1.00 15.41 ? 340  GLU A O     1 
ATOM   1619 C  CB    . GLU A 1  214 ? -22.975 4.550   -4.827  1.00 12.23 ? 340  GLU A CB    1 
ATOM   1620 C  CG    . GLU A 1  214 ? -22.682 4.477   -6.323  1.00 14.17 ? 340  GLU A CG    1 
ATOM   1621 C  CD    . GLU A 1  214 ? -21.518 3.529   -6.627  1.00 12.49 ? 340  GLU A CD    1 
ATOM   1622 O  OE1   . GLU A 1  214 ? -21.043 2.874   -5.684  1.00 12.81 ? 340  GLU A OE1   1 
ATOM   1623 O  OE2   . GLU A 1  214 ? -21.097 3.419   -7.789  1.00 14.64 ? 340  GLU A OE2   1 
ATOM   1624 N  N     . GLY A 1  215 ? -21.298 7.462   -5.310  1.00 13.69 ? 341  GLY A N     1 
ATOM   1625 C  CA    . GLY A 1  215 ? -21.386 8.781   -5.897  1.00 11.73 ? 341  GLY A CA    1 
ATOM   1626 C  C     . GLY A 1  215 ? -20.709 9.887   -5.085  1.00 11.06 ? 341  GLY A C     1 
ATOM   1627 O  O     . GLY A 1  215 ? -20.285 10.894  -5.647  1.00 11.64 ? 341  GLY A O     1 
ATOM   1628 N  N     . GLN A 1  216 ? -20.607 9.717   -3.771  1.00 10.28 ? 342  GLN A N     1 
ATOM   1629 C  CA    . GLN A 1  216 ? -20.026 10.769  -2.935  1.00 10.98 ? 342  GLN A CA    1 
ATOM   1630 C  C     . GLN A 1  216 ? -18.550 10.965  -3.251  1.00 12.12 ? 342  GLN A C     1 
ATOM   1631 O  O     . GLN A 1  216 ? -17.964 11.986  -2.908  1.00 11.77 ? 342  GLN A O     1 
ATOM   1632 C  CB    . GLN A 1  216 ? -20.198 10.459  -1.444  1.00 9.00  ? 342  GLN A CB    1 
ATOM   1633 C  CG    . GLN A 1  216 ? -21.625 10.645  -0.946  1.00 11.07 ? 342  GLN A CG    1 
ATOM   1634 C  CD    . GLN A 1  216 ? -22.076 12.084  -1.122  1.00 15.86 ? 342  GLN A CD    1 
ATOM   1635 O  OE1   . GLN A 1  216 ? -21.608 12.978  -0.411  1.00 13.70 ? 342  GLN A OE1   1 
ATOM   1636 N  NE2   . GLN A 1  216 ? -22.944 12.321  -2.092  1.00 13.27 ? 342  GLN A NE2   1 
ATOM   1637 N  N     . GLU A 1  217 ? -17.942 9.974   -3.895  1.00 11.61 ? 343  GLU A N     1 
ATOM   1638 C  CA    . GLU A 1  217 ? -16.506 10.030  -4.115  1.00 8.82  ? 343  GLU A CA    1 
ATOM   1639 C  C     . GLU A 1  217 ? -16.176 10.794  -5.378  1.00 8.81  ? 343  GLU A C     1 
ATOM   1640 O  O     . GLU A 1  217 ? -15.001 11.052  -5.649  1.00 9.41  ? 343  GLU A O     1 
ATOM   1641 C  CB    . GLU A 1  217 ? -15.927 8.612   -4.207  1.00 15.44 ? 343  GLU A CB    1 
ATOM   1642 C  CG    . GLU A 1  217 ? -16.087 7.990   -5.582  1.00 11.74 ? 343  GLU A CG    1 
ATOM   1643 C  CD    . GLU A 1  217 ? -17.531 7.743   -5.982  1.00 10.36 ? 343  GLU A CD    1 
ATOM   1644 O  OE1   . GLU A 1  217 ? -18.412 7.555   -5.109  1.00 10.85 ? 343  GLU A OE1   1 
ATOM   1645 O  OE2   . GLU A 1  217 ? -17.788 7.740   -7.196  1.00 14.93 ? 343  GLU A OE2   1 
ATOM   1646 N  N     . ALA A 1  218 ? -17.186 11.112  -6.186  1.00 9.98  ? 344  ALA A N     1 
ATOM   1647 C  CA    . ALA A 1  218 ? -16.950 11.914  -7.398  1.00 13.81 ? 344  ALA A CA    1 
ATOM   1648 C  C     . ALA A 1  218 ? -16.235 13.226  -7.045  1.00 16.44 ? 344  ALA A C     1 
ATOM   1649 O  O     . ALA A 1  218 ? -16.604 13.882  -6.076  1.00 11.03 ? 344  ALA A O     1 
ATOM   1650 C  CB    . ALA A 1  218 ? -18.259 12.202  -8.114  1.00 17.71 ? 344  ALA A CB    1 
ATOM   1651 N  N     . GLY A 1  219 ? -15.192 13.577  -7.801  1.00 13.46 ? 345  GLY A N     1 
ATOM   1652 C  CA    . GLY A 1  219 ? -14.464 14.823  -7.585  1.00 10.69 ? 345  GLY A CA    1 
ATOM   1653 C  C     . GLY A 1  219 ? -13.564 14.882  -6.359  1.00 11.85 ? 345  GLY A C     1 
ATOM   1654 O  O     . GLY A 1  219 ? -13.047 15.948  -6.007  1.00 9.90  ? 345  GLY A O     1 
ATOM   1655 N  N     . LEU A 1  220 ? -13.333 13.735  -5.723  1.00 7.61  ? 346  LEU A N     1 
ATOM   1656 C  CA    . LEU A 1  220 ? -12.644 13.690  -4.442  1.00 8.12  ? 346  LEU A CA    1 
ATOM   1657 C  C     . LEU A 1  220 ? -11.129 13.911  -4.524  1.00 6.98  ? 346  LEU A C     1 
ATOM   1658 O  O     . LEU A 1  220 ? -10.536 14.615  -3.702  1.00 9.47  ? 346  LEU A O     1 
ATOM   1659 C  CB    . LEU A 1  220 ? -12.903 12.338  -3.776  1.00 8.66  ? 346  LEU A CB    1 
ATOM   1660 C  CG    . LEU A 1  220 ? -12.210 12.087  -2.448  1.00 9.60  ? 346  LEU A CG    1 
ATOM   1661 C  CD1   . LEU A 1  220 ? -12.548 13.196  -1.457  1.00 13.54 ? 346  LEU A CD1   1 
ATOM   1662 C  CD2   . LEU A 1  220 ? -12.671 10.734  -1.913  1.00 7.81  ? 346  LEU A CD2   1 
ATOM   1663 N  N     . LEU A 1  221 ? -10.494 13.299  -5.512  1.00 6.98  ? 347  LEU A N     1 
ATOM   1664 C  CA    . LEU A 1  221 ? -9.033  13.317  -5.549  1.00 9.35  ? 347  LEU A CA    1 
ATOM   1665 C  C     . LEU A 1  221 ? -8.403  14.722  -5.628  1.00 8.25  ? 347  LEU A C     1 
ATOM   1666 O  O     . LEU A 1  221 ? -7.445  15.004  -4.916  1.00 9.82  ? 347  LEU A O     1 
ATOM   1667 C  CB    . LEU A 1  221 ? -8.493  12.393  -6.647  1.00 11.01 ? 347  LEU A CB    1 
ATOM   1668 C  CG    . LEU A 1  221 ? -7.026  12.016  -6.448  1.00 11.27 ? 347  LEU A CG    1 
ATOM   1669 C  CD1   . LEU A 1  221 ? -6.730  11.674  -4.992  1.00 8.84  ? 347  LEU A CD1   1 
ATOM   1670 C  CD2   . LEU A 1  221 ? -6.698  10.811  -7.323  1.00 12.67 ? 347  LEU A CD2   1 
ATOM   1671 N  N     . PRO A 1  222 ? -8.936  15.610  -6.480  1.00 9.69  ? 348  PRO A N     1 
ATOM   1672 C  CA    . PRO A 1  222 ? -8.382  16.977  -6.459  1.00 11.03 ? 348  PRO A CA    1 
ATOM   1673 C  C     . PRO A 1  222 ? -8.460  17.629  -5.086  1.00 9.78  ? 348  PRO A C     1 
ATOM   1674 O  O     . PRO A 1  222 ? -7.546  18.358  -4.696  1.00 11.63 ? 348  PRO A O     1 
ATOM   1675 C  CB    . PRO A 1  222 ? -9.291  17.746  -7.432  1.00 12.15 ? 348  PRO A CB    1 
ATOM   1676 C  CG    . PRO A 1  222 ? -9.803  16.700  -8.366  1.00 17.07 ? 348  PRO A CG    1 
ATOM   1677 C  CD    . PRO A 1  222 ? -9.929  15.430  -7.552  1.00 8.91  ? 348  PRO A CD    1 
ATOM   1678 N  N     . ARG A 1  223 ? -9.545  17.374  -4.356  1.00 12.27 ? 349  ARG A N     1 
ATOM   1679 C  CA    . ARG A 1  223 ? -9.726  17.947  -3.021  1.00 8.34  ? 349  ARG A CA    1 
ATOM   1680 C  C     . ARG A 1  223 ? -8.709  17.392  -2.038  1.00 10.66 ? 349  ARG A C     1 
ATOM   1681 O  O     . ARG A 1  223 ? -8.210  18.094  -1.158  1.00 11.07 ? 349  ARG A O     1 
ATOM   1682 C  CB    . ARG A 1  223 ? -11.153 17.672  -2.527  1.00 10.48 ? 349  ARG A CB    1 
ATOM   1683 C  CG    . ARG A 1  223 ? -12.221 18.460  -3.316  1.00 10.22 ? 349  ARG A CG    1 
ATOM   1684 C  CD    . ARG A 1  223 ? -13.653 18.080  -2.919  1.00 10.81 ? 349  ARG A CD    1 
ATOM   1685 N  NE    . ARG A 1  223 ? -13.880 18.117  -1.475  1.00 10.67 ? 349  ARG A NE    1 
ATOM   1686 C  CZ    . ARG A 1  223 ? -14.054 19.245  -0.783  1.00 15.64 ? 349  ARG A CZ    1 
ATOM   1687 N  NH1   . ARG A 1  223 ? -13.993 20.419  -1.412  1.00 12.12 ? 349  ARG A NH1   1 
ATOM   1688 N  NH2   . ARG A 1  223 ? -14.268 19.203  0.523   1.00 9.12  ? 349  ARG A NH2   1 
ATOM   1689 N  N     . VAL A 1  224 ? -8.427  16.102  -2.172  1.00 10.53 ? 350  VAL A N     1 
ATOM   1690 C  CA    . VAL A 1  224 ? -7.415  15.474  -1.345  1.00 8.06  ? 350  VAL A CA    1 
ATOM   1691 C  C     . VAL A 1  224 ? -6.054  16.070  -1.701  1.00 8.41  ? 350  VAL A C     1 
ATOM   1692 O  O     . VAL A 1  224 ? -5.263  16.417  -0.821  1.00 9.18  ? 350  VAL A O     1 
ATOM   1693 C  CB    . VAL A 1  224 ? -7.423  13.918  -1.552  1.00 8.97  ? 350  VAL A CB    1 
ATOM   1694 C  CG1   . VAL A 1  224 ? -6.243  13.242  -0.866  1.00 6.89  ? 350  VAL A CG1   1 
ATOM   1695 C  CG2   . VAL A 1  224 ? -8.712  13.343  -1.023  1.00 7.22  ? 350  VAL A CG2   1 
ATOM   1696 N  N     . MET A 1  225 ? -5.765  16.170  -2.998  1.00 11.03 ? 351  MET A N     1 
ATOM   1697 C  CA    . MET A 1  225 ? -4.435  16.616  -3.393  1.00 11.31 ? 351  MET A CA    1 
ATOM   1698 C  C     . MET A 1  225 ? -4.202  18.060  -2.937  1.00 13.93 ? 351  MET A C     1 
ATOM   1699 O  O     . MET A 1  225 ? -3.100  18.412  -2.499  1.00 15.06 ? 351  MET A O     1 
ATOM   1700 C  CB    . MET A 1  225 ? -4.229  16.478  -4.909  1.00 14.07 ? 351  MET A CB    1 
ATOM   1701 C  CG    . MET A 1  225 ? -4.154  14.997  -5.403  1.00 13.65 ? 351  MET A CG    1 
ATOM   1702 S  SD    . MET A 1  225 ? -3.047  13.994  -4.390  1.00 17.91 ? 351  MET A SD    1 
ATOM   1703 C  CE    . MET A 1  225 ? -1.523  14.907  -4.632  1.00 18.86 ? 351  MET A CE    1 
ATOM   1704 N  N     . CYS A 1  226 ? -5.241  18.888  -3.020  1.00 13.25 ? 352  CYS A N     1 
ATOM   1705 C  CA    . CYS A 1  226 ? -5.095  20.298  -2.615  1.00 12.89 ? 352  CYS A CA    1 
ATOM   1706 C  C     . CYS A 1  226 ? -4.800  20.399  -1.131  1.00 15.42 ? 352  CYS A C     1 
ATOM   1707 O  O     . CYS A 1  226 ? -3.973  21.201  -0.721  1.00 17.16 ? 352  CYS A O     1 
ATOM   1708 C  CB    . CYS A 1  226 ? -6.322  21.143  -3.007  1.00 18.65 ? 352  CYS A CB    1 
ATOM   1709 S  SG    . CYS A 1  226 ? -6.432  21.341  -4.798  1.00 37.70 ? 352  CYS A SG    1 
ATOM   1710 N  N     . ARG A 1  227 ? -5.444  19.562  -0.329  1.00 12.65 ? 353  ARG A N     1 
ATOM   1711 C  CA    . ARG A 1  227 ? -5.195  19.570  1.100   1.00 11.62 ? 353  ARG A CA    1 
ATOM   1712 C  C     . ARG A 1  227 ? -3.788  19.078  1.447   1.00 19.27 ? 353  ARG A C     1 
ATOM   1713 O  O     . ARG A 1  227 ? -3.101  19.641  2.299   1.00 19.51 ? 353  ARG A O     1 
ATOM   1714 C  CB    . ARG A 1  227 ? -6.269  18.755  1.817   1.00 12.50 ? 353  ARG A CB    1 
ATOM   1715 C  CG    . ARG A 1  227 ? -7.556  19.577  1.900   1.00 15.81 ? 353  ARG A CG    1 
ATOM   1716 C  CD    . ARG A 1  227 ? -8.849  18.788  2.076   1.00 15.82 ? 353  ARG A CD    1 
ATOM   1717 N  NE    . ARG A 1  227 ? -9.910  19.786  2.206   1.00 12.66 ? 353  ARG A NE    1 
ATOM   1718 C  CZ    . ARG A 1  227 ? -10.468 20.439  1.188   1.00 18.05 ? 353  ARG A CZ    1 
ATOM   1719 N  NH1   . ARG A 1  227 ? -10.137 20.141  -0.068  1.00 11.35 ? 353  ARG A NH1   1 
ATOM   1720 N  NH2   . ARG A 1  227 ? -11.384 21.382  1.428   1.00 14.27 ? 353  ARG A NH2   1 
ATOM   1721 N  N     . LEU A 1  228 ? -3.353  18.029  0.770   1.00 12.99 ? 354  LEU A N     1 
ATOM   1722 C  CA    . LEU A 1  228 ? -2.017  17.514  1.003   1.00 11.75 ? 354  LEU A CA    1 
ATOM   1723 C  C     . LEU A 1  228 ? -0.977  18.550  0.609   1.00 9.25  ? 354  LEU A C     1 
ATOM   1724 O  O     . LEU A 1  228 ? 0.013   18.750  1.317   1.00 13.48 ? 354  LEU A O     1 
ATOM   1725 C  CB    . LEU A 1  228 ? -1.805  16.234  0.203   1.00 11.26 ? 354  LEU A CB    1 
ATOM   1726 C  CG    . LEU A 1  228 ? -2.581  15.030  0.721   1.00 12.34 ? 354  LEU A CG    1 
ATOM   1727 C  CD1   . LEU A 1  228 ? -2.405  13.890  -0.284  1.00 10.49 ? 354  LEU A CD1   1 
ATOM   1728 C  CD2   . LEU A 1  228 ? -2.024  14.651  2.080   1.00 12.85 ? 354  LEU A CD2   1 
ATOM   1729 N  N     . GLN A 1  229 ? -1.205  19.219  -0.509  1.00 11.26 ? 355  GLN A N     1 
ATOM   1730 C  CA    . GLN A 1  229 ? -0.248  20.217  -0.981  1.00 17.88 ? 355  GLN A CA    1 
ATOM   1731 C  C     . GLN A 1  229 ? -0.239  21.413  -0.011  1.00 18.72 ? 355  GLN A C     1 
ATOM   1732 O  O     . GLN A 1  229 ? 0.809   21.949  0.310   1.00 19.45 ? 355  GLN A O     1 
ATOM   1733 C  CB    . GLN A 1  229 ? -0.561  20.657  -2.424  1.00 13.47 ? 355  GLN A CB    1 
ATOM   1734 C  CG    . GLN A 1  229 ? 0.604   21.404  -3.111  1.00 21.59 ? 355  GLN A CG    1 
ATOM   1735 N  N     . ASP A 1  230 ? -1.406  21.780  0.505   1.00 21.42 ? 356  ASP A N     1 
ATOM   1736 C  CA    . ASP A 1  230 ? -1.492  22.864  1.497   1.00 21.84 ? 356  ASP A CA    1 
ATOM   1737 C  C     . ASP A 1  230 ? -0.730  22.563  2.779   1.00 27.13 ? 356  ASP A C     1 
ATOM   1738 O  O     . ASP A 1  230 ? -0.194  23.471  3.410   1.00 27.61 ? 356  ASP A O     1 
ATOM   1739 C  CB    . ASP A 1  230 ? -2.950  23.188  1.837   1.00 24.47 ? 356  ASP A CB    1 
ATOM   1740 C  CG    . ASP A 1  230 ? -3.645  23.968  0.735   1.00 34.96 ? 356  ASP A CG    1 
ATOM   1741 O  OD1   . ASP A 1  230 ? -2.933  24.583  -0.094  1.00 34.17 ? 356  ASP A OD1   1 
ATOM   1742 O  OD2   . ASP A 1  230 ? -4.902  23.960  0.692   1.00 36.79 ? 356  ASP A OD2   1 
ATOM   1743 N  N     . GLN A 1  231 ? -0.691  21.291  3.172   1.00 16.16 ? 357  GLN A N     1 
ATOM   1744 C  CA    . GLN A 1  231 ? 0.071   20.895  4.340   1.00 15.33 ? 357  GLN A CA    1 
ATOM   1745 C  C     . GLN A 1  231 ? 1.582   20.782  4.078   1.00 15.03 ? 357  GLN A C     1 
ATOM   1746 O  O     . GLN A 1  231 ? 2.326   20.439  4.984   1.00 13.95 ? 357  GLN A O     1 
ATOM   1747 C  CB    . GLN A 1  231 ? -0.450  19.588  4.908   1.00 19.17 ? 357  GLN A CB    1 
ATOM   1748 C  CG    . GLN A 1  231 ? -1.853  19.703  5.471   1.00 24.78 ? 357  GLN A CG    1 
ATOM   1749 C  CD    . GLN A 1  231 ? -2.418  18.369  5.860   1.00 32.92 ? 357  GLN A CD    1 
ATOM   1750 N  N     . GLY A 1  232 ? 2.024   21.084  2.862   1.00 14.63 ? 358  GLY A N     1 
ATOM   1751 C  CA    . GLY A 1  232 ? 3.450   21.067  2.555   1.00 14.93 ? 358  GLY A CA    1 
ATOM   1752 C  C     . GLY A 1  232 ? 4.062   19.685  2.328   1.00 18.78 ? 358  GLY A C     1 
ATOM   1753 O  O     . GLY A 1  232 ? 5.286   19.528  2.331   1.00 13.89 ? 358  GLY A O     1 
ATOM   1754 N  N     . LEU A 1  233 ? 3.213   18.686  2.103   1.00 11.82 ? 359  LEU A N     1 
ATOM   1755 C  CA    . LEU A 1  233 ? 3.650   17.281  2.025   1.00 11.56 ? 359  LEU A CA    1 
ATOM   1756 C  C     . LEU A 1  233 ? 3.970   16.789  0.620   1.00 11.79 ? 359  LEU A C     1 
ATOM   1757 O  O     . LEU A 1  233 ? 4.554   15.708  0.440   1.00 14.31 ? 359  LEU A O     1 
ATOM   1758 C  CB    . LEU A 1  233 ? 2.553   16.399  2.625   1.00 10.44 ? 359  LEU A CB    1 
ATOM   1759 C  CG    . LEU A 1  233 ? 2.359   16.667  4.120   1.00 15.51 ? 359  LEU A CG    1 
ATOM   1760 C  CD1   . LEU A 1  233 ? 1.146   15.934  4.632   1.00 24.95 ? 359  LEU A CD1   1 
ATOM   1761 C  CD2   . LEU A 1  233 ? 3.603   16.260  4.891   1.00 16.68 ? 359  LEU A CD2   1 
ATOM   1762 N  N     . ILE A 1  234 ? 3.581   17.557  -0.385  1.00 8.66  ? 360  ILE A N     1 
ATOM   1763 C  CA    . ILE A 1  234 ? 3.724   17.103  -1.755  1.00 9.54  ? 360  ILE A CA    1 
ATOM   1764 C  C     . ILE A 1  234 ? 4.927   17.763  -2.409  1.00 12.62 ? 360  ILE A C     1 
ATOM   1765 O  O     . ILE A 1  234 ? 4.950   18.971  -2.581  1.00 12.47 ? 360  ILE A O     1 
ATOM   1766 C  CB    . ILE A 1  234 ? 2.466   17.407  -2.595  1.00 12.01 ? 360  ILE A CB    1 
ATOM   1767 C  CG1   . ILE A 1  234 ? 1.223   16.809  -1.938  1.00 12.00 ? 360  ILE A CG1   1 
ATOM   1768 C  CG2   . ILE A 1  234 ? 2.612   16.841  -4.012  1.00 10.42 ? 360  ILE A CG2   1 
ATOM   1769 C  CD1   . ILE A 1  234 ? 1.350   15.275  -1.753  1.00 9.32  ? 360  ILE A CD1   1 
ATOM   1770 N  N     . LEU A 1  235 ? 5.918   16.963  -2.777  1.00 9.33  ? 361  LEU A N     1 
ATOM   1771 C  CA    . LEU A 1  235 ? 7.113   17.467  -3.445  1.00 12.61 ? 361  LEU A CA    1 
ATOM   1772 C  C     . LEU A 1  235 ? 6.850   17.503  -4.924  1.00 14.80 ? 361  LEU A C     1 
ATOM   1773 O  O     . LEU A 1  235 ? 7.439   18.299  -5.647  1.00 12.31 ? 361  LEU A O     1 
ATOM   1774 C  CB    . LEU A 1  235 ? 8.326   16.567  -3.155  1.00 7.12  ? 361  LEU A CB    1 
ATOM   1775 C  CG    . LEU A 1  235 ? 8.847   16.685  -1.714  1.00 13.00 ? 361  LEU A CG    1 
ATOM   1776 C  CD1   . LEU A 1  235 ? 9.645   15.473  -1.305  1.00 11.84 ? 361  LEU A CD1   1 
ATOM   1777 C  CD2   . LEU A 1  235 ? 9.726   17.964  -1.543  1.00 12.09 ? 361  LEU A CD2   1 
ATOM   1778 N  N     . TYR A 1  236 ? 5.971   16.618  -5.386  1.00 10.24 ? 362  TYR A N     1 
ATOM   1779 C  CA    . TYR A 1  236 ? 5.628   16.587  -6.795  1.00 10.58 ? 362  TYR A CA    1 
ATOM   1780 C  C     . TYR A 1  236 ? 4.283   15.927  -7.014  1.00 13.97 ? 362  TYR A C     1 
ATOM   1781 O  O     . TYR A 1  236 ? 4.010   14.875  -6.456  1.00 9.73  ? 362  TYR A O     1 
ATOM   1782 C  CB    . TYR A 1  236 ? 6.661   15.794  -7.616  1.00 15.80 ? 362  TYR A CB    1 
ATOM   1783 C  CG    . TYR A 1  236 ? 6.244   15.699  -9.078  1.00 15.44 ? 362  TYR A CG    1 
ATOM   1784 C  CD1   . TYR A 1  236 ? 6.529   16.729  -9.963  1.00 25.04 ? 362  TYR A CD1   1 
ATOM   1785 C  CD2   . TYR A 1  236 ? 5.512   14.615  -9.550  1.00 20.51 ? 362  TYR A CD2   1 
ATOM   1786 C  CE1   . TYR A 1  236 ? 6.120   16.671  -11.283 1.00 23.42 ? 362  TYR A CE1   1 
ATOM   1787 C  CE2   . TYR A 1  236 ? 5.092   14.556  -10.857 1.00 25.01 ? 362  TYR A CE2   1 
ATOM   1788 C  CZ    . TYR A 1  236 ? 5.407   15.590  -11.716 1.00 20.73 ? 362  TYR A CZ    1 
ATOM   1789 O  OH    . TYR A 1  236 ? 4.998   15.530  -13.021 1.00 37.60 ? 362  TYR A OH    1 
ATOM   1790 N  N     . HIS A 1  237 ? 3.448   16.535  -7.846  1.00 14.68 ? 363  HIS A N     1 
ATOM   1791 C  CA    . HIS A 1  237 ? 2.352   15.793  -8.484  1.00 17.39 ? 363  HIS A CA    1 
ATOM   1792 C  C     . HIS A 1  237 ? 1.967   16.499  -9.771  1.00 20.76 ? 363  HIS A C     1 
ATOM   1793 O  O     . HIS A 1  237 ? 2.385   17.635  -10.005 1.00 22.33 ? 363  HIS A O     1 
ATOM   1794 C  CB    . HIS A 1  237 ? 1.142   15.591  -7.561  1.00 19.10 ? 363  HIS A CB    1 
ATOM   1795 C  CG    . HIS A 1  237 ? 0.369   16.830  -7.253  0.75 18.39 ? 363  HIS A CG    1 
ATOM   1796 N  ND1   . HIS A 1  237 ? -0.984  16.940  -7.491  0.75 23.08 ? 363  HIS A ND1   1 
ATOM   1797 C  CD2   . HIS A 1  237 ? 0.742   17.997  -6.664  0.75 21.89 ? 363  HIS A CD2   1 
ATOM   1798 C  CE1   . HIS A 1  237 ? -1.410  18.125  -7.082  0.75 21.62 ? 363  HIS A CE1   1 
ATOM   1799 N  NE2   . HIS A 1  237 ? -0.379  18.783  -6.576  0.75 26.13 ? 363  HIS A NE2   1 
ATOM   1800 N  N     . GLN A 1  238 ? 1.178   15.866  -10.619 1.00 20.59 ? 364  GLN A N     1 
ATOM   1801 C  CA    . GLN A 1  238 ? 0.838   16.579  -11.853 1.00 38.73 ? 364  GLN A CA    1 
ATOM   1802 C  C     . GLN A 1  238 ? -0.514  17.273  -11.783 1.00 32.81 ? 364  GLN A C     1 
ATOM   1803 O  O     . GLN A 1  238 ? -0.653  18.403  -12.245 1.00 46.09 ? 364  GLN A O     1 
ATOM   1804 C  CB    . GLN A 1  238 ? 0.963   15.686  -13.088 1.00 35.79 ? 364  GLN A CB    1 
ATOM   1805 C  CG    . GLN A 1  238 ? 0.174   14.400  -13.024 0.75 33.61 ? 364  GLN A CG    1 
ATOM   1806 C  CD    . GLN A 1  238 ? 1.042   13.164  -13.224 0.75 36.87 ? 364  GLN A CD    1 
ATOM   1807 O  OE1   . GLN A 1  238 ? 1.978   12.913  -12.453 0.75 41.77 ? 364  GLN A OE1   1 
ATOM   1808 N  NE2   . GLN A 1  238 ? 0.712   12.363  -14.236 0.75 28.36 ? 364  GLN A NE2   1 
ATOM   1809 N  N     . ALA A 1  258 ? -10.163 17.234  -13.391 1.00 32.76 ? 384  ALA A N     1 
ATOM   1810 C  CA    . ALA A 1  258 ? -10.821 16.050  -12.833 1.00 30.83 ? 384  ALA A CA    1 
ATOM   1811 C  C     . ALA A 1  258 ? -9.949  14.827  -13.058 1.00 32.47 ? 384  ALA A C     1 
ATOM   1812 O  O     . ALA A 1  258 ? -9.527  14.575  -14.190 1.00 28.65 ? 384  ALA A O     1 
ATOM   1813 C  CB    . ALA A 1  258 ? -12.178 15.828  -13.478 1.00 30.08 ? 384  ALA A CB    1 
ATOM   1814 N  N     . PHE A 1  259 ? -9.686  14.064  -11.997 1.00 23.23 ? 385  PHE A N     1 
ATOM   1815 C  CA    . PHE A 1  259 ? -8.847  12.868  -12.129 1.00 18.62 ? 385  PHE A CA    1 
ATOM   1816 C  C     . PHE A 1  259 ? -9.118  11.899  -10.993 1.00 18.53 ? 385  PHE A C     1 
ATOM   1817 O  O     . PHE A 1  259 ? -9.724  12.276  -9.982  1.00 18.59 ? 385  PHE A O     1 
ATOM   1818 C  CB    . PHE A 1  259 ? -7.363  13.244  -12.195 1.00 13.95 ? 385  PHE A CB    1 
ATOM   1819 C  CG    . PHE A 1  259 ? -6.893  14.134  -11.058 1.00 22.86 ? 385  PHE A CG    1 
ATOM   1820 C  CD1   . PHE A 1  259 ? -6.216  13.601  -9.969  1.00 20.87 ? 385  PHE A CD1   1 
ATOM   1821 C  CD2   . PHE A 1  259 ? -7.105  15.512  -11.093 1.00 25.43 ? 385  PHE A CD2   1 
ATOM   1822 C  CE1   . PHE A 1  259 ? -5.768  14.426  -8.917  1.00 17.77 ? 385  PHE A CE1   1 
ATOM   1823 C  CE2   . PHE A 1  259 ? -6.668  16.339  -10.050 1.00 24.02 ? 385  PHE A CE2   1 
ATOM   1824 C  CZ    . PHE A 1  259 ? -6.000  15.791  -8.957  1.00 22.57 ? 385  PHE A CZ    1 
ATOM   1825 N  N     . GLU A 1  260 ? -8.649  10.663  -11.157 1.00 14.02 ? 386  GLU A N     1 
ATOM   1826 C  CA    . GLU A 1  260 ? -8.952  9.592   -10.219 1.00 12.79 ? 386  GLU A CA    1 
ATOM   1827 C  C     . GLU A 1  260 ? -7.732  8.773   -9.802  1.00 13.82 ? 386  GLU A C     1 
ATOM   1828 O  O     . GLU A 1  260 ? -7.848  7.913   -8.927  1.00 7.96  ? 386  GLU A O     1 
ATOM   1829 C  CB    . GLU A 1  260 ? -10.027 8.664   -10.795 1.00 12.56 ? 386  GLU A CB    1 
ATOM   1830 C  CG    . GLU A 1  260 ? -9.586  7.785   -11.947 1.00 12.62 ? 386  GLU A CG    1 
ATOM   1831 C  CD    . GLU A 1  260 ? -10.781 7.234   -12.718 1.00 25.43 ? 386  GLU A CD    1 
ATOM   1832 O  OE1   . GLU A 1  260 ? -11.724 8.026   -12.907 1.00 29.82 ? 386  GLU A OE1   1 
ATOM   1833 O  OE2   . GLU A 1  260 ? -10.793 6.037   -13.121 1.00 18.53 ? 386  GLU A OE2   1 
ATOM   1834 N  N     . ARG A 1  261 ? -6.578  9.029   -10.435 1.00 10.23 ? 387  ARG A N     1 
ATOM   1835 C  CA    . ARG A 1  261 ? -5.322  8.416   -10.013 1.00 6.55  ? 387  ARG A CA    1 
ATOM   1836 C  C     . ARG A 1  261 ? -4.304  9.534   -9.887  1.00 10.04 ? 387  ARG A C     1 
ATOM   1837 O  O     . ARG A 1  261 ? -4.275  10.421  -10.739 1.00 10.06 ? 387  ARG A O     1 
ATOM   1838 C  CB    . ARG A 1  261 ? -4.827  7.417   -11.062 1.00 8.87  ? 387  ARG A CB    1 
ATOM   1839 C  CG    . ARG A 1  261 ? -5.833  6.328   -11.387 1.00 10.32 ? 387  ARG A CG    1 
ATOM   1840 C  CD    . ARG A 1  261 ? -5.227  5.327   -12.350 1.00 13.87 ? 387  ARG A CD    1 
ATOM   1841 N  NE    . ARG A 1  261 ? -6.175  4.241   -12.620 1.00 11.96 ? 387  ARG A NE    1 
ATOM   1842 C  CZ    . ARG A 1  261 ? -5.939  3.239   -13.453 1.00 17.66 ? 387  ARG A CZ    1 
ATOM   1843 N  NH1   . ARG A 1  261 ? -4.774  3.175   -14.104 1.00 17.42 ? 387  ARG A NH1   1 
ATOM   1844 N  NH2   . ARG A 1  261 ? -6.861  2.298   -13.620 1.00 20.04 ? 387  ARG A NH2   1 
ATOM   1845 N  N     . SER A 1  262 ? -3.508  9.524   -8.825  1.00 5.44  ? 388  SER A N     1 
ATOM   1846 C  CA    A SER A 1  262 ? -2.450  10.517  -8.661  0.50 8.43  ? 388  SER A CA    1 
ATOM   1847 C  CA    B SER A 1  262 ? -2.450  10.520  -8.642  0.50 8.44  ? 388  SER A CA    1 
ATOM   1848 C  C     . SER A 1  262 ? -1.132  9.812   -8.350  1.00 9.31  ? 388  SER A C     1 
ATOM   1849 O  O     . SER A 1  262 ? -1.074  8.983   -7.457  1.00 6.89  ? 388  SER A O     1 
ATOM   1850 C  CB    A SER A 1  262 ? -2.793  11.478  -7.518  0.50 11.71 ? 388  SER A CB    1 
ATOM   1851 C  CB    B SER A 1  262 ? -2.773  11.428  -7.451  0.50 11.68 ? 388  SER A CB    1 
ATOM   1852 O  OG    A SER A 1  262 ? -3.698  12.483  -7.948  0.50 17.73 ? 388  SER A OG    1 
ATOM   1853 O  OG    B SER A 1  262 ? -1.685  12.300  -7.170  0.50 12.60 ? 388  SER A OG    1 
ATOM   1854 N  N     . PHE A 1  263 ? -0.074  10.139  -9.090  1.00 9.04  ? 389  PHE A N     1 
ATOM   1855 C  CA    . PHE A 1  263 ? 1.245   9.531   -8.824  1.00 7.60  ? 389  PHE A CA    1 
ATOM   1856 C  C     . PHE A 1  263 ? 2.108   10.646  -8.253  1.00 10.69 ? 389  PHE A C     1 
ATOM   1857 O  O     . PHE A 1  263 ? 2.540   11.535  -8.969  1.00 10.36 ? 389  PHE A O     1 
ATOM   1858 C  CB    . PHE A 1  263 ? 1.843   8.990   -10.115 1.00 8.98  ? 389  PHE A CB    1 
ATOM   1859 C  CG    . PHE A 1  263 ? 0.828   8.333   -10.995 1.00 10.91 ? 389  PHE A CG    1 
ATOM   1860 C  CD1   . PHE A 1  263 ? 0.093   7.244   -10.525 1.00 9.33  ? 389  PHE A CD1   1 
ATOM   1861 C  CD2   . PHE A 1  263 ? 0.594   8.797   -12.279 1.00 13.91 ? 389  PHE A CD2   1 
ATOM   1862 C  CE1   . PHE A 1  263 ? -0.859  6.648   -11.302 1.00 10.81 ? 389  PHE A CE1   1 
ATOM   1863 C  CE2   . PHE A 1  263 ? -0.361  8.186   -13.079 1.00 14.86 ? 389  PHE A CE2   1 
ATOM   1864 C  CZ    . PHE A 1  263 ? -1.090  7.119   -12.595 1.00 11.95 ? 389  PHE A CZ    1 
ATOM   1865 N  N     A CYS A 1  264 ? 2.352   10.635  -6.958  0.50 8.85  ? 390  CYS A N     1 
ATOM   1866 N  N     B CYS A 1  264 ? 2.329   10.601  -6.942  0.50 8.84  ? 390  CYS A N     1 
ATOM   1867 C  CA    A CYS A 1  264 ? 3.022   11.793  -6.411  0.50 10.85 ? 390  CYS A CA    1 
ATOM   1868 C  CA    B CYS A 1  264 ? 2.938   11.719  -6.235  0.50 10.84 ? 390  CYS A CA    1 
ATOM   1869 C  C     A CYS A 1  264 ? 4.261   11.411  -5.640  0.50 9.81  ? 390  CYS A C     1 
ATOM   1870 C  C     B CYS A 1  264 ? 4.338   11.401  -5.756  0.50 9.80  ? 390  CYS A C     1 
ATOM   1871 O  O     A CYS A 1  264 ? 4.536   10.225  -5.404  0.50 7.51  ? 390  CYS A O     1 
ATOM   1872 O  O     B CYS A 1  264 ? 4.790   10.253  -5.814  0.50 7.92  ? 390  CYS A O     1 
ATOM   1873 C  CB    A CYS A 1  264 ? 2.068   12.595  -5.534  0.50 11.65 ? 390  CYS A CB    1 
ATOM   1874 C  CB    B CYS A 1  264 ? 2.112   12.079  -5.001  0.50 11.65 ? 390  CYS A CB    1 
ATOM   1875 S  SG    A CYS A 1  264 ? 1.803   11.877  -3.920  0.50 14.56 ? 390  CYS A SG    1 
ATOM   1876 S  SG    B CYS A 1  264 ? 0.335   12.179  -5.257  0.50 12.90 ? 390  CYS A SG    1 
ATOM   1877 N  N     . ILE A 1  265 ? 5.010   12.437  -5.261  1.00 8.27  ? 391  ILE A N     1 
ATOM   1878 C  CA    . ILE A 1  265 ? 6.204   12.277  -4.450  1.00 6.81  ? 391  ILE A CA    1 
ATOM   1879 C  C     . ILE A 1  265 ? 5.915   13.077  -3.187  1.00 10.63 ? 391  ILE A C     1 
ATOM   1880 O  O     . ILE A 1  265 ? 5.589   14.280  -3.248  1.00 11.45 ? 391  ILE A O     1 
ATOM   1881 C  CB    . ILE A 1  265 ? 7.453   12.812  -5.166  1.00 10.98 ? 391  ILE A CB    1 
ATOM   1882 C  CG1   . ILE A 1  265 ? 7.611   12.086  -6.512  1.00 13.02 ? 391  ILE A CG1   1 
ATOM   1883 C  CG2   . ILE A 1  265 ? 8.698   12.654  -4.256  1.00 10.37 ? 391  ILE A CG2   1 
ATOM   1884 C  CD1   . ILE A 1  265 ? 8.822   12.507  -7.339  1.00 10.92 ? 391  ILE A CD1   1 
ATOM   1885 N  N     . PHE A 1  266 ? 6.027   12.394  -2.057  1.00 7.59  ? 392  PHE A N     1 
ATOM   1886 C  CA    . PHE A 1  266 ? 5.617   12.885  -0.755  1.00 11.39 ? 392  PHE A CA    1 
ATOM   1887 C  C     . PHE A 1  266 ? 6.859   13.129  0.072   1.00 11.64 ? 392  PHE A C     1 
ATOM   1888 O  O     . PHE A 1  266 ? 7.854   12.431  -0.067  1.00 7.80  ? 392  PHE A O     1 
ATOM   1889 C  CB    . PHE A 1  266 ? 4.906   11.760  -0.012  1.00 10.72 ? 392  PHE A CB    1 
ATOM   1890 C  CG    . PHE A 1  266 ? 3.454   11.989  0.249   1.00 13.89 ? 392  PHE A CG    1 
ATOM   1891 C  CD1   . PHE A 1  266 ? 3.010   12.225  1.537   1.00 21.91 ? 392  PHE A CD1   1 
ATOM   1892 C  CD2   . PHE A 1  266 ? 2.534   11.875  -0.760  1.00 16.33 ? 392  PHE A CD2   1 
ATOM   1893 C  CE1   . PHE A 1  266 ? 1.668   12.381  1.801   1.00 21.83 ? 392  PHE A CE1   1 
ATOM   1894 C  CE2   . PHE A 1  266 ? 1.182   12.007  -0.500  1.00 24.16 ? 392  PHE A CE2   1 
ATOM   1895 C  CZ    . PHE A 1  266 ? 0.757   12.263  0.786   1.00 22.70 ? 392  PHE A CZ    1 
ATOM   1896 N  N     . ARG A 1  267 ? 6.765   14.088  0.975   1.00 8.71  ? 393  ARG A N     1 
ATOM   1897 C  CA    . ARG A 1  267 ? 7.782   14.348  1.958   1.00 9.26  ? 393  ARG A CA    1 
ATOM   1898 C  C     . ARG A 1  267 ? 7.507   13.494  3.202   1.00 16.44 ? 393  ARG A C     1 
ATOM   1899 O  O     . ARG A 1  267 ? 6.503   13.684  3.874   1.00 19.78 ? 393  ARG A O     1 
ATOM   1900 C  CB    . ARG A 1  267 ? 7.650   15.826  2.307   1.00 14.42 ? 393  ARG A CB    1 
ATOM   1901 C  CG    . ARG A 1  267 ? 8.659   16.350  3.238   1.00 23.10 ? 393  ARG A CG    1 
ATOM   1902 C  CD    . ARG A 1  267 ? 8.631   17.863  3.093   1.00 24.09 ? 393  ARG A CD    1 
ATOM   1903 N  NE    . ARG A 1  267 ? 9.444   18.450  4.115   1.00 26.94 ? 393  ARG A NE    1 
ATOM   1904 C  CZ    . ARG A 1  267 ? 10.262  19.459  3.913   1.00 11.21 ? 393  ARG A CZ    1 
ATOM   1905 N  NH1   . ARG A 1  267 ? 10.365  20.015  2.704   1.00 14.02 ? 393  ARG A NH1   1 
ATOM   1906 N  NH2   . ARG A 1  267 ? 10.965  19.899  4.928   1.00 18.60 ? 393  ARG A NH2   1 
ATOM   1907 N  N     . LEU A 1  268 ? 8.390   12.550  3.495   1.00 11.96 ? 394  LEU A N     1 
ATOM   1908 C  CA    . LEU A 1  268 ? 8.217   11.666  4.632   1.00 18.53 ? 394  LEU A CA    1 
ATOM   1909 C  C     . LEU A 1  268 ? 9.238   11.985  5.721   1.00 20.17 ? 394  LEU A C     1 
ATOM   1910 O  O     . LEU A 1  268 ? 10.439  11.972  5.457   1.00 17.86 ? 394  LEU A O     1 
ATOM   1911 C  CB    . LEU A 1  268 ? 8.401   10.227  4.189   1.00 18.24 ? 394  LEU A CB    1 
ATOM   1912 C  CG    . LEU A 1  268 ? 8.228   9.185   5.295   1.00 25.44 ? 394  LEU A CG    1 
ATOM   1913 C  CD1   . LEU A 1  268 ? 6.798   9.189   5.813   1.00 33.63 ? 394  LEU A CD1   1 
ATOM   1914 C  CD2   . LEU A 1  268 ? 8.626   7.826   4.786   1.00 28.23 ? 394  LEU A CD2   1 
ATOM   1915 N  N     . PRO A 1  269 ? 8.765   12.272  6.949   1.00 31.34 ? 395  PRO A N     1 
ATOM   1916 C  CA    . PRO A 1  269 ? 9.685   12.616  8.048   1.00 25.65 ? 395  PRO A CA    1 
ATOM   1917 C  C     . PRO A 1  269 ? 10.676  11.514  8.368   1.00 29.47 ? 395  PRO A C     1 
ATOM   1918 O  O     . PRO A 1  269 ? 10.331  10.334  8.287   1.00 31.38 ? 395  PRO A O     1 
ATOM   1919 C  CB    . PRO A 1  269 ? 8.743   12.860  9.226   1.00 30.50 ? 395  PRO A CB    1 
ATOM   1920 C  CG    . PRO A 1  269 ? 7.499   13.380  8.582   1.00 32.17 ? 395  PRO A CG    1 
ATOM   1921 C  CD    . PRO A 1  269 ? 7.364   12.554  7.307   1.00 34.41 ? 395  PRO A CD    1 
ATOM   1922 N  N     . GLN A 1  270 ? 11.910  11.922  8.672   1.00 20.10 ? 396  GLN A N     1 
ATOM   1923 C  CA    . GLN A 1  270 ? 12.995  11.051  9.091   1.00 23.32 ? 396  GLN A CA    1 
ATOM   1924 C  C     . GLN A 1  270 ? 13.608  11.762  10.294  1.00 27.97 ? 396  GLN A C     1 
ATOM   1925 O  O     . GLN A 1  270 ? 13.357  12.957  10.495  1.00 29.15 ? 396  GLN A O     1 
ATOM   1926 C  CB    . GLN A 1  270 ? 14.055  10.911  7.978   1.00 22.34 ? 396  GLN A CB    1 
ATOM   1927 C  CG    . GLN A 1  270 ? 13.592  10.227  6.694   1.00 20.04 ? 396  GLN A CG    1 
ATOM   1928 C  CD    . GLN A 1  270 ? 13.577  8.719   6.807   1.00 30.93 ? 396  GLN A CD    1 
ATOM   1929 O  OE1   . GLN A 1  270 ? 14.564  8.047   6.489   1.00 30.72 ? 396  GLN A OE1   1 
ATOM   1930 N  NE2   . GLN A 1  270 ? 12.454  8.175   7.264   1.00 29.97 ? 396  GLN A NE2   1 
ATOM   1931 N  N     . PRO A 1  271 ? 14.409  11.044  11.104  1.00 40.96 ? 397  PRO A N     1 
ATOM   1932 C  CA    . PRO A 1  271 ? 15.083  11.705  12.231  1.00 36.33 ? 397  PRO A CA    1 
ATOM   1933 C  C     . PRO A 1  271 ? 15.905  12.938  11.812  1.00 32.32 ? 397  PRO A C     1 
ATOM   1934 O  O     . PRO A 1  271 ? 16.893  12.821  11.071  1.00 30.45 ? 397  PRO A O     1 
ATOM   1935 C  CB    . PRO A 1  271 ? 15.992  10.598  12.798  1.00 39.49 ? 397  PRO A CB    1 
ATOM   1936 C  CG    . PRO A 1  271 ? 16.015  9.514   11.766  1.00 41.10 ? 397  PRO A CG    1 
ATOM   1937 C  CD    . PRO A 1  271 ? 14.696  9.598   11.072  1.00 39.25 ? 397  PRO A CD    1 
ATOM   1938 N  N     . GLY A 1  272 ? 15.466  14.111  12.263  1.00 27.71 ? 410  GLY A N     1 
ATOM   1939 C  CA    . GLY A 1  272 ? 16.158  15.362  11.981  1.00 28.26 ? 410  GLY A CA    1 
ATOM   1940 C  C     . GLY A 1  272 ? 16.046  15.876  10.554  1.00 23.59 ? 410  GLY A C     1 
ATOM   1941 O  O     . GLY A 1  272 ? 16.692  16.859  10.180  1.00 24.98 ? 410  GLY A O     1 
ATOM   1942 N  N     . SER A 1  273 ? 15.220  15.219  9.746   1.00 24.59 ? 411  SER A N     1 
ATOM   1943 C  CA    . SER A 1  273 ? 15.138  15.544  8.332   1.00 14.13 ? 411  SER A CA    1 
ATOM   1944 C  C     . SER A 1  273 ? 13.909  14.849  7.700   1.00 21.66 ? 411  SER A C     1 
ATOM   1945 O  O     . SER A 1  273 ? 12.899  14.633  8.363   1.00 18.70 ? 411  SER A O     1 
ATOM   1946 C  CB    . SER A 1  273 ? 16.420  15.115  7.630   1.00 18.33 ? 411  SER A CB    1 
ATOM   1947 O  OG    . SER A 1  273 ? 16.440  15.559  6.295   1.00 18.84 ? 411  SER A OG    1 
ATOM   1948 N  N     . TRP A 1  274 ? 14.009  14.493  6.425   1.00 15.45 ? 412  TRP A N     1 
ATOM   1949 C  CA    . TRP A 1  274 ? 12.915  13.820  5.733   1.00 14.20 ? 412  TRP A CA    1 
ATOM   1950 C  C     . TRP A 1  274 ? 13.462  13.132  4.489   1.00 14.40 ? 412  TRP A C     1 
ATOM   1951 O  O     . TRP A 1  274 ? 14.625  13.333  4.111   1.00 13.02 ? 412  TRP A O     1 
ATOM   1952 C  CB    . TRP A 1  274 ? 11.842  14.834  5.336   1.00 12.14 ? 412  TRP A CB    1 
ATOM   1953 C  CG    . TRP A 1  274 ? 12.394  16.032  4.605   1.00 18.84 ? 412  TRP A CG    1 
ATOM   1954 C  CD1   . TRP A 1  274 ? 12.884  17.184  5.173   1.00 13.61 ? 412  TRP A CD1   1 
ATOM   1955 C  CD2   . TRP A 1  274 ? 12.522  16.207  3.179   1.00 15.31 ? 412  TRP A CD2   1 
ATOM   1956 N  NE1   . TRP A 1  274 ? 13.293  18.052  4.197   1.00 11.23 ? 412  TRP A NE1   1 
ATOM   1957 C  CE2   . TRP A 1  274 ? 13.073  17.491  2.967   1.00 11.08 ? 412  TRP A CE2   1 
ATOM   1958 C  CE3   . TRP A 1  274 ? 12.190  15.423  2.067   1.00 12.72 ? 412  TRP A CE3   1 
ATOM   1959 C  CZ2   . TRP A 1  274 ? 13.325  17.999  1.687   1.00 13.80 ? 412  TRP A CZ2   1 
ATOM   1960 C  CZ3   . TRP A 1  274 ? 12.447  15.924  0.794   1.00 13.41 ? 412  TRP A CZ3   1 
ATOM   1961 C  CH2   . TRP A 1  274 ? 13.008  17.206  0.614   1.00 12.00 ? 412  TRP A CH2   1 
ATOM   1962 N  N     . LYS A 1  275 ? 12.637  12.306  3.850   1.00 11.29 ? 413  LYS A N     1 
ATOM   1963 C  CA    . LYS A 1  275 ? 13.009  11.768  2.552   1.00 8.50  ? 413  LYS A CA    1 
ATOM   1964 C  C     . LYS A 1  275 ? 11.809  11.773  1.611   1.00 6.68  ? 413  LYS A C     1 
ATOM   1965 O  O     . LYS A 1  275 ? 10.650  11.779  2.043   1.00 8.61  ? 413  LYS A O     1 
ATOM   1966 C  CB    . LYS A 1  275 ? 13.575  10.352  2.672   1.00 12.36 ? 413  LYS A CB    1 
ATOM   1967 C  CG    . LYS A 1  275 ? 12.575  9.351   3.239   1.00 15.26 ? 413  LYS A CG    1 
ATOM   1968 C  CD    . LYS A 1  275 ? 13.095  7.912   3.168   1.00 18.29 ? 413  LYS A CD    1 
ATOM   1969 C  CE    . LYS A 1  275 ? 12.071  6.945   3.790   1.00 26.12 ? 413  LYS A CE    1 
ATOM   1970 N  NZ    . LYS A 1  275 ? 12.371  5.501   3.519   1.00 23.18 ? 413  LYS A NZ    1 
ATOM   1971 N  N     . ALA A 1  276 ? 12.102  11.797  0.321   1.00 6.72  ? 414  ALA A N     1 
ATOM   1972 C  CA    . ALA A 1  276 ? 11.080  11.779  -0.706  1.00 9.51  ? 414  ALA A CA    1 
ATOM   1973 C  C     . ALA A 1  276 ? 10.644  10.336  -0.896  1.00 10.29 ? 414  ALA A C     1 
ATOM   1974 O  O     . ALA A 1  276 ? 11.485  9.445   -0.945  1.00 8.36  ? 414  ALA A O     1 
ATOM   1975 C  CB    . ALA A 1  276 ? 11.639  12.328  -2.010  1.00 11.39 ? 414  ALA A CB    1 
ATOM   1976 N  N     . VAL A 1  277 ? 9.333   10.116  -0.967  1.00 7.76  ? 415  VAL A N     1 
ATOM   1977 C  CA    A VAL A 1  277 ? 8.769   8.776   -1.169  0.70 8.28  ? 415  VAL A CA    1 
ATOM   1978 C  CA    B VAL A 1  277 ? 8.799   8.779   -1.221  0.30 8.27  ? 415  VAL A CA    1 
ATOM   1979 C  C     . VAL A 1  277 ? 7.677   8.858   -2.247  1.00 8.25  ? 415  VAL A C     1 
ATOM   1980 O  O     . VAL A 1  277 ? 6.919   9.828   -2.297  1.00 9.01  ? 415  VAL A O     1 
ATOM   1981 C  CB    A VAL A 1  277 ? 8.184   8.227   0.166   0.70 7.29  ? 415  VAL A CB    1 
ATOM   1982 C  CB    B VAL A 1  277 ? 8.290   8.077   0.068   0.30 7.43  ? 415  VAL A CB    1 
ATOM   1983 C  CG1   A VAL A 1  277 ? 7.442   6.925   -0.041  0.70 7.77  ? 415  VAL A CG1   1 
ATOM   1984 C  CG1   B VAL A 1  277 ? 9.442   7.784   1.021   0.30 9.18  ? 415  VAL A CG1   1 
ATOM   1985 C  CG2   A VAL A 1  277 ? 9.284   8.039   1.199   0.70 9.02  ? 415  VAL A CG2   1 
ATOM   1986 C  CG2   B VAL A 1  277 ? 7.215   8.900   0.755   0.30 7.93  ? 415  VAL A CG2   1 
ATOM   1987 N  N     . ARG A 1  278 ? 7.600   7.851   -3.113  1.00 6.44  ? 416  ARG A N     1 
ATOM   1988 C  CA    . ARG A 1  278 ? 6.531   7.790   -4.096  1.00 5.92  ? 416  ARG A CA    1 
ATOM   1989 C  C     . ARG A 1  278 ? 5.270   7.265   -3.423  1.00 6.53  ? 416  ARG A C     1 
ATOM   1990 O  O     . ARG A 1  278 ? 5.309   6.285   -2.661  1.00 5.51  ? 416  ARG A O     1 
ATOM   1991 C  CB    . ARG A 1  278 ? 6.946   6.865   -5.259  1.00 4.96  ? 416  ARG A CB    1 
ATOM   1992 C  CG    . ARG A 1  278 ? 7.849   7.560   -6.310  1.00 8.12  ? 416  ARG A CG    1 
ATOM   1993 C  CD    . ARG A 1  278 ? 7.003   8.254   -7.405  1.00 7.52  ? 416  ARG A CD    1 
ATOM   1994 N  NE    . ARG A 1  278 ? 6.175   7.281   -8.128  1.00 6.20  ? 416  ARG A NE    1 
ATOM   1995 C  CZ    . ARG A 1  278 ? 4.858   7.101   -7.960  1.00 9.51  ? 416  ARG A CZ    1 
ATOM   1996 N  NH1   . ARG A 1  278 ? 4.160   7.855   -7.108  1.00 5.34  ? 416  ARG A NH1   1 
ATOM   1997 N  NH2   . ARG A 1  278 ? 4.231   6.166   -8.661  1.00 7.61  ? 416  ARG A NH2   1 
ATOM   1998 N  N     . VAL A 1  279 ? 4.151   7.920   -3.700  1.00 8.25  ? 417  VAL A N     1 
ATOM   1999 C  CA    . VAL A 1  279 ? 2.860   7.529   -3.142  1.00 7.46  ? 417  VAL A CA    1 
ATOM   2000 C  C     . VAL A 1  279 ? 1.843   7.617   -4.262  1.00 7.26  ? 417  VAL A C     1 
ATOM   2001 O  O     . VAL A 1  279 ? 1.790   8.622   -4.956  1.00 6.50  ? 417  VAL A O     1 
ATOM   2002 C  CB    . VAL A 1  279 ? 2.416   8.470   -1.983  1.00 10.30 ? 417  VAL A CB    1 
ATOM   2003 C  CG1   . VAL A 1  279 ? 0.997   8.131   -1.520  1.00 6.32  ? 417  VAL A CG1   1 
ATOM   2004 C  CG2   . VAL A 1  279 ? 3.377   8.383   -0.834  1.00 7.08  ? 417  VAL A CG2   1 
ATOM   2005 N  N     . ASP A 1  280 ? 1.069   6.550   -4.462  1.00 6.64  ? 418  ASP A N     1 
ATOM   2006 C  CA    . ASP A 1  280 ? -0.018  6.544   -5.438  1.00 7.25  ? 418  ASP A CA    1 
ATOM   2007 C  C     . ASP A 1  280 ? -1.365  6.577   -4.726  1.00 3.94  ? 418  ASP A C     1 
ATOM   2008 O  O     . ASP A 1  280 ? -1.576  5.878   -3.737  1.00 5.56  ? 418  ASP A O     1 
ATOM   2009 C  CB    . ASP A 1  280 ? 0.023   5.280   -6.311  1.00 6.43  ? 418  ASP A CB    1 
ATOM   2010 C  CG    . ASP A 1  280 ? 1.210   5.262   -7.255  1.00 8.99  ? 418  ASP A CG    1 
ATOM   2011 O  OD1   . ASP A 1  280 ? 1.672   4.158   -7.613  1.00 6.48  ? 418  ASP A OD1   1 
ATOM   2012 O  OD2   . ASP A 1  280 ? 1.676   6.360   -7.644  1.00 8.83  ? 418  ASP A OD2   1 
ATOM   2013 N  N     . LEU A 1  281 ? -2.268  7.401   -5.234  1.00 3.55  ? 419  LEU A N     1 
ATOM   2014 C  CA    . LEU A 1  281 ? -3.606  7.488   -4.683  1.00 4.58  ? 419  LEU A CA    1 
ATOM   2015 C  C     . LEU A 1  281 ? -4.561  7.192   -5.796  1.00 4.79  ? 419  LEU A C     1 
ATOM   2016 O  O     . LEU A 1  281 ? -4.419  7.723   -6.912  1.00 8.91  ? 419  LEU A O     1 
ATOM   2017 C  CB    . LEU A 1  281 ? -3.906  8.925   -4.188  1.00 3.53  ? 419  LEU A CB    1 
ATOM   2018 C  CG    . LEU A 1  281 ? -3.008  9.493   -3.083  1.00 8.28  ? 419  LEU A CG    1 
ATOM   2019 C  CD1   . LEU A 1  281 ? -3.623  10.790  -2.577  1.00 12.23 ? 419  LEU A CD1   1 
ATOM   2020 C  CD2   . LEU A 1  281 ? -2.828  8.536   -1.909  1.00 10.07 ? 419  LEU A CD2   1 
ATOM   2021 N  N     . VAL A 1  282 ? -5.580  6.389   -5.504  1.00 3.97  ? 420  VAL A N     1 
ATOM   2022 C  CA    . VAL A 1  282 ? -6.597  6.115   -6.503  1.00 3.79  ? 420  VAL A CA    1 
ATOM   2023 C  C     . VAL A 1  282 ? -7.948  6.142   -5.807  1.00 6.46  ? 420  VAL A C     1 
ATOM   2024 O  O     . VAL A 1  282 ? -8.076  5.695   -4.662  1.00 5.01  ? 420  VAL A O     1 
ATOM   2025 C  CB    . VAL A 1  282 ? -6.369  4.758   -7.226  1.00 6.01  ? 420  VAL A CB    1 
ATOM   2026 C  CG1   . VAL A 1  282 ? -6.112  3.636   -6.205  1.00 4.51  ? 420  VAL A CG1   1 
ATOM   2027 C  CG2   . VAL A 1  282 ? -7.588  4.396   -8.130  1.00 6.34  ? 420  VAL A CG2   1 
ATOM   2028 N  N     . VAL A 1  283 ? -8.933  6.725   -6.482  1.00 5.19  ? 421  VAL A N     1 
ATOM   2029 C  CA    . VAL A 1  283 ? -10.294 6.777   -5.962  1.00 5.45  ? 421  VAL A CA    1 
ATOM   2030 C  C     . VAL A 1  283 ? -11.166 5.859   -6.810  1.00 6.83  ? 421  VAL A C     1 
ATOM   2031 O  O     . VAL A 1  283 ? -11.047 5.840   -8.029  1.00 7.50  ? 421  VAL A O     1 
ATOM   2032 C  CB    . VAL A 1  283 ? -10.842 8.221   -6.007  1.00 6.87  ? 421  VAL A CB    1 
ATOM   2033 C  CG1   . VAL A 1  283 ? -12.337 8.246   -5.677  1.00 7.22  ? 421  VAL A CG1   1 
ATOM   2034 C  CG2   . VAL A 1  283 ? -10.065 9.118   -5.033  1.00 4.91  ? 421  VAL A CG2   1 
ATOM   2035 N  N     . ALA A 1  284 ? -12.047 5.100   -6.163  1.00 5.40  ? 422  ALA A N     1 
ATOM   2036 C  CA    . ALA A 1  284 ? -13.054 4.313   -6.862  1.00 8.12  ? 422  ALA A CA    1 
ATOM   2037 C  C     . ALA A 1  284 ? -14.392 4.479   -6.154  1.00 6.46  ? 422  ALA A C     1 
ATOM   2038 O  O     . ALA A 1  284 ? -14.428 4.632   -4.942  1.00 5.43  ? 422  ALA A O     1 
ATOM   2039 C  CB    . ALA A 1  284 ? -12.682 2.814   -6.834  1.00 7.36  ? 422  ALA A CB    1 
ATOM   2040 N  N     . PRO A 1  285 ? -15.500 4.423   -6.905  1.00 8.30  ? 423  PRO A N     1 
ATOM   2041 C  CA    . PRO A 1  285 ? -16.799 4.329   -6.221  1.00 9.58  ? 423  PRO A CA    1 
ATOM   2042 C  C     . PRO A 1  285 ? -16.915 2.985   -5.475  1.00 8.88  ? 423  PRO A C     1 
ATOM   2043 O  O     . PRO A 1  285 ? -16.276 1.994   -5.868  1.00 7.75  ? 423  PRO A O     1 
ATOM   2044 C  CB    . PRO A 1  285 ? -17.824 4.429   -7.365  1.00 12.75 ? 423  PRO A CB    1 
ATOM   2045 C  CG    . PRO A 1  285 ? -17.069 4.123   -8.605  1.00 12.39 ? 423  PRO A CG    1 
ATOM   2046 C  CD    . PRO A 1  285 ? -15.607 4.395   -8.371  1.00 8.85  ? 423  PRO A CD    1 
ATOM   2047 N  N     . VAL A 1  286 ? -17.721 2.942   -4.418  1.00 6.78  ? 424  VAL A N     1 
ATOM   2048 C  CA    . VAL A 1  286 ? -17.797 1.716   -3.618  1.00 8.38  ? 424  VAL A CA    1 
ATOM   2049 C  C     . VAL A 1  286 ? -18.266 0.490   -4.430  1.00 9.03  ? 424  VAL A C     1 
ATOM   2050 O  O     . VAL A 1  286 ? -17.825 -0.641  -4.170  1.00 8.50  ? 424  VAL A O     1 
ATOM   2051 C  CB    . VAL A 1  286 ? -18.606 1.928   -2.301  1.00 10.28 ? 424  VAL A CB    1 
ATOM   2052 C  CG1   . VAL A 1  286 ? -20.111 2.147   -2.583  1.00 8.21  ? 424  VAL A CG1   1 
ATOM   2053 C  CG2   . VAL A 1  286 ? -18.370 0.769   -1.331  1.00 14.26 ? 424  VAL A CG2   1 
ATOM   2054 N  N     . SER A 1  287 ? -19.104 0.710   -5.443  1.00 9.86  ? 425  SER A N     1 
ATOM   2055 C  CA    . SER A 1  287 ? -19.528 -0.375  -6.341  1.00 8.67  ? 425  SER A CA    1 
ATOM   2056 C  C     . SER A 1  287 ? -18.346 -1.039  -7.042  1.00 11.52 ? 425  SER A C     1 
ATOM   2057 O  O     . SER A 1  287 ? -18.376 -2.241  -7.328  1.00 9.46  ? 425  SER A O     1 
ATOM   2058 C  CB    . SER A 1  287 ? -20.481 0.143   -7.410  1.00 13.26 ? 425  SER A CB    1 
ATOM   2059 O  OG    . SER A 1  287 ? -19.885 1.189   -8.171  1.00 11.89 ? 425  SER A OG    1 
ATOM   2060 N  N     . GLN A 1  288 ? -17.314 -0.254  -7.340  1.00 8.51  ? 426  GLN A N     1 
ATOM   2061 C  CA    . GLN A 1  288 ? -16.147 -0.772  -8.044  1.00 7.20  ? 426  GLN A CA    1 
ATOM   2062 C  C     . GLN A 1  288 ? -15.005 -1.134  -7.102  1.00 9.21  ? 426  GLN A C     1 
ATOM   2063 O  O     . GLN A 1  288 ? -13.997 -1.657  -7.550  1.00 6.87  ? 426  GLN A O     1 
ATOM   2064 C  CB    . GLN A 1  288 ? -15.621 0.254   -9.042  1.00 7.64  ? 426  GLN A CB    1 
ATOM   2065 C  CG    . GLN A 1  288 ? -16.630 0.647   -10.088 1.00 9.18  ? 426  GLN A CG    1 
ATOM   2066 C  CD    . GLN A 1  288 ? -16.083 1.656   -11.047 1.00 11.93 ? 426  GLN A CD    1 
ATOM   2067 O  OE1   . GLN A 1  288 ? -14.903 1.993   -11.013 1.00 12.84 ? 426  GLN A OE1   1 
ATOM   2068 N  NE2   . GLN A 1  288 ? -16.938 2.148   -11.920 1.00 13.45 ? 426  GLN A NE2   1 
ATOM   2069 N  N     . PHE A 1  289 ? -15.164 -0.855  -5.814  1.00 7.25  ? 427  PHE A N     1 
ATOM   2070 C  CA    . PHE A 1  289 ? -14.057 -1.010  -4.870  1.00 6.32  ? 427  PHE A CA    1 
ATOM   2071 C  C     . PHE A 1  289 ? -13.393 -2.405  -4.877  1.00 6.46  ? 427  PHE A C     1 
ATOM   2072 O  O     . PHE A 1  289 ? -12.173 -2.494  -4.851  1.00 6.69  ? 427  PHE A O     1 
ATOM   2073 C  CB    . PHE A 1  289 ? -14.504 -0.590  -3.470  1.00 9.54  ? 427  PHE A CB    1 
ATOM   2074 C  CG    . PHE A 1  289 ? -13.478 -0.842  -2.387  1.00 6.93  ? 427  PHE A CG    1 
ATOM   2075 C  CD1   . PHE A 1  289 ? -12.541 0.126   -2.054  1.00 7.02  ? 427  PHE A CD1   1 
ATOM   2076 C  CD2   . PHE A 1  289 ? -13.487 -2.028  -1.687  1.00 7.86  ? 427  PHE A CD2   1 
ATOM   2077 C  CE1   . PHE A 1  289 ? -11.607 -0.106  -1.010  1.00 9.55  ? 427  PHE A CE1   1 
ATOM   2078 C  CE2   . PHE A 1  289 ? -12.562 -2.285  -0.677  1.00 11.08 ? 427  PHE A CE2   1 
ATOM   2079 C  CZ    . PHE A 1  289 ? -11.615 -1.335  -0.346  1.00 8.62  ? 427  PHE A CZ    1 
ATOM   2080 N  N     . PRO A 1  290 ? -14.189 -3.492  -4.920  1.00 7.68  ? 428  PRO A N     1 
ATOM   2081 C  CA    . PRO A 1  290 ? -13.569 -4.825  -4.963  1.00 5.78  ? 428  PRO A CA    1 
ATOM   2082 C  C     . PRO A 1  290 ? -12.665 -5.019  -6.185  1.00 3.86  ? 428  PRO A C     1 
ATOM   2083 O  O     . PRO A 1  290 ? -11.598 -5.624  -6.104  1.00 4.58  ? 428  PRO A O     1 
ATOM   2084 C  CB    . PRO A 1  290 ? -14.790 -5.765  -5.065  1.00 6.89  ? 428  PRO A CB    1 
ATOM   2085 C  CG    . PRO A 1  290 ? -15.865 -5.023  -4.308  1.00 8.71  ? 428  PRO A CG    1 
ATOM   2086 C  CD    . PRO A 1  290 ? -15.649 -3.573  -4.696  1.00 8.06  ? 428  PRO A CD    1 
ATOM   2087 N  N     . PHE A 1  291 ? -13.098 -4.509  -7.322  1.00 4.47  ? 429  PHE A N     1 
ATOM   2088 C  CA    . PHE A 1  291 ? -12.312 -4.634  -8.539  1.00 6.33  ? 429  PHE A CA    1 
ATOM   2089 C  C     . PHE A 1  291 ? -11.064 -3.788  -8.443  1.00 7.29  ? 429  PHE A C     1 
ATOM   2090 O  O     . PHE A 1  291 ? -10.014 -4.183  -8.932  1.00 5.87  ? 429  PHE A O     1 
ATOM   2091 C  CB    . PHE A 1  291 ? -13.142 -4.174  -9.742  1.00 7.05  ? 429  PHE A CB    1 
ATOM   2092 C  CG    . PHE A 1  291 ? -14.360 -5.018  -9.965  1.00 6.61  ? 429  PHE A CG    1 
ATOM   2093 C  CD1   . PHE A 1  291 ? -15.613 -4.594  -9.517  1.00 8.43  ? 429  PHE A CD1   1 
ATOM   2094 C  CD2   . PHE A 1  291 ? -14.247 -6.249  -10.584 1.00 4.97  ? 429  PHE A CD2   1 
ATOM   2095 C  CE1   . PHE A 1  291 ? -16.751 -5.400  -9.702  1.00 9.70  ? 429  PHE A CE1   1 
ATOM   2096 C  CE2   . PHE A 1  291 ? -15.360 -7.045  -10.770 1.00 6.81  ? 429  PHE A CE2   1 
ATOM   2097 C  CZ    . PHE A 1  291 ? -16.631 -6.611  -10.333 1.00 6.98  ? 429  PHE A CZ    1 
ATOM   2098 N  N     . ALA A 1  292 ? -11.179 -2.612  -7.826  1.00 5.99  ? 430  ALA A N     1 
ATOM   2099 C  CA    . ALA A 1  292 ? -10.025 -1.722  -7.766  1.00 5.54  ? 430  ALA A CA    1 
ATOM   2100 C  C     . ALA A 1  292 ? -9.029  -2.258  -6.752  1.00 4.64  ? 430  ALA A C     1 
ATOM   2101 O  O     . ALA A 1  292 ? -7.810  -2.191  -6.955  1.00 5.98  ? 430  ALA A O     1 
ATOM   2102 C  CB    . ALA A 1  292 ? -10.448 -0.299  -7.381  1.00 6.23  ? 430  ALA A CB    1 
ATOM   2103 N  N     . LEU A 1  293 ? -9.561  -2.763  -5.644  1.00 3.76  ? 431  LEU A N     1 
ATOM   2104 C  CA    . LEU A 1  293 ? -8.726  -3.388  -4.628  1.00 5.36  ? 431  LEU A CA    1 
ATOM   2105 C  C     . LEU A 1  293 ? -7.966  -4.592  -5.214  1.00 6.23  ? 431  LEU A C     1 
ATOM   2106 O  O     . LEU A 1  293 ? -6.766  -4.763  -4.996  1.00 3.43  ? 431  LEU A O     1 
ATOM   2107 C  CB    . LEU A 1  293 ? -9.578  -3.829  -3.441  1.00 3.36  ? 431  LEU A CB    1 
ATOM   2108 C  CG    . LEU A 1  293 ? -8.787  -4.492  -2.310  1.00 5.13  ? 431  LEU A CG    1 
ATOM   2109 C  CD1   . LEU A 1  293 ? -7.780  -3.494  -1.740  1.00 3.47  ? 431  LEU A CD1   1 
ATOM   2110 C  CD2   . LEU A 1  293 ? -9.720  -4.976  -1.207  1.00 6.18  ? 431  LEU A CD2   1 
ATOM   2111 N  N     . LEU A 1  294 ? -8.666  -5.414  -5.966  1.00 4.71  ? 432  LEU A N     1 
ATOM   2112 C  CA    . LEU A 1  294 ? -8.034  -6.599  -6.570  1.00 5.96  ? 432  LEU A CA    1 
ATOM   2113 C  C     . LEU A 1  294 ? -6.924  -6.180  -7.541  1.00 3.77  ? 432  LEU A C     1 
ATOM   2114 O  O     . LEU A 1  294 ? -5.800  -6.682  -7.499  1.00 3.93  ? 432  LEU A O     1 
ATOM   2115 C  CB    . LEU A 1  294 ? -9.097  -7.425  -7.283  1.00 5.03  ? 432  LEU A CB    1 
ATOM   2116 C  CG    . LEU A 1  294 ? -8.638  -8.694  -8.007  1.00 3.84  ? 432  LEU A CG    1 
ATOM   2117 C  CD1   . LEU A 1  294 ? -8.081  -9.732  -6.995  1.00 4.03  ? 432  LEU A CD1   1 
ATOM   2118 C  CD2   . LEU A 1  294 ? -9.821  -9.272  -8.796  1.00 2.66  ? 432  LEU A CD2   1 
ATOM   2119 N  N     . GLY A 1  295 ? -7.234  -5.214  -8.395  1.00 4.69  ? 433  GLY A N     1 
ATOM   2120 C  CA    . GLY A 1  295 ? -6.252  -4.741  -9.357  1.00 5.03  ? 433  GLY A CA    1 
ATOM   2121 C  C     . GLY A 1  295 ? -5.047  -4.086  -8.715  1.00 4.27  ? 433  GLY A C     1 
ATOM   2122 O  O     . GLY A 1  295 ? -3.899  -4.422  -9.048  1.00 3.21  ? 433  GLY A O     1 
ATOM   2123 N  N     . TRP A 1  296 ? -5.294  -3.174  -7.777  1.00 4.21  ? 434  TRP A N     1 
ATOM   2124 C  CA    . TRP A 1  296 ? -4.198  -2.443  -7.153  1.00 4.98  ? 434  TRP A CA    1 
ATOM   2125 C  C     . TRP A 1  296 ? -3.399  -3.247  -6.166  1.00 3.51  ? 434  TRP A C     1 
ATOM   2126 O  O     . TRP A 1  296 ? -2.317  -2.819  -5.780  1.00 5.09  ? 434  TRP A O     1 
ATOM   2127 C  CB    . TRP A 1  296 ? -4.691  -1.151  -6.487  1.00 4.66  ? 434  TRP A CB    1 
ATOM   2128 C  CG    . TRP A 1  296 ? -4.925  -0.104  -7.505  1.00 7.53  ? 434  TRP A CG    1 
ATOM   2129 C  CD1   . TRP A 1  296 ? -5.988  -0.003  -8.383  1.00 8.86  ? 434  TRP A CD1   1 
ATOM   2130 C  CD2   . TRP A 1  296 ? -4.070  0.996   -7.772  1.00 12.12 ? 434  TRP A CD2   1 
ATOM   2131 N  NE1   . TRP A 1  296 ? -5.819  1.093   -9.195  1.00 12.18 ? 434  TRP A NE1   1 
ATOM   2132 C  CE2   . TRP A 1  296 ? -4.657  1.740   -8.822  1.00 12.30 ? 434  TRP A CE2   1 
ATOM   2133 C  CE3   . TRP A 1  296 ? -2.849  1.438   -7.219  1.00 7.84  ? 434  TRP A CE3   1 
ATOM   2134 C  CZ2   . TRP A 1  296 ? -4.072  2.901   -9.325  1.00 9.61  ? 434  TRP A CZ2   1 
ATOM   2135 C  CZ3   . TRP A 1  296 ? -2.270  2.611   -7.731  1.00 7.71  ? 434  TRP A CZ3   1 
ATOM   2136 C  CH2   . TRP A 1  296 ? -2.877  3.314   -8.771  1.00 9.92  ? 434  TRP A CH2   1 
ATOM   2137 N  N     . THR A 1  297 ? -3.922  -4.397  -5.745  1.00 3.36  ? 435  THR A N     1 
ATOM   2138 C  CA    . THR A 1  297 ? -3.174  -5.245  -4.814  1.00 3.62  ? 435  THR A CA    1 
ATOM   2139 C  C     . THR A 1  297 ? -2.148  -6.139  -5.550  1.00 5.16  ? 435  THR A C     1 
ATOM   2140 O  O     . THR A 1  297 ? -1.124  -6.549  -4.982  1.00 5.00  ? 435  THR A O     1 
ATOM   2141 C  CB    . THR A 1  297 ? -4.122  -6.054  -3.931  1.00 3.58  ? 435  THR A CB    1 
ATOM   2142 O  OG1   . THR A 1  297 ? -4.881  -5.152  -3.118  1.00 3.51  ? 435  THR A OG1   1 
ATOM   2143 C  CG2   . THR A 1  297 ? -3.356  -6.970  -2.993  1.00 1.95  ? 435  THR A CG2   1 
ATOM   2144 N  N     . GLY A 1  298 ? -2.403  -6.430  -6.822  1.00 3.51  ? 436  GLY A N     1 
ATOM   2145 C  CA    . GLY A 1  298 ? -1.382  -7.086  -7.627  1.00 4.16  ? 436  GLY A CA    1 
ATOM   2146 C  C     . GLY A 1  298 ? -1.222  -8.582  -7.291  1.00 5.74  ? 436  GLY A C     1 
ATOM   2147 O  O     . GLY A 1  298 ? -2.178  -9.190  -6.830  1.00 5.04  ? 436  GLY A O     1 
ATOM   2148 N  N     . SER A 1  299 ? -0.058  -9.180  -7.543  1.00 4.19  ? 437  SER A N     1 
ATOM   2149 C  CA    . SER A 1  299 ? 1.079   -8.544  -8.199  1.00 5.08  ? 437  SER A CA    1 
ATOM   2150 C  C     . SER A 1  299 ? 0.750   -8.164  -9.647  1.00 5.15  ? 437  SER A C     1 
ATOM   2151 O  O     . SER A 1  299 ? -0.305  -8.514  -10.173 1.00 3.75  ? 437  SER A O     1 
ATOM   2152 C  CB    . SER A 1  299 ? 2.280   -9.502  -8.206  1.00 4.10  ? 437  SER A CB    1 
ATOM   2153 O  OG    . SER A 1  299 ? 2.065   -10.572 -9.148  1.00 5.66  ? 437  SER A OG    1 
ATOM   2154 N  N     . LYS A 1  300 ? 1.649   -7.422  -10.277 1.00 4.59  ? 438  LYS A N     1 
ATOM   2155 C  CA    . LYS A 1  300 ? 1.416   -7.014  -11.662 1.00 7.18  ? 438  LYS A CA    1 
ATOM   2156 C  C     . LYS A 1  300 ? 1.230   -8.275  -12.519 1.00 5.78  ? 438  LYS A C     1 
ATOM   2157 O  O     . LYS A 1  300 ? 0.287   -8.374  -13.299 1.00 5.96  ? 438  LYS A O     1 
ATOM   2158 C  CB    . LYS A 1  300 ? 2.598   -6.201  -12.178 1.00 5.77  ? 438  LYS A CB    1 
ATOM   2159 C  CG    . LYS A 1  300 ? 2.552   -5.927  -13.679 1.00 10.10 ? 438  LYS A CG    1 
ATOM   2160 C  CD    . LYS A 1  300 ? 3.696   -4.965  -14.067 1.00 12.29 ? 438  LYS A CD    1 
ATOM   2161 C  CE    . LYS A 1  300 ? 3.783   -4.806  -15.585 1.00 12.18 ? 438  LYS A CE    1 
ATOM   2162 N  NZ    . LYS A 1  300 ? 4.671   -3.640  -15.922 1.00 17.50 ? 438  LYS A NZ    1 
ATOM   2163 N  N     . LEU A 1  301 ? 2.120   -9.243  -12.377 1.00 4.70  ? 439  LEU A N     1 
ATOM   2164 C  CA    . LEU A 1  301 ? 1.970   -10.457 -13.180 1.00 6.16  ? 439  LEU A CA    1 
ATOM   2165 C  C     . LEU A 1  301 ? 0.659   -11.179 -12.825 1.00 7.02  ? 439  LEU A C     1 
ATOM   2166 O  O     . LEU A 1  301 ? -0.040  -11.659 -13.702 1.00 5.22  ? 439  LEU A O     1 
ATOM   2167 C  CB    . LEU A 1  301 ? 3.161   -11.427 -12.963 1.00 5.25  ? 439  LEU A CB    1 
ATOM   2168 C  CG    . LEU A 1  301 ? 3.047   -12.760 -13.707 1.00 7.54  ? 439  LEU A CG    1 
ATOM   2169 C  CD1   . LEU A 1  301 ? 2.953   -12.575 -15.240 1.00 7.14  ? 439  LEU A CD1   1 
ATOM   2170 C  CD2   . LEU A 1  301 ? 4.228   -13.668 -13.366 1.00 3.79  ? 439  LEU A CD2   1 
ATOM   2171 N  N     . PHE A 1  302 ? 0.325   -11.246 -11.534 1.00 4.00  ? 440  PHE A N     1 
ATOM   2172 C  CA    . PHE A 1  302 ? -0.926  -11.895 -11.123 1.00 5.21  ? 440  PHE A CA    1 
ATOM   2173 C  C     . PHE A 1  302 ? -2.137  -11.284 -11.831 1.00 4.98  ? 440  PHE A C     1 
ATOM   2174 O  O     . PHE A 1  302 ? -3.035  -12.010 -12.280 1.00 4.83  ? 440  PHE A O     1 
ATOM   2175 C  CB    . PHE A 1  302 ? -1.103  -11.814 -9.596  1.00 6.33  ? 440  PHE A CB    1 
ATOM   2176 C  CG    . PHE A 1  302 ? -2.234  -12.655 -9.064  1.00 6.03  ? 440  PHE A CG    1 
ATOM   2177 C  CD1   . PHE A 1  302 ? -1.988  -13.914 -8.523  1.00 4.66  ? 440  PHE A CD1   1 
ATOM   2178 C  CD2   . PHE A 1  302 ? -3.536  -12.179 -9.082  1.00 7.12  ? 440  PHE A CD2   1 
ATOM   2179 C  CE1   . PHE A 1  302 ? -3.037  -14.679 -8.028  1.00 5.53  ? 440  PHE A CE1   1 
ATOM   2180 C  CE2   . PHE A 1  302 ? -4.592  -12.942 -8.595  1.00 4.64  ? 440  PHE A CE2   1 
ATOM   2181 C  CZ    . PHE A 1  302 ? -4.343  -14.189 -8.060  1.00 5.27  ? 440  PHE A CZ    1 
ATOM   2182 N  N     . GLN A 1  303 ? -2.172  -9.948  -11.911 1.00 5.69  ? 441  GLN A N     1 
ATOM   2183 C  CA    . GLN A 1  303 ? -3.310  -9.251  -12.523 1.00 6.96  ? 441  GLN A CA    1 
ATOM   2184 C  C     . GLN A 1  303 ? -3.398  -9.480  -14.034 1.00 7.07  ? 441  GLN A C     1 
ATOM   2185 O  O     . GLN A 1  303 ? -4.485  -9.707  -14.563 1.00 5.54  ? 441  GLN A O     1 
ATOM   2186 C  CB    . GLN A 1  303 ? -3.334  -7.763  -12.163 1.00 6.89  ? 441  GLN A CB    1 
ATOM   2187 C  CG    . GLN A 1  303 ? -3.505  -7.520  -10.649 1.00 5.95  ? 441  GLN A CG    1 
ATOM   2188 C  CD    . GLN A 1  303 ? -4.741  -8.173  -10.117 1.00 6.82  ? 441  GLN A CD    1 
ATOM   2189 O  OE1   . GLN A 1  303 ? -5.825  -8.010  -10.688 1.00 9.51  ? 441  GLN A OE1   1 
ATOM   2190 N  NE2   . GLN A 1  303 ? -4.597  -8.966  -9.060  1.00 8.09  ? 441  GLN A NE2   1 
ATOM   2191 N  N     . ARG A 1  304 ? -2.257  -9.443  -14.712 1.00 4.83  ? 442  ARG A N     1 
ATOM   2192 C  CA    . ARG A 1  304 ? -2.197  -9.749  -16.143 1.00 5.26  ? 442  ARG A CA    1 
ATOM   2193 C  C     . ARG A 1  304 ? -2.692  -11.179 -16.401 1.00 8.31  ? 442  ARG A C     1 
ATOM   2194 O  O     . ARG A 1  304 ? -3.467  -11.408 -17.316 1.00 5.74  ? 442  ARG A O     1 
ATOM   2195 C  CB    . ARG A 1  304 ? -0.765  -9.622  -16.668 1.00 5.20  ? 442  ARG A CB    1 
ATOM   2196 C  CG    . ARG A 1  304 ? -0.192  -8.206  -16.596 1.00 11.31 ? 442  ARG A CG    1 
ATOM   2197 C  CD    . ARG A 1  304 ? 1.259   -8.213  -17.041 1.00 11.82 ? 442  ARG A CD    1 
ATOM   2198 N  NE    . ARG A 1  304 ? 1.338   -8.311  -18.505 1.00 10.63 ? 442  ARG A NE    1 
ATOM   2199 C  CZ    . ARG A 1  304 ? 2.366   -7.885  -19.230 1.00 14.23 ? 442  ARG A CZ    1 
ATOM   2200 N  NH1   . ARG A 1  304 ? 3.438   -7.357  -18.634 1.00 11.25 ? 442  ARG A NH1   1 
ATOM   2201 N  NH2   . ARG A 1  304 ? 2.315   -7.980  -20.555 1.00 8.91  ? 442  ARG A NH2   1 
ATOM   2202 N  N     . GLU A 1  305 ? -2.247  -12.123 -15.583 1.00 5.66  ? 443  GLU A N     1 
ATOM   2203 C  CA    . GLU A 1  305 ? -2.671  -13.514 -15.728 1.00 6.04  ? 443  GLU A CA    1 
ATOM   2204 C  C     . GLU A 1  305 ? -4.148  -13.676 -15.400 1.00 8.44  ? 443  GLU A C     1 
ATOM   2205 O  O     . GLU A 1  305 ? -4.874  -14.402 -16.087 1.00 9.03  ? 443  GLU A O     1 
ATOM   2206 C  CB    . GLU A 1  305 ? -1.828  -14.414 -14.819 1.00 8.24  ? 443  GLU A CB    1 
ATOM   2207 C  CG    . GLU A 1  305 ? -0.375  -14.485 -15.233 1.00 7.25  ? 443  GLU A CG    1 
ATOM   2208 C  CD    . GLU A 1  305 ? -0.165  -15.476 -16.390 1.00 12.88 ? 443  GLU A CD    1 
ATOM   2209 O  OE1   . GLU A 1  305 ? -0.278  -16.698 -16.155 1.00 12.25 ? 443  GLU A OE1   1 
ATOM   2210 O  OE2   . GLU A 1  305 ? 0.083   -15.030 -17.519 1.00 13.35 ? 443  GLU A OE2   1 
ATOM   2211 N  N     . LEU A 1  306 ? -4.611  -12.998 -14.358 1.00 5.48  ? 444  LEU A N     1 
ATOM   2212 C  CA    . LEU A 1  306 ? -6.033  -13.037 -14.005 1.00 5.34  ? 444  LEU A CA    1 
ATOM   2213 C  C     . LEU A 1  306 ? -6.901  -12.475 -15.112 1.00 7.29  ? 444  LEU A C     1 
ATOM   2214 O  O     . LEU A 1  306 ? -7.942  -13.039 -15.455 1.00 7.56  ? 444  LEU A O     1 
ATOM   2215 C  CB    . LEU A 1  306 ? -6.282  -12.230 -12.718 1.00 5.13  ? 444  LEU A CB    1 
ATOM   2216 C  CG    . LEU A 1  306 ? -7.705  -12.352 -12.168 1.00 8.15  ? 444  LEU A CG    1 
ATOM   2217 C  CD1   . LEU A 1  306 ? -7.982  -13.767 -11.743 1.00 7.84  ? 444  LEU A CD1   1 
ATOM   2218 C  CD2   . LEU A 1  306 ? -7.895  -11.401 -10.976 1.00 6.66  ? 444  LEU A CD2   1 
ATOM   2219 N  N     . ARG A 1  307 ? -6.482  -11.361 -15.686 1.00 6.09  ? 445  ARG A N     1 
ATOM   2220 C  CA    . ARG A 1  307 ? -7.244  -10.789 -16.795 1.00 7.10  ? 445  ARG A CA    1 
ATOM   2221 C  C     . ARG A 1  307 ? -7.197  -11.683 -18.054 1.00 11.00 ? 445  ARG A C     1 
ATOM   2222 O  O     . ARG A 1  307 ? -8.195  -11.835 -18.771 1.00 9.14  ? 445  ARG A O     1 
ATOM   2223 C  CB    . ARG A 1  307 ? -6.738  -9.390  -17.102 1.00 5.96  ? 445  ARG A CB    1 
ATOM   2224 C  CG    . ARG A 1  307 ? -7.125  -8.382  -16.006 1.00 6.71  ? 445  ARG A CG    1 
ATOM   2225 C  CD    . ARG A 1  307 ? -6.371  -7.053  -16.117 1.00 5.19  ? 445  ARG A CD    1 
ATOM   2226 N  NE    . ARG A 1  307 ? -6.654  -6.247  -14.908 1.00 7.81  ? 445  ARG A NE    1 
ATOM   2227 C  CZ    . ARG A 1  307 ? -6.396  -4.951  -14.784 1.00 9.45  ? 445  ARG A CZ    1 
ATOM   2228 N  NH1   . ARG A 1  307 ? -5.858  -4.293  -15.796 1.00 9.33  ? 445  ARG A NH1   1 
ATOM   2229 N  NH2   . ARG A 1  307 ? -6.680  -4.319  -13.649 1.00 8.24  ? 445  ARG A NH2   1 
ATOM   2230 N  N     . ARG A 1  308 ? -6.035  -12.261 -18.310 1.00 6.83  ? 446  ARG A N     1 
ATOM   2231 C  CA    . ARG A 1  308 ? -5.882  -13.168 -19.445 1.00 7.86  ? 446  ARG A CA    1 
ATOM   2232 C  C     . ARG A 1  308 ? -6.757  -14.388 -19.242 1.00 9.01  ? 446  ARG A C     1 
ATOM   2233 O  O     . ARG A 1  308 ? -7.422  -14.862 -20.183 1.00 10.41 ? 446  ARG A O     1 
ATOM   2234 C  CB    . ARG A 1  308 ? -4.413  -13.585 -19.609 1.00 8.86  ? 446  ARG A CB    1 
ATOM   2235 C  CG    . ARG A 1  308 ? -4.138  -14.470 -20.839 1.00 8.43  ? 446  ARG A CG    1 
ATOM   2236 C  CD    . ARG A 1  308 ? -2.647  -14.611 -21.055 1.00 10.09 ? 446  ARG A CD    1 
ATOM   2237 N  NE    . ARG A 1  308 ? -1.964  -15.388 -20.013 1.00 8.06  ? 446  ARG A NE    1 
ATOM   2238 C  CZ    . ARG A 1  308 ? -1.659  -16.680 -20.123 1.00 17.89 ? 446  ARG A CZ    1 
ATOM   2239 N  NH1   . ARG A 1  308 ? -2.044  -17.359 -21.205 1.00 13.94 ? 446  ARG A NH1   1 
ATOM   2240 N  NH2   . ARG A 1  308 ? -0.992  -17.299 -19.150 1.00 13.49 ? 446  ARG A NH2   1 
ATOM   2241 N  N     . PHE A 1  309 ? -6.771  -14.896 -18.015 1.00 6.26  ? 447  PHE A N     1 
ATOM   2242 C  CA    . PHE A 1  309 ? -7.610  -16.060 -17.670 1.00 7.95  ? 447  PHE A CA    1 
ATOM   2243 C  C     . PHE A 1  309 ? -9.102  -15.777 -17.873 1.00 11.55 ? 447  PHE A C     1 
ATOM   2244 O  O     . PHE A 1  309 ? -9.832  -16.569 -18.517 1.00 12.77 ? 447  PHE A O     1 
ATOM   2245 C  CB    . PHE A 1  309 ? -7.335  -16.530 -16.229 1.00 7.97  ? 447  PHE A CB    1 
ATOM   2246 C  CG    . PHE A 1  309 ? -8.258  -17.634 -15.754 1.00 12.25 ? 447  PHE A CG    1 
ATOM   2247 C  CD1   . PHE A 1  309 ? -7.916  -18.972 -15.929 1.00 10.17 ? 447  PHE A CD1   1 
ATOM   2248 C  CD2   . PHE A 1  309 ? -9.471  -17.329 -15.141 1.00 10.11 ? 447  PHE A CD2   1 
ATOM   2249 C  CE1   . PHE A 1  309 ? -8.762  -19.987 -15.503 1.00 11.91 ? 447  PHE A CE1   1 
ATOM   2250 C  CE2   . PHE A 1  309 ? -10.318 -18.334 -14.710 1.00 9.13  ? 447  PHE A CE2   1 
ATOM   2251 C  CZ    . PHE A 1  309 ? -9.971  -19.673 -14.904 1.00 13.66 ? 447  PHE A CZ    1 
ATOM   2252 N  N     A SER A 1  310 ? -9.544  -14.659 -17.309 0.60 8.94  ? 448  SER A N     1 
ATOM   2253 N  N     B SER A 1  310 ? -9.571  -14.657 -17.333 0.40 8.95  ? 448  SER A N     1 
ATOM   2254 C  CA    A SER A 1  310 ? -10.914 -14.197 -17.430 0.60 8.38  ? 448  SER A CA    1 
ATOM   2255 C  CA    B SER A 1  310 ? -10.977 -14.300 -17.457 0.40 8.41  ? 448  SER A CA    1 
ATOM   2256 C  C     A SER A 1  310 ? -11.362 -14.159 -18.890 0.60 9.78  ? 448  SER A C     1 
ATOM   2257 C  C     B SER A 1  310 ? -11.393 -14.170 -18.922 0.40 9.81  ? 448  SER A C     1 
ATOM   2258 O  O     A SER A 1  310 ? -12.375 -14.754 -19.253 0.60 10.99 ? 448  SER A O     1 
ATOM   2259 O  O     B SER A 1  310 ? -12.425 -14.707 -19.322 0.40 11.00 ? 448  SER A O     1 
ATOM   2260 C  CB    A SER A 1  310 ? -11.038 -12.806 -16.791 0.60 7.91  ? 448  SER A CB    1 
ATOM   2261 C  CB    B SER A 1  310 ? -11.285 -13.005 -16.699 0.40 8.22  ? 448  SER A CB    1 
ATOM   2262 O  OG    A SER A 1  310 ? -12.351 -12.309 -16.892 0.60 7.72  ? 448  SER A OG    1 
ATOM   2263 O  OG    B SER A 1  310 ? -10.839 -11.888 -17.429 0.40 10.27 ? 448  SER A OG    1 
ATOM   2264 N  N     . ARG A 1  311 ? -10.601 -13.466 -19.726 1.00 8.19  ? 449  ARG A N     1 
ATOM   2265 C  CA    . ARG A 1  311 ? -10.944 -13.322 -21.145 1.00 11.72 ? 449  ARG A CA    1 
ATOM   2266 C  C     . ARG A 1  311 ? -10.838 -14.640 -21.919 1.00 16.87 ? 449  ARG A C     1 
ATOM   2267 O  O     . ARG A 1  311 ? -11.789 -15.057 -22.564 1.00 13.25 ? 449  ARG A O     1 
ATOM   2268 C  CB    . ARG A 1  311 ? -10.117 -12.231 -21.840 1.00 15.05 ? 449  ARG A CB    1 
ATOM   2269 C  CG    . ARG A 1  311 ? -10.463 -12.072 -23.335 1.00 16.19 ? 449  ARG A CG    1 
ATOM   2270 C  CD    . ARG A 1  311 ? -9.633  -10.975 -24.003 1.00 16.64 ? 449  ARG A CD    1 
ATOM   2271 N  NE    . ARG A 1  311 ? -10.040 -9.665  -23.533 1.00 20.56 ? 449  ARG A NE    1 
ATOM   2272 C  CZ    . ARG A 1  311 ? -10.848 -8.857  -24.211 1.00 27.17 ? 449  ARG A CZ    1 
ATOM   2273 N  NH1   . ARG A 1  311 ? -11.319 -9.226  -25.393 1.00 31.27 ? 449  ARG A NH1   1 
ATOM   2274 N  NH2   . ARG A 1  311 ? -11.174 -7.674  -23.714 1.00 29.45 ? 449  ARG A NH2   1 
ATOM   2275 N  N     . LYS A 1  312 ? -9.703  -15.319 -21.821 1.00 11.49 ? 450  LYS A N     1 
ATOM   2276 C  CA    . LYS A 1  312 ? -9.475  -16.501 -22.647 1.00 12.80 ? 450  LYS A CA    1 
ATOM   2277 C  C     . LYS A 1  312 ? -10.199 -17.749 -22.175 1.00 16.66 ? 450  LYS A C     1 
ATOM   2278 O  O     . LYS A 1  312 ? -10.608 -18.563 -22.990 1.00 17.30 ? 450  LYS A O     1 
ATOM   2279 C  CB    . LYS A 1  312 ? -7.971  -16.796 -22.755 1.00 13.53 ? 450  LYS A CB    1 
ATOM   2280 C  CG    . LYS A 1  312 ? -7.170  -15.640 -23.309 1.00 17.42 ? 450  LYS A CG    1 
ATOM   2281 C  CD    . LYS A 1  312 ? -7.669  -15.173 -24.693 1.00 25.25 ? 450  LYS A CD    1 
ATOM   2282 C  CE    . LYS A 1  312 ? -6.865  -13.964 -25.176 1.00 28.98 ? 450  LYS A CE    1 
ATOM   2283 N  NZ    . LYS A 1  312 ? -7.382  -13.334 -26.436 1.00 19.28 ? 450  LYS A NZ    1 
ATOM   2284 N  N     . GLU A 1  313 ? -10.348 -17.924 -20.863 1.00 12.75 ? 451  GLU A N     1 
ATOM   2285 C  CA    . GLU A 1  313 ? -10.978 -19.136 -20.354 1.00 13.09 ? 451  GLU A CA    1 
ATOM   2286 C  C     . GLU A 1  313 ? -12.454 -18.948 -20.041 1.00 21.71 ? 451  GLU A C     1 
ATOM   2287 O  O     . GLU A 1  313 ? -13.218 -19.897 -20.138 1.00 13.17 ? 451  GLU A O     1 
ATOM   2288 C  CB    . GLU A 1  313 ? -10.252 -19.675 -19.123 1.00 10.41 ? 451  GLU A CB    1 
ATOM   2289 C  CG    . GLU A 1  313 ? -8.749  -19.858 -19.313 1.00 12.80 ? 451  GLU A CG    1 
ATOM   2290 C  CD    . GLU A 1  313 ? -8.431  -20.842 -20.428 1.00 22.51 ? 451  GLU A CD    1 
ATOM   2291 O  OE1   . GLU A 1  313 ? -7.403  -20.657 -21.113 1.00 17.87 ? 451  GLU A OE1   1 
ATOM   2292 O  OE2   . GLU A 1  313 ? -9.222  -21.790 -20.625 1.00 15.27 ? 451  GLU A OE2   1 
ATOM   2293 N  N     . LYS A 1  314 ? -12.865 -17.731 -19.686 1.00 15.01 ? 452  LYS A N     1 
ATOM   2294 C  CA    . LYS A 1  314 ? -14.218 -17.535 -19.174 1.00 12.31 ? 452  LYS A CA    1 
ATOM   2295 C  C     . LYS A 1  314 ? -15.017 -16.641 -20.088 1.00 13.60 ? 452  LYS A C     1 
ATOM   2296 O  O     . LYS A 1  314 ? -16.218 -16.481 -19.905 1.00 14.71 ? 452  LYS A O     1 
ATOM   2297 C  CB    . LYS A 1  314 ? -14.184 -16.941 -17.755 1.00 14.73 ? 452  LYS A CB    1 
ATOM   2298 C  CG    . LYS A 1  314 ? -13.521 -17.874 -16.738 1.00 14.46 ? 452  LYS A CG    1 
ATOM   2299 C  CD    . LYS A 1  314 ? -14.317 -19.178 -16.562 1.00 13.80 ? 452  LYS A CD    1 
ATOM   2300 C  CE    . LYS A 1  314 ? -13.485 -20.216 -15.860 1.00 22.02 ? 452  LYS A CE    1 
ATOM   2301 N  NZ    . LYS A 1  314 ? -14.267 -21.458 -15.534 1.00 24.85 ? 452  LYS A NZ    1 
ATOM   2302 N  N     . GLY A 1  315 ? -14.345 -16.056 -21.075 1.00 12.66 ? 453  GLY A N     1 
ATOM   2303 C  CA    . GLY A 1  315 ? -14.989 -15.109 -21.972 1.00 14.59 ? 453  GLY A CA    1 
ATOM   2304 C  C     . GLY A 1  315 ? -15.500 -13.839 -21.305 1.00 18.91 ? 453  GLY A C     1 
ATOM   2305 O  O     . GLY A 1  315 ? -16.410 -13.192 -21.820 1.00 14.08 ? 453  GLY A O     1 
ATOM   2306 N  N     . LEU A 1  316 ? -14.910 -13.474 -20.166 1.00 13.73 ? 454  LEU A N     1 
ATOM   2307 C  CA    . LEU A 1  316 ? -15.305 -12.271 -19.424 1.00 10.92 ? 454  LEU A CA    1 
ATOM   2308 C  C     . LEU A 1  316 ? -14.184 -11.231 -19.415 1.00 12.50 ? 454  LEU A C     1 
ATOM   2309 O  O     . LEU A 1  316 ? -13.001 -11.576 -19.362 1.00 11.36 ? 454  LEU A O     1 
ATOM   2310 C  CB    . LEU A 1  316 ? -15.649 -12.653 -17.985 1.00 11.02 ? 454  LEU A CB    1 
ATOM   2311 C  CG    . LEU A 1  316 ? -16.758 -13.697 -17.856 1.00 16.53 ? 454  LEU A CG    1 
ATOM   2312 C  CD1   . LEU A 1  316 ? -17.024 -14.036 -16.400 1.00 16.71 ? 454  LEU A CD1   1 
ATOM   2313 C  CD2   . LEU A 1  316 ? -18.025 -13.167 -18.507 1.00 17.28 ? 454  LEU A CD2   1 
ATOM   2314 N  N     . TRP A 1  317 ? -14.550 -9.954  -19.461 1.00 10.63 ? 455  TRP A N     1 
ATOM   2315 C  CA    . TRP A 1  317 ? -13.539 -8.905  -19.567 1.00 12.87 ? 455  TRP A CA    1 
ATOM   2316 C  C     . TRP A 1  317 ? -13.354 -8.218  -18.217 1.00 11.72 ? 455  TRP A C     1 
ATOM   2317 O  O     . TRP A 1  317 ? -14.275 -7.590  -17.705 1.00 10.41 ? 455  TRP A O     1 
ATOM   2318 C  CB    . TRP A 1  317 ? -13.919 -7.887  -20.649 1.00 17.18 ? 455  TRP A CB    1 
ATOM   2319 C  CG    . TRP A 1  317 ? -14.128 -8.505  -22.007 1.00 18.80 ? 455  TRP A CG    1 
ATOM   2320 C  CD1   . TRP A 1  317 ? -13.782 -9.771  -22.401 1.00 20.97 ? 455  TRP A CD1   1 
ATOM   2321 C  CD2   . TRP A 1  317 ? -14.733 -7.880  -23.147 1.00 22.04 ? 455  TRP A CD2   1 
ATOM   2322 N  NE1   . TRP A 1  317 ? -14.145 -9.974  -23.718 1.00 21.24 ? 455  TRP A NE1   1 
ATOM   2323 C  CE2   . TRP A 1  317 ? -14.729 -8.825  -24.196 1.00 21.23 ? 455  TRP A CE2   1 
ATOM   2324 C  CE3   . TRP A 1  317 ? -15.291 -6.613  -23.379 1.00 27.90 ? 455  TRP A CE3   1 
ATOM   2325 C  CZ2   . TRP A 1  317 ? -15.246 -8.539  -25.461 1.00 25.33 ? 455  TRP A CZ2   1 
ATOM   2326 C  CZ3   . TRP A 1  317 ? -15.807 -6.331  -24.641 1.00 28.73 ? 455  TRP A CZ3   1 
ATOM   2327 C  CH2   . TRP A 1  317 ? -15.780 -7.295  -25.662 1.00 21.56 ? 455  TRP A CH2   1 
ATOM   2328 N  N     . LEU A 1  318 ? -12.146 -8.325  -17.664 1.00 11.09 ? 456  LEU A N     1 
ATOM   2329 C  CA    . LEU A 1  318 ? -11.874 -7.854  -16.308 1.00 6.79  ? 456  LEU A CA    1 
ATOM   2330 C  C     . LEU A 1  318 ? -10.994 -6.614  -16.347 1.00 6.63  ? 456  LEU A C     1 
ATOM   2331 O  O     . LEU A 1  318 ? -10.014 -6.580  -17.077 1.00 7.98  ? 456  LEU A O     1 
ATOM   2332 C  CB    . LEU A 1  318 ? -11.121 -8.956  -15.539 1.00 8.17  ? 456  LEU A CB    1 
ATOM   2333 C  CG    . LEU A 1  318 ? -10.713 -8.607  -14.104 1.00 6.67  ? 456  LEU A CG    1 
ATOM   2334 C  CD1   . LEU A 1  318 ? -11.959 -8.341  -13.244 1.00 2.85  ? 456  LEU A CD1   1 
ATOM   2335 C  CD2   . LEU A 1  318 ? -9.891  -9.735  -13.495 1.00 6.71  ? 456  LEU A CD2   1 
ATOM   2336 N  N     . ASN A 1  319 ? -11.302 -5.620  -15.519 1.00 7.38  ? 457  ASN A N     1 
ATOM   2337 C  CA    . ASN A 1  319 ? -10.358 -4.554  -15.268 1.00 7.95  ? 457  ASN A CA    1 
ATOM   2338 C  C     . ASN A 1  319 ? -10.525 -4.041  -13.845 1.00 8.16  ? 457  ASN A C     1 
ATOM   2339 O  O     . ASN A 1  319 ? -11.205 -4.687  -13.037 1.00 8.56  ? 457  ASN A O     1 
ATOM   2340 C  CB    . ASN A 1  319 ? -10.472 -3.425  -16.318 1.00 8.63  ? 457  ASN A CB    1 
ATOM   2341 C  CG    . ASN A 1  319 ? -11.846 -2.742  -16.326 1.00 11.24 ? 457  ASN A CG    1 
ATOM   2342 O  OD1   . ASN A 1  319 ? -12.564 -2.739  -15.326 1.00 9.43  ? 457  ASN A OD1   1 
ATOM   2343 N  ND2   . ASN A 1  319 ? -12.216 -2.161  -17.476 1.00 14.16 ? 457  ASN A ND2   1 
ATOM   2344 N  N     . SER A 1  320 ? -9.889  -2.911  -13.517 1.00 6.34  ? 458  SER A N     1 
ATOM   2345 C  CA    . SER A 1  320 ? -9.973  -2.408  -12.134 1.00 7.90  ? 458  SER A CA    1 
ATOM   2346 C  C     . SER A 1  320 ? -11.294 -1.725  -11.821 1.00 8.71  ? 458  SER A C     1 
ATOM   2347 O  O     . SER A 1  320 ? -11.504 -1.232  -10.703 1.00 6.79  ? 458  SER A O     1 
ATOM   2348 C  CB    . SER A 1  320 ? -8.808  -1.466  -11.815 1.00 11.51 ? 458  SER A CB    1 
ATOM   2349 O  OG    . SER A 1  320 ? -8.947  -0.231  -12.495 1.00 11.68 ? 458  SER A OG    1 
ATOM   2350 N  N     . HIS A 1  321 ? -12.197 -1.702  -12.804 1.00 7.74  ? 459  HIS A N     1 
ATOM   2351 C  CA    . HIS A 1  321 ? -13.513 -1.085  -12.629 1.00 7.92  ? 459  HIS A CA    1 
ATOM   2352 C  C     . HIS A 1  321 ? -14.631 -2.111  -12.565 1.00 10.14 ? 459  HIS A C     1 
ATOM   2353 O  O     . HIS A 1  321 ? -15.716 -1.804  -12.097 1.00 12.30 ? 459  HIS A O     1 
ATOM   2354 C  CB    . HIS A 1  321 ? -13.853 -0.199  -13.824 1.00 11.28 ? 459  HIS A CB    1 
ATOM   2355 C  CG    . HIS A 1  321 ? -12.905 0.930   -14.030 1.00 16.16 ? 459  HIS A CG    1 
ATOM   2356 N  ND1   . HIS A 1  321 ? -12.385 1.665   -12.994 1.00 21.99 ? 459  HIS A ND1   1 
ATOM   2357 C  CD2   . HIS A 1  321 ? -12.387 1.461   -15.171 1.00 19.05 ? 459  HIS A CD2   1 
ATOM   2358 C  CE1   . HIS A 1  321 ? -11.582 2.601   -13.477 1.00 26.02 ? 459  HIS A CE1   1 
ATOM   2359 N  NE2   . HIS A 1  321 ? -11.572 2.494   -14.796 1.00 22.14 ? 459  HIS A NE2   1 
ATOM   2360 N  N     . GLY A 1  322 ? -14.404 -3.313  -13.085 1.00 8.36  ? 460  GLY A N     1 
ATOM   2361 C  CA    . GLY A 1  322 ? -15.514 -4.252  -13.162 1.00 6.95  ? 460  GLY A CA    1 
ATOM   2362 C  C     . GLY A 1  322 ? -15.213 -5.466  -14.006 1.00 9.58  ? 460  GLY A C     1 
ATOM   2363 O  O     . GLY A 1  322 ? -14.091 -5.634  -14.482 1.00 8.15  ? 460  GLY A O     1 
ATOM   2364 N  N     . LEU A 1  323 ? -16.221 -6.318  -14.183 1.00 9.30  ? 461  LEU A N     1 
ATOM   2365 C  CA    . LEU A 1  323 ? -16.053 -7.569  -14.903 1.00 8.18  ? 461  LEU A CA    1 
ATOM   2366 C  C     . LEU A 1  323 ? -17.254 -7.663  -15.822 1.00 12.51 ? 461  LEU A C     1 
ATOM   2367 O  O     . LEU A 1  323 ? -18.390 -7.742  -15.342 1.00 9.53  ? 461  LEU A O     1 
ATOM   2368 C  CB    . LEU A 1  323 ? -16.041 -8.753  -13.920 1.00 6.84  ? 461  LEU A CB    1 
ATOM   2369 C  CG    . LEU A 1  323 ? -15.970 -10.165 -14.516 1.00 11.78 ? 461  LEU A CG    1 
ATOM   2370 C  CD1   . LEU A 1  323 ? -14.662 -10.397 -15.326 1.00 12.10 ? 461  LEU A CD1   1 
ATOM   2371 C  CD2   . LEU A 1  323 ? -16.083 -11.193 -13.418 1.00 10.53 ? 461  LEU A CD2   1 
ATOM   2372 N  N     . PHE A 1  324 ? -16.996 -7.664  -17.129 1.00 10.77 ? 462  PHE A N     1 
ATOM   2373 C  CA    . PHE A 1  324 ? -18.050 -7.520  -18.132 1.00 11.46 ? 462  PHE A CA    1 
ATOM   2374 C  C     . PHE A 1  324 ? -18.291 -8.814  -18.917 1.00 14.00 ? 462  PHE A C     1 
ATOM   2375 O  O     . PHE A 1  324 ? -17.347 -9.448  -19.394 1.00 14.81 ? 462  PHE A O     1 
ATOM   2376 C  CB    . PHE A 1  324 ? -17.643 -6.396  -19.075 1.00 11.61 ? 462  PHE A CB    1 
ATOM   2377 C  CG    . PHE A 1  324 ? -18.665 -6.046  -20.118 1.00 20.40 ? 462  PHE A CG    1 
ATOM   2378 C  CD1   . PHE A 1  324 ? -19.838 -5.385  -19.770 1.00 18.21 ? 462  PHE A CD1   1 
ATOM   2379 C  CD2   . PHE A 1  324 ? -18.415 -6.313  -21.459 1.00 21.31 ? 462  PHE A CD2   1 
ATOM   2380 C  CE1   . PHE A 1  324 ? -20.771 -5.032  -20.734 1.00 18.62 ? 462  PHE A CE1   1 
ATOM   2381 C  CE2   . PHE A 1  324 ? -19.337 -5.941  -22.440 1.00 25.36 ? 462  PHE A CE2   1 
ATOM   2382 C  CZ    . PHE A 1  324 ? -20.513 -5.307  -22.067 1.00 20.31 ? 462  PHE A CZ    1 
ATOM   2383 N  N     . ASP A 1  325 ? -19.561 -9.198  -19.030 1.00 14.00 ? 463  ASP A N     1 
ATOM   2384 C  CA    . ASP A 1  325 ? -19.989 -10.290 -19.904 1.00 15.77 ? 463  ASP A CA    1 
ATOM   2385 C  C     . ASP A 1  325 ? -20.392 -9.666  -21.229 1.00 20.95 ? 463  ASP A C     1 
ATOM   2386 O  O     . ASP A 1  325 ? -21.423 -8.997  -21.321 1.00 21.39 ? 463  ASP A O     1 
ATOM   2387 C  CB    . ASP A 1  325 ? -21.168 -11.043 -19.276 1.00 19.58 ? 463  ASP A CB    1 
ATOM   2388 C  CG    . ASP A 1  325 ? -21.622 -12.247 -20.111 1.00 25.57 ? 463  ASP A CG    1 
ATOM   2389 O  OD1   . ASP A 1  325 ? -21.296 -12.324 -21.310 1.00 24.82 ? 463  ASP A OD1   1 
ATOM   2390 O  OD2   . ASP A 1  325 ? -22.295 -13.119 -19.545 1.00 24.30 ? 463  ASP A OD2   1 
ATOM   2391 N  N     . PRO A 1  326 ? -19.566 -9.864  -22.259 1.00 18.68 ? 464  PRO A N     1 
ATOM   2392 C  CA    . PRO A 1  326 ? -19.735 -9.194  -23.547 1.00 18.74 ? 464  PRO A CA    1 
ATOM   2393 C  C     . PRO A 1  326 ? -20.866 -9.798  -24.381 1.00 27.74 ? 464  PRO A C     1 
ATOM   2394 O  O     . PRO A 1  326 ? -21.212 -9.247  -25.414 1.00 29.82 ? 464  PRO A O     1 
ATOM   2395 C  CB    . PRO A 1  326 ? -18.387 -9.429  -24.230 1.00 25.38 ? 464  PRO A CB    1 
ATOM   2396 C  CG    . PRO A 1  326 ? -17.941 -10.753 -23.711 1.00 22.24 ? 464  PRO A CG    1 
ATOM   2397 C  CD    . PRO A 1  326 ? -18.446 -10.822 -22.272 1.00 22.44 ? 464  PRO A CD    1 
ATOM   2398 N  N     . GLU A 1  327 ? -21.438 -10.904 -23.923 1.00 28.31 ? 465  GLU A N     1 
ATOM   2399 C  CA    . GLU A 1  327 ? -22.560 -11.522 -24.625 1.00 35.52 ? 465  GLU A CA    1 
ATOM   2400 C  C     . GLU A 1  327 ? -23.909 -11.085 -24.055 1.00 39.97 ? 465  GLU A C     1 
ATOM   2401 O  O     . GLU A 1  327 ? -24.830 -10.771 -24.807 1.00 42.63 ? 465  GLU A O     1 
ATOM   2402 C  CB    . GLU A 1  327 ? -22.423 -13.036 -24.611 1.00 30.71 ? 465  GLU A CB    1 
ATOM   2403 C  CG    . GLU A 1  327 ? -21.224 -13.487 -25.420 1.00 46.56 ? 465  GLU A CG    1 
ATOM   2404 C  CD    . GLU A 1  327 ? -21.153 -14.981 -25.560 1.00 59.36 ? 465  GLU A CD    1 
ATOM   2405 O  OE1   . GLU A 1  327 ? -21.932 -15.672 -24.867 1.00 67.25 ? 465  GLU A OE1   1 
ATOM   2406 O  OE2   . GLU A 1  327 ? -20.319 -15.463 -26.357 1.00 69.43 ? 465  GLU A OE2   1 
ATOM   2407 N  N     . GLN A 1  328 ? -24.021 -11.061 -22.730 1.00 37.24 ? 466  GLN A N     1 
ATOM   2408 C  CA    . GLN A 1  328 ? -25.184 -10.468 -22.082 1.00 29.23 ? 466  GLN A CA    1 
ATOM   2409 C  C     . GLN A 1  328 ? -25.092 -8.948  -22.008 1.00 25.74 ? 466  GLN A C     1 
ATOM   2410 O  O     . GLN A 1  328 ? -26.069 -8.288  -21.668 1.00 31.91 ? 466  GLN A O     1 
ATOM   2411 C  CB    . GLN A 1  328 ? -25.382 -11.031 -20.678 1.00 31.46 ? 466  GLN A CB    1 
ATOM   2412 C  CG    . GLN A 1  328 ? -25.830 -12.480 -20.621 1.00 41.39 ? 466  GLN A CG    1 
ATOM   2413 C  CD    . GLN A 1  328 ? -26.246 -12.907 -19.212 1.00 47.58 ? 466  GLN A CD    1 
ATOM   2414 O  OE1   . GLN A 1  328 ? -26.169 -12.125 -18.254 1.00 46.30 ? 466  GLN A OE1   1 
ATOM   2415 N  NE2   . GLN A 1  328 ? -26.696 -14.152 -19.085 1.00 51.05 ? 466  GLN A NE2   1 
ATOM   2416 N  N     . LYS A 1  329 ? -23.929 -8.395  -22.339 1.00 22.55 ? 467  LYS A N     1 
ATOM   2417 C  CA    . LYS A 1  329 ? -23.670 -6.964  -22.165 1.00 24.55 ? 467  LYS A CA    1 
ATOM   2418 C  C     . LYS A 1  329 ? -24.018 -6.515  -20.740 1.00 27.36 ? 467  LYS A C     1 
ATOM   2419 O  O     . LYS A 1  329 ? -24.685 -5.505  -20.548 1.00 26.14 ? 467  LYS A O     1 
ATOM   2420 C  CB    . LYS A 1  329 ? -24.427 -6.119  -23.203 1.00 32.22 ? 467  LYS A CB    1 
ATOM   2421 C  CG    . LYS A 1  329 ? -24.010 -6.359  -24.656 1.00 32.83 ? 467  LYS A CG    1 
ATOM   2422 N  N     . THR A 1  330 ? -23.569 -7.279  -19.746 1.00 21.74 ? 468  THR A N     1 
ATOM   2423 C  CA    . THR A 1  330 ? -23.832 -6.961  -18.345 1.00 18.76 ? 468  THR A CA    1 
ATOM   2424 C  C     . THR A 1  330 ? -22.548 -6.975  -17.514 1.00 17.79 ? 468  THR A C     1 
ATOM   2425 O  O     . THR A 1  330 ? -21.624 -7.738  -17.802 1.00 17.63 ? 468  THR A O     1 
ATOM   2426 C  CB    . THR A 1  330 ? -24.792 -7.973  -17.708 1.00 21.13 ? 468  THR A CB    1 
ATOM   2427 O  OG1   . THR A 1  330 ? -24.272 -9.291  -17.879 1.00 25.99 ? 468  THR A OG1   1 
ATOM   2428 C  CG2   . THR A 1  330 ? -26.163 -7.915  -18.364 1.00 26.54 ? 468  THR A CG2   1 
ATOM   2429 N  N     . PHE A 1  331 ? -22.519 -6.138  -16.484 1.00 18.40 ? 469  PHE A N     1 
ATOM   2430 C  CA    . PHE A 1  331 ? -21.419 -6.092  -15.509 1.00 14.89 ? 469  PHE A CA    1 
ATOM   2431 C  C     . PHE A 1  331 ? -21.780 -6.911  -14.265 1.00 17.39 ? 469  PHE A C     1 
ATOM   2432 O  O     . PHE A 1  331 ? -22.909 -6.857  -13.776 1.00 18.13 ? 469  PHE A O     1 
ATOM   2433 C  CB    . PHE A 1  331 ? -21.146 -4.628  -15.107 1.00 13.93 ? 469  PHE A CB    1 
ATOM   2434 C  CG    . PHE A 1  331 ? -20.446 -3.820  -16.173 1.00 21.18 ? 469  PHE A CG    1 
ATOM   2435 C  CD1   . PHE A 1  331 ? -19.057 -3.871  -16.309 1.00 17.56 ? 469  PHE A CD1   1 
ATOM   2436 C  CD2   . PHE A 1  331 ? -21.172 -3.028  -17.052 1.00 20.32 ? 469  PHE A CD2   1 
ATOM   2437 C  CE1   . PHE A 1  331 ? -18.408 -3.129  -17.291 1.00 15.45 ? 469  PHE A CE1   1 
ATOM   2438 C  CE2   . PHE A 1  331 ? -20.530 -2.284  -18.036 1.00 21.64 ? 469  PHE A CE2   1 
ATOM   2439 C  CZ    . PHE A 1  331 ? -19.150 -2.338  -18.156 1.00 24.78 ? 469  PHE A CZ    1 
ATOM   2440 N  N     A PHE A 1  332 ? -20.820 -7.672  -13.759 0.50 12.68 ? 470  PHE A N     1 
ATOM   2441 N  N     B PHE A 1  332 ? -20.824 -7.677  -13.748 0.50 12.68 ? 470  PHE A N     1 
ATOM   2442 C  CA    A PHE A 1  332 ? -21.020 -8.411  -12.525 0.50 12.52 ? 470  PHE A CA    1 
ATOM   2443 C  CA    B PHE A 1  332 ? -21.037 -8.448  -12.525 0.50 12.52 ? 470  PHE A CA    1 
ATOM   2444 C  C     A PHE A 1  332 ? -20.956 -7.448  -11.342 0.50 15.47 ? 470  PHE A C     1 
ATOM   2445 C  C     B PHE A 1  332 ? -20.886 -7.564  -11.287 0.50 15.51 ? 470  PHE A C     1 
ATOM   2446 O  O     A PHE A 1  332 ? -20.095 -6.567  -11.293 0.50 17.49 ? 470  PHE A O     1 
ATOM   2447 O  O     B PHE A 1  332 ? -19.880 -6.869  -11.139 0.50 17.50 ? 470  PHE A O     1 
ATOM   2448 C  CB    A PHE A 1  332 ? -19.946 -9.501  -12.393 0.50 13.38 ? 470  PHE A CB    1 
ATOM   2449 C  CB    B PHE A 1  332 ? -20.032 -9.607  -12.461 0.50 13.42 ? 470  PHE A CB    1 
ATOM   2450 C  CG    A PHE A 1  332 ? -20.083 -10.613 -13.403 0.50 12.51 ? 470  PHE A CG    1 
ATOM   2451 C  CG    B PHE A 1  332 ? -20.005 -10.324 -11.138 0.50 14.49 ? 470  PHE A CG    1 
ATOM   2452 C  CD1   A PHE A 1  332 ? -20.574 -11.849 -13.025 0.50 14.01 ? 470  PHE A CD1   1 
ATOM   2453 C  CD1   B PHE A 1  332 ? -21.094 -11.062 -10.717 0.50 15.23 ? 470  PHE A CD1   1 
ATOM   2454 C  CD2   A PHE A 1  332 ? -19.740 -10.412 -14.735 0.50 12.16 ? 470  PHE A CD2   1 
ATOM   2455 C  CD2   B PHE A 1  332 ? -18.879 -10.270 -10.323 0.50 15.25 ? 470  PHE A CD2   1 
ATOM   2456 C  CE1   A PHE A 1  332 ? -20.708 -12.863 -13.948 0.50 15.59 ? 470  PHE A CE1   1 
ATOM   2457 C  CE1   B PHE A 1  332 ? -21.075 -11.728 -9.501  0.50 15.58 ? 470  PHE A CE1   1 
ATOM   2458 C  CE2   A PHE A 1  332 ? -19.870 -11.422 -15.658 0.50 14.04 ? 470  PHE A CE2   1 
ATOM   2459 C  CE2   B PHE A 1  332 ? -18.849 -10.926 -9.108  0.50 13.93 ? 470  PHE A CE2   1 
ATOM   2460 C  CZ    A PHE A 1  332 ? -20.360 -12.649 -15.268 0.50 14.66 ? 470  PHE A CZ    1 
ATOM   2461 C  CZ    B PHE A 1  332 ? -19.945 -11.663 -8.697  0.50 14.79 ? 470  PHE A CZ    1 
ATOM   2462 N  N     . GLN A 1  333 ? -21.864 -7.592  -10.389 1.00 11.38 ? 471  GLN A N     1 
ATOM   2463 C  CA    . GLN A 1  333 ? -21.763 -6.791  -9.180  1.00 19.26 ? 471  GLN A CA    1 
ATOM   2464 C  C     . GLN A 1  333 ? -20.888 -7.592  -8.235  1.00 18.01 ? 471  GLN A C     1 
ATOM   2465 O  O     . GLN A 1  333 ? -20.992 -8.812  -8.154  1.00 23.26 ? 471  GLN A O     1 
ATOM   2466 C  CB    . GLN A 1  333 ? -23.135 -6.512  -8.542  1.00 21.47 ? 471  GLN A CB    1 
ATOM   2467 C  CG    . GLN A 1  333 ? -24.082 -5.656  -9.381  1.00 24.22 ? 471  GLN A CG    1 
ATOM   2468 C  CD    . GLN A 1  333 ? -23.445 -4.363  -9.864  1.00 31.67 ? 471  GLN A CD    1 
ATOM   2469 N  N     . ALA A 1  334 ? -20.004 -6.938  -7.519  1.00 15.31 ? 472  ALA A N     1 
ATOM   2470 C  CA    . ALA A 1  334 ? -19.196 -7.701  -6.584  1.00 12.69 ? 472  ALA A CA    1 
ATOM   2471 C  C     . ALA A 1  334 ? -19.184 -6.909  -5.318  1.00 10.72 ? 472  ALA A C     1 
ATOM   2472 O  O     . ALA A 1  334 ? -19.080 -5.683  -5.355  1.00 10.38 ? 472  ALA A O     1 
ATOM   2473 C  CB    . ALA A 1  334 ? -17.771 -7.887  -7.135  1.00 9.15  ? 472  ALA A CB    1 
ATOM   2474 N  N     . ALA A 1  335 ? -19.313 -7.596  -4.191  1.00 11.07 ? 473  ALA A N     1 
ATOM   2475 C  CA    . ALA A 1  335 ? -19.248 -6.924  -2.901  1.00 10.77 ? 473  ALA A CA    1 
ATOM   2476 C  C     . ALA A 1  335 ? -17.911 -7.167  -2.219  1.00 9.56  ? 473  ALA A C     1 
ATOM   2477 O  O     . ALA A 1  335 ? -17.617 -6.570  -1.184  1.00 7.52  ? 473  ALA A O     1 
ATOM   2478 C  CB    . ALA A 1  335 ? -20.403 -7.383  -1.994  1.00 11.50 ? 473  ALA A CB    1 
ATOM   2479 N  N     . SER A 1  336 ? -17.102 -8.050  -2.806  1.00 9.22  ? 474  SER A N     1 
ATOM   2480 C  CA    . SER A 1  336 ? -15.828 -8.436  -2.207  1.00 7.07  ? 474  SER A CA    1 
ATOM   2481 C  C     . SER A 1  336 ? -14.914 -9.031  -3.274  1.00 6.35  ? 474  SER A C     1 
ATOM   2482 O  O     . SER A 1  336 ? -15.368 -9.419  -4.364  1.00 6.65  ? 474  SER A O     1 
ATOM   2483 C  CB    . SER A 1  336 ? -16.082 -9.503  -1.133  1.00 6.46  ? 474  SER A CB    1 
ATOM   2484 O  OG    . SER A 1  336 ? -16.700 -10.656 -1.713  1.00 9.23  ? 474  SER A OG    1 
ATOM   2485 N  N     . GLU A 1  337 ? -13.630 -9.143  -2.952  1.00 5.67  ? 475  GLU A N     1 
ATOM   2486 C  CA    . GLU A 1  337 ? -12.716 -9.867  -3.810  1.00 3.21  ? 475  GLU A CA    1 
ATOM   2487 C  C     . GLU A 1  337 ? -13.158 -11.327 -3.910  1.00 7.48  ? 475  GLU A C     1 
ATOM   2488 O  O     . GLU A 1  337 ? -13.045 -11.960 -4.972  1.00 5.59  ? 475  GLU A O     1 
ATOM   2489 C  CB    . GLU A 1  337 ? -11.303 -9.799  -3.239  1.00 6.60  ? 475  GLU A CB    1 
ATOM   2490 C  CG    . GLU A 1  337 ? -10.664 -8.394  -3.327  1.00 3.65  ? 475  GLU A CG    1 
ATOM   2491 C  CD    . GLU A 1  337 ? -9.241  -8.414  -2.839  1.00 6.30  ? 475  GLU A CD    1 
ATOM   2492 O  OE1   . GLU A 1  337 ? -8.995  -9.056  -1.799  1.00 5.31  ? 475  GLU A OE1   1 
ATOM   2493 O  OE2   . GLU A 1  337 ? -8.375  -7.808  -3.498  1.00 6.00  ? 475  GLU A OE2   1 
ATOM   2494 N  N     . GLU A 1  338 ? -13.640 -11.866 -2.794  1.00 4.90  ? 476  GLU A N     1 
ATOM   2495 C  CA    . GLU A 1  338 ? -14.154 -13.236 -2.814  1.00 5.69  ? 476  GLU A CA    1 
ATOM   2496 C  C     . GLU A 1  338 ? -15.196 -13.433 -3.912  1.00 7.62  ? 476  GLU A C     1 
ATOM   2497 O  O     . GLU A 1  338 ? -15.182 -14.464 -4.610  1.00 7.42  ? 476  GLU A O     1 
ATOM   2498 C  CB    . GLU A 1  338 ? -14.720 -13.663 -1.443  1.00 7.82  ? 476  GLU A CB    1 
ATOM   2499 C  CG    . GLU A 1  338 ? -13.657 -13.830 -0.363  1.00 7.98  ? 476  GLU A CG    1 
ATOM   2500 C  CD    . GLU A 1  338 ? -14.195 -14.538 0.885   1.00 11.60 ? 476  GLU A CD    1 
ATOM   2501 O  OE1   . GLU A 1  338 ? -14.144 -13.937 1.978   1.00 9.32  ? 476  GLU A OE1   1 
ATOM   2502 O  OE2   . GLU A 1  338 ? -14.662 -15.699 0.773   1.00 8.82  ? 476  GLU A OE2   1 
ATOM   2503 N  N     . ASP A 1  339 ? -16.112 -12.476 -4.052  1.00 7.25  ? 477  ASP A N     1 
ATOM   2504 C  CA    . ASP A 1  339 ? -17.119 -12.530 -5.136  1.00 7.69  ? 477  ASP A CA    1 
ATOM   2505 C  C     . ASP A 1  339 ? -16.462 -12.683 -6.501  1.00 7.88  ? 477  ASP A C     1 
ATOM   2506 O  O     . ASP A 1  339 ? -16.944 -13.427 -7.365  1.00 7.24  ? 477  ASP A O     1 
ATOM   2507 C  CB    . ASP A 1  339 ? -17.950 -11.245 -5.199  1.00 7.83  ? 477  ASP A CB    1 
ATOM   2508 C  CG    . ASP A 1  339 ? -19.288 -11.359 -4.486  1.00 10.93 ? 477  ASP A CG    1 
ATOM   2509 O  OD1   . ASP A 1  339 ? -19.936 -10.304 -4.346  1.00 11.66 ? 477  ASP A OD1   1 
ATOM   2510 O  OD2   . ASP A 1  339 ? -19.665 -12.474 -4.059  1.00 11.34 ? 477  ASP A OD2   1 
ATOM   2511 N  N     . ILE A 1  340 ? -15.371 -11.945 -6.712  1.00 5.79  ? 478  ILE A N     1 
ATOM   2512 C  CA    . ILE A 1  340 ? -14.758 -11.896 -8.025  1.00 6.15  ? 478  ILE A CA    1 
ATOM   2513 C  C     . ILE A 1  340 ? -14.105 -13.243 -8.359  1.00 7.44  ? 478  ILE A C     1 
ATOM   2514 O  O     . ILE A 1  340 ? -14.247 -13.748 -9.470  1.00 6.37  ? 478  ILE A O     1 
ATOM   2515 C  CB    . ILE A 1  340 ? -13.709 -10.758 -8.135  1.00 5.05  ? 478  ILE A CB    1 
ATOM   2516 C  CG1   . ILE A 1  340 ? -14.388 -9.384  -7.947  1.00 6.62  ? 478  ILE A CG1   1 
ATOM   2517 C  CG2   . ILE A 1  340 ? -13.033 -10.839 -9.499  1.00 4.26  ? 478  ILE A CG2   1 
ATOM   2518 C  CD1   . ILE A 1  340 ? -13.458 -8.202  -7.638  1.00 3.02  ? 478  ILE A CD1   1 
ATOM   2519 N  N     . PHE A 1  341 ? -13.373 -13.816 -7.401  1.00 7.55  ? 479  PHE A N     1 
ATOM   2520 C  CA    . PHE A 1  341 ? -12.776 -15.142 -7.615  1.00 5.03  ? 479  PHE A CA    1 
ATOM   2521 C  C     . PHE A 1  341 ? -13.889 -16.162 -7.910  1.00 8.87  ? 479  PHE A C     1 
ATOM   2522 O  O     . PHE A 1  341 ? -13.776 -16.986 -8.833  1.00 8.29  ? 479  PHE A O     1 
ATOM   2523 C  CB    . PHE A 1  341 ? -11.951 -15.567 -6.399  1.00 4.15  ? 479  PHE A CB    1 
ATOM   2524 C  CG    . PHE A 1  341 ? -10.546 -14.999 -6.384  1.00 7.53  ? 479  PHE A CG    1 
ATOM   2525 C  CD1   . PHE A 1  341 ? -10.277 -13.773 -5.801  1.00 6.42  ? 479  PHE A CD1   1 
ATOM   2526 C  CD2   . PHE A 1  341 ? -9.493  -15.719 -6.939  1.00 8.13  ? 479  PHE A CD2   1 
ATOM   2527 C  CE1   . PHE A 1  341 ? -8.944  -13.259 -5.772  1.00 6.11  ? 479  PHE A CE1   1 
ATOM   2528 C  CE2   . PHE A 1  341 ? -8.171  -15.215 -6.924  1.00 8.57  ? 479  PHE A CE2   1 
ATOM   2529 C  CZ    . PHE A 1  341 ? -7.907  -13.990 -6.339  1.00 4.88  ? 479  PHE A CZ    1 
ATOM   2530 N  N     . ARG A 1  342 ? -14.984 -16.097 -7.153  1.00 9.13  ? 480  ARG A N     1 
ATOM   2531 C  CA    . ARG A 1  342 ? -16.106 -17.009 -7.428  1.00 10.84 ? 480  ARG A CA    1 
ATOM   2532 C  C     . ARG A 1  342 ? -16.716 -16.815 -8.841  1.00 10.85 ? 480  ARG A C     1 
ATOM   2533 O  O     . ARG A 1  342 ? -17.007 -17.788 -9.513  1.00 10.66 ? 480  ARG A O     1 
ATOM   2534 C  CB    . ARG A 1  342 ? -17.194 -16.911 -6.353  1.00 9.43  ? 480  ARG A CB    1 
ATOM   2535 C  CG    . ARG A 1  342 ? -16.786 -17.438 -5.004  1.00 11.55 ? 480  ARG A CG    1 
ATOM   2536 C  CD    . ARG A 1  342 ? -17.980 -17.457 -4.027  1.00 13.32 ? 480  ARG A CD    1 
ATOM   2537 N  NE    . ARG A 1  342 ? -18.408 -16.114 -3.621  1.00 9.53  ? 480  ARG A NE    1 
ATOM   2538 C  CZ    . ARG A 1  342 ? -18.107 -15.543 -2.458  1.00 7.29  ? 480  ARG A CZ    1 
ATOM   2539 N  NH1   . ARG A 1  342 ? -17.366 -16.197 -1.558  1.00 6.81  ? 480  ARG A NH1   1 
ATOM   2540 N  NH2   . ARG A 1  342 ? -18.547 -14.315 -2.191  1.00 11.79 ? 480  ARG A NH2   1 
ATOM   2541 N  N     A HIS A 1  343 ? -16.916 -15.560 -9.251  0.50 11.49 ? 481  HIS A N     1 
ATOM   2542 N  N     B HIS A 1  343 ? -16.885 -15.579 -9.290  0.50 11.49 ? 481  HIS A N     1 
ATOM   2543 C  CA    A HIS A 1  343 ? -17.429 -15.240 -10.585 0.50 12.03 ? 481  HIS A CA    1 
ATOM   2544 C  CA    B HIS A 1  343 ? -17.486 -15.375 -10.601 0.50 12.09 ? 481  HIS A CA    1 
ATOM   2545 C  C     A HIS A 1  343 ? -16.581 -15.950 -11.637 0.50 12.44 ? 481  HIS A C     1 
ATOM   2546 C  C     B HIS A 1  343 ? -16.565 -15.846 -11.724 0.50 12.44 ? 481  HIS A C     1 
ATOM   2547 O  O     A HIS A 1  343 ? -17.095 -16.535 -12.590 0.50 11.12 ? 481  HIS A O     1 
ATOM   2548 O  O     B HIS A 1  343 ? -17.020 -16.149 -12.830 0.50 10.91 ? 481  HIS A O     1 
ATOM   2549 C  CB    A HIS A 1  343 ? -17.365 -13.729 -10.853 0.50 13.18 ? 481  HIS A CB    1 
ATOM   2550 C  CB    B HIS A 1  343 ? -17.861 -13.919 -10.814 0.50 13.08 ? 481  HIS A CB    1 
ATOM   2551 C  CG    A HIS A 1  343 ? -18.413 -12.926 -10.142 0.50 12.98 ? 481  HIS A CG    1 
ATOM   2552 C  CG    B HIS A 1  343 ? -18.915 -13.724 -11.855 0.50 14.03 ? 481  HIS A CG    1 
ATOM   2553 N  ND1   A HIS A 1  343 ? -19.650 -13.429 -9.811  0.50 13.03 ? 481  HIS A ND1   1 
ATOM   2554 N  ND1   B HIS A 1  343 ? -20.224 -14.108 -11.666 0.50 15.62 ? 481  HIS A ND1   1 
ATOM   2555 C  CD2   A HIS A 1  343 ? -18.408 -11.637 -9.712  0.50 13.85 ? 481  HIS A CD2   1 
ATOM   2556 C  CD2   B HIS A 1  343 ? -18.853 -13.203 -13.103 0.50 14.14 ? 481  HIS A CD2   1 
ATOM   2557 C  CE1   A HIS A 1  343 ? -20.360 -12.498 -9.199  0.50 14.30 ? 481  HIS A CE1   1 
ATOM   2558 C  CE1   B HIS A 1  343 ? -20.927 -13.816 -12.745 0.50 15.25 ? 481  HIS A CE1   1 
ATOM   2559 N  NE2   A HIS A 1  343 ? -19.623 -11.400 -9.127  0.50 14.95 ? 481  HIS A NE2   1 
ATOM   2560 N  NE2   B HIS A 1  343 ? -20.117 -13.265 -13.631 0.50 14.78 ? 481  HIS A NE2   1 
ATOM   2561 N  N     . LEU A 1  344 ? -15.270 -15.900 -11.438 1.00 10.37 ? 482  LEU A N     1 
ATOM   2562 C  CA    . LEU A 1  344 ? -14.311 -16.452 -12.394 1.00 9.17  ? 482  LEU A CA    1 
ATOM   2563 C  C     . LEU A 1  344 ? -14.070 -17.946 -12.233 1.00 11.18 ? 482  LEU A C     1 
ATOM   2564 O  O     . LEU A 1  344 ? -13.265 -18.513 -12.965 1.00 14.35 ? 482  LEU A O     1 
ATOM   2565 C  CB    . LEU A 1  344 ? -12.975 -15.709 -12.295 1.00 8.76  ? 482  LEU A CB    1 
ATOM   2566 C  CG    . LEU A 1  344 ? -13.057 -14.215 -12.652 1.00 8.50  ? 482  LEU A CG    1 
ATOM   2567 C  CD1   . LEU A 1  344 ? -11.688 -13.585 -12.455 1.00 7.49  ? 482  LEU A CD1   1 
ATOM   2568 C  CD2   . LEU A 1  344 ? -13.513 -14.051 -14.082 1.00 9.47  ? 482  LEU A CD2   1 
ATOM   2569 N  N     . GLY A 1  345 ? -14.748 -18.593 -11.282 1.00 13.11 ? 483  GLY A N     1 
ATOM   2570 C  CA    . GLY A 1  345 ? -14.545 -20.029 -11.059 1.00 11.70 ? 483  GLY A CA    1 
ATOM   2571 C  C     . GLY A 1  345 ? -13.155 -20.383 -10.546 1.00 15.48 ? 483  GLY A C     1 
ATOM   2572 O  O     . GLY A 1  345 ? -12.640 -21.469 -10.814 1.00 9.52  ? 483  GLY A O     1 
ATOM   2573 N  N     . LEU A 1  346 ? -12.543 -19.471 -9.788  1.00 8.57  ? 484  LEU A N     1 
ATOM   2574 C  CA    . LEU A 1  346 ? -11.206 -19.701 -9.221  1.00 9.07  ? 484  LEU A CA    1 
ATOM   2575 C  C     . LEU A 1  346 ? -11.249 -19.854 -7.700  1.00 11.69 ? 484  LEU A C     1 
ATOM   2576 O  O     . LEU A 1  346 ? -12.011 -19.160 -7.026  1.00 13.28 ? 484  LEU A O     1 
ATOM   2577 C  CB    . LEU A 1  346 ? -10.294 -18.508 -9.539  1.00 5.53  ? 484  LEU A CB    1 
ATOM   2578 C  CG    . LEU A 1  346 ? -9.862  -18.307 -10.982 1.00 9.92  ? 484  LEU A CG    1 
ATOM   2579 C  CD1   . LEU A 1  346 ? -9.297  -16.883 -11.111 1.00 8.49  ? 484  LEU A CD1   1 
ATOM   2580 C  CD2   . LEU A 1  346 ? -8.804  -19.358 -11.369 1.00 8.05  ? 484  LEU A CD2   1 
ATOM   2581 N  N     . GLU A 1  347 ? -10.423 -20.735 -7.142  1.00 11.11 ? 485  GLU A N     1 
ATOM   2582 C  CA    . GLU A 1  347 ? -10.300 -20.773 -5.680  1.00 11.37 ? 485  GLU A CA    1 
ATOM   2583 C  C     . GLU A 1  347 ? -9.791  -19.418 -5.179  1.00 10.60 ? 485  GLU A C     1 
ATOM   2584 O  O     . GLU A 1  347 ? -8.894  -18.831 -5.775  1.00 9.24  ? 485  GLU A O     1 
ATOM   2585 C  CB    . GLU A 1  347 ? -9.320  -21.864 -5.230  1.00 10.49 ? 485  GLU A CB    1 
ATOM   2586 C  CG    . GLU A 1  347 ? -9.773  -23.255 -5.496  1.00 24.88 ? 485  GLU A CG    1 
ATOM   2587 C  CD    . GLU A 1  347 ? -8.787  -24.256 -4.919  1.00 44.15 ? 485  GLU A CD    1 
ATOM   2588 O  OE1   . GLU A 1  347 ? -8.265  -23.987 -3.810  1.00 42.24 ? 485  GLU A OE1   1 
ATOM   2589 O  OE2   . GLU A 1  347 ? -8.518  -25.284 -5.581  1.00 47.19 ? 485  GLU A OE2   1 
ATOM   2590 N  N     . TYR A 1  348 ? -10.335 -18.945 -4.064  1.00 9.81  ? 486  TYR A N     1 
ATOM   2591 C  CA    . TYR A 1  348 ? -9.915  -17.658 -3.511  1.00 7.61  ? 486  TYR A CA    1 
ATOM   2592 C  C     . TYR A 1  348 ? -8.439  -17.690 -3.083  1.00 13.70 ? 486  TYR A C     1 
ATOM   2593 O  O     . TYR A 1  348 ? -7.973  -18.668 -2.491  1.00 7.93  ? 486  TYR A O     1 
ATOM   2594 C  CB    . TYR A 1  348 ? -10.789 -17.276 -2.316  1.00 9.41  ? 486  TYR A CB    1 
ATOM   2595 C  CG    . TYR A 1  348 ? -10.312 -15.993 -1.656  1.00 11.94 ? 486  TYR A CG    1 
ATOM   2596 C  CD1   . TYR A 1  348 ? -10.505 -14.761 -2.282  1.00 9.89  ? 486  TYR A CD1   1 
ATOM   2597 C  CD2   . TYR A 1  348 ? -9.663  -16.015 -0.429  1.00 11.46 ? 486  TYR A CD2   1 
ATOM   2598 C  CE1   . TYR A 1  348 ? -10.056 -13.599 -1.713  1.00 11.06 ? 486  TYR A CE1   1 
ATOM   2599 C  CE2   . TYR A 1  348 ? -9.204  -14.843 0.152   1.00 13.83 ? 486  TYR A CE2   1 
ATOM   2600 C  CZ    . TYR A 1  348 ? -9.417  -13.640 -0.492  1.00 13.85 ? 486  TYR A CZ    1 
ATOM   2601 O  OH    . TYR A 1  348 ? -8.954  -12.470 0.070   1.00 16.00 ? 486  TYR A OH    1 
ATOM   2602 N  N     . LEU A 1  349 ? -7.700  -16.622 -3.388  1.00 6.55  ? 487  LEU A N     1 
ATOM   2603 C  CA    . LEU A 1  349 ? -6.341  -16.486 -2.889  1.00 8.10  ? 487  LEU A CA    1 
ATOM   2604 C  C     . LEU A 1  349 ? -6.268  -15.188 -2.108  1.00 8.62  ? 487  LEU A C     1 
ATOM   2605 O  O     . LEU A 1  349 ? -6.611  -14.144 -2.640  1.00 7.95  ? 487  LEU A O     1 
ATOM   2606 C  CB    . LEU A 1  349 ? -5.368  -16.415 -4.057  1.00 6.34  ? 487  LEU A CB    1 
ATOM   2607 C  CG    . LEU A 1  349 ? -5.212  -17.710 -4.856  1.00 8.05  ? 487  LEU A CG    1 
ATOM   2608 C  CD1   . LEU A 1  349 ? -4.465  -17.463 -6.138  1.00 9.77  ? 487  LEU A CD1   1 
ATOM   2609 C  CD2   . LEU A 1  349 ? -4.473  -18.796 -4.009  1.00 11.56 ? 487  LEU A CD2   1 
ATOM   2610 N  N     . PRO A 1  350 ? -5.832  -15.254 -0.846  1.00 8.24  ? 488  PRO A N     1 
ATOM   2611 C  CA    . PRO A 1  350 ? -5.634  -14.009 -0.107  1.00 7.93  ? 488  PRO A CA    1 
ATOM   2612 C  C     . PRO A 1  350 ? -4.462  -13.242 -0.737  1.00 5.68  ? 488  PRO A C     1 
ATOM   2613 O  O     . PRO A 1  350 ? -3.683  -13.830 -1.482  1.00 5.06  ? 488  PRO A O     1 
ATOM   2614 C  CB    . PRO A 1  350 ? -5.276  -14.505 1.309   1.00 7.81  ? 488  PRO A CB    1 
ATOM   2615 C  CG    . PRO A 1  350 ? -4.566  -15.798 1.062   1.00 10.40 ? 488  PRO A CG    1 
ATOM   2616 C  CD    . PRO A 1  350 ? -5.413  -16.434 -0.061  1.00 7.85  ? 488  PRO A CD    1 
ATOM   2617 N  N     . PRO A 1  351 ? -4.341  -11.937 -0.440  1.00 3.78  ? 489  PRO A N     1 
ATOM   2618 C  CA    . PRO A 1  351 ? -3.300  -11.093 -1.046  1.00 5.03  ? 489  PRO A CA    1 
ATOM   2619 C  C     . PRO A 1  351 ? -1.899  -11.659 -0.896  1.00 4.06  ? 489  PRO A C     1 
ATOM   2620 O  O     . PRO A 1  351 ? -1.104  -11.552 -1.825  1.00 5.56  ? 489  PRO A O     1 
ATOM   2621 C  CB    . PRO A 1  351 ? -3.414  -9.781  -0.236  1.00 3.61  ? 489  PRO A CB    1 
ATOM   2622 C  CG    . PRO A 1  351 ? -4.881  -9.692  0.070   1.00 5.32  ? 489  PRO A CG    1 
ATOM   2623 C  CD    . PRO A 1  351 ? -5.287  -11.148 0.371   1.00 6.26  ? 489  PRO A CD    1 
ATOM   2624 N  N     . GLU A 1  352 ? -1.615  -12.264 0.251   1.00 3.84  ? 490  GLU A N     1 
ATOM   2625 C  CA    A GLU A 1  352 ? -0.282  -12.814 0.487   0.30 6.96  ? 490  GLU A CA    1 
ATOM   2626 C  CA    B GLU A 1  352 ? -0.318  -12.881 0.543   0.70 7.00  ? 490  GLU A CA    1 
ATOM   2627 C  C     . GLU A 1  352 ? 0.056   -14.031 -0.392  1.00 6.14  ? 490  GLU A C     1 
ATOM   2628 O  O     . GLU A 1  352 ? 1.220   -14.407 -0.495  1.00 6.04  ? 490  GLU A O     1 
ATOM   2629 C  CB    A GLU A 1  352 ? -0.054  -13.120 1.979   0.30 8.59  ? 490  GLU A CB    1 
ATOM   2630 C  CB    B GLU A 1  352 ? -0.305  -13.394 1.999   0.70 8.53  ? 490  GLU A CB    1 
ATOM   2631 C  CG    A GLU A 1  352 ? -0.805  -14.324 2.503   0.30 7.52  ? 490  GLU A CG    1 
ATOM   2632 C  CG    B GLU A 1  352 ? -0.431  -12.300 3.040   0.70 8.62  ? 490  GLU A CG    1 
ATOM   2633 C  CD    A GLU A 1  352 ? -2.157  -13.986 3.096   0.30 7.09  ? 490  GLU A CD    1 
ATOM   2634 C  CD    B GLU A 1  352 ? -1.881  -11.886 3.340   0.70 14.80 ? 490  GLU A CD    1 
ATOM   2635 O  OE1   A GLU A 1  352 ? -2.666  -12.874 2.841   0.30 7.91  ? 490  GLU A OE1   1 
ATOM   2636 O  OE1   B GLU A 1  352 ? -2.830  -12.417 2.707   0.70 7.09  ? 490  GLU A OE1   1 
ATOM   2637 O  OE2   A GLU A 1  352 ? -2.721  -14.840 3.811   0.30 3.49  ? 490  GLU A OE2   1 
ATOM   2638 O  OE2   B GLU A 1  352 ? -2.064  -11.017 4.225   0.70 17.42 ? 490  GLU A OE2   1 
ATOM   2639 N  N     . GLN A 1  353 ? -0.940  -14.610 -1.060  1.00 5.44  ? 491  GLN A N     1 
ATOM   2640 C  CA    . GLN A 1  353 ? -0.694  -15.691 -2.030  1.00 4.75  ? 491  GLN A CA    1 
ATOM   2641 C  C     . GLN A 1  353 ? -0.854  -15.248 -3.477  1.00 6.00  ? 491  GLN A C     1 
ATOM   2642 O  O     . GLN A 1  353 ? -0.984  -16.082 -4.371  1.00 6.15  ? 491  GLN A O     1 
ATOM   2643 C  CB    . GLN A 1  353 ? -1.634  -16.883 -1.757  1.00 7.22  ? 491  GLN A CB    1 
ATOM   2644 C  CG    . GLN A 1  353 ? -1.482  -17.443 -0.355  1.00 7.01  ? 491  GLN A CG    1 
ATOM   2645 C  CD    . GLN A 1  353 ? -0.095  -17.994 -0.095  1.00 13.39 ? 491  GLN A CD    1 
ATOM   2646 O  OE1   . GLN A 1  353 ? 0.614   -18.392 -1.024  1.00 8.56  ? 491  GLN A OE1   1 
ATOM   2647 N  NE2   . GLN A 1  353 ? 0.305   -18.017 1.176   1.00 12.70 ? 491  GLN A NE2   1 
ATOM   2648 N  N     . ARG A 1  354 ? -0.813  -13.930 -3.701  1.00 5.80  ? 492  ARG A N     1 
ATOM   2649 C  CA    . ARG A 1  354 ? -0.882  -13.367 -5.041  1.00 3.75  ? 492  ARG A CA    1 
ATOM   2650 C  C     . ARG A 1  354 ? 0.466   -12.814 -5.465  1.00 5.15  ? 492  ARG A C     1 
ATOM   2651 O  O     . ARG A 1  354 ? 0.541   -11.954 -6.336  1.00 6.87  ? 492  ARG A O     1 
ATOM   2652 C  CB    . ARG A 1  354 ? -1.937  -12.255 -5.127  1.00 4.29  ? 492  ARG A CB    1 
ATOM   2653 C  CG    . ARG A 1  354 ? -3.331  -12.720 -4.735  1.00 4.46  ? 492  ARG A CG    1 
ATOM   2654 C  CD    . ARG A 1  354 ? -4.352  -11.583 -4.796  1.00 4.00  ? 492  ARG A CD    1 
ATOM   2655 N  NE    . ARG A 1  354 ? -5.525  -11.881 -3.961  1.00 4.22  ? 492  ARG A NE    1 
ATOM   2656 C  CZ    . ARG A 1  354 ? -6.364  -10.967 -3.488  1.00 6.07  ? 492  ARG A CZ    1 
ATOM   2657 N  NH1   . ARG A 1  354 ? -6.206  -9.671  -3.798  1.00 3.90  ? 492  ARG A NH1   1 
ATOM   2658 N  NH2   . ARG A 1  354 ? -7.376  -11.347 -2.699  1.00 6.23  ? 492  ARG A NH2   1 
ATOM   2659 N  N     . ASN A 1  355 ? 1.533   -13.319 -4.857  1.00 5.65  ? 493  ASN A N     1 
ATOM   2660 C  CA    . ASN A 1  355 ? 2.864   -12.802 -5.171  1.00 6.94  ? 493  ASN A CA    1 
ATOM   2661 C  C     . ASN A 1  355 ? 3.497   -13.466 -6.392  1.00 8.45  ? 493  ASN A C     1 
ATOM   2662 O  O     . ASN A 1  355 ? 4.667   -13.910 -6.351  1.00 7.41  ? 493  ASN A O     1 
ATOM   2663 C  CB    . ASN A 1  355 ? 3.790   -12.906 -3.947  1.00 4.62  ? 493  ASN A CB    1 
ATOM   2664 C  CG    . ASN A 1  355 ? 3.430   -11.905 -2.882  1.00 8.02  ? 493  ASN A CG    1 
ATOM   2665 O  OD1   . ASN A 1  355 ? 3.676   -10.706 -3.042  1.00 6.66  ? 493  ASN A OD1   1 
ATOM   2666 N  ND2   . ASN A 1  355 ? 2.837   -12.387 -1.774  1.00 7.74  ? 493  ASN A ND2   1 
ATOM   2667 N  N     . ALA A 1  356 ? 2.733   -13.522 -7.479  1.00 5.02  ? 494  ALA A N     1 
ATOM   2668 C  CA    . ALA A 1  356 ? 3.209   -14.169 -8.693  1.00 7.56  ? 494  ALA A CA    1 
ATOM   2669 C  C     . ALA A 1  356 ? 4.358   -13.401 -9.302  1.00 9.59  ? 494  ALA A C     1 
ATOM   2670 O  O     . ALA A 1  356 ? 4.343   -12.158 -9.295  1.00 9.09  ? 494  ALA A O     1 
ATOM   2671 C  CB    . ALA A 1  356 ? 2.082   -14.303 -9.700  1.00 5.70  ? 494  ALA A CB    1 
ATOM   2672 O  OXT   . ALA A 1  356 ? 5.299   -14.002 -9.821  1.00 9.23  ? 494  ALA A OXT   1 
ATOM   2673 O  "O5'" . DC  B 2  1   ? 3.103   -18.329 -38.382 1.00 23.07 ? 1    DC  T "O5'" 1 
ATOM   2674 C  "C5'" . DC  B 2  1   ? 1.989   -18.578 -39.242 1.00 25.99 ? 1    DC  T "C5'" 1 
ATOM   2675 C  "C4'" . DC  B 2  1   ? 0.739   -18.714 -38.404 1.00 27.90 ? 1    DC  T "C4'" 1 
ATOM   2676 O  "O4'" . DC  B 2  1   ? 0.870   -19.878 -37.559 1.00 27.54 ? 1    DC  T "O4'" 1 
ATOM   2677 C  "C3'" . DC  B 2  1   ? 0.591   -17.547 -37.442 1.00 26.91 ? 1    DC  T "C3'" 1 
ATOM   2678 O  "O3'" . DC  B 2  1   ? -0.338  -16.653 -37.966 1.00 25.47 ? 1    DC  T "O3'" 1 
ATOM   2679 C  "C2'" . DC  B 2  1   ? 0.098   -18.114 -36.120 1.00 25.72 ? 1    DC  T "C2'" 1 
ATOM   2680 C  "C1'" . DC  B 2  1   ? 0.347   -19.605 -36.265 1.00 26.73 ? 1    DC  T "C1'" 1 
ATOM   2681 N  N1    . DC  B 2  1   ? 1.243   -20.304 -35.289 1.00 20.31 ? 1    DC  T N1    1 
ATOM   2682 C  C2    . DC  B 2  1   ? 0.649   -20.765 -34.122 1.00 19.67 ? 1    DC  T C2    1 
ATOM   2683 O  O2    . DC  B 2  1   ? -0.558  -20.524 -33.969 1.00 20.95 ? 1    DC  T O2    1 
ATOM   2684 N  N3    . DC  B 2  1   ? 1.391   -21.453 -33.238 1.00 15.43 ? 1    DC  T N3    1 
ATOM   2685 C  C4    . DC  B 2  1   ? 2.670   -21.678 -33.484 1.00 13.43 ? 1    DC  T C4    1 
ATOM   2686 N  N4    . DC  B 2  1   ? 3.354   -22.374 -32.567 1.00 13.72 ? 1    DC  T N4    1 
ATOM   2687 C  C5    . DC  B 2  1   ? 3.312   -21.199 -34.668 1.00 16.88 ? 1    DC  T C5    1 
ATOM   2688 C  C6    . DC  B 2  1   ? 2.556   -20.531 -35.546 1.00 18.36 ? 1    DC  T C6    1 
ATOM   2689 P  P     . DG  B 2  2   ? -0.336  -15.152 -37.422 1.00 26.74 ? 2    DG  T P     1 
ATOM   2690 O  OP1   . DG  B 2  2   ? -0.941  -14.294 -38.465 1.00 36.14 ? 2    DG  T OP1   1 
ATOM   2691 O  OP2   . DG  B 2  2   ? 1.011   -14.838 -36.885 1.00 22.17 ? 2    DG  T OP2   1 
ATOM   2692 O  "O5'" . DG  B 2  2   ? -1.317  -15.227 -36.184 1.00 21.39 ? 2    DG  T "O5'" 1 
ATOM   2693 C  "C5'" . DG  B 2  2   ? -2.603  -15.807 -36.272 1.00 24.22 ? 2    DG  T "C5'" 1 
ATOM   2694 C  "C4'" . DG  B 2  2   ? -3.227  -15.691 -34.903 1.00 20.23 ? 2    DG  T "C4'" 1 
ATOM   2695 O  "O4'" . DG  B 2  2   ? -2.512  -16.534 -33.963 1.00 19.82 ? 2    DG  T "O4'" 1 
ATOM   2696 C  "C3'" . DG  B 2  2   ? -3.182  -14.289 -34.295 1.00 16.39 ? 2    DG  T "C3'" 1 
ATOM   2697 O  "O3'" . DG  B 2  2   ? -4.389  -14.181 -33.539 1.00 17.88 ? 2    DG  T "O3'" 1 
ATOM   2698 C  "C2'" . DG  B 2  2   ? -1.923  -14.307 -33.422 1.00 14.58 ? 2    DG  T "C2'" 1 
ATOM   2699 C  "C1'" . DG  B 2  2   ? -1.914  -15.751 -32.931 1.00 15.65 ? 2    DG  T "C1'" 1 
ATOM   2700 N  N9    . DG  B 2  2   ? -0.607  -16.372 -32.713 1.00 16.98 ? 2    DG  T N9    1 
ATOM   2701 C  C8    . DG  B 2  2   ? 0.520   -16.216 -33.464 1.00 17.05 ? 2    DG  T C8    1 
ATOM   2702 N  N7    . DG  B 2  2   ? 1.526   -16.939 -33.056 1.00 18.01 ? 2    DG  T N7    1 
ATOM   2703 C  C5    . DG  B 2  2   ? 1.042   -17.620 -31.951 1.00 18.71 ? 2    DG  T C5    1 
ATOM   2704 C  C6    . DG  B 2  2   ? 1.684   -18.558 -31.094 1.00 16.91 ? 2    DG  T C6    1 
ATOM   2705 O  O6    . DG  B 2  2   ? 2.853   -18.962 -31.159 1.00 16.60 ? 2    DG  T O6    1 
ATOM   2706 N  N1    . DG  B 2  2   ? 0.827   -19.025 -30.095 1.00 12.12 ? 2    DG  T N1    1 
ATOM   2707 C  C2    . DG  B 2  2   ? -0.482  -18.614 -29.956 1.00 15.10 ? 2    DG  T C2    1 
ATOM   2708 N  N2    . DG  B 2  2   ? -1.194  -19.128 -28.943 1.00 12.87 ? 2    DG  T N2    1 
ATOM   2709 N  N3    . DG  B 2  2   ? -1.082  -17.744 -30.755 1.00 17.53 ? 2    DG  T N3    1 
ATOM   2710 C  C4    . DG  B 2  2   ? -0.271  -17.288 -31.729 1.00 16.28 ? 2    DG  T C4    1 
ATOM   2711 P  P     . DG  B 2  3   ? -4.760  -12.805 -32.781 1.00 26.41 ? 3    DG  T P     1 
ATOM   2712 O  OP1   . DG  B 2  3   ? -6.228  -12.866 -32.677 1.00 20.74 ? 3    DG  T OP1   1 
ATOM   2713 O  OP2   . DG  B 2  3   ? -4.014  -11.683 -33.372 1.00 18.77 ? 3    DG  T OP2   1 
ATOM   2714 O  "O5'" . DG  B 2  3   ? -4.131  -12.996 -31.311 1.00 19.12 ? 3    DG  T "O5'" 1 
ATOM   2715 C  "C5'" . DG  B 2  3   ? -4.672  -14.014 -30.496 1.00 16.77 ? 3    DG  T "C5'" 1 
ATOM   2716 C  "C4'" . DG  B 2  3   ? -3.855  -14.025 -29.231 1.00 19.58 ? 3    DG  T "C4'" 1 
ATOM   2717 O  "O4'" . DG  B 2  3   ? -2.592  -14.665 -29.499 1.00 17.81 ? 3    DG  T "O4'" 1 
ATOM   2718 C  "C3'" . DG  B 2  3   ? -3.514  -12.624 -28.714 1.00 15.69 ? 3    DG  T "C3'" 1 
ATOM   2719 O  "O3'" . DG  B 2  3   ? -4.260  -12.475 -27.513 1.00 16.98 ? 3    DG  T "O3'" 1 
ATOM   2720 C  "C2'" . DG  B 2  3   ? -1.993  -12.639 -28.510 1.00 14.50 ? 3    DG  T "C2'" 1 
ATOM   2721 C  "C1'" . DG  B 2  3   ? -1.630  -14.130 -28.618 1.00 16.36 ? 3    DG  T "C1'" 1 
ATOM   2722 N  N9    . DG  B 2  3   ? -0.305  -14.429 -29.185 1.00 15.14 ? 3    DG  T N9    1 
ATOM   2723 C  C8    . DG  B 2  3   ? 0.240   -13.900 -30.331 1.00 16.01 ? 3    DG  T C8    1 
ATOM   2724 N  N7    . DG  B 2  3   ? 1.436   -14.353 -30.594 1.00 16.53 ? 3    DG  T N7    1 
ATOM   2725 C  C5    . DG  B 2  3   ? 1.700   -15.238 -29.561 1.00 15.18 ? 3    DG  T C5    1 
ATOM   2726 C  C6    . DG  B 2  3   ? 2.840   -16.031 -29.304 1.00 13.93 ? 3    DG  T C6    1 
ATOM   2727 O  O6    . DG  B 2  3   ? 3.861   -16.097 -29.980 1.00 14.46 ? 3    DG  T O6    1 
ATOM   2728 N  N1    . DG  B 2  3   ? 2.725   -16.804 -28.153 1.00 11.48 ? 3    DG  T N1    1 
ATOM   2729 C  C2    . DG  B 2  3   ? 1.625   -16.787 -27.347 1.00 14.08 ? 3    DG  T C2    1 
ATOM   2730 N  N2    . DG  B 2  3   ? 1.672   -17.583 -26.271 1.00 14.43 ? 3    DG  T N2    1 
ATOM   2731 N  N3    . DG  B 2  3   ? 0.540   -16.063 -27.578 1.00 15.06 ? 3    DG  T N3    1 
ATOM   2732 C  C4    . DG  B 2  3   ? 0.644   -15.301 -28.690 1.00 15.68 ? 3    DG  T C4    1 
ATOM   2733 P  P     . DC  B 2  4   ? -4.300  -11.069 -26.731 1.00 15.72 ? 4    DC  T P     1 
ATOM   2734 O  OP1   . DC  B 2  4   ? -5.546  -11.121 -25.968 1.00 18.94 ? 4    DC  T OP1   1 
ATOM   2735 O  OP2   . DC  B 2  4   ? -3.968  -9.951  -27.629 1.00 12.15 ? 4    DC  T OP2   1 
ATOM   2736 O  "O5'" . DC  B 2  4   ? -3.088  -11.205 -25.695 1.00 14.55 ? 4    DC  T "O5'" 1 
ATOM   2737 C  "C5'" . DC  B 2  4   ? -3.085  -12.254 -24.739 1.00 10.14 ? 4    DC  T "C5'" 1 
ATOM   2738 C  "C4'" . DC  B 2  4   ? -1.684  -12.315 -24.136 1.00 13.11 ? 4    DC  T "C4'" 1 
ATOM   2739 O  "O4'" . DC  B 2  4   ? -0.743  -12.777 -25.139 1.00 14.65 ? 4    DC  T "O4'" 1 
ATOM   2740 C  "C3'" . DC  B 2  4   ? -1.149  -10.978 -23.639 1.00 8.66  ? 4    DC  T "C3'" 1 
ATOM   2741 O  "O3'" . DC  B 2  4   ? -0.748  -11.084 -22.260 1.00 10.05 ? 4    DC  T "O3'" 1 
ATOM   2742 C  "C2'" . DC  B 2  4   ? 0.054   -10.692 -24.543 1.00 11.88 ? 4    DC  T "C2'" 1 
ATOM   2743 C  "C1'" . DC  B 2  4   ? 0.481   -12.122 -24.887 1.00 13.04 ? 4    DC  T "C1'" 1 
ATOM   2744 N  N1    . DC  B 2  4   ? 1.386   -12.218 -26.081 1.00 10.04 ? 4    DC  T N1    1 
ATOM   2745 C  C2    . DC  B 2  4   ? 2.396   -13.175 -26.089 1.00 13.25 ? 4    DC  T C2    1 
ATOM   2746 O  O2    . DC  B 2  4   ? 2.488   -13.936 -25.115 1.00 11.12 ? 4    DC  T O2    1 
ATOM   2747 N  N3    . DC  B 2  4   ? 3.222   -13.253 -27.168 1.00 11.03 ? 4    DC  T N3    1 
ATOM   2748 C  C4    . DC  B 2  4   ? 3.063   -12.422 -28.197 1.00 12.61 ? 4    DC  T C4    1 
ATOM   2749 N  N4    . DC  B 2  4   ? 3.922   -12.559 -29.218 1.00 17.63 ? 4    DC  T N4    1 
ATOM   2750 C  C5    . DC  B 2  4   ? 2.034   -11.427 -28.220 1.00 11.50 ? 4    DC  T C5    1 
ATOM   2751 C  C6    . DC  B 2  4   ? 1.234   -11.363 -27.146 1.00 16.65 ? 4    DC  T C6    1 
ATOM   2752 P  P     . DA  B 2  5   ? -0.726  -9.781  -21.311 1.00 8.53  ? 5    DA  T P     1 
ATOM   2753 O  OP1   . DA  B 2  5   ? -0.035  -8.654  -21.947 1.00 10.25 ? 5    DA  T OP1   1 
ATOM   2754 O  OP2   . DA  B 2  5   ? -0.263  -10.267 -19.999 1.00 10.26 ? 5    DA  T OP2   1 
ATOM   2755 O  "O5'" . DA  B 2  5   ? -2.267  -9.345  -21.226 1.00 8.46  ? 5    DA  T "O5'" 1 
ATOM   2756 C  "C5'" . DA  B 2  5   ? -3.202  -10.194 -20.511 1.00 6.00  ? 5    DA  T "C5'" 1 
ATOM   2757 C  "C4'" . DA  B 2  5   ? -4.349  -9.354  -19.965 1.00 8.50  ? 5    DA  T "C4'" 1 
ATOM   2758 O  "O4'" . DA  B 2  5   ? -3.817  -8.362  -19.054 1.00 8.48  ? 5    DA  T "O4'" 1 
ATOM   2759 C  "C3'" . DA  B 2  5   ? -5.092  -8.547  -21.034 1.00 8.28  ? 5    DA  T "C3'" 1 
ATOM   2760 O  "O3'" . DA  B 2  5   ? -6.444  -8.493  -20.664 1.00 11.87 ? 5    DA  T "O3'" 1 
ATOM   2761 C  "C2'" . DA  B 2  5   ? -4.458  -7.147  -20.998 1.00 6.49  ? 5    DA  T "C2'" 1 
ATOM   2762 C  "C1'" . DA  B 2  5   ? -4.003  -7.042  -19.540 1.00 10.50 ? 5    DA  T "C1'" 1 
ATOM   2763 N  N9    . DA  B 2  5   ? -2.738  -6.345  -19.290 1.00 8.51  ? 5    DA  T N9    1 
ATOM   2764 C  C8    . DA  B 2  5   ? -1.612  -6.336  -20.063 1.00 8.98  ? 5    DA  T C8    1 
ATOM   2765 N  N7    . DA  B 2  5   ? -0.617  -5.643  -19.542 1.00 9.65  ? 5    DA  T N7    1 
ATOM   2766 C  C5    . DA  B 2  5   ? -1.126  -5.173  -18.345 1.00 9.78  ? 5    DA  T C5    1 
ATOM   2767 C  C6    . DA  B 2  5   ? -0.563  -4.386  -17.329 1.00 9.89  ? 5    DA  T C6    1 
ATOM   2768 N  N6    . DA  B 2  5   ? 0.691   -3.930  -17.417 1.00 7.41  ? 5    DA  T N6    1 
ATOM   2769 N  N1    . DA  B 2  5   ? -1.333  -4.094  -16.236 1.00 8.52  ? 5    DA  T N1    1 
ATOM   2770 C  C2    . DA  B 2  5   ? -2.579  -4.578  -16.189 1.00 9.10  ? 5    DA  T C2    1 
ATOM   2771 N  N3    . DA  B 2  5   ? -3.209  -5.355  -17.092 1.00 8.61  ? 5    DA  T N3    1 
ATOM   2772 C  C4    . DA  B 2  5   ? -2.429  -5.610  -18.160 1.00 8.27  ? 5    DA  T C4    1 
ATOM   2773 P  P     . DT  B 2  6   ? -7.507  -7.698  -21.579 1.00 13.19 ? 6    DT  T P     1 
ATOM   2774 O  OP1   . DT  B 2  6   ? -8.818  -8.312  -21.301 1.00 16.25 ? 6    DT  T OP1   1 
ATOM   2775 O  OP2   . DT  B 2  6   ? -7.030  -7.652  -22.981 1.00 12.73 ? 6    DT  T OP2   1 
ATOM   2776 O  "O5'" . DT  B 2  6   ? -7.493  -6.254  -20.995 1.00 12.63 ? 6    DT  T "O5'" 1 
ATOM   2777 C  "C5'" . DT  B 2  6   ? -7.992  -6.119  -19.655 1.00 11.74 ? 6    DT  T "C5'" 1 
ATOM   2778 C  "C4'" . DT  B 2  6   ? -7.782  -4.701  -19.197 1.00 11.28 ? 6    DT  T "C4'" 1 
ATOM   2779 O  "O4'" . DT  B 2  6   ? -6.371  -4.513  -18.960 1.00 12.23 ? 6    DT  T "O4'" 1 
ATOM   2780 C  "C3'" . DT  B 2  6   ? -8.171  -3.667  -20.266 1.00 15.84 ? 6    DT  T "C3'" 1 
ATOM   2781 O  "O3'" . DT  B 2  6   ? -9.097  -2.751  -19.710 1.00 16.07 ? 6    DT  T "O3'" 1 
ATOM   2782 C  "C2'" . DT  B 2  6   ? -6.858  -2.939  -20.559 1.00 17.15 ? 6    DT  T "C2'" 1 
ATOM   2783 C  "C1'" . DT  B 2  6   ? -6.098  -3.170  -19.249 1.00 16.15 ? 6    DT  T "C1'" 1 
ATOM   2784 N  N1    . DT  B 2  6   ? -4.638  -2.867  -19.366 1.00 14.77 ? 6    DT  T N1    1 
ATOM   2785 C  C2    . DT  B 2  6   ? -4.038  -2.229  -18.309 1.00 12.23 ? 6    DT  T C2    1 
ATOM   2786 O  O2    . DT  B 2  6   ? -4.643  -1.947  -17.294 1.00 15.29 ? 6    DT  T O2    1 
ATOM   2787 N  N3    . DT  B 2  6   ? -2.716  -1.938  -18.479 1.00 11.12 ? 6    DT  T N3    1 
ATOM   2788 C  C4    . DT  B 2  6   ? -1.953  -2.223  -19.598 1.00 11.70 ? 6    DT  T C4    1 
ATOM   2789 O  O4    . DT  B 2  6   ? -0.777  -1.912  -19.641 1.00 12.70 ? 6    DT  T O4    1 
ATOM   2790 C  C5    . DT  B 2  6   ? -2.636  -2.892  -20.688 1.00 13.97 ? 6    DT  T C5    1 
ATOM   2791 C  C7    . DT  B 2  6   ? -1.903  -3.258  -21.948 1.00 12.93 ? 6    DT  T C7    1 
ATOM   2792 C  C6    . DT  B 2  6   ? -3.942  -3.176  -20.525 1.00 11.58 ? 6    DT  T C6    1 
ATOM   2793 P  P     . DA  B 2  7   ? -10.077 -1.896  -20.661 1.00 15.10 ? 7    DA  T P     1 
ATOM   2794 O  OP1   . DA  B 2  7   ? -11.353 -2.638  -20.722 1.00 26.44 ? 7    DA  T OP1   1 
ATOM   2795 O  OP2   . DA  B 2  7   ? -9.354  -1.566  -21.899 1.00 15.43 ? 7    DA  T OP2   1 
ATOM   2796 O  "O5'" . DA  B 2  7   ? -10.345 -0.574  -19.861 1.00 25.41 ? 7    DA  T "O5'" 1 
ATOM   2797 C  "C5'" . DA  B 2  7   ? -9.381  0.383   -19.933 1.00 21.52 ? 7    DA  T "C5'" 1 
ATOM   2798 C  "C4'" . DA  B 2  7   ? -8.955  0.731   -18.535 1.00 19.66 ? 7    DA  T "C4'" 1 
ATOM   2799 O  "O4'" . DA  B 2  7   ? -7.679  0.093   -18.359 1.00 22.81 ? 7    DA  T "O4'" 1 
ATOM   2800 C  "C3'" . DA  B 2  7   ? -8.707  2.223   -18.427 1.00 22.48 ? 7    DA  T "C3'" 1 
ATOM   2801 O  "O3'" . DA  B 2  7   ? -9.786  2.823   -17.746 1.00 24.37 ? 7    DA  T "O3'" 1 
ATOM   2802 C  "C2'" . DA  B 2  7   ? -7.420  2.349   -17.619 1.00 21.23 ? 7    DA  T "C2'" 1 
ATOM   2803 C  "C1'" . DA  B 2  7   ? -6.727  1.019   -17.870 1.00 22.79 ? 7    DA  T "C1'" 1 
ATOM   2804 N  N9    . DA  B 2  7   ? -5.512  1.043   -18.704 1.00 22.13 ? 7    DA  T N9    1 
ATOM   2805 C  C8    . DA  B 2  7   ? -5.307  0.554   -19.966 1.00 20.09 ? 7    DA  T C8    1 
ATOM   2806 N  N7    . DA  B 2  7   ? -4.072  0.729   -20.403 1.00 15.80 ? 7    DA  T N7    1 
ATOM   2807 C  C5    . DA  B 2  7   ? -3.422  1.365   -19.348 1.00 12.34 ? 7    DA  T C5    1 
ATOM   2808 C  C6    . DA  B 2  7   ? -2.087  1.804   -19.164 1.00 11.99 ? 7    DA  T C6    1 
ATOM   2809 N  N6    . DA  B 2  7   ? -1.119  1.659   -20.074 1.00 13.03 ? 7    DA  T N6    1 
ATOM   2810 N  N1    . DA  B 2  7   ? -1.774  2.415   -18.012 1.00 10.31 ? 7    DA  T N1    1 
ATOM   2811 C  C2    . DA  B 2  7   ? -2.732  2.549   -17.074 1.00 13.56 ? 7    DA  T C2    1 
ATOM   2812 N  N3    . DA  B 2  7   ? -4.013  2.152   -17.116 1.00 21.36 ? 7    DA  T N3    1 
ATOM   2813 C  C4    . DA  B 2  7   ? -4.294  1.564   -18.299 1.00 17.98 ? 7    DA  T C4    1 
ATOM   2814 P  P     . DC  B 2  8   ? -10.114 4.369   -17.988 1.00 21.78 ? 8    DC  T P     1 
ATOM   2815 O  OP1   . DC  B 2  8   ? -11.414 4.614   -17.341 1.00 29.04 ? 8    DC  T OP1   1 
ATOM   2816 O  OP2   . DC  B 2  8   ? -9.868  4.693   -19.379 1.00 16.74 ? 8    DC  T OP2   1 
ATOM   2817 O  "O5'" . DC  B 2  8   ? -9.022  5.162   -17.156 1.00 17.18 ? 8    DC  T "O5'" 1 
ATOM   2818 C  "C5'" . DC  B 2  8   ? -8.899  5.037   -15.741 1.00 15.00 ? 8    DC  T "C5'" 1 
ATOM   2819 C  "C4'" . DC  B 2  8   ? -7.742  5.905   -15.289 1.00 12.44 ? 8    DC  T "C4'" 1 
ATOM   2820 O  "O4'" . DC  B 2  8   ? -6.555  5.391   -15.944 1.00 12.71 ? 8    DC  T "O4'" 1 
ATOM   2821 C  "C3'" . DC  B 2  8   ? -7.821  7.385   -15.664 1.00 10.54 ? 8    DC  T "C3'" 1 
ATOM   2822 O  "O3'" . DC  B 2  8   ? -7.251  8.088   -14.551 1.00 12.04 ? 8    DC  T "O3'" 1 
ATOM   2823 C  "C2'" . DC  B 2  8   ? -6.969  7.451   -16.925 1.00 10.85 ? 8    DC  T "C2'" 1 
ATOM   2824 C  "C1'" . DC  B 2  8   ? -5.868  6.474   -16.525 1.00 16.10 ? 8    DC  T "C1'" 1 
ATOM   2825 N  N1    . DC  B 2  8   ? -5.116  5.962   -17.679 1.00 13.08 ? 8    DC  T N1    1 
ATOM   2826 C  C2    . DC  B 2  8   ? -3.726  6.094   -17.728 1.00 11.93 ? 8    DC  T C2    1 
ATOM   2827 O  O2    . DC  B 2  8   ? -3.122  6.639   -16.793 1.00 11.21 ? 8    DC  T O2    1 
ATOM   2828 N  N3    . DC  B 2  8   ? -3.079  5.618   -18.818 1.00 8.24  ? 8    DC  T N3    1 
ATOM   2829 C  C4    . DC  B 2  8   ? -3.749  5.025   -19.810 1.00 13.29 ? 8    DC  T C4    1 
ATOM   2830 N  N4    . DC  B 2  8   ? -3.055  4.560   -20.853 1.00 13.10 ? 8    DC  T N4    1 
ATOM   2831 C  C5    . DC  B 2  8   ? -5.164  4.871   -19.772 1.00 13.45 ? 8    DC  T C5    1 
ATOM   2832 C  C6    . DC  B 2  8   ? -5.802  5.346   -18.694 1.00 18.41 ? 8    DC  T C6    1 
ATOM   2833 P  P     . DG  B 2  9   ? -6.958  9.663   -14.583 1.00 13.53 ? 9    DG  T P     1 
ATOM   2834 O  OP1   . DG  B 2  9   ? -7.024  10.119  -13.178 1.00 9.64  ? 9    DG  T OP1   1 
ATOM   2835 O  OP2   . DG  B 2  9   ? -7.787  10.340  -15.604 1.00 10.18 ? 9    DG  T OP2   1 
ATOM   2836 O  "O5'" . DG  B 2  9   ? -5.433  9.774   -15.084 1.00 12.03 ? 9    DG  T "O5'" 1 
ATOM   2837 C  "C5'" . DG  B 2  9   ? -4.349  9.566   -14.220 1.00 8.83  ? 9    DG  T "C5'" 1 
ATOM   2838 C  "C4'" . DG  B 2  9   ? -3.258  10.596  -14.415 1.00 9.77  ? 9    DG  T "C4'" 1 
ATOM   2839 O  "O4'" . DG  B 2  9   ? -2.464  10.306  -15.607 1.00 13.50 ? 9    DG  T "O4'" 1 
ATOM   2840 C  "C3'" . DG  B 2  9   ? -3.771  12.012  -14.618 1.00 14.68 ? 9    DG  T "C3'" 1 
ATOM   2841 O  "O3'" . DG  B 2  9   ? -2.841  12.916  -14.045 1.00 17.11 ? 9    DG  T "O3'" 1 
ATOM   2842 C  "C2'" . DG  B 2  9   ? -3.863  12.148  -16.142 1.00 14.31 ? 9    DG  T "C2'" 1 
ATOM   2843 C  "C1'" . DG  B 2  9   ? -2.685  11.309  -16.619 1.00 13.17 ? 9    DG  T "C1'" 1 
ATOM   2844 N  N9    . DG  B 2  9   ? -2.889  10.493  -17.810 1.00 11.38 ? 9    DG  T N9    1 
ATOM   2845 C  C8    . DG  B 2  9   ? -4.007  9.769   -18.148 1.00 12.01 ? 9    DG  T C8    1 
ATOM   2846 N  N7    . DG  B 2  9   ? -3.853  9.080   -19.242 1.00 11.56 ? 9    DG  T N7    1 
ATOM   2847 C  C5    . DG  B 2  9   ? -2.544  9.361   -19.652 1.00 13.00 ? 9    DG  T C5    1 
ATOM   2848 C  C6    . DG  B 2  9   ? -1.803  8.919   -20.774 1.00 10.67 ? 9    DG  T C6    1 
ATOM   2849 O  O6    . DG  B 2  9   ? -2.147  8.137   -21.665 1.00 13.14 ? 9    DG  T O6    1 
ATOM   2850 N  N1    . DG  B 2  9   ? -0.524  9.451   -20.794 1.00 10.02 ? 9    DG  T N1    1 
ATOM   2851 C  C2    . DG  B 2  9   ? -0.002  10.309  -19.854 1.00 12.57 ? 9    DG  T C2    1 
ATOM   2852 N  N2    . DG  B 2  9   ? 1.267   10.743  -20.038 1.00 12.17 ? 9    DG  T N2    1 
ATOM   2853 N  N3    . DG  B 2  9   ? -0.679  10.726  -18.808 1.00 11.79 ? 9    DG  T N3    1 
ATOM   2854 C  C4    . DG  B 2  9   ? -1.938  10.219  -18.775 1.00 12.84 ? 9    DG  T C4    1 
ATOM   2855 O  "O5'" . DC  C 3  1   ? 5.711   6.436   -26.403 1.00 21.75 ? 1    DC  P "O5'" 1 
ATOM   2856 C  "C5'" . DC  C 3  1   ? 6.752   7.413   -26.469 1.00 13.97 ? 1    DC  P "C5'" 1 
ATOM   2857 C  "C4'" . DC  C 3  1   ? 6.493   8.419   -25.360 1.00 20.04 ? 1    DC  P "C4'" 1 
ATOM   2858 O  "O4'" . DC  C 3  1   ? 5.181   9.007   -25.568 1.00 19.35 ? 1    DC  P "O4'" 1 
ATOM   2859 C  "C3'" . DC  C 3  1   ? 6.360   7.846   -23.947 1.00 15.80 ? 1    DC  P "C3'" 1 
ATOM   2860 O  "O3'" . DC  C 3  1   ? 7.618   7.587   -23.360 1.00 14.14 ? 1    DC  P "O3'" 1 
ATOM   2861 C  "C2'" . DC  C 3  1   ? 5.642   8.997   -23.245 1.00 11.94 ? 1    DC  P "C2'" 1 
ATOM   2862 C  "C1'" . DC  C 3  1   ? 4.610   9.352   -24.310 1.00 16.26 ? 1    DC  P "C1'" 1 
ATOM   2863 N  N1    . DC  C 3  1   ? 3.282   8.660   -24.147 1.00 12.30 ? 1    DC  P N1    1 
ATOM   2864 C  C2    . DC  C 3  1   ? 2.430   9.136   -23.155 1.00 10.50 ? 1    DC  P C2    1 
ATOM   2865 O  O2    . DC  C 3  1   ? 2.818   10.088  -22.454 1.00 14.03 ? 1    DC  P O2    1 
ATOM   2866 N  N3    . DC  C 3  1   ? 1.219   8.558   -22.995 1.00 11.91 ? 1    DC  P N3    1 
ATOM   2867 C  C4    . DC  C 3  1   ? 0.859   7.532   -23.778 1.00 15.68 ? 1    DC  P C4    1 
ATOM   2868 N  N4    . DC  C 3  1   ? -0.346  6.978   -23.570 1.00 11.59 ? 1    DC  P N4    1 
ATOM   2869 C  C5    . DC  C 3  1   ? 1.727   7.018   -24.799 1.00 14.11 ? 1    DC  P C5    1 
ATOM   2870 C  C6    . DC  C 3  1   ? 2.918   7.609   -24.950 1.00 11.24 ? 1    DC  P C6    1 
ATOM   2871 P  P     . DG  C 3  2   ? 7.788   6.386   -22.301 1.00 13.78 ? 2    DG  P P     1 
ATOM   2872 O  OP1   . DG  C 3  2   ? 9.235   6.359   -22.048 1.00 11.49 ? 2    DG  P OP1   1 
ATOM   2873 O  OP2   . DG  C 3  2   ? 7.076   5.159   -22.760 1.00 12.69 ? 2    DG  P OP2   1 
ATOM   2874 O  "O5'" . DG  C 3  2   ? 7.045   6.921   -20.995 1.00 12.18 ? 2    DG  P "O5'" 1 
ATOM   2875 C  "C5'" . DG  C 3  2   ? 7.551   8.069   -20.279 1.00 9.78  ? 2    DG  P "C5'" 1 
ATOM   2876 C  "C4'" . DG  C 3  2   ? 6.563   8.530   -19.217 1.00 11.19 ? 2    DG  P "C4'" 1 
ATOM   2877 O  "O4'" . DG  C 3  2   ? 5.329   8.958   -19.832 1.00 14.72 ? 2    DG  P "O4'" 1 
ATOM   2878 C  "C3'" . DG  C 3  2   ? 6.087   7.481   -18.199 1.00 11.46 ? 2    DG  P "C3'" 1 
ATOM   2879 O  "O3'" . DG  C 3  2   ? 7.059   7.335   -17.174 1.00 11.97 ? 2    DG  P "O3'" 1 
ATOM   2880 C  "C2'" . DG  C 3  2   ? 4.800   8.159   -17.691 1.00 8.72  ? 2    DG  P "C2'" 1 
ATOM   2881 C  "C1'" . DG  C 3  2   ? 4.214   8.651   -19.000 1.00 12.86 ? 2    DG  P "C1'" 1 
ATOM   2882 N  N9    . DG  C 3  2   ? 3.380   7.647   -19.668 1.00 10.77 ? 2    DG  P N9    1 
ATOM   2883 C  C8    . DG  C 3  2   ? 3.692   6.873   -20.762 1.00 11.63 ? 2    DG  P C8    1 
ATOM   2884 N  N7    . DG  C 3  2   ? 2.718   6.072   -21.121 1.00 11.48 ? 2    DG  P N7    1 
ATOM   2885 C  C5    . DG  C 3  2   ? 1.689   6.347   -20.216 1.00 11.88 ? 2    DG  P C5    1 
ATOM   2886 C  C6    . DG  C 3  2   ? 0.381   5.802   -20.096 1.00 10.32 ? 2    DG  P C6    1 
ATOM   2887 O  O6    . DG  C 3  2   ? -0.150  4.944   -20.797 1.00 11.19 ? 2    DG  P O6    1 
ATOM   2888 N  N1    . DG  C 3  2   ? -0.346  6.369   -19.049 1.00 10.46 ? 2    DG  P N1    1 
ATOM   2889 C  C2    . DG  C 3  2   ? 0.149   7.331   -18.217 1.00 10.64 ? 2    DG  P C2    1 
ATOM   2890 N  N2    . DG  C 3  2   ? -0.676  7.752   -17.257 1.00 7.66  ? 2    DG  P N2    1 
ATOM   2891 N  N3    . DG  C 3  2   ? 1.370   7.847   -18.302 1.00 9.65  ? 2    DG  P N3    1 
ATOM   2892 C  C4    . DG  C 3  2   ? 2.079   7.315   -19.327 1.00 10.33 ? 2    DG  P C4    1 
ATOM   2893 P  P     . DT  C 3  3   ? 7.119   6.002   -16.272 1.00 10.85 ? 3    DT  P P     1 
ATOM   2894 O  OP1   . DT  C 3  3   ? 8.169   6.268   -15.264 1.00 10.46 ? 3    DT  P OP1   1 
ATOM   2895 O  OP2   . DT  C 3  3   ? 7.164   4.838   -17.152 1.00 8.99  ? 3    DT  P OP2   1 
ATOM   2896 O  "O5'" . DT  C 3  3   ? 5.676   5.971   -15.547 1.00 8.31  ? 3    DT  P "O5'" 1 
ATOM   2897 C  "C5'" . DT  C 3  3   ? 5.337   6.932   -14.542 1.00 11.34 ? 3    DT  P "C5'" 1 
ATOM   2898 C  "C4'" . DT  C 3  3   ? 3.887   6.752   -14.118 1.00 9.77  ? 3    DT  P "C4'" 1 
ATOM   2899 O  "O4'" . DT  C 3  3   ? 2.993   6.883   -15.228 1.00 10.15 ? 3    DT  P "O4'" 1 
ATOM   2900 C  "C3'" . DT  C 3  3   ? 3.576   5.354   -13.644 1.00 9.10  ? 3    DT  P "C3'" 1 
ATOM   2901 O  "O3'" . DT  C 3  3   ? 4.114   5.281   -12.363 1.00 9.16  ? 3    DT  P "O3'" 1 
ATOM   2902 C  "C2'" . DT  C 3  3   ? 2.043   5.392   -13.691 1.00 5.60  ? 3    DT  P "C2'" 1 
ATOM   2903 C  "C1'" . DT  C 3  3   ? 1.866   6.049   -15.048 1.00 8.69  ? 3    DT  P "C1'" 1 
ATOM   2904 N  N1    . DT  C 3  3   ? 1.824   5.060   -16.151 1.00 9.48  ? 3    DT  P N1    1 
ATOM   2905 C  C2    . DT  C 3  3   ? 0.648   4.364   -16.347 1.00 10.76 ? 3    DT  P C2    1 
ATOM   2906 O  O2    . DT  C 3  3   ? -0.333  4.545   -15.669 1.00 10.10 ? 3    DT  P O2    1 
ATOM   2907 N  N3    . DT  C 3  3   ? 0.657   3.472   -17.380 1.00 8.86  ? 3    DT  P N3    1 
ATOM   2908 C  C4    . DT  C 3  3   ? 1.736   3.204   -18.181 1.00 9.43  ? 3    DT  P C4    1 
ATOM   2909 O  O4    . DT  C 3  3   ? 1.677   2.390   -19.088 1.00 11.08 ? 3    DT  P O4    1 
ATOM   2910 C  C5    . DT  C 3  3   ? 2.945   3.946   -17.921 1.00 9.33  ? 3    DT  P C5    1 
ATOM   2911 C  C7    . DT  C 3  3   ? 4.158   3.697   -18.761 1.00 10.15 ? 3    DT  P C7    1 
ATOM   2912 C  C6    . DT  C 3  3   ? 2.945   4.830   -16.925 1.00 7.89  ? 3    DT  P C6    1 
ATOM   2913 P  P     . DA  C 3  4   ? 4.294   3.846   -11.703 1.00 13.26 ? 4    DA  P P     1 
ATOM   2914 O  OP1   . DA  C 3  4   ? 4.966   3.923   -10.399 1.00 7.89  ? 4    DA  P OP1   1 
ATOM   2915 O  OP2   . DA  C 3  4   ? 4.860   2.881   -12.688 1.00 9.48  ? 4    DA  P OP2   1 
ATOM   2916 O  "O5'" . DA  C 3  4   ? 2.751   3.400   -11.518 1.00 14.21 ? 4    DA  P "O5'" 1 
ATOM   2917 C  "C5'" . DA  C 3  4   ? 1.792   4.111   -10.658 1.00 9.60  ? 4    DA  P "C5'" 1 
ATOM   2918 C  "C4'" . DA  C 3  4   ? 0.506   3.288   -10.485 1.00 9.72  ? 4    DA  P "C4'" 1 
ATOM   2919 O  "O4'" . DA  C 3  4   ? -0.184  3.213   -11.748 1.00 9.32  ? 4    DA  P "O4'" 1 
ATOM   2920 C  "C3'" . DA  C 3  4   ? 0.686   1.827   -10.052 1.00 7.30  ? 4    DA  P "C3'" 1 
ATOM   2921 O  "O3'" . DA  C 3  4   ? 0.706   1.707   -8.594  1.00 4.20  ? 4    DA  P "O3'" 1 
ATOM   2922 C  "C2'" . DA  C 3  4   ? -0.512  1.112   -10.695 1.00 6.63  ? 4    DA  P "C2'" 1 
ATOM   2923 C  "C1'" . DA  C 3  4   ? -0.764  1.940   -11.964 1.00 9.29  ? 4    DA  P "C1'" 1 
ATOM   2924 N  N9    . DA  C 3  4   ? -0.137  1.461   -13.213 1.00 11.80 ? 4    DA  P N9    1 
ATOM   2925 C  C8    . DA  C 3  4   ? 1.154   1.647   -13.653 1.00 9.43  ? 4    DA  P C8    1 
ATOM   2926 N  N7    . DA  C 3  4   ? 1.393   1.133   -14.844 1.00 8.51  ? 4    DA  P N7    1 
ATOM   2927 C  C5    . DA  C 3  4   ? 0.185   0.584   -15.219 1.00 8.80  ? 4    DA  P C5    1 
ATOM   2928 C  C6    . DA  C 3  4   ? -0.235  -0.114  -16.367 1.00 10.11 ? 4    DA  P C6    1 
ATOM   2929 N  N6    . DA  C 3  4   ? 0.544   -0.405  -17.415 1.00 7.48  ? 4    DA  P N6    1 
ATOM   2930 N  N1    . DA  C 3  4   ? -1.510  -0.525  -16.393 1.00 16.52 ? 4    DA  P N1    1 
ATOM   2931 C  C2    . DA  C 3  4   ? -2.315  -0.254  -15.368 1.00 13.99 ? 4    DA  P C2    1 
ATOM   2932 N  N3    . DA  C 3  4   ? -2.042  0.388   -14.240 1.00 11.09 ? 4    DA  P N3    1 
ATOM   2933 C  C4    . DA  C 3  4   ? -0.761  0.777   -14.230 1.00 11.60 ? 4    DA  P C4    1 
ATOM   2934 O  OP3   . DG  D 4  1   ? 14.351  -18.533 -26.801 1.00 14.55 ? 1    DG  D OP3   1 
ATOM   2935 P  P     . DG  D 4  1   ? 13.695  -17.320 -27.342 1.00 17.68 ? 1    DG  D P     1 
ATOM   2936 O  OP1   . DG  D 4  1   ? 14.690  -16.235 -27.244 1.00 17.42 ? 1    DG  D OP1   1 
ATOM   2937 O  OP2   . DG  D 4  1   ? 13.084  -17.636 -28.644 1.00 17.38 ? 1    DG  D OP2   1 
ATOM   2938 O  "O5'" . DG  D 4  1   ? 12.451  -16.947 -26.394 1.00 17.57 ? 1    DG  D "O5'" 1 
ATOM   2939 C  "C5'" . DG  D 4  1   ? 12.604  -16.862 -24.981 1.00 12.65 ? 1    DG  D "C5'" 1 
ATOM   2940 C  "C4'" . DG  D 4  1   ? 11.531  -17.692 -24.300 1.00 17.59 ? 1    DG  D "C4'" 1 
ATOM   2941 O  "O4'" . DG  D 4  1   ? 10.222  -17.122 -24.589 1.00 11.35 ? 1    DG  D "O4'" 1 
ATOM   2942 C  "C3'" . DG  D 4  1   ? 11.458  -19.149 -24.737 1.00 10.12 ? 1    DG  D "C3'" 1 
ATOM   2943 O  "O3'" . DG  D 4  1   ? 11.059  -19.894 -23.604 1.00 13.12 ? 1    DG  D "O3'" 1 
ATOM   2944 C  "C2'" . DG  D 4  1   ? 10.374  -19.144 -25.807 1.00 12.08 ? 1    DG  D "C2'" 1 
ATOM   2945 C  "C1'" . DG  D 4  1   ? 9.427   -18.032 -25.336 1.00 12.02 ? 1    DG  D "C1'" 1 
ATOM   2946 N  N9    . DG  D 4  1   ? 8.882   -17.160 -26.368 1.00 12.12 ? 1    DG  D N9    1 
ATOM   2947 C  C8    . DG  D 4  1   ? 9.507   -16.736 -27.517 1.00 14.85 ? 1    DG  D C8    1 
ATOM   2948 N  N7    . DG  D 4  1   ? 8.793   -15.904 -28.231 1.00 13.67 ? 1    DG  D N7    1 
ATOM   2949 C  C5    . DG  D 4  1   ? 7.608   -15.771 -27.493 1.00 13.87 ? 1    DG  D C5    1 
ATOM   2950 C  C6    . DG  D 4  1   ? 6.449   -15.011 -27.764 1.00 14.08 ? 1    DG  D C6    1 
ATOM   2951 O  O6    . DG  D 4  1   ? 6.234   -14.273 -28.730 1.00 14.61 ? 1    DG  D O6    1 
ATOM   2952 N  N1    . DG  D 4  1   ? 5.482   -15.134 -26.770 1.00 11.00 ? 1    DG  D N1    1 
ATOM   2953 C  C2    . DG  D 4  1   ? 5.604   -15.906 -25.639 1.00 14.54 ? 1    DG  D C2    1 
ATOM   2954 N  N2    . DG  D 4  1   ? 4.539   -15.897 -24.798 1.00 10.39 ? 1    DG  D N2    1 
ATOM   2955 N  N3    . DG  D 4  1   ? 6.686   -16.649 -25.374 1.00 11.89 ? 1    DG  D N3    1 
ATOM   2956 C  C4    . DG  D 4  1   ? 7.646   -16.527 -26.344 1.00 13.04 ? 1    DG  D C4    1 
ATOM   2957 P  P     . DC  D 4  2   ? 11.219  -21.492 -23.560 1.00 15.76 ? 2    DC  D P     1 
ATOM   2958 O  OP1   . DC  D 4  2   ? 11.639  -21.934 -22.202 1.00 14.41 ? 2    DC  D OP1   1 
ATOM   2959 O  OP2   . DC  D 4  2   ? 12.006  -21.902 -24.726 1.00 17.14 ? 2    DC  D OP2   1 
ATOM   2960 O  "O5'" . DC  D 4  2   ? 9.734   -22.004 -23.745 1.00 12.20 ? 2    DC  D "O5'" 1 
ATOM   2961 C  "C5'" . DC  D 4  2   ? 8.808   -21.753 -22.702 1.00 15.28 ? 2    DC  D "C5'" 1 
ATOM   2962 C  "C4'" . DC  D 4  2   ? 7.401   -21.495 -23.219 1.00 10.34 ? 2    DC  D "C4'" 1 
ATOM   2963 O  "O4'" . DC  D 4  2   ? 7.389   -20.543 -24.298 1.00 10.11 ? 2    DC  D "O4'" 1 
ATOM   2964 C  "C3'" . DC  D 4  2   ? 6.644   -22.714 -23.734 1.00 12.00 ? 2    DC  D "C3'" 1 
ATOM   2965 O  "O3'" . DC  D 4  2   ? 5.943   -23.202 -22.604 1.00 15.21 ? 2    DC  D "O3'" 1 
ATOM   2966 C  "C2'" . DC  D 4  2   ? 5.733   -22.130 -24.807 1.00 14.06 ? 2    DC  D "C2'" 1 
ATOM   2967 C  "C1'" . DC  D 4  2   ? 6.066   -20.646 -24.808 1.00 13.73 ? 2    DC  D "C1'" 1 
ATOM   2968 N  N1    . DC  D 4  2   ? 6.029   -19.962 -26.130 1.00 11.93 ? 2    DC  D N1    1 
ATOM   2969 C  C2    . DC  D 4  2   ? 4.937   -19.172 -26.459 1.00 11.72 ? 2    DC  D C2    1 
ATOM   2970 O  O2    . DC  D 4  2   ? 4.031   -19.095 -25.632 1.00 13.29 ? 2    DC  D O2    1 
ATOM   2971 N  N3    . DC  D 4  2   ? 4.921   -18.522 -27.652 1.00 12.57 ? 2    DC  D N3    1 
ATOM   2972 C  C4    . DC  D 4  2   ? 5.944   -18.651 -28.510 1.00 12.99 ? 2    DC  D C4    1 
ATOM   2973 N  N4    . DC  D 4  2   ? 5.892   -18.000 -29.690 1.00 10.35 ? 2    DC  D N4    1 
ATOM   2974 C  C5    . DC  D 4  2   ? 7.068   -19.470 -28.194 1.00 14.74 ? 2    DC  D C5    1 
ATOM   2975 C  C6    . DC  D 4  2   ? 7.068   -20.094 -27.010 1.00 15.77 ? 2    DC  D C6    1 
ATOM   2976 P  P     A DC  D 4  3   ? 4.966   -24.471 -22.703 0.50 14.29 ? 3    DC  D P     1 
ATOM   2977 P  P     B DC  D 4  3   ? 4.913   -24.430 -22.726 0.50 14.27 ? 3    DC  D P     1 
ATOM   2978 O  OP1   A DC  D 4  3   ? 4.854   -25.031 -21.337 0.50 11.32 ? 3    DC  D OP1   1 
ATOM   2979 O  OP1   B DC  D 4  3   ? 4.781   -25.020 -21.375 0.50 11.35 ? 3    DC  D OP1   1 
ATOM   2980 O  OP2   A DC  D 4  3   ? 5.407   -25.325 -23.827 0.50 18.38 ? 3    DC  D OP2   1 
ATOM   2981 O  OP2   B DC  D 4  3   ? 5.309   -25.274 -23.873 0.50 18.33 ? 3    DC  D OP2   1 
ATOM   2982 O  "O5'" A DC  D 4  3   ? 3.561   -23.853 -23.117 0.50 14.80 ? 3    DC  D "O5'" 1 
ATOM   2983 O  "O5'" B DC  D 4  3   ? 3.531   -23.751 -23.125 0.50 14.83 ? 3    DC  D "O5'" 1 
ATOM   2984 C  "C5'" A DC  D 4  3   ? 2.879   -22.948 -22.267 0.50 16.32 ? 3    DC  D "C5'" 1 
ATOM   2985 C  "C5'" B DC  D 4  3   ? 2.959   -22.730 -22.328 0.50 16.25 ? 3    DC  D "C5'" 1 
ATOM   2986 C  "C4'" A DC  D 4  3   ? 1.476   -22.805 -22.807 0.50 16.95 ? 3    DC  D "C4'" 1 
ATOM   2987 C  "C4'" B DC  D 4  3   ? 1.541   -22.493 -22.799 0.50 16.58 ? 3    DC  D "C4'" 1 
ATOM   2988 O  "O4'" A DC  D 4  3   ? 1.581   -21.998 -23.995 0.50 18.22 ? 3    DC  D "O4'" 1 
ATOM   2989 O  "O4'" B DC  D 4  3   ? 1.617   -21.797 -24.062 0.50 18.14 ? 3    DC  D "O4'" 1 
ATOM   2990 C  "C3'" A DC  D 4  3   ? 0.900   -24.144 -23.259 0.50 18.85 ? 3    DC  D "C3'" 1 
ATOM   2991 C  "C3'" B DC  D 4  3   ? 0.753   -23.773 -23.063 0.50 18.38 ? 3    DC  D "C3'" 1 
ATOM   2992 O  "O3'" A DC  D 4  3   ? -0.093  -24.718 -22.356 0.50 26.21 ? 3    DC  D "O3'" 1 
ATOM   2993 O  "O3'" B DC  D 4  3   ? -0.544  -23.705 -22.454 0.50 22.02 ? 3    DC  D "O3'" 1 
ATOM   2994 C  "C2'" A DC  D 4  3   ? 0.430   -23.950 -24.703 0.50 18.06 ? 3    DC  D "C2'" 1 
ATOM   2995 C  "C2'" B DC  D 4  3   ? 0.720   -23.892 -24.595 0.50 17.97 ? 3    DC  D "C2'" 1 
ATOM   2996 C  "C1'" A DC  D 4  3   ? 0.771   -22.506 -25.044 0.50 17.81 ? 3    DC  D "C1'" 1 
ATOM   2997 C  "C1'" B DC  D 4  3   ? 0.845   -22.445 -25.060 0.50 17.82 ? 3    DC  D "C1'" 1 
ATOM   2998 N  N1    A DC  D 4  3   ? 1.587   -22.248 -26.272 0.50 15.33 ? 3    DC  D N1    1 
ATOM   2999 N  N1    B DC  D 4  3   ? 1.624   -22.151 -26.306 0.50 15.27 ? 3    DC  D N1    1 
ATOM   3000 C  C2    A DC  D 4  3   ? 1.130   -21.290 -27.176 0.50 14.03 ? 3    DC  D C2    1 
ATOM   3001 C  C2    B DC  D 4  3   ? 1.147   -21.174 -27.182 0.50 14.03 ? 3    DC  D C2    1 
ATOM   3002 O  O2    A DC  D 4  3   ? 0.052   -20.723 -26.952 0.50 15.16 ? 3    DC  D O2    1 
ATOM   3003 O  O2    B DC  D 4  3   ? 0.074   -20.610 -26.927 0.50 15.19 ? 3    DC  D O2    1 
ATOM   3004 N  N3    A DC  D 4  3   ? 1.872   -21.021 -28.270 0.50 13.99 ? 3    DC  D N3    1 
ATOM   3005 N  N3    B DC  D 4  3   ? 1.867   -20.879 -28.287 0.50 14.01 ? 3    DC  D N3    1 
ATOM   3006 C  C4    A DC  D 4  3   ? 3.027   -21.656 -28.467 0.50 14.99 ? 3    DC  D C4    1 
ATOM   3007 C  C4    B DC  D 4  3   ? 3.020   -21.505 -28.523 0.50 14.96 ? 3    DC  D C4    1 
ATOM   3008 N  N4    A DC  D 4  3   ? 3.725   -21.343 -29.569 0.50 14.10 ? 3    DC  D N4    1 
ATOM   3009 N  N4    B DC  D 4  3   ? 3.695   -21.172 -29.632 0.50 14.02 ? 3    DC  D N4    1 
ATOM   3010 C  C5    A DC  D 4  3   ? 3.516   -22.637 -27.554 0.50 13.43 ? 3    DC  D C5    1 
ATOM   3011 C  C5    B DC  D 4  3   ? 3.528   -22.505 -27.639 0.50 13.45 ? 3    DC  D C5    1 
ATOM   3012 C  C6    A DC  D 4  3   ? 2.771   -22.899 -26.477 0.50 14.00 ? 3    DC  D C6    1 
ATOM   3013 C  C6    B DC  D 4  3   ? 2.806   -22.792 -26.552 0.50 14.02 ? 3    DC  D C6    1 
ATOM   3014 P  P     A DG  D 4  4   ? -1.526  -24.027 -22.060 0.50 22.78 ? 4    DG  D P     1 
ATOM   3015 P  P     B DG  D 4  4   ? -1.500  -25.012 -22.403 0.50 22.46 ? 4    DG  D P     1 
ATOM   3016 O  OP1   A DG  D 4  4   ? -1.369  -22.589 -21.804 0.50 22.81 ? 4    DG  D OP1   1 
ATOM   3017 O  OP1   B DG  D 4  4   ? -2.197  -24.966 -21.111 0.50 24.33 ? 4    DG  D OP1   1 
ATOM   3018 O  OP2   A DG  D 4  4   ? -2.164  -24.927 -21.087 0.50 24.32 ? 4    DG  D OP2   1 
ATOM   3019 O  OP2   B DG  D 4  4   ? -0.767  -26.234 -22.786 0.50 17.28 ? 4    DG  D OP2   1 
ATOM   3020 O  "O5'" A DG  D 4  4   ? -2.364  -24.184 -23.421 0.50 22.70 ? 4    DG  D "O5'" 1 
ATOM   3021 O  "O5'" B DG  D 4  4   ? -2.569  -24.731 -23.562 0.50 21.06 ? 4    DG  D "O5'" 1 
ATOM   3022 C  "C5'" A DG  D 4  4   ? -3.266  -23.141 -23.785 0.50 19.97 ? 4    DG  D "C5'" 1 
ATOM   3023 C  "C5'" B DG  D 4  4   ? -3.047  -23.399 -23.779 0.50 20.29 ? 4    DG  D "C5'" 1 
ATOM   3024 C  "C4'" A DG  D 4  4   ? -3.919  -23.429 -25.132 0.50 21.43 ? 4    DG  D "C4'" 1 
ATOM   3025 C  "C4'" B DG  D 4  4   ? -3.791  -23.309 -25.105 0.50 21.52 ? 4    DG  D "C4'" 1 
ATOM   3026 O  "O4'" A DG  D 4  4   ? -2.983  -23.168 -26.217 0.50 20.19 ? 4    DG  D "O4'" 1 
ATOM   3027 O  "O4'" B DG  D 4  4   ? -2.861  -23.047 -26.194 0.50 20.14 ? 4    DG  D "O4'" 1 
ATOM   3028 C  "C3'" A DG  D 4  4   ? -4.408  -24.862 -25.343 0.50 22.96 ? 4    DG  D "C3'" 1 
ATOM   3029 C  "C3'" B DG  D 4  4   ? -4.550  -24.565 -25.514 0.50 23.21 ? 4    DG  D "C3'" 1 
ATOM   3030 O  "O3'" A DG  D 4  4   ? -5.690  -24.827 -25.965 0.50 22.77 ? 4    DG  D "O3'" 1 
ATOM   3031 O  "O3'" B DG  D 4  4   ? -5.763  -24.161 -26.156 0.50 18.58 ? 4    DG  D "O3'" 1 
ATOM   3032 C  "C2'" A DG  D 4  4   ? -3.348  -25.471 -26.261 0.50 18.83 ? 4    DG  D "C2'" 1 
ATOM   3033 C  "C2'" B DG  D 4  4   ? -3.567  -25.264 -26.460 0.50 18.97 ? 4    DG  D "C2'" 1 
ATOM   3034 C  "C1'" A DG  D 4  4   ? -2.989  -24.263 -27.114 0.50 18.63 ? 4    DG  D "C1'" 1 
ATOM   3035 C  "C1'" B DG  D 4  4   ? -2.982  -24.056 -27.182 0.50 18.65 ? 4    DG  D "C1'" 1 
ATOM   3036 N  N9    A DG  D 4  4   ? -1.682  -24.364 -27.767 0.50 17.27 ? 4    DG  D N9    1 
ATOM   3037 N  N9    B DG  D 4  4   ? -1.667  -24.265 -27.795 0.50 17.24 ? 4    DG  D N9    1 
ATOM   3038 C  C8    A DG  D 4  4   ? -0.648  -25.202 -27.437 0.50 15.74 ? 4    DG  D C8    1 
ATOM   3039 C  C8    B DG  D 4  4   ? -0.677  -25.134 -27.407 0.50 15.74 ? 4    DG  D C8    1 
ATOM   3040 N  N7    A DG  D 4  4   ? 0.401   -25.065 -28.200 0.50 15.18 ? 4    DG  D N7    1 
ATOM   3041 N  N7    B DG  D 4  4   ? 0.386   -25.080 -28.164 0.50 15.18 ? 4    DG  D N7    1 
ATOM   3042 C  C5    A DG  D 4  4   ? 0.030   -24.087 -29.111 0.50 15.08 ? 4    DG  D C5    1 
ATOM   3043 C  C5    B DG  D 4  4   ? 0.075   -24.124 -29.120 0.50 15.07 ? 4    DG  D C5    1 
ATOM   3044 C  C6    A DG  D 4  4   ? 0.749   -23.517 -30.191 0.50 14.58 ? 4    DG  D C6    1 
ATOM   3045 C  C6    B DG  D 4  4   ? 0.830   -23.629 -30.211 0.50 14.57 ? 4    DG  D C6    1 
ATOM   3046 O  O6    A DG  D 4  4   ? 1.901   -23.767 -30.572 0.50 15.48 ? 4    DG  D O6    1 
ATOM   3047 O  O6    B DG  D 4  4   ? 1.971   -23.945 -30.565 0.50 15.62 ? 4    DG  D O6    1 
ATOM   3048 N  N1    A DG  D 4  4   ? 0.002   -22.554 -30.856 0.50 12.92 ? 4    DG  D N1    1 
ATOM   3049 N  N1    B DG  D 4  4   ? 0.137   -22.659 -30.927 0.50 12.95 ? 4    DG  D N1    1 
ATOM   3050 C  C2    A DG  D 4  4   ? -1.277  -22.188 -30.522 0.50 15.26 ? 4    DG  D C2    1 
ATOM   3051 C  C2    B DG  D 4  4   ? -1.124  -22.222 -30.627 0.50 15.17 ? 4    DG  D C2    1 
ATOM   3052 N  N2    A DG  D 4  4   ? -1.840  -21.243 -31.288 0.50 17.68 ? 4    DG  D N2    1 
ATOM   3053 N  N2    B DG  D 4  4   ? -1.627  -21.283 -31.441 0.50 17.62 ? 4    DG  D N2    1 
ATOM   3054 N  N3    A DG  D 4  4   ? -1.969  -22.712 -29.517 0.50 15.40 ? 4    DG  D N3    1 
ATOM   3055 N  N3    B DG  D 4  4   ? -1.851  -22.674 -29.611 0.50 15.42 ? 4    DG  D N3    1 
ATOM   3056 C  C4    A DG  D 4  4   ? -1.250  -23.646 -28.855 0.50 15.14 ? 4    DG  D C4    1 
ATOM   3057 C  C4    B DG  D 4  4   ? -1.185  -23.614 -28.902 0.50 15.14 ? 4    DG  D C4    1 
HETATM 3058 O  O4    . DUP E 5  .   ? 1.500   -2.331  -14.979 1.00 7.74  ? 701  DUP A O4    1 
HETATM 3059 C  C4    . DUP E 5  .   ? 0.901   -2.456  -13.914 1.00 9.48  ? 701  DUP A C4    1 
HETATM 3060 C  C5    . DUP E 5  .   ? 1.463   -1.956  -12.707 1.00 6.93  ? 701  DUP A C5    1 
HETATM 3061 C  C6    . DUP E 5  .   ? 0.779   -2.123  -11.554 1.00 6.38  ? 701  DUP A C6    1 
HETATM 3062 N  N3    . DUP E 5  .   ? -0.296  -3.090  -13.893 1.00 7.95  ? 701  DUP A N3    1 
HETATM 3063 C  C2    . DUP E 5  .   ? -0.952  -3.252  -12.734 1.00 9.77  ? 701  DUP A C2    1 
HETATM 3064 O  O2    . DUP E 5  .   ? -2.033  -3.825  -12.726 1.00 7.43  ? 701  DUP A O2    1 
HETATM 3065 N  N1    . DUP E 5  .   ? -0.441  -2.775  -11.584 1.00 6.18  ? 701  DUP A N1    1 
HETATM 3066 C  "C1'" . DUP E 5  .   ? -1.185  -3.024  -10.347 1.00 5.28  ? 701  DUP A "C1'" 1 
HETATM 3067 C  "C2'" . DUP E 5  .   ? -0.663  -4.341  -9.664  1.00 4.35  ? 701  DUP A "C2'" 1 
HETATM 3068 C  "C3'" . DUP E 5  .   ? 0.464   -3.778  -8.752  1.00 3.52  ? 701  DUP A "C3'" 1 
HETATM 3069 O  "O3'" . DUP E 5  .   ? 0.744   -4.635  -7.637  1.00 4.52  ? 701  DUP A "O3'" 1 
HETATM 3070 O  "O4'" . DUP E 5  .   ? -0.899  -1.969  -9.419  1.00 6.10  ? 701  DUP A "O4'" 1 
HETATM 3071 C  "C4'" . DUP E 5  .   ? -0.225  -2.492  -8.247  1.00 2.76  ? 701  DUP A "C4'" 1 
HETATM 3072 C  "C5'" . DUP E 5  .   ? 0.755   -1.437  -7.686  1.00 2.48  ? 701  DUP A "C5'" 1 
HETATM 3073 O  "O5'" . DUP E 5  .   ? 1.704   -1.085  -8.692  1.00 4.14  ? 701  DUP A "O5'" 1 
HETATM 3074 P  PA    . DUP E 5  .   ? 3.162   -0.838  -8.102  1.00 4.85  ? 701  DUP A PA    1 
HETATM 3075 O  O1A   . DUP E 5  .   ? 3.123   0.118   -6.957  1.00 3.00  ? 701  DUP A O1A   1 
HETATM 3076 O  O2A   . DUP E 5  .   ? 4.019   -0.301  -9.315  1.00 6.62  ? 701  DUP A O2A   1 
HETATM 3077 N  N3A   . DUP E 5  .   ? 3.815   -2.344  -7.724  1.00 3.80  ? 701  DUP A N3A   1 
HETATM 3078 P  PB    . DUP E 5  .   ? 3.740   -3.079  -6.221  1.00 4.49  ? 701  DUP A PB    1 
HETATM 3079 O  O1B   . DUP E 5  .   ? 3.137   -4.452  -6.345  1.00 5.22  ? 701  DUP A O1B   1 
HETATM 3080 O  O2B   . DUP E 5  .   ? 3.040   -2.200  -5.117  1.00 2.87  ? 701  DUP A O2B   1 
HETATM 3081 O  O3B   . DUP E 5  .   ? 5.242   -3.252  -5.754  1.00 4.88  ? 701  DUP A O3B   1 
HETATM 3082 P  PG    . DUP E 5  .   ? 6.311   -2.054  -5.500  1.00 7.44  ? 701  DUP A PG    1 
HETATM 3083 O  O2G   . DUP E 5  .   ? 7.044   -2.367  -4.143  1.00 7.63  ? 701  DUP A O2G   1 
HETATM 3084 O  O1G   . DUP E 5  .   ? 7.243   -2.036  -6.667  1.00 6.69  ? 701  DUP A O1G   1 
HETATM 3085 O  O3G   . DUP E 5  .   ? 5.464   -0.711  -5.424  1.00 6.45  ? 701  DUP A O3G   1 
HETATM 3086 MG MG    . MG  F 6  .   ? 2.264   2.234   -7.237  1.00 6.49  ? 702  MG  A MG    1 
HETATM 3087 MG MG    . MG  G 6  .   ? 3.516   -0.228  -4.896  1.00 2.82  ? 703  MG  A MG    1 
HETATM 3088 C  C1    . EDO H 7  .   ? 17.819  -22.378 -25.801 1.00 33.55 ? 704  EDO A C1    1 
HETATM 3089 O  O1    . EDO H 7  .   ? 19.068  -22.586 -25.120 1.00 29.46 ? 704  EDO A O1    1 
HETATM 3090 C  C2    . EDO H 7  .   ? 17.964  -21.243 -26.811 1.00 35.68 ? 704  EDO A C2    1 
HETATM 3091 O  O2    . EDO H 7  .   ? 16.670  -20.844 -27.283 1.00 48.15 ? 704  EDO A O2    1 
HETATM 3092 C  C1    . EDO I 7  .   ? -4.739  -1.694  -11.207 1.00 17.47 ? 705  EDO A C1    1 
HETATM 3093 O  O1    . EDO I 7  .   ? -4.788  -2.681  -12.237 1.00 21.63 ? 705  EDO A O1    1 
HETATM 3094 C  C2    . EDO I 7  .   ? -3.826  -0.550  -11.639 1.00 24.33 ? 705  EDO A C2    1 
HETATM 3095 O  O2    . EDO I 7  .   ? -4.525  0.258   -12.600 1.00 25.76 ? 705  EDO A O2    1 
HETATM 3096 CL CL    B CL  J 8  .   ? 8.788   -11.151 -27.505 0.50 26.16 ? 706  CL  A CL    1 
HETATM 3097 NA NA    . NA  K 9  .   ? 10.470  4.904   -15.077 1.00 12.66 ? 707  NA  A NA    1 
HETATM 3098 C  C1    . EDO L 7  .   ? -18.065 -0.134  -14.012 1.00 37.00 ? 708  EDO A C1    1 
HETATM 3099 O  O1    . EDO L 7  .   ? -19.462 -0.443  -14.123 1.00 42.04 ? 708  EDO A O1    1 
HETATM 3100 C  C2    . EDO L 7  .   ? -17.415 -0.115  -15.393 1.00 35.20 ? 708  EDO A C2    1 
HETATM 3101 O  O2    . EDO L 7  .   ? -17.955 0.945   -16.192 1.00 44.17 ? 708  EDO A O2    1 
HETATM 3102 N  N1    . EPE M 10 .   ? 13.971  -7.783  1.947   1.00 46.87 ? 709  EPE A N1    1 
HETATM 3103 C  C2    . EPE M 10 .   ? 14.753  -6.884  2.817   1.00 56.09 ? 709  EPE A C2    1 
HETATM 3104 C  C3    . EPE M 10 .   ? 16.197  -7.376  2.945   1.00 47.35 ? 709  EPE A C3    1 
HETATM 3105 N  N4    . EPE M 10 .   ? 16.782  -7.651  1.649   1.00 45.03 ? 709  EPE A N4    1 
HETATM 3106 C  C5    . EPE M 10 .   ? 15.992  -8.377  0.675   1.00 45.10 ? 709  EPE A C5    1 
HETATM 3107 C  C6    . EPE M 10 .   ? 14.571  -7.819  0.599   1.00 35.44 ? 709  EPE A C6    1 
HETATM 3108 C  C9    . EPE M 10 .   ? 12.559  -7.333  1.916   1.00 37.33 ? 709  EPE A C9    1 
HETATM 3109 C  C10   . EPE M 10 .   ? 11.896  -7.766  0.611   1.00 36.90 ? 709  EPE A C10   1 
HETATM 3110 S  S     . EPE M 10 .   ? 10.077  -7.761  0.627   1.00 27.10 ? 709  EPE A S     1 
HETATM 3111 O  O1S   . EPE M 10 .   ? 9.626   -6.385  0.494   1.00 32.29 ? 709  EPE A O1S   1 
HETATM 3112 O  O2S   . EPE M 10 .   ? 9.580   -8.337  1.875   1.00 17.26 ? 709  EPE A O2S   1 
HETATM 3113 O  O3S   . EPE M 10 .   ? 9.675   -8.564  -0.536  1.00 33.47 ? 709  EPE A O3S   1 
HETATM 3114 O  O     . HOH N 11 .   ? 9.371   -22.335 -4.445  1.00 6.46  ? 801  HOH A O     1 
HETATM 3115 O  O     . HOH N 11 .   ? -4.700  -8.686  -6.059  1.00 4.49  ? 802  HOH A O     1 
HETATM 3116 O  O     . HOH N 11 .   ? 1.553   -0.197  -1.137  1.00 4.40  ? 803  HOH A O     1 
HETATM 3117 O  O     . HOH N 11 .   ? -10.676 2.653   1.029   1.00 6.81  ? 804  HOH A O     1 
HETATM 3118 O  O     . HOH N 11 .   ? 3.702   -6.284  -8.673  1.00 5.04  ? 805  HOH A O     1 
HETATM 3119 O  O     . HOH N 11 .   ? -18.609 -5.297  -12.941 1.00 10.83 ? 806  HOH A O     1 
HETATM 3120 O  O     . HOH N 11 .   ? 3.549   2.265   -8.860  1.00 7.73  ? 807  HOH A O     1 
HETATM 3121 O  O     . HOH N 11 .   ? 12.115  -16.157 -1.516  1.00 10.16 ? 808  HOH A O     1 
HETATM 3122 O  O     . HOH N 11 .   ? -12.918 -10.416 -0.110  1.00 10.63 ? 809  HOH A O     1 
HETATM 3123 O  O     . HOH N 11 .   ? 3.204   -14.807 1.383   1.00 8.92  ? 810  HOH A O     1 
HETATM 3124 O  O     . HOH N 11 .   ? -7.683  -6.686  -12.197 1.00 8.73  ? 811  HOH A O     1 
HETATM 3125 O  O     . HOH N 11 .   ? 5.968   -21.905 -3.018  1.00 9.52  ? 812  HOH A O     1 
HETATM 3126 O  O     . HOH N 11 .   ? 4.690   -9.023  -11.060 1.00 7.92  ? 813  HOH A O     1 
HETATM 3127 O  O     . HOH N 11 .   ? -18.606 5.415   -3.499  1.00 8.00  ? 814  HOH A O     1 
HETATM 3128 O  O     . HOH N 11 .   ? -10.142 -6.231  -10.980 1.00 5.37  ? 815  HOH A O     1 
HETATM 3129 O  O     . HOH N 11 .   ? -10.021 -9.544  -19.060 1.00 9.59  ? 816  HOH A O     1 
HETATM 3130 O  O     . HOH N 11 .   ? -14.598 20.010  3.220   1.00 14.33 ? 817  HOH A O     1 
HETATM 3131 O  O     . HOH N 11 .   ? 16.242  -22.868 -2.326  1.00 10.38 ? 818  HOH A O     1 
HETATM 3132 O  O     . HOH N 11 .   ? 6.335   -6.137  -6.110  1.00 11.32 ? 819  HOH A O     1 
HETATM 3133 O  O     . HOH N 11 .   ? 1.647   -23.117 -5.210  1.00 11.98 ? 820  HOH A O     1 
HETATM 3134 O  O     . HOH N 11 .   ? 3.986   -0.553  -2.837  1.00 5.07  ? 821  HOH A O     1 
HETATM 3135 O  O     . HOH N 11 .   ? 7.580   5.238   -9.526  1.00 11.88 ? 822  HOH A O     1 
HETATM 3136 O  O     . HOH N 11 .   ? 7.669   -13.270 -12.483 1.00 9.32  ? 823  HOH A O     1 
HETATM 3137 O  O     . HOH N 11 .   ? -14.100 -17.626 -0.938  1.00 11.29 ? 824  HOH A O     1 
HETATM 3138 O  O     . HOH N 11 .   ? -4.880  -3.099  3.401   1.00 12.12 ? 825  HOH A O     1 
HETATM 3139 O  O     . HOH N 11 .   ? 1.508   -18.442 -16.003 1.00 13.37 ? 826  HOH A O     1 
HETATM 3140 O  O     . HOH N 11 .   ? -16.908 5.467   6.391   1.00 14.03 ? 827  HOH A O     1 
HETATM 3141 O  O     . HOH N 11 .   ? 5.330   -2.688  -2.152  1.00 6.99  ? 828  HOH A O     1 
HETATM 3142 O  O     . HOH N 11 .   ? 6.451   -11.313 -11.000 1.00 11.20 ? 829  HOH A O     1 
HETATM 3143 O  O     . HOH N 11 .   ? -6.938  -19.739 -7.667  1.00 9.40  ? 830  HOH A O     1 
HETATM 3144 O  O     . HOH N 11 .   ? 10.724  4.336   -6.153  1.00 13.50 ? 831  HOH A O     1 
HETATM 3145 O  O     . HOH N 11 .   ? 1.748   -20.771 -0.649  1.00 11.78 ? 832  HOH A O     1 
HETATM 3146 O  O     . HOH N 11 .   ? 5.985   -22.389 -0.163  1.00 16.73 ? 833  HOH A O     1 
HETATM 3147 O  O     . HOH N 11 .   ? -0.405  -16.608 -7.506  1.00 7.43  ? 834  HOH A O     1 
HETATM 3148 O  O     . HOH N 11 .   ? 10.132  18.544  -5.517  1.00 10.88 ? 835  HOH A O     1 
HETATM 3149 O  O     . HOH N 11 .   ? -8.199  -21.894 -8.695  1.00 12.98 ? 836  HOH A O     1 
HETATM 3150 O  O     . HOH N 11 .   ? -5.435  -21.486 -6.028  1.00 13.18 ? 837  HOH A O     1 
HETATM 3151 O  O     . HOH N 11 .   ? 5.525   -9.611  -4.765  1.00 11.11 ? 838  HOH A O     1 
HETATM 3152 O  O     . HOH N 11 .   ? 11.032  -14.263 -5.799  1.00 14.61 ? 839  HOH A O     1 
HETATM 3153 O  O     . HOH N 11 .   ? 3.180   20.510  -0.692  1.00 13.12 ? 840  HOH A O     1 
HETATM 3154 O  O     . HOH N 11 .   ? 23.557  -16.512 -13.435 1.00 16.23 ? 841  HOH A O     1 
HETATM 3155 O  O     . HOH N 11 .   ? -18.902 -3.042  -3.703  1.00 12.16 ? 842  HOH A O     1 
HETATM 3156 O  O     . HOH N 11 .   ? -12.812 21.942  3.863   1.00 13.21 ? 843  HOH A O     1 
HETATM 3157 O  O     . HOH N 11 .   ? -13.669 -19.027 -4.929  1.00 14.96 ? 844  HOH A O     1 
HETATM 3158 O  O     . HOH N 11 .   ? -12.290 -14.451 3.827   1.00 16.02 ? 845  HOH A O     1 
HETATM 3159 O  O     . HOH N 11 .   ? 6.951   -14.393 -4.681  1.00 8.81  ? 846  HOH A O     1 
HETATM 3160 O  O     . HOH N 11 .   ? 16.286  -11.757 -22.467 1.00 11.88 ? 847  HOH A O     1 
HETATM 3161 O  O     . HOH N 11 .   ? 15.880  -10.477 -11.156 1.00 15.45 ? 848  HOH A O     1 
HETATM 3162 O  O     . HOH N 11 .   ? 5.617   -10.561 -7.265  1.00 11.32 ? 849  HOH A O     1 
HETATM 3163 O  O     . HOH N 11 .   ? 4.375   -18.453 -21.782 1.00 13.43 ? 850  HOH A O     1 
HETATM 3164 O  O     . HOH N 11 .   ? 16.284  -24.149 -6.267  1.00 16.58 ? 851  HOH A O     1 
HETATM 3165 O  O     . HOH N 11 .   ? 9.621   5.782   -2.904  1.00 8.99  ? 852  HOH A O     1 
HETATM 3166 O  O     . HOH N 11 .   ? 6.605   -0.929  -9.269  1.00 16.33 ? 853  HOH A O     1 
HETATM 3167 O  O     . HOH N 11 .   ? 13.368  -30.516 -3.626  1.00 23.05 ? 854  HOH A O     1 
HETATM 3168 O  O     . HOH N 11 .   ? -16.502 -18.791 -1.091  1.00 13.30 ? 855  HOH A O     1 
HETATM 3169 O  O     . HOH N 11 .   ? 13.115  8.701   -10.106 1.00 12.18 ? 856  HOH A O     1 
HETATM 3170 O  O     . HOH N 11 .   ? 3.839   1.330   9.702   1.00 23.97 ? 857  HOH A O     1 
HETATM 3171 O  O     . HOH N 11 .   ? 3.319   -5.467  4.639   1.00 10.51 ? 858  HOH A O     1 
HETATM 3172 O  O     . HOH N 11 .   ? 11.703  6.469   -1.261  1.00 13.67 ? 859  HOH A O     1 
HETATM 3173 O  O     . HOH N 11 .   ? -20.333 -4.041  -7.840  1.00 14.35 ? 860  HOH A O     1 
HETATM 3174 O  O     . HOH N 11 .   ? 10.292  18.464  7.404   1.00 21.22 ? 861  HOH A O     1 
HETATM 3175 O  O     . HOH N 11 .   ? -2.555  15.522  6.242   1.00 26.99 ? 862  HOH A O     1 
HETATM 3176 O  O     . HOH N 11 .   ? -6.617  -5.071  3.238   1.00 19.76 ? 863  HOH A O     1 
HETATM 3177 O  O     . HOH N 11 .   ? 17.121  -21.150 -6.408  1.00 15.24 ? 864  HOH A O     1 
HETATM 3178 O  O     . HOH N 11 .   ? 8.102   -8.747  -4.351  1.00 17.90 ? 865  HOH A O     1 
HETATM 3179 O  O     . HOH N 11 .   ? -17.042 2.894   5.580   1.00 19.92 ? 866  HOH A O     1 
HETATM 3180 O  O     . HOH N 11 .   ? -9.433  5.144   6.324   1.00 13.70 ? 867  HOH A O     1 
HETATM 3181 O  O     . HOH N 11 .   ? 6.265   -26.519 0.825   1.00 12.68 ? 868  HOH A O     1 
HETATM 3182 O  O     . HOH N 11 .   ? -21.018 12.675  2.200   1.00 19.14 ? 869  HOH A O     1 
HETATM 3183 O  O     . HOH N 11 .   ? 18.592  12.288  -6.399  1.00 16.73 ? 870  HOH A O     1 
HETATM 3184 O  O     . HOH N 11 .   ? -18.265 -2.731  -11.790 1.00 15.88 ? 871  HOH A O     1 
HETATM 3185 O  O     . HOH N 11 .   ? 8.075   -11.777 -6.903  1.00 22.74 ? 872  HOH A O     1 
HETATM 3186 O  O     . HOH N 11 .   ? 6.739   -20.190 1.329   1.00 20.20 ? 873  HOH A O     1 
HETATM 3187 O  O     . HOH N 11 .   ? -19.787 1.475   -11.111 1.00 19.40 ? 874  HOH A O     1 
HETATM 3188 O  O     . HOH N 11 .   ? -9.220  21.128  4.848   1.00 18.47 ? 875  HOH A O     1 
HETATM 3189 O  O     . HOH N 11 .   ? 4.108   0.175   -11.915 1.00 15.36 ? 876  HOH A O     1 
HETATM 3190 O  O     . HOH N 11 .   ? -14.423 -4.800  -18.109 1.00 16.52 ? 877  HOH A O     1 
HETATM 3191 O  O     A HOH N 11 .   ? -9.978  8.403   5.891   0.60 10.46 ? 878  HOH A O     1 
HETATM 3192 O  O     B HOH N 11 .   ? -10.274 7.254   7.552   0.40 8.97  ? 878  HOH A O     1 
HETATM 3193 O  O     . HOH N 11 .   ? 9.361   -28.864 -5.939  1.00 17.96 ? 879  HOH A O     1 
HETATM 3194 O  O     . HOH N 11 .   ? 19.923  -6.452  -12.048 1.00 22.20 ? 880  HOH A O     1 
HETATM 3195 O  O     . HOH N 11 .   ? -13.763 -16.611 -3.539  1.00 11.08 ? 881  HOH A O     1 
HETATM 3196 O  O     . HOH N 11 .   ? -2.671  -4.591  4.405   1.00 18.27 ? 882  HOH A O     1 
HETATM 3197 O  O     . HOH N 11 .   ? -5.487  -0.376  5.016   1.00 16.24 ? 883  HOH A O     1 
HETATM 3198 O  O     . HOH N 11 .   ? 4.806   -8.354  -15.990 1.00 18.25 ? 884  HOH A O     1 
HETATM 3199 O  O     . HOH N 11 .   ? 3.223   -12.369 2.496   1.00 15.64 ? 885  HOH A O     1 
HETATM 3200 O  O     . HOH N 11 .   ? 5.930   -8.127  -8.417  1.00 20.30 ? 886  HOH A O     1 
HETATM 3201 O  O     . HOH N 11 .   ? 18.347  -5.760  -22.849 1.00 21.11 ? 887  HOH A O     1 
HETATM 3202 O  O     . HOH N 11 .   ? 13.793  -10.420 -9.663  1.00 17.33 ? 888  HOH A O     1 
HETATM 3203 O  O     . HOH N 11 .   ? 14.986  -1.357  -11.845 1.00 24.82 ? 889  HOH A O     1 
HETATM 3204 O  O     . HOH N 11 .   ? -0.151  -19.504 -22.621 1.00 25.41 ? 890  HOH A O     1 
HETATM 3205 O  O     . HOH N 11 .   ? 2.858   -18.562 -9.716  1.00 13.07 ? 891  HOH A O     1 
HETATM 3206 O  O     . HOH N 11 .   ? -10.634 21.920  -2.187  1.00 21.08 ? 892  HOH A O     1 
HETATM 3207 O  O     . HOH N 11 .   ? 11.693  -4.538  -18.859 1.00 20.62 ? 893  HOH A O     1 
HETATM 3208 O  O     . HOH N 11 .   ? 22.422  -15.908 -11.147 1.00 21.95 ? 894  HOH A O     1 
HETATM 3209 O  O     . HOH N 11 .   ? 3.834   -3.464  -18.898 1.00 23.08 ? 895  HOH A O     1 
HETATM 3210 O  O     . HOH N 11 .   ? -20.349 -14.950 -5.746  1.00 23.15 ? 896  HOH A O     1 
HETATM 3211 O  O     . HOH N 11 .   ? 28.462  -4.338  -22.770 1.00 21.57 ? 897  HOH A O     1 
HETATM 3212 O  O     . HOH N 11 .   ? -24.262 10.214  -3.843  1.00 14.97 ? 898  HOH A O     1 
HETATM 3213 O  O     . HOH N 11 .   ? -21.276 0.967   1.292   1.00 22.03 ? 899  HOH A O     1 
HETATM 3214 O  O     . HOH N 11 .   ? 7.470   12.456  -18.541 1.00 20.13 ? 900  HOH A O     1 
HETATM 3215 O  O     . HOH N 11 .   ? 21.371  -19.168 -7.232  1.00 38.47 ? 901  HOH A O     1 
HETATM 3216 O  O     . HOH N 11 .   ? 27.782  -8.510  -21.759 1.00 23.62 ? 902  HOH A O     1 
HETATM 3217 O  O     . HOH N 11 .   ? 10.298  5.638   -8.462  1.00 19.36 ? 903  HOH A O     1 
HETATM 3218 O  O     . HOH N 11 .   ? -15.069 -3.034  -16.260 1.00 18.49 ? 904  HOH A O     1 
HETATM 3219 O  O     . HOH N 11 .   ? -0.321  12.162  -11.073 1.00 20.49 ? 905  HOH A O     1 
HETATM 3220 O  O     . HOH N 11 .   ? 9.783   10.865  -22.626 1.00 22.38 ? 906  HOH A O     1 
HETATM 3221 O  O     . HOH N 11 .   ? -19.366 13.465  4.028   1.00 15.91 ? 907  HOH A O     1 
HETATM 3222 O  O     . HOH N 11 .   ? -18.885 0.187   2.210   1.00 24.58 ? 908  HOH A O     1 
HETATM 3223 O  O     . HOH N 11 .   ? -10.588 -1.414  3.481   1.00 18.83 ? 909  HOH A O     1 
HETATM 3224 O  O     . HOH N 11 .   ? 12.099  13.880  -22.377 1.00 21.44 ? 910  HOH A O     1 
HETATM 3225 O  O     . HOH N 11 .   ? 11.214  0.101   -27.076 1.00 30.66 ? 911  HOH A O     1 
HETATM 3226 O  O     . HOH N 11 .   ? -4.974  -11.819 4.027   1.00 19.64 ? 912  HOH A O     1 
HETATM 3227 O  O     . HOH N 11 .   ? 0.069   -9.735  4.976   1.00 29.11 ? 913  HOH A O     1 
HETATM 3228 O  O     . HOH N 11 .   ? -22.163 -13.503 -3.614  1.00 25.12 ? 914  HOH A O     1 
HETATM 3229 O  O     . HOH N 11 .   ? 17.036  -14.441 -23.155 1.00 16.39 ? 915  HOH A O     1 
HETATM 3230 O  O     . HOH N 11 .   ? 17.684  -9.394  -9.387  1.00 26.29 ? 916  HOH A O     1 
HETATM 3231 O  O     . HOH N 11 .   ? 12.726  4.505   -28.385 1.00 31.05 ? 917  HOH A O     1 
HETATM 3232 O  O     . HOH N 11 .   ? 21.388  10.917  -8.072  1.00 26.72 ? 918  HOH A O     1 
HETATM 3233 O  O     . HOH N 11 .   ? 12.574  17.961  8.747   1.00 19.86 ? 919  HOH A O     1 
HETATM 3234 O  O     . HOH N 11 .   ? 16.973  10.583  -31.049 1.00 30.72 ? 920  HOH A O     1 
HETATM 3235 O  O     . HOH N 11 .   ? 12.562  -13.735 -7.893  1.00 25.93 ? 921  HOH A O     1 
HETATM 3236 O  O     . HOH N 11 .   ? 13.738  -0.948  -26.883 1.00 26.17 ? 922  HOH A O     1 
HETATM 3237 O  O     . HOH N 11 .   ? 11.693  -13.866 -2.724  1.00 27.65 ? 923  HOH A O     1 
HETATM 3238 O  O     . HOH N 11 .   ? 9.768   19.210  -12.091 1.00 25.41 ? 924  HOH A O     1 
HETATM 3239 O  O     . HOH N 11 .   ? 4.806   4.739   10.685  1.00 28.50 ? 925  HOH A O     1 
HETATM 3240 O  O     . HOH N 11 .   ? 5.942   -5.070  -19.526 1.00 25.65 ? 926  HOH A O     1 
HETATM 3241 O  O     . HOH N 11 .   ? 4.272   -3.905  -9.907  1.00 14.02 ? 927  HOH A O     1 
HETATM 3242 O  O     . HOH N 11 .   ? 8.181   1.267   -20.236 1.00 23.53 ? 928  HOH A O     1 
HETATM 3243 O  O     . HOH N 11 .   ? -5.458  10.519  10.440  1.00 27.28 ? 929  HOH A O     1 
HETATM 3244 O  O     . HOH N 11 .   ? -25.872 6.839   -3.422  1.00 23.33 ? 930  HOH A O     1 
HETATM 3245 O  O     . HOH N 11 .   ? 23.850  -19.578 -20.903 1.00 21.07 ? 931  HOH A O     1 
HETATM 3246 O  O     . HOH N 11 .   ? -4.287  -17.592 -22.599 1.00 24.48 ? 932  HOH A O     1 
HETATM 3247 O  O     . HOH N 11 .   ? 20.790  8.197   -7.390  1.00 23.96 ? 933  HOH A O     1 
HETATM 3248 O  O     . HOH N 11 .   ? -23.143 0.972   -4.730  1.00 20.97 ? 934  HOH A O     1 
HETATM 3249 O  O     . HOH N 11 .   ? 28.484  2.033   -26.150 1.00 33.91 ? 935  HOH A O     1 
HETATM 3250 O  O     . HOH N 11 .   ? -15.212 -3.683  -20.649 1.00 35.09 ? 936  HOH A O     1 
HETATM 3251 O  O     . HOH N 11 .   ? 21.997  -0.225  -13.892 1.00 20.03 ? 937  HOH A O     1 
HETATM 3252 O  O     . HOH N 11 .   ? 6.500   18.571  -18.819 1.00 17.78 ? 938  HOH A O     1 
HETATM 3253 O  O     . HOH N 11 .   ? 25.694  -3.797  -24.360 1.00 18.99 ? 939  HOH A O     1 
HETATM 3254 O  O     . HOH N 11 .   ? 8.976   -0.768  -25.977 1.00 32.91 ? 940  HOH A O     1 
HETATM 3255 O  O     . HOH N 11 .   ? 5.853   16.357  -17.255 1.00 19.17 ? 941  HOH A O     1 
HETATM 3256 O  O     . HOH N 11 .   ? 18.783  16.337  -10.725 1.00 27.75 ? 942  HOH A O     1 
HETATM 3257 O  O     . HOH N 11 .   ? 20.180  -15.891 -9.538  1.00 19.43 ? 943  HOH A O     1 
HETATM 3258 O  O     . HOH N 11 .   ? 28.139  7.109   -25.371 1.00 29.63 ? 944  HOH A O     1 
HETATM 3259 O  O     . HOH N 11 .   ? 12.767  6.363   -9.270  1.00 20.17 ? 945  HOH A O     1 
HETATM 3260 O  O     . HOH N 11 .   ? 17.727  0.619   -30.067 1.00 34.04 ? 946  HOH A O     1 
HETATM 3261 O  O     . HOH N 11 .   ? 4.833   -10.367 5.780   1.00 29.24 ? 947  HOH A O     1 
HETATM 3262 O  O     . HOH N 11 .   ? -24.073 3.173   -1.435  1.00 20.04 ? 948  HOH A O     1 
HETATM 3263 O  O     . HOH N 11 .   ? -16.742 -20.363 -14.068 1.00 30.19 ? 949  HOH A O     1 
HETATM 3264 O  O     . HOH N 11 .   ? 5.809   -8.168  -13.979 1.00 22.13 ? 950  HOH A O     1 
HETATM 3265 O  O     . HOH N 11 .   ? 4.278   19.428  -8.139  1.00 29.70 ? 951  HOH A O     1 
HETATM 3266 O  O     . HOH N 11 .   ? -6.857  -23.863 -17.572 1.00 33.90 ? 952  HOH A O     1 
HETATM 3267 O  O     . HOH N 11 .   ? -24.066 -9.316  -10.785 1.00 26.02 ? 953  HOH A O     1 
HETATM 3268 O  O     . HOH N 11 .   ? -13.739 -22.804 -7.078  1.00 35.16 ? 954  HOH A O     1 
HETATM 3269 O  O     . HOH N 11 .   ? 22.213  -7.730  -11.514 1.00 31.45 ? 955  HOH A O     1 
HETATM 3270 O  O     . HOH N 11 .   ? 3.037   -22.389 -2.691  1.00 21.30 ? 956  HOH A O     1 
HETATM 3271 O  O     . HOH N 11 .   ? 14.399  13.636  -24.512 1.00 25.58 ? 957  HOH A O     1 
HETATM 3272 O  O     . HOH N 11 .   ? -7.987  -7.827  3.383   1.00 27.26 ? 958  HOH A O     1 
HETATM 3273 O  O     . HOH N 11 .   ? -10.927 -6.592  -21.649 1.00 26.04 ? 959  HOH A O     1 
HETATM 3274 O  O     . HOH N 11 .   ? -22.598 -10.112 -4.336  1.00 27.32 ? 960  HOH A O     1 
HETATM 3275 O  O     . HOH N 11 .   ? 13.353  -3.045  -14.655 1.00 24.79 ? 961  HOH A O     1 
HETATM 3276 O  O     . HOH N 11 .   ? -17.733 -17.695 -17.801 1.00 28.81 ? 962  HOH A O     1 
HETATM 3277 O  O     . HOH N 11 .   ? 8.373   0.793   -10.327 1.00 30.21 ? 963  HOH A O     1 
HETATM 3278 O  O     . HOH N 11 .   ? -8.504  -22.957 -11.537 1.00 27.85 ? 964  HOH A O     1 
HETATM 3279 O  O     . HOH N 11 .   ? -1.514  -17.146 3.294   1.00 28.63 ? 965  HOH A O     1 
HETATM 3280 O  O     . HOH N 11 .   ? 16.102  -6.285  -11.238 1.00 32.00 ? 966  HOH A O     1 
HETATM 3281 O  O     . HOH N 11 .   ? 15.131  -8.144  -12.482 1.00 21.63 ? 967  HOH A O     1 
HETATM 3282 O  O     . HOH N 11 .   ? 14.413  4.748   5.001   1.00 32.35 ? 968  HOH A O     1 
HETATM 3283 O  O     . HOH N 11 .   ? -8.153  -12.236 2.267   1.00 23.59 ? 969  HOH A O     1 
HETATM 3284 O  O     . HOH N 11 .   ? 3.301   -16.864 2.976   1.00 28.35 ? 970  HOH A O     1 
HETATM 3285 O  O     . HOH N 11 .   ? 10.302  -10.590 -8.330  1.00 26.92 ? 971  HOH A O     1 
HETATM 3286 O  O     . HOH N 11 .   ? -11.330 -18.792 1.852   1.00 30.80 ? 972  HOH A O     1 
HETATM 3287 O  O     . HOH N 11 .   ? 14.931  2.342   3.427   1.00 28.21 ? 973  HOH A O     1 
HETATM 3288 O  O     . HOH N 11 .   ? 17.531  -34.587 -13.852 1.00 28.64 ? 974  HOH A O     1 
HETATM 3289 O  O     . HOH N 11 .   ? -13.324 10.810  -8.741  1.00 27.83 ? 975  HOH A O     1 
HETATM 3290 O  O     . HOH N 11 .   ? 9.159   -2.878  -23.625 1.00 25.77 ? 976  HOH A O     1 
HETATM 3291 O  O     . HOH N 11 .   ? 22.293  -7.419  -23.089 1.00 31.32 ? 977  HOH A O     1 
HETATM 3292 O  O     . HOH N 11 .   ? -16.610 -17.797 -14.871 1.00 27.60 ? 978  HOH A O     1 
HETATM 3293 O  O     . HOH N 11 .   ? 19.976  -21.229 -7.466  1.00 30.67 ? 979  HOH A O     1 
HETATM 3294 O  O     . HOH N 11 .   ? 22.636  -2.919  -13.245 1.00 29.05 ? 980  HOH A O     1 
HETATM 3295 O  O     . HOH N 11 .   ? -3.190  -8.569  3.540   1.00 19.62 ? 981  HOH A O     1 
HETATM 3296 O  O     . HOH N 11 .   ? -12.796 -22.716 -13.191 1.00 33.75 ? 982  HOH A O     1 
HETATM 3297 O  O     . HOH N 11 .   ? -12.663 -19.631 0.058   1.00 24.07 ? 983  HOH A O     1 
HETATM 3298 O  O     . HOH N 11 .   ? -19.883 9.767   -10.178 1.00 35.37 ? 984  HOH A O     1 
HETATM 3299 O  O     . HOH N 11 .   ? 12.166  5.142   1.156   1.00 17.91 ? 985  HOH A O     1 
HETATM 3300 O  O     . HOH N 11 .   ? 10.166  4.384   -12.598 1.00 17.69 ? 986  HOH A O     1 
HETATM 3301 O  O     . HOH N 11 .   ? 3.101   -18.581 -14.248 1.00 20.15 ? 987  HOH A O     1 
HETATM 3302 O  O     . HOH N 11 .   ? -3.514  -15.983 -24.036 1.00 28.53 ? 988  HOH A O     1 
HETATM 3303 O  O     . HOH N 11 .   ? -15.585 -0.753  -17.628 1.00 31.06 ? 989  HOH A O     1 
HETATM 3304 O  O     A HOH N 11 .   ? 11.455  19.337  -9.915  0.50 14.81 ? 990  HOH A O     1 
HETATM 3305 O  O     B HOH N 11 .   ? 9.863   18.838  -8.460  0.50 17.21 ? 990  HOH A O     1 
HETATM 3306 O  O     . HOH N 11 .   ? 20.693  0.519   -11.704 1.00 29.20 ? 991  HOH A O     1 
HETATM 3307 O  O     . HOH N 11 .   ? 9.067   -28.553 -18.987 1.00 28.20 ? 992  HOH A O     1 
HETATM 3308 O  O     . HOH N 11 .   ? -5.625  -1.586  -14.468 1.00 28.89 ? 993  HOH A O     1 
HETATM 3309 O  O     . HOH N 11 .   ? 9.526   -2.564  7.854   1.00 30.68 ? 994  HOH A O     1 
HETATM 3310 O  O     . HOH N 11 .   ? 9.833   -10.728 2.951   1.00 22.44 ? 995  HOH A O     1 
HETATM 3311 O  O     . HOH N 11 .   ? 9.617   -8.002  -15.835 1.00 27.22 ? 996  HOH A O     1 
HETATM 3312 O  O     . HOH N 11 .   ? 10.340  9.310   -26.044 1.00 30.76 ? 997  HOH A O     1 
HETATM 3313 O  O     . HOH N 11 .   ? 20.285  -31.612 -13.244 1.00 27.44 ? 998  HOH A O     1 
HETATM 3314 O  O     . HOH N 11 .   ? 13.150  19.312  10.703  1.00 30.32 ? 999  HOH A O     1 
HETATM 3315 O  O     A HOH N 11 .   ? 6.051   -15.836 2.493   0.50 11.04 ? 1000 HOH A O     1 
HETATM 3316 O  O     B HOH N 11 .   ? 5.994   -13.699 3.735   0.50 17.04 ? 1000 HOH A O     1 
HETATM 3317 O  O     . HOH N 11 .   ? -24.846 -4.488  -16.021 1.00 22.68 ? 1001 HOH A O     1 
HETATM 3318 O  O     . HOH N 11 .   ? -11.035 -16.847 3.227   1.00 29.19 ? 1002 HOH A O     1 
HETATM 3319 O  O     . HOH N 11 .   ? 17.143  -27.017 -22.758 1.00 22.78 ? 1003 HOH A O     1 
HETATM 3320 O  O     . HOH N 11 .   ? 23.465  -30.313 -16.290 1.00 36.34 ? 1004 HOH A O     1 
HETATM 3321 O  O     . HOH N 11 .   ? 12.287  2.477   -3.699  1.00 19.08 ? 1005 HOH A O     1 
HETATM 3322 O  O     . HOH N 11 .   ? -19.654 7.560   -8.778  1.00 27.75 ? 1006 HOH A O     1 
HETATM 3323 O  O     . HOH N 11 .   ? 7.120   -4.357  -8.142  1.00 25.48 ? 1007 HOH A O     1 
HETATM 3324 O  O     . HOH N 11 .   ? -0.960  -20.116 -19.959 1.00 31.31 ? 1008 HOH A O     1 
HETATM 3325 O  O     . HOH N 11 .   ? -20.761 5.779   -9.057  1.00 29.45 ? 1009 HOH A O     1 
HETATM 3326 O  O     . HOH N 11 .   ? 7.846   -12.190 4.294   1.00 29.33 ? 1010 HOH A O     1 
HETATM 3327 O  O     . HOH N 11 .   ? -14.961 5.677   8.382   1.00 35.38 ? 1011 HOH A O     1 
HETATM 3328 O  O     . HOH N 11 .   ? -9.975  -3.902  2.094   1.00 22.61 ? 1012 HOH A O     1 
HETATM 3329 O  O     . HOH N 11 .   ? 12.494  -31.898 -1.242  1.00 30.27 ? 1013 HOH A O     1 
HETATM 3330 O  O     . HOH N 11 .   ? -9.672  14.002  8.875   1.00 24.33 ? 1014 HOH A O     1 
HETATM 3331 O  O     . HOH N 11 .   ? -8.419  1.008   6.157   1.00 30.99 ? 1015 HOH A O     1 
HETATM 3332 O  O     . HOH N 11 .   ? -14.155 10.973  8.391   1.00 30.69 ? 1016 HOH A O     1 
HETATM 3333 O  O     . HOH N 11 .   ? 5.950   -2.820  -11.497 1.00 30.19 ? 1017 HOH A O     1 
HETATM 3334 O  O     . HOH N 11 .   ? -12.229 -5.669  1.680   1.00 31.42 ? 1018 HOH A O     1 
HETATM 3335 O  O     . HOH N 11 .   ? 7.229   18.728  -21.557 1.00 29.69 ? 1019 HOH A O     1 
HETATM 3336 O  O     . HOH N 11 .   ? 12.407  5.221   7.201   1.00 28.39 ? 1020 HOH A O     1 
HETATM 3337 O  O     . HOH N 11 .   ? -12.152 -20.717 -2.779  1.00 28.50 ? 1021 HOH A O     1 
HETATM 3338 O  O     . HOH N 11 .   ? 9.942   3.142   9.625   1.00 30.79 ? 1022 HOH A O     1 
HETATM 3339 O  O     . HOH N 11 .   ? 13.352  -31.315 -17.848 1.00 26.24 ? 1023 HOH A O     1 
HETATM 3340 O  O     . HOH N 11 .   ? 10.230  -12.187 -1.991  1.00 32.79 ? 1024 HOH A O     1 
HETATM 3341 O  O     . HOH N 11 .   ? 28.357  9.114   -21.424 1.00 32.78 ? 1025 HOH A O     1 
HETATM 3342 O  O     . HOH N 11 .   ? 11.175  -25.202 -26.155 1.00 23.05 ? 1026 HOH A O     1 
HETATM 3343 O  O     . HOH N 11 .   ? 13.047  -3.823  -1.289  1.00 30.99 ? 1027 HOH A O     1 
HETATM 3344 O  O     . HOH N 11 .   ? -19.614 -16.923 -13.147 1.00 29.02 ? 1028 HOH A O     1 
HETATM 3345 O  O     . HOH N 11 .   ? -11.918 -5.118  -24.068 1.00 33.57 ? 1029 HOH A O     1 
HETATM 3346 O  O     . HOH N 11 .   ? 11.382  -8.875  -14.634 1.00 28.28 ? 1030 HOH A O     1 
HETATM 3347 O  O     . HOH N 11 .   ? 14.956  -9.810  -26.650 1.00 29.52 ? 1031 HOH A O     1 
HETATM 3348 O  O     . HOH N 11 .   ? -17.385 -20.152 -8.435  1.00 24.89 ? 1032 HOH A O     1 
HETATM 3349 O  O     . HOH N 11 .   ? 2.719   -19.812 2.170   1.00 35.80 ? 1033 HOH A O     1 
HETATM 3350 O  O     . HOH N 11 .   ? -3.680  -19.270 2.480   1.00 30.19 ? 1034 HOH A O     1 
HETATM 3351 O  O     . HOH N 11 .   ? 14.168  -33.592 -18.523 1.00 36.20 ? 1035 HOH A O     1 
HETATM 3352 O  O     . HOH N 11 .   ? -11.187 -7.992  3.056   1.00 32.18 ? 1036 HOH A O     1 
HETATM 3353 O  O     . HOH N 11 .   ? 30.999  -5.245  -19.155 1.00 32.21 ? 1037 HOH A O     1 
HETATM 3354 O  O     . HOH N 11 .   ? -4.307  -24.666 -15.853 1.00 33.37 ? 1038 HOH A O     1 
HETATM 3355 O  O     . HOH N 11 .   ? -3.360  -0.784  6.957   1.00 28.06 ? 1039 HOH A O     1 
HETATM 3356 O  O     . HOH N 11 .   ? 20.847  -24.572 -6.888  1.00 36.67 ? 1040 HOH A O     1 
HETATM 3357 O  O     . HOH N 11 .   ? 28.531  3.524   -19.772 1.00 30.73 ? 1041 HOH A O     1 
HETATM 3358 O  O     . HOH N 11 .   ? -22.779 -10.827 -6.892  1.00 33.04 ? 1042 HOH A O     1 
HETATM 3359 O  O     A HOH N 11 .   ? 8.122   -9.620  -10.268 0.50 14.97 ? 1043 HOH A O     1 
HETATM 3360 O  O     B HOH N 11 .   ? 8.610   -9.731  -12.129 0.50 19.47 ? 1043 HOH A O     1 
HETATM 3361 O  O     . HOH N 11 .   ? 24.837  4.487   -28.156 1.00 32.38 ? 1044 HOH A O     1 
HETATM 3362 O  O     . HOH N 11 .   ? 12.242  -29.078 -18.991 1.00 30.36 ? 1045 HOH A O     1 
HETATM 3363 O  O     . HOH N 11 .   ? -16.509 -21.445 -1.677  1.00 30.75 ? 1046 HOH A O     1 
HETATM 3364 O  O     . HOH N 11 .   ? -5.026  -15.546 4.872   1.00 29.45 ? 1047 HOH A O     1 
HETATM 3365 O  O     . HOH N 11 .   ? 18.456  -10.334 -23.611 1.00 25.91 ? 1048 HOH A O     1 
HETATM 3366 O  O     . HOH N 11 .   ? 8.283   -3.714  9.547   1.00 32.55 ? 1049 HOH A O     1 
HETATM 3367 O  O     . HOH N 11 .   ? -13.773 0.567   -17.643 1.00 29.86 ? 1050 HOH A O     1 
HETATM 3368 O  O     A HOH N 11 .   ? 16.331  17.105  -12.978 0.60 15.48 ? 1051 HOH A O     1 
HETATM 3369 O  O     B HOH N 11 .   ? 17.231  18.717  -13.848 0.40 22.24 ? 1051 HOH A O     1 
HETATM 3370 O  O     . HOH N 11 .   ? -21.031 -15.731 -10.037 1.00 32.14 ? 1052 HOH A O     1 
HETATM 3371 O  O     . HOH N 11 .   ? 10.218  7.974   -28.133 1.00 36.09 ? 1053 HOH A O     1 
HETATM 3372 O  O     . HOH N 11 .   ? -10.158 -22.897 -13.197 1.00 35.49 ? 1054 HOH A O     1 
HETATM 3373 O  O     . HOH N 11 .   ? 11.094  1.119   -13.664 1.00 30.55 ? 1055 HOH A O     1 
HETATM 3374 O  O     . HOH N 11 .   ? 14.307  -9.794  -6.863  1.00 30.38 ? 1056 HOH A O     1 
HETATM 3375 O  O     . HOH N 11 .   ? -12.422 -6.457  -26.121 1.00 37.98 ? 1057 HOH A O     1 
HETATM 3376 O  O     . HOH N 11 .   ? -14.301 -12.189 -25.225 1.00 27.24 ? 1058 HOH A O     1 
HETATM 3377 O  O     A HOH N 11 .   ? -3.846  21.089  -5.935  0.50 16.72 ? 1059 HOH A O     1 
HETATM 3378 O  O     B HOH N 11 .   ? -4.835  23.013  -5.207  0.50 15.12 ? 1059 HOH A O     1 
HETATM 3379 O  O     . HOH N 11 .   ? 2.460   -11.710 4.986   1.00 24.31 ? 1060 HOH A O     1 
HETATM 3380 O  O     . HOH N 11 .   ? 8.842   -3.540  -19.743 1.00 33.17 ? 1061 HOH A O     1 
HETATM 3381 O  O     . HOH N 11 .   ? -20.314 -2.777  -10.476 1.00 27.58 ? 1062 HOH A O     1 
HETATM 3382 O  O     . HOH N 11 .   ? 10.116  -5.529  -16.739 1.00 31.78 ? 1063 HOH A O     1 
HETATM 3383 O  O     . HOH N 11 .   ? 7.968   -4.837  -24.220 1.00 31.77 ? 1064 HOH A O     1 
HETATM 3384 O  O     . HOH N 11 .   ? 10.115  -30.993 -7.317  1.00 28.61 ? 1065 HOH A O     1 
HETATM 3385 O  O     . HOH N 11 .   ? 2.816   -29.862 -14.405 0.50 23.75 ? 1066 HOH A O     1 
HETATM 3386 O  O     A HOH N 11 .   ? 27.308  -21.619 -16.530 0.50 16.94 ? 1067 HOH A O     1 
HETATM 3387 O  O     B HOH N 11 .   ? 26.458  -21.069 -18.048 0.50 16.58 ? 1067 HOH A O     1 
HETATM 3388 O  O     . HOH N 11 .   ? 12.355  2.491   -7.749  0.50 20.09 ? 1068 HOH A O     1 
HETATM 3389 O  O     . HOH N 11 .   ? 24.447  7.392   -13.165 1.00 21.56 ? 1069 HOH A O     1 
HETATM 3390 O  O     . HOH N 11 .   ? 11.482  -2.378  -2.838  1.00 24.93 ? 1070 HOH A O     1 
HETATM 3391 O  O     . HOH N 11 .   ? 13.396  -3.710  6.088   1.00 33.81 ? 1071 HOH A O     1 
HETATM 3392 O  O     . HOH N 11 .   ? -20.464 9.979   5.270   1.00 24.65 ? 1072 HOH A O     1 
HETATM 3393 O  O     . HOH N 11 .   ? -9.091  4.410   -12.173 1.00 12.92 ? 1073 HOH A O     1 
HETATM 3394 O  O     . HOH N 11 .   ? -10.405 3.419   -9.731  1.00 17.35 ? 1074 HOH A O     1 
HETATM 3395 O  O     . HOH N 11 .   ? -8.350  1.809   -10.603 1.00 10.67 ? 1075 HOH A O     1 
HETATM 3396 O  O     . HOH N 11 .   ? -12.410 1.378   -10.100 1.00 11.66 ? 1076 HOH A O     1 
HETATM 3397 O  O     . HOH N 11 .   ? -11.586 11.913  -7.762  1.00 14.78 ? 1077 HOH A O     1 
HETATM 3398 O  O     . HOH N 11 .   ? 19.733  13.899  9.947   1.00 31.43 ? 1078 HOH A O     1 
HETATM 3399 O  O     . HOH N 11 .   ? 17.934  19.564  10.195  1.00 23.10 ? 1079 HOH A O     1 
HETATM 3400 O  O     . HOH N 11 .   ? -10.427 -10.050 0.183   1.00 19.69 ? 1080 HOH A O     1 
HETATM 3401 O  O     . HOH N 11 .   ? -17.594 -3.054  -21.616 1.00 35.77 ? 1081 HOH A O     1 
HETATM 3402 O  O     . HOH N 11 .   ? 7.996   -27.540 -22.303 0.50 19.08 ? 1082 HOH A O     1 
HETATM 3403 O  O     A HOH N 11 .   ? 26.072  5.217   -14.553 0.60 22.11 ? 1083 HOH A O     1 
HETATM 3404 O  O     B HOH N 11 .   ? 25.796  4.246   -16.527 0.40 17.09 ? 1083 HOH A O     1 
HETATM 3405 O  O     . HOH N 11 .   ? -12.852 -7.208  -0.769  1.00 11.22 ? 1084 HOH A O     1 
HETATM 3406 O  O     . HOH N 11 .   ? -10.153 21.267  -5.703  1.00 31.57 ? 1085 HOH A O     1 
HETATM 3407 O  O     . HOH N 11 .   ? -1.810  14.650  -9.119  1.00 30.21 ? 1086 HOH A O     1 
HETATM 3408 O  O     . HOH N 11 .   ? 5.314   -1.625  -13.638 1.00 30.58 ? 1087 HOH A O     1 
HETATM 3409 O  O     . HOH N 11 .   ? -15.358 -20.686 -7.046  1.00 32.37 ? 1088 HOH A O     1 
HETATM 3410 O  O     . HOH N 11 .   ? -3.883  -19.863 -0.313  1.00 29.09 ? 1089 HOH A O     1 
HETATM 3411 O  O     . HOH N 11 .   ? 11.344  -11.391 0.378   1.00 36.19 ? 1090 HOH A O     1 
HETATM 3412 O  O     . HOH N 11 .   ? -16.009 -1.357  -20.349 1.00 37.25 ? 1091 HOH A O     1 
HETATM 3413 O  O     . HOH N 11 .   ? 6.890   -5.883  -16.992 0.50 14.82 ? 1092 HOH A O     1 
HETATM 3414 O  O     . HOH N 11 .   ? -0.122  -24.884 -3.680  1.00 33.64 ? 1093 HOH A O     1 
HETATM 3415 O  O     . HOH N 11 .   ? 8.398   -10.956 -29.580 1.00 31.96 ? 1094 HOH A O     1 
HETATM 3416 O  O     . HOH N 11 .   ? 6.551   -9.765  -28.443 1.00 29.36 ? 1095 HOH A O     1 
HETATM 3417 O  O     . HOH N 11 .   ? 6.375   -7.359  -28.225 1.00 31.98 ? 1096 HOH A O     1 
HETATM 3418 O  O     . HOH N 11 .   ? 14.131  -0.023  -13.915 1.00 26.17 ? 1097 HOH A O     1 
HETATM 3419 O  O     . HOH N 11 .   ? 28.612  10.622  -16.817 1.00 32.72 ? 1098 HOH A O     1 
HETATM 3420 O  O     . HOH N 11 .   ? 11.900  -0.533  10.153  1.00 31.14 ? 1099 HOH A O     1 
HETATM 3421 O  O     . HOH N 11 .   ? -4.123  4.745   10.177  1.00 34.63 ? 1100 HOH A O     1 
HETATM 3422 O  O     . HOH N 11 .   ? -8.501  11.872  10.272  1.00 43.10 ? 1101 HOH A O     1 
HETATM 3423 O  O     . HOH N 11 .   ? -13.592 7.769   7.613   1.00 34.81 ? 1102 HOH A O     1 
HETATM 3424 O  O     . HOH N 11 .   ? -12.516 0.966   6.063   1.00 35.49 ? 1103 HOH A O     1 
HETATM 3425 O  O     . HOH N 11 .   ? -5.792  19.337  -7.414  1.00 35.31 ? 1104 HOH A O     1 
HETATM 3426 O  O     . HOH N 11 .   ? -11.678 10.992  -13.246 1.00 29.83 ? 1105 HOH A O     1 
HETATM 3427 O  O     . HOH N 11 .   ? 8.554   19.907  8.836   1.00 32.95 ? 1106 HOH A O     1 
HETATM 3428 O  O     . HOH N 11 .   ? 16.853  11.849  4.791   1.00 31.97 ? 1107 HOH A O     1 
HETATM 3429 O  O     . HOH N 11 .   ? 8.893   -12.964 -5.024  1.00 31.09 ? 1108 HOH A O     1 
HETATM 3430 O  O     . HOH N 11 .   ? 7.770   -1.264  -20.813 1.00 33.09 ? 1109 HOH A O     1 
HETATM 3431 O  O     . HOH N 11 .   ? -7.595  -17.246 2.707   1.00 30.04 ? 1110 HOH A O     1 
HETATM 3432 O  O     . HOH N 11 .   ? 15.523  -30.077 -1.764  1.00 29.27 ? 1111 HOH A O     1 
HETATM 3433 O  O     . HOH N 11 .   ? 21.062  -15.561 -6.875  1.00 31.11 ? 1112 HOH A O     1 
HETATM 3434 O  O     . HOH N 11 .   ? 22.903  -13.000 -7.597  1.00 40.88 ? 1113 HOH A O     1 
HETATM 3435 O  O     . HOH N 11 .   ? 30.131  4.191   -23.460 1.00 37.00 ? 1114 HOH A O     1 
HETATM 3436 O  O     . HOH N 11 .   ? 5.094   20.913  -17.705 1.00 29.22 ? 1115 HOH A O     1 
HETATM 3437 O  O     . HOH N 11 .   ? -21.141 -1.753  -12.173 1.00 44.25 ? 1116 HOH A O     1 
HETATM 3438 O  O     . HOH N 11 .   ? -14.082 0.918   2.543   1.00 30.43 ? 1117 HOH A O     1 
HETATM 3439 O  O     . HOH N 11 .   ? -8.592  -0.522  -15.241 1.00 10.53 ? 1118 HOH A O     1 
HETATM 3440 O  O     . HOH N 11 .   ? 2.440   9.753   -15.888 1.00 23.28 ? 1119 HOH A O     1 
HETATM 3441 O  O     . HOH O 11 .   ? 0.584   -15.327 -23.739 1.00 9.11  ? 101  HOH T O     1 
HETATM 3442 O  O     . HOH O 11 .   ? -3.105  12.836  -11.467 1.00 17.34 ? 102  HOH T O     1 
HETATM 3443 O  O     . HOH O 11 .   ? -0.432  -12.822 -19.238 1.00 10.65 ? 103  HOH T O     1 
HETATM 3444 O  O     . HOH O 11 .   ? 2.794   -13.421 -32.621 1.00 21.52 ? 104  HOH T O     1 
HETATM 3445 O  O     . HOH O 11 .   ? 3.786   -11.121 -31.727 1.00 27.59 ? 105  HOH T O     1 
HETATM 3446 O  O     . HOH O 11 .   ? -4.528  7.224   -22.597 1.00 23.50 ? 106  HOH T O     1 
HETATM 3447 O  O     . HOH O 11 .   ? -1.302  -16.656 -25.454 1.00 21.26 ? 107  HOH T O     1 
HETATM 3448 O  O     . HOH O 11 .   ? -2.772  -19.464 -34.141 1.00 28.25 ? 108  HOH T O     1 
HETATM 3449 O  O     . HOH O 11 .   ? -5.120  -4.483  -23.577 1.00 22.18 ? 109  HOH T O     1 
HETATM 3450 O  O     . HOH O 11 .   ? -7.366  -5.399  -24.169 1.00 26.41 ? 110  HOH T O     1 
HETATM 3451 O  O     . HOH O 11 .   ? 4.870   -18.325 -32.857 1.00 22.28 ? 111  HOH T O     1 
HETATM 3452 O  O     . HOH O 11 .   ? -5.964  8.393   -20.712 1.00 23.84 ? 112  HOH T O     1 
HETATM 3453 O  O     . HOH O 11 .   ? -7.353  10.863  -18.058 1.00 28.85 ? 113  HOH T O     1 
HETATM 3454 O  O     . HOH O 11 .   ? -1.225  -9.190  -27.787 1.00 21.77 ? 114  HOH T O     1 
HETATM 3455 O  O     . HOH O 11 .   ? 1.914   -4.454  -20.338 1.00 19.28 ? 115  HOH T O     1 
HETATM 3456 O  O     . HOH O 11 .   ? -8.440  7.316   -20.333 1.00 28.64 ? 116  HOH T O     1 
HETATM 3457 O  O     . HOH O 11 .   ? -0.877  -7.180  -23.942 1.00 22.50 ? 117  HOH T O     1 
HETATM 3458 O  O     . HOH O 11 .   ? -4.126  -17.948 -30.793 1.00 22.60 ? 118  HOH T O     1 
HETATM 3459 O  O     . HOH O 11 .   ? -3.413  0.124   -23.008 1.00 24.08 ? 119  HOH T O     1 
HETATM 3460 O  O     . HOH O 11 .   ? -4.926  -1.471  -24.077 1.00 32.08 ? 120  HOH T O     1 
HETATM 3461 O  O     . HOH O 11 .   ? -7.236  -0.149  -22.946 1.00 24.47 ? 121  HOH T O     1 
HETATM 3462 O  O     . HOH O 11 .   ? -0.654  0.921   -22.871 1.00 25.20 ? 122  HOH T O     1 
HETATM 3463 O  O     . HOH O 11 .   ? -5.684  -17.684 -32.479 1.00 26.87 ? 123  HOH T O     1 
HETATM 3464 O  O     . HOH O 11 .   ? -4.227  -17.528 -27.906 1.00 29.12 ? 124  HOH T O     1 
HETATM 3465 O  O     . HOH O 11 .   ? 0.239   -7.611  -26.567 1.00 30.49 ? 125  HOH T O     1 
HETATM 3466 O  O     . HOH O 11 .   ? -9.443  -3.734  -23.781 1.00 31.70 ? 126  HOH T O     1 
HETATM 3467 O  O     . HOH O 11 .   ? 4.980   -15.211 -32.217 1.00 29.32 ? 127  HOH T O     1 
HETATM 3468 O  O     . HOH O 11 .   ? -6.070  -11.377 -22.700 0.50 10.91 ? 128  HOH T O     1 
HETATM 3469 O  O     . HOH O 11 .   ? -3.427  -6.626  -24.399 1.00 30.35 ? 129  HOH T O     1 
HETATM 3470 O  O     . HOH P 11 .   ? 8.030   2.733   -22.983 1.00 16.86 ? 101  HOH P O     1 
HETATM 3471 O  O     . HOH P 11 .   ? 4.586   11.812  -21.567 1.00 17.04 ? 102  HOH P O     1 
HETATM 3472 O  O     . HOH P 11 .   ? 7.244   11.478  -20.960 1.00 17.30 ? 103  HOH P O     1 
HETATM 3473 O  O     . HOH P 11 .   ? 0.406   3.400   -22.920 1.00 21.90 ? 104  HOH P O     1 
HETATM 3474 O  O     . HOH P 11 .   ? 9.150   3.025   -15.631 1.00 19.82 ? 105  HOH P O     1 
HETATM 3475 O  O     . HOH P 11 .   ? 7.347   2.385   -12.938 1.00 23.94 ? 106  HOH P O     1 
HETATM 3476 O  O     . HOH P 11 .   ? 5.433   2.509   -15.465 1.00 26.14 ? 107  HOH P O     1 
HETATM 3477 O  O     . HOH P 11 .   ? 5.047   4.586   -24.382 1.00 22.80 ? 108  HOH P O     1 
HETATM 3478 O  O     . HOH P 11 .   ? 2.903   4.087   -22.957 1.00 25.33 ? 109  HOH P O     1 
HETATM 3479 O  O     . HOH P 11 .   ? 3.741   0.882   -15.805 1.00 25.93 ? 110  HOH P O     1 
HETATM 3480 O  O     . HOH P 11 .   ? 2.887   0.605   -20.588 1.00 25.85 ? 111  HOH P O     1 
HETATM 3481 O  O     . HOH P 11 .   ? 7.977   4.864   -12.620 1.00 23.78 ? 112  HOH P O     1 
HETATM 3482 O  O     . HOH P 11 .   ? 9.982   1.159   -17.676 1.00 33.36 ? 113  HOH P O     1 
HETATM 3483 O  O     . HOH P 11 .   ? -2.643  5.002   -14.611 1.00 10.92 ? 114  HOH P O     1 
HETATM 3484 O  O     . HOH P 11 .   ? 4.690   13.704  -23.496 0.50 18.20 ? 115  HOH P O     1 
HETATM 3485 O  O     . HOH Q 11 .   ? 2.190   -19.019 -23.298 1.00 16.72 ? 101  HOH D O     1 
HETATM 3486 O  O     . HOH Q 11 .   ? 11.237  -19.337 -29.359 1.00 31.10 ? 102  HOH D O     1 
HETATM 3487 O  O     . HOH Q 11 .   ? -4.152  -21.171 -28.932 1.00 24.82 ? 103  HOH D O     1 
HETATM 3488 O  O     . HOH Q 11 .   ? -5.137  -23.683 -18.796 1.00 32.53 ? 104  HOH D O     1 
HETATM 3489 O  O     . HOH Q 11 .   ? 6.488   -26.954 -20.534 1.00 25.06 ? 105  HOH D O     1 
HETATM 3490 O  O     . HOH Q 11 .   ? 6.108   -22.926 -29.903 1.00 19.78 ? 106  HOH D O     1 
HETATM 3491 O  O     . HOH Q 11 .   ? 4.052   -25.443 -29.880 1.00 25.57 ? 107  HOH D O     1 
HETATM 3492 O  O     . HOH Q 11 .   ? 2.469   -26.455 -20.692 1.00 22.54 ? 108  HOH D O     1 
HETATM 3493 O  O     . HOH Q 11 .   ? 2.403   -26.552 -27.784 1.00 24.73 ? 109  HOH D O     1 
HETATM 3494 O  O     . HOH Q 11 .   ? -6.287  -22.393 -27.779 1.00 28.15 ? 110  HOH D O     1 
HETATM 3495 O  O     . HOH Q 11 .   ? 5.532   -25.221 -26.385 1.00 28.35 ? 111  HOH D O     1 
HETATM 3496 O  O     . HOH Q 11 .   ? -1.465  -19.457 -25.181 1.00 26.91 ? 112  HOH D O     1 
HETATM 3497 O  O     A HOH Q 11 .   ? -0.758  -27.178 -24.075 0.50 20.84 ? 113  HOH D O     1 
HETATM 3498 O  O     . HOH Q 11 .   ? 9.206   -22.973 -26.946 0.50 16.24 ? 114  HOH D O     1 
HETATM 3499 O  O     . HOH Q 11 .   ? 13.196  -21.444 -27.260 0.50 19.05 ? 115  HOH D O     1 
HETATM 3500 O  O     . HOH Q 11 .   ? 14.673  -18.498 -30.799 1.00 33.72 ? 116  HOH D O     1 
HETATM 3501 O  O     . HOH Q 11 .   ? 17.257  -16.845 -27.657 1.00 34.03 ? 117  HOH D O     1 
HETATM 3502 O  O     B HOH Q 11 .   ? -3.110  -22.755 -20.720 0.50 19.12 ? 118  HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   127 ?   ?   ?   A . n 
A 1 2   SER 2   128 ?   ?   ?   A . n 
A 1 3   ALA 3   129 ?   ?   ?   A . n 
A 1 4   ALA 4   130 ?   ?   ?   A . n 
A 1 5   ALA 5   131 ?   ?   ?   A . n 
A 1 6   PRO 6   132 ?   ?   ?   A . n 
A 1 7   LEU 7   133 ?   ?   ?   A . n 
A 1 8   SER 8   134 ?   ?   ?   A . n 
A 1 9   PRO 9   135 ?   ?   ?   A . n 
A 1 10  ALA 10  136 ?   ?   ?   A . n 
A 1 11  TRP 11  137 137 TRP TRP A . n 
A 1 12  MET 12  138 138 MET MET A . n 
A 1 13  PRO 13  139 139 PRO PRO A . n 
A 1 14  ALA 14  140 140 ALA ALA A . n 
A 1 15  TYR 15  141 141 TYR TYR A . n 
A 1 16  ALA 16  142 142 ALA ALA A . n 
A 1 17  CYS 17  143 143 CYS CYS A . n 
A 1 18  GLN 18  144 144 GLN GLN A . n 
A 1 19  ARG 19  145 145 ARG ARG A . n 
A 1 20  PRO 20  146 146 PRO PRO A . n 
A 1 21  THR 21  147 147 THR THR A . n 
A 1 22  PRO 22  148 148 PRO PRO A . n 
A 1 23  LEU 23  149 149 LEU LEU A . n 
A 1 24  THR 24  150 150 THR THR A . n 
A 1 25  HIS 25  151 151 HIS HIS A . n 
A 1 26  HIS 26  152 152 HIS HIS A . n 
A 1 27  ASN 27  153 153 ASN ASN A . n 
A 1 28  THR 28  154 154 THR THR A . n 
A 1 29  GLY 29  155 155 GLY GLY A . n 
A 1 30  LEU 30  156 156 LEU LEU A . n 
A 1 31  SER 31  157 157 SER SER A . n 
A 1 32  GLU 32  158 158 GLU GLU A . n 
A 1 33  ALA 33  159 159 ALA ALA A . n 
A 1 34  LEU 34  160 160 LEU LEU A . n 
A 1 35  GLU 35  161 161 GLU GLU A . n 
A 1 36  ILE 36  162 162 ILE ILE A . n 
A 1 37  LEU 37  163 163 LEU LEU A . n 
A 1 38  ALA 38  164 164 ALA ALA A . n 
A 1 39  GLU 39  165 165 GLU GLU A . n 
A 1 40  ALA 40  166 166 ALA ALA A . n 
A 1 41  ALA 41  167 167 ALA ALA A . n 
A 1 42  GLY 42  168 168 GLY GLY A . n 
A 1 43  PHE 43  169 169 PHE PHE A . n 
A 1 44  GLU 44  170 170 GLU GLU A . n 
A 1 45  GLY 45  171 171 GLY GLY A . n 
A 1 46  SER 46  172 172 SER SER A . n 
A 1 47  GLU 47  173 173 GLU GLU A . n 
A 1 48  GLY 48  174 174 GLY GLY A . n 
A 1 49  ARG 49  175 175 ARG ARG A . n 
A 1 50  LEU 50  176 176 LEU LEU A . n 
A 1 51  LEU 51  177 177 LEU LEU A . n 
A 1 52  THR 52  178 178 THR THR A . n 
A 1 53  PHE 53  179 179 PHE PHE A . n 
A 1 54  CYS 54  180 180 CYS CYS A . n 
A 1 55  ARG 55  181 181 ARG ARG A . n 
A 1 56  ALA 56  182 182 ALA ALA A . n 
A 1 57  ALA 57  183 183 ALA ALA A . n 
A 1 58  SER 58  184 184 SER SER A . n 
A 1 59  VAL 59  185 185 VAL VAL A . n 
A 1 60  LEU 60  186 186 LEU LEU A . n 
A 1 61  LYS 61  187 187 LYS LYS A . n 
A 1 62  ALA 62  188 188 ALA ALA A . n 
A 1 63  LEU 63  189 189 LEU LEU A . n 
A 1 64  PRO 64  190 190 PRO PRO A . n 
A 1 65  SER 65  191 191 SER SER A . n 
A 1 66  PRO 66  192 192 PRO PRO A . n 
A 1 67  VAL 67  193 193 VAL VAL A . n 
A 1 68  THR 68  194 194 THR THR A . n 
A 1 69  THR 69  195 195 THR THR A . n 
A 1 70  LEU 70  196 196 LEU LEU A . n 
A 1 71  SER 71  197 197 SER SER A . n 
A 1 72  GLN 72  198 198 GLN GLN A . n 
A 1 73  LEU 73  199 199 LEU LEU A . n 
A 1 74  GLN 74  200 200 GLN GLN A . n 
A 1 75  GLY 75  201 201 GLY GLY A . n 
A 1 76  LEU 76  202 202 LEU LEU A . n 
A 1 77  PRO 77  203 203 PRO PRO A . n 
A 1 78  HIS 78  204 204 HIS HIS A . n 
A 1 79  PHE 79  205 205 PHE PHE A . n 
A 1 80  GLY 80  206 206 GLY GLY A . n 
A 1 81  GLU 81  207 207 GLU GLU A . n 
A 1 82  HIS 82  208 208 HIS HIS A . n 
A 1 83  SER 83  209 209 SER SER A . n 
A 1 84  SER 84  210 210 SER SER A . n 
A 1 85  ARG 85  211 211 ARG ARG A . n 
A 1 86  VAL 86  212 212 VAL VAL A . n 
A 1 87  VAL 87  213 213 VAL VAL A . n 
A 1 88  GLN 88  214 214 GLN GLN A . n 
A 1 89  GLU 89  215 215 GLU GLU A . n 
A 1 90  LEU 90  216 216 LEU LEU A . n 
A 1 91  LEU 91  217 217 LEU LEU A . n 
A 1 92  GLU 92  218 218 GLU GLU A . n 
A 1 93  HIS 93  219 219 HIS HIS A . n 
A 1 94  GLY 94  220 220 GLY GLY A . n 
A 1 95  VAL 95  221 221 VAL VAL A . n 
A 1 96  CYS 96  222 222 CYS CYS A . n 
A 1 97  GLU 97  223 223 GLU GLU A . n 
A 1 98  GLU 98  224 224 GLU GLU A . n 
A 1 99  VAL 99  225 225 VAL VAL A . n 
A 1 100 GLU 100 226 226 GLU GLU A . n 
A 1 101 ARG 101 227 227 ARG ARG A . n 
A 1 102 VAL 102 228 228 VAL VAL A . n 
A 1 103 ARG 103 229 229 ARG ARG A . n 
A 1 104 ARG 104 230 230 ARG ARG A . n 
A 1 105 SER 105 231 231 SER SER A . n 
A 1 106 GLU 106 232 232 GLU GLU A . n 
A 1 107 ARG 107 233 233 ARG ARG A . n 
A 1 108 TYR 108 234 234 TYR TYR A . n 
A 1 109 GLN 109 235 235 GLN GLN A . n 
A 1 110 THR 110 236 236 THR THR A . n 
A 1 111 MET 111 237 237 MET MET A . n 
A 1 112 LYS 112 238 238 LYS LYS A . n 
A 1 113 LEU 113 239 239 LEU LEU A . n 
A 1 114 PHE 114 240 240 PHE PHE A . n 
A 1 115 THR 115 241 241 THR THR A . n 
A 1 116 GLN 116 242 242 GLN GLN A . n 
A 1 117 ILE 117 243 243 ILE ILE A . n 
A 1 118 PHE 118 244 244 PHE PHE A . n 
A 1 119 GLY 119 245 245 GLY GLY A . n 
A 1 120 VAL 120 246 246 VAL VAL A . n 
A 1 121 GLY 121 247 247 GLY GLY A . n 
A 1 122 VAL 122 248 248 VAL VAL A . n 
A 1 123 LYS 123 249 249 LYS LYS A . n 
A 1 124 THR 124 250 250 THR THR A . n 
A 1 125 ALA 125 251 251 ALA ALA A . n 
A 1 126 ASP 126 252 252 ASP ASP A . n 
A 1 127 ARG 127 253 253 ARG ARG A . n 
A 1 128 TRP 128 254 254 TRP TRP A . n 
A 1 129 TYR 129 255 255 TYR TYR A . n 
A 1 130 ARG 130 256 256 ARG ARG A . n 
A 1 131 GLU 131 257 257 GLU GLU A . n 
A 1 132 GLY 132 258 258 GLY GLY A . n 
A 1 133 LEU 133 259 259 LEU LEU A . n 
A 1 134 ARG 134 260 260 ARG ARG A . n 
A 1 135 THR 135 261 261 THR THR A . n 
A 1 136 LEU 136 262 262 LEU LEU A . n 
A 1 137 ASP 137 263 263 ASP ASP A . n 
A 1 138 ASP 138 264 264 ASP ASP A . n 
A 1 139 LEU 139 265 265 LEU LEU A . n 
A 1 140 ARG 140 266 266 ARG ARG A . n 
A 1 141 GLU 141 267 267 GLU GLU A . n 
A 1 142 GLN 142 268 268 GLN GLN A . n 
A 1 143 PRO 143 269 269 PRO PRO A . n 
A 1 144 GLN 144 270 270 GLN GLN A . n 
A 1 145 LYS 145 271 271 LYS LYS A . n 
A 1 146 LEU 146 272 272 LEU LEU A . n 
A 1 147 THR 147 273 273 THR THR A . n 
A 1 148 GLN 148 274 274 GLN GLN A . n 
A 1 149 GLN 149 275 275 GLN GLN A . n 
A 1 150 GLN 150 276 276 GLN GLN A . n 
A 1 151 LYS 151 277 277 LYS LYS A . n 
A 1 152 ALA 152 278 278 ALA ALA A . n 
A 1 153 GLY 153 279 279 GLY GLY A . n 
A 1 154 LEU 154 280 280 LEU LEU A . n 
A 1 155 GLN 155 281 281 GLN GLN A . n 
A 1 156 HIS 156 282 282 HIS HIS A . n 
A 1 157 HIS 157 283 283 HIS HIS A . n 
A 1 158 GLN 158 284 284 GLN GLN A . n 
A 1 159 ASP 159 285 285 ASP ASP A . n 
A 1 160 LEU 160 286 286 LEU LEU A . n 
A 1 161 SER 161 287 287 SER SER A . n 
A 1 162 THR 162 288 288 THR THR A . n 
A 1 163 PRO 163 289 289 PRO PRO A . n 
A 1 164 VAL 164 290 290 VAL VAL A . n 
A 1 165 LEU 165 291 291 LEU LEU A . n 
A 1 166 ARG 166 292 292 ARG ARG A . n 
A 1 167 SER 167 293 293 SER SER A . n 
A 1 168 ASP 168 294 294 ASP ASP A . n 
A 1 169 VAL 169 295 295 VAL VAL A . n 
A 1 170 ASP 170 296 296 ASP ASP A . n 
A 1 171 ALA 171 297 297 ALA ALA A . n 
A 1 172 LEU 172 298 298 LEU LEU A . n 
A 1 173 GLN 173 299 299 GLN GLN A . n 
A 1 174 GLN 174 300 300 GLN GLN A . n 
A 1 175 VAL 175 301 301 VAL VAL A . n 
A 1 176 VAL 176 302 302 VAL VAL A . n 
A 1 177 GLU 177 303 303 GLU GLU A . n 
A 1 178 GLU 178 304 304 GLU GLU A . n 
A 1 179 ALA 179 305 305 ALA ALA A . n 
A 1 180 VAL 180 306 306 VAL VAL A . n 
A 1 181 GLY 181 307 307 GLY GLY A . n 
A 1 182 GLN 182 308 308 GLN GLN A . n 
A 1 183 ALA 183 309 309 ALA ALA A . n 
A 1 184 LEU 184 310 310 LEU LEU A . n 
A 1 185 PRO 185 311 311 PRO PRO A . n 
A 1 186 GLY 186 312 312 GLY GLY A . n 
A 1 187 ALA 187 313 313 ALA ALA A . n 
A 1 188 THR 188 314 314 THR THR A . n 
A 1 189 VAL 189 315 315 VAL VAL A . n 
A 1 190 THR 190 316 316 THR THR A . n 
A 1 191 LEU 191 317 317 LEU LEU A . n 
A 1 192 THR 192 318 318 THR THR A . n 
A 1 193 GLY 193 319 319 GLY GLY A . n 
A 1 194 GLY 194 320 320 GLY GLY A . n 
A 1 195 PHE 195 321 321 PHE PHE A . n 
A 1 196 ARG 196 322 322 ARG ARG A . n 
A 1 197 ARG 197 323 323 ARG ARG A . n 
A 1 198 GLY 198 324 324 GLY GLY A . n 
A 1 199 LYS 199 325 325 LYS LYS A . n 
A 1 200 LEU 200 326 326 LEU LEU A . n 
A 1 201 GLN 201 327 327 GLN GLN A . n 
A 1 202 GLY 202 328 328 GLY GLY A . n 
A 1 203 HIS 203 329 329 HIS HIS A . n 
A 1 204 ASP 204 330 330 ASP ASP A . n 
A 1 205 VAL 205 331 331 VAL VAL A . n 
A 1 206 ASP 206 332 332 ASP ASP A . n 
A 1 207 PHE 207 333 333 PHE PHE A . n 
A 1 208 LEU 208 334 334 LEU LEU A . n 
A 1 209 ILE 209 335 335 ILE ILE A . n 
A 1 210 THR 210 336 336 THR THR A . n 
A 1 211 HIS 211 337 337 HIS HIS A . n 
A 1 212 PRO 212 338 338 PRO PRO A . n 
A 1 213 LYS 213 339 339 LYS LYS A . n 
A 1 214 GLU 214 340 340 GLU GLU A . n 
A 1 215 GLY 215 341 341 GLY GLY A . n 
A 1 216 GLN 216 342 342 GLN GLN A . n 
A 1 217 GLU 217 343 343 GLU GLU A . n 
A 1 218 ALA 218 344 344 ALA ALA A . n 
A 1 219 GLY 219 345 345 GLY GLY A . n 
A 1 220 LEU 220 346 346 LEU LEU A . n 
A 1 221 LEU 221 347 347 LEU LEU A . n 
A 1 222 PRO 222 348 348 PRO PRO A . n 
A 1 223 ARG 223 349 349 ARG ARG A . n 
A 1 224 VAL 224 350 350 VAL VAL A . n 
A 1 225 MET 225 351 351 MET MET A . n 
A 1 226 CYS 226 352 352 CYS CYS A . n 
A 1 227 ARG 227 353 353 ARG ARG A . n 
A 1 228 LEU 228 354 354 LEU LEU A . n 
A 1 229 GLN 229 355 355 GLN GLN A . n 
A 1 230 ASP 230 356 356 ASP ASP A . n 
A 1 231 GLN 231 357 357 GLN GLN A . n 
A 1 232 GLY 232 358 358 GLY GLY A . n 
A 1 233 LEU 233 359 359 LEU LEU A . n 
A 1 234 ILE 234 360 360 ILE ILE A . n 
A 1 235 LEU 235 361 361 LEU LEU A . n 
A 1 236 TYR 236 362 362 TYR TYR A . n 
A 1 237 HIS 237 363 363 HIS HIS A . n 
A 1 238 GLN 238 364 364 GLN GLN A . n 
A 1 239 HIS 239 365 ?   ?   ?   A . n 
A 1 240 GLN 240 366 ?   ?   ?   A . n 
A 1 241 HIS 241 367 ?   ?   ?   A . n 
A 1 242 SER 242 368 ?   ?   ?   A . n 
A 1 243 CYS 243 369 ?   ?   ?   A . n 
A 1 244 CYS 244 370 ?   ?   ?   A . n 
A 1 245 GLU 245 371 ?   ?   ?   A . n 
A 1 246 SER 246 372 ?   ?   ?   A . n 
A 1 247 PRO 247 373 ?   ?   ?   A . n 
A 1 248 THR 248 374 ?   ?   ?   A . n 
A 1 249 ARG 249 375 ?   ?   ?   A . n 
A 1 250 LEU 250 376 ?   ?   ?   A . n 
A 1 251 ALA 251 377 ?   ?   ?   A . n 
A 1 252 GLN 252 378 ?   ?   ?   A . n 
A 1 253 GLN 253 379 ?   ?   ?   A . n 
A 1 254 SER 254 380 ?   ?   ?   A . n 
A 1 255 HIS 255 381 ?   ?   ?   A . n 
A 1 256 MET 256 382 ?   ?   ?   A . n 
A 1 257 ASP 257 383 ?   ?   ?   A . n 
A 1 258 ALA 258 384 384 ALA ALA A . n 
A 1 259 PHE 259 385 385 PHE PHE A . n 
A 1 260 GLU 260 386 386 GLU GLU A . n 
A 1 261 ARG 261 387 387 ARG ARG A . n 
A 1 262 SER 262 388 388 SER SER A . n 
A 1 263 PHE 263 389 389 PHE PHE A . n 
A 1 264 CYS 264 390 390 CYS CYS A . n 
A 1 265 ILE 265 391 391 ILE ILE A . n 
A 1 266 PHE 266 392 392 PHE PHE A . n 
A 1 267 ARG 267 393 393 ARG ARG A . n 
A 1 268 LEU 268 394 394 LEU LEU A . n 
A 1 269 PRO 269 395 395 PRO PRO A . n 
A 1 270 GLN 270 396 396 GLN GLN A . n 
A 1 271 PRO 271 397 397 PRO PRO A . n 
A 1 272 GLY 272 410 410 GLY GLY A . n 
A 1 273 SER 273 411 411 SER SER A . n 
A 1 274 TRP 274 412 412 TRP TRP A . n 
A 1 275 LYS 275 413 413 LYS LYS A . n 
A 1 276 ALA 276 414 414 ALA ALA A . n 
A 1 277 VAL 277 415 415 VAL VAL A . n 
A 1 278 ARG 278 416 416 ARG ARG A . n 
A 1 279 VAL 279 417 417 VAL VAL A . n 
A 1 280 ASP 280 418 418 ASP ASP A . n 
A 1 281 LEU 281 419 419 LEU LEU A . n 
A 1 282 VAL 282 420 420 VAL VAL A . n 
A 1 283 VAL 283 421 421 VAL VAL A . n 
A 1 284 ALA 284 422 422 ALA ALA A . n 
A 1 285 PRO 285 423 423 PRO PRO A . n 
A 1 286 VAL 286 424 424 VAL VAL A . n 
A 1 287 SER 287 425 425 SER SER A . n 
A 1 288 GLN 288 426 426 GLN GLN A . n 
A 1 289 PHE 289 427 427 PHE PHE A . n 
A 1 290 PRO 290 428 428 PRO PRO A . n 
A 1 291 PHE 291 429 429 PHE PHE A . n 
A 1 292 ALA 292 430 430 ALA ALA A . n 
A 1 293 LEU 293 431 431 LEU LEU A . n 
A 1 294 LEU 294 432 432 LEU LEU A . n 
A 1 295 GLY 295 433 433 GLY GLY A . n 
A 1 296 TRP 296 434 434 TRP TRP A . n 
A 1 297 THR 297 435 435 THR THR A . n 
A 1 298 GLY 298 436 436 GLY GLY A . n 
A 1 299 SER 299 437 437 SER SER A . n 
A 1 300 LYS 300 438 438 LYS LYS A . n 
A 1 301 LEU 301 439 439 LEU LEU A . n 
A 1 302 PHE 302 440 440 PHE PHE A . n 
A 1 303 GLN 303 441 441 GLN GLN A . n 
A 1 304 ARG 304 442 442 ARG ARG A . n 
A 1 305 GLU 305 443 443 GLU GLU A . n 
A 1 306 LEU 306 444 444 LEU LEU A . n 
A 1 307 ARG 307 445 445 ARG ARG A . n 
A 1 308 ARG 308 446 446 ARG ARG A . n 
A 1 309 PHE 309 447 447 PHE PHE A . n 
A 1 310 SER 310 448 448 SER SER A . n 
A 1 311 ARG 311 449 449 ARG ARG A . n 
A 1 312 LYS 312 450 450 LYS LYS A . n 
A 1 313 GLU 313 451 451 GLU GLU A . n 
A 1 314 LYS 314 452 452 LYS LYS A . n 
A 1 315 GLY 315 453 453 GLY GLY A . n 
A 1 316 LEU 316 454 454 LEU LEU A . n 
A 1 317 TRP 317 455 455 TRP TRP A . n 
A 1 318 LEU 318 456 456 LEU LEU A . n 
A 1 319 ASN 319 457 457 ASN ASN A . n 
A 1 320 SER 320 458 458 SER SER A . n 
A 1 321 HIS 321 459 459 HIS HIS A . n 
A 1 322 GLY 322 460 460 GLY GLY A . n 
A 1 323 LEU 323 461 461 LEU LEU A . n 
A 1 324 PHE 324 462 462 PHE PHE A . n 
A 1 325 ASP 325 463 463 ASP ASP A . n 
A 1 326 PRO 326 464 464 PRO PRO A . n 
A 1 327 GLU 327 465 465 GLU GLU A . n 
A 1 328 GLN 328 466 466 GLN GLN A . n 
A 1 329 LYS 329 467 467 LYS LYS A . n 
A 1 330 THR 330 468 468 THR THR A . n 
A 1 331 PHE 331 469 469 PHE PHE A . n 
A 1 332 PHE 332 470 470 PHE PHE A . n 
A 1 333 GLN 333 471 471 GLN GLN A . n 
A 1 334 ALA 334 472 472 ALA ALA A . n 
A 1 335 ALA 335 473 473 ALA ALA A . n 
A 1 336 SER 336 474 474 SER SER A . n 
A 1 337 GLU 337 475 475 GLU GLU A . n 
A 1 338 GLU 338 476 476 GLU GLU A . n 
A 1 339 ASP 339 477 477 ASP ASP A . n 
A 1 340 ILE 340 478 478 ILE ILE A . n 
A 1 341 PHE 341 479 479 PHE PHE A . n 
A 1 342 ARG 342 480 480 ARG ARG A . n 
A 1 343 HIS 343 481 481 HIS HIS A . n 
A 1 344 LEU 344 482 482 LEU LEU A . n 
A 1 345 GLY 345 483 483 GLY GLY A . n 
A 1 346 LEU 346 484 484 LEU LEU A . n 
A 1 347 GLU 347 485 485 GLU GLU A . n 
A 1 348 TYR 348 486 486 TYR TYR A . n 
A 1 349 LEU 349 487 487 LEU LEU A . n 
A 1 350 PRO 350 488 488 PRO PRO A . n 
A 1 351 PRO 351 489 489 PRO PRO A . n 
A 1 352 GLU 352 490 490 GLU GLU A . n 
A 1 353 GLN 353 491 491 GLN GLN A . n 
A 1 354 ARG 354 492 492 ARG ARG A . n 
A 1 355 ASN 355 493 493 ASN ASN A . n 
A 1 356 ALA 356 494 494 ALA ALA A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DG  2   2   2   DG  DG  T . n 
B 2 3   DG  3   3   3   DG  DG  T . n 
B 2 4   DC  4   4   4   DC  DC  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DA  7   7   7   DA  DA  T . n 
B 2 8   DC  8   8   8   DC  DC  T . n 
B 2 9   DG  9   9   9   DG  DG  T . n 
C 3 1   DC  1   1   1   DC  DC  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DT  3   3   3   DT  DT  P . n 
C 3 4   DA  4   4   4   DA  DA  P . n 
D 4 1   DG  1   1   1   DG  DG  D . n 
D 4 2   DC  2   2   2   DC  DC  D . n 
D 4 3   DC  3   3   3   DC  DC  D . n 
D 4 4   DG  4   4   4   DG  DG  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5  DUP 1   701  701 DUP DUP A . 
F 6  MG  1   702  1   MG  MG  A . 
G 6  MG  1   703  2   MG  MG  A . 
H 7  EDO 1   704  1   EDO EDO A . 
I 7  EDO 1   705  1   EDO EDO A . 
J 8  CL  1   706  3   CL  CL  A . 
K 9  NA  1   707  4   NA  NA  A . 
L 7  EDO 1   708  1   EDO EDO A . 
M 10 EPE 1   709  1   EPE EPE A . 
N 11 HOH 1   801  2   HOH HOH A . 
N 11 HOH 2   802  3   HOH HOH A . 
N 11 HOH 3   803  4   HOH HOH A . 
N 11 HOH 4   804  5   HOH HOH A . 
N 11 HOH 5   805  6   HOH HOH A . 
N 11 HOH 6   806  7   HOH HOH A . 
N 11 HOH 7   807  8   HOH HOH A . 
N 11 HOH 8   808  9   HOH HOH A . 
N 11 HOH 9   809  10  HOH HOH A . 
N 11 HOH 10  810  12  HOH HOH A . 
N 11 HOH 11  811  13  HOH HOH A . 
N 11 HOH 12  812  14  HOH HOH A . 
N 11 HOH 13  813  15  HOH HOH A . 
N 11 HOH 14  814  16  HOH HOH A . 
N 11 HOH 15  815  17  HOH HOH A . 
N 11 HOH 16  816  18  HOH HOH A . 
N 11 HOH 17  817  20  HOH HOH A . 
N 11 HOH 18  818  21  HOH HOH A . 
N 11 HOH 19  819  22  HOH HOH A . 
N 11 HOH 20  820  23  HOH HOH A . 
N 11 HOH 21  821  24  HOH HOH A . 
N 11 HOH 22  822  25  HOH HOH A . 
N 11 HOH 23  823  26  HOH HOH A . 
N 11 HOH 24  824  28  HOH HOH A . 
N 11 HOH 25  825  29  HOH HOH A . 
N 11 HOH 26  826  30  HOH HOH A . 
N 11 HOH 27  827  31  HOH HOH A . 
N 11 HOH 28  828  32  HOH HOH A . 
N 11 HOH 29  829  33  HOH HOH A . 
N 11 HOH 30  830  35  HOH HOH A . 
N 11 HOH 31  831  36  HOH HOH A . 
N 11 HOH 32  832  37  HOH HOH A . 
N 11 HOH 33  833  38  HOH HOH A . 
N 11 HOH 34  834  39  HOH HOH A . 
N 11 HOH 35  835  40  HOH HOH A . 
N 11 HOH 36  836  41  HOH HOH A . 
N 11 HOH 37  837  42  HOH HOH A . 
N 11 HOH 38  838  43  HOH HOH A . 
N 11 HOH 39  839  44  HOH HOH A . 
N 11 HOH 40  840  45  HOH HOH A . 
N 11 HOH 41  841  46  HOH HOH A . 
N 11 HOH 42  842  47  HOH HOH A . 
N 11 HOH 43  843  48  HOH HOH A . 
N 11 HOH 44  844  50  HOH HOH A . 
N 11 HOH 45  845  53  HOH HOH A . 
N 11 HOH 46  846  54  HOH HOH A . 
N 11 HOH 47  847  55  HOH HOH A . 
N 11 HOH 48  848  56  HOH HOH A . 
N 11 HOH 49  849  57  HOH HOH A . 
N 11 HOH 50  850  58  HOH HOH A . 
N 11 HOH 51  851  59  HOH HOH A . 
N 11 HOH 52  852  60  HOH HOH A . 
N 11 HOH 53  853  61  HOH HOH A . 
N 11 HOH 54  854  62  HOH HOH A . 
N 11 HOH 55  855  63  HOH HOH A . 
N 11 HOH 56  856  64  HOH HOH A . 
N 11 HOH 57  857  65  HOH HOH A . 
N 11 HOH 58  858  66  HOH HOH A . 
N 11 HOH 59  859  67  HOH HOH A . 
N 11 HOH 60  860  68  HOH HOH A . 
N 11 HOH 61  861  69  HOH HOH A . 
N 11 HOH 62  862  70  HOH HOH A . 
N 11 HOH 63  863  71  HOH HOH A . 
N 11 HOH 64  864  72  HOH HOH A . 
N 11 HOH 65  865  73  HOH HOH A . 
N 11 HOH 66  866  74  HOH HOH A . 
N 11 HOH 67  867  75  HOH HOH A . 
N 11 HOH 68  868  76  HOH HOH A . 
N 11 HOH 69  869  77  HOH HOH A . 
N 11 HOH 70  870  78  HOH HOH A . 
N 11 HOH 71  871  79  HOH HOH A . 
N 11 HOH 72  872  80  HOH HOH A . 
N 11 HOH 73  873  81  HOH HOH A . 
N 11 HOH 74  874  82  HOH HOH A . 
N 11 HOH 75  875  83  HOH HOH A . 
N 11 HOH 76  876  84  HOH HOH A . 
N 11 HOH 77  877  85  HOH HOH A . 
N 11 HOH 78  878  87  HOH HOH A . 
N 11 HOH 79  879  88  HOH HOH A . 
N 11 HOH 80  880  89  HOH HOH A . 
N 11 HOH 81  881  90  HOH HOH A . 
N 11 HOH 82  882  91  HOH HOH A . 
N 11 HOH 83  883  92  HOH HOH A . 
N 11 HOH 84  884  93  HOH HOH A . 
N 11 HOH 85  885  95  HOH HOH A . 
N 11 HOH 86  886  97  HOH HOH A . 
N 11 HOH 87  887  99  HOH HOH A . 
N 11 HOH 88  888  100 HOH HOH A . 
N 11 HOH 89  889  101 HOH HOH A . 
N 11 HOH 90  890  102 HOH HOH A . 
N 11 HOH 91  891  104 HOH HOH A . 
N 11 HOH 92  892  106 HOH HOH A . 
N 11 HOH 93  893  107 HOH HOH A . 
N 11 HOH 94  894  110 HOH HOH A . 
N 11 HOH 95  895  111 HOH HOH A . 
N 11 HOH 96  896  112 HOH HOH A . 
N 11 HOH 97  897  113 HOH HOH A . 
N 11 HOH 98  898  115 HOH HOH A . 
N 11 HOH 99  899  116 HOH HOH A . 
N 11 HOH 100 900  117 HOH HOH A . 
N 11 HOH 101 901  118 HOH HOH A . 
N 11 HOH 102 902  120 HOH HOH A . 
N 11 HOH 103 903  121 HOH HOH A . 
N 11 HOH 104 904  122 HOH HOH A . 
N 11 HOH 105 905  123 HOH HOH A . 
N 11 HOH 106 906  124 HOH HOH A . 
N 11 HOH 107 907  126 HOH HOH A . 
N 11 HOH 108 908  128 HOH HOH A . 
N 11 HOH 109 909  129 HOH HOH A . 
N 11 HOH 110 910  130 HOH HOH A . 
N 11 HOH 111 911  131 HOH HOH A . 
N 11 HOH 112 912  134 HOH HOH A . 
N 11 HOH 113 913  135 HOH HOH A . 
N 11 HOH 114 914  139 HOH HOH A . 
N 11 HOH 115 915  140 HOH HOH A . 
N 11 HOH 116 916  141 HOH HOH A . 
N 11 HOH 117 917  142 HOH HOH A . 
N 11 HOH 118 918  143 HOH HOH A . 
N 11 HOH 119 919  145 HOH HOH A . 
N 11 HOH 120 920  146 HOH HOH A . 
N 11 HOH 121 921  147 HOH HOH A . 
N 11 HOH 122 922  150 HOH HOH A . 
N 11 HOH 123 923  151 HOH HOH A . 
N 11 HOH 124 924  154 HOH HOH A . 
N 11 HOH 125 925  155 HOH HOH A . 
N 11 HOH 126 926  156 HOH HOH A . 
N 11 HOH 127 927  157 HOH HOH A . 
N 11 HOH 128 928  158 HOH HOH A . 
N 11 HOH 129 929  159 HOH HOH A . 
N 11 HOH 130 930  161 HOH HOH A . 
N 11 HOH 131 931  164 HOH HOH A . 
N 11 HOH 132 932  165 HOH HOH A . 
N 11 HOH 133 933  166 HOH HOH A . 
N 11 HOH 134 934  167 HOH HOH A . 
N 11 HOH 135 935  168 HOH HOH A . 
N 11 HOH 136 936  169 HOH HOH A . 
N 11 HOH 137 937  170 HOH HOH A . 
N 11 HOH 138 938  171 HOH HOH A . 
N 11 HOH 139 939  172 HOH HOH A . 
N 11 HOH 140 940  173 HOH HOH A . 
N 11 HOH 141 941  175 HOH HOH A . 
N 11 HOH 142 942  177 HOH HOH A . 
N 11 HOH 143 943  178 HOH HOH A . 
N 11 HOH 144 944  179 HOH HOH A . 
N 11 HOH 145 945  180 HOH HOH A . 
N 11 HOH 146 946  181 HOH HOH A . 
N 11 HOH 147 947  185 HOH HOH A . 
N 11 HOH 148 948  186 HOH HOH A . 
N 11 HOH 149 949  189 HOH HOH A . 
N 11 HOH 150 950  192 HOH HOH A . 
N 11 HOH 151 951  193 HOH HOH A . 
N 11 HOH 152 952  195 HOH HOH A . 
N 11 HOH 153 953  196 HOH HOH A . 
N 11 HOH 154 954  197 HOH HOH A . 
N 11 HOH 155 955  198 HOH HOH A . 
N 11 HOH 156 956  199 HOH HOH A . 
N 11 HOH 157 957  201 HOH HOH A . 
N 11 HOH 158 958  204 HOH HOH A . 
N 11 HOH 159 959  207 HOH HOH A . 
N 11 HOH 160 960  209 HOH HOH A . 
N 11 HOH 161 961  211 HOH HOH A . 
N 11 HOH 162 962  212 HOH HOH A . 
N 11 HOH 163 963  213 HOH HOH A . 
N 11 HOH 164 964  214 HOH HOH A . 
N 11 HOH 165 965  215 HOH HOH A . 
N 11 HOH 166 966  216 HOH HOH A . 
N 11 HOH 167 967  219 HOH HOH A . 
N 11 HOH 168 968  220 HOH HOH A . 
N 11 HOH 169 969  221 HOH HOH A . 
N 11 HOH 170 970  222 HOH HOH A . 
N 11 HOH 171 971  223 HOH HOH A . 
N 11 HOH 172 972  224 HOH HOH A . 
N 11 HOH 173 973  225 HOH HOH A . 
N 11 HOH 174 974  226 HOH HOH A . 
N 11 HOH 175 975  227 HOH HOH A . 
N 11 HOH 176 976  228 HOH HOH A . 
N 11 HOH 177 977  229 HOH HOH A . 
N 11 HOH 178 978  230 HOH HOH A . 
N 11 HOH 179 979  231 HOH HOH A . 
N 11 HOH 180 980  236 HOH HOH A . 
N 11 HOH 181 981  239 HOH HOH A . 
N 11 HOH 182 982  242 HOH HOH A . 
N 11 HOH 183 983  243 HOH HOH A . 
N 11 HOH 184 984  247 HOH HOH A . 
N 11 HOH 185 985  248 HOH HOH A . 
N 11 HOH 186 986  249 HOH HOH A . 
N 11 HOH 187 987  252 HOH HOH A . 
N 11 HOH 188 988  255 HOH HOH A . 
N 11 HOH 189 989  257 HOH HOH A . 
N 11 HOH 190 990  260 HOH HOH A . 
N 11 HOH 191 991  261 HOH HOH A . 
N 11 HOH 192 992  263 HOH HOH A . 
N 11 HOH 193 993  264 HOH HOH A . 
N 11 HOH 194 994  265 HOH HOH A . 
N 11 HOH 195 995  267 HOH HOH A . 
N 11 HOH 196 996  268 HOH HOH A . 
N 11 HOH 197 997  270 HOH HOH A . 
N 11 HOH 198 998  271 HOH HOH A . 
N 11 HOH 199 999  272 HOH HOH A . 
N 11 HOH 200 1000 273 HOH HOH A . 
N 11 HOH 201 1001 277 HOH HOH A . 
N 11 HOH 202 1002 278 HOH HOH A . 
N 11 HOH 203 1003 279 HOH HOH A . 
N 11 HOH 204 1004 280 HOH HOH A . 
N 11 HOH 205 1005 284 HOH HOH A . 
N 11 HOH 206 1006 285 HOH HOH A . 
N 11 HOH 207 1007 286 HOH HOH A . 
N 11 HOH 208 1008 288 HOH HOH A . 
N 11 HOH 209 1009 289 HOH HOH A . 
N 11 HOH 210 1010 290 HOH HOH A . 
N 11 HOH 211 1011 294 HOH HOH A . 
N 11 HOH 212 1012 297 HOH HOH A . 
N 11 HOH 213 1013 298 HOH HOH A . 
N 11 HOH 214 1014 299 HOH HOH A . 
N 11 HOH 215 1015 300 HOH HOH A . 
N 11 HOH 216 1016 303 HOH HOH A . 
N 11 HOH 217 1017 305 HOH HOH A . 
N 11 HOH 218 1018 306 HOH HOH A . 
N 11 HOH 219 1019 307 HOH HOH A . 
N 11 HOH 220 1020 308 HOH HOH A . 
N 11 HOH 221 1021 310 HOH HOH A . 
N 11 HOH 222 1022 311 HOH HOH A . 
N 11 HOH 223 1023 314 HOH HOH A . 
N 11 HOH 224 1024 317 HOH HOH A . 
N 11 HOH 225 1025 318 HOH HOH A . 
N 11 HOH 226 1026 319 HOH HOH A . 
N 11 HOH 227 1027 320 HOH HOH A . 
N 11 HOH 228 1028 321 HOH HOH A . 
N 11 HOH 229 1029 323 HOH HOH A . 
N 11 HOH 230 1030 324 HOH HOH A . 
N 11 HOH 231 1031 326 HOH HOH A . 
N 11 HOH 232 1032 327 HOH HOH A . 
N 11 HOH 233 1033 329 HOH HOH A . 
N 11 HOH 234 1034 330 HOH HOH A . 
N 11 HOH 235 1035 331 HOH HOH A . 
N 11 HOH 236 1036 332 HOH HOH A . 
N 11 HOH 237 1037 334 HOH HOH A . 
N 11 HOH 238 1038 335 HOH HOH A . 
N 11 HOH 239 1039 337 HOH HOH A . 
N 11 HOH 240 1040 338 HOH HOH A . 
N 11 HOH 241 1041 339 HOH HOH A . 
N 11 HOH 242 1042 341 HOH HOH A . 
N 11 HOH 243 1043 342 HOH HOH A . 
N 11 HOH 244 1044 343 HOH HOH A . 
N 11 HOH 245 1045 344 HOH HOH A . 
N 11 HOH 246 1046 345 HOH HOH A . 
N 11 HOH 247 1047 348 HOH HOH A . 
N 11 HOH 248 1048 350 HOH HOH A . 
N 11 HOH 249 1049 352 HOH HOH A . 
N 11 HOH 250 1050 354 HOH HOH A . 
N 11 HOH 251 1051 356 HOH HOH A . 
N 11 HOH 252 1052 358 HOH HOH A . 
N 11 HOH 253 1053 361 HOH HOH A . 
N 11 HOH 254 1054 362 HOH HOH A . 
N 11 HOH 255 1055 363 HOH HOH A . 
N 11 HOH 256 1056 364 HOH HOH A . 
N 11 HOH 257 1057 367 HOH HOH A . 
N 11 HOH 258 1058 369 HOH HOH A . 
N 11 HOH 259 1059 370 HOH HOH A . 
N 11 HOH 260 1060 373 HOH HOH A . 
N 11 HOH 261 1061 375 HOH HOH A . 
N 11 HOH 262 1062 378 HOH HOH A . 
N 11 HOH 263 1063 379 HOH HOH A . 
N 11 HOH 264 1064 380 HOH HOH A . 
N 11 HOH 265 1065 381 HOH HOH A . 
N 11 HOH 266 1066 382 HOH HOH A . 
N 11 HOH 267 1067 384 HOH HOH A . 
N 11 HOH 268 1068 385 HOH HOH A . 
N 11 HOH 269 1069 386 HOH HOH A . 
N 11 HOH 270 1070 387 HOH HOH A . 
N 11 HOH 271 1071 388 HOH HOH A . 
N 11 HOH 272 1072 389 HOH HOH A . 
N 11 HOH 273 1073 390 HOH HOH A . 
N 11 HOH 274 1074 391 HOH HOH A . 
N 11 HOH 275 1075 392 HOH HOH A . 
N 11 HOH 276 1076 393 HOH HOH A . 
N 11 HOH 277 1077 395 HOH HOH A . 
N 11 HOH 278 1078 397 HOH HOH A . 
N 11 HOH 279 1079 398 HOH HOH A . 
N 11 HOH 280 1080 399 HOH HOH A . 
N 11 HOH 281 1081 401 HOH HOH A . 
N 11 HOH 282 1082 403 HOH HOH A . 
N 11 HOH 283 1083 404 HOH HOH A . 
N 11 HOH 284 1084 406 HOH HOH A . 
N 11 HOH 285 1085 409 HOH HOH A . 
N 11 HOH 286 1086 411 HOH HOH A . 
N 11 HOH 287 1087 413 HOH HOH A . 
N 11 HOH 288 1088 415 HOH HOH A . 
N 11 HOH 289 1089 416 HOH HOH A . 
N 11 HOH 290 1090 418 HOH HOH A . 
N 11 HOH 291 1091 419 HOH HOH A . 
N 11 HOH 292 1092 422 HOH HOH A . 
N 11 HOH 293 1093 424 HOH HOH A . 
N 11 HOH 294 1094 427 HOH HOH A . 
N 11 HOH 295 1095 428 HOH HOH A . 
N 11 HOH 296 1096 429 HOH HOH A . 
N 11 HOH 297 1097 430 HOH HOH A . 
N 11 HOH 298 1098 431 HOH HOH A . 
N 11 HOH 299 1099 432 HOH HOH A . 
N 11 HOH 300 1100 433 HOH HOH A . 
N 11 HOH 301 1101 434 HOH HOH A . 
N 11 HOH 302 1102 435 HOH HOH A . 
N 11 HOH 303 1103 436 HOH HOH A . 
N 11 HOH 304 1104 437 HOH HOH A . 
N 11 HOH 305 1105 438 HOH HOH A . 
N 11 HOH 306 1106 439 HOH HOH A . 
N 11 HOH 307 1107 440 HOH HOH A . 
N 11 HOH 308 1108 442 HOH HOH A . 
N 11 HOH 309 1109 443 HOH HOH A . 
N 11 HOH 310 1110 444 HOH HOH A . 
N 11 HOH 311 1111 445 HOH HOH A . 
N 11 HOH 312 1112 446 HOH HOH A . 
N 11 HOH 313 1113 447 HOH HOH A . 
N 11 HOH 314 1114 448 HOH HOH A . 
N 11 HOH 315 1115 449 HOH HOH A . 
N 11 HOH 316 1116 450 HOH HOH A . 
N 11 HOH 317 1117 451 HOH HOH A . 
N 11 HOH 318 1118 453 HOH HOH A . 
N 11 HOH 319 1119 98  HOH HOH A . 
O 11 HOH 1   101  11  HOH HOH T . 
O 11 HOH 2   102  27  HOH HOH T . 
O 11 HOH 3   103  34  HOH HOH T . 
O 11 HOH 4   104  52  HOH HOH T . 
O 11 HOH 5   105  96  HOH HOH T . 
O 11 HOH 6   106  103 HOH HOH T . 
O 11 HOH 7   107  108 HOH HOH T . 
O 11 HOH 8   108  109 HOH HOH T . 
O 11 HOH 9   109  114 HOH HOH T . 
O 11 HOH 10  110  133 HOH HOH T . 
O 11 HOH 11  111  138 HOH HOH T . 
O 11 HOH 12  112  144 HOH HOH T . 
O 11 HOH 13  113  153 HOH HOH T . 
O 11 HOH 14  114  174 HOH HOH T . 
O 11 HOH 15  115  182 HOH HOH T . 
O 11 HOH 16  116  188 HOH HOH T . 
O 11 HOH 17  117  194 HOH HOH T . 
O 11 HOH 18  118  200 HOH HOH T . 
O 11 HOH 19  119  233 HOH HOH T . 
O 11 HOH 20  120  238 HOH HOH T . 
O 11 HOH 21  121  246 HOH HOH T . 
O 11 HOH 22  122  256 HOH HOH T . 
O 11 HOH 23  123  283 HOH HOH T . 
O 11 HOH 24  124  295 HOH HOH T . 
O 11 HOH 25  125  304 HOH HOH T . 
O 11 HOH 26  126  313 HOH HOH T . 
O 11 HOH 27  127  315 HOH HOH T . 
O 11 HOH 28  128  400 HOH HOH T . 
O 11 HOH 29  129  452 HOH HOH T . 
P 11 HOH 1   101  51  HOH HOH P . 
P 11 HOH 2   102  94  HOH HOH P . 
P 11 HOH 3   103  105 HOH HOH P . 
P 11 HOH 4   104  119 HOH HOH P . 
P 11 HOH 5   105  132 HOH HOH P . 
P 11 HOH 6   106  136 HOH HOH P . 
P 11 HOH 7   107  176 HOH HOH P . 
P 11 HOH 8   108  187 HOH HOH P . 
P 11 HOH 9   109  205 HOH HOH P . 
P 11 HOH 10  110  208 HOH HOH P . 
P 11 HOH 11  111  210 HOH HOH P . 
P 11 HOH 12  112  240 HOH HOH P . 
P 11 HOH 13  113  359 HOH HOH P . 
P 11 HOH 14  114  394 HOH HOH P . 
P 11 HOH 15  115  420 HOH HOH P . 
Q 11 HOH 1   101  137 HOH HOH D . 
Q 11 HOH 2   102  163 HOH HOH D . 
Q 11 HOH 3   103  183 HOH HOH D . 
Q 11 HOH 4   104  190 HOH HOH D . 
Q 11 HOH 5   105  206 HOH HOH D . 
Q 11 HOH 6   106  250 HOH HOH D . 
Q 11 HOH 7   107  258 HOH HOH D . 
Q 11 HOH 8   108  266 HOH HOH D . 
Q 11 HOH 9   109  275 HOH HOH D . 
Q 11 HOH 10  110  287 HOH HOH D . 
Q 11 HOH 11  111  296 HOH HOH D . 
Q 11 HOH 12  112  301 HOH HOH D . 
Q 11 HOH 13  113  377 HOH HOH D . 
Q 11 HOH 14  114  402 HOH HOH D . 
Q 11 HOH 15  115  423 HOH HOH D . 
Q 11 HOH 16  116  425 HOH HOH D . 
Q 11 HOH 17  117  426 HOH HOH D . 
Q 11 HOH 18  118  441 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   ? A ASP 204 ? A ASP 330 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O2B   ? E DUP .   ? A DUP 701 ? 1_555 169.2 ? 
2  OD1   ? A ASP 204 ? A ASP 330 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 OD2   ? A ASP 206 ? A ASP 332 ? 1_555 91.6  ? 
3  O2B   ? E DUP .   ? A DUP 701 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 OD2   ? A ASP 206 ? A ASP 332 ? 1_555 95.5  ? 
4  OD1   ? A ASP 204 ? A ASP 330 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O3G   ? E DUP .   ? A DUP 701 ? 1_555 84.8  ? 
5  O2B   ? E DUP .   ? A DUP 701 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O3G   ? E DUP .   ? A DUP 701 ? 1_555 88.1  ? 
6  OD2   ? A ASP 206 ? A ASP 332 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O3G   ? E DUP .   ? A DUP 701 ? 1_555 176.4 ? 
7  OD1   ? A ASP 204 ? A ASP 330 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O1A   ? E DUP .   ? A DUP 701 ? 1_555 97.3  ? 
8  O2B   ? E DUP .   ? A DUP 701 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O1A   ? E DUP .   ? A DUP 701 ? 1_555 90.5  ? 
9  OD2   ? A ASP 206 ? A ASP 332 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O1A   ? E DUP .   ? A DUP 701 ? 1_555 91.9  ? 
10 O3G   ? E DUP .   ? A DUP 701 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O1A   ? E DUP .   ? A DUP 701 ? 1_555 88.0  ? 
11 OD1   ? A ASP 204 ? A ASP 330 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O     ? N HOH .   ? A HOH 821 ? 1_555 81.4  ? 
12 O2B   ? E DUP .   ? A DUP 701 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O     ? N HOH .   ? A HOH 821 ? 1_555 90.5  ? 
13 OD2   ? A ASP 206 ? A ASP 332 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O     ? N HOH .   ? A HOH 821 ? 1_555 89.9  ? 
14 O3G   ? E DUP .   ? A DUP 701 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O     ? N HOH .   ? A HOH 821 ? 1_555 90.2  ? 
15 O1A   ? E DUP .   ? A DUP 701 ? 1_555 MG ? G MG . ? A MG 703 ? 1_555 O     ? N HOH .   ? A HOH 821 ? 1_555 177.9 ? 
16 OD2   ? A ASP 204 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 OD1   ? A ASP 206 ? A ASP 332 ? 1_555 93.8  ? 
17 OD2   ? A ASP 204 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 OD1   ? A ASP 280 ? A ASP 418 ? 1_555 87.5  ? 
18 OD1   ? A ASP 206 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 OD1   ? A ASP 280 ? A ASP 418 ? 1_555 93.8  ? 
19 OD2   ? A ASP 204 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 "O3'" ? C DA  4   ? P DA  4   ? 1_555 171.7 ? 
20 OD1   ? A ASP 206 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 "O3'" ? C DA  4   ? P DA  4   ? 1_555 88.7  ? 
21 OD1   ? A ASP 280 ? A ASP 418 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 "O3'" ? C DA  4   ? P DA  4   ? 1_555 84.5  ? 
22 OD2   ? A ASP 204 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O1A   ? E DUP .   ? A DUP 701 ? 1_555 90.7  ? 
23 OD1   ? A ASP 206 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O1A   ? E DUP .   ? A DUP 701 ? 1_555 92.1  ? 
24 OD1   ? A ASP 280 ? A ASP 418 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O1A   ? E DUP .   ? A DUP 701 ? 1_555 173.9 ? 
25 "O3'" ? C DA  4   ? P DA  4   ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O1A   ? E DUP .   ? A DUP 701 ? 1_555 97.1  ? 
26 OD2   ? A ASP 204 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     ? N HOH .   ? A HOH 807 ? 1_555 90.7  ? 
27 OD1   ? A ASP 206 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     ? N HOH .   ? A HOH 807 ? 1_555 173.5 ? 
28 OD1   ? A ASP 280 ? A ASP 418 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     ? N HOH .   ? A HOH 807 ? 1_555 91.2  ? 
29 "O3'" ? C DA  4   ? P DA  4   ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     ? N HOH .   ? A HOH 807 ? 1_555 87.6  ? 
30 O1A   ? E DUP .   ? A DUP 701 ? 1_555 MG ? F MG . ? A MG 702 ? 1_555 O     ? N HOH .   ? A HOH 807 ? 1_555 83.0  ? 
31 O     ? A VAL 120 ? A VAL 246 ? 1_555 NA ? K NA . ? A NA 707 ? 1_555 O     ? A THR 115 ? A THR 241 ? 1_555 91.1  ? 
32 O     ? A VAL 120 ? A VAL 246 ? 1_555 NA ? K NA . ? A NA 707 ? 1_555 O     ? A ILE 117 ? A ILE 243 ? 1_555 94.5  ? 
33 O     ? A THR 115 ? A THR 241 ? 1_555 NA ? K NA . ? A NA 707 ? 1_555 O     ? A ILE 117 ? A ILE 243 ? 1_555 97.2  ? 
34 O     ? A VAL 120 ? A VAL 246 ? 1_555 NA ? K NA . ? A NA 707 ? 1_555 OP1   ? C DT  3   ? P DT  3   ? 1_555 90.1  ? 
35 O     ? A THR 115 ? A THR 241 ? 1_555 NA ? K NA . ? A NA 707 ? 1_555 OP1   ? C DT  3   ? P DT  3   ? 1_555 170.3 ? 
36 O     ? A ILE 117 ? A ILE 243 ? 1_555 NA ? K NA . ? A NA 707 ? 1_555 OP1   ? C DT  3   ? P DT  3   ? 1_555 92.2  ? 
37 O     ? A VAL 120 ? A VAL 246 ? 1_555 NA ? K NA . ? A NA 707 ? 1_555 O     ? P HOH .   ? P HOH 105 ? 1_555 88.8  ? 
38 O     ? A THR 115 ? A THR 241 ? 1_555 NA ? K NA . ? A NA 707 ? 1_555 O     ? P HOH .   ? P HOH 105 ? 1_555 85.7  ? 
39 O     ? A ILE 117 ? A ILE 243 ? 1_555 NA ? K NA . ? A NA 707 ? 1_555 O     ? P HOH .   ? P HOH 105 ? 1_555 175.5 ? 
40 OP1   ? C DT  3   ? P DT  3   ? 1_555 NA ? K NA . ? A NA 707 ? 1_555 O     ? P HOH .   ? P HOH 105 ? 1_555 84.8  ? 
41 O     ? A VAL 120 ? A VAL 246 ? 1_555 NA ? K NA . ? A NA 707 ? 1_555 O     ? N HOH .   ? A HOH 986 ? 1_555 175.6 ? 
42 O     ? A THR 115 ? A THR 241 ? 1_555 NA ? K NA . ? A NA 707 ? 1_555 O     ? N HOH .   ? A HOH 986 ? 1_555 84.6  ? 
43 O     ? A ILE 117 ? A ILE 243 ? 1_555 NA ? K NA . ? A NA 707 ? 1_555 O     ? N HOH .   ? A HOH 986 ? 1_555 87.0  ? 
44 OP1   ? C DT  3   ? P DT  3   ? 1_555 NA ? K NA . ? A NA 707 ? 1_555 O     ? N HOH .   ? A HOH 986 ? 1_555 94.0  ? 
45 O     ? P HOH .   ? P HOH 105 ? 1_555 NA ? K NA . ? A NA 707 ? 1_555 O     ? N HOH .   ? A HOH 986 ? 1_555 90.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-02-05 
2 'Structure model' 1 1 2014-03-05 
3 'Structure model' 1 2 2014-03-19 
4 'Structure model' 1 3 2017-11-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 4 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification'       
2 4 'Structure model' '_software.contact_author'       
3 4 'Structure model' '_software.contact_author_email' 
4 4 'Structure model' '_software.date'                 
5 4 'Structure model' '_software.language'             
6 4 'Structure model' '_software.location'             
7 4 'Structure model' '_software.name'                 
8 4 'Structure model' '_software.type'                 
9 4 'Structure model' '_software.version'              
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO           .        ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data reduction'  
http://www.hkl-xray.com/                    ?   ? 
2 SCALEPACK       .        ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data scaling'    
http://www.hkl-xray.com/                    ?   ? 
3 PHASER          .        ?                program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/ ?   ? 
4 PHENIX          1.8_1069 ?                package 'Paul D. Adams'      PDAdams@lbl.gov             refinement        
http://www.phenix-online.org/               C++ ? 
5 PDB_EXTRACT     3.11     'April 22, 2011' package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/   C++ ? 
6 StructureStudio .        ?                ?       ?                    ?                           'data collection' ? ?   ? 
7 HKL-2000        .        ?                ?       ?                    ?                           'data reduction'  ? ?   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 1006 ? ? O A HOH 1009 ? ? 2.12 
2 1 O   A HOH 952  ? ? O D HOH 104  ? ? 2.12 
3 1 CL  A CL  706  ? B O A HOH 1094 ? ? 2.12 
4 1 NH2 A ARG 145  ? ? O A HOH 987  ? ? 2.12 
5 1 O   A HOH 1062 ? ? O A HOH 1116 ? ? 2.15 
6 1 OE2 A GLU 218  ? ? O A HOH 1004 ? ? 2.16 
7 1 NH1 A ARG 253  ? B O A HOH 997  ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 267 ? ? OE2 A GLU 267 ? ? 1.327 1.252 0.075  0.011 N 
2 1 P  D DG  1   ? ? OP3 D DG  1   ? ? 1.481 1.607 -0.126 0.012 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" T DC 4 ? ? "C1'" T DC 4 ? ? N1    T DC 4 ? ? 110.56 108.30 2.26  0.30 N 
2  1 "O4'" T DT 6 ? ? "C1'" T DT 6 ? ? N1    T DT 6 ? ? 113.62 108.30 5.32  0.30 N 
3  1 "O4'" T DA 7 ? ? "C1'" T DA 7 ? ? N9    T DA 7 ? ? 111.69 108.30 3.39  0.30 N 
4  1 "O4'" T DG 9 ? ? "C1'" T DG 9 ? ? N9    T DG 9 ? ? 101.86 108.00 -6.14 0.70 N 
5  1 "O4'" P DC 1 ? ? "C4'" P DC 1 ? ? "C3'" P DC 1 ? ? 101.84 104.50 -2.66 0.40 N 
6  1 "O4'" P DT 3 ? ? "C4'" P DT 3 ? ? "C3'" P DT 3 ? ? 101.52 104.50 -2.98 0.40 N 
7  1 "O4'" D DG 1 ? ? "C1'" D DG 1 ? ? N9    D DG 1 ? ? 101.44 108.00 -6.56 0.70 N 
8  1 "C1'" D DC 2 ? ? "O4'" D DC 2 ? ? "C4'" D DC 2 ? ? 103.23 110.10 -6.87 1.00 N 
9  1 "O4'" D DC 3 ? A "C1'" D DC 3 ? A N1    D DC 3 ? A 103.51 108.00 -4.49 0.70 N 
10 1 "O4'" D DC 3 ? B "C1'" D DC 3 ? B N1    D DC 3 ? B 102.27 108.00 -5.73 0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 153 ? ? -141.94 38.16   
2 1 LEU A 310 ? ? -161.91 96.10   
3 1 THR A 318 ? A -125.42 -148.46 
4 1 THR A 318 ? B -129.52 -153.66 
5 1 SER A 411 ? ? -168.12 -148.64 
6 1 ASN A 493 ? ? -85.33  49.84   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A TRP 137 ? CG  ? A TRP 11  CG  
2  1 Y 1 A TRP 137 ? CD1 ? A TRP 11  CD1 
3  1 Y 1 A TRP 137 ? CD2 ? A TRP 11  CD2 
4  1 Y 1 A TRP 137 ? NE1 ? A TRP 11  NE1 
5  1 Y 1 A TRP 137 ? CE2 ? A TRP 11  CE2 
6  1 Y 1 A TRP 137 ? CE3 ? A TRP 11  CE3 
7  1 Y 1 A TRP 137 ? CZ2 ? A TRP 11  CZ2 
8  1 Y 1 A TRP 137 ? CZ3 ? A TRP 11  CZ3 
9  1 Y 1 A TRP 137 ? CH2 ? A TRP 11  CH2 
10 1 Y 1 A GLN 200 ? CD  ? A GLN 74  CD  
11 1 Y 1 A GLN 200 ? OE1 ? A GLN 74  OE1 
12 1 Y 1 A GLN 200 ? NE2 ? A GLN 74  NE2 
13 1 Y 1 A GLU 223 ? CD  ? A GLU 97  CD  
14 1 Y 1 A GLU 223 ? OE1 ? A GLU 97  OE1 
15 1 Y 1 A GLU 223 ? OE2 ? A GLU 97  OE2 
16 1 Y 1 A GLN 268 ? CG  ? A GLN 142 CG  
17 1 Y 1 A GLN 268 ? CD  ? A GLN 142 CD  
18 1 Y 1 A GLN 268 ? OE1 ? A GLN 142 OE1 
19 1 Y 1 A GLN 268 ? NE2 ? A GLN 142 NE2 
20 1 Y 1 A GLN 270 ? CG  ? A GLN 144 CG  
21 1 Y 1 A GLN 270 ? CD  ? A GLN 144 CD  
22 1 Y 1 A GLN 270 ? OE1 ? A GLN 144 OE1 
23 1 Y 1 A GLN 270 ? NE2 ? A GLN 144 NE2 
24 1 Y 1 A LYS 271 ? CG  ? A LYS 145 CG  
25 1 Y 1 A LYS 271 ? CD  ? A LYS 145 CD  
26 1 Y 1 A LYS 271 ? CE  ? A LYS 145 CE  
27 1 Y 1 A LYS 271 ? NZ  ? A LYS 145 NZ  
28 1 Y 1 A GLN 274 ? CG  ? A GLN 148 CG  
29 1 Y 1 A GLN 274 ? CD  ? A GLN 148 CD  
30 1 Y 1 A GLN 274 ? OE1 ? A GLN 148 OE1 
31 1 Y 1 A GLN 274 ? NE2 ? A GLN 148 NE2 
32 1 Y 1 A ASP 296 ? OD1 ? A ASP 170 OD1 
33 1 Y 1 A ASP 296 ? OD2 ? A ASP 170 OD2 
34 1 Y 1 A GLN 300 ? CD  ? A GLN 174 CD  
35 1 Y 1 A GLN 300 ? OE1 ? A GLN 174 OE1 
36 1 Y 1 A GLN 300 ? NE2 ? A GLN 174 NE2 
37 1 Y 1 A LYS 339 ? CD  ? A LYS 213 CD  
38 1 Y 1 A LYS 339 ? CE  ? A LYS 213 CE  
39 1 Y 1 A LYS 339 ? NZ  ? A LYS 213 NZ  
40 1 Y 1 A GLN 355 ? CD  ? A GLN 229 CD  
41 1 Y 1 A GLN 355 ? OE1 ? A GLN 229 OE1 
42 1 Y 1 A GLN 355 ? NE2 ? A GLN 229 NE2 
43 1 Y 1 A GLN 357 ? OE1 ? A GLN 231 OE1 
44 1 Y 1 A GLN 357 ? NE2 ? A GLN 231 NE2 
45 1 Y 1 A LYS 467 ? CD  ? A LYS 329 CD  
46 1 Y 1 A LYS 467 ? CE  ? A LYS 329 CE  
47 1 Y 1 A LYS 467 ? NZ  ? A LYS 329 NZ  
48 1 Y 1 A GLN 471 ? OE1 ? A GLN 333 OE1 
49 1 Y 1 A GLN 471 ? NE2 ? A GLN 333 NE2 
50 1 N 1 A EPE 709 ? C7  ? M EPE 1   C7  
51 1 N 1 A EPE 709 ? C8  ? M EPE 1   C8  
52 1 N 1 A EPE 709 ? O8  ? M EPE 1   O8  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 127 ? A GLY 1   
2  1 Y 1 A SER 128 ? A SER 2   
3  1 Y 1 A ALA 129 ? A ALA 3   
4  1 Y 1 A ALA 130 ? A ALA 4   
5  1 Y 1 A ALA 131 ? A ALA 5   
6  1 Y 1 A PRO 132 ? A PRO 6   
7  1 Y 1 A LEU 133 ? A LEU 7   
8  1 Y 1 A SER 134 ? A SER 8   
9  1 Y 1 A PRO 135 ? A PRO 9   
10 1 Y 1 A ALA 136 ? A ALA 10  
11 1 Y 1 A HIS 365 ? A HIS 239 
12 1 Y 1 A GLN 366 ? A GLN 240 
13 1 Y 1 A HIS 367 ? A HIS 241 
14 1 Y 1 A SER 368 ? A SER 242 
15 1 Y 1 A CYS 369 ? A CYS 243 
16 1 Y 1 A CYS 370 ? A CYS 244 
17 1 Y 1 A GLU 371 ? A GLU 245 
18 1 Y 1 A SER 372 ? A SER 246 
19 1 Y 1 A PRO 373 ? A PRO 247 
20 1 Y 1 A THR 374 ? A THR 248 
21 1 Y 1 A ARG 375 ? A ARG 249 
22 1 Y 1 A LEU 376 ? A LEU 250 
23 1 Y 1 A ALA 377 ? A ALA 251 
24 1 Y 1 A GLN 378 ? A GLN 252 
25 1 Y 1 A GLN 379 ? A GLN 253 
26 1 Y 1 A SER 380 ? A SER 254 
27 1 Y 1 A HIS 381 ? A HIS 255 
28 1 Y 1 A MET 382 ? A MET 256 
29 1 Y 1 A ASP 383 ? A ASP 257 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4M04 'double helix'        
4M04 'a-form double helix' 
4M04 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1 1_555 D DG 4 1_555 0.211  -0.102 0.224  -9.012 -10.973 -3.500 1 T_DC1:DG4_D T 1 ? D 4 ? 19 1 
1 B DG 2 1_555 D DC 3 1_555 -0.199 -0.105 0.165  -0.017 -12.112 0.677  2 T_DG2:DC3_D T 2 ? D 3 ? 19 1 
1 B DG 3 1_555 D DC 2 1_555 -0.193 -0.225 0.243  1.889  -7.684  -2.987 3 T_DG3:DC2_D T 3 ? D 2 ? 19 1 
1 B DC 4 1_555 D DG 1 1_555 0.379  -0.085 -0.247 14.781 2.757   -1.130 4 T_DC4:DG1_D T 4 ? D 1 ? 19 1 
1 B DT 6 1_555 C DA 4 1_555 -0.062 -0.135 -0.126 2.582  -0.345  3.509  5 T_DT6:DA4_P T 6 ? P 4 ? 20 1 
1 B DA 7 1_555 C DT 3 1_555 0.070  -0.167 0.457  11.145 -13.853 2.443  6 T_DA7:DT3_P T 7 ? P 3 ? 20 1 
1 B DC 8 1_555 C DG 2 1_555 0.238  -0.144 -0.147 12.848 -14.573 1.228  7 T_DC8:DG2_P T 8 ? P 2 ? 19 1 
1 B DG 9 1_555 C DC 1 1_555 -0.124 -0.093 -0.001 -3.871 -10.626 -1.972 8 T_DG9:DC1_P T 9 ? P 1 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1 1_555 D DG 4 1_555 B DG 2 1_555 D DC 3 1_555 -0.421 0.746  3.198 2.114  5.521 32.775 0.388  1.085  3.244 9.685  -3.708  
33.290 1 TT_DC1DG2:DC3DG4_DD T 1 ? D 4 ? T 2 ? D 3 ? 
1 B DG 2 1_555 D DC 3 1_555 B DG 3 1_555 D DC 2 1_555 0.582  -0.071 3.338 -2.737 4.351 34.838 -0.774 -1.374 3.252 7.218  4.541   
35.203 2 TT_DG2DG3:DC2DC3_DD T 2 ? D 3 ? T 3 ? D 2 ? 
1 B DG 3 1_555 D DC 2 1_555 B DC 4 1_555 D DG 1 1_555 0.467  0.097  3.077 5.671  1.849 26.464 -0.241 0.375  3.106 3.976  -12.190 
27.116 3 TT_DG3DC4:DG1DC2_DD T 3 ? D 2 ? T 4 ? D 1 ? 
1 B DT 6 1_555 C DA 4 1_555 B DA 7 1_555 C DT 3 1_555 0.412  -0.990 3.117 -6.062 4.141 30.384 -2.563 -1.826 2.827 7.759  11.360  
31.238 4 TT_DT6DA7:DT3DA4_PP T 6 ? P 4 ? T 7 ? P 3 ? 
1 B DA 7 1_555 C DT 3 1_555 B DC 8 1_555 C DG 2 1_555 -0.644 -1.224 3.332 2.571  1.954 35.664 -2.272 1.417  3.210 3.183  -4.188  
35.805 5 TT_DA7DC8:DG2DT3_PP T 7 ? P 3 ? T 8 ? P 2 ? 
1 B DC 8 1_555 C DG 2 1_555 B DG 9 1_555 C DC 1 1_555 -0.819 -1.213 3.589 -5.159 8.535 37.265 -2.975 0.555  3.322 13.073 7.901   
38.530 6 TT_DC8DG9:DC1DG2_PP T 8 ? P 2 ? T 9 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5  
;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE
;
DUP 
6  'MAGNESIUM ION'                                       MG  
7  1,2-ETHANEDIOL                                        EDO 
8  'CHLORIDE ION'                                        CL  
9  'SODIUM ION'                                          NA  
10 '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 
11 water                                                 HOH 
#