data_4M0A
# 
_entry.id   4M0A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4M0A         
NDB   NA2651       
RCSB  RCSB081303   
WWPDB D_1000081303 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2IHM . unspecified 
PDB 4LZD . unspecified 
PDB 4LZG . unspecified 
PDB 4M04 . unspecified 
# 
_pdbx_database_status.entry_id                        4M0A 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-08-01 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Moon, A.F.'     1 
'Pryor, J.M.'    2 
'Ramsden, D.A.'  3 
'Kunkel, T.A.'   4 
'Bebenek, K.'    5 
'Pedersen, L.C.' 6 
# 
_citation.id                        primary 
_citation.title                     'Sustained active site rigidity during synthesis by human DNA polymerase mu.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            21 
_citation.page_first                253 
_citation.page_last                 260 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24487959 
_citation.pdbx_database_id_DOI      10.1038/nsmb.2766 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Moon, A.F.'     1 
primary 'Pryor, J.M.'    2 
primary 'Ramsden, D.A.'  3 
primary 'Kunkel, T.A.'   4 
primary 'Bebenek, K.'    5 
primary 'Pedersen, L.C.' 6 
# 
_cell.length_a           60.018 
_cell.length_b           68.670 
_cell.length_c           110.444 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4M0A 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         4M0A 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA-directed DNA/RNA polymerase mu'                  40054.434 1   2.7.7.7 ? 'UNP residues 132-494' ? 
2  polymer     syn 'template strand'                                     2740.812  1   ?       ? ?                      ? 
3  polymer     syn 'upstream primer strand'                              1495.023  1   ?       ? ?                      ? 
4  polymer     syn 'downstream primer strand'                            1191.818  1   ?       ? ?                      ? 
5  non-polymer syn 'MAGNESIUM ION'                                       24.305    3   ?       ? ?                      ? 
6  non-polymer syn PYROPHOSPHATE                                         177.975   1   ?       ? ?                      ? 
7  non-polymer syn 1,2-ETHANEDIOL                                        62.068    3   ?       ? ?                      ? 
8  non-polymer syn 'MANGANESE (II) ION'                                  54.938    1   ?       ? ?                      ? 
9  non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305   1   ?       ? ?                      ? 
10 water       nat water                                                 18.015    398 ?       ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol Mu, Terminal transferase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSAAAPLSPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFG
EHSSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDL
STPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQ
HSCCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNS
HGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
;GSAAAPLSPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFG
EHSSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDL
STPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQ
HSCCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNS
HGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DG)(DG)(DC)(DA)(DT)(DA)(DC)(DG)' CGGCATACG T ? 
3 polydeoxyribonucleotide no no '(DC)(DG)(DT)(DA)(DT)' CGTAT P ? 
4 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DG)' GCCG D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ALA n 
1 4   ALA n 
1 5   ALA n 
1 6   PRO n 
1 7   LEU n 
1 8   SER n 
1 9   PRO n 
1 10  ALA n 
1 11  TRP n 
1 12  MET n 
1 13  PRO n 
1 14  ALA n 
1 15  TYR n 
1 16  ALA n 
1 17  CYS n 
1 18  GLN n 
1 19  ARG n 
1 20  PRO n 
1 21  THR n 
1 22  PRO n 
1 23  LEU n 
1 24  THR n 
1 25  HIS n 
1 26  HIS n 
1 27  ASN n 
1 28  THR n 
1 29  GLY n 
1 30  LEU n 
1 31  SER n 
1 32  GLU n 
1 33  ALA n 
1 34  LEU n 
1 35  GLU n 
1 36  ILE n 
1 37  LEU n 
1 38  ALA n 
1 39  GLU n 
1 40  ALA n 
1 41  ALA n 
1 42  GLY n 
1 43  PHE n 
1 44  GLU n 
1 45  GLY n 
1 46  SER n 
1 47  GLU n 
1 48  GLY n 
1 49  ARG n 
1 50  LEU n 
1 51  LEU n 
1 52  THR n 
1 53  PHE n 
1 54  CYS n 
1 55  ARG n 
1 56  ALA n 
1 57  ALA n 
1 58  SER n 
1 59  VAL n 
1 60  LEU n 
1 61  LYS n 
1 62  ALA n 
1 63  LEU n 
1 64  PRO n 
1 65  SER n 
1 66  PRO n 
1 67  VAL n 
1 68  THR n 
1 69  THR n 
1 70  LEU n 
1 71  SER n 
1 72  GLN n 
1 73  LEU n 
1 74  GLN n 
1 75  GLY n 
1 76  LEU n 
1 77  PRO n 
1 78  HIS n 
1 79  PHE n 
1 80  GLY n 
1 81  GLU n 
1 82  HIS n 
1 83  SER n 
1 84  SER n 
1 85  ARG n 
1 86  VAL n 
1 87  VAL n 
1 88  GLN n 
1 89  GLU n 
1 90  LEU n 
1 91  LEU n 
1 92  GLU n 
1 93  HIS n 
1 94  GLY n 
1 95  VAL n 
1 96  CYS n 
1 97  GLU n 
1 98  GLU n 
1 99  VAL n 
1 100 GLU n 
1 101 ARG n 
1 102 VAL n 
1 103 ARG n 
1 104 ARG n 
1 105 SER n 
1 106 GLU n 
1 107 ARG n 
1 108 TYR n 
1 109 GLN n 
1 110 THR n 
1 111 MET n 
1 112 LYS n 
1 113 LEU n 
1 114 PHE n 
1 115 THR n 
1 116 GLN n 
1 117 ILE n 
1 118 PHE n 
1 119 GLY n 
1 120 VAL n 
1 121 GLY n 
1 122 VAL n 
1 123 LYS n 
1 124 THR n 
1 125 ALA n 
1 126 ASP n 
1 127 ARG n 
1 128 TRP n 
1 129 TYR n 
1 130 ARG n 
1 131 GLU n 
1 132 GLY n 
1 133 LEU n 
1 134 ARG n 
1 135 THR n 
1 136 LEU n 
1 137 ASP n 
1 138 ASP n 
1 139 LEU n 
1 140 ARG n 
1 141 GLU n 
1 142 GLN n 
1 143 PRO n 
1 144 GLN n 
1 145 LYS n 
1 146 LEU n 
1 147 THR n 
1 148 GLN n 
1 149 GLN n 
1 150 GLN n 
1 151 LYS n 
1 152 ALA n 
1 153 GLY n 
1 154 LEU n 
1 155 GLN n 
1 156 HIS n 
1 157 HIS n 
1 158 GLN n 
1 159 ASP n 
1 160 LEU n 
1 161 SER n 
1 162 THR n 
1 163 PRO n 
1 164 VAL n 
1 165 LEU n 
1 166 ARG n 
1 167 SER n 
1 168 ASP n 
1 169 VAL n 
1 170 ASP n 
1 171 ALA n 
1 172 LEU n 
1 173 GLN n 
1 174 GLN n 
1 175 VAL n 
1 176 VAL n 
1 177 GLU n 
1 178 GLU n 
1 179 ALA n 
1 180 VAL n 
1 181 GLY n 
1 182 GLN n 
1 183 ALA n 
1 184 LEU n 
1 185 PRO n 
1 186 GLY n 
1 187 ALA n 
1 188 THR n 
1 189 VAL n 
1 190 THR n 
1 191 LEU n 
1 192 THR n 
1 193 GLY n 
1 194 GLY n 
1 195 PHE n 
1 196 ARG n 
1 197 ARG n 
1 198 GLY n 
1 199 LYS n 
1 200 LEU n 
1 201 GLN n 
1 202 GLY n 
1 203 HIS n 
1 204 ASP n 
1 205 VAL n 
1 206 ASP n 
1 207 PHE n 
1 208 LEU n 
1 209 ILE n 
1 210 THR n 
1 211 HIS n 
1 212 PRO n 
1 213 LYS n 
1 214 GLU n 
1 215 GLY n 
1 216 GLN n 
1 217 GLU n 
1 218 ALA n 
1 219 GLY n 
1 220 LEU n 
1 221 LEU n 
1 222 PRO n 
1 223 ARG n 
1 224 VAL n 
1 225 MET n 
1 226 CYS n 
1 227 ARG n 
1 228 LEU n 
1 229 GLN n 
1 230 ASP n 
1 231 GLN n 
1 232 GLY n 
1 233 LEU n 
1 234 ILE n 
1 235 LEU n 
1 236 TYR n 
1 237 HIS n 
1 238 GLN n 
1 239 HIS n 
1 240 GLN n 
1 241 HIS n 
1 242 SER n 
1 243 CYS n 
1 244 CYS n 
1 245 GLU n 
1 246 SER n 
1 247 PRO n 
1 248 THR n 
1 249 ARG n 
1 250 LEU n 
1 251 ALA n 
1 252 GLN n 
1 253 GLN n 
1 254 SER n 
1 255 HIS n 
1 256 MET n 
1 257 ASP n 
1 258 ALA n 
1 259 PHE n 
1 260 GLU n 
1 261 ARG n 
1 262 SER n 
1 263 PHE n 
1 264 CYS n 
1 265 ILE n 
1 266 PHE n 
1 267 ARG n 
1 268 LEU n 
1 269 PRO n 
1 270 GLN n 
1 271 PRO n 
1 272 GLY n 
1 273 SER n 
1 274 TRP n 
1 275 LYS n 
1 276 ALA n 
1 277 VAL n 
1 278 ARG n 
1 279 VAL n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 VAL n 
1 284 ALA n 
1 285 PRO n 
1 286 VAL n 
1 287 SER n 
1 288 GLN n 
1 289 PHE n 
1 290 PRO n 
1 291 PHE n 
1 292 ALA n 
1 293 LEU n 
1 294 LEU n 
1 295 GLY n 
1 296 TRP n 
1 297 THR n 
1 298 GLY n 
1 299 SER n 
1 300 LYS n 
1 301 LEU n 
1 302 PHE n 
1 303 GLN n 
1 304 ARG n 
1 305 GLU n 
1 306 LEU n 
1 307 ARG n 
1 308 ARG n 
1 309 PHE n 
1 310 SER n 
1 311 ARG n 
1 312 LYS n 
1 313 GLU n 
1 314 LYS n 
1 315 GLY n 
1 316 LEU n 
1 317 TRP n 
1 318 LEU n 
1 319 ASN n 
1 320 SER n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 PHE n 
1 325 ASP n 
1 326 PRO n 
1 327 GLU n 
1 328 GLN n 
1 329 LYS n 
1 330 THR n 
1 331 PHE n 
1 332 PHE n 
1 333 GLN n 
1 334 ALA n 
1 335 ALA n 
1 336 SER n 
1 337 GLU n 
1 338 GLU n 
1 339 ASP n 
1 340 ILE n 
1 341 PHE n 
1 342 ARG n 
1 343 HIS n 
1 344 LEU n 
1 345 GLY n 
1 346 LEU n 
1 347 GLU n 
1 348 TYR n 
1 349 LEU n 
1 350 PRO n 
1 351 PRO n 
1 352 GLU n 
1 353 GLN n 
1 354 ARG n 
1 355 ASN n 
1 356 ALA n 
2 1   DC  n 
2 2   DG  n 
2 3   DG  n 
2 4   DC  n 
2 5   DA  n 
2 6   DT  n 
2 7   DA  n 
2 8   DC  n 
2 9   DG  n 
3 1   DC  n 
3 2   DG  n 
3 3   DT  n 
3 4   DA  n 
3 5   DT  n 
4 1   DG  n 
4 2   DC  n 
4 3   DC  n 
4 4   DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLM, polmu' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   
;Modified version of the pGEX4T3 vector backbone, where a TEV protease cleavage site has been inserted downstream of the thrombin cleavage site, and the sequence of the multicloning site has been replaced by that of the pMALX vector (Moon et al, 2010).  Three TGA stop codons have been inserted downstream of the multicloning site, each utilizing a different reading frame.
;
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEXM 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'synthesized by Oligos Etc' 
3 1 sample ? ? ? ? ? 'synthesized by Oligos Etc' 
4 1 sample ? ? ? ? ? 'synthesized by Oligos Etc' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOLM_HUMAN Q9NP87 1 
;PLSPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFGEHSSR
VVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLSTPVL
RSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQHSCCE
SPTRLAQQSHMDAFERSFCIFRLPQPPGAAVGGSTRPCPSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKE
KGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
132 ? 
2 PDB 4M0A        4M0A   2 CGGCATACG ?   ? 
3 PDB 4M0A        4M0A   3 CGTA ?   ? 
4 PDB 4M0A        4M0A   4 GCCG ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4M0A A 6 ? 356 ? Q9NP87 132 ? 494 ? 132 494 
2 2 4M0A T 1 ? 9   ? 4M0A   1   ? 9   ? 1   9   
3 3 4M0A P 1 ? 5   ? 4M0A   1   ? 5   ? 1   5   
4 4 4M0A D 1 ? 4   ? 4M0A   1   ? 4   ? 1   4   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4M0A GLY A 1   ? UNP Q9NP87 ?   ?   'EXPRESSION TAG' 127 1  
1 4M0A SER A 2   ? UNP Q9NP87 ?   ?   'EXPRESSION TAG' 128 2  
1 4M0A ALA A 3   ? UNP Q9NP87 ?   ?   'EXPRESSION TAG' 129 3  
1 4M0A ALA A 4   ? UNP Q9NP87 ?   ?   'EXPRESSION TAG' 130 4  
1 4M0A ALA A 5   ? UNP Q9NP87 ?   ?   'EXPRESSION TAG' 131 5  
1 4M0A ?   A ?   ? UNP Q9NP87 PRO 398 DELETION         ?   6  
1 4M0A ?   A ?   ? UNP Q9NP87 GLY 399 DELETION         ?   7  
1 4M0A ?   A ?   ? UNP Q9NP87 ALA 400 DELETION         ?   8  
1 4M0A ?   A ?   ? UNP Q9NP87 ALA 401 DELETION         ?   9  
1 4M0A ?   A ?   ? UNP Q9NP87 VAL 402 DELETION         ?   10 
1 4M0A ?   A ?   ? UNP Q9NP87 GLY 403 DELETION         ?   11 
1 4M0A ?   A ?   ? UNP Q9NP87 GLY 404 DELETION         ?   12 
1 4M0A ?   A ?   ? UNP Q9NP87 SER 405 DELETION         ?   13 
1 4M0A ?   A ?   ? UNP Q9NP87 THR 406 DELETION         ?   14 
1 4M0A ?   A ?   ? UNP Q9NP87 ARG 407 DELETION         ?   15 
1 4M0A ?   A ?   ? UNP Q9NP87 PRO 408 DELETION         ?   16 
1 4M0A ?   A ?   ? UNP Q9NP87 CYS 409 DELETION         ?   17 
1 4M0A ?   A ?   ? UNP Q9NP87 PRO 410 DELETION         ?   18 
1 4M0A GLY A 272 ? UNP Q9NP87 ?   ?   INSERTION        410 19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                               ?                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                              ?                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                            ?                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                       ?                 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                              ?                 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                  ?                 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                   ?                 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                  ?                 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                          ?                 'C10 H15 N2 O8 P' 322.208 
EDO non-polymer         . 1,2-ETHANEDIOL                                        'ETHYLENE GLYCOL' 'C2 H6 O2'        62.068  
EPE non-polymer         . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES             'C8 H18 N2 O4 S'  238.305 
GLN 'L-peptide linking' y GLUTAMINE                                             ?                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                       ?                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                               ?                 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                             ?                 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                 ?                 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                            ?                 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                               ?                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                ?                 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                            ?                 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                       ?                 'Mg 2'            24.305  
MN  non-polymer         . 'MANGANESE (II) ION'                                  ?                 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                                         ?                 'C9 H11 N O2'     165.189 
PPV non-polymer         . PYROPHOSPHATE                                         ?                 'H4 O7 P2'        177.975 
PRO 'L-peptide linking' y PROLINE                                               ?                 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                ?                 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                             ?                 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                            ?                 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                              ?                 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                ?                 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4M0A 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.50 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   50.84 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;Crystals were grown by mixing 1uL protein/DNA mixture with 1uL mother liquor (85-90mM HEPES pH 7.5, 17-18% PEG4000), using the sitting drop vapor diffusion technique.  Crystals were transferred in two steps to a cryoprotectant solution containing 0.1M HEPES pH 7.5, 10mM MgCl2, 50mM NaCl, 20% PEG4000, 5% glycerol, 15% ethylene glycol, 10mM dTTP for 16 hours.  The crystals were then backsoaked in cryoprotectant containing 2mM pyrophosphate.  , VAPOR DIFFUSION, SITTING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2012-10-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
# 
_reflns.entry_id                     4M0A 
_reflns.d_resolution_high            1.850 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   39012 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_netI_over_sigmaI        9.400 
_reflns.pdbx_chi_squared             1.127 
_reflns.pdbx_redundancy              6.900 
_reflns.percent_possible_obs         98.200 
_reflns.B_iso_Wilson_estimate        22.480 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.number_all                   39012 
_reflns.pdbx_Rsym_value              0.071 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.850 1.880  ? ? ? 0.442 ? ? 1.031 4.100 ? 1796 92.100 1  1 
1.880 1.920  ? ? ? 0.406 ? ? 1.081 5.000 ? 1860 95.600 2  1 
1.920 1.950  ? ? ? 0.396 ? ? 1.134 5.900 ? 1874 96.800 3  1 
1.950 1.990  ? ? ? 0.336 ? ? 1.116 6.500 ? 1936 98.200 4  1 
1.990 2.040  ? ? ? 0.288 ? ? 1.139 7.000 ? 1907 97.800 5  1 
2.040 2.080  ? ? ? 0.270 ? ? 1.212 7.100 ? 1928 97.500 6  1 
2.080 2.140  ? ? ? 0.217 ? ? 1.202 7.200 ? 1942 98.600 7  1 
2.140 2.190  ? ? ? 0.193 ? ? 1.222 7.300 ? 1902 98.700 8  1 
2.190 2.260  ? ? ? 0.175 ? ? 1.251 7.300 ? 1929 98.500 9  1 
2.260 2.330  ? ? ? 0.151 ? ? 1.161 7.300 ? 1958 98.500 10 1 
2.330 2.410  ? ? ? 0.136 ? ? 1.088 7.300 ? 1951 98.600 11 1 
2.410 2.510  ? ? ? 0.116 ? ? 1.142 7.300 ? 1956 98.800 12 1 
2.510 2.630  ? ? ? 0.109 ? ? 1.158 7.400 ? 1948 99.000 13 1 
2.630 2.760  ? ? ? 0.096 ? ? 1.149 7.400 ? 1966 98.600 14 1 
2.760 2.940  ? ? ? 0.087 ? ? 1.088 7.400 ? 1967 99.400 15 1 
2.940 3.160  ? ? ? 0.072 ? ? 1.080 7.400 ? 1980 99.000 16 1 
3.160 3.480  ? ? ? 0.054 ? ? 1.033 7.400 ? 1990 99.500 17 1 
3.480 3.990  ? ? ? 0.045 ? ? 1.028 7.300 ? 2018 99.700 18 1 
3.990 5.020  ? ? ? 0.035 ? ? 1.125 7.200 ? 2049 99.700 19 1 
5.020 50.000 ? ? ? 0.030 ? ? 1.049 6.800 ? 2155 99.500 20 1 
# 
_refine.entry_id                                 4M0A 
_refine.ls_d_res_high                            1.8500 
_refine.ls_d_res_low                             31.3810 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.1500 
_refine.ls_number_reflns_obs                     38959 
_refine.ls_number_reflns_all                     39012 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1645 
_refine.ls_R_factor_R_work                       0.1626 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2003 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.9900 
_refine.ls_number_reflns_R_free                  1945 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               13.3783 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.1900 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'Ternary complex of human Polymerase Mu' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8756 
_refine.B_iso_max                                62.790 
_refine.B_iso_min                                0.450 
_refine.pdbx_overall_phase_error                 19.0500 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.300 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2540 
_refine_hist.pdbx_number_atoms_nucleic_acid   364 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             398 
_refine_hist.number_atoms_total               3332 
_refine_hist.d_res_high                       1.8500 
_refine_hist.d_res_low                        31.3810 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           3115 0.013  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          4313 1.522  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     473  0.101  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      504  0.008  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 1004 12.922 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.8501 1.8964  14 91.0000  2413 . 0.2080 0.2439 . 127 . 2540 . . 'X-RAY DIFFRACTION' 
1.8964 1.9477  14 97.0000  2570 . 0.1975 0.2468 . 135 . 2705 . . 'X-RAY DIFFRACTION' 
1.9477 2.0050  14 98.0000  2610 . 0.1952 0.2431 . 139 . 2749 . . 'X-RAY DIFFRACTION' 
2.0050 2.0697  14 98.0000  2611 . 0.1767 0.2477 . 137 . 2748 . . 'X-RAY DIFFRACTION' 
2.0697 2.1436  14 98.0000  2579 . 0.1670 0.2457 . 136 . 2715 . . 'X-RAY DIFFRACTION' 
2.1436 2.2294  14 99.0000  2643 . 0.1747 0.2370 . 140 . 2783 . . 'X-RAY DIFFRACTION' 
2.2294 2.3309  14 99.0000  2628 . 0.1671 0.2212 . 134 . 2762 . . 'X-RAY DIFFRACTION' 
2.3309 2.4537  14 98.0000  2634 . 0.1666 0.2063 . 140 . 2774 . . 'X-RAY DIFFRACTION' 
2.4537 2.6074  14 99.0000  2664 . 0.1716 0.2191 . 143 . 2807 . . 'X-RAY DIFFRACTION' 
2.6074 2.8086  14 99.0000  2649 . 0.1803 0.2145 . 137 . 2786 . . 'X-RAY DIFFRACTION' 
2.8086 3.0910  14 99.0000  2684 . 0.1799 0.2101 . 140 . 2824 . . 'X-RAY DIFFRACTION' 
3.0910 3.5377  14 99.0000  2711 . 0.1538 0.1920 . 142 . 2853 . . 'X-RAY DIFFRACTION' 
3.5377 4.4551  14 100.0000 2740 . 0.1307 0.1521 . 146 . 2886 . . 'X-RAY DIFFRACTION' 
4.4551 31.3859 14 100.0000 2878 . 0.1544 0.1749 . 149 . 3027 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4M0A 
_struct.title                     'Human DNA Polymerase Mu post-catalytic complex' 
_struct.pdbx_descriptor           'DNA-directed DNA/RNA polymerase mu (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4M0A 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'polymerase, DNA break repair, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 5  ? 
K N N 7  ? 
L N N 9  ? 
M N N 7  ? 
N N N 10 ? 
O N N 10 ? 
P N N 10 ? 
Q N N 10 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 15  ? ARG A 19  ? TYR A 141 ARG A 145 5 ? 5  
HELX_P HELX_P2  2  ASN A 27  ? GLU A 44  ? ASN A 153 GLU A 170 1 ? 18 
HELX_P HELX_P3  3  SER A 46  ? ALA A 62  ? SER A 172 ALA A 188 1 ? 17 
HELX_P HELX_P4  4  THR A 69  ? GLN A 74  ? THR A 195 GLN A 200 5 ? 6  
HELX_P HELX_P5  5  GLY A 80  ? GLY A 94  ? GLY A 206 GLY A 220 1 ? 15 
HELX_P HELX_P6  6  CYS A 96  ? SER A 105 ? CYS A 222 SER A 231 1 ? 10 
HELX_P HELX_P7  7  SER A 105 ? GLN A 116 ? SER A 231 GLN A 242 1 ? 12 
HELX_P HELX_P8  8  GLY A 121 ? GLU A 131 ? GLY A 247 GLU A 257 1 ? 11 
HELX_P HELX_P9  9  THR A 135 ? GLU A 141 ? THR A 261 GLU A 267 1 ? 7  
HELX_P HELX_P10 10 GLN A 142 ? LEU A 146 ? GLN A 268 LEU A 272 5 ? 5  
HELX_P HELX_P11 11 THR A 147 ? HIS A 156 ? THR A 273 HIS A 282 1 ? 10 
HELX_P HELX_P12 12 HIS A 156 ? SER A 161 ? HIS A 282 SER A 287 1 ? 6  
HELX_P HELX_P13 13 ARG A 166 ? LEU A 184 ? ARG A 292 LEU A 310 1 ? 19 
HELX_P HELX_P14 14 THR A 192 ? ARG A 197 ? THR A 318 ARG A 323 1 ? 6  
HELX_P HELX_P15 15 GLY A 219 ? GLN A 231 ? GLY A 345 GLN A 357 1 ? 13 
HELX_P HELX_P16 16 PRO A 285 ? SER A 287 ? PRO A 423 SER A 425 5 ? 3  
HELX_P HELX_P17 17 GLN A 288 ? GLY A 298 ? GLN A 426 GLY A 436 1 ? 11 
HELX_P HELX_P18 18 SER A 299 ? GLY A 315 ? SER A 437 GLY A 453 1 ? 17 
HELX_P HELX_P19 19 SER A 336 ? LEU A 344 ? SER A 474 LEU A 482 1 ? 9  
HELX_P HELX_P20 20 PRO A 350 ? ARG A 354 ? PRO A 488 ARG A 492 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? G PPV .   O22 ? ? ? 1_555 J MG  . MG  ? ? A PPV 503 A MG  506 1_555 ? ? ? ? ? ? ?            1.905 ? 
metalc2  metalc ? ? G PPV .   O11 ? ? ? 1_555 J MG  . MG  ? ? A PPV 503 A MG  506 1_555 ? ? ? ? ? ? ?            1.928 ? 
metalc3  metalc ? ? A ASP 206 OD1 ? ? ? 1_555 I MN  . MN  ? ? A ASP 332 A MN  505 1_555 ? ? ? ? ? ? ?            1.974 ? 
metalc4  metalc ? ? A ASP 204 OD1 B ? ? 1_555 I MN  . MN  ? ? A ASP 330 A MN  505 1_555 ? ? ? ? ? ? ?            2.031 ? 
metalc5  metalc ? ? J MG  .   MG  ? ? ? 1_555 N HOH . O   ? ? A MG  506 A HOH 900 1_555 ? ? ? ? ? ? ?            2.056 ? 
metalc6  metalc ? ? A ASP 204 OD1 A ? ? 1_555 E MG  . MG  ? ? A ASP 330 A MG  501 1_555 ? ? ? ? ? ? ?            2.072 ? 
metalc7  metalc ? ? E MG  .   MG  ? ? ? 1_555 N HOH . O   ? ? A MG  501 A HOH 601 1_555 ? ? ? ? ? ? ?            2.075 ? 
metalc8  metalc ? ? E MG  .   MG  ? ? ? 1_555 G PPV . O12 ? ? A MG  501 A PPV 503 1_555 ? ? ? ? ? ? ?            2.101 ? 
metalc9  metalc ? ? A ASP 206 OD2 ? ? ? 1_555 E MG  . MG  ? ? A ASP 332 A MG  501 1_555 ? ? ? ? ? ? ?            2.106 ? 
metalc10 metalc ? ? C DT  5   OP1 ? ? ? 1_555 E MG  . MG  ? ? P DT  5   A MG  501 1_555 ? ? ? ? ? ? ?            2.119 ? 
metalc11 metalc ? ? J MG  .   MG  ? ? ? 1_555 N HOH . O   ? ? A MG  506 A HOH 843 1_555 ? ? ? ? ? ? ?            2.210 ? 
metalc12 metalc ? ? J MG  .   MG  ? ? ? 1_555 P HOH . O   ? ? A MG  506 P HOH 218 1_555 ? ? ? ? ? ? ?            2.221 ? 
metalc13 metalc ? ? A ASP 280 OD1 ? ? ? 1_555 I MN  . MN  ? ? A ASP 418 A MN  505 1_555 ? ? ? ? ? ? ?            2.239 ? 
metalc14 metalc ? ? A ASP 204 OD2 B ? ? 1_555 E MG  . MG  ? ? A ASP 330 A MG  501 1_555 ? ? ? ? ? ? ?            2.280 ? 
metalc15 metalc ? ? C DT  5   OP1 ? ? ? 1_555 I MN  . MN  ? ? P DT  5   A MN  505 1_555 ? ? ? ? ? ? ?            2.309 ? 
metalc16 metalc ? ? A VAL 120 O   ? ? ? 1_555 F MG  . MG  ? ? A VAL 246 A MG  502 1_555 ? ? ? ? ? ? ?            2.355 ? 
metalc17 metalc ? ? A ILE 117 O   ? ? ? 1_555 F MG  . MG  ? ? A ILE 243 A MG  502 1_555 ? ? ? ? ? ? ?            2.364 ? 
metalc18 metalc ? ? F MG  .   MG  ? ? ? 1_555 P HOH . O   ? ? A MG  502 P HOH 202 1_555 ? ? ? ? ? ? ?            2.369 ? 
metalc19 metalc ? ? A THR 115 O   ? ? ? 1_555 F MG  . MG  ? ? A THR 241 A MG  502 1_555 ? ? ? ? ? ? ?            2.381 ? 
metalc20 metalc ? ? E MG  .   MG  ? ? ? 1_555 N HOH . O   ? ? A MG  501 A HOH 900 1_555 ? ? ? ? ? ? ?            2.431 ? 
metalc21 metalc ? ? F MG  .   MG  ? ? ? 1_555 N HOH . O   ? ? A MG  502 A HOH 737 1_555 ? ? ? ? ? ? ?            2.456 ? 
metalc22 metalc ? ? C DT  3   OP1 ? ? ? 1_555 F MG  . MG  ? ? P DT  3   A MG  502 1_555 ? ? ? ? ? ? ?            2.619 ? 
metalc23 metalc ? ? A ASP 204 OD1 A ? ? 1_555 I MN  . MN  ? ? A ASP 330 A MN  505 1_555 ? ? ? ? ? ? ?            2.657 ? 
metalc24 metalc ? ? A ASP 204 OD2 B ? ? 1_555 I MN  . MN  ? ? A ASP 330 A MN  505 1_555 ? ? ? ? ? ? ?            2.772 ? 
hydrog1  hydrog ? ? B DC  1   N3  ? ? ? 1_555 D DG  4 N1  ? ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  1   N4  ? ? ? 1_555 D DG  4 O6  ? ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  1   O2  ? ? ? 1_555 D DG  4 N2  ? ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2   N1  ? ? ? 1_555 D DC  3 N3  ? ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2   N2  ? ? ? 1_555 D DC  3 O2  ? ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  2   O6  ? ? ? 1_555 D DC  3 N4  ? ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  3   N1  ? ? ? 1_555 D DC  2 N3  ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  3   N2  ? ? ? 1_555 D DC  2 O2  ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  3   O6  ? ? ? 1_555 D DC  2 N4  ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  4   N3  ? ? ? 1_555 D DG  1 N1  ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  4   N4  ? ? ? 1_555 D DG  1 O6  ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  4   O2  ? ? ? 1_555 D DG  1 N2  ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DA  5   N1  ? ? ? 1_555 C DT  5 N3  ? ? T DA  5   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DA  5   N6  ? ? ? 1_555 C DT  5 O4  ? ? T DA  5   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DT  6   N3  ? ? ? 1_555 C DA  4 N1  ? ? T DT  6   P DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DT  6   O4  ? ? ? 1_555 C DA  4 N6  ? ? T DT  6   P DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DA  7   N1  ? ? ? 1_555 C DT  3 N3  ? ? T DA  7   P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DA  7   N6  ? ? ? 1_555 C DT  3 O4  ? ? T DA  7   P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  8   N3  ? ? ? 1_555 C DG  2 N1  ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC  8   N4  ? ? ? 1_555 C DG  2 O6  ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DC  8   O2  ? ? ? 1_555 C DG  2 N2  ? ? T DC  8   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  9   N1  ? ? ? 1_555 C DC  1 N3  ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DG  9   N2  ? ? ? 1_555 C DC  1 O2  ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DG  9   O6  ? ? ? 1_555 C DC  1 N4  ? ? T DG  9   P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           298 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            436 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    299 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     437 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.90 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 164 ? LEU A 165 ? VAL A 290 LEU A 291 
A 2 GLN A 201 ? GLY A 202 ? GLN A 327 GLY A 328 
B 1 THR A 188 ? LEU A 191 ? THR A 314 LEU A 317 
B 2 VAL A 205 ? THR A 210 ? VAL A 331 THR A 336 
B 3 SER A 273 ? VAL A 283 ? SER A 411 VAL A 421 
B 4 ARG A 261 ? GLN A 270 ? ARG A 387 GLN A 396 
B 5 ILE A 234 ? TYR A 236 ? ILE A 360 TYR A 362 
C 1 TRP A 317 ? LEU A 318 ? TRP A 455 LEU A 456 
C 2 LEU A 323 ? ASP A 325 ? LEU A 461 ASP A 463 
C 3 THR A 330 ? PHE A 331 ? THR A 468 PHE A 469 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 164 ? N VAL A 290 O GLY A 202 ? O GLY A 328 
B 1 2 N THR A 190 ? N THR A 316 O LEU A 208 ? O LEU A 334 
B 2 3 N ILE A 209 ? N ILE A 335 O VAL A 282 ? O VAL A 420 
B 3 4 O VAL A 277 ? O VAL A 415 N PHE A 266 ? N PHE A 392 
B 4 5 O ILE A 265 ? O ILE A 391 N TYR A 236 ? N TYR A 362 
C 1 2 N TRP A 317 ? N TRP A 455 O PHE A 324 ? O PHE A 462 
C 2 3 N ASP A 325 ? N ASP A 463 O THR A 330 ? O THR A 468 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 501'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 502'  
AC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE PPV A 503' 
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 504' 
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MN A 505'  
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 506'  
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 507' 
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EPE A 508' 
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO P 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  ASP A 204 ? ASP A 330 . ? 1_555 ? 
2  AC1 7  ASP A 206 ? ASP A 332 . ? 1_555 ? 
3  AC1 7  PPV G .   ? PPV A 503 . ? 1_555 ? 
4  AC1 7  MN  I .   ? MN  A 505 . ? 1_555 ? 
5  AC1 7  HOH N .   ? HOH A 601 . ? 1_555 ? 
6  AC1 7  HOH N .   ? HOH A 900 . ? 1_555 ? 
7  AC1 7  DT  C 5   ? DT  P 5   . ? 1_555 ? 
8  AC2 6  THR A 115 ? THR A 241 . ? 1_555 ? 
9  AC2 6  ILE A 117 ? ILE A 243 . ? 1_555 ? 
10 AC2 6  VAL A 120 ? VAL A 246 . ? 1_555 ? 
11 AC2 6  HOH N .   ? HOH A 737 . ? 1_555 ? 
12 AC2 6  DT  C 3   ? DT  P 3   . ? 1_555 ? 
13 AC2 6  HOH P .   ? HOH P 202 . ? 1_555 ? 
14 AC3 15 GLY A 193 ? GLY A 319 . ? 1_555 ? 
15 AC3 15 GLY A 194 ? GLY A 320 . ? 1_555 ? 
16 AC3 15 ARG A 197 ? ARG A 323 . ? 1_555 ? 
17 AC3 15 LYS A 199 ? LYS A 325 . ? 1_555 ? 
18 AC3 15 ASP A 206 ? ASP A 332 . ? 1_555 ? 
19 AC3 15 MG  E .   ? MG  A 501 . ? 1_555 ? 
20 AC3 15 MG  J .   ? MG  A 506 . ? 1_555 ? 
21 AC3 15 HOH N .   ? HOH A 601 . ? 1_555 ? 
22 AC3 15 HOH N .   ? HOH A 609 . ? 1_555 ? 
23 AC3 15 HOH N .   ? HOH A 665 . ? 1_555 ? 
24 AC3 15 HOH N .   ? HOH A 683 . ? 1_555 ? 
25 AC3 15 HOH N .   ? HOH A 730 . ? 1_555 ? 
26 AC3 15 HOH N .   ? HOH A 843 . ? 1_555 ? 
27 AC3 15 HOH N .   ? HOH A 900 . ? 1_555 ? 
28 AC3 15 DT  C 5   ? DT  P 5   . ? 1_555 ? 
29 AC4 5  PRO A 64  ? PRO A 190 . ? 1_555 ? 
30 AC4 5  SER A 65  ? SER A 191 . ? 1_555 ? 
31 AC4 5  PRO A 66  ? PRO A 192 . ? 1_555 ? 
32 AC4 5  GLN A 72  ? GLN A 198 . ? 1_555 ? 
33 AC4 5  HOH N .   ? HOH A 870 . ? 1_555 ? 
34 AC5 7  ASP A 204 ? ASP A 330 . ? 1_555 ? 
35 AC5 7  ASP A 206 ? ASP A 332 . ? 1_555 ? 
36 AC5 7  ASP A 280 ? ASP A 418 . ? 1_555 ? 
37 AC5 7  MG  E .   ? MG  A 501 . ? 1_555 ? 
38 AC5 7  DA  C 4   ? DA  P 4   . ? 1_555 ? 
39 AC5 7  DT  C 5   ? DT  P 5   . ? 1_555 ? 
40 AC5 7  HOH P .   ? HOH P 208 . ? 1_555 ? 
41 AC6 4  PPV G .   ? PPV A 503 . ? 1_555 ? 
42 AC6 4  HOH N .   ? HOH A 843 . ? 1_555 ? 
43 AC6 4  HOH N .   ? HOH A 900 . ? 1_555 ? 
44 AC6 4  HOH P .   ? HOH P 218 . ? 1_555 ? 
45 AC7 5  THR A 68  ? THR A 194 . ? 4_445 ? 
46 AC7 5  THR A 188 ? THR A 314 . ? 1_555 ? 
47 AC7 5  THR A 210 ? THR A 336 . ? 1_555 ? 
48 AC7 5  PHE A 289 ? PHE A 427 . ? 1_555 ? 
49 AC7 5  HOH N .   ? HOH A 706 . ? 1_555 ? 
50 AC8 4  LYS A 199 ? LYS A 325 . ? 1_555 ? 
51 AC8 4  LEU A 200 ? LEU A 326 . ? 1_555 ? 
52 AC8 4  GLN A 201 ? GLN A 327 . ? 1_555 ? 
53 AC8 4  HOH N .   ? HOH A 862 . ? 1_555 ? 
54 AC9 6  ARG A 261 ? ARG A 387 . ? 1_555 ? 
55 AC9 6  GLY A 295 ? GLY A 433 . ? 1_555 ? 
56 AC9 6  TRP A 296 ? TRP A 434 . ? 1_555 ? 
57 AC9 6  ARG A 307 ? ARG A 445 . ? 1_555 ? 
58 AC9 6  DA  C 4   ? DA  P 4   . ? 1_555 ? 
59 AC9 6  DT  C 5   ? DT  P 5   . ? 1_555 ? 
# 
_atom_sites.entry_id                    4M0A 
_atom_sites.fract_transf_matrix[1][1]   0.016662 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014562 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009054 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1  12  ? 0.520   -28.703 -11.524 1.00 22.25 ? 138 MET A N     1 
ATOM   2    C  CA    . MET A 1  12  ? 0.738   -27.252 -11.573 1.00 16.97 ? 138 MET A CA    1 
ATOM   3    C  C     . MET A 1  12  ? -0.073  -26.600 -12.700 1.00 14.31 ? 138 MET A C     1 
ATOM   4    O  O     . MET A 1  12  ? 0.227   -26.769 -13.874 1.00 15.85 ? 138 MET A O     1 
ATOM   5    C  CB    . MET A 1  12  ? 2.229   -26.978 -11.714 1.00 21.58 ? 138 MET A CB    1 
ATOM   6    C  CG    . MET A 1  12  ? 2.611   -25.569 -12.128 1.00 27.30 ? 138 MET A CG    1 
ATOM   7    S  SD    . MET A 1  12  ? 2.818   -24.381 -10.796 1.00 23.32 ? 138 MET A SD    1 
ATOM   8    C  CE    . MET A 1  12  ? 3.873   -25.262 -9.640  1.00 15.06 ? 138 MET A CE    1 
ATOM   9    N  N     . PRO A 1  13  ? -1.124  -25.834 -12.347 1.00 15.76 ? 139 PRO A N     1 
ATOM   10   C  CA    . PRO A 1  13  ? -1.934  -25.173 -13.382 1.00 16.97 ? 139 PRO A CA    1 
ATOM   11   C  C     . PRO A 1  13  ? -1.158  -24.142 -14.223 1.00 14.62 ? 139 PRO A C     1 
ATOM   12   O  O     . PRO A 1  13  ? -0.115  -23.644 -13.822 1.00 16.86 ? 139 PRO A O     1 
ATOM   13   C  CB    . PRO A 1  13  ? -3.067  -24.503 -12.593 1.00 18.79 ? 139 PRO A CB    1 
ATOM   14   C  CG    . PRO A 1  13  ? -2.588  -24.397 -11.220 1.00 17.56 ? 139 PRO A CG    1 
ATOM   15   C  CD    . PRO A 1  13  ? -1.591  -25.532 -10.986 1.00 17.48 ? 139 PRO A CD    1 
ATOM   16   N  N     . ALA A 1  14  ? -1.665  -23.846 -15.404 1.00 13.70 ? 140 ALA A N     1 
ATOM   17   C  CA    . ALA A 1  14  ? -0.908  -23.043 -16.347 1.00 11.76 ? 140 ALA A CA    1 
ATOM   18   C  C     . ALA A 1  14  ? -0.963  -21.547 -16.060 1.00 14.00 ? 140 ALA A C     1 
ATOM   19   O  O     . ALA A 1  14  ? -0.044  -20.826 -16.437 1.00 13.24 ? 140 ALA A O     1 
ATOM   20   C  CB    . ALA A 1  14  ? -1.357  -23.327 -17.762 1.00 18.67 ? 140 ALA A CB    1 
ATOM   21   N  N     . TYR A 1  15  ? -2.024  -21.085 -15.394 1.00 6.79  ? 141 TYR A N     1 
ATOM   22   C  CA    . TYR A 1  15  ? -2.214  -19.635 -15.150 1.00 5.94  ? 141 TYR A CA    1 
ATOM   23   C  C     . TYR A 1  15  ? -1.821  -19.340 -13.704 1.00 7.06  ? 141 TYR A C     1 
ATOM   24   O  O     . TYR A 1  15  ? -2.122  -20.143 -12.821 1.00 6.36  ? 141 TYR A O     1 
ATOM   25   C  CB    . TYR A 1  15  ? -3.682  -19.262 -15.293 1.00 7.07  ? 141 TYR A CB    1 
ATOM   26   C  CG    . TYR A 1  15  ? -4.235  -19.241 -16.700 1.00 4.46  ? 141 TYR A CG    1 
ATOM   27   C  CD1   . TYR A 1  15  ? -4.764  -20.406 -17.274 1.00 10.59 ? 141 TYR A CD1   1 
ATOM   28   C  CD2   . TYR A 1  15  ? -4.303  -18.067 -17.422 1.00 7.24  ? 141 TYR A CD2   1 
ATOM   29   C  CE1   . TYR A 1  15  ? -5.348  -20.376 -18.540 1.00 8.38  ? 141 TYR A CE1   1 
ATOM   30   C  CE2   . TYR A 1  15  ? -4.866  -18.021 -18.683 1.00 8.80  ? 141 TYR A CE2   1 
ATOM   31   C  CZ    . TYR A 1  15  ? -5.380  -19.180 -19.242 1.00 8.26  ? 141 TYR A CZ    1 
ATOM   32   O  OH    . TYR A 1  15  ? -5.931  -19.115 -20.485 1.00 11.75 ? 141 TYR A OH    1 
ATOM   33   N  N     . ALA A 1  16  ? -1.167  -18.204 -13.455 1.00 4.33  ? 142 ALA A N     1 
ATOM   34   C  CA    . ALA A 1  16  ? -0.699  -17.897 -12.112 1.00 6.20  ? 142 ALA A CA    1 
ATOM   35   C  C     . ALA A 1  16  ? -1.855  -17.667 -11.139 1.00 4.58  ? 142 ALA A C     1 
ATOM   36   O  O     . ALA A 1  16  ? -1.706  -17.817 -9.910  1.00 5.60  ? 142 ALA A O     1 
ATOM   37   C  CB    . ALA A 1  16  ? 0.282   -16.671 -12.137 1.00 5.14  ? 142 ALA A CB    1 
ATOM   38   N  N     . CYS A 1  17  ? -3.025  -17.300 -11.663 1.00 3.72  ? 143 CYS A N     1 
ATOM   39   C  CA    . CYS A 1  17  ? -4.159  -17.025 -10.777 1.00 3.83  ? 143 CYS A CA    1 
ATOM   40   C  C     . CYS A 1  17  ? -4.849  -18.295 -10.309 1.00 7.25  ? 143 CYS A C     1 
ATOM   41   O  O     . CYS A 1  17  ? -5.786  -18.258 -9.500  1.00 4.90  ? 143 CYS A O     1 
ATOM   42   C  CB    . CYS A 1  17  ? -5.154  -16.087 -11.481 1.00 2.62  ? 143 CYS A CB    1 
ATOM   43   S  SG    . CYS A 1  17  ? -5.752  -16.816 -13.055 1.00 6.58  ? 143 CYS A SG    1 
ATOM   44   N  N     . GLN A 1  18  ? -4.364  -19.434 -10.803 1.00 3.97  ? 144 GLN A N     1 
ATOM   45   C  CA    . GLN A 1  18  ? -4.908  -20.727 -10.433 1.00 5.09  ? 144 GLN A CA    1 
ATOM   46   C  C     . GLN A 1  18  ? -4.115  -21.401 -9.312  1.00 9.77  ? 144 GLN A C     1 
ATOM   47   O  O     . GLN A 1  18  ? -4.426  -22.526 -8.919  1.00 10.00 ? 144 GLN A O     1 
ATOM   48   C  CB    . GLN A 1  18  ? -4.926  -21.660 -11.654 1.00 7.56  ? 144 GLN A CB    1 
ATOM   49   C  CG    . GLN A 1  18  ? -5.958  -21.283 -12.676 1.00 9.06  ? 144 GLN A CG    1 
ATOM   50   C  CD    . GLN A 1  18  ? -5.929  -22.250 -13.848 1.00 10.13 ? 144 GLN A CD    1 
ATOM   51   O  OE1   . GLN A 1  18  ? -4.907  -22.389 -14.496 1.00 11.48 ? 144 GLN A OE1   1 
ATOM   52   N  NE2   . GLN A 1  18  ? -7.011  -22.972 -14.054 1.00 14.67 ? 144 GLN A NE2   1 
ATOM   53   N  N     . ARG A 1  19  ? -3.097  -20.731 -8.791  1.00 5.08  ? 145 ARG A N     1 
ATOM   54   C  CA    . ARG A 1  19  ? -2.289  -21.363 -7.774  1.00 8.23  ? 145 ARG A CA    1 
ATOM   55   C  C     . ARG A 1  19  ? -1.797  -20.314 -6.755  1.00 6.29  ? 145 ARG A C     1 
ATOM   56   O  O     . ARG A 1  19  ? -1.552  -19.162 -7.118  1.00 7.34  ? 145 ARG A O     1 
ATOM   57   C  CB    . ARG A 1  19  ? -1.109  -22.033 -8.464  1.00 9.03  ? 145 ARG A CB    1 
ATOM   58   C  CG    . ARG A 1  19  ? -0.297  -21.041 -9.269  1.00 9.71  ? 145 ARG A CG    1 
ATOM   59   C  CD    . ARG A 1  19  ? 0.650   -21.667 -10.268 1.00 12.58 ? 145 ARG A CD    1 
ATOM   60   N  NE    . ARG A 1  19  ? 1.550   -20.643 -10.771 1.00 16.52 ? 145 ARG A NE    1 
ATOM   61   C  CZ    . ARG A 1  19  ? 1.774   -20.406 -12.058 1.00 11.93 ? 145 ARG A CZ    1 
ATOM   62   N  NH1   . ARG A 1  19  ? 1.165   -21.135 -13.024 1.00 13.10 ? 145 ARG A NH1   1 
ATOM   63   N  NH2   . ARG A 1  19  ? 2.583   -19.422 -12.370 1.00 13.19 ? 145 ARG A NH2   1 
ATOM   64   N  N     . PRO A 1  20  ? -1.647  -20.714 -5.476  1.00 6.24  ? 146 PRO A N     1 
ATOM   65   C  CA    A PRO A 1  20  ? -1.086  -19.824 -4.459  0.50 6.24  ? 146 PRO A CA    1 
ATOM   66   C  CA    B PRO A 1  20  ? -1.102  -19.784 -4.490  0.50 6.24  ? 146 PRO A CA    1 
ATOM   67   C  C     . PRO A 1  20  ? 0.359   -19.511 -4.773  1.00 5.95  ? 146 PRO A C     1 
ATOM   68   O  O     . PRO A 1  20  ? 1.134   -20.435 -5.128  1.00 6.83  ? 146 PRO A O     1 
ATOM   69   C  CB    A PRO A 1  20  ? -1.135  -20.673 -3.182  0.50 7.38  ? 146 PRO A CB    1 
ATOM   70   C  CB    B PRO A 1  20  ? -1.253  -20.552 -3.171  0.50 7.37  ? 146 PRO A CB    1 
ATOM   71   C  CG    A PRO A 1  20  ? -2.062  -21.779 -3.467  0.50 8.76  ? 146 PRO A CG    1 
ATOM   72   C  CG    B PRO A 1  20  ? -1.253  -21.980 -3.568  0.50 8.51  ? 146 PRO A CG    1 
ATOM   73   C  CD    A PRO A 1  20  ? -1.997  -22.032 -4.925  0.50 8.56  ? 146 PRO A CD    1 
ATOM   74   C  CD    B PRO A 1  20  ? -2.013  -22.000 -4.861  0.50 8.55  ? 146 PRO A CD    1 
ATOM   75   N  N     . THR A 1  21  ? 0.742   -18.248 -4.661  1.00 3.52  ? 147 THR A N     1 
ATOM   76   C  CA    . THR A 1  21  ? 2.172   -17.930 -4.804  1.00 3.28  ? 147 THR A CA    1 
ATOM   77   C  C     . THR A 1  21  ? 2.541   -17.082 -3.591  1.00 5.14  ? 147 THR A C     1 
ATOM   78   O  O     . THR A 1  21  ? 2.132   -15.912 -3.482  1.00 3.03  ? 147 THR A O     1 
ATOM   79   C  CB    . THR A 1  21  ? 2.477   -17.156 -6.094  1.00 3.83  ? 147 THR A CB    1 
ATOM   80   O  OG1   . THR A 1  21  ? 1.847   -17.760 -7.228  1.00 4.91  ? 147 THR A OG1   1 
ATOM   81   C  CG2   . THR A 1  21  ? 4.006   -17.176 -6.380  1.00 3.95  ? 147 THR A CG2   1 
ATOM   82   N  N     . PRO A 1  22  ? 3.298   -17.656 -2.662  1.00 5.89  ? 148 PRO A N     1 
ATOM   83   C  CA    . PRO A 1  22  ? 3.604   -16.906 -1.434  1.00 4.28  ? 148 PRO A CA    1 
ATOM   84   C  C     . PRO A 1  22  ? 4.687   -15.868 -1.668  1.00 5.44  ? 148 PRO A C     1 
ATOM   85   O  O     . PRO A 1  22  ? 5.366   -15.873 -2.690  1.00 5.91  ? 148 PRO A O     1 
ATOM   86   C  CB    . PRO A 1  22  ? 4.066   -18.003 -0.473  1.00 6.09  ? 148 PRO A CB    1 
ATOM   87   C  CG    . PRO A 1  22  ? 4.835   -18.987 -1.463  1.00 3.76  ? 148 PRO A CG    1 
ATOM   88   C  CD    . PRO A 1  22  ? 3.926   -18.996 -2.689  1.00 4.51  ? 148 PRO A CD    1 
ATOM   89   N  N     . LEU A 1  23  ? 4.869   -14.976 -0.703  1.00 4.84  ? 149 LEU A N     1 
ATOM   90   C  CA    . LEU A 1  23  ? 5.853   -13.900 -0.866  1.00 6.63  ? 149 LEU A CA    1 
ATOM   91   C  C     . LEU A 1  23  ? 7.264   -14.444 -0.885  1.00 9.28  ? 149 LEU A C     1 
ATOM   92   O  O     . LEU A 1  23  ? 8.107   -14.010 -1.695  1.00 9.74  ? 149 LEU A O     1 
ATOM   93   C  CB    . LEU A 1  23  ? 5.715   -12.871 0.256   1.00 8.85  ? 149 LEU A CB    1 
ATOM   94   C  CG    . LEU A 1  23  ? 6.759   -11.747 0.113   1.00 13.00 ? 149 LEU A CG    1 
ATOM   95   C  CD1   . LEU A 1  23  ? 6.830   -11.126 -1.341  1.00 15.81 ? 149 LEU A CD1   1 
ATOM   96   C  CD2   . LEU A 1  23  ? 6.538   -10.679 1.176   1.00 12.51 ? 149 LEU A CD2   1 
ATOM   97   N  N     . THR A 1  24  ? 7.512   -15.418 -0.018  1.00 4.85  ? 150 THR A N     1 
ATOM   98   C  CA    . THR A 1  24  ? 8.840   -16.017 0.036   1.00 4.61  ? 150 THR A CA    1 
ATOM   99   C  C     . THR A 1  24  ? 8.714   -17.504 -0.313  1.00 4.79  ? 150 THR A C     1 
ATOM   100  O  O     . THR A 1  24  ? 7.675   -18.122 -0.074  1.00 5.26  ? 150 THR A O     1 
ATOM   101  C  CB    . THR A 1  24  ? 9.480   -15.857 1.480   1.00 5.65  ? 150 THR A CB    1 
ATOM   102  O  OG1   . THR A 1  24  ? 8.668   -16.492 2.459   1.00 10.38 ? 150 THR A OG1   1 
ATOM   103  C  CG2   . THR A 1  24  ? 9.607   -14.405 1.863   1.00 11.55 ? 150 THR A CG2   1 
ATOM   104  N  N     . HIS A 1  25  ? 9.754   -18.088 -0.893  1.00 2.49  ? 151 HIS A N     1 
ATOM   105  C  CA    . HIS A 1  25  ? 9.558   -19.415 -1.471  1.00 2.41  ? 151 HIS A CA    1 
ATOM   106  C  C     . HIS A 1  25  ? 10.870  -20.199 -1.460  1.00 5.82  ? 151 HIS A C     1 
ATOM   107  O  O     . HIS A 1  25  ? 11.777  -19.879 -0.679  1.00 5.51  ? 151 HIS A O     1 
ATOM   108  C  CB    . HIS A 1  25  ? 8.909   -19.333 -2.880  1.00 3.21  ? 151 HIS A CB    1 
ATOM   109  C  CG    . HIS A 1  25  ? 9.703   -18.535 -3.861  1.00 3.34  ? 151 HIS A CG    1 
ATOM   110  N  ND1   . HIS A 1  25  ? 10.671  -19.084 -4.681  1.00 4.30  ? 151 HIS A ND1   1 
ATOM   111  C  CD2   . HIS A 1  25  ? 9.699   -17.205 -4.124  1.00 5.91  ? 151 HIS A CD2   1 
ATOM   112  C  CE1   . HIS A 1  25  ? 11.195  -18.135 -5.437  1.00 6.99  ? 151 HIS A CE1   1 
ATOM   113  N  NE2   . HIS A 1  25  ? 10.648  -16.974 -5.093  1.00 4.30  ? 151 HIS A NE2   1 
ATOM   114  N  N     . HIS A 1  26  ? 10.946  -21.243 -2.279  1.00 4.64  ? 152 HIS A N     1 
ATOM   115  C  CA    . HIS A 1  26  ? 12.042  -22.223 -2.182  1.00 3.42  ? 152 HIS A CA    1 
ATOM   116  C  C     . HIS A 1  26  ? 12.922  -22.257 -3.410  1.00 5.75  ? 152 HIS A C     1 
ATOM   117  O  O     . HIS A 1  26  ? 13.777  -23.139 -3.565  1.00 4.94  ? 152 HIS A O     1 
ATOM   118  C  CB    . HIS A 1  26  ? 11.437  -23.593 -1.950  1.00 3.96  ? 152 HIS A CB    1 
ATOM   119  C  CG    . HIS A 1  26  ? 10.403  -23.570 -0.881  1.00 2.43  ? 152 HIS A CG    1 
ATOM   120  N  ND1   . HIS A 1  26  ? 10.713  -23.393 0.453   1.00 3.72  ? 152 HIS A ND1   1 
ATOM   121  C  CD2   . HIS A 1  26  ? 9.053   -23.610 -0.957  1.00 5.03  ? 152 HIS A CD2   1 
ATOM   122  C  CE1   . HIS A 1  26  ? 9.595   -23.343 1.153   1.00 9.58  ? 152 HIS A CE1   1 
ATOM   123  N  NE2   . HIS A 1  26  ? 8.574   -23.469 0.321   1.00 4.40  ? 152 HIS A NE2   1 
ATOM   124  N  N     . ASN A 1  27  ? 12.741  -21.276 -4.284  1.00 3.92  ? 153 ASN A N     1 
ATOM   125  C  CA    . ASN A 1  27  ? 13.517  -21.264 -5.535  1.00 5.04  ? 153 ASN A CA    1 
ATOM   126  C  C     . ASN A 1  27  ? 13.950  -19.860 -5.904  1.00 4.86  ? 153 ASN A C     1 
ATOM   127  O  O     . ASN A 1  27  ? 13.945  -19.459 -7.077  1.00 4.59  ? 153 ASN A O     1 
ATOM   128  C  CB    . ASN A 1  27  ? 12.684  -21.881 -6.655  1.00 3.30  ? 153 ASN A CB    1 
ATOM   129  C  CG    . ASN A 1  27  ? 12.616  -23.383 -6.531  1.00 6.77  ? 153 ASN A CG    1 
ATOM   130  O  OD1   . ASN A 1  27  ? 13.639  -24.074 -6.746  1.00 5.57  ? 153 ASN A OD1   1 
ATOM   131  N  ND2   . ASN A 1  27  ? 11.458  -23.902 -6.120  1.00 4.02  ? 153 ASN A ND2   1 
ATOM   132  N  N     . THR A 1  28  ? 14.342  -19.124 -4.888  1.00 2.78  ? 154 THR A N     1 
ATOM   133  C  CA    . THR A 1  28  ? 14.601  -17.712 -5.051  1.00 3.92  ? 154 THR A CA    1 
ATOM   134  C  C     . THR A 1  28  ? 15.638  -17.381 -6.126  1.00 7.18  ? 154 THR A C     1 
ATOM   135  O  O     . THR A 1  28  ? 15.398  -16.528 -7.004  1.00 4.89  ? 154 THR A O     1 
ATOM   136  C  CB    . THR A 1  28  ? 14.974  -17.099 -3.707  1.00 4.29  ? 154 THR A CB    1 
ATOM   137  O  OG1   . THR A 1  28  ? 13.957  -17.434 -2.763  1.00 5.41  ? 154 THR A OG1   1 
ATOM   138  C  CG2   . THR A 1  28  ? 15.049  -15.562 -3.820  1.00 9.08  ? 154 THR A CG2   1 
ATOM   139  N  N     . GLY A 1  29  ? 16.773  -18.072 -6.083  1.00 6.03  ? 155 GLY A N     1 
ATOM   140  C  CA    . GLY A 1  29  ? 17.824  -17.795 -7.047  1.00 7.35  ? 155 GLY A CA    1 
ATOM   141  C  C     . GLY A 1  29  ? 17.423  -18.125 -8.475  1.00 6.34  ? 155 GLY A C     1 
ATOM   142  O  O     . GLY A 1  29  ? 17.801  -17.401 -9.403  1.00 7.16  ? 155 GLY A O     1 
ATOM   143  N  N     . LEU A 1  30  ? 16.701  -19.228 -8.656  1.00 4.75  ? 156 LEU A N     1 
ATOM   144  C  CA    . LEU A 1  30  ? 16.287  -19.631 -9.998  1.00 6.53  ? 156 LEU A CA    1 
ATOM   145  C  C     . LEU A 1  30  ? 15.301  -18.595 -10.548 1.00 5.28  ? 156 LEU A C     1 
ATOM   146  O  O     . LEU A 1  30  ? 15.406  -18.149 -11.703 1.00 3.91  ? 156 LEU A O     1 
ATOM   147  C  CB    . LEU A 1  30  ? 15.641  -21.018 -9.962  1.00 4.36  ? 156 LEU A CB    1 
ATOM   148  C  CG    . LEU A 1  30  ? 16.497  -22.194 -9.483  1.00 5.96  ? 156 LEU A CG    1 
ATOM   149  C  CD1   . LEU A 1  30  ? 15.762  -23.541 -9.572  1.00 6.24  ? 156 LEU A CD1   1 
ATOM   150  C  CD2   . LEU A 1  30  ? 17.790  -22.193 -10.324 1.00 9.00  ? 156 LEU A CD2   1 
ATOM   151  N  N     . SER A 1  31  ? 14.330  -18.194 -9.727  1.00 4.74  ? 157 SER A N     1 
ATOM   152  C  CA    A SER A 1  31  ? 13.343  -17.221 -10.190 0.50 4.72  ? 157 SER A CA    1 
ATOM   153  C  CA    B SER A 1  31  ? 13.345  -17.207 -10.179 0.50 4.72  ? 157 SER A CA    1 
ATOM   154  C  C     . SER A 1  31  ? 14.014  -15.869 -10.473 1.00 5.25  ? 157 SER A C     1 
ATOM   155  O  O     . SER A 1  31  ? 13.683  -15.184 -11.444 1.00 3.87  ? 157 SER A O     1 
ATOM   156  C  CB    A SER A 1  31  ? 12.180  -17.079 -9.182  0.50 4.93  ? 157 SER A CB    1 
ATOM   157  C  CB    B SER A 1  31  ? 12.231  -17.011 -9.138  0.50 4.93  ? 157 SER A CB    1 
ATOM   158  O  OG    A SER A 1  31  ? 12.644  -16.644 -7.913  0.50 4.25  ? 157 SER A OG    1 
ATOM   159  O  OG    B SER A 1  31  ? 11.471  -18.184 -8.990  0.50 5.76  ? 157 SER A OG    1 
ATOM   160  N  N     . GLU A 1  32  ? 14.960  -15.473 -9.635  1.00 3.90  ? 158 GLU A N     1 
ATOM   161  C  CA    . GLU A 1  32  ? 15.644  -14.199 -9.890  1.00 5.55  ? 158 GLU A CA    1 
ATOM   162  C  C     . GLU A 1  32  ? 16.386  -14.183 -11.238 1.00 5.27  ? 158 GLU A C     1 
ATOM   163  O  O     . GLU A 1  32  ? 16.372  -13.185 -11.967 1.00 6.08  ? 158 GLU A O     1 
ATOM   164  C  CB    . GLU A 1  32  ? 16.566  -13.823 -8.740  1.00 9.09  ? 158 GLU A CB    1 
ATOM   165  C  CG    . GLU A 1  32  ? 15.723  -13.350 -7.520  1.00 18.88 ? 158 GLU A CG    1 
ATOM   166  C  CD    . GLU A 1  32  ? 16.564  -13.076 -6.263  1.00 35.52 ? 158 GLU A CD    1 
ATOM   167  O  OE1   . GLU A 1  32  ? 17.793  -13.312 -6.295  1.00 33.01 ? 158 GLU A OE1   1 
ATOM   168  O  OE2   . GLU A 1  32  ? 15.989  -12.632 -5.241  1.00 37.54 ? 158 GLU A OE2   1 
ATOM   169  N  N     . ALA A 1  33  ? 16.998  -15.303 -11.596 1.00 4.15  ? 159 ALA A N     1 
ATOM   170  C  CA    . ALA A 1  33  ? 17.723  -15.349 -12.869 1.00 5.88  ? 159 ALA A CA    1 
ATOM   171  C  C     . ALA A 1  33  ? 16.765  -15.247 -14.062 1.00 6.02  ? 159 ALA A C     1 
ATOM   172  O  O     . ALA A 1  33  ? 17.032  -14.546 -15.024 1.00 6.76  ? 159 ALA A O     1 
ATOM   173  C  CB    . ALA A 1  33  ? 18.510  -16.629 -12.959 1.00 6.58  ? 159 ALA A CB    1 
ATOM   174  N  N     . LEU A 1  34  ? 15.642  -15.951 -14.000 1.00 4.60  ? 160 LEU A N     1 
ATOM   175  C  CA    . LEU A 1  34  ? 14.668  -15.862 -15.091 1.00 5.76  ? 160 LEU A CA    1 
ATOM   176  C  C     . LEU A 1  34  ? 14.103  -14.456 -15.199 1.00 7.22  ? 160 LEU A C     1 
ATOM   177  O  O     . LEU A 1  34  ? 13.804  -13.961 -16.297 1.00 5.86  ? 160 LEU A O     1 
ATOM   178  C  CB    . LEU A 1  34  ? 13.561  -16.920 -14.886 1.00 4.30  ? 160 LEU A CB    1 
ATOM   179  C  CG    . LEU A 1  34  ? 14.112  -18.344 -15.079 1.00 6.19  ? 160 LEU A CG    1 
ATOM   180  C  CD1   . LEU A 1  34  ? 13.220  -19.389 -14.470 1.00 6.14  ? 160 LEU A CD1   1 
ATOM   181  C  CD2   . LEU A 1  34  ? 14.334  -18.676 -16.569 1.00 6.08  ? 160 LEU A CD2   1 
ATOM   182  N  N     . GLU A 1  35  ? 13.939  -13.791 -14.060 1.00 4.62  ? 161 GLU A N     1 
ATOM   183  C  CA    . GLU A 1  35  ? 13.397  -12.436 -14.088 1.00 4.43  ? 161 GLU A CA    1 
ATOM   184  C  C     . GLU A 1  35  ? 14.387  -11.418 -14.669 1.00 7.45  ? 161 GLU A C     1 
ATOM   185  O  O     . GLU A 1  35  ? 13.976  -10.416 -15.263 1.00 6.42  ? 161 GLU A O     1 
ATOM   186  C  CB    . GLU A 1  35  ? 12.872  -12.042 -12.692 1.00 6.31  ? 161 GLU A CB    1 
ATOM   187  C  CG    . GLU A 1  35  ? 11.583  -12.781 -12.432 1.00 7.41  ? 161 GLU A CG    1 
ATOM   188  C  CD    . GLU A 1  35  ? 10.960  -12.545 -11.069 1.00 15.89 ? 161 GLU A CD    1 
ATOM   189  O  OE1   . GLU A 1  35  ? 11.643  -12.024 -10.159 1.00 12.58 ? 161 GLU A OE1   1 
ATOM   190  O  OE2   . GLU A 1  35  ? 9.763   -12.913 -10.920 1.00 13.48 ? 161 GLU A OE2   1 
ATOM   191  N  N     . ILE A 1  36  ? 15.688  -11.691 -14.551 1.00 4.78  ? 162 ILE A N     1 
ATOM   192  C  CA    . ILE A 1  36  ? 16.668  -10.875 -15.278 1.00 7.00  ? 162 ILE A CA    1 
ATOM   193  C  C     . ILE A 1  36  ? 16.437  -10.990 -16.789 1.00 8.02  ? 162 ILE A C     1 
ATOM   194  O  O     . ILE A 1  36  ? 16.422  -9.983  -17.535 1.00 7.68  ? 162 ILE A O     1 
ATOM   195  C  CB    . ILE A 1  36  ? 18.102  -11.361 -14.999 1.00 7.09  ? 162 ILE A CB    1 
ATOM   196  C  CG1   . ILE A 1  36  ? 18.480  -11.072 -13.550 1.00 8.97  ? 162 ILE A CG1   1 
ATOM   197  C  CG2   . ILE A 1  36  ? 19.073  -10.692 -15.946 1.00 10.09 ? 162 ILE A CG2   1 
ATOM   198  C  CD1   . ILE A 1  36  ? 18.522  -9.616  -13.239 1.00 14.21 ? 162 ILE A CD1   1 
ATOM   199  N  N     . LEU A 1  37  ? 16.248  -12.209 -17.258 1.00 4.87  ? 163 LEU A N     1 
ATOM   200  C  CA    . LEU A 1  37  ? 16.020  -12.395 -18.687 1.00 6.83  ? 163 LEU A CA    1 
ATOM   201  C  C     . LEU A 1  37  ? 14.682  -11.777 -19.123 1.00 9.11  ? 163 LEU A C     1 
ATOM   202  O  O     . LEU A 1  37  ? 14.570  -11.270 -20.244 1.00 7.30  ? 163 LEU A O     1 
ATOM   203  C  CB    . LEU A 1  37  ? 16.046  -13.862 -19.051 1.00 5.03  ? 163 LEU A CB    1 
ATOM   204  C  CG    . LEU A 1  37  ? 17.382  -14.589 -18.752 1.00 7.33  ? 163 LEU A CG    1 
ATOM   205  C  CD1   . LEU A 1  37  ? 17.322  -16.035 -19.198 1.00 9.89  ? 163 LEU A CD1   1 
ATOM   206  C  CD2   . LEU A 1  37  ? 18.606  -13.861 -19.335 1.00 8.02  ? 163 LEU A CD2   1 
ATOM   207  N  N     . ALA A 1  38  ? 13.681  -11.837 -18.243 1.00 6.45  ? 164 ALA A N     1 
ATOM   208  C  CA    . ALA A 1  38  ? 12.396  -11.189 -18.509 1.00 7.36  ? 164 ALA A CA    1 
ATOM   209  C  C     . ALA A 1  38  ? 12.591  -9.695  -18.664 1.00 9.79  ? 164 ALA A C     1 
ATOM   210  O  O     . ALA A 1  38  ? 12.085  -9.069  -19.604 1.00 8.91  ? 164 ALA A O     1 
ATOM   211  C  CB    . ALA A 1  38  ? 11.372  -11.495 -17.353 1.00 5.34  ? 164 ALA A CB    1 
ATOM   212  N  N     . GLU A 1  39  ? 13.336  -9.111  -17.736 1.00 5.94  ? 165 GLU A N     1 
ATOM   213  C  CA    . GLU A 1  39  ? 13.548  -7.665  -17.731 1.00 7.50  ? 165 GLU A CA    1 
ATOM   214  C  C     . GLU A 1  39  ? 14.320  -7.250  -18.986 1.00 10.93 ? 165 GLU A C     1 
ATOM   215  O  O     . GLU A 1  39  ? 13.964  -6.270  -19.659 1.00 10.69 ? 165 GLU A O     1 
ATOM   216  C  CB    . GLU A 1  39  ? 14.281  -7.275  -16.434 1.00 9.88  ? 165 GLU A CB    1 
ATOM   217  C  CG    . GLU A 1  39  ? 14.620  -5.841  -16.284 1.00 12.39 ? 165 GLU A CG    1 
ATOM   218  C  CD    . GLU A 1  39  ? 15.414  -5.561  -14.995 1.00 17.07 ? 165 GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1  39  ? 16.109  -6.469  -14.470 1.00 15.24 ? 165 GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1  39  ? 15.320  -4.429  -14.508 1.00 18.79 ? 165 GLU A OE2   1 
ATOM   221  N  N     . ALA A 1  40  ? 15.353  -8.016  -19.317 1.00 9.16  ? 166 ALA A N     1 
ATOM   222  C  CA    . ALA A 1  40  ? 16.130  -7.747  -20.530 1.00 10.53 ? 166 ALA A CA    1 
ATOM   223  C  C     . ALA A 1  40  ? 15.273  -7.843  -21.797 1.00 11.05 ? 166 ALA A C     1 
ATOM   224  O  O     . ALA A 1  40  ? 15.412  -7.013  -22.711 1.00 11.90 ? 166 ALA A O     1 
ATOM   225  C  CB    . ALA A 1  40  ? 17.325  -8.690  -20.630 1.00 12.52 ? 166 ALA A CB    1 
ATOM   226  N  N     . ALA A 1  41  ? 14.377  -8.819  -21.868 1.00 7.45  ? 167 ALA A N     1 
ATOM   227  C  CA    . ALA A 1  41  ? 13.512  -8.904  -23.042 1.00 9.70  ? 167 ALA A CA    1 
ATOM   228  C  C     . ALA A 1  41  ? 12.654  -7.656  -23.166 1.00 13.37 ? 167 ALA A C     1 
ATOM   229  O  O     . ALA A 1  41  ? 12.415  -7.152  -24.264 1.00 13.87 ? 167 ALA A O     1 
ATOM   230  C  CB    . ALA A 1  41  ? 12.653  -10.109 -22.981 1.00 9.03  ? 167 ALA A CB    1 
ATOM   231  N  N     . GLY A 1  42  ? 12.193  -7.150  -22.033 1.00 12.12 ? 168 GLY A N     1 
ATOM   232  C  CA    . GLY A 1  42  ? 11.384  -5.936  -22.024 1.00 11.55 ? 168 GLY A CA    1 
ATOM   233  C  C     . GLY A 1  42  ? 12.165  -4.738  -22.532 1.00 13.49 ? 168 GLY A C     1 
ATOM   234  O  O     . GLY A 1  42  ? 11.630  -3.879  -23.230 1.00 11.87 ? 168 GLY A O     1 
ATOM   235  N  N     . PHE A 1  43  ? 13.436  -4.655  -22.165 1.00 11.06 ? 169 PHE A N     1 
ATOM   236  C  CA    . PHE A 1  43  ? 14.237  -3.519  -22.570 1.00 12.14 ? 169 PHE A CA    1 
ATOM   237  C  C     . PHE A 1  43  ? 14.424  -3.561  -24.083 1.00 13.96 ? 169 PHE A C     1 
ATOM   238  O  O     . PHE A 1  43  ? 14.716  -2.532  -24.707 1.00 15.79 ? 169 PHE A O     1 
ATOM   239  C  CB    . PHE A 1  43  ? 15.603  -3.548  -21.912 1.00 11.10 ? 169 PHE A CB    1 
ATOM   240  C  CG    . PHE A 1  43  ? 15.584  -3.285  -20.418 1.00 11.46 ? 169 PHE A CG    1 
ATOM   241  C  CD1   . PHE A 1  43  ? 14.516  -2.651  -19.807 1.00 11.46 ? 169 PHE A CD1   1 
ATOM   242  C  CD2   . PHE A 1  43  ? 16.673  -3.666  -19.633 1.00 11.05 ? 169 PHE A CD2   1 
ATOM   243  C  CE1   . PHE A 1  43  ? 14.522  -2.402  -18.428 1.00 12.46 ? 169 PHE A CE1   1 
ATOM   244  C  CE2   . PHE A 1  43  ? 16.706  -3.419  -18.257 1.00 9.24  ? 169 PHE A CE2   1 
ATOM   245  C  CZ    . PHE A 1  43  ? 15.620  -2.791  -17.654 1.00 11.26 ? 169 PHE A CZ    1 
ATOM   246  N  N     . GLU A 1  44  ? 14.259  -4.745  -24.672 1.00 11.33 ? 170 GLU A N     1 
ATOM   247  C  CA    . GLU A 1  44  ? 14.371  -4.889  -26.131 1.00 15.96 ? 170 GLU A CA    1 
ATOM   248  C  C     . GLU A 1  44  ? 13.020  -4.872  -26.836 1.00 16.87 ? 170 GLU A C     1 
ATOM   249  O  O     . GLU A 1  44  ? 12.938  -5.089  -28.038 1.00 20.89 ? 170 GLU A O     1 
ATOM   250  C  CB    . GLU A 1  44  ? 15.160  -6.148  -26.503 1.00 16.28 ? 170 GLU A CB    1 
ATOM   251  C  CG    . GLU A 1  44  ? 16.552  -6.190  -25.868 1.00 20.74 ? 170 GLU A CG    1 
ATOM   252  C  CD    . GLU A 1  44  ? 17.326  -4.873  -26.061 1.00 31.41 ? 170 GLU A CD    1 
ATOM   253  O  OE1   . GLU A 1  44  ? 17.434  -4.437  -27.229 1.00 28.01 ? 170 GLU A OE1   1 
ATOM   254  O  OE2   . GLU A 1  44  ? 17.813  -4.262  -25.064 1.00 16.67 ? 170 GLU A OE2   1 
ATOM   255  N  N     . GLY A 1  45  ? 11.958  -4.617  -26.088 1.00 16.32 ? 171 GLY A N     1 
ATOM   256  C  CA    . GLY A 1  45  ? 10.632  -4.537  -26.674 1.00 16.87 ? 171 GLY A CA    1 
ATOM   257  C  C     . GLY A 1  45  ? 10.016  -5.883  -26.996 1.00 14.50 ? 171 GLY A C     1 
ATOM   258  O  O     . GLY A 1  45  ? 9.052   -6.000  -27.755 1.00 18.90 ? 171 GLY A O     1 
ATOM   259  N  N     . SER A 1  46  ? 10.558  -6.934  -26.401 1.00 13.38 ? 172 SER A N     1 
ATOM   260  C  CA    . SER A 1  46  ? 10.060  -8.258  -26.709 1.00 12.94 ? 172 SER A CA    1 
ATOM   261  C  C     . SER A 1  46  ? 9.061   -8.702  -25.636 1.00 14.22 ? 172 SER A C     1 
ATOM   262  O  O     . SER A 1  46  ? 9.427   -9.434  -24.712 1.00 10.92 ? 172 SER A O     1 
ATOM   263  C  CB    . SER A 1  46  ? 11.254  -9.224  -26.808 1.00 19.66 ? 172 SER A CB    1 
ATOM   264  O  OG    . SER A 1  46  ? 10.864  -10.466 -27.352 1.00 28.96 ? 172 SER A OG    1 
ATOM   265  N  N     . GLU A 1  47  ? 7.807   -8.259  -25.747 1.00 11.54 ? 173 GLU A N     1 
ATOM   266  C  CA    . GLU A 1  47  ? 6.821   -8.533  -24.668 1.00 13.59 ? 173 GLU A CA    1 
ATOM   267  C  C     . GLU A 1  47  ? 6.483   -10.007 -24.491 1.00 9.47  ? 173 GLU A C     1 
ATOM   268  O  O     . GLU A 1  47  ? 6.176   -10.455 -23.378 1.00 8.36  ? 173 GLU A O     1 
ATOM   269  C  CB    . GLU A 1  47  ? 5.497   -7.791  -24.898 1.00 21.62 ? 173 GLU A CB    1 
ATOM   270  C  CG    . GLU A 1  47  ? 5.384   -6.395  -24.312 1.00 40.45 ? 173 GLU A CG    1 
ATOM   271  C  CD    . GLU A 1  47  ? 5.638   -6.321  -22.798 1.00 28.55 ? 173 GLU A CD    1 
ATOM   272  O  OE1   . GLU A 1  47  ? 4.915   -6.981  -21.998 1.00 34.11 ? 173 GLU A OE1   1 
ATOM   273  O  OE2   . GLU A 1  47  ? 6.558   -5.568  -22.427 1.00 38.77 ? 173 GLU A OE2   1 
ATOM   274  N  N     . GLY A 1  48  ? 6.471   -10.764 -25.587 1.00 9.73  ? 174 GLY A N     1 
ATOM   275  C  CA    . GLY A 1  48  ? 6.148   -12.170 -25.510 1.00 7.52  ? 174 GLY A CA    1 
ATOM   276  C  C     . GLY A 1  48  ? 7.187   -12.937 -24.717 1.00 7.44  ? 174 GLY A C     1 
ATOM   277  O  O     . GLY A 1  48  ? 6.852   -13.773 -23.851 1.00 7.74  ? 174 GLY A O     1 
ATOM   278  N  N     . ARG A 1  49  ? 8.464   -12.702 -25.027 1.00 8.26  ? 175 ARG A N     1 
ATOM   279  C  CA    . ARG A 1  49  ? 9.521   -13.392 -24.288 1.00 9.08  ? 175 ARG A CA    1 
ATOM   280  C  C     . ARG A 1  49  ? 9.519   -12.935 -22.807 1.00 7.37  ? 175 ARG A C     1 
ATOM   281  O  O     . ARG A 1  49  ? 9.712   -13.750 -21.909 1.00 7.18  ? 175 ARG A O     1 
ATOM   282  C  CB    . ARG A 1  49  ? 10.902  -13.182 -24.919 1.00 12.09 ? 175 ARG A CB    1 
ATOM   283  C  CG    . ARG A 1  49  ? 11.062  -13.697 -26.368 1.00 10.55 ? 175 ARG A CG    1 
ATOM   284  C  CD    . ARG A 1  49  ? 12.397  -13.190 -26.973 1.00 12.56 ? 175 ARG A CD    1 
ATOM   285  N  NE    . ARG A 1  49  ? 13.521  -13.993 -26.503 0.75 22.21 ? 175 ARG A NE    1 
ATOM   286  C  CZ    . ARG A 1  49  ? 14.476  -13.603 -25.656 0.75 22.34 ? 175 ARG A CZ    1 
ATOM   287  N  NH1   . ARG A 1  49  ? 14.518  -12.355 -25.173 0.75 17.72 ? 175 ARG A NH1   1 
ATOM   288  N  NH2   . ARG A 1  49  ? 15.429  -14.478 -25.316 0.75 12.81 ? 175 ARG A NH2   1 
ATOM   289  N  N     . LEU A 1  50  ? 9.305   -11.645 -22.566 1.00 5.72  ? 176 LEU A N     1 
ATOM   290  C  CA    . LEU A 1  50  ? 9.263   -11.124 -21.179 1.00 7.61  ? 176 LEU A CA    1 
ATOM   291  C  C     . LEU A 1  50  ? 8.207   -11.912 -20.439 1.00 7.06  ? 176 LEU A C     1 
ATOM   292  O  O     . LEU A 1  50  ? 8.399   -12.349 -19.299 1.00 5.14  ? 176 LEU A O     1 
ATOM   293  C  CB    . LEU A 1  50  ? 8.848   -9.649  -21.167 1.00 9.03  ? 176 LEU A CB    1 
ATOM   294  C  CG    . LEU A 1  50  ? 8.547   -9.032  -19.797 1.00 10.28 ? 176 LEU A CG    1 
ATOM   295  C  CD1   . LEU A 1  50  ? 9.046   -7.612  -19.774 1.00 12.49 ? 176 LEU A CD1   1 
ATOM   296  C  CD2   . LEU A 1  50  ? 7.054   -9.108  -19.443 1.00 9.03  ? 176 LEU A CD2   1 
ATOM   297  N  N     . LEU A 1  51  ? 7.060   -12.072 -21.083 1.00 5.52  ? 177 LEU A N     1 
ATOM   298  C  CA    . LEU A 1  51  ? 5.942   -12.741 -20.439 1.00 7.65  ? 177 LEU A CA    1 
ATOM   299  C  C     . LEU A 1  51  ? 6.282   -14.200 -20.114 1.00 5.67  ? 177 LEU A C     1 
ATOM   300  O  O     . LEU A 1  51  ? 5.974   -14.705 -19.040 1.00 4.53  ? 177 LEU A O     1 
ATOM   301  C  CB    . LEU A 1  51  ? 4.699   -12.691 -21.349 1.00 7.05  ? 177 LEU A CB    1 
ATOM   302  C  CG    . LEU A 1  51  ? 3.555   -11.766 -20.991 1.00 18.35 ? 177 LEU A CG    1 
ATOM   303  C  CD1   . LEU A 1  51  ? 2.434   -11.941 -22.037 1.00 9.56  ? 177 LEU A CD1   1 
ATOM   304  C  CD2   . LEU A 1  51  ? 3.021   -11.969 -19.528 1.00 10.20 ? 177 LEU A CD2   1 
ATOM   305  N  N     . THR A 1  52  ? 6.914   -14.903 -21.049 1.00 5.53  ? 178 THR A N     1 
ATOM   306  C  CA    . THR A 1  52  ? 7.194   -16.304 -20.790 1.00 4.84  ? 178 THR A CA    1 
ATOM   307  C  C     . THR A 1  52  ? 8.204   -16.481 -19.655 1.00 4.65  ? 178 THR A C     1 
ATOM   308  O  O     . THR A 1  52  ? 8.017   -17.345 -18.762 1.00 5.58  ? 178 THR A O     1 
ATOM   309  C  CB    . THR A 1  52  ? 7.700   -17.006 -22.059 1.00 6.36  ? 178 THR A CB    1 
ATOM   310  O  OG1   . THR A 1  52  ? 6.569   -17.335 -22.890 1.00 8.65  ? 178 THR A OG1   1 
ATOM   311  C  CG2   . THR A 1  52  ? 8.425   -18.314 -21.719 1.00 7.83  ? 178 THR A CG2   1 
ATOM   312  N  N     . PHE A 1  53  ? 9.248   -15.652 -19.670 1.00 5.61  ? 179 PHE A N     1 
ATOM   313  C  CA    . PHE A 1  53  ? 10.235  -15.719 -18.586 1.00 4.31  ? 179 PHE A CA    1 
ATOM   314  C  C     . PHE A 1  53  ? 9.591   -15.329 -17.249 1.00 6.74  ? 179 PHE A C     1 
ATOM   315  O  O     . PHE A 1  53  ? 9.910   -15.949 -16.237 1.00 3.90  ? 179 PHE A O     1 
ATOM   316  C  CB    . PHE A 1  53  ? 11.448  -14.831 -18.849 1.00 5.07  ? 179 PHE A CB    1 
ATOM   317  C  CG    . PHE A 1  53  ? 12.400  -15.400 -19.879 1.00 8.38  ? 179 PHE A CG    1 
ATOM   318  C  CD1   . PHE A 1  53  ? 12.854  -16.716 -19.757 1.00 7.37  ? 179 PHE A CD1   1 
ATOM   319  C  CD2   . PHE A 1  53  ? 12.822  -14.636 -20.959 1.00 9.52  ? 179 PHE A CD2   1 
ATOM   320  C  CE1   . PHE A 1  53  ? 13.735  -17.270 -20.714 1.00 9.98  ? 179 PHE A CE1   1 
ATOM   321  C  CE2   . PHE A 1  53  ? 13.715  -15.178 -21.921 1.00 9.90  ? 179 PHE A CE2   1 
ATOM   322  C  CZ    . PHE A 1  53  ? 14.163  -16.485 -21.797 1.00 9.40  ? 179 PHE A CZ    1 
ATOM   323  N  N     . CYS A 1  54  ? 8.751   -14.293 -17.238 1.00 3.89  ? 180 CYS A N     1 
ATOM   324  C  CA    . CYS A 1  54  ? 7.997   -13.960 -15.995 1.00 3.81  ? 180 CYS A CA    1 
ATOM   325  C  C     . CYS A 1  54  ? 7.171   -15.136 -15.497 1.00 4.06  ? 180 CYS A C     1 
ATOM   326  O  O     . CYS A 1  54  ? 7.098   -15.420 -14.281 1.00 3.42  ? 180 CYS A O     1 
ATOM   327  C  CB    . CYS A 1  54  ? 7.058   -12.766 -16.233 1.00 6.94  ? 180 CYS A CB    1 
ATOM   328  S  SG    . CYS A 1  54  ? 7.925   -11.174 -16.218 1.00 13.64 ? 180 CYS A SG    1 
ATOM   329  N  N     . ARG A 1  55  ? 6.491   -15.802 -16.426 1.00 3.23  ? 181 ARG A N     1 
ATOM   330  C  CA    . ARG A 1  55  ? 5.616   -16.909 -16.062 1.00 3.29  ? 181 ARG A CA    1 
ATOM   331  C  C     . ARG A 1  55  ? 6.418   -18.086 -15.557 1.00 4.45  ? 181 ARG A C     1 
ATOM   332  O  O     . ARG A 1  55  ? 6.017   -18.750 -14.588 1.00 4.13  ? 181 ARG A O     1 
ATOM   333  C  CB    . ARG A 1  55  ? 4.746   -17.358 -17.237 1.00 1.85  ? 181 ARG A CB    1 
ATOM   334  C  CG    . ARG A 1  55  ? 3.646   -16.426 -17.567 1.00 3.87  ? 181 ARG A CG    1 
ATOM   335  C  CD    . ARG A 1  55  ? 3.123   -16.772 -18.993 1.00 5.93  ? 181 ARG A CD    1 
ATOM   336  N  NE    . ARG A 1  55  ? 2.016   -15.922 -19.442 1.00 7.38  ? 181 ARG A NE    1 
ATOM   337  C  CZ    . ARG A 1  55  ? 1.611   -15.858 -20.708 1.00 8.44  ? 181 ARG A CZ    1 
ATOM   338  N  NH1   . ARG A 1  55  ? 2.193   -16.631 -21.631 1.00 4.97  ? 181 ARG A NH1   1 
ATOM   339  N  NH2   . ARG A 1  55  ? 0.607   -15.063 -21.047 1.00 7.94  ? 181 ARG A NH2   1 
ATOM   340  N  N     . ALA A 1  56  ? 7.549   -18.359 -16.207 1.00 4.72  ? 182 ALA A N     1 
ATOM   341  C  CA    . ALA A 1  56  ? 8.363   -19.468 -15.766 1.00 4.80  ? 182 ALA A CA    1 
ATOM   342  C  C     . ALA A 1  56  ? 8.925   -19.187 -14.372 1.00 5.02  ? 182 ALA A C     1 
ATOM   343  O  O     . ALA A 1  56  ? 8.973   -20.085 -13.510 1.00 4.11  ? 182 ALA A O     1 
ATOM   344  C  CB    . ALA A 1  56  ? 9.509   -19.714 -16.748 1.00 3.69  ? 182 ALA A CB    1 
ATOM   345  N  N     . ALA A 1  57  ? 9.388   -17.964 -14.157 1.00 3.68  ? 183 ALA A N     1 
ATOM   346  C  CA    . ALA A 1  57  ? 9.886   -17.622 -12.818 1.00 3.67  ? 183 ALA A CA    1 
ATOM   347  C  C     . ALA A 1  57  ? 8.777   -17.825 -11.809 1.00 4.26  ? 183 ALA A C     1 
ATOM   348  O  O     . ALA A 1  57  ? 9.019   -18.310 -10.696 1.00 2.90  ? 183 ALA A O     1 
ATOM   349  C  CB    . ALA A 1  57  ? 10.333  -16.153 -12.779 1.00 3.87  ? 183 ALA A CB    1 
ATOM   350  N  N     . SER A 1  58  ? 7.563   -17.410 -12.168 1.00 2.34  ? 184 SER A N     1 
ATOM   351  C  CA    A SER A 1  58  ? 6.435   -17.488 -11.238 0.70 3.73  ? 184 SER A CA    1 
ATOM   352  C  CA    B SER A 1  58  ? 6.442   -17.485 -11.220 0.30 3.75  ? 184 SER A CA    1 
ATOM   353  C  C     . SER A 1  58  ? 6.078   -18.936 -10.855 1.00 5.63  ? 184 SER A C     1 
ATOM   354  O  O     . SER A 1  58  ? 5.761   -19.250 -9.703  1.00 5.08  ? 184 SER A O     1 
ATOM   355  C  CB    A SER A 1  58  ? 5.213   -16.794 -11.817 0.70 4.40  ? 184 SER A CB    1 
ATOM   356  C  CB    B SER A 1  58  ? 5.223   -16.724 -11.751 0.30 4.41  ? 184 SER A CB    1 
ATOM   357  O  OG    A SER A 1  58  ? 4.255   -16.727 -10.787 0.70 6.16  ? 184 SER A OG    1 
ATOM   358  O  OG    B SER A 1  58  ? 4.554   -17.457 -12.754 0.30 4.13  ? 184 SER A OG    1 
ATOM   359  N  N     . VAL A 1  59  ? 6.149   -19.830 -11.827 1.00 3.98  ? 185 VAL A N     1 
ATOM   360  C  CA    . VAL A 1  59  ? 5.899   -21.231 -11.564 1.00 3.80  ? 185 VAL A CA    1 
ATOM   361  C  C     . VAL A 1  59  ? 6.848   -21.740 -10.462 1.00 4.14  ? 185 VAL A C     1 
ATOM   362  O  O     . VAL A 1  59  ? 6.427   -22.455 -9.546  1.00 5.65  ? 185 VAL A O     1 
ATOM   363  C  CB    . VAL A 1  59  ? 6.137   -22.084 -12.845 1.00 5.82  ? 185 VAL A CB    1 
ATOM   364  C  CG1   . VAL A 1  59  ? 6.236   -23.544 -12.486 1.00 5.92  ? 185 VAL A CG1   1 
ATOM   365  C  CG2   . VAL A 1  59  ? 4.999   -21.850 -13.864 1.00 9.96  ? 185 VAL A CG2   1 
ATOM   366  N  N     . LEU A 1  60  ? 8.095   -21.326 -10.531 1.00 2.89  ? 186 LEU A N     1 
ATOM   367  C  CA    . LEU A 1  60  ? 9.052   -21.754 -9.516  1.00 4.69  ? 186 LEU A CA    1 
ATOM   368  C  C     . LEU A 1  60  ? 8.712   -21.224 -8.136  1.00 5.50  ? 186 LEU A C     1 
ATOM   369  O  O     . LEU A 1  60  ? 8.907   -21.937 -7.130  1.00 4.08  ? 186 LEU A O     1 
ATOM   370  C  CB    . LEU A 1  60  ? 10.458  -21.347 -9.887  1.00 3.22  ? 186 LEU A CB    1 
ATOM   371  C  CG    . LEU A 1  60  ? 11.002  -21.974 -11.205 1.00 6.40  ? 186 LEU A CG    1 
ATOM   372  C  CD1   . LEU A 1  60  ? 12.428  -21.573 -11.408 1.00 8.05  ? 186 LEU A CD1   1 
ATOM   373  C  CD2   . LEU A 1  60  ? 10.860  -23.501 -11.134 1.00 7.11  ? 186 LEU A CD2   1 
ATOM   374  N  N     . LYS A 1  61  ? 8.213   -19.986 -8.091  1.00 4.73  ? 187 LYS A N     1 
ATOM   375  C  CA    . LYS A 1  61  ? 7.756   -19.417 -6.828  1.00 4.21  ? 187 LYS A CA    1 
ATOM   376  C  C     . LYS A 1  61  ? 6.645   -20.234 -6.189  1.00 2.94  ? 187 LYS A C     1 
ATOM   377  O  O     . LYS A 1  61  ? 6.496   -20.235 -4.965  1.00 4.75  ? 187 LYS A O     1 
ATOM   378  C  CB    . LYS A 1  61  ? 7.279   -17.965 -6.987  1.00 2.62  ? 187 LYS A CB    1 
ATOM   379  C  CG    . LYS A 1  61  ? 8.278   -17.062 -7.661  1.00 2.42  ? 187 LYS A CG    1 
ATOM   380  C  CD    . LYS A 1  61  ? 7.700   -15.637 -7.775  1.00 4.19  ? 187 LYS A CD    1 
ATOM   381  C  CE    . LYS A 1  61  ? 8.563   -14.833 -8.714  1.00 8.73  ? 187 LYS A CE    1 
ATOM   382  N  NZ    . LYS A 1  61  ? 8.007   -13.477 -8.970  1.00 7.07  ? 187 LYS A NZ    1 
ATOM   383  N  N     . ALA A 1  62  ? 5.854   -20.922 -7.017  1.00 4.08  ? 188 ALA A N     1 
ATOM   384  C  CA    . ALA A 1  62  ? 4.683   -21.647 -6.535  1.00 5.29  ? 188 ALA A CA    1 
ATOM   385  C  C     . ALA A 1  62  ? 4.981   -23.101 -6.093  1.00 6.66  ? 188 ALA A C     1 
ATOM   386  O  O     . ALA A 1  62  ? 4.089   -23.773 -5.556  1.00 4.61  ? 188 ALA A O     1 
ATOM   387  C  CB    . ALA A 1  62  ? 3.574   -21.662 -7.593  1.00 6.89  ? 188 ALA A CB    1 
ATOM   388  N  N     . LEU A 1  63  ? 6.208   -23.551 -6.325  1.00 6.62  ? 189 LEU A N     1 
ATOM   389  C  CA    . LEU A 1  63  ? 6.588   -24.932 -5.992  1.00 4.90  ? 189 LEU A CA    1 
ATOM   390  C  C     . LEU A 1  63  ? 6.751   -25.120 -4.489  1.00 5.54  ? 189 LEU A C     1 
ATOM   391  O  O     . LEU A 1  63  ? 7.136   -24.201 -3.780  1.00 4.13  ? 189 LEU A O     1 
ATOM   392  C  CB    . LEU A 1  63  ? 7.903   -25.308 -6.695  1.00 5.48  ? 189 LEU A CB    1 
ATOM   393  C  CG    . LEU A 1  63  ? 7.801   -25.502 -8.215  1.00 5.72  ? 189 LEU A CG    1 
ATOM   394  C  CD1   . LEU A 1  63  ? 9.171   -25.733 -8.769  1.00 9.14  ? 189 LEU A CD1   1 
ATOM   395  C  CD2   . LEU A 1  63  ? 6.889   -26.669 -8.527  1.00 8.07  ? 189 LEU A CD2   1 
ATOM   396  N  N     . PRO A 1  64  ? 6.508   -26.341 -4.000  1.00 5.38  ? 190 PRO A N     1 
ATOM   397  C  CA    . PRO A 1  64  ? 6.510   -26.522 -2.536  1.00 5.83  ? 190 PRO A CA    1 
ATOM   398  C  C     . PRO A 1  64  ? 7.907   -26.821 -1.984  1.00 4.86  ? 190 PRO A C     1 
ATOM   399  O  O     . PRO A 1  64  ? 8.047   -26.896 -0.781  1.00 4.51  ? 190 PRO A O     1 
ATOM   400  C  CB    . PRO A 1  64  ? 5.620   -27.754 -2.337  1.00 9.38  ? 190 PRO A CB    1 
ATOM   401  C  CG    . PRO A 1  64  ? 5.838   -28.563 -3.613  1.00 7.91  ? 190 PRO A CG    1 
ATOM   402  C  CD    . PRO A 1  64  ? 5.928   -27.507 -4.708  1.00 8.85  ? 190 PRO A CD    1 
ATOM   403  N  N     . SER A 1  65  ? 8.897   -26.955 -2.846  1.00 6.12  ? 191 SER A N     1 
ATOM   404  C  CA    . SER A 1  65  ? 10.277  -27.210 -2.380  1.00 4.72  ? 191 SER A CA    1 
ATOM   405  C  C     . SER A 1  65  ? 11.288  -26.828 -3.458  1.00 6.53  ? 191 SER A C     1 
ATOM   406  O  O     . SER A 1  65  ? 10.907  -26.491 -4.575  1.00 5.52  ? 191 SER A O     1 
ATOM   407  C  CB    . SER A 1  65  ? 10.435  -28.691 -1.996  1.00 7.61  ? 191 SER A CB    1 
ATOM   408  O  OG    . SER A 1  65  ? 10.279  -29.448 -3.159  1.00 9.60  ? 191 SER A OG    1 
ATOM   409  N  N     . PRO A 1  66  ? 12.595  -26.876 -3.137  1.00 4.58  ? 192 PRO A N     1 
ATOM   410  C  CA    . PRO A 1  66  ? 13.580  -26.487 -4.146  1.00 5.05  ? 192 PRO A CA    1 
ATOM   411  C  C     . PRO A 1  66  ? 13.670  -27.449 -5.334  1.00 7.86  ? 192 PRO A C     1 
ATOM   412  O  O     . PRO A 1  66  ? 13.560  -28.665 -5.188  1.00 8.25  ? 192 PRO A O     1 
ATOM   413  C  CB    . PRO A 1  66  ? 14.915  -26.482 -3.367  1.00 6.06  ? 192 PRO A CB    1 
ATOM   414  C  CG    . PRO A 1  66  ? 14.511  -26.203 -1.961  1.00 3.69  ? 192 PRO A CG    1 
ATOM   415  C  CD    . PRO A 1  66  ? 13.192  -26.976 -1.798  1.00 4.48  ? 192 PRO A CD    1 
ATOM   416  N  N     . VAL A 1  67  ? 13.852  -26.882 -6.525  1.00 5.74  ? 193 VAL A N     1 
ATOM   417  C  CA    . VAL A 1  67  ? 14.208  -27.705 -7.679  1.00 6.88  ? 193 VAL A CA    1 
ATOM   418  C  C     . VAL A 1  67  ? 15.683  -28.057 -7.520  1.00 8.18  ? 193 VAL A C     1 
ATOM   419  O  O     . VAL A 1  67  ? 16.506  -27.171 -7.407  1.00 7.68  ? 193 VAL A O     1 
ATOM   420  C  CB    . VAL A 1  67  ? 14.028  -26.934 -8.958  1.00 8.62  ? 193 VAL A CB    1 
ATOM   421  C  CG1   . VAL A 1  67  ? 14.589  -27.751 -10.171 1.00 8.83  ? 193 VAL A CG1   1 
ATOM   422  C  CG2   . VAL A 1  67  ? 12.547  -26.608 -9.145  1.00 6.83  ? 193 VAL A CG2   1 
ATOM   423  N  N     . THR A 1  68  ? 16.012  -29.348 -7.486  1.00 9.08  ? 194 THR A N     1 
ATOM   424  C  CA    . THR A 1  68  ? 17.422  -29.729 -7.360  1.00 12.08 ? 194 THR A CA    1 
ATOM   425  C  C     . THR A 1  68  ? 17.923  -30.500 -8.579  1.00 15.46 ? 194 THR A C     1 
ATOM   426  O  O     . THR A 1  68  ? 19.121  -30.656 -8.761  1.00 18.98 ? 194 THR A O     1 
ATOM   427  C  CB    . THR A 1  68  ? 17.629  -30.635 -6.149  1.00 14.01 ? 194 THR A CB    1 
ATOM   428  O  OG1   . THR A 1  68  ? 16.697  -31.719 -6.210  1.00 16.57 ? 194 THR A OG1   1 
ATOM   429  C  CG2   . THR A 1  68  ? 17.349  -29.848 -4.857  1.00 19.28 ? 194 THR A CG2   1 
ATOM   430  N  N     . THR A 1  69  ? 17.014  -31.009 -9.384  1.00 16.09 ? 195 THR A N     1 
ATOM   431  C  CA    . THR A 1  69  ? 17.430  -31.768 -10.564 1.00 21.18 ? 195 THR A CA    1 
ATOM   432  C  C     . THR A 1  69  ? 16.615  -31.324 -11.750 1.00 19.81 ? 195 THR A C     1 
ATOM   433  O  O     . THR A 1  69  ? 15.471  -30.886 -11.611 1.00 17.11 ? 195 THR A O     1 
ATOM   434  C  CB    . THR A 1  69  ? 17.259  -33.306 -10.360 1.00 20.61 ? 195 THR A CB    1 
ATOM   435  O  OG1   . THR A 1  69  ? 15.868  -33.648 -10.335 1.00 29.40 ? 195 THR A OG1   1 
ATOM   436  C  CG2   . THR A 1  69  ? 17.892  -33.743 -9.061  1.00 21.96 ? 195 THR A CG2   1 
ATOM   437  N  N     . LEU A 1  70  ? 17.190  -31.470 -12.927 1.00 20.37 ? 196 LEU A N     1 
ATOM   438  C  CA    . LEU A 1  70  ? 16.541  -31.023 -14.146 1.00 21.15 ? 196 LEU A CA    1 
ATOM   439  C  C     . LEU A 1  70  ? 15.235  -31.754 -14.398 1.00 22.22 ? 196 LEU A C     1 
ATOM   440  O  O     . LEU A 1  70  ? 14.285  -31.173 -14.920 1.00 19.98 ? 196 LEU A O     1 
ATOM   441  C  CB    . LEU A 1  70  ? 17.498  -31.189 -15.325 1.00 21.61 ? 196 LEU A CB    1 
ATOM   442  C  CG    . LEU A 1  70  ? 17.106  -30.409 -16.579 1.00 32.97 ? 196 LEU A CG    1 
ATOM   443  C  CD1   . LEU A 1  70  ? 17.124  -28.911 -16.284 1.00 20.38 ? 196 LEU A CD1   1 
ATOM   444  C  CD2   . LEU A 1  70  ? 18.037  -30.749 -17.732 1.00 31.77 ? 196 LEU A CD2   1 
ATOM   445  N  N     . SER A 1  71  ? 15.158  -33.017 -13.989 1.00 19.08 ? 197 SER A N     1 
ATOM   446  C  CA    . SER A 1  71  ? 13.941  -33.799 -14.218 1.00 25.53 ? 197 SER A CA    1 
ATOM   447  C  C     . SER A 1  71  ? 12.707  -33.208 -13.543 1.00 23.49 ? 197 SER A C     1 
ATOM   448  O  O     . SER A 1  71  ? 11.581  -33.456 -13.971 1.00 19.70 ? 197 SER A O     1 
ATOM   449  C  CB    . SER A 1  71  ? 14.118  -35.247 -13.742 1.00 27.28 ? 197 SER A CB    1 
ATOM   450  O  OG    . SER A 1  71  ? 14.359  -35.281 -12.348 1.00 30.46 ? 197 SER A OG    1 
ATOM   451  N  N     . GLN A 1  72  ? 12.907  -32.444 -12.476 1.00 19.82 ? 198 GLN A N     1 
ATOM   452  C  CA    . GLN A 1  72  ? 11.771  -31.859 -11.772 1.00 20.51 ? 198 GLN A CA    1 
ATOM   453  C  C     . GLN A 1  72  ? 11.051  -30.766 -12.608 1.00 12.85 ? 198 GLN A C     1 
ATOM   454  O  O     . GLN A 1  72  ? 9.973   -30.333 -12.233 1.00 12.95 ? 198 GLN A O     1 
ATOM   455  C  CB    . GLN A 1  72  ? 12.191  -31.332 -10.391 1.00 17.04 ? 198 GLN A CB    1 
ATOM   456  C  CG    . GLN A 1  72  ? 12.600  -32.449 -9.419  1.00 19.21 ? 198 GLN A CG    1 
ATOM   457  C  CD    . GLN A 1  72  ? 13.447  -32.001 -8.218  1.00 20.72 ? 198 GLN A CD    1 
ATOM   458  O  OE1   . GLN A 1  72  ? 14.128  -30.967 -8.243  1.00 19.42 ? 198 GLN A OE1   1 
ATOM   459  N  NE2   . GLN A 1  72  ? 13.442  -32.828 -7.169  1.00 21.69 ? 198 GLN A NE2   1 
ATOM   460  N  N     . LEU A 1  73  ? 11.621  -30.349 -13.738 1.00 11.34 ? 199 LEU A N     1 
ATOM   461  C  CA    . LEU A 1  73  ? 10.953  -29.354 -14.582 1.00 14.05 ? 199 LEU A CA    1 
ATOM   462  C  C     . LEU A 1  73  ? 9.997   -30.004 -15.569 1.00 20.73 ? 199 LEU A C     1 
ATOM   463  O  O     . LEU A 1  73  ? 9.207   -29.322 -16.204 1.00 16.18 ? 199 LEU A O     1 
ATOM   464  C  CB    . LEU A 1  73  ? 11.965  -28.508 -15.351 1.00 14.29 ? 199 LEU A CB    1 
ATOM   465  C  CG    . LEU A 1  73  ? 12.909  -27.630 -14.536 1.00 12.63 ? 199 LEU A CG    1 
ATOM   466  C  CD1   . LEU A 1  73  ? 13.856  -26.922 -15.475 1.00 13.37 ? 199 LEU A CD1   1 
ATOM   467  C  CD2   . LEU A 1  73  ? 12.140  -26.615 -13.671 1.00 13.51 ? 199 LEU A CD2   1 
ATOM   468  N  N     . GLN A 1  74  ? 10.096  -31.329 -15.714 1.00 20.79 ? 200 GLN A N     1 
ATOM   469  C  CA    . GLN A 1  74  ? 9.234   -32.076 -16.641 1.00 17.83 ? 200 GLN A CA    1 
ATOM   470  C  C     . GLN A 1  74  ? 7.752   -31.888 -16.307 1.00 17.32 ? 200 GLN A C     1 
ATOM   471  O  O     . GLN A 1  74  ? 7.300   -32.119 -15.187 1.00 24.34 ? 200 GLN A O     1 
ATOM   472  C  CB    . GLN A 1  74  ? 9.616   -33.567 -16.652 1.00 26.84 ? 200 GLN A CB    1 
ATOM   473  N  N     . GLY A 1  75  ? 6.991   -31.412 -17.277 1.00 26.08 ? 201 GLY A N     1 
ATOM   474  C  CA    . GLY A 1  75  ? 5.573   -31.237 -17.033 1.00 28.57 ? 201 GLY A CA    1 
ATOM   475  C  C     . GLY A 1  75  ? 5.177   -29.908 -16.405 1.00 23.77 ? 201 GLY A C     1 
ATOM   476  O  O     . GLY A 1  75  ? 3.992   -29.631 -16.264 1.00 27.92 ? 201 GLY A O     1 
ATOM   477  N  N     . LEU A 1  76  ? 6.153   -29.101 -15.991 1.00 21.55 ? 202 LEU A N     1 
ATOM   478  C  CA    . LEU A 1  76  ? 5.838   -27.745 -15.538 1.00 14.23 ? 202 LEU A CA    1 
ATOM   479  C  C     . LEU A 1  76  ? 5.523   -26.831 -16.718 1.00 9.85  ? 202 LEU A C     1 
ATOM   480  O  O     . LEU A 1  76  ? 6.267   -26.773 -17.692 1.00 12.63 ? 202 LEU A O     1 
ATOM   481  C  CB    . LEU A 1  76  ? 6.998   -27.147 -14.757 1.00 12.13 ? 202 LEU A CB    1 
ATOM   482  C  CG    . LEU A 1  76  ? 7.291   -27.852 -13.435 1.00 12.09 ? 202 LEU A CG    1 
ATOM   483  C  CD1   . LEU A 1  76  ? 8.451   -27.106 -12.759 1.00 10.10 ? 202 LEU A CD1   1 
ATOM   484  C  CD2   . LEU A 1  76  ? 6.060   -27.946 -12.539 1.00 13.51 ? 202 LEU A CD2   1 
ATOM   485  N  N     . PRO A 1  77  ? 4.427   -26.078 -16.627 1.00 14.90 ? 203 PRO A N     1 
ATOM   486  C  CA    . PRO A 1  77  ? 4.120   -25.146 -17.713 1.00 10.38 ? 203 PRO A CA    1 
ATOM   487  C  C     . PRO A 1  77  ? 5.132   -24.020 -17.792 1.00 11.68 ? 203 PRO A C     1 
ATOM   488  O  O     . PRO A 1  77  ? 5.709   -23.617 -16.777 1.00 9.04  ? 203 PRO A O     1 
ATOM   489  C  CB    . PRO A 1  77  ? 2.741   -24.615 -17.340 1.00 12.06 ? 203 PRO A CB    1 
ATOM   490  C  CG    . PRO A 1  77  ? 2.682   -24.774 -15.874 1.00 16.49 ? 203 PRO A CG    1 
ATOM   491  C  CD    . PRO A 1  77  ? 3.415   -26.048 -15.565 1.00 14.24 ? 203 PRO A CD    1 
ATOM   492  N  N     . HIS A 1  78  ? 5.366   -23.542 -19.005 1.00 8.72  ? 204 HIS A N     1 
ATOM   493  C  CA    . HIS A 1  78  ? 6.249   -22.402 -19.279 1.00 8.95  ? 204 HIS A CA    1 
ATOM   494  C  C     . HIS A 1  78  ? 7.733   -22.720 -19.220 1.00 10.50 ? 204 HIS A C     1 
ATOM   495  O  O     . HIS A 1  78  ? 8.558   -21.834 -19.378 1.00 11.05 ? 204 HIS A O     1 
ATOM   496  C  CB    . HIS A 1  78  ? 5.844   -21.149 -18.447 1.00 6.66  ? 204 HIS A CB    1 
ATOM   497  C  CG    . HIS A 1  78  ? 4.384   -20.878 -18.536 1.00 8.47  ? 204 HIS A CG    1 
ATOM   498  N  ND1   . HIS A 1  78  ? 3.779   -20.528 -19.724 1.00 9.87  ? 204 HIS A ND1   1 
ATOM   499  C  CD2   . HIS A 1  78  ? 3.392   -20.991 -17.621 1.00 9.29  ? 204 HIS A CD2   1 
ATOM   500  C  CE1   . HIS A 1  78  ? 2.477   -20.393 -19.526 1.00 8.01  ? 204 HIS A CE1   1 
ATOM   501  N  NE2   . HIS A 1  78  ? 2.215   -20.699 -18.266 1.00 9.59  ? 204 HIS A NE2   1 
ATOM   502  N  N     . PHE A 1  79  ? 8.063   -24.003 -19.066 1.00 10.05 ? 205 PHE A N     1 
ATOM   503  C  CA    . PHE A 1  79  ? 9.453   -24.416 -19.187 1.00 9.11  ? 205 PHE A CA    1 
ATOM   504  C  C     . PHE A 1  79  ? 9.714   -25.198 -20.462 1.00 14.56 ? 205 PHE A C     1 
ATOM   505  O  O     . PHE A 1  79  ? 9.393   -26.363 -20.546 1.00 19.02 ? 205 PHE A O     1 
ATOM   506  C  CB    . PHE A 1  79  ? 9.886   -25.223 -17.973 1.00 8.29  ? 205 PHE A CB    1 
ATOM   507  C  CG    . PHE A 1  79  ? 10.274  -24.351 -16.816 1.00 8.76  ? 205 PHE A CG    1 
ATOM   508  C  CD1   . PHE A 1  79  ? 11.579  -23.907 -16.687 1.00 7.87  ? 205 PHE A CD1   1 
ATOM   509  C  CD2   . PHE A 1  79  ? 9.314   -23.890 -15.924 1.00 12.07 ? 205 PHE A CD2   1 
ATOM   510  C  CE1   . PHE A 1  79  ? 11.931  -23.044 -15.668 1.00 8.62  ? 205 PHE A CE1   1 
ATOM   511  C  CE2   . PHE A 1  79  ? 9.663   -23.025 -14.902 1.00 6.88  ? 205 PHE A CE2   1 
ATOM   512  C  CZ    . PHE A 1  79  ? 10.948  -22.600 -14.773 1.00 5.91  ? 205 PHE A CZ    1 
ATOM   513  N  N     . GLY A 1  80  ? 10.311  -24.536 -21.439 1.00 11.11 ? 206 GLY A N     1 
ATOM   514  C  CA    . GLY A 1  80  ? 10.712  -25.183 -22.689 1.00 13.40 ? 206 GLY A CA    1 
ATOM   515  C  C     . GLY A 1  80  ? 12.227  -25.208 -22.757 1.00 14.53 ? 206 GLY A C     1 
ATOM   516  O  O     . GLY A 1  80  ? 12.896  -25.183 -21.715 1.00 12.95 ? 206 GLY A O     1 
ATOM   517  N  N     . GLU A 1  81  ? 12.781  -25.215 -23.963 1.00 14.27 ? 207 GLU A N     1 
ATOM   518  C  CA    . GLU A 1  81  ? 14.220  -25.411 -24.107 1.00 15.51 ? 207 GLU A CA    1 
ATOM   519  C  C     . GLU A 1  81  ? 15.007  -24.308 -23.400 1.00 15.35 ? 207 GLU A C     1 
ATOM   520  O  O     . GLU A 1  81  ? 15.962  -24.582 -22.667 1.00 15.61 ? 207 GLU A O     1 
ATOM   521  C  CB    . GLU A 1  81  ? 14.630  -25.521 -25.598 1.00 15.47 ? 207 GLU A CB    1 
ATOM   522  C  CG    . GLU A 1  81  ? 16.126  -25.607 -25.847 1.00 23.05 ? 207 GLU A CG    1 
ATOM   523  N  N     . HIS A 1  82  ? 14.590  -23.062 -23.589 1.00 13.10 ? 208 HIS A N     1 
ATOM   524  C  CA    . HIS A 1  82  ? 15.377  -21.945 -23.098 1.00 11.94 ? 208 HIS A CA    1 
ATOM   525  C  C     . HIS A 1  82  ? 15.371  -21.833 -21.558 1.00 9.60  ? 208 HIS A C     1 
ATOM   526  O  O     . HIS A 1  82  ? 16.443  -21.793 -20.920 1.00 9.83  ? 208 HIS A O     1 
ATOM   527  C  CB    . HIS A 1  82  ? 14.919  -20.648 -23.771 1.00 10.08 ? 208 HIS A CB    1 
ATOM   528  C  CG    . HIS A 1  82  ? 15.935  -19.557 -23.750 1.00 11.77 ? 208 HIS A CG    1 
ATOM   529  N  ND1   . HIS A 1  82  ? 16.022  -18.610 -24.748 1.00 13.10 ? 208 HIS A ND1   1 
ATOM   530  C  CD2   . HIS A 1  82  ? 16.859  -19.212 -22.823 1.00 12.24 ? 208 HIS A CD2   1 
ATOM   531  C  CE1   . HIS A 1  82  ? 16.988  -17.758 -24.460 1.00 8.82  ? 208 HIS A CE1   1 
ATOM   532  N  NE2   . HIS A 1  82  ? 17.497  -18.092 -23.284 1.00 13.11 ? 208 HIS A NE2   1 
ATOM   533  N  N     . SER A 1  83  ? 14.190  -21.773 -20.940 1.00 9.91  ? 209 SER A N     1 
ATOM   534  C  CA    A SER A 1  83  ? 14.131  -21.639 -19.486 0.70 8.73  ? 209 SER A CA    1 
ATOM   535  C  CA    B SER A 1  83  ? 14.129  -21.634 -19.487 0.30 8.76  ? 209 SER A CA    1 
ATOM   536  C  C     . SER A 1  83  ? 14.706  -22.856 -18.784 1.00 10.90 ? 209 SER A C     1 
ATOM   537  O  O     . SER A 1  83  ? 15.276  -22.751 -17.691 1.00 9.91  ? 209 SER A O     1 
ATOM   538  C  CB    A SER A 1  83  ? 12.689  -21.415 -19.032 0.70 7.35  ? 209 SER A CB    1 
ATOM   539  C  CB    B SER A 1  83  ? 12.690  -21.405 -19.033 0.30 7.39  ? 209 SER A CB    1 
ATOM   540  O  OG    A SER A 1  83  ? 12.157  -20.261 -19.659 0.70 6.56  ? 209 SER A OG    1 
ATOM   541  O  OG    B SER A 1  83  ? 11.843  -22.399 -19.571 0.30 7.86  ? 209 SER A OG    1 
ATOM   542  N  N     . SER A 1  84  ? 14.552  -24.022 -19.408 1.00 10.37 ? 210 SER A N     1 
ATOM   543  C  CA    . SER A 1  84  ? 15.107  -25.236 -18.805 1.00 9.36  ? 210 SER A CA    1 
ATOM   544  C  C     . SER A 1  84  ? 16.621  -25.214 -18.822 1.00 9.95  ? 210 SER A C     1 
ATOM   545  O  O     . SER A 1  84  ? 17.265  -25.666 -17.879 1.00 11.62 ? 210 SER A O     1 
ATOM   546  C  CB    . SER A 1  84  ? 14.628  -26.499 -19.520 1.00 10.85 ? 210 SER A CB    1 
ATOM   547  O  OG    . SER A 1  84  ? 13.226  -26.632 -19.366 1.00 13.88 ? 210 SER A OG    1 
ATOM   548  N  N     . ARG A 1  85  ? 17.183  -24.712 -19.910 1.00 11.57 ? 211 ARG A N     1 
ATOM   549  C  CA    . ARG A 1  85  ? 18.636  -24.631 -20.028 1.00 14.71 ? 211 ARG A CA    1 
ATOM   550  C  C     . ARG A 1  85  ? 19.186  -23.658 -18.986 1.00 13.96 ? 211 ARG A C     1 
ATOM   551  O  O     . ARG A 1  85  ? 20.253  -23.892 -18.390 1.00 13.27 ? 211 ARG A O     1 
ATOM   552  C  CB    . ARG A 1  85  ? 19.028  -24.205 -21.457 1.00 14.06 ? 211 ARG A CB    1 
ATOM   553  C  CG    . ARG A 1  85  ? 20.525  -24.276 -21.790 1.00 20.19 ? 211 ARG A CG    1 
ATOM   554  C  CD    . ARG A 1  85  ? 21.173  -22.892 -21.927 1.00 32.63 ? 211 ARG A CD    1 
ATOM   555  N  NE    . ARG A 1  85  ? 20.599  -22.083 -23.003 1.00 38.97 ? 211 ARG A NE    1 
ATOM   556  C  CZ    . ARG A 1  85  ? 20.534  -20.748 -22.992 1.00 41.05 ? 211 ARG A CZ    1 
ATOM   557  N  NH1   . ARG A 1  85  ? 21.012  -20.044 -21.956 1.00 28.40 ? 211 ARG A NH1   1 
ATOM   558  N  NH2   . ARG A 1  85  ? 19.974  -20.111 -24.017 1.00 39.29 ? 211 ARG A NH2   1 
ATOM   559  N  N     . VAL A 1  86  ? 18.470  -22.552 -18.765 1.00 9.86  ? 212 VAL A N     1 
ATOM   560  C  CA    . VAL A 1  86  ? 18.894  -21.575 -17.762 1.00 9.62  ? 212 VAL A CA    1 
ATOM   561  C  C     . VAL A 1  86  ? 18.983  -22.251 -16.397 1.00 10.60 ? 212 VAL A C     1 
ATOM   562  O  O     . VAL A 1  86  ? 19.965  -22.066 -15.683 1.00 9.43  ? 212 VAL A O     1 
ATOM   563  C  CB    . VAL A 1  86  ? 17.940  -20.363 -17.656 1.00 9.17  ? 212 VAL A CB    1 
ATOM   564  C  CG1   . VAL A 1  86  ? 18.323  -19.479 -16.467 1.00 8.85  ? 212 VAL A CG1   1 
ATOM   565  C  CG2   . VAL A 1  86  ? 17.965  -19.546 -18.942 1.00 11.73 ? 212 VAL A CG2   1 
ATOM   566  N  N     . VAL A 1  87  ? 17.954  -23.004 -16.049 1.00 8.12  ? 213 VAL A N     1 
ATOM   567  C  CA    . VAL A 1  87  ? 17.893  -23.677 -14.743 1.00 8.75  ? 213 VAL A CA    1 
ATOM   568  C  C     . VAL A 1  87  ? 18.978  -24.763 -14.655 1.00 10.82 ? 213 VAL A C     1 
ATOM   569  O  O     . VAL A 1  87  ? 19.633  -24.912 -13.629 1.00 9.45  ? 213 VAL A O     1 
ATOM   570  C  CB    . VAL A 1  87  ? 16.535  -24.322 -14.506 1.00 8.92  ? 213 VAL A CB    1 
ATOM   571  C  CG1   . VAL A 1  87  ? 16.578  -25.290 -13.309 1.00 12.79 ? 213 VAL A CG1   1 
ATOM   572  C  CG2   . VAL A 1  87  ? 15.436  -23.267 -14.250 1.00 8.51  ? 213 VAL A CG2   1 
ATOM   573  N  N     . GLN A 1  88  ? 19.174  -25.503 -15.743 1.00 13.40 ? 214 GLN A N     1 
ATOM   574  C  CA    . GLN A 1  88  ? 20.191  -26.551 -15.761 1.00 12.31 ? 214 GLN A CA    1 
ATOM   575  C  C     . GLN A 1  88  ? 21.579  -25.984 -15.499 1.00 13.05 ? 214 GLN A C     1 
ATOM   576  O  O     . GLN A 1  88  ? 22.341  -26.581 -14.745 1.00 16.44 ? 214 GLN A O     1 
ATOM   577  C  CB    . GLN A 1  88  ? 20.153  -27.303 -17.108 1.00 15.42 ? 214 GLN A CB    1 
ATOM   578  C  CG    . GLN A 1  88  ? 21.287  -28.333 -17.278 1.00 20.24 ? 214 GLN A CG    1 
ATOM   579  C  CD    . GLN A 1  88  ? 21.486  -28.727 -18.733 1.00 44.91 ? 214 GLN A CD    1 
ATOM   580  O  OE1   . GLN A 1  88  ? 20.675  -28.386 -19.612 1.00 28.57 ? 214 GLN A OE1   1 
ATOM   581  N  NE2   . GLN A 1  88  ? 22.573  -29.449 -18.999 1.00 56.29 ? 214 GLN A NE2   1 
ATOM   582  N  N     . GLU A 1  89  ? 21.915  -24.839 -16.104 1.00 9.43  ? 215 GLU A N     1 
ATOM   583  C  CA    . GLU A 1  89  ? 23.222  -24.213 -15.869 1.00 9.44  ? 215 GLU A CA    1 
ATOM   584  C  C     . GLU A 1  89  ? 23.379  -23.763 -14.430 1.00 15.10 ? 215 GLU A C     1 
ATOM   585  O  O     . GLU A 1  89  ? 24.433  -23.941 -13.836 1.00 16.88 ? 215 GLU A O     1 
ATOM   586  C  CB    . GLU A 1  89  ? 23.524  -23.071 -16.851 1.00 14.13 ? 215 GLU A CB    1 
ATOM   587  C  CG    . GLU A 1  89  ? 23.603  -23.578 -18.277 1.00 20.26 ? 215 GLU A CG    1 
ATOM   588  C  CD    . GLU A 1  89  ? 23.938  -22.505 -19.304 1.00 23.28 ? 215 GLU A CD    1 
ATOM   589  O  OE1   . GLU A 1  89  ? 24.311  -21.373 -18.935 1.00 23.86 ? 215 GLU A OE1   1 
ATOM   590  O  OE2   . GLU A 1  89  ? 23.826  -22.813 -20.511 1.00 31.26 ? 215 GLU A OE2   1 
ATOM   591  N  N     . LEU A 1  90  ? 22.319  -23.213 -13.851 1.00 9.98  ? 216 LEU A N     1 
ATOM   592  C  CA    . LEU A 1  90  ? 22.399  -22.774 -12.470 1.00 10.66 ? 216 LEU A CA    1 
ATOM   593  C  C     . LEU A 1  90  ? 22.557  -23.972 -11.535 1.00 11.21 ? 216 LEU A C     1 
ATOM   594  O  O     . LEU A 1  90  ? 23.298  -23.891 -10.559 1.00 16.76 ? 216 LEU A O     1 
ATOM   595  C  CB    . LEU A 1  90  ? 21.146  -21.948 -12.083 1.00 8.88  ? 216 LEU A CB    1 
ATOM   596  C  CG    . LEU A 1  90  ? 21.074  -20.581 -12.732 1.00 11.63 ? 216 LEU A CG    1 
ATOM   597  C  CD1   . LEU A 1  90  ? 19.599  -20.071 -12.849 1.00 6.66  ? 216 LEU A CD1   1 
ATOM   598  C  CD2   . LEU A 1  90  ? 21.910  -19.631 -11.880 1.00 15.11 ? 216 LEU A CD2   1 
ATOM   599  N  N     . LEU A 1  91  ? 21.851  -25.063 -11.818 1.00 9.44  ? 217 LEU A N     1 
ATOM   600  C  CA    . LEU A 1  91  ? 21.914  -26.260 -10.972 1.00 14.38 ? 217 LEU A CA    1 
ATOM   601  C  C     . LEU A 1  91  ? 23.297  -26.911 -11.040 1.00 19.71 ? 217 LEU A C     1 
ATOM   602  O  O     . LEU A 1  91  ? 23.828  -27.391 -10.038 1.00 19.83 ? 217 LEU A O     1 
ATOM   603  C  CB    . LEU A 1  91  ? 20.860  -27.283 -11.368 1.00 12.97 ? 217 LEU A CB    1 
ATOM   604  C  CG    . LEU A 1  91  ? 19.368  -27.027 -11.135 1.00 13.84 ? 217 LEU A CG    1 
ATOM   605  C  CD1   . LEU A 1  91  ? 18.545  -28.225 -11.663 1.00 12.77 ? 217 LEU A CD1   1 
ATOM   606  C  CD2   . LEU A 1  91  ? 19.071  -26.794 -9.656  1.00 13.65 ? 217 LEU A CD2   1 
ATOM   607  N  N     . GLU A 1  92  ? 23.869  -26.920 -12.231 1.00 13.34 ? 218 GLU A N     1 
ATOM   608  C  CA    . GLU A 1  92  ? 25.187  -27.521 -12.475 1.00 21.19 ? 218 GLU A CA    1 
ATOM   609  C  C     . GLU A 1  92  ? 26.385  -26.653 -12.042 1.00 24.75 ? 218 GLU A C     1 
ATOM   610  O  O     . GLU A 1  92  ? 27.338  -27.162 -11.459 1.00 27.50 ? 218 GLU A O     1 
ATOM   611  C  CB    . GLU A 1  92  ? 25.302  -27.869 -13.959 1.00 28.65 ? 218 GLU A CB    1 
ATOM   612  C  CG    . GLU A 1  92  ? 26.186  -29.052 -14.288 1.00 41.88 ? 218 GLU A CG    1 
ATOM   613  C  CD    . GLU A 1  92  ? 25.997  -29.504 -15.724 1.00 55.15 ? 218 GLU A CD    1 
ATOM   614  O  OE1   . GLU A 1  92  ? 27.010  -29.883 -16.355 1.00 62.79 ? 218 GLU A OE1   1 
ATOM   615  O  OE2   . GLU A 1  92  ? 24.836  -29.473 -16.219 1.00 47.77 ? 218 GLU A OE2   1 
ATOM   616  N  N     . HIS A 1  93  ? 26.324  -25.344 -12.282 1.00 18.34 ? 219 HIS A N     1 
ATOM   617  C  CA    . HIS A 1  93  ? 27.476  -24.476 -12.089 1.00 18.80 ? 219 HIS A CA    1 
ATOM   618  C  C     . HIS A 1  93  ? 27.241  -23.311 -11.147 1.00 21.65 ? 219 HIS A C     1 
ATOM   619  O  O     . HIS A 1  93  ? 28.168  -22.555 -10.846 1.00 26.99 ? 219 HIS A O     1 
ATOM   620  C  CB    . HIS A 1  93  ? 27.945  -23.950 -13.443 1.00 22.69 ? 219 HIS A CB    1 
ATOM   621  C  CG    . HIS A 1  93  ? 28.255  -25.036 -14.419 1.00 34.73 ? 219 HIS A CG    1 
ATOM   622  N  ND1   . HIS A 1  93  ? 27.713  -25.080 -15.685 1.00 37.11 ? 219 HIS A ND1   1 
ATOM   623  C  CD2   . HIS A 1  93  ? 29.041  -26.132 -14.306 1.00 35.80 ? 219 HIS A CD2   1 
ATOM   624  C  CE1   . HIS A 1  93  ? 28.150  -26.159 -16.311 1.00 41.89 ? 219 HIS A CE1   1 
ATOM   625  N  NE2   . HIS A 1  93  ? 28.959  -26.812 -15.496 1.00 40.81 ? 219 HIS A NE2   1 
ATOM   626  N  N     . GLY A 1  94  ? 26.005  -23.135 -10.707 1.00 17.52 ? 220 GLY A N     1 
ATOM   627  C  CA    . GLY A 1  94  ? 25.686  -22.037 -9.809  1.00 17.30 ? 220 GLY A CA    1 
ATOM   628  C  C     . GLY A 1  94  ? 25.531  -20.702 -10.506 1.00 16.25 ? 220 GLY A C     1 
ATOM   629  O  O     . GLY A 1  94  ? 25.302  -19.671 -9.861  1.00 16.10 ? 220 GLY A O     1 
ATOM   630  N  N     A VAL A 1  95  ? 25.663  -20.712 -11.831 0.50 16.24 ? 221 VAL A N     1 
ATOM   631  N  N     B VAL A 1  95  ? 25.611  -20.732 -11.832 0.50 16.26 ? 221 VAL A N     1 
ATOM   632  C  CA    A VAL A 1  95  ? 25.617  -19.495 -12.624 0.50 14.65 ? 221 VAL A CA    1 
ATOM   633  C  CA    B VAL A 1  95  ? 25.605  -19.523 -12.618 0.50 14.64 ? 221 VAL A CA    1 
ATOM   634  C  C     A VAL A 1  95  ? 25.198  -19.824 -14.063 0.50 15.86 ? 221 VAL A C     1 
ATOM   635  C  C     B VAL A 1  95  ? 25.150  -19.855 -14.049 0.50 15.86 ? 221 VAL A C     1 
ATOM   636  O  O     A VAL A 1  95  ? 25.552  -20.879 -14.589 0.50 15.68 ? 221 VAL A O     1 
ATOM   637  O  O     B VAL A 1  95  ? 25.420  -20.948 -14.552 0.50 15.65 ? 221 VAL A O     1 
ATOM   638  C  CB    A VAL A 1  95  ? 27.006  -18.796 -12.596 0.50 20.28 ? 221 VAL A CB    1 
ATOM   639  C  CB    B VAL A 1  95  ? 27.028  -18.921 -12.601 0.50 20.29 ? 221 VAL A CB    1 
ATOM   640  C  CG1   A VAL A 1  95  ? 27.379  -18.232 -13.955 0.50 20.24 ? 221 VAL A CG1   1 
ATOM   641  C  CG1   B VAL A 1  95  ? 28.026  -19.912 -13.167 0.50 13.58 ? 221 VAL A CG1   1 
ATOM   642  C  CG2   A VAL A 1  95  ? 27.043  -17.723 -11.528 0.50 16.93 ? 221 VAL A CG2   1 
ATOM   643  C  CG2   B VAL A 1  95  ? 27.078  -17.645 -13.355 0.50 17.91 ? 221 VAL A CG2   1 
ATOM   644  N  N     . CYS A 1  96  ? 24.418  -18.938 -14.684 1.00 13.17 ? 222 CYS A N     1 
ATOM   645  C  CA    . CYS A 1  96  ? 23.991  -19.124 -16.072 1.00 14.21 ? 222 CYS A CA    1 
ATOM   646  C  C     . CYS A 1  96  ? 24.724  -18.107 -16.950 1.00 13.10 ? 222 CYS A C     1 
ATOM   647  O  O     . CYS A 1  96  ? 24.609  -16.909 -16.717 1.00 12.56 ? 222 CYS A O     1 
ATOM   648  C  CB    . CYS A 1  96  ? 22.471  -18.952 -16.201 1.00 10.07 ? 222 CYS A CB    1 
ATOM   649  S  SG    . CYS A 1  96  ? 21.931  -18.887 -17.919 1.00 13.75 ? 222 CYS A SG    1 
ATOM   650  N  N     . GLU A 1  97  ? 25.507  -18.569 -17.934 1.00 13.79 ? 223 GLU A N     1 
ATOM   651  C  CA    . GLU A 1  97  ? 26.325  -17.635 -18.687 1.00 14.52 ? 223 GLU A CA    1 
ATOM   652  C  C     . GLU A 1  97  ? 25.513  -16.496 -19.316 1.00 12.13 ? 223 GLU A C     1 
ATOM   653  O  O     . GLU A 1  97  ? 25.909  -15.333 -19.246 1.00 12.08 ? 223 GLU A O     1 
ATOM   654  C  CB    . GLU A 1  97  ? 27.169  -18.325 -19.771 1.00 15.41 ? 223 GLU A CB    1 
ATOM   655  C  CG    . GLU A 1  97  ? 28.272  -17.384 -20.343 1.00 28.16 ? 223 GLU A CG    1 
ATOM   656  C  CD    . GLU A 1  97  ? 28.952  -16.485 -19.268 1.00 46.74 ? 223 GLU A CD    1 
ATOM   657  O  OE1   . GLU A 1  97  ? 29.426  -17.009 -18.222 1.00 44.79 ? 223 GLU A OE1   1 
ATOM   658  O  OE2   . GLU A 1  97  ? 29.013  -15.242 -19.470 1.00 44.34 ? 223 GLU A OE2   1 
ATOM   659  N  N     . GLU A 1  98  ? 24.374  -16.838 -19.904 1.00 13.32 ? 224 GLU A N     1 
ATOM   660  C  CA    . GLU A 1  98  ? 23.530  -15.822 -20.540 1.00 14.36 ? 224 GLU A CA    1 
ATOM   661  C  C     . GLU A 1  98  ? 23.105  -14.747 -19.555 1.00 10.86 ? 224 GLU A C     1 
ATOM   662  O  O     . GLU A 1  98  ? 23.163  -13.544 -19.838 1.00 12.31 ? 224 GLU A O     1 
ATOM   663  C  CB    . GLU A 1  98  ? 22.294  -16.468 -21.151 1.00 10.17 ? 224 GLU A CB    1 
ATOM   664  C  CG    . GLU A 1  98  ? 21.518  -15.449 -22.020 1.00 13.54 ? 224 GLU A CG    1 
ATOM   665  C  CD    . GLU A 1  98  ? 20.169  -15.954 -22.529 1.00 14.42 ? 224 GLU A CD    1 
ATOM   666  O  OE1   . GLU A 1  98  ? 19.821  -17.132 -22.283 1.00 17.58 ? 224 GLU A OE1   1 
ATOM   667  O  OE2   . GLU A 1  98  ? 19.455  -15.144 -23.171 1.00 17.52 ? 224 GLU A OE2   1 
ATOM   668  N  N     . VAL A 1  99  ? 22.708  -15.190 -18.364 1.00 13.03 ? 225 VAL A N     1 
ATOM   669  C  CA    . VAL A 1  99  ? 22.216  -14.282 -17.361 1.00 8.03  ? 225 VAL A CA    1 
ATOM   670  C  C     . VAL A 1  99  ? 23.353  -13.351 -16.922 1.00 13.01 ? 225 VAL A C     1 
ATOM   671  O  O     . VAL A 1  99  ? 23.167  -12.144 -16.752 1.00 11.58 ? 225 VAL A O     1 
ATOM   672  C  CB    . VAL A 1  99  ? 21.647  -15.038 -16.136 1.00 12.90 ? 225 VAL A CB    1 
ATOM   673  C  CG1   . VAL A 1  99  ? 21.326  -14.067 -15.003 1.00 9.94  ? 225 VAL A CG1   1 
ATOM   674  C  CG2   . VAL A 1  99  ? 20.394  -15.829 -16.516 1.00 7.97  ? 225 VAL A CG2   1 
ATOM   675  N  N     . GLU A 1  100 ? 24.548  -13.912 -16.749 1.00 13.14 ? 226 GLU A N     1 
ATOM   676  C  CA    . GLU A 1  100 ? 25.666  -13.074 -16.335 1.00 12.62 ? 226 GLU A CA    1 
ATOM   677  C  C     . GLU A 1  100 ? 26.042  -12.089 -17.426 1.00 11.36 ? 226 GLU A C     1 
ATOM   678  O  O     . GLU A 1  100 ? 26.394  -10.958 -17.141 1.00 13.37 ? 226 GLU A O     1 
ATOM   679  C  CB    . GLU A 1  100 ? 26.861  -13.939 -15.950 1.00 16.38 ? 226 GLU A CB    1 
ATOM   680  C  CG    . GLU A 1  100 ? 26.504  -14.804 -14.788 1.00 14.84 ? 226 GLU A CG    1 
ATOM   681  C  CD    . GLU A 1  100 ? 26.009  -13.984 -13.599 1.00 22.25 ? 226 GLU A CD    1 
ATOM   682  O  OE1   . GLU A 1  100 ? 26.736  -13.049 -13.213 1.00 20.90 ? 226 GLU A OE1   1 
ATOM   683  O  OE2   . GLU A 1  100 ? 24.896  -14.248 -13.070 1.00 19.45 ? 226 GLU A OE2   1 
ATOM   684  N  N     . ARG A 1  101 ? 25.965  -12.536 -18.669 1.00 12.23 ? 227 ARG A N     1 
ATOM   685  C  CA    . ARG A 1  101 ? 26.306  -11.667 -19.771 1.00 16.36 ? 227 ARG A CA    1 
ATOM   686  C  C     . ARG A 1  101 ? 25.334  -10.482 -19.826 1.00 16.38 ? 227 ARG A C     1 
ATOM   687  O  O     . ARG A 1  101 ? 25.728  -9.350  -20.057 1.00 15.07 ? 227 ARG A O     1 
ATOM   688  C  CB    . ARG A 1  101 ? 26.293  -12.472 -21.074 1.00 19.33 ? 227 ARG A CB    1 
ATOM   689  C  CG    . ARG A 1  101 ? 26.914  -11.781 -22.280 1.00 34.45 ? 227 ARG A CG    1 
ATOM   690  C  CD    . ARG A 1  101 ? 27.205  -12.775 -23.424 1.00 28.69 ? 227 ARG A CD    1 
ATOM   691  N  NE    . ARG A 1  101 ? 25.996  -13.447 -23.901 1.00 39.16 ? 227 ARG A NE    1 
ATOM   692  C  CZ    . ARG A 1  101 ? 25.737  -14.739 -23.723 1.00 31.75 ? 227 ARG A CZ    1 
ATOM   693  N  NH1   . ARG A 1  101 ? 26.614  -15.515 -23.085 1.00 43.26 ? 227 ARG A NH1   1 
ATOM   694  N  NH2   . ARG A 1  101 ? 24.605  -15.256 -24.186 1.00 37.01 ? 227 ARG A NH2   1 
ATOM   695  N  N     . VAL A 1  102 ? 24.055  -10.749 -19.629 1.00 12.43 ? 228 VAL A N     1 
ATOM   696  C  CA    . VAL A 1  102 ? 23.083  -9.662  -19.512 1.00 11.54 ? 228 VAL A CA    1 
ATOM   697  C  C     . VAL A 1  102 ? 23.425  -8.684  -18.399 1.00 10.99 ? 228 VAL A C     1 
ATOM   698  O  O     . VAL A 1  102 ? 23.494  -7.474  -18.639 1.00 12.27 ? 228 VAL A O     1 
ATOM   699  C  CB    . VAL A 1  102 ? 21.665  -10.224 -19.269 1.00 12.98 ? 228 VAL A CB    1 
ATOM   700  C  CG1   . VAL A 1  102 ? 20.677  -9.059  -19.007 1.00 11.09 ? 228 VAL A CG1   1 
ATOM   701  C  CG2   . VAL A 1  102 ? 21.237  -11.044 -20.462 1.00 13.08 ? 228 VAL A CG2   1 
ATOM   702  N  N     . ARG A 1  103 ? 23.669  -9.203  -17.190 1.00 12.21 ? 229 ARG A N     1 
ATOM   703  C  CA    . ARG A 1  103 ? 23.910  -8.346  -16.027 1.00 13.20 ? 229 ARG A CA    1 
ATOM   704  C  C     . ARG A 1  103 ? 25.058  -7.384  -16.253 1.00 17.36 ? 229 ARG A C     1 
ATOM   705  O  O     . ARG A 1  103 ? 25.021  -6.239  -15.780 1.00 16.70 ? 229 ARG A O     1 
ATOM   706  C  CB    . ARG A 1  103 ? 24.330  -9.158  -14.803 1.00 16.68 ? 229 ARG A CB    1 
ATOM   707  C  CG    . ARG A 1  103 ? 23.342  -10.054 -14.216 1.00 19.92 ? 229 ARG A CG    1 
ATOM   708  C  CD    . ARG A 1  103 ? 23.848  -10.469 -12.827 1.00 20.59 ? 229 ARG A CD    1 
ATOM   709  N  NE    . ARG A 1  103 ? 23.307  -11.771 -12.462 1.00 28.09 ? 229 ARG A NE    1 
ATOM   710  C  CZ    . ARG A 1  103 ? 22.219  -11.924 -11.717 1.00 29.17 ? 229 ARG A CZ    1 
ATOM   711  N  NH1   . ARG A 1  103 ? 21.594  -10.848 -11.246 1.00 19.46 ? 229 ARG A NH1   1 
ATOM   712  N  NH2   . ARG A 1  103 ? 21.767  -13.139 -11.427 1.00 28.69 ? 229 ARG A NH2   1 
ATOM   713  N  N     . ARG A 1  104 ? 26.092  -7.887  -16.926 1.00 14.76 ? 230 ARG A N     1 
ATOM   714  C  CA    . ARG A 1  104 ? 27.334  -7.142  -17.190 1.00 19.64 ? 230 ARG A CA    1 
ATOM   715  C  C     . ARG A 1  104 ? 27.170  -6.081  -18.268 1.00 23.90 ? 230 ARG A C     1 
ATOM   716  O  O     . ARG A 1  104 ? 27.938  -5.118  -18.331 1.00 27.37 ? 230 ARG A O     1 
ATOM   717  C  CB    . ARG A 1  104 ? 28.437  -8.085  -17.701 1.00 18.68 ? 230 ARG A CB    1 
ATOM   718  C  CG    . ARG A 1  104 ? 28.999  -9.055  -16.711 1.00 28.84 ? 230 ARG A CG    1 
ATOM   719  C  CD    . ARG A 1  104 ? 30.334  -9.628  -17.227 1.00 29.65 ? 230 ARG A CD    1 
ATOM   720  N  NE    . ARG A 1  104 ? 30.224  -10.368 -18.486 1.00 26.64 ? 230 ARG A NE    1 
ATOM   721  C  CZ    . ARG A 1  104 ? 30.077  -11.689 -18.572 1.00 27.10 ? 230 ARG A CZ    1 
ATOM   722  N  NH1   . ARG A 1  104 ? 30.025  -12.432 -17.470 1.00 30.35 ? 230 ARG A NH1   1 
ATOM   723  N  NH2   . ARG A 1  104 ? 29.983  -12.264 -19.761 1.00 32.84 ? 230 ARG A NH2   1 
ATOM   724  N  N     . SER A 1  105 ? 26.205  -6.290  -19.151 1.00 12.92 ? 231 SER A N     1 
ATOM   725  C  CA    . SER A 1  105 ? 26.159  -5.522  -20.368 1.00 17.39 ? 231 SER A CA    1 
ATOM   726  C  C     . SER A 1  105 ? 25.830  -4.050  -20.129 1.00 18.85 ? 231 SER A C     1 
ATOM   727  O  O     . SER A 1  105 ? 25.055  -3.679  -19.239 1.00 13.31 ? 231 SER A O     1 
ATOM   728  C  CB    . SER A 1  105 ? 25.199  -6.157  -21.368 1.00 15.12 ? 231 SER A CB    1 
ATOM   729  O  OG    . SER A 1  105 ? 23.885  -5.998  -20.926 1.00 18.05 ? 231 SER A OG    1 
ATOM   730  N  N     . GLU A 1  106 ? 26.427  -3.196  -20.946 1.00 14.43 ? 232 GLU A N     1 
ATOM   731  C  CA    . GLU A 1  106 ? 26.221  -1.771  -20.818 1.00 13.68 ? 232 GLU A CA    1 
ATOM   732  C  C     . GLU A 1  106 ? 24.765  -1.453  -21.122 1.00 14.93 ? 232 GLU A C     1 
ATOM   733  O  O     . GLU A 1  106 ? 24.155  -0.600  -20.484 1.00 15.77 ? 232 GLU A O     1 
ATOM   734  C  CB    . GLU A 1  106 ? 27.170  -1.022  -21.775 1.00 21.18 ? 232 GLU A CB    1 
ATOM   735  C  CG    . GLU A 1  106 ? 27.311  0.454   -21.449 1.00 26.69 ? 232 GLU A CG    1 
ATOM   736  C  CD    . GLU A 1  106 ? 28.157  1.224   -22.472 1.00 29.59 ? 232 GLU A CD    1 
ATOM   737  O  OE1   . GLU A 1  106 ? 28.336  0.730   -23.606 1.00 30.04 ? 232 GLU A OE1   1 
ATOM   738  O  OE2   . GLU A 1  106 ? 28.623  2.331   -22.128 1.00 26.43 ? 232 GLU A OE2   1 
ATOM   739  N  N     . ARG A 1  107 ? 24.207  -2.180  -22.073 1.00 14.09 ? 233 ARG A N     1 
ATOM   740  C  CA    . ARG A 1  107 ? 22.843  -1.952  -22.506 1.00 17.68 ? 233 ARG A CA    1 
ATOM   741  C  C     . ARG A 1  107 ? 21.877  -2.250  -21.355 1.00 15.71 ? 233 ARG A C     1 
ATOM   742  O  O     . ARG A 1  107 ? 21.039  -1.422  -21.022 1.00 13.15 ? 233 ARG A O     1 
ATOM   743  C  CB    . ARG A 1  107 ? 22.543  -2.821  -23.718 1.00 15.06 ? 233 ARG A CB    1 
ATOM   744  C  CG    . ARG A 1  107 ? 21.065  -2.945  -24.128 1.00 19.20 ? 233 ARG A CG    1 
ATOM   745  C  CD    . ARG A 1  107 ? 20.523  -1.663  -24.765 1.00 17.31 ? 233 ARG A CD    1 
ATOM   746  N  NE    . ARG A 1  107 ? 19.093  -1.791  -25.098 1.00 18.63 ? 233 ARG A NE    1 
ATOM   747  C  CZ    . ARG A 1  107 ? 18.385  -0.861  -25.734 1.00 15.14 ? 233 ARG A CZ    1 
ATOM   748  N  NH1   . ARG A 1  107 ? 18.979  0.254   -26.155 1.00 18.02 ? 233 ARG A NH1   1 
ATOM   749  N  NH2   . ARG A 1  107 ? 17.089  -1.043  -25.982 1.00 13.35 ? 233 ARG A NH2   1 
ATOM   750  N  N     . TYR A 1  108 ? 22.008  -3.418  -20.730 1.00 10.01 ? 234 TYR A N     1 
ATOM   751  C  CA    . TYR A 1  108 ? 21.129  -3.745  -19.616 1.00 10.59 ? 234 TYR A CA    1 
ATOM   752  C  C     . TYR A 1  108 ? 21.275  -2.751  -18.470 1.00 9.92  ? 234 TYR A C     1 
ATOM   753  O  O     . TYR A 1  108 ? 20.282  -2.206  -17.969 1.00 10.57 ? 234 TYR A O     1 
ATOM   754  C  CB    . TYR A 1  108 ? 21.416  -5.174  -19.132 1.00 9.87  ? 234 TYR A CB    1 
ATOM   755  C  CG    . TYR A 1  108 ? 20.683  -5.538  -17.874 1.00 9.57  ? 234 TYR A CG    1 
ATOM   756  C  CD1   . TYR A 1  108 ? 19.349  -5.970  -17.919 1.00 8.85  ? 234 TYR A CD1   1 
ATOM   757  C  CD2   . TYR A 1  108 ? 21.298  -5.431  -16.646 1.00 8.89  ? 234 TYR A CD2   1 
ATOM   758  C  CE1   . TYR A 1  108 ? 18.662  -6.311  -16.747 1.00 13.18 ? 234 TYR A CE1   1 
ATOM   759  C  CE2   . TYR A 1  108 ? 20.623  -5.776  -15.470 1.00 12.51 ? 234 TYR A CE2   1 
ATOM   760  C  CZ    . TYR A 1  108 ? 19.301  -6.210  -15.534 1.00 19.29 ? 234 TYR A CZ    1 
ATOM   761  O  OH    . TYR A 1  108 ? 18.631  -6.543  -14.364 1.00 14.61 ? 234 TYR A OH    1 
ATOM   762  N  N     . GLN A 1  109 ? 22.510  -2.468  -18.066 1.00 9.35  ? 235 GLN A N     1 
ATOM   763  C  CA    . GLN A 1  109 ? 22.707  -1.610  -16.907 1.00 12.94 ? 235 GLN A CA    1 
ATOM   764  C  C     . GLN A 1  109 ? 22.199  -0.193  -17.138 1.00 11.54 ? 235 GLN A C     1 
ATOM   765  O  O     . GLN A 1  109 ? 21.642  0.438   -16.226 1.00 10.22 ? 235 GLN A O     1 
ATOM   766  C  CB    . GLN A 1  109 ? 24.176  -1.577  -16.493 1.00 11.76 ? 235 GLN A CB    1 
ATOM   767  C  CG    . GLN A 1  109 ? 24.703  -2.946  -16.104 1.00 15.42 ? 235 GLN A CG    1 
ATOM   768  C  CD    . GLN A 1  109 ? 26.199  -2.887  -15.732 1.00 37.62 ? 235 GLN A CD    1 
ATOM   769  O  OE1   . GLN A 1  109 ? 26.731  -1.822  -15.391 1.00 39.19 ? 235 GLN A OE1   1 
ATOM   770  N  NE2   . GLN A 1  109 ? 26.875  -4.027  -15.811 1.00 28.82 ? 235 GLN A NE2   1 
ATOM   771  N  N     . THR A 1  110 ? 22.358  0.301   -18.356 1.00 12.87 ? 236 THR A N     1 
ATOM   772  C  CA    . THR A 1  110 ? 21.913  1.664   -18.638 1.00 10.85 ? 236 THR A CA    1 
ATOM   773  C  C     . THR A 1  110 ? 20.395  1.747   -18.770 1.00 11.26 ? 236 THR A C     1 
ATOM   774  O  O     . THR A 1  110 ? 19.783  2.692   -18.277 1.00 8.10  ? 236 THR A O     1 
ATOM   775  C  CB    . THR A 1  110 ? 22.602  2.204   -19.905 1.00 15.07 ? 236 THR A CB    1 
ATOM   776  O  OG1   . THR A 1  110 ? 24.019  2.083   -19.722 1.00 16.97 ? 236 THR A OG1   1 
ATOM   777  C  CG2   . THR A 1  110 ? 22.240  3.685   -20.139 1.00 16.08 ? 236 THR A CG2   1 
ATOM   778  N  N     . MET A 1  111 ? 19.796  0.786   -19.459 1.00 8.66  ? 237 MET A N     1 
ATOM   779  C  CA    . MET A 1  111 ? 18.330  0.757   -19.568 1.00 9.49  ? 237 MET A CA    1 
ATOM   780  C  C     . MET A 1  111 ? 17.676  0.582   -18.193 1.00 12.65 ? 237 MET A C     1 
ATOM   781  O  O     . MET A 1  111 ? 16.604  1.129   -17.925 1.00 10.79 ? 237 MET A O     1 
ATOM   782  C  CB    . MET A 1  111 ? 17.875  -0.370  -20.488 1.00 8.18  ? 237 MET A CB    1 
ATOM   783  C  CG    . MET A 1  111 ? 18.214  -0.177  -21.961 1.00 11.18 ? 237 MET A CG    1 
ATOM   784  S  SD    . MET A 1  111 ? 17.281  1.173   -22.728 1.00 13.24 ? 237 MET A SD    1 
ATOM   785  C  CE    . MET A 1  111 ? 15.637  0.463   -22.818 1.00 12.41 ? 237 MET A CE    1 
ATOM   786  N  N     . LYS A 1  112 ? 18.298  -0.207  -17.327 1.00 8.23  ? 238 LYS A N     1 
ATOM   787  C  CA    . LYS A 1  112 ? 17.758  -0.384  -15.991 1.00 9.29  ? 238 LYS A CA    1 
ATOM   788  C  C     . LYS A 1  112 ? 17.855  0.924   -15.254 1.00 12.76 ? 238 LYS A C     1 
ATOM   789  O  O     . LYS A 1  112 ? 16.879  1.364   -14.680 1.00 13.01 ? 238 LYS A O     1 
ATOM   790  C  CB    . LYS A 1  112 ? 18.495  -1.488  -15.227 1.00 11.91 ? 238 LYS A CB    1 
ATOM   791  C  CG    . LYS A 1  112 ? 17.792  -1.866  -13.905 1.00 14.98 ? 238 LYS A CG    1 
ATOM   792  C  CD    . LYS A 1  112 ? 18.417  -3.132  -13.276 1.00 15.49 ? 238 LYS A CD    1 
ATOM   793  C  CE    . LYS A 1  112 ? 17.742  -3.519  -11.963 1.00 15.22 ? 238 LYS A CE    1 
ATOM   794  N  NZ    . LYS A 1  112 ? 16.266  -3.827  -12.120 1.00 15.61 ? 238 LYS A NZ    1 
ATOM   795  N  N     . LEU A 1  113 ? 19.031  1.569   -15.289 1.00 10.08 ? 239 LEU A N     1 
ATOM   796  C  CA    . LEU A 1  113 ? 19.194  2.859   -14.613 1.00 12.61 ? 239 LEU A CA    1 
ATOM   797  C  C     . LEU A 1  113 ? 18.199  3.896   -15.128 1.00 12.95 ? 239 LEU A C     1 
ATOM   798  O  O     . LEU A 1  113 ? 17.562  4.617   -14.334 1.00 14.12 ? 239 LEU A O     1 
ATOM   799  C  CB    . LEU A 1  113 ? 20.626  3.369   -14.814 1.00 12.81 ? 239 LEU A CB    1 
ATOM   800  C  CG    . LEU A 1  113 ? 20.957  4.759   -14.317 1.00 16.78 ? 239 LEU A CG    1 
ATOM   801  C  CD1   . LEU A 1  113 ? 21.042  4.751   -12.794 1.00 28.85 ? 239 LEU A CD1   1 
ATOM   802  C  CD2   . LEU A 1  113 ? 22.265  5.228   -14.974 1.00 18.20 ? 239 LEU A CD2   1 
ATOM   803  N  N     . PHE A 1  114 ? 18.035  3.977   -16.448 1.00 8.24  ? 240 PHE A N     1 
ATOM   804  C  CA    . PHE A 1  114 ? 17.189  5.033   -16.993 1.00 8.38  ? 240 PHE A CA    1 
ATOM   805  C  C     . PHE A 1  114 ? 15.695  4.741   -16.722 1.00 9.23  ? 240 PHE A C     1 
ATOM   806  O  O     . PHE A 1  114 ? 14.958  5.635   -16.334 1.00 9.16  ? 240 PHE A O     1 
ATOM   807  C  CB    . PHE A 1  114 ? 17.425  5.196   -18.502 1.00 9.42  ? 240 PHE A CB    1 
ATOM   808  C  CG    . PHE A 1  114 ? 18.707  5.958   -18.856 1.00 9.57  ? 240 PHE A CG    1 
ATOM   809  C  CD1   . PHE A 1  114 ? 19.118  6.077   -20.170 1.00 14.83 ? 240 PHE A CD1   1 
ATOM   810  C  CD2   . PHE A 1  114 ? 19.467  6.543   -17.882 1.00 12.00 ? 240 PHE A CD2   1 
ATOM   811  C  CE1   . PHE A 1  114 ? 20.276  6.779   -20.486 1.00 12.48 ? 240 PHE A CE1   1 
ATOM   812  C  CE2   . PHE A 1  114 ? 20.634  7.240   -18.195 1.00 16.94 ? 240 PHE A CE2   1 
ATOM   813  C  CZ    . PHE A 1  114 ? 21.024  7.355   -19.495 1.00 13.42 ? 240 PHE A CZ    1 
ATOM   814  N  N     . THR A 1  115 ? 15.258  3.503   -16.936 1.00 10.48 ? 241 THR A N     1 
ATOM   815  C  CA    . THR A 1  115 ? 13.826  3.199   -16.744 1.00 11.47 ? 241 THR A CA    1 
ATOM   816  C  C     . THR A 1  115 ? 13.397  3.309   -15.281 1.00 14.16 ? 241 THR A C     1 
ATOM   817  O  O     . THR A 1  115 ? 12.219  3.466   -14.992 1.00 11.48 ? 241 THR A O     1 
ATOM   818  C  CB    . THR A 1  115 ? 13.442  1.810   -17.232 1.00 12.51 ? 241 THR A CB    1 
ATOM   819  O  OG1   . THR A 1  115 ? 14.292  0.838   -16.619 1.00 10.41 ? 241 THR A OG1   1 
ATOM   820  C  CG2   . THR A 1  115 ? 13.526  1.703   -18.761 1.00 15.78 ? 241 THR A CG2   1 
ATOM   821  N  N     . GLN A 1  116 ? 14.355  3.204   -14.368 1.00 10.44 ? 242 GLN A N     1 
ATOM   822  C  CA    . GLN A 1  116 ? 14.097  3.434   -12.944 1.00 12.31 ? 242 GLN A CA    1 
ATOM   823  C  C     . GLN A 1  116 ? 13.645  4.850   -12.631 1.00 16.94 ? 242 GLN A C     1 
ATOM   824  O  O     . GLN A 1  116 ? 13.036  5.113   -11.595 1.00 14.67 ? 242 GLN A O     1 
ATOM   825  C  CB    . GLN A 1  116 ? 15.341  3.099   -12.102 1.00 19.44 ? 242 GLN A CB    1 
ATOM   826  C  CG    . GLN A 1  116 ? 15.398  1.663   -11.707 1.00 27.53 ? 242 GLN A CG    1 
ATOM   827  C  CD    . GLN A 1  116 ? 16.734  1.228   -11.112 1.00 29.22 ? 242 GLN A CD    1 
ATOM   828  O  OE1   . GLN A 1  116 ? 17.656  2.024   -10.937 1.00 29.13 ? 242 GLN A OE1   1 
ATOM   829  N  NE2   . GLN A 1  116 ? 16.835  -0.049  -10.807 1.00 32.67 ? 242 GLN A NE2   1 
ATOM   830  N  N     . ILE A 1  117 ? 13.960  5.782   -13.518 1.00 12.13 ? 243 ILE A N     1 
ATOM   831  C  CA    . ILE A 1  117 ? 13.593  7.159   -13.285 1.00 8.36  ? 243 ILE A CA    1 
ATOM   832  C  C     . ILE A 1  117 ? 12.096  7.327   -13.503 1.00 8.99  ? 243 ILE A C     1 
ATOM   833  O  O     . ILE A 1  117 ? 11.582  6.914   -14.532 1.00 8.27  ? 243 ILE A O     1 
ATOM   834  C  CB    . ILE A 1  117 ? 14.304  8.077   -14.263 1.00 12.41 ? 243 ILE A CB    1 
ATOM   835  C  CG1   . ILE A 1  117 ? 15.809  7.824   -14.166 1.00 12.74 ? 243 ILE A CG1   1 
ATOM   836  C  CG2   . ILE A 1  117 ? 13.923  9.568   -14.003 1.00 9.16  ? 243 ILE A CG2   1 
ATOM   837  C  CD1   . ILE A 1  117 ? 16.592  8.484   -15.293 1.00 15.15 ? 243 ILE A CD1   1 
ATOM   838  N  N     . PHE A 1  118 ? 11.432  7.948   -12.525 1.00 7.36  ? 244 PHE A N     1 
ATOM   839  C  CA    . PHE A 1  118 ? 10.015  8.293   -12.627 1.00 8.48  ? 244 PHE A CA    1 
ATOM   840  C  C     . PHE A 1  118 ? 9.861   9.276   -13.810 1.00 10.32 ? 244 PHE A C     1 
ATOM   841  O  O     . PHE A 1  118 ? 10.447  10.369  -13.813 1.00 9.50  ? 244 PHE A O     1 
ATOM   842  C  CB    . PHE A 1  118 ? 9.571   8.909   -11.285 1.00 11.55 ? 244 PHE A CB    1 
ATOM   843  C  CG    . PHE A 1  118 ? 8.128   9.328   -11.247 1.00 8.47  ? 244 PHE A CG    1 
ATOM   844  C  CD1   . PHE A 1  118 ? 7.128   8.369   -11.301 1.00 6.03  ? 244 PHE A CD1   1 
ATOM   845  C  CD2   . PHE A 1  118 ? 7.776   10.668  -11.122 1.00 8.37  ? 244 PHE A CD2   1 
ATOM   846  C  CE1   . PHE A 1  118 ? 5.795   8.716   -11.276 1.00 8.09  ? 244 PHE A CE1   1 
ATOM   847  C  CE2   . PHE A 1  118 ? 6.427   11.041  -11.086 1.00 14.87 ? 244 PHE A CE2   1 
ATOM   848  C  CZ    . PHE A 1  118 ? 5.438   10.070  -11.167 1.00 17.53 ? 244 PHE A CZ    1 
ATOM   849  N  N     . GLY A 1  119 ? 9.083   8.885   -14.817 1.00 7.14  ? 245 GLY A N     1 
ATOM   850  C  CA    . GLY A 1  119 ? 8.860   9.736   -15.959 1.00 9.55  ? 245 GLY A CA    1 
ATOM   851  C  C     . GLY A 1  119 ? 9.574   9.184   -17.186 1.00 10.46 ? 245 GLY A C     1 
ATOM   852  O  O     . GLY A 1  119 ? 9.413   9.694   -18.299 1.00 9.50  ? 245 GLY A O     1 
ATOM   853  N  N     . VAL A 1  120 ? 10.375  8.136   -16.992 1.00 10.42 ? 246 VAL A N     1 
ATOM   854  C  CA    . VAL A 1  120 ? 11.147  7.573   -18.092 1.00 10.35 ? 246 VAL A CA    1 
ATOM   855  C  C     . VAL A 1  120 ? 10.762  6.129   -18.365 1.00 9.46  ? 246 VAL A C     1 
ATOM   856  O  O     . VAL A 1  120 ? 10.903  5.288   -17.479 1.00 10.19 ? 246 VAL A O     1 
ATOM   857  C  CB    . VAL A 1  120 ? 12.660  7.619   -17.768 1.00 9.78  ? 246 VAL A CB    1 
ATOM   858  C  CG1   . VAL A 1  120 ? 13.475  7.059   -18.950 1.00 10.28 ? 246 VAL A CG1   1 
ATOM   859  C  CG2   . VAL A 1  120 ? 13.098  9.047   -17.455 1.00 8.85  ? 246 VAL A CG2   1 
ATOM   860  N  N     . GLY A 1  121 ? 10.289  5.824   -19.574 1.00 7.39  ? 247 GLY A N     1 
ATOM   861  C  CA    . GLY A 1  121 ? 9.918   4.465   -19.901 1.00 10.29 ? 247 GLY A CA    1 
ATOM   862  C  C     . GLY A 1  121 ? 10.908  3.797   -20.810 1.00 12.97 ? 247 GLY A C     1 
ATOM   863  O  O     . GLY A 1  121 ? 11.948  4.366   -21.108 1.00 10.42 ? 247 GLY A O     1 
ATOM   864  N  N     . VAL A 1  122 ? 10.614  2.576   -21.242 1.00 11.52 ? 248 VAL A N     1 
ATOM   865  C  CA    . VAL A 1  122 ? 11.532  1.868   -22.142 1.00 13.56 ? 248 VAL A CA    1 
ATOM   866  C  C     . VAL A 1  122 ? 11.863  2.677   -23.405 1.00 13.62 ? 248 VAL A C     1 
ATOM   867  O  O     . VAL A 1  122 ? 13.039  2.818   -23.782 1.00 10.80 ? 248 VAL A O     1 
ATOM   868  C  CB    . VAL A 1  122 ? 11.014  0.464   -22.516 1.00 9.94  ? 248 VAL A CB    1 
ATOM   869  C  CG1   . VAL A 1  122 ? 11.930  -0.198  -23.531 1.00 15.15 ? 248 VAL A CG1   1 
ATOM   870  C  CG2   . VAL A 1  122 ? 11.009  -0.434  -21.275 1.00 14.28 ? 248 VAL A CG2   1 
ATOM   871  N  N     . LYS A 1  123 ? 10.833  3.222   -24.044 1.00 15.26 ? 249 LYS A N     1 
ATOM   872  C  CA    . LYS A 1  123 ? 11.034  3.973   -25.288 1.00 15.56 ? 249 LYS A CA    1 
ATOM   873  C  C     . LYS A 1  123 ? 11.934  5.189   -25.086 1.00 14.12 ? 249 LYS A C     1 
ATOM   874  O  O     . LYS A 1  123 ? 12.813  5.460   -25.907 1.00 16.98 ? 249 LYS A O     1 
ATOM   875  C  CB    . LYS A 1  123 ? 9.687   4.369   -25.919 1.00 14.59 ? 249 LYS A CB    1 
ATOM   876  C  CG    . LYS A 1  123 ? 8.893   3.146   -26.398 1.00 20.33 ? 249 LYS A CG    1 
ATOM   877  C  CD    . LYS A 1  123 ? 7.538   3.494   -27.050 1.00 19.68 ? 249 LYS A CD    1 
ATOM   878  N  N     . THR A 1  124 ? 11.748  5.918   -23.990 1.00 11.83 ? 250 THR A N     1 
ATOM   879  C  CA    . THR A 1  124 ? 12.588  7.086   -23.754 1.00 11.27 ? 250 THR A CA    1 
ATOM   880  C  C     . THR A 1  124 ? 14.020  6.651   -23.444 1.00 14.96 ? 250 THR A C     1 
ATOM   881  O  O     . THR A 1  124 ? 14.970  7.182   -24.031 1.00 13.43 ? 250 THR A O     1 
ATOM   882  C  CB    . THR A 1  124 ? 12.035  7.941   -22.641 1.00 10.51 ? 250 THR A CB    1 
ATOM   883  O  OG1   . THR A 1  124 ? 10.735  8.421   -23.018 1.00 11.24 ? 250 THR A OG1   1 
ATOM   884  C  CG2   . THR A 1  124 ? 12.943  9.107   -22.337 1.00 13.00 ? 250 THR A CG2   1 
ATOM   885  N  N     . ALA A 1  125 ? 14.170  5.690   -22.529 1.00 9.42  ? 251 ALA A N     1 
ATOM   886  C  CA    . ALA A 1  125 ? 15.485  5.149   -22.157 1.00 9.34  ? 251 ALA A CA    1 
ATOM   887  C  C     . ALA A 1  125 ? 16.278  4.693   -23.383 1.00 12.82 ? 251 ALA A C     1 
ATOM   888  O  O     . ALA A 1  125 ? 17.481  4.997   -23.513 1.00 11.50 ? 251 ALA A O     1 
ATOM   889  C  CB    . ALA A 1  125 ? 15.313  3.948   -21.200 1.00 11.53 ? 251 ALA A CB    1 
ATOM   890  N  N     . ASP A 1  126 ? 15.601  3.958   -24.264 1.00 10.06 ? 252 ASP A N     1 
ATOM   891  C  CA    . ASP A 1  126 ? 16.231  3.418   -25.468 1.00 16.05 ? 252 ASP A CA    1 
ATOM   892  C  C     . ASP A 1  126 ? 16.723  4.538   -26.405 1.00 19.11 ? 252 ASP A C     1 
ATOM   893  O  O     . ASP A 1  126 ? 17.825  4.455   -26.946 1.00 14.18 ? 252 ASP A O     1 
ATOM   894  C  CB    . ASP A 1  126 ? 15.268  2.501   -26.219 1.00 11.67 ? 252 ASP A CB    1 
ATOM   895  C  CG    . ASP A 1  126 ? 15.815  2.064   -27.557 1.00 17.02 ? 252 ASP A CG    1 
ATOM   896  O  OD1   . ASP A 1  126 ? 16.782  1.275   -27.565 1.00 16.21 ? 252 ASP A OD1   1 
ATOM   897  O  OD2   . ASP A 1  126 ? 15.281  2.507   -28.604 1.00 21.24 ? 252 ASP A OD2   1 
ATOM   898  N  N     . ARG A 1  127 ? 15.906  5.578   -26.602 1.00 15.29 ? 253 ARG A N     1 
ATOM   899  C  CA    . ARG A 1  127 ? 16.350  6.713   -27.430 1.00 15.11 ? 253 ARG A CA    1 
ATOM   900  C  C     . ARG A 1  127 ? 17.583  7.396   -26.818 1.00 18.40 ? 253 ARG A C     1 
ATOM   901  O  O     . ARG A 1  127 ? 18.572  7.638   -27.509 1.00 14.95 ? 253 ARG A O     1 
ATOM   902  C  CB    . ARG A 1  127 ? 15.224  7.727   -27.619 1.00 19.63 ? 253 ARG A CB    1 
ATOM   903  C  CG    . ARG A 1  127 ? 15.656  9.012   -28.396 1.00 21.23 ? 253 ARG A CG    1 
ATOM   904  C  CD    . ARG A 1  127 ? 14.435  9.830   -28.783 1.00 25.58 ? 253 ARG A CD    1 
ATOM   905  N  NE    . ARG A 1  127 ? 13.579  10.180  -27.633 1.00 27.64 ? 253 ARG A NE    1 
ATOM   906  C  CZ    . ARG A 1  127 ? 13.903  11.081  -26.709 1.00 32.93 ? 253 ARG A CZ    1 
ATOM   907  N  NH1   . ARG A 1  127 ? 15.071  11.722  -26.794 1.00 29.09 ? 253 ARG A NH1   1 
ATOM   908  N  NH2   . ARG A 1  127 ? 13.063  11.358  -25.702 1.00 28.44 ? 253 ARG A NH2   1 
ATOM   909  N  N     . TRP A 1  128 ? 17.528  7.717   -25.523 1.00 13.52 ? 254 TRP A N     1 
ATOM   910  C  CA    . TRP A 1  128 ? 18.715  8.222   -24.817 1.00 16.48 ? 254 TRP A CA    1 
ATOM   911  C  C     . TRP A 1  128 ? 19.950  7.309   -24.980 1.00 20.21 ? 254 TRP A C     1 
ATOM   912  O  O     . TRP A 1  128 ? 21.056  7.785   -25.251 1.00 15.12 ? 254 TRP A O     1 
ATOM   913  C  CB    . TRP A 1  128 ? 18.415  8.485   -23.335 1.00 13.36 ? 254 TRP A CB    1 
ATOM   914  C  CG    . TRP A 1  128 ? 17.433  9.620   -23.113 1.00 17.09 ? 254 TRP A CG    1 
ATOM   915  C  CD1   . TRP A 1  128 ? 17.040  10.560  -24.025 1.00 18.99 ? 254 TRP A CD1   1 
ATOM   916  C  CD2   . TRP A 1  128 ? 16.715  9.922   -21.895 1.00 18.79 ? 254 TRP A CD2   1 
ATOM   917  N  NE1   . TRP A 1  128 ? 16.138  11.428  -23.450 1.00 21.50 ? 254 TRP A NE1   1 
ATOM   918  C  CE2   . TRP A 1  128 ? 15.926  11.060  -22.147 1.00 20.18 ? 254 TRP A CE2   1 
ATOM   919  C  CE3   . TRP A 1  128 ? 16.672  9.337   -20.626 1.00 16.78 ? 254 TRP A CE3   1 
ATOM   920  C  CZ2   . TRP A 1  128 ? 15.087  11.624  -21.178 1.00 20.32 ? 254 TRP A CZ2   1 
ATOM   921  C  CZ3   . TRP A 1  128 ? 15.847  9.909   -19.650 1.00 12.93 ? 254 TRP A CZ3   1 
ATOM   922  C  CH2   . TRP A 1  128 ? 15.073  11.040  -19.937 1.00 13.00 ? 254 TRP A CH2   1 
ATOM   923  N  N     . TYR A 1  129 ? 19.749  6.001   -24.851 1.00 13.43 ? 255 TYR A N     1 
ATOM   924  C  CA    . TYR A 1  129 ? 20.848  5.056   -25.011 1.00 12.97 ? 255 TYR A CA    1 
ATOM   925  C  C     . TYR A 1  129 ? 21.458  5.203   -26.390 1.00 18.16 ? 255 TYR A C     1 
ATOM   926  O  O     . TYR A 1  129 ? 22.679  5.218   -26.534 1.00 18.66 ? 255 TYR A O     1 
ATOM   927  C  CB    . TYR A 1  129 ? 20.382  3.602   -24.857 1.00 12.38 ? 255 TYR A CB    1 
ATOM   928  C  CG    . TYR A 1  129 ? 21.540  2.649   -24.774 1.00 13.32 ? 255 TYR A CG    1 
ATOM   929  C  CD1   . TYR A 1  129 ? 22.219  2.467   -23.570 1.00 15.22 ? 255 TYR A CD1   1 
ATOM   930  C  CD2   . TYR A 1  129 ? 21.991  1.959   -25.901 1.00 17.81 ? 255 TYR A CD2   1 
ATOM   931  C  CE1   . TYR A 1  129 ? 23.308  1.597   -23.481 1.00 16.90 ? 255 TYR A CE1   1 
ATOM   932  C  CE2   . TYR A 1  129 ? 23.086  1.083   -25.822 1.00 16.59 ? 255 TYR A CE2   1 
ATOM   933  C  CZ    . TYR A 1  129 ? 23.740  0.918   -24.612 1.00 19.11 ? 255 TYR A CZ    1 
ATOM   934  O  OH    . TYR A 1  129 ? 24.814  0.058   -24.498 1.00 21.33 ? 255 TYR A OH    1 
ATOM   935  N  N     . ARG A 1  130 ? 20.581  5.271   -27.392 1.00 17.34 ? 256 ARG A N     1 
ATOM   936  C  CA    . ARG A 1  130 ? 21.008  5.422   -28.782 1.00 25.07 ? 256 ARG A CA    1 
ATOM   937  C  C     . ARG A 1  130 ? 21.717  6.756   -29.033 1.00 24.04 ? 256 ARG A C     1 
ATOM   938  O  O     . ARG A 1  130 ? 22.652  6.833   -29.822 1.00 25.81 ? 256 ARG A O     1 
ATOM   939  C  CB    . ARG A 1  130 ? 19.815  5.240   -29.719 1.00 20.24 ? 256 ARG A CB    1 
ATOM   940  C  CG    . ARG A 1  130 ? 19.332  3.805   -29.817 1.00 23.21 ? 256 ARG A CG    1 
ATOM   941  C  CD    . ARG A 1  130 ? 18.256  3.639   -30.916 1.00 29.36 ? 256 ARG A CD    1 
ATOM   942  N  NE    . ARG A 1  130 ? 16.908  4.066   -30.505 1.00 27.32 ? 256 ARG A NE    1 
ATOM   943  C  CZ    . ARG A 1  130 ? 16.292  5.183   -30.913 1.00 35.80 ? 256 ARG A CZ    1 
ATOM   944  N  NH1   . ARG A 1  130 ? 16.889  6.020   -31.754 1.00 32.53 ? 256 ARG A NH1   1 
ATOM   945  N  NH2   . ARG A 1  130 ? 15.060  5.473   -30.481 1.00 40.43 ? 256 ARG A NH2   1 
ATOM   946  N  N     . GLU A 1  131 ? 21.288  7.810   -28.356 1.00 19.19 ? 257 GLU A N     1 
ATOM   947  C  CA    . GLU A 1  131 ? 21.969  9.088   -28.462 1.00 21.98 ? 257 GLU A CA    1 
ATOM   948  C  C     . GLU A 1  131 ? 23.334  9.069   -27.759 1.00 19.60 ? 257 GLU A C     1 
ATOM   949  O  O     . GLU A 1  131 ? 24.102  10.017  -27.838 1.00 18.40 ? 257 GLU A O     1 
ATOM   950  C  CB    . GLU A 1  131 ? 21.069  10.207  -27.917 1.00 19.43 ? 257 GLU A CB    1 
ATOM   951  C  CG    . GLU A 1  131 ? 19.812  10.390  -28.744 1.00 20.40 ? 257 GLU A CG    1 
ATOM   952  C  CD    . GLU A 1  131 ? 18.805  11.338  -28.101 1.00 27.97 ? 257 GLU A CD    1 
ATOM   953  O  OE1   . GLU A 1  131 ? 19.121  11.924  -27.054 1.00 27.36 ? 257 GLU A OE1   1 
ATOM   954  O  OE2   . GLU A 1  131 ? 17.689  11.492  -28.640 1.00 33.23 ? 257 GLU A OE2   1 
ATOM   955  N  N     . GLY A 1  132 ? 23.625  7.983   -27.060 1.00 18.84 ? 258 GLY A N     1 
ATOM   956  C  CA    . GLY A 1  132 ? 24.891  7.843   -26.379 1.00 19.31 ? 258 GLY A CA    1 
ATOM   957  C  C     . GLY A 1  132 ? 24.899  8.229   -24.910 1.00 26.45 ? 258 GLY A C     1 
ATOM   958  O  O     . GLY A 1  132 ? 25.962  8.251   -24.309 1.00 25.99 ? 258 GLY A O     1 
ATOM   959  N  N     . LEU A 1  133 ? 23.744  8.523   -24.314 1.00 15.30 ? 259 LEU A N     1 
ATOM   960  C  CA    . LEU A 1  133 ? 23.728  8.911   -22.903 1.00 18.15 ? 259 LEU A CA    1 
ATOM   961  C  C     . LEU A 1  133 ? 23.846  7.645   -22.043 1.00 20.41 ? 259 LEU A C     1 
ATOM   962  O  O     . LEU A 1  133 ? 23.337  6.599   -22.417 1.00 16.03 ? 259 LEU A O     1 
ATOM   963  C  CB    . LEU A 1  133 ? 22.444  9.687   -22.579 1.00 18.97 ? 259 LEU A CB    1 
ATOM   964  C  CG    . LEU A 1  133 ? 22.268  10.936  -23.456 1.00 18.93 ? 259 LEU A CG    1 
ATOM   965  C  CD1   . LEU A 1  133 ? 20.813  11.381  -23.565 1.00 19.80 ? 259 LEU A CD1   1 
ATOM   966  C  CD2   . LEU A 1  133 ? 23.130  12.036  -22.874 1.00 22.68 ? 259 LEU A CD2   1 
ATOM   967  N  N     . ARG A 1  134 ? 24.522  7.734   -20.903 1.00 19.63 ? 260 ARG A N     1 
ATOM   968  C  CA    . ARG A 1  134 ? 24.793  6.545   -20.112 1.00 18.68 ? 260 ARG A CA    1 
ATOM   969  C  C     . ARG A 1  134 ? 24.496  6.727   -18.621 1.00 19.78 ? 260 ARG A C     1 
ATOM   970  O  O     . ARG A 1  134 ? 24.161  5.764   -17.944 1.00 19.17 ? 260 ARG A O     1 
ATOM   971  C  CB    . ARG A 1  134 ? 26.255  6.107   -20.312 1.00 21.61 ? 260 ARG A CB    1 
ATOM   972  C  CG    . ARG A 1  134 ? 26.571  5.616   -21.704 1.00 20.17 ? 260 ARG A CG    1 
ATOM   973  C  CD    . ARG A 1  134 ? 25.888  4.297   -21.992 1.00 20.58 ? 260 ARG A CD    1 
ATOM   974  N  NE    . ARG A 1  134 ? 26.216  3.773   -23.315 1.00 18.82 ? 260 ARG A NE    1 
ATOM   975  C  CZ    . ARG A 1  134 ? 25.594  4.107   -24.440 1.00 20.09 ? 260 ARG A CZ    1 
ATOM   976  N  NH1   . ARG A 1  134 ? 24.600  4.988   -24.434 1.00 18.59 ? 260 ARG A NH1   1 
ATOM   977  N  NH2   . ARG A 1  134 ? 25.971  3.551   -25.584 1.00 25.60 ? 260 ARG A NH2   1 
ATOM   978  N  N     . THR A 1  135 ? 24.631  7.951   -18.111 1.00 17.24 ? 261 THR A N     1 
ATOM   979  C  CA    . THR A 1  135 ? 24.563  8.178   -16.662 1.00 17.84 ? 261 THR A CA    1 
ATOM   980  C  C     . THR A 1  135 ? 23.525  9.220   -16.268 1.00 14.89 ? 261 THR A C     1 
ATOM   981  O  O     . THR A 1  135 ? 23.071  10.005  -17.101 1.00 19.69 ? 261 THR A O     1 
ATOM   982  C  CB    . THR A 1  135 ? 25.906  8.681   -16.112 1.00 23.33 ? 261 THR A CB    1 
ATOM   983  O  OG1   . THR A 1  135 ? 26.112  10.020  -16.564 1.00 21.33 ? 261 THR A OG1   1 
ATOM   984  C  CG2   . THR A 1  135 ? 27.045  7.820   -16.584 1.00 17.39 ? 261 THR A CG2   1 
ATOM   985  N  N     . LEU A 1  136 ? 23.177  9.263   -14.984 1.00 17.93 ? 262 LEU A N     1 
ATOM   986  C  CA    . LEU A 1  136 ? 22.194  10.253  -14.539 1.00 18.66 ? 262 LEU A CA    1 
ATOM   987  C  C     . LEU A 1  136 ? 22.733  11.670  -14.752 1.00 22.23 ? 262 LEU A C     1 
ATOM   988  O  O     . LEU A 1  136 ? 22.000  12.562  -15.136 1.00 19.80 ? 262 LEU A O     1 
ATOM   989  C  CB    . LEU A 1  136 ? 21.803  10.047  -13.077 1.00 17.86 ? 262 LEU A CB    1 
ATOM   990  C  CG    . LEU A 1  136 ? 21.074  8.724   -12.747 1.00 16.26 ? 262 LEU A CG    1 
ATOM   991  C  CD1   . LEU A 1  136 ? 20.449  8.782   -11.338 1.00 22.90 ? 262 LEU A CD1   1 
ATOM   992  C  CD2   . LEU A 1  136 ? 20.019  8.454   -13.774 1.00 14.08 ? 262 LEU A CD2   1 
ATOM   993  N  N     . ASP A 1  137 ? 24.018  11.868  -14.507 1.00 21.07 ? 263 ASP A N     1 
ATOM   994  C  CA    . ASP A 1  137 ? 24.612  13.186  -14.766 1.00 24.35 ? 263 ASP A CA    1 
ATOM   995  C  C     . ASP A 1  137 ? 24.597  13.580  -16.247 1.00 19.21 ? 263 ASP A C     1 
ATOM   996  O  O     . ASP A 1  137 ? 24.512  14.771  -16.580 1.00 27.52 ? 263 ASP A O     1 
ATOM   997  C  CB    . ASP A 1  137 ? 26.004  13.315  -14.121 1.00 23.56 ? 263 ASP A CB    1 
ATOM   998  C  CG    . ASP A 1  137 ? 25.929  13.406  -12.587 1.00 34.04 ? 263 ASP A CG    1 
ATOM   999  O  OD1   . ASP A 1  137 ? 24.881  13.877  -12.047 1.00 33.28 ? 263 ASP A OD1   1 
ATOM   1000 O  OD2   . ASP A 1  137 ? 26.904  12.993  -11.915 1.00 37.67 ? 263 ASP A OD2   1 
ATOM   1001 N  N     . ASP A 1  138 ? 24.648  12.605  -17.148 1.00 20.17 ? 264 ASP A N     1 
ATOM   1002 C  CA    . ASP A 1  138 ? 24.439  12.929  -18.553 1.00 17.27 ? 264 ASP A CA    1 
ATOM   1003 C  C     . ASP A 1  138 ? 23.088  13.598  -18.751 1.00 26.16 ? 264 ASP A C     1 
ATOM   1004 O  O     . ASP A 1  138 ? 22.938  14.536  -19.537 1.00 21.93 ? 264 ASP A O     1 
ATOM   1005 C  CB    . ASP A 1  138 ? 24.538  11.690  -19.437 1.00 18.66 ? 264 ASP A CB    1 
ATOM   1006 C  CG    . ASP A 1  138 ? 25.937  11.071  -19.435 1.00 28.59 ? 264 ASP A CG    1 
ATOM   1007 O  OD1   . ASP A 1  138 ? 26.914  11.777  -19.107 1.00 26.26 ? 264 ASP A OD1   1 
ATOM   1008 O  OD2   . ASP A 1  138 ? 26.063  9.880   -19.790 1.00 24.56 ? 264 ASP A OD2   1 
ATOM   1009 N  N     . LEU A 1  139 ? 22.097  13.118  -18.016 1.00 19.30 ? 265 LEU A N     1 
ATOM   1010 C  CA    . LEU A 1  139 ? 20.756  13.640  -18.168 1.00 23.12 ? 265 LEU A CA    1 
ATOM   1011 C  C     . LEU A 1  139 ? 20.641  15.008  -17.507 1.00 20.97 ? 265 LEU A C     1 
ATOM   1012 O  O     . LEU A 1  139 ? 19.981  15.909  -18.032 1.00 29.85 ? 265 LEU A O     1 
ATOM   1013 C  CB    . LEU A 1  139 ? 19.719  12.657  -17.590 1.00 17.57 ? 265 LEU A CB    1 
ATOM   1014 C  CG    . LEU A 1  139 ? 19.718  11.262  -18.192 1.00 16.22 ? 265 LEU A CG    1 
ATOM   1015 C  CD1   . LEU A 1  139 ? 18.790  10.370  -17.362 1.00 15.01 ? 265 LEU A CD1   1 
ATOM   1016 C  CD2   . LEU A 1  139 ? 19.214  11.323  -19.612 1.00 14.95 ? 265 LEU A CD2   1 
ATOM   1017 N  N     . ARG A 1  140 ? 21.282  15.154  -16.357 1.00 20.39 ? 266 ARG A N     1 
ATOM   1018 C  CA    . ARG A 1  140 ? 21.221  16.401  -15.620 1.00 24.50 ? 266 ARG A CA    1 
ATOM   1019 C  C     . ARG A 1  140 ? 21.844  17.552  -16.423 1.00 35.34 ? 266 ARG A C     1 
ATOM   1020 O  O     . ARG A 1  140 ? 21.320  18.665  -16.435 1.00 40.81 ? 266 ARG A O     1 
ATOM   1021 C  CB    . ARG A 1  140 ? 21.890  16.228  -14.266 1.00 27.82 ? 266 ARG A CB    1 
ATOM   1022 C  CG    . ARG A 1  140 ? 21.239  15.106  -13.441 1.00 24.83 ? 266 ARG A CG    1 
ATOM   1023 C  CD    . ARG A 1  140 ? 21.666  15.164  -12.013 1.00 27.90 ? 266 ARG A CD    1 
ATOM   1024 N  NE    . ARG A 1  140 ? 20.703  14.511  -11.128 1.00 35.10 ? 266 ARG A NE    1 
ATOM   1025 C  CZ    . ARG A 1  140 ? 20.993  13.462  -10.371 1.00 32.32 ? 266 ARG A CZ    1 
ATOM   1026 N  NH1   . ARG A 1  140 ? 22.215  12.955  -10.411 1.00 19.75 ? 266 ARG A NH1   1 
ATOM   1027 N  NH2   . ARG A 1  140 ? 20.073  12.924  -9.575  1.00 22.14 ? 266 ARG A NH2   1 
ATOM   1028 N  N     . GLU A 1  141 ? 22.933  17.255  -17.126 1.00 33.51 ? 267 GLU A N     1 
ATOM   1029 C  CA    . GLU A 1  141 ? 23.647  18.229  -17.960 1.00 37.94 ? 267 GLU A CA    1 
ATOM   1030 C  C     . GLU A 1  141 ? 23.005  18.443  -19.342 1.00 46.43 ? 267 GLU A C     1 
ATOM   1031 O  O     . GLU A 1  141 ? 23.711  18.581  -20.340 1.00 44.94 ? 267 GLU A O     1 
ATOM   1032 C  CB    . GLU A 1  141 ? 25.111  17.789  -18.122 1.00 34.61 ? 267 GLU A CB    1 
ATOM   1033 N  N     . GLN A 1  142 ? 21.673  18.450  -19.390 1.00 43.90 ? 268 GLN A N     1 
ATOM   1034 C  CA    . GLN A 1  142 ? 20.910  18.757  -20.608 1.00 50.73 ? 268 GLN A CA    1 
ATOM   1035 C  C     . GLN A 1  142 ? 19.410  18.822  -20.287 1.00 50.53 ? 268 GLN A C     1 
ATOM   1036 O  O     . GLN A 1  142 ? 18.595  18.173  -20.948 1.00 50.34 ? 268 GLN A O     1 
ATOM   1037 C  CB    . GLN A 1  142 ? 21.160  17.709  -21.700 1.00 40.59 ? 268 GLN A CB    1 
ATOM   1038 N  N     . PRO A 1  143 ? 19.036  19.624  -19.281 1.00 43.06 ? 269 PRO A N     1 
ATOM   1039 C  CA    . PRO A 1  143 ? 17.709  19.475  -18.690 1.00 37.25 ? 269 PRO A CA    1 
ATOM   1040 C  C     . PRO A 1  143 ? 16.624  20.068  -19.555 1.00 47.01 ? 269 PRO A C     1 
ATOM   1041 O  O     . PRO A 1  143 ? 15.457  19.983  -19.180 1.00 45.57 ? 269 PRO A O     1 
ATOM   1042 C  CB    . PRO A 1  143 ? 17.828  20.257  -17.386 1.00 39.85 ? 269 PRO A CB    1 
ATOM   1043 C  CG    . PRO A 1  143 ? 18.777  21.340  -17.713 1.00 47.95 ? 269 PRO A CG    1 
ATOM   1044 C  CD    . PRO A 1  143 ? 19.761  20.768  -18.703 1.00 45.94 ? 269 PRO A CD    1 
ATOM   1045 N  N     . GLN A 1  144 ? 17.000  20.660  -20.683 1.00 49.28 ? 270 GLN A N     1 
ATOM   1046 C  CA    . GLN A 1  144 ? 16.020  21.189  -21.621 1.00 51.92 ? 270 GLN A CA    1 
ATOM   1047 C  C     . GLN A 1  144 ? 15.321  20.022  -22.312 1.00 46.52 ? 270 GLN A C     1 
ATOM   1048 O  O     . GLN A 1  144 ? 14.178  20.136  -22.756 1.00 55.17 ? 270 GLN A O     1 
ATOM   1049 C  CB    . GLN A 1  144 ? 16.692  22.108  -22.651 1.00 51.28 ? 270 GLN A CB    1 
ATOM   1050 N  N     . LYS A 1  145 ? 16.010  18.892  -22.391 1.00 39.06 ? 271 LYS A N     1 
ATOM   1051 C  CA    . LYS A 1  145 ? 15.437  17.702  -22.998 1.00 39.01 ? 271 LYS A CA    1 
ATOM   1052 C  C     . LYS A 1  145 ? 14.489  16.916  -22.066 1.00 31.13 ? 271 LYS A C     1 
ATOM   1053 O  O     . LYS A 1  145 ? 13.941  15.899  -22.469 1.00 35.26 ? 271 LYS A O     1 
ATOM   1054 C  CB    . LYS A 1  145 ? 16.559  16.786  -23.478 1.00 43.91 ? 271 LYS A CB    1 
ATOM   1055 N  N     . LEU A 1  146 ? 14.309  17.366  -20.828 1.00 22.38 ? 272 LEU A N     1 
ATOM   1056 C  CA    . LEU A 1  146 ? 13.541  16.582  -19.847 1.00 24.27 ? 272 LEU A CA    1 
ATOM   1057 C  C     . LEU A 1  146 ? 12.147  17.135  -19.663 1.00 22.77 ? 272 LEU A C     1 
ATOM   1058 O  O     . LEU A 1  146 ? 11.971  18.343  -19.635 1.00 23.80 ? 272 LEU A O     1 
ATOM   1059 C  CB    . LEU A 1  146 ? 14.229  16.612  -18.477 1.00 20.90 ? 272 LEU A CB    1 
ATOM   1060 C  CG    . LEU A 1  146 ? 15.640  16.072  -18.435 1.00 21.35 ? 272 LEU A CG    1 
ATOM   1061 C  CD1   . LEU A 1  146 ? 16.214  16.169  -17.018 1.00 21.48 ? 272 LEU A CD1   1 
ATOM   1062 C  CD2   . LEU A 1  146 ? 15.595  14.652  -18.907 1.00 19.47 ? 272 LEU A CD2   1 
ATOM   1063 N  N     . THR A 1  147 ? 11.154  16.268  -19.478 1.00 15.74 ? 273 THR A N     1 
ATOM   1064 C  CA    . THR A 1  147 ? 9.831   16.760  -19.125 1.00 14.80 ? 273 THR A CA    1 
ATOM   1065 C  C     . THR A 1  147 ? 9.865   17.193  -17.650 1.00 18.82 ? 273 THR A C     1 
ATOM   1066 O  O     . THR A 1  147 ? 10.835  16.916  -16.947 1.00 16.20 ? 273 THR A O     1 
ATOM   1067 C  CB    . THR A 1  147 ? 8.795   15.685  -19.275 1.00 16.17 ? 273 THR A CB    1 
ATOM   1068 O  OG1   . THR A 1  147 ? 9.057   14.663  -18.301 1.00 13.63 ? 273 THR A OG1   1 
ATOM   1069 C  CG2   . THR A 1  147 ? 8.852   15.079  -20.659 1.00 16.92 ? 273 THR A CG2   1 
ATOM   1070 N  N     . GLN A 1  148 ? 8.830   17.884  -17.181 1.00 17.69 ? 274 GLN A N     1 
ATOM   1071 C  CA    . GLN A 1  148 ? 8.806   18.311  -15.782 1.00 16.33 ? 274 GLN A CA    1 
ATOM   1072 C  C     . GLN A 1  148 ? 8.702   17.083  -14.872 1.00 14.35 ? 274 GLN A C     1 
ATOM   1073 O  O     . GLN A 1  148 ? 9.278   17.050  -13.774 1.00 14.43 ? 274 GLN A O     1 
ATOM   1074 C  CB    . GLN A 1  148 ? 7.668   19.321  -15.527 1.00 23.57 ? 274 GLN A CB    1 
ATOM   1075 C  CG    . GLN A 1  148 ? 8.046   20.773  -15.904 1.00 33.19 ? 274 GLN A CG    1 
ATOM   1076 N  N     . GLN A 1  149 ? 7.988   16.067  -15.341 1.00 11.33 ? 275 GLN A N     1 
ATOM   1077 C  CA    . GLN A 1  149 ? 7.880   14.802  -14.597 1.00 17.15 ? 275 GLN A CA    1 
ATOM   1078 C  C     . GLN A 1  149 ? 9.259   14.141  -14.481 1.00 17.79 ? 275 GLN A C     1 
ATOM   1079 O  O     . GLN A 1  149 ? 9.656   13.647  -13.420 1.00 17.90 ? 275 GLN A O     1 
ATOM   1080 C  CB    . GLN A 1  149 ? 6.910   13.863  -15.295 1.00 14.80 ? 275 GLN A CB    1 
ATOM   1081 C  CG    . GLN A 1  149 ? 6.679   12.540  -14.572 1.00 15.09 ? 275 GLN A CG    1 
ATOM   1082 C  CD    . GLN A 1  149 ? 5.727   11.614  -15.343 1.00 17.72 ? 275 GLN A CD    1 
ATOM   1083 O  OE1   . GLN A 1  149 ? 5.937   11.316  -16.518 1.00 23.28 ? 275 GLN A OE1   1 
ATOM   1084 N  NE2   . GLN A 1  149 ? 4.663   11.216  -14.707 1.00 14.34 ? 275 GLN A NE2   1 
ATOM   1085 N  N     . GLN A 1  150 ? 9.991   14.143  -15.581 1.00 12.44 ? 276 GLN A N     1 
ATOM   1086 C  CA    . GLN A 1  150 ? 11.327  13.579  -15.579 1.00 9.75  ? 276 GLN A CA    1 
ATOM   1087 C  C     . GLN A 1  150 ? 12.259  14.389  -14.718 1.00 11.33 ? 276 GLN A C     1 
ATOM   1088 O  O     . GLN A 1  150 ? 13.085  13.818  -14.012 1.00 11.43 ? 276 GLN A O     1 
ATOM   1089 C  CB    . GLN A 1  150 ? 11.849  13.453  -17.004 1.00 12.61 ? 276 GLN A CB    1 
ATOM   1090 C  CG    . GLN A 1  150 ? 11.134  12.354  -17.770 1.00 8.06  ? 276 GLN A CG    1 
ATOM   1091 C  CD    . GLN A 1  150 ? 11.318  12.482  -19.265 1.00 16.00 ? 276 GLN A CD    1 
ATOM   1092 O  OE1   . GLN A 1  150 ? 11.891  13.458  -19.750 1.00 13.32 ? 276 GLN A OE1   1 
ATOM   1093 N  NE2   . GLN A 1  150 ? 10.817  11.525  -19.999 1.00 10.20 ? 276 GLN A NE2   1 
ATOM   1094 N  N     . LYS A 1  151 ? 12.127  15.712  -14.718 1.00 10.52 ? 277 LYS A N     1 
ATOM   1095 C  CA    . LYS A 1  151 ? 12.986  16.497  -13.838 1.00 14.47 ? 277 LYS A CA    1 
ATOM   1096 C  C     . LYS A 1  151 ? 12.758  16.144  -12.372 1.00 9.48  ? 277 LYS A C     1 
ATOM   1097 O  O     . LYS A 1  151 ? 13.700  16.119  -11.579 1.00 11.82 ? 277 LYS A O     1 
ATOM   1098 C  CB    . LYS A 1  151 ? 12.767  18.007  -14.020 1.00 17.09 ? 277 LYS A CB    1 
ATOM   1099 C  CG    . LYS A 1  151 ? 13.202  18.541  -15.377 1.00 26.77 ? 277 LYS A CG    1 
ATOM   1100 C  CD    . LYS A 1  151 ? 12.809  20.027  -15.539 1.00 29.18 ? 277 LYS A CD    1 
ATOM   1101 C  CE    . LYS A 1  151 ? 13.269  20.596  -16.885 1.00 32.39 ? 277 LYS A CE    1 
ATOM   1102 N  NZ    . LYS A 1  151 ? 12.581  21.875  -17.197 1.00 37.32 ? 277 LYS A NZ    1 
ATOM   1103 N  N     . ALA A 1  152 ? 11.492  15.945  -12.011 1.00 13.83 ? 278 ALA A N     1 
ATOM   1104 C  CA    . ALA A 1  152 ? 11.127  15.542  -10.652 1.00 9.19  ? 278 ALA A CA    1 
ATOM   1105 C  C     . ALA A 1  152 ? 11.733  14.193  -10.301 1.00 10.67 ? 278 ALA A C     1 
ATOM   1106 O  O     . ALA A 1  152 ? 12.345  14.012  -9.229  1.00 9.81  ? 278 ALA A O     1 
ATOM   1107 C  CB    . ALA A 1  152 ? 9.605   15.466  -10.536 1.00 14.40 ? 278 ALA A CB    1 
ATOM   1108 N  N     . GLY A 1  153 ? 11.562  13.248  -11.213 1.00 8.40  ? 279 GLY A N     1 
ATOM   1109 C  CA    . GLY A 1  153 ? 12.072  11.902  -11.040 1.00 8.38  ? 279 GLY A CA    1 
ATOM   1110 C  C     . GLY A 1  153 ? 13.586  11.910  -10.893 1.00 12.42 ? 279 GLY A C     1 
ATOM   1111 O  O     . GLY A 1  153 ? 14.142  11.186  -10.077 1.00 9.47  ? 279 GLY A O     1 
ATOM   1112 N  N     . LEU A 1  154 ? 14.255  12.767  -11.656 1.00 8.43  ? 280 LEU A N     1 
ATOM   1113 C  CA    . LEU A 1  154 ? 15.704  12.846  -11.558 1.00 8.90  ? 280 LEU A CA    1 
ATOM   1114 C  C     . LEU A 1  154 ? 16.200  13.525  -10.271 1.00 7.17  ? 280 LEU A C     1 
ATOM   1115 O  O     . LEU A 1  154 ? 17.133  13.028  -9.633  1.00 10.89 ? 280 LEU A O     1 
ATOM   1116 C  CB    . LEU A 1  154 ? 16.247  13.529  -12.820 1.00 12.54 ? 280 LEU A CB    1 
ATOM   1117 C  CG    . LEU A 1  154 ? 17.701  13.347  -13.266 1.00 28.22 ? 280 LEU A CG    1 
ATOM   1118 C  CD1   . LEU A 1  154 ? 18.081  11.858  -13.409 1.00 21.64 ? 280 LEU A CD1   1 
ATOM   1119 C  CD2   . LEU A 1  154 ? 17.919  14.086  -14.602 1.00 27.19 ? 280 LEU A CD2   1 
ATOM   1120 N  N     . GLN A 1  155 ? 15.567  14.627  -9.874  1.00 10.57 ? 281 GLN A N     1 
ATOM   1121 C  CA    . GLN A 1  155 ? 15.925  15.295  -8.613  1.00 10.33 ? 281 GLN A CA    1 
ATOM   1122 C  C     . GLN A 1  155 ? 15.759  14.363  -7.443  1.00 10.37 ? 281 GLN A C     1 
ATOM   1123 O  O     . GLN A 1  155 ? 16.609  14.312  -6.543  1.00 9.92  ? 281 GLN A O     1 
ATOM   1124 C  CB    . GLN A 1  155 ? 15.053  16.528  -8.357  1.00 11.72 ? 281 GLN A CB    1 
ATOM   1125 C  CG    . GLN A 1  155 ? 15.542  17.814  -9.048  1.00 16.03 ? 281 GLN A CG    1 
ATOM   1126 C  CD    . GLN A 1  155 ? 14.382  18.756  -9.405  1.00 28.20 ? 281 GLN A CD    1 
ATOM   1127 O  OE1   . GLN A 1  155 ? 13.201  18.363  -9.394  1.00 23.43 ? 281 GLN A OE1   1 
ATOM   1128 N  NE2   . GLN A 1  155 ? 14.715  20.003  -9.723  1.00 31.25 ? 281 GLN A NE2   1 
ATOM   1129 N  N     . HIS A 1  156 ? 14.659  13.608  -7.452  1.00 5.59  ? 282 HIS A N     1 
ATOM   1130 C  CA    . HIS A 1  156 ? 14.315  12.778  -6.306  1.00 5.73  ? 282 HIS A CA    1 
ATOM   1131 C  C     . HIS A 1  156 ? 14.831  11.346  -6.409  1.00 9.58  ? 282 HIS A C     1 
ATOM   1132 O  O     . HIS A 1  156 ? 14.542  10.508  -5.551  1.00 8.83  ? 282 HIS A O     1 
ATOM   1133 C  CB    . HIS A 1  156 ? 12.773  12.790  -6.106  1.00 3.34  ? 282 HIS A CB    1 
ATOM   1134 C  CG    . HIS A 1  156 ? 12.270  14.126  -5.649  1.00 6.68  ? 282 HIS A CG    1 
ATOM   1135 N  ND1   . HIS A 1  156 ? 12.668  14.686  -4.458  1.00 8.88  ? 282 HIS A ND1   1 
ATOM   1136 C  CD2   . HIS A 1  156 ? 11.478  15.041  -6.256  1.00 5.52  ? 282 HIS A CD2   1 
ATOM   1137 C  CE1   . HIS A 1  156 ? 12.082  15.859  -4.313  1.00 11.60 ? 282 HIS A CE1   1 
ATOM   1138 N  NE2   . HIS A 1  156 ? 11.353  16.097  -5.390  1.00 6.45  ? 282 HIS A NE2   1 
ATOM   1139 N  N     . HIS A 1  157 ? 15.599  11.075  -7.452  1.00 10.49 ? 283 HIS A N     1 
ATOM   1140 C  CA    . HIS A 1  157 ? 15.942  9.695   -7.784  1.00 10.25 ? 283 HIS A CA    1 
ATOM   1141 C  C     . HIS A 1  157 ? 16.610  8.964   -6.631  1.00 8.75  ? 283 HIS A C     1 
ATOM   1142 O  O     . HIS A 1  157 ? 16.320  7.807   -6.401  1.00 6.99  ? 283 HIS A O     1 
ATOM   1143 C  CB    . HIS A 1  157 ? 16.851  9.646   -9.017  1.00 8.04  ? 283 HIS A CB    1 
ATOM   1144 C  CG    . HIS A 1  157 ? 17.204  8.254   -9.441  1.00 13.34 ? 283 HIS A CG    1 
ATOM   1145 N  ND1   . HIS A 1  157 ? 18.347  7.616   -9.007  1.00 12.64 ? 283 HIS A ND1   1 
ATOM   1146 C  CD2   . HIS A 1  157 ? 16.580  7.391   -10.277 1.00 18.37 ? 283 HIS A CD2   1 
ATOM   1147 C  CE1   . HIS A 1  157 ? 18.396  6.406   -9.538  1.00 16.04 ? 283 HIS A CE1   1 
ATOM   1148 N  NE2   . HIS A 1  157 ? 17.346  6.251   -10.326 1.00 16.25 ? 283 HIS A NE2   1 
ATOM   1149 N  N     . GLN A 1  158 ? 17.496  9.643   -5.889  1.00 8.99  ? 284 GLN A N     1 
ATOM   1150 C  CA    . GLN A 1  158 ? 18.224  8.937   -4.857  1.00 8.98  ? 284 GLN A CA    1 
ATOM   1151 C  C     . GLN A 1  158 ? 17.290  8.464   -3.729  1.00 7.32  ? 284 GLN A C     1 
ATOM   1152 O  O     . GLN A 1  158 ? 17.343  7.297   -3.302  1.00 8.38  ? 284 GLN A O     1 
ATOM   1153 C  CB    . GLN A 1  158 ? 19.356  9.799   -4.304  1.00 11.49 ? 284 GLN A CB    1 
ATOM   1154 C  CG    . GLN A 1  158 ? 20.089  9.162   -3.156  1.00 13.60 ? 284 GLN A CG    1 
ATOM   1155 C  CD    . GLN A 1  158 ? 21.379  9.924   -2.791  1.00 28.65 ? 284 GLN A CD    1 
ATOM   1156 O  OE1   . GLN A 1  158 ? 21.546  11.098  -3.136  1.00 24.36 ? 284 GLN A OE1   1 
ATOM   1157 N  NE2   . GLN A 1  158 ? 22.293  9.249   -2.097  1.00 38.71 ? 284 GLN A NE2   1 
ATOM   1158 N  N     . ASP A 1  159 ? 16.426  9.367   -3.273  1.00 5.78  ? 285 ASP A N     1 
ATOM   1159 C  CA    . ASP A 1  159 ? 15.466  9.035   -2.216  1.00 7.71  ? 285 ASP A CA    1 
ATOM   1160 C  C     . ASP A 1  159 ? 14.517  7.944   -2.724  1.00 7.94  ? 285 ASP A C     1 
ATOM   1161 O  O     . ASP A 1  159 ? 14.123  7.053   -1.972  1.00 6.34  ? 285 ASP A O     1 
ATOM   1162 C  CB    . ASP A 1  159 ? 14.625  10.253  -1.820  1.00 6.93  ? 285 ASP A CB    1 
ATOM   1163 C  CG    . ASP A 1  159 ? 15.305  11.134  -0.769  1.00 8.37  ? 285 ASP A CG    1 
ATOM   1164 O  OD1   . ASP A 1  159 ? 16.451  10.836  -0.358  1.00 9.34  ? 285 ASP A OD1   1 
ATOM   1165 O  OD2   . ASP A 1  159 ? 14.680  12.098  -0.280  1.00 10.99 ? 285 ASP A OD2   1 
ATOM   1166 N  N     . LEU A 1  160 ? 14.128  8.045   -3.985  1.00 6.07  ? 286 LEU A N     1 
ATOM   1167 C  CA    . LEU A 1  160 ? 13.159  7.100   -4.526  1.00 6.81  ? 286 LEU A CA    1 
ATOM   1168 C  C     . LEU A 1  160 ? 13.754  5.705   -4.705  1.00 11.31 ? 286 LEU A C     1 
ATOM   1169 O  O     . LEU A 1  160 ? 13.012  4.750   -4.893  1.00 9.87  ? 286 LEU A O     1 
ATOM   1170 C  CB    . LEU A 1  160 ? 12.546  7.594   -5.841  1.00 7.08  ? 286 LEU A CB    1 
ATOM   1171 C  CG    . LEU A 1  160 ? 11.750  8.914   -5.800  1.00 7.50  ? 286 LEU A CG    1 
ATOM   1172 C  CD1   . LEU A 1  160 ? 11.004  9.107   -7.105  1.00 7.09  ? 286 LEU A CD1   1 
ATOM   1173 C  CD2   . LEU A 1  160 ? 10.811  8.965   -4.621  1.00 8.75  ? 286 LEU A CD2   1 
ATOM   1174 N  N     . SER A 1  161 ? 15.083  5.597   -4.648  1.00 7.81  ? 287 SER A N     1 
ATOM   1175 C  CA    A SER A 1  161 ? 15.751  4.308   -4.769  0.50 10.57 ? 287 SER A CA    1 
ATOM   1176 C  CA    B SER A 1  161 ? 15.795  4.327   -4.768  0.50 10.59 ? 287 SER A CA    1 
ATOM   1177 C  C     . SER A 1  161 ? 15.933  3.624   -3.431  1.00 10.43 ? 287 SER A C     1 
ATOM   1178 O  O     . SER A 1  161 ? 16.351  2.456   -3.366  1.00 13.04 ? 287 SER A O     1 
ATOM   1179 C  CB    A SER A 1  161 ? 17.120  4.483   -5.445  0.50 11.51 ? 287 SER A CB    1 
ATOM   1180 C  CB    B SER A 1  161 ? 17.215  4.561   -5.326  0.50 11.43 ? 287 SER A CB    1 
ATOM   1181 O  OG    A SER A 1  161 ? 16.942  5.054   -6.720  0.50 12.94 ? 287 SER A OG    1 
ATOM   1182 O  OG    B SER A 1  161 ? 18.095  4.956   -4.286  0.50 9.79  ? 287 SER A OG    1 
ATOM   1183 N  N     . THR A 1  162 ? 15.627  4.334   -2.358  1.00 10.76 ? 288 THR A N     1 
ATOM   1184 C  CA    . THR A 1  162 ? 15.746  3.794   -1.012  1.00 10.93 ? 288 THR A CA    1 
ATOM   1185 C  C     . THR A 1  162 ? 14.424  3.088   -0.653  1.00 14.27 ? 288 THR A C     1 
ATOM   1186 O  O     . THR A 1  162 ? 13.359  3.679   -0.775  1.00 12.37 ? 288 THR A O     1 
ATOM   1187 C  CB    . THR A 1  162 ? 15.910  4.970   -0.014  1.00 12.25 ? 288 THR A CB    1 
ATOM   1188 O  OG1   . THR A 1  162 ? 17.032  5.759   -0.405  1.00 26.01 ? 288 THR A OG1   1 
ATOM   1189 C  CG2   . THR A 1  162 ? 16.096  4.485   1.420   1.00 19.60 ? 288 THR A CG2   1 
ATOM   1190 N  N     . PRO A 1  163 ? 14.494  1.852   -0.154  1.00 15.87 ? 289 PRO A N     1 
ATOM   1191 C  CA    . PRO A 1  163 ? 13.253  1.143   0.177   1.00 20.22 ? 289 PRO A CA    1 
ATOM   1192 C  C     . PRO A 1  163 ? 12.408  1.896   1.196   1.00 10.19 ? 289 PRO A C     1 
ATOM   1193 O  O     . PRO A 1  163 ? 12.913  2.430   2.178   1.00 11.69 ? 289 PRO A O     1 
ATOM   1194 C  CB    . PRO A 1  163 ? 13.758  -0.157  0.824   1.00 18.97 ? 289 PRO A CB    1 
ATOM   1195 C  CG    . PRO A 1  163 ? 15.168  -0.300  0.374   1.00 23.86 ? 289 PRO A CG    1 
ATOM   1196 C  CD    . PRO A 1  163 ? 15.699  1.075   0.194   1.00 18.36 ? 289 PRO A CD    1 
ATOM   1197 N  N     . VAL A 1  164 ? 11.108  1.920   0.955   1.00 12.66 ? 290 VAL A N     1 
ATOM   1198 C  CA    . VAL A 1  164 ? 10.129  2.362   1.916   1.00 12.81 ? 290 VAL A CA    1 
ATOM   1199 C  C     . VAL A 1  164 ? 9.810   1.224   2.880   1.00 12.33 ? 290 VAL A C     1 
ATOM   1200 O  O     . VAL A 1  164 ? 9.606   0.095   2.426   1.00 9.97  ? 290 VAL A O     1 
ATOM   1201 C  CB    . VAL A 1  164 ? 8.776   2.626   1.185   1.00 15.45 ? 290 VAL A CB    1 
ATOM   1202 C  CG1   . VAL A 1  164 ? 7.813   3.238   2.139   1.00 11.41 ? 290 VAL A CG1   1 
ATOM   1203 C  CG2   . VAL A 1  164 ? 8.979   3.498   -0.048  1.00 15.78 ? 290 VAL A CG2   1 
ATOM   1204 N  N     . LEU A 1  165 ? 9.722   1.511   4.187   1.00 11.56 ? 291 LEU A N     1 
ATOM   1205 C  CA    . LEU A 1  165 ? 9.429   0.472   5.190   1.00 14.22 ? 291 LEU A CA    1 
ATOM   1206 C  C     . LEU A 1  165 ? 7.984   0.486   5.667   1.00 12.81 ? 291 LEU A C     1 
ATOM   1207 O  O     . LEU A 1  165 ? 7.311   1.491   5.591   1.00 10.55 ? 291 LEU A O     1 
ATOM   1208 C  CB    . LEU A 1  165 ? 10.313  0.656   6.428   1.00 14.37 ? 291 LEU A CB    1 
ATOM   1209 C  CG    . LEU A 1  165 ? 11.820  0.815   6.137   1.00 18.99 ? 291 LEU A CG    1 
ATOM   1210 C  CD1   . LEU A 1  165 ? 12.575  0.813   7.464   1.00 26.55 ? 291 LEU A CD1   1 
ATOM   1211 C  CD2   . LEU A 1  165 ? 12.368  -0.271  5.216   1.00 16.71 ? 291 LEU A CD2   1 
ATOM   1212 N  N     . ARG A 1  166 ? 7.536   -0.628  6.248   1.00 14.01 ? 292 ARG A N     1 
ATOM   1213 C  CA    . ARG A 1  166 ? 6.163   -0.711  6.736   1.00 14.71 ? 292 ARG A CA    1 
ATOM   1214 C  C     . ARG A 1  166 ? 5.881   0.394   7.787   1.00 20.38 ? 292 ARG A C     1 
ATOM   1215 O  O     . ARG A 1  166 ? 4.812   1.004   7.784   1.00 20.41 ? 292 ARG A O     1 
ATOM   1216 C  CB    . ARG A 1  166 ? 5.839   -2.177  7.160   1.00 17.52 ? 292 ARG A CB    1 
ATOM   1217 C  CG    . ARG A 1  166 ? 4.363   -2.479  7.547   1.00 24.02 ? 292 ARG A CG    1 
ATOM   1218 C  CD    . ARG A 1  166 ? 3.364   -1.868  6.569   1.00 33.11 ? 292 ARG A CD    1 
ATOM   1219 N  NE    . ARG A 1  166 ? 2.010   -1.714  7.118   1.00 29.95 ? 292 ARG A NE    1 
ATOM   1220 C  CZ    . ARG A 1  166 ? 1.012   -2.539  6.830   1.00 38.58 ? 292 ARG A CZ    1 
ATOM   1221 N  NH1   . ARG A 1  166 ? 1.237   -3.575  6.014   1.00 30.24 ? 292 ARG A NH1   1 
ATOM   1222 N  NH2   . ARG A 1  166 ? -0.199  -2.336  7.353   1.00 39.56 ? 292 ARG A NH2   1 
ATOM   1223 N  N     . SER A 1  167 ? 6.875   0.750   8.606   1.00 20.29 ? 293 SER A N     1 
ATOM   1224 C  CA    . SER A 1  167 ? 6.710   1.886   9.526   1.00 20.70 ? 293 SER A CA    1 
ATOM   1225 C  C     . SER A 1  167 ? 6.425   3.174   8.789   1.00 18.95 ? 293 SER A C     1 
ATOM   1226 O  O     . SER A 1  167 ? 5.620   3.997   9.232   1.00 26.81 ? 293 SER A O     1 
ATOM   1227 C  CB    . SER A 1  167 ? 7.948   2.079   10.401  1.00 31.32 ? 293 SER A CB    1 
ATOM   1228 O  OG    . SER A 1  167 ? 9.081   2.453   9.625   1.00 33.96 ? 293 SER A OG    1 
ATOM   1229 N  N     . ASP A 1  168 ? 7.082   3.367   7.649   1.00 16.22 ? 294 ASP A N     1 
ATOM   1230 C  CA    . ASP A 1  168 ? 6.826   4.558   6.879   1.00 14.51 ? 294 ASP A CA    1 
ATOM   1231 C  C     . ASP A 1  168 ? 5.382   4.564   6.403   1.00 17.83 ? 294 ASP A C     1 
ATOM   1232 O  O     . ASP A 1  168 ? 4.725   5.618   6.354   1.00 18.27 ? 294 ASP A O     1 
ATOM   1233 C  CB    . ASP A 1  168 ? 7.730   4.590   5.652   1.00 18.52 ? 294 ASP A CB    1 
ATOM   1234 C  CG    . ASP A 1  168 ? 9.207   4.711   6.019   1.00 26.71 ? 294 ASP A CG    1 
ATOM   1235 O  OD1   . ASP A 1  168 ? 9.515   5.226   7.120   1.00 24.25 ? 294 ASP A OD1   1 
ATOM   1236 O  OD2   . ASP A 1  168 ? 10.044  4.301   5.189   1.00 20.39 ? 294 ASP A OD2   1 
ATOM   1237 N  N     . VAL A 1  169 ? 4.891   3.375   6.052   1.00 16.06 ? 295 VAL A N     1 
ATOM   1238 C  CA    . VAL A 1  169 ? 3.573   3.256   5.420   1.00 13.38 ? 295 VAL A CA    1 
ATOM   1239 C  C     . VAL A 1  169 ? 2.488   3.673   6.419   1.00 9.81  ? 295 VAL A C     1 
ATOM   1240 O  O     . VAL A 1  169 ? 1.541   4.375   6.083   1.00 11.47 ? 295 VAL A O     1 
ATOM   1241 C  CB    . VAL A 1  169 ? 3.326   1.815   4.897   1.00 11.56 ? 295 VAL A CB    1 
ATOM   1242 C  CG1   . VAL A 1  169 ? 1.876   1.645   4.451   1.00 15.30 ? 295 VAL A CG1   1 
ATOM   1243 C  CG2   . VAL A 1  169 ? 4.283   1.479   3.727   1.00 10.80 ? 295 VAL A CG2   1 
ATOM   1244 N  N     . ASP A 1  170 ? 2.624   3.238   7.663   1.00 13.37 ? 296 ASP A N     1 
ATOM   1245 C  CA    . ASP A 1  170 ? 1.645   3.617   8.683   1.00 14.55 ? 296 ASP A CA    1 
ATOM   1246 C  C     . ASP A 1  170 ? 1.603   5.126   8.874   1.00 16.06 ? 296 ASP A C     1 
ATOM   1247 O  O     . ASP A 1  170 ? 0.528   5.723   9.008   1.00 16.25 ? 296 ASP A O     1 
ATOM   1248 C  CB    . ASP A 1  170 ? 1.948   2.916   9.999   1.00 28.95 ? 296 ASP A CB    1 
ATOM   1249 C  CG    . ASP A 1  170 ? 1.994   1.399   9.852   1.00 36.71 ? 296 ASP A CG    1 
ATOM   1250 O  OD1   . ASP A 1  170 ? 1.202   0.842   9.045   1.00 39.26 ? 296 ASP A OD1   1 
ATOM   1251 O  OD2   . ASP A 1  170 ? 2.830   0.770   10.532  1.00 36.32 ? 296 ASP A OD2   1 
ATOM   1252 N  N     . ALA A 1  171 ? 2.770   5.762   8.829   1.00 19.54 ? 297 ALA A N     1 
ATOM   1253 C  CA    . ALA A 1  171 ? 2.831   7.224   8.923   1.00 17.55 ? 297 ALA A CA    1 
ATOM   1254 C  C     . ALA A 1  171 ? 2.093   7.933   7.784   1.00 12.49 ? 297 ALA A C     1 
ATOM   1255 O  O     . ALA A 1  171 ? 1.305   8.853   8.047   1.00 14.02 ? 297 ALA A O     1 
ATOM   1256 C  CB    . ALA A 1  171 ? 4.291   7.715   8.987   1.00 19.64 ? 297 ALA A CB    1 
ATOM   1257 N  N     . LEU A 1  172 ? 2.351   7.528   6.534   1.00 11.31 ? 298 LEU A N     1 
ATOM   1258 C  CA    . LEU A 1  172 ? 1.671   8.107   5.378   1.00 14.55 ? 298 LEU A CA    1 
ATOM   1259 C  C     . LEU A 1  172 ? 0.158   7.839   5.394   1.00 11.36 ? 298 LEU A C     1 
ATOM   1260 O  O     . LEU A 1  172 ? -0.616  8.670   4.937   1.00 13.11 ? 298 LEU A O     1 
ATOM   1261 C  CB    . LEU A 1  172 ? 2.230   7.559   4.057   1.00 10.53 ? 298 LEU A CB    1 
ATOM   1262 C  CG    . LEU A 1  172 ? 3.642   8.039   3.707   1.00 17.76 ? 298 LEU A CG    1 
ATOM   1263 C  CD1   . LEU A 1  172 ? 4.376   7.026   2.825   1.00 14.76 ? 298 LEU A CD1   1 
ATOM   1264 C  CD2   . LEU A 1  172 ? 3.631   9.457   3.079   1.00 16.74 ? 298 LEU A CD2   1 
ATOM   1265 N  N     . GLN A 1  173 ? -0.255  6.659   5.842   1.00 13.41 ? 299 GLN A N     1 
ATOM   1266 C  CA    . GLN A 1  173 ? -1.685  6.394   5.865   1.00 10.42 ? 299 GLN A CA    1 
ATOM   1267 C  C     . GLN A 1  173 ? -2.426  7.371   6.778   1.00 13.40 ? 299 GLN A C     1 
ATOM   1268 O  O     . GLN A 1  173 ? -3.494  7.905   6.422   1.00 13.00 ? 299 GLN A O     1 
ATOM   1269 C  CB    . GLN A 1  173 ? -2.006  4.957   6.243   1.00 11.88 ? 299 GLN A CB    1 
ATOM   1270 C  CG    . GLN A 1  173 ? -3.506  4.715   6.016   1.00 9.49  ? 299 GLN A CG    1 
ATOM   1271 C  CD    . GLN A 1  173 ? -3.855  3.250   5.863   1.00 18.09 ? 299 GLN A CD    1 
ATOM   1272 O  OE1   . GLN A 1  173 ? -2.983  2.400   5.804   1.00 11.42 ? 299 GLN A OE1   1 
ATOM   1273 N  NE2   . GLN A 1  173 ? -5.154  2.956   5.797   1.00 17.02 ? 299 GLN A NE2   1 
ATOM   1274 N  N     . GLN A 1  174 ? -1.838  7.677   7.934   1.00 13.52 ? 300 GLN A N     1 
ATOM   1275 C  CA    . GLN A 1  174 ? -2.554  8.585   8.843   1.00 13.04 ? 300 GLN A CA    1 
ATOM   1276 C  C     . GLN A 1  174 ? -2.708  9.945   8.215   1.00 11.42 ? 300 GLN A C     1 
ATOM   1277 O  O     . GLN A 1  174 ? -3.763  10.580  8.291   1.00 12.91 ? 300 GLN A O     1 
ATOM   1278 C  CB    . GLN A 1  174 ? -1.849  8.673   10.191  1.00 19.38 ? 300 GLN A CB    1 
ATOM   1279 C  CG    . GLN A 1  174 ? -1.896  7.352   10.942  1.00 26.78 ? 300 GLN A CG    1 
ATOM   1280 C  CD    . GLN A 1  174 ? -1.383  7.480   12.368  1.00 47.60 ? 300 GLN A CD    1 
ATOM   1281 O  OE1   . GLN A 1  174 ? -1.499  8.540   12.983  1.00 47.11 ? 300 GLN A OE1   1 
ATOM   1282 N  NE2   . GLN A 1  174 ? -0.800  6.403   12.893  1.00 50.14 ? 300 GLN A NE2   1 
ATOM   1283 N  N     . VAL A 1  175 ? -1.655  10.352  7.527   1.00 11.41 ? 301 VAL A N     1 
ATOM   1284 C  CA    . VAL A 1  175 ? -1.598  11.634  6.908   1.00 15.02 ? 301 VAL A CA    1 
ATOM   1285 C  C     . VAL A 1  175 ? -2.622  11.708  5.762   1.00 14.45 ? 301 VAL A C     1 
ATOM   1286 O  O     . VAL A 1  175 ? -3.365  12.699  5.632   1.00 16.26 ? 301 VAL A O     1 
ATOM   1287 C  CB    . VAL A 1  175 ? -0.145  11.839  6.438   1.00 20.88 ? 301 VAL A CB    1 
ATOM   1288 C  CG1   . VAL A 1  175 ? -0.075  12.535  5.122   1.00 18.90 ? 301 VAL A CG1   1 
ATOM   1289 C  CG2   . VAL A 1  175 ? 0.643   12.517  7.540   1.00 21.00 ? 301 VAL A CG2   1 
ATOM   1290 N  N     . VAL A 1  176 ? -2.693  10.652  4.956   1.00 9.95  ? 302 VAL A N     1 
ATOM   1291 C  CA    . VAL A 1  176 ? -3.689  10.592  3.877   1.00 8.74  ? 302 VAL A CA    1 
ATOM   1292 C  C     . VAL A 1  176 ? -5.137  10.556  4.428   1.00 9.83  ? 302 VAL A C     1 
ATOM   1293 O  O     . VAL A 1  176 ? -6.040  11.248  3.915   1.00 10.30 ? 302 VAL A O     1 
ATOM   1294 C  CB    . VAL A 1  176 ? -3.419  9.396   2.951   1.00 10.76 ? 302 VAL A CB    1 
ATOM   1295 C  CG1   . VAL A 1  176 ? -4.514  9.262   1.892   1.00 8.90  ? 302 VAL A CG1   1 
ATOM   1296 C  CG2   . VAL A 1  176 ? -2.042  9.553   2.281   1.00 10.44 ? 302 VAL A CG2   1 
ATOM   1297 N  N     . GLU A 1  177 ? -5.344  9.807   5.502   1.00 9.39  ? 303 GLU A N     1 
ATOM   1298 C  CA    . GLU A 1  177 ? -6.681  9.747   6.107   1.00 12.25 ? 303 GLU A CA    1 
ATOM   1299 C  C     . GLU A 1  177 ? -7.160  11.106  6.601   1.00 15.67 ? 303 GLU A C     1 
ATOM   1300 O  O     . GLU A 1  177 ? -8.339  11.458  6.471   1.00 10.85 ? 303 GLU A O     1 
ATOM   1301 C  CB    . GLU A 1  177 ? -6.716  8.707   7.213   1.00 11.14 ? 303 GLU A CB    1 
ATOM   1302 C  CG    . GLU A 1  177 ? -6.565  7.314   6.624   1.00 10.52 ? 303 GLU A CG    1 
ATOM   1303 C  CD    . GLU A 1  177 ? -6.439  6.252   7.659   1.00 18.88 ? 303 GLU A CD    1 
ATOM   1304 O  OE1   . GLU A 1  177 ? -6.130  6.590   8.808   1.00 18.90 ? 303 GLU A OE1   1 
ATOM   1305 O  OE2   . GLU A 1  177 ? -6.644  5.072   7.331   1.00 20.34 ? 303 GLU A OE2   1 
ATOM   1306 N  N     . GLU A 1  178 ? -6.233  11.890  7.141   1.00 14.09 ? 304 GLU A N     1 
ATOM   1307 C  CA    . GLU A 1  178 ? -6.586  13.210  7.664   1.00 15.77 ? 304 GLU A CA    1 
ATOM   1308 C  C     . GLU A 1  178 ? -7.075  14.090  6.534   1.00 14.69 ? 304 GLU A C     1 
ATOM   1309 O  O     . GLU A 1  178 ? -8.114  14.743  6.649   1.00 11.43 ? 304 GLU A O     1 
ATOM   1310 C  CB    . GLU A 1  178 ? -5.381  13.874  8.366   1.00 15.10 ? 304 GLU A CB    1 
ATOM   1311 C  CG    . GLU A 1  178 ? -5.638  15.339  8.739   1.00 22.58 ? 304 GLU A CG    1 
ATOM   1312 N  N     . ALA A 1  179 ? -6.339  14.099  5.423   1.00 10.99 ? 305 ALA A N     1 
ATOM   1313 C  CA    . ALA A 1  179 ? -6.754  14.918  4.290   1.00 11.52 ? 305 ALA A CA    1 
ATOM   1314 C  C     . ALA A 1  179 ? -8.068  14.407  3.681   1.00 8.69  ? 305 ALA A C     1 
ATOM   1315 O  O     . ALA A 1  179 ? -8.937  15.184  3.324   1.00 13.27 ? 305 ALA A O     1 
ATOM   1316 C  CB    . ALA A 1  179 ? -5.662  14.972  3.218   1.00 10.03 ? 305 ALA A CB    1 
ATOM   1317 N  N     . VAL A 1  180 ? -8.177  13.094  3.550   1.00 7.62  ? 306 VAL A N     1 
ATOM   1318 C  CA    . VAL A 1  180 ? -9.388  12.480  2.969   1.00 7.60  ? 306 VAL A CA    1 
ATOM   1319 C  C     . VAL A 1  180 ? -10.617 12.787  3.835   1.00 8.47  ? 306 VAL A C     1 
ATOM   1320 O  O     . VAL A 1  180 ? -11.696 13.075  3.322   1.00 8.62  ? 306 VAL A O     1 
ATOM   1321 C  CB    . VAL A 1  180 ? -9.182  10.956  2.852   1.00 7.09  ? 306 VAL A CB    1 
ATOM   1322 C  CG1   . VAL A 1  180 ? -10.533 10.182  2.681   1.00 8.45  ? 306 VAL A CG1   1 
ATOM   1323 C  CG2   . VAL A 1  180 ? -8.196  10.620  1.727   1.00 4.70  ? 306 VAL A CG2   1 
ATOM   1324 N  N     . GLY A 1  181 ? -10.430 12.722  5.151   1.00 11.69 ? 307 GLY A N     1 
ATOM   1325 C  CA    . GLY A 1  181 ? -11.482 13.074  6.111   1.00 12.48 ? 307 GLY A CA    1 
ATOM   1326 C  C     . GLY A 1  181 ? -12.025 14.491  5.985   1.00 16.82 ? 307 GLY A C     1 
ATOM   1327 O  O     . GLY A 1  181 ? -13.223 14.706  6.183   1.00 14.96 ? 307 GLY A O     1 
ATOM   1328 N  N     . GLN A 1  182 ? -11.167 15.464  5.654   1.00 13.18 ? 308 GLN A N     1 
ATOM   1329 C  CA    . GLN A 1  182 ? -11.616 16.837  5.454   1.00 10.64 ? 308 GLN A CA    1 
ATOM   1330 C  C     . GLN A 1  182 ? -12.240 16.974  4.101   1.00 10.71 ? 308 GLN A C     1 
ATOM   1331 O  O     . GLN A 1  182 ? -13.228 17.698  3.912   1.00 13.38 ? 308 GLN A O     1 
ATOM   1332 C  CB    . GLN A 1  182 ? -10.441 17.809  5.608   1.00 12.29 ? 308 GLN A CB    1 
ATOM   1333 C  CG    . GLN A 1  182 ? -9.924  17.786  7.048   1.00 12.51 ? 308 GLN A CG    1 
ATOM   1334 C  CD    . GLN A 1  182 ? -8.660  18.587  7.233   1.00 20.25 ? 308 GLN A CD    1 
ATOM   1335 O  OE1   . GLN A 1  182 ? -8.353  19.484  6.440   1.00 17.80 ? 308 GLN A OE1   1 
ATOM   1336 N  NE2   . GLN A 1  182 ? -7.907  18.264  8.284   1.00 23.48 ? 308 GLN A NE2   1 
ATOM   1337 N  N     . ALA A 1  183 ? -11.695 16.240  3.140   1.00 11.94 ? 309 ALA A N     1 
ATOM   1338 C  CA    . ALA A 1  183 ? -12.172 16.396  1.784   1.00 8.64  ? 309 ALA A CA    1 
ATOM   1339 C  C     . ALA A 1  183 ? -13.570 15.822  1.658   1.00 8.63  ? 309 ALA A C     1 
ATOM   1340 O  O     . ALA A 1  183 ? -14.398 16.347  0.905   1.00 13.33 ? 309 ALA A O     1 
ATOM   1341 C  CB    . ALA A 1  183 ? -11.211 15.707  0.775   1.00 11.31 ? 309 ALA A CB    1 
ATOM   1342 N  N     . LEU A 1  184 ? -13.831 14.733  2.372   1.00 7.76  ? 310 LEU A N     1 
ATOM   1343 C  CA    . LEU A 1  184 ? -15.124 14.043  2.260   1.00 7.99  ? 310 LEU A CA    1 
ATOM   1344 C  C     . LEU A 1  184 ? -15.324 13.159  3.477   1.00 9.06  ? 310 LEU A C     1 
ATOM   1345 O  O     . LEU A 1  184 ? -14.854 12.021  3.529   1.00 7.88  ? 310 LEU A O     1 
ATOM   1346 C  CB    . LEU A 1  184 ? -15.210 13.194  0.995   1.00 9.25  ? 310 LEU A CB    1 
ATOM   1347 C  CG    . LEU A 1  184 ? -16.533 12.431  0.838   1.00 9.52  ? 310 LEU A CG    1 
ATOM   1348 C  CD1   . LEU A 1  184 ? -17.724 13.388  0.716   1.00 9.31  ? 310 LEU A CD1   1 
ATOM   1349 C  CD2   . LEU A 1  184 ? -16.478 11.441  -0.335  1.00 6.95  ? 310 LEU A CD2   1 
ATOM   1350 N  N     . PRO A 1  185 ? -15.973 13.695  4.506   1.00 8.74  ? 311 PRO A N     1 
ATOM   1351 C  CA    . PRO A 1  185 ? -16.208 12.889  5.717   1.00 7.26  ? 311 PRO A CA    1 
ATOM   1352 C  C     . PRO A 1  185 ? -16.857 11.550  5.383   1.00 9.66  ? 311 PRO A C     1 
ATOM   1353 O  O     . PRO A 1  185 ? -17.782 11.488  4.586   1.00 8.07  ? 311 PRO A O     1 
ATOM   1354 C  CB    . PRO A 1  185 ? -17.160 13.773  6.534   1.00 13.48 ? 311 PRO A CB    1 
ATOM   1355 C  CG    . PRO A 1  185 ? -16.738 15.203  6.097   1.00 8.27  ? 311 PRO A CG    1 
ATOM   1356 C  CD    . PRO A 1  185 ? -16.463 15.088  4.625   1.00 8.65  ? 311 PRO A CD    1 
ATOM   1357 N  N     . GLY A 1  186 ? -16.339 10.476  5.960   1.00 7.17  ? 312 GLY A N     1 
ATOM   1358 C  CA    . GLY A 1  186 ? -16.924 9.170   5.746   1.00 7.75  ? 312 GLY A CA    1 
ATOM   1359 C  C     . GLY A 1  186 ? -16.123 8.374   4.716   1.00 8.37  ? 312 GLY A C     1 
ATOM   1360 O  O     . GLY A 1  186 ? -16.308 7.146   4.560   1.00 6.03  ? 312 GLY A O     1 
ATOM   1361 N  N     . ALA A 1  187 ? -15.250 9.065   3.997   1.00 7.56  ? 313 ALA A N     1 
ATOM   1362 C  CA    . ALA A 1  187 ? -14.468 8.388   2.943   1.00 7.35  ? 313 ALA A CA    1 
ATOM   1363 C  C     . ALA A 1  187 ? -13.450 7.515   3.635   1.00 9.24  ? 313 ALA A C     1 
ATOM   1364 O  O     . ALA A 1  187 ? -13.034 7.838   4.748   1.00 11.10 ? 313 ALA A O     1 
ATOM   1365 C  CB    . ALA A 1  187 ? -13.795 9.412   2.040   1.00 5.36  ? 313 ALA A CB    1 
ATOM   1366 N  N     . THR A 1  188 ? -13.041 6.406   3.005   1.00 4.41  ? 314 THR A N     1 
ATOM   1367 C  CA    . THR A 1  188 ? -12.110 5.471   3.649   1.00 3.76  ? 314 THR A CA    1 
ATOM   1368 C  C     . THR A 1  188 ? -10.859 5.348   2.816   1.00 6.49  ? 314 THR A C     1 
ATOM   1369 O  O     . THR A 1  188 ? -10.875 5.693   1.635   1.00 3.94  ? 314 THR A O     1 
ATOM   1370 C  CB    . THR A 1  188 ? -12.744 4.101   3.772   1.00 7.02  ? 314 THR A CB    1 
ATOM   1371 O  OG1   . THR A 1  188 ? -13.026 3.564   2.463   1.00 7.47  ? 314 THR A OG1   1 
ATOM   1372 C  CG2   . THR A 1  188 ? -14.070 4.220   4.597   1.00 9.49  ? 314 THR A CG2   1 
ATOM   1373 N  N     . VAL A 1  189 ? -9.790  4.889   3.447   1.00 4.13  ? 315 VAL A N     1 
ATOM   1374 C  CA    . VAL A 1  189 ? -8.508  4.723   2.773   1.00 3.97  ? 315 VAL A CA    1 
ATOM   1375 C  C     . VAL A 1  189 ? -8.054  3.310   2.995   1.00 6.20  ? 315 VAL A C     1 
ATOM   1376 O  O     . VAL A 1  189 ? -7.982  2.861   4.132   1.00 7.10  ? 315 VAL A O     1 
ATOM   1377 C  CB    . VAL A 1  189 ? -7.449  5.676   3.358   1.00 5.21  ? 315 VAL A CB    1 
ATOM   1378 C  CG1   . VAL A 1  189 ? -6.085  5.382   2.772   1.00 4.67  ? 315 VAL A CG1   1 
ATOM   1379 C  CG2   . VAL A 1  189 ? -7.840  7.124   3.073   1.00 3.47  ? 315 VAL A CG2   1 
ATOM   1380 N  N     . THR A 1  190 ? -7.740  2.591   1.924   1.00 2.49  ? 316 THR A N     1 
ATOM   1381 C  CA    . THR A 1  190 ? -7.289  1.209   2.058   1.00 1.66  ? 316 THR A CA    1 
ATOM   1382 C  C     . THR A 1  190 ? -5.885  1.067   1.472   1.00 2.35  ? 316 THR A C     1 
ATOM   1383 O  O     . THR A 1  190 ? -5.640  1.492   0.341   1.00 2.18  ? 316 THR A O     1 
ATOM   1384 C  CB    . THR A 1  190 ? -8.202  0.278   1.285   1.00 3.63  ? 316 THR A CB    1 
ATOM   1385 O  OG1   . THR A 1  190 ? -9.521  0.346   1.862   1.00 4.06  ? 316 THR A OG1   1 
ATOM   1386 C  CG2   . THR A 1  190 ? -7.680  -1.191  1.378   1.00 4.89  ? 316 THR A CG2   1 
ATOM   1387 N  N     . LEU A 1  191 ? -4.990  0.424   2.210   1.00 1.77  ? 317 LEU A N     1 
ATOM   1388 C  CA    . LEU A 1  191 ? -3.635  0.153   1.705   1.00 2.30  ? 317 LEU A CA    1 
ATOM   1389 C  C     . LEU A 1  191 ? -3.690  -0.969  0.670   1.00 2.80  ? 317 LEU A C     1 
ATOM   1390 O  O     . LEU A 1  191 ? -4.248  -2.041  0.938   1.00 2.53  ? 317 LEU A O     1 
ATOM   1391 C  CB    . LEU A 1  191 ? -2.756  -0.248  2.893   1.00 2.64  ? 317 LEU A CB    1 
ATOM   1392 C  CG    . LEU A 1  191 ? -1.321  -0.626  2.563   1.00 5.15  ? 317 LEU A CG    1 
ATOM   1393 C  CD1   . LEU A 1  191 ? -0.582  0.544   1.897   1.00 1.92  ? 317 LEU A CD1   1 
ATOM   1394 C  CD2   . LEU A 1  191 ? -0.637  -1.058  3.881   1.00 10.34 ? 317 LEU A CD2   1 
ATOM   1395 N  N     A THR A 1  192 ? -3.147  -0.734  -0.523  0.50 2.63  ? 318 THR A N     1 
ATOM   1396 N  N     B THR A 1  192 ? -3.105  -0.736  -0.496  0.50 2.63  ? 318 THR A N     1 
ATOM   1397 C  CA    A THR A 1  192 ? -3.122  -1.784  -1.547  0.50 2.02  ? 318 THR A CA    1 
ATOM   1398 C  CA    B THR A 1  192 ? -3.138  -1.746  -1.541  0.50 2.08  ? 318 THR A CA    1 
ATOM   1399 C  C     A THR A 1  192 ? -1.697  -2.081  -1.996  0.50 1.53  ? 318 THR A C     1 
ATOM   1400 C  C     B THR A 1  192 ? -1.705  -2.037  -2.013  0.50 1.55  ? 318 THR A C     1 
ATOM   1401 O  O     A THR A 1  192 ? -0.758  -1.946  -1.211  0.50 2.03  ? 318 THR A O     1 
ATOM   1402 O  O     B THR A 1  192 ? -0.760  -1.859  -1.244  0.50 2.09  ? 318 THR A O     1 
ATOM   1403 C  CB    A THR A 1  192 ? -3.986  -1.411  -2.780  0.50 2.57  ? 318 THR A CB    1 
ATOM   1404 C  CB    B THR A 1  192 ? -4.059  -1.279  -2.690  0.50 2.57  ? 318 THR A CB    1 
ATOM   1405 O  OG1   A THR A 1  192 ? -3.530  -0.162  -3.339  0.50 0.45  ? 318 THR A OG1   1 
ATOM   1406 O  OG1   B THR A 1  192 ? -5.202  -0.608  -2.146  0.50 5.55  ? 318 THR A OG1   1 
ATOM   1407 C  CG2   A THR A 1  192 ? -5.448  -1.302  -2.382  0.50 3.36  ? 318 THR A CG2   1 
ATOM   1408 C  CG2   B THR A 1  192 ? -4.550  -2.428  -3.441  0.50 1.56  ? 318 THR A CG2   1 
ATOM   1409 N  N     . GLY A 1  193 ? -1.534  -2.519  -3.246  1.00 1.50  ? 319 GLY A N     1 
ATOM   1410 C  CA    . GLY A 1  193 ? -0.201  -2.834  -3.755  1.00 2.36  ? 319 GLY A CA    1 
ATOM   1411 C  C     . GLY A 1  193 ? 0.588   -3.883  -2.964  1.00 2.11  ? 319 GLY A C     1 
ATOM   1412 O  O     . GLY A 1  193 ? 0.016   -4.730  -2.269  1.00 1.75  ? 319 GLY A O     1 
ATOM   1413 N  N     . GLY A 1  194 ? 1.906   -3.848  -3.099  1.00 1.81  ? 320 GLY A N     1 
ATOM   1414 C  CA    . GLY A 1  194 ? 2.753   -4.841  -2.472  1.00 3.27  ? 320 GLY A CA    1 
ATOM   1415 C  C     . GLY A 1  194 ? 2.616   -4.953  -0.964  1.00 4.33  ? 320 GLY A C     1 
ATOM   1416 O  O     . GLY A 1  194 ? 2.680   -6.062  -0.411  1.00 2.77  ? 320 GLY A O     1 
ATOM   1417 N  N     . PHE A 1  195 ? 2.402   -3.828  -0.284  1.00 2.00  ? 321 PHE A N     1 
ATOM   1418 C  CA    . PHE A 1  195 ? 2.267   -3.896  1.177   1.00 2.15  ? 321 PHE A CA    1 
ATOM   1419 C  C     . PHE A 1  195 ? 1.046   -4.703  1.567   1.00 2.15  ? 321 PHE A C     1 
ATOM   1420 O  O     . PHE A 1  195 ? 1.060   -5.425  2.574   1.00 2.22  ? 321 PHE A O     1 
ATOM   1421 C  CB    . PHE A 1  195 ? 2.268   -2.490  1.804   1.00 2.22  ? 321 PHE A CB    1 
ATOM   1422 C  CG    . PHE A 1  195 ? 3.638   -1.843  1.752   1.00 4.18  ? 321 PHE A CG    1 
ATOM   1423 C  CD1   . PHE A 1  195 ? 3.948   -0.883  0.793   1.00 5.96  ? 321 PHE A CD1   1 
ATOM   1424 C  CD2   . PHE A 1  195 ? 4.622   -2.267  2.629   1.00 6.66  ? 321 PHE A CD2   1 
ATOM   1425 C  CE1   . PHE A 1  195 ? 5.247   -0.336  0.735   1.00 7.34  ? 321 PHE A CE1   1 
ATOM   1426 C  CE2   . PHE A 1  195 ? 5.904   -1.727  2.595   1.00 6.28  ? 321 PHE A CE2   1 
ATOM   1427 C  CZ    . PHE A 1  195 ? 6.216   -0.759  1.668   1.00 7.70  ? 321 PHE A CZ    1 
ATOM   1428 N  N     . ARG A 1  196 ? -0.017  -4.624  0.777   1.00 1.84  ? 322 ARG A N     1 
ATOM   1429 C  CA    . ARG A 1  196 ? -1.186  -5.437  1.130   1.00 1.67  ? 322 ARG A CA    1 
ATOM   1430 C  C     . ARG A 1  196 ? -0.909  -6.936  0.930   1.00 2.85  ? 322 ARG A C     1 
ATOM   1431 O  O     . ARG A 1  196 ? -1.488  -7.786  1.626   1.00 3.63  ? 322 ARG A O     1 
ATOM   1432 C  CB    . ARG A 1  196 ? -2.425  -5.019  0.319   1.00 0.90  ? 322 ARG A CB    1 
ATOM   1433 C  CG    . ARG A 1  196 ? -3.716  -5.825  0.722   1.00 1.11  ? 322 ARG A CG    1 
ATOM   1434 C  CD    . ARG A 1  196 ? -5.000  -5.219  0.122   1.00 2.20  ? 322 ARG A CD    1 
ATOM   1435 N  NE    . ARG A 1  196 ? -6.168  -6.003  0.576   1.00 1.85  ? 322 ARG A NE    1 
ATOM   1436 C  CZ    . ARG A 1  196 ? -6.928  -6.778  -0.197  1.00 2.53  ? 322 ARG A CZ    1 
ATOM   1437 N  NH1   . ARG A 1  196 ? -6.717  -6.844  -1.515  1.00 1.56  ? 322 ARG A NH1   1 
ATOM   1438 N  NH2   . ARG A 1  196 ? -7.930  -7.472  0.350   1.00 2.44  ? 322 ARG A NH2   1 
ATOM   1439 N  N     . ARG A 1  197 ? -0.006  -7.274  0.009   1.00 1.67  ? 323 ARG A N     1 
ATOM   1440 C  CA    . ARG A 1  197 ? 0.369   -8.685  -0.196  1.00 2.30  ? 323 ARG A CA    1 
ATOM   1441 C  C     . ARG A 1  197 ? 1.367   -9.155  0.847   1.00 3.27  ? 323 ARG A C     1 
ATOM   1442 O  O     . ARG A 1  197 ? 1.853   -10.273 0.729   1.00 4.93  ? 323 ARG A O     1 
ATOM   1443 C  CB    . ARG A 1  197 ? 0.985   -8.937  -1.599  1.00 1.59  ? 323 ARG A CB    1 
ATOM   1444 C  CG    . ARG A 1  197 ? 0.041   -8.482  -2.748  1.00 1.63  ? 323 ARG A CG    1 
ATOM   1445 C  CD    . ARG A 1  197 ? 0.484   -9.098  -4.105  1.00 1.33  ? 323 ARG A CD    1 
ATOM   1446 N  NE    . ARG A 1  197 ? 1.894   -8.808  -4.397  1.00 2.64  ? 323 ARG A NE    1 
ATOM   1447 C  CZ    . ARG A 1  197 ? 2.334   -7.648  -4.908  1.00 3.78  ? 323 ARG A CZ    1 
ATOM   1448 N  NH1   . ARG A 1  197 ? 3.630   -7.466  -5.087  1.00 3.63  ? 323 ARG A NH1   1 
ATOM   1449 N  NH2   . ARG A 1  197 ? 1.470   -6.682  -5.250  1.00 1.41  ? 323 ARG A NH2   1 
ATOM   1450 N  N     . GLY A 1  198 ? 1.754   -8.269  1.769   1.00 3.55  ? 324 GLY A N     1 
ATOM   1451 C  CA    . GLY A 1  198 ? 2.587   -8.687  2.890   1.00 4.91  ? 324 GLY A CA    1 
ATOM   1452 C  C     . GLY A 1  198 ? 4.038   -8.260  2.796   1.00 7.17  ? 324 GLY A C     1 
ATOM   1453 O  O     . GLY A 1  198 ? 4.881   -8.621  3.633   1.00 5.55  ? 324 GLY A O     1 
ATOM   1454 N  N     . LYS A 1  199 ? 4.374   -7.506  1.769   1.00 4.65  ? 325 LYS A N     1 
ATOM   1455 C  CA    . LYS A 1  199 ? 5.775   -7.072  1.661   1.00 5.97  ? 325 LYS A CA    1 
ATOM   1456 C  C     . LYS A 1  199 ? 6.177   -6.208  2.835   1.00 6.87  ? 325 LYS A C     1 
ATOM   1457 O  O     . LYS A 1  199 ? 5.377   -5.432  3.322   1.00 4.91  ? 325 LYS A O     1 
ATOM   1458 C  CB    . LYS A 1  199 ? 5.997   -6.318  0.356   1.00 7.22  ? 325 LYS A CB    1 
ATOM   1459 C  CG    . LYS A 1  199 ? 5.853   -7.257  -0.854  1.00 9.65  ? 325 LYS A CG    1 
ATOM   1460 C  CD    . LYS A 1  199 ? 6.353   -6.587  -2.077  1.00 18.80 ? 325 LYS A CD    1 
ATOM   1461 C  CE    . LYS A 1  199 ? 7.860   -6.413  -1.993  1.00 33.48 ? 325 LYS A CE    1 
ATOM   1462 N  NZ    . LYS A 1  199 ? 8.364   -5.602  -3.112  1.00 39.09 ? 325 LYS A NZ    1 
ATOM   1463 N  N     . LEU A 1  200 ? 7.427   -6.331  3.264   1.00 7.65  ? 326 LEU A N     1 
ATOM   1464 C  CA    . LEU A 1  200 ? 7.893   -5.582  4.426   1.00 10.92 ? 326 LEU A CA    1 
ATOM   1465 C  C     . LEU A 1  200 ? 8.547   -4.292  3.964   1.00 13.71 ? 326 LEU A C     1 
ATOM   1466 O  O     . LEU A 1  200 ? 8.700   -3.362  4.749   1.00 13.85 ? 326 LEU A O     1 
ATOM   1467 C  CB    . LEU A 1  200 ? 8.891   -6.418  5.240   1.00 13.17 ? 326 LEU A CB    1 
ATOM   1468 C  CG    . LEU A 1  200 ? 8.215   -7.650  5.868   1.00 15.73 ? 326 LEU A CG    1 
ATOM   1469 C  CD1   . LEU A 1  200 ? 9.188   -8.413  6.741   1.00 27.29 ? 326 LEU A CD1   1 
ATOM   1470 C  CD2   . LEU A 1  200 ? 6.970   -7.270  6.658   1.00 17.42 ? 326 LEU A CD2   1 
ATOM   1471 N  N     . GLN A 1  201 ? 8.910   -4.243  2.683   1.00 7.83  ? 327 GLN A N     1 
ATOM   1472 C  CA    . GLN A 1  201 ? 9.495   -3.043  2.075   1.00 13.21 ? 327 GLN A CA    1 
ATOM   1473 C  C     . GLN A 1  201 ? 8.907   -2.838  0.715   1.00 16.62 ? 327 GLN A C     1 
ATOM   1474 O  O     . GLN A 1  201 ? 8.317   -3.751  0.154   1.00 16.47 ? 327 GLN A O     1 
ATOM   1475 C  CB    . GLN A 1  201 ? 11.001  -3.208  1.876   1.00 17.03 ? 327 GLN A CB    1 
ATOM   1476 C  CG    . GLN A 1  201 ? 11.768  -3.353  3.143   1.00 21.21 ? 327 GLN A CG    1 
ATOM   1477 C  CD    . GLN A 1  201 ? 13.273  -3.427  2.884   1.00 22.42 ? 327 GLN A CD    1 
ATOM   1478 O  OE1   . GLN A 1  201 ? 13.723  -3.644  1.746   1.00 26.17 ? 327 GLN A OE1   1 
ATOM   1479 N  NE2   . GLN A 1  201 ? 14.047  -3.266  3.939   1.00 25.70 ? 327 GLN A NE2   1 
ATOM   1480 N  N     . GLY A 1  202 ? 9.071   -1.635  0.164   1.00 13.32 ? 328 GLY A N     1 
ATOM   1481 C  CA    . GLY A 1  202 ? 8.563   -1.384  -1.178  1.00 11.29 ? 328 GLY A CA    1 
ATOM   1482 C  C     . GLY A 1  202 ? 9.206   -0.150  -1.762  1.00 13.77 ? 328 GLY A C     1 
ATOM   1483 O  O     . GLY A 1  202 ? 9.980   0.509   -1.085  1.00 16.80 ? 328 GLY A O     1 
ATOM   1484 N  N     . HIS A 1  203 ? 8.935   0.147   -3.024  1.00 8.93  ? 329 HIS A N     1 
ATOM   1485 C  CA    . HIS A 1  203 ? 9.487   1.378   -3.586  1.00 7.32  ? 329 HIS A CA    1 
ATOM   1486 C  C     . HIS A 1  203 ? 8.423   2.451   -3.762  1.00 9.47  ? 329 HIS A C     1 
ATOM   1487 O  O     . HIS A 1  203 ? 8.705   3.552   -4.237  1.00 8.15  ? 329 HIS A O     1 
ATOM   1488 C  CB    . HIS A 1  203 ? 10.262  1.081   -4.861  1.00 17.73 ? 329 HIS A CB    1 
ATOM   1489 C  CG    . HIS A 1  203 ? 11.535  0.342   -4.594  0.75 17.65 ? 329 HIS A CG    1 
ATOM   1490 N  ND1   . HIS A 1  203 ? 12.588  0.916   -3.913  0.75 24.19 ? 329 HIS A ND1   1 
ATOM   1491 C  CD2   . HIS A 1  203 ? 11.907  -0.931  -4.862  0.75 19.82 ? 329 HIS A CD2   1 
ATOM   1492 C  CE1   . HIS A 1  203 ? 13.561  0.031   -3.790  0.75 24.10 ? 329 HIS A CE1   1 
ATOM   1493 N  NE2   . HIS A 1  203 ? 13.176  -1.094  -4.364  0.75 30.97 ? 329 HIS A NE2   1 
ATOM   1494 N  N     A ASP A 1  204 ? 7.212   2.142   -3.318  0.50 5.31  ? 330 ASP A N     1 
ATOM   1495 N  N     B ASP A 1  204 ? 7.192   2.127   -3.381  0.50 5.32  ? 330 ASP A N     1 
ATOM   1496 C  CA    A ASP A 1  204 ? 6.128   3.110   -3.364  0.50 6.18  ? 330 ASP A CA    1 
ATOM   1497 C  CA    B ASP A 1  204 ? 6.128   3.129   -3.347  0.50 6.18  ? 330 ASP A CA    1 
ATOM   1498 C  C     A ASP A 1  204 ? 5.018   2.618   -2.455  0.50 5.70  ? 330 ASP A C     1 
ATOM   1499 C  C     B ASP A 1  204 ? 4.996   2.610   -2.486  0.50 5.70  ? 330 ASP A C     1 
ATOM   1500 O  O     A ASP A 1  204 ? 5.058   1.484   -1.979  0.50 5.32  ? 330 ASP A O     1 
ATOM   1501 O  O     B ASP A 1  204 ? 4.997   1.448   -2.083  0.50 5.32  ? 330 ASP A O     1 
ATOM   1502 C  CB    A ASP A 1  204 ? 5.612   3.261   -4.792  0.50 6.04  ? 330 ASP A CB    1 
ATOM   1503 C  CB    B ASP A 1  204 ? 5.649   3.522   -4.761  0.50 5.90  ? 330 ASP A CB    1 
ATOM   1504 C  CG    A ASP A 1  204 ? 5.312   1.915   -5.446  0.50 8.00  ? 330 ASP A CG    1 
ATOM   1505 C  CG    B ASP A 1  204 ? 4.334   2.867   -5.166  0.50 8.53  ? 330 ASP A CG    1 
ATOM   1506 O  OD1   A ASP A 1  204 ? 4.176   1.432   -5.268  0.50 6.63  ? 330 ASP A OD1   1 
ATOM   1507 O  OD1   B ASP A 1  204 ? 3.506   3.590   -5.772  0.50 10.47 ? 330 ASP A OD1   1 
ATOM   1508 O  OD2   A ASP A 1  204 ? 6.204   1.343   -6.123  0.50 8.23  ? 330 ASP A OD2   1 
ATOM   1509 O  OD2   B ASP A 1  204 ? 4.131   1.647   -4.924  0.50 6.77  ? 330 ASP A OD2   1 
ATOM   1510 N  N     . VAL A 1  205 ? 4.044   3.474   -2.189  1.00 4.15  ? 331 VAL A N     1 
ATOM   1511 C  CA    . VAL A 1  205 ? 2.914   3.063   -1.340  1.00 3.74  ? 331 VAL A CA    1 
ATOM   1512 C  C     . VAL A 1  205 ? 1.640   3.330   -2.122  1.00 4.30  ? 331 VAL A C     1 
ATOM   1513 O  O     . VAL A 1  205 ? 1.509   4.394   -2.702  1.00 2.79  ? 331 VAL A O     1 
ATOM   1514 C  CB    . VAL A 1  205 ? 2.878   3.863   -0.047  1.00 7.42  ? 331 VAL A CB    1 
ATOM   1515 C  CG1   . VAL A 1  205 ? 1.780   3.308   0.861   1.00 7.73  ? 331 VAL A CG1   1 
ATOM   1516 C  CG2   . VAL A 1  205 ? 4.259   3.754   0.669   1.00 5.89  ? 331 VAL A CG2   1 
ATOM   1517 N  N     . ASP A 1  206 ? 0.696   2.385   -2.114  1.00 2.07  ? 332 ASP A N     1 
ATOM   1518 C  CA    . ASP A 1  206 ? -0.517  2.547   -2.912  1.00 3.07  ? 332 ASP A CA    1 
ATOM   1519 C  C     . ASP A 1  206 ? -1.744  2.619   -2.011  1.00 3.00  ? 332 ASP A C     1 
ATOM   1520 O  O     . ASP A 1  206 ? -1.895  1.748   -1.157  1.00 1.95  ? 332 ASP A O     1 
ATOM   1521 C  CB    . ASP A 1  206 ? -0.656  1.310   -3.814  1.00 2.21  ? 332 ASP A CB    1 
ATOM   1522 C  CG    . ASP A 1  206 ? 0.545   1.152   -4.717  1.00 4.43  ? 332 ASP A CG    1 
ATOM   1523 O  OD1   . ASP A 1  206 ? 0.717   2.045   -5.552  1.00 4.86  ? 332 ASP A OD1   1 
ATOM   1524 O  OD2   . ASP A 1  206 ? 1.355   0.207   -4.566  1.00 4.68  ? 332 ASP A OD2   1 
ATOM   1525 N  N     . PHE A 1  207 ? -2.651  3.571   -2.258  1.00 1.74  ? 333 PHE A N     1 
ATOM   1526 C  CA    . PHE A 1  207 ? -3.873  3.640   -1.460  1.00 1.75  ? 333 PHE A CA    1 
ATOM   1527 C  C     . PHE A 1  207 ? -5.089  3.723   -2.347  1.00 3.18  ? 333 PHE A C     1 
ATOM   1528 O  O     . PHE A 1  207 ? -5.061  4.353   -3.406  1.00 2.11  ? 333 PHE A O     1 
ATOM   1529 C  CB    . PHE A 1  207 ? -3.889  4.890   -0.597  1.00 4.75  ? 333 PHE A CB    1 
ATOM   1530 C  CG    . PHE A 1  207 ? -2.833  4.899   0.482   1.00 4.39  ? 333 PHE A CG    1 
ATOM   1531 C  CD1   . PHE A 1  207 ? -1.769  5.787   0.424   1.00 7.17  ? 333 PHE A CD1   1 
ATOM   1532 C  CD2   . PHE A 1  207 ? -2.935  4.019   1.584   1.00 3.10  ? 333 PHE A CD2   1 
ATOM   1533 C  CE1   . PHE A 1  207 ? -0.808  5.816   1.423   1.00 7.44  ? 333 PHE A CE1   1 
ATOM   1534 C  CE2   . PHE A 1  207 ? -1.972  4.029   2.598   1.00 6.00  ? 333 PHE A CE2   1 
ATOM   1535 C  CZ    . PHE A 1  207 ? -0.891  4.931   2.512   1.00 6.24  ? 333 PHE A CZ    1 
ATOM   1536 N  N     . LEU A 1  208 ? -6.171  3.112   -1.902  1.00 0.83  ? 334 LEU A N     1 
ATOM   1537 C  CA    . LEU A 1  208 ? -7.407  3.113   -2.660  1.00 1.32  ? 334 LEU A CA    1 
ATOM   1538 C  C     . LEU A 1  208 ? -8.434  3.799   -1.771  1.00 1.28  ? 334 LEU A C     1 
ATOM   1539 O  O     . LEU A 1  208 ? -8.588  3.439   -0.585  1.00 2.33  ? 334 LEU A O     1 
ATOM   1540 C  CB    . LEU A 1  208 ? -7.842  1.673   -2.933  1.00 0.69  ? 334 LEU A CB    1 
ATOM   1541 C  CG    . LEU A 1  208 ? -9.189  1.526   -3.638  1.00 1.16  ? 334 LEU A CG    1 
ATOM   1542 C  CD1   . LEU A 1  208 ? -9.193  2.233   -4.993  1.00 2.33  ? 334 LEU A CD1   1 
ATOM   1543 C  CD2   . LEU A 1  208 ? -9.429  -0.003  -3.867  1.00 1.22  ? 334 LEU A CD2   1 
ATOM   1544 N  N     . ILE A 1  209 ? -9.131  4.772   -2.327  1.00 1.76  ? 335 ILE A N     1 
ATOM   1545 C  CA    . ILE A 1  209 ? -10.034 5.627   -1.530  1.00 1.74  ? 335 ILE A CA    1 
ATOM   1546 C  C     . ILE A 1  209 ? -11.459 5.446   -2.059  1.00 3.85  ? 335 ILE A C     1 
ATOM   1547 O  O     . ILE A 1  209 ? -11.671 5.429   -3.289  1.00 1.75  ? 335 ILE A O     1 
ATOM   1548 C  CB    . ILE A 1  209 ? -9.632  7.112   -1.705  1.00 2.74  ? 335 ILE A CB    1 
ATOM   1549 C  CG1   . ILE A 1  209 ? -8.186  7.297   -1.213  1.00 3.54  ? 335 ILE A CG1   1 
ATOM   1550 C  CG2   . ILE A 1  209 ? -10.617 8.011   -0.952  1.00 4.98  ? 335 ILE A CG2   1 
ATOM   1551 C  CD1   . ILE A 1  209 ? -7.488  8.625   -1.735  1.00 3.14  ? 335 ILE A CD1   1 
ATOM   1552 N  N     . THR A 1  210 ? -12.447 5.299   -1.154  1.00 1.85  ? 336 THR A N     1 
ATOM   1553 C  CA    . THR A 1  210 ? -13.817 5.233   -1.620  1.00 2.78  ? 336 THR A CA    1 
ATOM   1554 C  C     . THR A 1  210 ? -14.745 5.842   -0.553  1.00 3.55  ? 336 THR A C     1 
ATOM   1555 O  O     . THR A 1  210 ? -14.281 6.379   0.453   1.00 2.36  ? 336 THR A O     1 
ATOM   1556 C  CB    . THR A 1  210 ? -14.213 3.777   -1.979  1.00 3.98  ? 336 THR A CB    1 
ATOM   1557 O  OG1   . THR A 1  210 ? -15.466 3.749   -2.670  1.00 6.04  ? 336 THR A OG1   1 
ATOM   1558 C  CG2   . THR A 1  210 ? -14.332 2.914   -0.696  1.00 3.11  ? 336 THR A CG2   1 
ATOM   1559 N  N     . HIS A 1  211 ? -16.051 5.737   -0.772  1.00 3.82  ? 337 HIS A N     1 
ATOM   1560 C  CA    . HIS A 1  211 ? -17.033 6.268   0.171   1.00 6.41  ? 337 HIS A CA    1 
ATOM   1561 C  C     . HIS A 1  211 ? -18.219 5.334   0.079   1.00 6.88  ? 337 HIS A C     1 
ATOM   1562 O  O     . HIS A 1  211 ? -18.553 4.875   -1.006  1.00 6.66  ? 337 HIS A O     1 
ATOM   1563 C  CB    . HIS A 1  211 ? -17.474 7.689   -0.194  1.00 6.15  ? 337 HIS A CB    1 
ATOM   1564 C  CG    . HIS A 1  211 ? -18.305 8.335   0.883   1.00 6.89  ? 337 HIS A CG    1 
ATOM   1565 N  ND1   . HIS A 1  211 ? -19.656 8.084   1.040   1.00 11.57 ? 337 HIS A ND1   1 
ATOM   1566 C  CD2   . HIS A 1  211 ? -17.957 9.175   1.894   1.00 5.76  ? 337 HIS A CD2   1 
ATOM   1567 C  CE1   . HIS A 1  211 ? -20.106 8.757   2.090   1.00 7.56  ? 337 HIS A CE1   1 
ATOM   1568 N  NE2   . HIS A 1  211 ? -19.097 9.437   2.621   1.00 6.27  ? 337 HIS A NE2   1 
ATOM   1569 N  N     . PRO A 1  212 ? -18.820 4.994   1.230   1.00 8.38  ? 338 PRO A N     1 
ATOM   1570 C  CA    . PRO A 1  212 ? -19.876 3.955   1.240   1.00 7.13  ? 338 PRO A CA    1 
ATOM   1571 C  C     . PRO A 1  212 ? -21.138 4.397   0.519   1.00 11.16 ? 338 PRO A C     1 
ATOM   1572 O  O     . PRO A 1  212 ? -21.979 3.576   0.220   1.00 10.80 ? 338 PRO A O     1 
ATOM   1573 C  CB    . PRO A 1  212 ? -20.166 3.775   2.730   1.00 12.00 ? 338 PRO A CB    1 
ATOM   1574 C  CG    . PRO A 1  212 ? -19.713 5.061   3.378   1.00 8.33  ? 338 PRO A CG    1 
ATOM   1575 C  CD    . PRO A 1  212 ? -18.499 5.467   2.585   1.00 7.92  ? 338 PRO A CD    1 
ATOM   1576 N  N     . LYS A 1  213 ? -21.280 5.681   0.250   1.00 7.92  ? 339 LYS A N     1 
ATOM   1577 C  CA    . LYS A 1  213 ? -22.452 6.163   -0.484  1.00 9.51  ? 339 LYS A CA    1 
ATOM   1578 C  C     . LYS A 1  213 ? -22.093 6.404   -1.957  1.00 13.61 ? 339 LYS A C     1 
ATOM   1579 O  O     . LYS A 1  213 ? -21.413 7.370   -2.303  1.00 9.89  ? 339 LYS A O     1 
ATOM   1580 C  CB    . LYS A 1  213 ? -23.005 7.442   0.179   1.00 15.06 ? 339 LYS A CB    1 
ATOM   1581 C  CG    . LYS A 1  213 ? -24.290 7.943   -0.422  1.00 18.77 ? 339 LYS A CG    1 
ATOM   1582 C  CD    . LYS A 1  213 ? -25.437 7.007   -0.055  1.00 29.98 ? 339 LYS A CD    1 
ATOM   1583 N  N     . GLU A 1  214 ? -22.558 5.507   -2.824  1.00 7.34  ? 340 GLU A N     1 
ATOM   1584 C  CA    . GLU A 1  214 ? -22.291 5.601   -4.252  1.00 9.09  ? 340 GLU A CA    1 
ATOM   1585 C  C     . GLU A 1  214 ? -22.521 6.990   -4.827  1.00 14.05 ? 340 GLU A C     1 
ATOM   1586 O  O     . GLU A 1  214 ? -23.600 7.584   -4.686  1.00 11.56 ? 340 GLU A O     1 
ATOM   1587 C  CB    . GLU A 1  214 ? -23.153 4.599   -5.017  1.00 11.07 ? 340 GLU A CB    1 
ATOM   1588 C  CG    . GLU A 1  214 ? -22.856 4.549   -6.493  1.00 8.53  ? 340 GLU A CG    1 
ATOM   1589 C  CD    . GLU A 1  214 ? -21.720 3.556   -6.823  1.00 9.96  ? 340 GLU A CD    1 
ATOM   1590 O  OE1   . GLU A 1  214 ? -21.202 2.891   -5.895  1.00 10.19 ? 340 GLU A OE1   1 
ATOM   1591 O  OE2   . GLU A 1  214 ? -21.350 3.445   -8.000  1.00 11.41 ? 340 GLU A OE2   1 
ATOM   1592 N  N     . GLY A 1  215 ? -21.484 7.507   -5.459  1.00 11.04 ? 341 GLY A N     1 
ATOM   1593 C  CA    . GLY A 1  215 ? -21.517 8.820   -6.081  1.00 10.00 ? 341 GLY A CA    1 
ATOM   1594 C  C     . GLY A 1  215 ? -20.831 9.897   -5.239  1.00 11.34 ? 341 GLY A C     1 
ATOM   1595 O  O     . GLY A 1  215 ? -20.426 10.931  -5.777  1.00 10.79 ? 341 GLY A O     1 
ATOM   1596 N  N     . GLN A 1  216 ? -20.721 9.694   -3.923  1.00 8.45  ? 342 GLN A N     1 
ATOM   1597 C  CA    . GLN A 1  216 ? -20.156 10.742  -3.068  1.00 8.87  ? 342 GLN A CA    1 
ATOM   1598 C  C     . GLN A 1  216 ? -18.682 10.933  -3.389  1.00 11.16 ? 342 GLN A C     1 
ATOM   1599 O  O     . GLN A 1  216 ? -18.115 11.971  -3.120  1.00 9.43  ? 342 GLN A O     1 
ATOM   1600 C  CB    . GLN A 1  216 ? -20.365 10.464  -1.562  1.00 7.39  ? 342 GLN A CB    1 
ATOM   1601 C  CG    . GLN A 1  216 ? -21.830 10.667  -1.115  1.00 8.15  ? 342 GLN A CG    1 
ATOM   1602 C  CD    . GLN A 1  216 ? -22.262 12.119  -1.318  1.00 14.95 ? 342 GLN A CD    1 
ATOM   1603 O  OE1   . GLN A 1  216 ? -21.768 13.033  -0.621  1.00 14.79 ? 342 GLN A OE1   1 
ATOM   1604 N  NE2   . GLN A 1  216 ? -23.162 12.351  -2.279  1.00 15.32 ? 342 GLN A NE2   1 
ATOM   1605 N  N     . GLU A 1  217 ? -18.074 9.931   -4.013  1.00 10.08 ? 343 GLU A N     1 
ATOM   1606 C  CA    . GLU A 1  217 ? -16.640 10.023  -4.275  1.00 6.92  ? 343 GLU A CA    1 
ATOM   1607 C  C     . GLU A 1  217 ? -16.331 10.809  -5.539  1.00 6.41  ? 343 GLU A C     1 
ATOM   1608 O  O     . GLU A 1  217 ? -15.154 11.083  -5.795  1.00 7.60  ? 343 GLU A O     1 
ATOM   1609 C  CB    . GLU A 1  217 ? -16.046 8.613   -4.365  1.00 9.91  ? 343 GLU A CB    1 
ATOM   1610 C  CG    . GLU A 1  217 ? -16.197 8.007   -5.715  1.00 8.31  ? 343 GLU A CG    1 
ATOM   1611 C  CD    . GLU A 1  217 ? -17.654 7.754   -6.165  1.00 10.92 ? 343 GLU A CD    1 
ATOM   1612 O  OE1   . GLU A 1  217 ? -18.599 7.547   -5.341  1.00 10.57 ? 343 GLU A OE1   1 
ATOM   1613 O  OE2   . GLU A 1  217 ? -17.856 7.761   -7.387  1.00 14.70 ? 343 GLU A OE2   1 
ATOM   1614 N  N     . ALA A 1  218 ? -17.340 11.171  -6.339  1.00 8.71  ? 344 ALA A N     1 
ATOM   1615 C  CA    . ALA A 1  218 ? -17.080 12.025  -7.517  1.00 12.98 ? 344 ALA A CA    1 
ATOM   1616 C  C     . ALA A 1  218 ? -16.375 13.315  -7.099  1.00 15.86 ? 344 ALA A C     1 
ATOM   1617 O  O     . ALA A 1  218 ? -16.738 13.906  -6.098  1.00 11.57 ? 344 ALA A O     1 
ATOM   1618 C  CB    . ALA A 1  218 ? -18.354 12.351  -8.286  1.00 13.34 ? 344 ALA A CB    1 
ATOM   1619 N  N     . GLY A 1  219 ? -15.323 13.689  -7.829  1.00 13.37 ? 345 GLY A N     1 
ATOM   1620 C  CA    . GLY A 1  219 ? -14.591 14.927  -7.575  1.00 12.55 ? 345 GLY A CA    1 
ATOM   1621 C  C     . GLY A 1  219 ? -13.688 14.913  -6.364  1.00 9.70  ? 345 GLY A C     1 
ATOM   1622 O  O     . GLY A 1  219 ? -13.135 15.945  -5.952  1.00 7.51  ? 345 GLY A O     1 
ATOM   1623 N  N     . LEU A 1  220 ? -13.487 13.732  -5.788  1.00 6.74  ? 346 LEU A N     1 
ATOM   1624 C  CA    . LEU A 1  220 ? -12.807 13.666  -4.516  1.00 5.71  ? 346 LEU A CA    1 
ATOM   1625 C  C     . LEU A 1  220 ? -11.297 13.905  -4.627  1.00 7.64  ? 346 LEU A C     1 
ATOM   1626 O  O     . LEU A 1  220 ? -10.701 14.621  -3.828  1.00 9.52  ? 346 LEU A O     1 
ATOM   1627 C  CB    . LEU A 1  220 ? -13.062 12.308  -3.853  1.00 8.11  ? 346 LEU A CB    1 
ATOM   1628 C  CG    . LEU A 1  220 ? -12.339 12.060  -2.546  1.00 9.48  ? 346 LEU A CG    1 
ATOM   1629 C  CD1   . LEU A 1  220 ? -12.701 13.142  -1.563  1.00 9.90  ? 346 LEU A CD1   1 
ATOM   1630 C  CD2   . LEU A 1  220 ? -12.746 10.692  -1.977  1.00 9.82  ? 346 LEU A CD2   1 
ATOM   1631 N  N     . LEU A 1  221 ? -10.660 13.296  -5.605  1.00 8.79  ? 347 LEU A N     1 
ATOM   1632 C  CA    . LEU A 1  221 ? -9.200  13.391  -5.644  1.00 8.38  ? 347 LEU A CA    1 
ATOM   1633 C  C     . LEU A 1  221 ? -8.612  14.807  -5.671  1.00 8.47  ? 347 LEU A C     1 
ATOM   1634 O  O     . LEU A 1  221 ? -7.638  15.069  -4.968  1.00 8.22  ? 347 LEU A O     1 
ATOM   1635 C  CB    . LEU A 1  221 ? -8.614  12.542  -6.778  1.00 9.99  ? 347 LEU A CB    1 
ATOM   1636 C  CG    . LEU A 1  221 ? -7.694  11.376  -6.428  1.00 21.77 ? 347 LEU A CG    1 
ATOM   1637 C  CD1   . LEU A 1  221 ? -6.961  10.892  -7.681  1.00 11.58 ? 347 LEU A CD1   1 
ATOM   1638 C  CD2   . LEU A 1  221 ? -6.758  11.563  -5.210  1.00 10.35 ? 347 LEU A CD2   1 
ATOM   1639 N  N     . PRO A 1  222 ? -9.167  15.719  -6.491  1.00 9.73  ? 348 PRO A N     1 
ATOM   1640 C  CA    A PRO A 1  222 ? -8.609  17.077  -6.448  0.50 11.11 ? 348 PRO A CA    1 
ATOM   1641 C  CA    B PRO A 1  222 ? -8.639  17.089  -6.456  0.50 11.11 ? 348 PRO A CA    1 
ATOM   1642 C  C     . PRO A 1  222 ? -8.731  17.706  -5.074  1.00 9.33  ? 348 PRO A C     1 
ATOM   1643 O  O     . PRO A 1  222 ? -7.861  18.464  -4.686  1.00 10.30 ? 348 PRO A O     1 
ATOM   1644 C  CB    A PRO A 1  222 ? -9.428  17.861  -7.490  0.50 10.63 ? 348 PRO A CB    1 
ATOM   1645 C  CB    B PRO A 1  222 ? -9.549  17.847  -7.431  0.50 10.62 ? 348 PRO A CB    1 
ATOM   1646 C  CG    A PRO A 1  222 ? -10.532 16.960  -7.927  0.50 13.33 ? 348 PRO A CG    1 
ATOM   1647 C  CG    B PRO A 1  222 ? -9.996  16.805  -8.406  0.50 12.24 ? 348 PRO A CG    1 
ATOM   1648 C  CD    A PRO A 1  222 ? -10.151 15.543  -7.573  0.50 11.32 ? 348 PRO A CD    1 
ATOM   1649 C  CD    B PRO A 1  222 ? -10.142 15.528  -7.582  0.50 11.32 ? 348 PRO A CD    1 
ATOM   1650 N  N     . ARG A 1  223 ? -9.802  17.390  -4.349  1.00 8.62  ? 349 ARG A N     1 
ATOM   1651 C  CA    . ARG A 1  223 ? -9.982  17.984  -3.038  1.00 9.04  ? 349 ARG A CA    1 
ATOM   1652 C  C     . ARG A 1  223 ? -8.917  17.457  -2.092  1.00 9.92  ? 349 ARG A C     1 
ATOM   1653 O  O     . ARG A 1  223 ? -8.378  18.178  -1.247  1.00 11.87 ? 349 ARG A O     1 
ATOM   1654 C  CB    . ARG A 1  223 ? -11.398 17.660  -2.542  1.00 9.83  ? 349 ARG A CB    1 
ATOM   1655 C  CG    . ARG A 1  223 ? -12.467 18.464  -3.315  1.00 8.58  ? 349 ARG A CG    1 
ATOM   1656 C  CD    . ARG A 1  223 ? -13.913 18.046  -2.897  1.00 7.26  ? 349 ARG A CD    1 
ATOM   1657 N  NE    . ARG A 1  223 ? -14.039 18.070  -1.447  1.00 7.42  ? 349 ARG A NE    1 
ATOM   1658 C  CZ    . ARG A 1  223 ? -14.270 19.185  -0.738  1.00 9.08  ? 349 ARG A CZ    1 
ATOM   1659 N  NH1   . ARG A 1  223 ? -14.371 20.349  -1.362  1.00 10.21 ? 349 ARG A NH1   1 
ATOM   1660 N  NH2   . ARG A 1  223 ? -14.404 19.132  0.586   1.00 6.74  ? 349 ARG A NH2   1 
ATOM   1661 N  N     . VAL A 1  224 ? -8.599  16.175  -2.262  1.00 9.49  ? 350 VAL A N     1 
ATOM   1662 C  CA    . VAL A 1  224 ? -7.595  15.537  -1.439  1.00 6.55  ? 350 VAL A CA    1 
ATOM   1663 C  C     . VAL A 1  224 ? -6.238  16.136  -1.759  1.00 6.48  ? 350 VAL A C     1 
ATOM   1664 O  O     . VAL A 1  224 ? -5.493  16.472  -0.854  1.00 9.19  ? 350 VAL A O     1 
ATOM   1665 C  CB    . VAL A 1  224 ? -7.569  13.974  -1.650  1.00 7.35  ? 350 VAL A CB    1 
ATOM   1666 C  CG1   . VAL A 1  224 ? -6.407  13.335  -0.880  1.00 7.01  ? 350 VAL A CG1   1 
ATOM   1667 C  CG2   . VAL A 1  224 ? -8.870  13.375  -1.133  1.00 6.78  ? 350 VAL A CG2   1 
ATOM   1668 N  N     . MET A 1  225 ? -5.927  16.254  -3.044  1.00 9.27  ? 351 MET A N     1 
ATOM   1669 C  CA    . MET A 1  225 ? -4.591  16.725  -3.431  1.00 11.59 ? 351 MET A CA    1 
ATOM   1670 C  C     . MET A 1  225 ? -4.372  18.142  -2.930  1.00 12.02 ? 351 MET A C     1 
ATOM   1671 O  O     . MET A 1  225 ? -3.284  18.470  -2.441  1.00 13.73 ? 351 MET A O     1 
ATOM   1672 C  CB    . MET A 1  225 ? -4.394  16.674  -4.949  1.00 8.64  ? 351 MET A CB    1 
ATOM   1673 C  CG    . MET A 1  225 ? -4.334  15.224  -5.481  1.00 13.40 ? 351 MET A CG    1 
ATOM   1674 S  SD    . MET A 1  225 ? -3.164  14.187  -4.533  1.00 17.52 ? 351 MET A SD    1 
ATOM   1675 C  CE    . MET A 1  225 ? -1.628  15.128  -4.767  1.00 19.08 ? 351 MET A CE    1 
ATOM   1676 N  N     . CYS A 1  226 ? -5.404  18.978  -3.062  1.00 16.59 ? 352 CYS A N     1 
ATOM   1677 C  CA    . CYS A 1  226 ? -5.288  20.375  -2.639  1.00 12.96 ? 352 CYS A CA    1 
ATOM   1678 C  C     . CYS A 1  226 ? -4.994  20.460  -1.156  1.00 12.01 ? 352 CYS A C     1 
ATOM   1679 O  O     . CYS A 1  226 ? -4.207  21.312  -0.728  1.00 16.00 ? 352 CYS A O     1 
ATOM   1680 C  CB    . CYS A 1  226 ? -6.524  21.227  -3.050  1.00 15.01 ? 352 CYS A CB    1 
ATOM   1681 S  SG    . CYS A 1  226 ? -6.452  21.710  -4.790  1.00 40.78 ? 352 CYS A SG    1 
ATOM   1682 N  N     . ARG A 1  227 ? -5.577  19.566  -0.366  1.00 9.23  ? 353 ARG A N     1 
ATOM   1683 C  CA    . ARG A 1  227 ? -5.357  19.597  1.062   1.00 8.94  ? 353 ARG A CA    1 
ATOM   1684 C  C     . ARG A 1  227 ? -3.976  19.066  1.431   1.00 16.80 ? 353 ARG A C     1 
ATOM   1685 O  O     . ARG A 1  227 ? -3.304  19.590  2.314   1.00 17.67 ? 353 ARG A O     1 
ATOM   1686 C  CB    . ARG A 1  227 ? -6.465  18.813  1.784   1.00 12.43 ? 353 ARG A CB    1 
ATOM   1687 C  CG    . ARG A 1  227 ? -7.780  19.644  1.789   1.00 13.90 ? 353 ARG A CG    1 
ATOM   1688 C  CD    . ARG A 1  227 ? -9.060  18.842  2.029   1.00 17.50 ? 353 ARG A CD    1 
ATOM   1689 N  NE    . ARG A 1  227 ? -10.133 19.820  2.174   1.00 13.29 ? 353 ARG A NE    1 
ATOM   1690 C  CZ    . ARG A 1  227 ? -10.713 20.457  1.162   1.00 18.18 ? 353 ARG A CZ    1 
ATOM   1691 N  NH1   . ARG A 1  227 ? -10.393 20.155  -0.105  1.00 14.11 ? 353 ARG A NH1   1 
ATOM   1692 N  NH2   . ARG A 1  227 ? -11.641 21.384  1.420   1.00 15.86 ? 353 ARG A NH2   1 
ATOM   1693 N  N     . LEU A 1  228 ? -3.551  18.001  0.766   1.00 11.11 ? 354 LEU A N     1 
ATOM   1694 C  CA    . LEU A 1  228 ? -2.179  17.537  1.005   1.00 8.32  ? 354 LEU A CA    1 
ATOM   1695 C  C     . LEU A 1  228 ? -1.165  18.611  0.625   1.00 8.39  ? 354 LEU A C     1 
ATOM   1696 O  O     . LEU A 1  228 ? -0.179  18.834  1.346   1.00 14.91 ? 354 LEU A O     1 
ATOM   1697 C  CB    . LEU A 1  228 ? -1.911  16.273  0.202   1.00 9.54  ? 354 LEU A CB    1 
ATOM   1698 C  CG    . LEU A 1  228 ? -2.683  15.071  0.729   1.00 9.63  ? 354 LEU A CG    1 
ATOM   1699 C  CD1   . LEU A 1  228 ? -2.601  13.952  -0.318  1.00 8.97  ? 354 LEU A CD1   1 
ATOM   1700 C  CD2   . LEU A 1  228 ? -2.161  14.643  2.105   1.00 9.59  ? 354 LEU A CD2   1 
ATOM   1701 N  N     . GLN A 1  229 ? -1.418  19.272  -0.501  1.00 12.14 ? 355 GLN A N     1 
ATOM   1702 C  CA    . GLN A 1  229 ? -0.505  20.299  -1.008  1.00 17.61 ? 355 GLN A CA    1 
ATOM   1703 C  C     . GLN A 1  229 ? -0.478  21.493  -0.063  1.00 20.43 ? 355 GLN A C     1 
ATOM   1704 O  O     . GLN A 1  229 ? 0.564   22.070  0.186   1.00 19.72 ? 355 GLN A O     1 
ATOM   1705 C  CB    . GLN A 1  229 ? -0.891  20.720  -2.433  1.00 12.54 ? 355 GLN A CB    1 
ATOM   1706 N  N     . ASP A 1  230 ? -1.624  21.819  0.514   1.00 21.70 ? 356 ASP A N     1 
ATOM   1707 C  CA    . ASP A 1  230 ? -1.704  22.886  1.523   1.00 22.28 ? 356 ASP A CA    1 
ATOM   1708 C  C     . ASP A 1  230 ? -0.974  22.555  2.810   1.00 27.90 ? 356 ASP A C     1 
ATOM   1709 O  O     . ASP A 1  230 ? -0.491  23.458  3.500   1.00 24.20 ? 356 ASP A O     1 
ATOM   1710 C  CB    . ASP A 1  230 ? -3.170  23.247  1.824   1.00 22.57 ? 356 ASP A CB    1 
ATOM   1711 C  CG    . ASP A 1  230 ? -3.796  24.088  0.713   1.00 37.22 ? 356 ASP A CG    1 
ATOM   1712 O  OD1   . ASP A 1  230 ? -3.030  24.614  -0.134  1.00 32.53 ? 356 ASP A OD1   1 
ATOM   1713 O  OD2   . ASP A 1  230 ? -5.047  24.224  0.681   1.00 42.16 ? 356 ASP A OD2   1 
ATOM   1714 N  N     . GLN A 1  231 ? -0.873  21.268  3.139   1.00 17.24 ? 357 GLN A N     1 
ATOM   1715 C  CA    . GLN A 1  231 ? -0.097  20.875  4.291   1.00 11.74 ? 357 GLN A CA    1 
ATOM   1716 C  C     . GLN A 1  231 ? 1.427   20.777  4.017   1.00 14.86 ? 357 GLN A C     1 
ATOM   1717 O  O     . GLN A 1  231 ? 2.180   20.380  4.892   1.00 13.97 ? 357 GLN A O     1 
ATOM   1718 C  CB    . GLN A 1  231 ? -0.609  19.560  4.854   1.00 20.72 ? 357 GLN A CB    1 
ATOM   1719 C  CG    . GLN A 1  231 ? -1.951  19.679  5.580   1.00 22.75 ? 357 GLN A CG    1 
ATOM   1720 C  CD    . GLN A 1  231 ? -2.422  18.354  6.104   1.00 32.89 ? 357 GLN A CD    1 
ATOM   1721 N  N     . GLY A 1  232 ? 1.865   21.145  2.821   1.00 13.19 ? 358 GLY A N     1 
ATOM   1722 C  CA    . GLY A 1  232 ? 3.273   21.104  2.490   1.00 18.27 ? 358 GLY A CA    1 
ATOM   1723 C  C     . GLY A 1  232 ? 3.833   19.703  2.307   1.00 18.21 ? 358 GLY A C     1 
ATOM   1724 O  O     . GLY A 1  232 ? 5.043   19.523  2.386   1.00 14.89 ? 358 GLY A O     1 
ATOM   1725 N  N     . LEU A 1  233 ? 2.970   18.720  2.024   1.00 13.41 ? 359 LEU A N     1 
ATOM   1726 C  CA    . LEU A 1  233 ? 3.384   17.317  1.990   1.00 11.79 ? 359 LEU A CA    1 
ATOM   1727 C  C     . LEU A 1  233 ? 3.706   16.808  0.595   1.00 12.26 ? 359 LEU A C     1 
ATOM   1728 O  O     . LEU A 1  233 ? 4.218   15.691  0.441   1.00 13.94 ? 359 LEU A O     1 
ATOM   1729 C  CB    . LEU A 1  233 ? 2.281   16.432  2.567   1.00 10.43 ? 359 LEU A CB    1 
ATOM   1730 C  CG    . LEU A 1  233 ? 2.153   16.619  4.074   1.00 13.15 ? 359 LEU A CG    1 
ATOM   1731 C  CD1   . LEU A 1  233 ? 0.975   15.807  4.617   1.00 29.40 ? 359 LEU A CD1   1 
ATOM   1732 C  CD2   . LEU A 1  233 ? 3.463   16.253  4.771   1.00 21.47 ? 359 LEU A CD2   1 
ATOM   1733 N  N     . ILE A 1  234 ? 3.386   17.594  -0.420  1.00 9.70  ? 360 ILE A N     1 
ATOM   1734 C  CA    . ILE A 1  234 ? 3.530   17.138  -1.786  1.00 7.42  ? 360 ILE A CA    1 
ATOM   1735 C  C     . ILE A 1  234 ? 4.741   17.783  -2.445  1.00 13.68 ? 360 ILE A C     1 
ATOM   1736 O  O     . ILE A 1  234 ? 4.739   18.975  -2.687  1.00 13.38 ? 360 ILE A O     1 
ATOM   1737 C  CB    . ILE A 1  234 ? 2.258   17.425  -2.618  1.00 8.89  ? 360 ILE A CB    1 
ATOM   1738 C  CG1   . ILE A 1  234 ? 1.046   16.799  -1.940  1.00 11.22 ? 360 ILE A CG1   1 
ATOM   1739 C  CG2   . ILE A 1  234 ? 2.380   16.926  -4.087  1.00 11.32 ? 360 ILE A CG2   1 
ATOM   1740 C  CD1   . ILE A 1  234 ? 1.216   15.279  -1.742  1.00 10.98 ? 360 ILE A CD1   1 
ATOM   1741 N  N     . LEU A 1  235 ? 5.776   16.991  -2.717  1.00 9.59  ? 361 LEU A N     1 
ATOM   1742 C  CA    . LEU A 1  235 ? 6.938   17.466  -3.481  1.00 11.53 ? 361 LEU A CA    1 
ATOM   1743 C  C     . LEU A 1  235 ? 6.633   17.493  -4.968  1.00 12.04 ? 361 LEU A C     1 
ATOM   1744 O  O     . LEU A 1  235 ? 7.151   18.343  -5.688  1.00 13.74 ? 361 LEU A O     1 
ATOM   1745 C  CB    . LEU A 1  235 ? 8.177   16.579  -3.199  1.00 5.43  ? 361 LEU A CB    1 
ATOM   1746 C  CG    . LEU A 1  235 ? 8.603   16.623  -1.730  1.00 12.75 ? 361 LEU A CG    1 
ATOM   1747 C  CD1   . LEU A 1  235 ? 9.437   15.404  -1.347  1.00 9.68  ? 361 LEU A CD1   1 
ATOM   1748 C  CD2   . LEU A 1  235 ? 9.418   17.911  -1.472  1.00 11.97 ? 361 LEU A CD2   1 
ATOM   1749 N  N     . TYR A 1  236 ? 5.801   16.561  -5.448  1.00 9.63  ? 362 TYR A N     1 
ATOM   1750 C  CA    . TYR A 1  236 ? 5.427   16.533  -6.867  1.00 10.05 ? 362 TYR A CA    1 
ATOM   1751 C  C     . TYR A 1  236 ? 4.067   15.879  -7.089  1.00 14.66 ? 362 TYR A C     1 
ATOM   1752 O  O     . TYR A 1  236 ? 3.744   14.886  -6.447  1.00 11.74 ? 362 TYR A O     1 
ATOM   1753 C  CB    . TYR A 1  236 ? 6.465   15.774  -7.734  1.00 13.59 ? 362 TYR A CB    1 
ATOM   1754 C  CG    . TYR A 1  236 ? 5.956   15.489  -9.163  1.00 14.86 ? 362 TYR A CG    1 
ATOM   1755 C  CD1   . TYR A 1  236 ? 6.202   16.375  -10.212 1.00 22.56 ? 362 TYR A CD1   1 
ATOM   1756 C  CD2   . TYR A 1  236 ? 5.195   14.345  -9.444  1.00 20.64 ? 362 TYR A CD2   1 
ATOM   1757 C  CE1   . TYR A 1  236 ? 5.707   16.119  -11.510 1.00 18.09 ? 362 TYR A CE1   1 
ATOM   1758 C  CE2   . TYR A 1  236 ? 4.711   14.091  -10.710 1.00 21.31 ? 362 TYR A CE2   1 
ATOM   1759 C  CZ    . TYR A 1  236 ? 4.971   14.976  -11.741 1.00 24.92 ? 362 TYR A CZ    1 
ATOM   1760 O  OH    . TYR A 1  236 ? 4.474   14.692  -13.001 1.00 35.59 ? 362 TYR A OH    1 
ATOM   1761 N  N     . HIS A 1  237 ? 3.277   16.427  -8.009  1.00 18.89 ? 363 HIS A N     1 
ATOM   1762 C  CA    . HIS A 1  237 ? 2.132   15.687  -8.578  1.00 16.87 ? 363 HIS A CA    1 
ATOM   1763 C  C     . HIS A 1  237 ? 1.693   16.330  -9.884  1.00 18.59 ? 363 HIS A C     1 
ATOM   1764 O  O     . HIS A 1  237 ? 2.158   17.420  -10.226 1.00 21.16 ? 363 HIS A O     1 
ATOM   1765 C  CB    . HIS A 1  237 ? 0.940   15.621  -7.610  1.00 21.02 ? 363 HIS A CB    1 
ATOM   1766 C  CG    . HIS A 1  237 ? 0.177   16.903  -7.480  0.50 17.65 ? 363 HIS A CG    1 
ATOM   1767 N  ND1   . HIS A 1  237 ? -1.184  16.980  -7.694  0.50 21.45 ? 363 HIS A ND1   1 
ATOM   1768 C  CD2   . HIS A 1  237 ? 0.573   18.150  -7.130  0.50 20.81 ? 363 HIS A CD2   1 
ATOM   1769 C  CE1   . HIS A 1  237 ? -1.591  18.221  -7.489  0.50 23.41 ? 363 HIS A CE1   1 
ATOM   1770 N  NE2   . HIS A 1  237 ? -0.545  18.951  -7.146  0.50 26.75 ? 363 HIS A NE2   1 
ATOM   1771 N  N     . GLN A 1  238 ? 0.775   15.660  -10.572 1.00 25.94 ? 364 GLN A N     1 
ATOM   1772 C  CA    . GLN A 1  238 ? -0.019  16.210  -11.689 1.00 34.93 ? 364 GLN A CA    1 
ATOM   1773 C  C     . GLN A 1  238 ? 0.778   16.388  -12.952 1.00 43.18 ? 364 GLN A C     1 
ATOM   1774 O  O     . GLN A 1  238 ? 0.479   17.293  -13.721 1.00 51.77 ? 364 GLN A O     1 
ATOM   1775 C  CB    . GLN A 1  238 ? -0.721  17.546  -11.332 1.00 21.88 ? 364 GLN A CB    1 
ATOM   1776 N  N     . PHE A 1  259 ? -10.040 13.695  -12.048 1.00 28.16 ? 385 PHE A N     1 
ATOM   1777 C  CA    . PHE A 1  259 ? -9.151  12.547  -12.273 1.00 14.18 ? 385 PHE A CA    1 
ATOM   1778 C  C     . PHE A 1  259 ? -9.351  11.482  -11.181 1.00 21.56 ? 385 PHE A C     1 
ATOM   1779 O  O     . PHE A 1  259 ? -9.945  11.774  -10.152 1.00 22.02 ? 385 PHE A O     1 
ATOM   1780 C  CB    . PHE A 1  259 ? -7.684  13.023  -12.406 1.00 17.79 ? 385 PHE A CB    1 
ATOM   1781 C  CG    . PHE A 1  259 ? -7.194  13.890  -11.245 1.00 27.65 ? 385 PHE A CG    1 
ATOM   1782 C  CD1   . PHE A 1  259 ? -7.591  15.223  -11.117 1.00 41.22 ? 385 PHE A CD1   1 
ATOM   1783 C  CD2   . PHE A 1  259 ? -6.293  13.387  -10.308 1.00 24.49 ? 385 PHE A CD2   1 
ATOM   1784 C  CE1   . PHE A 1  259 ? -7.117  16.033  -10.049 1.00 30.89 ? 385 PHE A CE1   1 
ATOM   1785 C  CE2   . PHE A 1  259 ? -5.817  14.197  -9.233  1.00 22.62 ? 385 PHE A CE2   1 
ATOM   1786 C  CZ    . PHE A 1  259 ? -6.237  15.508  -9.103  1.00 21.44 ? 385 PHE A CZ    1 
ATOM   1787 N  N     . GLU A 1  260 ? -8.862  10.261  -11.434 1.00 16.62 ? 386 GLU A N     1 
ATOM   1788 C  CA    . GLU A 1  260 ? -9.121  9.046   -10.639 1.00 15.28 ? 386 GLU A CA    1 
ATOM   1789 C  C     . GLU A 1  260 ? -7.825  8.511   -9.984  1.00 14.08 ? 386 GLU A C     1 
ATOM   1790 O  O     . GLU A 1  260 ? -7.865  7.766   -8.993  1.00 8.40  ? 386 GLU A O     1 
ATOM   1791 C  CB    . GLU A 1  260 ? -9.633  7.898   -11.544 1.00 11.64 ? 386 GLU A CB    1 
ATOM   1792 C  CG    . GLU A 1  260 ? -10.884 8.114   -12.374 1.00 24.39 ? 386 GLU A CG    1 
ATOM   1793 C  CD    . GLU A 1  260 ? -11.289 6.879   -13.196 1.00 28.75 ? 386 GLU A CD    1 
ATOM   1794 O  OE1   . GLU A 1  260 ? -12.194 7.020   -14.050 1.00 39.30 ? 386 GLU A OE1   1 
ATOM   1795 O  OE2   . GLU A 1  260 ? -10.727 5.772   -13.011 1.00 24.54 ? 386 GLU A OE2   1 
ATOM   1796 N  N     . ARG A 1  261 ? -6.672  8.850   -10.568 1.00 9.31  ? 387 ARG A N     1 
ATOM   1797 C  CA    . ARG A 1  261 ? -5.384  8.313   -10.107 1.00 5.03  ? 387 ARG A CA    1 
ATOM   1798 C  C     . ARG A 1  261 ? -4.385  9.464   -9.987  1.00 7.78  ? 387 ARG A C     1 
ATOM   1799 O  O     . ARG A 1  261 ? -4.331  10.306  -10.875 1.00 8.57  ? 387 ARG A O     1 
ATOM   1800 C  CB    . ARG A 1  261 ? -4.846  7.328   -11.157 1.00 9.39  ? 387 ARG A CB    1 
ATOM   1801 C  CG    . ARG A 1  261 ? -5.690  6.066   -11.322 1.00 9.76  ? 387 ARG A CG    1 
ATOM   1802 C  CD    . ARG A 1  261 ? -5.157  5.188   -12.434 1.00 8.24  ? 387 ARG A CD    1 
ATOM   1803 N  NE    . ARG A 1  261 ? -6.090  4.078   -12.639 1.00 7.95  ? 387 ARG A NE    1 
ATOM   1804 C  CZ    . ARG A 1  261 ? -5.862  3.045   -13.429 1.00 10.58 ? 387 ARG A CZ    1 
ATOM   1805 N  NH1   . ARG A 1  261 ? -4.708  2.964   -14.093 1.00 11.98 ? 387 ARG A NH1   1 
ATOM   1806 N  NH2   . ARG A 1  261 ? -6.784  2.083   -13.530 1.00 10.33 ? 387 ARG A NH2   1 
ATOM   1807 N  N     . SER A 1  262 ? -3.653  9.530   -8.891  1.00 3.33  ? 388 SER A N     1 
ATOM   1808 C  CA    A SER A 1  262 ? -2.647  10.572  -8.681  0.50 7.24  ? 388 SER A CA    1 
ATOM   1809 C  CA    B SER A 1  262 ? -2.653  10.576  -8.703  0.50 7.24  ? 388 SER A CA    1 
ATOM   1810 C  C     . SER A 1  262 ? -1.319  9.908   -8.399  1.00 7.88  ? 388 SER A C     1 
ATOM   1811 O  O     . SER A 1  262 ? -1.229  9.120   -7.481  1.00 6.21  ? 388 SER A O     1 
ATOM   1812 C  CB    A SER A 1  262 ? -2.991  11.408  -7.447  0.50 9.73  ? 388 SER A CB    1 
ATOM   1813 C  CB    B SER A 1  262 ? -3.059  11.489  -7.534  0.50 9.75  ? 388 SER A CB    1 
ATOM   1814 O  OG    A SER A 1  262 ? -3.995  12.356  -7.715  0.50 15.34 ? 388 SER A OG    1 
ATOM   1815 O  OG    B SER A 1  262 ? -2.079  12.480  -7.253  0.50 9.52  ? 388 SER A OG    1 
ATOM   1816 N  N     . PHE A 1  263 ? -0.281  10.221  -9.172  1.00 6.71  ? 389 PHE A N     1 
ATOM   1817 C  CA    . PHE A 1  263 ? 1.020   9.637   -8.879  1.00 6.58  ? 389 PHE A CA    1 
ATOM   1818 C  C     . PHE A 1  263 ? 1.885   10.730  -8.215  1.00 8.32  ? 389 PHE A C     1 
ATOM   1819 O  O     . PHE A 1  263 ? 2.296   11.649  -8.874  1.00 10.22 ? 389 PHE A O     1 
ATOM   1820 C  CB    . PHE A 1  263 ? 1.643   9.113   -10.177 1.00 5.09  ? 389 PHE A CB    1 
ATOM   1821 C  CG    . PHE A 1  263 ? 0.676   8.354   -11.045 1.00 7.09  ? 389 PHE A CG    1 
ATOM   1822 C  CD1   . PHE A 1  263 ? 0.105   7.167   -10.592 1.00 8.65  ? 389 PHE A CD1   1 
ATOM   1823 C  CD2   . PHE A 1  263 ? 0.376   8.791   -12.329 1.00 9.07  ? 389 PHE A CD2   1 
ATOM   1824 C  CE1   . PHE A 1  263 ? -0.773  6.447   -11.373 1.00 9.10  ? 389 PHE A CE1   1 
ATOM   1825 C  CE2   . PHE A 1  263 ? -0.504  8.080   -13.118 1.00 9.19  ? 389 PHE A CE2   1 
ATOM   1826 C  CZ    . PHE A 1  263 ? -1.099  6.917   -12.642 1.00 11.25 ? 389 PHE A CZ    1 
ATOM   1827 N  N     . CYS A 1  264 ? 2.070   10.670  -6.899  1.00 4.83  ? 390 CYS A N     1 
ATOM   1828 C  CA    . CYS A 1  264 ? 2.646   11.764  -6.160  1.00 6.25  ? 390 CYS A CA    1 
ATOM   1829 C  C     . CYS A 1  264 ? 4.050   11.407  -5.733  1.00 8.88  ? 390 CYS A C     1 
ATOM   1830 O  O     . CYS A 1  264 ? 4.389   10.233  -5.665  1.00 5.96  ? 390 CYS A O     1 
ATOM   1831 C  CB    . CYS A 1  264 ? 1.838   12.016  -4.875  1.00 8.04  ? 390 CYS A CB    1 
ATOM   1832 S  SG    . CYS A 1  264 ? 0.079   12.189  -5.272  1.00 18.79 ? 390 CYS A SG    1 
ATOM   1833 N  N     . ILE A 1  265 ? 4.837   12.433  -5.400  1.00 5.23  ? 391 ILE A N     1 
ATOM   1834 C  CA    . ILE A 1  265 ? 6.000   12.271  -4.518  1.00 6.56  ? 391 ILE A CA    1 
ATOM   1835 C  C     . ILE A 1  265 ? 5.681   13.056  -3.245  1.00 8.64  ? 391 ILE A C     1 
ATOM   1836 O  O     . ILE A 1  265 ? 5.375   14.258  -3.324  1.00 8.05  ? 391 ILE A O     1 
ATOM   1837 C  CB    . ILE A 1  265 ? 7.279   12.807  -5.192  1.00 10.10 ? 391 ILE A CB    1 
ATOM   1838 C  CG1   . ILE A 1  265 ? 7.450   12.120  -6.554  1.00 11.73 ? 391 ILE A CG1   1 
ATOM   1839 C  CG2   . ILE A 1  265 ? 8.480   12.633  -4.241  1.00 9.14  ? 391 ILE A CG2   1 
ATOM   1840 C  CD1   . ILE A 1  265 ? 8.668   12.616  -7.424  1.00 10.05 ? 391 ILE A CD1   1 
ATOM   1841 N  N     . PHE A 1  266 ? 5.714   12.372  -2.096  1.00 8.85  ? 392 PHE A N     1 
ATOM   1842 C  CA    . PHE A 1  266 ? 5.368   12.939  -0.808  1.00 6.62  ? 392 PHE A CA    1 
ATOM   1843 C  C     . PHE A 1  266 ? 6.636   13.180  -0.029  1.00 10.24 ? 392 PHE A C     1 
ATOM   1844 O  O     . PHE A 1  266 ? 7.617   12.485  -0.197  1.00 7.88  ? 392 PHE A O     1 
ATOM   1845 C  CB    . PHE A 1  266 ? 4.656   11.905  0.068   1.00 7.13  ? 392 PHE A CB    1 
ATOM   1846 C  CG    . PHE A 1  266 ? 3.160   11.917  -0.028  1.00 7.02  ? 392 PHE A CG    1 
ATOM   1847 C  CD1   . PHE A 1  266 ? 2.394   12.050  1.125   1.00 11.90 ? 392 PHE A CD1   1 
ATOM   1848 C  CD2   . PHE A 1  266 ? 2.533   11.731  -1.240  1.00 8.38  ? 392 PHE A CD2   1 
ATOM   1849 C  CE1   . PHE A 1  266 ? 1.016   12.025  1.067   1.00 10.92 ? 392 PHE A CE1   1 
ATOM   1850 C  CE2   . PHE A 1  266 ? 1.151   11.687  -1.310  1.00 14.82 ? 392 PHE A CE2   1 
ATOM   1851 C  CZ    . PHE A 1  266 ? 0.394   11.821  -0.145  1.00 11.77 ? 392 PHE A CZ    1 
ATOM   1852 N  N     . ARG A 1  267 ? 6.567   14.146  0.865   1.00 8.39  ? 393 ARG A N     1 
ATOM   1853 C  CA    . ARG A 1  267 ? 7.582   14.380  1.860   1.00 6.76  ? 393 ARG A CA    1 
ATOM   1854 C  C     . ARG A 1  267 ? 7.305   13.579  3.120   1.00 11.82 ? 393 ARG A C     1 
ATOM   1855 O  O     . ARG A 1  267 ? 6.348   13.835  3.836   1.00 17.06 ? 393 ARG A O     1 
ATOM   1856 C  CB    . ARG A 1  267 ? 7.488   15.863  2.168   1.00 12.36 ? 393 ARG A CB    1 
ATOM   1857 C  CG    . ARG A 1  267 ? 8.557   16.425  2.984   1.00 21.50 ? 393 ARG A CG    1 
ATOM   1858 C  CD    . ARG A 1  267 ? 8.387   17.937  2.938   1.00 15.71 ? 393 ARG A CD    1 
ATOM   1859 N  NE    . ARG A 1  267 ? 9.178   18.494  3.989   1.00 23.97 ? 393 ARG A NE    1 
ATOM   1860 C  CZ    . ARG A 1  267 ? 10.025  19.490  3.823   1.00 13.00 ? 393 ARG A CZ    1 
ATOM   1861 N  NH1   . ARG A 1  267 ? 10.172  20.078  2.629   1.00 8.50  ? 393 ARG A NH1   1 
ATOM   1862 N  NH2   . ARG A 1  267 ? 10.699  19.882  4.878   1.00 13.75 ? 393 ARG A NH2   1 
ATOM   1863 N  N     . LEU A 1  268 ? 8.167   12.623  3.413   1.00 12.03 ? 394 LEU A N     1 
ATOM   1864 C  CA    . LEU A 1  268 ? 7.992   11.761  4.559   1.00 16.09 ? 394 LEU A CA    1 
ATOM   1865 C  C     . LEU A 1  268 ? 9.004   12.094  5.643   1.00 18.62 ? 394 LEU A C     1 
ATOM   1866 O  O     . LEU A 1  268 ? 10.218  11.997  5.417   1.00 14.41 ? 394 LEU A O     1 
ATOM   1867 C  CB    . LEU A 1  268 ? 8.202   10.308  4.167   1.00 15.61 ? 394 LEU A CB    1 
ATOM   1868 C  CG    . LEU A 1  268 ? 7.897   9.317   5.308   1.00 24.25 ? 394 LEU A CG    1 
ATOM   1869 C  CD1   . LEU A 1  268 ? 6.431   9.300   5.714   1.00 24.97 ? 394 LEU A CD1   1 
ATOM   1870 C  CD2   . LEU A 1  268 ? 8.404   7.938   4.931   1.00 22.61 ? 394 LEU A CD2   1 
ATOM   1871 N  N     . PRO A 1  269 ? 8.509   12.467  6.834   1.00 27.76 ? 395 PRO A N     1 
ATOM   1872 C  CA    . PRO A 1  269 ? 9.377   12.696  8.002   1.00 24.62 ? 395 PRO A CA    1 
ATOM   1873 C  C     . PRO A 1  269 ? 10.337  11.571  8.300   1.00 26.99 ? 395 PRO A C     1 
ATOM   1874 O  O     . PRO A 1  269 ? 9.986   10.396  8.200   1.00 25.85 ? 395 PRO A O     1 
ATOM   1875 C  CB    . PRO A 1  269 ? 8.376   12.886  9.138   1.00 31.77 ? 395 PRO A CB    1 
ATOM   1876 C  CG    . PRO A 1  269 ? 7.253   13.631  8.462   1.00 32.93 ? 395 PRO A CG    1 
ATOM   1877 C  CD    . PRO A 1  269 ? 7.146   12.985  7.062   1.00 31.77 ? 395 PRO A CD    1 
ATOM   1878 N  N     . GLN A 1  270 ? 11.573  11.974  8.592   1.00 25.31 ? 396 GLN A N     1 
ATOM   1879 C  CA    . GLN A 1  270 ? 12.668  11.122  9.005   1.00 24.37 ? 396 GLN A CA    1 
ATOM   1880 C  C     . GLN A 1  270 ? 13.281  11.850  10.198  1.00 32.08 ? 396 GLN A C     1 
ATOM   1881 O  O     . GLN A 1  270 ? 13.124  13.068  10.329  1.00 34.35 ? 396 GLN A O     1 
ATOM   1882 C  CB    . GLN A 1  270 ? 13.737  11.024  7.909   1.00 31.38 ? 396 GLN A CB    1 
ATOM   1883 C  CG    . GLN A 1  270 ? 13.329  10.321  6.626   1.00 20.21 ? 396 GLN A CG    1 
ATOM   1884 C  CD    . GLN A 1  270 ? 13.325  8.829   6.770   1.00 38.45 ? 396 GLN A CD    1 
ATOM   1885 O  OE1   . GLN A 1  270 ? 14.316  8.164   6.455   1.00 42.36 ? 396 GLN A OE1   1 
ATOM   1886 N  NE2   . GLN A 1  270 ? 12.209  8.283   7.245   1.00 30.75 ? 396 GLN A NE2   1 
ATOM   1887 N  N     . PRO A 1  271 ? 13.982  11.117  11.072  1.00 43.66 ? 397 PRO A N     1 
ATOM   1888 C  CA    . PRO A 1  271 ? 14.631  11.763  12.221  1.00 41.78 ? 397 PRO A CA    1 
ATOM   1889 C  C     . PRO A 1  271 ? 15.473  12.994  11.831  1.00 34.79 ? 397 PRO A C     1 
ATOM   1890 O  O     . PRO A 1  271 ? 16.479  12.868  11.120  1.00 33.71 ? 397 PRO A O     1 
ATOM   1891 C  CB    . PRO A 1  271 ? 15.521  10.642  12.794  1.00 43.81 ? 397 PRO A CB    1 
ATOM   1892 C  CG    . PRO A 1  271 ? 15.544  9.548   11.738  1.00 48.51 ? 397 PRO A CG    1 
ATOM   1893 C  CD    . PRO A 1  271 ? 14.228  9.664   11.045  1.00 40.16 ? 397 PRO A CD    1 
ATOM   1894 N  N     . GLY A 1  272 ? 15.042  14.176  12.273  1.00 28.36 ? 410 GLY A N     1 
ATOM   1895 C  CA    . GLY A 1  272 ? 15.766  15.402  11.986  1.00 31.93 ? 410 GLY A CA    1 
ATOM   1896 C  C     . GLY A 1  272 ? 15.772  15.827  10.522  1.00 31.36 ? 410 GLY A C     1 
ATOM   1897 O  O     . GLY A 1  272 ? 16.478  16.765  10.120  1.00 29.42 ? 410 GLY A O     1 
ATOM   1898 N  N     . SER A 1  273 ? 14.971  15.149  9.709   1.00 28.74 ? 411 SER A N     1 
ATOM   1899 C  CA    . SER A 1  273 ? 14.943  15.467  8.297   1.00 17.13 ? 411 SER A CA    1 
ATOM   1900 C  C     . SER A 1  273 ? 13.699  14.871  7.630   1.00 18.92 ? 411 SER A C     1 
ATOM   1901 O  O     . SER A 1  273 ? 12.656  14.752  8.254   1.00 17.86 ? 411 SER A O     1 
ATOM   1902 C  CB    . SER A 1  273 ? 16.195  14.931  7.638   1.00 17.32 ? 411 SER A CB    1 
ATOM   1903 O  OG    . SER A 1  273 ? 16.342  15.525  6.385   1.00 16.96 ? 411 SER A OG    1 
ATOM   1904 N  N     . TRP A 1  274 ? 13.821  14.485  6.370   1.00 11.26 ? 412 TRP A N     1 
ATOM   1905 C  CA    . TRP A 1  274 ? 12.689  13.845  5.672   1.00 13.83 ? 412 TRP A CA    1 
ATOM   1906 C  C     . TRP A 1  274 ? 13.210  13.161  4.427   1.00 12.00 ? 412 TRP A C     1 
ATOM   1907 O  O     . TRP A 1  274 ? 14.365  13.357  4.064   1.00 12.10 ? 412 TRP A O     1 
ATOM   1908 C  CB    . TRP A 1  274 ? 11.659  14.886  5.274   1.00 9.73  ? 412 TRP A CB    1 
ATOM   1909 C  CG    . TRP A 1  274 ? 12.218  16.059  4.512   1.00 14.32 ? 412 TRP A CG    1 
ATOM   1910 C  CD1   . TRP A 1  274 ? 12.705  17.224  5.048   1.00 12.71 ? 412 TRP A CD1   1 
ATOM   1911 C  CD2   . TRP A 1  274 ? 12.331  16.203  3.082   1.00 13.28 ? 412 TRP A CD2   1 
ATOM   1912 N  NE1   . TRP A 1  274 ? 13.098  18.072  4.052   1.00 12.15 ? 412 TRP A NE1   1 
ATOM   1913 C  CE2   . TRP A 1  274 ? 12.892  17.478  2.836   1.00 10.03 ? 412 TRP A CE2   1 
ATOM   1914 C  CE3   . TRP A 1  274 ? 12.020  15.385  1.991   1.00 11.53 ? 412 TRP A CE3   1 
ATOM   1915 C  CZ2   . TRP A 1  274 ? 13.126  17.947  1.557   1.00 13.20 ? 412 TRP A CZ2   1 
ATOM   1916 C  CZ3   . TRP A 1  274 ? 12.253  15.859  0.721   1.00 11.31 ? 412 TRP A CZ3   1 
ATOM   1917 C  CH2   . TRP A 1  274 ? 12.799  17.132  0.515   1.00 10.99 ? 412 TRP A CH2   1 
ATOM   1918 N  N     . LYS A 1  275 ? 12.379  12.355  3.760   1.00 8.12  ? 413 LYS A N     1 
ATOM   1919 C  CA    . LYS A 1  275 ? 12.788  11.835  2.452   1.00 6.19  ? 413 LYS A CA    1 
ATOM   1920 C  C     . LYS A 1  275 ? 11.597  11.789  1.515   1.00 5.47  ? 413 LYS A C     1 
ATOM   1921 O  O     . LYS A 1  275 ? 10.436  11.786  1.971   1.00 7.75  ? 413 LYS A O     1 
ATOM   1922 C  CB    . LYS A 1  275 ? 13.424  10.436  2.549   1.00 6.86  ? 413 LYS A CB    1 
ATOM   1923 C  CG    . LYS A 1  275 ? 12.438  9.377   3.020   1.00 13.57 ? 413 LYS A CG    1 
ATOM   1924 C  CD    . LYS A 1  275 ? 12.973  7.919   2.971   1.00 13.99 ? 413 LYS A CD    1 
ATOM   1925 C  CE    . LYS A 1  275 ? 11.966  7.024   3.748   1.00 27.50 ? 413 LYS A CE    1 
ATOM   1926 N  NZ    . LYS A 1  275 ? 12.237  5.548   3.764   1.00 22.28 ? 413 LYS A NZ    1 
ATOM   1927 N  N     . ALA A 1  276 ? 11.879  11.818  0.218   1.00 6.83  ? 414 ALA A N     1 
ATOM   1928 C  CA    . ALA A 1  276 ? 10.832  11.804  -0.806  1.00 6.84  ? 414 ALA A CA    1 
ATOM   1929 C  C     . ALA A 1  276 ? 10.374  10.353  -0.955  1.00 7.88  ? 414 ALA A C     1 
ATOM   1930 O  O     . ALA A 1  276 ? 11.211  9.437   -0.945  1.00 5.61  ? 414 ALA A O     1 
ATOM   1931 C  CB    . ALA A 1  276 ? 11.389  12.297  -2.114  1.00 10.13 ? 414 ALA A CB    1 
ATOM   1932 N  N     . VAL A 1  277 ? 9.068   10.143  -1.081  1.00 5.83  ? 415 VAL A N     1 
ATOM   1933 C  CA    . VAL A 1  277 ? 8.519   8.775   -1.245  1.00 3.57  ? 415 VAL A CA    1 
ATOM   1934 C  C     . VAL A 1  277 ? 7.404   8.829   -2.292  1.00 5.59  ? 415 VAL A C     1 
ATOM   1935 O  O     . VAL A 1  277 ? 6.610   9.768   -2.306  1.00 7.51  ? 415 VAL A O     1 
ATOM   1936 C  CB    . VAL A 1  277 ? 7.940   8.226   0.084   1.00 8.51  ? 415 VAL A CB    1 
ATOM   1937 C  CG1   . VAL A 1  277 ? 7.320   6.822   -0.124  1.00 6.61  ? 415 VAL A CG1   1 
ATOM   1938 C  CG2   . VAL A 1  277 ? 9.023   8.092   1.137   1.00 8.82  ? 415 VAL A CG2   1 
ATOM   1939 N  N     . ARG A 1  278 ? 7.355   7.832   -3.180  1.00 4.65  ? 416 ARG A N     1 
ATOM   1940 C  CA    . ARG A 1  278 ? 6.320   7.758   -4.202  1.00 3.20  ? 416 ARG A CA    1 
ATOM   1941 C  C     . ARG A 1  278 ? 5.049   7.181   -3.560  1.00 3.84  ? 416 ARG A C     1 
ATOM   1942 O  O     . ARG A 1  278 ? 5.093   6.175   -2.869  1.00 4.03  ? 416 ARG A O     1 
ATOM   1943 C  CB    . ARG A 1  278 ? 6.795   6.829   -5.345  1.00 2.48  ? 416 ARG A CB    1 
ATOM   1944 C  CG    . ARG A 1  278 ? 7.674   7.571   -6.399  1.00 6.52  ? 416 ARG A CG    1 
ATOM   1945 C  CD    . ARG A 1  278 ? 6.766   8.282   -7.435  1.00 6.64  ? 416 ARG A CD    1 
ATOM   1946 N  NE    . ARG A 1  278 ? 5.972   7.321   -8.221  1.00 5.14  ? 416 ARG A NE    1 
ATOM   1947 C  CZ    . ARG A 1  278 ? 4.652   7.094   -8.097  1.00 6.90  ? 416 ARG A CZ    1 
ATOM   1948 N  NH1   . ARG A 1  278 ? 3.899   7.799   -7.264  1.00 4.00  ? 416 ARG A NH1   1 
ATOM   1949 N  NH2   . ARG A 1  278 ? 4.073   6.159   -8.840  1.00 4.10  ? 416 ARG A NH2   1 
ATOM   1950 N  N     . VAL A 1  279 ? 3.929   7.853   -3.780  1.00 3.51  ? 417 VAL A N     1 
ATOM   1951 C  CA    . VAL A 1  279 ? 2.637   7.405   -3.246  1.00 3.62  ? 417 VAL A CA    1 
ATOM   1952 C  C     . VAL A 1  279 ? 1.645   7.529   -4.367  1.00 3.86  ? 417 VAL A C     1 
ATOM   1953 O  O     . VAL A 1  279 ? 1.612   8.568   -5.030  1.00 4.73  ? 417 VAL A O     1 
ATOM   1954 C  CB    . VAL A 1  279 ? 2.163   8.317   -2.083  1.00 6.26  ? 417 VAL A CB    1 
ATOM   1955 C  CG1   . VAL A 1  279 ? 0.778   7.894   -1.616  1.00 3.94  ? 417 VAL A CG1   1 
ATOM   1956 C  CG2   . VAL A 1  279 ? 3.173   8.292   -0.912  1.00 4.04  ? 417 VAL A CG2   1 
ATOM   1957 N  N     . ASP A 1  280 ? 0.852   6.473   -4.590  1.00 2.29  ? 418 ASP A N     1 
ATOM   1958 C  CA    . ASP A 1  280 ? -0.222  6.528   -5.558  1.00 3.54  ? 418 ASP A CA    1 
ATOM   1959 C  C     . ASP A 1  280 ? -1.548  6.613   -4.844  1.00 3.19  ? 418 ASP A C     1 
ATOM   1960 O  O     . ASP A 1  280 ? -1.789  5.849   -3.899  1.00 2.11  ? 418 ASP A O     1 
ATOM   1961 C  CB    . ASP A 1  280 ? -0.186  5.290   -6.455  1.00 2.70  ? 418 ASP A CB    1 
ATOM   1962 C  CG    . ASP A 1  280 ? 1.016   5.306   -7.388  1.00 8.05  ? 418 ASP A CG    1 
ATOM   1963 O  OD1   . ASP A 1  280 ? 1.461   4.232   -7.811  1.00 4.96  ? 418 ASP A OD1   1 
ATOM   1964 O  OD2   . ASP A 1  280 ? 1.489   6.415   -7.695  1.00 7.41  ? 418 ASP A OD2   1 
ATOM   1965 N  N     . LEU A 1  281 ? -2.404  7.531   -5.283  1.00 3.77  ? 419 LEU A N     1 
ATOM   1966 C  CA    . LEU A 1  281 ? -3.762  7.641   -4.701  1.00 5.31  ? 419 LEU A CA    1 
ATOM   1967 C  C     . LEU A 1  281 ? -4.760  7.357   -5.760  1.00 2.52  ? 419 LEU A C     1 
ATOM   1968 O  O     . LEU A 1  281 ? -4.685  7.925   -6.857  1.00 4.43  ? 419 LEU A O     1 
ATOM   1969 C  CB    . LEU A 1  281 ? -4.016  9.057   -4.135  1.00 4.76  ? 419 LEU A CB    1 
ATOM   1970 C  CG    . LEU A 1  281 ? -3.028  9.548   -3.066  1.00 7.48  ? 419 LEU A CG    1 
ATOM   1971 C  CD1   . LEU A 1  281 ? -3.427  10.920  -2.529  1.00 9.76  ? 419 LEU A CD1   1 
ATOM   1972 C  CD2   . LEU A 1  281 ? -2.902  8.585   -1.871  1.00 5.82  ? 419 LEU A CD2   1 
ATOM   1973 N  N     . VAL A 1  282 ? -5.745  6.494   -5.457  1.00 1.95  ? 420 VAL A N     1 
ATOM   1974 C  CA    . VAL A 1  282 ? -6.691  6.097   -6.481  1.00 1.37  ? 420 VAL A CA    1 
ATOM   1975 C  C     . VAL A 1  282 ? -8.066  6.153   -5.851  1.00 2.20  ? 420 VAL A C     1 
ATOM   1976 O  O     . VAL A 1  282 ? -8.195  5.817   -4.681  1.00 2.23  ? 420 VAL A O     1 
ATOM   1977 C  CB    . VAL A 1  282 ? -6.438  4.647   -6.895  1.00 4.19  ? 420 VAL A CB    1 
ATOM   1978 C  CG1   . VAL A 1  282 ? -7.472  4.193   -7.997  1.00 6.56  ? 420 VAL A CG1   1 
ATOM   1979 C  CG2   . VAL A 1  282 ? -4.988  4.489   -7.367  1.00 7.39  ? 420 VAL A CG2   1 
ATOM   1980 N  N     . VAL A 1  283 ? -9.050  6.633   -6.593  1.00 2.43  ? 421 VAL A N     1 
ATOM   1981 C  CA    . VAL A 1  283 ? -10.428 6.687   -6.094  1.00 1.60  ? 421 VAL A CA    1 
ATOM   1982 C  C     . VAL A 1  283 ? -11.318 5.796   -6.929  1.00 5.92  ? 421 VAL A C     1 
ATOM   1983 O  O     . VAL A 1  283 ? -11.175 5.740   -8.133  1.00 5.81  ? 421 VAL A O     1 
ATOM   1984 C  CB    . VAL A 1  283 ? -10.968 8.134   -6.110  1.00 1.15  ? 421 VAL A CB    1 
ATOM   1985 C  CG1   . VAL A 1  283 ? -12.459 8.187   -5.720  1.00 5.14  ? 421 VAL A CG1   1 
ATOM   1986 C  CG2   . VAL A 1  283 ? -10.207 9.011   -5.115  1.00 4.72  ? 421 VAL A CG2   1 
ATOM   1987 N  N     . ALA A 1  284 ? -12.242 5.091   -6.285  1.00 2.07  ? 422 ALA A N     1 
ATOM   1988 C  CA    . ALA A 1  284 ? -13.213 4.281   -7.019  1.00 4.28  ? 422 ALA A CA    1 
ATOM   1989 C  C     . ALA A 1  284 ? -14.540 4.422   -6.320  1.00 2.43  ? 422 ALA A C     1 
ATOM   1990 O  O     . ALA A 1  284 ? -14.589 4.534   -5.109  1.00 2.48  ? 422 ALA A O     1 
ATOM   1991 C  CB    . ALA A 1  284 ? -12.808 2.817   -6.974  1.00 4.06  ? 422 ALA A CB    1 
ATOM   1992 N  N     . PRO A 1  285 ? -15.630 4.376   -7.073  1.00 6.07  ? 423 PRO A N     1 
ATOM   1993 C  CA    . PRO A 1  285 ? -16.952 4.323   -6.431  1.00 5.01  ? 423 PRO A CA    1 
ATOM   1994 C  C     . PRO A 1  285 ? -17.138 2.990   -5.699  1.00 5.81  ? 423 PRO A C     1 
ATOM   1995 O  O     . PRO A 1  285 ? -16.539 1.983   -6.135  1.00 5.67  ? 423 PRO A O     1 
ATOM   1996 C  CB    . PRO A 1  285 ? -17.940 4.388   -7.612  1.00 7.91  ? 423 PRO A CB    1 
ATOM   1997 C  CG    . PRO A 1  285 ? -17.167 4.015   -8.810  1.00 7.82  ? 423 PRO A CG    1 
ATOM   1998 C  CD    . PRO A 1  285 ? -15.674 4.325   -8.540  1.00 5.16  ? 423 PRO A CD    1 
ATOM   1999 N  N     . VAL A 1  286 ? -17.935 2.955   -4.631  1.00 4.44  ? 424 VAL A N     1 
ATOM   2000 C  CA    . VAL A 1  286 ? -18.044 1.720   -3.857  1.00 5.72  ? 424 VAL A CA    1 
ATOM   2001 C  C     . VAL A 1  286 ? -18.517 0.502   -4.683  1.00 7.44  ? 424 VAL A C     1 
ATOM   2002 O  O     . VAL A 1  286 ? -18.049 -0.616  -4.437  1.00 5.18  ? 424 VAL A O     1 
ATOM   2003 C  CB    . VAL A 1  286 ? -18.820 1.907   -2.491  1.00 5.66  ? 424 VAL A CB    1 
ATOM   2004 C  CG1   . VAL A 1  286 ? -20.328 2.231   -2.709  1.00 6.57  ? 424 VAL A CG1   1 
ATOM   2005 C  CG2   . VAL A 1  286 ? -18.637 0.659   -1.618  1.00 10.55 ? 424 VAL A CG2   1 
ATOM   2006 N  N     . SER A 1  287 ? -19.346 0.703   -5.715  1.00 6.67  ? 425 SER A N     1 
ATOM   2007 C  CA    . SER A 1  287 ? -19.761 -0.412  -6.563  1.00 7.93  ? 425 SER A CA    1 
ATOM   2008 C  C     . SER A 1  287 ? -18.569 -1.070  -7.237  1.00 7.39  ? 425 SER A C     1 
ATOM   2009 O  O     . SER A 1  287 ? -18.587 -2.259  -7.543  1.00 7.52  ? 425 SER A O     1 
ATOM   2010 C  CB    . SER A 1  287 ? -20.721 0.044   -7.679  1.00 8.07  ? 425 SER A CB    1 
ATOM   2011 O  OG    . SER A 1  287 ? -20.145 1.107   -8.436  1.00 8.74  ? 425 SER A OG    1 
ATOM   2012 N  N     . GLN A 1  288 ? -17.542 -0.288  -7.519  1.00 5.59  ? 426 GLN A N     1 
ATOM   2013 C  CA    . GLN A 1  288 ? -16.388 -0.827  -8.247  1.00 5.83  ? 426 GLN A CA    1 
ATOM   2014 C  C     . GLN A 1  288 ? -15.245 -1.189  -7.294  1.00 5.57  ? 426 GLN A C     1 
ATOM   2015 O  O     . GLN A 1  288 ? -14.222 -1.733  -7.728  1.00 3.86  ? 426 GLN A O     1 
ATOM   2016 C  CB    . GLN A 1  288 ? -15.872 0.209   -9.257  1.00 5.68  ? 426 GLN A CB    1 
ATOM   2017 C  CG    . GLN A 1  288 ? -16.887 0.500   -10.341 1.00 7.13  ? 426 GLN A CG    1 
ATOM   2018 C  CD    . GLN A 1  288 ? -16.416 1.514   -11.320 1.00 12.18 ? 426 GLN A CD    1 
ATOM   2019 O  OE1   . GLN A 1  288 ? -15.258 1.947   -11.303 1.00 13.28 ? 426 GLN A OE1   1 
ATOM   2020 N  NE2   . GLN A 1  288 ? -17.307 1.896   -12.212 1.00 12.56 ? 426 GLN A NE2   1 
ATOM   2021 N  N     . PHE A 1  289 ? -15.421 -0.910  -6.003  1.00 3.99  ? 427 PHE A N     1 
ATOM   2022 C  CA    . PHE A 1  289 ? -14.296 -1.051  -5.063  1.00 5.11  ? 427 PHE A CA    1 
ATOM   2023 C  C     . PHE A 1  289 ? -13.638 -2.444  -5.076  1.00 4.26  ? 427 PHE A C     1 
ATOM   2024 O  O     . PHE A 1  289 ? -12.417 -2.525  -5.124  1.00 2.59  ? 427 PHE A O     1 
ATOM   2025 C  CB    . PHE A 1  289 ? -14.702 -0.598  -3.648  1.00 6.93  ? 427 PHE A CB    1 
ATOM   2026 C  CG    . PHE A 1  289 ? -13.656 -0.831  -2.601  1.00 4.62  ? 427 PHE A CG    1 
ATOM   2027 C  CD1   . PHE A 1  289 ? -12.705 0.142   -2.300  1.00 3.72  ? 427 PHE A CD1   1 
ATOM   2028 C  CD2   . PHE A 1  289 ? -13.659 -2.011  -1.880  1.00 6.36  ? 427 PHE A CD2   1 
ATOM   2029 C  CE1   . PHE A 1  289 ? -11.756 -0.085  -1.254  1.00 7.33  ? 427 PHE A CE1   1 
ATOM   2030 C  CE2   . PHE A 1  289 ? -12.725 -2.261  -0.877  1.00 12.28 ? 427 PHE A CE2   1 
ATOM   2031 C  CZ    . PHE A 1  289 ? -11.768 -1.314  -0.561  1.00 7.16  ? 427 PHE A CZ    1 
ATOM   2032 N  N     . PRO A 1  290 ? -14.433 -3.534  -5.096  1.00 2.83  ? 428 PRO A N     1 
ATOM   2033 C  CA    . PRO A 1  290 ? -13.791 -4.862  -5.108  1.00 1.95  ? 428 PRO A CA    1 
ATOM   2034 C  C     . PRO A 1  290 ? -12.888 -5.053  -6.309  1.00 2.28  ? 428 PRO A C     1 
ATOM   2035 O  O     . PRO A 1  290 ? -11.821 -5.638  -6.217  1.00 3.08  ? 428 PRO A O     1 
ATOM   2036 C  CB    . PRO A 1  290 ? -14.993 -5.832  -5.218  1.00 1.60  ? 428 PRO A CB    1 
ATOM   2037 C  CG    . PRO A 1  290 ? -16.104 -5.096  -4.481  1.00 5.95  ? 428 PRO A CG    1 
ATOM   2038 C  CD    . PRO A 1  290 ? -15.896 -3.640  -4.953  1.00 2.80  ? 428 PRO A CD    1 
ATOM   2039 N  N     . PHE A 1  291 ? -13.338 -4.551  -7.445  1.00 3.08  ? 429 PHE A N     1 
ATOM   2040 C  CA    . PHE A 1  291 ? -12.545 -4.694  -8.652  1.00 3.14  ? 429 PHE A CA    1 
ATOM   2041 C  C     . PHE A 1  291 ? -11.294 -3.846  -8.583  1.00 3.17  ? 429 PHE A C     1 
ATOM   2042 O  O     . PHE A 1  291 ? -10.264 -4.248  -9.076  1.00 2.76  ? 429 PHE A O     1 
ATOM   2043 C  CB    . PHE A 1  291 ? -13.378 -4.280  -9.879  1.00 2.85  ? 429 PHE A CB    1 
ATOM   2044 C  CG    . PHE A 1  291 ? -14.555 -5.161  -10.106 1.00 3.47  ? 429 PHE A CG    1 
ATOM   2045 C  CD1   . PHE A 1  291 ? -15.840 -4.752  -9.713  1.00 6.13  ? 429 PHE A CD1   1 
ATOM   2046 C  CD2   . PHE A 1  291 ? -14.396 -6.408  -10.693 1.00 3.09  ? 429 PHE A CD2   1 
ATOM   2047 C  CE1   . PHE A 1  291 ? -16.946 -5.618  -9.916  1.00 4.26  ? 429 PHE A CE1   1 
ATOM   2048 C  CE2   . PHE A 1  291 ? -15.479 -7.257  -10.908 1.00 2.56  ? 429 PHE A CE2   1 
ATOM   2049 C  CZ    . PHE A 1  291 ? -16.768 -6.852  -10.510 1.00 5.99  ? 429 PHE A CZ    1 
ATOM   2050 N  N     . ALA A 1  292 ? -11.401 -2.649  -8.007  1.00 2.68  ? 430 ALA A N     1 
ATOM   2051 C  CA    . ALA A 1  292 ? -10.238 -1.770  -7.960  1.00 3.04  ? 430 ALA A CA    1 
ATOM   2052 C  C     . ALA A 1  292 ? -9.257  -2.297  -6.898  1.00 2.23  ? 430 ALA A C     1 
ATOM   2053 O  O     . ALA A 1  292 ? -8.052  -2.204  -7.061  1.00 2.69  ? 430 ALA A O     1 
ATOM   2054 C  CB    . ALA A 1  292 ? -10.684 -0.348  -7.608  1.00 3.01  ? 430 ALA A CB    1 
ATOM   2055 N  N     . LEU A 1  293 ? -9.796  -2.797  -5.783  1.00 2.03  ? 431 LEU A N     1 
ATOM   2056 C  CA    . LEU A 1  293 ? -8.954  -3.423  -4.764  1.00 3.65  ? 431 LEU A CA    1 
ATOM   2057 C  C     . LEU A 1  293 ? -8.199  -4.611  -5.366  1.00 2.63  ? 431 LEU A C     1 
ATOM   2058 O  O     . LEU A 1  293 ? -6.987  -4.772  -5.194  1.00 2.14  ? 431 LEU A O     1 
ATOM   2059 C  CB    . LEU A 1  293 ? -9.818  -3.886  -3.583  1.00 2.61  ? 431 LEU A CB    1 
ATOM   2060 C  CG    . LEU A 1  293 ? -9.071  -4.540  -2.432  1.00 1.93  ? 431 LEU A CG    1 
ATOM   2061 C  CD1   . LEU A 1  293 ? -8.032  -3.571  -1.850  1.00 1.51  ? 431 LEU A CD1   1 
ATOM   2062 C  CD2   . LEU A 1  293 ? -10.066 -4.987  -1.361  1.00 4.56  ? 431 LEU A CD2   1 
ATOM   2063 N  N     . LEU A 1  294 ? -8.914  -5.448  -6.093  1.00 2.36  ? 432 LEU A N     1 
ATOM   2064 C  CA    . LEU A 1  294 ? -8.269  -6.635  -6.668  1.00 2.14  ? 432 LEU A CA    1 
ATOM   2065 C  C     . LEU A 1  294 ? -7.168  -6.196  -7.627  1.00 2.24  ? 432 LEU A C     1 
ATOM   2066 O  O     . LEU A 1  294 ? -6.022  -6.648  -7.547  1.00 1.06  ? 432 LEU A O     1 
ATOM   2067 C  CB    . LEU A 1  294 ? -9.326  -7.444  -7.409  1.00 1.79  ? 432 LEU A CB    1 
ATOM   2068 C  CG    . LEU A 1  294 ? -8.863  -8.692  -8.144  1.00 1.63  ? 432 LEU A CG    1 
ATOM   2069 C  CD1   . LEU A 1  294 ? -8.233  -9.728  -7.175  1.00 2.46  ? 432 LEU A CD1   1 
ATOM   2070 C  CD2   . LEU A 1  294 ? -10.059 -9.335  -8.892  1.00 0.77  ? 432 LEU A CD2   1 
ATOM   2071 N  N     . GLY A 1  295 ? -7.507  -5.273  -8.526  1.00 1.79  ? 433 GLY A N     1 
ATOM   2072 C  CA    . GLY A 1  295 ? -6.508  -4.823  -9.517  1.00 1.27  ? 433 GLY A CA    1 
ATOM   2073 C  C     . GLY A 1  295 ? -5.290  -4.158  -8.860  1.00 2.51  ? 433 GLY A C     1 
ATOM   2074 O  O     . GLY A 1  295 ? -4.124  -4.470  -9.179  1.00 2.38  ? 433 GLY A O     1 
ATOM   2075 N  N     . TRP A 1  296 ? -5.537  -3.246  -7.928  1.00 2.22  ? 434 TRP A N     1 
ATOM   2076 C  CA    . TRP A 1  296 ? -4.414  -2.513  -7.303  1.00 2.45  ? 434 TRP A CA    1 
ATOM   2077 C  C     . TRP A 1  296 ? -3.617  -3.330  -6.281  1.00 2.03  ? 434 TRP A C     1 
ATOM   2078 O  O     . TRP A 1  296 ? -2.589  -2.869  -5.808  1.00 3.09  ? 434 TRP A O     1 
ATOM   2079 C  CB    . TRP A 1  296 ? -4.892  -1.181  -6.674  1.00 2.40  ? 434 TRP A CB    1 
ATOM   2080 C  CG    . TRP A 1  296 ? -5.085  -0.166  -7.756  1.00 3.21  ? 434 TRP A CG    1 
ATOM   2081 C  CD1   . TRP A 1  296 ? -6.188  -0.003  -8.554  1.00 3.65  ? 434 TRP A CD1   1 
ATOM   2082 C  CD2   . TRP A 1  296 ? -4.116  0.783   -8.194  1.00 2.99  ? 434 TRP A CD2   1 
ATOM   2083 N  NE1   . TRP A 1  296 ? -5.952  1.013   -9.486  1.00 4.21  ? 434 TRP A NE1   1 
ATOM   2084 C  CE2   . TRP A 1  296 ? -4.690  1.511   -9.272  1.00 6.19  ? 434 TRP A CE2   1 
ATOM   2085 C  CE3   . TRP A 1  296 ? -2.802  1.099   -7.778  1.00 3.63  ? 434 TRP A CE3   1 
ATOM   2086 C  CZ2   . TRP A 1  296 ? -4.000  2.546   -9.930  1.00 5.35  ? 434 TRP A CZ2   1 
ATOM   2087 C  CZ3   . TRP A 1  296 ? -2.122  2.132   -8.443  1.00 3.61  ? 434 TRP A CZ3   1 
ATOM   2088 C  CH2   . TRP A 1  296 ? -2.719  2.835   -9.497  1.00 4.24  ? 434 TRP A CH2   1 
ATOM   2089 N  N     . THR A 1  297 ? -4.091  -4.521  -5.934  1.00 1.25  ? 435 THR A N     1 
ATOM   2090 C  CA    . THR A 1  297 ? -3.345  -5.348  -4.975  1.00 0.76  ? 435 THR A CA    1 
ATOM   2091 C  C     . THR A 1  297 ? -2.346  -6.234  -5.699  1.00 1.48  ? 435 THR A C     1 
ATOM   2092 O  O     . THR A 1  297 ? -1.352  -6.671  -5.115  1.00 2.00  ? 435 THR A O     1 
ATOM   2093 C  CB    . THR A 1  297 ? -4.322  -6.182  -4.090  1.00 1.34  ? 435 THR A CB    1 
ATOM   2094 O  OG1   . THR A 1  297 ? -5.071  -5.290  -3.268  1.00 1.31  ? 435 THR A OG1   1 
ATOM   2095 C  CG2   . THR A 1  297 ? -3.559  -7.118  -3.127  1.00 0.90  ? 435 THR A CG2   1 
ATOM   2096 N  N     . GLY A 1  298 ? -2.570  -6.449  -6.984  1.00 1.99  ? 436 GLY A N     1 
ATOM   2097 C  CA    . GLY A 1  298 ? -1.574  -7.151  -7.778  1.00 1.81  ? 436 GLY A CA    1 
ATOM   2098 C  C     . GLY A 1  298 ? -1.389  -8.633  -7.384  1.00 4.08  ? 436 GLY A C     1 
ATOM   2099 O  O     . GLY A 1  298 ? -2.337  -9.259  -6.900  1.00 1.56  ? 436 GLY A O     1 
ATOM   2100 N  N     . SER A 1  299 ? -0.215  -9.217  -7.652  1.00 1.84  ? 437 SER A N     1 
ATOM   2101 C  CA    . SER A 1  299 ? 0.900   -8.570  -8.328  1.00 1.62  ? 437 SER A CA    1 
ATOM   2102 C  C     . SER A 1  299 ? 0.551   -8.260  -9.763  1.00 2.71  ? 437 SER A C     1 
ATOM   2103 O  O     . SER A 1  299 ? -0.483  -8.663  -10.244 1.00 1.40  ? 437 SER A O     1 
ATOM   2104 C  CB    . SER A 1  299 ? 2.088   -9.541  -8.377  1.00 1.63  ? 437 SER A CB    1 
ATOM   2105 O  OG    . SER A 1  299 ? 1.797   -10.664 -9.251  1.00 2.75  ? 437 SER A OG    1 
ATOM   2106 N  N     . LYS A 1  300 ? 1.436   -7.544  -10.440 1.00 1.87  ? 438 LYS A N     1 
ATOM   2107 C  CA    . LYS A 1  300 ? 1.164   -7.159  -11.824 1.00 3.27  ? 438 LYS A CA    1 
ATOM   2108 C  C     . LYS A 1  300 ? 0.983   -8.443  -12.630 1.00 2.90  ? 438 LYS A C     1 
ATOM   2109 O  O     . LYS A 1  300 ? 0.043   -8.569  -13.423 1.00 1.82  ? 438 LYS A O     1 
ATOM   2110 C  CB    . LYS A 1  300 ? 2.344   -6.374  -12.380 1.00 3.82  ? 438 LYS A CB    1 
ATOM   2111 C  CG    . LYS A 1  300 ? 2.374   -6.290  -13.941 1.00 2.31  ? 438 LYS A CG    1 
ATOM   2112 C  CD    . LYS A 1  300 ? 3.597   -5.439  -14.367 1.00 7.45  ? 438 LYS A CD    1 
ATOM   2113 C  CE    . LYS A 1  300 ? 3.656   -5.351  -15.867 1.00 9.40  ? 438 LYS A CE    1 
ATOM   2114 N  NZ    . LYS A 1  300 ? 4.818   -4.542  -16.342 1.00 14.85 ? 438 LYS A NZ    1 
ATOM   2115 N  N     . LEU A 1  301 ? 1.883   -9.402  -12.469 1.00 1.47  ? 439 LEU A N     1 
ATOM   2116 C  CA    . LEU A 1  301 ? 1.724   -10.644 -13.238 1.00 3.39  ? 439 LEU A CA    1 
ATOM   2117 C  C     . LEU A 1  301 ? 0.443   -11.374 -12.858 1.00 3.61  ? 439 LEU A C     1 
ATOM   2118 O  O     . LEU A 1  301 ? -0.272  -11.891 -13.733 1.00 2.16  ? 439 LEU A O     1 
ATOM   2119 C  CB    . LEU A 1  301 ? 2.953   -11.580 -13.056 1.00 2.65  ? 439 LEU A CB    1 
ATOM   2120 C  CG    . LEU A 1  301 ? 2.844   -12.934 -13.752 1.00 4.38  ? 439 LEU A CG    1 
ATOM   2121 C  CD1   . LEU A 1  301 ? 2.786   -12.709 -15.271 1.00 2.21  ? 439 LEU A CD1   1 
ATOM   2122 C  CD2   . LEU A 1  301 ? 4.079   -13.809 -13.391 1.00 2.22  ? 439 LEU A CD2   1 
ATOM   2123 N  N     . PHE A 1  302 ? 0.121   -11.407 -11.551 1.00 1.37  ? 440 PHE A N     1 
ATOM   2124 C  CA    . PHE A 1  302 ? -1.142  -12.017 -11.126 1.00 0.91  ? 440 PHE A CA    1 
ATOM   2125 C  C     . PHE A 1  302 ? -2.335  -11.391 -11.868 1.00 1.91  ? 440 PHE A C     1 
ATOM   2126 O  O     . PHE A 1  302 ? -3.205  -12.125 -12.349 1.00 1.53  ? 440 PHE A O     1 
ATOM   2127 C  CB    . PHE A 1  302 ? -1.336  -11.912 -9.589  1.00 1.19  ? 440 PHE A CB    1 
ATOM   2128 C  CG    . PHE A 1  302 ? -2.474  -12.756 -9.061  1.00 1.46  ? 440 PHE A CG    1 
ATOM   2129 C  CD1   . PHE A 1  302 ? -2.235  -14.028 -8.538  1.00 1.35  ? 440 PHE A CD1   1 
ATOM   2130 C  CD2   . PHE A 1  302 ? -3.770  -12.286 -9.112  1.00 2.18  ? 440 PHE A CD2   1 
ATOM   2131 C  CE1   . PHE A 1  302 ? -3.299  -14.806 -8.063  1.00 2.49  ? 440 PHE A CE1   1 
ATOM   2132 C  CE2   . PHE A 1  302 ? -4.825  -13.032 -8.634  1.00 2.09  ? 440 PHE A CE2   1 
ATOM   2133 C  CZ    . PHE A 1  302 ? -4.570  -14.320 -8.096  1.00 3.94  ? 440 PHE A CZ    1 
ATOM   2134 N  N     . GLN A 1  303 ? -2.402  -10.052 -11.929 1.00 1.49  ? 441 GLN A N     1 
ATOM   2135 C  CA    . GLN A 1  303 ? -3.537  -9.386  -12.608 1.00 2.28  ? 441 GLN A CA    1 
ATOM   2136 C  C     . GLN A 1  303 ? -3.575  -9.641  -14.124 1.00 3.16  ? 441 GLN A C     1 
ATOM   2137 O  O     . GLN A 1  303 ? -4.647  -9.857  -14.672 1.00 3.38  ? 441 GLN A O     1 
ATOM   2138 C  CB    . GLN A 1  303 ? -3.575  -7.886  -12.339 1.00 2.17  ? 441 GLN A CB    1 
ATOM   2139 C  CG    . GLN A 1  303 ? -3.693  -7.567  -10.838 1.00 2.43  ? 441 GLN A CG    1 
ATOM   2140 C  CD    . GLN A 1  303 ? -4.898  -8.210  -10.244 1.00 4.20  ? 441 GLN A CD    1 
ATOM   2141 O  OE1   . GLN A 1  303 ? -5.997  -8.086  -10.798 1.00 4.39  ? 441 GLN A OE1   1 
ATOM   2142 N  NE2   . GLN A 1  303 ? -4.718  -8.954  -9.138  1.00 7.08  ? 441 GLN A NE2   1 
ATOM   2143 N  N     . ARG A 1  304 ? -2.424  -9.628  -14.783 1.00 2.03  ? 442 ARG A N     1 
ATOM   2144 C  CA    . ARG A 1  304 ? -2.393  -9.979  -16.217 1.00 3.83  ? 442 ARG A CA    1 
ATOM   2145 C  C     . ARG A 1  304 ? -2.898  -11.388 -16.462 1.00 4.07  ? 442 ARG A C     1 
ATOM   2146 O  O     . ARG A 1  304 ? -3.694  -11.613 -17.399 1.00 2.90  ? 442 ARG A O     1 
ATOM   2147 C  CB    . ARG A 1  304 ? -0.967  -9.878  -16.776 1.00 3.47  ? 442 ARG A CB    1 
ATOM   2148 C  CG    . ARG A 1  304 ? -0.406  -8.521  -16.752 1.00 6.95  ? 442 ARG A CG    1 
ATOM   2149 C  CD    . ARG A 1  304 ? 1.103   -8.553  -17.132 1.00 8.63  ? 442 ARG A CD    1 
ATOM   2150 N  NE    . ARG A 1  304 ? 1.233   -8.687  -18.589 1.00 7.99  ? 442 ARG A NE    1 
ATOM   2151 C  CZ    . ARG A 1  304 ? 2.302   -8.343  -19.302 1.00 9.06  ? 442 ARG A CZ    1 
ATOM   2152 N  NH1   . ARG A 1  304 ? 3.420   -7.933  -18.695 1.00 11.55 ? 442 ARG A NH1   1 
ATOM   2153 N  NH2   . ARG A 1  304 ? 2.270   -8.469  -20.635 1.00 7.10  ? 442 ARG A NH2   1 
ATOM   2154 N  N     . GLU A 1  305 ? -2.452  -12.334 -15.622 1.00 3.44  ? 443 GLU A N     1 
ATOM   2155 C  CA    . GLU A 1  305 ? -2.884  -13.724 -15.731 1.00 2.33  ? 443 GLU A CA    1 
ATOM   2156 C  C     . GLU A 1  305 ? -4.359  -13.871 -15.416 1.00 6.92  ? 443 GLU A C     1 
ATOM   2157 O  O     . GLU A 1  305 ? -5.079  -14.643 -16.082 1.00 2.90  ? 443 GLU A O     1 
ATOM   2158 C  CB    . GLU A 1  305 ? -2.042  -14.645 -14.815 1.00 3.99  ? 443 GLU A CB    1 
ATOM   2159 C  CG    . GLU A 1  305 ? -0.589  -14.668 -15.228 1.00 5.34  ? 443 GLU A CG    1 
ATOM   2160 C  CD    . GLU A 1  305 ? -0.363  -15.714 -16.327 1.00 8.15  ? 443 GLU A CD    1 
ATOM   2161 O  OE1   . GLU A 1  305 ? -0.454  -16.908 -15.996 1.00 9.67  ? 443 GLU A OE1   1 
ATOM   2162 O  OE2   . GLU A 1  305 ? -0.116  -15.354 -17.487 1.00 9.67  ? 443 GLU A OE2   1 
ATOM   2163 N  N     . LEU A 1  306 ? -4.824  -13.142 -14.412 1.00 1.50  ? 444 LEU A N     1 
ATOM   2164 C  CA    . LEU A 1  306 ? -6.246  -13.211 -14.043 1.00 2.17  ? 444 LEU A CA    1 
ATOM   2165 C  C     . LEU A 1  306 ? -7.114  -12.688 -15.175 1.00 1.96  ? 444 LEU A C     1 
ATOM   2166 O  O     . LEU A 1  306 ? -8.166  -13.273 -15.500 1.00 3.55  ? 444 LEU A O     1 
ATOM   2167 C  CB    . LEU A 1  306 ? -6.489  -12.400 -12.767 1.00 3.08  ? 444 LEU A CB    1 
ATOM   2168 C  CG    . LEU A 1  306 ? -7.872  -12.505 -12.167 1.00 4.92  ? 444 LEU A CG    1 
ATOM   2169 C  CD1   . LEU A 1  306 ? -8.126  -13.942 -11.705 1.00 5.25  ? 444 LEU A CD1   1 
ATOM   2170 C  CD2   . LEU A 1  306 ? -8.024  -11.501 -10.960 1.00 4.21  ? 444 LEU A CD2   1 
ATOM   2171 N  N     . ARG A 1  307 ? -6.699  -11.580 -15.786 1.00 3.31  ? 445 ARG A N     1 
ATOM   2172 C  CA    . ARG A 1  307 ? -7.473  -11.047 -16.922 1.00 4.30  ? 445 ARG A CA    1 
ATOM   2173 C  C     . ARG A 1  307 ? -7.414  -11.964 -18.153 1.00 4.47  ? 445 ARG A C     1 
ATOM   2174 O  O     . ARG A 1  307 ? -8.421  -12.166 -18.856 1.00 5.09  ? 445 ARG A O     1 
ATOM   2175 C  CB    . ARG A 1  307 ? -7.010  -9.643  -17.296 1.00 3.13  ? 445 ARG A CB    1 
ATOM   2176 C  CG    . ARG A 1  307 ? -7.322  -8.626  -16.186 1.00 4.61  ? 445 ARG A CG    1 
ATOM   2177 C  CD    . ARG A 1  307 ? -6.451  -7.354  -16.277 1.00 3.60  ? 445 ARG A CD    1 
ATOM   2178 N  NE    . ARG A 1  307 ? -6.769  -6.531  -15.084 1.00 4.12  ? 445 ARG A NE    1 
ATOM   2179 C  CZ    . ARG A 1  307 ? -6.503  -5.236  -14.951 1.00 5.25  ? 445 ARG A CZ    1 
ATOM   2180 N  NH1   . ARG A 1  307 ? -5.920  -4.559  -15.938 1.00 6.22  ? 445 ARG A NH1   1 
ATOM   2181 N  NH2   . ARG A 1  307 ? -6.829  -4.616  -13.820 1.00 3.82  ? 445 ARG A NH2   1 
ATOM   2182 N  N     . ARG A 1  308 ? -6.240  -12.520 -18.402 1.00 3.70  ? 446 ARG A N     1 
ATOM   2183 C  CA    . ARG A 1  308 ? -6.097  -13.476 -19.504 1.00 4.11  ? 446 ARG A CA    1 
ATOM   2184 C  C     . ARG A 1  308 ? -6.984  -14.687 -19.276 1.00 8.73  ? 446 ARG A C     1 
ATOM   2185 O  O     . ARG A 1  308 ? -7.664  -15.140 -20.200 1.00 9.07  ? 446 ARG A O     1 
ATOM   2186 C  CB    . ARG A 1  308 ? -4.634  -13.914 -19.645 1.00 5.67  ? 446 ARG A CB    1 
ATOM   2187 C  CG    . ARG A 1  308 ? -4.388  -14.743 -20.938 1.00 7.48  ? 446 ARG A CG    1 
ATOM   2188 C  CD    . ARG A 1  308 ? -2.879  -14.936 -21.120 1.00 6.86  ? 446 ARG A CD    1 
ATOM   2189 N  NE    . ARG A 1  308 ? -2.241  -15.679 -20.018 1.00 9.16  ? 446 ARG A NE    1 
ATOM   2190 C  CZ    . ARG A 1  308 ? -1.867  -16.958 -20.095 1.00 16.00 ? 446 ARG A CZ    1 
ATOM   2191 N  NH1   . ARG A 1  308 ? -2.145  -17.658 -21.188 1.00 15.38 ? 446 ARG A NH1   1 
ATOM   2192 N  NH2   . ARG A 1  308 ? -1.216  -17.544 -19.083 1.00 12.91 ? 446 ARG A NH2   1 
ATOM   2193 N  N     . PHE A 1  309 ? -6.989  -15.203 -18.046 1.00 5.22  ? 447 PHE A N     1 
ATOM   2194 C  CA    . PHE A 1  309 ? -7.831  -16.337 -17.682 1.00 7.27  ? 447 PHE A CA    1 
ATOM   2195 C  C     . PHE A 1  309 ? -9.302  -16.024 -17.884 1.00 9.32  ? 447 PHE A C     1 
ATOM   2196 O  O     . PHE A 1  309 ? -10.075 -16.832 -18.460 1.00 11.05 ? 447 PHE A O     1 
ATOM   2197 C  CB    . PHE A 1  309 ? -7.583  -16.758 -16.224 1.00 4.19  ? 447 PHE A CB    1 
ATOM   2198 C  CG    . PHE A 1  309 ? -8.464  -17.897 -15.742 1.00 6.56  ? 447 PHE A CG    1 
ATOM   2199 C  CD1   . PHE A 1  309 ? -8.048  -19.213 -15.869 1.00 8.50  ? 447 PHE A CD1   1 
ATOM   2200 C  CD2   . PHE A 1  309 ? -9.701  -17.645 -15.145 1.00 4.22  ? 447 PHE A CD2   1 
ATOM   2201 C  CE1   . PHE A 1  309 ? -8.829  -20.255 -15.419 1.00 9.68  ? 447 PHE A CE1   1 
ATOM   2202 C  CE2   . PHE A 1  309 ? -10.492 -18.687 -14.689 1.00 10.13 ? 447 PHE A CE2   1 
ATOM   2203 C  CZ    . PHE A 1  309 ? -10.056 -20.002 -14.829 1.00 12.15 ? 447 PHE A CZ    1 
ATOM   2204 N  N     . SER A 1  310 ? -9.701  -14.870 -17.376 1.00 5.35  ? 448 SER A N     1 
ATOM   2205 C  CA    . SER A 1  310 ? -11.082 -14.430 -17.468 1.00 6.24  ? 448 SER A CA    1 
ATOM   2206 C  C     . SER A 1  310 ? -11.520 -14.448 -18.935 1.00 6.99  ? 448 SER A C     1 
ATOM   2207 O  O     . SER A 1  310 ? -12.565 -15.017 -19.302 1.00 9.58  ? 448 SER A O     1 
ATOM   2208 C  CB    . SER A 1  310 ? -11.160 -13.003 -16.904 1.00 8.03  ? 448 SER A CB    1 
ATOM   2209 O  OG    . SER A 1  310 ? -12.482 -12.544 -16.959 1.00 12.85 ? 448 SER A OG    1 
ATOM   2210 N  N     . ARG A 1  311 ? -10.713 -13.831 -19.787 1.00 6.40  ? 449 ARG A N     1 
ATOM   2211 C  CA    . ARG A 1  311 ? -11.113 -13.647 -21.186 1.00 7.24  ? 449 ARG A CA    1 
ATOM   2212 C  C     . ARG A 1  311 ? -11.016 -14.953 -21.967 1.00 13.25 ? 449 ARG A C     1 
ATOM   2213 O  O     . ARG A 1  311 ? -11.981 -15.385 -22.613 1.00 10.26 ? 449 ARG A O     1 
ATOM   2214 C  CB    . ARG A 1  311 ? -10.315 -12.534 -21.858 1.00 8.33  ? 449 ARG A CB    1 
ATOM   2215 C  CG    . ARG A 1  311 ? -10.623 -12.355 -23.377 1.00 11.00 ? 449 ARG A CG    1 
ATOM   2216 C  CD    . ARG A 1  311 ? -9.742  -11.281 -23.991 1.00 12.81 ? 449 ARG A CD    1 
ATOM   2217 N  NE    . ARG A 1  311 ? -10.186 -9.963  -23.611 1.00 11.83 ? 449 ARG A NE    1 
ATOM   2218 C  CZ    . ARG A 1  311 ? -11.037 -9.217  -24.316 1.00 25.24 ? 449 ARG A CZ    1 
ATOM   2219 N  NH1   . ARG A 1  311 ? -11.556 -9.664  -25.452 1.00 28.04 ? 449 ARG A NH1   1 
ATOM   2220 N  NH2   . ARG A 1  311 ? -11.368 -8.011  -23.885 1.00 21.30 ? 449 ARG A NH2   1 
ATOM   2221 N  N     . LYS A 1  312 ? -9.871  -15.607 -21.876 1.00 9.89  ? 450 LYS A N     1 
ATOM   2222 C  CA    . LYS A 1  312 ? -9.629  -16.835 -22.650 1.00 10.88 ? 450 LYS A CA    1 
ATOM   2223 C  C     . LYS A 1  312 ? -10.369 -18.078 -22.171 1.00 14.59 ? 450 LYS A C     1 
ATOM   2224 O  O     . LYS A 1  312 ? -10.819 -18.883 -22.983 1.00 13.80 ? 450 LYS A O     1 
ATOM   2225 C  CB    . LYS A 1  312 ? -8.126  -17.106 -22.729 1.00 12.72 ? 450 LYS A CB    1 
ATOM   2226 C  CG    . LYS A 1  312 ? -7.346  -15.910 -23.282 1.00 13.93 ? 450 LYS A CG    1 
ATOM   2227 C  CD    . LYS A 1  312 ? -7.675  -15.549 -24.767 1.00 25.10 ? 450 LYS A CD    1 
ATOM   2228 C  CE    . LYS A 1  312 ? -6.879  -14.328 -25.219 1.00 22.43 ? 450 LYS A CE    1 
ATOM   2229 N  NZ    . LYS A 1  312 ? -7.346  -13.684 -26.507 1.00 22.64 ? 450 LYS A NZ    1 
ATOM   2230 N  N     . GLU A 1  313 ? -10.512 -18.252 -20.859 1.00 9.82  ? 451 GLU A N     1 
ATOM   2231 C  CA    . GLU A 1  313 ? -11.134 -19.460 -20.327 1.00 11.04 ? 451 GLU A CA    1 
ATOM   2232 C  C     . GLU A 1  313 ? -12.628 -19.290 -20.027 1.00 14.94 ? 451 GLU A C     1 
ATOM   2233 O  O     . GLU A 1  313 ? -13.384 -20.235 -20.190 1.00 11.62 ? 451 GLU A O     1 
ATOM   2234 C  CB    . GLU A 1  313 ? -10.402 -19.979 -19.074 1.00 10.70 ? 451 GLU A CB    1 
ATOM   2235 C  CG    . GLU A 1  313 ? -8.919  -20.161 -19.257 1.00 11.76 ? 451 GLU A CG    1 
ATOM   2236 C  CD    . GLU A 1  313 ? -8.604  -21.169 -20.356 1.00 21.50 ? 451 GLU A CD    1 
ATOM   2237 O  OE1   . GLU A 1  313 ? -7.632  -20.947 -21.098 1.00 14.70 ? 451 GLU A OE1   1 
ATOM   2238 O  OE2   . GLU A 1  313 ? -9.339  -22.163 -20.478 1.00 14.47 ? 451 GLU A OE2   1 
ATOM   2239 N  N     . LYS A 1  314 ? -13.052 -18.097 -19.611 1.00 13.23 ? 452 LYS A N     1 
ATOM   2240 C  CA    . LYS A 1  314 ? -14.438 -17.874 -19.160 1.00 12.95 ? 452 LYS A CA    1 
ATOM   2241 C  C     . LYS A 1  314 ? -15.217 -16.947 -20.094 1.00 12.55 ? 452 LYS A C     1 
ATOM   2242 O  O     . LYS A 1  314 ? -16.418 -16.788 -19.946 1.00 13.95 ? 452 LYS A O     1 
ATOM   2243 C  CB    . LYS A 1  314 ? -14.449 -17.300 -17.740 1.00 13.68 ? 452 LYS A CB    1 
ATOM   2244 C  CG    . LYS A 1  314 ? -13.690 -18.171 -16.725 1.00 10.56 ? 452 LYS A CG    1 
ATOM   2245 C  CD    . LYS A 1  314 ? -14.452 -19.454 -16.466 1.00 13.63 ? 452 LYS A CD    1 
ATOM   2246 C  CE    . LYS A 1  314 ? -13.582 -20.526 -15.869 1.00 17.86 ? 452 LYS A CE    1 
ATOM   2247 N  NZ    . LYS A 1  314 ? -14.427 -21.708 -15.454 1.00 20.27 ? 452 LYS A NZ    1 
ATOM   2248 N  N     . GLY A 1  315 ? -14.529 -16.337 -21.051 1.00 10.83 ? 453 GLY A N     1 
ATOM   2249 C  CA    . GLY A 1  315 ? -15.179 -15.429 -21.985 1.00 12.27 ? 453 GLY A CA    1 
ATOM   2250 C  C     . GLY A 1  315 ? -15.711 -14.160 -21.349 1.00 18.36 ? 453 GLY A C     1 
ATOM   2251 O  O     . GLY A 1  315 ? -16.607 -13.515 -21.884 1.00 12.56 ? 453 GLY A O     1 
ATOM   2252 N  N     . LEU A 1  316 ? -15.150 -13.795 -20.201 1.00 10.01 ? 454 LEU A N     1 
ATOM   2253 C  CA    . LEU A 1  316 ? -15.554 -12.583 -19.475 1.00 9.66  ? 454 LEU A CA    1 
ATOM   2254 C  C     . LEU A 1  316 ? -14.424 -11.525 -19.493 1.00 8.23  ? 454 LEU A C     1 
ATOM   2255 O  O     . LEU A 1  316 ? -13.242 -11.885 -19.464 1.00 11.10 ? 454 LEU A O     1 
ATOM   2256 C  CB    . LEU A 1  316 ? -15.887 -12.958 -18.028 1.00 8.51  ? 454 LEU A CB    1 
ATOM   2257 C  CG    . LEU A 1  316 ? -17.017 -13.966 -17.858 1.00 15.91 ? 454 LEU A CG    1 
ATOM   2258 C  CD1   . LEU A 1  316 ? -17.268 -14.260 -16.394 1.00 10.59 ? 454 LEU A CD1   1 
ATOM   2259 C  CD2   . LEU A 1  316 ? -18.290 -13.414 -18.516 1.00 12.91 ? 454 LEU A CD2   1 
ATOM   2260 N  N     . TRP A 1  317 ? -14.762 -10.230 -19.531 1.00 6.20  ? 455 TRP A N     1 
ATOM   2261 C  CA    . TRP A 1  317 ? -13.729 -9.202  -19.692 1.00 8.45  ? 455 TRP A CA    1 
ATOM   2262 C  C     . TRP A 1  317 ? -13.524 -8.480  -18.363 1.00 6.52  ? 455 TRP A C     1 
ATOM   2263 O  O     . TRP A 1  317 ? -14.415 -7.790  -17.885 1.00 5.74  ? 455 TRP A O     1 
ATOM   2264 C  CB    . TRP A 1  317 ? -14.108 -8.191  -20.770 1.00 11.59 ? 455 TRP A CB    1 
ATOM   2265 C  CG    . TRP A 1  317 ? -14.282 -8.815  -22.104 1.00 15.73 ? 455 TRP A CG    1 
ATOM   2266 C  CD1   . TRP A 1  317 ? -13.955 -10.096 -22.470 1.00 16.59 ? 455 TRP A CD1   1 
ATOM   2267 C  CD2   . TRP A 1  317 ? -14.868 -8.201  -23.258 1.00 15.19 ? 455 TRP A CD2   1 
ATOM   2268 N  NE1   . TRP A 1  317 ? -14.300 -10.308 -23.797 1.00 17.69 ? 455 TRP A NE1   1 
ATOM   2269 C  CE2   . TRP A 1  317 ? -14.864 -9.161  -24.294 1.00 14.31 ? 455 TRP A CE2   1 
ATOM   2270 C  CE3   . TRP A 1  317 ? -15.394 -6.931  -23.514 1.00 18.09 ? 455 TRP A CE3   1 
ATOM   2271 C  CZ2   . TRP A 1  317 ? -15.362 -8.883  -25.574 1.00 20.07 ? 455 TRP A CZ2   1 
ATOM   2272 C  CZ3   . TRP A 1  317 ? -15.889 -6.653  -24.792 1.00 25.87 ? 455 TRP A CZ3   1 
ATOM   2273 C  CH2   . TRP A 1  317 ? -15.855 -7.623  -25.802 1.00 16.35 ? 455 TRP A CH2   1 
ATOM   2274 N  N     . LEU A 1  318 ? -12.334 -8.614  -17.803 1.00 7.33  ? 456 LEU A N     1 
ATOM   2275 C  CA    . LEU A 1  318 ? -12.061 -8.098  -16.461 1.00 3.71  ? 456 LEU A CA    1 
ATOM   2276 C  C     . LEU A 1  318 ? -11.171 -6.872  -16.532 1.00 4.68  ? 456 LEU A C     1 
ATOM   2277 O  O     . LEU A 1  318 ? -10.160 -6.870  -17.263 1.00 8.02  ? 456 LEU A O     1 
ATOM   2278 C  CB    . LEU A 1  318 ? -11.293 -9.203  -15.699 1.00 5.25  ? 456 LEU A CB    1 
ATOM   2279 C  CG    . LEU A 1  318 ? -10.859 -8.798  -14.287 1.00 3.61  ? 456 LEU A CG    1 
ATOM   2280 C  CD1   . LEU A 1  318 ? -12.107 -8.517  -13.395 1.00 2.44  ? 456 LEU A CD1   1 
ATOM   2281 C  CD2   . LEU A 1  318 ? -9.975  -9.877  -13.646 1.00 3.58  ? 456 LEU A CD2   1 
ATOM   2282 N  N     . ASN A 1  319 ? -11.497 -5.845  -15.753 1.00 4.83  ? 457 ASN A N     1 
ATOM   2283 C  CA    . ASN A 1  319 ? -10.567 -4.755  -15.531 1.00 5.77  ? 457 ASN A CA    1 
ATOM   2284 C  C     . ASN A 1  319 ? -10.714 -4.248  -14.108 1.00 5.10  ? 457 ASN A C     1 
ATOM   2285 O  O     . ASN A 1  319 ? -11.340 -4.924  -13.269 1.00 6.44  ? 457 ASN A O     1 
ATOM   2286 C  CB    . ASN A 1  319 ? -10.675 -3.624  -16.577 1.00 5.24  ? 457 ASN A CB    1 
ATOM   2287 C  CG    . ASN A 1  319 ? -12.050 -2.985  -16.598 1.00 10.54 ? 457 ASN A CG    1 
ATOM   2288 O  OD1   . ASN A 1  319 ? -12.745 -2.979  -15.583 1.00 7.53  ? 457 ASN A OD1   1 
ATOM   2289 N  ND2   . ASN A 1  319 ? -12.459 -2.460  -17.767 1.00 12.01 ? 457 ASN A ND2   1 
ATOM   2290 N  N     . SER A 1  320 ? -10.070 -3.114  -13.795 1.00 5.01  ? 458 SER A N     1 
ATOM   2291 C  CA    . SER A 1  320 ? -10.087 -2.652  -12.412 1.00 5.58  ? 458 SER A CA    1 
ATOM   2292 C  C     . SER A 1  320 ? -11.373 -1.925  -12.056 1.00 5.55  ? 458 SER A C     1 
ATOM   2293 O  O     . SER A 1  320 ? -11.531 -1.449  -10.932 1.00 4.85  ? 458 SER A O     1 
ATOM   2294 C  CB    . SER A 1  320 ? -8.877  -1.769  -12.122 1.00 7.71  ? 458 SER A CB    1 
ATOM   2295 O  OG    . SER A 1  320 ? -8.978  -0.553  -12.806 1.00 11.07 ? 458 SER A OG    1 
ATOM   2296 N  N     . HIS A 1  321 ? -12.319 -1.892  -12.999 1.00 4.14  ? 459 HIS A N     1 
ATOM   2297 C  CA    . HIS A 1  321 ? -13.627 -1.249  -12.793 1.00 7.14  ? 459 HIS A CA    1 
ATOM   2298 C  C     . HIS A 1  321 ? -14.750 -2.287  -12.708 1.00 5.01  ? 459 HIS A C     1 
ATOM   2299 O  O     . HIS A 1  321 ? -15.840 -1.979  -12.240 1.00 8.70  ? 459 HIS A O     1 
ATOM   2300 C  CB    . HIS A 1  321 ? -14.017 -0.392  -14.007 1.00 7.66  ? 459 HIS A CB    1 
ATOM   2301 C  CG    . HIS A 1  321 ? -13.113 0.759   -14.279 1.00 16.07 ? 459 HIS A CG    1 
ATOM   2302 N  ND1   . HIS A 1  321 ? -12.641 1.590   -13.287 1.00 23.35 ? 459 HIS A ND1   1 
ATOM   2303 C  CD2   . HIS A 1  321 ? -12.630 1.249   -15.445 1.00 14.80 ? 459 HIS A CD2   1 
ATOM   2304 C  CE1   . HIS A 1  321 ? -11.886 2.530   -13.829 1.00 26.17 ? 459 HIS A CE1   1 
ATOM   2305 N  NE2   . HIS A 1  321 ? -11.865 2.350   -15.136 1.00 20.38 ? 459 HIS A NE2   1 
ATOM   2306 N  N     . GLY A 1  322 ? -14.543 -3.495  -13.225 1.00 5.63  ? 460 GLY A N     1 
ATOM   2307 C  CA    . GLY A 1  322 ? -15.666 -4.406  -13.367 1.00 5.79  ? 460 GLY A CA    1 
ATOM   2308 C  C     . GLY A 1  322 ? -15.368 -5.645  -14.186 1.00 5.28  ? 460 GLY A C     1 
ATOM   2309 O  O     . GLY A 1  322 ? -14.216 -5.870  -14.616 1.00 5.60  ? 460 GLY A O     1 
ATOM   2310 N  N     . LEU A 1  323 ? -16.404 -6.447  -14.399 1.00 6.66  ? 461 LEU A N     1 
ATOM   2311 C  CA    . LEU A 1  323 ? -16.253 -7.721  -15.082 1.00 7.00  ? 461 LEU A CA    1 
ATOM   2312 C  C     . LEU A 1  323 ? -17.487 -7.841  -15.966 1.00 8.44  ? 461 LEU A C     1 
ATOM   2313 O  O     . LEU A 1  323 ? -18.630 -7.876  -15.467 1.00 8.55  ? 461 LEU A O     1 
ATOM   2314 C  CB    . LEU A 1  323 ? -16.222 -8.878  -14.084 1.00 6.20  ? 461 LEU A CB    1 
ATOM   2315 C  CG    . LEU A 1  323 ? -16.144 -10.305 -14.646 1.00 7.61  ? 461 LEU A CG    1 
ATOM   2316 C  CD1   . LEU A 1  323 ? -14.856 -10.540 -15.465 1.00 7.35  ? 461 LEU A CD1   1 
ATOM   2317 C  CD2   . LEU A 1  323 ? -16.214 -11.294 -13.501 1.00 8.70  ? 461 LEU A CD2   1 
ATOM   2318 N  N     . PHE A 1  324 ? -17.235 -7.905  -17.264 1.00 10.25 ? 462 PHE A N     1 
ATOM   2319 C  CA    . PHE A 1  324 ? -18.285 -7.775  -18.276 1.00 9.94  ? 462 PHE A CA    1 
ATOM   2320 C  C     . PHE A 1  324 ? -18.516 -9.080  -18.998 1.00 12.80 ? 462 PHE A C     1 
ATOM   2321 O  O     . PHE A 1  324 ? -17.564 -9.729  -19.429 1.00 10.74 ? 462 PHE A O     1 
ATOM   2322 C  CB    . PHE A 1  324 ? -17.822 -6.709  -19.282 1.00 11.10 ? 462 PHE A CB    1 
ATOM   2323 C  CG    . PHE A 1  324 ? -18.833 -6.374  -20.335 1.00 15.17 ? 462 PHE A CG    1 
ATOM   2324 C  CD1   . PHE A 1  324 ? -20.003 -5.717  -19.998 1.00 12.19 ? 462 PHE A CD1   1 
ATOM   2325 C  CD2   . PHE A 1  324 ? -18.583 -6.678  -21.683 1.00 21.71 ? 462 PHE A CD2   1 
ATOM   2326 C  CE1   . PHE A 1  324 ? -20.944 -5.392  -20.981 1.00 18.66 ? 462 PHE A CE1   1 
ATOM   2327 C  CE2   . PHE A 1  324 ? -19.499 -6.340  -22.677 1.00 23.33 ? 462 PHE A CE2   1 
ATOM   2328 C  CZ    . PHE A 1  324 ? -20.682 -5.704  -22.323 1.00 15.50 ? 462 PHE A CZ    1 
ATOM   2329 N  N     . ASP A 1  325 ? -19.795 -9.444  -19.157 1.00 12.02 ? 463 ASP A N     1 
ATOM   2330 C  CA    . ASP A 1  325 ? -20.196 -10.591 -19.937 1.00 13.77 ? 463 ASP A CA    1 
ATOM   2331 C  C     . ASP A 1  325 ? -20.621 -9.992  -21.273 1.00 19.28 ? 463 ASP A C     1 
ATOM   2332 O  O     . ASP A 1  325 ? -21.639 -9.298  -21.354 1.00 17.79 ? 463 ASP A O     1 
ATOM   2333 C  CB    . ASP A 1  325 ? -21.359 -11.338 -19.251 1.00 17.95 ? 463 ASP A CB    1 
ATOM   2334 C  CG    . ASP A 1  325 ? -21.829 -12.579 -20.036 1.00 27.02 ? 463 ASP A CG    1 
ATOM   2335 O  OD1   . ASP A 1  325 ? -21.550 -12.689 -21.245 1.00 23.30 ? 463 ASP A OD1   1 
ATOM   2336 O  OD2   . ASP A 1  325 ? -22.480 -13.457 -19.431 1.00 23.53 ? 463 ASP A OD2   1 
ATOM   2337 N  N     . PRO A 1  326 ? -19.807 -10.204 -22.308 1.00 17.72 ? 464 PRO A N     1 
ATOM   2338 C  CA    . PRO A 1  326 ? -20.010 -9.578  -23.610 1.00 16.62 ? 464 PRO A CA    1 
ATOM   2339 C  C     . PRO A 1  326 ? -21.091 -10.291 -24.409 1.00 20.29 ? 464 PRO A C     1 
ATOM   2340 O  O     . PRO A 1  326 ? -21.416 -9.844  -25.495 1.00 29.75 ? 464 PRO A O     1 
ATOM   2341 C  CB    . PRO A 1  326 ? -18.656 -9.775  -24.297 1.00 16.93 ? 464 PRO A CB    1 
ATOM   2342 C  CG    . PRO A 1  326 ? -18.187 -11.100 -23.780 1.00 21.46 ? 464 PRO A CG    1 
ATOM   2343 C  CD    . PRO A 1  326 ? -18.678 -11.150 -22.317 1.00 16.41 ? 464 PRO A CD    1 
ATOM   2344 N  N     . GLU A 1  327 ? -21.633 -11.371 -23.870 1.00 24.08 ? 465 GLU A N     1 
ATOM   2345 C  CA    . GLU A 1  327 ? -22.678 -12.126 -24.559 1.00 24.78 ? 465 GLU A CA    1 
ATOM   2346 C  C     . GLU A 1  327 ? -24.032 -11.577 -24.088 1.00 37.98 ? 465 GLU A C     1 
ATOM   2347 O  O     . GLU A 1  327 ? -24.894 -11.229 -24.897 1.00 33.75 ? 465 GLU A O     1 
ATOM   2348 C  CB    . GLU A 1  327 ? -22.537 -13.621 -24.240 1.00 26.19 ? 465 GLU A CB    1 
ATOM   2349 C  CG    . GLU A 1  327 ? -22.653 -14.573 -25.428 1.00 38.51 ? 465 GLU A CG    1 
ATOM   2350 C  CD    . GLU A 1  327 ? -21.389 -14.643 -26.271 1.00 33.53 ? 465 GLU A CD    1 
ATOM   2351 N  N     . GLN A 1  328 ? -24.211 -11.477 -22.773 1.00 30.78 ? 466 GLN A N     1 
ATOM   2352 C  CA    . GLN A 1  328 ? -25.397 -10.842 -22.219 1.00 24.01 ? 466 GLN A CA    1 
ATOM   2353 C  C     . GLN A 1  328 ? -25.305 -9.327  -22.141 1.00 24.73 ? 466 GLN A C     1 
ATOM   2354 O  O     . GLN A 1  328 ? -26.283 -8.677  -21.807 1.00 31.37 ? 466 GLN A O     1 
ATOM   2355 C  CB    . GLN A 1  328 ? -25.702 -11.358 -20.826 1.00 26.30 ? 466 GLN A CB    1 
ATOM   2356 C  CG    . GLN A 1  328 ? -25.999 -12.827 -20.711 1.00 34.79 ? 466 GLN A CG    1 
ATOM   2357 C  CD    . GLN A 1  328 ? -26.505 -13.175 -19.318 1.00 47.35 ? 466 GLN A CD    1 
ATOM   2358 O  OE1   . GLN A 1  328 ? -26.466 -12.339 -18.396 1.00 45.00 ? 466 GLN A OE1   1 
ATOM   2359 N  NE2   . GLN A 1  328 ? -26.997 -14.404 -19.155 1.00 60.90 ? 466 GLN A NE2   1 
ATOM   2360 N  N     . LYS A 1  329 ? -24.137 -8.770  -22.429 1.00 18.01 ? 467 LYS A N     1 
ATOM   2361 C  CA    . LYS A 1  329 ? -23.901 -7.334  -22.307 1.00 22.23 ? 467 LYS A CA    1 
ATOM   2362 C  C     . LYS A 1  329 ? -24.255 -6.806  -20.909 1.00 24.10 ? 467 LYS A C     1 
ATOM   2363 O  O     . LYS A 1  329 ? -24.849 -5.738  -20.752 1.00 23.35 ? 467 LYS A O     1 
ATOM   2364 C  CB    . LYS A 1  329 ? -24.591 -6.537  -23.439 1.00 27.35 ? 467 LYS A CB    1 
ATOM   2365 C  CG    . LYS A 1  329 ? -24.194 -7.004  -24.861 1.00 28.36 ? 467 LYS A CG    1 
ATOM   2366 C  CD    . LYS A 1  329 ? -24.439 -5.937  -25.927 1.00 37.38 ? 467 LYS A CD    1 
ATOM   2367 N  N     . THR A 1  330 ? -23.840 -7.550  -19.887 1.00 24.72 ? 468 THR A N     1 
ATOM   2368 C  CA    . THR A 1  330 ? -24.071 -7.157  -18.499 1.00 18.06 ? 468 THR A CA    1 
ATOM   2369 C  C     . THR A 1  330 ? -22.774 -7.156  -17.661 1.00 17.56 ? 468 THR A C     1 
ATOM   2370 O  O     . THR A 1  330 ? -21.854 -7.934  -17.925 1.00 14.05 ? 468 THR A O     1 
ATOM   2371 C  CB    . THR A 1  330 ? -25.003 -8.130  -17.834 1.00 21.69 ? 468 THR A CB    1 
ATOM   2372 O  OG1   . THR A 1  330 ? -24.438 -9.439  -17.903 1.00 24.16 ? 468 THR A OG1   1 
ATOM   2373 C  CG2   . THR A 1  330 ? -26.343 -8.150  -18.557 1.00 20.37 ? 468 THR A CG2   1 
ATOM   2374 N  N     . PHE A 1  331 ? -22.733 -6.306  -16.646 1.00 13.30 ? 469 PHE A N     1 
ATOM   2375 C  CA    . PHE A 1  331 ? -21.612 -6.269  -15.676 1.00 12.22 ? 469 PHE A CA    1 
ATOM   2376 C  C     . PHE A 1  331 ? -21.985 -7.061  -14.422 1.00 15.31 ? 469 PHE A C     1 
ATOM   2377 O  O     . PHE A 1  331 ? -23.130 -7.023  -13.972 1.00 15.03 ? 469 PHE A O     1 
ATOM   2378 C  CB    . PHE A 1  331 ? -21.316 -4.809  -15.292 1.00 14.25 ? 469 PHE A CB    1 
ATOM   2379 C  CG    . PHE A 1  331 ? -20.651 -4.025  -16.374 1.00 19.51 ? 469 PHE A CG    1 
ATOM   2380 C  CD1   . PHE A 1  331 ? -19.261 -4.063  -16.529 1.00 18.62 ? 469 PHE A CD1   1 
ATOM   2381 C  CD2   . PHE A 1  331 ? -21.398 -3.260  -17.259 1.00 20.21 ? 469 PHE A CD2   1 
ATOM   2382 C  CE1   . PHE A 1  331 ? -18.633 -3.340  -17.547 1.00 16.03 ? 469 PHE A CE1   1 
ATOM   2383 C  CE2   . PHE A 1  331 ? -20.776 -2.556  -18.280 1.00 21.24 ? 469 PHE A CE2   1 
ATOM   2384 C  CZ    . PHE A 1  331 ? -19.397 -2.592  -18.421 1.00 25.89 ? 469 PHE A CZ    1 
ATOM   2385 N  N     A PHE A 1  332 ? -21.030 -7.791  -13.870 0.70 9.77  ? 470 PHE A N     1 
ATOM   2386 N  N     B PHE A 1  332 ? -21.023 -7.785  -13.856 0.30 9.87  ? 470 PHE A N     1 
ATOM   2387 C  CA    A PHE A 1  332 ? -21.247 -8.515  -12.626 0.70 9.64  ? 470 PHE A CA    1 
ATOM   2388 C  CA    B PHE A 1  332 ? -21.248 -8.569  -12.637 0.30 9.71  ? 470 PHE A CA    1 
ATOM   2389 C  C     A PHE A 1  332 ? -21.155 -7.551  -11.457 0.70 11.22 ? 470 PHE A C     1 
ATOM   2390 C  C     B PHE A 1  332 ? -21.054 -7.723  -11.377 0.30 11.20 ? 470 PHE A C     1 
ATOM   2391 O  O     A PHE A 1  332 ? -20.267 -6.705  -11.397 0.70 11.97 ? 470 PHE A O     1 
ATOM   2392 O  O     B PHE A 1  332 ? -19.996 -7.131  -11.181 0.30 11.22 ? 470 PHE A O     1 
ATOM   2393 C  CB    A PHE A 1  332 ? -20.157 -9.571  -12.451 0.70 10.19 ? 470 PHE A CB    1 
ATOM   2394 C  CB    B PHE A 1  332 ? -20.275 -9.754  -12.586 0.30 10.53 ? 470 PHE A CB    1 
ATOM   2395 C  CG    A PHE A 1  332 ? -20.256 -10.687 -13.429 0.70 11.51 ? 470 PHE A CG    1 
ATOM   2396 C  CG    B PHE A 1  332 ? -20.201 -10.422 -11.240 0.30 10.35 ? 470 PHE A CG    1 
ATOM   2397 C  CD1   A PHE A 1  332 ? -20.730 -11.926 -13.036 0.70 11.64 ? 470 PHE A CD1   1 
ATOM   2398 C  CD1   B PHE A 1  332 ? -21.240 -11.214 -10.791 0.30 11.29 ? 470 PHE A CD1   1 
ATOM   2399 C  CD2   A PHE A 1  332 ? -19.895 -10.496 -14.756 0.70 11.02 ? 470 PHE A CD2   1 
ATOM   2400 C  CD2   B PHE A 1  332 ? -19.093 -10.254 -10.424 0.30 10.05 ? 470 PHE A CD2   1 
ATOM   2401 C  CE1   A PHE A 1  332 ? -20.823 -12.961 -13.954 0.70 15.43 ? 470 PHE A CE1   1 
ATOM   2402 C  CE1   B PHE A 1  332 ? -21.185 -11.822 -9.552  0.30 11.79 ? 470 PHE A CE1   1 
ATOM   2403 C  CE2   A PHE A 1  332 ? -19.984 -11.513 -15.669 0.70 12.57 ? 470 PHE A CE2   1 
ATOM   2404 C  CE2   B PHE A 1  332 ? -19.020 -10.863 -9.191  0.30 9.55  ? 470 PHE A CE2   1 
ATOM   2405 C  CZ    A PHE A 1  332 ? -20.457 -12.742 -15.281 0.70 14.66 ? 470 PHE A CZ    1 
ATOM   2406 C  CZ    B PHE A 1  332 ? -20.069 -11.657 -8.752  0.30 10.77 ? 470 PHE A CZ    1 
ATOM   2407 N  N     . GLN A 1  333 ? -22.049 -7.681  -10.501 1.00 6.88  ? 471 GLN A N     1 
ATOM   2408 C  CA    . GLN A 1  333 ? -21.924 -6.848  -9.323  1.00 10.61 ? 471 GLN A CA    1 
ATOM   2409 C  C     . GLN A 1  333 ? -21.032 -7.650  -8.391  1.00 12.51 ? 471 GLN A C     1 
ATOM   2410 O  O     . GLN A 1  333 ? -21.150 -8.871  -8.300  1.00 18.91 ? 471 GLN A O     1 
ATOM   2411 C  CB    . GLN A 1  333 ? -23.286 -6.545  -8.696  1.00 17.28 ? 471 GLN A CB    1 
ATOM   2412 C  CG    . GLN A 1  333 ? -24.081 -5.495  -9.472  1.00 20.18 ? 471 GLN A CG    1 
ATOM   2413 N  N     . ALA A 1  334 ? -20.109 -7.000  -7.727  1.00 10.08 ? 472 ALA A N     1 
ATOM   2414 C  CA    . ALA A 1  334 ? -19.339 -7.739  -6.739  1.00 6.93  ? 472 ALA A CA    1 
ATOM   2415 C  C     . ALA A 1  334 ? -19.367 -6.947  -5.465  1.00 5.88  ? 472 ALA A C     1 
ATOM   2416 O  O     . ALA A 1  334 ? -19.326 -5.734  -5.510  1.00 8.40  ? 472 ALA A O     1 
ATOM   2417 C  CB    . ALA A 1  334 ? -17.905 -7.940  -7.245  1.00 4.96  ? 472 ALA A CB    1 
ATOM   2418 N  N     . ALA A 1  335 ? -19.496 -7.639  -4.325  1.00 5.73  ? 473 ALA A N     1 
ATOM   2419 C  CA    . ALA A 1  335 ? -19.454 -6.982  -3.026  1.00 7.95  ? 473 ALA A CA    1 
ATOM   2420 C  C     . ALA A 1  335 ? -18.121 -7.215  -2.331  1.00 5.48  ? 473 ALA A C     1 
ATOM   2421 O  O     . ALA A 1  335 ? -17.843 -6.616  -1.293  1.00 6.14  ? 473 ALA A O     1 
ATOM   2422 C  CB    . ALA A 1  335 ? -20.625 -7.471  -2.127  1.00 6.85  ? 473 ALA A CB    1 
ATOM   2423 N  N     . SER A 1  336 ? -17.300 -8.086  -2.910  1.00 4.34  ? 474 SER A N     1 
ATOM   2424 C  CA    . SER A 1  336 ? -16.005 -8.461  -2.311  1.00 3.50  ? 474 SER A CA    1 
ATOM   2425 C  C     . SER A 1  336 ? -15.106 -9.070  -3.358  1.00 2.21  ? 474 SER A C     1 
ATOM   2426 O  O     . SER A 1  336 ? -15.555 -9.465  -4.438  1.00 2.45  ? 474 SER A O     1 
ATOM   2427 C  CB    . SER A 1  336 ? -16.231 -9.524  -1.208  1.00 2.43  ? 474 SER A CB    1 
ATOM   2428 O  OG    . SER A 1  336 ? -16.886 -10.687 -1.751  1.00 5.58  ? 474 SER A OG    1 
ATOM   2429 N  N     . GLU A 1  337 ? -13.817 -9.194  -3.044  1.00 2.52  ? 475 GLU A N     1 
ATOM   2430 C  CA    . GLU A 1  337 ? -12.937 -9.918  -3.928  1.00 1.81  ? 475 GLU A CA    1 
ATOM   2431 C  C     . GLU A 1  337 ? -13.401 -11.390 -3.988  1.00 4.35  ? 475 GLU A C     1 
ATOM   2432 O  O     . GLU A 1  337 ? -13.362 -12.042 -5.039  1.00 3.84  ? 475 GLU A O     1 
ATOM   2433 C  CB    . GLU A 1  337 ? -11.527 -9.853  -3.372  1.00 3.10  ? 475 GLU A CB    1 
ATOM   2434 C  CG    . GLU A 1  337 ? -10.907 -8.423  -3.372  1.00 2.41  ? 475 GLU A CG    1 
ATOM   2435 C  CD    . GLU A 1  337 ? -9.439  -8.473  -2.928  1.00 2.24  ? 475 GLU A CD    1 
ATOM   2436 O  OE1   . GLU A 1  337 ? -9.141  -9.092  -1.864  1.00 1.71  ? 475 GLU A OE1   1 
ATOM   2437 O  OE2   . GLU A 1  337 ? -8.590  -7.946  -3.654  1.00 3.24  ? 475 GLU A OE2   1 
ATOM   2438 N  N     . GLU A 1  338 ? -13.858 -11.905 -2.844  1.00 2.97  ? 476 GLU A N     1 
ATOM   2439 C  CA    . GLU A 1  338 ? -14.366 -13.262 -2.828  1.00 3.68  ? 476 GLU A CA    1 
ATOM   2440 C  C     . GLU A 1  338 ? -15.384 -13.487 -3.949  1.00 3.51  ? 476 GLU A C     1 
ATOM   2441 O  O     . GLU A 1  338 ? -15.314 -14.507 -4.642  1.00 4.10  ? 476 GLU A O     1 
ATOM   2442 C  CB    . GLU A 1  338 ? -14.976 -13.648 -1.465  1.00 3.71  ? 476 GLU A CB    1 
ATOM   2443 C  CG    . GLU A 1  338 ? -13.900 -13.926 -0.396  1.00 3.24  ? 476 GLU A CG    1 
ATOM   2444 C  CD    . GLU A 1  338 ? -14.470 -14.612 0.828   1.00 6.23  ? 476 GLU A CD    1 
ATOM   2445 O  OE1   . GLU A 1  338 ? -14.405 -14.009 1.926   1.00 4.07  ? 476 GLU A OE1   1 
ATOM   2446 O  OE2   . GLU A 1  338 ? -14.934 -15.780 0.686   1.00 4.63  ? 476 GLU A OE2   1 
ATOM   2447 N  N     . ASP A 1  339 ? -16.315 -12.543 -4.110  1.00 2.52  ? 477 ASP A N     1 
ATOM   2448 C  CA    . ASP A 1  339 ? -17.329 -12.616 -5.186  1.00 3.99  ? 477 ASP A CA    1 
ATOM   2449 C  C     . ASP A 1  339 ? -16.673 -12.761 -6.559  1.00 4.50  ? 477 ASP A C     1 
ATOM   2450 O  O     . ASP A 1  339 ? -17.157 -13.511 -7.441  1.00 4.43  ? 477 ASP A O     1 
ATOM   2451 C  CB    . ASP A 1  339 ? -18.161 -11.333 -5.278  1.00 3.13  ? 477 ASP A CB    1 
ATOM   2452 C  CG    . ASP A 1  339 ? -19.494 -11.425 -4.539  1.00 7.64  ? 477 ASP A CG    1 
ATOM   2453 O  OD1   . ASP A 1  339 ? -20.120 -10.351 -4.398  1.00 6.84  ? 477 ASP A OD1   1 
ATOM   2454 O  OD2   . ASP A 1  339 ? -19.867 -12.546 -4.103  1.00 5.75  ? 477 ASP A OD2   1 
ATOM   2455 N  N     . ILE A 1  340 ? -15.595 -12.007 -6.778  1.00 2.42  ? 478 ILE A N     1 
ATOM   2456 C  CA    . ILE A 1  340 ? -14.970 -12.000 -8.099  1.00 2.26  ? 478 ILE A CA    1 
ATOM   2457 C  C     . ILE A 1  340 ? -14.308 -13.338 -8.413  1.00 3.34  ? 478 ILE A C     1 
ATOM   2458 O  O     . ILE A 1  340 ? -14.471 -13.882 -9.513  1.00 3.56  ? 478 ILE A O     1 
ATOM   2459 C  CB    . ILE A 1  340 ? -13.919 -10.868 -8.194  1.00 2.63  ? 478 ILE A CB    1 
ATOM   2460 C  CG1   . ILE A 1  340 ? -14.638 -9.523  -8.003  1.00 3.21  ? 478 ILE A CG1   1 
ATOM   2461 C  CG2   . ILE A 1  340 ? -13.223 -10.917 -9.572  1.00 1.59  ? 478 ILE A CG2   1 
ATOM   2462 C  CD1   . ILE A 1  340 ? -13.661 -8.321  -7.853  1.00 1.78  ? 478 ILE A CD1   1 
ATOM   2463 N  N     . PHE A 1  341 ? -13.573 -13.884 -7.452  1.00 3.57  ? 479 PHE A N     1 
ATOM   2464 C  CA    . PHE A 1  341 ? -12.969 -15.214 -7.651  1.00 3.27  ? 479 PHE A CA    1 
ATOM   2465 C  C     . PHE A 1  341 ? -14.082 -16.245 -7.930  1.00 5.10  ? 479 PHE A C     1 
ATOM   2466 O  O     . PHE A 1  341 ? -13.968 -17.096 -8.837  1.00 5.86  ? 479 PHE A O     1 
ATOM   2467 C  CB    . PHE A 1  341 ? -12.178 -15.628 -6.426  1.00 2.35  ? 479 PHE A CB    1 
ATOM   2468 C  CG    . PHE A 1  341 ? -10.801 -15.057 -6.396  1.00 3.11  ? 479 PHE A CG    1 
ATOM   2469 C  CD1   . PHE A 1  341 ? -10.552 -13.821 -5.790  1.00 4.66  ? 479 PHE A CD1   1 
ATOM   2470 C  CD2   . PHE A 1  341 ? -9.742  -15.764 -6.970  1.00 3.59  ? 479 PHE A CD2   1 
ATOM   2471 C  CE1   . PHE A 1  341 ? -9.221  -13.287 -5.749  1.00 2.32  ? 479 PHE A CE1   1 
ATOM   2472 C  CE2   . PHE A 1  341 ? -8.417  -15.230 -6.932  1.00 6.32  ? 479 PHE A CE2   1 
ATOM   2473 C  CZ    . PHE A 1  341 ? -8.180  -13.990 -6.332  1.00 1.71  ? 479 PHE A CZ    1 
ATOM   2474 N  N     . ARG A 1  342 ? -15.176 -16.155 -7.167  1.00 4.70  ? 480 ARG A N     1 
ATOM   2475 C  CA    . ARG A 1  342 ? -16.322 -17.044 -7.450  1.00 6.75  ? 480 ARG A CA    1 
ATOM   2476 C  C     . ARG A 1  342 ? -16.937 -16.858 -8.880  1.00 8.20  ? 480 ARG A C     1 
ATOM   2477 O  O     . ARG A 1  342 ? -17.230 -17.840 -9.537  1.00 9.29  ? 480 ARG A O     1 
ATOM   2478 C  CB    . ARG A 1  342 ? -17.421 -16.929 -6.367  1.00 6.49  ? 480 ARG A CB    1 
ATOM   2479 C  CG    . ARG A 1  342 ? -17.005 -17.503 -4.981  1.00 6.23  ? 480 ARG A CG    1 
ATOM   2480 C  CD    . ARG A 1  342 ? -18.218 -17.489 -4.023  1.00 7.23  ? 480 ARG A CD    1 
ATOM   2481 N  NE    . ARG A 1  342 ? -18.613 -16.127 -3.664  1.00 6.10  ? 480 ARG A NE    1 
ATOM   2482 C  CZ    . ARG A 1  342 ? -18.325 -15.569 -2.489  1.00 5.69  ? 480 ARG A CZ    1 
ATOM   2483 N  NH1   . ARG A 1  342 ? -17.662 -16.263 -1.560  1.00 3.42  ? 480 ARG A NH1   1 
ATOM   2484 N  NH2   . ARG A 1  342 ? -18.711 -14.318 -2.233  1.00 5.57  ? 480 ARG A NH2   1 
ATOM   2485 N  N     A HIS A 1  343 ? -17.158 -15.611 -9.308  0.70 6.29  ? 481 HIS A N     1 
ATOM   2486 N  N     B HIS A 1  343 ? -17.107 -15.624 -9.343  0.30 6.36  ? 481 HIS A N     1 
ATOM   2487 C  CA    A HIS A 1  343 ? -17.664 -15.317 -10.653 0.70 8.98  ? 481 HIS A CA    1 
ATOM   2488 C  CA    B HIS A 1  343 ? -17.689 -15.398 -10.668 0.30 8.98  ? 481 HIS A CA    1 
ATOM   2489 C  C     A HIS A 1  343 ? -16.797 -16.031 -11.700 0.70 8.50  ? 481 HIS A C     1 
ATOM   2490 C  C     B HIS A 1  343 ? -16.761 -15.843 -11.808 0.30 8.49  ? 481 HIS A C     1 
ATOM   2491 O  O     A HIS A 1  343 ? -17.305 -16.582 -12.683 0.70 8.12  ? 481 HIS A O     1 
ATOM   2492 O  O     B HIS A 1  343 ? -17.190 -16.022 -12.960 0.30 7.97  ? 481 HIS A O     1 
ATOM   2493 C  CB    A HIS A 1  343 ? -17.637 -13.809 -10.953 0.70 9.39  ? 481 HIS A CB    1 
ATOM   2494 C  CB    B HIS A 1  343 ? -18.073 -13.936 -10.855 0.30 9.41  ? 481 HIS A CB    1 
ATOM   2495 C  CG    A HIS A 1  343 ? -18.653 -13.002 -10.200 0.70 10.29 ? 481 HIS A CG    1 
ATOM   2496 C  CG    B HIS A 1  343 ? -19.043 -13.714 -11.969 0.30 10.66 ? 481 HIS A CG    1 
ATOM   2497 N  ND1   A HIS A 1  343 ? -19.931 -13.454 -9.946  0.70 10.86 ? 481 HIS A ND1   1 
ATOM   2498 N  ND1   B HIS A 1  343 ? -20.348 -14.149 -11.913 0.30 11.26 ? 481 HIS A ND1   1 
ATOM   2499 C  CD2   A HIS A 1  343 ? -18.579 -11.763 -9.653  0.70 9.53  ? 481 HIS A CD2   1 
ATOM   2500 C  CD2   B HIS A 1  343 ? -18.899 -13.113 -13.170 0.30 11.40 ? 481 HIS A CD2   1 
ATOM   2501 C  CE1   A HIS A 1  343 ? -20.599 -12.532 -9.273  0.70 12.75 ? 481 HIS A CE1   1 
ATOM   2502 C  CE1   B HIS A 1  343 ? -20.967 -13.823 -13.031 0.30 12.34 ? 481 HIS A CE1   1 
ATOM   2503 N  NE2   A HIS A 1  343 ? -19.802 -11.495 -9.086  0.70 11.46 ? 481 HIS A NE2   1 
ATOM   2504 N  NE2   B HIS A 1  343 ? -20.110 -13.192 -13.811 0.30 13.43 ? 481 HIS A NE2   1 
ATOM   2505 N  N     . LEU A 1  344 ? -15.485 -16.005 -11.492 1.00 8.49  ? 482 LEU A N     1 
ATOM   2506 C  CA    . LEU A 1  344 ? -14.548 -16.570 -12.450 1.00 8.39  ? 482 LEU A CA    1 
ATOM   2507 C  C     . LEU A 1  344 ? -14.262 -18.052 -12.235 1.00 7.80  ? 482 LEU A C     1 
ATOM   2508 O  O     . LEU A 1  344 ? -13.408 -18.615 -12.936 1.00 9.30  ? 482 LEU A O     1 
ATOM   2509 C  CB    . LEU A 1  344 ? -13.218 -15.812 -12.390 1.00 6.42  ? 482 LEU A CB    1 
ATOM   2510 C  CG    . LEU A 1  344 ? -13.284 -14.316 -12.745 1.00 4.61  ? 482 LEU A CG    1 
ATOM   2511 C  CD1   . LEU A 1  344 ? -11.928 -13.711 -12.486 1.00 7.09  ? 482 LEU A CD1   1 
ATOM   2512 C  CD2   . LEU A 1  344 ? -13.672 -14.103 -14.212 1.00 6.12  ? 482 LEU A CD2   1 
ATOM   2513 N  N     . GLY A 1  345 ? -14.925 -18.680 -11.265 1.00 8.89  ? 483 GLY A N     1 
ATOM   2514 C  CA    . GLY A 1  345 ? -14.691 -20.101 -11.000 1.00 10.78 ? 483 GLY A CA    1 
ATOM   2515 C  C     . GLY A 1  345 ? -13.299 -20.518 -10.533 1.00 14.72 ? 483 GLY A C     1 
ATOM   2516 O  O     . GLY A 1  345 ? -12.815 -21.596 -10.871 1.00 10.96 ? 483 GLY A O     1 
ATOM   2517 N  N     . LEU A 1  346 ? -12.661 -19.670 -9.733  1.00 5.42  ? 484 LEU A N     1 
ATOM   2518 C  CA    . LEU A 1  346 ? -11.304 -19.882 -9.241  1.00 5.15  ? 484 LEU A CA    1 
ATOM   2519 C  C     . LEU A 1  346 ? -11.417 -20.018 -7.741  1.00 8.78  ? 484 LEU A C     1 
ATOM   2520 O  O     . LEU A 1  346 ? -12.248 -19.343 -7.118  1.00 8.50  ? 484 LEU A O     1 
ATOM   2521 C  CB    . LEU A 1  346 ? -10.458 -18.618 -9.509  1.00 4.76  ? 484 LEU A CB    1 
ATOM   2522 C  CG    . LEU A 1  346 ? -10.050 -18.414 -10.959 1.00 6.92  ? 484 LEU A CG    1 
ATOM   2523 C  CD1   . LEU A 1  346 ? -9.412  -17.036 -11.233 1.00 5.24  ? 484 LEU A CD1   1 
ATOM   2524 C  CD2   . LEU A 1  346 ? -9.022  -19.506 -11.303 1.00 8.73  ? 484 LEU A CD2   1 
ATOM   2525 N  N     . GLU A 1  347 ? -10.581 -20.856 -7.147  1.00 7.90  ? 485 GLU A N     1 
ATOM   2526 C  CA    . GLU A 1  347 ? -10.474 -20.879 -5.683  1.00 6.40  ? 485 GLU A CA    1 
ATOM   2527 C  C     . GLU A 1  347 ? -9.966  -19.509 -5.183  1.00 9.57  ? 485 GLU A C     1 
ATOM   2528 O  O     . GLU A 1  347 ? -9.066  -18.916 -5.771  1.00 4.64  ? 485 GLU A O     1 
ATOM   2529 C  CB    . GLU A 1  347 ? -9.548  -22.016 -5.208  1.00 7.36  ? 485 GLU A CB    1 
ATOM   2530 N  N     . TYR A 1  348 ? -10.529 -19.021 -4.079  1.00 6.14  ? 486 TYR A N     1 
ATOM   2531 C  CA    . TYR A 1  348 ? -10.118 -17.724 -3.523  1.00 7.01  ? 486 TYR A CA    1 
ATOM   2532 C  C     . TYR A 1  348 ? -8.627  -17.746 -3.090  1.00 7.57  ? 486 TYR A C     1 
ATOM   2533 O  O     . TYR A 1  348 ? -8.182  -18.702 -2.491  1.00 3.45  ? 486 TYR A O     1 
ATOM   2534 C  CB    . TYR A 1  348 ? -10.993 -17.359 -2.315  1.00 7.90  ? 486 TYR A CB    1 
ATOM   2535 C  CG    . TYR A 1  348 ? -10.532 -16.044 -1.677  1.00 5.84  ? 486 TYR A CG    1 
ATOM   2536 C  CD1   . TYR A 1  348 ? -10.744 -14.817 -2.321  1.00 4.70  ? 486 TYR A CD1   1 
ATOM   2537 C  CD2   . TYR A 1  348 ? -9.826  -16.044 -0.499  1.00 5.25  ? 486 TYR A CD2   1 
ATOM   2538 C  CE1   . TYR A 1  348 ? -10.282 -13.641 -1.753  1.00 5.77  ? 486 TYR A CE1   1 
ATOM   2539 C  CE2   . TYR A 1  348 ? -9.378  -14.867 0.076   1.00 7.29  ? 486 TYR A CE2   1 
ATOM   2540 C  CZ    . TYR A 1  348 ? -9.617  -13.678 -0.561  1.00 8.11  ? 486 TYR A CZ    1 
ATOM   2541 O  OH    . TYR A 1  348 ? -9.119  -12.525 -0.003  1.00 8.47  ? 486 TYR A OH    1 
ATOM   2542 N  N     . LEU A 1  349 ? -7.875  -16.681 -3.371  1.00 3.29  ? 487 LEU A N     1 
ATOM   2543 C  CA    . LEU A 1  349 ? -6.501  -16.529 -2.879  1.00 3.23  ? 487 LEU A CA    1 
ATOM   2544 C  C     . LEU A 1  349 ? -6.422  -15.218 -2.142  1.00 2.69  ? 487 LEU A C     1 
ATOM   2545 O  O     . LEU A 1  349 ? -6.778  -14.187 -2.687  1.00 2.70  ? 487 LEU A O     1 
ATOM   2546 C  CB    . LEU A 1  349 ? -5.519  -16.463 -4.055  1.00 1.75  ? 487 LEU A CB    1 
ATOM   2547 C  CG    . LEU A 1  349 ? -5.434  -17.790 -4.818  1.00 4.70  ? 487 LEU A CG    1 
ATOM   2548 C  CD1   . LEU A 1  349 ? -4.623  -17.630 -6.140  1.00 4.48  ? 487 LEU A CD1   1 
ATOM   2549 C  CD2   . LEU A 1  349 ? -4.728  -18.829 -3.898  1.00 8.43  ? 487 LEU A CD2   1 
ATOM   2550 N  N     . PRO A 1  350 ? -5.998  -15.266 -0.885  1.00 3.18  ? 488 PRO A N     1 
ATOM   2551 C  CA    . PRO A 1  350 ? -5.814  -14.010 -0.166  1.00 3.43  ? 488 PRO A CA    1 
ATOM   2552 C  C     . PRO A 1  350 ? -4.634  -13.247 -0.799  1.00 1.94  ? 488 PRO A C     1 
ATOM   2553 O  O     . PRO A 1  350 ? -3.863  -13.831 -1.534  1.00 1.60  ? 488 PRO A O     1 
ATOM   2554 C  CB    . PRO A 1  350 ? -5.485  -14.472 1.264   1.00 3.69  ? 488 PRO A CB    1 
ATOM   2555 C  CG    . PRO A 1  350 ? -4.755  -15.777 1.051   1.00 6.45  ? 488 PRO A CG    1 
ATOM   2556 C  CD    . PRO A 1  350 ? -5.540  -16.435 -0.105  1.00 3.44  ? 488 PRO A CD    1 
ATOM   2557 N  N     . PRO A 1  351 ? -4.520  -11.934 -0.526  1.00 1.73  ? 489 PRO A N     1 
ATOM   2558 C  CA    . PRO A 1  351 ? -3.457  -11.089 -1.108  1.00 1.89  ? 489 PRO A CA    1 
ATOM   2559 C  C     . PRO A 1  351 ? -2.070  -11.664 -0.959  1.00 1.92  ? 489 PRO A C     1 
ATOM   2560 O  O     . PRO A 1  351 ? -1.252  -11.540 -1.872  1.00 2.83  ? 489 PRO A O     1 
ATOM   2561 C  CB    . PRO A 1  351 ? -3.581  -9.780  -0.301  1.00 2.65  ? 489 PRO A CB    1 
ATOM   2562 C  CG    . PRO A 1  351 ? -5.058  -9.701  -0.007  1.00 2.36  ? 489 PRO A CG    1 
ATOM   2563 C  CD    . PRO A 1  351 ? -5.485  -11.148 0.269   1.00 3.41  ? 489 PRO A CD    1 
ATOM   2564 N  N     . GLU A 1  352 ? -1.812  -12.289 0.184   1.00 1.55  ? 490 GLU A N     1 
ATOM   2565 C  CA    A GLU A 1  352 ? -0.474  -12.803 0.466   0.50 2.46  ? 490 GLU A CA    1 
ATOM   2566 C  CA    B GLU A 1  352 ? -0.496  -12.851 0.500   0.50 2.52  ? 490 GLU A CA    1 
ATOM   2567 C  C     . GLU A 1  352 ? -0.137  -14.052 -0.381  1.00 4.05  ? 490 GLU A C     1 
ATOM   2568 O  O     . GLU A 1  352 ? 1.006   -14.491 -0.414  1.00 2.98  ? 490 GLU A O     1 
ATOM   2569 C  CB    A GLU A 1  352 ? -0.305  -13.066 1.974   0.50 5.08  ? 490 GLU A CB    1 
ATOM   2570 C  CB    B GLU A 1  352 ? -0.447  -13.279 1.973   0.50 5.18  ? 490 GLU A CB    1 
ATOM   2571 C  CG    A GLU A 1  352 ? -1.072  -14.280 2.472   0.50 5.24  ? 490 GLU A CG    1 
ATOM   2572 C  CG    B GLU A 1  352 ? -0.580  -12.172 2.955   0.50 4.03  ? 490 GLU A CG    1 
ATOM   2573 C  CD    A GLU A 1  352 ? -2.380  -13.932 3.127   0.50 6.19  ? 490 GLU A CD    1 
ATOM   2574 C  CD    B GLU A 1  352 ? -2.023  -11.762 3.245   0.50 7.05  ? 490 GLU A CD    1 
ATOM   2575 O  OE1   A GLU A 1  352 ? -2.855  -12.784 2.925   0.50 6.06  ? 490 GLU A OE1   1 
ATOM   2576 O  OE1   B GLU A 1  352 ? -2.956  -12.286 2.601   0.50 4.76  ? 490 GLU A OE1   1 
ATOM   2577 O  OE2   A GLU A 1  352 ? -2.926  -14.810 3.843   0.50 2.35  ? 490 GLU A OE2   1 
ATOM   2578 O  OE2   B GLU A 1  352 ? -2.213  -10.903 4.130   0.50 9.51  ? 490 GLU A OE2   1 
ATOM   2579 N  N     . GLN A 1  353 ? -1.116  -14.579 -1.096  1.00 1.63  ? 491 GLN A N     1 
ATOM   2580 C  CA    . GLN A 1  353 ? -0.874  -15.695 -2.017  1.00 2.85  ? 491 GLN A CA    1 
ATOM   2581 C  C     . GLN A 1  353 ? -1.021  -15.272 -3.472  1.00 2.99  ? 491 GLN A C     1 
ATOM   2582 O  O     . GLN A 1  353 ? -1.207  -16.126 -4.342  1.00 3.40  ? 491 GLN A O     1 
ATOM   2583 C  CB    . GLN A 1  353 ? -1.844  -16.853 -1.701  1.00 3.86  ? 491 GLN A CB    1 
ATOM   2584 C  CG    . GLN A 1  353 ? -1.668  -17.394 -0.257  1.00 4.39  ? 491 GLN A CG    1 
ATOM   2585 C  CD    . GLN A 1  353 ? -0.277  -17.978 -0.016  1.00 7.90  ? 491 GLN A CD    1 
ATOM   2586 O  OE1   . GLN A 1  353 ? 0.425   -18.365 -0.959  1.00 6.08  ? 491 GLN A OE1   1 
ATOM   2587 N  NE2   . GLN A 1  353 ? 0.131   -18.035 1.248   1.00 7.67  ? 491 GLN A NE2   1 
ATOM   2588 N  N     . ARG A 1  354 ? -0.959  -13.957 -3.727  1.00 1.96  ? 492 ARG A N     1 
ATOM   2589 C  CA    . ARG A 1  354 ? -1.068  -13.420 -5.078  1.00 0.63  ? 492 ARG A CA    1 
ATOM   2590 C  C     . ARG A 1  354 ? 0.277   -12.883 -5.539  1.00 2.13  ? 492 ARG A C     1 
ATOM   2591 O  O     . ARG A 1  354 ? 0.357   -12.016 -6.437  1.00 2.16  ? 492 ARG A O     1 
ATOM   2592 C  CB    . ARG A 1  354 ? -2.117  -12.300 -5.132  1.00 1.13  ? 492 ARG A CB    1 
ATOM   2593 C  CG    . ARG A 1  354 ? -3.487  -12.762 -4.632  1.00 1.46  ? 492 ARG A CG    1 
ATOM   2594 C  CD    . ARG A 1  354 ? -4.573  -11.661 -4.859  1.00 1.11  ? 492 ARG A CD    1 
ATOM   2595 N  NE    . ARG A 1  354 ? -5.767  -11.940 -4.036  1.00 1.35  ? 492 ARG A NE    1 
ATOM   2596 C  CZ    . ARG A 1  354 ? -6.590  -11.002 -3.584  1.00 1.95  ? 492 ARG A CZ    1 
ATOM   2597 N  NH1   . ARG A 1  354 ? -6.403  -9.727  -3.921  1.00 0.69  ? 492 ARG A NH1   1 
ATOM   2598 N  NH2   . ARG A 1  354 ? -7.605  -11.327 -2.780  1.00 1.48  ? 492 ARG A NH2   1 
ATOM   2599 N  N     . ASN A 1  355 ? 1.345   -13.406 -4.954  1.00 3.30  ? 493 ASN A N     1 
ATOM   2600 C  CA    . ASN A 1  355 ? 2.675   -12.859 -5.233  1.00 2.57  ? 493 ASN A CA    1 
ATOM   2601 C  C     . ASN A 1  355 ? 3.303   -13.513 -6.447  1.00 5.17  ? 493 ASN A C     1 
ATOM   2602 O  O     . ASN A 1  355 ? 4.465   -13.959 -6.396  1.00 5.21  ? 493 ASN A O     1 
ATOM   2603 C  CB    . ASN A 1  355 ? 3.585   -12.986 -3.977  1.00 2.14  ? 493 ASN A CB    1 
ATOM   2604 C  CG    . ASN A 1  355 ? 3.209   -11.997 -2.926  1.00 4.61  ? 493 ASN A CG    1 
ATOM   2605 O  OD1   . ASN A 1  355 ? 3.433   -10.787 -3.096  1.00 2.92  ? 493 ASN A OD1   1 
ATOM   2606 N  ND2   . ASN A 1  355 ? 2.620   -12.484 -1.814  1.00 4.88  ? 493 ASN A ND2   1 
ATOM   2607 N  N     . ALA A 1  356 ? 2.530   -13.604 -7.528  1.00 2.32  ? 494 ALA A N     1 
ATOM   2608 C  CA    . ALA A 1  356 ? 3.043   -14.231 -8.736  1.00 4.90  ? 494 ALA A CA    1 
ATOM   2609 C  C     . ALA A 1  356 ? 4.183   -13.469 -9.340  1.00 6.08  ? 494 ALA A C     1 
ATOM   2610 O  O     . ALA A 1  356 ? 4.124   -12.237 -9.356  1.00 3.92  ? 494 ALA A O     1 
ATOM   2611 C  CB    . ALA A 1  356 ? 1.929   -14.391 -9.766  1.00 4.46  ? 494 ALA A CB    1 
ATOM   2612 O  OXT   . ALA A 1  356 ? 5.170   -14.074 -9.839  1.00 8.27  ? 494 ALA A OXT   1 
ATOM   2613 O  "O5'" . DC  B 2  1   ? 3.074   -18.613 -38.696 1.00 26.77 ? 1   DC  T "O5'" 1 
ATOM   2614 C  "C5'" . DC  B 2  1   ? 1.933   -19.082 -39.422 1.00 31.17 ? 1   DC  T "C5'" 1 
ATOM   2615 C  "C4'" . DC  B 2  1   ? 0.749   -19.049 -38.480 1.00 34.24 ? 1   DC  T "C4'" 1 
ATOM   2616 O  "O4'" . DC  B 2  1   ? 0.797   -20.156 -37.547 1.00 35.56 ? 1   DC  T "O4'" 1 
ATOM   2617 C  "C3'" . DC  B 2  1   ? 0.816   -17.792 -37.637 1.00 29.33 ? 1   DC  T "C3'" 1 
ATOM   2618 O  "O3'" . DC  B 2  1   ? -0.237  -16.983 -38.029 1.00 26.24 ? 1   DC  T "O3'" 1 
ATOM   2619 C  "C2'" . DC  B 2  1   ? 0.713   -18.213 -36.179 1.00 28.65 ? 1   DC  T "C2'" 1 
ATOM   2620 C  "C1'" . DC  B 2  1   ? 0.482   -19.716 -36.235 1.00 30.43 ? 1   DC  T "C1'" 1 
ATOM   2621 N  N1    . DC  B 2  1   ? 1.326   -20.530 -35.293 1.00 20.55 ? 1   DC  T N1    1 
ATOM   2622 C  C2    . DC  B 2  1   ? 0.731   -20.996 -34.125 1.00 17.21 ? 1   DC  T C2    1 
ATOM   2623 O  O2    . DC  B 2  1   ? -0.448  -20.711 -33.935 1.00 18.60 ? 1   DC  T O2    1 
ATOM   2624 N  N3    . DC  B 2  1   ? 1.436   -21.751 -33.267 1.00 10.86 ? 1   DC  T N3    1 
ATOM   2625 C  C4    . DC  B 2  1   ? 2.688   -22.031 -33.529 1.00 12.43 ? 1   DC  T C4    1 
ATOM   2626 N  N4    . DC  B 2  1   ? 3.342   -22.776 -32.645 1.00 10.63 ? 1   DC  T N4    1 
ATOM   2627 C  C5    . DC  B 2  1   ? 3.346   -21.552 -34.707 1.00 15.78 ? 1   DC  T C5    1 
ATOM   2628 C  C6    . DC  B 2  1   ? 2.630   -20.808 -35.558 1.00 21.44 ? 1   DC  T C6    1 
ATOM   2629 P  P     . DG  B 2  2   ? -0.295  -15.484 -37.486 1.00 28.51 ? 2   DG  T P     1 
ATOM   2630 O  OP1   . DG  B 2  2   ? -1.040  -14.729 -38.523 1.00 34.84 ? 2   DG  T OP1   1 
ATOM   2631 O  OP2   . DG  B 2  2   ? 1.051   -15.042 -37.050 1.00 19.39 ? 2   DG  T OP2   1 
ATOM   2632 O  "O5'" . DG  B 2  2   ? -1.212  -15.631 -36.199 1.00 20.90 ? 2   DG  T "O5'" 1 
ATOM   2633 C  "C5'" . DG  B 2  2   ? -2.566  -16.062 -36.335 1.00 21.10 ? 2   DG  T "C5'" 1 
ATOM   2634 C  "C4'" . DG  B 2  2   ? -3.221  -15.927 -34.986 1.00 18.29 ? 2   DG  T "C4'" 1 
ATOM   2635 O  "O4'" . DG  B 2  2   ? -2.509  -16.739 -34.023 1.00 15.87 ? 2   DG  T "O4'" 1 
ATOM   2636 C  "C3'" . DG  B 2  2   ? -3.197  -14.509 -34.408 1.00 17.15 ? 2   DG  T "C3'" 1 
ATOM   2637 O  "O3'" . DG  B 2  2   ? -4.407  -14.394 -33.687 1.00 18.46 ? 2   DG  T "O3'" 1 
ATOM   2638 C  "C2'" . DG  B 2  2   ? -1.959  -14.497 -33.510 1.00 16.51 ? 2   DG  T "C2'" 1 
ATOM   2639 C  "C1'" . DG  B 2  2   ? -1.908  -15.932 -33.004 1.00 16.56 ? 2   DG  T "C1'" 1 
ATOM   2640 N  N9    . DG  B 2  2   ? -0.582  -16.543 -32.810 1.00 17.20 ? 2   DG  T N9    1 
ATOM   2641 C  C8    . DG  B 2  2   ? 0.556   -16.366 -33.554 1.00 16.98 ? 2   DG  T C8    1 
ATOM   2642 N  N7    . DG  B 2  2   ? 1.570   -17.089 -33.138 1.00 15.90 ? 2   DG  T N7    1 
ATOM   2643 C  C5    . DG  B 2  2   ? 1.072   -17.777 -32.042 1.00 14.57 ? 2   DG  T C5    1 
ATOM   2644 C  C6    . DG  B 2  2   ? 1.688   -18.729 -31.204 1.00 12.19 ? 2   DG  T C6    1 
ATOM   2645 O  O6    . DG  B 2  2   ? 2.845   -19.111 -31.280 1.00 14.98 ? 2   DG  T O6    1 
ATOM   2646 N  N1    . DG  B 2  2   ? 0.836   -19.209 -30.215 1.00 10.68 ? 2   DG  T N1    1 
ATOM   2647 C  C2    . DG  B 2  2   ? -0.457  -18.805 -30.075 1.00 11.97 ? 2   DG  T C2    1 
ATOM   2648 N  N2    . DG  B 2  2   ? -1.169  -19.317 -29.060 1.00 8.01  ? 2   DG  T N2    1 
ATOM   2649 N  N3    . DG  B 2  2   ? -1.046  -17.919 -30.861 1.00 15.29 ? 2   DG  T N3    1 
ATOM   2650 C  C4    . DG  B 2  2   ? -0.239  -17.459 -31.828 1.00 12.34 ? 2   DG  T C4    1 
ATOM   2651 P  P     . DG  B 2  3   ? -4.777  -13.021 -32.948 1.00 22.34 ? 3   DG  T P     1 
ATOM   2652 O  OP1   . DG  B 2  3   ? -6.245  -13.107 -32.850 1.00 15.93 ? 3   DG  T OP1   1 
ATOM   2653 O  OP2   . DG  B 2  3   ? -3.978  -11.918 -33.490 1.00 17.77 ? 3   DG  T OP2   1 
ATOM   2654 O  "O5'" . DG  B 2  3   ? -4.144  -13.237 -31.470 1.00 13.66 ? 3   DG  T "O5'" 1 
ATOM   2655 C  "C5'" . DG  B 2  3   ? -4.631  -14.328 -30.721 1.00 12.15 ? 3   DG  T "C5'" 1 
ATOM   2656 C  "C4'" . DG  B 2  3   ? -3.881  -14.318 -29.397 1.00 13.92 ? 3   DG  T "C4'" 1 
ATOM   2657 O  "O4'" . DG  B 2  3   ? -2.597  -14.921 -29.625 1.00 12.50 ? 3   DG  T "O4'" 1 
ATOM   2658 C  "C3'" . DG  B 2  3   ? -3.590  -12.930 -28.861 1.00 10.30 ? 3   DG  T "C3'" 1 
ATOM   2659 O  "O3'" . DG  B 2  3   ? -4.396  -12.813 -27.661 1.00 12.67 ? 3   DG  T "O3'" 1 
ATOM   2660 C  "C2'" . DG  B 2  3   ? -2.064  -12.895 -28.606 1.00 12.18 ? 3   DG  T "C2'" 1 
ATOM   2661 C  "C1'" . DG  B 2  3   ? -1.668  -14.363 -28.727 1.00 12.23 ? 3   DG  T "C1'" 1 
ATOM   2662 N  N9    . DG  B 2  3   ? -0.343  -14.625 -29.288 1.00 14.53 ? 3   DG  T N9    1 
ATOM   2663 C  C8    . DG  B 2  3   ? 0.197   -14.086 -30.432 1.00 14.48 ? 3   DG  T C8    1 
ATOM   2664 N  N7    . DG  B 2  3   ? 1.391   -14.522 -30.673 1.00 12.16 ? 3   DG  T N7    1 
ATOM   2665 C  C5    . DG  B 2  3   ? 1.656   -15.398 -29.626 1.00 12.22 ? 3   DG  T C5    1 
ATOM   2666 C  C6    . DG  B 2  3   ? 2.800   -16.179 -29.356 1.00 10.50 ? 3   DG  T C6    1 
ATOM   2667 O  O6    . DG  B 2  3   ? 3.855   -16.249 -30.005 1.00 11.76 ? 3   DG  T O6    1 
ATOM   2668 N  N1    . DG  B 2  3   ? 2.675   -16.947 -28.206 1.00 7.92  ? 3   DG  T N1    1 
ATOM   2669 C  C2    . DG  B 2  3   ? 1.564   -16.966 -27.435 1.00 9.69  ? 3   DG  T C2    1 
ATOM   2670 N  N2    . DG  B 2  3   ? 1.638   -17.783 -26.373 1.00 10.49 ? 3   DG  T N2    1 
ATOM   2671 N  N3    . DG  B 2  3   ? 0.465   -16.257 -27.671 1.00 9.78  ? 3   DG  T N3    1 
ATOM   2672 C  C4    . DG  B 2  3   ? 0.593   -15.485 -28.777 1.00 12.92 ? 3   DG  T C4    1 
ATOM   2673 P  P     . DC  B 2  4   ? -4.455  -11.428 -26.835 1.00 14.02 ? 4   DC  T P     1 
ATOM   2674 O  OP1   . DC  B 2  4   ? -5.714  -11.591 -26.097 1.00 12.65 ? 4   DC  T OP1   1 
ATOM   2675 O  OP2   . DC  B 2  4   ? -4.135  -10.224 -27.615 1.00 12.70 ? 4   DC  T OP2   1 
ATOM   2676 O  "O5'" . DC  B 2  4   ? -3.244  -11.534 -25.767 1.00 12.69 ? 4   DC  T "O5'" 1 
ATOM   2677 C  "C5'" . DC  B 2  4   ? -3.215  -12.659 -24.891 1.00 8.44  ? 4   DC  T "C5'" 1 
ATOM   2678 C  "C4'" . DC  B 2  4   ? -1.837  -12.645 -24.244 1.00 9.13  ? 4   DC  T "C4'" 1 
ATOM   2679 O  "O4'" . DC  B 2  4   ? -0.847  -13.100 -25.197 1.00 8.70  ? 4   DC  T "O4'" 1 
ATOM   2680 C  "C3'" . DC  B 2  4   ? -1.363  -11.286 -23.762 1.00 6.00  ? 4   DC  T "C3'" 1 
ATOM   2681 O  "O3'" . DC  B 2  4   ? -0.976  -11.450 -22.370 1.00 8.28  ? 4   DC  T "O3'" 1 
ATOM   2682 C  "C2'" . DC  B 2  4   ? -0.149  -10.988 -24.655 1.00 8.58  ? 4   DC  T "C2'" 1 
ATOM   2683 C  "C1'" . DC  B 2  4   ? 0.334   -12.416 -24.955 1.00 8.83  ? 4   DC  T "C1'" 1 
ATOM   2684 N  N1    . DC  B 2  4   ? 1.275   -12.503 -26.152 1.00 9.85  ? 4   DC  T N1    1 
ATOM   2685 C  C2    . DC  B 2  4   ? 2.312   -13.441 -26.143 1.00 9.51  ? 4   DC  T C2    1 
ATOM   2686 O  O2    . DC  B 2  4   ? 2.404   -14.207 -25.177 1.00 8.88  ? 4   DC  T O2    1 
ATOM   2687 N  N3    . DC  B 2  4   ? 3.172   -13.495 -27.213 1.00 8.35  ? 4   DC  T N3    1 
ATOM   2688 C  C4    . DC  B 2  4   ? 3.029   -12.633 -28.230 1.00 11.99 ? 4   DC  T C4    1 
ATOM   2689 N  N4    . DC  B 2  4   ? 3.924   -12.686 -29.243 1.00 11.32 ? 4   DC  T N4    1 
ATOM   2690 C  C5    . DC  B 2  4   ? 1.960   -11.671 -28.260 1.00 11.90 ? 4   DC  T C5    1 
ATOM   2691 C  C6    . DC  B 2  4   ? 1.134   -11.638 -27.197 1.00 10.34 ? 4   DC  T C6    1 
ATOM   2692 P  P     . DA  B 2  5   ? -0.900  -10.165 -21.410 1.00 6.19  ? 5   DA  T P     1 
ATOM   2693 O  OP1   . DA  B 2  5   ? -0.202  -9.059  -22.046 1.00 5.43  ? 5   DA  T OP1   1 
ATOM   2694 O  OP2   . DA  B 2  5   ? -0.391  -10.663 -20.112 1.00 6.86  ? 5   DA  T OP2   1 
ATOM   2695 O  "O5'" . DA  B 2  5   ? -2.431  -9.687  -21.302 1.00 4.93  ? 5   DA  T "O5'" 1 
ATOM   2696 C  "C5'" . DA  B 2  5   ? -3.351  -10.521 -20.581 1.00 2.91  ? 5   DA  T "C5'" 1 
ATOM   2697 C  "C4'" . DA  B 2  5   ? -4.523  -9.666  -20.107 1.00 6.74  ? 5   DA  T "C4'" 1 
ATOM   2698 O  "O4'" . DA  B 2  5   ? -3.987  -8.672  -19.209 1.00 5.31  ? 5   DA  T "O4'" 1 
ATOM   2699 C  "C3'" . DA  B 2  5   ? -5.246  -8.852  -21.187 1.00 5.62  ? 5   DA  T "C3'" 1 
ATOM   2700 O  "O3'" . DA  B 2  5   ? -6.641  -8.798  -20.808 1.00 8.39  ? 5   DA  T "O3'" 1 
ATOM   2701 C  "C2'" . DA  B 2  5   ? -4.585  -7.464  -21.165 1.00 5.50  ? 5   DA  T "C2'" 1 
ATOM   2702 C  "C1'" . DA  B 2  5   ? -4.163  -7.346  -19.697 1.00 6.09  ? 5   DA  T "C1'" 1 
ATOM   2703 N  N9    . DA  B 2  5   ? -2.864  -6.683  -19.484 1.00 5.64  ? 5   DA  T N9    1 
ATOM   2704 C  C8    . DA  B 2  5   ? -1.760  -6.693  -20.285 1.00 6.21  ? 5   DA  T C8    1 
ATOM   2705 N  N7    . DA  B 2  5   ? -0.744  -6.025  -19.786 1.00 8.33  ? 5   DA  T N7    1 
ATOM   2706 C  C5    . DA  B 2  5   ? -1.236  -5.541  -18.569 1.00 6.76  ? 5   DA  T C5    1 
ATOM   2707 C  C6    . DA  B 2  5   ? -0.664  -4.765  -17.536 1.00 6.61  ? 5   DA  T C6    1 
ATOM   2708 N  N6    . DA  B 2  5   ? 0.581   -4.285  -17.599 1.00 7.79  ? 5   DA  T N6    1 
ATOM   2709 N  N1    . DA  B 2  5   ? -1.418  -4.481  -16.445 1.00 3.78  ? 5   DA  T N1    1 
ATOM   2710 C  C2    . DA  B 2  5   ? -2.661  -4.971  -16.389 1.00 6.71  ? 5   DA  T C2    1 
ATOM   2711 N  N3    . DA  B 2  5   ? -3.302  -5.742  -17.301 1.00 4.11  ? 5   DA  T N3    1 
ATOM   2712 C  C4    . DA  B 2  5   ? -2.533  -5.943  -18.382 1.00 5.99  ? 5   DA  T C4    1 
ATOM   2713 P  P     . DT  B 2  6   ? -7.697  -7.982  -21.706 1.00 8.34  ? 6   DT  T P     1 
ATOM   2714 O  OP1   . DT  B 2  6   ? -9.031  -8.561  -21.421 1.00 11.96 ? 6   DT  T OP1   1 
ATOM   2715 O  OP2   . DT  B 2  6   ? -7.203  -7.915  -23.121 1.00 9.52  ? 6   DT  T OP2   1 
ATOM   2716 O  "O5'" . DT  B 2  6   ? -7.628  -6.502  -21.141 1.00 6.58  ? 6   DT  T "O5'" 1 
ATOM   2717 C  "C5'" . DT  B 2  6   ? -8.075  -6.317  -19.765 1.00 6.11  ? 6   DT  T "C5'" 1 
ATOM   2718 C  "C4'" . DT  B 2  6   ? -7.736  -4.915  -19.331 1.00 6.11  ? 6   DT  T "C4'" 1 
ATOM   2719 O  "O4'" . DT  B 2  6   ? -6.288  -4.846  -19.227 1.00 6.79  ? 6   DT  T "O4'" 1 
ATOM   2720 C  "C3'" . DT  B 2  6   ? -8.142  -3.864  -20.376 1.00 10.25 ? 6   DT  T "C3'" 1 
ATOM   2721 O  "O3'" . DT  B 2  6   ? -9.150  -3.040  -19.813 1.00 13.23 ? 6   DT  T "O3'" 1 
ATOM   2722 C  "C2'" . DT  B 2  6   ? -6.866  -3.038  -20.547 1.00 10.20 ? 6   DT  T "C2'" 1 
ATOM   2723 C  "C1'" . DT  B 2  6   ? -6.034  -3.480  -19.321 1.00 8.05  ? 6   DT  T "C1'" 1 
ATOM   2724 N  N1    . DT  B 2  6   ? -4.598  -3.168  -19.480 1.00 5.73  ? 6   DT  T N1    1 
ATOM   2725 C  C2    . DT  B 2  6   ? -3.960  -2.538  -18.416 1.00 7.24  ? 6   DT  T C2    1 
ATOM   2726 O  O2    . DT  B 2  6   ? -4.528  -2.257  -17.377 1.00 7.76  ? 6   DT  T O2    1 
ATOM   2727 N  N3    . DT  B 2  6   ? -2.645  -2.228  -18.600 1.00 7.06  ? 6   DT  T N3    1 
ATOM   2728 C  C4    . DT  B 2  6   ? -1.925  -2.509  -19.752 1.00 7.39  ? 6   DT  T C4    1 
ATOM   2729 O  O4    . DT  B 2  6   ? -0.743  -2.181  -19.854 1.00 9.21  ? 6   DT  T O4    1 
ATOM   2730 C  C5    . DT  B 2  6   ? -2.625  -3.194  -20.808 1.00 6.82  ? 6   DT  T C5    1 
ATOM   2731 C  C7    . DT  B 2  6   ? -1.881  -3.548  -22.081 1.00 9.25  ? 6   DT  T C7    1 
ATOM   2732 C  C6    . DT  B 2  6   ? -3.928  -3.496  -20.648 1.00 7.33  ? 6   DT  T C6    1 
ATOM   2733 P  P     . DA  B 2  7   ? -10.125 -2.130  -20.714 1.00 13.06 ? 7   DA  T P     1 
ATOM   2734 O  OP1   . DA  B 2  7   ? -11.458 -2.734  -20.632 1.00 18.72 ? 7   DA  T OP1   1 
ATOM   2735 O  OP2   . DA  B 2  7   ? -9.517  -1.760  -21.977 1.00 14.85 ? 7   DA  T OP2   1 
ATOM   2736 O  "O5'" . DA  B 2  7   ? -10.314 -0.821  -19.865 1.00 20.77 ? 7   DA  T "O5'" 1 
ATOM   2737 C  "C5'" . DA  B 2  7   ? -9.325  0.168   -19.902 1.00 17.43 ? 7   DA  T "C5'" 1 
ATOM   2738 C  "C4'" . DA  B 2  7   ? -8.833  0.451   -18.510 1.00 13.04 ? 7   DA  T "C4'" 1 
ATOM   2739 O  "O4'" . DA  B 2  7   ? -7.560  -0.203  -18.426 1.00 16.24 ? 7   DA  T "O4'" 1 
ATOM   2740 C  "C3'" . DA  B 2  7   ? -8.532  1.928   -18.308 1.00 13.30 ? 7   DA  T "C3'" 1 
ATOM   2741 O  "O3'" . DA  B 2  7   ? -9.682  2.529   -17.744 1.00 12.63 ? 7   DA  T "O3'" 1 
ATOM   2742 C  "C2'" . DA  B 2  7   ? -7.350  1.918   -17.355 1.00 15.89 ? 7   DA  T "C2'" 1 
ATOM   2743 C  "C1'" . DA  B 2  7   ? -6.639  0.636   -17.761 1.00 14.54 ? 7   DA  T "C1'" 1 
ATOM   2744 N  N9    . DA  B 2  7   ? -5.412  0.752   -18.576 1.00 12.91 ? 7   DA  T N9    1 
ATOM   2745 C  C8    . DA  B 2  7   ? -5.180  0.278   -19.826 1.00 11.83 ? 7   DA  T C8    1 
ATOM   2746 N  N7    . DA  B 2  7   ? -3.957  0.487   -20.257 1.00 13.21 ? 7   DA  T N7    1 
ATOM   2747 C  C5    . DA  B 2  7   ? -3.346  1.122   -19.197 1.00 9.46  ? 7   DA  T C5    1 
ATOM   2748 C  C6    . DA  B 2  7   ? -2.034  1.605   -19.016 1.00 7.18  ? 7   DA  T C6    1 
ATOM   2749 N  N6    . DA  B 2  7   ? -1.092  1.516   -19.957 1.00 8.33  ? 7   DA  T N6    1 
ATOM   2750 N  N1    . DA  B 2  7   ? -1.753  2.221   -17.837 1.00 9.62  ? 7   DA  T N1    1 
ATOM   2751 C  C2    . DA  B 2  7   ? -2.722  2.297   -16.903 1.00 7.70  ? 7   DA  T C2    1 
ATOM   2752 N  N3    . DA  B 2  7   ? -3.995  1.873   -16.960 1.00 12.72 ? 7   DA  T N3    1 
ATOM   2753 C  C4    . DA  B 2  7   ? -4.229  1.286   -18.160 1.00 9.03  ? 7   DA  T C4    1 
ATOM   2754 P  P     . DC  B 2  8   ? -10.041 4.064   -18.053 1.00 14.61 ? 8   DC  T P     1 
ATOM   2755 O  OP1   . DC  B 2  8   ? -11.330 4.267   -17.361 1.00 16.56 ? 8   DC  T OP1   1 
ATOM   2756 O  OP2   . DC  B 2  8   ? -9.797  4.382   -19.456 1.00 13.05 ? 8   DC  T OP2   1 
ATOM   2757 O  "O5'" . DC  B 2  8   ? -8.983  4.893   -17.249 1.00 10.72 ? 8   DC  T "O5'" 1 
ATOM   2758 C  "C5'" . DC  B 2  8   ? -8.836  4.816   -15.851 1.00 8.10  ? 8   DC  T "C5'" 1 
ATOM   2759 C  "C4'" . DC  B 2  8   ? -7.690  5.693   -15.397 1.00 10.29 ? 8   DC  T "C4'" 1 
ATOM   2760 O  "O4'" . DC  B 2  8   ? -6.493  5.141   -16.000 1.00 9.27  ? 8   DC  T "O4'" 1 
ATOM   2761 C  "C3'" . DC  B 2  8   ? -7.746  7.179   -15.796 1.00 8.34  ? 8   DC  T "C3'" 1 
ATOM   2762 O  "O3'" . DC  B 2  8   ? -7.194  7.869   -14.710 1.00 9.21  ? 8   DC  T "O3'" 1 
ATOM   2763 C  "C2'" . DC  B 2  8   ? -6.847  7.238   -17.007 1.00 10.10 ? 8   DC  T "C2'" 1 
ATOM   2764 C  "C1'" . DC  B 2  8   ? -5.783  6.211   -16.598 1.00 10.23 ? 8   DC  T "C1'" 1 
ATOM   2765 N  N1    . DC  B 2  8   ? -5.047  5.676   -17.761 1.00 10.04 ? 8   DC  T N1    1 
ATOM   2766 C  C2    . DC  B 2  8   ? -3.655  5.871   -17.829 1.00 7.09  ? 8   DC  T C2    1 
ATOM   2767 O  O2    . DC  B 2  8   ? -3.073  6.492   -16.921 1.00 8.20  ? 8   DC  T O2    1 
ATOM   2768 N  N3    . DC  B 2  8   ? -3.005  5.386   -18.901 1.00 8.21  ? 8   DC  T N3    1 
ATOM   2769 C  C4    . DC  B 2  8   ? -3.649  4.713   -19.862 1.00 8.34  ? 8   DC  T C4    1 
ATOM   2770 N  N4    . DC  B 2  8   ? -2.912  4.254   -20.894 1.00 10.46 ? 8   DC  T N4    1 
ATOM   2771 C  C5    . DC  B 2  8   ? -5.054  4.490   -19.807 1.00 8.26  ? 8   DC  T C5    1 
ATOM   2772 C  C6    . DC  B 2  8   ? -5.710  4.967   -18.729 1.00 11.19 ? 8   DC  T C6    1 
ATOM   2773 P  P     . DG  B 2  9   ? -6.948  9.451   -14.737 1.00 10.30 ? 9   DG  T P     1 
ATOM   2774 O  OP1   . DG  B 2  9   ? -7.024  9.901   -13.338 1.00 11.30 ? 9   DG  T OP1   1 
ATOM   2775 O  OP2   . DG  B 2  9   ? -7.832  10.091  -15.760 1.00 9.50  ? 9   DG  T OP2   1 
ATOM   2776 O  "O5'" . DG  B 2  9   ? -5.425  9.600   -15.223 1.00 10.02 ? 9   DG  T "O5'" 1 
ATOM   2777 C  "C5'" . DG  B 2  9   ? -4.337  9.375   -14.342 1.00 9.97  ? 9   DG  T "C5'" 1 
ATOM   2778 C  "C4'" . DG  B 2  9   ? -3.239  10.399  -14.596 1.00 11.72 ? 9   DG  T "C4'" 1 
ATOM   2779 O  "O4'" . DG  B 2  9   ? -2.464  10.084  -15.802 1.00 12.78 ? 9   DG  T "O4'" 1 
ATOM   2780 C  "C3'" . DG  B 2  9   ? -3.805  11.785  -14.835 1.00 15.54 ? 9   DG  T "C3'" 1 
ATOM   2781 O  "O3'" . DG  B 2  9   ? -3.002  12.749  -14.168 1.00 18.70 ? 9   DG  T "O3'" 1 
ATOM   2782 C  "C2'" . DG  B 2  9   ? -3.797  11.960  -16.361 1.00 14.58 ? 9   DG  T "C2'" 1 
ATOM   2783 C  "C1'" . DG  B 2  9   ? -2.630  11.101  -16.814 1.00 16.36 ? 9   DG  T "C1'" 1 
ATOM   2784 N  N9    . DG  B 2  9   ? -2.860  10.304  -18.017 1.00 8.80  ? 9   DG  T N9    1 
ATOM   2785 C  C8    . DG  B 2  9   ? -3.973  9.565   -18.350 1.00 8.92  ? 9   DG  T C8    1 
ATOM   2786 N  N7    . DG  B 2  9   ? -3.830  8.876   -19.451 1.00 8.47  ? 9   DG  T N7    1 
ATOM   2787 C  C5    . DG  B 2  9   ? -2.513  9.190   -19.846 1.00 7.71  ? 9   DG  T C5    1 
ATOM   2788 C  C6    . DG  B 2  9   ? -1.766  8.801   -20.972 1.00 8.60  ? 9   DG  T C6    1 
ATOM   2789 O  O6    . DG  B 2  9   ? -2.085  8.034   -21.875 1.00 8.70  ? 9   DG  T O6    1 
ATOM   2790 N  N1    . DG  B 2  9   ? -0.503  9.376   -20.979 1.00 9.18  ? 9   DG  T N1    1 
ATOM   2791 C  C2    . DG  B 2  9   ? -0.002  10.235  -20.042 1.00 10.43 ? 9   DG  T C2    1 
ATOM   2792 N  N2    . DG  B 2  9   ? 1.268   10.681  -20.190 1.00 7.39  ? 9   DG  T N2    1 
ATOM   2793 N  N3    . DG  B 2  9   ? -0.689  10.603  -18.992 1.00 9.86  ? 9   DG  T N3    1 
ATOM   2794 C  C4    . DG  B 2  9   ? -1.924  10.043  -18.975 1.00 10.84 ? 9   DG  T C4    1 
ATOM   2795 O  "O5'" . DC  C 3  1   ? 5.806   6.577   -26.680 1.00 18.66 ? 1   DC  P "O5'" 1 
ATOM   2796 C  "C5'" . DC  C 3  1   ? 6.864   7.493   -26.676 1.00 12.18 ? 1   DC  P "C5'" 1 
ATOM   2797 C  "C4'" . DC  C 3  1   ? 6.572   8.430   -25.542 1.00 15.95 ? 1   DC  P "C4'" 1 
ATOM   2798 O  "O4'" . DC  C 3  1   ? 5.218   8.923   -25.762 1.00 12.65 ? 1   DC  P "O4'" 1 
ATOM   2799 C  "C3'" . DC  C 3  1   ? 6.422   7.784   -24.165 1.00 13.23 ? 1   DC  P "C3'" 1 
ATOM   2800 O  "O3'" . DC  C 3  1   ? 7.681   7.551   -23.582 1.00 11.25 ? 1   DC  P "O3'" 1 
ATOM   2801 C  "C2'" . DC  C 3  1   ? 5.745   8.921   -23.438 1.00 10.42 ? 1   DC  P "C2'" 1 
ATOM   2802 C  "C1'" . DC  C 3  1   ? 4.702   9.313   -24.476 1.00 12.54 ? 1   DC  P "C1'" 1 
ATOM   2803 N  N1    . DC  C 3  1   ? 3.409   8.636   -24.306 1.00 10.76 ? 1   DC  P N1    1 
ATOM   2804 C  C2    . DC  C 3  1   ? 2.532   9.064   -23.314 1.00 8.77  ? 1   DC  P C2    1 
ATOM   2805 O  O2    . DC  C 3  1   ? 2.875   10.005  -22.591 1.00 12.23 ? 1   DC  P O2    1 
ATOM   2806 N  N3    . DC  C 3  1   ? 1.334   8.451   -23.174 1.00 9.24  ? 1   DC  P N3    1 
ATOM   2807 C  C4    . DC  C 3  1   ? 0.982   7.454   -23.988 1.00 11.45 ? 1   DC  P C4    1 
ATOM   2808 N  N4    . DC  C 3  1   ? -0.232  6.894   -23.815 1.00 9.48  ? 1   DC  P N4    1 
ATOM   2809 C  C5    . DC  C 3  1   ? 1.863   6.982   -25.002 1.00 10.66 ? 1   DC  P C5    1 
ATOM   2810 C  C6    . DC  C 3  1   ? 3.053   7.604   -25.137 1.00 10.69 ? 1   DC  P C6    1 
ATOM   2811 P  P     . DG  C 3  2   ? 7.832   6.397   -22.503 1.00 11.76 ? 2   DG  P P     1 
ATOM   2812 O  OP1   . DG  C 3  2   ? 9.275   6.357   -22.201 1.00 9.68  ? 2   DG  P OP1   1 
ATOM   2813 O  OP2   . DG  C 3  2   ? 7.212   5.141   -23.005 1.00 9.79  ? 2   DG  P OP2   1 
ATOM   2814 O  "O5'" . DG  C 3  2   ? 7.037   6.967   -21.235 1.00 8.19  ? 2   DG  P "O5'" 1 
ATOM   2815 C  "C5'" . DG  C 3  2   ? 7.591   8.023   -20.443 1.00 6.22  ? 2   DG  P "C5'" 1 
ATOM   2816 C  "C4'" . DG  C 3  2   ? 6.607   8.493   -19.396 1.00 9.78  ? 2   DG  P "C4'" 1 
ATOM   2817 O  "O4'" . DG  C 3  2   ? 5.390   8.854   -20.080 1.00 8.30  ? 2   DG  P "O4'" 1 
ATOM   2818 C  "C3'" . DG  C 3  2   ? 6.123   7.436   -18.402 1.00 6.85  ? 2   DG  P "C3'" 1 
ATOM   2819 O  "O3'" . DG  C 3  2   ? 7.108   7.321   -17.409 1.00 8.82  ? 2   DG  P "O3'" 1 
ATOM   2820 C  "C2'" . DG  C 3  2   ? 4.839   8.160   -17.910 1.00 6.18  ? 2   DG  P "C2'" 1 
ATOM   2821 C  "C1'" . DG  C 3  2   ? 4.249   8.598   -19.251 1.00 10.34 ? 2   DG  P "C1'" 1 
ATOM   2822 N  N9    . DG  C 3  2   ? 3.415   7.584   -19.905 1.00 9.36  ? 2   DG  P N9    1 
ATOM   2823 C  C8    . DG  C 3  2   ? 3.707   6.803   -21.008 1.00 10.25 ? 2   DG  P C8    1 
ATOM   2824 N  N7    . DG  C 3  2   ? 2.734   6.013   -21.339 1.00 9.96  ? 2   DG  P N7    1 
ATOM   2825 C  C5    . DG  C 3  2   ? 1.726   6.272   -20.431 1.00 7.40  ? 2   DG  P C5    1 
ATOM   2826 C  C6    . DG  C 3  2   ? 0.436   5.693   -20.267 1.00 8.52  ? 2   DG  P C6    1 
ATOM   2827 O  O6    . DG  C 3  2   ? -0.096  4.850   -20.970 1.00 9.31  ? 2   DG  P O6    1 
ATOM   2828 N  N1    . DG  C 3  2   ? -0.287  6.263   -19.201 1.00 9.06  ? 2   DG  P N1    1 
ATOM   2829 C  C2    . DG  C 3  2   ? 0.226   7.220   -18.381 1.00 8.56  ? 2   DG  P C2    1 
ATOM   2830 N  N2    . DG  C 3  2   ? -0.556  7.660   -17.392 1.00 7.36  ? 2   DG  P N2    1 
ATOM   2831 N  N3    . DG  C 3  2   ? 1.437   7.753   -18.503 1.00 8.70  ? 2   DG  P N3    1 
ATOM   2832 C  C4    . DG  C 3  2   ? 2.126   7.225   -19.537 1.00 8.25  ? 2   DG  P C4    1 
ATOM   2833 P  P     . DT  C 3  3   ? 7.123   6.050   -16.439 1.00 8.60  ? 3   DT  P P     1 
ATOM   2834 O  OP1   . DT  C 3  3   ? 8.158   6.321   -15.444 1.00 7.86  ? 3   DT  P OP1   1 
ATOM   2835 O  OP2   . DT  C 3  3   ? 7.108   4.847   -17.242 1.00 5.43  ? 3   DT  P OP2   1 
ATOM   2836 O  "O5'" . DT  C 3  3   ? 5.655   6.114   -15.746 1.00 5.71  ? 3   DT  P "O5'" 1 
ATOM   2837 C  "C5'" . DT  C 3  3   ? 5.362   7.066   -14.735 1.00 7.13  ? 3   DT  P "C5'" 1 
ATOM   2838 C  "C4'" . DT  C 3  3   ? 3.941   6.850   -14.236 1.00 4.57  ? 3   DT  P "C4'" 1 
ATOM   2839 O  "O4'" . DT  C 3  3   ? 2.983   6.977   -15.312 1.00 7.78  ? 3   DT  P "O4'" 1 
ATOM   2840 C  "C3'" . DT  C 3  3   ? 3.667   5.449   -13.705 1.00 3.03  ? 3   DT  P "C3'" 1 
ATOM   2841 O  "O3'" . DT  C 3  3   ? 4.241   5.365   -12.416 1.00 4.95  ? 3   DT  P "O3'" 1 
ATOM   2842 C  "C2'" . DT  C 3  3   ? 2.136   5.479   -13.676 1.00 2.70  ? 3   DT  P "C2'" 1 
ATOM   2843 C  "C1'" . DT  C 3  3   ? 1.889   6.104   -15.052 1.00 6.00  ? 3   DT  P "C1'" 1 
ATOM   2844 N  N1    . DT  C 3  3   ? 1.848   5.123   -16.136 1.00 5.67  ? 3   DT  P N1    1 
ATOM   2845 C  C2    . DT  C 3  3   ? 0.675   4.412   -16.281 1.00 5.40  ? 3   DT  P C2    1 
ATOM   2846 O  O2    . DT  C 3  3   ? -0.276  4.587   -15.567 1.00 6.86  ? 3   DT  P O2    1 
ATOM   2847 N  N3    . DT  C 3  3   ? 0.644   3.502   -17.295 1.00 5.11  ? 3   DT  P N3    1 
ATOM   2848 C  C4    . DT  C 3  3   ? 1.702   3.239   -18.127 1.00 7.75  ? 3   DT  P C4    1 
ATOM   2849 O  O4    . DT  C 3  3   ? 1.613   2.400   -18.999 1.00 10.10 ? 3   DT  P O4    1 
ATOM   2850 C  C5    . DT  C 3  3   ? 2.924   3.984   -17.920 1.00 6.44  ? 3   DT  P C5    1 
ATOM   2851 C  C7    . DT  C 3  3   ? 4.110   3.703   -18.798 1.00 9.92  ? 3   DT  P C7    1 
ATOM   2852 C  C6    . DT  C 3  3   ? 2.958   4.878   -16.934 1.00 5.44  ? 3   DT  P C6    1 
ATOM   2853 P  P     . DA  C 3  4   ? 4.608   3.916   -11.828 1.00 5.43  ? 4   DA  P P     1 
ATOM   2854 O  OP1   . DA  C 3  4   ? 5.243   4.120   -10.532 1.00 3.76  ? 4   DA  P OP1   1 
ATOM   2855 O  OP2   . DA  C 3  4   ? 5.336   3.152   -12.879 1.00 4.70  ? 4   DA  P OP2   1 
ATOM   2856 O  "O5'" . DA  C 3  4   ? 3.176   3.228   -11.712 1.00 5.33  ? 4   DA  P "O5'" 1 
ATOM   2857 C  "C5'" . DA  C 3  4   ? 2.327   3.670   -10.670 1.00 6.64  ? 4   DA  P "C5'" 1 
ATOM   2858 C  "C4'" . DA  C 3  4   ? 1.035   2.853   -10.708 1.00 3.97  ? 4   DA  P "C4'" 1 
ATOM   2859 O  "O4'" . DA  C 3  4   ? 0.332   3.075   -11.937 1.00 4.02  ? 4   DA  P "O4'" 1 
ATOM   2860 C  "C3'" . DA  C 3  4   ? 1.230   1.352   -10.610 1.00 2.38  ? 4   DA  P "C3'" 1 
ATOM   2861 O  "O3'" . DA  C 3  4   ? 1.484   1.147   -9.202  1.00 4.30  ? 4   DA  P "O3'" 1 
ATOM   2862 C  "C2'" . DA  C 3  4   ? -0.143  0.891   -11.088 1.00 5.04  ? 4   DA  P "C2'" 1 
ATOM   2863 C  "C1'" . DA  C 3  4   ? -0.339  1.860   -12.271 1.00 3.84  ? 4   DA  P "C1'" 1 
ATOM   2864 N  N9    . DA  C 3  4   ? 0.179   1.377   -13.554 1.00 6.26  ? 4   DA  P N9    1 
ATOM   2865 C  C8    . DA  C 3  4   ? 1.428   1.600   -14.092 1.00 5.97  ? 4   DA  P C8    1 
ATOM   2866 N  N7    . DA  C 3  4   ? 1.591   1.060   -15.277 1.00 4.24  ? 4   DA  P N7    1 
ATOM   2867 C  C5    . DA  C 3  4   ? 0.383   0.411   -15.511 1.00 5.25  ? 4   DA  P C5    1 
ATOM   2868 C  C6    . DA  C 3  4   ? -0.065  -0.374  -16.590 1.00 7.32  ? 4   DA  P C6    1 
ATOM   2869 N  N6    . DA  C 3  4   ? 0.701   -0.648  -17.666 1.00 2.46  ? 4   DA  P N6    1 
ATOM   2870 N  N1    . DA  C 3  4   ? -1.317  -0.867  -16.513 1.00 6.33  ? 4   DA  P N1    1 
ATOM   2871 C  C2    . DA  C 3  4   ? -2.074  -0.607  -15.444 1.00 5.83  ? 4   DA  P C2    1 
ATOM   2872 N  N3    . DA  C 3  4   ? -1.747  0.111   -14.375 1.00 6.31  ? 4   DA  P N3    1 
ATOM   2873 C  C4    . DA  C 3  4   ? -0.491  0.585   -14.470 1.00 3.68  ? 4   DA  P C4    1 
ATOM   2874 P  P     . DT  C 3  5   ? 2.432   -0.046  -8.712  1.00 4.36  ? 5   DT  P P     1 
ATOM   2875 O  OP1   . DT  C 3  5   ? 2.784   0.209   -7.287  1.00 3.22  ? 5   DT  P OP1   1 
ATOM   2876 O  OP2   . DT  C 3  5   ? 3.519   -0.363  -9.674  1.00 4.63  ? 5   DT  P OP2   1 
ATOM   2877 O  "O5'" . DT  C 3  5   ? 1.487   -1.298  -8.795  1.00 2.32  ? 5   DT  P "O5'" 1 
ATOM   2878 C  "C5'" . DT  C 3  5   ? 0.337   -1.348  -7.927  1.00 1.47  ? 5   DT  P "C5'" 1 
ATOM   2879 C  "C4'" . DT  C 3  5   ? -0.604  -2.449  -8.426  1.00 2.01  ? 5   DT  P "C4'" 1 
ATOM   2880 O  "O4'" . DT  C 3  5   ? -1.129  -2.063  -9.724  1.00 2.31  ? 5   DT  P "O4'" 1 
ATOM   2881 C  "C3'" . DT  C 3  5   ? 0.111   -3.794  -8.717  1.00 2.28  ? 5   DT  P "C3'" 1 
ATOM   2882 O  "O3'" . DT  C 3  5   ? 0.228   -4.546  -7.489  1.00 3.13  ? 5   DT  P "O3'" 1 
ATOM   2883 C  "C2'" . DT  C 3  5   ? -0.843  -4.457  -9.714  1.00 2.83  ? 5   DT  P "C2'" 1 
ATOM   2884 C  "C1'" . DT  C 3  5   ? -1.336  -3.226  -10.517 1.00 2.52  ? 5   DT  P "C1'" 1 
ATOM   2885 N  N1    . DT  C 3  5   ? -0.546  -3.067  -11.792 1.00 2.78  ? 5   DT  P N1    1 
ATOM   2886 C  C2    . DT  C 3  5   ? -1.148  -3.540  -12.950 1.00 4.76  ? 5   DT  P C2    1 
ATOM   2887 O  O2    . DT  C 3  5   ? -2.273  -4.025  -12.972 1.00 5.01  ? 5   DT  P O2    1 
ATOM   2888 N  N3    . DT  C 3  5   ? -0.407  -3.389  -14.087 1.00 4.79  ? 5   DT  P N3    1 
ATOM   2889 C  C4    . DT  C 3  5   ? 0.874   -2.842  -14.138 1.00 4.96  ? 5   DT  P C4    1 
ATOM   2890 O  O4    . DT  C 3  5   ? 1.501   -2.747  -15.210 1.00 4.94  ? 5   DT  P O4    1 
ATOM   2891 C  C5    . DT  C 3  5   ? 1.433   -2.380  -12.888 1.00 3.24  ? 5   DT  P C5    1 
ATOM   2892 C  C7    . DT  C 3  5   ? 2.815   -1.780  -12.897 1.00 5.08  ? 5   DT  P C7    1 
ATOM   2893 C  C6    . DT  C 3  5   ? 0.710   -2.512  -11.779 1.00 3.39  ? 5   DT  P C6    1 
ATOM   2894 O  OP3   . DG  D 4  1   ? 14.350  -18.661 -26.755 1.00 13.35 ? 1   DG  D OP3   1 
ATOM   2895 P  P     . DG  D 4  1   ? 13.726  -17.424 -27.305 1.00 14.63 ? 1   DG  D P     1 
ATOM   2896 O  OP1   . DG  D 4  1   ? 14.647  -16.308 -27.190 1.00 11.15 ? 1   DG  D OP1   1 
ATOM   2897 O  OP2   . DG  D 4  1   ? 13.123  -17.743 -28.619 1.00 16.73 ? 1   DG  D OP2   1 
ATOM   2898 O  "O5'" . DG  D 4  1   ? 12.435  -17.138 -26.386 1.00 15.30 ? 1   DG  D "O5'" 1 
ATOM   2899 C  "C5'" . DG  D 4  1   ? 12.553  -16.960 -24.968 1.00 13.48 ? 1   DG  D "C5'" 1 
ATOM   2900 C  "C4'" . DG  D 4  1   ? 11.454  -17.797 -24.322 1.00 14.61 ? 1   DG  D "C4'" 1 
ATOM   2901 O  "O4'" . DG  D 4  1   ? 10.141  -17.235 -24.585 1.00 7.89  ? 1   DG  D "O4'" 1 
ATOM   2902 C  "C3'" . DG  D 4  1   ? 11.371  -19.247 -24.757 1.00 11.26 ? 1   DG  D "C3'" 1 
ATOM   2903 O  "O3'" . DG  D 4  1   ? 11.047  -19.986 -23.579 1.00 11.33 ? 1   DG  D "O3'" 1 
ATOM   2904 C  "C2'" . DG  D 4  1   ? 10.231  -19.321 -25.776 1.00 9.19  ? 1   DG  D "C2'" 1 
ATOM   2905 C  "C1'" . DG  D 4  1   ? 9.343   -18.153 -25.326 1.00 7.28  ? 1   DG  D "C1'" 1 
ATOM   2906 N  N9    . DG  D 4  1   ? 8.830   -17.272 -26.378 1.00 8.78  ? 1   DG  D N9    1 
ATOM   2907 C  C8    . DG  D 4  1   ? 9.468   -16.860 -27.538 1.00 11.00 ? 1   DG  D C8    1 
ATOM   2908 N  N7    . DG  D 4  1   ? 8.755   -16.007 -28.255 1.00 12.88 ? 1   DG  D N7    1 
ATOM   2909 C  C5    . DG  D 4  1   ? 7.564   -15.860 -27.528 1.00 7.41  ? 1   DG  D C5    1 
ATOM   2910 C  C6    . DG  D 4  1   ? 6.415   -15.081 -27.801 1.00 10.53 ? 1   DG  D C6    1 
ATOM   2911 O  O6    . DG  D 4  1   ? 6.208   -14.325 -28.766 1.00 8.71  ? 1   DG  D O6    1 
ATOM   2912 N  N1    . DG  D 4  1   ? 5.447   -15.224 -26.811 1.00 7.74  ? 1   DG  D N1    1 
ATOM   2913 C  C2    . DG  D 4  1   ? 5.595   -15.995 -25.677 1.00 6.77  ? 1   DG  D C2    1 
ATOM   2914 N  N2    . DG  D 4  1   ? 4.544   -16.015 -24.800 1.00 7.32  ? 1   DG  D N2    1 
ATOM   2915 N  N3    . DG  D 4  1   ? 6.668   -16.730 -25.409 1.00 8.09  ? 1   DG  D N3    1 
ATOM   2916 C  C4    . DG  D 4  1   ? 7.614   -16.611 -26.373 1.00 10.01 ? 1   DG  D C4    1 
ATOM   2917 P  P     . DC  D 4  2   ? 11.188  -21.581 -23.517 1.00 11.85 ? 2   DC  D P     1 
ATOM   2918 O  OP1   . DC  D 4  2   ? 11.592  -21.965 -22.129 1.00 10.60 ? 2   DC  D OP1   1 
ATOM   2919 O  OP2   . DC  D 4  2   ? 11.976  -22.022 -24.681 1.00 12.37 ? 2   DC  D OP2   1 
ATOM   2920 O  "O5'" . DC  D 4  2   ? 9.718   -22.102 -23.711 1.00 8.71  ? 2   DC  D "O5'" 1 
ATOM   2921 C  "C5'" . DC  D 4  2   ? 8.782   -21.825 -22.678 1.00 11.21 ? 2   DC  D "C5'" 1 
ATOM   2922 C  "C4'" . DC  D 4  2   ? 7.357   -21.605 -23.220 1.00 7.99  ? 2   DC  D "C4'" 1 
ATOM   2923 O  "O4'" . DC  D 4  2   ? 7.300   -20.638 -24.271 1.00 9.20  ? 2   DC  D "O4'" 1 
ATOM   2924 C  "C3'" . DC  D 4  2   ? 6.651   -22.835 -23.750 1.00 10.03 ? 2   DC  D "C3'" 1 
ATOM   2925 O  "O3'" . DC  D 4  2   ? 5.985   -23.365 -22.620 1.00 9.99  ? 2   DC  D "O3'" 1 
ATOM   2926 C  "C2'" . DC  D 4  2   ? 5.717   -22.297 -24.820 1.00 13.38 ? 2   DC  D "C2'" 1 
ATOM   2927 C  "C1'" . DC  D 4  2   ? 6.009   -20.803 -24.840 1.00 12.52 ? 2   DC  D "C1'" 1 
ATOM   2928 N  N1    . DC  D 4  2   ? 6.013   -20.103 -26.179 1.00 10.63 ? 2   DC  D N1    1 
ATOM   2929 C  C2    . DC  D 4  2   ? 4.934   -19.278 -26.522 1.00 11.02 ? 2   DC  D C2    1 
ATOM   2930 O  O2    . DC  D 4  2   ? 4.018   -19.206 -25.719 1.00 9.56  ? 2   DC  D O2    1 
ATOM   2931 N  N3    . DC  D 4  2   ? 4.916   -18.614 -27.711 1.00 9.16  ? 2   DC  D N3    1 
ATOM   2932 C  C4    . DC  D 4  2   ? 5.948   -18.757 -28.539 1.00 10.36 ? 2   DC  D C4    1 
ATOM   2933 N  N4    . DC  D 4  2   ? 5.912   -18.084 -29.695 1.00 8.94  ? 2   DC  D N4    1 
ATOM   2934 C  C5    . DC  D 4  2   ? 7.073   -19.593 -28.220 1.00 10.26 ? 2   DC  D C5    1 
ATOM   2935 C  C6    . DC  D 4  2   ? 7.049   -20.257 -27.048 1.00 11.57 ? 2   DC  D C6    1 
ATOM   2936 P  P     . DC  D 4  3   ? 4.983   -24.607 -22.715 1.00 13.23 ? 3   DC  D P     1 
ATOM   2937 O  OP1   . DC  D 4  3   ? 4.801   -25.155 -21.365 1.00 10.37 ? 3   DC  D OP1   1 
ATOM   2938 O  OP2   . DC  D 4  3   ? 5.465   -25.500 -23.803 1.00 13.69 ? 3   DC  D OP2   1 
ATOM   2939 O  "O5'" . DC  D 4  3   ? 3.609   -23.987 -23.186 1.00 12.03 ? 3   DC  D "O5'" 1 
ATOM   2940 C  "C5'" . DC  D 4  3   ? 2.987   -23.024 -22.372 1.00 15.38 ? 3   DC  D "C5'" 1 
ATOM   2941 C  "C4'" . DC  D 4  3   ? 1.593   -22.748 -22.866 1.00 15.45 ? 3   DC  D "C4'" 1 
ATOM   2942 O  "O4'" . DC  D 4  3   ? 1.708   -22.112 -24.161 1.00 19.70 ? 3   DC  D "O4'" 1 
ATOM   2943 C  "C3'" . DC  D 4  3   ? 0.758   -24.010 -23.061 1.00 21.14 ? 3   DC  D "C3'" 1 
ATOM   2944 O  "O3'" . DC  D 4  3   ? -0.513  -23.799 -22.439 1.00 28.37 ? 3   DC  D "O3'" 1 
ATOM   2945 C  "C2'" . DC  D 4  3   ? 0.721   -24.209 -24.581 1.00 20.46 ? 3   DC  D "C2'" 1 
ATOM   2946 C  "C1'" . DC  D 4  3   ? 0.907   -22.784 -25.124 1.00 19.84 ? 3   DC  D "C1'" 1 
ATOM   2947 N  N1    . DC  D 4  3   ? 1.688   -22.463 -26.381 1.00 17.03 ? 3   DC  D N1    1 
ATOM   2948 C  C2    . DC  D 4  3   ? 1.202   -21.473 -27.243 1.00 11.34 ? 3   DC  D C2    1 
ATOM   2949 O  O2    . DC  D 4  3   ? 0.109   -20.926 -27.025 1.00 12.47 ? 3   DC  D O2    1 
ATOM   2950 N  N3    . DC  D 4  3   ? 1.916   -21.173 -28.344 1.00 10.18 ? 3   DC  D N3    1 
ATOM   2951 C  C4    . DC  D 4  3   ? 3.092   -21.753 -28.571 1.00 9.76  ? 3   DC  D C4    1 
ATOM   2952 N  N4    . DC  D 4  3   ? 3.786   -21.373 -29.646 1.00 10.47 ? 3   DC  D N4    1 
ATOM   2953 C  C5    . DC  D 4  3   ? 3.620   -22.742 -27.694 1.00 9.99  ? 3   DC  D C5    1 
ATOM   2954 C  C6    . DC  D 4  3   ? 2.897   -23.063 -26.633 1.00 10.17 ? 3   DC  D C6    1 
ATOM   2955 P  P     . DG  D 4  4   ? -1.599  -24.986 -22.439 1.00 32.47 ? 4   DG  D P     1 
ATOM   2956 O  OP1   . DG  D 4  4   ? -2.398  -24.816 -21.215 1.00 26.55 ? 4   DG  D OP1   1 
ATOM   2957 O  OP2   . DG  D 4  4   ? -0.968  -26.286 -22.793 1.00 29.36 ? 4   DG  D OP2   1 
ATOM   2958 O  "O5'" . DG  D 4  4   ? -2.508  -24.656 -23.723 1.00 21.28 ? 4   DG  D "O5'" 1 
ATOM   2959 C  "C5'" . DG  D 4  4   ? -3.201  -23.417 -23.849 1.00 19.53 ? 4   DG  D "C5'" 1 
ATOM   2960 C  "C4'" . DG  D 4  4   ? -3.913  -23.504 -25.194 1.00 19.61 ? 4   DG  D "C4'" 1 
ATOM   2961 O  "O4'" . DG  D 4  4   ? -2.874  -23.375 -26.195 1.00 17.29 ? 4   DG  D "O4'" 1 
ATOM   2962 C  "C3'" . DG  D 4  4   ? -4.572  -24.848 -25.520 1.00 17.84 ? 4   DG  D "C3'" 1 
ATOM   2963 O  "O3'" . DG  D 4  4   ? -5.832  -24.627 -26.171 1.00 20.87 ? 4   DG  D "O3'" 1 
ATOM   2964 C  "C2'" . DG  D 4  4   ? -3.574  -25.555 -26.451 1.00 19.19 ? 4   DG  D "C2'" 1 
ATOM   2965 C  "C1'" . DG  D 4  4   ? -3.023  -24.355 -27.206 1.00 17.53 ? 4   DG  D "C1'" 1 
ATOM   2966 N  N9    . DG  D 4  4   ? -1.699  -24.546 -27.832 1.00 12.36 ? 4   DG  D N9    1 
ATOM   2967 C  C8    . DG  D 4  4   ? -0.719  -25.407 -27.454 1.00 12.45 ? 4   DG  D C8    1 
ATOM   2968 N  N7    . DG  D 4  4   ? 0.348   -25.326 -28.205 1.00 11.48 ? 4   DG  D N7    1 
ATOM   2969 C  C5    . DG  D 4  4   ? 0.021   -24.369 -29.170 1.00 12.91 ? 4   DG  D C5    1 
ATOM   2970 C  C6    . DG  D 4  4   ? 0.757   -23.859 -30.271 1.00 9.98  ? 4   DG  D C6    1 
ATOM   2971 O  O6    . DG  D 4  4   ? 1.898   -24.159 -30.619 1.00 14.63 ? 4   DG  D O6    1 
ATOM   2972 N  N1    . DG  D 4  4   ? 0.091   -22.888 -30.987 1.00 9.81  ? 4   DG  D N1    1 
ATOM   2973 C  C2    . DG  D 4  4   ? -1.187  -22.484 -30.691 1.00 10.15 ? 4   DG  D C2    1 
ATOM   2974 N  N2    . DG  D 4  4   ? -1.708  -21.562 -31.510 1.00 13.04 ? 4   DG  D N2    1 
ATOM   2975 N  N3    . DG  D 4  4   ? -1.898  -22.944 -29.659 1.00 14.44 ? 4   DG  D N3    1 
ATOM   2976 C  C4    . DG  D 4  4   ? -1.228  -23.876 -28.940 1.00 10.24 ? 4   DG  D C4    1 
HETATM 2977 MG MG    . MG  E 5  .   ? 3.227   -0.410  -5.309  1.00 5.62  ? 501 MG  A MG    1 
HETATM 2978 MG MG    . MG  F 5  .   ? 10.395  4.982   -15.200 1.00 10.79 ? 502 MG  A MG    1 
HETATM 2979 O  O11   . PPV G 6  .   ? 6.752   -3.714  -6.151  0.50 15.12 ? 503 PPV A O11   1 
HETATM 2980 P  P1    . PPV G 6  .   ? 5.916   -4.560  -5.209  0.50 15.45 ? 503 PPV A P1    1 
HETATM 2981 O  O21   . PPV G 6  .   ? 6.485   -4.333  -3.836  0.50 17.47 ? 503 PPV A O21   1 
HETATM 2982 O  O31   . PPV G 6  .   ? 6.013   -5.994  -5.719  0.75 16.92 ? 503 PPV A O31   1 
HETATM 2983 O  OPP   . PPV G 6  .   ? 4.423   -4.175  -5.090  0.75 9.44  ? 503 PPV A OPP   1 
HETATM 2984 P  P2    . PPV G 6  .   ? 3.551   -3.539  -6.229  0.75 6.52  ? 503 PPV A P2    1 
HETATM 2985 O  O12   . PPV G 6  .   ? 2.756   -2.439  -5.582  0.50 1.16  ? 503 PPV A O12   1 
HETATM 2986 O  O22   . PPV G 6  .   ? 4.494   -3.023  -7.285  0.75 9.82  ? 503 PPV A O22   1 
HETATM 2987 O  O32   . PPV G 6  .   ? 2.703   -4.621  -6.758  0.75 2.92  ? 503 PPV A O32   1 
HETATM 2988 C  C1    . EDO H 7  .   ? 10.826  -30.084 -6.910  1.00 20.93 ? 504 EDO A C1    1 
HETATM 2989 O  O1    . EDO H 7  .   ? 10.018  -31.250 -7.179  1.00 25.38 ? 504 EDO A O1    1 
HETATM 2990 C  C2    . EDO H 7  .   ? 9.887   -28.862 -6.843  1.00 18.39 ? 504 EDO A C2    1 
HETATM 2991 O  O2    . EDO H 7  .   ? 9.001   -28.936 -5.708  1.00 15.88 ? 504 EDO A O2    1 
HETATM 2992 MN MN    . MN  I 8  .   ? 2.218   2.391   -6.787  1.00 15.43 ? 505 MN  A MN    1 
HETATM 2993 MG MG    . MG  J 5  .   ? 6.283   -2.399  -7.481  1.00 22.69 ? 506 MG  A MG    1 
HETATM 2994 C  C1    . EDO K 7  .   ? -14.745 -0.177  1.552   1.00 24.56 ? 507 EDO A C1    1 
HETATM 2995 O  O1    . EDO K 7  .   ? -14.547 1.051   2.282   1.00 29.69 ? 507 EDO A O1    1 
HETATM 2996 C  C2    . EDO K 7  .   ? -14.097 -1.286  2.367   1.00 29.58 ? 507 EDO A C2    1 
HETATM 2997 O  O2    . EDO K 7  .   ? -13.571 -0.680  3.558   1.00 43.72 ? 507 EDO A O2    1 
HETATM 2998 C  C10   . EPE L 9  .   ? 11.681  -8.105  1.216   0.75 28.38 ? 508 EPE A C10   1 
HETATM 2999 S  S     . EPE L 9  .   ? 9.885   -7.799  1.056   0.75 21.07 ? 508 EPE A S     1 
HETATM 3000 O  O1S   . EPE L 9  .   ? 9.700   -6.362  0.951   0.75 26.59 ? 508 EPE A O1S   1 
HETATM 3001 O  O2S   . EPE L 9  .   ? 9.227   -8.337  2.242   0.75 13.22 ? 508 EPE A O2S   1 
HETATM 3002 O  O3S   . EPE L 9  .   ? 9.429   -8.451  -0.161  0.75 20.26 ? 508 EPE A O3S   1 
HETATM 3003 C  C1    . EDO M 7  .   ? -4.883  -1.757  -11.516 1.00 10.25 ? 101 EDO P C1    1 
HETATM 3004 O  O1    . EDO M 7  .   ? -4.866  -2.822  -12.461 1.00 13.96 ? 101 EDO P O1    1 
HETATM 3005 C  C2    . EDO M 7  .   ? -3.831  -0.723  -11.933 1.00 11.34 ? 101 EDO P C2    1 
HETATM 3006 O  O2    . EDO M 7  .   ? -4.321  -0.123  -13.131 1.00 20.91 ? 101 EDO P O2    1 
HETATM 3007 O  O     . HOH N 10 .   ? 3.791   -0.737  -3.339  1.00 7.90  ? 601 HOH A O     1 
HETATM 3008 O  O     . HOH N 10 .   ? -4.885  -8.755  -6.152  1.00 2.05  ? 602 HOH A O     1 
HETATM 3009 O  O     . HOH N 10 .   ? 9.295   -22.423 -4.469  1.00 3.69  ? 603 HOH A O     1 
HETATM 3010 O  O     . HOH N 10 .   ? -10.343 -6.289  -11.178 1.00 2.60  ? 604 HOH A O     1 
HETATM 3011 O  O     . HOH N 10 .   ? -10.889 2.552   0.912   1.00 3.71  ? 605 HOH A O     1 
HETATM 3012 O  O     . HOH N 10 .   ? 16.094  -22.891 -2.214  1.00 5.47  ? 606 HOH A O     1 
HETATM 3013 O  O     . HOH N 10 .   ? 4.477   -9.087  -11.145 1.00 6.44  ? 607 HOH A O     1 
HETATM 3014 O  O     . HOH N 10 .   ? -18.746 -5.389  -13.079 1.00 6.59  ? 608 HOH A O     1 
HETATM 3015 O  O     . HOH N 10 .   ? 3.456   -6.197  -8.851  1.00 6.23  ? 609 HOH A O     1 
HETATM 3016 O  O     . HOH N 10 .   ? -7.871  -6.895  -12.338 1.00 6.46  ? 610 HOH A O     1 
HETATM 3017 O  O     . HOH N 10 .   ? 2.759   -18.684 -9.669  1.00 7.44  ? 611 HOH A O     1 
HETATM 3018 O  O     . HOH N 10 .   ? 5.775   -21.881 -2.952  1.00 7.02  ? 612 HOH A O     1 
HETATM 3019 O  O     . HOH N 10 .   ? -13.143 -10.514 -0.162  1.00 5.84  ? 613 HOH A O     1 
HETATM 3020 O  O     . HOH N 10 .   ? 11.924  -16.154 -1.477  1.00 5.31  ? 614 HOH A O     1 
HETATM 3021 O  O     . HOH N 10 .   ? -18.766 5.385   -3.643  1.00 7.86  ? 615 HOH A O     1 
HETATM 3022 O  O     . HOH N 10 .   ? 2.979   -14.836 1.386   1.00 6.94  ? 616 HOH A O     1 
HETATM 3023 O  O     . HOH N 10 .   ? 1.442   -0.495  -1.449  1.00 3.89  ? 617 HOH A O     1 
HETATM 3024 O  O     . HOH N 10 .   ? -7.854  -1.576  -15.473 1.00 10.22 ? 618 HOH A O     1 
HETATM 3025 O  O     . HOH N 10 .   ? -7.101  -19.847 -7.652  1.00 5.02  ? 619 HOH A O     1 
HETATM 3026 O  O     . HOH N 10 .   ? -13.099 -7.299  -0.897  1.00 9.68  ? 620 HOH A O     1 
HETATM 3027 O  O     . HOH N 10 .   ? -5.074  -3.117  3.305   1.00 10.76 ? 621 HOH A O     1 
HETATM 3028 O  O     . HOH N 10 .   ? 23.470  -16.602 -13.310 1.00 12.40 ? 622 HOH A O     1 
HETATM 3029 O  O     . HOH N 10 .   ? -8.521  1.703   -10.899 1.00 10.34 ? 623 HOH A O     1 
HETATM 3030 O  O     . HOH N 10 .   ? 7.534   -13.254 -12.464 1.00 7.47  ? 624 HOH A O     1 
HETATM 3031 O  O     . HOH N 10 .   ? 1.494   -23.151 -5.136  1.00 9.60  ? 625 HOH A O     1 
HETATM 3032 O  O     . HOH N 10 .   ? -18.447 -2.908  -12.035 1.00 12.87 ? 626 HOH A O     1 
HETATM 3033 O  O     . HOH N 10 .   ? 6.698   -14.408 -4.629  1.00 7.70  ? 627 HOH A O     1 
HETATM 3034 O  O     . HOH N 10 .   ? 5.239   -9.782  -5.015  1.00 12.93 ? 628 HOH A O     1 
HETATM 3035 O  O     . HOH N 10 .   ? 1.507   -18.671 -15.949 1.00 10.53 ? 629 HOH A O     1 
HETATM 3036 O  O     . HOH N 10 .   ? 1.601   -20.860 -0.598  1.00 10.02 ? 630 HOH A O     1 
HETATM 3037 O  O     . HOH N 10 .   ? -8.450  -22.072 -8.647  1.00 9.34  ? 631 HOH A O     1 
HETATM 3038 O  O     . HOH N 10 .   ? 4.264   -18.608 -21.748 1.00 9.08  ? 632 HOH A O     1 
HETATM 3039 O  O     . HOH N 10 .   ? -19.166 -3.092  -3.838  1.00 11.99 ? 633 HOH A O     1 
HETATM 3040 O  O     . HOH N 10 .   ? -0.557  -16.613 -7.454  1.00 5.41  ? 634 HOH A O     1 
HETATM 3041 O  O     . HOH N 10 .   ? 11.541  6.587   -1.165  1.00 8.39  ? 635 HOH A O     1 
HETATM 3042 O  O     . HOH N 10 .   ? -13.057 22.107  3.828   1.00 12.47 ? 636 HOH A O     1 
HETATM 3043 O  O     . HOH N 10 .   ? -13.980 -16.672 -3.568  1.00 6.21  ? 637 HOH A O     1 
HETATM 3044 O  O     . HOH N 10 .   ? -16.768 -18.909 -1.123  1.00 11.60 ? 638 HOH A O     1 
HETATM 3045 O  O     . HOH N 10 .   ? -12.446 -14.477 3.714   1.00 12.25 ? 639 HOH A O     1 
HETATM 3046 O  O     . HOH N 10 .   ? 10.934  -14.355 -5.877  1.00 13.34 ? 640 HOH A O     1 
HETATM 3047 O  O     . HOH N 10 .   ? 5.442   -10.579 -7.247  1.00 12.08 ? 641 HOH A O     1 
HETATM 3048 O  O     . HOH N 10 .   ? 12.925  8.622   -10.162 1.00 10.49 ? 642 HOH A O     1 
HETATM 3049 O  O     . HOH N 10 .   ? 5.741   -22.358 -0.125  1.00 14.62 ? 643 HOH A O     1 
HETATM 3050 O  O     . HOH N 10 .   ? -14.359 -17.627 -1.075  1.00 10.20 ? 644 HOH A O     1 
HETATM 3051 O  O     . HOH N 10 .   ? 6.216   -11.382 -11.037 1.00 8.64  ? 645 HOH A O     1 
HETATM 3052 O  O     . HOH N 10 .   ? 16.997  -21.304 -6.199  1.00 12.92 ? 646 HOH A O     1 
HETATM 3053 O  O     . HOH N 10 .   ? -5.719  -0.679  4.766   1.00 9.51  ? 647 HOH A O     1 
HETATM 3054 O  O     . HOH N 10 .   ? 16.192  -11.867 -22.486 1.00 11.87 ? 648 HOH A O     1 
HETATM 3055 O  O     . HOH N 10 .   ? -14.912 20.100  3.005   1.00 12.21 ? 649 HOH A O     1 
HETATM 3056 O  O     . HOH N 10 .   ? -10.611 -9.840  0.099   1.00 13.89 ? 650 HOH A O     1 
HETATM 3057 O  O     . HOH N 10 .   ? -20.505 -4.144  -7.990  1.00 13.18 ? 651 HOH A O     1 
HETATM 3058 O  O     . HOH N 10 .   ? 18.431  12.206  -6.357  1.00 14.01 ? 652 HOH A O     1 
HETATM 3059 O  O     . HOH N 10 .   ? 15.094  -1.310  -11.738 1.00 22.83 ? 653 HOH A O     1 
HETATM 3060 O  O     . HOH N 10 .   ? 9.468   5.892   -3.004  1.00 8.20  ? 654 HOH A O     1 
HETATM 3061 O  O     . HOH N 10 .   ? 6.104   -26.528 1.028   1.00 10.98 ? 655 HOH A O     1 
HETATM 3062 O  O     . HOH N 10 .   ? -13.922 -19.040 -5.090  1.00 12.09 ? 656 HOH A O     1 
HETATM 3063 O  O     . HOH N 10 .   ? 8.198   1.346   -20.310 1.00 16.84 ? 657 HOH A O     1 
HETATM 3064 O  O     . HOH N 10 .   ? -8.429  -12.415 2.363   1.00 15.89 ? 658 HOH A O     1 
HETATM 3065 O  O     . HOH N 10 .   ? 15.698  -10.582 -10.987 1.00 13.08 ? 659 HOH A O     1 
HETATM 3066 O  O     . HOH N 10 .   ? 16.161  -24.129 -5.984  1.00 14.64 ? 660 HOH A O     1 
HETATM 3067 O  O     . HOH N 10 .   ? -9.793  5.002   6.232   1.00 12.27 ? 661 HOH A O     1 
HETATM 3068 O  O     . HOH N 10 .   ? -9.553  21.084  4.845   1.00 17.88 ? 662 HOH A O     1 
HETATM 3069 O  O     . HOH N 10 .   ? -5.581  -21.670 -5.974  1.00 9.05  ? 663 HOH A O     1 
HETATM 3070 O  O     . HOH N 10 .   ? -14.432 10.737  8.152   1.00 18.72 ? 664 HOH A O     1 
HETATM 3071 O  O     . HOH N 10 .   ? 7.467   -1.609  -4.301  1.00 19.22 ? 665 HOH A O     1 
HETATM 3072 O  O     . HOH N 10 .   ? 9.861   11.058  -22.686 1.00 19.83 ? 666 HOH A O     1 
HETATM 3073 O  O     . HOH N 10 .   ? 7.749   -8.480  -4.443  1.00 20.44 ? 667 HOH A O     1 
HETATM 3074 O  O     . HOH N 10 .   ? -17.292 5.420   6.165   1.00 13.61 ? 668 HOH A O     1 
HETATM 3075 O  O     . HOH N 10 .   ? -6.947  -5.046  3.163   1.00 15.66 ? 669 HOH A O     1 
HETATM 3076 O  O     . HOH N 10 .   ? 10.515  4.476   -6.178  1.00 14.23 ? 670 HOH A O     1 
HETATM 3077 O  O     . HOH N 10 .   ? -14.705 -5.099  -18.280 1.00 15.85 ? 671 HOH A O     1 
HETATM 3078 O  O     . HOH N 10 .   ? 12.000  5.116   1.148   1.00 17.26 ? 672 HOH A O     1 
HETATM 3079 O  O     . HOH N 10 .   ? 23.718  -19.622 -20.902 1.00 17.82 ? 673 HOH A O     1 
HETATM 3080 O  O     . HOH N 10 .   ? 13.405  -30.422 -3.389  1.00 19.75 ? 674 HOH A O     1 
HETATM 3081 O  O     . HOH N 10 .   ? 3.013   20.476  -0.718  1.00 16.08 ? 675 HOH A O     1 
HETATM 3082 O  O     . HOH N 10 .   ? 10.154  18.594  -5.510  1.00 14.37 ? 676 HOH A O     1 
HETATM 3083 O  O     . HOH N 10 .   ? -4.544  -17.909 -22.687 1.00 18.34 ? 677 HOH A O     1 
HETATM 3084 O  O     . HOH N 10 .   ? -15.276 -3.167  -16.436 1.00 13.58 ? 678 HOH A O     1 
HETATM 3085 O  O     . HOH N 10 .   ? 16.990  -14.426 -23.047 1.00 15.27 ? 679 HOH A O     1 
HETATM 3086 O  O     . HOH N 10 .   ? 4.639   -8.941  -16.025 1.00 15.09 ? 680 HOH A O     1 
HETATM 3087 O  O     . HOH N 10 .   ? 12.285  13.939  -22.352 1.00 17.35 ? 681 HOH A O     1 
HETATM 3088 O  O     . HOH N 10 .   ? -17.551 2.864   5.151   1.00 14.03 ? 682 HOH A O     1 
HETATM 3089 O  O     . HOH N 10 .   ? 3.743   -3.489  -10.218 1.00 15.52 ? 683 HOH A O     1 
HETATM 3090 O  O     . HOH N 10 .   ? 10.080  18.604  7.455   1.00 21.71 ? 684 HOH A O     1 
HETATM 3091 O  O     . HOH N 10 .   ? 7.640   12.299  -18.654 1.00 19.40 ? 685 HOH A O     1 
HETATM 3092 O  O     . HOH N 10 .   ? 18.298  -5.767  -22.846 1.00 20.00 ? 686 HOH A O     1 
HETATM 3093 O  O     . HOH N 10 .   ? -20.025 1.280   -11.333 1.00 20.25 ? 687 HOH A O     1 
HETATM 3094 O  O     . HOH N 10 .   ? -1.740  -17.089 3.303   1.00 18.51 ? 688 HOH A O     1 
HETATM 3095 O  O     . HOH N 10 .   ? -20.637 -15.126 -5.702  1.00 19.25 ? 689 HOH A O     1 
HETATM 3096 O  O     . HOH N 10 .   ? 22.365  -16.057 -10.984 1.00 23.24 ? 690 HOH A O     1 
HETATM 3097 O  O     . HOH N 10 .   ? -24.461 10.263  -3.947  1.00 15.19 ? 691 HOH A O     1 
HETATM 3098 O  O     . HOH N 10 .   ? -12.750 1.431   -10.262 1.00 14.63 ? 692 HOH A O     1 
HETATM 3099 O  O     . HOH N 10 .   ? -11.762 11.938  -7.806  1.00 15.03 ? 693 HOH A O     1 
HETATM 3100 O  O     . HOH N 10 .   ? 6.627   -20.228 1.447   1.00 18.02 ? 694 HOH A O     1 
HETATM 3101 O  O     . HOH N 10 .   ? -25.176 -4.627  -16.323 1.00 18.10 ? 695 HOH A O     1 
HETATM 3102 O  O     . HOH N 10 .   ? -4.286  -24.683 -15.698 1.00 21.85 ? 696 HOH A O     1 
HETATM 3103 O  O     . HOH N 10 .   ? 13.494  -10.511 -9.607  1.00 17.70 ? 697 HOH A O     1 
HETATM 3104 O  O     . HOH N 10 .   ? 19.830  -6.408  -11.895 1.00 21.25 ? 698 HOH A O     1 
HETATM 3105 O  O     . HOH N 10 .   ? -15.991 13.705  -3.598  1.00 17.45 ? 699 HOH A O     1 
HETATM 3106 O  O     . HOH N 10 .   ? -21.233 12.627  2.150   1.00 20.11 ? 700 HOH A O     1 
HETATM 3107 O  O     . HOH N 10 .   ? 10.443  -5.548  -16.666 1.00 26.55 ? 701 HOH A O     1 
HETATM 3108 O  O     . HOH N 10 .   ? 5.840   16.435  -17.401 1.00 19.89 ? 702 HOH A O     1 
HETATM 3109 O  O     . HOH N 10 .   ? 13.835  -0.792  -27.012 1.00 21.63 ? 703 HOH A O     1 
HETATM 3110 O  O     . HOH N 10 .   ? -2.863  -4.508  4.534   1.00 16.81 ? 704 HOH A O     1 
HETATM 3111 O  O     . HOH N 10 .   ? 19.960  -15.892 -9.436  1.00 13.66 ? 705 HOH A O     1 
HETATM 3112 O  O     . HOH N 10 .   ? -10.954 -1.561  3.221   1.00 17.19 ? 706 HOH A O     1 
HETATM 3113 O  O     . HOH N 10 .   ? 8.167   -12.393 -6.671  1.00 28.25 ? 707 HOH A O     1 
HETATM 3114 O  O     . HOH N 10 .   ? -12.378 -20.651 -2.861  1.00 16.96 ? 708 HOH A O     1 
HETATM 3115 O  O     . HOH N 10 .   ? 25.713  -3.848  -24.284 1.00 16.23 ? 709 HOH A O     1 
HETATM 3116 O  O     . HOH N 10 .   ? -0.331  -19.719 -22.889 1.00 22.22 ? 710 HOH A O     1 
HETATM 3117 O  O     . HOH N 10 .   ? -2.880  15.422  6.090   1.00 22.05 ? 711 HOH A O     1 
HETATM 3118 O  O     . HOH N 10 .   ? 3.096   -18.631 -14.141 0.50 5.93  ? 712 HOH A O     1 
HETATM 3119 O  O     . HOH N 10 .   ? 11.651  -4.677  -18.734 1.00 15.78 ? 713 HOH A O     1 
HETATM 3120 O  O     . HOH N 10 .   ? 13.379  -3.040  -14.555 1.00 18.84 ? 714 HOH A O     1 
HETATM 3121 O  O     . HOH N 10 .   ? 15.077  -8.151  -12.506 1.00 18.02 ? 715 HOH A O     1 
HETATM 3122 O  O     . HOH N 10 .   ? -16.849 -18.184 -15.005 1.00 19.94 ? 716 HOH A O     1 
HETATM 3123 O  O     . HOH N 10 .   ? 7.329   11.568  -21.193 1.00 15.12 ? 717 HOH A O     1 
HETATM 3124 O  O     . HOH N 10 .   ? -12.262 -5.144  -24.248 1.00 32.65 ? 718 HOH A O     1 
HETATM 3125 O  O     . HOH N 10 .   ? -21.542 0.951   0.930   1.00 19.21 ? 719 HOH A O     1 
HETATM 3126 O  O     . HOH N 10 .   ? -5.471  10.791  10.377  1.00 24.94 ? 720 HOH A O     1 
HETATM 3127 O  O     . HOH N 10 .   ? -21.993 11.985  -7.798  1.00 22.49 ? 721 HOH A O     1 
HETATM 3128 O  O     . HOH N 10 .   ? -10.808 -6.564  -21.948 1.00 24.80 ? 722 HOH A O     1 
HETATM 3129 O  O     . HOH N 10 .   ? -23.083 0.976   -4.753  1.00 19.11 ? 723 HOH A O     1 
HETATM 3130 O  O     . HOH N 10 .   ? -22.676 -10.088 -4.312  1.00 21.72 ? 724 HOH A O     1 
HETATM 3131 O  O     . HOH N 10 .   ? 16.974  -27.272 -22.673 1.00 20.27 ? 725 HOH A O     1 
HETATM 3132 O  O     . HOH N 10 .   ? 20.643  8.356   -7.365  1.00 22.18 ? 726 HOH A O     1 
HETATM 3133 O  O     . HOH N 10 .   ? -8.247  -7.878  3.261   1.00 23.67 ? 727 HOH A O     1 
HETATM 3134 O  O     . HOH N 10 .   ? -16.852 -20.598 -13.954 1.00 24.13 ? 728 HOH A O     1 
HETATM 3135 O  O     . HOH N 10 .   ? 21.252  -19.018 -7.589  1.00 37.35 ? 729 HOH A O     1 
HETATM 3136 O  O     . HOH N 10 .   ? 5.239   -2.854  -2.156  1.00 17.79 ? 730 HOH A O     1 
HETATM 3137 O  O     . HOH N 10 .   ? 21.946  -0.202  -13.715 1.00 17.97 ? 731 HOH A O     1 
HETATM 3138 O  O     . HOH N 10 .   ? -14.606 12.538  -10.321 1.00 24.98 ? 732 HOH A O     1 
HETATM 3139 O  O     . HOH N 10 .   ? -13.332 -23.019 -13.245 1.00 25.40 ? 733 HOH A O     1 
HETATM 3140 O  O     . HOH N 10 .   ? -10.878 21.838  -2.386  1.00 26.66 ? 734 HOH A O     1 
HETATM 3141 O  O     . HOH N 10 .   ? 27.941  -8.333  -21.417 1.00 21.14 ? 735 HOH A O     1 
HETATM 3142 O  O     . HOH N 10 .   ? 9.366   -2.737  7.376   1.00 24.70 ? 736 HOH A O     1 
HETATM 3143 O  O     . HOH N 10 .   ? 10.027  4.401   -12.842 1.00 17.16 ? 737 HOH A O     1 
HETATM 3144 O  O     . HOH N 10 .   ? -19.586 13.418  3.724   1.00 16.58 ? 738 HOH A O     1 
HETATM 3145 O  O     . HOH N 10 .   ? 11.287  -13.780 -2.711  1.00 30.20 ? 739 HOH A O     1 
HETATM 3146 O  O     . HOH N 10 .   ? 8.243   -31.334 -2.429  1.00 29.47 ? 740 HOH A O     1 
HETATM 3147 O  O     . HOH N 10 .   ? 12.452  -13.726 -7.847  1.00 22.92 ? 741 HOH A O     1 
HETATM 3148 O  O     . HOH N 10 .   ? -19.174 0.121   2.039   1.00 22.41 ? 742 HOH A O     1 
HETATM 3149 O  O     . HOH N 10 .   ? 17.163  -34.706 -13.903 1.00 25.09 ? 743 HOH A O     1 
HETATM 3150 O  O     . HOH N 10 .   ? -2.082  15.092  -9.202  1.00 32.33 ? 744 HOH A O     1 
HETATM 3151 O  O     . HOH N 10 .   ? 5.836   -7.942  -8.206  1.00 25.41 ? 745 HOH A O     1 
HETATM 3152 O  O     . HOH N 10 .   ? 5.816   -3.889  -11.437 1.00 21.21 ? 746 HOH A O     1 
HETATM 3153 O  O     . HOH N 10 .   ? -0.175  -9.664  5.097   1.00 28.97 ? 747 HOH A O     1 
HETATM 3154 O  O     . HOH N 10 .   ? 16.184  17.058  -12.504 1.00 23.52 ? 748 HOH A O     1 
HETATM 3155 O  O     . HOH N 10 .   ? 13.092  4.631   -28.477 1.00 27.49 ? 749 HOH A O     1 
HETATM 3156 O  O     . HOH N 10 .   ? -24.177 3.252   -1.630  1.00 19.49 ? 750 HOH A O     1 
HETATM 3157 O  O     . HOH N 10 .   ? 12.490  17.893  8.679   1.00 24.55 ? 751 HOH A O     1 
HETATM 3158 O  O     . HOH N 10 .   ? 4.582   -10.176 5.799   1.00 25.95 ? 752 HOH A O     1 
HETATM 3159 O  O     . HOH N 10 .   ? -0.557  12.197  -11.407 1.00 19.50 ? 753 HOH A O     1 
HETATM 3160 O  O     . HOH N 10 .   ? 11.088  -0.287  -27.254 1.00 29.31 ? 754 HOH A O     1 
HETATM 3161 O  O     . HOH N 10 .   ? 8.024   2.360   -7.588  1.00 23.65 ? 755 HOH A O     1 
HETATM 3162 O  O     . HOH N 10 .   ? -22.273 -13.251 -3.572  1.00 22.27 ? 756 HOH A O     1 
HETATM 3163 O  O     . HOH N 10 .   ? 18.120  -7.046  -9.939  1.00 31.07 ? 757 HOH A O     1 
HETATM 3164 O  O     . HOH N 10 .   ? 14.586  13.716  -24.496 1.00 26.32 ? 758 HOH A O     1 
HETATM 3165 O  O     . HOH N 10 .   ? 3.424   -3.376  -19.189 1.00 22.47 ? 759 HOH A O     1 
HETATM 3166 O  O     . HOH N 10 .   ? 23.721  -5.318  -13.721 1.00 30.37 ? 760 HOH A O     1 
HETATM 3167 O  O     . HOH N 10 .   ? 5.900   -15.983 2.524   1.00 21.55 ? 761 HOH A O     1 
HETATM 3168 O  O     . HOH N 10 .   ? 28.383  7.033   -25.253 1.00 28.87 ? 762 HOH A O     1 
HETATM 3169 O  O     . HOH N 10 .   ? 20.227  -12.524 -23.889 1.00 24.07 ? 763 HOH A O     1 
HETATM 3170 O  O     . HOH N 10 .   ? 6.470   -10.116 -28.386 1.00 20.86 ? 764 HOH A O     1 
HETATM 3171 O  O     . HOH N 10 .   ? 21.126  11.007  -7.937  1.00 23.67 ? 765 HOH A O     1 
HETATM 3172 O  O     . HOH N 10 .   ? 17.378  13.675  -26.004 1.00 33.55 ? 766 HOH A O     1 
HETATM 3173 O  O     . HOH N 10 .   ? -24.235 -9.455  -10.964 1.00 19.49 ? 767 HOH A O     1 
HETATM 3174 O  O     . HOH N 10 .   ? 23.165  -24.115 -7.759  1.00 24.42 ? 768 HOH A O     1 
HETATM 3175 O  O     . HOH N 10 .   ? 19.865  -21.356 -7.025  1.00 26.39 ? 769 HOH A O     1 
HETATM 3176 O  O     . HOH N 10 .   ? -8.542  0.537   5.836   1.00 24.04 ? 770 HOH A O     1 
HETATM 3177 O  O     . HOH N 10 .   ? -12.835 -19.456 0.056   1.00 26.98 ? 771 HOH A O     1 
HETATM 3178 O  O     . HOH N 10 .   ? 24.822  4.297   -28.133 1.00 26.10 ? 772 HOH A O     1 
HETATM 3179 O  O     . HOH N 10 .   ? -3.662  -16.288 -24.215 1.00 25.32 ? 773 HOH A O     1 
HETATM 3180 O  O     . HOH N 10 .   ? -20.726 -2.802  -10.770 1.00 26.22 ? 774 HOH A O     1 
HETATM 3181 O  O     . HOH N 10 .   ? 4.736   4.702   11.704  1.00 28.20 ? 775 HOH A O     1 
HETATM 3182 O  O     . HOH N 10 .   ? -21.103 -15.925 -10.919 1.00 25.43 ? 776 HOH A O     1 
HETATM 3183 O  O     . HOH N 10 .   ? 6.376   -7.710  -28.547 1.00 29.68 ? 777 HOH A O     1 
HETATM 3184 O  O     . HOH N 10 .   ? 10.537  9.364   -26.108 1.00 27.84 ? 778 HOH A O     1 
HETATM 3185 O  O     . HOH N 10 .   ? -18.175 -17.874 -17.555 1.00 29.81 ? 779 HOH A O     1 
HETATM 3186 O  O     . HOH N 10 .   ? 10.597  8.089   -28.246 1.00 39.87 ? 780 HOH A O     1 
HETATM 3187 O  O     . HOH N 10 .   ? 9.687   -8.051  -16.146 1.00 22.18 ? 781 HOH A O     1 
HETATM 3188 O  O     . HOH N 10 .   ? -10.316 3.183   -9.993  1.00 26.03 ? 782 HOH A O     1 
HETATM 3189 O  O     . HOH N 10 .   ? -8.871  -23.227 -11.319 1.00 28.54 ? 783 HOH A O     1 
HETATM 3190 O  O     . HOH N 10 .   ? 11.450  -8.911  -14.506 1.00 24.11 ? 784 HOH A O     1 
HETATM 3191 O  O     . HOH N 10 .   ? 6.652   18.644  -18.945 1.00 20.80 ? 785 HOH A O     1 
HETATM 3192 O  O     . HOH N 10 .   ? 3.042   -17.176 3.020   1.00 26.00 ? 786 HOH A O     1 
HETATM 3193 O  O     . HOH N 10 .   ? -3.506  -8.576  3.526   1.00 19.30 ? 787 HOH A O     1 
HETATM 3194 O  O     . HOH N 10 .   ? -21.043 5.848   -9.361  1.00 25.22 ? 788 HOH A O     1 
HETATM 3195 O  O     . HOH N 10 .   ? 18.438  16.420  -10.624 1.00 24.21 ? 789 HOH A O     1 
HETATM 3196 O  O     . HOH N 10 .   ? 24.927  -26.908 -17.557 1.00 27.38 ? 790 HOH A O     1 
HETATM 3197 O  O     . HOH N 10 .   ? 13.929  -0.008  -13.896 1.00 24.17 ? 791 HOH A O     1 
HETATM 3198 O  O     . HOH N 10 .   ? 7.804   -4.752  -24.372 1.00 28.54 ? 792 HOH A O     1 
HETATM 3199 O  O     . HOH N 10 .   ? 19.952  2.814   -9.695  1.00 31.62 ? 793 HOH A O     1 
HETATM 3200 O  O     . HOH N 10 .   ? 0.166   -24.753 -3.449  1.00 29.98 ? 794 HOH A O     1 
HETATM 3201 O  O     . HOH N 10 .   ? 11.120  -25.319 -26.200 1.00 18.39 ? 795 HOH A O     1 
HETATM 3202 O  O     . HOH N 10 .   ? 3.072   -22.435 -2.455  1.00 16.35 ? 796 HOH A O     1 
HETATM 3203 O  O     . HOH N 10 .   ? 2.365   -26.920 -3.825  1.00 28.46 ? 797 HOH A O     1 
HETATM 3204 O  O     . HOH N 10 .   ? 9.038   -2.984  -23.441 1.00 21.03 ? 798 HOH A O     1 
HETATM 3205 O  O     . HOH N 10 .   ? -5.439  -24.084 -18.492 1.00 32.24 ? 799 HOH A O     1 
HETATM 3206 O  O     . HOH N 10 .   ? -10.228 8.322   6.001   1.00 19.97 ? 800 HOH A O     1 
HETATM 3207 O  O     . HOH N 10 .   ? -12.719 -6.706  -26.222 1.00 27.05 ? 801 HOH A O     1 
HETATM 3208 O  O     . HOH N 10 .   ? 28.460  -4.480  -22.694 1.00 20.99 ? 802 HOH A O     1 
HETATM 3209 O  O     . HOH N 10 .   ? 29.904  -11.791 -15.153 0.50 19.28 ? 803 HOH A O     1 
HETATM 3210 O  O     . HOH N 10 .   ? 20.410  0.337   -11.410 1.00 25.33 ? 804 HOH A O     1 
HETATM 3211 O  O     . HOH N 10 .   ? 12.691  6.163   -9.242  1.00 21.61 ? 805 HOH A O     1 
HETATM 3212 O  O     . HOH N 10 .   ? -15.194 -5.196  -0.781  1.00 18.57 ? 806 HOH A O     1 
HETATM 3213 O  O     . HOH N 10 .   ? 20.750  -24.320 -6.705  1.00 30.09 ? 807 HOH A O     1 
HETATM 3214 O  O     . HOH N 10 .   ? 27.211  -21.503 -16.584 1.00 27.05 ? 808 HOH A O     1 
HETATM 3215 O  O     . HOH N 10 .   ? 19.235  -10.971 -9.821  0.50 11.96 ? 809 HOH A O     1 
HETATM 3216 O  O     . HOH N 10 .   ? -7.205  -24.242 -17.052 1.00 30.05 ? 810 HOH A O     1 
HETATM 3217 O  O     . HOH N 10 .   ? 5.583   -8.399  -13.820 1.00 21.43 ? 811 HOH A O     1 
HETATM 3218 O  O     . HOH N 10 .   ? 28.055  9.291   -21.833 1.00 28.22 ? 812 HOH A O     1 
HETATM 3219 O  O     . HOH N 10 .   ? -10.094 -4.050  1.968   1.00 20.72 ? 813 HOH A O     1 
HETATM 3220 O  O     . HOH N 10 .   ? 16.690  11.980  4.554   1.00 25.44 ? 814 HOH A O     1 
HETATM 3221 O  O     . HOH N 10 .   ? 17.706  -9.505  -9.370  1.00 27.36 ? 815 HOH A O     1 
HETATM 3222 O  O     . HOH N 10 .   ? -12.021 14.491  -10.352 1.00 23.44 ? 816 HOH A O     1 
HETATM 3223 O  O     . HOH N 10 .   ? 8.795   -0.890  -25.597 1.00 25.95 ? 817 HOH A O     1 
HETATM 3224 O  O     . HOH N 10 .   ? 21.913  -7.975  -11.615 1.00 32.21 ? 818 HOH A O     1 
HETATM 3225 O  O     . HOH N 10 .   ? 7.592   -1.138  -21.135 1.00 27.11 ? 819 HOH A O     1 
HETATM 3226 O  O     . HOH N 10 .   ? 3.112   -25.006 -2.234  1.00 31.96 ? 820 HOH A O     1 
HETATM 3227 O  O     . HOH N 10 .   ? -21.961 -1.782  -4.202  1.00 34.26 ? 821 HOH A O     1 
HETATM 3228 O  O     . HOH N 10 .   ? 22.267  -7.425  -23.086 1.00 30.27 ? 822 HOH A O     1 
HETATM 3229 O  O     . HOH N 10 .   ? -22.996 -3.798  -12.038 1.00 29.64 ? 823 HOH A O     1 
HETATM 3230 O  O     . HOH N 10 .   ? 5.060   20.778  -17.816 1.00 23.05 ? 824 HOH A O     1 
HETATM 3231 O  O     . HOH N 10 .   ? 23.438  -10.291 -23.632 1.00 34.25 ? 825 HOH A O     1 
HETATM 3232 O  O     . HOH N 10 .   ? 18.534  -10.396 -23.580 1.00 29.71 ? 826 HOH A O     1 
HETATM 3233 O  O     . HOH N 10 .   ? -23.860 -15.550 -20.341 1.00 32.99 ? 827 HOH A O     1 
HETATM 3234 O  O     . HOH N 10 .   ? 8.690   -28.707 -19.052 1.00 27.10 ? 828 HOH A O     1 
HETATM 3235 O  O     . HOH N 10 .   ? 3.938   -2.273  -15.942 1.00 20.11 ? 829 HOH A O     1 
HETATM 3236 O  O     . HOH N 10 .   ? -5.293  19.429  8.887   1.00 30.02 ? 830 HOH A O     1 
HETATM 3237 O  O     . HOH N 10 .   ? 2.059   -11.589 5.063   1.00 22.71 ? 831 HOH A O     1 
HETATM 3238 O  O     . HOH N 10 .   ? 19.840  -7.672  -23.308 1.00 30.84 ? 832 HOH A O     1 
HETATM 3239 O  O     . HOH N 10 .   ? -5.300  -11.889 4.003   1.00 19.55 ? 833 HOH A O     1 
HETATM 3240 O  O     . HOH N 10 .   ? -9.631  -20.325 -0.882  1.00 33.02 ? 834 HOH A O     1 
HETATM 3241 O  O     . HOH N 10 .   ? -17.893 -3.061  -21.888 1.00 32.48 ? 835 HOH A O     1 
HETATM 3242 O  O     . HOH N 10 .   ? 3.934   19.261  -8.350  1.00 29.30 ? 836 HOH A O     1 
HETATM 3243 O  O     . HOH N 10 .   ? 8.922   -11.324 -27.689 1.00 20.58 ? 837 HOH A O     1 
HETATM 3244 O  O     . HOH N 10 .   ? -12.041 -6.247  1.588   1.00 25.90 ? 838 HOH A O     1 
HETATM 3245 O  O     . HOH N 10 .   ? -11.148 -17.154 3.182   1.00 24.46 ? 839 HOH A O     1 
HETATM 3246 O  O     . HOH N 10 .   ? 20.167  -31.668 -13.088 1.00 22.75 ? 840 HOH A O     1 
HETATM 3247 O  O     . HOH N 10 .   ? 18.560  -25.890 -6.203  1.00 28.87 ? 841 HOH A O     1 
HETATM 3248 O  O     . HOH N 10 .   ? -20.664 9.752   5.234   1.00 20.21 ? 842 HOH A O     1 
HETATM 3249 O  O     . HOH N 10 .   ? 6.873   -3.820  -9.067  1.00 19.74 ? 843 HOH A O     1 
HETATM 3250 O  O     . HOH N 10 .   ? -7.298  22.840  -0.557  1.00 33.38 ? 844 HOH A O     1 
HETATM 3251 O  O     . HOH N 10 .   ? -15.270 -4.101  -20.833 1.00 32.22 ? 845 HOH A O     1 
HETATM 3252 O  O     . HOH N 10 .   ? 7.617   -12.023 4.483   1.00 25.86 ? 846 HOH A O     1 
HETATM 3253 O  O     . HOH N 10 .   ? -22.879 -10.307 -15.805 1.00 24.20 ? 847 HOH A O     1 
HETATM 3254 O  O     . HOH N 10 .   ? 11.932  -29.026 -19.020 1.00 25.71 ? 848 HOH A O     1 
HETATM 3255 O  O     . HOH N 10 .   ? -3.313  -20.242 -0.146  1.00 27.33 ? 849 HOH A O     1 
HETATM 3256 O  O     . HOH N 10 .   ? -19.656 6.102   7.099   1.00 25.71 ? 850 HOH A O     1 
HETATM 3257 O  O     . HOH N 10 .   ? -23.810 -10.413 -2.109  1.00 28.82 ? 851 HOH A O     1 
HETATM 3258 O  O     . HOH N 10 .   ? 25.388  -18.783 -23.207 1.00 31.18 ? 852 HOH A O     1 
HETATM 3259 O  O     . HOH N 10 .   ? -25.933 6.893   -4.174  1.00 26.89 ? 853 HOH A O     1 
HETATM 3260 O  O     . HOH N 10 .   ? 6.252   -6.539  -11.981 1.00 25.78 ? 854 HOH A O     1 
HETATM 3261 O  O     . HOH N 10 .   ? -3.672  -0.599  6.743   1.00 27.08 ? 855 HOH A O     1 
HETATM 3262 O  O     . HOH N 10 .   ? -7.604  14.949  11.069  1.00 36.89 ? 856 HOH A O     1 
HETATM 3263 O  O     . HOH N 10 .   ? 3.200   -12.280 2.482   1.00 20.97 ? 857 HOH A O     1 
HETATM 3264 O  O     . HOH N 10 .   ? 11.173  1.225   -13.656 1.00 26.95 ? 858 HOH A O     1 
HETATM 3265 O  O     . HOH N 10 .   ? -0.532  -22.082 0.193   1.00 27.80 ? 859 HOH A O     1 
HETATM 3266 O  O     . HOH N 10 .   ? -15.794 -0.968  -17.585 1.00 32.66 ? 860 HOH A O     1 
HETATM 3267 O  O     . HOH N 10 .   ? 23.585  2.158   -29.537 1.00 33.91 ? 861 HOH A O     1 
HETATM 3268 O  O     . HOH N 10 .   ? 9.609   -10.643 3.016   1.00 23.89 ? 862 HOH A O     1 
HETATM 3269 O  O     . HOH N 10 .   ? -20.924 -15.951 -8.757  1.00 23.78 ? 863 HOH A O     1 
HETATM 3270 O  O     . HOH N 10 .   ? 18.038  0.405   -30.126 1.00 31.70 ? 864 HOH A O     1 
HETATM 3271 O  O     . HOH N 10 .   ? -14.828 -21.571 0.900   1.00 26.20 ? 865 HOH A O     1 
HETATM 3272 O  O     . HOH N 10 .   ? 9.643   19.053  -11.905 1.00 23.26 ? 866 HOH A O     1 
HETATM 3273 O  O     . HOH N 10 .   ? -20.839 -18.132 -9.168  1.00 26.95 ? 867 HOH A O     1 
HETATM 3274 O  O     . HOH N 10 .   ? -5.249  -15.181 4.992   1.00 29.22 ? 868 HOH A O     1 
HETATM 3275 O  O     . HOH N 10 .   ? 3.638   20.193  -5.629  1.00 30.81 ? 869 HOH A O     1 
HETATM 3276 O  O     . HOH N 10 .   ? 6.839   -30.544 -6.261  1.00 29.46 ? 870 HOH A O     1 
HETATM 3277 O  O     . HOH N 10 .   ? -16.885 -21.582 -1.786  1.00 26.16 ? 871 HOH A O     1 
HETATM 3278 O  O     . HOH N 10 .   ? -1.117  -20.506 -19.835 1.00 32.27 ? 872 HOH A O     1 
HETATM 3279 O  O     . HOH N 10 .   ? -22.254 -3.545  -5.810  1.00 33.19 ? 873 HOH A O     1 
HETATM 3280 O  O     . HOH N 10 .   ? 28.582  3.210   -19.571 1.00 31.30 ? 874 HOH A O     1 
HETATM 3281 O  O     . HOH N 10 .   ? 10.929  18.942  -9.612  1.00 32.23 ? 875 HOH A O     1 
HETATM 3282 O  O     . HOH N 10 .   ? 28.254  1.846   -26.175 1.00 37.09 ? 876 HOH A O     1 
HETATM 3283 O  O     . HOH N 10 .   ? -23.601 13.746  -6.067  1.00 34.55 ? 877 HOH A O     1 
HETATM 3284 O  O     . HOH N 10 .   ? 30.492  -9.858  -21.154 1.00 37.63 ? 878 HOH A O     1 
HETATM 3285 O  O     . HOH N 10 .   ? 3.493   -26.443 0.208   1.00 27.16 ? 879 HOH A O     1 
HETATM 3286 O  O     . HOH N 10 .   ? -14.696 -4.282  1.566   1.00 25.77 ? 880 HOH A O     1 
HETATM 3287 O  O     . HOH N 10 .   ? -8.921  16.482  10.007  1.00 37.07 ? 881 HOH A O     1 
HETATM 3288 O  O     . HOH N 10 .   ? 18.584  -22.666 -25.147 1.00 29.58 ? 882 HOH A O     1 
HETATM 3289 O  O     . HOH N 10 .   ? 18.625  14.464  -23.445 1.00 39.93 ? 883 HOH A O     1 
HETATM 3290 O  O     . HOH N 10 .   ? -9.786  14.185  8.822   1.00 25.91 ? 884 HOH A O     1 
HETATM 3291 O  O     . HOH N 10 .   ? -24.363 -10.505 -13.918 1.00 27.17 ? 885 HOH A O     1 
HETATM 3292 O  O     . HOH N 10 .   ? -14.201 -12.553 -25.216 1.00 33.76 ? 886 HOH A O     1 
HETATM 3293 O  O     . HOH N 10 .   ? 2.102   -28.945 -1.507  1.00 33.82 ? 887 HOH A O     1 
HETATM 3294 O  O     . HOH N 10 .   ? -11.205 -8.107  3.380   1.00 25.35 ? 888 HOH A O     1 
HETATM 3295 O  O     . HOH N 10 .   ? -11.372 -18.947 1.981   1.00 35.22 ? 889 HOH A O     1 
HETATM 3296 O  O     . HOH N 10 .   ? -23.111 -13.169 -16.905 1.00 35.27 ? 890 HOH A O     1 
HETATM 3297 O  O     . HOH N 10 .   ? -10.079 -23.576 -13.289 1.00 36.76 ? 891 HOH A O     1 
HETATM 3298 O  O     . HOH N 10 .   ? 8.506   6.580   9.478   1.00 32.66 ? 892 HOH A O     1 
HETATM 3299 O  O     . HOH N 10 .   ? 22.858  -27.170 -7.595  1.00 34.03 ? 893 HOH A O     1 
HETATM 3300 O  O     . HOH N 10 .   ? 23.634  -24.939 -21.209 1.00 39.01 ? 894 HOH A O     1 
HETATM 3301 O  O     . HOH N 10 .   ? 9.036   16.768  7.767   1.00 37.71 ? 895 HOH A O     1 
HETATM 3302 O  O     . HOH N 10 .   ? -22.935 -11.102 -6.621  1.00 32.35 ? 896 HOH A O     1 
HETATM 3303 O  O     . HOH N 10 .   ? 13.471  -31.321 -17.401 1.00 28.81 ? 897 HOH A O     1 
HETATM 3304 O  O     . HOH N 10 .   ? 16.401  -37.531 -11.630 1.00 31.73 ? 898 HOH A O     1 
HETATM 3305 O  O     . HOH N 10 .   ? -14.998 5.655   7.968   1.00 33.78 ? 899 HOH A O     1 
HETATM 3306 O  O     . HOH N 10 .   ? 5.393   -1.245  -6.031  1.00 13.40 ? 900 HOH A O     1 
HETATM 3307 O  O     . HOH N 10 .   ? 13.375  -3.713  -0.312  1.00 27.90 ? 901 HOH A O     1 
HETATM 3308 O  O     . HOH N 10 .   ? -4.731  1.711   -5.040  1.00 10.88 ? 902 HOH A O     1 
HETATM 3309 O  O     . HOH N 10 .   ? -9.051  4.219   -12.185 1.00 14.02 ? 903 HOH A O     1 
HETATM 3310 O  O     A HOH N 10 .   ? -17.742 -0.411  -15.618 0.50 20.03 ? 904 HOH A O     1 
HETATM 3311 O  O     B HOH N 10 .   ? -19.431 -0.638  -14.934 0.50 17.63 ? 904 HOH A O     1 
HETATM 3312 O  O     . HOH N 10 .   ? 2.978   -5.323  4.718   1.00 10.13 ? 905 HOH A O     1 
HETATM 3313 O  O     . HOH N 10 .   ? 18.327  3.885   -11.325 1.00 31.05 ? 906 HOH A O     1 
HETATM 3314 O  O     . HOH N 10 .   ? 24.441  7.459   -13.068 1.00 16.99 ? 907 HOH A O     1 
HETATM 3315 O  O     . HOH N 10 .   ? 25.452  9.939   -12.733 1.00 26.01 ? 908 HOH A O     1 
HETATM 3316 O  O     . HOH N 10 .   ? 26.097  5.331   -14.238 1.00 30.47 ? 909 HOH A O     1 
HETATM 3317 O  O     . HOH N 10 .   ? 23.641  6.175   -10.504 1.00 27.67 ? 910 HOH A O     1 
HETATM 3318 O  O     . HOH N 10 .   ? 8.725   -1.067  9.697   0.50 24.09 ? 911 HOH A O     1 
HETATM 3319 O  O     . HOH N 10 .   ? -4.089  4.599   10.258  0.75 22.89 ? 912 HOH A O     1 
HETATM 3320 O  O     . HOH N 10 .   ? -5.652  19.412  -7.240  0.50 11.32 ? 913 HOH A O     1 
HETATM 3321 O  O     . HOH N 10 .   ? -0.515  -26.926 -16.813 1.00 33.82 ? 914 HOH A O     1 
HETATM 3322 O  O     . HOH N 10 .   ? 18.839  -14.967 -4.739  1.00 33.43 ? 915 HOH A O     1 
HETATM 3323 O  O     . HOH N 10 .   ? 10.056  -10.646 -8.138  1.00 29.46 ? 916 HOH A O     1 
HETATM 3324 O  O     . HOH N 10 .   ? 17.179  10.532  -31.277 1.00 33.76 ? 917 HOH A O     1 
HETATM 3325 O  O     . HOH N 10 .   ? -15.876 8.602   -9.082  1.00 30.81 ? 918 HOH A O     1 
HETATM 3326 O  O     . HOH N 10 .   ? -10.545 21.392  -5.856  1.00 27.15 ? 919 HOH A O     1 
HETATM 3327 O  O     . HOH N 10 .   ? 13.367  19.216  10.916  1.00 30.84 ? 920 HOH A O     1 
HETATM 3328 O  O     . HOH N 10 .   ? -6.873  -25.291 -11.193 1.00 31.22 ? 921 HOH A O     1 
HETATM 3329 O  O     . HOH N 10 .   ? 26.554  -26.177 -19.736 1.00 35.82 ? 922 HOH A O     1 
HETATM 3330 O  O     . HOH N 10 .   ? 0.490   -25.328 -6.258  1.00 38.71 ? 923 HOH A O     1 
HETATM 3331 O  O     . HOH N 10 .   ? 29.603  -19.894 -16.824 1.00 35.20 ? 924 HOH A O     1 
HETATM 3332 O  O     . HOH N 10 .   ? -23.408 8.542   4.133   1.00 31.83 ? 925 HOH A O     1 
HETATM 3333 O  O     . HOH N 10 .   ? -1.584  1.348   7.772   1.00 33.70 ? 926 HOH A O     1 
HETATM 3334 O  O     . HOH O 10 .   ? -10.215 -9.952  -19.216 1.00 6.86  ? 101 HOH T O     1 
HETATM 3335 O  O     . HOH O 10 .   ? 0.488   -15.650 -23.811 1.00 8.79  ? 102 HOH T O     1 
HETATM 3336 O  O     . HOH O 10 .   ? -0.749  -13.181 -19.283 1.00 7.85  ? 103 HOH T O     1 
HETATM 3337 O  O     . HOH O 10 .   ? -3.364  -6.917  -24.543 1.00 21.24 ? 104 HOH T O     1 
HETATM 3338 O  O     . HOH O 10 .   ? -6.074  8.054   -20.823 1.00 18.49 ? 105 HOH T O     1 
HETATM 3339 O  O     . HOH O 10 .   ? -4.487  7.050   -22.920 1.00 18.10 ? 106 HOH T O     1 
HETATM 3340 O  O     . HOH O 10 .   ? 2.752   -13.539 -32.669 1.00 17.27 ? 107 HOH T O     1 
HETATM 3341 O  O     . HOH O 10 .   ? -1.439  -9.386  -28.064 1.00 15.05 ? 108 HOH T O     1 
HETATM 3342 O  O     . HOH O 10 .   ? -1.346  -16.905 -25.605 1.00 19.08 ? 109 HOH T O     1 
HETATM 3343 O  O     . HOH O 10 .   ? -5.170  -4.687  -23.542 1.00 16.83 ? 110 HOH T O     1 
HETATM 3344 O  O     . HOH O 10 .   ? -7.560  -5.603  -24.167 1.00 23.49 ? 111 HOH T O     1 
HETATM 3345 O  O     . HOH O 10 .   ? -4.018  -18.152 -30.940 1.00 16.78 ? 112 HOH T O     1 
HETATM 3346 O  O     . HOH O 10 .   ? -3.158  12.944  -11.654 1.00 23.00 ? 113 HOH T O     1 
HETATM 3347 O  O     . HOH O 10 .   ? -7.377  10.611  -18.401 1.00 23.10 ? 114 HOH T O     1 
HETATM 3348 O  O     . HOH O 10 .   ? -3.416  -0.069  -22.881 1.00 21.80 ? 115 HOH T O     1 
HETATM 3349 O  O     . HOH O 10 .   ? 4.939   -18.698 -32.890 1.00 22.73 ? 116 HOH T O     1 
HETATM 3350 O  O     . HOH O 10 .   ? 3.517   -11.056 -31.599 1.00 22.90 ? 117 HOH T O     1 
HETATM 3351 O  O     . HOH O 10 .   ? -4.774  -1.646  -23.975 1.00 24.57 ? 118 HOH T O     1 
HETATM 3352 O  O     . HOH O 10 .   ? -4.321  2.862   -23.004 1.00 21.72 ? 119 HOH T O     1 
HETATM 3353 O  O     . HOH O 10 .   ? -5.699  -18.015 -32.684 1.00 21.94 ? 120 HOH T O     1 
HETATM 3354 O  O     . HOH O 10 .   ? -7.247  -0.228  -22.870 1.00 19.61 ? 121 HOH T O     1 
HETATM 3355 O  O     . HOH O 10 .   ? -7.416  -15.636 -33.666 1.00 23.43 ? 122 HOH T O     1 
HETATM 3356 O  O     . HOH O 10 .   ? 1.077   -1.304  -21.785 1.00 23.68 ? 123 HOH T O     1 
HETATM 3357 O  O     . HOH O 10 .   ? -0.707  -7.342  -23.947 1.00 23.11 ? 124 HOH T O     1 
HETATM 3358 O  O     . HOH O 10 .   ? -10.443 10.633  -15.486 1.00 30.00 ? 125 HOH T O     1 
HETATM 3359 O  O     . HOH O 10 .   ? -0.647  0.691   -22.938 1.00 26.48 ? 126 HOH T O     1 
HETATM 3360 O  O     . HOH O 10 .   ? 1.894   -4.763  -20.547 1.00 21.10 ? 127 HOH T O     1 
HETATM 3361 O  O     . HOH O 10 .   ? -5.090  -9.358  -30.192 1.00 32.48 ? 128 HOH T O     1 
HETATM 3362 O  O     . HOH O 10 .   ? 6.033   -19.526 -39.657 1.00 31.27 ? 129 HOH T O     1 
HETATM 3363 O  O     . HOH O 10 .   ? -12.011 -5.283  -19.942 1.00 21.47 ? 130 HOH T O     1 
HETATM 3364 O  O     . HOH O 10 .   ? -9.454  -4.039  -23.802 1.00 32.45 ? 131 HOH T O     1 
HETATM 3365 O  O     . HOH O 10 .   ? 1.901   -3.791  -22.978 1.00 34.03 ? 132 HOH T O     1 
HETATM 3366 O  O     . HOH O 10 .   ? -6.744  12.736  -19.213 1.00 32.05 ? 133 HOH T O     1 
HETATM 3367 O  O     . HOH O 10 .   ? -9.876  -15.703 -32.689 1.00 33.04 ? 134 HOH T O     1 
HETATM 3368 O  O     . HOH O 10 .   ? -8.379  7.140   -20.342 1.00 28.34 ? 135 HOH T O     1 
HETATM 3369 O  O     . HOH P 10 .   ? -2.693  4.955   -14.726 1.00 7.29  ? 201 HOH P O     1 
HETATM 3370 O  O     . HOH P 10 .   ? 9.102   3.083   -15.778 1.00 12.12 ? 202 HOH P O     1 
HETATM 3371 O  O     . HOH P 10 .   ? 7.559   5.301   -9.481  1.00 9.96  ? 203 HOH P O     1 
HETATM 3372 O  O     . HOH P 10 .   ? 4.056   0.763   -16.594 1.00 12.18 ? 204 HOH P O     1 
HETATM 3373 O  O     . HOH P 10 .   ? 7.935   2.681   -23.153 1.00 17.70 ? 205 HOH P O     1 
HETATM 3374 O  O     . HOH P 10 .   ? 5.568   2.722   -15.682 1.00 15.71 ? 206 HOH P O     1 
HETATM 3375 O  O     . HOH P 10 .   ? 5.208   0.429   -11.807 1.00 11.59 ? 207 HOH P O     1 
HETATM 3376 O  O     . HOH P 10 .   ? 4.745   2.636   -8.303  1.00 13.92 ? 208 HOH P O     1 
HETATM 3377 O  O     . HOH P 10 .   ? 4.629   11.842  -21.573 1.00 15.50 ? 209 HOH P O     1 
HETATM 3378 O  O     . HOH P 10 .   ? 2.140   9.665   -16.537 1.00 19.36 ? 210 HOH P O     1 
HETATM 3379 O  O     . HOH P 10 .   ? 0.484   3.293   -23.187 1.00 22.61 ? 211 HOH P O     1 
HETATM 3380 O  O     . HOH P 10 .   ? 2.599   0.734   -20.652 1.00 20.87 ? 212 HOH P O     1 
HETATM 3381 O  O     . HOH P 10 .   ? 8.016   2.657   -13.222 1.00 24.95 ? 213 HOH P O     1 
HETATM 3382 O  O     . HOH P 10 .   ? 3.919   -0.714  -18.754 1.00 23.02 ? 214 HOH P O     1 
HETATM 3383 O  O     . HOH P 10 .   ? 5.180   4.564   -24.719 1.00 20.43 ? 215 HOH P O     1 
HETATM 3384 O  O     . HOH P 10 .   ? -1.080  4.699   -25.345 1.00 31.08 ? 216 HOH P O     1 
HETATM 3385 O  O     . HOH P 10 .   ? 3.064   4.070   -23.231 1.00 23.81 ? 217 HOH P O     1 
HETATM 3386 O  O     . HOH P 10 .   ? 5.942   -0.908  -9.092  1.00 21.35 ? 218 HOH P O     1 
HETATM 3387 O  O     . HOH P 10 .   ? 9.356   1.564   -17.597 1.00 28.90 ? 219 HOH P O     1 
HETATM 3388 O  O     . HOH P 10 .   ? 3.843   1.834   -22.308 1.00 26.13 ? 220 HOH P O     1 
HETATM 3389 O  O     . HOH P 10 .   ? 5.499   5.506   -29.188 1.00 31.62 ? 221 HOH P O     1 
HETATM 3390 O  O     . HOH Q 10 .   ? 6.202   -23.068 -30.142 1.00 23.29 ? 101 HOH D O     1 
HETATM 3391 O  O     . HOH Q 10 .   ? 2.142   -19.304 -23.337 1.00 16.94 ? 102 HOH D O     1 
HETATM 3392 O  O     . HOH Q 10 .   ? 3.826   -25.722 -30.023 1.00 23.05 ? 103 HOH D O     1 
HETATM 3393 O  O     . HOH Q 10 .   ? -1.724  -19.705 -25.307 1.00 21.81 ? 104 HOH D O     1 
HETATM 3394 O  O     . HOH Q 10 .   ? -6.315  -22.518 -27.744 1.00 23.96 ? 105 HOH D O     1 
HETATM 3395 O  O     . HOH Q 10 .   ? -4.032  -21.530 -28.644 1.00 20.55 ? 106 HOH D O     1 
HETATM 3396 O  O     . HOH Q 10 .   ? 14.648  -18.614 -30.633 1.00 28.16 ? 107 HOH D O     1 
HETATM 3397 O  O     . HOH Q 10 .   ? 2.441   -26.849 -27.873 1.00 24.18 ? 108 HOH D O     1 
HETATM 3398 O  O     . HOH Q 10 .   ? 11.197  -19.577 -29.386 1.00 27.22 ? 109 HOH D O     1 
HETATM 3399 O  O     . HOH Q 10 .   ? 2.455   -26.475 -20.714 1.00 22.82 ? 110 HOH D O     1 
HETATM 3400 O  O     . HOH Q 10 .   ? 13.288  -21.445 -27.047 1.00 24.79 ? 111 HOH D O     1 
HETATM 3401 O  O     . HOH Q 10 .   ? 7.807   -18.882 -31.893 1.00 33.52 ? 112 HOH D O     1 
HETATM 3402 O  O     . HOH Q 10 .   ? 0.670   -28.381 -22.053 1.00 46.05 ? 113 HOH D O     1 
HETATM 3403 O  O     A HOH Q 10 .   ? 10.184  -14.525 -30.326 0.75 22.90 ? 114 HOH D O     1 
HETATM 3404 O  O     . HOH Q 10 .   ? 6.402   -27.236 -20.457 1.00 26.53 ? 115 HOH D O     1 
HETATM 3405 O  O     A HOH Q 10 .   ? 12.320  -15.268 -29.978 0.75 18.81 ? 116 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   127 ?   ?   ?   A . n 
A 1 2   SER 2   128 ?   ?   ?   A . n 
A 1 3   ALA 3   129 ?   ?   ?   A . n 
A 1 4   ALA 4   130 ?   ?   ?   A . n 
A 1 5   ALA 5   131 ?   ?   ?   A . n 
A 1 6   PRO 6   132 ?   ?   ?   A . n 
A 1 7   LEU 7   133 ?   ?   ?   A . n 
A 1 8   SER 8   134 ?   ?   ?   A . n 
A 1 9   PRO 9   135 ?   ?   ?   A . n 
A 1 10  ALA 10  136 ?   ?   ?   A . n 
A 1 11  TRP 11  137 ?   ?   ?   A . n 
A 1 12  MET 12  138 138 MET MET A . n 
A 1 13  PRO 13  139 139 PRO PRO A . n 
A 1 14  ALA 14  140 140 ALA ALA A . n 
A 1 15  TYR 15  141 141 TYR TYR A . n 
A 1 16  ALA 16  142 142 ALA ALA A . n 
A 1 17  CYS 17  143 143 CYS CYS A . n 
A 1 18  GLN 18  144 144 GLN GLN A . n 
A 1 19  ARG 19  145 145 ARG ARG A . n 
A 1 20  PRO 20  146 146 PRO PRO A . n 
A 1 21  THR 21  147 147 THR THR A . n 
A 1 22  PRO 22  148 148 PRO PRO A . n 
A 1 23  LEU 23  149 149 LEU LEU A . n 
A 1 24  THR 24  150 150 THR THR A . n 
A 1 25  HIS 25  151 151 HIS HIS A . n 
A 1 26  HIS 26  152 152 HIS HIS A . n 
A 1 27  ASN 27  153 153 ASN ASN A . n 
A 1 28  THR 28  154 154 THR THR A . n 
A 1 29  GLY 29  155 155 GLY GLY A . n 
A 1 30  LEU 30  156 156 LEU LEU A . n 
A 1 31  SER 31  157 157 SER SER A . n 
A 1 32  GLU 32  158 158 GLU GLU A . n 
A 1 33  ALA 33  159 159 ALA ALA A . n 
A 1 34  LEU 34  160 160 LEU LEU A . n 
A 1 35  GLU 35  161 161 GLU GLU A . n 
A 1 36  ILE 36  162 162 ILE ILE A . n 
A 1 37  LEU 37  163 163 LEU LEU A . n 
A 1 38  ALA 38  164 164 ALA ALA A . n 
A 1 39  GLU 39  165 165 GLU GLU A . n 
A 1 40  ALA 40  166 166 ALA ALA A . n 
A 1 41  ALA 41  167 167 ALA ALA A . n 
A 1 42  GLY 42  168 168 GLY GLY A . n 
A 1 43  PHE 43  169 169 PHE PHE A . n 
A 1 44  GLU 44  170 170 GLU GLU A . n 
A 1 45  GLY 45  171 171 GLY GLY A . n 
A 1 46  SER 46  172 172 SER SER A . n 
A 1 47  GLU 47  173 173 GLU GLU A . n 
A 1 48  GLY 48  174 174 GLY GLY A . n 
A 1 49  ARG 49  175 175 ARG ARG A . n 
A 1 50  LEU 50  176 176 LEU LEU A . n 
A 1 51  LEU 51  177 177 LEU LEU A . n 
A 1 52  THR 52  178 178 THR THR A . n 
A 1 53  PHE 53  179 179 PHE PHE A . n 
A 1 54  CYS 54  180 180 CYS CYS A . n 
A 1 55  ARG 55  181 181 ARG ARG A . n 
A 1 56  ALA 56  182 182 ALA ALA A . n 
A 1 57  ALA 57  183 183 ALA ALA A . n 
A 1 58  SER 58  184 184 SER SER A . n 
A 1 59  VAL 59  185 185 VAL VAL A . n 
A 1 60  LEU 60  186 186 LEU LEU A . n 
A 1 61  LYS 61  187 187 LYS LYS A . n 
A 1 62  ALA 62  188 188 ALA ALA A . n 
A 1 63  LEU 63  189 189 LEU LEU A . n 
A 1 64  PRO 64  190 190 PRO PRO A . n 
A 1 65  SER 65  191 191 SER SER A . n 
A 1 66  PRO 66  192 192 PRO PRO A . n 
A 1 67  VAL 67  193 193 VAL VAL A . n 
A 1 68  THR 68  194 194 THR THR A . n 
A 1 69  THR 69  195 195 THR THR A . n 
A 1 70  LEU 70  196 196 LEU LEU A . n 
A 1 71  SER 71  197 197 SER SER A . n 
A 1 72  GLN 72  198 198 GLN GLN A . n 
A 1 73  LEU 73  199 199 LEU LEU A . n 
A 1 74  GLN 74  200 200 GLN GLN A . n 
A 1 75  GLY 75  201 201 GLY GLY A . n 
A 1 76  LEU 76  202 202 LEU LEU A . n 
A 1 77  PRO 77  203 203 PRO PRO A . n 
A 1 78  HIS 78  204 204 HIS HIS A . n 
A 1 79  PHE 79  205 205 PHE PHE A . n 
A 1 80  GLY 80  206 206 GLY GLY A . n 
A 1 81  GLU 81  207 207 GLU GLU A . n 
A 1 82  HIS 82  208 208 HIS HIS A . n 
A 1 83  SER 83  209 209 SER SER A . n 
A 1 84  SER 84  210 210 SER SER A . n 
A 1 85  ARG 85  211 211 ARG ARG A . n 
A 1 86  VAL 86  212 212 VAL VAL A . n 
A 1 87  VAL 87  213 213 VAL VAL A . n 
A 1 88  GLN 88  214 214 GLN GLN A . n 
A 1 89  GLU 89  215 215 GLU GLU A . n 
A 1 90  LEU 90  216 216 LEU LEU A . n 
A 1 91  LEU 91  217 217 LEU LEU A . n 
A 1 92  GLU 92  218 218 GLU GLU A . n 
A 1 93  HIS 93  219 219 HIS HIS A . n 
A 1 94  GLY 94  220 220 GLY GLY A . n 
A 1 95  VAL 95  221 221 VAL VAL A . n 
A 1 96  CYS 96  222 222 CYS CYS A . n 
A 1 97  GLU 97  223 223 GLU GLU A . n 
A 1 98  GLU 98  224 224 GLU GLU A . n 
A 1 99  VAL 99  225 225 VAL VAL A . n 
A 1 100 GLU 100 226 226 GLU GLU A . n 
A 1 101 ARG 101 227 227 ARG ARG A . n 
A 1 102 VAL 102 228 228 VAL VAL A . n 
A 1 103 ARG 103 229 229 ARG ARG A . n 
A 1 104 ARG 104 230 230 ARG ARG A . n 
A 1 105 SER 105 231 231 SER SER A . n 
A 1 106 GLU 106 232 232 GLU GLU A . n 
A 1 107 ARG 107 233 233 ARG ARG A . n 
A 1 108 TYR 108 234 234 TYR TYR A . n 
A 1 109 GLN 109 235 235 GLN GLN A . n 
A 1 110 THR 110 236 236 THR THR A . n 
A 1 111 MET 111 237 237 MET MET A . n 
A 1 112 LYS 112 238 238 LYS LYS A . n 
A 1 113 LEU 113 239 239 LEU LEU A . n 
A 1 114 PHE 114 240 240 PHE PHE A . n 
A 1 115 THR 115 241 241 THR THR A . n 
A 1 116 GLN 116 242 242 GLN GLN A . n 
A 1 117 ILE 117 243 243 ILE ILE A . n 
A 1 118 PHE 118 244 244 PHE PHE A . n 
A 1 119 GLY 119 245 245 GLY GLY A . n 
A 1 120 VAL 120 246 246 VAL VAL A . n 
A 1 121 GLY 121 247 247 GLY GLY A . n 
A 1 122 VAL 122 248 248 VAL VAL A . n 
A 1 123 LYS 123 249 249 LYS LYS A . n 
A 1 124 THR 124 250 250 THR THR A . n 
A 1 125 ALA 125 251 251 ALA ALA A . n 
A 1 126 ASP 126 252 252 ASP ASP A . n 
A 1 127 ARG 127 253 253 ARG ARG A . n 
A 1 128 TRP 128 254 254 TRP TRP A . n 
A 1 129 TYR 129 255 255 TYR TYR A . n 
A 1 130 ARG 130 256 256 ARG ARG A . n 
A 1 131 GLU 131 257 257 GLU GLU A . n 
A 1 132 GLY 132 258 258 GLY GLY A . n 
A 1 133 LEU 133 259 259 LEU LEU A . n 
A 1 134 ARG 134 260 260 ARG ARG A . n 
A 1 135 THR 135 261 261 THR THR A . n 
A 1 136 LEU 136 262 262 LEU LEU A . n 
A 1 137 ASP 137 263 263 ASP ASP A . n 
A 1 138 ASP 138 264 264 ASP ASP A . n 
A 1 139 LEU 139 265 265 LEU LEU A . n 
A 1 140 ARG 140 266 266 ARG ARG A . n 
A 1 141 GLU 141 267 267 GLU GLU A . n 
A 1 142 GLN 142 268 268 GLN GLN A . n 
A 1 143 PRO 143 269 269 PRO PRO A . n 
A 1 144 GLN 144 270 270 GLN GLN A . n 
A 1 145 LYS 145 271 271 LYS LYS A . n 
A 1 146 LEU 146 272 272 LEU LEU A . n 
A 1 147 THR 147 273 273 THR THR A . n 
A 1 148 GLN 148 274 274 GLN GLN A . n 
A 1 149 GLN 149 275 275 GLN GLN A . n 
A 1 150 GLN 150 276 276 GLN GLN A . n 
A 1 151 LYS 151 277 277 LYS LYS A . n 
A 1 152 ALA 152 278 278 ALA ALA A . n 
A 1 153 GLY 153 279 279 GLY GLY A . n 
A 1 154 LEU 154 280 280 LEU LEU A . n 
A 1 155 GLN 155 281 281 GLN GLN A . n 
A 1 156 HIS 156 282 282 HIS HIS A . n 
A 1 157 HIS 157 283 283 HIS HIS A . n 
A 1 158 GLN 158 284 284 GLN GLN A . n 
A 1 159 ASP 159 285 285 ASP ASP A . n 
A 1 160 LEU 160 286 286 LEU LEU A . n 
A 1 161 SER 161 287 287 SER SER A . n 
A 1 162 THR 162 288 288 THR THR A . n 
A 1 163 PRO 163 289 289 PRO PRO A . n 
A 1 164 VAL 164 290 290 VAL VAL A . n 
A 1 165 LEU 165 291 291 LEU LEU A . n 
A 1 166 ARG 166 292 292 ARG ARG A . n 
A 1 167 SER 167 293 293 SER SER A . n 
A 1 168 ASP 168 294 294 ASP ASP A . n 
A 1 169 VAL 169 295 295 VAL VAL A . n 
A 1 170 ASP 170 296 296 ASP ASP A . n 
A 1 171 ALA 171 297 297 ALA ALA A . n 
A 1 172 LEU 172 298 298 LEU LEU A . n 
A 1 173 GLN 173 299 299 GLN GLN A . n 
A 1 174 GLN 174 300 300 GLN GLN A . n 
A 1 175 VAL 175 301 301 VAL VAL A . n 
A 1 176 VAL 176 302 302 VAL VAL A . n 
A 1 177 GLU 177 303 303 GLU GLU A . n 
A 1 178 GLU 178 304 304 GLU GLU A . n 
A 1 179 ALA 179 305 305 ALA ALA A . n 
A 1 180 VAL 180 306 306 VAL VAL A . n 
A 1 181 GLY 181 307 307 GLY GLY A . n 
A 1 182 GLN 182 308 308 GLN GLN A . n 
A 1 183 ALA 183 309 309 ALA ALA A . n 
A 1 184 LEU 184 310 310 LEU LEU A . n 
A 1 185 PRO 185 311 311 PRO PRO A . n 
A 1 186 GLY 186 312 312 GLY GLY A . n 
A 1 187 ALA 187 313 313 ALA ALA A . n 
A 1 188 THR 188 314 314 THR THR A . n 
A 1 189 VAL 189 315 315 VAL VAL A . n 
A 1 190 THR 190 316 316 THR THR A . n 
A 1 191 LEU 191 317 317 LEU LEU A . n 
A 1 192 THR 192 318 318 THR THR A . n 
A 1 193 GLY 193 319 319 GLY GLY A . n 
A 1 194 GLY 194 320 320 GLY GLY A . n 
A 1 195 PHE 195 321 321 PHE PHE A . n 
A 1 196 ARG 196 322 322 ARG ARG A . n 
A 1 197 ARG 197 323 323 ARG ARG A . n 
A 1 198 GLY 198 324 324 GLY GLY A . n 
A 1 199 LYS 199 325 325 LYS LYS A . n 
A 1 200 LEU 200 326 326 LEU LEU A . n 
A 1 201 GLN 201 327 327 GLN GLN A . n 
A 1 202 GLY 202 328 328 GLY GLY A . n 
A 1 203 HIS 203 329 329 HIS HIS A . n 
A 1 204 ASP 204 330 330 ASP ASP A . n 
A 1 205 VAL 205 331 331 VAL VAL A . n 
A 1 206 ASP 206 332 332 ASP ASP A . n 
A 1 207 PHE 207 333 333 PHE PHE A . n 
A 1 208 LEU 208 334 334 LEU LEU A . n 
A 1 209 ILE 209 335 335 ILE ILE A . n 
A 1 210 THR 210 336 336 THR THR A . n 
A 1 211 HIS 211 337 337 HIS HIS A . n 
A 1 212 PRO 212 338 338 PRO PRO A . n 
A 1 213 LYS 213 339 339 LYS LYS A . n 
A 1 214 GLU 214 340 340 GLU GLU A . n 
A 1 215 GLY 215 341 341 GLY GLY A . n 
A 1 216 GLN 216 342 342 GLN GLN A . n 
A 1 217 GLU 217 343 343 GLU GLU A . n 
A 1 218 ALA 218 344 344 ALA ALA A . n 
A 1 219 GLY 219 345 345 GLY GLY A . n 
A 1 220 LEU 220 346 346 LEU LEU A . n 
A 1 221 LEU 221 347 347 LEU LEU A . n 
A 1 222 PRO 222 348 348 PRO PRO A . n 
A 1 223 ARG 223 349 349 ARG ARG A . n 
A 1 224 VAL 224 350 350 VAL VAL A . n 
A 1 225 MET 225 351 351 MET MET A . n 
A 1 226 CYS 226 352 352 CYS CYS A . n 
A 1 227 ARG 227 353 353 ARG ARG A . n 
A 1 228 LEU 228 354 354 LEU LEU A . n 
A 1 229 GLN 229 355 355 GLN GLN A . n 
A 1 230 ASP 230 356 356 ASP ASP A . n 
A 1 231 GLN 231 357 357 GLN GLN A . n 
A 1 232 GLY 232 358 358 GLY GLY A . n 
A 1 233 LEU 233 359 359 LEU LEU A . n 
A 1 234 ILE 234 360 360 ILE ILE A . n 
A 1 235 LEU 235 361 361 LEU LEU A . n 
A 1 236 TYR 236 362 362 TYR TYR A . n 
A 1 237 HIS 237 363 363 HIS HIS A . n 
A 1 238 GLN 238 364 364 GLN GLN A . n 
A 1 239 HIS 239 365 ?   ?   ?   A . n 
A 1 240 GLN 240 366 ?   ?   ?   A . n 
A 1 241 HIS 241 367 ?   ?   ?   A . n 
A 1 242 SER 242 368 ?   ?   ?   A . n 
A 1 243 CYS 243 369 ?   ?   ?   A . n 
A 1 244 CYS 244 370 ?   ?   ?   A . n 
A 1 245 GLU 245 371 ?   ?   ?   A . n 
A 1 246 SER 246 372 ?   ?   ?   A . n 
A 1 247 PRO 247 373 ?   ?   ?   A . n 
A 1 248 THR 248 374 ?   ?   ?   A . n 
A 1 249 ARG 249 375 ?   ?   ?   A . n 
A 1 250 LEU 250 376 ?   ?   ?   A . n 
A 1 251 ALA 251 377 ?   ?   ?   A . n 
A 1 252 GLN 252 378 ?   ?   ?   A . n 
A 1 253 GLN 253 379 ?   ?   ?   A . n 
A 1 254 SER 254 380 ?   ?   ?   A . n 
A 1 255 HIS 255 381 ?   ?   ?   A . n 
A 1 256 MET 256 382 ?   ?   ?   A . n 
A 1 257 ASP 257 383 ?   ?   ?   A . n 
A 1 258 ALA 258 384 ?   ?   ?   A . n 
A 1 259 PHE 259 385 385 PHE PHE A . n 
A 1 260 GLU 260 386 386 GLU GLU A . n 
A 1 261 ARG 261 387 387 ARG ARG A . n 
A 1 262 SER 262 388 388 SER SER A . n 
A 1 263 PHE 263 389 389 PHE PHE A . n 
A 1 264 CYS 264 390 390 CYS CYS A . n 
A 1 265 ILE 265 391 391 ILE ILE A . n 
A 1 266 PHE 266 392 392 PHE PHE A . n 
A 1 267 ARG 267 393 393 ARG ARG A . n 
A 1 268 LEU 268 394 394 LEU LEU A . n 
A 1 269 PRO 269 395 395 PRO PRO A . n 
A 1 270 GLN 270 396 396 GLN GLN A . n 
A 1 271 PRO 271 397 397 PRO PRO A . n 
A 1 272 GLY 272 410 410 GLY GLY A . n 
A 1 273 SER 273 411 411 SER SER A . n 
A 1 274 TRP 274 412 412 TRP TRP A . n 
A 1 275 LYS 275 413 413 LYS LYS A . n 
A 1 276 ALA 276 414 414 ALA ALA A . n 
A 1 277 VAL 277 415 415 VAL VAL A . n 
A 1 278 ARG 278 416 416 ARG ARG A . n 
A 1 279 VAL 279 417 417 VAL VAL A . n 
A 1 280 ASP 280 418 418 ASP ASP A . n 
A 1 281 LEU 281 419 419 LEU LEU A . n 
A 1 282 VAL 282 420 420 VAL VAL A . n 
A 1 283 VAL 283 421 421 VAL VAL A . n 
A 1 284 ALA 284 422 422 ALA ALA A . n 
A 1 285 PRO 285 423 423 PRO PRO A . n 
A 1 286 VAL 286 424 424 VAL VAL A . n 
A 1 287 SER 287 425 425 SER SER A . n 
A 1 288 GLN 288 426 426 GLN GLN A . n 
A 1 289 PHE 289 427 427 PHE PHE A . n 
A 1 290 PRO 290 428 428 PRO PRO A . n 
A 1 291 PHE 291 429 429 PHE PHE A . n 
A 1 292 ALA 292 430 430 ALA ALA A . n 
A 1 293 LEU 293 431 431 LEU LEU A . n 
A 1 294 LEU 294 432 432 LEU LEU A . n 
A 1 295 GLY 295 433 433 GLY GLY A . n 
A 1 296 TRP 296 434 434 TRP TRP A . n 
A 1 297 THR 297 435 435 THR THR A . n 
A 1 298 GLY 298 436 436 GLY GLY A . n 
A 1 299 SER 299 437 437 SER SER A . n 
A 1 300 LYS 300 438 438 LYS LYS A . n 
A 1 301 LEU 301 439 439 LEU LEU A . n 
A 1 302 PHE 302 440 440 PHE PHE A . n 
A 1 303 GLN 303 441 441 GLN GLN A . n 
A 1 304 ARG 304 442 442 ARG ARG A . n 
A 1 305 GLU 305 443 443 GLU GLU A . n 
A 1 306 LEU 306 444 444 LEU LEU A . n 
A 1 307 ARG 307 445 445 ARG ARG A . n 
A 1 308 ARG 308 446 446 ARG ARG A . n 
A 1 309 PHE 309 447 447 PHE PHE A . n 
A 1 310 SER 310 448 448 SER SER A . n 
A 1 311 ARG 311 449 449 ARG ARG A . n 
A 1 312 LYS 312 450 450 LYS LYS A . n 
A 1 313 GLU 313 451 451 GLU GLU A . n 
A 1 314 LYS 314 452 452 LYS LYS A . n 
A 1 315 GLY 315 453 453 GLY GLY A . n 
A 1 316 LEU 316 454 454 LEU LEU A . n 
A 1 317 TRP 317 455 455 TRP TRP A . n 
A 1 318 LEU 318 456 456 LEU LEU A . n 
A 1 319 ASN 319 457 457 ASN ASN A . n 
A 1 320 SER 320 458 458 SER SER A . n 
A 1 321 HIS 321 459 459 HIS HIS A . n 
A 1 322 GLY 322 460 460 GLY GLY A . n 
A 1 323 LEU 323 461 461 LEU LEU A . n 
A 1 324 PHE 324 462 462 PHE PHE A . n 
A 1 325 ASP 325 463 463 ASP ASP A . n 
A 1 326 PRO 326 464 464 PRO PRO A . n 
A 1 327 GLU 327 465 465 GLU GLU A . n 
A 1 328 GLN 328 466 466 GLN GLN A . n 
A 1 329 LYS 329 467 467 LYS LYS A . n 
A 1 330 THR 330 468 468 THR THR A . n 
A 1 331 PHE 331 469 469 PHE PHE A . n 
A 1 332 PHE 332 470 470 PHE PHE A . n 
A 1 333 GLN 333 471 471 GLN GLN A . n 
A 1 334 ALA 334 472 472 ALA ALA A . n 
A 1 335 ALA 335 473 473 ALA ALA A . n 
A 1 336 SER 336 474 474 SER SER A . n 
A 1 337 GLU 337 475 475 GLU GLU A . n 
A 1 338 GLU 338 476 476 GLU GLU A . n 
A 1 339 ASP 339 477 477 ASP ASP A . n 
A 1 340 ILE 340 478 478 ILE ILE A . n 
A 1 341 PHE 341 479 479 PHE PHE A . n 
A 1 342 ARG 342 480 480 ARG ARG A . n 
A 1 343 HIS 343 481 481 HIS HIS A . n 
A 1 344 LEU 344 482 482 LEU LEU A . n 
A 1 345 GLY 345 483 483 GLY GLY A . n 
A 1 346 LEU 346 484 484 LEU LEU A . n 
A 1 347 GLU 347 485 485 GLU GLU A . n 
A 1 348 TYR 348 486 486 TYR TYR A . n 
A 1 349 LEU 349 487 487 LEU LEU A . n 
A 1 350 PRO 350 488 488 PRO PRO A . n 
A 1 351 PRO 351 489 489 PRO PRO A . n 
A 1 352 GLU 352 490 490 GLU GLU A . n 
A 1 353 GLN 353 491 491 GLN GLN A . n 
A 1 354 ARG 354 492 492 ARG ARG A . n 
A 1 355 ASN 355 493 493 ASN ASN A . n 
A 1 356 ALA 356 494 494 ALA ALA A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DG  2   2   2   DG  DG  T . n 
B 2 3   DG  3   3   3   DG  DG  T . n 
B 2 4   DC  4   4   4   DC  DC  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DA  7   7   7   DA  DA  T . n 
B 2 8   DC  8   8   8   DC  DC  T . n 
B 2 9   DG  9   9   9   DG  DG  T . n 
C 3 1   DC  1   1   1   DC  DC  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DT  3   3   3   DT  DT  P . n 
C 3 4   DA  4   4   4   DA  DA  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
D 4 1   DG  1   1   1   DG  DG  D . n 
D 4 2   DC  2   2   2   DC  DC  D . n 
D 4 3   DC  3   3   3   DC  DC  D . n 
D 4 4   DG  4   4   4   DG  DG  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5  MG  1   501 2   MG  MG  A . 
F 5  MG  1   502 4   MG  MG  A . 
G 6  PPV 1   503 600 PPV PPV A . 
H 7  EDO 1   504 2   EDO EDO A . 
I 8  MN  1   505 1   MN  MN  A . 
J 5  MG  1   506 1   MG  MG  A . 
K 7  EDO 1   507 1   EDO EDO A . 
L 9  EPE 1   508 1   EPE EPE A . 
M 7  EDO 1   101 1   EDO EDO P . 
N 10 HOH 1   601 1   HOH HOH A . 
N 10 HOH 2   602 2   HOH HOH A . 
N 10 HOH 3   603 3   HOH HOH A . 
N 10 HOH 4   604 4   HOH HOH A . 
N 10 HOH 5   605 5   HOH HOH A . 
N 10 HOH 6   606 6   HOH HOH A . 
N 10 HOH 7   607 7   HOH HOH A . 
N 10 HOH 8   608 8   HOH HOH A . 
N 10 HOH 9   609 9   HOH HOH A . 
N 10 HOH 10  610 10  HOH HOH A . 
N 10 HOH 11  611 11  HOH HOH A . 
N 10 HOH 12  612 13  HOH HOH A . 
N 10 HOH 13  613 14  HOH HOH A . 
N 10 HOH 14  614 15  HOH HOH A . 
N 10 HOH 15  615 17  HOH HOH A . 
N 10 HOH 16  616 18  HOH HOH A . 
N 10 HOH 17  617 19  HOH HOH A . 
N 10 HOH 18  618 20  HOH HOH A . 
N 10 HOH 19  619 21  HOH HOH A . 
N 10 HOH 20  620 22  HOH HOH A . 
N 10 HOH 21  621 24  HOH HOH A . 
N 10 HOH 22  622 25  HOH HOH A . 
N 10 HOH 23  623 26  HOH HOH A . 
N 10 HOH 24  624 27  HOH HOH A . 
N 10 HOH 25  625 28  HOH HOH A . 
N 10 HOH 26  626 29  HOH HOH A . 
N 10 HOH 27  627 31  HOH HOH A . 
N 10 HOH 28  628 32  HOH HOH A . 
N 10 HOH 29  629 33  HOH HOH A . 
N 10 HOH 30  630 35  HOH HOH A . 
N 10 HOH 31  631 36  HOH HOH A . 
N 10 HOH 32  632 37  HOH HOH A . 
N 10 HOH 33  633 39  HOH HOH A . 
N 10 HOH 34  634 40  HOH HOH A . 
N 10 HOH 35  635 41  HOH HOH A . 
N 10 HOH 36  636 42  HOH HOH A . 
N 10 HOH 37  637 43  HOH HOH A . 
N 10 HOH 38  638 45  HOH HOH A . 
N 10 HOH 39  639 46  HOH HOH A . 
N 10 HOH 40  640 47  HOH HOH A . 
N 10 HOH 41  641 49  HOH HOH A . 
N 10 HOH 42  642 50  HOH HOH A . 
N 10 HOH 43  643 51  HOH HOH A . 
N 10 HOH 44  644 53  HOH HOH A . 
N 10 HOH 45  645 54  HOH HOH A . 
N 10 HOH 46  646 55  HOH HOH A . 
N 10 HOH 47  647 57  HOH HOH A . 
N 10 HOH 48  648 59  HOH HOH A . 
N 10 HOH 49  649 61  HOH HOH A . 
N 10 HOH 50  650 63  HOH HOH A . 
N 10 HOH 51  651 64  HOH HOH A . 
N 10 HOH 52  652 66  HOH HOH A . 
N 10 HOH 53  653 67  HOH HOH A . 
N 10 HOH 54  654 68  HOH HOH A . 
N 10 HOH 55  655 69  HOH HOH A . 
N 10 HOH 56  656 70  HOH HOH A . 
N 10 HOH 57  657 71  HOH HOH A . 
N 10 HOH 58  658 72  HOH HOH A . 
N 10 HOH 59  659 73  HOH HOH A . 
N 10 HOH 60  660 75  HOH HOH A . 
N 10 HOH 61  661 77  HOH HOH A . 
N 10 HOH 62  662 78  HOH HOH A . 
N 10 HOH 63  663 79  HOH HOH A . 
N 10 HOH 64  664 80  HOH HOH A . 
N 10 HOH 65  665 82  HOH HOH A . 
N 10 HOH 66  666 85  HOH HOH A . 
N 10 HOH 67  667 86  HOH HOH A . 
N 10 HOH 68  668 88  HOH HOH A . 
N 10 HOH 69  669 89  HOH HOH A . 
N 10 HOH 70  670 90  HOH HOH A . 
N 10 HOH 71  671 91  HOH HOH A . 
N 10 HOH 72  672 93  HOH HOH A . 
N 10 HOH 73  673 94  HOH HOH A . 
N 10 HOH 74  674 95  HOH HOH A . 
N 10 HOH 75  675 96  HOH HOH A . 
N 10 HOH 76  676 97  HOH HOH A . 
N 10 HOH 77  677 98  HOH HOH A . 
N 10 HOH 78  678 99  HOH HOH A . 
N 10 HOH 79  679 102 HOH HOH A . 
N 10 HOH 80  680 103 HOH HOH A . 
N 10 HOH 81  681 104 HOH HOH A . 
N 10 HOH 82  682 106 HOH HOH A . 
N 10 HOH 83  683 107 HOH HOH A . 
N 10 HOH 84  684 108 HOH HOH A . 
N 10 HOH 85  685 109 HOH HOH A . 
N 10 HOH 86  686 110 HOH HOH A . 
N 10 HOH 87  687 111 HOH HOH A . 
N 10 HOH 88  688 112 HOH HOH A . 
N 10 HOH 89  689 113 HOH HOH A . 
N 10 HOH 90  690 114 HOH HOH A . 
N 10 HOH 91  691 116 HOH HOH A . 
N 10 HOH 92  692 119 HOH HOH A . 
N 10 HOH 93  693 120 HOH HOH A . 
N 10 HOH 94  694 121 HOH HOH A . 
N 10 HOH 95  695 123 HOH HOH A . 
N 10 HOH 96  696 124 HOH HOH A . 
N 10 HOH 97  697 125 HOH HOH A . 
N 10 HOH 98  698 127 HOH HOH A . 
N 10 HOH 99  699 128 HOH HOH A . 
N 10 HOH 100 700 129 HOH HOH A . 
N 10 HOH 101 701 130 HOH HOH A . 
N 10 HOH 102 702 131 HOH HOH A . 
N 10 HOH 103 703 132 HOH HOH A . 
N 10 HOH 104 704 133 HOH HOH A . 
N 10 HOH 105 705 134 HOH HOH A . 
N 10 HOH 106 706 135 HOH HOH A . 
N 10 HOH 107 707 137 HOH HOH A . 
N 10 HOH 108 708 139 HOH HOH A . 
N 10 HOH 109 709 140 HOH HOH A . 
N 10 HOH 110 710 141 HOH HOH A . 
N 10 HOH 111 711 142 HOH HOH A . 
N 10 HOH 112 712 143 HOH HOH A . 
N 10 HOH 113 713 144 HOH HOH A . 
N 10 HOH 114 714 145 HOH HOH A . 
N 10 HOH 115 715 146 HOH HOH A . 
N 10 HOH 116 716 147 HOH HOH A . 
N 10 HOH 117 717 149 HOH HOH A . 
N 10 HOH 118 718 151 HOH HOH A . 
N 10 HOH 119 719 152 HOH HOH A . 
N 10 HOH 120 720 153 HOH HOH A . 
N 10 HOH 121 721 158 HOH HOH A . 
N 10 HOH 122 722 159 HOH HOH A . 
N 10 HOH 123 723 160 HOH HOH A . 
N 10 HOH 124 724 162 HOH HOH A . 
N 10 HOH 125 725 163 HOH HOH A . 
N 10 HOH 126 726 164 HOH HOH A . 
N 10 HOH 127 727 165 HOH HOH A . 
N 10 HOH 128 728 167 HOH HOH A . 
N 10 HOH 129 729 170 HOH HOH A . 
N 10 HOH 130 730 171 HOH HOH A . 
N 10 HOH 131 731 172 HOH HOH A . 
N 10 HOH 132 732 173 HOH HOH A . 
N 10 HOH 133 733 174 HOH HOH A . 
N 10 HOH 134 734 175 HOH HOH A . 
N 10 HOH 135 735 176 HOH HOH A . 
N 10 HOH 136 736 178 HOH HOH A . 
N 10 HOH 137 737 179 HOH HOH A . 
N 10 HOH 138 738 180 HOH HOH A . 
N 10 HOH 139 739 182 HOH HOH A . 
N 10 HOH 140 740 183 HOH HOH A . 
N 10 HOH 141 741 184 HOH HOH A . 
N 10 HOH 142 742 185 HOH HOH A . 
N 10 HOH 143 743 186 HOH HOH A . 
N 10 HOH 144 744 187 HOH HOH A . 
N 10 HOH 145 745 188 HOH HOH A . 
N 10 HOH 146 746 189 HOH HOH A . 
N 10 HOH 147 747 190 HOH HOH A . 
N 10 HOH 148 748 191 HOH HOH A . 
N 10 HOH 149 749 192 HOH HOH A . 
N 10 HOH 150 750 196 HOH HOH A . 
N 10 HOH 151 751 197 HOH HOH A . 
N 10 HOH 152 752 198 HOH HOH A . 
N 10 HOH 153 753 199 HOH HOH A . 
N 10 HOH 154 754 200 HOH HOH A . 
N 10 HOH 155 755 203 HOH HOH A . 
N 10 HOH 156 756 206 HOH HOH A . 
N 10 HOH 157 757 207 HOH HOH A . 
N 10 HOH 158 758 208 HOH HOH A . 
N 10 HOH 159 759 211 HOH HOH A . 
N 10 HOH 160 760 212 HOH HOH A . 
N 10 HOH 161 761 213 HOH HOH A . 
N 10 HOH 162 762 214 HOH HOH A . 
N 10 HOH 163 763 215 HOH HOH A . 
N 10 HOH 164 764 216 HOH HOH A . 
N 10 HOH 165 765 217 HOH HOH A . 
N 10 HOH 166 766 219 HOH HOH A . 
N 10 HOH 167 767 220 HOH HOH A . 
N 10 HOH 168 768 221 HOH HOH A . 
N 10 HOH 169 769 222 HOH HOH A . 
N 10 HOH 170 770 223 HOH HOH A . 
N 10 HOH 171 771 224 HOH HOH A . 
N 10 HOH 172 772 225 HOH HOH A . 
N 10 HOH 173 773 226 HOH HOH A . 
N 10 HOH 174 774 227 HOH HOH A . 
N 10 HOH 175 775 230 HOH HOH A . 
N 10 HOH 176 776 231 HOH HOH A . 
N 10 HOH 177 777 232 HOH HOH A . 
N 10 HOH 178 778 233 HOH HOH A . 
N 10 HOH 179 779 235 HOH HOH A . 
N 10 HOH 180 780 236 HOH HOH A . 
N 10 HOH 181 781 237 HOH HOH A . 
N 10 HOH 182 782 239 HOH HOH A . 
N 10 HOH 183 783 240 HOH HOH A . 
N 10 HOH 184 784 241 HOH HOH A . 
N 10 HOH 185 785 242 HOH HOH A . 
N 10 HOH 186 786 243 HOH HOH A . 
N 10 HOH 187 787 245 HOH HOH A . 
N 10 HOH 188 788 246 HOH HOH A . 
N 10 HOH 189 789 247 HOH HOH A . 
N 10 HOH 190 790 248 HOH HOH A . 
N 10 HOH 191 791 249 HOH HOH A . 
N 10 HOH 192 792 250 HOH HOH A . 
N 10 HOH 193 793 251 HOH HOH A . 
N 10 HOH 194 794 252 HOH HOH A . 
N 10 HOH 195 795 255 HOH HOH A . 
N 10 HOH 196 796 256 HOH HOH A . 
N 10 HOH 197 797 257 HOH HOH A . 
N 10 HOH 198 798 258 HOH HOH A . 
N 10 HOH 199 799 259 HOH HOH A . 
N 10 HOH 200 800 260 HOH HOH A . 
N 10 HOH 201 801 261 HOH HOH A . 
N 10 HOH 202 802 262 HOH HOH A . 
N 10 HOH 203 803 263 HOH HOH A . 
N 10 HOH 204 804 265 HOH HOH A . 
N 10 HOH 205 805 269 HOH HOH A . 
N 10 HOH 206 806 270 HOH HOH A . 
N 10 HOH 207 807 272 HOH HOH A . 
N 10 HOH 208 808 274 HOH HOH A . 
N 10 HOH 209 809 275 HOH HOH A . 
N 10 HOH 210 810 278 HOH HOH A . 
N 10 HOH 211 811 279 HOH HOH A . 
N 10 HOH 212 812 280 HOH HOH A . 
N 10 HOH 213 813 281 HOH HOH A . 
N 10 HOH 214 814 284 HOH HOH A . 
N 10 HOH 215 815 286 HOH HOH A . 
N 10 HOH 216 816 287 HOH HOH A . 
N 10 HOH 217 817 288 HOH HOH A . 
N 10 HOH 218 818 289 HOH HOH A . 
N 10 HOH 219 819 290 HOH HOH A . 
N 10 HOH 220 820 291 HOH HOH A . 
N 10 HOH 221 821 292 HOH HOH A . 
N 10 HOH 222 822 293 HOH HOH A . 
N 10 HOH 223 823 294 HOH HOH A . 
N 10 HOH 224 824 296 HOH HOH A . 
N 10 HOH 225 825 299 HOH HOH A . 
N 10 HOH 226 826 300 HOH HOH A . 
N 10 HOH 227 827 302 HOH HOH A . 
N 10 HOH 228 828 305 HOH HOH A . 
N 10 HOH 229 829 307 HOH HOH A . 
N 10 HOH 230 830 308 HOH HOH A . 
N 10 HOH 231 831 309 HOH HOH A . 
N 10 HOH 232 832 310 HOH HOH A . 
N 10 HOH 233 833 311 HOH HOH A . 
N 10 HOH 234 834 313 HOH HOH A . 
N 10 HOH 235 835 315 HOH HOH A . 
N 10 HOH 236 836 316 HOH HOH A . 
N 10 HOH 237 837 317 HOH HOH A . 
N 10 HOH 238 838 319 HOH HOH A . 
N 10 HOH 239 839 321 HOH HOH A . 
N 10 HOH 240 840 322 HOH HOH A . 
N 10 HOH 241 841 325 HOH HOH A . 
N 10 HOH 242 842 327 HOH HOH A . 
N 10 HOH 243 843 328 HOH HOH A . 
N 10 HOH 244 844 330 HOH HOH A . 
N 10 HOH 245 845 331 HOH HOH A . 
N 10 HOH 246 846 332 HOH HOH A . 
N 10 HOH 247 847 333 HOH HOH A . 
N 10 HOH 248 848 339 HOH HOH A . 
N 10 HOH 249 849 340 HOH HOH A . 
N 10 HOH 250 850 341 HOH HOH A . 
N 10 HOH 251 851 342 HOH HOH A . 
N 10 HOH 252 852 344 HOH HOH A . 
N 10 HOH 253 853 345 HOH HOH A . 
N 10 HOH 254 854 346 HOH HOH A . 
N 10 HOH 255 855 347 HOH HOH A . 
N 10 HOH 256 856 348 HOH HOH A . 
N 10 HOH 257 857 349 HOH HOH A . 
N 10 HOH 258 858 350 HOH HOH A . 
N 10 HOH 259 859 351 HOH HOH A . 
N 10 HOH 260 860 352 HOH HOH A . 
N 10 HOH 261 861 353 HOH HOH A . 
N 10 HOH 262 862 354 HOH HOH A . 
N 10 HOH 263 863 355 HOH HOH A . 
N 10 HOH 264 864 358 HOH HOH A . 
N 10 HOH 265 865 359 HOH HOH A . 
N 10 HOH 266 866 360 HOH HOH A . 
N 10 HOH 267 867 362 HOH HOH A . 
N 10 HOH 268 868 363 HOH HOH A . 
N 10 HOH 269 869 365 HOH HOH A . 
N 10 HOH 270 870 366 HOH HOH A . 
N 10 HOH 271 871 369 HOH HOH A . 
N 10 HOH 272 872 370 HOH HOH A . 
N 10 HOH 273 873 371 HOH HOH A . 
N 10 HOH 274 874 374 HOH HOH A . 
N 10 HOH 275 875 375 HOH HOH A . 
N 10 HOH 276 876 376 HOH HOH A . 
N 10 HOH 277 877 377 HOH HOH A . 
N 10 HOH 278 878 378 HOH HOH A . 
N 10 HOH 279 879 379 HOH HOH A . 
N 10 HOH 280 880 384 HOH HOH A . 
N 10 HOH 281 881 385 HOH HOH A . 
N 10 HOH 282 882 386 HOH HOH A . 
N 10 HOH 283 883 387 HOH HOH A . 
N 10 HOH 284 884 388 HOH HOH A . 
N 10 HOH 285 885 389 HOH HOH A . 
N 10 HOH 286 886 390 HOH HOH A . 
N 10 HOH 287 887 397 HOH HOH A . 
N 10 HOH 288 888 398 HOH HOH A . 
N 10 HOH 289 889 401 HOH HOH A . 
N 10 HOH 290 890 402 HOH HOH A . 
N 10 HOH 291 891 404 HOH HOH A . 
N 10 HOH 292 892 405 HOH HOH A . 
N 10 HOH 293 893 406 HOH HOH A . 
N 10 HOH 294 894 409 HOH HOH A . 
N 10 HOH 295 895 410 HOH HOH A . 
N 10 HOH 296 896 411 HOH HOH A . 
N 10 HOH 297 897 414 HOH HOH A . 
N 10 HOH 298 898 415 HOH HOH A . 
N 10 HOH 299 899 417 HOH HOH A . 
N 10 HOH 300 900 418 HOH HOH A . 
N 10 HOH 301 901 419 HOH HOH A . 
N 10 HOH 302 902 420 HOH HOH A . 
N 10 HOH 303 903 421 HOH HOH A . 
N 10 HOH 304 904 422 HOH HOH A . 
N 10 HOH 305 905 423 HOH HOH A . 
N 10 HOH 306 906 424 HOH HOH A . 
N 10 HOH 307 907 425 HOH HOH A . 
N 10 HOH 308 908 426 HOH HOH A . 
N 10 HOH 309 909 430 HOH HOH A . 
N 10 HOH 310 910 431 HOH HOH A . 
N 10 HOH 311 911 432 HOH HOH A . 
N 10 HOH 312 912 433 HOH HOH A . 
N 10 HOH 313 913 434 HOH HOH A . 
N 10 HOH 314 914 436 HOH HOH A . 
N 10 HOH 315 915 437 HOH HOH A . 
N 10 HOH 316 916 438 HOH HOH A . 
N 10 HOH 317 917 440 HOH HOH A . 
N 10 HOH 318 918 441 HOH HOH A . 
N 10 HOH 319 919 442 HOH HOH A . 
N 10 HOH 320 920 443 HOH HOH A . 
N 10 HOH 321 921 444 HOH HOH A . 
N 10 HOH 322 922 445 HOH HOH A . 
N 10 HOH 323 923 446 HOH HOH A . 
N 10 HOH 324 924 447 HOH HOH A . 
N 10 HOH 325 925 448 HOH HOH A . 
N 10 HOH 326 926 449 HOH HOH A . 
O 10 HOH 1   101 16  HOH HOH T . 
O 10 HOH 2   102 23  HOH HOH T . 
O 10 HOH 3   103 52  HOH HOH T . 
O 10 HOH 4   104 65  HOH HOH T . 
O 10 HOH 5   105 101 HOH HOH T . 
O 10 HOH 6   106 115 HOH HOH T . 
O 10 HOH 7   107 117 HOH HOH T . 
O 10 HOH 8   108 118 HOH HOH T . 
O 10 HOH 9   109 122 HOH HOH T . 
O 10 HOH 10  110 126 HOH HOH T . 
O 10 HOH 11  111 136 HOH HOH T . 
O 10 HOH 12  112 150 HOH HOH T . 
O 10 HOH 13  113 155 HOH HOH T . 
O 10 HOH 14  114 156 HOH HOH T . 
O 10 HOH 15  115 166 HOH HOH T . 
O 10 HOH 16  116 193 HOH HOH T . 
O 10 HOH 17  117 194 HOH HOH T . 
O 10 HOH 18  118 195 HOH HOH T . 
O 10 HOH 19  119 201 HOH HOH T . 
O 10 HOH 20  120 202 HOH HOH T . 
O 10 HOH 21  121 238 HOH HOH T . 
O 10 HOH 22  122 244 HOH HOH T . 
O 10 HOH 23  123 266 HOH HOH T . 
O 10 HOH 24  124 267 HOH HOH T . 
O 10 HOH 25  125 283 HOH HOH T . 
O 10 HOH 26  126 285 HOH HOH T . 
O 10 HOH 27  127 298 HOH HOH T . 
O 10 HOH 28  128 301 HOH HOH T . 
O 10 HOH 29  129 303 HOH HOH T . 
O 10 HOH 30  130 323 HOH HOH T . 
O 10 HOH 31  131 357 HOH HOH T . 
O 10 HOH 32  132 392 HOH HOH T . 
O 10 HOH 33  133 394 HOH HOH T . 
O 10 HOH 34  134 395 HOH HOH T . 
O 10 HOH 35  135 400 HOH HOH T . 
P 10 HOH 1   201 12  HOH HOH P . 
P 10 HOH 2   202 34  HOH HOH P . 
P 10 HOH 3   203 38  HOH HOH P . 
P 10 HOH 4   204 48  HOH HOH P . 
P 10 HOH 5   205 56  HOH HOH P . 
P 10 HOH 6   206 58  HOH HOH P . 
P 10 HOH 7   207 60  HOH HOH P . 
P 10 HOH 8   208 92  HOH HOH P . 
P 10 HOH 9   209 138 HOH HOH P . 
P 10 HOH 10  210 161 HOH HOH P . 
P 10 HOH 11  211 177 HOH HOH P . 
P 10 HOH 12  212 204 HOH HOH P . 
P 10 HOH 13  213 209 HOH HOH P . 
P 10 HOH 14  214 218 HOH HOH P . 
P 10 HOH 15  215 228 HOH HOH P . 
P 10 HOH 16  216 268 HOH HOH P . 
P 10 HOH 17  217 276 HOH HOH P . 
P 10 HOH 18  218 320 HOH HOH P . 
P 10 HOH 19  219 334 HOH HOH P . 
P 10 HOH 20  220 343 HOH HOH P . 
P 10 HOH 21  221 408 HOH HOH P . 
Q 10 HOH 1   101 84  HOH HOH D . 
Q 10 HOH 2   102 148 HOH HOH D . 
Q 10 HOH 3   103 154 HOH HOH D . 
Q 10 HOH 4   104 168 HOH HOH D . 
Q 10 HOH 5   105 181 HOH HOH D . 
Q 10 HOH 6   106 253 HOH HOH D . 
Q 10 HOH 7   107 271 HOH HOH D . 
Q 10 HOH 8   108 282 HOH HOH D . 
Q 10 HOH 9   109 297 HOH HOH D . 
Q 10 HOH 10  110 304 HOH HOH D . 
Q 10 HOH 11  111 312 HOH HOH D . 
Q 10 HOH 12  112 314 HOH HOH D . 
Q 10 HOH 13  113 416 HOH HOH D . 
Q 10 HOH 14  114 435 HOH HOH D . 
Q 10 HOH 15  115 439 HOH HOH D . 
Q 10 HOH 16  116 450 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O22 ? G PPV .   ? A PPV 503 ? 1_555 MG ? J MG . ? A MG 506 ? 1_555 O11 ? G PPV .   ? A PPV 503 ? 1_555 86.2  ? 
2  O22 ? G PPV .   ? A PPV 503 ? 1_555 MG ? J MG . ? A MG 506 ? 1_555 O   ? N HOH .   ? A HOH 900 ? 1_555 72.8  ? 
3  O11 ? G PPV .   ? A PPV 503 ? 1_555 MG ? J MG . ? A MG 506 ? 1_555 O   ? N HOH .   ? A HOH 900 ? 1_555 90.1  ? 
4  O22 ? G PPV .   ? A PPV 503 ? 1_555 MG ? J MG . ? A MG 506 ? 1_555 O   ? N HOH .   ? A HOH 843 ? 1_555 96.5  ? 
5  O11 ? G PPV .   ? A PPV 503 ? 1_555 MG ? J MG . ? A MG 506 ? 1_555 O   ? N HOH .   ? A HOH 843 ? 1_555 89.5  ? 
6  O   ? N HOH .   ? A HOH 900 ? 1_555 MG ? J MG . ? A MG 506 ? 1_555 O   ? N HOH .   ? A HOH 843 ? 1_555 169.4 ? 
7  O22 ? G PPV .   ? A PPV 503 ? 1_555 MG ? J MG . ? A MG 506 ? 1_555 O   ? P HOH .   ? P HOH 218 ? 1_555 98.6  ? 
8  O11 ? G PPV .   ? A PPV 503 ? 1_555 MG ? J MG . ? A MG 506 ? 1_555 O   ? P HOH .   ? P HOH 218 ? 1_555 174.4 ? 
9  O   ? N HOH .   ? A HOH 900 ? 1_555 MG ? J MG . ? A MG 506 ? 1_555 O   ? P HOH .   ? P HOH 218 ? 1_555 93.9  ? 
10 O   ? N HOH .   ? A HOH 843 ? 1_555 MG ? J MG . ? A MG 506 ? 1_555 O   ? P HOH .   ? P HOH 218 ? 1_555 87.3  ? 
11 OD1 ? A ASP 206 ? A ASP 332 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OD1 B A ASP 204 ? A ASP 330 ? 1_555 105.8 ? 
12 OD1 ? A ASP 206 ? A ASP 332 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OD1 ? A ASP 280 ? A ASP 418 ? 1_555 100.0 ? 
13 OD1 B A ASP 204 ? A ASP 330 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OD1 ? A ASP 280 ? A ASP 418 ? 1_555 87.6  ? 
14 OD1 ? A ASP 206 ? A ASP 332 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OP1 ? C DT  5   ? P DT  5   ? 1_555 99.0  ? 
15 OD1 B A ASP 204 ? A ASP 330 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OP1 ? C DT  5   ? P DT  5   ? 1_555 120.7 ? 
16 OD1 ? A ASP 280 ? A ASP 418 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OP1 ? C DT  5   ? P DT  5   ? 1_555 139.6 ? 
17 OD1 ? A ASP 206 ? A ASP 332 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OD1 A A ASP 204 ? A ASP 330 ? 1_555 98.0  ? 
18 OD1 B A ASP 204 ? A ASP 330 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OD1 A A ASP 204 ? A ASP 330 ? 1_555 57.3  ? 
19 OD1 ? A ASP 280 ? A ASP 418 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OD1 A A ASP 204 ? A ASP 330 ? 1_555 143.9 ? 
20 OP1 ? C DT  5   ? P DT  5   ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OD1 A A ASP 204 ? A ASP 330 ? 1_555 66.6  ? 
21 OD1 ? A ASP 206 ? A ASP 332 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OD2 B A ASP 204 ? A ASP 330 ? 1_555 93.3  ? 
22 OD1 B A ASP 204 ? A ASP 330 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OD2 B A ASP 204 ? A ASP 330 ? 1_555 52.1  ? 
23 OD1 ? A ASP 280 ? A ASP 418 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OD2 B A ASP 204 ? A ASP 330 ? 1_555 139.6 ? 
24 OP1 ? C DT  5   ? P DT  5   ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OD2 B A ASP 204 ? A ASP 330 ? 1_555 73.9  ? 
25 OD1 A A ASP 204 ? A ASP 330 ? 1_555 MN ? I MN . ? A MN 505 ? 1_555 OD2 B A ASP 204 ? A ASP 330 ? 1_555 8.3   ? 
26 OD1 A A ASP 204 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? N HOH .   ? A HOH 601 ? 1_555 89.8  ? 
27 OD1 A A ASP 204 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O12 ? G PPV .   ? A PPV 503 ? 1_555 164.5 ? 
28 O   ? N HOH .   ? A HOH 601 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O12 ? G PPV .   ? A PPV 503 ? 1_555 91.8  ? 
29 OD1 A A ASP 204 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OD2 ? A ASP 206 ? A ASP 332 ? 1_555 98.0  ? 
30 O   ? N HOH .   ? A HOH 601 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OD2 ? A ASP 206 ? A ASP 332 ? 1_555 87.3  ? 
31 O12 ? G PPV .   ? A PPV 503 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OD2 ? A ASP 206 ? A ASP 332 ? 1_555 97.4  ? 
32 OD1 A A ASP 204 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OP1 ? C DT  5   ? P DT  5   ? 1_555 81.6  ? 
33 O   ? N HOH .   ? A HOH 601 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OP1 ? C DT  5   ? P DT  5   ? 1_555 171.4 ? 
34 O12 ? G PPV .   ? A PPV 503 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OP1 ? C DT  5   ? P DT  5   ? 1_555 96.5  ? 
35 OD2 ? A ASP 206 ? A ASP 332 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OP1 ? C DT  5   ? P DT  5   ? 1_555 93.3  ? 
36 OD1 A A ASP 204 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OD2 B A ASP 204 ? A ASP 330 ? 1_555 9.3   ? 
37 O   ? N HOH .   ? A HOH 601 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OD2 B A ASP 204 ? A ASP 330 ? 1_555 82.8  ? 
38 O12 ? G PPV .   ? A PPV 503 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OD2 B A ASP 204 ? A ASP 330 ? 1_555 169.2 ? 
39 OD2 ? A ASP 206 ? A ASP 332 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OD2 B A ASP 204 ? A ASP 330 ? 1_555 91.6  ? 
40 OP1 ? C DT  5   ? P DT  5   ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 OD2 B A ASP 204 ? A ASP 330 ? 1_555 88.7  ? 
41 OD1 A A ASP 204 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? N HOH .   ? A HOH 900 ? 1_555 84.4  ? 
42 O   ? N HOH .   ? A HOH 601 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? N HOH .   ? A HOH 900 ? 1_555 89.2  ? 
43 O12 ? G PPV .   ? A PPV 503 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? N HOH .   ? A HOH 900 ? 1_555 80.2  ? 
44 OD2 ? A ASP 206 ? A ASP 332 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? N HOH .   ? A HOH 900 ? 1_555 175.7 ? 
45 OP1 ? C DT  5   ? P DT  5   ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? N HOH .   ? A HOH 900 ? 1_555 90.5  ? 
46 OD2 B A ASP 204 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 501 ? 1_555 O   ? N HOH .   ? A HOH 900 ? 1_555 90.4  ? 
47 O   ? A VAL 120 ? A VAL 246 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O   ? A ILE 117 ? A ILE 243 ? 1_555 93.4  ? 
48 O   ? A VAL 120 ? A VAL 246 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O   ? P HOH .   ? P HOH 202 ? 1_555 89.2  ? 
49 O   ? A ILE 117 ? A ILE 243 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O   ? P HOH .   ? P HOH 202 ? 1_555 176.5 ? 
50 O   ? A VAL 120 ? A VAL 246 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O   ? A THR 115 ? A THR 241 ? 1_555 90.1  ? 
51 O   ? A ILE 117 ? A ILE 243 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O   ? A THR 115 ? A THR 241 ? 1_555 96.4  ? 
52 O   ? P HOH .   ? P HOH 202 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O   ? A THR 115 ? A THR 241 ? 1_555 85.9  ? 
53 O   ? A VAL 120 ? A VAL 246 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O   ? N HOH .   ? A HOH 737 ? 1_555 172.8 ? 
54 O   ? A ILE 117 ? A ILE 243 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O   ? N HOH .   ? A HOH 737 ? 1_555 89.8  ? 
55 O   ? P HOH .   ? P HOH 202 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O   ? N HOH .   ? A HOH 737 ? 1_555 87.9  ? 
56 O   ? A THR 115 ? A THR 241 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 O   ? N HOH .   ? A HOH 737 ? 1_555 83.1  ? 
57 O   ? A VAL 120 ? A VAL 246 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 91.6  ? 
58 O   ? A ILE 117 ? A ILE 243 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 92.1  ? 
59 O   ? P HOH .   ? P HOH 202 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 85.5  ? 
60 O   ? A THR 115 ? A THR 241 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 171.2 ? 
61 O   ? N HOH .   ? A HOH 737 ? 1_555 MG ? F MG . ? A MG 502 ? 1_555 OP1 ? C DT  3   ? P DT  3   ? 1_555 94.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-02-05 
2 'Structure model' 1 1 2014-03-05 
3 'Structure model' 1 2 2014-03-19 
4 'Structure model' 1 3 2017-11-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 4 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification'       
2 4 'Structure model' '_software.contact_author'       
3 4 'Structure model' '_software.contact_author_email' 
4 4 'Structure model' '_software.date'                 
5 4 'Structure model' '_software.language'             
6 4 'Structure model' '_software.location'             
7 4 'Structure model' '_software.name'                 
8 4 'Structure model' '_software.type'                 
9 4 'Structure model' '_software.version'              
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO           .        ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data reduction'  
http://www.hkl-xray.com/                  ?   ? 
2 SCALEPACK       .        ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                  ?   ? 
3 PHENIX          1.8_1069 ?                package 'Paul D. Adams'      PDAdams@lbl.gov          refinement        
http://www.phenix-online.org/             C++ ? 
4 PDB_EXTRACT     3.11     'April 22, 2011' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 
5 StructureStudio .        ?                ?       ?                    ?                        'data collection' ? ?   ? 
6 HKL-2000        .        ?                ?       ?                    ?                        'data reduction'  ? ?   ? 
7 PHASER          .        ?                ?       ?                    ?                        phasing           ? ?   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 A GLN 242 ? ? O A HOH 906 ? ? 2.02 
2 1 OE1 A GLN 327 ? ? O A HOH 901 ? ? 2.09 
3 1 O   A HOH 684 ? ? O A HOH 895 ? ? 2.13 
4 1 OG  A SER 172 ? ? O A HOH 837 ? ? 2.15 
5 1 O   A HOH 776 ? ? O A HOH 863 ? ? 2.17 
6 1 O   A HOH 839 ? ? O A HOH 889 ? ? 2.17 
7 1 ND1 A HIS 481 ? B O A HOH 776 ? ? 2.17 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            P 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OP3 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.491 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.116 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE    A ARG 393 ? ? CZ    A ARG 393 ? ? NH2   A ARG 393 ? ? 117.05 120.30 -3.25 0.50 N 
2  1 "O4'" T DG  2   ? ? "C1'" T DG  2   ? ? N9    T DG  2   ? ? 103.76 108.00 -4.24 0.70 N 
3  1 "O4'" T DC  4   ? ? "C1'" T DC  4   ? ? N1    T DC  4   ? ? 111.13 108.30 2.83  0.30 N 
4  1 "C1'" T DT  6   ? ? "O4'" T DT  6   ? ? "C4'" T DT  6   ? ? 102.91 110.10 -7.19 1.00 N 
5  1 "O4'" T DT  6   ? ? "C1'" T DT  6   ? ? N1    T DT  6   ? ? 113.05 108.30 4.75  0.30 N 
6  1 "O4'" T DG  9   ? ? "C1'" T DG  9   ? ? N9    T DG  9   ? ? 102.17 108.00 -5.83 0.70 N 
7  1 "O4'" P DC  1   ? ? "C4'" P DC  1   ? ? "C3'" P DC  1   ? ? 100.82 104.50 -3.68 0.40 N 
8  1 "O4'" D DG  1   ? ? "C1'" D DG  1   ? ? N9    D DG  1   ? ? 100.50 108.00 -7.50 0.70 N 
9  1 N1    D DC  3   ? ? "C1'" D DC  3   ? ? "C2'" D DC  3   ? ? 123.54 114.30 9.24  1.40 N 
10 1 "O4'" D DC  3   ? ? "C1'" D DC  3   ? ? N1    D DC  3   ? ? 99.88  108.00 -8.12 0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 153 ? ? -140.73 40.16   
2 1 GLU A 267 ? ? -81.13  38.34   
3 1 GLN A 268 ? ? -174.12 52.58   
4 1 LEU A 310 ? ? -161.11 92.27   
5 1 THR A 318 ? A -122.18 -151.03 
6 1 THR A 318 ? B -126.24 -155.28 
7 1 SER A 411 ? ? -163.73 -147.38 
8 1 ASN A 493 ? ? -87.63  47.97   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 200 ? CG  ? A GLN 74  CG  
2  1 Y 1 A GLN 200 ? CD  ? A GLN 74  CD  
3  1 Y 1 A GLN 200 ? OE1 ? A GLN 74  OE1 
4  1 Y 1 A GLN 200 ? NE2 ? A GLN 74  NE2 
5  1 Y 1 A GLU 207 ? CD  ? A GLU 81  CD  
6  1 Y 1 A GLU 207 ? OE1 ? A GLU 81  OE1 
7  1 Y 1 A GLU 207 ? OE2 ? A GLU 81  OE2 
8  1 Y 1 A LYS 249 ? CE  ? A LYS 123 CE  
9  1 Y 1 A LYS 249 ? NZ  ? A LYS 123 NZ  
10 1 Y 1 A GLU 267 ? CG  ? A GLU 141 CG  
11 1 Y 1 A GLU 267 ? CD  ? A GLU 141 CD  
12 1 Y 1 A GLU 267 ? OE1 ? A GLU 141 OE1 
13 1 Y 1 A GLU 267 ? OE2 ? A GLU 141 OE2 
14 1 Y 1 A GLN 268 ? CG  ? A GLN 142 CG  
15 1 Y 1 A GLN 268 ? CD  ? A GLN 142 CD  
16 1 Y 1 A GLN 268 ? OE1 ? A GLN 142 OE1 
17 1 Y 1 A GLN 268 ? NE2 ? A GLN 142 NE2 
18 1 Y 1 A GLN 270 ? CG  ? A GLN 144 CG  
19 1 Y 1 A GLN 270 ? CD  ? A GLN 144 CD  
20 1 Y 1 A GLN 270 ? OE1 ? A GLN 144 OE1 
21 1 Y 1 A GLN 270 ? NE2 ? A GLN 144 NE2 
22 1 Y 1 A LYS 271 ? CG  ? A LYS 145 CG  
23 1 Y 1 A LYS 271 ? CD  ? A LYS 145 CD  
24 1 Y 1 A LYS 271 ? CE  ? A LYS 145 CE  
25 1 Y 1 A LYS 271 ? NZ  ? A LYS 145 NZ  
26 1 Y 1 A GLN 274 ? CD  ? A GLN 148 CD  
27 1 Y 1 A GLN 274 ? OE1 ? A GLN 148 OE1 
28 1 Y 1 A GLN 274 ? NE2 ? A GLN 148 NE2 
29 1 Y 1 A GLU 304 ? CD  ? A GLU 178 CD  
30 1 Y 1 A GLU 304 ? OE1 ? A GLU 178 OE1 
31 1 Y 1 A GLU 304 ? OE2 ? A GLU 178 OE2 
32 1 Y 1 A LYS 339 ? CE  ? A LYS 213 CE  
33 1 Y 1 A LYS 339 ? NZ  ? A LYS 213 NZ  
34 1 Y 1 A GLN 355 ? CG  ? A GLN 229 CG  
35 1 Y 1 A GLN 355 ? CD  ? A GLN 229 CD  
36 1 Y 1 A GLN 355 ? OE1 ? A GLN 229 OE1 
37 1 Y 1 A GLN 355 ? NE2 ? A GLN 229 NE2 
38 1 Y 1 A GLN 357 ? OE1 ? A GLN 231 OE1 
39 1 Y 1 A GLN 357 ? NE2 ? A GLN 231 NE2 
40 1 Y 1 A GLN 364 ? CG  ? A GLN 238 CG  
41 1 Y 1 A GLN 364 ? CD  ? A GLN 238 CD  
42 1 Y 1 A GLN 364 ? OE1 ? A GLN 238 OE1 
43 1 Y 1 A GLN 364 ? NE2 ? A GLN 238 NE2 
44 1 Y 1 A GLU 465 ? OE1 ? A GLU 327 OE1 
45 1 Y 1 A GLU 465 ? OE2 ? A GLU 327 OE2 
46 1 Y 1 A LYS 467 ? CE  ? A LYS 329 CE  
47 1 Y 1 A LYS 467 ? NZ  ? A LYS 329 NZ  
48 1 Y 1 A GLN 471 ? CD  ? A GLN 333 CD  
49 1 Y 1 A GLN 471 ? OE1 ? A GLN 333 OE1 
50 1 Y 1 A GLN 471 ? NE2 ? A GLN 333 NE2 
51 1 Y 1 A GLU 485 ? CG  ? A GLU 347 CG  
52 1 Y 1 A GLU 485 ? CD  ? A GLU 347 CD  
53 1 Y 1 A GLU 485 ? OE1 ? A GLU 347 OE1 
54 1 Y 1 A GLU 485 ? OE2 ? A GLU 347 OE2 
55 1 N 1 A EPE 508 ? N1  ? L EPE 1   N1  
56 1 N 1 A EPE 508 ? C2  ? L EPE 1   C2  
57 1 N 1 A EPE 508 ? C3  ? L EPE 1   C3  
58 1 N 1 A EPE 508 ? N4  ? L EPE 1   N4  
59 1 N 1 A EPE 508 ? C5  ? L EPE 1   C5  
60 1 N 1 A EPE 508 ? C6  ? L EPE 1   C6  
61 1 N 1 A EPE 508 ? C7  ? L EPE 1   C7  
62 1 N 1 A EPE 508 ? C8  ? L EPE 1   C8  
63 1 N 1 A EPE 508 ? O8  ? L EPE 1   O8  
64 1 N 1 A EPE 508 ? C9  ? L EPE 1   C9  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 127 ? A GLY 1   
2  1 Y 1 A SER 128 ? A SER 2   
3  1 Y 1 A ALA 129 ? A ALA 3   
4  1 Y 1 A ALA 130 ? A ALA 4   
5  1 Y 1 A ALA 131 ? A ALA 5   
6  1 Y 1 A PRO 132 ? A PRO 6   
7  1 Y 1 A LEU 133 ? A LEU 7   
8  1 Y 1 A SER 134 ? A SER 8   
9  1 Y 1 A PRO 135 ? A PRO 9   
10 1 Y 1 A ALA 136 ? A ALA 10  
11 1 Y 1 A TRP 137 ? A TRP 11  
12 1 Y 1 A HIS 365 ? A HIS 239 
13 1 Y 1 A GLN 366 ? A GLN 240 
14 1 Y 1 A HIS 367 ? A HIS 241 
15 1 Y 1 A SER 368 ? A SER 242 
16 1 Y 1 A CYS 369 ? A CYS 243 
17 1 Y 1 A CYS 370 ? A CYS 244 
18 1 Y 1 A GLU 371 ? A GLU 245 
19 1 Y 1 A SER 372 ? A SER 246 
20 1 Y 1 A PRO 373 ? A PRO 247 
21 1 Y 1 A THR 374 ? A THR 248 
22 1 Y 1 A ARG 375 ? A ARG 249 
23 1 Y 1 A LEU 376 ? A LEU 250 
24 1 Y 1 A ALA 377 ? A ALA 251 
25 1 Y 1 A GLN 378 ? A GLN 252 
26 1 Y 1 A GLN 379 ? A GLN 253 
27 1 Y 1 A SER 380 ? A SER 254 
28 1 Y 1 A HIS 381 ? A HIS 255 
29 1 Y 1 A MET 382 ? A MET 256 
30 1 Y 1 A ASP 383 ? A ASP 257 
31 1 Y 1 A ALA 384 ? A ALA 258 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4M0A 'double helix'        
4M0A 'a-form double helix' 
4M0A 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1 1_555 D DG 4 1_555 0.108  -0.134 0.274  -6.015  -8.445  -1.803 1 T_DC1:DG4_D T 1 ? D 4 ? 19 1 
1 B DG 2 1_555 D DC 3 1_555 -0.111 -0.111 0.057  -0.263  -11.317 -1.505 2 T_DG2:DC3_D T 2 ? D 3 ? 19 1 
1 B DG 3 1_555 D DC 2 1_555 -0.253 -0.217 0.152  0.095   -8.311  -2.729 3 T_DG3:DC2_D T 3 ? D 2 ? 19 1 
1 B DC 4 1_555 D DG 1 1_555 0.317  -0.146 -0.305 12.906  1.127   -0.789 4 T_DC4:DG1_D T 4 ? D 1 ? 19 1 
1 B DA 5 1_555 C DT 5 1_555 0.133  -0.100 -0.194 -15.336 8.772   0.128  5 T_DA5:DT5_P T 5 ? P 5 ? 20 1 
1 B DT 6 1_555 C DA 4 1_555 -0.101 -0.095 -0.023 6.895   2.204   1.249  6 T_DT6:DA4_P T 6 ? P 4 ? 20 1 
1 B DA 7 1_555 C DT 3 1_555 0.146  -0.140 0.269  11.356  -14.381 -0.798 7 T_DA7:DT3_P T 7 ? P 3 ? 20 1 
1 B DC 8 1_555 C DG 2 1_555 0.231  -0.133 -0.189 11.594  -11.387 0.003  8 T_DC8:DG2_P T 8 ? P 2 ? 19 1 
1 B DG 9 1_555 C DC 1 1_555 -0.133 -0.060 0.100  -3.848  -9.518  -1.765 9 T_DG9:DC1_P T 9 ? P 1 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1 1_555 D DG 4 1_555 B DG 2 1_555 D DC 3 1_555 -0.578 0.895  3.357 2.618  3.018 35.462 1.010  1.335  3.369 4.935  -4.281  
35.680 1 TT_DC1DG2:DC3DG4_DD T 1 ? D 4 ? T 2 ? D 3 ? 
1 B DG 2 1_555 D DC 3 1_555 B DG 3 1_555 D DC 2 1_555 0.618  -0.050 3.371 -2.665 4.595 33.289 -0.851 -1.510 3.277 7.957  4.616   
33.699 2 TT_DG2DG3:DC2DC3_DD T 2 ? D 3 ? T 3 ? D 2 ? 
1 B DG 3 1_555 D DC 2 1_555 B DC 4 1_555 D DG 1 1_555 0.478  0.083  3.049 5.224  1.864 26.773 -0.263 0.218  3.084 3.970  -11.130 
27.332 3 TT_DG3DC4:DG1DC2_DD T 3 ? D 2 ? T 4 ? D 1 ? 
1 B DA 5 1_555 C DT 5 1_555 B DT 6 1_555 C DA 4 1_555 0.573  -0.572 2.936 -4.145 6.479 19.343 -3.964 -3.110 2.442 18.371 11.752  
20.803 4 TT_DA5DT6:DA4DT5_PP T 5 ? P 5 ? T 6 ? P 4 ? 
1 B DT 6 1_555 C DA 4 1_555 B DA 7 1_555 C DT 3 1_555 0.103  -1.310 3.166 -4.228 4.667 28.652 -3.528 -1.055 2.877 9.289  8.415   
29.322 5 TT_DT6DA7:DT3DA4_PP T 6 ? P 4 ? T 7 ? P 3 ? 
1 B DA 7 1_555 C DT 3 1_555 B DC 8 1_555 C DG 2 1_555 -0.363 -1.366 3.385 1.656  2.817 35.728 -2.628 0.830  3.251 4.579  -2.691  
35.872 6 TT_DA7DC8:DG2DT3_PP T 7 ? P 3 ? T 8 ? P 2 ? 
1 B DC 8 1_555 C DG 2 1_555 B DG 9 1_555 C DC 1 1_555 -0.817 -1.338 3.594 -4.817 6.207 36.102 -3.020 0.586  3.403 9.871  7.661   
36.919 7 TT_DC8DG9:DC1DG2_PP T 8 ? P 2 ? T 9 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5  'MAGNESIUM ION'                                       MG  
6  PYROPHOSPHATE                                         PPV 
7  1,2-ETHANEDIOL                                        EDO 
8  'MANGANESE (II) ION'                                  MN  
9  '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 
10 water                                                 HOH 
#