data_4M83
# 
_entry.id   4M83 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4M83         
RCSB  RCSB081584   
WWPDB D_1000081584 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB         2IYF             
;The crystal structure of macrolide glycosyltransferases: a blueprint for antibiotic engineering. Entry 4M83 reflects an alternative modeling of X-ray data r2IYFSF
;
re-refinement 
PDB         4M60             . unspecified   
PDB         4M7P             . unspecified   
TargetTrack NatPro-GO.122287 . unspecified   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4M83 
_pdbx_database_status.recvd_initial_deposition_date   2013-08-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, F.'                                                   1  
'Helmich, K.E.'                                              2  
'Xu, W.'                                                     3  
'Singh, S.'                                                  4  
'Olmos Jr., J.L.'                                            5  
'Martinez iii, E.'                                           6  
'Bingman, C.A.'                                              7  
'Thorson, J.S.'                                              8  
'Phillips Jr., G.N.'                                         9  
'Enzyme Discovery for Natural Product Biosynthesis (NatPro)' 10 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary         'Crystal structure of macrolide glycosyltransferases OleD' 'To be Published'      ?   ?    ?    ?    ?      ?  ? 
0353 ? ?        ?                       
original_data_1 
'The crystal structure of two macrolide glycosyltransferases provides a blueprint for host cell antibiotic immunity.' 
Proc.Natl.Acad.Sci.USA 104 5336 5341 2007 PNASA6 US 0027-8424 0040 ? 17376874 10.1073/pnas.0607897104 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary         'Olmos, J.L.'          1  
primary         Jr.                    2  
primary         'Wang, F.'             3  
primary         'Martinez iii, E.'     4  
primary         'Helmich, K.E.'        5  
primary         'Singh, S.'            6  
primary         'Xu, W.'               7  
primary         'Bingman, C.A.'        8  
primary         'Thorson, J.S.'        9  
primary         'Phillips Jr., G.N.'   10 
original_data_1 'Bolam, D.N.'          11 
original_data_1 'Roberts, S.'          12 
original_data_1 'Proctor, M.R.'        13 
original_data_1 'Turkenburg, J.P.'     14 
original_data_1 'Dodson, E.J.'         15 
original_data_1 'Martinez-Fleites, C.' 16 
original_data_1 'Yang, M.'             17 
original_data_1 'Davis, B.G.'          18 
original_data_1 'Davies, G.J.'         19 
original_data_1 'Gilbert, H.J.'        20 
# 
_cell.entry_id           4M83 
_cell.length_a           72.718 
_cell.length_b           65.778 
_cell.length_c           91.940 
_cell.angle_alpha        90.00 
_cell.angle_beta         100.42 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4M83 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Oleandomycin glycosyltransferase' 45365.973 2   ? ? ? ? 
2 non-polymer syn 'ERYTHROMYCIN A'                   733.927   2   ? ? ? ? 
3 non-polymer syn "URIDINE-5'-DIPHOSPHATE"           404.161   2   ? ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                    24.305    1   ? ? ? ? 
5 water       nat water                              18.015    521 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTTQTTPAHIAMFSIAAHGHVNPSLEVIRELVARGHRVTYAIPPVFADKVAATGARPVLYHSTLPGPDADPEAWGSTLLD
NVEPFLNDAIQALPQLADAYADDIPDLVLHDITSYPARVLARRWGVPAVSLSPNLVAWKGYEEEVAEPMWREPRQTERGR
AYYARFEAWLKENGITEHPDTFASHPPRSLVLIPKALQPHADRVDEDVYTFVGACQGDRAEEGGWQRPAGAEKVVLVSLG
SAFTKQPAFYRECVRAFGNLPGWHLVLQIGRKVTPAELGELPDNVEVHDWVPQLAILRQADLFVTHAGAGGSQEGLATAT
PMIAVPQAVDQFGNADMLQGLGVARKLATEEATADLLRETALALVDDPEVARRLRRIQAEMAQEGGTRRAADLIEAELPA
RHERQEPVGDRPNGG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTTQTTPAHIAMFSIAAHGHVNPSLEVIRELVARGHRVTYAIPPVFADKVAATGARPVLYHSTLPGPDADPEAWGSTLLD
NVEPFLNDAIQALPQLADAYADDIPDLVLHDITSYPARVLARRWGVPAVSLSPNLVAWKGYEEEVAEPMWREPRQTERGR
AYYARFEAWLKENGITEHPDTFASHPPRSLVLIPKALQPHADRVDEDVYTFVGACQGDRAEEGGWQRPAGAEKVVLVSLG
SAFTKQPAFYRECVRAFGNLPGWHLVLQIGRKVTPAELGELPDNVEVHDWVPQLAILRQADLFVTHAGAGGSQEGLATAT
PMIAVPQAVDQFGNADMLQGLGVARKLATEEATADLLRETALALVDDPEVARRLRRIQAEMAQEGGTRRAADLIEAELPA
RHERQEPVGDRPNGG
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         NatPro-GO.122287 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   THR n 
1 4   GLN n 
1 5   THR n 
1 6   THR n 
1 7   PRO n 
1 8   ALA n 
1 9   HIS n 
1 10  ILE n 
1 11  ALA n 
1 12  MET n 
1 13  PHE n 
1 14  SER n 
1 15  ILE n 
1 16  ALA n 
1 17  ALA n 
1 18  HIS n 
1 19  GLY n 
1 20  HIS n 
1 21  VAL n 
1 22  ASN n 
1 23  PRO n 
1 24  SER n 
1 25  LEU n 
1 26  GLU n 
1 27  VAL n 
1 28  ILE n 
1 29  ARG n 
1 30  GLU n 
1 31  LEU n 
1 32  VAL n 
1 33  ALA n 
1 34  ARG n 
1 35  GLY n 
1 36  HIS n 
1 37  ARG n 
1 38  VAL n 
1 39  THR n 
1 40  TYR n 
1 41  ALA n 
1 42  ILE n 
1 43  PRO n 
1 44  PRO n 
1 45  VAL n 
1 46  PHE n 
1 47  ALA n 
1 48  ASP n 
1 49  LYS n 
1 50  VAL n 
1 51  ALA n 
1 52  ALA n 
1 53  THR n 
1 54  GLY n 
1 55  ALA n 
1 56  ARG n 
1 57  PRO n 
1 58  VAL n 
1 59  LEU n 
1 60  TYR n 
1 61  HIS n 
1 62  SER n 
1 63  THR n 
1 64  LEU n 
1 65  PRO n 
1 66  GLY n 
1 67  PRO n 
1 68  ASP n 
1 69  ALA n 
1 70  ASP n 
1 71  PRO n 
1 72  GLU n 
1 73  ALA n 
1 74  TRP n 
1 75  GLY n 
1 76  SER n 
1 77  THR n 
1 78  LEU n 
1 79  LEU n 
1 80  ASP n 
1 81  ASN n 
1 82  VAL n 
1 83  GLU n 
1 84  PRO n 
1 85  PHE n 
1 86  LEU n 
1 87  ASN n 
1 88  ASP n 
1 89  ALA n 
1 90  ILE n 
1 91  GLN n 
1 92  ALA n 
1 93  LEU n 
1 94  PRO n 
1 95  GLN n 
1 96  LEU n 
1 97  ALA n 
1 98  ASP n 
1 99  ALA n 
1 100 TYR n 
1 101 ALA n 
1 102 ASP n 
1 103 ASP n 
1 104 ILE n 
1 105 PRO n 
1 106 ASP n 
1 107 LEU n 
1 108 VAL n 
1 109 LEU n 
1 110 HIS n 
1 111 ASP n 
1 112 ILE n 
1 113 THR n 
1 114 SER n 
1 115 TYR n 
1 116 PRO n 
1 117 ALA n 
1 118 ARG n 
1 119 VAL n 
1 120 LEU n 
1 121 ALA n 
1 122 ARG n 
1 123 ARG n 
1 124 TRP n 
1 125 GLY n 
1 126 VAL n 
1 127 PRO n 
1 128 ALA n 
1 129 VAL n 
1 130 SER n 
1 131 LEU n 
1 132 SER n 
1 133 PRO n 
1 134 ASN n 
1 135 LEU n 
1 136 VAL n 
1 137 ALA n 
1 138 TRP n 
1 139 LYS n 
1 140 GLY n 
1 141 TYR n 
1 142 GLU n 
1 143 GLU n 
1 144 GLU n 
1 145 VAL n 
1 146 ALA n 
1 147 GLU n 
1 148 PRO n 
1 149 MET n 
1 150 TRP n 
1 151 ARG n 
1 152 GLU n 
1 153 PRO n 
1 154 ARG n 
1 155 GLN n 
1 156 THR n 
1 157 GLU n 
1 158 ARG n 
1 159 GLY n 
1 160 ARG n 
1 161 ALA n 
1 162 TYR n 
1 163 TYR n 
1 164 ALA n 
1 165 ARG n 
1 166 PHE n 
1 167 GLU n 
1 168 ALA n 
1 169 TRP n 
1 170 LEU n 
1 171 LYS n 
1 172 GLU n 
1 173 ASN n 
1 174 GLY n 
1 175 ILE n 
1 176 THR n 
1 177 GLU n 
1 178 HIS n 
1 179 PRO n 
1 180 ASP n 
1 181 THR n 
1 182 PHE n 
1 183 ALA n 
1 184 SER n 
1 185 HIS n 
1 186 PRO n 
1 187 PRO n 
1 188 ARG n 
1 189 SER n 
1 190 LEU n 
1 191 VAL n 
1 192 LEU n 
1 193 ILE n 
1 194 PRO n 
1 195 LYS n 
1 196 ALA n 
1 197 LEU n 
1 198 GLN n 
1 199 PRO n 
1 200 HIS n 
1 201 ALA n 
1 202 ASP n 
1 203 ARG n 
1 204 VAL n 
1 205 ASP n 
1 206 GLU n 
1 207 ASP n 
1 208 VAL n 
1 209 TYR n 
1 210 THR n 
1 211 PHE n 
1 212 VAL n 
1 213 GLY n 
1 214 ALA n 
1 215 CYS n 
1 216 GLN n 
1 217 GLY n 
1 218 ASP n 
1 219 ARG n 
1 220 ALA n 
1 221 GLU n 
1 222 GLU n 
1 223 GLY n 
1 224 GLY n 
1 225 TRP n 
1 226 GLN n 
1 227 ARG n 
1 228 PRO n 
1 229 ALA n 
1 230 GLY n 
1 231 ALA n 
1 232 GLU n 
1 233 LYS n 
1 234 VAL n 
1 235 VAL n 
1 236 LEU n 
1 237 VAL n 
1 238 SER n 
1 239 LEU n 
1 240 GLY n 
1 241 SER n 
1 242 ALA n 
1 243 PHE n 
1 244 THR n 
1 245 LYS n 
1 246 GLN n 
1 247 PRO n 
1 248 ALA n 
1 249 PHE n 
1 250 TYR n 
1 251 ARG n 
1 252 GLU n 
1 253 CYS n 
1 254 VAL n 
1 255 ARG n 
1 256 ALA n 
1 257 PHE n 
1 258 GLY n 
1 259 ASN n 
1 260 LEU n 
1 261 PRO n 
1 262 GLY n 
1 263 TRP n 
1 264 HIS n 
1 265 LEU n 
1 266 VAL n 
1 267 LEU n 
1 268 GLN n 
1 269 ILE n 
1 270 GLY n 
1 271 ARG n 
1 272 LYS n 
1 273 VAL n 
1 274 THR n 
1 275 PRO n 
1 276 ALA n 
1 277 GLU n 
1 278 LEU n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 PRO n 
1 283 ASP n 
1 284 ASN n 
1 285 VAL n 
1 286 GLU n 
1 287 VAL n 
1 288 HIS n 
1 289 ASP n 
1 290 TRP n 
1 291 VAL n 
1 292 PRO n 
1 293 GLN n 
1 294 LEU n 
1 295 ALA n 
1 296 ILE n 
1 297 LEU n 
1 298 ARG n 
1 299 GLN n 
1 300 ALA n 
1 301 ASP n 
1 302 LEU n 
1 303 PHE n 
1 304 VAL n 
1 305 THR n 
1 306 HIS n 
1 307 ALA n 
1 308 GLY n 
1 309 ALA n 
1 310 GLY n 
1 311 GLY n 
1 312 SER n 
1 313 GLN n 
1 314 GLU n 
1 315 GLY n 
1 316 LEU n 
1 317 ALA n 
1 318 THR n 
1 319 ALA n 
1 320 THR n 
1 321 PRO n 
1 322 MET n 
1 323 ILE n 
1 324 ALA n 
1 325 VAL n 
1 326 PRO n 
1 327 GLN n 
1 328 ALA n 
1 329 VAL n 
1 330 ASP n 
1 331 GLN n 
1 332 PHE n 
1 333 GLY n 
1 334 ASN n 
1 335 ALA n 
1 336 ASP n 
1 337 MET n 
1 338 LEU n 
1 339 GLN n 
1 340 GLY n 
1 341 LEU n 
1 342 GLY n 
1 343 VAL n 
1 344 ALA n 
1 345 ARG n 
1 346 LYS n 
1 347 LEU n 
1 348 ALA n 
1 349 THR n 
1 350 GLU n 
1 351 GLU n 
1 352 ALA n 
1 353 THR n 
1 354 ALA n 
1 355 ASP n 
1 356 LEU n 
1 357 LEU n 
1 358 ARG n 
1 359 GLU n 
1 360 THR n 
1 361 ALA n 
1 362 LEU n 
1 363 ALA n 
1 364 LEU n 
1 365 VAL n 
1 366 ASP n 
1 367 ASP n 
1 368 PRO n 
1 369 GLU n 
1 370 VAL n 
1 371 ALA n 
1 372 ARG n 
1 373 ARG n 
1 374 LEU n 
1 375 ARG n 
1 376 ARG n 
1 377 ILE n 
1 378 GLN n 
1 379 ALA n 
1 380 GLU n 
1 381 MET n 
1 382 ALA n 
1 383 GLN n 
1 384 GLU n 
1 385 GLY n 
1 386 GLY n 
1 387 THR n 
1 388 ARG n 
1 389 ARG n 
1 390 ALA n 
1 391 ALA n 
1 392 ASP n 
1 393 LEU n 
1 394 ILE n 
1 395 GLU n 
1 396 ALA n 
1 397 GLU n 
1 398 LEU n 
1 399 PRO n 
1 400 ALA n 
1 401 ARG n 
1 402 HIS n 
1 403 GLU n 
1 404 ARG n 
1 405 GLN n 
1 406 GLU n 
1 407 PRO n 
1 408 VAL n 
1 409 GLY n 
1 410 ASP n 
1 411 ARG n 
1 412 PRO n 
1 413 ASN n 
1 414 GLY n 
1 415 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 oleD 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Streptomyces antibioticus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1890 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q3HTL6_STRAT 
_struct_ref.pdbx_db_accession          Q3HTL6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTTQTTPAHIAMFSIAAHGHVNPSLEVIRELVARGHRVTYAIPPVFADKVAATGARPVLYHSTLPGPDADPEAWGSTLLD
NVEPFLNDAIQALPQLADAYADDIPDLVLHDITSYPARVLARRWGVPAVSLSPNLVAWKGYEEEVAEPMWREPRQTERGR
AYYARFEAWLKENGITEHPDTFASHPPRSLVLIPKALQPHADRVDEDVYTFVGACQGDRAEEGGWQRPAGAEKVVLVSLG
SAFTKQPAFYRECVRAFGNLPGWHLVLQIGRKVTPAELGELPDNVEVHDWVPQLAILRQADLFVTHAGAGGSQEGLATAT
PMIAVPQAVDQFGNADMLQGLGVARKLATEEATADLLRETALALVDDPEVARRLRRIQAEMAQEGGTRRAADLIEAELPA
RHERQEPVGDRPNGG
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4M83 A 1 ? 415 ? Q3HTL6 1 ? 415 ? 0 414 
2 1 4M83 B 1 ? 415 ? Q3HTL6 1 ? 415 ? 0 414 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                 ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE               ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                 ? 'C3 H7 N O2 S'     121.158 
ERY non-polymer         . 'ERYTHROMYCIN A'         ? 'C37 H67 N O13'    733.927 
GLN 'L-peptide linking' y GLUTAMINE                ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                  ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                    ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                  ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                   ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE               ? 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'          ? 'Mg 2'             24.305  
PHE 'L-peptide linking' y PHENYLALANINE            ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                  ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                   ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                 ? 'C9 H11 N O3'      181.189 
UDP 'RNA linking'       . "URIDINE-5'-DIPHOSPHATE" ? 'C9 H14 N2 O12 P2' 404.161 
VAL 'L-peptide linking' y VALINE                   ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          4M83 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.38 
_exptl_crystal.density_percent_sol   48.39 
_exptl_crystal.description           'AUTHOR USED THE SF DATA FROM ENTRY 2IYF' 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4M83 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     94017 
_refine.ls_number_reflns_all                     94281 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.034 
_refine.ls_d_res_high                            1.698 
_refine.ls_percent_reflns_obs                    99.72 
_refine.ls_R_factor_obs                          0.1610 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1602 
_refine.ls_R_factor_R_free                       0.2006 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.12 
_refine.ls_number_reflns_R_free                  1992 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.00 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.15 
_refine.pdbx_overall_phase_error                 19.02 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5974 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         153 
_refine_hist.number_atoms_solvent             521 
_refine_hist.number_atoms_total               6648 
_refine_hist.d_res_high                       1.698 
_refine_hist.d_res_low                        29.034 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          1.362 ? ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.95 ? ? . 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.087 ? ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 1.6981 1.7406  6405 0.2016 97.00  0.2930 . . 138 . . . . 
'X-RAY DIFFRACTION' . 1.7406 1.7876  6524 0.1890 100.00 0.2334 . . 141 . . . . 
'X-RAY DIFFRACTION' . 1.7876 1.8402  6549 0.1916 100.00 0.2791 . . 143 . . . . 
'X-RAY DIFFRACTION' . 1.8402 1.8996  6529 0.1792 100.00 0.2576 . . 141 . . . . 
'X-RAY DIFFRACTION' . 1.8996 1.9675  6557 0.1577 100.00 0.2094 . . 142 . . . . 
'X-RAY DIFFRACTION' . 1.9675 2.0463  6580 0.1501 100.00 0.2020 . . 143 . . . . 
'X-RAY DIFFRACTION' . 2.0463 2.1394  6567 0.1523 100.00 0.2092 . . 142 . . . . 
'X-RAY DIFFRACTION' . 2.1394 2.2521  6558 0.1474 100.00 0.1994 . . 143 . . . . 
'X-RAY DIFFRACTION' . 2.2521 2.3932  6571 0.1461 100.00 0.2083 . . 141 . . . . 
'X-RAY DIFFRACTION' . 2.3932 2.5778  6596 0.1571 100.00 0.1985 . . 142 . . . . 
'X-RAY DIFFRACTION' . 2.5778 2.8371  6582 0.1639 100.00 0.2075 . . 143 . . . . 
'X-RAY DIFFRACTION' . 2.8371 3.2471  6622 0.1674 100.00 0.2004 . . 144 . . . . 
'X-RAY DIFFRACTION' . 3.2471 4.0892  6646 0.1544 100.00 0.2018 . . 143 . . . . 
'X-RAY DIFFRACTION' . 4.0892 29.0381 6739 0.1570 100.00 0.1495 . . 146 . . . . 
# 
_struct.entry_id                  4M83 
_struct.title                     
;Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A
;
_struct.pdbx_descriptor           'Oleandomycin glycosyltransferase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.pdbx_keywords   Transferase/Antibiotic 
_struct_keywords.text            
;Structural Genomics, Protein Structure Initiative, Enzyme Discovery for Natural Product Biosynthesis, NatPro, OLEANDOMYCIN GLYCOSYLTRANSFERASE, PSI-Biology, Transferase-Antibiotic complex
;
_struct_keywords.entry_id        4M83 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 17  ? PRO A 23  ? ALA A 16  PRO A 22  5 ? 7  
HELX_P HELX_P2  2  SER A 24  ? GLY A 35  ? SER A 23  GLY A 34  1 ? 12 
HELX_P HELX_P3  3  PRO A 43  ? VAL A 45  ? PRO A 42  VAL A 44  5 ? 3  
HELX_P HELX_P4  4  PHE A 46  ? ALA A 52  ? PHE A 45  ALA A 51  1 ? 7  
HELX_P HELX_P5  5  ASP A 70  ? GLY A 75  ? ASP A 69  GLY A 74  5 ? 6  
HELX_P HELX_P6  6  THR A 77  ? ASP A 102 ? THR A 76  ASP A 101 1 ? 26 
HELX_P HELX_P7  7  SER A 114 ? GLY A 125 ? SER A 113 GLY A 124 1 ? 12 
HELX_P HELX_P8  8  GLY A 140 ? VAL A 145 ? GLY A 139 VAL A 144 1 ? 6  
HELX_P HELX_P9  9  VAL A 145 ? GLN A 155 ? VAL A 144 GLN A 154 1 ? 11 
HELX_P HELX_P10 10 THR A 156 ? ASN A 173 ? THR A 155 ASN A 172 1 ? 18 
HELX_P HELX_P11 11 HIS A 178 ? HIS A 185 ? HIS A 177 HIS A 184 1 ? 8  
HELX_P HELX_P12 12 PRO A 194 ? GLN A 198 ? PRO A 193 GLN A 197 5 ? 5  
HELX_P HELX_P13 13 HIS A 200 ? VAL A 204 ? HIS A 199 VAL A 203 5 ? 5  
HELX_P HELX_P14 14 GLN A 246 ? GLY A 258 ? GLN A 245 GLY A 257 1 ? 13 
HELX_P HELX_P15 15 PRO A 292 ? ARG A 298 ? PRO A 291 ARG A 297 1 ? 7  
HELX_P HELX_P16 16 GLY A 308 ? THR A 318 ? GLY A 307 THR A 317 1 ? 11 
HELX_P HELX_P17 17 GLN A 331 ? LEU A 341 ? GLN A 330 LEU A 340 1 ? 11 
HELX_P HELX_P18 18 THR A 353 ? ASP A 366 ? THR A 352 ASP A 365 1 ? 14 
HELX_P HELX_P19 19 ASP A 367 ? GLY A 385 ? ASP A 366 GLY A 384 1 ? 19 
HELX_P HELX_P20 20 GLY A 386 ? LEU A 398 ? GLY A 385 LEU A 397 1 ? 13 
HELX_P HELX_P21 21 ALA B 17  ? ASN B 22  ? ALA B 16  ASN B 21  1 ? 6  
HELX_P HELX_P22 22 SER B 24  ? ALA B 33  ? SER B 23  ALA B 32  1 ? 10 
HELX_P HELX_P23 23 PRO B 43  ? VAL B 45  ? PRO B 42  VAL B 44  5 ? 3  
HELX_P HELX_P24 24 PHE B 46  ? ALA B 52  ? PHE B 45  ALA B 51  1 ? 7  
HELX_P HELX_P25 25 THR B 77  ? TYR B 100 ? THR B 76  TYR B 99  1 ? 24 
HELX_P HELX_P26 26 ALA B 101 ? ASP B 103 ? ALA B 100 ASP B 102 5 ? 3  
HELX_P HELX_P27 27 SER B 114 ? GLY B 125 ? SER B 113 GLY B 124 1 ? 12 
HELX_P HELX_P28 28 GLY B 140 ? VAL B 145 ? GLY B 139 VAL B 144 1 ? 6  
HELX_P HELX_P29 29 VAL B 145 ? TRP B 150 ? VAL B 144 TRP B 149 1 ? 6  
HELX_P HELX_P30 30 GLU B 152 ? GLN B 155 ? GLU B 151 GLN B 154 5 ? 4  
HELX_P HELX_P31 31 THR B 156 ? ASN B 173 ? THR B 155 ASN B 172 1 ? 18 
HELX_P HELX_P32 32 HIS B 178 ? HIS B 185 ? HIS B 177 HIS B 184 1 ? 8  
HELX_P HELX_P33 33 PRO B 194 ? GLN B 198 ? PRO B 193 GLN B 197 5 ? 5  
HELX_P HELX_P34 34 HIS B 200 ? VAL B 204 ? HIS B 199 VAL B 203 5 ? 5  
HELX_P HELX_P35 35 GLN B 246 ? GLY B 258 ? GLN B 245 GLY B 257 1 ? 13 
HELX_P HELX_P36 36 THR B 274 ? GLY B 279 ? THR B 273 GLY B 278 5 ? 6  
HELX_P HELX_P37 37 PRO B 292 ? GLN B 299 ? PRO B 291 GLN B 298 1 ? 8  
HELX_P HELX_P38 38 GLY B 308 ? THR B 318 ? GLY B 307 THR B 317 1 ? 11 
HELX_P HELX_P39 39 ASP B 330 ? LEU B 341 ? ASP B 329 LEU B 340 1 ? 12 
HELX_P HELX_P40 40 THR B 353 ? VAL B 365 ? THR B 352 VAL B 364 1 ? 13 
HELX_P HELX_P41 41 ASP B 367 ? GLY B 385 ? ASP B 366 GLY B 384 1 ? 19 
HELX_P HELX_P42 42 GLY B 385 ? ALA B 396 ? GLY B 384 ALA B 395 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? G MG  .   MG A ? ? 1_555 I HOH . O  A ? B MG  503 B HOH 830 1_555 ? ? ? ? ? ? ? 2.116 ? 
metalc2 metalc ? ? G MG  .   MG A ? ? 1_555 I HOH . O  A ? B MG  503 B HOH 809 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc3 metalc ? ? G MG  .   MG A ? ? 1_555 I HOH . O  A ? B MG  503 B HOH 684 1_555 ? ? ? ? ? ? ? 2.443 ? 
metalc4 metalc ? ? B ARG 298 O  A ? ? 1_555 G MG  . MG A ? B ARG 297 B MG  503 1_555 ? ? ? ? ? ? ? 2.582 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 1  6.43   
2  ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 1  1.63   
3  GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 1  -16.16 
4  LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 1  10.93  
5  ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 2  -10.79 
6  ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 2  8.99   
7  GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 2  11.97  
8  VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 2  6.10   
9  ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 3  6.16   
10 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 3  -6.25  
11 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 3  20.62  
12 LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 3  -24.61 
13 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 3  -0.45  
14 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 4  -10.55 
15 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 4  10.81  
16 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 4  -10.71 
17 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 4  -3.49  
18 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 5  -8.73  
19 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 5  -8.43  
20 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 5  -8.51  
21 LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 5  -7.08  
22 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 5  -1.11  
23 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 6  3.37   
24 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 6  2.20   
25 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 6  -3.18  
26 LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 6  5.13   
27 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 6  -8.85  
28 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 7  -9.48  
29 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 7  -12.77 
30 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 7  -14.33 
31 LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 7  -3.81  
32 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 7  5.63   
33 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 8  -5.58  
34 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 8  -18.14 
35 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 8  -6.64  
36 LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 8  -6.11  
37 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 8  8.34   
38 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 9  15.82  
39 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 9  9.07   
40 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 9  -10.76 
41 LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 9  3.24   
42 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 9  -9.25  
43 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 10 -10.22 
44 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 10 -17.58 
45 LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 10 17.62  
46 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 10 7.14   
47 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 11 7.41   
48 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 11 -6.54  
49 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 11 2.47   
50 LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 11 8.68   
51 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 11 2.91   
52 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 12 3.62   
53 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 12 -11.75 
54 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 12 -10.14 
55 LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 12 -24.44 
56 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 12 -4.13  
57 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 13 -1.19  
58 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 13 -17.71 
59 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 13 11.29  
60 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 13 14.55  
61 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 14 -1.35  
62 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 14 0.84   
63 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 14 -0.98  
64 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 14 6.55   
65 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 15 -10.95 
66 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 15 -1.37  
67 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 15 -18.37 
68 LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 15 11.29  
69 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 15 2.13   
70 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 16 -0.77  
71 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 16 -4.88  
72 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 16 -8.46  
73 LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 16 -7.25  
74 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 16 7.32   
75 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 17 -6.00  
76 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 17 -2.67  
77 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 17 -15.95 
78 LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 17 27.43  
79 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 17 -3.91  
80 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 18 4.32   
81 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 18 -5.99  
82 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 18 -10.10 
83 LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 18 -12.40 
84 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 18 12.95  
85 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 19 4.33   
86 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 19 -11.52 
87 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 19 12.41  
88 LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 19 20.82  
89 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 19 12.10  
90 ASP 218 A . ? ASP 217 A ARG 219 A ? ARG 218 A 20 -22.26 
91 ARG 219 A . ? ARG 218 A ALA 220 A ? ALA 219 A 20 2.39   
92 GLU 221 A . ? GLU 220 A GLU 222 A ? GLU 221 A 20 -13.23 
93 LYS 272 A . ? LYS 271 A VAL 273 A ? VAL 272 A 20 25.29  
94 VAL 273 A . ? VAL 272 A THR 274 A ? THR 273 A 20 -7.54  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 6 ? 
C ? 7 ? 
D ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
A 5 6 ? parallel 
A 6 7 ? parallel 
B 1 2 ? parallel 
B 2 3 ? parallel 
B 3 4 ? parallel 
B 4 5 ? parallel 
B 5 6 ? parallel 
C 1 2 ? parallel 
C 2 3 ? parallel 
C 3 4 ? parallel 
C 4 5 ? parallel 
C 5 6 ? parallel 
C 6 7 ? parallel 
D 1 2 ? parallel 
D 2 3 ? parallel 
D 3 4 ? parallel 
D 4 5 ? parallel 
D 5 6 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 56  ? LEU A 59  ? ARG A 55  LEU A 58  
A 2 ARG A 37  ? ILE A 42  ? ARG A 36  ILE A 41  
A 3 HIS A 9   ? PHE A 13  ? HIS A 8   PHE A 12  
A 4 LEU A 107 ? ASP A 111 ? LEU A 106 ASP A 110 
A 5 ALA A 128 ? SER A 132 ? ALA A 127 SER A 131 
A 6 SER A 189 ? VAL A 191 ? SER A 188 VAL A 190 
A 7 TYR A 209 ? PHE A 211 ? TYR A 208 PHE A 210 
B 1 VAL A 285 ? HIS A 288 ? VAL A 284 HIS A 287 
B 2 TRP A 263 ? GLN A 268 ? TRP A 262 GLN A 267 
B 3 LYS A 233 ? VAL A 237 ? LYS A 232 VAL A 236 
B 4 LEU A 302 ? THR A 305 ? LEU A 301 THR A 304 
B 5 MET A 322 ? ALA A 324 ? MET A 321 ALA A 323 
B 6 ALA A 344 ? LYS A 346 ? ALA A 343 LYS A 345 
C 1 ARG B 56  ? LEU B 59  ? ARG B 55  LEU B 58  
C 2 ARG B 37  ? ILE B 42  ? ARG B 36  ILE B 41  
C 3 HIS B 9   ? PHE B 13  ? HIS B 8   PHE B 12  
C 4 LEU B 107 ? ASP B 111 ? LEU B 106 ASP B 110 
C 5 ALA B 128 ? SER B 132 ? ALA B 127 SER B 131 
C 6 SER B 189 ? VAL B 191 ? SER B 188 VAL B 190 
C 7 TYR B 209 ? PHE B 211 ? TYR B 208 PHE B 210 
D 1 VAL B 285 ? HIS B 288 ? VAL B 284 HIS B 287 
D 2 HIS B 264 ? GLN B 268 ? HIS B 263 GLN B 267 
D 3 VAL B 234 ? SER B 238 ? VAL B 233 SER B 237 
D 4 LEU B 302 ? THR B 305 ? LEU B 301 THR B 304 
D 5 MET B 322 ? ALA B 324 ? MET B 321 ALA B 323 
D 6 ALA B 344 ? LYS B 346 ? ALA B 343 LYS B 345 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 56  ? O ARG A 55  N VAL A 38  ? N VAL A 37  
A 2 3 O THR A 39  ? O THR A 38  N MET A 12  ? N MET A 11  
A 3 4 N ALA A 11  ? N ALA A 10  O LEU A 107 ? O LEU A 106 
A 4 5 N HIS A 110 ? N HIS A 109 O LEU A 131 ? O LEU A 130 
A 5 6 N SER A 130 ? N SER A 129 O LEU A 190 ? O LEU A 189 
A 6 7 N VAL A 191 ? N VAL A 190 O THR A 210 ? O THR A 209 
B 1 2 O GLU A 286 ? O GLU A 285 N LEU A 267 ? N LEU A 266 
B 2 3 O VAL A 266 ? O VAL A 265 N VAL A 235 ? N VAL A 234 
B 3 4 N LEU A 236 ? N LEU A 235 O VAL A 304 ? O VAL A 303 
B 4 5 N THR A 305 ? N THR A 304 O ILE A 323 ? O ILE A 322 
B 5 6 N ALA A 324 ? N ALA A 323 O ARG A 345 ? O ARG A 344 
C 1 2 O ARG B 56  ? O ARG B 55  N VAL B 38  ? N VAL B 37  
C 2 3 O THR B 39  ? O THR B 38  N MET B 12  ? N MET B 11  
C 3 4 N ALA B 11  ? N ALA B 10  O LEU B 109 ? O LEU B 108 
C 4 5 N HIS B 110 ? N HIS B 109 O LEU B 131 ? O LEU B 130 
C 5 6 N SER B 130 ? N SER B 129 O LEU B 190 ? O LEU B 189 
C 6 7 N VAL B 191 ? N VAL B 190 O THR B 210 ? O THR B 209 
D 1 2 O HIS B 288 ? O HIS B 287 N LEU B 267 ? N LEU B 266 
D 2 3 O VAL B 266 ? O VAL B 265 N VAL B 235 ? N VAL B 234 
D 3 4 N LEU B 236 ? N LEU B 235 O VAL B 304 ? O VAL B 303 
D 4 5 N THR B 305 ? N THR B 304 O ILE B 323 ? O ILE B 322 
D 5 6 N ALA B 324 ? N ALA B 323 O ARG B 345 ? O ARG B 344 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE ERY A 1400' 
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE UDP A 1401' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE ERY B 501'  
AC4 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE UDP B 502'  
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG B 503'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 HIS A 20  ? HIS A 19   . ? 1_555 ? 
2  AC1 11 ASN A 81  ? ASN A 80   . ? 1_555 ? 
3  AC1 11 VAL A 82  ? VAL A 81   . ? 1_555 ? 
4  AC1 11 ILE A 112 ? ILE A 111  . ? 1_555 ? 
5  AC1 11 ASN A 134 ? ASN A 133  . ? 1_555 ? 
6  AC1 11 ALA A 183 ? ALA A 182  . ? 1_555 ? 
7  AC1 11 SER A 184 ? SER A 183  . ? 1_555 ? 
8  AC1 11 VAL A 329 ? VAL A 328  . ? 1_555 ? 
9  AC1 11 HOH H .   ? HOH A 1545 . ? 1_555 ? 
10 AC1 11 HOH H .   ? HOH A 1549 . ? 1_555 ? 
11 AC1 11 HOH H .   ? HOH A 1742 . ? 1_555 ? 
12 AC2 14 GLY A 240 ? GLY A 239  . ? 1_555 ? 
13 AC2 14 SER A 241 ? SER A 240  . ? 1_555 ? 
14 AC2 14 ALA A 242 ? ALA A 241  . ? 1_555 ? 
15 AC2 14 TRP A 290 ? TRP A 289  . ? 1_555 ? 
16 AC2 14 VAL A 291 ? VAL A 290  . ? 1_555 ? 
17 AC2 14 GLN A 293 ? GLN A 292  . ? 1_555 ? 
18 AC2 14 HIS A 306 ? HIS A 305  . ? 1_555 ? 
19 AC2 14 ALA A 309 ? ALA A 308  . ? 1_555 ? 
20 AC2 14 GLY A 310 ? GLY A 309  . ? 1_555 ? 
21 AC2 14 GLY A 311 ? GLY A 310  . ? 1_555 ? 
22 AC2 14 GLU A 314 ? GLU A 313  . ? 1_555 ? 
23 AC2 14 HOH H .   ? HOH A 1554 . ? 1_555 ? 
24 AC2 14 HOH H .   ? HOH A 1672 . ? 1_555 ? 
25 AC2 14 HOH H .   ? HOH A 1685 . ? 1_555 ? 
26 AC3 10 HIS B 20  ? HIS B 19   . ? 1_555 ? 
27 AC3 10 TRP B 74  ? TRP B 73   . ? 1_555 ? 
28 AC3 10 ASN B 81  ? ASN B 80   . ? 1_555 ? 
29 AC3 10 PHE B 85  ? PHE B 84   . ? 1_555 ? 
30 AC3 10 TYR B 115 ? TYR B 114  . ? 1_555 ? 
31 AC3 10 ASN B 134 ? ASN B 133  . ? 1_555 ? 
32 AC3 10 LEU B 135 ? LEU B 134  . ? 1_555 ? 
33 AC3 10 ALA B 183 ? ALA B 182  . ? 1_555 ? 
34 AC3 10 SER B 184 ? SER B 183  . ? 1_555 ? 
35 AC3 10 HOH I .   ? HOH B 670  . ? 1_555 ? 
36 AC4 18 ARG B 219 ? ARG B 218  . ? 1_555 ? 
37 AC4 18 SER B 238 ? SER B 237  . ? 1_555 ? 
38 AC4 18 GLY B 240 ? GLY B 239  . ? 1_555 ? 
39 AC4 18 SER B 241 ? SER B 240  . ? 1_555 ? 
40 AC4 18 PHE B 243 ? PHE B 242  . ? 1_555 ? 
41 AC4 18 GLN B 268 ? GLN B 267  . ? 1_555 ? 
42 AC4 18 TRP B 290 ? TRP B 289  . ? 1_555 ? 
43 AC4 18 VAL B 291 ? VAL B 290  . ? 1_555 ? 
44 AC4 18 GLN B 293 ? GLN B 292  . ? 1_555 ? 
45 AC4 18 HIS B 306 ? HIS B 305  . ? 1_555 ? 
46 AC4 18 GLY B 308 ? GLY B 307  . ? 1_555 ? 
47 AC4 18 ALA B 309 ? ALA B 308  . ? 1_555 ? 
48 AC4 18 GLY B 310 ? GLY B 309  . ? 1_555 ? 
49 AC4 18 GLY B 311 ? GLY B 310  . ? 1_555 ? 
50 AC4 18 GLU B 314 ? GLU B 313  . ? 1_555 ? 
51 AC4 18 HOH I .   ? HOH B 674  . ? 1_555 ? 
52 AC4 18 HOH I .   ? HOH B 728  . ? 1_555 ? 
53 AC4 18 HOH I .   ? HOH B 844  . ? 1_555 ? 
54 AC5 6  ARG B 298 ? ARG B 297  . ? 1_555 ? 
55 AC5 6  GLN B 299 ? GLN B 298  . ? 1_555 ? 
56 AC5 6  ALA B 300 ? ALA B 299  . ? 1_555 ? 
57 AC5 6  HOH I .   ? HOH B 684  . ? 1_555 ? 
58 AC5 6  HOH I .   ? HOH B 809  . ? 1_555 ? 
59 AC5 6  HOH I .   ? HOH B 830  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4M83 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4M83 
_atom_sites.fract_transf_matrix[1][1]   0.013752 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002529 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015203 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011059 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N  N     A ALA A 1 8   ? -26.717 -20.732 -44.401 0.05 12.25 ? 7    ALA A N     1  
ATOM   2      C  CA    A ALA A 1 8   ? -28.134 -20.367 -44.498 0.05 12.36 ? 7    ALA A CA    1  
ATOM   3      C  C     A ALA A 1 8   ? -28.458 -19.029 -43.846 0.05 12.27 ? 7    ALA A C     1  
ATOM   4      O  O     A ALA A 1 8   ? -28.049 -17.993 -44.346 0.05 12.29 ? 7    ALA A O     1  
ATOM   5      C  CB    A ALA A 1 8   ? -29.002 -21.458 -43.955 0.05 12.49 ? 7    ALA A CB    1  
ATOM   6      N  N     A HIS A 1 9   ? -29.208 -19.049 -42.745 0.05 12.19 ? 8    HIS A N     1  
ATOM   7      C  CA    A HIS A 1 9   ? -29.495 -17.827 -41.999 0.05 12.11 ? 8    HIS A CA    1  
ATOM   8      C  C     A HIS A 1 9   ? -28.420 -17.705 -40.932 0.05 11.92 ? 8    HIS A C     1  
ATOM   9      O  O     A HIS A 1 9   ? -28.378 -18.506 -40.005 0.05 11.85 ? 8    HIS A O     1  
ATOM   10     C  CB    A HIS A 1 9   ? -30.899 -17.842 -41.348 0.05 12.16 ? 8    HIS A CB    1  
ATOM   11     C  CG    A HIS A 1 9   ? -31.204 -16.645 -40.477 0.05 12.07 ? 8    HIS A CG    1  
ATOM   12     N  ND1   A HIS A 1 9   ? -30.325 -15.600 -40.283 0.05 11.97 ? 8    HIS A ND1   1  
ATOM   13     C  CD2   A HIS A 1 9   ? -32.306 -16.342 -39.747 0.05 12.08 ? 8    HIS A CD2   1  
ATOM   14     C  CE1   A HIS A 1 9   ? -30.871 -14.710 -39.473 0.05 11.92 ? 8    HIS A CE1   1  
ATOM   15     N  NE2   A HIS A 1 9   ? -32.071 -15.138 -39.130 0.05 11.98 ? 8    HIS A NE2   1  
ATOM   16     N  N     A ILE A 1 10  ? -27.535 -16.724 -41.093 0.05 11.87 ? 9    ILE A N     1  
ATOM   17     C  CA    A ILE A 1 10  ? -26.484 -16.476 -40.099 0.05 11.71 ? 9    ILE A CA    1  
ATOM   18     C  C     A ILE A 1 10  ? -26.822 -15.238 -39.281 0.05 11.65 ? 9    ILE A C     1  
ATOM   19     O  O     A ILE A 1 10  ? -26.948 -14.150 -39.827 0.05 11.70 ? 9    ILE A O     1  
ATOM   20     C  CB    A ILE A 1 10  ? -25.092 -16.289 -40.749 0.05 11.70 ? 9    ILE A CB    1  
ATOM   21     C  CG1   A ILE A 1 10  ? -24.551 -17.629 -41.267 0.05 11.75 ? 9    ILE A CG1   1  
ATOM   22     C  CG2   A ILE A 1 10  ? -24.096 -15.699 -39.727 0.05 11.56 ? 9    ILE A CG2   1  
ATOM   23     C  CD1   A ILE A 1 10  ? -23.366 -17.507 -42.231 0.05 11.80 ? 9    ILE A CD1   1  
ATOM   24     N  N     A ALA A 1 11  ? -26.945 -15.395 -37.965 0.05 11.54 ? 10   ALA A N     1  
ATOM   25     C  CA    A ALA A 1 11  ? -27.276 -14.270 -37.098 0.05 11.49 ? 10   ALA A CA    1  
ATOM   26     C  C     A ALA A 1 11  ? -26.096 -13.867 -36.215 0.05 11.37 ? 10   ALA A C     1  
ATOM   27     O  O     A ALA A 1 11  ? -25.717 -14.606 -35.306 0.05 11.29 ? 10   ALA A O     1  
ATOM   28     C  CB    A ALA A 1 11  ? -28.472 -14.605 -36.227 0.05 11.48 ? 10   ALA A CB    1  
ATOM   29     N  N     A MET A 1 12  ? -25.541 -12.693 -36.492 0.05 11.36 ? 11   MET A N     1  
ATOM   30     C  CA    A MET A 1 12  ? -24.437 -12.130 -35.717 0.05 11.27 ? 11   MET A CA    1  
ATOM   31     C  C     A MET A 1 12  ? -25.016 -11.349 -34.535 0.05 11.21 ? 11   MET A C     1  
ATOM   32     O  O     A MET A 1 12  ? -26.099 -10.800 -34.644 0.05 11.26 ? 11   MET A O     1  
ATOM   33     C  CB    A MET A 1 12  ? -23.611 -11.214 -36.628 0.05 11.32 ? 11   MET A CB    1  
ATOM   34     C  CG    A MET A 1 12  ? -22.538 -10.402 -35.927 0.05 11.24 ? 11   MET A CG    1  
ATOM   35     S  SD    A MET A 1 12  ? -21.278 -11.438 -35.170 0.05 11.14 ? 11   MET A SD    1  
ATOM   36     C  CE    A MET A 1 12  ? -20.188 -10.169 -34.514 0.05 11.10 ? 11   MET A CE    1  
ATOM   37     N  N     A PHE A 1 13  ? -24.313 -11.327 -33.401 0.05 11.11 ? 12   PHE A N     1  
ATOM   38     C  CA    A PHE A 1 13  ? -24.755 -10.593 -32.215 0.05 11.05 ? 12   PHE A CA    1  
ATOM   39     C  C     A PHE A 1 13  ? -23.595 -9.765  -31.691 0.05 11.00 ? 12   PHE A C     1  
ATOM   40     O  O     A PHE A 1 13  ? -22.479 -10.275 -31.590 0.05 10.96 ? 12   PHE A O     1  
ATOM   41     C  CB    A PHE A 1 13  ? -25.151 -11.565 -31.085 0.05 10.99 ? 12   PHE A CB    1  
ATOM   42     C  CG    A PHE A 1 13  ? -26.409 -12.347 -31.348 0.05 11.05 ? 12   PHE A CG    1  
ATOM   43     C  CD1   A PHE A 1 13  ? -26.413 -13.405 -32.241 0.05 11.09 ? 12   PHE A CD1   1  
ATOM   44     C  CD2   A PHE A 1 13  ? -27.581 -12.044 -30.667 0.05 11.06 ? 12   PHE A CD2   1  
ATOM   45     C  CE1   A PHE A 1 13  ? -27.572 -14.128 -32.477 0.05 11.16 ? 12   PHE A CE1   1  
ATOM   46     C  CE2   A PHE A 1 13  ? -28.742 -12.761 -30.902 0.05 11.13 ? 12   PHE A CE2   1  
ATOM   47     C  CZ    A PHE A 1 13  ? -28.733 -13.807 -31.808 0.05 11.18 ? 12   PHE A CZ    1  
ATOM   48     N  N     A SER A 1 14  ? -23.856 -8.511  -31.335 0.05 11.02 ? 13   SER A N     1  
ATOM   49     C  CA    A SER A 1 14  ? -22.881 -7.726  -30.587 0.05 10.98 ? 13   SER A CA    1  
ATOM   50     C  C     A SER A 1 14  ? -23.515 -6.598  -29.764 0.05 10.99 ? 13   SER A C     1  
ATOM   51     O  O     A SER A 1 14  ? -24.745 -6.530  -29.614 0.05 11.02 ? 13   SER A O     1  
ATOM   52     C  CB    A SER A 1 14  ? -21.778 -7.185  -31.503 0.05 11.02 ? 13   SER A CB    1  
ATOM   53     O  OG    A SER A 1 14  ? -20.632 -6.850  -30.728 0.05 10.98 ? 13   SER A OG    1  
ATOM   54     N  N     A ILE A 1 15  ? -22.659 -5.737  -29.215 0.05 10.98 ? 14   ILE A N     1  
ATOM   55     C  CA    A ILE A 1 15  ? -23.081 -4.593  -28.415 0.05 11.00 ? 14   ILE A CA    1  
ATOM   56     C  C     A ILE A 1 15  ? -22.659 -3.310  -29.125 0.05 11.09 ? 14   ILE A C     1  
ATOM   57     O  O     A ILE A 1 15  ? -21.892 -3.357  -30.086 0.05 11.12 ? 14   ILE A O     1  
ATOM   58     C  CB    A ILE A 1 15  ? -22.448 -4.613  -27.005 0.05 10.93 ? 14   ILE A CB    1  
ATOM   59     C  CG1   A ILE A 1 15  ? -20.921 -4.632  -27.097 0.05 10.91 ? 14   ILE A CG1   1  
ATOM   60     C  CG2   A ILE A 1 15  ? -22.919 -5.824  -26.209 0.05 10.86 ? 14   ILE A CG2   1  
ATOM   61     C  CD1   A ILE A 1 15  ? -20.235 -4.390  -25.772 0.05 10.88 ? 14   ILE A CD1   1  
ATOM   62     N  N     A ALA A 1 16  ? -23.150 -2.168  -28.656 0.05 11.14 ? 15   ALA A N     1  
ATOM   63     C  CA    A ALA A 1 16  ? -22.843 -0.899  -29.311 0.05 11.24 ? 15   ALA A CA    1  
ATOM   64     C  C     A ALA A 1 16  ? -21.509 -0.333  -28.844 0.05 11.24 ? 15   ALA A C     1  
ATOM   65     O  O     A ALA A 1 16  ? -21.471 0.676   -28.159 0.05 11.28 ? 15   ALA A O     1  
ATOM   66     C  CB    A ALA A 1 16  ? -23.949 0.109   -29.065 0.05 11.32 ? 15   ALA A CB    1  
ATOM   67     N  N     A ALA A 1 17  ? -20.421 -1.000  -29.208 0.05 11.20 ? 16   ALA A N     1  
ATOM   68     C  CA    A ALA A 1 17  ? -19.083 -0.512  -28.892 0.05 11.21 ? 16   ALA A CA    1  
ATOM   69     C  C     A ALA A 1 17  ? -18.210 -0.752  -30.110 0.05 11.25 ? 16   ALA A C     1  
ATOM   70     O  O     A ALA A 1 17  ? -18.201 -1.850  -30.657 0.05 11.21 ? 16   ALA A O     1  
ATOM   71     C  CB    A ALA A 1 17  ? -18.512 -1.236  -27.663 0.05 11.11 ? 16   ALA A CB    1  
ATOM   72     N  N     A HIS A 1 18  ? -17.491 0.280   -30.547 0.05 11.34 ? 17   HIS A N     1  
ATOM   73     C  CA    A HIS A 1 18  ? -16.679 0.162   -31.754 0.05 11.40 ? 17   HIS A CA    1  
ATOM   74     C  C     A HIS A 1 18  ? -15.730 -1.031  -31.696 0.05 11.32 ? 17   HIS A C     1  
ATOM   75     O  O     A HIS A 1 18  ? -15.609 -1.777  -32.657 0.05 11.33 ? 17   HIS A O     1  
ATOM   76     C  CB    A HIS A 1 18  ? -15.905 1.460   -32.022 0.05 11.53 ? 17   HIS A CB    1  
ATOM   77     C  CG    A HIS A 1 18  ? -16.707 2.506   -32.738 0.05 11.65 ? 17   HIS A CG    1  
ATOM   78     N  ND1   A HIS A 1 18  ? -17.695 3.241   -32.121 0.05 11.69 ? 17   HIS A ND1   1  
ATOM   79     C  CD2   A HIS A 1 18  ? -16.663 2.939   -34.020 0.05 11.76 ? 17   HIS A CD2   1  
ATOM   80     C  CE1   A HIS A 1 18  ? -18.228 4.080   -32.992 0.05 11.82 ? 17   HIS A CE1   1  
ATOM   81     N  NE2   A HIS A 1 18  ? -17.621 3.914   -34.154 0.05 11.86 ? 17   HIS A NE2   1  
ATOM   82     N  N     A GLY A 1 19  ? -15.094 -1.231  -30.550 0.05 11.25 ? 18   GLY A N     1  
ATOM   83     C  CA    A GLY A 1 19  ? -14.117 -2.292  -30.405 0.05 11.19 ? 18   GLY A CA    1  
ATOM   84     C  C     A GLY A 1 19  ? -14.694 -3.696  -30.448 0.05 11.10 ? 18   GLY A C     1  
ATOM   85     O  O     A GLY A 1 19  ? -13.943 -4.670  -30.511 0.05 11.06 ? 18   GLY A O     1  
ATOM   86     N  N     A HIS A 1 20  ? -16.021 -3.801  -30.413 0.05 11.08 ? 19   HIS A N     1  
ATOM   87     C  CA    A HIS A 1 20  ? -16.686 -5.098  -30.502 0.05 11.02 ? 19   HIS A CA    1  
ATOM   88     C  C     A HIS A 1 20  ? -17.538 -5.262  -31.760 0.05 11.07 ? 19   HIS A C     1  
ATOM   89     O  O     A HIS A 1 20  ? -18.246 -6.253  -31.912 0.05 11.04 ? 19   HIS A O     1  
ATOM   90     C  CB    A HIS A 1 20  ? -17.498 -5.370  -29.230 0.05 10.95 ? 19   HIS A CB    1  
ATOM   91     C  CG    A HIS A 1 20  ? -16.639 -5.552  -28.020 0.05 10.90 ? 19   HIS A CG    1  
ATOM   92     N  ND1   A HIS A 1 20  ? -15.940 -6.714  -27.779 0.05 10.85 ? 19   HIS A ND1   1  
ATOM   93     C  CD2   A HIS A 1 20  ? -16.314 -4.701  -27.019 0.05 10.90 ? 19   HIS A CD2   1  
ATOM   94     C  CE1   A HIS A 1 20  ? -15.238 -6.580  -26.668 0.05 10.82 ? 19   HIS A CE1   1  
ATOM   95     N  NE2   A HIS A 1 20  ? -15.450 -5.369  -26.185 0.05 10.86 ? 19   HIS A NE2   1  
ATOM   96     N  N     A VAL A 1 21  ? -17.452 -4.295  -32.670 0.05 11.17 ? 20   VAL A N     1  
ATOM   97     C  CA    A VAL A 1 21  ? -18.195 -4.385  -33.922 0.05 11.25 ? 20   VAL A CA    1  
ATOM   98     C  C     A VAL A 1 21  ? -17.260 -4.207  -35.118 0.05 11.33 ? 20   VAL A C     1  
ATOM   99     O  O     A VAL A 1 21  ? -17.237 -5.030  -36.041 0.05 11.36 ? 20   VAL A O     1  
ATOM   100    C  CB    A VAL A 1 21  ? -19.353 -3.365  -33.972 0.05 11.31 ? 20   VAL A CB    1  
ATOM   101    C  CG1   A VAL A 1 21  ? -19.968 -3.309  -35.374 0.05 11.42 ? 20   VAL A CG1   1  
ATOM   102    C  CG2   A VAL A 1 21  ? -20.419 -3.722  -32.931 0.05 11.23 ? 20   VAL A CG2   1  
ATOM   103    N  N     A ASN A 1 22  ? -16.467 -3.148  -35.088 0.05 11.39 ? 21   ASN A N     1  
ATOM   104    C  CA    A ASN A 1 22  ? -15.538 -2.883  -36.187 0.05 11.48 ? 21   ASN A CA    1  
ATOM   105    C  C     A ASN A 1 22  ? -14.590 -4.032  -36.558 0.05 11.45 ? 21   ASN A C     1  
ATOM   106    O  O     A ASN A 1 22  ? -14.339 -4.254  -37.749 0.05 11.53 ? 21   ASN A O     1  
ATOM   107    C  CB    A ASN A 1 22  ? -14.758 -1.583  -35.945 0.05 11.54 ? 21   ASN A CB    1  
ATOM   108    C  CG    A ASN A 1 22  ? -15.667 -0.397  -35.734 0.05 11.62 ? 21   ASN A CG    1  
ATOM   109    O  OD1   A ASN A 1 22  ? -15.273 0.609   -35.144 0.05 11.65 ? 21   ASN A OD1   1  
ATOM   110    N  ND2   A ASN A 1 22  ? -16.903 -0.515  -36.196 0.05 11.68 ? 21   ASN A ND2   1  
ATOM   111    N  N     A PRO A 1 23  ? -14.063 -4.774  -35.556 0.05 11.35 ? 22   PRO A N     1  
ATOM   112    C  CA    A PRO A 1 23  ? -13.163 -5.873  -35.919 0.05 11.33 ? 22   PRO A CA    1  
ATOM   113    C  C     A PRO A 1 23  ? -13.762 -6.893  -36.879 0.05 11.35 ? 22   PRO A C     1  
ATOM   114    O  O     A PRO A 1 23  ? -13.018 -7.448  -37.676 0.05 11.38 ? 22   PRO A O     1  
ATOM   115    C  CB    A PRO A 1 23  ? -12.884 -6.549  -34.572 0.05 11.22 ? 22   PRO A CB    1  
ATOM   116    C  CG    A PRO A 1 23  ? -12.959 -5.441  -33.601 0.05 11.21 ? 22   PRO A CG    1  
ATOM   117    C  CD    A PRO A 1 23  ? -14.069 -4.550  -34.096 0.05 11.26 ? 22   PRO A CD    1  
ATOM   118    N  N     A SER A 1 24  ? -15.066 -7.152  -36.808 0.05 11.33 ? 23   SER A N     1  
ATOM   119    C  CA    A SER A 1 24  ? -15.636 -8.224  -37.623 0.05 11.35 ? 23   SER A CA    1  
ATOM   120    C  C     A SER A 1 24  ? -16.531 -7.767  -38.775 0.05 11.46 ? 23   SER A C     1  
ATOM   121    O  O     A SER A 1 24  ? -17.173 -8.594  -39.401 0.05 11.49 ? 23   SER A O     1  
ATOM   122    C  CB    A SER A 1 24  ? -16.407 -9.230  -36.753 0.05 11.25 ? 23   SER A CB    1  
ATOM   123    O  OG    A SER A 1 24  ? -17.422 -8.575  -36.014 0.05 11.22 ? 23   SER A OG    1  
ATOM   124    N  N     A LEU A 1 25  ? -16.588 -6.473  -39.057 0.05 11.53 ? 24   LEU A N     1  
ATOM   125    C  CA    A LEU A 1 25  ? -17.449 -6.016  -40.154 0.05 11.65 ? 24   LEU A CA    1  
ATOM   126    C  C     A LEU A 1 25  ? -17.198 -6.743  -41.486 0.05 11.75 ? 24   LEU A C     1  
ATOM   127    O  O     A LEU A 1 25  ? -18.133 -7.275  -42.089 0.05 11.81 ? 24   LEU A O     1  
ATOM   128    C  CB    A LEU A 1 25  ? -17.353 -4.503  -40.343 0.05 11.74 ? 24   LEU A CB    1  
ATOM   129    C  CG    A LEU A 1 25  ? -18.080 -3.600  -39.342 0.05 11.71 ? 24   LEU A CG    1  
ATOM   130    C  CD1   A LEU A 1 25  ? -17.543 -2.193  -39.448 0.05 11.81 ? 24   LEU A CD1   1  
ATOM   131    C  CD2   A LEU A 1 25  ? -19.581 -3.611  -39.585 0.05 11.75 ? 24   LEU A CD2   1  
ATOM   132    N  N     A GLU A 1 26  ? -15.948 -6.784  -41.941 0.05 11.77 ? 25   GLU A N     1  
ATOM   133    C  CA    A GLU A 1 26  ? -15.676 -7.372  -43.256 0.05 11.87 ? 25   GLU A CA    1  
ATOM   134    C  C     A GLU A 1 26  ? -16.021 -8.867  -43.361 0.05 11.83 ? 25   GLU A C     1  
ATOM   135    O  O     A GLU A 1 26  ? -16.347 -9.349  -44.447 0.05 11.94 ? 25   GLU A O     1  
ATOM   136    C  CB    A GLU A 1 26  ? -14.227 -7.107  -43.707 0.05 11.93 ? 25   GLU A CB    1  
ATOM   137    C  CG    A GLU A 1 26  ? -13.889 -5.625  -43.925 0.05 12.01 ? 25   GLU A CG    1  
ATOM   138    C  CD    A GLU A 1 26  ? -14.579 -4.998  -45.138 0.05 12.17 ? 25   GLU A CD    1  
ATOM   139    O  OE1   A GLU A 1 26  ? -14.748 -3.761  -45.141 0.05 12.22 ? 25   GLU A OE1   1  
ATOM   140    O  OE2   A GLU A 1 26  ? -14.935 -5.719  -46.095 0.05 12.26 ? 25   GLU A OE2   1  
ATOM   141    N  N     A VAL A 1 27  ? -15.964 -9.602  -42.248 0.05 11.70 ? 26   VAL A N     1  
ATOM   142    C  CA    A VAL A 1 27  ? -16.291 -11.029 -42.302 0.05 11.67 ? 26   VAL A CA    1  
ATOM   143    C  C     A VAL A 1 27  ? -17.798 -11.221 -42.508 0.05 11.71 ? 26   VAL A C     1  
ATOM   144    O  O     A VAL A 1 27  ? -18.227 -12.113 -43.242 0.05 11.77 ? 26   VAL A O     1  
ATOM   145    C  CB    A VAL A 1 27  ? -15.778 -11.832 -41.065 0.05 11.53 ? 26   VAL A CB    1  
ATOM   146    C  CG1   A VAL A 1 27  ? -16.423 -11.370 -39.800 0.05 11.43 ? 26   VAL A CG1   1  
ATOM   147    C  CG2   A VAL A 1 27  ? -16.037 -13.313 -41.240 0.05 11.53 ? 26   VAL A CG2   1  
ATOM   148    N  N     A ILE A 1 28  ? -18.584 -10.365 -41.861 0.05 11.68 ? 27   ILE A N     1  
ATOM   149    C  CA    A ILE A 1 28  ? -20.026 -10.345 -42.060 0.05 11.73 ? 27   ILE A CA    1  
ATOM   150    C  C     A ILE A 1 28  ? -20.286 -10.119 -43.548 0.05 11.90 ? 27   ILE A C     1  
ATOM   151    O  O     A ILE A 1 28  ? -20.930 -10.937 -44.203 0.05 11.98 ? 27   ILE A O     1  
ATOM   152    C  CB    A ILE A 1 28  ? -20.681 -9.230  -41.221 0.05 11.68 ? 27   ILE A CB    1  
ATOM   153    C  CG1   A ILE A 1 28  ? -20.458 -9.495  -39.727 0.05 11.52 ? 27   ILE A CG1   1  
ATOM   154    C  CG2   A ILE A 1 28  ? -22.165 -9.097  -41.540 0.05 11.75 ? 27   ILE A CG2   1  
ATOM   155    C  CD1   A ILE A 1 28  ? -20.812 -10.904 -39.285 0.05 11.47 ? 27   ILE A CD1   1  
ATOM   156    N  N     A ARG A 1 29  ? -19.744 -9.016  -44.062 0.05 11.97 ? 28   ARG A N     1  
ATOM   157    C  CA    A ARG A 1 29  ? -19.777 -8.662  -45.485 0.05 12.15 ? 28   ARG A CA    1  
ATOM   158    C  C     A ARG A 1 29  ? -19.478 -9.825  -46.410 0.05 12.21 ? 28   ARG A C     1  
ATOM   159    O  O     A ARG A 1 29  ? -20.125 -9.994  -47.449 0.05 12.32 ? 28   ARG A O     1  
ATOM   160    C  CB    A ARG A 1 29  ? -18.739 -7.579  -45.773 0.05 12.21 ? 28   ARG A CB    1  
ATOM   161    C  CG    A ARG A 1 29  ? -19.281 -6.183  -45.829 0.05 12.30 ? 28   ARG A CG    1  
ATOM   162    C  CD    A ARG A 1 29  ? -18.243 -5.195  -46.352 0.05 12.44 ? 28   ARG A CD    1  
ATOM   163    N  NE    A ARG A 1 29  ? -18.562 -3.838  -45.913 0.05 12.48 ? 28   ARG A NE    1  
ATOM   164    C  CZ    A ARG A 1 29  ? -19.563 -3.114  -46.397 0.05 12.62 ? 28   ARG A CZ    1  
ATOM   165    N  NH1   A ARG A 1 29  ? -20.350 -3.604  -47.344 0.05 12.74 ? 28   ARG A NH1   1  
ATOM   166    N  NH2   A ARG A 1 29  ? -19.784 -1.899  -45.930 0.05 12.66 ? 28   ARG A NH2   1  
ATOM   167    N  N     A GLU A 1 30  ? -18.476 -10.611 -46.044 0.05 12.15 ? 29   GLU A N     1  
ATOM   168    C  CA    A GLU A 1 30  ? -18.038 -11.699 -46.906 0.05 12.21 ? 29   GLU A CA    1  
ATOM   169    C  C     A GLU A 1 30  ? -19.075 -12.810 -46.961 0.05 12.19 ? 29   GLU A C     1  
ATOM   170    O  O     A GLU A 1 30  ? -19.440 -13.256 -48.041 0.05 12.30 ? 29   GLU A O     1  
ATOM   171    C  CB    A GLU A 1 30  ? -16.667 -12.230 -46.481 0.05 12.13 ? 29   GLU A CB    1  
ATOM   172    C  CG    A GLU A 1 30  ? -16.158 -13.418 -47.298 0.05 12.21 ? 29   GLU A CG    1  
ATOM   173    C  CD    A GLU A 1 30  ? -15.881 -13.114 -48.764 0.05 12.40 ? 29   GLU A CD    1  
ATOM   174    O  OE1   A GLU A 1 30  ? -15.556 -14.065 -49.507 0.05 12.50 ? 29   GLU A OE1   1  
ATOM   175    O  OE2   A GLU A 1 30  ? -15.978 -11.941 -49.179 0.05 12.47 ? 29   GLU A OE2   1  
ATOM   176    N  N     A LEU A 1 31  ? -19.563 -13.235 -45.797 0.05 12.07 ? 30   LEU A N     1  
ATOM   177    C  CA    A LEU A 1 31  ? -20.601 -14.260 -45.731 0.05 12.05 ? 30   LEU A CA    1  
ATOM   178    C  C     A LEU A 1 31  ? -21.848 -13.824 -46.499 0.05 12.19 ? 30   LEU A C     1  
ATOM   179    O  O     A LEU A 1 31  ? -22.536 -14.649 -47.112 0.05 12.27 ? 30   LEU A O     1  
ATOM   180    C  CB    A LEU A 1 31  ? -20.948 -14.571 -44.276 0.05 11.90 ? 30   LEU A CB    1  
ATOM   181    C  CG    A LEU A 1 31  ? -19.767 -15.038 -43.425 0.05 11.80 ? 30   LEU A CG    1  
ATOM   182    C  CD1   A LEU A 1 31  ? -20.079 -14.846 -41.961 0.05 11.66 ? 30   LEU A CD1   1  
ATOM   183    C  CD2   A LEU A 1 31  ? -19.471 -16.498 -43.705 0.05 11.87 ? 30   LEU A CD2   1  
ATOM   184    N  N     A VAL A 1 32  ? -22.127 -12.524 -46.470 0.05 12.24 ? 31   VAL A N     1  
ATOM   185    C  CA    A VAL A 1 32  ? -23.205 -11.962 -47.265 0.05 12.39 ? 31   VAL A CA    1  
ATOM   186    C  C     A VAL A 1 32  ? -22.854 -12.069 -48.747 0.05 12.56 ? 31   VAL A C     1  
ATOM   187    O  O     A VAL A 1 32  ? -23.666 -12.516 -49.573 0.05 12.70 ? 31   VAL A O     1  
ATOM   188    C  CB    A VAL A 1 32  ? -23.455 -10.486 -46.896 0.05 12.40 ? 31   VAL A CB    1  
ATOM   189    C  CG1   A VAL A 1 32  ? -24.464 -9.862  -47.843 0.05 12.57 ? 31   VAL A CG1   1  
ATOM   190    C  CG2   A VAL A 1 32  ? -23.920 -10.380 -45.446 0.05 12.24 ? 31   VAL A CG2   1  
ATOM   191    N  N     A ALA A 1 33  ? -21.628 -11.680 -49.076 0.05 12.57 ? 32   ALA A N     1  
ATOM   192    C  CA    A ALA A 1 33  ? -21.174 -11.702 -50.460 0.05 12.75 ? 32   ALA A CA    1  
ATOM   193    C  C     A ALA A 1 33  ? -21.222 -13.120 -51.010 0.05 12.80 ? 32   ALA A C     1  
ATOM   194    O  O     A ALA A 1 33  ? -21.428 -13.320 -52.211 0.05 12.98 ? 32   ALA A O     1  
ATOM   195    C  CB    A ALA A 1 33  ? -19.766 -11.117 -50.578 0.05 12.73 ? 32   ALA A CB    1  
ATOM   196    N  N     A ARG A 1 34  ? -21.040 -14.096 -50.125 0.05 12.66 ? 33   ARG A N     1  
ATOM   197    C  CA    A ARG A 1 34  ? -21.138 -15.501 -50.490 0.05 12.72 ? 33   ARG A CA    1  
ATOM   198    C  C     A ARG A 1 34  ? -22.543 -15.771 -51.007 0.05 12.82 ? 33   ARG A C     1  
ATOM   199    O  O     A ARG A 1 34  ? -22.724 -16.303 -52.097 0.05 12.97 ? 33   ARG A O     1  
ATOM   200    C  CB    A ARG A 1 34  ? -20.877 -16.401 -49.279 0.05 12.55 ? 33   ARG A CB    1  
ATOM   201    C  CG    A ARG A 1 34  ? -19.556 -16.183 -48.563 0.05 12.43 ? 33   ARG A CG    1  
ATOM   202    C  CD    A ARG A 1 34  ? -18.371 -16.380 -49.462 0.05 12.53 ? 33   ARG A CD    1  
ATOM   203    N  NE    A ARG A 1 34  ? -17.111 -16.247 -48.740 0.05 12.43 ? 33   ARG A NE    1  
ATOM   204    C  CZ    A ARG A 1 34  ? -16.086 -17.083 -48.881 0.05 12.36 ? 33   ARG A CZ    1  
ATOM   205    N  NH1   A ARG A 1 34  ? -16.174 -18.108 -49.726 0.05 12.39 ? 33   ARG A NH1   1  
ATOM   206    N  NH2   A ARG A 1 34  ? -14.972 -16.892 -48.191 0.05 12.28 ? 33   ARG A NH2   1  
ATOM   207    N  N     A GLY A 1 35  ? -23.533 -15.382 -50.213 0.05 12.76 ? 34   GLY A N     1  
ATOM   208    C  CA    A GLY A 1 35  ? -24.926 -15.552 -50.577 0.05 12.87 ? 34   GLY A CA    1  
ATOM   209    C  C     A GLY A 1 35  ? -25.773 -16.007 -49.402 0.05 12.74 ? 34   GLY A C     1  
ATOM   210    O  O     A GLY A 1 35  ? -26.903 -16.435 -49.573 0.05 12.82 ? 34   GLY A O     1  
ATOM   211    N  N     A HIS A 1 36  ? -25.216 -15.935 -48.197 0.05 12.55 ? 35   HIS A N     1  
ATOM   212    C  CA    A HIS A 1 36  ? -25.968 -16.330 -47.023 0.05 12.44 ? 35   HIS A CA    1  
ATOM   213    C  C     A HIS A 1 36  ? -26.854 -15.172 -46.638 0.05 12.43 ? 35   HIS A C     1  
ATOM   214    O  O     A HIS A 1 36  ? -26.569 -14.025 -46.994 0.05 12.47 ? 35   HIS A O     1  
ATOM   215    C  CB    A HIS A 1 36  ? -25.027 -16.693 -45.878 0.05 12.25 ? 35   HIS A CB    1  
ATOM   216    C  CG    A HIS A 1 36  ? -23.983 -17.693 -46.263 0.05 12.26 ? 35   HIS A CG    1  
ATOM   217    N  ND1   A HIS A 1 36  ? -24.253 -19.039 -46.394 0.05 12.29 ? 35   HIS A ND1   1  
ATOM   218    C  CD2   A HIS A 1 36  ? -22.674 -17.538 -46.569 0.05 12.25 ? 35   HIS A CD2   1  
ATOM   219    C  CE1   A HIS A 1 36  ? -23.149 -19.671 -46.753 0.05 12.31 ? 35   HIS A CE1   1  
ATOM   220    N  NE2   A HIS A 1 36  ? -22.176 -18.785 -46.862 0.05 12.28 ? 35   HIS A NE2   1  
ATOM   221    N  N     A ARG A 1 37  ? -27.939 -15.476 -45.936 0.05 12.41 ? 36   ARG A N     1  
ATOM   222    C  CA    A ARG A 1 37  ? -28.794 -14.446 -45.372 0.05 12.39 ? 36   ARG A CA    1  
ATOM   223    C  C     A ARG A 1 37  ? -28.239 -14.130 -43.996 0.05 12.20 ? 36   ARG A C     1  
ATOM   224    O  O     A ARG A 1 37  ? -28.214 -14.997 -43.126 0.05 12.10 ? 36   ARG A O     1  
ATOM   225    C  CB    A ARG A 1 37  ? -30.241 -14.943 -45.267 0.05 12.47 ? 36   ARG A CB    1  
ATOM   226    C  CG    A ARG A 1 37  ? -31.241 -13.891 -44.787 0.05 12.50 ? 36   ARG A CG    1  
ATOM   227    C  CD    A ARG A 1 37  ? -32.693 -14.329 -45.037 0.05 12.65 ? 36   ARG A CD    1  
ATOM   228    N  NE    A ARG A 1 37  ? -33.027 -15.592 -44.376 0.05 12.60 ? 36   ARG A NE    1  
ATOM   229    C  CZ    A ARG A 1 37  ? -33.634 -15.690 -43.194 0.05 12.51 ? 36   ARG A CZ    1  
ATOM   230    N  NH1   A ARG A 1 37  ? -33.979 -14.600 -42.526 0.05 12.46 ? 36   ARG A NH1   1  
ATOM   231    N  NH2   A ARG A 1 37  ? -33.895 -16.881 -42.679 0.05 12.48 ? 36   ARG A NH2   1  
ATOM   232    N  N     A VAL A 1 38  ? -27.776 -12.900 -43.807 0.05 12.16 ? 37   VAL A N     1  
ATOM   233    C  CA    A VAL A 1 38  ? -27.109 -12.543 -42.565 0.05 11.99 ? 37   VAL A CA    1  
ATOM   234    C  C     A VAL A 1 38  ? -27.851 -11.429 -41.833 0.05 11.97 ? 37   VAL A C     1  
ATOM   235    O  O     A VAL A 1 38  ? -28.153 -10.379 -42.406 0.05 12.09 ? 37   VAL A O     1  
ATOM   236    C  CB    A VAL A 1 38  ? -25.646 -12.139 -42.815 0.05 11.95 ? 37   VAL A CB    1  
ATOM   237    C  CG1   A VAL A 1 38  ? -24.995 -11.647 -41.525 0.05 11.79 ? 37   VAL A CG1   1  
ATOM   238    C  CG2   A VAL A 1 38  ? -24.873 -13.315 -43.394 0.05 11.98 ? 37   VAL A CG2   1  
ATOM   239    N  N     A THR A 1 39  ? -28.186 -11.686 -40.572 0.05 11.85 ? 38   THR A N     1  
ATOM   240    C  CA    A THR A 1 39  ? -28.795 -10.665 -39.735 0.05 11.82 ? 38   THR A CA    1  
ATOM   241    C  C     A THR A 1 39  ? -27.880 -10.377 -38.560 0.05 11.67 ? 38   THR A C     1  
ATOM   242    O  O     A THR A 1 39  ? -27.022 -11.194 -38.224 0.05 11.58 ? 38   THR A O     1  
ATOM   243    C  CB    A THR A 1 39  ? -30.188 -11.076 -39.215 0.05 11.85 ? 38   THR A CB    1  
ATOM   244    O  OG1   A THR A 1 39  ? -30.066 -12.148 -38.277 0.05 11.74 ? 38   THR A OG1   1  
ATOM   245    C  CG2   A THR A 1 39  ? -31.066 -11.517 -40.367 0.05 12.02 ? 38   THR A CG2   1  
ATOM   246    N  N     A TYR A 1 40  ? -28.084 -9.221  -37.940 0.05 11.66 ? 39   TYR A N     1  
ATOM   247    C  CA    A TYR A 1 40  ? -27.139 -8.688  -36.961 0.05 11.54 ? 39   TYR A CA    1  
ATOM   248    C  C     A TYR A 1 40  ? -27.898 -7.988  -35.832 0.05 11.50 ? 39   TYR A C     1  
ATOM   249    O  O     A TYR A 1 40  ? -28.483 -6.927  -36.024 0.05 11.58 ? 39   TYR A O     1  
ATOM   250    C  CB    A TYR A 1 40  ? -26.185 -7.715  -37.666 0.05 11.59 ? 39   TYR A CB    1  
ATOM   251    C  CG    A TYR A 1 40  ? -24.856 -7.452  -36.968 0.05 11.49 ? 39   TYR A CG    1  
ATOM   252    C  CD1   A TYR A 1 40  ? -24.758 -7.420  -35.583 0.05 11.38 ? 39   TYR A CD1   1  
ATOM   253    C  CD2   A TYR A 1 40  ? -23.700 -7.231  -37.709 0.05 11.51 ? 39   TYR A CD2   1  
ATOM   254    C  CE1   A TYR A 1 40  ? -23.545 -7.177  -34.955 0.05 11.30 ? 39   TYR A CE1   1  
ATOM   255    C  CE2   A TYR A 1 40  ? -22.483 -6.982  -37.091 0.05 11.43 ? 39   TYR A CE2   1  
ATOM   256    C  CZ    A TYR A 1 40  ? -22.413 -6.956  -35.712 0.05 11.33 ? 39   TYR A CZ    1  
ATOM   257    O  OH    A TYR A 1 40  ? -21.204 -6.710  -35.097 0.05 11.27 ? 39   TYR A OH    1  
ATOM   258    N  N     A ALA A 1 41  ? -27.886 -8.599  -34.652 0.05 11.39 ? 40   ALA A N     1  
ATOM   259    C  CA    A ALA A 1 41  ? -28.514 -8.014  -33.477 0.05 11.35 ? 40   ALA A CA    1  
ATOM   260    C  C     A ALA A 1 41  ? -27.629 -6.929  -32.873 0.05 11.30 ? 40   ALA A C     1  
ATOM   261    O  O     A ALA A 1 41  ? -26.469 -7.172  -32.538 0.05 11.23 ? 40   ALA A O     1  
ATOM   262    C  CB    A ALA A 1 41  ? -28.804 -9.094  -32.445 0.05 11.26 ? 40   ALA A CB    1  
ATOM   263    N  N     A ILE A 1 42  ? -28.191 -5.740  -32.705 0.05 11.36 ? 41   ILE A N     1  
ATOM   264    C  CA    A ILE A 1 42  ? -27.402 -4.581  -32.309 0.05 11.35 ? 41   ILE A CA    1  
ATOM   265    C  C     A ILE A 1 42  ? -28.340 -3.514  -31.753 0.05 11.41 ? 41   ILE A C     1  
ATOM   266    O  O     A ILE A 1 42  ? -29.500 -3.442  -32.161 0.05 11.50 ? 41   ILE A O     1  
ATOM   267    C  CB    A ILE A 1 42  ? -26.635 -4.034  -33.542 0.05 11.43 ? 41   ILE A CB    1  
ATOM   268    C  CG1   A ILE A 1 42  ? -25.614 -2.974  -33.140 0.05 11.42 ? 41   ILE A CG1   1  
ATOM   269    C  CG2   A ILE A 1 42  ? -27.611 -3.486  -34.599 0.05 11.58 ? 41   ILE A CG2   1  
ATOM   270    C  CD1   A ILE A 1 42  ? -24.356 -3.530  -32.479 0.05 11.31 ? 41   ILE A CD1   1  
ATOM   271    N  N     A PRO A 1 43  ? -27.870 -2.696  -30.799 0.05 11.38 ? 42   PRO A N     1  
ATOM   272    C  CA    A PRO A 1 43  ? -28.747 -1.588  -30.409 0.05 11.46 ? 42   PRO A CA    1  
ATOM   273    C  C     A PRO A 1 43  ? -28.892 -0.573  -31.549 0.05 11.60 ? 42   PRO A C     1  
ATOM   274    O  O     A PRO A 1 43  ? -28.049 -0.560  -32.460 0.05 11.62 ? 42   PRO A O     1  
ATOM   275    C  CB    A PRO A 1 43  ? -28.024 -0.977  -29.202 0.05 11.39 ? 42   PRO A CB    1  
ATOM   276    C  CG    A PRO A 1 43  ? -27.214 -2.109  -28.652 0.05 11.26 ? 42   PRO A CG    1  
ATOM   277    C  CD    A PRO A 1 43  ? -26.737 -2.849  -29.868 0.05 11.27 ? 42   PRO A CD    1  
ATOM   278    N  N     A PRO A 1 44  ? -29.952 0.254   -31.511 0.05 11.70 ? 43   PRO A N     1  
ATOM   279    C  CA    A PRO A 1 44  ? -30.264 1.143   -32.640 0.05 11.86 ? 43   PRO A CA    1  
ATOM   280    C  C     A PRO A 1 44  ? -29.134 2.071   -33.084 0.05 11.92 ? 43   PRO A C     1  
ATOM   281    O  O     A PRO A 1 44  ? -29.085 2.384   -34.271 0.05 12.05 ? 43   PRO A O     1  
ATOM   282    C  CB    A PRO A 1 44  ? -31.452 1.964   -32.124 0.05 11.96 ? 43   PRO A CB    1  
ATOM   283    C  CG    A PRO A 1 44  ? -32.090 1.083   -31.101 0.05 11.85 ? 43   PRO A CG    1  
ATOM   284    C  CD    A PRO A 1 44  ? -30.955 0.366   -30.436 0.05 11.70 ? 43   PRO A CD    1  
ATOM   285    N  N     A VAL A 1 45  ? -28.249 2.495   -32.184 0.05 11.83 ? 44   VAL A N     1  
ATOM   286    C  CA    A VAL A 1 45  ? -27.203 3.447   -32.573 0.05 11.89 ? 44   VAL A CA    1  
ATOM   287    C  C     A VAL A 1 45  ? -26.317 2.891   -33.697 0.05 11.89 ? 44   VAL A C     1  
ATOM   288    O  O     A VAL A 1 45  ? -25.894 3.619   -34.598 0.05 12.00 ? 44   VAL A O     1  
ATOM   289    C  CB    A VAL A 1 45  ? -26.329 3.885   -31.365 0.05 11.81 ? 44   VAL A CB    1  
ATOM   290    C  CG1   A VAL A 1 45  ? -25.700 2.678   -30.682 0.05 11.65 ? 44   VAL A CG1   1  
ATOM   291    C  CG2   A VAL A 1 45  ? -25.252 4.869   -31.808 0.05 11.91 ? 44   VAL A CG2   1  
ATOM   292    N  N     A PHE A 1 46  ? -26.065 1.589   -33.656 0.05 11.79 ? 45   PHE A N     1  
ATOM   293    C  CA    A PHE A 1 46  ? -25.170 0.958   -34.616 0.05 11.78 ? 45   PHE A CA    1  
ATOM   294    C  C     A PHE A 1 46  ? -25.923 0.241   -35.736 0.05 11.84 ? 45   PHE A C     1  
ATOM   295    O  O     A PHE A 1 46  ? -25.310 -0.457  -36.547 0.05 11.83 ? 45   PHE A O     1  
ATOM   296    C  CB    A PHE A 1 46  ? -24.243 -0.044  -33.913 0.05 11.62 ? 45   PHE A CB    1  
ATOM   297    C  CG    A PHE A 1 46  ? -22.888 0.505   -33.531 0.05 11.60 ? 45   PHE A CG    1  
ATOM   298    C  CD1   A PHE A 1 46  ? -22.545 1.819   -33.777 0.05 11.72 ? 45   PHE A CD1   1  
ATOM   299    C  CD2   A PHE A 1 46  ? -21.945 -0.326  -32.948 0.05 11.48 ? 45   PHE A CD2   1  
ATOM   300    C  CE1   A PHE A 1 46  ? -21.299 2.302   -33.418 0.05 11.71 ? 45   PHE A CE1   1  
ATOM   301    C  CE2   A PHE A 1 46  ? -20.699 0.144   -32.583 0.05 11.47 ? 45   PHE A CE2   1  
ATOM   302    C  CZ    A PHE A 1 46  ? -20.369 1.461   -32.817 0.05 11.59 ? 45   PHE A CZ    1  
ATOM   303    N  N     A ALA A 1 47  ? -27.246 0.395   -35.776 0.05 11.91 ? 46   ALA A N     1  
ATOM   304    C  CA    A ALA A 1 47  ? -28.050 -0.197  -36.843 0.05 12.00 ? 46   ALA A CA    1  
ATOM   305    C  C     A ALA A 1 47  ? -27.494 0.119   -38.238 0.05 12.12 ? 46   ALA A C     1  
ATOM   306    O  O     A ALA A 1 47  ? -27.330 -0.785  -39.062 0.05 12.14 ? 46   ALA A O     1  
ATOM   307    C  CB    A ALA A 1 47  ? -29.494 0.261   -36.738 0.05 12.09 ? 46   ALA A CB    1  
ATOM   308    N  N     A ASP A 1 48  ? -27.198 1.393   -38.486 0.05 12.23 ? 47   ASP A N     1  
ATOM   309    C  CA    A ASP A 1 48  ? -26.706 1.848   -39.788 0.05 12.37 ? 47   ASP A CA    1  
ATOM   310    C  C     A ASP A 1 48  ? -25.277 1.382   -40.050 0.05 12.30 ? 47   ASP A C     1  
ATOM   311    O  O     A ASP A 1 48  ? -24.905 1.114   -41.193 0.05 12.38 ? 47   ASP A O     1  
ATOM   312    C  CB    A ASP A 1 48  ? -26.760 3.381   -39.892 0.05 12.52 ? 47   ASP A CB    1  
ATOM   313    C  CG    A ASP A 1 48  ? -28.176 3.929   -39.881 0.05 12.63 ? 47   ASP A CG    1  
ATOM   314    O  OD1   A ASP A 1 48  ? -28.862 3.848   -40.923 0.05 12.67 ? 47   ASP A OD1   1  
ATOM   315    O  OD2   A ASP A 1 48  ? -28.594 4.480   -38.838 0.05 12.70 ? 47   ASP A OD2   1  
ATOM   316    N  N     A LYS A 1 49  ? -24.478 1.288   -38.985 0.05 12.17 ? 48   LYS A N     1  
ATOM   317    C  CA    A LYS A 1 49  ? -23.110 0.788   -39.099 0.05 12.09 ? 48   LYS A CA    1  
ATOM   318    C  C     A LYS A 1 49  ? -23.079 -0.641  -39.624 0.05 12.03 ? 48   LYS A C     1  
ATOM   319    O  O     A LYS A 1 49  ? -22.331 -0.957  -40.552 0.05 12.08 ? 48   LYS A O     1  
ATOM   320    C  CB    A LYS A 1 49  ? -22.366 0.878   -37.760 0.05 11.95 ? 48   LYS A CB    1  
ATOM   321    C  CG    A LYS A 1 49  ? -21.104 0.018   -37.712 0.05 11.85 ? 48   LYS A CG    1  
ATOM   322    C  CD    A LYS A 1 49  ? -20.375 0.131   -36.374 0.05 11.73 ? 48   LYS A CD    1  
ATOM   323    C  CE    A LYS A 1 49  ? -19.540 1.393   -36.293 0.05 11.79 ? 48   LYS A CE    1  
ATOM   324    N  NZ    A LYS A 1 49  ? -18.500 1.467   -37.365 0.05 11.88 ? 48   LYS A NZ    1  
ATOM   325    N  N     A VAL A 1 50  ? -23.890 -1.513  -39.040 0.05 11.93 ? 49   VAL A N     1  
ATOM   326    C  CA    A VAL A 1 50  ? -23.883 -2.898  -39.480 0.05 11.88 ? 49   VAL A CA    1  
ATOM   327    C  C     A VAL A 1 50  ? -24.637 -3.072  -40.804 0.05 12.02 ? 49   VAL A C     1  
ATOM   328    O  O     A VAL A 1 50  ? -24.314 -3.966  -41.590 0.05 12.03 ? 49   VAL A O     1  
ATOM   329    C  CB    A VAL A 1 50  ? -24.418 -3.870  -38.395 0.05 11.74 ? 49   VAL A CB    1  
ATOM   330    C  CG1   A VAL A 1 50  ? -24.141 -3.313  -37.008 0.05 11.64 ? 49   VAL A CG1   1  
ATOM   331    C  CG2   A VAL A 1 50  ? -25.901 -4.149  -38.574 0.05 11.80 ? 49   VAL A CG2   1  
ATOM   332    N  N     A ALA A 1 51  ? -25.623 -2.214  -41.050 0.05 12.15 ? 50   ALA A N     1  
ATOM   333    C  CA    A ALA A 1 51  ? -26.445 -2.331  -42.253 0.05 12.30 ? 50   ALA A CA    1  
ATOM   334    C  C     A ALA A 1 51  ? -25.608 -2.121  -43.511 0.05 12.42 ? 50   ALA A C     1  
ATOM   335    O  O     A ALA A 1 51  ? -25.900 -2.695  -44.554 0.05 12.52 ? 50   ALA A O     1  
ATOM   336    C  CB    A ALA A 1 51  ? -27.613 -1.348  -42.216 0.05 12.43 ? 50   ALA A CB    1  
ATOM   337    N  N     A ALA A 1 52  ? -24.542 -1.333  -43.391 0.05 12.40 ? 51   ALA A N     1  
ATOM   338    C  CA    A ALA A 1 52  ? -23.672 -1.034  -44.535 0.05 12.53 ? 51   ALA A CA    1  
ATOM   339    C  C     A ALA A 1 52  ? -23.113 -2.293  -45.193 0.05 12.49 ? 51   ALA A C     1  
ATOM   340    O  O     A ALA A 1 52  ? -22.569 -2.233  -46.298 0.05 12.61 ? 51   ALA A O     1  
ATOM   341    C  CB    A ALA A 1 52  ? -22.531 -0.123  -44.105 0.05 12.52 ? 51   ALA A CB    1  
ATOM   342    N  N     A THR A 1 53  ? -23.254 -3.425  -44.508 0.05 12.34 ? 52   THR A N     1  
ATOM   343    C  CA    A THR A 1 53  ? -22.625 -4.680  -44.901 0.05 12.29 ? 52   THR A CA    1  
ATOM   344    C  C     A THR A 1 53  ? -23.587 -5.673  -45.545 0.05 12.38 ? 52   THR A C     1  
ATOM   345    O  O     A THR A 1 53  ? -23.247 -6.849  -45.735 0.05 12.37 ? 52   THR A O     1  
ATOM   346    C  CB    A THR A 1 53  ? -22.019 -5.361  -43.677 0.05 12.10 ? 52   THR A CB    1  
ATOM   347    O  OG1   A THR A 1 53  ? -23.070 -5.914  -42.873 0.05 12.03 ? 52   THR A OG1   1  
ATOM   348    C  CG2   A THR A 1 53  ? -21.226 -4.358  -42.845 0.05 12.02 ? 52   THR A CG2   1  
ATOM   349    N  N     A GLY A 1 54  ? -24.793 -5.212  -45.862 0.05 12.46 ? 53   GLY A N     1  
ATOM   350    C  CA    A GLY A 1 54  ? -25.828 -6.076  -46.399 0.05 12.54 ? 53   GLY A CA    1  
ATOM   351    C  C     A GLY A 1 54  ? -26.639 -6.727  -45.292 0.05 12.42 ? 53   GLY A C     1  
ATOM   352    O  O     A GLY A 1 54  ? -27.844 -6.956  -45.444 0.05 12.48 ? 53   GLY A O     1  
ATOM   353    N  N     A ALA A 1 55  ? -25.968 -7.022  -44.178 0.05 12.24 ? 54   ALA A N     1  
ATOM   354    C  CA    A ALA A 1 55  ? -26.596 -7.633  -43.008 0.05 12.12 ? 54   ALA A CA    1  
ATOM   355    C  C     A ALA A 1 55  ? -27.888 -6.927  -42.637 0.05 12.18 ? 54   ALA A C     1  
ATOM   356    O  O     A ALA A 1 55  ? -27.968 -5.705  -42.735 0.05 12.25 ? 54   ALA A O     1  
ATOM   357    C  CB    A ALA A 1 55  ? -25.643 -7.594  -41.825 0.05 11.95 ? 54   ALA A CB    1  
ATOM   358    N  N     A ARG A 1 56  ? -28.901 -7.692  -42.227 0.05 12.16 ? 55   ARG A N     1  
ATOM   359    C  CA    A ARG A 1 56  ? -30.135 -7.080  -41.753 0.05 12.21 ? 55   ARG A CA    1  
ATOM   360    C  C     A ARG A 1 56  ? -30.066 -6.846  -40.254 0.05 12.06 ? 55   ARG A C     1  
ATOM   361    O  O     A ARG A 1 56  ? -29.918 -7.790  -39.485 0.05 11.95 ? 55   ARG A O     1  
ATOM   362    C  CB    A ARG A 1 56  ? -31.373 -7.926  -42.079 0.05 12.30 ? 55   ARG A CB    1  
ATOM   363    C  CG    A ARG A 1 56  ? -32.676 -7.225  -41.675 0.05 12.39 ? 55   ARG A CG    1  
ATOM   364    C  CD    A ARG A 1 56  ? -33.952 -8.001  -42.033 0.05 12.48 ? 55   ARG A CD    1  
ATOM   365    N  NE    A ARG A 1 56  ? -34.220 -9.128  -41.142 0.05 12.36 ? 55   ARG A NE    1  
ATOM   366    C  CZ    A ARG A 1 56  ? -34.757 -9.029  -39.927 0.05 12.29 ? 55   ARG A CZ    1  
ATOM   367    N  NH1   A ARG A 1 56  ? -35.080 -7.845  -39.425 0.05 12.31 ? 55   ARG A NH1   1  
ATOM   368    N  NH2   A ARG A 1 56  ? -34.959 -10.124 -39.206 0.05 12.19 ? 55   ARG A NH2   1  
ATOM   369    N  N     A PRO A 1 57  ? -30.182 -5.582  -39.834 0.05 12.07 ? 56   PRO A N     1  
ATOM   370    C  CA    A PRO A 1 57  ? -30.135 -5.283  -38.400 0.05 11.94 ? 56   PRO A CA    1  
ATOM   371    C  C     A PRO A 1 57  ? -31.356 -5.833  -37.673 0.05 11.92 ? 56   PRO A C     1  
ATOM   372    O  O     A PRO A 1 57  ? -32.439 -5.911  -38.262 0.05 12.03 ? 56   PRO A O     1  
ATOM   373    C  CB    A PRO A 1 57  ? -30.156 -3.753  -38.352 0.05 12.00 ? 56   PRO A CB    1  
ATOM   374    C  CG    A PRO A 1 57  ? -29.841 -3.291  -39.746 0.05 12.13 ? 56   PRO A CG    1  
ATOM   375    C  CD    A PRO A 1 57  ? -30.317 -4.372  -40.659 0.05 12.21 ? 56   PRO A CD    1  
ATOM   376    N  N     A VAL A 1 58  ? -31.171 -6.203  -36.408 0.05 11.79 ? 57   VAL A N     1  
ATOM   377    C  CA    A VAL A 1 58  ? -32.259 -6.640  -35.530 0.05 11.77 ? 57   VAL A CA    1  
ATOM   378    C  C     A VAL A 1 58  ? -32.084 -5.910  -34.200 0.05 11.69 ? 57   VAL A C     1  
ATOM   379    O  O     A VAL A 1 58  ? -31.169 -6.233  -33.437 0.05 11.56 ? 57   VAL A O     1  
ATOM   380    C  CB    A VAL A 1 58  ? -32.181 -8.148  -35.272 0.05 11.70 ? 57   VAL A CB    1  
ATOM   381    C  CG1   A VAL A 1 58  ? -33.330 -8.597  -34.386 0.05 11.71 ? 57   VAL A CG1   1  
ATOM   382    C  CG2   A VAL A 1 58  ? -32.182 -8.935  -36.591 0.05 11.78 ? 57   VAL A CG2   1  
ATOM   383    N  N     A LEU A 1 59  ? -32.947 -4.931  -33.931 0.05 11.76 ? 58   LEU A N     1  
ATOM   384    C  CA    A LEU A 1 59  ? -32.724 -3.933  -32.872 0.05 11.72 ? 58   LEU A CA    1  
ATOM   385    C  C     A LEU A 1 59  ? -33.176 -4.308  -31.458 0.05 11.63 ? 58   LEU A C     1  
ATOM   386    O  O     A LEU A 1 59  ? -34.370 -4.312  -31.157 0.05 11.69 ? 58   LEU A O     1  
ATOM   387    C  CB    A LEU A 1 59  ? -33.412 -2.613  -33.244 0.05 11.87 ? 58   LEU A CB    1  
ATOM   388    C  CG    A LEU A 1 59  ? -32.956 -1.894  -34.516 0.05 11.97 ? 58   LEU A CG    1  
ATOM   389    C  CD1   A LEU A 1 59  ? -33.605 -0.518  -34.631 0.05 12.11 ? 58   LEU A CD1   1  
ATOM   390    C  CD2   A LEU A 1 59  ? -31.440 -1.795  -34.551 0.05 11.86 ? 58   LEU A CD2   1  
ATOM   391    N  N     A TYR A 1 60  ? -32.224 -4.571  -30.570 0.05 11.50 ? 59   TYR A N     1  
ATOM   392    C  CA    A TYR A 1 60  ? -32.554 -4.708  -29.155 0.05 11.43 ? 59   TYR A CA    1  
ATOM   393    C  C     A TYR A 1 60  ? -32.052 -3.502  -28.360 0.05 11.41 ? 59   TYR A C     1  
ATOM   394    O  O     A TYR A 1 60  ? -31.178 -2.753  -28.813 0.05 11.41 ? 59   TYR A O     1  
ATOM   395    C  CB    A TYR A 1 60  ? -32.010 -6.017  -28.579 0.05 11.31 ? 59   TYR A CB    1  
ATOM   396    C  CG    A TYR A 1 60  ? -30.526 -5.982  -28.294 0.05 11.22 ? 59   TYR A CG    1  
ATOM   397    C  CD1   A TYR A 1 60  ? -29.607 -5.910  -29.327 0.05 11.22 ? 59   TYR A CD1   1  
ATOM   398    C  CD2   A TYR A 1 60  ? -30.053 -6.024  -26.995 0.05 11.13 ? 59   TYR A CD2   1  
ATOM   399    C  CE1   A TYR A 1 60  ? -28.250 -5.874  -29.069 0.05 11.15 ? 59   TYR A CE1   1  
ATOM   400    C  CE2   A TYR A 1 60  ? -28.700 -5.986  -26.725 0.05 11.06 ? 59   TYR A CE2   1  
ATOM   401    C  CZ    A TYR A 1 60  ? -27.806 -5.905  -27.767 0.05 11.07 ? 59   TYR A CZ    1  
ATOM   402    O  OH    A TYR A 1 60  ? -26.460 -5.876  -27.503 0.05 11.01 ? 59   TYR A OH    1  
ATOM   403    N  N     A HIS A 1 61  ? -32.626 -3.296  -27.184 0.05 11.40 ? 60   HIS A N     1  
ATOM   404    C  CA    A HIS A 1 61  ? -32.208 -2.201  -26.318 0.05 11.40 ? 60   HIS A CA    1  
ATOM   405    C  C     A HIS A 1 61  ? -31.082 -2.661  -25.390 0.05 11.28 ? 60   HIS A C     1  
ATOM   406    O  O     A HIS A 1 61  ? -31.169 -3.731  -24.797 0.05 11.20 ? 60   HIS A O     1  
ATOM   407    C  CB    A HIS A 1 61  ? -33.394 -1.716  -25.486 0.05 11.47 ? 60   HIS A CB    1  
ATOM   408    C  CG    A HIS A 1 61  ? -33.030 -0.708  -24.444 0.05 11.46 ? 60   HIS A CG    1  
ATOM   409    N  ND1   A HIS A 1 61  ? -32.787 0.616   -24.743 0.05 11.55 ? 60   HIS A ND1   1  
ATOM   410    C  CD2   A HIS A 1 61  ? -32.869 -0.829  -23.104 0.05 11.40 ? 60   HIS A CD2   1  
ATOM   411    C  CE1   A HIS A 1 61  ? -32.488 1.266   -23.631 0.05 11.53 ? 60   HIS A CE1   1  
ATOM   412    N  NE2   A HIS A 1 61  ? -32.537 0.414   -22.622 0.05 11.45 ? 60   HIS A NE2   1  
ATOM   413    N  N     A SER A 1 62  ? -30.036 -1.848  -25.265 0.05 11.27 ? 61   SER A N     1  
ATOM   414    C  CA    A SER A 1 62  ? -28.914 -2.150  -24.372 0.05 11.17 ? 61   SER A CA    1  
ATOM   415    C  C     A SER A 1 62  ? -28.952 -1.279  -23.124 0.05 11.19 ? 61   SER A C     1  
ATOM   416    O  O     A SER A 1 62  ? -29.548 -0.199  -23.135 0.05 11.28 ? 61   SER A O     1  
ATOM   417    C  CB    A SER A 1 62  ? -27.588 -1.922  -25.106 0.05 11.16 ? 61   SER A CB    1  
ATOM   418    O  OG    A SER A 1 62  ? -26.467 -2.302  -24.327 0.05 11.08 ? 61   SER A OG    1  
ATOM   419    N  N     A THR A 1 63  ? -28.308 -1.750  -22.056 0.05 11.11 ? 62   THR A N     1  
ATOM   420    C  CA    A THR A 1 63  ? -28.153 -0.980  -20.822 0.05 11.13 ? 62   THR A CA    1  
ATOM   421    C  C     A THR A 1 63  ? -26.689 -0.615  -20.558 0.05 11.10 ? 62   THR A C     1  
ATOM   422    O  O     A THR A 1 63  ? -26.360 0.012   -19.550 0.05 11.13 ? 62   THR A O     1  
ATOM   423    C  CB    A THR A 1 63  ? -28.713 -1.724  -19.597 0.05 11.09 ? 62   THR A CB    1  
ATOM   424    O  OG1   A THR A 1 63  ? -27.921 -2.896  -19.332 0.05 11.00 ? 62   THR A OG1   1  
ATOM   425    C  CG2   A THR A 1 63  ? -30.182 -2.118  -19.828 0.05 11.13 ? 62   THR A CG2   1  
ATOM   426    N  N     A LEU A 1 64  ? -25.819 -1.011  -21.479 0.05 11.06 ? 63   LEU A N     1  
ATOM   427    C  CA    A LEU A 1 64  ? -24.401 -0.682  -21.405 0.05 11.04 ? 63   LEU A CA    1  
ATOM   428    C  C     A LEU A 1 64  ? -24.172 0.761   -21.862 0.05 11.14 ? 63   LEU A C     1  
ATOM   429    O  O     A LEU A 1 64  ? -25.035 1.340   -22.531 0.05 11.21 ? 63   LEU A O     1  
ATOM   430    C  CB    A LEU A 1 64  ? -23.624 -1.650  -22.296 0.05 10.98 ? 63   LEU A CB    1  
ATOM   431    C  CG    A LEU A 1 64  ? -23.652 -3.122  -21.884 0.05 10.90 ? 63   LEU A CG    1  
ATOM   432    C  CD1   A LEU A 1 64  ? -23.120 -3.983  -23.024 0.05 10.87 ? 63   LEU A CD1   1  
ATOM   433    C  CD2   A LEU A 1 64  ? -22.866 -3.366  -20.599 0.05 10.86 ? 63   LEU A CD2   1  
ATOM   434    N  N     A PRO A 1 65  ? -23.017 1.353   -21.499 0.05 11.16 ? 64   PRO A N     1  
ATOM   435    C  CA    A PRO A 1 65  ? -22.691 2.698   -21.993 0.05 11.27 ? 64   PRO A CA    1  
ATOM   436    C  C     A PRO A 1 65  ? -22.730 2.774   -23.528 0.05 11.29 ? 64   PRO A C     1  
ATOM   437    O  O     A PRO A 1 65  ? -22.553 1.759   -24.210 0.05 11.22 ? 64   PRO A O     1  
ATOM   438    C  CB    A PRO A 1 65  ? -21.267 2.922   -21.472 0.05 11.27 ? 64   PRO A CB    1  
ATOM   439    C  CG    A PRO A 1 65  ? -21.206 2.073   -20.206 0.05 11.19 ? 64   PRO A CG    1  
ATOM   440    C  CD    A PRO A 1 65  ? -21.989 0.838   -20.571 0.05 11.10 ? 64   PRO A CD    1  
ATOM   441    N  N     A GLY A 1 66  ? -22.981 3.967   -24.061 0.05 11.41 ? 65   GLY A N     1  
ATOM   442    C  CA    A GLY A 1 66  ? -23.060 4.159   -25.502 0.05 11.46 ? 65   GLY A CA    1  
ATOM   443    C  C     A GLY A 1 66  ? -21.693 4.117   -26.154 0.05 11.46 ? 65   GLY A C     1  
ATOM   444    O  O     A GLY A 1 66  ? -20.682 4.242   -25.469 0.05 11.43 ? 65   GLY A O     1  
ATOM   445    N  N     A PRO A 1 67  ? -21.651 3.921   -27.481 0.05 11.51 ? 66   PRO A N     1  
ATOM   446    C  CA    A PRO A 1 67  ? -20.371 3.816   -28.193 0.05 11.53 ? 66   PRO A CA    1  
ATOM   447    C  C     A PRO A 1 67  ? -19.530 5.078   -28.020 0.05 11.63 ? 66   PRO A C     1  
ATOM   448    O  O     A PRO A 1 67  ? -18.299 5.020   -27.950 0.05 11.63 ? 66   PRO A O     1  
ATOM   449    C  CB    A PRO A 1 67  ? -20.797 3.638   -29.663 0.05 11.58 ? 66   PRO A CB    1  
ATOM   450    C  CG    A PRO A 1 67  ? -22.207 4.109   -29.727 0.05 11.65 ? 66   PRO A CG    1  
ATOM   451    C  CD    A PRO A 1 67  ? -22.802 3.792   -28.390 0.05 11.57 ? 66   PRO A CD    1  
ATOM   452    N  N     A ASP A 1 68  ? -20.219 6.209   -27.932 0.05 11.74 ? 67   ASP A N     1  
ATOM   453    C  CA    A ASP A 1 68  ? -19.594 7.511   -27.753 0.05 11.87 ? 67   ASP A CA    1  
ATOM   454    C  C     A ASP A 1 68  ? -19.147 7.760   -26.306 0.05 11.85 ? 67   ASP A C     1  
ATOM   455    O  O     A ASP A 1 68  ? -18.168 8.467   -26.073 0.05 11.94 ? 67   ASP A O     1  
ATOM   456    C  CB    A ASP A 1 68  ? -20.558 8.612   -28.205 0.05 12.02 ? 67   ASP A CB    1  
ATOM   457    C  CG    A ASP A 1 68  ? -20.559 8.817   -29.713 0.05 12.13 ? 67   ASP A CG    1  
ATOM   458    O  OD1   A ASP A 1 68  ? -20.289 7.847   -30.461 0.05 12.06 ? 67   ASP A OD1   1  
ATOM   459    O  OD2   A ASP A 1 68  ? -20.833 9.959   -30.152 0.05 12.29 ? 67   ASP A OD2   1  
ATOM   460    N  N     A ALA A 1 69  ? -19.875 7.182   -25.348 0.05 11.75 ? 68   ALA A N     1  
ATOM   461    C  CA    A ALA A 1 69  ? -19.594 7.353   -23.917 0.05 11.73 ? 68   ALA A CA    1  
ATOM   462    C  C     A ALA A 1 69  ? -18.122 7.183   -23.527 0.05 11.71 ? 68   ALA A C     1  
ATOM   463    O  O     A ALA A 1 69  ? -17.364 6.486   -24.203 0.05 11.66 ? 68   ALA A O     1  
ATOM   464    C  CB    A ALA A 1 69  ? -20.470 6.410   -23.089 0.05 11.61 ? 68   ALA A CB    1  
ATOM   465    N  N     A ASP A 1 70  ? -17.733 7.817   -22.422 0.05 11.76 ? 69   ASP A N     1  
ATOM   466    C  CA    A ASP A 1 70  ? -16.355 7.783   -21.937 0.05 11.76 ? 69   ASP A CA    1  
ATOM   467    C  C     A ASP A 1 70  ? -15.900 6.355   -21.573 0.05 11.61 ? 69   ASP A C     1  
ATOM   468    O  O     A ASP A 1 70  ? -16.726 5.497   -21.261 0.05 11.52 ? 69   ASP A O     1  
ATOM   469    C  CB    A ASP A 1 70  ? -16.196 8.742   -20.750 0.05 11.87 ? 69   ASP A CB    1  
ATOM   470    C  CG    A ASP A 1 70  ? -15.072 9.739   -20.949 0.05 11.96 ? 69   ASP A CG    1  
ATOM   471    O  OD1   A ASP A 1 70  ? -15.224 10.654  -21.788 0.05 12.03 ? 69   ASP A OD1   1  
ATOM   472    O  OD2   A ASP A 1 70  ? -14.038 9.605   -20.262 0.05 11.98 ? 69   ASP A OD2   1  
ATOM   473    N  N     A PRO A 1 71  ? -14.587 6.084   -21.657 0.05 11.60 ? 70   PRO A N     1  
ATOM   474    C  CA    A PRO A 1 71  ? -14.060 4.753   -21.305 0.05 11.48 ? 70   PRO A CA    1  
ATOM   475    C  C     A PRO A 1 71  ? -14.272 4.407   -19.824 0.05 11.45 ? 70   PRO A C     1  
ATOM   476    O  O     A PRO A 1 71  ? -14.480 3.243   -19.471 0.05 11.34 ? 70   PRO A O     1  
ATOM   477    C  CB    A PRO A 1 71  ? -12.561 4.872   -21.601 0.05 11.53 ? 70   PRO A CB    1  
ATOM   478    C  CG    A PRO A 1 71  ? -12.453 5.982   -22.597 0.05 11.64 ? 70   PRO A CG    1  
ATOM   479    C  CD    A PRO A 1 71  ? -13.575 6.933   -22.310 0.05 11.70 ? 70   PRO A CD    1  
ATOM   480    N  N     A GLU A 1 72  ? -14.220 5.419   -18.966 0.05 11.55 ? 71   GLU A N     1  
ATOM   481    C  CA    A GLU A 1 72  ? -14.425 5.202   -17.540 0.05 11.54 ? 71   GLU A CA    1  
ATOM   482    C  C     A GLU A 1 72  ? -15.857 4.779   -17.213 0.05 11.46 ? 71   GLU A C     1  
ATOM   483    O  O     A GLU A 1 72  ? -16.130 4.291   -16.117 0.05 11.42 ? 71   GLU A O     1  
ATOM   484    C  CB    A GLU A 1 72  ? -14.028 6.447   -16.736 0.05 11.68 ? 71   GLU A CB    1  
ATOM   485    C  CG    A GLU A 1 72  ? -12.841 6.221   -15.825 0.05 11.73 ? 71   GLU A CG    1  
ATOM   486    C  CD    A GLU A 1 72  ? -11.514 6.749   -16.374 0.05 11.79 ? 71   GLU A CD    1  
ATOM   487    O  OE1   A GLU A 1 72  ? -11.367 6.893   -17.606 0.05 11.75 ? 71   GLU A OE1   1  
ATOM   488    O  OE2   A GLU A 1 72  ? -10.605 7.022   -15.554 0.05 11.88 ? 71   GLU A OE2   1  
ATOM   489    N  N     A ALA A 1 73  ? -16.763 4.955   -18.170 0.05 11.45 ? 72   ALA A N     1  
ATOM   490    C  CA    A ALA A 1 73  ? -18.161 4.592   -17.973 0.05 11.40 ? 72   ALA A CA    1  
ATOM   491    C  C     A ALA A 1 73  ? -18.325 3.083   -17.827 0.05 11.27 ? 72   ALA A C     1  
ATOM   492    O  O     A ALA A 1 73  ? -19.360 2.609   -17.370 0.05 11.22 ? 72   ALA A O     1  
ATOM   493    C  CB    A ALA A 1 73  ? -19.014 5.115   -19.117 0.05 11.44 ? 72   ALA A CB    1  
ATOM   494    N  N     A TRP A 1 74  ? -17.291 2.336   -18.208 0.05 11.22 ? 73   TRP A N     1  
ATOM   495    C  CA    A TRP A 1 74  ? -17.341 0.873   -18.160 0.05 11.11 ? 73   TRP A CA    1  
ATOM   496    C  C     A TRP A 1 74  ? -16.829 0.303   -16.842 0.05 11.09 ? 73   TRP A C     1  
ATOM   497    O  O     A TRP A 1 74  ? -16.723 -0.917  -16.679 0.05 11.02 ? 73   TRP A O     1  
ATOM   498    C  CB    A TRP A 1 74  ? -16.562 0.284   -19.337 0.05 11.08 ? 73   TRP A CB    1  
ATOM   499    C  CG    A TRP A 1 74  ? -17.177 0.643   -20.654 0.05 11.10 ? 73   TRP A CG    1  
ATOM   500    C  CD1   A TRP A 1 74  ? -17.014 1.816   -21.354 0.05 11.19 ? 73   TRP A CD1   1  
ATOM   501    C  CD2   A TRP A 1 74  ? -18.073 -0.164  -21.428 0.05 11.04 ? 73   TRP A CD2   1  
ATOM   502    N  NE1   A TRP A 1 74  ? -17.752 1.776   -22.513 0.05 11.19 ? 73   TRP A NE1   1  
ATOM   503    C  CE2   A TRP A 1 74  ? -18.415 0.576   -22.581 0.05 11.10 ? 73   TRP A CE2   1  
ATOM   504    C  CE3   A TRP A 1 74  ? -18.616 -1.444  -21.262 0.05 10.95 ? 73   TRP A CE3   1  
ATOM   505    C  CZ2   A TRP A 1 74  ? -19.273 0.076   -23.563 0.05 11.08 ? 73   TRP A CZ2   1  
ATOM   506    C  CZ3   A TRP A 1 74  ? -19.476 -1.935  -22.236 0.05 10.93 ? 73   TRP A CZ3   1  
ATOM   507    C  CH2   A TRP A 1 74  ? -19.789 -1.182  -23.371 0.05 10.99 ? 73   TRP A CH2   1  
ATOM   508    N  N     A GLY A 1 75  ? -16.512 1.186   -15.898 0.05 11.18 ? 74   GLY A N     1  
ATOM   509    C  CA    A GLY A 1 75  ? -16.066 0.751   -14.589 0.05 11.19 ? 74   GLY A CA    1  
ATOM   510    C  C     A GLY A 1 75  ? -14.561 0.607   -14.445 0.05 11.22 ? 74   GLY A C     1  
ATOM   511    O  O     A GLY A 1 75  ? -13.814 0.535   -15.427 0.05 11.21 ? 74   GLY A O     1  
ATOM   512    N  N     A SER A 1 76  ? -14.111 0.562   -13.198 0.05 11.26 ? 75   SER A N     1  
ATOM   513    C  CA    A SER A 1 76  ? -12.687 0.492   -12.918 0.05 11.31 ? 75   SER A CA    1  
ATOM   514    C  C     A SER A 1 76  ? -12.395 -0.404  -11.723 0.05 11.31 ? 75   SER A C     1  
ATOM   515    O  O     A SER A 1 76  ? -11.451 -0.158  -10.967 0.05 11.39 ? 75   SER A O     1  
ATOM   516    C  CB    A SER A 1 76  ? -12.131 1.900   -12.693 0.05 11.45 ? 75   SER A CB    1  
ATOM   517    O  OG    A SER A 1 76  ? -12.227 2.656   -13.888 0.05 11.47 ? 75   SER A OG    1  
ATOM   518    N  N     A THR A 1 77  ? -13.235 -1.421  -11.536 0.05 11.23 ? 76   THR A N     1  
ATOM   519    C  CA    A THR A 1 77  ? -12.941 -2.538  -10.641 0.05 11.21 ? 76   THR A CA    1  
ATOM   520    C  C     A THR A 1 77  ? -13.381 -3.811  -11.362 0.05 11.10 ? 76   THR A C     1  
ATOM   521    O  O     A THR A 1 77  ? -14.182 -3.746  -12.291 0.05 11.04 ? 76   THR A O     1  
ATOM   522    C  CB    A THR A 1 77  ? -13.694 -2.455  -9.289  0.05 11.26 ? 76   THR A CB    1  
ATOM   523    O  OG1   A THR A 1 77  ? -15.081 -2.743  -9.479  0.05 11.19 ? 76   THR A OG1   1  
ATOM   524    C  CG2   A THR A 1 77  ? -13.561 -1.071  -8.661  0.05 11.37 ? 76   THR A CG2   1  
ATOM   525    N  N     A LEU A 1 78  ? -12.866 -4.955  -10.926 0.05 11.09 ? 77   LEU A N     1  
ATOM   526    C  CA    A LEU A 1 78  ? -13.204 -6.233  -11.551 0.05 11.00 ? 77   LEU A CA    1  
ATOM   527    C  C     A LEU A 1 78  ? -14.713 -6.439  -11.610 0.05 10.95 ? 77   LEU A C     1  
ATOM   528    O  O     A LEU A 1 78  ? -15.277 -6.694  -12.669 0.05 10.89 ? 77   LEU A O     1  
ATOM   529    C  CB    A LEU A 1 78  ? -12.546 -7.386  -10.793 0.05 11.03 ? 77   LEU A CB    1  
ATOM   530    C  CG    A LEU A 1 78  ? -12.916 -8.793  -11.263 0.05 10.96 ? 77   LEU A CG    1  
ATOM   531    C  CD1   A LEU A 1 78  ? -12.555 -8.976  -12.726 0.05 10.90 ? 77   LEU A CD1   1  
ATOM   532    C  CD2   A LEU A 1 78  ? -12.233 -9.845  -10.400 0.05 11.00 ? 77   LEU A CD2   1  
ATOM   533    N  N     A LEU A 1 79  ? -15.372 -6.310  -10.467 0.05 10.99 ? 78   LEU A N     1  
ATOM   534    C  CA    A LEU A 1 79  ? -16.815 -6.502  -10.448 0.05 10.95 ? 78   LEU A CA    1  
ATOM   535    C  C     A LEU A 1 79  ? -17.581 -5.405  -11.202 0.05 10.94 ? 78   LEU A C     1  
ATOM   536    O  O     A LEU A 1 79  ? -18.615 -5.675  -11.811 0.05 10.89 ? 78   LEU A O     1  
ATOM   537    C  CB    A LEU A 1 79  ? -17.309 -6.716  -9.009  0.05 11.01 ? 78   LEU A CB    1  
ATOM   538    C  CG    A LEU A 1 79  ? -16.997 -8.154  -8.584  0.05 11.02 ? 78   LEU A CG    1  
ATOM   539    C  CD1   A LEU A 1 79  ? -16.767 -8.343  -7.081  0.05 11.10 ? 78   LEU A CD1   1  
ATOM   540    C  CD2   A LEU A 1 79  ? -18.149 -9.038  -9.051  0.05 10.95 ? 78   LEU A CD2   1  
ATOM   541    N  N     A ASP A 1 80  ? -17.085 -4.170  -11.188 0.05 11.00 ? 79   ASP A N     1  
ATOM   542    C  CA    A ASP A 1 80  ? -17.750 -3.132  -11.977 0.05 11.01 ? 79   ASP A CA    1  
ATOM   543    C  C     A ASP A 1 80  ? -17.544 -3.335  -13.480 0.05 10.95 ? 79   ASP A C     1  
ATOM   544    O  O     A ASP A 1 80  ? -18.338 -2.855  -14.286 0.05 10.94 ? 79   ASP A O     1  
ATOM   545    C  CB    A ASP A 1 80  ? -17.305 -1.728  -11.563 0.05 11.10 ? 79   ASP A CB    1  
ATOM   546    C  CG    A ASP A 1 80  ? -17.756 -1.367  -10.158 0.05 11.18 ? 79   ASP A CG    1  
ATOM   547    O  OD1   A ASP A 1 80  ? -18.897 -1.714  -9.769  0.05 11.17 ? 79   ASP A OD1   1  
ATOM   548    O  OD2   A ASP A 1 80  ? -16.958 -0.742  -9.440  0.05 11.25 ? 79   ASP A OD2   1  
ATOM   549    N  N     A ASN A 1 81  ? -16.481 -4.043  -13.852 0.05 10.92 ? 80   ASN A N     1  
ATOM   550    C  CA    A ASN A 1 81  ? -16.257 -4.362  -15.261 0.05 10.88 ? 80   ASN A CA    1  
ATOM   551    C  C     A ASN A 1 81  ? -17.200 -5.462  -15.744 0.05 10.81 ? 80   ASN A C     1  
ATOM   552    O  O     A ASN A 1 81  ? -17.767 -5.361  -16.826 0.05 10.78 ? 80   ASN A O     1  
ATOM   553    C  CB    A ASN A 1 81  ? -14.818 -4.814  -15.523 0.05 10.88 ? 80   ASN A CB    1  
ATOM   554    C  CG    A ASN A 1 81  ? -13.812 -3.691  -15.392 0.05 10.96 ? 80   ASN A CG    1  
ATOM   555    O  OD1   A ASN A 1 81  ? -14.136 -2.511  -15.588 0.05 11.00 ? 80   ASN A OD1   1  
ATOM   556    N  ND2   A ASN A 1 81  ? -12.580 -4.053  -15.068 0.05 10.99 ? 80   ASN A ND2   1  
ATOM   557    N  N     A VAL A 1 82  ? -17.348 -6.521  -14.951 0.05 10.78 ? 81   VAL A N     1  
ATOM   558    C  CA    A VAL A 1 82  ? -18.123 -7.681  -15.415 0.05 10.73 ? 81   VAL A CA    1  
ATOM   559    C  C     A VAL A 1 82  ? -19.629 -7.606  -15.148 0.05 10.73 ? 81   VAL A C     1  
ATOM   560    O  O     A VAL A 1 82  ? -20.419 -8.007  -15.996 0.05 10.70 ? 81   VAL A O     1  
ATOM   561    C  CB    A VAL A 1 82  ? -17.562 -9.032  -14.892 0.05 10.72 ? 81   VAL A CB    1  
ATOM   562    C  CG1   A VAL A 1 82  ? -16.111 -9.195  -15.301 0.05 10.73 ? 81   VAL A CG1   1  
ATOM   563    C  CG2   A VAL A 1 82  ? -17.723 -9.161  -13.369 0.05 10.76 ? 81   VAL A CG2   1  
ATOM   564    N  N     A GLU A 1 83  ? -20.028 -7.119  -13.976 0.05 10.77 ? 82   GLU A N     1  
ATOM   565    C  CA    A GLU A 1 83  ? -21.453 -7.038  -13.637 0.05 10.78 ? 82   GLU A CA    1  
ATOM   566    C  C     A GLU A 1 83  ? -22.357 -6.482  -14.740 0.05 10.78 ? 82   GLU A C     1  
ATOM   567    O  O     A GLU A 1 83  ? -23.425 -7.044  -15.002 0.05 10.77 ? 82   GLU A O     1  
ATOM   568    C  CB    A GLU A 1 83  ? -21.680 -6.250  -12.336 0.05 10.84 ? 82   GLU A CB    1  
ATOM   569    C  CG    A GLU A 1 83  ? -21.376 -7.012  -11.061 0.05 10.87 ? 82   GLU A CG    1  
ATOM   570    C  CD    A GLU A 1 83  ? -21.578 -6.154  -9.818  0.05 10.94 ? 82   GLU A CD    1  
ATOM   571    O  OE1   A GLU A 1 83  ? -21.376 -6.663  -8.689  0.05 10.99 ? 82   GLU A OE1   1  
ATOM   572    O  OE2   A GLU A 1 83  ? -21.939 -4.968  -9.972  0.05 10.95 ? 82   GLU A OE2   1  
ATOM   573    N  N     A PRO A 1 84  ? -21.941 -5.384  -15.400 0.05 10.80 ? 83   PRO A N     1  
ATOM   574    C  CA    A PRO A 1 84  ? -22.833 -4.829  -16.422 0.05 10.81 ? 83   PRO A CA    1  
ATOM   575    C  C     A PRO A 1 84  ? -23.153 -5.767  -17.588 0.05 10.77 ? 83   PRO A C     1  
ATOM   576    O  O     A PRO A 1 84  ? -24.222 -5.632  -18.180 0.05 10.78 ? 83   PRO A O     1  
ATOM   577    C  CB    A PRO A 1 84  ? -22.062 -3.604  -16.922 0.05 10.85 ? 83   PRO A CB    1  
ATOM   578    C  CG    A PRO A 1 84  ? -21.261 -3.179  -15.742 0.05 10.88 ? 83   PRO A CG    1  
ATOM   579    C  CD    A PRO A 1 84  ? -20.818 -4.466  -15.113 0.05 10.83 ? 83   PRO A CD    1  
ATOM   580    N  N     A PHE A 1 85  ? -22.255 -6.688  -17.921 0.05 10.72 ? 84   PHE A N     1  
ATOM   581    C  CA    A PHE A 1 85  ? -22.521 -7.577  -19.052 0.05 10.70 ? 84   PHE A CA    1  
ATOM   582    C  C     A PHE A 1 85  ? -23.586 -8.611  -18.718 0.05 10.69 ? 84   PHE A C     1  
ATOM   583    O  O     A PHE A 1 85  ? -24.357 -9.024  -19.590 0.05 10.69 ? 84   PHE A O     1  
ATOM   584    C  CB    A PHE A 1 85  ? -21.241 -8.243  -19.546 0.05 10.67 ? 84   PHE A CB    1  
ATOM   585    C  CG    A PHE A 1 85  ? -20.278 -7.277  -20.162 0.05 10.68 ? 84   PHE A CG    1  
ATOM   586    C  CD1   A PHE A 1 85  ? -20.433 -6.876  -21.478 0.05 10.70 ? 84   PHE A CD1   1  
ATOM   587    C  CD2   A PHE A 1 85  ? -19.238 -6.748  -19.417 0.05 10.70 ? 84   PHE A CD2   1  
ATOM   588    C  CE1   A PHE A 1 85  ? -19.555 -5.968  -22.044 0.05 10.74 ? 84   PHE A CE1   1  
ATOM   589    C  CE2   A PHE A 1 85  ? -18.358 -5.846  -19.980 0.05 10.73 ? 84   PHE A CE2   1  
ATOM   590    C  CZ    A PHE A 1 85  ? -18.513 -5.461  -21.288 0.05 10.75 ? 84   PHE A CZ    1  
ATOM   591    N  N     A LEU A 1 86  ? -23.631 -9.019  -17.455 0.05 10.69 ? 85   LEU A N     1  
ATOM   592    C  CA    A LEU A 1 86  ? -24.659 -9.947  -17.008 0.05 10.70 ? 85   LEU A CA    1  
ATOM   593    C  C     A LEU A 1 86  ? -25.991 -9.224  -16.941 0.05 10.74 ? 85   LEU A C     1  
ATOM   594    O  O     A LEU A 1 86  ? -26.996 -9.692  -17.477 0.05 10.76 ? 85   LEU A O     1  
ATOM   595    C  CB    A LEU A 1 86  ? -24.310 -10.517 -15.634 0.05 10.71 ? 85   LEU A CB    1  
ATOM   596    C  CG    A LEU A 1 86  ? -25.405 -11.381 -15.002 0.05 10.74 ? 85   LEU A CG    1  
ATOM   597    C  CD1   A LEU A 1 86  ? -25.754 -12.569 -15.892 0.05 10.73 ? 85   LEU A CD1   1  
ATOM   598    C  CD2   A LEU A 1 86  ? -24.952 -11.860 -13.628 0.05 10.76 ? 85   LEU A CD2   1  
ATOM   599    N  N     A ASN A 1 87  ? -26.000 -8.069  -16.284 0.05 10.77 ? 86   ASN A N     1  
ATOM   600    C  CA    A ASN A 1 87  ? -27.242 -7.311  -16.168 0.05 10.82 ? 86   ASN A CA    1  
ATOM   601    C  C     A ASN A 1 87  ? -27.826 -6.944  -17.519 0.05 10.84 ? 86   ASN A C     1  
ATOM   602    O  O     A ASN A 1 87  ? -29.043 -6.985  -17.709 0.05 10.88 ? 86   ASN A O     1  
ATOM   603    C  CB    A ASN A 1 87  ? -27.053 -6.059  -15.316 0.05 10.86 ? 86   ASN A CB    1  
ATOM   604    C  CG    A ASN A 1 87  ? -27.404 -6.289  -13.874 0.05 10.89 ? 86   ASN A CG    1  
ATOM   605    O  OD1   A ASN A 1 87  ? -28.210 -7.170  -13.549 0.05 10.90 ? 86   ASN A OD1   1  
ATOM   606    N  ND2   A ASN A 1 87  ? -26.810 -5.495  -12.988 0.05 10.92 ? 86   ASN A ND2   1  
ATOM   607    N  N     A ASP A 1 88  ? -26.967 -6.583  -18.466 0.05 10.82 ? 87   ASP A N     1  
ATOM   608    C  CA    A ASP A 1 88  ? -27.460 -6.288  -19.803 0.05 10.85 ? 87   ASP A CA    1  
ATOM   609    C  C     A ASP A 1 88  ? -28.028 -7.543  -20.474 0.05 10.84 ? 87   ASP A C     1  
ATOM   610    O  O     A ASP A 1 88  ? -29.081 -7.499  -21.116 0.05 10.89 ? 87   ASP A O     1  
ATOM   611    C  CB    A ASP A 1 88  ? -26.364 -5.671  -20.673 0.05 10.84 ? 87   ASP A CB    1  
ATOM   612    C  CG    A ASP A 1 88  ? -26.898 -5.195  -21.989 0.05 10.88 ? 87   ASP A CG    1  
ATOM   613    O  OD1   A ASP A 1 88  ? -28.077 -4.798  -22.016 0.05 10.95 ? 87   ASP A OD1   1  
ATOM   614    O  OD2   A ASP A 1 88  ? -26.166 -5.230  -22.993 0.05 10.86 ? 87   ASP A OD2   1  
ATOM   615    N  N     A ALA A 1 89  ? -27.333 -8.662  -20.313 0.05 10.79 ? 88   ALA A N     1  
ATOM   616    C  CA    A ALA A 1 89  ? -27.775 -9.925  -20.905 0.05 10.79 ? 88   ALA A CA    1  
ATOM   617    C  C     A ALA A 1 89  ? -29.164 -10.304 -20.425 0.05 10.83 ? 88   ALA A C     1  
ATOM   618    O  O     A ALA A 1 89  ? -29.995 -10.792 -21.193 0.05 10.87 ? 88   ALA A O     1  
ATOM   619    C  CB    A ALA A 1 89  ? -26.815 -11.030 -20.557 0.05 10.74 ? 88   ALA A CB    1  
ATOM   620    N  N     A ILE A 1 90  ? -29.405 -10.103 -19.141 0.05 10.84 ? 89   ILE A N     1  
ATOM   621    C  CA    A ILE A 1 90  ? -30.667 -10.548 -18.568 0.05 10.89 ? 89   ILE A CA    1  
ATOM   622    C  C     A ILE A 1 90  ? -31.861 -9.817  -19.196 0.05 10.96 ? 89   ILE A C     1  
ATOM   623    O  O     A ILE A 1 90  ? -32.889 -10.439 -19.485 0.05 11.01 ? 89   ILE A O     1  
ATOM   624    C  CB    A ILE A 1 90  ? -30.631 -10.478 -17.037 0.05 10.90 ? 89   ILE A CB    1  
ATOM   625    C  CG1   A ILE A 1 90  ? -29.630 -11.520 -16.524 0.05 10.86 ? 89   ILE A CG1   1  
ATOM   626    C  CG2   A ILE A 1 90  ? -32.019 -10.714 -16.451 0.05 10.97 ? 89   ILE A CG2   1  
ATOM   627    C  CD1   A ILE A 1 90  ? -29.307 -11.435 -15.044 0.05 10.87 ? 89   ILE A CD1   1  
ATOM   628    N  N     A GLN A 1 91  ? -31.710 -8.522  -19.467 0.05 10.97 ? 90   GLN A N     1  
ATOM   629    C  CA    A GLN A 1 91  ? -32.796 -7.773  -20.096 0.05 11.05 ? 90   GLN A CA    1  
ATOM   630    C  C     A GLN A 1 91  ? -32.766 -7.866  -21.627 0.05 11.07 ? 90   GLN A C     1  
ATOM   631    O  O     A GLN A 1 91  ? -33.788 -7.647  -22.276 0.05 11.15 ? 90   GLN A O     1  
ATOM   632    C  CB    A GLN A 1 91  ? -32.825 -6.305  -19.634 0.05 11.09 ? 90   GLN A CB    1  
ATOM   633    C  CG    A GLN A 1 91  ? -31.636 -5.461  -20.078 0.05 11.06 ? 90   GLN A CG    1  
ATOM   634    C  CD    A GLN A 1 91  ? -31.786 -4.909  -21.484 0.05 11.10 ? 90   GLN A CD    1  
ATOM   635    O  OE1   A GLN A 1 91  ? -32.872 -4.511  -21.892 0.05 11.18 ? 90   GLN A OE1   1  
ATOM   636    N  NE2   A GLN A 1 91  ? -30.688 -4.886  -22.232 0.05 11.06 ? 90   GLN A NE2   1  
ATOM   637    N  N     A ALA A 1 92  ? -31.607 -8.194  -22.198 0.05 11.01 ? 91   ALA A N     1  
ATOM   638    C  CA    A ALA A 1 92  ? -31.501 -8.324  -23.650 0.05 11.03 ? 91   ALA A CA    1  
ATOM   639    C  C     A ALA A 1 92  ? -32.083 -9.629  -24.166 0.05 11.05 ? 91   ALA A C     1  
ATOM   640    O  O     A ALA A 1 92  ? -32.750 -9.651  -25.207 0.05 11.12 ? 91   ALA A O     1  
ATOM   641    C  CB    A ALA A 1 92  ? -30.045 -8.172  -24.121 0.05 10.97 ? 91   ALA A CB    1  
ATOM   642    N  N     A LEU A 1 93  ? -31.813 -10.712 -23.444 0.05 11.01 ? 92   LEU A N     1  
ATOM   643    C  CA    A LEU A 1 93  ? -32.197 -12.052 -23.876 0.05 11.03 ? 92   LEU A CA    1  
ATOM   644    C  C     A LEU A 1 93  ? -33.668 -12.187 -24.314 0.05 11.14 ? 92   LEU A C     1  
ATOM   645    O  O     A LEU A 1 93  ? -33.930 -12.685 -25.406 0.05 11.19 ? 92   LEU A O     1  
ATOM   646    C  CB    A LEU A 1 93  ? -31.828 -13.096 -22.811 0.05 10.99 ? 92   LEU A CB    1  
ATOM   647    C  CG    A LEU A 1 93  ? -32.291 -14.535 -23.027 0.05 11.03 ? 92   LEU A CG    1  
ATOM   648    C  CD1   A LEU A 1 93  ? -31.763 -15.105 -24.341 0.05 11.04 ? 92   LEU A CD1   1  
ATOM   649    C  CD2   A LEU A 1 93  ? -31.861 -15.411 -21.866 0.05 11.00 ? 92   LEU A CD2   1  
ATOM   650    N  N     A PRO A 1 94  ? -34.622 -11.732 -23.482 0.05 11.18 ? 93   PRO A N     1  
ATOM   651    C  CA    A PRO A 1 94  ? -36.016 -11.900 -23.919 0.05 11.29 ? 93   PRO A CA    1  
ATOM   652    C  C     A PRO A 1 94  ? -36.420 -11.029 -25.113 0.05 11.36 ? 93   PRO A C     1  
ATOM   653    O  O     A PRO A 1 94  ? -37.409 -11.342 -25.777 0.05 11.45 ? 93   PRO A O     1  
ATOM   654    C  CB    A PRO A 1 94  ? -36.833 -11.538 -22.667 0.05 11.32 ? 93   PRO A CB    1  
ATOM   655    C  CG    A PRO A 1 94  ? -35.944 -10.688 -21.854 0.05 11.24 ? 93   PRO A CG    1  
ATOM   656    C  CD    A PRO A 1 94  ? -34.537 -11.149 -22.130 0.05 11.14 ? 93   PRO A CD    1  
ATOM   657    N  N     A GLN A 1 95  ? -35.687 -9.960  -25.389 0.05 11.33 ? 94   GLN A N     1  
ATOM   658    C  CA    A GLN A 1 95  ? -35.961 -9.203  -26.605 0.05 11.41 ? 94   GLN A CA    1  
ATOM   659    C  C     A GLN A 1 95  ? -35.532 -10.017 -27.814 0.05 11.42 ? 94   GLN A C     1  
ATOM   660    O  O     A GLN A 1 95  ? -36.236 -10.074 -28.821 0.05 11.52 ? 94   GLN A O     1  
ATOM   661    C  CB    A GLN A 1 95  ? -35.216 -7.875  -26.612 0.05 11.38 ? 94   GLN A CB    1  
ATOM   662    C  CG    A GLN A 1 95  ? -35.654 -6.901  -25.553 0.05 11.40 ? 94   GLN A CG    1  
ATOM   663    C  CD    A GLN A 1 95  ? -34.798 -5.661  -25.559 0.05 11.37 ? 94   GLN A CD    1  
ATOM   664    O  OE1   A GLN A 1 95  ? -34.856 -4.858  -26.490 0.05 11.44 ? 94   GLN A OE1   1  
ATOM   665    N  NE2   A GLN A 1 95  ? -33.973 -5.511  -24.532 0.05 11.27 ? 94   GLN A NE2   1  
ATOM   666    N  N     A LEU A 1 96  ? -34.363 -10.642 -27.716 0.05 11.32 ? 95   LEU A N     1  
ATOM   667    C  CA    A LEU A 1 96  ? -33.806 -11.358 -28.856 0.05 11.33 ? 95   LEU A CA    1  
ATOM   668    C  C     A LEU A 1 96  ? -34.465 -12.721 -29.089 0.05 11.38 ? 95   LEU A C     1  
ATOM   669    O  O     A LEU A 1 96  ? -34.641 -13.138 -30.236 0.05 11.46 ? 95   LEU A O     1  
ATOM   670    C  CB    A LEU A 1 96  ? -32.288 -11.494 -28.709 0.05 11.22 ? 95   LEU A CB    1  
ATOM   671    C  CG    A LEU A 1 96  ? -31.556 -10.150 -28.627 0.05 11.18 ? 95   LEU A CG    1  
ATOM   672    C  CD1   A LEU A 1 96  ? -30.122 -10.350 -28.135 0.05 11.07 ? 95   LEU A CD1   1  
ATOM   673    C  CD2   A LEU A 1 96  ? -31.580 -9.429  -29.967 0.05 11.26 ? 95   LEU A CD2   1  
ATOM   674    N  N     A ALA A 1 97  ? -34.829 -13.410 -28.010 0.05 11.36 ? 96   ALA A N     1  
ATOM   675    C  CA    A ALA A 1 97  ? -35.548 -14.676 -28.140 0.05 11.44 ? 96   ALA A CA    1  
ATOM   676    C  C     A ALA A 1 97  ? -36.839 -14.443 -28.908 0.05 11.57 ? 96   ALA A C     1  
ATOM   677    O  O     A ALA A 1 97  ? -37.236 -15.266 -29.726 0.05 11.66 ? 96   ALA A O     1  
ATOM   678    C  CB    A ALA A 1 97  ? -35.846 -15.279 -26.771 0.05 11.41 ? 96   ALA A CB    1  
ATOM   679    N  N     A ASP A 1 98  ? -37.476 -13.309 -28.637 0.05 11.60 ? 97   ASP A N     1  
ATOM   680    C  CA    A ASP A 1 98  ? -38.696 -12.918 -29.340 0.05 11.75 ? 97   ASP A CA    1  
ATOM   681    C  C     A ASP A 1 98  ? -38.409 -12.693 -30.820 0.05 11.80 ? 97   ASP A C     1  
ATOM   682    O  O     A ASP A 1 98  ? -39.151 -13.158 -31.685 0.05 11.92 ? 97   ASP A O     1  
ATOM   683    C  CB    A ASP A 1 98  ? -39.298 -11.652 -28.710 0.05 11.76 ? 97   ASP A CB    1  
ATOM   684    C  CG    A ASP A 1 98  ? -40.279 -11.966 -27.591 0.05 11.80 ? 97   ASP A CG    1  
ATOM   685    O  OD1   A ASP A 1 98  ? -40.802 -13.097 -27.575 0.05 11.89 ? 97   ASP A OD1   1  
ATOM   686    O  OD2   A ASP A 1 98  ? -40.539 -11.092 -26.737 0.05 11.75 ? 97   ASP A OD2   1  
ATOM   687    N  N     A ALA A 1 99  ? -37.315 -11.991 -31.101 0.05 11.73 ? 98   ALA A N     1  
ATOM   688    C  CA    A ALA A 1 99  ? -37.022 -11.535 -32.454 0.05 11.80 ? 98   ALA A CA    1  
ATOM   689    C  C     A ALA A 1 99  ? -36.736 -12.681 -33.407 0.05 11.84 ? 98   ALA A C     1  
ATOM   690    O  O     A ALA A 1 99  ? -37.003 -12.582 -34.612 0.05 11.96 ? 98   ALA A O     1  
ATOM   691    C  CB    A ALA A 1 99  ? -35.852 -10.549 -32.438 0.05 11.71 ? 98   ALA A CB    1  
ATOM   692    N  N     A TYR A 1 100 ? -36.193 -13.770 -32.873 0.05 11.75 ? 99   TYR A N     1  
ATOM   693    C  CA    A TYR A 1 100 ? -35.761 -14.883 -33.721 0.05 11.79 ? 99   TYR A CA    1  
ATOM   694    C  C     A TYR A 1 100 ? -36.734 -16.058 -33.743 0.05 11.89 ? 99   TYR A C     1  
ATOM   695    O  O     A TYR A 1 100 ? -36.526 -17.025 -34.483 0.05 11.93 ? 99   TYR A O     1  
ATOM   696    C  CB    A TYR A 1 100 ? -34.341 -15.342 -33.359 0.05 11.66 ? 99   TYR A CB    1  
ATOM   697    C  CG    A TYR A 1 100 ? -33.267 -14.464 -33.961 0.05 11.61 ? 99   TYR A CG    1  
ATOM   698    C  CD1   A TYR A 1 100 ? -32.583 -13.532 -33.189 0.05 11.50 ? 99   TYR A CD1   1  
ATOM   699    C  CD2   A TYR A 1 100 ? -32.954 -14.552 -35.310 0.05 11.68 ? 99   TYR A CD2   1  
ATOM   700    C  CE1   A TYR A 1 100 ? -31.603 -12.723 -33.748 0.05 11.47 ? 99   TYR A CE1   1  
ATOM   701    C  CE2   A TYR A 1 100 ? -31.979 -13.753 -35.876 0.05 11.65 ? 99   TYR A CE2   1  
ATOM   702    C  CZ    A TYR A 1 100 ? -31.307 -12.843 -35.092 0.05 11.55 ? 99   TYR A CZ    1  
ATOM   703    O  OH    A TYR A 1 100 ? -30.345 -12.044 -35.668 0.05 11.53 ? 99   TYR A OH    1  
ATOM   704    N  N     A ALA A 1 101 ? -37.801 -15.966 -32.951 0.05 11.93 ? 100  ALA A N     1  
ATOM   705    C  CA    A ALA A 1 101 ? -38.828 -17.001 -32.967 0.05 12.05 ? 100  ALA A CA    1  
ATOM   706    C  C     A ALA A 1 101 ? -39.524 -17.076 -34.331 0.05 12.21 ? 100  ALA A C     1  
ATOM   707    O  O     A ALA A 1 101 ? -39.742 -18.167 -34.838 0.05 12.28 ? 100  ALA A O     1  
ATOM   708    C  CB    A ALA A 1 101 ? -39.845 -16.769 -31.866 0.05 12.09 ? 100  ALA A CB    1  
ATOM   709    N  N     A ASP A 1 102 ? -39.882 -15.937 -34.927 0.05 12.29 ? 101  ASP A N     1  
ATOM   710    C  CA    A ASP A 1 102 ? -40.493 -15.974 -36.275 0.05 12.46 ? 101  ASP A CA    1  
ATOM   711    C  C     A ASP A 1 102 ? -39.455 -15.949 -37.404 0.05 12.44 ? 101  ASP A C     1  
ATOM   712    O  O     A ASP A 1 102 ? -39.698 -15.287 -38.431 0.05 12.54 ? 101  ASP A O     1  
ATOM   713    C  CB    A ASP A 1 102 ? -41.524 -14.838 -36.495 0.05 12.60 ? 101  ASP A CB    1  
ATOM   714    C  CG    A ASP A 1 102 ? -42.866 -15.135 -35.884 0.05 12.68 ? 101  ASP A CG    1  
ATOM   715    O  OD1   A ASP A 1 102 ? -43.265 -16.317 -35.956 0.05 12.82 ? 101  ASP A OD1   1  
ATOM   716    O  OD2   A ASP A 1 102 ? -43.518 -14.213 -35.338 0.05 12.60 ? 101  ASP A OD2   1  
ATOM   717    N  N     A ASP A 1 103 ? -38.326 -16.655 -37.195 0.05 12.32 ? 102  ASP A N     1  
ATOM   718    C  CA    A ASP A 1 103 ? -37.183 -16.758 -38.125 0.05 12.30 ? 102  ASP A CA    1  
ATOM   719    C  C     A ASP A 1 103 ? -35.893 -17.274 -37.443 0.05 12.13 ? 102  ASP A C     1  
ATOM   720    O  O     A ASP A 1 103 ? -34.932 -16.511 -37.300 0.05 12.03 ? 102  ASP A O     1  
ATOM   721    C  CB    A ASP A 1 103 ? -36.873 -15.388 -38.737 0.05 12.32 ? 102  ASP A CB    1  
ATOM   722    C  CG    A ASP A 1 103 ? -36.097 -15.477 -40.041 0.05 12.39 ? 102  ASP A CG    1  
ATOM   723    O  OD1   A ASP A 1 103 ? -36.507 -16.216 -40.958 0.05 12.56 ? 102  ASP A OD1   1  
ATOM   724    O  OD2   A ASP A 1 103 ? -35.082 -14.780 -40.158 0.05 12.28 ? 102  ASP A OD2   1  
ATOM   725    N  N     A ILE A 1 104 ? -35.855 -18.551 -37.051 0.05 12.12 ? 103  ILE A N     1  
ATOM   726    C  CA    A ILE A 1 104 ? -34.711 -19.103 -36.317 0.05 11.97 ? 103  ILE A CA    1  
ATOM   727    C  C     A ILE A 1 104 ? -33.444 -19.214 -37.165 0.05 11.96 ? 103  ILE A C     1  
ATOM   728    O  O     A ILE A 1 104 ? -33.418 -19.943 -38.160 0.05 12.08 ? 103  ILE A O     1  
ATOM   729    C  CB    A ILE A 1 104 ? -35.025 -20.504 -35.752 0.05 11.99 ? 103  ILE A CB    1  
ATOM   730    C  CG1   A ILE A 1 104 ? -36.346 -20.486 -34.984 0.05 12.04 ? 103  ILE A CG1   1  
ATOM   731    C  CG2   A ILE A 1 104 ? -33.881 -20.986 -34.864 0.05 11.85 ? 103  ILE A CG2   1  
ATOM   732    C  CD1   A ILE A 1 104 ? -36.791 -21.836 -34.504 0.05 12.00 ? 103  ILE A CD1   1  
ATOM   733    N  N     A PRO A 1 105 ? -32.363 -18.525 -36.756 0.05 11.83 ? 104  PRO A N     1  
ATOM   734    C  CA    A PRO A 1 105 ? -31.191 -18.569 -37.635 0.05 11.82 ? 104  PRO A CA    1  
ATOM   735    C  C     A PRO A 1 105 ? -30.535 -19.940 -37.654 0.05 11.82 ? 104  PRO A C     1  
ATOM   736    O  O     A PRO A 1 105 ? -30.752 -20.741 -36.740 0.05 11.78 ? 104  PRO A O     1  
ATOM   737    C  CB    A PRO A 1 105 ? -30.262 -17.520 -37.028 0.05 11.69 ? 104  PRO A CB    1  
ATOM   738    C  CG    A PRO A 1 105 ? -30.599 -17.527 -35.599 0.05 11.59 ? 104  PRO A CG    1  
ATOM   739    C  CD    A PRO A 1 105 ? -32.075 -17.827 -35.491 0.05 11.68 ? 104  PRO A CD    1  
ATOM   740    N  N     A ASP A 1 106 ? -29.762 -20.214 -38.702 0.05 11.87 ? 105  ASP A N     1  
ATOM   741    C  CA    A ASP A 1 106 ? -29.056 -21.484 -38.812 0.05 11.87 ? 105  ASP A CA    1  
ATOM   742    C  C     A ASP A 1 106 ? -27.765 -21.553 -38.004 0.05 11.72 ? 105  ASP A C     1  
ATOM   743    O  O     A ASP A 1 106 ? -27.438 -22.592 -37.442 0.05 11.69 ? 105  ASP A O     1  
ATOM   744    C  CB    A ASP A 1 106 ? -28.771 -21.838 -40.275 0.05 11.97 ? 105  ASP A CB    1  
ATOM   745    C  CG    A ASP A 1 106 ? -29.791 -22.811 -40.841 0.05 12.12 ? 105  ASP A CG    1  
ATOM   746    O  OD1   A ASP A 1 106 ? -29.394 -23.853 -41.400 0.05 12.15 ? 105  ASP A OD1   1  
ATOM   747    O  OD2   A ASP A 1 106 ? -30.992 -22.532 -40.702 0.05 12.23 ? 105  ASP A OD2   1  
ATOM   748    N  N     A LEU A 1 107 ? -27.032 -20.449 -37.962 0.05 11.64 ? 106  LEU A N     1  
ATOM   749    C  CA    A LEU A 1 107 ? -25.783 -20.395 -37.222 0.05 11.52 ? 106  LEU A CA    1  
ATOM   750    C  C     A LEU A 1 107 ? -25.758 -19.090 -36.451 0.05 11.42 ? 106  LEU A C     1  
ATOM   751    O  O     A LEU A 1 107 ? -26.269 -18.078 -36.930 0.05 11.45 ? 106  LEU A O     1  
ATOM   752    C  CB    A LEU A 1 107 ? -24.595 -20.468 -38.180 0.05 11.55 ? 106  LEU A CB    1  
ATOM   753    C  CG    A LEU A 1 107 ? -23.211 -20.200 -37.587 0.05 11.45 ? 106  LEU A CG    1  
ATOM   754    C  CD1   A LEU A 1 107 ? -22.316 -21.410 -37.783 0.05 11.43 ? 106  LEU A CD1   1  
ATOM   755    C  CD2   A LEU A 1 107 ? -22.608 -18.956 -38.220 0.05 11.49 ? 106  LEU A CD2   1  
ATOM   756    N  N     A VAL A 1 108 ? -25.183 -19.128 -35.252 0.05 11.31 ? 107  VAL A N     1  
ATOM   757    C  CA    A VAL A 1 108 ? -25.051 -17.950 -34.406 0.05 11.22 ? 107  VAL A CA    1  
ATOM   758    C  C     A VAL A 1 108 ? -23.595 -17.478 -34.397 0.05 11.16 ? 107  VAL A C     1  
ATOM   759    O  O     A VAL A 1 108 ? -22.691 -18.259 -34.127 0.05 11.14 ? 107  VAL A O     1  
ATOM   760    C  CB    A VAL A 1 108 ? -25.495 -18.246 -32.955 0.05 11.15 ? 107  VAL A CB    1  
ATOM   761    C  CG1   A VAL A 1 108 ? -25.036 -17.138 -32.016 0.05 11.06 ? 107  VAL A CG1   1  
ATOM   762    C  CG2   A VAL A 1 108 ? -27.012 -18.404 -32.875 0.05 11.21 ? 107  VAL A CG2   1  
ATOM   763    N  N     A LEU A 1 109 ? -23.381 -16.213 -34.731 0.05 11.16 ? 108  LEU A N     1  
ATOM   764    C  CA    A LEU A 1 109 ? -22.068 -15.590 -34.623 0.05 11.11 ? 108  LEU A CA    1  
ATOM   765    C  C     A LEU A 1 109 ? -22.181 -14.555 -33.529 0.05 11.03 ? 108  LEU A C     1  
ATOM   766    O  O     A LEU A 1 109 ? -23.217 -13.920 -33.400 0.05 11.05 ? 108  LEU A O     1  
ATOM   767    C  CB    A LEU A 1 109 ? -21.719 -14.857 -35.912 0.05 11.18 ? 108  LEU A CB    1  
ATOM   768    C  CG    A LEU A 1 109 ? -21.414 -15.653 -37.170 0.05 11.28 ? 108  LEU A CG    1  
ATOM   769    C  CD1   A LEU A 1 109 ? -21.020 -14.665 -38.264 0.05 11.33 ? 108  LEU A CD1   1  
ATOM   770    C  CD2   A LEU A 1 109 ? -20.293 -16.640 -36.914 0.05 11.25 ? 108  LEU A CD2   1  
ATOM   771    N  N     A HIS A 1 110 ? -21.129 -14.355 -32.742 0.05 10.96 ? 109  HIS A N     1  
ATOM   772    C  CA    A HIS A 1 110 ? -21.243 -13.354 -31.699 0.05 10.91 ? 109  HIS A CA    1  
ATOM   773    C  C     A HIS A 1 110 ? -19.909 -12.873 -31.176 0.05 10.86 ? 109  HIS A C     1  
ATOM   774    O  O     A HIS A 1 110 ? -18.962 -13.637 -31.037 0.05 10.84 ? 109  HIS A O     1  
ATOM   775    C  CB    A HIS A 1 110 ? -22.077 -13.884 -30.531 0.05 10.87 ? 109  HIS A CB    1  
ATOM   776    C  CG    A HIS A 1 110 ? -21.415 -14.980 -29.758 0.05 10.82 ? 109  HIS A CG    1  
ATOM   777    N  ND1   A HIS A 1 110 ? -20.622 -14.737 -28.656 0.05 10.76 ? 109  HIS A ND1   1  
ATOM   778    C  CD2   A HIS A 1 110 ? -21.435 -16.325 -29.918 0.05 10.85 ? 109  HIS A CD2   1  
ATOM   779    C  CE1   A HIS A 1 110 ? -20.177 -15.884 -28.174 0.05 10.75 ? 109  HIS A CE1   1  
ATOM   780    N  NE2   A HIS A 1 110 ? -20.656 -16.864 -28.921 0.05 10.80 ? 109  HIS A NE2   1  
ATOM   781    N  N     A ASP A 1 111 ? -19.860 -11.586 -30.884 0.05 10.86 ? 110  ASP A N     1  
ATOM   782    C  CA    A ASP A 1 111 ? -18.735 -11.031 -30.171 0.05 10.82 ? 110  ASP A CA    1  
ATOM   783    C  C     A ASP A 1 111 ? -18.758 -11.603 -28.752 0.05 10.76 ? 110  ASP A C     1  
ATOM   784    O  O     A ASP A 1 111 ? -19.820 -11.965 -28.235 0.05 10.74 ? 110  ASP A O     1  
ATOM   785    C  CB    A ASP A 1 111 ? -18.836 -9.509  -30.154 0.05 10.85 ? 110  ASP A CB    1  
ATOM   786    C  CG    A ASP A 1 111 ? -17.862 -8.880  -29.192 0.05 10.82 ? 110  ASP A CG    1  
ATOM   787    O  OD1   A ASP A 1 111 ? -16.672 -8.766  -29.552 0.05 10.84 ? 110  ASP A OD1   1  
ATOM   788    O  OD2   A ASP A 1 111 ? -18.283 -8.523  -28.074 0.05 10.79 ? 110  ASP A OD2   1  
ATOM   789    N  N     A ILE A 1 112 ? -17.585 -11.692 -28.134 0.05 10.73 ? 111  ILE A N     1  
ATOM   790    C  CA    A ILE A 1 112 ? -17.447 -12.230 -26.785 0.05 10.69 ? 111  ILE A CA    1  
ATOM   791    C  C     A ILE A 1 112 ? -18.360 -11.602 -25.724 0.05 10.66 ? 111  ILE A C     1  
ATOM   792    O  O     A ILE A 1 112 ? -18.649 -12.237 -24.710 0.05 10.64 ? 111  ILE A O     1  
ATOM   793    C  CB    A ILE A 1 112 ? -15.977 -12.134 -26.293 0.05 10.68 ? 111  ILE A CB    1  
ATOM   794    C  CG1   A ILE A 1 112 ? -15.454 -10.707 -26.430 0.05 10.70 ? 111  ILE A CG1   1  
ATOM   795    C  CG2   A ILE A 1 112 ? -15.078 -13.079 -27.072 0.05 10.70 ? 111  ILE A CG2   1  
ATOM   796    C  CD1   A ILE A 1 112 ? -14.100 -10.507 -25.768 0.05 10.71 ? 111  ILE A CD1   1  
ATOM   797    N  N     A THR A 1 113 ? -18.816 -10.371 -25.946 0.05 10.69 ? 112  THR A N     1  
ATOM   798    C  CA    A THR A 1 113 ? -19.583 -9.666  -24.911 0.05 10.68 ? 112  THR A CA    1  
ATOM   799    C  C     A THR A 1 113 ? -21.053 -10.075 -24.844 0.05 10.68 ? 112  THR A C     1  
ATOM   800    O  O     A THR A 1 113 ? -21.747 -9.763  -23.877 0.05 10.68 ? 112  THR A O     1  
ATOM   801    C  CB    A THR A 1 113 ? -19.550 -8.141  -25.114 0.05 10.72 ? 112  THR A CB    1  
ATOM   802    O  OG1   A THR A 1 113 ? -20.062 -7.833  -26.411 0.05 10.76 ? 112  THR A OG1   1  
ATOM   803    C  CG2   A THR A 1 113 ? -18.131 -7.628  -25.005 0.05 10.73 ? 112  THR A CG2   1  
ATOM   804    N  N     A SER A 1 114 ? -21.538 -10.756 -25.875 0.05 10.70 ? 113  SER A N     1  
ATOM   805    C  CA    A SER A 1 114 ? -22.963 -11.071 -25.929 0.05 10.73 ? 113  SER A CA    1  
ATOM   806    C  C     A SER A 1 114 ? -23.296 -12.407 -25.264 0.05 10.71 ? 113  SER A C     1  
ATOM   807    O  O     A SER A 1 114 ? -23.199 -13.457 -25.883 0.05 10.72 ? 113  SER A O     1  
ATOM   808    C  CB    A SER A 1 114 ? -23.481 -11.054 -27.375 0.05 10.78 ? 113  SER A CB    1  
ATOM   809    O  OG    A SER A 1 114 ? -24.873 -11.361 -27.414 0.05 10.82 ? 113  SER A OG    1  
ATOM   810    N  N     A TYR A 1 115 ? -23.684 -12.367 -23.996 0.05 10.69 ? 114  TYR A N     1  
ATOM   811    C  CA    A TYR A 1 115 ? -24.180 -13.571 -23.335 0.05 10.69 ? 114  TYR A CA    1  
ATOM   812    C  C     A TYR A 1 115 ? -25.482 -14.121 -23.955 0.05 10.74 ? 114  TYR A C     1  
ATOM   813    O  O     A TYR A 1 115 ? -25.651 -15.336 -24.025 0.05 10.76 ? 114  TYR A O     1  
ATOM   814    C  CB    A TYR A 1 115 ? -24.400 -13.345 -21.838 0.05 10.68 ? 114  TYR A CB    1  
ATOM   815    C  CG    A TYR A 1 115 ? -23.158 -12.994 -21.045 0.05 10.64 ? 114  TYR A CG    1  
ATOM   816    C  CD1   A TYR A 1 115 ? -21.887 -13.271 -21.532 0.05 10.62 ? 114  TYR A CD1   1  
ATOM   817    C  CD2   A TYR A 1 115 ? -23.264 -12.396 -19.797 0.05 10.64 ? 114  TYR A CD2   1  
ATOM   818    C  CE1   A TYR A 1 115 ? -20.748 -12.950 -20.788 0.05 10.61 ? 114  TYR A CE1   1  
ATOM   819    C  CE2   A TYR A 1 115 ? -22.142 -12.079 -19.050 0.05 10.63 ? 114  TYR A CE2   1  
ATOM   820    C  CZ    A TYR A 1 115 ? -20.890 -12.348 -19.551 0.05 10.61 ? 114  TYR A CZ    1  
ATOM   821    O  OH    A TYR A 1 115 ? -19.782 -12.018 -18.803 0.05 10.61 ? 114  TYR A OH    1  
ATOM   822    N  N     A PRO A 1 116 ? -26.412 -13.237 -24.383 0.05 10.78 ? 115  PRO A N     1  
ATOM   823    C  CA    A PRO A 1 116 ? -27.631 -13.825 -24.960 0.05 10.84 ? 115  PRO A CA    1  
ATOM   824    C  C     A PRO A 1 116 ? -27.375 -14.715 -26.176 0.05 10.87 ? 115  PRO A C     1  
ATOM   825    O  O     A PRO A 1 116 ? -28.066 -15.727 -26.359 0.05 10.92 ? 115  PRO A O     1  
ATOM   826    C  CB    A PRO A 1 116 ? -28.452 -12.599 -25.361 0.05 10.88 ? 115  PRO A CB    1  
ATOM   827    C  CG    A PRO A 1 116 ? -28.034 -11.543 -24.389 0.05 10.84 ? 115  PRO A CG    1  
ATOM   828    C  CD    A PRO A 1 116 ? -26.554 -11.780 -24.193 0.05 10.78 ? 115  PRO A CD    1  
ATOM   829    N  N     A ALA A 1 117 ? -26.392 -14.355 -26.996 0.05 10.85 ? 116  ALA A N     1  
ATOM   830    C  CA    A ALA A 1 117 ? -26.085 -15.162 -28.170 0.05 10.89 ? 116  ALA A CA    1  
ATOM   831    C  C     A ALA A 1 117 ? -25.727 -16.586 -27.775 0.05 10.88 ? 116  ALA A C     1  
ATOM   832    O  O     A ALA A 1 117 ? -26.156 -17.539 -28.416 0.05 10.94 ? 116  ALA A O     1  
ATOM   833    C  CB    A ALA A 1 117 ? -24.956 -14.543 -28.959 0.05 10.88 ? 116  ALA A CB    1  
ATOM   834    N  N     A ARG A 1 118 ? -24.934 -16.718 -26.713 0.05 10.82 ? 117  ARG A N     1  
ATOM   835    C  CA    A ARG A 1 118 ? -24.554 -18.030 -26.209 0.05 10.83 ? 117  ARG A CA    1  
ATOM   836    C  C     A ARG A 1 118 ? -25.809 -18.785 -25.790 0.05 10.88 ? 117  ARG A C     1  
ATOM   837    O  O     A ARG A 1 118 ? -26.009 -19.932 -26.180 0.05 10.94 ? 117  ARG A O     1  
ATOM   838    C  CB    A ARG A 1 118 ? -23.626 -17.904 -24.998 0.05 10.77 ? 117  ARG A CB    1  
ATOM   839    C  CG    A ARG A 1 118 ? -22.246 -17.252 -25.244 0.05 10.73 ? 117  ARG A CG    1  
ATOM   840    C  CD    A ARG A 1 118 ? -21.653 -16.965 -23.864 0.05 10.69 ? 117  ARG A CD    1  
ATOM   841    N  NE    A ARG A 1 118 ? -20.272 -16.472 -23.764 0.05 10.66 ? 117  ARG A NE    1  
ATOM   842    C  CZ    A ARG A 1 118 ? -19.859 -15.256 -24.113 0.05 10.64 ? 117  ARG A CZ    1  
ATOM   843    N  NH1   A ARG A 1 118 ? -20.685 -14.405 -24.704 0.05 10.65 ? 117  ARG A NH1   1  
ATOM   844    N  NH2   A ARG A 1 118 ? -18.595 -14.904 -23.899 0.05 10.63 ? 117  ARG A NH2   1  
ATOM   845    N  N     A VAL A 1 119 ? -26.646 -18.134 -24.994 0.05 10.87 ? 118  VAL A N     1  
ATOM   846    C  CA    A VAL A 1 119 ? -27.854 -18.784 -24.481 0.05 10.93 ? 118  VAL A CA    1  
ATOM   847    C  C     A VAL A 1 119 ? -28.764 -19.202 -25.635 0.05 11.01 ? 118  VAL A C     1  
ATOM   848    O  O     A VAL A 1 119 ? -29.198 -20.354 -25.712 0.05 11.08 ? 118  VAL A O     1  
ATOM   849    C  CB    A VAL A 1 119 ? -28.622 -17.859 -23.520 0.05 10.92 ? 118  VAL A CB    1  
ATOM   850    C  CG1   A VAL A 1 119 ? -29.963 -18.483 -23.121 0.05 10.99 ? 118  VAL A CG1   1  
ATOM   851    C  CG2   A VAL A 1 119 ? -27.781 -17.566 -22.284 0.05 10.85 ? 118  VAL A CG2   1  
ATOM   852    N  N     A LEU A 1 120 ? -29.038 -18.267 -26.539 0.05 11.03 ? 119  LEU A N     1  
ATOM   853    C  CA    A LEU A 1 120 ? -29.926 -18.561 -27.668 0.05 11.12 ? 119  LEU A CA    1  
ATOM   854    C  C     A LEU A 1 120 ? -29.404 -19.666 -28.590 0.05 11.16 ? 119  LEU A C     1  
ATOM   855    O  O     A LEU A 1 120 ? -30.182 -20.514 -29.049 0.05 11.26 ? 119  LEU A O     1  
ATOM   856    C  CB    A LEU A 1 120 ? -30.233 -17.291 -28.460 0.05 11.14 ? 119  LEU A CB    1  
ATOM   857    C  CG    A LEU A 1 120 ? -31.102 -16.293 -27.702 0.05 11.13 ? 119  LEU A CG    1  
ATOM   858    C  CD1   A LEU A 1 120 ? -31.092 -14.932 -28.386 0.05 11.14 ? 119  LEU A CD1   1  
ATOM   859    C  CD2   A LEU A 1 120 ? -32.544 -16.825 -27.543 0.05 11.23 ? 119  LEU A CD2   1  
ATOM   860    N  N     A ALA A 1 121 ? -28.104 -19.667 -28.866 0.05 11.11 ? 120  ALA A N     1  
ATOM   861    C  CA    A ALA A 1 121 ? -27.531 -20.714 -29.708 0.05 11.16 ? 120  ALA A CA    1  
ATOM   862    C  C     A ALA A 1 121 ? -27.826 -22.097 -29.115 0.05 11.20 ? 120  ALA A C     1  
ATOM   863    O  O     A ALA A 1 121 ? -28.268 -23.014 -29.822 0.05 11.30 ? 120  ALA A O     1  
ATOM   864    C  CB    A ALA A 1 121 ? -26.033 -20.500 -29.898 0.05 11.09 ? 120  ALA A CB    1  
ATOM   865    N  N     A ARG A 1 122 ? -27.618 -22.239 -27.811 0.05 11.15 ? 121  ARG A N     1  
ATOM   866    C  CA    A ARG A 1 122 ? -27.954 -23.487 -27.136 0.05 11.20 ? 121  ARG A CA    1  
ATOM   867    C  C     A ARG A 1 122 ? -29.441 -23.789 -27.215 0.05 11.30 ? 121  ARG A C     1  
ATOM   868    O  O     A ARG A 1 122 ? -29.836 -24.946 -27.368 0.05 11.40 ? 121  ARG A O     1  
ATOM   869    C  CB    A ARG A 1 122 ? -27.549 -23.442 -25.673 0.05 11.14 ? 121  ARG A CB    1  
ATOM   870    C  CG    A ARG A 1 122 ? -26.068 -23.517 -25.464 0.05 11.07 ? 121  ARG A CG    1  
ATOM   871    C  CD    A ARG A 1 122 ? -25.676 -22.383 -24.576 0.05 10.98 ? 121  ARG A CD    1  
ATOM   872    N  NE    A ARG A 1 122 ? -24.721 -22.793 -23.582 0.05 10.97 ? 121  ARG A NE    1  
ATOM   873    C  CZ    A ARG A 1 122 ? -23.434 -22.504 -23.638 0.05 10.92 ? 121  ARG A CZ    1  
ATOM   874    N  NH1   A ARG A 1 122 ? -22.949 -21.806 -24.653 0.05 10.89 ? 121  ARG A NH1   1  
ATOM   875    N  NH2   A ARG A 1 122 ? -22.646 -22.919 -22.674 0.05 10.93 ? 121  ARG A NH2   1  
ATOM   876    N  N     A ARG A 1 123 ? -30.259 -22.750 -27.094 0.05 11.28 ? 122  ARG A N     1  
ATOM   877    C  CA    A ARG A 1 123 ? -31.707 -22.913 -27.155 0.05 11.38 ? 122  ARG A CA    1  
ATOM   878    C  C     A ARG A 1 123 ? -32.121 -23.450 -28.523 0.05 11.49 ? 122  ARG A C     1  
ATOM   879    O  O     A ARG A 1 123 ? -33.083 -24.214 -28.646 0.05 11.60 ? 122  ARG A O     1  
ATOM   880    C  CB    A ARG A 1 123 ? -32.417 -21.590 -26.851 0.05 11.35 ? 122  ARG A CB    1  
ATOM   881    C  CG    A ARG A 1 123 ? -33.887 -21.760 -26.497 0.05 11.45 ? 122  ARG A CG    1  
ATOM   882    C  CD    A ARG A 1 123 ? -34.545 -20.436 -26.174 0.05 11.43 ? 122  ARG A CD    1  
ATOM   883    N  NE    A ARG A 1 123 ? -34.143 -19.892 -24.878 0.05 11.33 ? 122  ARG A NE    1  
ATOM   884    C  CZ    A ARG A 1 123 ? -34.592 -18.736 -24.399 0.05 11.31 ? 122  ARG A CZ    1  
ATOM   885    N  NH1   A ARG A 1 123 ? -35.452 -18.025 -25.114 0.05 11.37 ? 122  ARG A NH1   1  
ATOM   886    N  NH2   A ARG A 1 123 ? -34.195 -18.293 -23.208 0.05 11.24 ? 122  ARG A NH2   1  
ATOM   887    N  N     A TRP A 1 124 ? -31.370 -23.066 -29.545 0.05 11.47 ? 123  TRP A N     1  
ATOM   888    C  CA    A TRP A 1 124 ? -31.718 -23.389 -30.923 0.05 11.58 ? 123  TRP A CA    1  
ATOM   889    C  C     A TRP A 1 124 ? -31.134 -24.707 -31.418 0.05 11.63 ? 123  TRP A C     1  
ATOM   890    O  O     A TRP A 1 124 ? -31.501 -25.189 -32.499 0.05 11.76 ? 123  TRP A O     1  
ATOM   891    C  CB    A TRP A 1 124 ? -31.292 -22.234 -31.831 0.05 11.55 ? 123  TRP A CB    1  
ATOM   892    C  CG    A TRP A 1 124 ? -32.053 -21.000 -31.505 0.05 11.53 ? 123  TRP A CG    1  
ATOM   893    C  CD1   A TRP A 1 124 ? -33.280 -20.937 -30.920 0.05 11.58 ? 123  TRP A CD1   1  
ATOM   894    C  CD2   A TRP A 1 124 ? -31.638 -19.648 -31.715 0.05 11.46 ? 123  TRP A CD2   1  
ATOM   895    N  NE1   A TRP A 1 124 ? -33.665 -19.631 -30.763 0.05 11.55 ? 123  TRP A NE1   1  
ATOM   896    C  CE2   A TRP A 1 124 ? -32.672 -18.819 -31.244 0.05 11.48 ? 123  TRP A CE2   1  
ATOM   897    C  CE3   A TRP A 1 124 ? -30.497 -19.057 -32.259 0.05 11.40 ? 123  TRP A CE3   1  
ATOM   898    C  CZ2   A TRP A 1 124 ? -32.603 -17.431 -31.304 0.05 11.44 ? 123  TRP A CZ2   1  
ATOM   899    C  CZ3   A TRP A 1 124 ? -30.429 -17.673 -32.309 0.05 11.36 ? 123  TRP A CZ3   1  
ATOM   900    C  CH2   A TRP A 1 124 ? -31.478 -16.881 -31.840 0.05 11.39 ? 123  TRP A CH2   1  
ATOM   901    N  N     A GLY A 1 125 ? -30.232 -25.277 -30.621 0.05 11.56 ? 124  GLY A N     1  
ATOM   902    C  CA    A GLY A 1 125 ? -29.512 -26.480 -30.987 0.05 11.61 ? 124  GLY A CA    1  
ATOM   903    C  C     A GLY A 1 125 ? -28.593 -26.263 -32.172 0.05 11.63 ? 124  GLY A C     1  
ATOM   904    O  O     A GLY A 1 125 ? -28.352 -27.173 -32.959 0.05 11.74 ? 124  GLY A O     1  
ATOM   905    N  N     A VAL A 1 126 ? -28.080 -25.045 -32.304 0.05 11.52 ? 125  VAL A N     1  
ATOM   906    C  CA    A VAL A 1 126 ? -27.248 -24.698 -33.456 0.05 11.53 ? 125  VAL A CA    1  
ATOM   907    C  C     A VAL A 1 126 ? -25.827 -24.311 -33.040 0.05 11.42 ? 125  VAL A C     1  
ATOM   908    O  O     A VAL A 1 126 ? -25.597 -23.954 -31.882 0.05 11.32 ? 125  VAL A O     1  
ATOM   909    C  CB    A VAL A 1 126 ? -27.891 -23.571 -34.306 0.05 11.54 ? 125  VAL A CB    1  
ATOM   910    C  CG1   A VAL A 1 126 ? -29.288 -23.977 -34.760 0.05 11.68 ? 125  VAL A CG1   1  
ATOM   911    C  CG2   A VAL A 1 126 ? -27.918 -22.257 -33.547 0.05 11.44 ? 125  VAL A CG2   1  
ATOM   912    N  N     A PRO A 1 127 ? -24.866 -24.399 -33.980 0.05 11.44 ? 126  PRO A N     1  
ATOM   913    C  CA    A PRO A 1 127 ? -23.493 -23.996 -33.662 0.05 11.35 ? 126  PRO A CA    1  
ATOM   914    C  C     A PRO A 1 127 ? -23.409 -22.514 -33.320 0.05 11.26 ? 126  PRO A C     1  
ATOM   915    O  O     A PRO A 1 127 ? -24.138 -21.688 -33.873 0.05 11.28 ? 126  PRO A O     1  
ATOM   916    C  CB    A PRO A 1 127 ? -22.728 -24.268 -34.965 0.05 11.43 ? 126  PRO A CB    1  
ATOM   917    C  CG    A PRO A 1 127 ? -23.559 -25.226 -35.721 0.05 11.56 ? 126  PRO A CG    1  
ATOM   918    C  CD    A PRO A 1 127 ? -24.978 -24.927 -35.354 0.05 11.57 ? 126  PRO A CD    1  
ATOM   919    N  N     A ALA A 1 128 ? -22.532 -22.187 -32.380 0.05 11.17 ? 127  ALA A N     1  
ATOM   920    C  CA    A ALA A 1 128 ? -22.212 -20.793 -32.103 0.05 11.09 ? 127  ALA A CA    1  
ATOM   921    C  C     A ALA A 1 128 ? -20.740 -20.602 -32.409 0.05 11.06 ? 127  ALA A C     1  
ATOM   922    O  O     A ALA A 1 128 ? -19.929 -21.437 -32.037 0.05 11.07 ? 127  ALA A O     1  
ATOM   923    C  CB    A ALA A 1 128 ? -22.475 -20.463 -30.652 0.05 11.01 ? 127  ALA A CB    1  
ATOM   924    N  N     A VAL A 1 129 ? -20.396 -19.510 -33.078 0.05 11.05 ? 128  VAL A N     1  
ATOM   925    C  CA    A VAL A 1 129 ? -18.990 -19.170 -33.274 0.05 11.03 ? 128  VAL A CA    1  
ATOM   926    C  C     A VAL A 1 129 ? -18.703 -17.832 -32.609 0.05 10.96 ? 128  VAL A C     1  
ATOM   927    O  O     A VAL A 1 129 ? -19.311 -16.819 -32.944 0.05 10.97 ? 128  VAL A O     1  
ATOM   928    C  CB    A VAL A 1 129 ? -18.605 -19.119 -34.761 0.05 11.11 ? 128  VAL A CB    1  
ATOM   929    C  CG1   A VAL A 1 129 ? -17.147 -18.665 -34.939 0.05 11.10 ? 128  VAL A CG1   1  
ATOM   930    C  CG2   A VAL A 1 129 ? -18.804 -20.486 -35.389 0.05 11.19 ? 128  VAL A CG2   1  
ATOM   931    N  N     A SER A 1 130 ? -17.793 -17.853 -31.643 0.05 10.90 ? 129  SER A N     1  
ATOM   932    C  CA    A SER A 1 130 ? -17.424 -16.651 -30.899 0.05 10.85 ? 129  SER A CA    1  
ATOM   933    C  C     A SER A 1 130 ? -16.331 -15.930 -31.668 0.05 10.87 ? 129  SER A C     1  
ATOM   934    O  O     A SER A 1 130 ? -15.404 -16.568 -32.146 0.05 10.90 ? 129  SER A O     1  
ATOM   935    C  CB    A SER A 1 130 ? -16.915 -17.040 -29.507 0.05 10.79 ? 129  SER A CB    1  
ATOM   936    O  OG    A SER A 1 130 ? -16.462 -15.914 -28.766 0.05 10.75 ? 129  SER A OG    1  
ATOM   937    N  N     A LEU A 1 131 ? -16.453 -14.613 -31.799 0.05 10.87 ? 130  LEU A N     1  
ATOM   938    C  CA    A LEU A 1 131 ? -15.450 -13.802 -32.482 0.05 10.91 ? 130  LEU A CA    1  
ATOM   939    C  C     A LEU A 1 131 ? -14.773 -12.907 -31.448 0.05 10.86 ? 130  LEU A C     1  
ATOM   940    O  O     A LEU A 1 131 ? -15.425 -12.055 -30.845 0.05 10.84 ? 130  LEU A O     1  
ATOM   941    C  CB    A LEU A 1 131 ? -16.103 -12.944 -33.561 0.05 10.97 ? 130  LEU A CB    1  
ATOM   942    C  CG    A LEU A 1 131 ? -16.901 -13.708 -34.621 0.05 11.03 ? 130  LEU A CG    1  
ATOM   943    C  CD1   A LEU A 1 131 ? -17.456 -12.752 -35.668 0.05 11.10 ? 130  LEU A CD1   1  
ATOM   944    C  CD2   A LEU A 1 131 ? -16.041 -14.787 -35.264 0.05 11.07 ? 130  LEU A CD2   1  
ATOM   945    N  N     A SER A 1 132 ? -13.479 -13.118 -31.225 0.05 10.87 ? 131  SER A N     1  
ATOM   946    C  CA    A SER A 1 132 ? -12.756 -12.368 -30.187 0.05 10.84 ? 131  SER A CA    1  
ATOM   947    C  C     A SER A 1 132 ? -11.812 -11.336 -30.779 0.05 10.90 ? 131  SER A C     1  
ATOM   948    O  O     A SER A 1 132 ? -10.925 -11.686 -31.550 0.05 10.95 ? 131  SER A O     1  
ATOM   949    C  CB    A SER A 1 132 ? -11.931 -13.307 -29.312 0.05 10.82 ? 131  SER A CB    1  
ATOM   950    O  OG    A SER A 1 132 ? -11.208 -12.564 -28.346 0.05 10.81 ? 131  SER A OG    1  
ATOM   951    N  N     A PRO A 1 133 ? -11.981 -10.065 -30.391 0.05 10.90 ? 132  PRO A N     1  
ATOM   952    C  CA    A PRO A 1 133 ? -11.147 -8.983  -30.917 0.05 10.97 ? 132  PRO A CA    1  
ATOM   953    C  C     A PRO A 1 133 ? -9.917  -8.762  -30.042 0.05 10.98 ? 132  PRO A C     1  
ATOM   954    O  O     A PRO A 1 133 ? -9.226  -7.755  -30.185 0.05 11.04 ? 132  PRO A O     1  
ATOM   955    C  CB    A PRO A 1 133 ? -12.077 -7.776  -30.827 0.05 10.98 ? 132  PRO A CB    1  
ATOM   956    C  CG    A PRO A 1 133 ? -12.878 -8.041  -29.602 0.05 10.91 ? 132  PRO A CG    1  
ATOM   957    C  CD    A PRO A 1 133 ? -13.049 -9.550  -29.514 0.05 10.86 ? 132  PRO A CD    1  
ATOM   958    N  N     A ASN A 1 134 ? -9.659  -9.695  -29.136 0.05 10.93 ? 133  ASN A N     1  
ATOM   959    C  CA    A ASN A 1 134 ? -8.493  -9.620  -28.265 0.05 10.95 ? 133  ASN A CA    1  
ATOM   960    C  C     A ASN A 1 134 ? -8.047  -11.024 -27.905 0.05 10.93 ? 133  ASN A C     1  
ATOM   961    O  O     A ASN A 1 134 ? -8.602  -12.005 -28.400 0.05 10.90 ? 133  ASN A O     1  
ATOM   962    C  CB    A ASN A 1 134 ? -8.826  -8.848  -26.990 0.05 10.93 ? 133  ASN A CB    1  
ATOM   963    C  CG    A ASN A 1 134 ? -10.120 -9.320  -26.351 0.05 10.85 ? 133  ASN A CG    1  
ATOM   964    O  OD1   A ASN A 1 134 ? -10.155 -10.348 -25.666 0.05 10.82 ? 133  ASN A OD1   1  
ATOM   965    N  ND2   A ASN A 1 134 ? -11.187 -8.575  -26.575 0.05 10.84 ? 133  ASN A ND2   1  
ATOM   966    N  N     A LEU A 1 135 ? -7.048  -11.117 -27.033 0.05 10.95 ? 134  LEU A N     1  
ATOM   967    C  CA    A LEU A 1 135 ? -6.506  -12.413 -26.641 0.05 10.95 ? 134  LEU A CA    1  
ATOM   968    C  C     A LEU A 1 135 ? -7.580  -13.308 -26.026 0.05 10.88 ? 134  LEU A C     1  
ATOM   969    O  O     A LEU A 1 135 ? -8.602  -12.821 -25.529 0.05 10.83 ? 134  LEU A O     1  
ATOM   970    C  CB    A LEU A 1 135 ? -5.341  -12.231 -25.664 0.05 10.99 ? 134  LEU A CB    1  
ATOM   971    C  CG    A LEU A 1 135 ? -5.716  -11.490 -24.376 0.05 10.97 ? 134  LEU A CG    1  
ATOM   972    C  CD1   A LEU A 1 135 ? -6.013  -12.468 -23.254 0.05 10.94 ? 134  LEU A CD1   1  
ATOM   973    C  CD2   A LEU A 1 135 ? -4.600  -10.523 -23.961 0.05 11.05 ? 134  LEU A CD2   1  
ATOM   974    N  N     A VAL A 1 136 ? -7.328  -14.612 -26.055 0.05 10.89 ? 135  VAL A N     1  
ATOM   975    C  CA    A VAL A 1 136 ? -8.253  -15.587 -25.493 0.05 10.85 ? 135  VAL A CA    1  
ATOM   976    C  C     A VAL A 1 136 ? -7.563  -16.409 -24.410 0.05 10.88 ? 135  VAL A C     1  
ATOM   977    O  O     A VAL A 1 136 ? -6.354  -16.319 -24.217 0.05 10.93 ? 135  VAL A O     1  
ATOM   978    C  CB    A VAL A 1 136 ? -8.781  -16.550 -26.582 0.05 10.85 ? 135  VAL A CB    1  
ATOM   979    C  CG1   A VAL A 1 136 ? -9.585  -15.790 -27.624 0.05 10.84 ? 135  VAL A CG1   1  
ATOM   980    C  CG2   A VAL A 1 136 ? -7.624  -17.284 -27.245 0.05 10.92 ? 135  VAL A CG2   1  
ATOM   981    N  N     A ALA A 1 137 ? -8.346  -17.217 -23.702 0.05 10.85 ? 136  ALA A N     1  
ATOM   982    C  CA    A ALA A 1 137 ? -7.787  -18.113 -22.701 0.05 10.89 ? 136  ALA A CA    1  
ATOM   983    C  C     A ALA A 1 137 ? -6.887  -19.174 -23.326 0.05 10.96 ? 136  ALA A C     1  
ATOM   984    O  O     A ALA A 1 137 ? -7.205  -19.727 -24.376 0.05 10.96 ? 136  ALA A O     1  
ATOM   985    C  CB    A ALA A 1 137 ? -8.919  -18.792 -21.921 0.05 10.87 ? 136  ALA A CB    1  
ATOM   986    N  N     A TRP A 1 138 ? -5.762  -19.453 -22.667 0.05 11.02 ? 137  TRP A N     1  
ATOM   987    C  CA    A TRP A 1 138 ? -4.920  -20.582 -23.035 0.05 11.10 ? 137  TRP A CA    1  
ATOM   988    C  C     A TRP A 1 138 ? -5.224  -21.738 -22.094 0.05 11.13 ? 137  TRP A C     1  
ATOM   989    O  O     A TRP A 1 138 ? -5.934  -21.562 -21.109 0.05 11.10 ? 137  TRP A O     1  
ATOM   990    C  CB    A TRP A 1 138 ? -3.441  -20.205 -22.923 0.05 11.17 ? 137  TRP A CB    1  
ATOM   991    C  CG    A TRP A 1 138 ? -3.058  -19.633 -21.585 0.05 11.19 ? 137  TRP A CG    1  
ATOM   992    C  CD1   A TRP A 1 138 ? -2.500  -20.301 -20.531 0.05 11.27 ? 137  TRP A CD1   1  
ATOM   993    C  CD2   A TRP A 1 138 ? -3.199  -18.269 -21.162 0.05 11.15 ? 137  TRP A CD2   1  
ATOM   994    N  NE1   A TRP A 1 138 ? -2.288  -19.437 -19.476 0.05 11.28 ? 137  TRP A NE1   1  
ATOM   995    C  CE2   A TRP A 1 138 ? -2.706  -18.185 -19.842 0.05 11.21 ? 137  TRP A CE2   1  
ATOM   996    C  CE3   A TRP A 1 138 ? -3.693  -17.115 -21.770 0.05 11.09 ? 137  TRP A CE3   1  
ATOM   997    C  CZ2   A TRP A 1 138 ? -2.699  -16.994 -19.126 0.05 11.20 ? 137  TRP A CZ2   1  
ATOM   998    C  CZ3   A TRP A 1 138 ? -3.679  -15.935 -21.057 0.05 11.08 ? 137  TRP A CZ3   1  
ATOM   999    C  CH2   A TRP A 1 138 ? -3.184  -15.883 -19.751 0.05 11.14 ? 137  TRP A CH2   1  
ATOM   1000   N  N     A LYS A 1 139 ? -4.696  -22.918 -22.403 0.05 11.21 ? 138  LYS A N     1  
ATOM   1001   C  CA    A LYS A 1 139 ? -4.778  -24.040 -21.476 0.05 11.26 ? 138  LYS A CA    1  
ATOM   1002   C  C     A LYS A 1 139 ? -3.891  -23.723 -20.276 0.05 11.31 ? 138  LYS A C     1  
ATOM   1003   O  O     A LYS A 1 139 ? -2.665  -23.633 -20.414 0.05 11.38 ? 138  LYS A O     1  
ATOM   1004   C  CB    A LYS A 1 139 ? -4.317  -25.326 -22.153 0.05 11.36 ? 138  LYS A CB    1  
ATOM   1005   C  CG    A LYS A 1 139 ? -5.315  -25.886 -23.151 0.05 11.33 ? 138  LYS A CG    1  
ATOM   1006   C  CD    A LYS A 1 139 ? -4.809  -27.211 -23.710 0.05 11.44 ? 138  LYS A CD    1  
ATOM   1007   C  CE    A LYS A 1 139 ? -5.930  -28.023 -24.309 0.05 11.43 ? 138  LYS A CE    1  
ATOM   1008   N  NZ    A LYS A 1 139 ? -5.448  -29.354 -24.729 0.05 11.56 ? 138  LYS A NZ    1  
ATOM   1009   N  N     A GLY A 1 140 ? -4.518  -23.538 -19.112 0.05 11.30 ? 139  GLY A N     1  
ATOM   1010   C  CA    A GLY A 1 140 ? -3.832  -23.080 -17.911 0.05 11.35 ? 139  GLY A CA    1  
ATOM   1011   C  C     A GLY A 1 140 ? -4.481  -21.836 -17.305 0.05 11.27 ? 139  GLY A C     1  
ATOM   1012   O  O     A GLY A 1 140 ? -4.355  -21.551 -16.120 0.05 11.30 ? 139  GLY A O     1  
ATOM   1013   N  N     A TYR A 1 141 ? -5.207  -21.098 -18.135 0.05 11.19 ? 140  TYR A N     1  
ATOM   1014   C  CA    A TYR A 1 141 ? -5.696  -19.778 -17.773 0.05 11.12 ? 140  TYR A CA    1  
ATOM   1015   C  C     A TYR A 1 141 ? -6.534  -19.733 -16.494 0.05 11.11 ? 140  TYR A C     1  
ATOM   1016   O  O     A TYR A 1 141 ? -6.348  -18.787 -15.698 0.05 11.11 ? 140  TYR A O     1  
ATOM   1017   C  CB    A TYR A 1 141 ? -6.452  -19.178 -18.958 0.05 11.03 ? 140  TYR A CB    1  
ATOM   1018   C  CG    A TYR A 1 141 ? -7.221  -17.902 -18.691 0.05 10.96 ? 140  TYR A CG    1  
ATOM   1019   C  CD1   A TYR A 1 141 ? -6.647  -16.655 -18.899 0.05 10.97 ? 140  TYR A CD1   1  
ATOM   1020   C  CD2   A TYR A 1 141 ? -8.556  -17.954 -18.305 0.05 10.91 ? 140  TYR A CD2   1  
ATOM   1021   C  CE1   A TYR A 1 141 ? -7.376  -15.495 -18.681 0.05 10.92 ? 140  TYR A CE1   1  
ATOM   1022   C  CE2   A TYR A 1 141 ? -9.272  -16.824 -18.078 0.05 10.86 ? 140  TYR A CE2   1  
ATOM   1023   C  CZ    A TYR A 1 141 ? -8.691  -15.597 -18.270 0.05 10.86 ? 140  TYR A CZ    1  
ATOM   1024   O  OH    A TYR A 1 141 ? -9.440  -14.469 -18.047 0.05 10.83 ? 140  TYR A OH    1  
ATOM   1025   N  N     A GLU A 1 142 ? -7.400  -20.738 -16.289 0.05 11.11 ? 141  GLU A N     1  
ATOM   1026   C  CA    A GLU A 1 142 ? -8.308  -20.718 -15.140 0.05 11.11 ? 141  GLU A CA    1  
ATOM   1027   C  C     A GLU A 1 142 ? -7.462  -20.785 -13.865 0.05 11.21 ? 141  GLU A C     1  
ATOM   1028   O  O     A GLU A 1 142 ? -7.567  -19.883 -13.032 0.05 11.20 ? 141  GLU A O     1  
ATOM   1029   C  CB    A GLU A 1 142 ? -9.429  -21.781 -15.247 0.05 11.13 ? 141  GLU A CB    1  
ATOM   1030   C  CG    A GLU A 1 142 ? -10.428 -21.783 -14.117 0.05 11.12 ? 141  GLU A CG    1  
ATOM   1031   C  CD    A GLU A 1 142 ? -11.560 -20.763 -14.307 0.05 11.02 ? 141  GLU A CD    1  
ATOM   1032   O  OE1   A GLU A 1 142 ? -11.980 -20.573 -15.479 0.05 10.96 ? 141  GLU A OE1   1  
ATOM   1033   O  OE2   A GLU A 1 142 ? -12.025 -20.214 -13.269 0.05 11.00 ? 141  GLU A OE2   1  
ATOM   1034   N  N     A GLU A 1 143 ? -6.582  -21.783 -13.735 0.05 11.30 ? 142  GLU A N     1  
ATOM   1035   C  CA    A GLU A 1 143 ? -5.695  -21.850 -12.558 0.05 11.41 ? 142  GLU A CA    1  
ATOM   1036   C  C     A GLU A 1 143 ? -4.645  -20.745 -12.498 0.05 11.42 ? 142  GLU A C     1  
ATOM   1037   O  O     A GLU A 1 143 ? -4.363  -20.186 -11.430 0.05 11.47 ? 142  GLU A O     1  
ATOM   1038   C  CB    A GLU A 1 143 ? -4.983  -23.201 -12.470 0.05 11.53 ? 142  GLU A CB    1  
ATOM   1039   C  CG    A GLU A 1 143 ? -5.911  -24.374 -12.350 0.05 11.57 ? 142  GLU A CG    1  
ATOM   1040   C  CD    A GLU A 1 143 ? -5.988  -25.173 -13.632 0.05 11.58 ? 142  GLU A CD    1  
ATOM   1041   O  OE1   A GLU A 1 143 ? -5.791  -24.581 -14.720 0.05 11.49 ? 142  GLU A OE1   1  
ATOM   1042   O  OE2   A GLU A 1 143 ? -6.240  -26.397 -13.539 0.05 11.69 ? 142  GLU A OE2   1  
ATOM   1043   N  N     A GLU A 1 144 ? -4.049  -20.448 -13.642 0.05 11.39 ? 143  GLU A N     1  
ATOM   1044   C  CA    A GLU A 1 144 ? -2.965  -19.484 -13.680 0.05 11.43 ? 143  GLU A CA    1  
ATOM   1045   C  C     A GLU A 1 144 ? -3.430  -18.050 -13.469 0.05 11.36 ? 143  GLU A C     1  
ATOM   1046   O  O     A GLU A 1 144 ? -2.751  -17.278 -12.797 0.05 11.43 ? 143  GLU A O     1  
ATOM   1047   C  CB    A GLU A 1 144 ? -2.167  -19.616 -14.986 0.05 11.43 ? 143  GLU A CB    1  
ATOM   1048   C  CG    A GLU A 1 144 ? -1.450  -20.964 -15.105 0.05 11.52 ? 143  GLU A CG    1  
ATOM   1049   C  CD    A GLU A 1 144 ? -0.589  -21.114 -16.361 0.05 11.55 ? 143  GLU A CD    1  
ATOM   1050   O  OE1   A GLU A 1 144 ? 0.124   -22.138 -16.460 0.05 11.64 ? 143  GLU A OE1   1  
ATOM   1051   O  OE2   A GLU A 1 144 ? -0.627  -20.240 -17.252 0.05 11.49 ? 143  GLU A OE2   1  
ATOM   1052   N  N     A VAL A 1 145 ? -4.585  -17.690 -14.031 0.05 11.25 ? 144  VAL A N     1  
ATOM   1053   C  CA    A VAL A 1 145 ? -4.983  -16.281 -14.074 0.05 11.20 ? 144  VAL A CA    1  
ATOM   1054   C  C     A VAL A 1 145 ? -6.394  -15.962 -13.548 0.05 11.14 ? 144  VAL A C     1  
ATOM   1055   O  O     A VAL A 1 145 ? -6.561  -15.009 -12.784 0.05 11.16 ? 144  VAL A O     1  
ATOM   1056   C  CB    A VAL A 1 145 ? -4.770  -15.686 -15.490 0.05 11.14 ? 144  VAL A CB    1  
ATOM   1057   C  CG1   A VAL A 1 145 ? -5.530  -14.373 -15.663 0.05 11.09 ? 144  VAL A CG1   1  
ATOM   1058   C  CG2   A VAL A 1 145 ? -3.271  -15.490 -15.761 0.05 11.21 ? 144  VAL A CG2   1  
ATOM   1059   N  N     A ALA A 1 146 ? -7.402  -16.740 -13.940 0.05 11.08 ? 145  ALA A N     1  
ATOM   1060   C  CA    A ALA A 1 146 ? -8.766  -16.457 -13.485 0.05 11.03 ? 145  ALA A CA    1  
ATOM   1061   C  C     A ALA A 1 146 ? -8.923  -16.620 -11.968 0.05 11.09 ? 145  ALA A C     1  
ATOM   1062   O  O     A ALA A 1 146 ? -9.605  -15.821 -11.320 0.05 11.08 ? 145  ALA A O     1  
ATOM   1063   C  CB    A ALA A 1 146 ? -9.797  -17.314 -14.235 0.05 10.96 ? 145  ALA A CB    1  
ATOM   1064   N  N     A GLU A 1 147 ? -8.295  -17.652 -11.404 0.05 11.17 ? 146  GLU A N     1  
ATOM   1065   C  CA    A GLU A 1 147 ? -8.412  -17.898 -9.959  0.05 11.26 ? 146  GLU A CA    1  
ATOM   1066   C  C     A GLU A 1 147 ? -7.858  -16.795 -9.029  0.05 11.32 ? 146  GLU A C     1  
ATOM   1067   O  O     A GLU A 1 147 ? -8.582  -16.331 -8.145  0.05 11.34 ? 146  GLU A O     1  
ATOM   1068   C  CB    A GLU A 1 147 ? -7.877  -19.288 -9.575  0.05 11.35 ? 146  GLU A CB    1  
ATOM   1069   C  CG    A GLU A 1 147 ? -8.277  -19.762 -8.159  0.05 11.44 ? 146  GLU A CG    1  
ATOM   1070   C  CD    A GLU A 1 147 ? -7.443  -19.134 -7.060  0.05 11.55 ? 146  GLU A CD    1  
ATOM   1071   O  OE1   A GLU A 1 147 ? -6.307  -18.705 -7.345  0.05 11.58 ? 146  GLU A OE1   1  
ATOM   1072   O  OE2   A GLU A 1 147 ? -7.922  -19.058 -5.910  0.05 11.61 ? 146  GLU A OE2   1  
ATOM   1073   N  N     A PRO A 1 148 ? -6.583  -16.383 -9.199  0.05 11.37 ? 147  PRO A N     1  
ATOM   1074   C  CA    A PRO A 1 148 ? -6.046  -15.377 -8.271  0.05 11.44 ? 147  PRO A CA    1  
ATOM   1075   C  C     A PRO A 1 148 ? -6.676  -14.012 -8.514  0.05 11.38 ? 147  PRO A C     1  
ATOM   1076   O  O     A PRO A 1 148 ? -6.614  -13.108 -7.680  0.05 11.44 ? 147  PRO A O     1  
ATOM   1077   C  CB    A PRO A 1 148 ? -4.550  -15.332 -8.622  0.05 11.50 ? 147  PRO A CB    1  
ATOM   1078   C  CG    A PRO A 1 148 ? -4.299  -16.541 -9.451  0.05 11.49 ? 147  PRO A CG    1  
ATOM   1079   C  CD    A PRO A 1 148 ? -5.568  -16.795 -10.182 0.05 11.38 ? 147  PRO A CD    1  
ATOM   1080   N  N     A MET A 1 149 ? -7.278  -13.860 -9.683  0.05 11.26 ? 148  MET A N     1  
ATOM   1081   C  CA    A MET A 1 149 ? -7.996  -12.645 -9.995  0.05 11.21 ? 148  MET A CA    1  
ATOM   1082   C  C     A MET A 1 149 ? -9.278  -12.594 -9.180  0.05 11.19 ? 148  MET A C     1  
ATOM   1083   O  O     A MET A 1 149 ? -9.641  -11.558 -8.626  0.05 11.21 ? 148  MET A O     1  
ATOM   1084   C  CB    A MET A 1 149 ? -8.314  -12.631 -11.482 0.05 11.11 ? 148  MET A CB    1  
ATOM   1085   C  CG    A MET A 1 149 ? -9.075  -11.433 -11.954 0.05 11.06 ? 148  MET A CG    1  
ATOM   1086   S  SD    A MET A 1 149 ? -9.026  -11.456 -13.748 0.05 10.98 ? 148  MET A SD    1  
ATOM   1087   C  CE    A MET A 1 149 ? -10.651 -12.094 -14.140 0.05 10.89 ? 148  MET A CE    1  
ATOM   1088   N  N     A TRP A 1 150 ? -9.951  -13.732 -9.088  0.05 11.17 ? 149  TRP A N     1  
ATOM   1089   C  CA    A TRP A 1 150 ? -11.267 -13.781 -8.460  0.05 11.15 ? 149  TRP A CA    1  
ATOM   1090   C  C     A TRP A 1 150 ? -11.258 -14.124 -6.974  0.05 11.25 ? 149  TRP A C     1  
ATOM   1091   O  O     A TRP A 1 150 ? -12.277 -13.977 -6.313  0.05 11.26 ? 149  TRP A O     1  
ATOM   1092   C  CB    A TRP A 1 150 ? -12.192 -14.736 -9.220  0.05 11.08 ? 149  TRP A CB    1  
ATOM   1093   C  CG    A TRP A 1 150 ? -12.884 -14.048 -10.346 0.05 10.98 ? 149  TRP A CG    1  
ATOM   1094   C  CD1   A TRP A 1 150 ? -12.623 -14.176 -11.680 0.05 10.92 ? 149  TRP A CD1   1  
ATOM   1095   C  CD2   A TRP A 1 150 ? -13.937 -13.094 -10.230 0.05 10.95 ? 149  TRP A CD2   1  
ATOM   1096   N  NE1   A TRP A 1 150 ? -13.463 -13.361 -12.403 0.05 10.86 ? 149  TRP A NE1   1  
ATOM   1097   C  CE2   A TRP A 1 150 ? -14.285 -12.694 -11.533 0.05 10.87 ? 149  TRP A CE2   1  
ATOM   1098   C  CE3   A TRP A 1 150 ? -14.633 -12.548 -9.145  0.05 10.99 ? 149  TRP A CE3   1  
ATOM   1099   C  CZ2   A TRP A 1 150 ? -15.290 -11.766 -11.781 0.05 10.84 ? 149  TRP A CZ2   1  
ATOM   1100   C  CZ3   A TRP A 1 150 ? -15.632 -11.637 -9.394  0.05 10.95 ? 149  TRP A CZ3   1  
ATOM   1101   C  CH2   A TRP A 1 150 ? -15.954 -11.254 -10.703 0.05 10.88 ? 149  TRP A CH2   1  
ATOM   1102   N  N     A ARG A 1 151 ? -10.114 -14.559 -6.451  0.05 11.35 ? 150  ARG A N     1  
ATOM   1103   C  CA    A ARG A 1 151 ? -10.070 -15.061 -5.080  0.05 11.46 ? 150  ARG A CA    1  
ATOM   1104   C  C     A ARG A 1 151 ? -10.641 -14.049 -4.081  0.05 11.50 ? 150  ARG A C     1  
ATOM   1105   O  O     A ARG A 1 151 ? -11.630 -14.332 -3.402  0.05 11.52 ? 150  ARG A O     1  
ATOM   1106   C  CB    A ARG A 1 151 ? -8.647  -15.486 -4.703  0.05 11.57 ? 150  ARG A CB    1  
ATOM   1107   C  CG    A ARG A 1 151 ? -8.584  -16.569 -3.626  0.05 11.69 ? 150  ARG A CG    1  
ATOM   1108   C  CD    A ARG A 1 151 ? -7.141  -16.860 -3.241  0.05 11.82 ? 150  ARG A CD    1  
ATOM   1109   N  NE    A ARG A 1 151 ? -6.366  -17.388 -4.360  0.05 11.77 ? 150  ARG A NE    1  
ATOM   1110   C  CZ    A ARG A 1 151 ? -5.037  -17.457 -4.373  0.05 11.84 ? 150  ARG A CZ    1  
ATOM   1111   N  NH1   A ARG A 1 151 ? -4.340  -17.024 -3.326  0.05 11.97 ? 150  ARG A NH1   1  
ATOM   1112   N  NH2   A ARG A 1 151 ? -4.401  -17.952 -5.429  0.05 11.80 ? 150  ARG A NH2   1  
ATOM   1113   N  N     A GLU A 1 152 ? -10.069 -12.850 -4.045  0.05 11.53 ? 151  GLU A N     1  
ATOM   1114   C  CA    A GLU A 1 152 ? -10.475 -11.854 -3.050  0.05 11.59 ? 151  GLU A CA    1  
ATOM   1115   C  C     A GLU A 1 152 ? -11.811 -11.091 -3.253  0.05 11.51 ? 151  GLU A C     1  
ATOM   1116   O  O     A GLU A 1 152 ? -12.443 -10.704 -2.267  0.05 11.55 ? 151  GLU A O     1  
ATOM   1117   C  CB    A GLU A 1 152 ? -9.291  -10.929 -2.688  0.05 11.68 ? 151  GLU A CB    1  
ATOM   1118   C  CG    A GLU A 1 152 ? -8.386  -11.559 -1.615  0.05 11.82 ? 151  GLU A CG    1  
ATOM   1119   C  CD    A GLU A 1 152 ? -6.947  -11.060 -1.612  0.05 11.91 ? 151  GLU A CD    1  
ATOM   1120   O  OE1   A GLU A 1 152 ? -6.177  -11.487 -0.719  0.05 12.06 ? 151  GLU A OE1   1  
ATOM   1121   O  OE2   A GLU A 1 152 ? -6.578  -10.254 -2.487  0.05 11.85 ? 151  GLU A OE2   1  
ATOM   1122   N  N     A PRO A 1 153 ? -12.239 -10.866 -4.513  0.05 11.39 ? 152  PRO A N     1  
ATOM   1123   C  CA    A PRO A 1 153 ? -13.592 -10.349 -4.801  0.05 11.31 ? 152  PRO A CA    1  
ATOM   1124   C  C     A PRO A 1 153 ? -14.731 -11.374 -4.719  0.05 11.28 ? 152  PRO A C     1  
ATOM   1125   O  O     A PRO A 1 153 ? -15.779 -11.044 -4.142  0.05 11.29 ? 152  PRO A O     1  
ATOM   1126   C  CB    A PRO A 1 153 ? -13.463 -9.813  -6.236  0.05 11.22 ? 152  PRO A CB    1  
ATOM   1127   C  CG    A PRO A 1 153 ? -12.003 -9.532  -6.398  0.05 11.27 ? 152  PRO A CG    1  
ATOM   1128   C  CD    A PRO A 1 153 ? -11.333 -10.648 -5.657  0.05 11.35 ? 152  PRO A CD    1  
ATOM   1129   N  N     A ARG A 1 154 ? -14.548 -12.568 -5.291  0.05 11.25 ? 153  ARG A N     1  
ATOM   1130   C  CA    A ARG A 1 154 ? -15.574 -13.608 -5.269  0.05 11.23 ? 153  ARG A CA    1  
ATOM   1131   C  C     A ARG A 1 154 ? -15.871 -13.904 -3.823  0.05 11.35 ? 153  ARG A C     1  
ATOM   1132   O  O     A ARG A 1 154 ? -16.972 -14.277 -3.485  0.05 11.36 ? 153  ARG A O     1  
ATOM   1133   C  CB    A ARG A 1 154 ? -15.084 -14.885 -5.958  0.05 11.19 ? 153  ARG A CB    1  
ATOM   1134   C  CG    A ARG A 1 154 ? -16.148 -15.914 -6.260  0.05 11.14 ? 153  ARG A CG    1  
ATOM   1135   C  CD    A ARG A 1 154 ? -15.988 -16.437 -7.686  0.05 11.06 ? 153  ARG A CD    1  
ATOM   1136   N  NE    A ARG A 1 154 ? -15.635 -17.847 -7.757  0.05 11.11 ? 153  ARG A NE    1  
ATOM   1137   C  CZ    A ARG A 1 154 ? -16.234 -18.727 -8.547  0.05 11.10 ? 153  ARG A CZ    1  
ATOM   1138   N  NH1   A ARG A 1 154 ? -17.219 -18.337 -9.335  0.05 11.06 ? 153  ARG A NH1   1  
ATOM   1139   N  NH2   A ARG A 1 154 ? -15.844 -19.997 -8.548  0.05 11.16 ? 153  ARG A NH2   1  
ATOM   1140   N  N     A GLN A 1 155 ? -14.855 -13.715 -2.984  0.05 11.44 ? 154  GLN A N     1  
ATOM   1141   C  CA    A GLN A 1 155 ? -14.931 -13.945 -1.552  0.05 11.57 ? 154  GLN A CA    1  
ATOM   1142   C  C     A GLN A 1 155 ? -15.819 -12.948 -0.808  0.05 11.58 ? 154  GLN A C     1  
ATOM   1143   O  O     A GLN A 1 155 ? -16.373 -13.257 0.251   0.05 11.66 ? 154  GLN A O     1  
ATOM   1144   C  CB    A GLN A 1 155 ? -13.519 -13.928 -0.968  0.05 11.69 ? 154  GLN A CB    1  
ATOM   1145   C  CG    A GLN A 1 155 ? -13.404 -13.733 0.528   0.05 11.83 ? 154  GLN A CG    1  
ATOM   1146   C  CD    A GLN A 1 155 ? -13.832 -14.957 1.339   0.05 11.91 ? 154  GLN A CD    1  
ATOM   1147   O  OE1   A GLN A 1 155 ? -13.191 -15.293 2.327   0.05 12.06 ? 154  GLN A OE1   1  
ATOM   1148   N  NE2   A GLN A 1 155 ? -14.929 -15.609 0.936   0.05 11.83 ? 154  GLN A NE2   1  
ATOM   1149   N  N     A THR A 1 156 ? -15.945 -11.750 -1.358  0.05 11.53 ? 155  THR A N     1  
ATOM   1150   C  CA    A THR A 1 156 ? -16.785 -10.715 -0.760  0.05 11.56 ? 155  THR A CA    1  
ATOM   1151   C  C     A THR A 1 156 ? -18.250 -11.086 -0.932  0.05 11.51 ? 155  THR A C     1  
ATOM   1152   O  O     A THR A 1 156 ? -18.583 -11.845 -1.833  0.05 11.43 ? 155  THR A O     1  
ATOM   1153   C  CB    A THR A 1 156 ? -16.536 -9.356  -1.422  0.05 11.52 ? 155  THR A CB    1  
ATOM   1154   O  OG1   A THR A 1 156 ? -16.850 -9.436  -2.821  0.05 11.39 ? 155  THR A OG1   1  
ATOM   1155   C  CG2   A THR A 1 156 ? -15.080 -8.954  -1.261  0.05 11.58 ? 155  THR A CG2   1  
ATOM   1156   N  N     A GLU A 1 157 ? -19.125 -10.555 -0.078  0.05 11.58 ? 156  GLU A N     1  
ATOM   1157   C  CA    A GLU A 1 157 ? -20.561 -10.801 -0.223  0.05 11.55 ? 156  GLU A CA    1  
ATOM   1158   C  C     A GLU A 1 157 ? -21.024 -10.346 -1.609  0.05 11.42 ? 156  GLU A C     1  
ATOM   1159   O  O     A GLU A 1 157 ? -21.857 -10.994 -2.243  0.05 11.36 ? 156  GLU A O     1  
ATOM   1160   C  CB    A GLU A 1 157 ? -21.362 -10.127 0.917   0.05 11.64 ? 156  GLU A CB    1  
ATOM   1161   C  CG    A GLU A 1 157 ? -22.509 -9.198  0.497   0.05 11.59 ? 156  GLU A CG    1  
ATOM   1162   C  CD    A GLU A 1 157 ? -23.451 -8.888  1.663   0.05 11.70 ? 156  GLU A CD    1  
ATOM   1163   O  OE1   A GLU A 1 157 ? -23.624 -9.783  2.511   0.05 11.80 ? 156  GLU A OE1   1  
ATOM   1164   O  OE2   A GLU A 1 157 ? -23.998 -7.764  1.750   0.05 11.69 ? 156  GLU A OE2   1  
ATOM   1165   N  N     A ARG A 1 158 ? -20.440 -9.257  -2.094  0.05 11.38 ? 157  ARG A N     1  
ATOM   1166   C  CA    A ARG A 1 158 ? -20.775 -8.747  -3.416  0.05 11.28 ? 157  ARG A CA    1  
ATOM   1167   C  C     A ARG A 1 158 ? -20.410 -9.740  -4.526  0.05 11.19 ? 157  ARG A C     1  
ATOM   1168   O  O     A ARG A 1 158 ? -21.187 -9.957  -5.454  0.05 11.12 ? 157  ARG A O     1  
ATOM   1169   C  CB    A ARG A 1 158 ? -20.062 -7.425  -3.681  0.05 11.28 ? 157  ARG A CB    1  
ATOM   1170   C  CG    A ARG A 1 158 ? -20.325 -6.924  -5.070  0.05 11.19 ? 157  ARG A CG    1  
ATOM   1171   C  CD    A ARG A 1 158 ? -19.369 -5.823  -5.510  0.05 11.21 ? 157  ARG A CD    1  
ATOM   1172   N  NE    A ARG A 1 158 ? -19.774 -5.339  -6.825  0.05 11.13 ? 157  ARG A NE    1  
ATOM   1173   C  CZ    A ARG A 1 158 ? -19.246 -4.289  -7.443  0.05 11.15 ? 157  ARG A CZ    1  
ATOM   1174   N  NH1   A ARG A 1 158 ? -18.277 -3.591  -6.868  0.05 11.24 ? 157  ARG A NH1   1  
ATOM   1175   N  NH2   A ARG A 1 158 ? -19.701 -3.928  -8.633  0.05 11.09 ? 157  ARG A NH2   1  
ATOM   1176   N  N     A GLY A 1 159 ? -19.221 -10.327 -4.428  0.05 11.21 ? 158  GLY A N     1  
ATOM   1177   C  CA    A GLY A 1 159 ? -18.748 -11.279 -5.419  0.05 11.15 ? 158  GLY A CA    1  
ATOM   1178   C  C     A GLY A 1 159 ? -19.484 -12.604 -5.389  0.05 11.15 ? 158  GLY A C     1  
ATOM   1179   O  O     A GLY A 1 159 ? -19.835 -13.144 -6.439  0.05 11.08 ? 158  GLY A O     1  
ATOM   1180   N  N     A ARG A 1 160 ? -19.716 -13.139 -4.193  0.05 11.24 ? 159  ARG A N     1  
ATOM   1181   C  CA    A ARG A 1 160 ? -20.441 -14.405 -4.070  0.05 11.27 ? 159  ARG A CA    1  
ATOM   1182   C  C     A ARG A 1 160 ? -21.844 -14.268 -4.652  0.05 11.21 ? 159  ARG A C     1  
ATOM   1183   O  O     A ARG A 1 160 ? -22.361 -15.188 -5.286  0.05 11.17 ? 159  ARG A O     1  
ATOM   1184   C  CB    A ARG A 1 160 ? -20.544 -14.852 -2.607  0.05 11.39 ? 159  ARG A CB    1  
ATOM   1185   C  CG    A ARG A 1 160 ? -19.225 -14.856 -1.889  0.05 11.48 ? 159  ARG A CG    1  
ATOM   1186   C  CD    A ARG A 1 160 ? -19.181 -15.778 -0.704  0.05 11.60 ? 159  ARG A CD    1  
ATOM   1187   N  NE    A ARG A 1 160 ? -17.808 -16.182 -0.409  0.05 11.67 ? 159  ARG A NE    1  
ATOM   1188   C  CZ    A ARG A 1 160 ? -17.481 -17.298 0.236   0.05 11.79 ? 159  ARG A CZ    1  
ATOM   1189   N  N     A ALA A 1 161 ? -22.451 -13.109 -4.433  0.05 11.21 ? 160  ALA A N     1  
ATOM   1190   C  CA    A ALA A 1 161 ? -23.815 -12.856 -4.885  0.05 11.18 ? 160  ALA A CA    1  
ATOM   1191   C  C     A ALA A 1 161 ? -23.864 -12.714 -6.401  0.05 11.08 ? 160  ALA A C     1  
ATOM   1192   O  O     A ALA A 1 161 ? -24.815 -13.152 -7.045  0.05 11.05 ? 160  ALA A O     1  
ATOM   1193   C  CB    A ALA A 1 161 ? -24.392 -11.612 -4.199  0.05 11.22 ? 160  ALA A CB    1  
ATOM   1194   N  N     A TYR A 1 162 ? -22.830 -12.096 -6.967  0.05 11.03 ? 161  TYR A N     1  
ATOM   1195   C  CA    A TYR A 1 162 ? -22.746 -11.947 -8.415  0.05 10.94 ? 161  TYR A CA    1  
ATOM   1196   C  C     A TYR A 1 162 ? -22.701 -13.316 -9.084  0.05 10.92 ? 161  TYR A C     1  
ATOM   1197   O  O     A TYR A 1 162 ? -23.463 -13.597 -10.017 0.05 10.88 ? 161  TYR A O     1  
ATOM   1198   C  CB    A TYR A 1 162 ? -21.544 -11.086 -8.808  0.05 10.92 ? 161  TYR A CB    1  
ATOM   1199   C  CG    A TYR A 1 162 ? -21.047 -11.331 -10.215 0.05 10.85 ? 161  TYR A CG    1  
ATOM   1200   C  CD1   A TYR A 1 162 ? -21.778 -10.910 -11.323 0.05 10.80 ? 161  TYR A CD1   1  
ATOM   1201   C  CD2   A TYR A 1 162 ? -19.844 -11.985 -10.432 0.05 10.84 ? 161  TYR A CD2   1  
ATOM   1202   C  CE1   A TYR A 1 162 ? -21.318 -11.149 -12.615 0.05 10.75 ? 161  TYR A CE1   1  
ATOM   1203   C  CE2   A TYR A 1 162 ? -19.380 -12.221 -11.699 0.05 10.78 ? 161  TYR A CE2   1  
ATOM   1204   C  CZ    A TYR A 1 162 ? -20.113 -11.802 -12.790 0.05 10.74 ? 161  TYR A CZ    1  
ATOM   1205   O  OH    A TYR A 1 162 ? -19.620 -12.052 -14.049 0.05 10.70 ? 161  TYR A OH    1  
ATOM   1206   N  N     A TYR A 1 163 ? -21.836 -14.182 -8.582  0.05 10.95 ? 162  TYR A N     1  
ATOM   1207   C  CA    A TYR A 1 163 ? -21.732 -15.521 -9.149  0.05 10.94 ? 162  TYR A CA    1  
ATOM   1208   C  C     A TYR A 1 163 ? -22.969 -16.385 -8.919  0.05 10.98 ? 162  TYR A C     1  
ATOM   1209   O  O     A TYR A 1 163 ? -23.362 -17.147 -9.800  0.05 10.96 ? 162  TYR A O     1  
ATOM   1210   C  CB    A TYR A 1 163 ? -20.446 -16.220 -8.710  0.05 10.97 ? 162  TYR A CB    1  
ATOM   1211   C  CG    A TYR A 1 163 ? -19.329 -15.903 -9.668  0.05 10.92 ? 162  TYR A CG    1  
ATOM   1212   C  CD1   A TYR A 1 163 ? -19.270 -16.512 -10.910 0.05 10.87 ? 162  TYR A CD1   1  
ATOM   1213   C  CD2   A TYR A 1 163 ? -18.375 -14.948 -9.364  0.05 10.92 ? 162  TYR A CD2   1  
ATOM   1214   C  CE1   A TYR A 1 163 ? -18.262 -16.216 -11.803 0.05 10.83 ? 162  TYR A CE1   1  
ATOM   1215   C  CE2   A TYR A 1 163 ? -17.362 -14.643 -10.252 0.05 10.88 ? 162  TYR A CE2   1  
ATOM   1216   C  CZ    A TYR A 1 163 ? -17.312 -15.273 -11.472 0.05 10.83 ? 162  TYR A CZ    1  
ATOM   1217   O  OH    A TYR A 1 163 ? -16.309 -14.966 -12.372 0.05 10.80 ? 162  TYR A OH    1  
ATOM   1218   N  N     A ALA A 1 164 ? -23.587 -16.257 -7.750  0.05 11.05 ? 163  ALA A N     1  
ATOM   1219   C  CA    A ALA A 1 164 ? -24.811 -17.001 -7.484  0.05 11.10 ? 163  ALA A CA    1  
ATOM   1220   C  C     A ALA A 1 164 ? -25.923 -16.560 -8.434  0.05 11.06 ? 163  ALA A C     1  
ATOM   1221   O  O     A ALA A 1 164 ? -26.698 -17.387 -8.922  0.05 11.08 ? 163  ALA A O     1  
ATOM   1222   C  CB    A ALA A 1 164 ? -25.243 -16.845 -6.016  0.05 11.20 ? 163  ALA A CB    1  
ATOM   1223   N  N     A ARG A 1 165 ? -25.988 -15.258 -8.705  0.05 11.01 ? 164  ARG A N     1  
ATOM   1224   C  CA    A ARG A 1 165 ? -26.968 -14.711 -9.645  0.05 10.98 ? 164  ARG A CA    1  
ATOM   1225   C  C     A ARG A 1 165 ? -26.708 -15.182 -11.077 0.05 10.92 ? 164  ARG A C     1  
ATOM   1226   O  O     A ARG A 1 165 ? -27.634 -15.513 -11.810 0.05 10.93 ? 164  ARG A O     1  
ATOM   1227   C  CB    A ARG A 1 165 ? -26.966 -13.172 -9.589  0.05 10.96 ? 164  ARG A CB    1  
ATOM   1228   C  CG    A ARG A 1 165 ? -27.714 -12.577 -8.400  0.05 11.00 ? 164  ARG A CG    1  
ATOM   1229   C  CD    A ARG A 1 165 ? -27.358 -11.121 -8.139  0.05 11.01 ? 164  ARG A CD    1  
ATOM   1230   N  NE    A ARG A 1 165 ? -27.277 -10.318 -9.357  0.05 10.96 ? 164  ARG A NE    1  
ATOM   1231   C  CZ    A ARG A 1 165 ? -26.144 -9.824  -9.855  0.05 10.91 ? 164  ARG A CZ    1  
ATOM   1232   N  NH1   A ARG A 1 165 ? -24.994 -10.055 -9.250  0.05 10.90 ? 164  ARG A NH1   1  
ATOM   1233   N  NH2   A ARG A 1 165 ? -26.166 -9.093  -10.963 0.05 10.88 ? 164  ARG A NH2   1  
ATOM   1234   N  N     A PHE A 1 166 ? -25.437 -15.197 -11.468 0.05 10.88 ? 165  PHE A N     1  
ATOM   1235   C  CA    A PHE A 1 166 ? -25.052 -15.631 -12.801 0.05 10.83 ? 165  PHE A CA    1  
ATOM   1236   C  C     A PHE A 1 166 ? -25.437 -17.107 -12.942 0.05 10.87 ? 165  PHE A C     1  
ATOM   1237   O  O     A PHE A 1 166 ? -26.068 -17.505 -13.922 0.05 10.86 ? 165  PHE A O     1  
ATOM   1238   C  CB    A PHE A 1 166 ? -23.538 -15.429 -12.981 0.05 10.79 ? 165  PHE A CB    1  
ATOM   1239   C  CG    A PHE A 1 166 ? -23.081 -15.277 -14.421 0.05 10.74 ? 165  PHE A CG    1  
ATOM   1240   C  CD1   A PHE A 1 166 ? -23.739 -15.906 -15.464 0.05 10.73 ? 165  PHE A CD1   1  
ATOM   1241   C  CD2   A PHE A 1 166 ? -21.955 -14.521 -14.712 0.05 10.70 ? 165  PHE A CD2   1  
ATOM   1242   C  CE1   A PHE A 1 166 ? -23.286 -15.767 -16.777 0.05 10.70 ? 165  PHE A CE1   1  
ATOM   1243   C  CE2   A PHE A 1 166 ? -21.497 -14.376 -16.012 0.05 10.67 ? 165  PHE A CE2   1  
ATOM   1244   C  CZ    A PHE A 1 166 ? -22.166 -14.996 -17.049 0.05 10.67 ? 165  PHE A CZ    1  
ATOM   1245   N  N     A GLU A 1 167 ? -25.076 -17.911 -11.949 0.05 10.92 ? 166  GLU A N     1  
ATOM   1246   C  CA    A GLU A 1 167 ? -25.427 -19.332 -11.977 0.05 10.98 ? 166  GLU A CA    1  
ATOM   1247   C  C     A GLU A 1 167 ? -26.938 -19.549 -12.074 0.05 11.02 ? 166  GLU A C     1  
ATOM   1248   O  O     A GLU A 1 167 ? -27.414 -20.374 -12.860 0.05 11.05 ? 166  GLU A O     1  
ATOM   1249   C  CB    A GLU A 1 167 ? -24.889 -20.067 -10.740 0.05 11.05 ? 166  GLU A CB    1  
ATOM   1250   C  CG    A GLU A 1 167 ? -25.523 -21.455 -10.570 0.05 11.12 ? 166  GLU A CG    1  
ATOM   1251   C  CD    A GLU A 1 167 ? -24.952 -22.258 -9.413  0.05 11.22 ? 166  GLU A CD    1  
ATOM   1252   O  OE1   A GLU A 1 167 ? -23.990 -21.790 -8.765  0.05 11.21 ? 166  GLU A OE1   1  
ATOM   1253   O  OE2   A GLU A 1 167 ? -25.469 -23.375 -9.165  0.05 11.31 ? 166  GLU A OE2   1  
ATOM   1254   N  N     A ALA A 1 168 ? -27.689 -18.802 -11.277 0.05 11.05 ? 167  ALA A N     1  
ATOM   1255   C  CA    A ALA A 1 168 ? -29.142 -18.975 -11.240 0.05 11.11 ? 167  ALA A CA    1  
ATOM   1256   C  C     A ALA A 1 168 ? -29.764 -18.630 -12.587 0.05 11.07 ? 167  ALA A C     1  
ATOM   1257   O  O     A ALA A 1 168 ? -30.701 -19.284 -13.042 0.05 11.12 ? 167  ALA A O     1  
ATOM   1258   C  CB    A ALA A 1 168 ? -29.752 -18.139 -10.127 0.05 11.15 ? 167  ALA A CB    1  
ATOM   1259   N  N     A TRP A 1 169 ? -29.223 -17.608 -13.236 0.05 10.99 ? 168  TRP A N     1  
ATOM   1260   C  CA    A TRP A 1 169 ? -29.727 -17.202 -14.545 0.05 10.97 ? 168  TRP A CA    1  
ATOM   1261   C  C     A TRP A 1 169 ? -29.434 -18.265 -15.596 0.05 10.97 ? 168  TRP A C     1  
ATOM   1262   O  O     A TRP A 1 169 ? -30.288 -18.586 -16.419 0.05 11.00 ? 168  TRP A O     1  
ATOM   1263   C  CB    A TRP A 1 169 ? -29.118 -15.861 -14.952 0.05 10.90 ? 168  TRP A CB    1  
ATOM   1264   C  CG    A TRP A 1 169 ? -29.537 -15.349 -16.302 0.05 10.88 ? 168  TRP A CG    1  
ATOM   1265   C  CD1   A TRP A 1 169 ? -30.781 -14.935 -16.672 0.05 10.93 ? 168  TRP A CD1   1  
ATOM   1266   C  CD2   A TRP A 1 169 ? -28.692 -15.152 -17.445 0.05 10.83 ? 168  TRP A CD2   1  
ATOM   1267   N  NE1   A TRP A 1 169 ? -30.768 -14.509 -17.980 0.05 10.91 ? 168  TRP A NE1   1  
ATOM   1268   C  CE2   A TRP A 1 169 ? -29.497 -14.635 -18.476 0.05 10.85 ? 168  TRP A CE2   1  
ATOM   1269   C  CE3   A TRP A 1 169 ? -27.339 -15.374 -17.696 0.05 10.78 ? 168  TRP A CE3   1  
ATOM   1270   C  CZ2   A TRP A 1 169 ? -28.989 -14.324 -19.738 0.05 10.83 ? 168  TRP A CZ2   1  
ATOM   1271   C  CZ3   A TRP A 1 169 ? -26.834 -15.069 -18.951 0.05 10.75 ? 168  TRP A CZ3   1  
ATOM   1272   C  CH2   A TRP A 1 169 ? -27.654 -14.548 -19.954 0.05 10.78 ? 168  TRP A CH2   1  
ATOM   1273   N  N     A LEU A 1 170 ? -28.224 -18.813 -15.570 0.05 10.94 ? 169  LEU A N     1  
ATOM   1274   C  CA    A LEU A 1 170 ? -27.893 -19.908 -16.483 0.05 10.95 ? 169  LEU A CA    1  
ATOM   1275   C  C     A LEU A 1 170 ? -28.808 -21.128 -16.243 0.05 11.05 ? 169  LEU A C     1  
ATOM   1276   O  O     A LEU A 1 170 ? -29.372 -21.680 -17.189 0.05 11.09 ? 169  LEU A O     1  
ATOM   1277   C  CB    A LEU A 1 170 ? -26.424 -20.303 -16.353 0.05 10.92 ? 169  LEU A CB    1  
ATOM   1278   C  CG    A LEU A 1 170 ? -25.400 -19.299 -16.881 0.05 10.84 ? 169  LEU A CG    1  
ATOM   1279   C  CD1   A LEU A 1 170 ? -23.990 -19.822 -16.644 0.05 10.83 ? 169  LEU A CD1   1  
ATOM   1280   C  CD2   A LEU A 1 170 ? -25.629 -19.018 -18.373 0.05 10.82 ? 169  LEU A CD2   1  
ATOM   1281   N  N     A LYS A 1 171 ? -28.965 -21.520 -14.981 0.05 11.10 ? 170  LYS A N     1  
ATOM   1282   C  CA    A LYS A 1 171 ? -29.767 -22.707 -14.634 0.05 11.21 ? 170  LYS A CA    1  
ATOM   1283   C  C     A LYS A 1 171 ? -31.224 -22.614 -15.107 0.05 11.26 ? 170  LYS A C     1  
ATOM   1284   O  O     A LYS A 1 171 ? -31.804 -23.605 -15.547 0.05 11.34 ? 170  LYS A O     1  
ATOM   1285   C  CB    A LYS A 1 171 ? -29.718 -22.983 -13.122 0.05 11.27 ? 170  LYS A CB    1  
ATOM   1286   C  CG    A LYS A 1 171 ? -28.385 -23.581 -12.649 0.05 11.26 ? 170  LYS A CG    1  
ATOM   1287   C  CD    A LYS A 1 171 ? -28.389 -23.923 -11.157 0.05 11.33 ? 170  LYS A CD    1  
ATOM   1288   C  CE    A LYS A 1 171 ? -29.230 -25.170 -10.844 0.05 11.46 ? 170  LYS A CE    1  
ATOM   1289   N  NZ    A LYS A 1 171 ? -29.224 -25.572 -9.393  0.05 11.54 ? 170  LYS A NZ    1  
ATOM   1290   N  N     A GLU A 1 172 ? -31.816 -21.428 -14.998 0.05 11.22 ? 171  GLU A N     1  
ATOM   1291   C  CA    A GLU A 1 172 ? -33.182 -21.228 -15.476 0.05 11.27 ? 171  GLU A CA    1  
ATOM   1292   C  C     A GLU A 1 172 ? -33.238 -21.389 -17.000 0.05 11.27 ? 171  GLU A C     1  
ATOM   1293   O  O     A GLU A 1 172 ? -34.279 -21.718 -17.571 0.05 11.35 ? 171  GLU A O     1  
ATOM   1294   C  CB    A GLU A 1 172 ? -33.710 -19.860 -15.027 0.05 11.22 ? 171  GLU A CB    1  
ATOM   1295   C  CG    A GLU A 1 172 ? -34.909 -19.309 -15.802 0.05 11.27 ? 171  GLU A CG    1  
ATOM   1296   C  CD    A GLU A 1 172 ? -34.997 -17.791 -15.695 0.05 11.23 ? 171  GLU A CD    1  
ATOM   1297   O  OE1   A GLU A 1 172 ? -34.342 -17.241 -14.791 0.05 11.15 ? 171  GLU A OE1   1  
ATOM   1298   O  OE2   A GLU A 1 172 ? -35.686 -17.148 -16.518 0.05 11.29 ? 171  GLU A OE2   1  
ATOM   1299   N  N     A ASN A 1 173 ? -32.097 -21.168 -17.651 0.05 11.19 ? 172  ASN A N     1  
ATOM   1300   C  CA    A ASN A 1 173 ? -31.981 -21.373 -19.086 0.05 11.19 ? 172  ASN A CA    1  
ATOM   1301   C  C     A ASN A 1 173 ? -31.494 -22.754 -19.489 0.05 11.24 ? 172  ASN A C     1  
ATOM   1302   O  O     A ASN A 1 173 ? -31.115 -22.966 -20.643 0.05 11.23 ? 172  ASN A O     1  
ATOM   1303   C  CB    A ASN A 1 173 ? -31.047 -20.337 -19.690 0.05 11.09 ? 172  ASN A CB    1  
ATOM   1304   C  CG    A ASN A 1 173 ? -31.713 -19.009 -19.856 0.05 11.07 ? 172  ASN A CG    1  
ATOM   1305   O  OD1   A ASN A 1 173 ? -32.554 -18.827 -20.742 0.05 11.10 ? 172  ASN A OD1   1  
ATOM   1306   N  ND2   A ASN A 1 173 ? -31.350 -18.064 -19.007 0.05 11.04 ? 172  ASN A ND2   1  
ATOM   1307   N  N     A GLY A 1 174 ? -31.493 -23.686 -18.541 0.05 11.30 ? 173  GLY A N     1  
ATOM   1308   C  CA    A GLY A 1 174 ? -31.127 -25.061 -18.831 0.05 11.36 ? 173  GLY A CA    1  
ATOM   1309   C  C     A GLY A 1 174 ? -29.635 -25.267 -18.987 0.05 11.30 ? 173  GLY A C     1  
ATOM   1310   O  O     A GLY A 1 174 ? -29.181 -26.290 -19.497 0.05 11.35 ? 173  GLY A O     1  
ATOM   1311   N  N     A ILE A 1 175 ? -28.870 -24.281 -18.530 0.05 11.20 ? 174  ILE A N     1  
ATOM   1312   C  CA    A ILE A 1 175 ? -27.421 -24.295 -18.674 0.05 11.14 ? 174  ILE A CA    1  
ATOM   1313   C  C     A ILE A 1 175 ? -26.774 -24.616 -17.326 0.05 11.15 ? 174  ILE A C     1  
ATOM   1314   O  O     A ILE A 1 175 ? -26.911 -23.855 -16.380 0.05 11.13 ? 174  ILE A O     1  
ATOM   1315   C  CB    A ILE A 1 175 ? -26.942 -22.932 -19.203 0.05 11.04 ? 174  ILE A CB    1  
ATOM   1316   C  CG1   A ILE A 1 175 ? -27.441 -22.731 -20.634 0.05 11.04 ? 174  ILE A CG1   1  
ATOM   1317   C  CG2   A ILE A 1 175 ? -25.420 -22.811 -19.144 0.05 10.98 ? 174  ILE A CG2   1  
ATOM   1318   C  CD1   A ILE A 1 175 ? -27.065 -21.379 -21.238 0.05 10.96 ? 174  ILE A CD1   1  
ATOM   1319   N  N     A THR A 1 176 ? -26.088 -25.754 -17.240 0.05 11.21 ? 175  THR A N     1  
ATOM   1320   C  CA    A THR A 1 176 ? -25.519 -26.185 -15.967 0.05 11.25 ? 175  THR A CA    1  
ATOM   1321   C  C     A THR A 1 176 ? -24.063 -25.758 -15.873 0.05 11.18 ? 175  THR A C     1  
ATOM   1322   O  O     A THR A 1 176 ? -23.409 -25.959 -14.853 0.05 11.22 ? 175  THR A O     1  
ATOM   1323   C  CB    A THR A 1 176 ? -25.637 -27.719 -15.751 0.05 11.38 ? 175  THR A CB    1  
ATOM   1324   O  OG1   A THR A 1 176 ? -24.592 -28.399 -16.455 0.05 11.40 ? 175  THR A OG1   1  
ATOM   1325   C  CG2   A THR A 1 176 ? -26.983 -28.227 -16.241 0.05 11.45 ? 175  THR A CG2   1  
ATOM   1326   N  N     A GLU A 1 177 ? -23.572 -25.170 -16.961 0.05 11.10 ? 176  GLU A N     1  
ATOM   1327   C  CA    A GLU A 1 177 ? -22.254 -24.550 -16.995 0.05 11.04 ? 176  GLU A CA    1  
ATOM   1328   C  C     A GLU A 1 177 ? -21.998 -23.654 -15.805 0.05 11.01 ? 176  GLU A C     1  
ATOM   1329   O  O     A GLU A 1 177 ? -22.860 -22.871 -15.427 0.05 10.99 ? 176  GLU A O     1  
ATOM   1330   C  CB    A GLU A 1 177 ? -22.169 -23.625 -18.194 0.05 10.96 ? 176  GLU A CB    1  
ATOM   1331   C  CG    A GLU A 1 177 ? -21.959 -24.290 -19.483 0.05 10.99 ? 176  GLU A CG    1  
ATOM   1332   C  CD    A GLU A 1 177 ? -20.872 -23.590 -20.232 0.05 10.94 ? 176  GLU A CD    1  
ATOM   1333   O  OE1   A GLU A 1 177 ? -21.162 -22.935 -21.236 0.05 10.89 ? 176  GLU A OE1   1  
ATOM   1334   O  OE2   A GLU A 1 177 ? -19.717 -23.660 -19.785 0.05 10.98 ? 176  GLU A OE2   1  
ATOM   1335   N  N     A HIS A 1 178 ? -20.801 -23.726 -15.242 0.05 11.01 ? 177  HIS A N     1  
ATOM   1336   C  CA    A HIS A 1 178 ? -20.410 -22.689 -14.311 0.05 10.98 ? 177  HIS A CA    1  
ATOM   1337   C  C     A HIS A 1 178 ? -20.221 -21.419 -15.126 0.05 10.89 ? 177  HIS A C     1  
ATOM   1338   O  O     A HIS A 1 178 ? -19.738 -21.477 -16.246 0.05 10.86 ? 177  HIS A O     1  
ATOM   1339   C  CB    A HIS A 1 178 ? -19.111 -23.036 -13.602 0.05 11.02 ? 177  HIS A CB    1  
ATOM   1340   C  CG    A HIS A 1 178 ? -18.726 -22.048 -12.545 0.05 11.01 ? 177  HIS A CG    1  
ATOM   1341   N  ND1   A HIS A 1 178 ? -18.080 -20.862 -12.830 0.05 10.94 ? 177  HIS A ND1   1  
ATOM   1342   C  CD2   A HIS A 1 178 ? -18.903 -22.068 -11.202 0.05 11.08 ? 177  HIS A CD2   1  
ATOM   1343   C  CE1   A HIS A 1 178 ? -17.869 -20.200 -11.707 0.05 10.97 ? 177  HIS A CE1   1  
ATOM   1344   N  NE2   A HIS A 1 178 ? -18.360 -20.910 -10.704 0.05 11.05 ? 177  HIS A NE2   1  
ATOM   1345   N  N     A PRO A 1 179 ? -20.618 -20.273 -14.568 0.05 10.86 ? 178  PRO A N     1  
ATOM   1346   C  CA    A PRO A 1 179 ? -20.519 -19.012 -15.306 0.05 10.79 ? 178  PRO A CA    1  
ATOM   1347   C  C     A PRO A 1 179 ? -19.153 -18.748 -15.951 0.05 10.76 ? 178  PRO A C     1  
ATOM   1348   O  O     A PRO A 1 179 ? -19.128 -18.182 -17.032 0.05 10.71 ? 178  PRO A O     1  
ATOM   1349   C  CB    A PRO A 1 179 ? -20.831 -17.966 -14.237 0.05 10.79 ? 178  PRO A CB    1  
ATOM   1350   C  CG    A PRO A 1 179 ? -21.831 -18.674 -13.352 0.05 10.85 ? 178  PRO A CG    1  
ATOM   1351   C  CD    A PRO A 1 179 ? -21.357 -20.111 -13.299 0.05 10.90 ? 178  PRO A CD    1  
ATOM   1352   N  N     A ASP A 1 180 ? -18.052 -19.131 -15.320 0.05 10.79 ? 179  ASP A N     1  
ATOM   1353   C  CA    A ASP A 1 180 ? -16.743 -18.867 -15.935 0.05 10.77 ? 179  ASP A CA    1  
ATOM   1354   C  C     A ASP A 1 180 ? -16.490 -19.699 -17.188 0.05 10.77 ? 179  ASP A C     1  
ATOM   1355   O  O     A ASP A 1 180 ? -15.819 -19.249 -18.125 0.05 10.74 ? 179  ASP A O     1  
ATOM   1356   C  CB    A ASP A 1 180 ? -15.600 -19.020 -14.935 0.05 10.82 ? 179  ASP A CB    1  
ATOM   1357   C  CG    A ASP A 1 180 ? -15.476 -17.818 -14.022 0.05 10.82 ? 179  ASP A CG    1  
ATOM   1358   O  OD1   A ASP A 1 180 ? -15.689 -16.681 -14.503 0.05 10.77 ? 179  ASP A OD1   1  
ATOM   1359   O  OD2   A ASP A 1 180 ? -15.180 -18.009 -12.826 0.05 10.88 ? 179  ASP A OD2   1  
ATOM   1360   N  N     A THR A 1 181 ? -17.019 -20.911 -17.227 0.05 10.81 ? 180  THR A N     1  
ATOM   1361   C  CA    A THR A 1 181 ? -16.822 -21.691 -18.439 0.05 10.83 ? 180  THR A CA    1  
ATOM   1362   C  C     A THR A 1 181 ? -17.759 -21.166 -19.545 0.05 10.79 ? 180  THR A C     1  
ATOM   1363   O  O     A THR A 1 181 ? -17.363 -21.060 -20.705 0.05 10.77 ? 180  THR A O     1  
ATOM   1364   C  CB    A THR A 1 181 ? -16.877 -23.236 -18.196 0.05 10.91 ? 180  THR A CB    1  
ATOM   1365   O  OG1   A THR A 1 181 ? -18.123 -23.774 -18.621 0.05 10.94 ? 180  THR A OG1   1  
ATOM   1366   C  CG2   A THR A 1 181 ? -16.645 -23.578 -16.747 0.05 10.96 ? 180  THR A CG2   1  
ATOM   1367   N  N     A PHE A 1 182 ? -18.979 -20.788 -19.163 0.05 10.77 ? 181  PHE A N     1  
ATOM   1368   C  CA    A PHE A 1 182 ? -19.954 -20.202 -20.084 0.05 10.75 ? 181  PHE A CA    1  
ATOM   1369   C  C     A PHE A 1 182 ? -19.412 -18.920 -20.707 0.05 10.70 ? 181  PHE A C     1  
ATOM   1370   O  O     A PHE A 1 182 ? -19.505 -18.714 -21.919 0.05 10.69 ? 181  PHE A O     1  
ATOM   1371   C  CB    A PHE A 1 182 ? -21.276 -19.926 -19.338 0.05 10.75 ? 181  PHE A CB    1  
ATOM   1372   C  CG    A PHE A 1 182 ? -22.236 -19.022 -20.073 0.05 10.73 ? 181  PHE A CG    1  
ATOM   1373   C  CD1   A PHE A 1 182 ? -23.161 -19.549 -20.962 0.05 10.76 ? 181  PHE A CD1   1  
ATOM   1374   C  CD2   A PHE A 1 182 ? -22.246 -17.655 -19.840 0.05 10.69 ? 181  PHE A CD2   1  
ATOM   1375   C  CE1   A PHE A 1 182 ? -24.055 -18.732 -21.625 0.05 10.76 ? 181  PHE A CE1   1  
ATOM   1376   C  CE2   A PHE A 1 182 ? -23.139 -16.823 -20.504 0.05 10.69 ? 181  PHE A CE2   1  
ATOM   1377   C  CZ    A PHE A 1 182 ? -24.045 -17.365 -21.397 0.05 10.72 ? 181  PHE A CZ    1  
ATOM   1378   N  N     A ALA A 1 183 ? -18.822 -18.075 -19.865 0.05 10.67 ? 182  ALA A N     1  
ATOM   1379   C  CA    A ALA A 1 183 ? -18.345 -16.763 -20.297 0.05 10.64 ? 182  ALA A CA    1  
ATOM   1380   C  C     A ALA A 1 183 ? -16.988 -16.792 -21.007 0.05 10.64 ? 182  ALA A C     1  
ATOM   1381   O  O     A ALA A 1 183 ? -16.821 -16.150 -22.043 0.05 10.63 ? 182  ALA A O     1  
ATOM   1382   C  CB    A ALA A 1 183 ? -18.291 -15.800 -19.099 0.05 10.63 ? 182  ALA A CB    1  
ATOM   1383   N  N     A SER A 1 184 ? -16.027 -17.526 -20.449 0.05 10.67 ? 183  SER A N     1  
ATOM   1384   C  CA    A SER A 1 184 ? -14.633 -17.390 -20.880 0.05 10.68 ? 183  SER A CA    1  
ATOM   1385   C  C     A SER A 1 184 ? -14.149 -18.515 -21.777 0.05 10.71 ? 183  SER A C     1  
ATOM   1386   O  O     A SER A 1 184 ? -13.036 -18.452 -22.303 0.05 10.73 ? 183  SER A O     1  
ATOM   1387   C  CB    A SER A 1 184 ? -13.700 -17.295 -19.669 0.05 10.71 ? 183  SER A CB    1  
ATOM   1388   O  OG    A SER A 1 184 ? -13.934 -16.105 -18.930 0.05 10.69 ? 183  SER A OG    1  
ATOM   1389   N  N     A HIS A 1 185 ? -14.977 -19.543 -21.946 0.05 10.73 ? 184  HIS A N     1  
ATOM   1390   C  CA    A HIS A 1 185 ? -14.536 -20.735 -22.662 0.05 10.78 ? 184  HIS A CA    1  
ATOM   1391   C  C     A HIS A 1 185 ? -15.516 -21.209 -23.728 0.05 10.79 ? 184  HIS A C     1  
ATOM   1392   O  O     A HIS A 1 185 ? -16.246 -22.187 -23.528 0.05 10.83 ? 184  HIS A O     1  
ATOM   1393   C  CB    A HIS A 1 185 ? -14.207 -21.848 -21.667 0.05 10.83 ? 184  HIS A CB    1  
ATOM   1394   C  CG    A HIS A 1 185 ? -13.061 -21.503 -20.773 0.05 10.84 ? 184  HIS A CG    1  
ATOM   1395   N  ND1   A HIS A 1 185 ? -13.230 -21.002 -19.501 0.05 10.83 ? 184  HIS A ND1   1  
ATOM   1396   C  CD2   A HIS A 1 185 ? -11.726 -21.528 -20.994 0.05 10.87 ? 184  HIS A CD2   1  
ATOM   1397   C  CE1   A HIS A 1 185 ? -12.047 -20.756 -18.966 0.05 10.86 ? 184  HIS A CE1   1  
ATOM   1398   N  NE2   A HIS A 1 185 ? -11.119 -21.067 -19.852 0.05 10.88 ? 184  HIS A NE2   1  
ATOM   1399   N  N     A PRO A 1 186 ? -15.519 -20.517 -24.875 0.05 10.78 ? 185  PRO A N     1  
ATOM   1400   C  CA    A PRO A 1 186 ? -16.402 -20.879 -25.984 0.05 10.80 ? 185  PRO A CA    1  
ATOM   1401   C  C     A PRO A 1 186 ? -16.003 -22.228 -26.564 0.05 10.87 ? 185  PRO A C     1  
ATOM   1402   O  O     A PRO A 1 186 ? -14.837 -22.600 -26.523 0.05 10.89 ? 185  PRO A O     1  
ATOM   1403   C  CB    A PRO A 1 186 ? -16.147 -19.771 -27.009 0.05 10.79 ? 185  PRO A CB    1  
ATOM   1404   C  CG    A PRO A 1 186 ? -14.742 -19.345 -26.740 0.05 10.78 ? 185  PRO A CG    1  
ATOM   1405   C  CD    A PRO A 1 186 ? -14.576 -19.443 -25.247 0.05 10.75 ? 185  PRO A CD    1  
ATOM   1406   N  N     A PRO A 1 187 ? -16.974 -22.972 -27.101 0.05 10.92 ? 186  PRO A N     1  
ATOM   1407   C  CA    A PRO A 1 187 ? -16.605 -24.243 -27.733 0.05 11.00 ? 186  PRO A CA    1  
ATOM   1408   C  C     A PRO A 1 187 ? -15.915 -24.047 -29.086 0.05 11.02 ? 186  PRO A C     1  
ATOM   1409   O  O     A PRO A 1 187 ? -15.165 -24.922 -29.521 0.05 11.09 ? 186  PRO A O     1  
ATOM   1410   C  CB    A PRO A 1 187 ? -17.948 -24.966 -27.887 0.05 11.05 ? 186  PRO A CB    1  
ATOM   1411   C  CG    A PRO A 1 187 ? -18.966 -23.890 -27.883 0.05 11.00 ? 186  PRO A CG    1  
ATOM   1412   C  CD    A PRO A 1 187 ? -18.431 -22.808 -26.971 0.05 10.91 ? 186  PRO A CD    1  
ATOM   1413   N  N     A ARG A 1 188 ? -16.144 -22.906 -29.725 0.05 10.99 ? 187  ARG A N     1  
ATOM   1414   C  CA    A ARG A 1 188 ? -15.483 -22.580 -30.991 0.05 11.02 ? 187  ARG A CA    1  
ATOM   1415   C  C     A ARG A 1 188 ? -15.292 -21.069 -31.123 0.05 10.97 ? 187  ARG A C     1  
ATOM   1416   O  O     A ARG A 1 188 ? -16.227 -20.298 -30.945 0.05 10.93 ? 187  ARG A O     1  
ATOM   1417   C  CB    A ARG A 1 188 ? -16.294 -23.104 -32.179 0.05 11.10 ? 187  ARG A CB    1  
ATOM   1418   C  CG    A ARG A 1 188 ? -15.660 -22.832 -33.557 0.05 11.15 ? 187  ARG A CG    1  
ATOM   1419   C  CD    A ARG A 1 188 ? -14.358 -23.607 -33.731 0.05 11.20 ? 187  ARG A CD    1  
ATOM   1420   N  NE    A ARG A 1 188 ? -13.811 -23.506 -35.087 0.05 11.27 ? 187  ARG A NE    1  
ATOM   1421   C  CZ    A ARG A 1 188 ? -12.586 -23.069 -35.374 0.05 11.27 ? 187  ARG A CZ    1  
ATOM   1422   N  NH1   A ARG A 1 188 ? -11.773 -22.683 -34.396 0.05 11.22 ? 187  ARG A NH1   1  
ATOM   1423   N  NH2   A ARG A 1 188 ? -12.173 -23.011 -36.640 0.05 11.35 ? 187  ARG A NH2   1  
ATOM   1424   N  N     A SER A 1 189 ? -14.075 -20.650 -31.442 0.05 10.97 ? 188  SER A N     1  
ATOM   1425   C  CA    A SER A 1 189 ? -13.763 -19.225 -31.487 0.05 10.94 ? 188  SER A CA    1  
ATOM   1426   C  C     A SER A 1 189 ? -12.797 -18.885 -32.611 0.05 10.99 ? 188  SER A C     1  
ATOM   1427   O  O     A SER A 1 189 ? -11.853 -19.628 -32.854 0.05 11.03 ? 188  SER A O     1  
ATOM   1428   C  CB    A SER A 1 189 ? -13.151 -18.787 -30.153 0.05 10.88 ? 188  SER A CB    1  
ATOM   1429   O  OG    A SER A 1 189 ? -12.564 -17.499 -30.248 0.05 10.87 ? 188  SER A OG    1  
ATOM   1430   N  N     A LEU A 1 190 ? -13.054 -17.769 -33.292 0.05 11.00 ? 189  LEU A N     1  
ATOM   1431   C  CA    A LEU A 1 190 ? -12.084 -17.181 -34.212 0.05 11.05 ? 189  LEU A CA    1  
ATOM   1432   C  C     A LEU A 1 190 ? -11.529 -15.934 -33.559 0.05 11.01 ? 189  LEU A C     1  
ATOM   1433   O  O     A LEU A 1 190 ? -12.287 -15.121 -33.032 0.05 10.97 ? 189  LEU A O     1  
ATOM   1434   C  CB    A LEU A 1 190 ? -12.728 -16.806 -35.543 0.05 11.11 ? 189  LEU A CB    1  
ATOM   1435   C  CG    A LEU A 1 190 ? -13.365 -17.953 -36.321 0.05 11.17 ? 189  LEU A CG    1  
ATOM   1436   C  CD1   A LEU A 1 190 ? -13.857 -17.434 -37.669 0.05 11.25 ? 189  LEU A CD1   1  
ATOM   1437   C  CD2   A LEU A 1 190 ? -12.360 -19.068 -36.497 0.05 11.22 ? 189  LEU A CD2   1  
ATOM   1438   N  N     A VAL A 1 191 ? -10.209 -15.786 -33.600 0.05 11.04 ? 190  VAL A N     1  
ATOM   1439   C  CA    A VAL A 1 191 ? -9.548  -14.706 -32.879 0.05 11.02 ? 190  VAL A CA    1  
ATOM   1440   C  C     A VAL A 1 191 ? -8.984  -13.690 -33.862 0.05 11.09 ? 190  VAL A C     1  
ATOM   1441   O  O     A VAL A 1 191 ? -8.162  -14.031 -34.707 0.05 11.16 ? 190  VAL A O     1  
ATOM   1442   C  CB    A VAL A 1 191 ? -8.415  -15.238 -31.979 0.05 11.02 ? 190  VAL A CB    1  
ATOM   1443   C  CG1   A VAL A 1 191 ? -7.938  -14.138 -31.020 0.05 11.00 ? 190  VAL A CG1   1  
ATOM   1444   C  CG2   A VAL A 1 191 ? -8.875  -16.474 -31.189 0.05 10.98 ? 190  VAL A CG2   1  
ATOM   1445   N  N     A LEU A 1 192 ? -9.427  -12.443 -33.741 0.05 11.08 ? 191  LEU A N     1  
ATOM   1446   C  CA    A LEU A 1 192 ? -9.116  -11.421 -34.738 0.05 11.16 ? 191  LEU A CA    1  
ATOM   1447   C  C     A LEU A 1 192 ? -7.899  -10.576 -34.357 0.05 11.20 ? 191  LEU A C     1  
ATOM   1448   O  O     A LEU A 1 192 ? -7.835  -9.378  -34.659 0.05 11.25 ? 191  LEU A O     1  
ATOM   1449   C  CB    A LEU A 1 192 ? -10.331 -10.517 -35.002 0.05 11.16 ? 191  LEU A CB    1  
ATOM   1450   C  CG    A LEU A 1 192 ? -11.689 -11.158 -35.343 0.05 11.13 ? 191  LEU A CG    1  
ATOM   1451   C  CD1   A LEU A 1 192 ? -12.601 -10.172 -36.055 0.05 11.16 ? 191  LEU A CD1   1  
ATOM   1452   C  CD2   A LEU A 1 192 ? -11.552 -12.407 -36.163 0.05 11.18 ? 191  LEU A CD2   1  
ATOM   1453   N  N     A ILE A 1 193 ? -6.948  -11.193 -33.673 0.05 11.19 ? 192  ILE A N     1  
ATOM   1454   C  CA    A ILE A 1 193 ? -5.630  -10.587 -33.505 0.05 11.25 ? 192  ILE A CA    1  
ATOM   1455   C  C     A ILE A 1 193 ? -4.593  -11.577 -34.005 0.05 11.31 ? 192  ILE A C     1  
ATOM   1456   O  O     A ILE A 1 193 ? -4.840  -12.776 -34.022 0.05 11.28 ? 192  ILE A O     1  
ATOM   1457   C  CB    A ILE A 1 193 ? -5.316  -10.201 -32.036 0.05 11.21 ? 192  ILE A CB    1  
ATOM   1458   C  CG1   A ILE A 1 193 ? -5.364  -11.426 -31.123 0.05 11.14 ? 192  ILE A CG1   1  
ATOM   1459   C  CG2   A ILE A 1 193 ? -6.259  -9.102  -31.550 0.05 11.17 ? 192  ILE A CG2   1  
ATOM   1460   C  CD1   A ILE A 1 193 ? -4.623  -11.237 -29.818 0.05 11.14 ? 192  ILE A CD1   1  
ATOM   1461   N  N     A PRO A 1 194 ? -3.424  -11.086 -34.426 0.05 11.40 ? 193  PRO A N     1  
ATOM   1462   C  CA    A PRO A 1 194 ? -2.394  -12.064 -34.790 0.05 11.45 ? 193  PRO A CA    1  
ATOM   1463   C  C     A PRO A 1 194 ? -1.944  -12.874 -33.572 0.05 11.41 ? 193  PRO A C     1  
ATOM   1464   O  O     A PRO A 1 194 ? -1.867  -12.345 -32.463 0.05 11.37 ? 193  PRO A O     1  
ATOM   1465   C  CB    A PRO A 1 194 ? -1.245  -11.194 -35.319 0.05 11.57 ? 193  PRO A CB    1  
ATOM   1466   C  CG    A PRO A 1 194 ? -1.509  -9.825  -34.787 0.05 11.56 ? 193  PRO A CG    1  
ATOM   1467   C  CD    A PRO A 1 194 ? -2.990  -9.695  -34.638 0.05 11.47 ? 193  PRO A CD    1  
ATOM   1468   N  N     A LYS A 1 195 ? -1.649  -14.153 -33.778 0.05 11.43 ? 194  LYS A N     1  
ATOM   1469   C  CA    A LYS A 1 195 ? -1.250  -15.007 -32.671 0.05 11.40 ? 194  LYS A CA    1  
ATOM   1470   C  C     A LYS A 1 195 ? 0.054   -14.518 -32.030 0.05 11.47 ? 194  LYS A C     1  
ATOM   1471   O  O     A LYS A 1 195 ? 0.358   -14.855 -30.890 0.05 11.45 ? 194  LYS A O     1  
ATOM   1472   C  CB    A LYS A 1 195 ? -1.127  -16.464 -33.123 0.05 11.44 ? 194  LYS A CB    1  
ATOM   1473   C  CG    A LYS A 1 195 ? -1.204  -17.456 -31.980 0.05 11.39 ? 194  LYS A CG    1  
ATOM   1474   C  CD    A LYS A 1 195 ? -1.225  -18.890 -32.482 0.05 11.43 ? 194  LYS A CD    1  
ATOM   1475   C  CE    A LYS A 1 195 ? -1.487  -19.849 -31.334 0.05 11.38 ? 194  LYS A CE    1  
ATOM   1476   N  NZ    A LYS A 1 195 ? -1.404  -21.279 -31.763 0.05 11.43 ? 194  LYS A NZ    1  
ATOM   1477   N  N     A ALA A 1 196 ? 0.797   -13.697 -32.764 0.05 11.55 ? 195  ALA A N     1  
ATOM   1478   C  CA    A ALA A 1 196 ? 2.007   -13.071 -32.243 0.05 11.63 ? 195  ALA A CA    1  
ATOM   1479   C  C     A ALA A 1 196 ? 1.721   -12.187 -31.031 0.05 11.58 ? 195  ALA A C     1  
ATOM   1480   O  O     A ALA A 1 196 ? 2.607   -11.945 -30.207 0.05 11.63 ? 195  ALA A O     1  
ATOM   1481   C  CB    A ALA A 1 196 ? 2.688   -12.264 -33.336 0.05 11.74 ? 195  ALA A CB    1  
ATOM   1482   N  N     A LEU A 1 197 ? 0.482   -11.706 -30.930 0.05 11.49 ? 196  LEU A N     1  
ATOM   1483   C  CA    A LEU A 1 197 ? 0.083   -10.842 -29.821 0.05 11.44 ? 196  LEU A CA    1  
ATOM   1484   C  C     A LEU A 1 197 ? -0.791  -11.571 -28.788 0.05 11.34 ? 196  LEU A C     1  
ATOM   1485   O  O     A LEU A 1 197 ? -1.499  -10.936 -28.007 0.05 11.28 ? 196  LEU A O     1  
ATOM   1486   C  CB    A LEU A 1 197 ? -0.645  -9.602  -30.342 0.05 11.44 ? 196  LEU A CB    1  
ATOM   1487   C  CG    A LEU A 1 197 ? 0.225   -8.668  -31.189 0.05 11.56 ? 196  LEU A CG    1  
ATOM   1488   C  CD1   A LEU A 1 197 ? -0.596  -7.524  -31.787 0.05 11.57 ? 196  LEU A CD1   1  
ATOM   1489   C  CD2   A LEU A 1 197 ? 1.372   -8.123  -30.339 0.05 11.64 ? 196  LEU A CD2   1  
ATOM   1490   N  N     A GLN A 1 198 ? -0.737  -12.898 -28.795 0.05 11.33 ? 197  GLN A N     1  
ATOM   1491   C  CA    A GLN A 1 198 ? -1.465  -13.701 -27.815 0.05 11.25 ? 197  GLN A CA    1  
ATOM   1492   C  C     A GLN A 1 198 ? -0.500  -14.263 -26.776 0.05 11.30 ? 197  GLN A C     1  
ATOM   1493   O  O     A GLN A 1 198 ? 0.421   -14.986 -27.121 0.05 11.37 ? 197  GLN A O     1  
ATOM   1494   C  CB    A GLN A 1 198 ? -2.181  -14.861 -28.516 0.05 11.21 ? 197  GLN A CB    1  
ATOM   1495   C  CG    A GLN A 1 198 ? -2.628  -15.971 -27.582 0.05 11.17 ? 197  GLN A CG    1  
ATOM   1496   C  CD    A GLN A 1 198 ? -3.889  -15.626 -26.810 0.05 11.08 ? 197  GLN A CD    1  
ATOM   1497   O  OE1   A GLN A 1 198 ? -3.969  -15.836 -25.591 0.05 11.06 ? 197  GLN A OE1   1  
ATOM   1498   N  NE2   A GLN A 1 198 ? -4.882  -15.120 -27.510 0.05 11.04 ? 197  GLN A NE2   1  
ATOM   1499   N  N     A PRO A 1 199 ? -0.708  -13.930 -25.494 0.05 11.27 ? 198  PRO A N     1  
ATOM   1500   C  CA    A PRO A 1 199 ? 0.170   -14.493 -24.461 0.05 11.33 ? 198  PRO A CA    1  
ATOM   1501   C  C     A PRO A 1 199 ? 0.046   -16.013 -24.399 0.05 11.33 ? 198  PRO A C     1  
ATOM   1502   O  O     A PRO A 1 199 ? -1.050  -16.535 -24.607 0.05 11.25 ? 198  PRO A O     1  
ATOM   1503   C  CB    A PRO A 1 199 ? -0.362  -13.866 -23.167 0.05 11.29 ? 198  PRO A CB    1  
ATOM   1504   C  CG    A PRO A 1 199 ? -1.042  -12.593 -23.609 0.05 11.24 ? 198  PRO A CG    1  
ATOM   1505   C  CD    A PRO A 1 199 ? -1.651  -12.934 -24.949 0.05 11.20 ? 198  PRO A CD    1  
ATOM   1506   N  N     A HIS A 1 200 ? 1.153   -16.701 -24.135 0.05 11.42 ? 199  HIS A N     1  
ATOM   1507   C  CA    A HIS A 1 200 ? 1.143   -18.160 -24.004 0.05 11.44 ? 199  HIS A CA    1  
ATOM   1508   C  C     A HIS A 1 200 ? 0.549   -18.838 -25.227 0.05 11.40 ? 199  HIS A C     1  
ATOM   1509   O  O     A HIS A 1 200 ? -0.292  -19.725 -25.129 0.05 11.37 ? 199  HIS A O     1  
ATOM   1510   C  CB    A HIS A 1 200 ? 0.437   -18.547 -22.709 0.05 11.39 ? 199  HIS A CB    1  
ATOM   1511   C  CG    A HIS A 1 200 ? 0.988   -17.823 -21.527 0.05 11.44 ? 199  HIS A CG    1  
ATOM   1512   N  ND1   A HIS A 1 200 ? 2.338   -17.796 -21.253 0.05 11.56 ? 199  HIS A ND1   1  
ATOM   1513   C  CD2   A HIS A 1 200 ? 0.395   -17.045 -20.592 0.05 11.39 ? 199  HIS A CD2   1  
ATOM   1514   C  CE1   A HIS A 1 200 ? 2.551   -17.055 -20.182 0.05 11.59 ? 199  HIS A CE1   1  
ATOM   1515   N  NE2   A HIS A 1 200 ? 1.389   -16.588 -19.761 0.05 11.49 ? 199  HIS A NE2   1  
ATOM   1516   N  N     A ALA A 1 201 ? 1.045   -18.421 -26.386 0.05 11.43 ? 200  ALA A N     1  
ATOM   1517   C  CA    A ALA A 1 201 ? 0.509   -18.849 -27.675 0.05 11.41 ? 200  ALA A CA    1  
ATOM   1518   C  C     A ALA A 1 201 ? 0.485   -20.362 -27.964 0.05 11.45 ? 200  ALA A C     1  
ATOM   1519   O  O     A ALA A 1 201 ? -0.531  -20.845 -28.467 0.05 11.41 ? 200  ALA A O     1  
ATOM   1520   C  CB    A ALA A 1 201 ? 1.200   -18.107 -28.808 0.05 11.46 ? 200  ALA A CB    1  
ATOM   1521   N  N     A ASP A 1 202 ? 1.564   -21.109 -27.687 0.05 11.55 ? 201  ASP A N     1  
ATOM   1522   C  CA    A ASP A 1 202 ? 1.506   -22.550 -27.990 0.05 11.61 ? 201  ASP A CA    1  
ATOM   1523   C  C     A ASP A 1 202 ? 0.423   -23.263 -27.186 0.05 11.56 ? 201  ASP A C     1  
ATOM   1524   O  O     A ASP A 1 202 ? -0.135  -24.262 -27.642 0.05 11.57 ? 201  ASP A O     1  
ATOM   1525   C  CB    A ASP A 1 202 ? 2.837   -23.348 -27.860 0.05 11.74 ? 201  ASP A CB    1  
ATOM   1526   C  CG    A ASP A 1 202 ? 4.020   -22.529 -27.422 0.05 11.80 ? 201  ASP A CG    1  
ATOM   1527   O  OD1   A ASP A 1 202 ? 5.118   -22.713 -28.013 0.05 11.81 ? 201  ASP A OD1   1  
ATOM   1528   O  OD2   A ASP A 1 202 ? 3.877   -21.768 -26.454 0.05 11.85 ? 201  ASP A OD2   1  
ATOM   1529   N  N     A ARG A 1 203 ? 0.114   -22.745 -26.000 0.05 11.50 ? 202  ARG A N     1  
ATOM   1530   C  CA    A ARG A 1 203 ? -0.814  -23.444 -25.118 0.05 11.46 ? 202  ARG A CA    1  
ATOM   1531   C  C     A ARG A 1 203 ? -2.291  -23.126 -25.333 0.05 11.35 ? 202  ARG A C     1  
ATOM   1532   O  O     A ARG A 1 203 ? -3.137  -23.616 -24.594 0.05 11.32 ? 202  ARG A O     1  
ATOM   1533   C  CB    A ARG A 1 203 ? -0.411  -23.291 -23.653 0.05 11.49 ? 202  ARG A CB    1  
ATOM   1534   C  CG    A ARG A 1 203 ? 0.917   -23.987 -23.376 0.05 11.62 ? 202  ARG A CG    1  
ATOM   1535   C  CD    A ARG A 1 203 ? 1.080   -24.383 -21.928 0.05 11.67 ? 202  ARG A CD    1  
ATOM   1536   N  NE    A ARG A 1 203 ? 2.098   -23.563 -21.292 0.05 11.72 ? 202  ARG A NE    1  
ATOM   1537   C  CZ    A ARG A 1 203 ? 1.822   -22.528 -20.504 0.05 11.66 ? 202  ARG A CZ    1  
ATOM   1538   N  NH1   A ARG A 1 203 ? 0.561   -22.218 -20.237 0.05 11.55 ? 202  ARG A NH1   1  
ATOM   1539   N  NH2   A ARG A 1 203 ? 2.803   -21.824 -19.959 0.05 11.72 ? 202  ARG A NH2   1  
ATOM   1540   N  N     A VAL A 1 204 ? -2.597  -22.329 -26.348 0.05 11.31 ? 203  VAL A N     1  
ATOM   1541   C  CA    A VAL A 1 204 ? -3.991  -22.108 -26.733 0.05 11.22 ? 203  VAL A CA    1  
ATOM   1542   C  C     A VAL A 1 204 ? -4.483  -23.318 -27.519 0.05 11.25 ? 203  VAL A C     1  
ATOM   1543   O  O     A VAL A 1 204 ? -3.737  -23.897 -28.307 0.05 11.33 ? 203  VAL A O     1  
ATOM   1544   C  CB    A VAL A 1 204 ? -4.158  -20.829 -27.579 0.05 11.18 ? 203  VAL A CB    1  
ATOM   1545   C  CG1   A VAL A 1 204 ? -5.591  -20.684 -28.071 0.05 11.11 ? 203  VAL A CG1   1  
ATOM   1546   C  CG2   A VAL A 1 204 ? -3.771  -19.615 -26.754 0.05 11.15 ? 203  VAL A CG2   1  
ATOM   1547   N  N     A ASP A 1 205 ? -5.738  -23.691 -27.297 0.05 11.21 ? 204  ASP A N     1  
ATOM   1548   C  CA    A ASP A 1 205 ? -6.320  -24.896 -27.881 0.05 11.25 ? 204  ASP A CA    1  
ATOM   1549   C  C     A ASP A 1 205 ? -6.763  -24.652 -29.322 0.05 11.25 ? 204  ASP A C     1  
ATOM   1550   O  O     A ASP A 1 205 ? -7.802  -24.052 -29.559 0.05 11.19 ? 204  ASP A O     1  
ATOM   1551   C  CB    A ASP A 1 205 ? -7.509  -25.340 -27.021 0.05 11.20 ? 204  ASP A CB    1  
ATOM   1552   C  CG    A ASP A 1 205 ? -8.084  -26.674 -27.457 0.05 11.26 ? 204  ASP A CG    1  
ATOM   1553   O  OD1   A ASP A 1 205 ? -8.155  -26.918 -28.673 0.05 11.30 ? 204  ASP A OD1   1  
ATOM   1554   O  OD2   A ASP A 1 205 ? -8.471  -27.463 -26.574 0.05 11.29 ? 204  ASP A OD2   1  
ATOM   1555   N  N     A GLU A 1 206 ? -5.989  -25.174 -30.272 0.05 11.34 ? 205  GLU A N     1  
ATOM   1556   C  CA    A GLU A 1 206 ? -6.244  -24.973 -31.701 0.05 11.38 ? 205  GLU A CA    1  
ATOM   1557   C  C     A GLU A 1 206 ? -7.564  -25.574 -32.207 0.05 11.37 ? 205  GLU A C     1  
ATOM   1558   O  O     A GLU A 1 206 ? -8.113  -25.132 -33.223 0.05 11.38 ? 205  GLU A O     1  
ATOM   1559   C  CB    A GLU A 1 206 ? -5.068  -25.529 -32.515 0.05 11.49 ? 205  GLU A CB    1  
ATOM   1560   C  CG    A GLU A 1 206 ? -3.824  -24.663 -32.458 0.05 11.51 ? 205  GLU A CG    1  
ATOM   1561   C  CD    A GLU A 1 206 ? -2.580  -25.401 -31.981 0.05 11.60 ? 205  GLU A CD    1  
ATOM   1562   O  OE1   A GLU A 1 206 ? -1.468  -24.830 -32.102 0.05 11.65 ? 205  GLU A OE1   1  
ATOM   1563   O  OE2   A GLU A 1 206 ? -2.706  -26.548 -31.492 0.05 11.62 ? 205  GLU A OE2   1  
ATOM   1564   N  N     A ASP A 1 207 ? -8.082  -26.573 -31.508 0.05 11.38 ? 206  ASP A N     1  
ATOM   1565   C  CA    A ASP A 1 207 ? -9.328  -27.199 -31.940 0.05 11.40 ? 206  ASP A CA    1  
ATOM   1566   C  C     A ASP A 1 207 ? -10.540 -26.344 -31.543 0.05 11.30 ? 206  ASP A C     1  
ATOM   1567   O  O     A ASP A 1 207 ? -11.631 -26.502 -32.082 0.05 11.31 ? 206  ASP A O     1  
ATOM   1568   C  CB    A ASP A 1 207 ? -9.440  -28.638 -31.408 0.05 11.45 ? 206  ASP A CB    1  
ATOM   1569   C  CG    A ASP A 1 207 ? -8.158  -29.125 -30.749 0.05 11.53 ? 206  ASP A CG    1  
ATOM   1570   O  OD1   A ASP A 1 207 ? -8.167  -29.275 -29.508 0.05 11.51 ? 206  ASP A OD1   1  
ATOM   1571   O  OD2   A ASP A 1 207 ? -7.148  -29.365 -31.455 0.05 11.64 ? 206  ASP A OD2   1  
ATOM   1572   N  N     A VAL A 1 208 ? -10.329 -25.430 -30.602 0.05 11.21 ? 207  VAL A N     1  
ATOM   1573   C  CA    A VAL A 1 208 ? -11.349 -24.465 -30.219 0.05 11.13 ? 207  VAL A CA    1  
ATOM   1574   C  C     A VAL A 1 208 ? -11.089 -23.127 -30.901 0.05 11.09 ? 207  VAL A C     1  
ATOM   1575   O  O     A VAL A 1 208 ? -11.990 -22.538 -31.498 0.05 11.07 ? 207  VAL A O     1  
ATOM   1576   C  CB    A VAL A 1 208 ? -11.363 -24.249 -28.699 0.05 11.07 ? 207  VAL A CB    1  
ATOM   1577   C  CG1   A VAL A 1 208 ? -12.198 -23.016 -28.332 0.05 10.99 ? 207  VAL A CG1   1  
ATOM   1578   C  CG2   A VAL A 1 208 ? -11.915 -25.481 -28.004 0.05 11.11 ? 207  VAL A CG2   1  
ATOM   1579   N  N     A TYR A 1 209 ? -9.843  -22.665 -30.815 0.05 11.10 ? 208  TYR A N     1  
ATOM   1580   C  CA    A TYR A 1 209 ? -9.481  -21.340 -31.307 0.05 11.07 ? 208  TYR A CA    1  
ATOM   1581   C  C     A TYR A 1 209 ? -8.680  -21.389 -32.591 0.05 11.15 ? 208  TYR A C     1  
ATOM   1582   O  O     A TYR A 1 209 ? -7.684  -22.100 -32.673 0.05 11.21 ? 208  TYR A O     1  
ATOM   1583   C  CB    A TYR A 1 209 ? -8.633  -20.603 -30.271 0.05 11.04 ? 208  TYR A CB    1  
ATOM   1584   C  CG    A TYR A 1 209 ? -9.311  -20.422 -28.939 0.05 10.97 ? 208  TYR A CG    1  
ATOM   1585   C  CD1   A TYR A 1 209 ? -10.225 -19.396 -28.741 0.05 10.91 ? 208  TYR A CD1   1  
ATOM   1586   C  CD2   A TYR A 1 209 ? -9.032  -21.273 -27.880 0.05 10.99 ? 208  TYR A CD2   1  
ATOM   1587   C  CE1   A TYR A 1 209 ? -10.849 -19.221 -27.521 0.05 10.86 ? 208  TYR A CE1   1  
ATOM   1588   C  CE2   A TYR A 1 209 ? -9.649  -21.111 -26.655 0.05 10.94 ? 208  TYR A CE2   1  
ATOM   1589   C  CZ    A TYR A 1 209 ? -10.550 -20.082 -26.478 0.05 10.87 ? 208  TYR A CZ    1  
ATOM   1590   O  OH    A TYR A 1 209 ? -11.155 -19.937 -25.257 0.05 10.84 ? 208  TYR A OH    1  
ATOM   1591   N  N     A THR A 1 210 ? -9.101  -20.601 -33.571 0.05 11.16 ? 209  THR A N     1  
ATOM   1592   C  CA    A THR A 1 210 ? -8.293  -20.368 -34.756 0.05 11.23 ? 209  THR A CA    1  
ATOM   1593   C  C     A THR A 1 210 ? -8.015  -18.879 -34.867 0.05 11.21 ? 209  THR A C     1  
ATOM   1594   O  O     A THR A 1 210 ? -8.937  -18.072 -34.842 0.05 11.17 ? 209  THR A O     1  
ATOM   1595   C  CB    A THR A 1 210 ? -9.008  -20.824 -36.033 0.05 11.29 ? 209  THR A CB    1  
ATOM   1596   O  OG1   A THR A 1 210 ? -9.414  -22.188 -35.886 0.05 11.32 ? 209  THR A OG1   1  
ATOM   1597   C  CG2   A THR A 1 210 ? -8.065  -20.707 -37.232 0.05 11.39 ? 209  THR A CG2   1  
ATOM   1598   N  N     A PHE A 1 211 ? -6.742  -18.525 -34.975 0.05 11.26 ? 210  PHE A N     1  
ATOM   1599   C  CA    A PHE A 1 211 ? -6.350  -17.138 -35.169 0.05 11.26 ? 210  PHE A CA    1  
ATOM   1600   C  C     A PHE A 1 211 ? -6.391  -16.776 -36.641 0.05 11.34 ? 210  PHE A C     1  
ATOM   1601   O  O     A PHE A 1 211 ? -5.741  -17.428 -37.461 0.05 11.43 ? 210  PHE A O     1  
ATOM   1602   C  CB    A PHE A 1 211 ? -4.947  -16.895 -34.604 0.05 11.29 ? 210  PHE A CB    1  
ATOM   1603   C  CG    A PHE A 1 211 ? -4.904  -16.906 -33.112 0.05 11.22 ? 210  PHE A CG    1  
ATOM   1604   C  CD1   A PHE A 1 211 ? -4.973  -18.095 -32.417 0.05 11.20 ? 210  PHE A CD1   1  
ATOM   1605   C  CD2   A PHE A 1 211 ? -4.829  -15.720 -32.399 0.05 11.19 ? 210  PHE A CD2   1  
ATOM   1606   C  CE1   A PHE A 1 211 ? -4.955  -18.108 -31.023 0.05 11.15 ? 210  PHE A CE1   1  
ATOM   1607   C  CE2   A PHE A 1 211 ? -4.806  -15.730 -31.016 0.05 11.14 ? 210  PHE A CE2   1  
ATOM   1608   C  CZ    A PHE A 1 211 ? -4.869  -16.923 -30.328 0.05 11.12 ? 210  PHE A CZ    1  
ATOM   1609   N  N     A VAL A 1 212 ? -7.163  -15.744 -36.968 0.05 11.33 ? 211  VAL A N     1  
ATOM   1610   C  CA    A VAL A 1 212 ? -7.244  -15.257 -38.338 0.05 11.42 ? 211  VAL A CA    1  
ATOM   1611   C  C     A VAL A 1 212 ? -6.686  -13.840 -38.485 0.05 11.45 ? 211  VAL A C     1  
ATOM   1612   O  O     A VAL A 1 212 ? -6.467  -13.368 -39.597 0.05 11.53 ? 211  VAL A O     1  
ATOM   1613   C  CB    A VAL A 1 212 ? -8.687  -15.312 -38.877 0.05 11.42 ? 211  VAL A CB    1  
ATOM   1614   C  CG1   A VAL A 1 212 ? -9.184  -16.743 -38.878 0.05 11.41 ? 211  VAL A CG1   1  
ATOM   1615   C  CG2   A VAL A 1 212 ? -9.588  -14.450 -38.042 0.05 11.33 ? 211  VAL A CG2   1  
ATOM   1616   N  N     A GLY A 1 213 ? -6.437  -13.178 -37.361 0.05 11.40 ? 212  GLY A N     1  
ATOM   1617   C  CA    A GLY A 1 213 ? -5.831  -11.854 -37.384 0.05 11.45 ? 212  GLY A CA    1  
ATOM   1618   C  C     A GLY A 1 213 ? -6.769  -10.743 -37.831 0.05 11.46 ? 212  GLY A C     1  
ATOM   1619   O  O     A GLY A 1 213 ? -7.997  -10.877 -37.768 0.05 11.40 ? 212  GLY A O     1  
ATOM   1620   N  N     A ALA A 1 214 ? -6.192  -9.635  -38.282 0.05 11.54 ? 213  ALA A N     1  
ATOM   1621   C  CA    A ALA A 1 214 ? -6.988  -8.486  -38.721 0.05 11.57 ? 213  ALA A CA    1  
ATOM   1622   C  C     A ALA A 1 214 ? -7.847  -8.821  -39.932 0.05 11.63 ? 213  ALA A C     1  
ATOM   1623   O  O     A ALA A 1 214 ? -7.517  -9.711  -40.697 0.05 11.68 ? 213  ALA A O     1  
ATOM   1624   C  CB    A ALA A 1 214 ? -6.100  -7.305  -39.029 0.05 11.68 ? 213  ALA A CB    1  
ATOM   1625   N  N     A CYS A 1 215 ? -8.955  -8.100  -40.094 0.05 11.62 ? 214  CYS A N     1  
ATOM   1626   C  CA    A CYS A 1 215 ? -9.869  -8.332  -41.210 0.05 11.69 ? 214  CYS A CA    1  
ATOM   1627   C  C     A CYS A 1 215 ? -10.312 -6.986  -41.784 0.05 11.78 ? 214  CYS A C     1  
ATOM   1628   O  O     A CYS A 1 215 ? -11.201 -6.331  -41.219 0.05 11.75 ? 214  CYS A O     1  
ATOM   1629   C  CB    A CYS A 1 215 ? -11.096 -9.156  -40.772 0.05 11.60 ? 214  CYS A CB    1  
ATOM   1630   S  SG    A CYS A 1 215 ? -10.729 -10.700 -39.895 0.05 11.49 ? 214  CYS A SG    1  
ATOM   1631   N  N     A GLN A 1 216 ? -9.687  -6.585  -42.893 0.05 13.09 ? 215  GLN A N     1  
ATOM   1632   C  CA    A GLN A 1 216 ? -9.986  -5.310  -43.554 0.05 13.16 ? 215  GLN A CA    1  
ATOM   1633   C  C     A GLN A 1 216 ? -9.169  -4.940  -44.813 0.05 13.12 ? 215  GLN A C     1  
ATOM   1634   O  O     A GLN A 1 216 ? -9.602  -5.189  -45.944 0.05 13.36 ? 215  GLN A O     1  
ATOM   1635   N  N     A GLY A 1 217 ? -8.010  -4.312  -44.631 0.05 12.86 ? 216  GLY A N     1  
ATOM   1636   C  CA    A GLY A 1 217 ? -7.342  -3.675  -45.756 0.05 12.86 ? 216  GLY A CA    1  
ATOM   1637   C  C     A GLY A 1 217 ? -5.835  -3.741  -45.962 0.05 12.57 ? 216  GLY A C     1  
ATOM   1638   O  O     A GLY A 1 217 ? -5.328  -3.075  -46.863 0.05 12.57 ? 216  GLY A O     1  
ATOM   1639   N  N     A ASP A 1 218 ? -5.099  -4.516  -45.167 0.05 12.35 ? 217  ASP A N     1  
ATOM   1640   C  CA    A ASP A 1 218 ? -3.648  -4.572  -45.367 0.05 12.11 ? 217  ASP A CA    1  
ATOM   1641   C  C     A ASP A 1 218 ? -3.230  -5.301  -46.659 0.05 12.18 ? 217  ASP A C     1  
ATOM   1642   O  O     A ASP A 1 218 ? -3.518  -6.491  -46.840 0.05 12.24 ? 217  ASP A O     1  
ATOM   1643   C  CB    A ASP A 1 218 ? -2.909  -5.108  -44.126 0.05 11.91 ? 217  ASP A CB    1  
ATOM   1644   C  CG    A ASP A 1 218 ? -3.528  -6.375  -43.567 0.05 12.00 ? 217  ASP A CG    1  
ATOM   1645   O  OD1   A ASP A 1 218 ? -3.223  -7.458  -44.099 0.05 11.98 ? 217  ASP A OD1   1  
ATOM   1646   O  OD2   A ASP A 1 218 ? -4.314  -6.298  -42.598 0.05 12.12 ? 217  ASP A OD2   1  
ATOM   1647   N  N     A ARG A 1 219 ? -2.518  -4.598  -47.544 0.05 12.19 ? 218  ARG A N     1  
ATOM   1648   C  CA    A ARG A 1 219 ? -2.008  -3.240  -47.290 0.05 12.10 ? 218  ARG A CA    1  
ATOM   1649   C  C     A ARG A 1 219 ? -2.112  -2.312  -48.517 0.05 12.29 ? 218  ARG A C     1  
ATOM   1650   O  O     A ARG A 1 219 ? -1.997  -2.771  -49.645 0.05 12.46 ? 218  ARG A O     1  
ATOM   1651   C  CB    A ARG A 1 219 ? -0.548  -3.297  -46.806 0.05 11.82 ? 218  ARG A CB    1  
ATOM   1652   C  CG    A ARG A 1 219 ? 0.138   -4.660  -46.912 0.05 11.76 ? 218  ARG A CG    1  
ATOM   1653   C  CD    A ARG A 1 219 ? 0.577   -4.981  -48.342 0.05 11.94 ? 218  ARG A CD    1  
ATOM   1654   N  NE    A ARG A 1 219 ? 1.506   -6.113  -48.387 0.05 11.89 ? 218  ARG A NE    1  
ATOM   1655   C  CZ    A ARG A 1 219 ? 1.997   -6.633  -49.506 0.05 12.06 ? 218  ARG A CZ    1  
ATOM   1656   N  NH1   A ARG A 1 219 ? 1.649   -6.133  -50.689 0.05 12.29 ? 218  ARG A NH1   1  
ATOM   1657   N  NH2   A ARG A 1 219 ? 2.836   -7.656  -49.444 0.05 12.04 ? 218  ARG A NH2   1  
ATOM   1658   N  N     A ALA A 1 220 ? -2.320  -1.011  -48.310 0.05 12.31 ? 219  ALA A N     1  
ATOM   1659   C  CA    A ALA A 1 220 ? -2.421  -0.408  -46.987 0.05 12.16 ? 219  ALA A CA    1  
ATOM   1660   C  C     A ALA A 1 220 ? -3.434  0.731   -46.961 0.05 12.35 ? 219  ALA A C     1  
ATOM   1661   O  O     A ALA A 1 220 ? -3.307  1.684   -47.731 0.05 12.48 ? 219  ALA A O     1  
ATOM   1662   C  CB    A ALA A 1 220 ? -1.087  0.109   -46.583 0.05 11.90 ? 219  ALA A CB    1  
ATOM   1663   N  N     A GLU A 1 221 ? -4.403  0.651   -46.041 0.05 12.39 ? 220  GLU A N     1  
ATOM   1664   C  CA    A GLU A 1 221 ? -5.542  1.580   -46.023 0.05 12.64 ? 220  GLU A CA    1  
ATOM   1665   C  C     A GLU A 1 221 ? -5.361  2.941   -45.312 0.05 12.55 ? 220  GLU A C     1  
ATOM   1666   O  O     A GLU A 1 221 ? -5.067  2.957   -44.120 0.05 12.32 ? 220  GLU A O     1  
ATOM   1667   C  CB    A GLU A 1 221 ? -6.835  0.893   -45.522 0.05 12.79 ? 220  GLU A CB    1  
ATOM   1668   C  CG    A GLU A 1 221 ? -8.141  1.723   -45.712 0.05 13.15 ? 220  GLU A CG    1  
ATOM   1669   C  CD    A GLU A 1 221 ? -8.388  2.831   -44.670 0.05 13.18 ? 220  GLU A CD    1  
ATOM   1670   O  OE1   A GLU A 1 221 ? -9.317  3.652   -44.869 0.05 13.47 ? 220  GLU A OE1   1  
ATOM   1671   O  OE2   A GLU A 1 221 ? -7.685  2.885   -43.643 0.05 12.95 ? 220  GLU A OE2   1  
ATOM   1672   N  N     A GLU A 1 222 ? -5.556  4.081   -45.994 0.05 12.74 ? 221  GLU A N     1  
ATOM   1673   C  CA    A GLU A 1 222 ? -5.621  4.277   -47.455 0.05 13.01 ? 221  GLU A CA    1  
ATOM   1674   C  C     A GLU A 1 222 ? -5.612  5.808   -47.740 0.05 13.08 ? 221  GLU A C     1  
ATOM   1675   O  O     A GLU A 1 222 ? -6.553  6.542   -47.383 0.05 13.35 ? 221  GLU A O     1  
ATOM   1676   C  CB    A GLU A 1 222 ? -6.829  3.605   -48.144 0.05 13.37 ? 221  GLU A CB    1  
ATOM   1677   C  CG    A GLU A 1 222 ? -6.398  2.463   -49.043 0.05 13.66 ? 221  GLU A CG    1  
ATOM   1678   C  CD    A GLU A 1 222 ? -7.548  1.775   -49.775 0.05 13.75 ? 221  GLU A CD    1  
ATOM   1679   O  OE1   A GLU A 1 222 ? -7.743  2.047   -50.965 0.05 14.03 ? 221  GLU A OE1   1  
ATOM   1680   O  OE2   A GLU A 1 222 ? -8.185  0.883   -49.172 0.05 13.55 ? 221  GLU A OE2   1  
ATOM   1681   N  N     A GLY A 1 223 ? -4.564  6.278   -48.414 0.05 12.86 ? 222  GLY A N     1  
ATOM   1682   C  CA    A GLY A 1 223 ? -4.401  7.686   -48.727 0.05 12.92 ? 222  GLY A CA    1  
ATOM   1683   C  C     A GLY A 1 223 ? -3.080  7.750   -49.443 0.05 12.72 ? 222  GLY A C     1  
ATOM   1684   O  O     A GLY A 1 223 ? -2.113  7.175   -48.953 0.05 12.43 ? 222  GLY A O     1  
ATOM   1685   N  N     A GLY A 1 224 ? -3.049  8.413   -50.595 0.05 12.92 ? 223  GLY A N     1  
ATOM   1686   C  CA    A GLY A 1 224 ? -1.883  8.423   -51.465 0.05 12.82 ? 223  GLY A CA    1  
ATOM   1687   C  C     A GLY A 1 224 ? -0.543  8.944   -50.953 0.05 12.55 ? 223  GLY A C     1  
ATOM   1688   O  O     A GLY A 1 224 ? 0.081   9.794   -51.608 0.05 12.64 ? 223  GLY A O     1  
ATOM   1689   N  N     A TRP A 1 225 ? -0.071  8.429   -49.814 0.05 12.24 ? 224  TRP A N     1  
ATOM   1690   C  CA    A TRP A 1 225 ? 1.205   8.917   -49.270 0.05 11.96 ? 224  TRP A CA    1  
ATOM   1691   C  C     A TRP A 1 225 ? 2.440   8.598   -50.127 0.05 11.92 ? 224  TRP A C     1  
ATOM   1692   O  O     A TRP A 1 225 ? 2.525   7.554   -50.767 0.05 11.99 ? 224  TRP A O     1  
ATOM   1693   C  CB    A TRP A 1 225 ? 1.445   8.510   -47.805 0.05 11.69 ? 224  TRP A CB    1  
ATOM   1694   C  CG    A TRP A 1 225 ? 2.458   9.437   -47.143 0.05 11.47 ? 224  TRP A CG    1  
ATOM   1695   C  CD1   A TRP A 1 225 ? 2.235   10.711  -46.718 0.05 11.49 ? 224  TRP A CD1   1  
ATOM   1696   C  CD2   A TRP A 1 225 ? 3.844   9.163   -46.867 0.05 11.23 ? 224  TRP A CD2   1  
ATOM   1697   N  NE1   A TRP A 1 225 ? 3.388   11.248  -46.190 0.05 11.25 ? 224  TRP A NE1   1  
ATOM   1698   C  CE2   A TRP A 1 225 ? 4.389   10.318  -46.274 0.05 11.09 ? 224  TRP A CE2   1  
ATOM   1699   C  CE3   A TRP A 1 225 ? 4.674   8.056   -47.068 0.05 11.13 ? 224  TRP A CE3   1  
ATOM   1700   C  CZ2   A TRP A 1 225 ? 5.723   10.395  -45.868 0.05 10.87 ? 224  TRP A CZ2   1  
ATOM   1701   C  CZ3   A TRP A 1 225 ? 5.995   8.134   -46.660 0.05 10.92 ? 224  TRP A CZ3   1  
ATOM   1702   C  CH2   A TRP A 1 225 ? 6.507   9.297   -46.072 0.05 10.79 ? 224  TRP A CH2   1  
ATOM   1703   N  N     A GLN A 1 226 ? 3.395   9.523   -50.124 0.05 11.82 ? 225  GLN A N     1  
ATOM   1704   C  CA    A GLN A 1 226 ? 4.624   9.373   -50.894 0.05 11.79 ? 225  GLN A CA    1  
ATOM   1705   C  C     A GLN A 1 226 ? 5.848   9.663   -50.037 0.05 11.49 ? 225  GLN A C     1  
ATOM   1706   O  O     A GLN A 1 226 ? 5.939   10.726  -49.424 0.05 11.39 ? 225  GLN A O     1  
ATOM   1707   C  CB    A GLN A 1 226 ? 4.616   10.314  -52.103 0.05 12.06 ? 225  GLN A CB    1  
ATOM   1708   N  N     A ARG A 1 227 ? 6.785   8.718   -49.993 0.05 11.37 ? 226  ARG A N     1  
ATOM   1709   C  CA    A ARG A 1 227 ? 8.066   8.969   -49.340 0.05 11.13 ? 226  ARG A CA    1  
ATOM   1710   C  C     A ARG A 1 227 ? 8.782   10.066  -50.098 0.05 11.20 ? 226  ARG A C     1  
ATOM   1711   O  O     A ARG A 1 227 ? 8.758   10.080  -51.326 0.05 11.44 ? 226  ARG A O     1  
ATOM   1712   C  CB    A ARG A 1 227 ? 8.963   7.730   -49.359 0.05 11.07 ? 226  ARG A CB    1  
ATOM   1713   C  CG    A ARG A 1 227 ? 8.722   6.729   -48.257 0.05 11.01 ? 226  ARG A CG    1  
ATOM   1714   C  CD    A ARG A 1 227 ? 9.610   5.505   -48.437 0.05 11.04 ? 226  ARG A CD    1  
ATOM   1715   N  NE    A ARG A 1 227 ? 11.028  5.750   -48.177 0.05 10.91 ? 226  ARG A NE    1  
ATOM   1716   C  CZ    A ARG A 1 227 ? 11.742  5.091   -47.266 0.05 10.74 ? 226  ARG A CZ    1  
ATOM   1717   N  NH1   A ARG A 1 227 ? 13.030  5.358   -47.100 0.05 10.66 ? 226  ARG A NH1   1  
ATOM   1718   N  NH2   A ARG A 1 227 ? 11.166  4.160   -46.519 0.05 10.68 ? 226  ARG A NH2   1  
ATOM   1719   N  N     A PRO A 1 228 ? 9.433   10.983  -49.368 0.05 11.01 ? 227  PRO A N     1  
ATOM   1720   C  CA    A PRO A 1 228 ? 10.287  11.980  -50.015 0.05 11.05 ? 227  PRO A CA    1  
ATOM   1721   C  C     A PRO A 1 228 ? 11.402  11.319  -50.813 0.05 11.13 ? 227  PRO A C     1  
ATOM   1722   O  O     A PRO A 1 228 ? 12.035  10.372  -50.337 0.05 11.02 ? 227  PRO A O     1  
ATOM   1723   C  CB    A PRO A 1 228 ? 10.898  12.734  -48.831 0.05 10.79 ? 227  PRO A CB    1  
ATOM   1724   C  CG    A PRO A 1 228 ? 9.898   12.565  -47.724 0.05 10.69 ? 227  PRO A CG    1  
ATOM   1725   C  CD    A PRO A 1 228 ? 9.365   11.172  -47.909 0.05 10.78 ? 227  PRO A CD    1  
ATOM   1726   N  N     A ALA A 1 229 ? 11.627  11.809  -52.025 0.05 11.36 ? 228  ALA A N     1  
ATOM   1727   C  CA    A ALA A 1 229 ? 12.784  11.396  -52.782 0.05 11.48 ? 228  ALA A CA    1  
ATOM   1728   C  C     A ALA A 1 229 ? 13.979  11.838  -51.948 0.05 11.26 ? 228  ALA A C     1  
ATOM   1729   O  O     A ALA A 1 229 ? 14.063  12.994  -51.544 0.05 11.12 ? 228  ALA A O     1  
ATOM   1730   C  CB    A ALA A 1 229 ? 12.789  12.063  -54.150 0.05 11.80 ? 228  ALA A CB    1  
ATOM   1731   N  N     A GLY A 1 230 ? 14.880  10.910  -51.644 0.05 11.23 ? 229  GLY A N     1  
ATOM   1732   C  CA    A GLY A 1 230 ? 15.997  11.227  -50.772 0.05 11.04 ? 229  GLY A CA    1  
ATOM   1733   C  C     A GLY A 1 230 ? 15.976  10.449  -49.472 0.05 10.80 ? 229  GLY A C     1  
ATOM   1734   O  O     A GLY A 1 230 ? 17.026  10.055  -48.961 0.05 10.72 ? 229  GLY A O     1  
ATOM   1735   N  N     A ALA A 1 231 ? 14.776  10.219  -48.944 0.05 10.74 ? 230  ALA A N     1  
ATOM   1736   C  CA    A ALA A 1 231 ? 14.605  9.527   -47.666 0.05 10.54 ? 230  ALA A CA    1  
ATOM   1737   C  C     A ALA A 1 231 ? 15.180  8.111   -47.646 0.05 10.59 ? 230  ALA A C     1  
ATOM   1738   O  O     A ALA A 1 231 ? 14.726  7.244   -48.385 0.05 10.75 ? 230  ALA A O     1  
ATOM   1739   C  CB    A ALA A 1 231 ? 13.135  9.489   -47.290 0.05 10.49 ? 230  ALA A CB    1  
ATOM   1740   N  N     A GLU A 1 232 ? 16.168  7.895   -46.784 0.05 10.47 ? 231  GLU A N     1  
ATOM   1741   C  CA    A GLU A 1 232 ? 16.694  6.555   -46.510 0.05 10.52 ? 231  GLU A CA    1  
ATOM   1742   C  C     A GLU A 1 232 ? 15.853  5.836   -45.461 0.05 10.41 ? 231  GLU A C     1  
ATOM   1743   O  O     A GLU A 1 232 ? 15.516  4.657   -45.617 0.05 10.50 ? 231  GLU A O     1  
ATOM   1744   C  CB    A GLU A 1 232 ? 18.140  6.639   -46.015 0.05 10.51 ? 231  GLU A CB    1  
ATOM   1745   C  CG    A GLU A 1 232 ? 19.120  7.028   -47.093 0.05 10.70 ? 231  GLU A CG    1  
ATOM   1746   N  N     A LYS A 1 233 ? 15.540  6.545   -44.382 0.05 10.24 ? 232  LYS A N     1  
ATOM   1747   C  CA    A LYS A 1 233 ? 14.799  5.963   -43.274 0.05 10.17 ? 232  LYS A CA    1  
ATOM   1748   C  C     A LYS A 1 233 ? 13.608  6.847   -42.894 0.05 10.10 ? 232  LYS A C     1  
ATOM   1749   O  O     A LYS A 1 233 ? 13.787  7.963   -42.397 0.05 10.00 ? 232  LYS A O     1  
ATOM   1750   C  CB    A LYS A 1 233 ? 15.716  5.769   -42.059 0.05 10.08 ? 232  LYS A CB    1  
ATOM   1751   C  CG    A LYS A 1 233 ? 17.032  5.016   -42.352 0.05 10.18 ? 232  LYS A CG    1  
ATOM   1752   C  CD    A LYS A 1 233 ? 16.785  3.631   -42.946 0.05 10.31 ? 232  LYS A CD    1  
ATOM   1753   C  CE    A LYS A 1 233 ? 18.099  2.924   -43.329 0.05 10.46 ? 232  LYS A CE    1  
ATOM   1754   N  NZ    A LYS A 1 233 ? 17.856  1.549   -43.852 0.05 10.60 ? 232  LYS A NZ    1  
ATOM   1755   N  N     A VAL A 1 234 ? 12.398  6.344   -43.123 0.05 10.17 ? 233  VAL A N     1  
ATOM   1756   C  CA    A VAL A 1 234 ? 11.190  7.059   -42.727 0.05 10.15 ? 233  VAL A CA    1  
ATOM   1757   C  C     A VAL A 1 234 ? 10.695  6.539   -41.376 0.05 10.09 ? 233  VAL A C     1  
ATOM   1758   O  O     A VAL A 1 234 ? 10.559  5.329   -41.190 0.05 10.13 ? 233  VAL A O     1  
ATOM   1759   C  CB    A VAL A 1 234 ? 10.072  6.909   -43.791 0.05 10.31 ? 233  VAL A CB    1  
ATOM   1760   C  CG1   A VAL A 1 234 ? 8.743   7.461   -43.278 0.05 10.33 ? 233  VAL A CG1   1  
ATOM   1761   C  CG2   A VAL A 1 234 ? 10.476  7.618   -45.097 0.05 10.41 ? 233  VAL A CG2   1  
ATOM   1762   N  N     A VAL A 1 235 ? 10.452  7.447   -40.433 0.05 10.02 ? 234  VAL A N     1  
ATOM   1763   C  CA    A VAL A 1 235 ? 9.885   7.042   -39.147 0.05 10.01 ? 234  VAL A CA    1  
ATOM   1764   C  C     A VAL A 1 235 ? 8.517   7.680   -38.964 0.05 10.09 ? 234  VAL A C     1  
ATOM   1765   O  O     A VAL A 1 235 ? 8.346   8.877   -39.193 0.05 10.08 ? 234  VAL A O     1  
ATOM   1766   C  CB    A VAL A 1 235 ? 10.826  7.365   -37.951 0.05 9.91  ? 234  VAL A CB    1  
ATOM   1767   C  CG1   A VAL A 1 235 ? 11.289  8.810   -38.004 0.05 9.84  ? 234  VAL A CG1   1  
ATOM   1768   C  CG2   A VAL A 1 235 ? 10.136  7.070   -36.616 0.05 9.95  ? 234  VAL A CG2   1  
ATOM   1769   N  N     A LEU A 1 236 ? 7.540   6.857   -38.591 0.05 10.18 ? 235  LEU A N     1  
ATOM   1770   C  CA    A LEU A 1 236 ? 6.206   7.330   -38.274 0.05 10.30 ? 235  LEU A CA    1  
ATOM   1771   C  C     A LEU A 1 236 ? 5.993   7.310   -36.760 0.05 10.31 ? 235  LEU A C     1  
ATOM   1772   O  O     A LEU A 1 236 ? 6.247   6.300   -36.108 0.05 10.29 ? 235  LEU A O     1  
ATOM   1773   C  CB    A LEU A 1 236 ? 5.156   6.428   -38.938 0.05 10.44 ? 235  LEU A CB    1  
ATOM   1774   C  CG    A LEU A 1 236 ? 3.723   6.768   -38.538 0.05 10.61 ? 235  LEU A CG    1  
ATOM   1775   C  CD1   A LEU A 1 236 ? 3.370   8.188   -38.980 0.05 10.67 ? 235  LEU A CD1   1  
ATOM   1776   C  CD2   A LEU A 1 236 ? 2.714   5.766   -39.107 0.05 10.76 ? 235  LEU A CD2   1  
ATOM   1777   N  N     A VAL A 1 237 ? 5.562   8.438   -36.208 0.05 10.36 ? 236  VAL A N     1  
ATOM   1778   C  CA    A VAL A 1 237 ? 4.995   8.483   -34.866 0.05 10.45 ? 236  VAL A CA    1  
ATOM   1779   C  C     A VAL A 1 237 ? 3.497   8.730   -35.055 0.05 10.66 ? 236  VAL A C     1  
ATOM   1780   O  O     A VAL A 1 237 ? 3.121   9.729   -35.660 0.05 10.71 ? 236  VAL A O     1  
ATOM   1781   C  CB    A VAL A 1 237 ? 5.592   9.640   -34.039 0.05 10.38 ? 236  VAL A CB    1  
ATOM   1782   C  CG1   A VAL A 1 237 ? 4.884   9.767   -32.684 0.05 10.53 ? 236  VAL A CG1   1  
ATOM   1783   C  CG2   A VAL A 1 237 ? 7.104   9.482   -33.873 0.05 10.20 ? 236  VAL A CG2   1  
ATOM   1784   N  N     A SER A 1 238 ? 2.639   7.832   -34.561 0.05 10.79 ? 237  SER A N     1  
ATOM   1785   C  CA    A SER A 1 238 ? 1.209   7.887   -34.918 0.05 11.03 ? 237  SER A CA    1  
ATOM   1786   C  C     A SER A 1 238 ? 0.256   7.141   -33.976 0.05 11.22 ? 237  SER A C     1  
ATOM   1787   O  O     A SER A 1 238 ? -0.361  6.155   -34.370 0.05 11.32 ? 237  SER A O     1  
ATOM   1788   C  CB    A SER A 1 238 ? 1.024   7.373   -36.352 0.05 11.06 ? 237  SER A CB    1  
ATOM   1789   O  OG    A SER A 1 238 ? -0.302  7.533   -36.835 0.05 11.30 ? 237  SER A OG    1  
ATOM   1790   N  N     A LEU A 1 239 ? 0.098   7.644   -32.751 0.05 11.30 ? 238  LEU A N     1  
ATOM   1791   C  CA    A LEU A 1 239 ? -0.502  6.857   -31.665 0.05 11.49 ? 238  LEU A CA    1  
ATOM   1792   C  C     A LEU A 1 239 ? -2.012  6.626   -31.742 0.05 11.77 ? 238  LEU A C     1  
ATOM   1793   O  O     A LEU A 1 239 ? -2.748  6.974   -30.811 0.05 12.02 ? 238  LEU A O     1  
ATOM   1794   C  CB    A LEU A 1 239 ? -0.169  7.488   -30.314 0.05 11.56 ? 238  LEU A CB    1  
ATOM   1795   C  CG    A LEU A 1 239 ? 1.281   7.902   -30.081 0.05 11.32 ? 238  LEU A CG    1  
ATOM   1796   C  CD1   A LEU A 1 239 ? 1.473   8.259   -28.622 0.05 11.45 ? 238  LEU A CD1   1  
ATOM   1797   C  CD2   A LEU A 1 239 ? 2.230   6.789   -30.491 0.05 11.11 ? 238  LEU A CD2   1  
ATOM   1798   N  N     A GLY A 1 240 ? -2.481  6.016   -32.825 0.05 11.77 ? 239  GLY A N     1  
ATOM   1799   C  CA    A GLY A 1 240 ? -3.903  5.798   -32.984 0.05 12.05 ? 239  GLY A CA    1  
ATOM   1800   C  C     A GLY A 1 240 ? -4.657  7.112   -32.911 0.05 12.26 ? 239  GLY A C     1  
ATOM   1801   O  O     A GLY A 1 240 ? -4.059  8.190   -32.923 0.05 12.15 ? 239  GLY A O     1  
ATOM   1802   N  N     A SER A 1 241 ? -5.976  7.041   -32.824 0.05 12.59 ? 240  SER A N     1  
ATOM   1803   C  CA    A SER A 1 241 ? -6.765  8.262   -32.816 0.05 12.86 ? 240  SER A CA    1  
ATOM   1804   C  C     A SER A 1 241 ? -7.311  8.568   -31.425 0.05 13.13 ? 240  SER A C     1  
ATOM   1805   O  O     A SER A 1 241 ? -8.243  9.348   -31.287 0.05 13.48 ? 240  SER A O     1  
ATOM   1806   C  CB    A SER A 1 241 ? -7.909  8.169   -33.840 0.05 13.10 ? 240  SER A CB    1  
ATOM   1807   O  OG    A SER A 1 241 ? -7.716  9.076   -34.920 0.05 13.05 ? 240  SER A OG    1  
ATOM   1808   N  N     A ALA A 1 242 ? -6.726  7.961   -30.395 0.05 13.01 ? 241  ALA A N     1  
ATOM   1809   C  CA    A ALA A 1 242 ? -7.236  8.140   -29.035 0.05 13.31 ? 241  ALA A CA    1  
ATOM   1810   C  C     A ALA A 1 242 ? -6.236  8.777   -28.055 0.05 13.21 ? 241  ALA A C     1  
ATOM   1811   O  O     A ALA A 1 242 ? -6.412  9.927   -27.640 0.05 13.37 ? 241  ALA A O     1  
ATOM   1812   C  CB    A ALA A 1 242 ? -7.772  6.821   -28.485 0.05 13.45 ? 241  ALA A CB    1  
ATOM   1813   N  N     A PHE A 1 243 ? -5.189  8.036   -27.693 0.05 12.98 ? 242  PHE A N     1  
ATOM   1814   C  CA    A PHE A 1 243 ? -4.268  8.464   -26.634 0.05 12.88 ? 242  PHE A CA    1  
ATOM   1815   C  C     A PHE A 1 243 ? -3.217  9.474   -27.095 0.05 12.55 ? 242  PHE A C     1  
ATOM   1816   O  O     A PHE A 1 243 ? -2.029  9.331   -26.780 0.05 12.25 ? 242  PHE A O     1  
ATOM   1817   N  N     A THR A 1 244 ? -3.678  10.515  -27.794 0.05 12.63 ? 243  THR A N     1  
ATOM   1818   C  CA    A THR A 1 244 ? -2.820  11.379  -28.606 0.05 12.34 ? 243  THR A CA    1  
ATOM   1819   C  C     A THR A 1 244 ? -2.918  12.874  -28.295 0.05 12.40 ? 243  THR A C     1  
ATOM   1820   O  O     A THR A 1 244 ? -3.119  13.686  -29.199 0.05 12.26 ? 243  THR A O     1  
ATOM   1821   C  CB    A THR A 1 244 ? -3.141  11.203  -30.110 0.05 12.32 ? 243  THR A CB    1  
ATOM   1822   O  OG1   A THR A 1 244 ? -3.954  12.294  -30.574 0.05 12.60 ? 243  THR A OG1   1  
ATOM   1823   C  CG2   A THR A 1 244 ? -3.867  9.887   -30.346 0.05 12.38 ? 243  THR A CG2   1  
ATOM   1824   N  N     A LYS A 1 245 ? -2.750  13.250  -27.031 0.05 12.63 ? 244  LYS A N     1  
ATOM   1825   C  CA    A LYS A 1 245 ? -2.728  14.670  -26.680 0.05 12.67 ? 244  LYS A CA    1  
ATOM   1826   C  C     A LYS A 1 245 ? -1.593  14.954  -25.677 0.05 12.57 ? 244  LYS A C     1  
ATOM   1827   O  O     A LYS A 1 245 ? -1.784  15.416  -24.556 0.05 12.83 ? 244  LYS A O     1  
ATOM   1828   C  CB    A LYS A 1 245 ? -4.130  15.107  -26.222 0.05 13.10 ? 244  LYS A CB    1  
ATOM   1829   C  CG    A LYS A 1 245 ? -4.275  16.459  -25.550 0.05 13.26 ? 244  LYS A CG    1  
ATOM   1830   C  CD    A LYS A 1 245 ? -5.019  16.264  -24.223 0.05 13.68 ? 244  LYS A CD    1  
ATOM   1831   C  CE    A LYS A 1 245 ? -4.601  14.936  -23.555 0.05 13.69 ? 244  LYS A CE    1  
ATOM   1832   N  NZ    A LYS A 1 245 ? -5.434  14.525  -22.375 0.05 14.12 ? 244  LYS A NZ    1  
ATOM   1833   N  N     A GLN A 1 246 ? -0.374  14.677  -26.115 0.05 12.21 ? 245  GLN A N     1  
ATOM   1834   C  CA    A GLN A 1 246 ? 0.753   14.695  -25.194 0.05 12.13 ? 245  GLN A CA    1  
ATOM   1835   C  C     A GLN A 1 246 ? 1.689   15.863  -25.467 0.05 11.96 ? 245  GLN A C     1  
ATOM   1836   O  O     A GLN A 1 246 ? 2.326   15.896  -26.518 0.05 11.74 ? 245  GLN A O     1  
ATOM   1837   C  CB    A GLN A 1 246 ? 1.511   13.375  -25.304 0.05 11.89 ? 245  GLN A CB    1  
ATOM   1838   C  CG    A GLN A 1 246 ? 0.751   12.181  -24.742 0.05 12.08 ? 245  GLN A CG    1  
ATOM   1839   C  CD    A GLN A 1 246 ? 1.052   11.945  -23.273 0.05 12.25 ? 245  GLN A CD    1  
ATOM   1840   O  OE1   A GLN A 1 246 ? 2.132   12.278  -22.782 0.05 12.14 ? 245  GLN A OE1   1  
ATOM   1841   N  NE2   A GLN A 1 246 ? 0.094   11.364  -22.563 0.05 12.55 ? 245  GLN A NE2   1  
ATOM   1842   N  N     A PRO A 1 247 ? 1.770   16.831  -24.532 0.05 12.10 ? 246  PRO A N     1  
ATOM   1843   C  CA    A PRO A 1 247 ? 2.762   17.882  -24.762 0.05 11.91 ? 246  PRO A CA    1  
ATOM   1844   C  C     A PRO A 1 247 ? 4.152   17.265  -24.813 0.05 11.60 ? 246  PRO A C     1  
ATOM   1845   O  O     A PRO A 1 247 ? 4.762   17.198  -25.872 0.05 11.33 ? 246  PRO A O     1  
ATOM   1846   C  CB    A PRO A 1 247 ? 2.625   18.785  -23.529 0.05 12.20 ? 246  PRO A CB    1  
ATOM   1847   C  CG    A PRO A 1 247 ? 1.977   17.934  -22.491 0.05 12.46 ? 246  PRO A CG    1  
ATOM   1848   C  CD    A PRO A 1 247 ? 1.082   16.995  -23.239 0.05 12.45 ? 246  PRO A CD    1  
ATOM   1849   N  N     A ALA A 1 248 ? 4.622   16.768  -23.677 0.05 11.69 ? 247  ALA A N     1  
ATOM   1850   C  CA    A ALA A 1 248 ? 5.994   16.298  -23.579 0.05 11.47 ? 247  ALA A CA    1  
ATOM   1851   C  C     A ALA A 1 248 ? 6.244   14.953  -24.273 0.05 11.27 ? 247  ALA A C     1  
ATOM   1852   O  O     A ALA A 1 248 ? 6.642   13.993  -23.620 0.05 11.30 ? 247  ALA A O     1  
ATOM   1853   C  CB    A ALA A 1 248 ? 6.425   16.237  -22.113 0.05 11.68 ? 247  ALA A CB    1  
ATOM   1854   N  N     A PHE A 1 249 ? 6.016   14.888  -25.583 0.05 11.10 ? 248  PHE A N     1  
ATOM   1855   C  CA    A PHE A 1 249 ? 6.460   13.725  -26.349 0.05 10.92 ? 248  PHE A CA    1  
ATOM   1856   C  C     A PHE A 1 249 ? 6.755   13.954  -27.829 0.05 10.71 ? 248  PHE A C     1  
ATOM   1857   O  O     A PHE A 1 249 ? 7.825   13.584  -28.301 0.05 10.51 ? 248  PHE A O     1  
ATOM   1858   C  CB    A PHE A 1 249 ? 5.530   12.521  -26.183 0.05 11.08 ? 248  PHE A CB    1  
ATOM   1859   C  CG    A PHE A 1 249 ? 6.086   11.266  -26.797 0.05 10.92 ? 248  PHE A CG    1  
ATOM   1860   C  CD1   A PHE A 1 249 ? 5.469   10.680  -27.888 0.05 10.89 ? 248  PHE A CD1   1  
ATOM   1861   C  CD2   A PHE A 1 249 ? 7.257   10.700  -26.309 0.05 10.83 ? 248  PHE A CD2   1  
ATOM   1862   C  CE1   A PHE A 1 249 ? 6.000   9.526   -28.471 0.05 10.76 ? 248  PHE A CE1   1  
ATOM   1863   C  CE2   A PHE A 1 249 ? 7.786   9.551   -26.878 0.05 10.70 ? 248  PHE A CE2   1  
ATOM   1864   C  CZ    A PHE A 1 249 ? 7.159   8.963   -27.963 0.05 10.67 ? 248  PHE A CZ    1  
ATOM   1865   N  N     A TYR A 1 250 ? 5.808   14.520  -28.572 0.05 10.79 ? 249  TYR A N     1  
ATOM   1866   C  CA    A TYR A 1 250 ? 6.045   14.764  -29.992 0.05 10.63 ? 249  TYR A CA    1  
ATOM   1867   C  C     A TYR A 1 250 ? 7.249   15.689  -30.154 0.05 10.43 ? 249  TYR A C     1  
ATOM   1868   O  O     A TYR A 1 250 ? 8.171   15.391  -30.913 0.05 10.25 ? 249  TYR A O     1  
ATOM   1869   C  CB    A TYR A 1 250 ? 4.817   15.369  -30.664 0.05 10.79 ? 249  TYR A CB    1  
ATOM   1870   C  CG    A TYR A 1 250 ? 3.546   14.553  -30.545 0.05 11.00 ? 249  TYR A CG    1  
ATOM   1871   C  CD1   A TYR A 1 250 ? 3.564   13.161  -30.598 0.05 10.95 ? 249  TYR A CD1   1  
ATOM   1872   C  CD2   A TYR A 1 250 ? 2.326   15.183  -30.368 0.05 11.28 ? 249  TYR A CD2   1  
ATOM   1873   C  CE1   A TYR A 1 250 ? 2.382   12.431  -30.487 0.05 11.15 ? 249  TYR A CE1   1  
ATOM   1874   C  CE2   A TYR A 1 250 ? 1.152   14.472  -30.259 0.05 11.50 ? 249  TYR A CE2   1  
ATOM   1875   C  CZ    A TYR A 1 250 ? 1.179   13.100  -30.315 0.05 11.42 ? 249  TYR A CZ    1  
ATOM   1876   O  OH    A TYR A 1 250 ? -0.013  12.420  -30.203 0.05 11.65 ? 249  TYR A OH    1  
ATOM   1877   N  N     A ARG A 1 251 ? 7.244   16.798  -29.416 0.05 10.49 ? 250  ARG A N     1  
ATOM   1878   C  CA    A ARG A 1 251 ? 8.398   17.695  -29.376 0.05 10.33 ? 250  ARG A CA    1  
ATOM   1879   C  C     A ARG A 1 251 ? 9.679   16.929  -29.022 0.05 10.19 ? 250  ARG A C     1  
ATOM   1880   O  O     A ARG A 1 251 ? 10.769  17.293  -29.454 0.05 10.01 ? 250  ARG A O     1  
ATOM   1881   C  CB    A ARG A 1 251 ? 8.155   18.814  -28.364 0.05 10.46 ? 250  ARG A CB    1  
ATOM   1882   C  CG    A ARG A 1 251 ? 6.754   19.373  -28.397 0.05 10.60 ? 250  ARG A CG    1  
ATOM   1883   C  CD    A ARG A 1 251 ? 6.203   19.486  -26.997 0.05 10.87 ? 250  ARG A CD    1  
ATOM   1884   N  NE    A ARG A 1 251 ? 7.231   19.837  -26.021 0.05 10.84 ? 250  ARG A NE    1  
ATOM   1885   C  CZ    A ARG A 1 251 ? 6.969   20.418  -24.858 0.05 11.07 ? 250  ARG A CZ    1  
ATOM   1886   N  NH1   A ARG A 1 251 ? 5.715   20.707  -24.542 0.05 11.35 ? 250  ARG A NH1   1  
ATOM   1887   N  NH2   A ARG A 1 251 ? 7.955   20.706  -24.021 0.05 11.05 ? 250  ARG A NH2   1  
ATOM   1888   N  N     A GLU A 1 252 ? 9.548   15.862  -28.239 0.05 10.30 ? 251  GLU A N     1  
ATOM   1889   C  CA    A GLU A 1 252 ? 10.683  14.983  -27.968 0.05 10.22 ? 251  GLU A CA    1  
ATOM   1890   C  C     A GLU A 1 252 ? 11.066  14.121  -29.171 0.05 10.06 ? 251  GLU A C     1  
ATOM   1891   O  O     A GLU A 1 252 ? 12.234  13.792  -29.368 0.05 9.95  ? 251  GLU A O     1  
ATOM   1892   C  CB    A GLU A 1 252 ? 10.409  14.091  -26.756 0.05 10.41 ? 251  GLU A CB    1  
ATOM   1893   C  CG    A GLU A 1 252 ? 10.779  14.742  -25.451 0.05 10.55 ? 251  GLU A CG    1  
ATOM   1894   C  CD    A GLU A 1 252 ? 12.219  15.216  -25.449 0.05 10.42 ? 251  GLU A CD    1  
ATOM   1895   O  OE1   A GLU A 1 252 ? 12.480  16.378  -25.835 0.05 10.38 ? 251  GLU A OE1   1  
ATOM   1896   O  OE2   A GLU A 1 252 ? 13.098  14.425  -25.062 0.05 10.38 ? 251  GLU A OE2   1  
ATOM   1897   N  N     A CYS A 1 253 ? 10.081  13.752  -29.973 0.05 10.08 ? 252  CYS A N     1  
ATOM   1898   C  CA    A CYS A 1 253 ? 10.369  12.999  -31.183 0.05 9.97  ? 252  CYS A CA    1  
ATOM   1899   C  C     A CYS A 1 253 ? 11.032  13.885  -32.231 0.05 9.83  ? 252  CYS A C     1  
ATOM   1900   O  O     A CYS A 1 253 ? 11.901  13.428  -32.973 0.05 9.73  ? 252  CYS A O     1  
ATOM   1901   C  CB    A CYS A 1 253 ? 9.101   12.363  -31.730 0.05 10.06 ? 252  CYS A CB    1  
ATOM   1902   S  SG    A CYS A 1 253 ? 8.536   11.017  -30.666 0.05 10.22 ? 252  CYS A SG    1  
ATOM   1903   N  N     A VAL A 1 254 ? 10.630  15.153  -32.279 0.05 9.85  ? 253  VAL A N     1  
ATOM   1904   C  CA    A VAL A 1 254 ? 11.210  16.084  -33.241 0.05 9.74  ? 253  VAL A CA    1  
ATOM   1905   C  C     A VAL A 1 254 ? 12.693  16.229  -32.973 0.05 9.62  ? 253  VAL A C     1  
ATOM   1906   O  O     A VAL A 1 254 ? 13.513  16.297  -33.889 0.05 9.53  ? 253  VAL A O     1  
ATOM   1907   C  CB    A VAL A 1 254 ? 10.560  17.475  -33.141 0.05 9.79  ? 253  VAL A CB    1  
ATOM   1908   C  CG1   A VAL A 1 254 ? 11.256  18.453  -34.065 0.05 9.68  ? 253  VAL A CG1   1  
ATOM   1909   C  CG2   A VAL A 1 254 ? 9.094   17.389  -33.470 0.05 9.94  ? 253  VAL A CG2   1  
ATOM   1910   N  N     A ARG A 1 255 ? 13.033  16.265  -31.697 0.05 9.66  ? 254  ARG A N     1  
ATOM   1911   C  CA    A ARG A 1 255 ? 14.399  16.496  -31.281 0.05 9.59  ? 254  ARG A CA    1  
ATOM   1912   C  C     A ARG A 1 255 ? 15.279  15.282  -31.582 0.05 9.56  ? 254  ARG A C     1  
ATOM   1913   O  O     A ARG A 1 255 ? 16.458  15.414  -31.901 0.05 9.49  ? 254  ARG A O     1  
ATOM   1914   C  CB    A ARG A 1 255 ? 14.418  16.853  -29.795 0.05 9.68  ? 254  ARG A CB    1  
ATOM   1915   C  CG    A ARG A 1 255 ? 15.772  17.253  -29.255 0.05 9.64  ? 254  ARG A CG    1  
ATOM   1916   C  CD    A ARG A 1 255 ? 15.627  18.053  -27.954 0.05 9.76  ? 254  ARG A CD    1  
ATOM   1917   N  NE    A ARG A 1 255 ? 16.926  18.358  -27.372 0.05 9.74  ? 254  ARG A NE    1  
ATOM   1918   C  CZ    A ARG A 1 255 ? 17.707  19.352  -27.783 0.05 9.65  ? 254  ARG A CZ    1  
ATOM   1919   N  NH1   A ARG A 1 255 ? 17.318  20.137  -28.776 0.05 9.57  ? 254  ARG A NH1   1  
ATOM   1920   N  NH2   A ARG A 1 255 ? 18.885  19.554  -27.215 0.05 9.65  ? 254  ARG A NH2   1  
ATOM   1921   N  N     A ALA A 1 256 ? 14.692  14.094  -31.514 0.05 9.63  ? 255  ALA A N     1  
ATOM   1922   C  CA    A ALA A 1 256 ? 15.434  12.871  -31.816 0.05 9.63  ? 255  ALA A CA    1  
ATOM   1923   C  C     A ALA A 1 256 ? 15.803  12.733  -33.292 0.05 9.55  ? 255  ALA A C     1  
ATOM   1924   O  O     A ALA A 1 256 ? 16.905  12.288  -33.631 0.05 9.54  ? 255  ALA A O     1  
ATOM   1925   C  CB    A ALA A 1 256 ? 14.632  11.658  -31.376 0.05 9.73  ? 255  ALA A CB    1  
ATOM   1926   N  N     A PHE A 1 257 ? 14.861  13.078  -34.167 0.05 9.54  ? 256  PHE A N     1  
ATOM   1927   C  CA    A PHE A 1 257 ? 15.018  12.814  -35.595 0.05 9.52  ? 256  PHE A CA    1  
ATOM   1928   C  C     A PHE A 1 257 ? 15.183  14.073  -36.441 0.05 9.47  ? 256  PHE A C     1  
ATOM   1929   O  O     A PHE A 1 257 ? 15.622  13.996  -37.588 0.05 9.46  ? 256  PHE A O     1  
ATOM   1930   C  CB    A PHE A 1 257 ? 13.829  12.005  -36.115 0.05 9.59  ? 256  PHE A CB    1  
ATOM   1931   C  CG    A PHE A 1 257 ? 13.607  10.721  -35.365 0.05 9.65  ? 256  PHE A CG    1  
ATOM   1932   C  CD1   A PHE A 1 257 ? 14.497  9.671   -35.505 0.05 9.66  ? 256  PHE A CD1   1  
ATOM   1933   C  CD2   A PHE A 1 257 ? 12.520  10.573  -34.516 0.05 9.72  ? 256  PHE A CD2   1  
ATOM   1934   C  CE1   A PHE A 1 257 ? 14.311  8.485   -34.812 0.05 9.72  ? 256  PHE A CE1   1  
ATOM   1935   C  CE2   A PHE A 1 257 ? 12.320  9.387   -33.813 0.05 9.79  ? 256  PHE A CE2   1  
ATOM   1936   C  CZ    A PHE A 1 257 ? 13.223  8.340   -33.968 0.05 9.78  ? 256  PHE A CZ    1  
ATOM   1937   N  N     A GLY A 1 258 ? 14.828  15.217  -35.872 0.05 9.45  ? 257  GLY A N     1  
ATOM   1938   C  CA    A GLY A 1 258 ? 14.911  16.471  -36.604 0.05 9.41  ? 257  GLY A CA    1  
ATOM   1939   C  C     A GLY A 1 258 ? 16.336  16.821  -36.961 0.05 9.35  ? 257  GLY A C     1  
ATOM   1940   O  O     A GLY A 1 258 ? 17.195  16.877  -36.082 0.05 9.31  ? 257  GLY A O     1  
ATOM   1941   N  N     A ASN A 1 259 ? 16.569  17.060  -38.252 0.05 9.36  ? 258  ASN A N     1  
ATOM   1942   C  CA    A ASN A 1 259 ? 17.891  17.359  -38.811 0.05 9.34  ? 258  ASN A CA    1  
ATOM   1943   C  C     A ASN A 1 259 ? 18.854  16.182  -38.756 0.05 9.37  ? 258  ASN A C     1  
ATOM   1944   O  O     A ASN A 1 259 ? 20.057  16.355  -38.949 0.05 9.36  ? 258  ASN A O     1  
ATOM   1945   C  CB    A ASN A 1 259 ? 18.534  18.593  -38.152 0.05 9.27  ? 258  ASN A CB    1  
ATOM   1946   C  CG    A ASN A 1 259 ? 17.605  19.783  -38.111 0.05 9.26  ? 258  ASN A CG    1  
ATOM   1947   O  OD1   A ASN A 1 259 ? 17.239  20.262  -37.031 0.05 9.23  ? 258  ASN A OD1   1  
ATOM   1948   N  ND2   A ASN A 1 259 ? 17.195  20.256  -39.283 0.05 9.32  ? 258  ASN A ND2   1  
ATOM   1949   N  N     A LEU A 1 260 ? 18.327  14.990  -38.481 0.05 9.42  ? 259  LEU A N     1  
ATOM   1950   C  CA    A LEU A 1 260 ? 19.134  13.773  -38.479 0.05 9.48  ? 259  LEU A CA    1  
ATOM   1951   C  C     A LEU A 1 260 ? 19.295  13.284  -39.915 0.05 9.57  ? 259  LEU A C     1  
ATOM   1952   O  O     A LEU A 1 260 ? 18.332  12.833  -40.519 0.05 9.61  ? 259  LEU A O     1  
ATOM   1953   C  CB    A LEU A 1 260 ? 18.467  12.691  -37.603 0.05 9.50  ? 259  LEU A CB    1  
ATOM   1954   C  CG    A LEU A 1 260 ? 19.211  11.366  -37.404 0.05 9.59  ? 259  LEU A CG    1  
ATOM   1955   C  CD1   A LEU A 1 260 ? 20.601  11.594  -36.827 0.05 9.61  ? 259  LEU A CD1   1  
ATOM   1956   C  CD2   A LEU A 1 260 ? 18.396  10.411  -36.508 0.05 9.62  ? 259  LEU A CD2   1  
ATOM   1957   N  N     A PRO A 1 261 ? 20.518  13.391  -40.471 0.05 9.64  ? 260  PRO A N     1  
ATOM   1958   C  CA    A PRO A 1 261 ? 20.772  13.084  -41.887 0.05 9.77  ? 260  PRO A CA    1  
ATOM   1959   C  C     A PRO A 1 261 ? 20.279  11.690  -42.272 0.05 9.86  ? 260  PRO A C     1  
ATOM   1960   O  O     A PRO A 1 261 ? 20.559  10.730  -41.560 0.05 9.86  ? 260  PRO A O     1  
ATOM   1961   C  CB    A PRO A 1 261 ? 22.301  13.178  -41.993 0.05 9.86  ? 260  PRO A CB    1  
ATOM   1962   C  CG    A PRO A 1 261 ? 22.679  14.157  -40.904 0.05 9.74  ? 260  PRO A CG    1  
ATOM   1963   C  CD    A PRO A 1 261 ? 21.735  13.856  -39.776 0.05 9.62  ? 260  PRO A CD    1  
ATOM   1964   N  N     A GLY A 1 262 ? 19.527  11.594  -43.367 0.05 9.95  ? 261  GLY A N     1  
ATOM   1965   C  CA    A GLY A 1 262 ? 19.022  10.317  -43.833 0.05 10.06 ? 261  GLY A CA    1  
ATOM   1966   C  C     A GLY A 1 262 ? 17.591  10.014  -43.412 0.05 9.99  ? 261  GLY A C     1  
ATOM   1967   O  O     A GLY A 1 262 ? 16.914  9.220   -44.058 0.05 10.09 ? 261  GLY A O     1  
ATOM   1968   N  N     A TRP A 1 263 ? 17.131  10.660  -42.344 0.05 9.85  ? 262  TRP A N     1  
ATOM   1969   C  CA    A TRP A 1 263 ? 15.835  10.328  -41.748 0.05 9.82  ? 262  TRP A CA    1  
ATOM   1970   C  C     A TRP A 1 263 ? 14.747  11.333  -42.079 0.05 9.81  ? 262  TRP A C     1  
ATOM   1971   O  O     A TRP A 1 263 ? 14.992  12.534  -42.116 0.05 9.76  ? 262  TRP A O     1  
ATOM   1972   C  CB    A TRP A 1 263 ? 15.965  10.236  -40.227 0.05 9.72  ? 262  TRP A CB    1  
ATOM   1973   C  CG    A TRP A 1 263 ? 16.721  9.038   -39.768 0.05 9.76  ? 262  TRP A CG    1  
ATOM   1974   C  CD1   A TRP A 1 263 ? 18.072  8.848   -39.825 0.05 9.80  ? 262  TRP A CD1   1  
ATOM   1975   C  CD2   A TRP A 1 263 ? 16.172  7.861   -39.160 0.05 9.80  ? 262  TRP A CD2   1  
ATOM   1976   N  NE1   A TRP A 1 263 ? 18.401  7.617   -39.294 0.05 9.86  ? 262  TRP A NE1   1  
ATOM   1977   C  CE2   A TRP A 1 263 ? 17.251  6.994   -38.879 0.05 9.85  ? 262  TRP A CE2   1  
ATOM   1978   C  CE3   A TRP A 1 263 ? 14.874  7.456   -38.826 0.05 9.80  ? 262  TRP A CE3   1  
ATOM   1979   C  CZ2   A TRP A 1 263 ? 17.069  5.740   -38.287 0.05 9.91  ? 262  TRP A CZ2   1  
ATOM   1980   C  CZ3   A TRP A 1 263 ? 14.694  6.208   -38.233 0.05 9.85  ? 262  TRP A CZ3   1  
ATOM   1981   C  CH2   A TRP A 1 263 ? 15.787  5.369   -37.971 0.05 9.90  ? 262  TRP A CH2   1  
ATOM   1982   N  N     A HIS A 1 264 ? 13.534  10.828  -42.289 0.05 9.88  ? 263  HIS A N     1  
ATOM   1983   C  CA    A HIS A 1 264 ? 12.375  11.684  -42.462 0.05 9.92  ? 263  HIS A CA    1  
ATOM   1984   C  C     A HIS A 1 264 ? 11.312  11.269  -41.462 0.05 9.92  ? 263  HIS A C     1  
ATOM   1985   O  O     A HIS A 1 264 ? 10.922  10.099  -41.415 0.05 9.97  ? 263  HIS A O     1  
ATOM   1986   C  CB    A HIS A 1 264 ? 11.823  11.610  -43.886 0.05 10.08 ? 263  HIS A CB    1  
ATOM   1987   C  CG    A HIS A 1 264 ? 10.702  12.574  -44.140 0.05 10.16 ? 263  HIS A CG    1  
ATOM   1988   N  ND1   A HIS A 1 264 ? 10.912  13.920  -44.352 0.05 10.15 ? 263  HIS A ND1   1  
ATOM   1989   C  CD2   A HIS A 1 264 ? 9.360   12.391  -44.181 0.05 10.26 ? 263  HIS A CD2   1  
ATOM   1990   C  CE1   A HIS A 1 264 ? 9.748   14.523  -44.530 0.05 10.26 ? 263  HIS A CE1   1  
ATOM   1991   N  NE2   A HIS A 1 264 ? 8.790   13.618  -44.427 0.05 10.33 ? 263  HIS A NE2   1  
ATOM   1992   N  N     A LEU A 1 265 ? 10.867  12.234  -40.666 0.05 9.88  ? 264  LEU A N     1  
ATOM   1993   C  CA    A LEU A 1 265 ? 9.893   11.991  -39.613 0.05 9.91  ? 264  LEU A CA    1  
ATOM   1994   C  C     A LEU A 1 265 ? 8.505   12.447  -40.028 0.05 10.05 ? 264  LEU A C     1  
ATOM   1995   O  O     A LEU A 1 265 ? 8.293   13.632  -40.290 0.05 10.08 ? 264  LEU A O     1  
ATOM   1996   C  CB    A LEU A 1 265 ? 10.305  12.707  -38.319 0.05 9.82  ? 264  LEU A CB    1  
ATOM   1997   C  CG    A LEU A 1 265 ? 9.224   12.752  -37.233 0.05 9.91  ? 264  LEU A CG    1  
ATOM   1998   C  CD1   A LEU A 1 265 ? 8.762   11.343  -36.871 0.05 9.97  ? 264  LEU A CD1   1  
ATOM   1999   C  CD2   A LEU A 1 265 ? 9.706   13.513  -35.995 0.05 9.85  ? 264  LEU A CD2   1  
ATOM   2000   N  N     A VAL A 1 266 ? 7.572   11.495  -40.091 0.05 10.16 ? 265  VAL A N     1  
ATOM   2001   C  CA    A VAL A 1 266 ? 6.150   11.798  -40.233 0.05 10.34 ? 265  VAL A CA    1  
ATOM   2002   C  C     A VAL A 1 266 ? 5.559   11.801  -38.839 0.05 10.35 ? 265  VAL A C     1  
ATOM   2003   O  O     A VAL A 1 266 ? 5.471   10.757  -38.182 0.05 10.34 ? 265  VAL A O     1  
ATOM   2004   C  CB    A VAL A 1 266 ? 5.403   10.755  -41.069 0.05 10.48 ? 265  VAL A CB    1  
ATOM   2005   C  CG1   A VAL A 1 266 ? 3.913   11.118  -41.170 0.05 10.69 ? 265  VAL A CG1   1  
ATOM   2006   C  CG2   A VAL A 1 266 ? 6.010   10.646  -42.447 0.05 10.50 ? 265  VAL A CG2   1  
ATOM   2007   N  N     A LEU A 1 267 ? 5.182   12.987  -38.382 0.05 10.41 ? 266  LEU A N     1  
ATOM   2008   C  CA    A LEU A 1 267 ? 4.736   13.184  -37.028 0.05 10.44 ? 266  LEU A CA    1  
ATOM   2009   C  C     A LEU A 1 267 ? 3.262   13.549  -37.025 0.05 10.68 ? 266  LEU A C     1  
ATOM   2010   O  O     A LEU A 1 267 ? 2.763   14.212  -37.933 0.05 10.76 ? 266  LEU A O     1  
ATOM   2011   C  CB    A LEU A 1 267 ? 5.560   14.298  -36.386 0.05 10.31 ? 266  LEU A CB    1  
ATOM   2012   C  CG    A LEU A 1 267 ? 5.511   14.426  -34.869 0.05 10.34 ? 266  LEU A CG    1  
ATOM   2013   C  CD1   A LEU A 1 267 ? 6.025   13.176  -34.217 0.05 10.31 ? 266  LEU A CD1   1  
ATOM   2014   C  CD2   A LEU A 1 267 ? 6.342   15.612  -34.446 0.05 10.22 ? 266  LEU A CD2   1  
ATOM   2015   N  N     A GLN A 1 268 ? 2.546   13.116  -36.002 0.05 10.81 ? 267  GLN A N     1  
ATOM   2016   C  CA    A GLN A 1 268 ? 1.163   13.536  -35.926 0.05 11.08 ? 267  GLN A CA    1  
ATOM   2017   C  C     A GLN A 1 268 ? 0.755   13.938  -34.525 0.05 11.23 ? 267  GLN A C     1  
ATOM   2018   O  O     A GLN A 1 268 ? 1.461   13.662  -33.546 0.05 11.15 ? 267  GLN A O     1  
ATOM   2019   C  CB    A GLN A 1 268 ? 0.248   12.463  -36.494 0.05 11.19 ? 267  GLN A CB    1  
ATOM   2020   C  CG    A GLN A 1 268 ? 0.211   11.211  -35.661 0.05 11.21 ? 267  GLN A CG    1  
ATOM   2021   C  CD    A GLN A 1 268 ? -0.960  11.208  -34.694 0.05 11.51 ? 267  GLN A CD    1  
ATOM   2022   O  OE1   A GLN A 1 268 ? -1.814  12.089  -34.739 0.05 11.69 ? 267  GLN A OE1   1  
ATOM   2023   N  NE2   A GLN A 1 268 ? -1.012  10.199  -33.823 0.05 11.59 ? 267  GLN A NE2   1  
ATOM   2024   N  N     A ILE A 1 269 ? -0.387  14.611  -34.468 0.05 11.49 ? 268  ILE A N     1  
ATOM   2025   C  CA    A ILE A 1 269 ? -0.946  15.214  -33.269 0.05 11.71 ? 268  ILE A CA    1  
ATOM   2026   C  C     A ILE A 1 269 ? -2.453  15.003  -33.356 0.05 12.07 ? 268  ILE A C     1  
ATOM   2027   O  O     A ILE A 1 269 ? -2.920  13.889  -33.133 0.05 12.13 ? 268  ILE A O     1  
ATOM   2028   C  CB    A ILE A 1 269 ? -0.648  16.733  -33.195 0.05 11.68 ? 268  ILE A CB    1  
ATOM   2029   C  CG1   A ILE A 1 269 ? -0.234  17.289  -34.545 0.05 11.52 ? 268  ILE A CG1   1  
ATOM   2030   C  CG2   A ILE A 1 269 ? 0.487   17.019  -32.294 0.05 11.50 ? 268  ILE A CG2   1  
ATOM   2031   C  CD1   A ILE A 1 269 ? 0.134   18.752  -34.459 0.05 11.44 ? 268  ILE A CD1   1  
ATOM   2032   N  N     A GLY A 1 270 ? -3.218  16.051  -33.687 0.05 12.33 ? 269  GLY A N     1  
ATOM   2033   C  CA    A GLY A 1 270 ? -4.614  15.860  -34.062 0.05 12.71 ? 269  GLY A CA    1  
ATOM   2034   C  C     A GLY A 1 270 ? -5.645  16.994  -34.087 0.05 13.03 ? 269  GLY A C     1  
ATOM   2035   O  O     A GLY A 1 270 ? -6.837  16.732  -33.937 0.05 13.36 ? 269  GLY A O     1  
ATOM   2036   N  N     A ARG A 1 271 ? -5.226  18.243  -34.286 0.05 12.96 ? 270  ARG A N     1  
ATOM   2037   C  CA    A ARG A 1 271 ? -6.194  19.355  -34.334 0.05 13.19 ? 270  ARG A CA    1  
ATOM   2038   C  C     A ARG A 1 271 ? -6.423  19.816  -35.786 0.05 13.24 ? 270  ARG A C     1  
ATOM   2039   O  O     A ARG A 1 271 ? -6.264  19.015  -36.705 0.05 13.11 ? 270  ARG A O     1  
ATOM   2040   C  CB    A ARG A 1 271 ? -5.778  20.522  -33.415 0.05 12.96 ? 270  ARG A CB    1  
ATOM   2041   C  CG    A ARG A 1 271 ? -4.976  20.136  -32.158 0.05 12.82 ? 270  ARG A CG    1  
ATOM   2042   C  CD    A ARG A 1 271 ? -3.492  19.847  -32.463 0.05 12.41 ? 270  ARG A CD    1  
ATOM   2043   N  NE    A ARG A 1 271 ? -2.696  19.570  -31.269 0.05 12.37 ? 270  ARG A NE    1  
ATOM   2044   C  CZ    A ARG A 1 271 ? -1.771  20.384  -30.766 0.05 12.22 ? 270  ARG A CZ    1  
ATOM   2045   N  NH1   A ARG A 1 271 ? -1.498  21.542  -31.343 0.05 12.09 ? 270  ARG A NH1   1  
ATOM   2046   N  NH2   A ARG A 1 271 ? -1.109  20.036  -29.676 0.05 12.24 ? 270  ARG A NH2   1  
ATOM   2047   N  N     A LYS A 1 272 ? -6.768  21.091  -35.996 0.05 13.44 ? 271  LYS A N     1  
ATOM   2048   C  CA    A LYS A 1 272 ? -7.083  21.621  -37.345 0.05 13.56 ? 271  LYS A CA    1  
ATOM   2049   C  C     A LYS A 1 272 ? -6.071  22.519  -38.132 0.05 13.37 ? 271  LYS A C     1  
ATOM   2050   O  O     A LYS A 1 272 ? -5.963  22.304  -39.339 0.05 13.34 ? 271  LYS A O     1  
ATOM   2051   C  CB    A LYS A 1 272 ? -8.476  22.272  -37.381 0.05 14.08 ? 271  LYS A CB    1  
ATOM   2052   C  CG    A LYS A 1 272 ? -9.634  21.309  -37.163 0.05 14.31 ? 271  LYS A CG    1  
ATOM   2053   C  CD    A LYS A 1 272 ? -9.708  20.258  -38.265 0.05 14.09 ? 271  LYS A CD    1  
ATOM   2054   C  CE    A LYS A 1 272 ? -10.144 18.915  -37.705 0.05 14.10 ? 271  LYS A CE    1  
ATOM   2055   N  NZ    A LYS A 1 272 ? -9.045  17.898  -37.739 0.05 13.75 ? 271  LYS A NZ    1  
ATOM   2056   N  N     A VAL A 1 273 ? -5.327  23.488  -37.554 0.05 13.24 ? 272  VAL A N     1  
ATOM   2057   C  CA    A VAL A 1 273 ? -5.110  23.783  -36.124 0.05 13.17 ? 272  VAL A CA    1  
ATOM   2058   C  C     A VAL A 1 273 ? -4.401  22.578  -35.466 0.05 12.85 ? 272  VAL A C     1  
ATOM   2059   O  O     A VAL A 1 273 ? -4.299  21.536  -36.105 0.05 12.75 ? 272  VAL A O     1  
ATOM   2060   C  CB    A VAL A 1 273 ? -6.447  24.257  -35.424 0.05 13.63 ? 272  VAL A CB    1  
ATOM   2061   C  CG1   A VAL A 1 273 ? -6.300  24.479  -33.945 0.05 13.62 ? 272  VAL A CG1   1  
ATOM   2062   C  CG2   A VAL A 1 273 ? -6.983  25.515  -36.098 0.05 13.94 ? 272  VAL A CG2   1  
ATOM   2063   N  N     A THR A 1 274 ? -3.740  22.708  -34.316 0.05 12.68 ? 273  THR A N     1  
ATOM   2064   C  CA    A THR A 1 274 ? -2.819  23.781  -33.988 0.05 12.52 ? 273  THR A CA    1  
ATOM   2065   C  C     A THR A 1 274 ? -1.514  22.982  -33.922 0.05 12.09 ? 273  THR A C     1  
ATOM   2066   O  O     A THR A 1 274 ? -1.501  21.874  -33.400 0.05 11.99 ? 273  THR A O     1  
ATOM   2067   C  CB    A THR A 1 274 ? -3.146  24.463  -32.617 0.05 12.65 ? 273  THR A CB    1  
ATOM   2068   O  OG1   A THR A 1 274 ? -1.945  24.932  -31.987 0.05 12.33 ? 273  THR A OG1   1  
ATOM   2069   C  CG2   A THR A 1 274 ? -3.890  23.509  -31.666 0.05 12.90 ? 273  THR A CG2   1  
ATOM   2070   N  N     A PRO A 1 275 ? -0.437  23.489  -34.522 0.05 11.87 ? 274  PRO A N     1  
ATOM   2071   C  CA    A PRO A 1 275 ? 0.876   22.819  -34.509 0.05 11.51 ? 274  PRO A CA    1  
ATOM   2072   C  C     A PRO A 1 275 ? 1.774   23.533  -33.516 0.05 11.47 ? 274  PRO A C     1  
ATOM   2073   O  O     A PRO A 1 275 ? 3.007   23.474  -33.580 0.05 11.22 ? 274  PRO A O     1  
ATOM   2074   C  CB    A PRO A 1 275 ? 1.388   23.091  -35.919 0.05 11.33 ? 274  PRO A CB    1  
ATOM   2075   C  CG    A PRO A 1 275 ? 0.820   24.465  -36.237 0.05 11.57 ? 274  PRO A CG    1  
ATOM   2076   C  CD    A PRO A 1 275 ? -0.470  24.626  -35.460 0.05 11.93 ? 274  PRO A CD    1  
ATOM   2077   N  N     A ALA A 1 276 ? 1.119   24.200  -32.580 0.05 11.74 ? 275  ALA A N     1  
ATOM   2078   C  CA    A ALA A 1 276 ? 1.643   25.433  -32.050 0.05 11.83 ? 275  ALA A CA    1  
ATOM   2079   C  C     A ALA A 1 276 ? 1.509   25.518  -30.559 0.05 11.85 ? 275  ALA A C     1  
ATOM   2080   O  O     A ALA A 1 276 ? 1.010   26.510  -30.025 0.05 12.08 ? 275  ALA A O     1  
ATOM   2081   C  CB    A ALA A 1 276 ? 0.922   26.601  -32.692 0.05 12.20 ? 275  ALA A CB    1  
ATOM   2082   N  N     A GLU A 1 277 ? 1.939   24.463  -29.884 0.05 11.65 ? 276  GLU A N     1  
ATOM   2083   C  CA    A GLU A 1 277 ? 2.316   24.614  -28.496 0.05 11.64 ? 276  GLU A CA    1  
ATOM   2084   C  C     A GLU A 1 277 ? 3.752   25.102  -28.624 0.05 11.34 ? 276  GLU A C     1  
ATOM   2085   O  O     A GLU A 1 277 ? 4.354   25.546  -27.646 0.05 11.33 ? 276  GLU A O     1  
ATOM   2086   C  CB    A GLU A 1 277 ? 2.268   23.288  -27.731 0.05 11.62 ? 276  GLU A CB    1  
ATOM   2087   N  N     A LEU A 1 278 ? 4.314   24.914  -29.830 0.05 11.12 ? 277  LEU A N     1  
ATOM   2088   C  CA    A LEU A 1 278 ? 5.669   25.366  -30.179 0.05 10.84 ? 277  LEU A CA    1  
ATOM   2089   C  C     A LEU A 1 278 ? 6.586   24.442  -31.013 0.05 10.59 ? 277  LEU A C     1  
ATOM   2090   O  O     A LEU A 1 278 ? 6.351   23.232  -31.122 0.05 10.56 ? 277  LEU A O     1  
ATOM   2091   N  N     A GLY A 1 279 ? 7.630   25.047  -31.588 0.05 10.42 ? 278  GLY A N     1  
ATOM   2092   C  CA    A GLY A 1 279 ? 8.715   24.339  -32.238 0.05 10.23 ? 278  GLY A CA    1  
ATOM   2093   C  C     A GLY A 1 279 ? 8.931   24.814  -33.654 0.05 10.13 ? 278  GLY A C     1  
ATOM   2094   O  O     A GLY A 1 279 ? 8.237   24.351  -34.552 0.05 10.22 ? 278  GLY A O     1  
ATOM   2095   N  N     A GLU A 1 280 ? 9.896   25.717  -33.851 0.05 9.96  ? 279  GLU A N     1  
ATOM   2096   C  CA    A GLU A 1 280 ? 10.277  26.233  -35.177 0.05 9.85  ? 279  GLU A CA    1  
ATOM   2097   C  C     A GLU A 1 280 ? 10.430  25.147  -36.234 0.05 9.77  ? 279  GLU A C     1  
ATOM   2098   O  O     A GLU A 1 280 ? 10.282  25.419  -37.436 0.05 9.75  ? 279  GLU A O     1  
ATOM   2099   C  CB    A GLU A 1 280 ? 11.595  27.012  -35.100 0.05 9.70  ? 279  GLU A CB    1  
ATOM   2100   N  N     A LEU A 1 281 ? 10.757  23.939  -35.772 0.05 9.75  ? 280  LEU A N     1  
ATOM   2101   C  CA    A LEU A 1 281 ? 10.787  22.713  -36.591 0.05 9.72  ? 280  LEU A CA    1  
ATOM   2102   C  C     A LEU A 1 281 ? 11.926  22.576  -37.608 0.05 9.60  ? 280  LEU A C     1  
ATOM   2103   O  O     A LEU A 1 281 ? 12.205  23.503  -38.367 0.05 9.62  ? 280  LEU A O     1  
ATOM   2104   C  CB    A LEU A 1 281 ? 9.441   22.479  -37.287 0.05 9.89  ? 280  LEU A CB    1  
ATOM   2105   C  CG    A LEU A 1 281 ? 8.342   21.853  -36.432 0.05 10.06 ? 280  LEU A CG    1  
ATOM   2106   C  CD1   A LEU A 1 281 ? 7.218   21.329  -37.306 0.05 10.23 ? 280  LEU A CD1   1  
ATOM   2107   C  CD2   A LEU A 1 281 ? 8.924   20.759  -35.541 0.05 10.01 ? 280  LEU A CD2   1  
ATOM   2108   N  N     A PRO A 1 282 ? 12.599  21.409  -37.612 0.05 9.52  ? 281  PRO A N     1  
ATOM   2109   C  CA    A PRO A 1 282 ? 13.533  21.038  -38.684 0.05 9.47  ? 281  PRO A CA    1  
ATOM   2110   C  C     A PRO A 1 282 ? 12.835  20.721  -40.018 0.05 9.59  ? 281  PRO A C     1  
ATOM   2111   O  O     A PRO A 1 282 ? 11.619  20.498  -40.058 0.05 9.71  ? 281  PRO A O     1  
ATOM   2112   C  CB    A PRO A 1 282 ? 14.219  19.786  -38.129 0.05 9.42  ? 281  PRO A CB    1  
ATOM   2113   C  CG    A PRO A 1 282 ? 14.132  19.950  -36.630 0.05 9.38  ? 281  PRO A CG    1  
ATOM   2114   C  CD    A PRO A 1 282 ? 12.791  20.584  -36.406 0.05 9.47  ? 281  PRO A CD    1  
ATOM   2115   N  N     A ASP A 1 283 ? 13.609  20.686  -41.101 0.05 9.60  ? 282  ASP A N     1  
ATOM   2116   C  CA    A ASP A 1 283 ? 13.050  20.561  -42.448 0.05 9.75  ? 282  ASP A CA    1  
ATOM   2117   C  C     A ASP A 1 283 ? 12.630  19.133  -42.798 0.05 9.82  ? 282  ASP A C     1  
ATOM   2118   O  O     A ASP A 1 283 ? 11.829  18.918  -43.706 0.05 9.97  ? 282  ASP A O     1  
ATOM   2119   C  CB    A ASP A 1 283 ? 14.047  21.057  -43.499 0.05 9.77  ? 282  ASP A CB    1  
ATOM   2120   C  CG    A ASP A 1 283 ? 14.674  22.394  -43.135 0.05 9.68  ? 282  ASP A CG    1  
ATOM   2121   O  OD1   A ASP A 1 283 ? 14.672  23.296  -44.001 0.05 9.75  ? 282  ASP A OD1   1  
ATOM   2122   O  OD2   A ASP A 1 283 ? 15.192  22.529  -41.993 0.05 9.55  ? 282  ASP A OD2   1  
ATOM   2123   N  N     A ASN A 1 284 ? 13.175  18.161  -42.077 0.05 9.72  ? 283  ASN A N     1  
ATOM   2124   C  CA    A ASN A 1 284 ? 12.895  16.763  -42.378 0.05 9.78  ? 283  ASN A CA    1  
ATOM   2125   C  C     A ASN A 1 284 ? 11.778  16.214  -41.501 0.05 9.80  ? 283  ASN A C     1  
ATOM   2126   O  O     A ASN A 1 284 ? 11.747  15.025  -41.207 0.05 9.81  ? 283  ASN A O     1  
ATOM   2127   C  CB    A ASN A 1 284 ? 14.157  15.914  -42.196 0.05 9.71  ? 283  ASN A CB    1  
ATOM   2128   C  CG    A ASN A 1 284 ? 14.609  15.860  -40.748 0.05 9.59  ? 283  ASN A CG    1  
ATOM   2129   O  OD1   A ASN A 1 284 ? 14.503  16.843  -40.026 0.05 9.52  ? 283  ASN A OD1   1  
ATOM   2130   N  ND2   A ASN A 1 284 ? 15.081  14.698  -40.312 0.05 9.58  ? 283  ASN A ND2   1  
ATOM   2131   N  N     A VAL A 1 285 ? 10.870  17.086  -41.074 0.05 9.82  ? 284  VAL A N     1  
ATOM   2132   C  CA    A VAL A 1 285 ? 9.766   16.671  -40.213 0.05 9.88  ? 284  VAL A CA    1  
ATOM   2133   C  C     A VAL A 1 285 ? 8.445   17.167  -40.777 0.05 10.06 ? 284  VAL A C     1  
ATOM   2134   O  O     A VAL A 1 285 ? 8.291   18.358  -41.047 0.05 10.11 ? 284  VAL A O     1  
ATOM   2135   C  CB    A VAL A 1 285 ? 9.917   17.233  -38.788 0.05 9.81  ? 284  VAL A CB    1  
ATOM   2136   C  CG1   A VAL A 1 285 ? 8.743   16.783  -37.905 0.05 9.92  ? 284  VAL A CG1   1  
ATOM   2137   C  CG2   A VAL A 1 285 ? 11.240  16.801  -38.176 0.05 9.66  ? 284  VAL A CG2   1  
ATOM   2138   N  N     A GLU A 1 286 ? 7.491   16.262  -40.951 0.05 10.18 ? 285  GLU A N     1  
ATOM   2139   C  CA    A GLU A 1 286 ? 6.167   16.662  -41.402 0.05 10.39 ? 285  GLU A CA    1  
ATOM   2140   C  C     A GLU A 1 286 ? 5.127   16.276  -40.352 0.05 10.49 ? 285  GLU A C     1  
ATOM   2141   O  O     A GLU A 1 286 ? 5.142   15.163  -39.799 0.05 10.43 ? 285  GLU A O     1  
ATOM   2142   C  CB    A GLU A 1 286 ? 5.845   16.083  -42.782 0.05 10.54 ? 285  GLU A CB    1  
ATOM   2143   C  CG    A GLU A 1 286 ? 5.276   14.676  -42.782 0.05 10.58 ? 285  GLU A CG    1  
ATOM   2144   C  CD    A GLU A 1 286 ? 4.976   14.147  -44.185 0.05 10.78 ? 285  GLU A CD    1  
ATOM   2145   O  OE1   A GLU A 1 286 ? 3.796   14.157  -44.606 0.05 10.99 ? 285  GLU A OE1   1  
ATOM   2146   O  OE2   A GLU A 1 286 ? 5.918   13.706  -44.870 0.05 10.76 ? 285  GLU A OE2   1  
ATOM   2147   N  N     A VAL A 1 287 ? 4.248   17.230  -40.071 0.05 10.66 ? 286  VAL A N     1  
ATOM   2148   C  CA    A VAL A 1 287 ? 3.300   17.139  -38.985 0.05 10.81 ? 286  VAL A CA    1  
ATOM   2149   C  C     A VAL A 1 287 ? 1.911   17.030  -39.582 0.05 11.08 ? 286  VAL A C     1  
ATOM   2150   O  O     A VAL A 1 287 ? 1.658   17.558  -40.663 0.05 11.22 ? 286  VAL A O     1  
ATOM   2151   C  CB    A VAL A 1 287 ? 3.363   18.387  -38.101 0.05 10.82 ? 286  VAL A CB    1  
ATOM   2152   C  CG1   A VAL A 1 287 ? 4.702   18.479  -37.422 0.05 10.59 ? 286  VAL A CG1   1  
ATOM   2153   C  CG2   A VAL A 1 287 ? 3.102   19.633  -38.930 0.05 10.89 ? 286  VAL A CG2   1  
ATOM   2154   N  N     A HIS A 1 288 ? 1.019   16.327  -38.890 0.05 11.19 ? 287  HIS A N     1  
ATOM   2155   C  CA    A HIS A 1 288 ? -0.328  16.129  -39.395 0.05 11.49 ? 287  HIS A CA    1  
ATOM   2156   C  C     A HIS A 1 288 ? -1.331  16.093  -38.264 0.05 11.65 ? 287  HIS A C     1  
ATOM   2157   O  O     A HIS A 1 288 ? -0.962  15.991  -37.098 0.05 11.51 ? 287  HIS A O     1  
ATOM   2158   C  CB    A HIS A 1 288 ? -0.424  14.819  -40.180 0.05 11.50 ? 287  HIS A CB    1  
ATOM   2159   C  CG    A HIS A 1 288 ? 0.268   14.857  -41.502 0.05 11.46 ? 287  HIS A CG    1  
ATOM   2160   N  ND1   A HIS A 1 288 ? -0.315  15.389  -42.632 0.05 11.70 ? 287  HIS A ND1   1  
ATOM   2161   C  CD2   A HIS A 1 288 ? 1.490   14.418  -41.880 0.05 11.23 ? 287  HIS A CD2   1  
ATOM   2162   C  CE1   A HIS A 1 288 ? 0.525   15.289  -43.646 0.05 11.63 ? 287  HIS A CE1   1  
ATOM   2163   N  NE2   A HIS A 1 288 ? 1.626   14.699  -43.216 0.05 11.34 ? 287  HIS A NE2   1  
ATOM   2164   N  N     A ASP A 1 289 ? -2.608  16.156  -38.617 0.05 11.96 ? 288  ASP A N     1  
ATOM   2165   C  CA    A ASP A 1 289 ? -3.666  15.923  -37.648 0.05 12.16 ? 288  ASP A CA    1  
ATOM   2166   C  C     A ASP A 1 289 ? -4.004  14.432  -37.599 0.05 12.22 ? 288  ASP A C     1  
ATOM   2167   O  O     A ASP A 1 289 ? -4.426  13.912  -36.575 0.05 12.31 ? 288  ASP A O     1  
ATOM   2168   C  CB    A ASP A 1 289 ? -4.903  16.719  -38.039 0.05 12.53 ? 288  ASP A CB    1  
ATOM   2169   C  CG    A ASP A 1 289 ? -5.816  15.953  -38.974 0.05 12.81 ? 288  ASP A CG    1  
ATOM   2170   O  OD1   A ASP A 1 289 ? -6.768  15.330  -38.464 0.05 12.96 ? 288  ASP A OD1   1  
ATOM   2171   O  OD2   A ASP A 1 289 ? -5.579  15.969  -40.201 0.05 12.91 ? 288  ASP A OD2   1  
ATOM   2172   N  N     A TRP A 1 290 ? -3.782  13.757  -38.720 0.05 12.18 ? 289  TRP A N     1  
ATOM   2173   C  CA    A TRP A 1 290 ? -4.180  12.376  -38.913 0.05 12.26 ? 289  TRP A CA    1  
ATOM   2174   C  C     A TRP A 1 290 ? -3.445  11.924  -40.174 0.05 12.11 ? 289  TRP A C     1  
ATOM   2175   O  O     A TRP A 1 290 ? -3.016  12.773  -40.965 0.05 12.15 ? 289  TRP A O     1  
ATOM   2176   C  CB    A TRP A 1 290 ? -5.716  12.307  -39.075 0.05 12.66 ? 289  TRP A CB    1  
ATOM   2177   C  CG    A TRP A 1 290 ? -6.254  10.999  -39.560 0.05 12.75 ? 289  TRP A CG    1  
ATOM   2178   C  CD1   A TRP A 1 290 ? -6.788  9.999   -38.805 0.05 12.85 ? 289  TRP A CD1   1  
ATOM   2179   C  CD2   A TRP A 1 290 ? -6.319  10.556  -40.915 0.05 12.78 ? 289  TRP A CD2   1  
ATOM   2180   N  NE1   A TRP A 1 290 ? -7.175  8.958   -39.605 0.05 12.91 ? 289  TRP A NE1   1  
ATOM   2181   C  CE2   A TRP A 1 290 ? -6.894  9.274   -40.907 0.05 12.87 ? 289  TRP A CE2   1  
ATOM   2182   C  CE3   A TRP A 1 290 ? -5.940  11.117  -42.135 0.05 12.75 ? 289  TRP A CE3   1  
ATOM   2183   C  CZ2   A TRP A 1 290 ? -7.100  8.546   -42.070 0.05 12.94 ? 289  TRP A CZ2   1  
ATOM   2184   C  CZ3   A TRP A 1 290 ? -6.142  10.391  -43.286 0.05 12.83 ? 289  TRP A CZ3   1  
ATOM   2185   C  CH2   A TRP A 1 290 ? -6.709  9.117   -43.246 0.05 12.92 ? 289  TRP A CH2   1  
ATOM   2186   N  N     A VAL A 1 291 ? -3.270  10.612  -40.353 0.05 11.99 ? 290  VAL A N     1  
ATOM   2187   C  CA    A VAL A 1 291 ? -2.590  10.072  -41.533 0.05 11.89 ? 290  VAL A CA    1  
ATOM   2188   C  C     A VAL A 1 291 ? -3.251  8.802   -42.086 0.05 12.02 ? 290  VAL A C     1  
ATOM   2189   O  O     A VAL A 1 291 ? -3.938  8.076   -41.357 0.05 12.11 ? 290  VAL A O     1  
ATOM   2190   C  CB    A VAL A 1 291 ? -1.092  9.748   -41.231 0.05 11.55 ? 290  VAL A CB    1  
ATOM   2191   C  CG1   A VAL A 1 291 ? -0.319  11.011  -40.893 0.05 11.43 ? 290  VAL A CG1   1  
ATOM   2192   C  CG2   A VAL A 1 291 ? -0.973  8.735   -40.102 0.05 11.43 ? 290  VAL A CG2   1  
ATOM   2193   N  N     A PRO A 1 292 ? -3.058  8.528   -43.386 0.05 12.07 ? 291  PRO A N     1  
ATOM   2194   C  CA    A PRO A 1 292 ? -3.357  7.164   -43.818 0.05 12.13 ? 291  PRO A CA    1  
ATOM   2195   C  C     A PRO A 1 292 ? -2.260  6.275   -43.229 0.05 11.83 ? 291  PRO A C     1  
ATOM   2196   O  O     A PRO A 1 292 ? -1.248  6.029   -43.885 0.05 11.68 ? 291  PRO A O     1  
ATOM   2197   C  CB    A PRO A 1 292 ? -3.271  7.251   -45.346 0.05 12.27 ? 291  PRO A CB    1  
ATOM   2198   C  CG    A PRO A 1 292 ? -2.401  8.450   -45.621 0.05 12.15 ? 291  PRO A CG    1  
ATOM   2199   C  CD    A PRO A 1 292 ? -2.661  9.408   -44.503 0.05 12.09 ? 291  PRO A CD    1  
ATOM   2200   N  N     A GLN A 1 293 ? -2.451  5.840   -41.984 0.05 11.78 ? 292  GLN A N     1  
ATOM   2201   C  CA    A GLN A 1 293 ? -1.377  5.206   -41.214 0.05 11.52 ? 292  GLN A CA    1  
ATOM   2202   C  C     A GLN A 1 293 ? -0.892  3.911   -41.836 0.05 11.45 ? 292  GLN A C     1  
ATOM   2203   O  O     A GLN A 1 293 ? 0.311   3.716   -42.009 0.05 11.26 ? 292  GLN A O     1  
ATOM   2204   C  CB    A GLN A 1 293 ? -1.786  4.953   -39.758 0.05 11.54 ? 292  GLN A CB    1  
ATOM   2205   C  CG    A GLN A 1 293 ? -0.778  4.071   -39.004 0.05 11.34 ? 292  GLN A CG    1  
ATOM   2206   C  CD    A GLN A 1 293 ? -1.068  3.956   -37.516 0.05 11.37 ? 292  GLN A CD    1  
ATOM   2207   O  OE1   A GLN A 1 293 ? -0.952  4.927   -36.765 0.05 11.42 ? 292  GLN A OE1   1  
ATOM   2208   N  NE2   A GLN A 1 293 ? -1.431  2.760   -37.083 0.05 11.37 ? 292  GLN A NE2   1  
ATOM   2209   N  N     A LEU A 1 294 ? -1.825  3.024   -42.165 0.05 11.62 ? 293  LEU A N     1  
ATOM   2210   C  CA    A LEU A 1 294 ? -1.450  1.767   -42.786 0.05 11.59 ? 293  LEU A CA    1  
ATOM   2211   C  C     A LEU A 1 294 ? -0.662  2.091   -44.049 0.05 11.57 ? 293  LEU A C     1  
ATOM   2212   O  O     A LEU A 1 294 ? 0.356   1.464   -44.323 0.05 11.45 ? 293  LEU A O     1  
ATOM   2213   C  CB    A LEU A 1 294 ? -2.682  0.905   -43.081 0.05 11.82 ? 293  LEU A CB    1  
ATOM   2214   C  CG    A LEU A 1 294 ? -2.502  -0.595  -43.360 0.05 11.81 ? 293  LEU A CG    1  
ATOM   2215   C  CD1   A LEU A 1 294 ? -1.654  -1.274  -42.297 0.05 11.59 ? 293  LEU A CD1   1  
ATOM   2216   C  CD2   A LEU A 1 294 ? -3.861  -1.281  -43.454 0.05 12.05 ? 293  LEU A CD2   1  
ATOM   2217   N  N     A ALA A 1 295 ? -1.112  3.103   -44.791 0.05 11.71 ? 294  ALA A N     1  
ATOM   2218   C  CA    A ALA A 1 295 ? -0.439  3.513   -46.022 0.05 11.75 ? 294  ALA A CA    1  
ATOM   2219   C  C     A ALA A 1 295 ? 1.000   3.968   -45.778 0.05 11.51 ? 294  ALA A C     1  
ATOM   2220   O  O     A ALA A 1 295 ? 1.912   3.585   -46.514 0.05 11.48 ? 294  ALA A O     1  
ATOM   2221   C  CB    A ALA A 1 295 ? -1.238  4.612   -46.737 0.05 11.99 ? 294  ALA A CB    1  
ATOM   2222   N  N     A ILE A 1 296 ? 1.196   4.787   -44.750 0.05 11.35 ? 295  ILE A N     1  
ATOM   2223   C  CA    A ILE A 1 296 ? 2.535   5.259   -44.390 0.05 11.12 ? 295  ILE A CA    1  
ATOM   2224   C  C     A ILE A 1 296 ? 3.458   4.137   -43.909 0.05 10.97 ? 295  ILE A C     1  
ATOM   2225   O  O     A ILE A 1 296 ? 4.588   4.027   -44.370 0.05 10.88 ? 295  ILE A O     1  
ATOM   2226   C  CB    A ILE A 1 296 ? 2.477   6.394   -43.356 0.05 11.03 ? 295  ILE A CB    1  
ATOM   2227   C  CG1   A ILE A 1 296 ? 1.899   7.656   -44.007 0.05 11.16 ? 295  ILE A CG1   1  
ATOM   2228   C  CG2   A ILE A 1 296 ? 3.864   6.667   -42.778 0.05 10.79 ? 295  ILE A CG2   1  
ATOM   2229   C  CD1   A ILE A 1 296 ? 1.886   8.865   -43.102 0.05 11.12 ? 295  ILE A CD1   1  
ATOM   2230   N  N     A LEU A 1 297 ? 2.971   3.302   -42.992 0.05 10.97 ? 296  LEU A N     1  
ATOM   2231   C  CA    A LEU A 1 297 ? 3.739   2.150   -42.513 0.05 10.85 ? 296  LEU A CA    1  
ATOM   2232   C  C     A LEU A 1 297 ? 4.171   1.268   -43.677 0.05 10.91 ? 296  LEU A C     1  
ATOM   2233   O  O     A LEU A 1 297 ? 5.190   0.586   -43.610 0.05 10.81 ? 296  LEU A O     1  
ATOM   2234   C  CB    A LEU A 1 297 ? 2.909   1.331   -41.516 0.05 10.90 ? 296  LEU A CB    1  
ATOM   2235   C  CG    A LEU A 1 297 ? 2.681   1.987   -40.154 0.05 10.85 ? 296  LEU A CG    1  
ATOM   2236   C  CD1   A LEU A 1 297 ? 1.675   1.202   -39.309 0.05 10.96 ? 296  LEU A CD1   1  
ATOM   2237   C  CD2   A LEU A 1 297 ? 3.999   2.099   -39.406 0.05 10.66 ? 296  LEU A CD2   1  
ATOM   2238   N  N     A ARG A 1 298 ? 3.385   1.294   -44.751 0.05 11.09 ? 297  ARG A N     1  
ATOM   2239   C  CA    A ARG A 1 298 ? 3.667   0.504   -45.934 0.05 11.19 ? 297  ARG A CA    1  
ATOM   2240   C  C     A ARG A 1 298 ? 4.980   0.876   -46.644 0.05 11.15 ? 297  ARG A C     1  
ATOM   2241   O  O     A ARG A 1 298 ? 5.456   0.146   -47.515 0.05 11.23 ? 297  ARG A O     1  
ATOM   2242   C  CB    A ARG A 1 298 ? 2.498   0.622   -46.905 0.05 11.44 ? 297  ARG A CB    1  
ATOM   2243   C  CG    A ARG A 1 298 ? 2.105   -0.672  -47.550 0.05 11.57 ? 297  ARG A CG    1  
ATOM   2244   C  CD    A ARG A 1 298 ? 2.433   -0.619  -49.024 0.05 11.75 ? 297  ARG A CD    1  
ATOM   2245   N  NE    A ARG A 1 298 ? 1.486   0.194   -49.794 0.05 11.95 ? 297  ARG A NE    1  
ATOM   2246   C  CZ    A ARG A 1 298 ? 0.692   -0.301  -50.740 0.05 12.21 ? 297  ARG A CZ    1  
ATOM   2247   N  NH1   A ARG A 1 298 ? 0.731   -1.598  -51.020 0.05 12.30 ? 297  ARG A NH1   1  
ATOM   2248   N  NH2   A ARG A 1 298 ? -0.139  0.491   -51.408 0.05 12.42 ? 297  ARG A NH2   1  
ATOM   2249   N  N     A GLN A 1 299 ? 5.557   2.018   -46.297 0.05 11.05 ? 298  GLN A N     1  
ATOM   2250   C  CA    A GLN A 1 299 ? 6.873   2.353   -46.828 0.05 11.00 ? 298  GLN A CA    1  
ATOM   2251   C  C     A GLN A 1 299 ? 7.851   2.668   -45.708 0.05 10.78 ? 298  GLN A C     1  
ATOM   2252   O  O     A GLN A 1 299 ? 9.064   2.660   -45.923 0.05 10.75 ? 298  GLN A O     1  
ATOM   2253   C  CB    A GLN A 1 299 ? 6.801   3.529   -47.803 0.05 11.05 ? 298  GLN A CB    1  
ATOM   2254   C  CG    A GLN A 1 299 ? 5.977   3.274   -49.058 0.05 11.30 ? 298  GLN A CG    1  
ATOM   2255   C  CD    A GLN A 1 299 ? 4.850   4.261   -49.162 0.05 11.43 ? 298  GLN A CD    1  
ATOM   2256   O  OE1   A GLN A 1 299 ? 3.886   4.169   -48.417 0.05 11.44 ? 298  GLN A OE1   1  
ATOM   2257   N  NE2   A GLN A 1 299 ? 4.983   5.244   -50.050 0.05 11.56 ? 298  GLN A NE2   1  
ATOM   2258   N  N     A ALA A 1 300 ? 7.317   2.906   -44.512 0.05 10.68 ? 299  ALA A N     1  
ATOM   2259   C  CA    A ALA A 1 300 ? 8.115   3.331   -43.362 0.05 10.50 ? 299  ALA A CA    1  
ATOM   2260   C  C     A ALA A 1 300 ? 9.140   2.289   -42.935 0.05 10.44 ? 299  ALA A C     1  
ATOM   2261   O  O     A ALA A 1 300 ? 8.975   1.094   -43.188 0.05 10.51 ? 299  ALA A O     1  
ATOM   2262   C  CB    A ALA A 1 300 ? 7.204   3.678   -42.186 0.05 10.46 ? 299  ALA A CB    1  
ATOM   2263   N  N     A ASP A 1 301 ? 10.194  2.747   -42.270 0.05 10.33 ? 300  ASP A N     1  
ATOM   2264   C  CA    A ASP A 1 301 ? 11.242  1.852   -41.802 0.05 10.30 ? 300  ASP A CA    1  
ATOM   2265   C  C     A ASP A 1 301 ? 11.224  1.706   -40.291 0.05 10.22 ? 300  ASP A C     1  
ATOM   2266   O  O     A ASP A 1 301 ? 11.881  0.830   -39.736 0.05 10.23 ? 300  ASP A O     1  
ATOM   2267   C  CB    A ASP A 1 301 ? 12.608  2.354   -42.266 0.05 10.29 ? 300  ASP A CB    1  
ATOM   2268   C  CG    A ASP A 1 301 ? 12.682  2.490   -43.767 0.05 10.41 ? 300  ASP A CG    1  
ATOM   2269   O  OD1   A ASP A 1 301 ? 12.694  1.441   -44.454 0.05 10.54 ? 300  ASP A OD1   1  
ATOM   2270   O  OD2   A ASP A 1 301 ? 12.700  3.643   -44.260 0.05 10.39 ? 300  ASP A OD2   1  
ATOM   2271   N  N     A LEU A 1 302 ? 10.475  2.576   -39.630 0.05 10.17 ? 301  LEU A N     1  
ATOM   2272   C  CA    A LEU A 1 302 ? 10.411  2.550   -38.180 0.05 10.13 ? 301  LEU A CA    1  
ATOM   2273   C  C     A LEU A 1 302 ? 9.086   3.126   -37.722 0.05 10.16 ? 301  LEU A C     1  
ATOM   2274   O  O     A LEU A 1 302 ? 8.577   4.065   -38.325 0.05 10.17 ? 301  LEU A O     1  
ATOM   2275   C  CB    A LEU A 1 302 ? 11.567  3.355   -37.600 0.05 10.04 ? 301  LEU A CB    1  
ATOM   2276   C  CG    A LEU A 1 302 ? 11.755  3.248   -36.094 0.05 10.04 ? 301  LEU A CG    1  
ATOM   2277   C  CD1   A LEU A 1 302 ? 12.080  1.805   -35.707 0.05 10.11 ? 301  LEU A CD1   1  
ATOM   2278   C  CD2   A LEU A 1 302 ? 12.864  4.178   -35.675 0.05 9.97  ? 301  LEU A CD2   1  
ATOM   2279   N  N     A PHE A 1 303 ? 8.522   2.552   -36.663 0.05 10.21 ? 302  PHE A N     1  
ATOM   2280   C  CA    A PHE A 1 303 ? 7.221   2.988   -36.161 0.05 10.29 ? 302  PHE A CA    1  
ATOM   2281   C  C     A PHE A 1 303 ? 7.307   3.207   -34.649 0.05 10.31 ? 302  PHE A C     1  
ATOM   2282   O  O     A PHE A 1 303 ? 7.526   2.266   -33.896 0.05 10.35 ? 302  PHE A O     1  
ATOM   2283   C  CB    A PHE A 1 303 ? 6.181   1.913   -36.514 0.05 10.41 ? 302  PHE A CB    1  
ATOM   2284   C  CG    A PHE A 1 303 ? 4.768   2.216   -36.070 0.05 10.54 ? 302  PHE A CG    1  
ATOM   2285   C  CD1   A PHE A 1 303 ? 4.333   3.512   -35.837 0.05 10.56 ? 302  PHE A CD1   1  
ATOM   2286   C  CD2   A PHE A 1 303 ? 3.865   1.170   -35.903 0.05 10.67 ? 302  PHE A CD2   1  
ATOM   2287   C  CE1   A PHE A 1 303 ? 3.020   3.762   -35.433 0.05 10.73 ? 302  PHE A CE1   1  
ATOM   2288   C  CE2   A PHE A 1 303 ? 2.554   1.403   -35.506 0.05 10.83 ? 302  PHE A CE2   1  
ATOM   2289   C  CZ    A PHE A 1 303 ? 2.124   2.699   -35.271 0.05 10.87 ? 302  PHE A CZ    1  
ATOM   2290   N  N     A VAL A 1 304 ? 7.159   4.458   -34.215 0.05 10.29 ? 303  VAL A N     1  
ATOM   2291   C  CA    A VAL A 1 304 ? 7.075   4.766   -32.794 0.05 10.36 ? 303  VAL A CA    1  
ATOM   2292   C  C     A VAL A 1 304 ? 5.592   4.732   -32.456 0.05 10.52 ? 303  VAL A C     1  
ATOM   2293   O  O     A VAL A 1 304 ? 4.826   5.566   -32.939 0.05 10.57 ? 303  VAL A O     1  
ATOM   2294   C  CB    A VAL A 1 304 ? 7.670   6.153   -32.461 0.05 10.28 ? 303  VAL A CB    1  
ATOM   2295   C  CG1   A VAL A 1 304 ? 7.644   6.405   -30.952 0.05 10.38 ? 303  VAL A CG1   1  
ATOM   2296   C  CG2   A VAL A 1 304 ? 9.085   6.252   -32.977 0.05 10.13 ? 303  VAL A CG2   1  
ATOM   2297   N  N     A THR A 1 305 ? 5.194   3.741   -31.665 0.05 10.64 ? 304  THR A N     1  
ATOM   2298   C  CA    A THR A 1 305 ? 3.780   3.437   -31.433 0.05 10.83 ? 304  THR A CA    1  
ATOM   2299   C  C     A THR A 1 305 ? 3.453   3.337   -29.941 0.05 11.00 ? 304  THR A C     1  
ATOM   2300   O  O     A THR A 1 305 ? 4.327   3.040   -29.132 0.05 10.98 ? 304  THR A O     1  
ATOM   2301   C  CB    A THR A 1 305 ? 3.402   2.094   -32.094 0.05 10.86 ? 304  THR A CB    1  
ATOM   2302   O  OG1   A THR A 1 305 ? 2.022   1.792   -31.834 0.05 11.06 ? 304  THR A OG1   1  
ATOM   2303   C  CG2   A THR A 1 305 ? 4.288   0.962   -31.565 0.05 10.82 ? 304  THR A CG2   1  
ATOM   2304   N  N     A HIS A 1 306 ? 2.194   3.587   -29.584 0.05 11.21 ? 305  HIS A N     1  
ATOM   2305   C  CA    A HIS A 1 306 ? 1.732   3.378   -28.217 0.05 11.43 ? 305  HIS A CA    1  
ATOM   2306   C  C     A HIS A 1 306 ? 1.428   1.899   -27.947 0.05 11.53 ? 305  HIS A C     1  
ATOM   2307   O  O     A HIS A 1 306 ? 1.138   1.523   -26.815 0.05 11.72 ? 305  HIS A O     1  
ATOM   2308   C  CB    A HIS A 1 306 ? 0.492   4.228   -27.917 0.05 11.66 ? 305  HIS A CB    1  
ATOM   2309   C  CG    A HIS A 1 306 ? -0.761  3.725   -28.564 0.05 11.80 ? 305  HIS A CG    1  
ATOM   2310   N  ND1   A HIS A 1 306 ? -0.890  3.579   -29.929 0.05 11.66 ? 305  HIS A ND1   1  
ATOM   2311   C  CD2   A HIS A 1 306 ? -1.949  3.350   -28.031 0.05 12.09 ? 305  HIS A CD2   1  
ATOM   2312   C  CE1   A HIS A 1 306 ? -2.099  3.127   -30.209 0.05 11.85 ? 305  HIS A CE1   1  
ATOM   2313   N  NE2   A HIS A 1 306 ? -2.762  2.981   -29.075 0.05 12.11 ? 305  HIS A NE2   1  
ATOM   2314   N  N     A ALA A 1 307 ? 1.510   1.079   -28.988 0.05 11.41 ? 306  ALA A N     1  
ATOM   2315   C  CA    A ALA A 1 307 ? 1.262   -0.366  -28.896 0.05 11.48 ? 306  ALA A CA    1  
ATOM   2316   C  C     A ALA A 1 307 ? -0.194  -0.706  -28.586 0.05 11.74 ? 306  ALA A C     1  
ATOM   2317   O  O     A ALA A 1 307 ? -0.477  -1.708  -27.931 0.05 11.88 ? 306  ALA A O     1  
ATOM   2318   C  CB    A ALA A 1 307 ? 2.205   -1.036  -27.895 0.05 11.49 ? 306  ALA A CB    1  
ATOM   2319   N  N     A GLY A 1 308 ? -1.116  0.126   -29.067 0.05 11.82 ? 307  GLY A N     1  
ATOM   2320   C  CA    A GLY A 1 308 ? -2.511  -0.273  -29.120 0.05 12.06 ? 307  GLY A CA    1  
ATOM   2321   C  C     A GLY A 1 308 ? -2.673  -1.476  -30.038 0.05 11.99 ? 307  GLY A C     1  
ATOM   2322   O  O     A GLY A 1 308 ? -1.771  -1.810  -30.812 0.05 11.77 ? 307  GLY A O     1  
ATOM   2323   N  N     A ALA A 1 309 ? -3.826  -2.137  -29.962 0.05 12.22 ? 308  ALA A N     1  
ATOM   2324   C  CA    A ALA A 1 309 ? -4.054  -3.332  -30.771 0.05 12.18 ? 308  ALA A CA    1  
ATOM   2325   C  C     A ALA A 1 309 ? -3.866  -3.106  -32.274 0.05 12.02 ? 308  ALA A C     1  
ATOM   2326   O  O     A ALA A 1 309 ? -3.233  -3.911  -32.954 0.05 11.87 ? 308  ALA A O     1  
ATOM   2327   C  CB    A ALA A 1 309 ? -5.435  -3.903  -30.498 0.05 12.48 ? 308  ALA A CB    1  
ATOM   2328   N  N     A GLY A 1 310 ? -4.421  -2.014  -32.794 0.05 12.09 ? 309  GLY A N     1  
ATOM   2329   C  CA    A GLY A 1 310 ? -4.344  -1.750  -34.218 0.05 12.00 ? 309  GLY A CA    1  
ATOM   2330   C  C     A GLY A 1 310 ? -2.922  -1.472  -34.660 0.05 11.72 ? 309  GLY A C     1  
ATOM   2331   O  O     A GLY A 1 310 ? -2.388  -2.143  -35.544 0.05 11.60 ? 309  GLY A O     1  
ATOM   2332   N  N     A GLY A 1 311 ? -2.305  -0.475  -34.038 0.05 11.63 ? 310  GLY A N     1  
ATOM   2333   C  CA    A GLY A 1 311 ? -0.933  -0.115  -34.356 0.05 11.38 ? 310  GLY A CA    1  
ATOM   2334   C  C     A GLY A 1 311 ? 0.004   -1.301  -34.261 0.05 11.26 ? 310  GLY A C     1  
ATOM   2335   O  O     A GLY A 1 311 ? 0.852   -1.496  -35.133 0.05 11.11 ? 310  GLY A O     1  
ATOM   2336   N  N     A SER A 1 312 ? -0.159  -2.107  -33.216 0.05 11.35 ? 311  SER A N     1  
ATOM   2337   C  CA    A SER A 1 312 ? 0.703   -3.265  -33.031 0.05 11.27 ? 311  SER A CA    1  
ATOM   2338   C  C     A SER A 1 312 ? 0.484   -4.247  -34.171 0.05 11.25 ? 311  SER A C     1  
ATOM   2339   O  O     A SER A 1 312 ? 1.441   -4.785  -34.716 0.05 11.12 ? 311  SER A O     1  
ATOM   2340   C  CB    A SER A 1 312 ? 0.437   -3.953  -31.690 0.05 11.41 ? 311  SER A CB    1  
ATOM   2341   O  OG    A SER A 1 312 ? 0.612   -3.059  -30.605 0.05 11.45 ? 311  SER A OG    1  
ATOM   2342   N  N     A GLN A 1 313 ? -0.774  -4.481  -34.533 0.05 11.41 ? 312  GLN A N     1  
ATOM   2343   C  CA    A GLN A 1 313 ? -1.057  -5.368  -35.659 0.05 11.41 ? 312  GLN A CA    1  
ATOM   2344   C  C     A GLN A 1 313 ? -0.483  -4.792  -36.948 0.05 11.32 ? 312  GLN A C     1  
ATOM   2345   O  O     A GLN A 1 313 ? 0.070   -5.524  -37.762 0.05 11.26 ? 312  GLN A O     1  
ATOM   2346   C  CB    A GLN A 1 313 ? -2.563  -5.652  -35.813 0.05 11.61 ? 312  GLN A CB    1  
ATOM   2347   C  CG    A GLN A 1 313 ? -3.282  -4.892  -36.951 0.05 11.75 ? 312  GLN A CG    1  
ATOM   2348   C  CD    A GLN A 1 313 ? -3.226  -5.587  -38.319 0.05 11.74 ? 312  GLN A CD    1  
ATOM   2349   O  OE1   A GLN A 1 313 ? -3.632  -5.013  -39.333 0.05 11.80 ? 312  GLN A OE1   1  
ATOM   2350   N  NE2   A GLN A 1 313 ? -2.736  -6.817  -38.349 0.05 11.68 ? 312  GLN A NE2   1  
ATOM   2351   N  N     A GLU A 1 314 ? -0.603  -3.475  -37.115 0.05 11.32 ? 313  GLU A N     1  
ATOM   2352   C  CA    A GLU A 1 314 ? -0.211  -2.826  -38.361 0.05 11.26 ? 313  GLU A CA    1  
ATOM   2353   C  C     A GLU A 1 314 ? 1.302   -2.824  -38.541 0.05 11.07 ? 313  GLU A C     1  
ATOM   2354   O  O     A GLU A 1 314 ? 1.802   -3.015  -39.649 0.05 11.03 ? 313  GLU A O     1  
ATOM   2355   C  CB    A GLU A 1 314 ? -0.777  -1.403  -38.420 0.05 11.34 ? 313  GLU A CB    1  
ATOM   2356   C  CG    A GLU A 1 314 ? -2.286  -1.402  -38.683 0.05 11.58 ? 313  GLU A CG    1  
ATOM   2357   C  CD    A GLU A 1 314 ? -3.036  -0.332  -37.921 0.05 11.70 ? 313  GLU A CD    1  
ATOM   2358   O  OE1   A GLU A 1 314 ? -2.421  0.694   -37.555 0.05 11.58 ? 313  GLU A OE1   1  
ATOM   2359   O  OE2   A GLU A 1 314 ? -4.251  -0.530  -37.692 0.05 11.92 ? 313  GLU A OE2   1  
ATOM   2360   N  N     A GLY A 1 315 ? 2.022   -2.612  -37.446 0.05 10.97 ? 314  GLY A N     1  
ATOM   2361   C  CA    A GLY A 1 315 ? 3.473   -2.683  -37.476 0.05 10.81 ? 314  GLY A CA    1  
ATOM   2362   C  C     A GLY A 1 315 ? 3.945   -4.056  -37.925 0.05 10.82 ? 314  GLY A C     1  
ATOM   2363   O  O     A GLY A 1 315 ? 4.778   -4.174  -38.816 0.05 10.77 ? 314  GLY A O     1  
ATOM   2364   N  N     A LEU A 1 316 ? 3.398   -5.105  -37.317 0.05 10.91 ? 315  LEU A N     1  
ATOM   2365   C  CA    A LEU A 1 316 ? 3.773   -6.462  -37.702 0.05 10.94 ? 315  LEU A CA    1  
ATOM   2366   C  C     A LEU A 1 316 ? 3.351   -6.756  -39.144 0.05 11.00 ? 315  LEU A C     1  
ATOM   2367   O  O     A LEU A 1 316 ? 4.099   -7.363  -39.899 0.05 11.00 ? 315  LEU A O     1  
ATOM   2368   C  CB    A LEU A 1 316 ? 3.132   -7.479  -36.756 0.05 11.04 ? 315  LEU A CB    1  
ATOM   2369   C  CG    A LEU A 1 316 ? 3.513   -7.343  -35.281 0.05 11.03 ? 315  LEU A CG    1  
ATOM   2370   C  CD1   A LEU A 1 316 ? 2.688   -8.311  -34.425 0.05 11.17 ? 315  LEU A CD1   1  
ATOM   2371   C  CD2   A LEU A 1 316 ? 5.007   -7.567  -35.081 0.05 10.94 ? 315  LEU A CD2   1  
ATOM   2372   N  N     A ALA A 1 317 ? 2.148   -6.324  -39.512 0.05 11.10 ? 316  ALA A N     1  
ATOM   2373   C  CA    A ALA A 1 317 ? 1.608   -6.567  -40.850 0.05 11.21 ? 316  ALA A CA    1  
ATOM   2374   C  C     A ALA A 1 317 ? 2.500   -5.997  -41.952 0.05 11.17 ? 316  ALA A C     1  
ATOM   2375   O  O     A ALA A 1 317 ? 2.542   -6.517  -43.075 0.05 11.26 ? 316  ALA A O     1  
ATOM   2376   C  CB    A ALA A 1 317 ? 0.198   -5.983  -40.965 0.05 11.35 ? 316  ALA A CB    1  
ATOM   2377   N  N     A THR A 1 318 ? 3.208   -4.923  -41.620 0.05 11.04 ? 317  THR A N     1  
ATOM   2378   C  CA    A THR A 1 318 ? 4.023   -4.198  -42.586 0.05 11.01 ? 317  THR A CA    1  
ATOM   2379   C  C     A THR A 1 318 ? 5.520   -4.405  -42.361 0.05 10.90 ? 317  THR A C     1  
ATOM   2380   O  O     A THR A 1 318 ? 6.343   -3.722  -42.979 0.05 10.87 ? 317  THR A O     1  
ATOM   2381   C  CB    A THR A 1 318 ? 3.727   -2.687  -42.534 0.05 10.97 ? 317  THR A CB    1  
ATOM   2382   O  OG1   A THR A 1 318 ? 3.881   -2.218  -41.192 0.05 10.85 ? 317  THR A OG1   1  
ATOM   2383   C  CG2   A THR A 1 318 ? 2.300   -2.401  -42.996 0.05 11.14 ? 317  THR A CG2   1  
ATOM   2384   N  N     A ALA A 1 319 ? 5.860   -5.352  -41.488 0.05 10.87 ? 318  ALA A N     1  
ATOM   2385   C  CA    A ALA A 1 319 ? 7.255   -5.657  -41.143 0.05 10.80 ? 318  ALA A CA    1  
ATOM   2386   C  C     A ALA A 1 319 ? 8.046   -4.407  -40.775 0.05 10.68 ? 318  ALA A C     1  
ATOM   2387   O  O     A ALA A 1 319 ? 9.177   -4.208  -41.229 0.05 10.66 ? 318  ALA A O     1  
ATOM   2388   C  CB    A ALA A 1 319 ? 7.955   -6.429  -42.276 0.05 10.90 ? 318  ALA A CB    1  
ATOM   2389   N  N     A THR A 1 320 ? 7.442   -3.567  -39.946 0.05 10.62 ? 319  THR A N     1  
ATOM   2390   C  CA    A THR A 1 320 ? 8.077   -2.322  -39.541 0.05 10.51 ? 319  THR A CA    1  
ATOM   2391   C  C     A THR A 1 320 ? 8.534   -2.465  -38.098 0.05 10.46 ? 319  THR A C     1  
ATOM   2392   O  O     A THR A 1 320 ? 7.704   -2.665  -37.219 0.05 10.50 ? 319  THR A O     1  
ATOM   2393   C  CB    A THR A 1 320 ? 7.090   -1.144  -39.620 0.05 10.51 ? 319  THR A CB    1  
ATOM   2394   O  OG1   A THR A 1 320 ? 6.438   -1.131  -40.897 0.05 10.60 ? 319  THR A OG1   1  
ATOM   2395   C  CG2   A THR A 1 320 ? 7.820   0.177   -39.421 0.05 10.40 ? 319  THR A CG2   1  
ATOM   2396   N  N     A PRO A 1 321 ? 9.853   -2.372  -37.847 0.05 10.41 ? 320  PRO A N     1  
ATOM   2397   C  CA    A PRO A 1 321 ? 10.326  -2.435  -36.463 0.05 10.39 ? 320  PRO A CA    1  
ATOM   2398   C  C     A PRO A 1 321 ? 9.696   -1.309  -35.651 0.05 10.35 ? 320  PRO A C     1  
ATOM   2399   O  O     A PRO A 1 321 ? 9.398   -0.242  -36.206 0.05 10.30 ? 320  PRO A O     1  
ATOM   2400   C  CB    A PRO A 1 321 ? 11.839  -2.217  -36.585 0.05 10.36 ? 320  PRO A CB    1  
ATOM   2401   C  CG    A PRO A 1 321 ? 12.176  -2.495  -37.988 0.05 10.39 ? 320  PRO A CG    1  
ATOM   2402   C  CD    A PRO A 1 321 ? 10.951  -2.173  -38.804 0.05 10.40 ? 320  PRO A CD    1  
ATOM   2403   N  N     A MET A 1 322 ? 9.491   -1.541  -34.359 0.05 10.40 ? 321  MET A N     1  
ATOM   2404   C  CA    A MET A 1 322 ? 8.775   -0.575  -33.539 0.05 10.41 ? 321  MET A CA    1  
ATOM   2405   C  C     A MET A 1 322 ? 9.522   -0.138  -32.285 0.05 10.42 ? 321  MET A C     1  
ATOM   2406   O  O     A MET A 1 322 ? 10.251  -0.917  -31.676 0.05 10.48 ? 321  MET A O     1  
ATOM   2407   C  CB    A MET A 1 322 ? 7.395   -1.129  -33.146 0.05 10.53 ? 321  MET A CB    1  
ATOM   2408   C  CG    A MET A 1 322 ? 6.369   -1.065  -34.272 0.05 10.55 ? 321  MET A CG    1  
ATOM   2409   S  SD    A MET A 1 322 ? 5.000   -2.243  -34.077 0.05 10.72 ? 321  MET A SD    1  
ATOM   2410   C  CE    A MET A 1 322 ? 5.758   -3.758  -34.659 0.05 10.71 ? 321  MET A CE    1  
ATOM   2411   N  N     A ILE A 1 323 ? 9.320   1.123   -31.909 0.05 10.39 ? 322  ILE A N     1  
ATOM   2412   C  CA    A ILE A 1 323 ? 9.632   1.571   -30.562 0.05 10.45 ? 322  ILE A CA    1  
ATOM   2413   C  C     A ILE A 1 323 ? 8.294   1.701   -29.869 0.05 10.58 ? 322  ILE A C     1  
ATOM   2414   O  O     A ILE A 1 323 ? 7.467   2.524   -30.250 0.05 10.58 ? 322  ILE A O     1  
ATOM   2415   C  CB    A ILE A 1 323 ? 10.377  2.920   -30.560 0.05 10.35 ? 322  ILE A CB    1  
ATOM   2416   C  CG1   A ILE A 1 323 ? 11.657  2.804   -31.383 0.05 10.24 ? 322  ILE A CG1   1  
ATOM   2417   C  CG2   A ILE A 1 323 ? 10.700  3.357   -29.136 0.05 10.44 ? 322  ILE A CG2   1  
ATOM   2418   C  CD1   A ILE A 1 323 ? 12.457  4.092   -31.454 0.05 10.14 ? 322  ILE A CD1   1  
ATOM   2419   N  N     A ALA A 1 324 ? 8.066   0.836   -28.890 0.05 10.74 ? 323  ALA A N     1  
ATOM   2420   C  CA    A ALA A 1 324 ? 6.800   0.790   -28.184 0.05 10.91 ? 323  ALA A CA    1  
ATOM   2421   C  C     A ALA A 1 324 ? 6.931   1.614   -26.922 0.05 11.02 ? 323  ALA A C     1  
ATOM   2422   O  O     A ALA A 1 324 ? 7.735   1.295   -26.052 0.05 11.08 ? 323  ALA A O     1  
ATOM   2423   C  CB    A ALA A 1 324 ? 6.434   -0.658  -27.840 0.05 11.05 ? 323  ALA A CB    1  
ATOM   2424   N  N     A VAL A 1 325 ? 6.149   2.682   -26.842 0.05 11.08 ? 324  VAL A N     1  
ATOM   2425   C  CA    A VAL A 1 325 ? 6.187   3.577   -25.701 0.05 11.21 ? 324  VAL A CA    1  
ATOM   2426   C  C     A VAL A 1 325 ? 4.791   3.572   -25.078 0.05 11.46 ? 324  VAL A C     1  
ATOM   2427   O  O     A VAL A 1 325 ? 3.964   4.439   -25.359 0.05 11.50 ? 324  VAL A O     1  
ATOM   2428   C  CB    A VAL A 1 325 ? 6.631   5.003   -26.119 0.05 11.06 ? 324  VAL A CB    1  
ATOM   2429   C  CG1   A VAL A 1 325 ? 6.889   5.863   -24.891 0.05 11.19 ? 324  VAL A CG1   1  
ATOM   2430   C  CG2   A VAL A 1 325 ? 7.893   4.926   -26.980 0.05 10.82 ? 324  VAL A CG2   1  
ATOM   2431   N  N     A PRO A 1 326 ? 4.519   2.564   -24.238 0.05 11.66 ? 325  PRO A N     1  
ATOM   2432   C  CA    A PRO A 1 326 ? 3.189   2.363   -23.660 0.05 11.93 ? 325  PRO A CA    1  
ATOM   2433   C  C     A PRO A 1 326 ? 2.755   3.503   -22.758 0.05 12.14 ? 325  PRO A C     1  
ATOM   2434   O  O     A PRO A 1 326 ? 3.578   4.114   -22.083 0.05 12.17 ? 325  PRO A O     1  
ATOM   2435   C  CB    A PRO A 1 326 ? 3.357   1.083   -22.832 0.05 12.09 ? 325  PRO A CB    1  
ATOM   2436   C  CG    A PRO A 1 326 ? 4.810   1.035   -22.513 0.05 11.99 ? 325  PRO A CG    1  
ATOM   2437   C  CD    A PRO A 1 326 ? 5.480   1.560   -23.754 0.05 11.67 ? 325  PRO A CD    1  
ATOM   2438   N  N     A GLN A 1 327 ? 1.451   3.756   -22.739 0.05 12.33 ? 326  GLN A N     1  
ATOM   2439   C  CA    A GLN A 1 327 ? 0.895   4.903   -22.040 0.05 12.57 ? 326  GLN A CA    1  
ATOM   2440   C  C     A GLN A 1 327 ? -0.284  4.540   -21.145 0.05 12.97 ? 326  GLN A C     1  
ATOM   2441   O  O     A GLN A 1 327 ? -0.512  5.208   -20.136 0.05 13.24 ? 326  GLN A O     1  
ATOM   2442   C  CB    A GLN A 1 327 ? 0.444   5.950   -23.060 0.05 12.49 ? 326  GLN A CB    1  
ATOM   2443   C  CG    A GLN A 1 327 ? 1.581   6.578   -23.864 0.05 12.13 ? 326  GLN A CG    1  
ATOM   2444   C  CD    A GLN A 1 327 ? 1.921   7.967   -23.380 0.05 12.14 ? 326  GLN A CD    1  
ATOM   2445   O  OE1   A GLN A 1 327 ? 1.165   8.909   -23.598 0.05 12.24 ? 326  GLN A OE1   1  
ATOM   2446   N  NE2   A GLN A 1 327 ? 3.058   8.102   -22.714 0.05 12.06 ? 326  GLN A NE2   1  
ATOM   2447   N  N     A ALA A 1 328 ? -1.028  3.493   -21.512 0.05 13.03 ? 327  ALA A N     1  
ATOM   2448   C  CA    A ALA A 1 328 ? -2.293  3.171   -20.836 0.05 13.42 ? 327  ALA A CA    1  
ATOM   2449   C  C     A ALA A 1 328 ? -2.885  1.782   -21.157 0.05 13.48 ? 327  ALA A C     1  
ATOM   2450   O  O     A ALA A 1 328 ? -2.505  1.134   -22.132 0.05 13.21 ? 327  ALA A O     1  
ATOM   2451   C  CB    A ALA A 1 328 ? -3.318  4.252   -21.130 0.05 13.54 ? 327  ALA A CB    1  
ATOM   2452   N  N     A VAL A 1 329 ? -3.822  1.350   -20.309 0.05 13.87 ? 328  VAL A N     1  
ATOM   2453   C  CA    A VAL A 1 329 ? -4.532  0.064   -20.401 0.05 14.00 ? 328  VAL A CA    1  
ATOM   2454   C  C     A VAL A 1 329 ? -4.477  -0.815  -21.658 0.05 13.71 ? 328  VAL A C     1  
ATOM   2455   O  O     A VAL A 1 329 ? -4.694  -2.020  -21.572 0.05 13.74 ? 328  VAL A O     1  
ATOM   2456   N  N     A ASP A 1 330 ? -4.201  -0.228  -22.822 0.05 13.46 ? 329  ASP A N     1  
ATOM   2457   C  CA    A ASP A 1 330 ? -4.183  -1.002  -24.063 0.05 13.22 ? 329  ASP A CA    1  
ATOM   2458   C  C     A ASP A 1 330 ? -2.808  -1.536  -24.461 0.05 12.83 ? 329  ASP A C     1  
ATOM   2459   O  O     A ASP A 1 330 ? -2.643  -2.017  -25.591 0.05 12.61 ? 329  ASP A O     1  
ATOM   2460   C  CB    A ASP A 1 330 ? -4.655  -0.132  -25.233 0.05 13.22 ? 329  ASP A CB    1  
ATOM   2461   C  CG    A ASP A 1 330 ? -5.684  0.888   -24.833 0.05 13.45 ? 329  ASP A CG    1  
ATOM   2462   O  OD1   A ASP A 1 330 ? -5.294  1.960   -24.319 0.05 13.54 ? 329  ASP A OD1   1  
ATOM   2463   O  OD2   A ASP A 1 330 ? -6.888  0.631   -25.069 0.05 13.58 ? 329  ASP A OD2   1  
ATOM   2464   N  N     A GLN A 1 331 ? -1.811  -1.421  -23.583 0.05 12.78 ? 330  GLN A N     1  
ATOM   2465   C  CA    A GLN A 1 331 ? -0.455  -1.235  -24.112 0.05 12.44 ? 330  GLN A CA    1  
ATOM   2466   C  C     A GLN A 1 331 ? 0.732   -2.031  -23.531 0.05 12.39 ? 330  GLN A C     1  
ATOM   2467   O  O     A GLN A 1 331 ? 1.573   -2.520  -24.289 0.05 12.13 ? 330  GLN A O     1  
ATOM   2468   C  CB    A GLN A 1 331 ? -0.143  0.271   -24.117 0.05 12.36 ? 330  GLN A CB    1  
ATOM   2469   C  CG    A GLN A 1 331 ? -1.128  1.076   -24.985 0.05 12.40 ? 330  GLN A CG    1  
ATOM   2470   C  CD    A GLN A 1 331 ? -1.084  2.580   -24.781 0.05 12.48 ? 330  GLN A CD    1  
ATOM   2471   O  OE1   A GLN A 1 331 ? -0.034  3.172   -24.536 0.05 12.43 ? 330  GLN A OE1   1  
ATOM   2472   N  NE2   A GLN A 1 331 ? -2.240  3.211   -24.912 0.05 12.64 ? 330  GLN A NE2   1  
ATOM   2473   N  N     A PHE A 1 332 ? 0.811   -2.120  -22.209 0.05 12.66 ? 331  PHE A N     1  
ATOM   2474   C  CA    A PHE A 1 332 ? 1.941   -2.738  -21.505 0.05 12.69 ? 331  PHE A CA    1  
ATOM   2475   C  C     A PHE A 1 332 ? 2.316   -4.122  -22.049 0.05 12.57 ? 331  PHE A C     1  
ATOM   2476   O  O     A PHE A 1 332 ? 3.411   -4.322  -22.580 0.05 12.35 ? 331  PHE A O     1  
ATOM   2477   C  CB    A PHE A 1 332 ? 1.609   -2.815  -20.010 0.05 13.08 ? 331  PHE A CB    1  
ATOM   2478   C  CG    A PHE A 1 332 ? 0.704   -1.700  -19.551 0.05 13.26 ? 331  PHE A CG    1  
ATOM   2479   C  CD1   A PHE A 1 332 ? 1.231   -0.455  -19.238 0.05 13.10 ? 331  PHE A CD1   1  
ATOM   2480   C  CD2   A PHE A 1 332 ? -0.678  -1.882  -19.478 0.05 13.60 ? 331  PHE A CD2   1  
ATOM   2481   C  CE1   A PHE A 1 332 ? 0.405   0.584   -18.846 0.05 13.27 ? 331  PHE A CE1   1  
ATOM   2482   C  CE2   A PHE A 1 332 ? -1.508  -0.849  -19.092 0.05 13.80 ? 331  PHE A CE2   1  
ATOM   2483   C  CZ    A PHE A 1 332 ? -0.962  0.389   -18.766 0.05 13.63 ? 331  PHE A CZ    1  
ATOM   2484   N  N     A GLY A 1 333 ? 1.397   -5.069  -21.913 0.05 12.73 ? 332  GLY A N     1  
ATOM   2485   C  CA    A GLY A 1 333 ? 1.572   -6.398  -22.466 0.05 12.64 ? 332  GLY A CA    1  
ATOM   2486   C  C     A GLY A 1 333 ? 1.851   -6.433  -23.962 0.05 12.32 ? 332  GLY A C     1  
ATOM   2487   O  O     A GLY A 1 333 ? 2.749   -7.150  -24.405 0.05 12.19 ? 332  GLY A O     1  
ATOM   2488   N  N     A ASN A 1 334 ? 1.086   -5.674  -24.745 0.05 12.24 ? 333  ASN A N     1  
ATOM   2489   C  CA    A ASN A 1 334 ? 1.352   -5.588  -26.181 0.05 11.97 ? 333  ASN A CA    1  
ATOM   2490   C  C     A ASN A 1 334 ? 2.780   -5.145  -26.428 0.05 11.76 ? 333  ASN A C     1  
ATOM   2491   O  O     A ASN A 1 334 ? 3.480   -5.713  -27.254 0.05 11.61 ? 333  ASN A O     1  
ATOM   2492   C  CB    A ASN A 1 334 ? 0.398   -4.619  -26.878 0.05 11.94 ? 333  ASN A CB    1  
ATOM   2493   C  CG    A ASN A 1 334 ? -0.930  -5.256  -27.233 0.05 12.10 ? 333  ASN A CG    1  
ATOM   2494   O  OD1   A ASN A 1 334 ? -1.101  -6.473  -27.126 0.05 12.14 ? 333  ASN A OD1   1  
ATOM   2495   N  ND2   A ASN A 1 334 ? -1.876  -4.433  -27.681 0.05 12.20 ? 333  ASN A ND2   1  
ATOM   2496   N  N     A ALA A 1 335 ? 3.217   -4.129  -25.695 0.05 11.78 ? 334  ALA A N     1  
ATOM   2497   C  CA    A ALA A 1 335 ? 4.597   -3.677  -25.829 0.05 11.61 ? 334  ALA A CA    1  
ATOM   2498   C  C     A ALA A 1 335 ? 5.573   -4.767  -25.391 0.05 11.66 ? 334  ALA A C     1  
ATOM   2499   O  O     A ALA A 1 335 ? 6.603   -4.967  -26.019 0.05 11.51 ? 334  ALA A O     1  
ATOM   2500   C  CB    A ALA A 1 335 ? 4.821   -2.393  -25.032 0.05 11.66 ? 334  ALA A CB    1  
ATOM   2501   N  N     A ASP A 1 336 ? 5.244   -5.473  -24.312 0.05 11.90 ? 335  ASP A N     1  
ATOM   2502   C  CA    A ASP A 1 336 ? 6.097   -6.567  -23.852 0.05 12.00 ? 335  ASP A CA    1  
ATOM   2503   C  C     A ASP A 1 336 ? 6.144   -7.698  -24.873 0.05 11.88 ? 335  ASP A C     1  
ATOM   2504   O  O     A ASP A 1 336 ? 7.166   -8.346  -25.042 0.05 11.85 ? 335  ASP A O     1  
ATOM   2505   C  CB    A ASP A 1 336 ? 5.633   -7.117  -22.501 0.05 12.32 ? 335  ASP A CB    1  
ATOM   2506   C  CG    A ASP A 1 336 ? 6.101   -6.274  -21.332 0.05 12.48 ? 335  ASP A CG    1  
ATOM   2507   O  OD1   A ASP A 1 336 ? 7.213   -5.717  -21.407 0.05 12.35 ? 335  ASP A OD1   1  
ATOM   2508   O  OD2   A ASP A 1 336 ? 5.351   -6.172  -20.344 0.05 12.76 ? 335  ASP A OD2   1  
ATOM   2509   N  N     A MET A 1 337 ? 5.034   -7.948  -25.553 0.05 11.86 ? 336  MET A N     1  
ATOM   2510   C  CA    A MET A 1 337 ? 5.041   -9.019  -26.538 0.05 11.77 ? 336  MET A CA    1  
ATOM   2511   C  C     A MET A 1 337 ? 5.821   -8.638  -27.795 0.05 11.53 ? 336  MET A C     1  
ATOM   2512   O  O     A MET A 1 337 ? 6.575   -9.454  -28.320 0.05 11.49 ? 336  MET A O     1  
ATOM   2513   C  CB    A MET A 1 337 ? 3.628   -9.510  -26.851 0.05 11.85 ? 336  MET A CB    1  
ATOM   2514   C  CG    A MET A 1 337 ? 3.053   -10.346 -25.716 0.05 12.11 ? 336  MET A CG    1  
ATOM   2515   S  SD    A MET A 1 337 ? 1.440   -10.996 -26.128 0.05 12.19 ? 336  MET A SD    1  
ATOM   2516   C  CE    A MET A 1 337 ? 0.489   -9.468  -26.121 0.05 12.23 ? 336  MET A CE    1  
ATOM   2517   N  N     A LEU A 1 338 ? 5.657   -7.398  -28.253 0.05 11.41 ? 337  LEU A N     1  
ATOM   2518   C  CA    A LEU A 1 338 ? 6.423   -6.913  -29.407 0.05 11.20 ? 337  LEU A CA    1  
ATOM   2519   C  C     A LEU A 1 338 ? 7.897   -6.998  -29.076 0.05 11.18 ? 337  LEU A C     1  
ATOM   2520   O  O     A LEU A 1 338 ? 8.726   -7.429  -29.888 0.05 11.10 ? 337  LEU A O     1  
ATOM   2521   C  CB    A LEU A 1 338 ? 6.052   -5.469  -29.717 0.05 11.10 ? 337  LEU A CB    1  
ATOM   2522   C  CG    A LEU A 1 338 ? 4.658   -5.294  -30.312 0.05 11.13 ? 337  LEU A CG    1  
ATOM   2523   C  CD1   A LEU A 1 338 ? 4.309   -3.828  -30.385 0.05 11.08 ? 337  LEU A CD1   1  
ATOM   2524   C  CD2   A LEU A 1 338 ? 4.606   -5.928  -31.699 0.05 11.05 ? 337  LEU A CD2   1  
ATOM   2525   N  N     A GLN A 1 339 ? 8.198   -6.554  -27.865 0.05 11.28 ? 338  GLN A N     1  
ATOM   2526   C  CA    A GLN A 1 339 ? 9.499   -6.718  -27.249 0.05 11.34 ? 338  GLN A CA    1  
ATOM   2527   C  C     A GLN A 1 339 ? 10.006  -8.153  -27.400 0.05 11.42 ? 338  GLN A C     1  
ATOM   2528   O  O     A GLN A 1 339 ? 11.042  -8.411  -28.022 0.05 11.36 ? 338  GLN A O     1  
ATOM   2529   C  CB    A GLN A 1 339 ? 9.352   -6.401  -25.760 0.05 11.52 ? 338  GLN A CB    1  
ATOM   2530   C  CG    A GLN A 1 339 ? 10.546  -6.763  -24.945 0.05 11.64 ? 338  GLN A CG    1  
ATOM   2531   C  CD    A GLN A 1 339 ? 11.691  -5.867  -25.291 0.05 11.49 ? 338  GLN A CD    1  
ATOM   2532   O  OE1   A GLN A 1 339 ? 11.869  -4.810  -24.689 0.05 11.51 ? 338  GLN A OE1   1  
ATOM   2533   N  NE2   A GLN A 1 339 ? 12.459  -6.264  -26.286 0.05 11.34 ? 338  GLN A NE2   1  
ATOM   2534   N  N     A GLY A 1 340 ? 9.247   -9.091  -26.845 0.05 11.59 ? 339  GLY A N     1  
ATOM   2535   C  CA    A GLY A 1 340 ? 9.650   -10.488 -26.804 0.05 11.71 ? 339  GLY A CA    1  
ATOM   2536   C  C     A GLY A 1 340 ? 9.777   -11.167 -28.154 0.05 11.59 ? 339  GLY A C     1  
ATOM   2537   O  O     A GLY A 1 340 ? 10.457  -12.195 -28.279 0.05 11.69 ? 339  GLY A O     1  
ATOM   2538   N  N     A LEU A 1 341 ? 9.121   -10.604 -29.164 0.05 11.42 ? 340  LEU A N     1  
ATOM   2539   C  CA    A LEU A 1 341 ? 9.231   -11.117 -30.526 0.05 11.34 ? 340  LEU A CA    1  
ATOM   2540   C  C     A LEU A 1 341 ? 10.582  -10.735 -31.121 0.05 11.26 ? 340  LEU A C     1  
ATOM   2541   O  O     A LEU A 1 341 ? 10.971  -11.232 -32.176 0.05 11.23 ? 340  LEU A O     1  
ATOM   2542   C  CB    A LEU A 1 341 ? 8.095   -10.576 -31.402 0.05 11.23 ? 340  LEU A CB    1  
ATOM   2543   C  CG    A LEU A 1 341 ? 6.698   -11.161 -31.192 0.05 11.33 ? 340  LEU A CG    1  
ATOM   2544   C  CD1   A LEU A 1 341 ? 5.625   -10.171 -31.626 0.05 11.25 ? 340  LEU A CD1   1  
ATOM   2545   C  CD2   A LEU A 1 341 ? 6.568   -12.463 -31.972 0.05 11.41 ? 340  LEU A CD2   1  
ATOM   2546   N  N     A GLY A 1 342 ? 11.290  -9.842  -30.432 0.05 11.25 ? 341  GLY A N     1  
ATOM   2547   C  CA    A GLY A 1 342 ? 12.584  -9.375  -30.890 0.05 11.19 ? 341  GLY A CA    1  
ATOM   2548   C  C     A GLY A 1 342 ? 12.479  -8.352  -32.006 0.05 11.01 ? 341  GLY A C     1  
ATOM   2549   O  O     A GLY A 1 342 ? 13.437  -8.142  -32.745 0.05 10.98 ? 341  GLY A O     1  
ATOM   2550   N  N     A VAL A 1 343 ? 11.319  -7.711  -32.129 0.05 10.93 ? 342  VAL A N     1  
ATOM   2551   C  CA    A VAL A 1 343 ? 11.088  -6.803  -33.245 0.05 10.79 ? 342  VAL A CA    1  
ATOM   2552   C  C     A VAL A 1 343 ? 10.829  -5.379  -32.783 0.05 10.70 ? 342  VAL A C     1  
ATOM   2553   O  O     A VAL A 1 343 ? 10.424  -4.530  -33.565 0.05 10.60 ? 342  VAL A O     1  
ATOM   2554   C  CB    A VAL A 1 343 ? 9.903   -7.277  -34.110 0.05 10.79 ? 342  VAL A CB    1  
ATOM   2555   C  CG1   A VAL A 1 343 ? 10.157  -8.701  -34.586 0.05 10.88 ? 342  VAL A CG1   1  
ATOM   2556   C  CG2   A VAL A 1 343 ? 8.606   -7.217  -33.319 0.05 10.84 ? 342  VAL A CG2   1  
ATOM   2557   N  N     A ALA A 1 344 ? 11.064  -5.126  -31.504 0.05 10.76 ? 343  ALA A N     1  
ATOM   2558   C  CA    A ALA A 1 344 ? 10.725  -3.836  -30.931 0.05 10.71 ? 343  ALA A CA    1  
ATOM   2559   C  C     A ALA A 1 344 ? 11.508  -3.581  -29.662 0.05 10.81 ? 343  ALA A C     1  
ATOM   2560   O  O     A ALA A 1 344 ? 12.083  -4.499  -29.080 0.05 10.93 ? 343  ALA A O     1  
ATOM   2561   C  CB    A ALA A 1 344 ? 9.236   -3.760  -30.644 0.05 10.77 ? 343  ALA A CB    1  
ATOM   2562   N  N     A ARG A 1 345 ? 11.508  -2.321  -29.248 0.05 10.76 ? 344  ARG A N     1  
ATOM   2563   C  CA    A ARG A 1 345 ? 12.068  -1.903  -27.974 0.05 10.89 ? 344  ARG A CA    1  
ATOM   2564   C  C     A ARG A 1 345 ? 10.960  -1.201  -27.196 0.05 10.94 ? 344  ARG A C     1  
ATOM   2565   O  O     A ARG A 1 345 ? 10.270  -0.325  -27.733 0.05 10.83 ? 344  ARG A O     1  
ATOM   2566   C  CB    A ARG A 1 345 ? 13.246  -0.946  -28.195 0.05 10.84 ? 344  ARG A CB    1  
ATOM   2567   C  CG    A ARG A 1 345 ? 13.834  -0.355  -26.923 0.05 11.03 ? 344  ARG A CG    1  
ATOM   2568   C  CD    A ARG A 1 345 ? 14.922  -1.235  -26.319 0.05 11.06 ? 344  ARG A CD    1  
ATOM   2569   N  NE    A ARG A 1 345 ? 16.261  -0.810  -26.724 0.05 10.96 ? 344  ARG A NE    1  
ATOM   2570   N  N     A LYS A 1 346 ? 10.779  -1.593  -25.940 0.05 11.14 ? 345  LYS A N     1  
ATOM   2571   C  CA    A LYS A 1 346 ? 9.823   -0.932  -25.058 0.05 11.26 ? 345  LYS A CA    1  
ATOM   2572   C  C     A LYS A 1 346 ? 10.493  0.222   -24.325 0.05 11.27 ? 345  LYS A C     1  
ATOM   2573   O  O     A LYS A 1 346 ? 11.575  0.057   -23.772 0.05 11.33 ? 345  LYS A O     1  
ATOM   2574   C  CB    A LYS A 1 346 ? 9.265   -1.938  -24.041 0.05 11.52 ? 345  LYS A CB    1  
ATOM   2575   C  CG    A LYS A 1 346 ? 8.503   -1.319  -22.870 0.05 11.72 ? 345  LYS A CG    1  
ATOM   2576   C  CD    A LYS A 1 346 ? 8.329   -2.346  -21.744 0.05 12.01 ? 345  LYS A CD    1  
ATOM   2577   C  CE    A LYS A 1 346 ? 7.322   -1.886  -20.693 0.05 12.25 ? 345  LYS A CE    1  
ATOM   2578   N  NZ    A LYS A 1 346 ? 7.064   -2.950  -19.684 0.05 12.57 ? 345  LYS A NZ    1  
ATOM   2579   N  N     A LEU A 1 347 ? 9.856   1.391   -24.334 0.05 11.24 ? 346  LEU A N     1  
ATOM   2580   C  CA    A LEU A 1 347 ? 10.349  2.551   -23.597 0.05 11.28 ? 346  LEU A CA    1  
ATOM   2581   C  C     A LEU A 1 347 ? 9.268   3.113   -22.695 0.05 11.48 ? 346  LEU A C     1  
ATOM   2582   O  O     A LEU A 1 347 ? 8.119   3.227   -23.108 0.05 11.49 ? 346  LEU A O     1  
ATOM   2583   C  CB    A LEU A 1 347 ? 10.780  3.660   -24.560 0.05 11.03 ? 346  LEU A CB    1  
ATOM   2584   C  CG    A LEU A 1 347 ? 12.196  3.649   -25.117 0.05 10.88 ? 346  LEU A CG    1  
ATOM   2585   C  CD1   A LEU A 1 347 ? 12.397  4.831   -26.068 0.05 10.66 ? 346  LEU A CD1   1  
ATOM   2586   C  CD2   A LEU A 1 347 ? 13.181  3.701   -23.974 0.05 11.02 ? 346  LEU A CD2   1  
ATOM   2587   N  N     A ALA A 1 348 ? 9.640   3.493   -21.475 0.05 11.68 ? 347  ALA A N     1  
ATOM   2588   C  CA    A ALA A 1 348 ? 8.749   4.297   -20.640 0.05 11.88 ? 347  ALA A CA    1  
ATOM   2589   C  C     A ALA A 1 348 ? 8.752   5.725   -21.182 0.05 11.71 ? 347  ALA A C     1  
ATOM   2590   O  O     A ALA A 1 348 ? 9.805   6.236   -21.559 0.05 11.52 ? 347  ALA A O     1  
ATOM   2591   C  CB    A ALA A 1 348 ? 9.211   4.284   -19.186 0.05 12.17 ? 347  ALA A CB    1  
ATOM   2592   N  N     A THR A 1 349 ? 7.581   6.359   -21.221 0.05 11.79 ? 348  THR A N     1  
ATOM   2593   C  CA    A THR A 1 349 ? 7.455   7.718   -21.752 0.05 11.65 ? 348  THR A CA    1  
ATOM   2594   C  C     A THR A 1 349 ? 8.526   8.659   -21.206 0.05 11.62 ? 348  THR A C     1  
ATOM   2595   O  O     A THR A 1 349 ? 9.257   9.278   -21.964 0.05 11.38 ? 348  THR A O     1  
ATOM   2596   C  CB    A THR A 1 349 ? 6.092   8.343   -21.415 0.05 11.85 ? 348  THR A CB    1  
ATOM   2597   O  OG1   A THR A 1 349 ? 5.031   7.509   -21.900 0.05 11.87 ? 348  THR A OG1   1  
ATOM   2598   C  CG2   A THR A 1 349 ? 5.989   9.732   -22.034 0.05 11.73 ? 348  THR A CG2   1  
ATOM   2599   N  N     A GLU A 1 350 ? 8.619   8.736   -19.882 0.05 11.89 ? 349  GLU A N     1  
ATOM   2600   C  CA    A GLU A 1 350 ? 9.557   9.640   -19.226 0.05 11.92 ? 349  GLU A CA    1  
ATOM   2601   O  O     A GLU A 1 350 ? 14.170  11.009  -16.079 0.05 12.35 ? 349  GLU A O     1  
ATOM   2602   C  CB    A GLU A 1 350 ? 9.600   9.367   -17.723 0.05 12.27 ? 349  GLU A CB    1  
ATOM   2603   N  N     A GLU A 1 351 ? 11.910  7.952   -20.093 0.05 11.64 ? 350  GLU A N     1  
ATOM   2604   C  CA    A GLU A 1 351 ? 13.337  7.918   -20.343 0.05 11.53 ? 350  GLU A CA    1  
ATOM   2605   C  C     A GLU A 1 351 ? 13.570  8.091   -21.827 0.05 11.20 ? 350  GLU A C     1  
ATOM   2606   O  O     A GLU A 1 351 ? 14.707  8.099   -22.293 0.05 11.09 ? 350  GLU A O     1  
ATOM   2607   C  CB    A GLU A 1 351 ? 13.907  6.574   -19.922 0.05 11.69 ? 350  GLU A CB    1  
ATOM   2608   C  CG    A GLU A 1 351 ? 13.361  6.046   -18.622 0.05 12.05 ? 350  GLU A CG    1  
ATOM   2609   C  CD    A GLU A 1 351 ? 13.627  4.570   -18.487 0.05 12.21 ? 350  GLU A CD    1  
ATOM   2610   O  OE1   A GLU A 1 351 ? 14.449  4.048   -19.274 0.05 12.05 ? 350  GLU A OE1   1  
ATOM   2611   O  OE2   A GLU A 1 351 ? 13.009  3.928   -17.626 0.05 12.52 ? 350  GLU A OE2   1  
ATOM   2612   N  N     A ALA A 1 352 ? 12.484  8.203   -22.575 0.05 11.08 ? 351  ALA A N     1  
ATOM   2613   C  CA    A ALA A 1 352 ? 12.587  8.364   -24.018 0.05 10.81 ? 351  ALA A CA    1  
ATOM   2614   C  C     A ALA A 1 352 ? 13.240  9.691   -24.345 0.05 10.66 ? 351  ALA A C     1  
ATOM   2615   O  O     A ALA A 1 352 ? 12.578  10.616  -24.785 0.05 10.58 ? 351  ALA A O     1  
ATOM   2616   C  CB    A ALA A 1 352 ? 11.208  8.273   -24.671 0.05 10.77 ? 351  ALA A CB    1  
ATOM   2617   N  N     A THR A 1 353 ? 14.544  9.792   -24.132 0.05 10.64 ? 352  THR A N     1  
ATOM   2618   C  CA    A THR A 1 353 ? 15.225  11.017  -24.496 0.05 10.48 ? 352  THR A CA    1  
ATOM   2619   C  C     A THR A 1 353 ? 15.510  11.029  -25.983 0.05 10.26 ? 352  THR A C     1  
ATOM   2620   O  O     A THR A 1 353 ? 15.414  10.003  -26.654 0.05 10.24 ? 352  THR A O     1  
ATOM   2621   C  CB    A THR A 1 353 ? 16.522  11.202  -23.727 0.05 10.57 ? 352  THR A CB    1  
ATOM   2622   O  OG1   A THR A 1 353 ? 17.455  10.190  -24.115 0.05 10.48 ? 352  THR A OG1   1  
ATOM   2623   C  CG2   A THR A 1 353 ? 16.254  11.130  -22.241 0.05 10.85 ? 352  THR A CG2   1  
ATOM   2624   N  N     A ALA A 1 354 ? 15.855  12.198  -26.504 0.05 10.12 ? 353  ALA A N     1  
ATOM   2625   C  CA    A ALA A 1 354 ? 16.126  12.313  -27.926 0.05 9.94  ? 353  ALA A CA    1  
ATOM   2626   C  C     A ALA A 1 354 ? 17.267  11.371  -28.291 0.05 9.95  ? 353  ALA A C     1  
ATOM   2627   O  O     A ALA A 1 354 ? 17.270  10.751  -29.353 0.05 9.88  ? 353  ALA A O     1  
ATOM   2628   C  CB    A ALA A 1 354 ? 16.488  13.753  -28.274 0.05 9.83  ? 353  ALA A CB    1  
ATOM   2629   N  N     A ASP A 1 355 ? 18.230  11.265  -27.387 0.05 10.07 ? 354  ASP A N     1  
ATOM   2630   C  CA    A ASP A 1 355 ? 19.401  10.442  -27.617 0.05 10.13 ? 354  ASP A CA    1  
ATOM   2631   C  C     A ASP A 1 355 ? 19.042  8.960   -27.529 0.05 10.21 ? 354  ASP A C     1  
ATOM   2632   O  O     A ASP A 1 355 ? 19.528  8.160   -28.315 0.05 10.19 ? 354  ASP A O     1  
ATOM   2633   C  CB    A ASP A 1 355 ? 20.498  10.783  -26.604 0.05 10.29 ? 354  ASP A CB    1  
ATOM   2634   N  N     A LEU A 1 356 ? 18.199  8.601   -26.567 0.05 10.34 ? 355  LEU A N     1  
ATOM   2635   C  CA    A LEU A 1 356 ? 17.762  7.210   -26.436 0.05 10.43 ? 355  LEU A CA    1  
ATOM   2636   C  C     A LEU A 1 356 ? 16.802  6.822   -27.569 0.05 10.30 ? 355  LEU A C     1  
ATOM   2637   O  O     A LEU A 1 356 ? 16.903  5.730   -28.125 0.05 10.32 ? 355  LEU A O     1  
ATOM   2638   C  CB    A LEU A 1 356 ? 17.114  6.971   -25.066 0.05 10.63 ? 355  LEU A CB    1  
ATOM   2639   C  CG    A LEU A 1 356 ? 16.695  5.529   -24.766 0.05 10.78 ? 355  LEU A CG    1  
ATOM   2640   C  CD1   A LEU A 1 356 ? 17.855  4.562   -24.992 0.05 10.85 ? 355  LEU A CD1   1  
ATOM   2641   C  CD2   A LEU A 1 356 ? 16.204  5.434   -23.330 0.05 11.01 ? 355  LEU A CD2   1  
ATOM   2642   N  N     A LEU A 1 357 ? 15.876  7.714   -27.908 0.05 10.20 ? 356  LEU A N     1  
ATOM   2643   C  CA    A LEU A 1 357 ? 15.001  7.465   -29.053 0.05 10.10 ? 356  LEU A CA    1  
ATOM   2644   C  C     A LEU A 1 357 ? 15.844  7.290   -30.296 0.05 10.00 ? 356  LEU A C     1  
ATOM   2645   O  O     A LEU A 1 357 ? 15.668  6.324   -31.030 0.05 10.01 ? 356  LEU A O     1  
ATOM   2646   C  CB    A LEU A 1 357 ? 13.995  8.596   -29.265 0.05 10.04 ? 356  LEU A CB    1  
ATOM   2647   C  CG    A LEU A 1 357 ? 12.662  8.495   -28.528 0.05 10.19 ? 356  LEU A CG    1  
ATOM   2648   C  CD1   A LEU A 1 357 ? 11.741  9.626   -28.950 0.05 10.17 ? 356  LEU A CD1   1  
ATOM   2649   C  CD2   A LEU A 1 357 ? 11.993  7.147   -28.799 0.05 10.24 ? 356  LEU A CD2   1  
ATOM   2650   N  N     A ARG A 1 358 ? 16.772  8.216   -30.537 0.05 9.93  ? 357  ARG A N     1  
ATOM   2651   C  CA    A ARG A 1 358 ? 17.619  8.086   -31.717 0.05 9.87  ? 357  ARG A CA    1  
ATOM   2652   C  C     A ARG A 1 358 ? 18.457  6.816   -31.672 0.05 9.98  ? 357  ARG A C     1  
ATOM   2653   O  O     A ARG A 1 358 ? 18.533  6.089   -32.652 0.05 9.98  ? 357  ARG A O     1  
ATOM   2654   C  CB    A ARG A 1 358 ? 18.536  9.290   -31.922 0.05 9.79  ? 357  ARG A CB    1  
ATOM   2655   C  CG    A ARG A 1 358 ? 19.516  9.061   -33.067 0.05 9.78  ? 357  ARG A CG    1  
ATOM   2656   C  CD    A ARG A 1 358 ? 20.342  10.284  -33.350 0.05 9.71  ? 357  ARG A CD    1  
ATOM   2657   N  NE    A ARG A 1 358 ? 20.273  11.163  -32.204 0.05 9.71  ? 357  ARG A NE    1  
ATOM   2658   C  CZ    A ARG A 1 358 ? 21.241  11.290  -31.302 0.05 9.74  ? 357  ARG A CZ    1  
ATOM   2659   N  NH1   A ARG A 1 358 ? 21.075  12.107  -30.277 0.05 9.76  ? 357  ARG A NH1   1  
ATOM   2660   N  NH2   A ARG A 1 358 ? 22.381  10.622  -31.442 0.05 9.76  ? 357  ARG A NH2   1  
ATOM   2661   N  N     A GLU A 1 359 ? 19.080  6.545   -30.530 0.05 10.10 ? 358  GLU A N     1  
ATOM   2662   C  CA    A GLU A 1 359 ? 19.934  5.375   -30.435 0.05 10.24 ? 358  GLU A CA    1  
ATOM   2663   C  C     A GLU A 1 359 ? 19.125  4.109   -30.683 0.05 10.28 ? 358  GLU A C     1  
ATOM   2664   O  O     A GLU A 1 359 ? 19.567  3.206   -31.382 0.05 10.33 ? 358  GLU A O     1  
ATOM   2665   C  CB    A GLU A 1 359 ? 20.589  5.297   -29.064 0.05 10.40 ? 358  GLU A CB    1  
ATOM   2666   C  CG    A GLU A 1 359 ? 21.469  4.089   -28.876 0.05 10.58 ? 358  GLU A CG    1  
ATOM   2667   C  CD    A GLU A 1 359 ? 22.091  4.090   -27.504 0.05 10.80 ? 358  GLU A CD    1  
ATOM   2668   O  OE1   A GLU A 1 359 ? 21.649  3.282   -26.658 0.05 10.87 ? 358  GLU A OE1   1  
ATOM   2669   O  OE2   A GLU A 1 359 ? 22.997  4.926   -27.274 0.05 10.91 ? 358  GLU A OE2   1  
ATOM   2670   N  N     A THR A 1 360 ? 17.930  4.071   -30.115 0.05 10.27 ? 359  THR A N     1  
ATOM   2671   C  CA    A THR A 1 360 ? 17.063  2.911   -30.251 0.05 10.32 ? 359  THR A CA    1  
ATOM   2672   C  C     A THR A 1 360 ? 16.652  2.735   -31.713 0.05 10.22 ? 359  THR A C     1  
ATOM   2673   O  O     A THR A 1 360 ? 16.710  1.635   -32.275 0.05 10.27 ? 359  THR A O     1  
ATOM   2674   C  CB    A THR A 1 360 ? 15.817  3.067   -29.366 0.05 10.37 ? 359  THR A CB    1  
ATOM   2675   O  OG1   A THR A 1 360 ? 16.221  3.189   -27.991 0.05 10.50 ? 359  THR A OG1   1  
ATOM   2676   C  CG2   A THR A 1 360 ? 14.904  1.864   -29.523 0.05 10.44 ? 359  THR A CG2   1  
ATOM   2677   N  N     A ALA A 1 361 ? 16.262  3.848   -32.322 0.05 10.09 ? 360  ALA A N     1  
ATOM   2678   C  CA    A ALA A 1 361 ? 15.889  3.892   -33.728 0.05 10.02 ? 360  ALA A CA    1  
ATOM   2679   C  C     A ALA A 1 361 ? 16.971  3.308   -34.610 0.05 10.06 ? 360  ALA A C     1  
ATOM   2680   O  O     A ALA A 1 361 ? 16.721  2.442   -35.447 0.05 10.11 ? 360  ALA A O     1  
ATOM   2681   C  CB    A ALA A 1 361 ? 15.640  5.335   -34.127 0.05 9.91  ? 360  ALA A CB    1  
ATOM   2682   N  N     A LEU A 1 362 ? 18.178  3.819   -34.436 0.05 10.07 ? 361  LEU A N     1  
ATOM   2683   C  CA    A LEU A 1 362 ? 19.314  3.361   -35.203 0.05 10.16 ? 361  LEU A CA    1  
ATOM   2684   C  C     A LEU A 1 362 ? 19.534  1.874   -34.960 0.05 10.30 ? 361  LEU A C     1  
ATOM   2685   O  O     A LEU A 1 362 ? 19.760  1.120   -35.899 0.05 10.38 ? 361  LEU A O     1  
ATOM   2686   C  CB    A LEU A 1 362 ? 20.550  4.176   -34.820 0.05 10.19 ? 361  LEU A CB    1  
ATOM   2687   C  CG    A LEU A 1 362 ? 20.336  5.674   -35.043 0.05 10.07 ? 361  LEU A CG    1  
ATOM   2688   C  CD1   A LEU A 1 362 ? 21.399  6.451   -34.298 0.05 10.16 ? 361  LEU A CD1   1  
ATOM   2689   C  CD2   A LEU A 1 362 ? 20.355  6.030   -36.518 0.05 9.99  ? 361  LEU A CD2   1  
ATOM   2690   N  N     A ALA A 1 363 ? 19.416  1.452   -33.705 0.05 10.36 ? 362  ALA A N     1  
ATOM   2691   C  CA    A ALA A 1 363 ? 19.675  0.059   -33.333 0.05 10.52 ? 362  ALA A CA    1  
ATOM   2692   C  C     A ALA A 1 363 ? 18.678  -0.932  -33.928 0.05 10.52 ? 362  ALA A C     1  
ATOM   2693   O  O     A ALA A 1 363 ? 18.972  -2.124  -34.035 0.05 10.65 ? 362  ALA A O     1  
ATOM   2694   C  CB    A ALA A 1 363 ? 19.719  -0.091  -31.808 0.05 10.60 ? 362  ALA A CB    1  
ATOM   2695   N  N     A LEU A 1 364 ? 17.496  -0.445  -34.291 0.05 10.39 ? 363  LEU A N     1  
ATOM   2696   C  CA    A LEU A 1 364 ? 16.440  -1.301  -34.824 0.05 10.40 ? 363  LEU A CA    1  
ATOM   2697   C  C     A LEU A 1 364 ? 16.439  -1.353  -36.346 0.05 10.39 ? 363  LEU A C     1  
ATOM   2698   O  O     A LEU A 1 364 ? 16.269  -2.423  -36.937 0.05 10.47 ? 363  LEU A O     1  
ATOM   2699   C  CB    A LEU A 1 364 ? 15.071  -0.822  -34.335 0.05 10.33 ? 363  LEU A CB    1  
ATOM   2700   C  CG    A LEU A 1 364 ? 14.746  -1.121  -32.877 0.05 10.40 ? 363  LEU A CG    1  
ATOM   2701   C  CD1   A LEU A 1 364 ? 13.461  -0.427  -32.475 0.05 10.35 ? 363  LEU A CD1   1  
ATOM   2702   C  CD2   A LEU A 1 364 ? 14.606  -2.624  -32.694 0.05 10.53 ? 363  LEU A CD2   1  
ATOM   2703   N  N     A VAL A 1 365 ? 16.607  -0.202  -36.988 0.05 10.31 ? 364  VAL A N     1  
ATOM   2704   C  CA    A VAL A 1 365 ? 16.492  -0.175  -38.444 0.05 10.33 ? 364  VAL A CA    1  
ATOM   2705   C  C     A VAL A 1 365 ? 17.679  -0.836  -39.135 0.05 10.47 ? 364  VAL A C     1  
ATOM   2706   O  O     A VAL A 1 365 ? 17.560  -1.278  -40.267 0.05 10.55 ? 364  VAL A O     1  
ATOM   2707   C  CB    A VAL A 1 365 ? 16.271  1.240   -39.024 0.05 10.22 ? 364  VAL A CB    1  
ATOM   2708   C  CG1   A VAL A 1 365 ? 15.011  1.861   -38.437 0.05 10.13 ? 364  VAL A CG1   1  
ATOM   2709   C  CG2   A VAL A 1 365 ? 17.509  2.114   -38.823 0.05 10.19 ? 364  VAL A CG2   1  
ATOM   2710   N  N     A ASP A 1 366 ? 18.824  -0.918  -38.470 0.05 10.53 ? 365  ASP A N     1  
ATOM   2711   C  CA    A ASP A 1 366 ? 19.914  -1.667  -39.089 0.05 10.72 ? 365  ASP A CA    1  
ATOM   2712   C  C     A ASP A 1 366 ? 20.193  -2.968  -38.339 0.05 10.87 ? 365  ASP A C     1  
ATOM   2713   O  O     A ASP A 1 366 ? 21.173  -3.105  -37.612 0.05 11.02 ? 365  ASP A O     1  
ATOM   2714   C  CB    A ASP A 1 366 ? 21.161  -0.804  -39.339 0.05 10.76 ? 365  ASP A CB    1  
ATOM   2715   C  CG    A ASP A 1 366 ? 21.459  0.133   -38.198 0.05 10.69 ? 365  ASP A CG    1  
ATOM   2716   O  OD1   A ASP A 1 366 ? 21.476  -0.372  -37.059 0.05 10.72 ? 365  ASP A OD1   1  
ATOM   2717   O  OD2   A ASP A 1 366 ? 21.679  1.352   -38.437 0.05 10.61 ? 365  ASP A OD2   1  
ATOM   2718   N  N     A ASP A 1 367 ? 19.276  -3.914  -38.518 0.05 10.84 ? 366  ASP A N     1  
ATOM   2719   C  CA    A ASP A 1 367 ? 19.389  -5.236  -37.928 0.05 10.99 ? 366  ASP A CA    1  
ATOM   2720   C  C     A ASP A 1 367 ? 18.673  -6.214  -38.857 0.05 11.04 ? 366  ASP A C     1  
ATOM   2721   O  O     A ASP A 1 367 ? 17.444  -6.258  -38.890 0.05 10.94 ? 366  ASP A O     1  
ATOM   2722   C  CB    A ASP A 1 367 ? 18.747  -5.243  -36.539 0.05 10.93 ? 366  ASP A CB    1  
ATOM   2723   C  CG    A ASP A 1 367 ? 19.142  -6.454  -35.710 0.05 11.11 ? 366  ASP A CG    1  
ATOM   2724   O  OD1   A ASP A 1 367 ? 19.489  -7.492  -36.299 0.05 11.26 ? 366  ASP A OD1   1  
ATOM   2725   O  OD2   A ASP A 1 367 ? 19.110  -6.356  -34.467 0.05 11.12 ? 366  ASP A OD2   1  
ATOM   2726   N  N     A PRO A 1 368 ? 19.447  -7.004  -39.616 0.05 11.24 ? 367  PRO A N     1  
ATOM   2727   C  CA    A PRO A 1 368 ? 18.870  -7.952  -40.575 0.05 11.33 ? 367  PRO A CA    1  
ATOM   2728   C  C     A PRO A 1 368 ? 18.101  -9.046  -39.857 0.05 11.35 ? 367  PRO A C     1  
ATOM   2729   O  O     A PRO A 1 368 ? 17.274  -9.719  -40.462 0.05 11.36 ? 367  PRO A O     1  
ATOM   2730   C  CB    A PRO A 1 368 ? 20.101  -8.548  -41.265 0.05 11.57 ? 367  PRO A CB    1  
ATOM   2731   C  CG    A PRO A 1 368 ? 21.216  -8.367  -40.291 0.05 11.64 ? 367  PRO A CG    1  
ATOM   2732   C  CD    A PRO A 1 368 ? 20.919  -7.098  -39.551 0.05 11.41 ? 367  PRO A CD    1  
ATOM   2733   N  N     A GLU A 1 369 ? 18.385  -9.202  -38.570 0.05 11.37 ? 368  GLU A N     1  
ATOM   2734   C  CA    A GLU A 1 369 ? 17.738  -10.207 -37.746 0.05 11.41 ? 368  GLU A CA    1  
ATOM   2735   C  C     A GLU A 1 369 ? 16.388  -9.718  -37.242 0.05 11.22 ? 368  GLU A C     1  
ATOM   2736   O  O     A GLU A 1 369 ? 15.413  -10.464 -37.232 0.05 11.23 ? 368  GLU A O     1  
ATOM   2737   C  CB    A GLU A 1 369 ? 18.647  -10.573 -36.578 0.05 11.54 ? 368  GLU A CB    1  
ATOM   2738   C  CG    A GLU A 1 369 ? 20.046  -11.001 -37.019 0.05 11.79 ? 368  GLU A CG    1  
ATOM   2739   N  N     A VAL A 1 370 ? 16.332  -8.464  -36.807 0.05 11.07 ? 369  VAL A N     1  
ATOM   2740   C  CA    A VAL A 1 370 ? 15.045  -7.861  -36.472 0.05 10.93 ? 369  VAL A CA    1  
ATOM   2741   C  C     A VAL A 1 370 ? 14.150  -7.967  -37.698 0.05 10.90 ? 369  VAL A C     1  
ATOM   2742   O  O     A VAL A 1 370 ? 12.997  -8.390  -37.611 0.05 10.89 ? 369  VAL A O     1  
ATOM   2743   C  CB    A VAL A 1 370 ? 15.212  -6.393  -36.038 0.05 10.79 ? 369  VAL A CB    1  
ATOM   2744   C  CG1   A VAL A 1 370 ? 13.878  -5.646  -36.102 0.05 10.66 ? 369  VAL A CG1   1  
ATOM   2745   C  CG2   A VAL A 1 370 ? 15.807  -6.336  -34.641 0.05 10.84 ? 369  VAL A CG2   1  
ATOM   2746   N  N     A ALA A 1 371 ? 14.703  -7.613  -38.851 0.05 10.91 ? 370  ALA A N     1  
ATOM   2747   C  CA    A ALA A 1 371 ? 13.983  -7.765  -40.105 0.05 10.93 ? 370  ALA A CA    1  
ATOM   2748   C  C     A ALA A 1 371 ? 13.661  -9.242  -40.343 0.05 11.07 ? 370  ALA A C     1  
ATOM   2749   O  O     A ALA A 1 371 ? 12.575  -9.576  -40.823 0.05 11.08 ? 370  ALA A O     1  
ATOM   2750   C  CB    A ALA A 1 371 ? 14.798  -7.196  -41.257 0.05 10.98 ? 370  ALA A CB    1  
ATOM   2751   N  N     A ARG A 1 372 ? 14.600  -10.117 -39.981 0.05 11.19 ? 371  ARG A N     1  
ATOM   2752   C  CA    A ARG A 1 372 ? 14.400  -11.561 -40.125 0.05 11.34 ? 371  ARG A CA    1  
ATOM   2753   C  C     A ARG A 1 372 ? 13.214  -12.064 -39.284 0.05 11.28 ? 371  ARG A C     1  
ATOM   2754   O  O     A ARG A 1 372 ? 12.513  -13.002 -39.671 0.05 11.35 ? 371  ARG A O     1  
ATOM   2755   C  CB    A ARG A 1 372 ? 15.696  -12.336 -39.804 0.05 11.51 ? 371  ARG A CB    1  
ATOM   2756   C  CG    A ARG A 1 372 ? 15.633  -13.214 -38.567 0.05 11.59 ? 371  ARG A CG    1  
ATOM   2757   C  CD    A ARG A 1 372 ? 17.014  -13.708 -38.093 0.05 11.68 ? 371  ARG A CD    1  
ATOM   2758   N  NE    A ARG A 1 372 ? 16.880  -14.443 -36.839 0.05 11.78 ? 371  ARG A NE    1  
ATOM   2759   C  CZ    A ARG A 1 372 ? 17.716  -14.365 -35.809 0.05 11.86 ? 371  ARG A CZ    1  
ATOM   2760   N  NH1   A ARG A 1 372 ? 17.479  -15.078 -34.718 0.05 11.98 ? 371  ARG A NH1   1  
ATOM   2761   N  NH2   A ARG A 1 372 ? 18.786  -13.586 -35.862 0.05 11.86 ? 371  ARG A NH2   1  
ATOM   2762   N  N     A ARG A 1 373 ? 12.968  -11.434 -38.147 0.05 11.19 ? 372  ARG A N     1  
ATOM   2763   C  CA    A ARG A 1 373 ? 11.853  -11.867 -37.310 0.05 11.17 ? 372  ARG A CA    1  
ATOM   2764   C  C     A ARG A 1 373 ? 10.557  -11.334 -37.881 0.05 11.08 ? 372  ARG A C     1  
ATOM   2765   O  O     A ARG A 1 373 ? 9.541   -12.020 -37.858 0.05 11.13 ? 372  ARG A O     1  
ATOM   2766   C  CB    A ARG A 1 373 ? 11.996  -11.385 -35.867 0.05 11.12 ? 372  ARG A CB    1  
ATOM   2767   C  CG    A ARG A 1 373 ? 13.363  -11.557 -35.250 0.05 11.23 ? 372  ARG A CG    1  
ATOM   2768   C  CD    A ARG A 1 373 ? 13.914  -12.921 -35.515 0.05 11.40 ? 372  ARG A CD    1  
ATOM   2769   N  NE    A ARG A 1 373 ? 14.971  -13.227 -34.564 0.05 11.54 ? 372  ARG A NE    1  
ATOM   2770   C  CZ    A ARG A 1 373 ? 14.778  -13.956 -33.475 0.05 11.62 ? 372  ARG A CZ    1  
ATOM   2771   N  NH1   A ARG A 1 373 ? 13.579  -14.461 -33.218 0.05 11.56 ? 372  ARG A NH1   1  
ATOM   2772   N  NH2   A ARG A 1 373 ? 15.785  -14.177 -32.649 0.05 11.79 ? 372  ARG A NH2   1  
ATOM   2773   N  N     A LEU A 1 374 ? 10.595  -10.098 -38.378 0.05 10.98 ? 373  LEU A N     1  
ATOM   2774   C  CA    A LEU A 1 374 ? 9.397   -9.455  -38.914 0.05 10.93 ? 373  LEU A CA    1  
ATOM   2775   C  C     A LEU A 1 374 ? 8.907   -10.160 -40.164 0.05 11.03 ? 373  LEU A C     1  
ATOM   2776   O  O     A LEU A 1 374 ? 7.708   -10.320 -40.368 0.05 11.06 ? 373  LEU A O     1  
ATOM   2777   C  CB    A LEU A 1 374 ? 9.657   -7.970  -39.194 0.05 10.82 ? 373  LEU A CB    1  
ATOM   2778   C  CG    A LEU A 1 374 ? 9.750   -7.122  -37.921 0.05 10.73 ? 373  LEU A CG    1  
ATOM   2779   C  CD1   A LEU A 1 374 ? 10.444  -5.793  -38.208 0.05 10.64 ? 373  LEU A CD1   1  
ATOM   2780   C  CD2   A LEU A 1 374 ? 8.353   -6.892  -37.340 0.05 10.73 ? 373  LEU A CD2   1  
ATOM   2781   N  N     A ARG A 1 375 ? 9.835   -10.608 -41.001 0.05 11.11 ? 374  ARG A N     1  
ATOM   2782   C  CA    A ARG A 1 375 ? 9.416   -11.335 -42.196 0.05 11.24 ? 374  ARG A CA    1  
ATOM   2783   C  C     A ARG A 1 375 ? 8.772   -12.673 -41.843 0.05 11.32 ? 374  ARG A C     1  
ATOM   2784   O  O     A ARG A 1 375 ? 7.782   -13.062 -42.455 0.05 11.39 ? 374  ARG A O     1  
ATOM   2785   C  CB    A ARG A 1 375 ? 10.559  -11.476 -43.207 0.05 11.35 ? 374  ARG A CB    1  
ATOM   2786   C  CG    A ARG A 1 375 ? 10.916  -10.130 -43.829 0.05 11.31 ? 374  ARG A CG    1  
ATOM   2787   C  CD    A ARG A 1 375 ? 11.859  -10.224 -45.026 0.05 11.46 ? 374  ARG A CD    1  
ATOM   2788   N  NE    A ARG A 1 375 ? 12.368  -8.895  -45.345 0.05 11.38 ? 374  ARG A NE    1  
ATOM   2789   C  CZ    A ARG A 1 375 ? 13.455  -8.362  -44.793 0.05 11.32 ? 374  ARG A CZ    1  
ATOM   2790   N  NH1   A ARG A 1 375 ? 14.162  -9.044  -43.903 0.05 11.34 ? 374  ARG A NH1   1  
ATOM   2791   N  NH2   A ARG A 1 375 ? 13.840  -7.145  -45.129 0.05 11.26 ? 374  ARG A NH2   1  
ATOM   2792   N  N     A ARG A 1 376 ? 9.291   -13.365 -40.838 0.05 11.34 ? 375  ARG A N     1  
ATOM   2793   C  CA    A ARG A 1 376 ? 8.647   -14.624 -40.455 0.05 11.42 ? 375  ARG A CA    1  
ATOM   2794   C  C     A ARG A 1 376 ? 7.276   -14.363 -39.816 0.05 11.37 ? 375  ARG A C     1  
ATOM   2795   O  O     A ARG A 1 376 ? 6.366   -15.174 -39.940 0.05 11.44 ? 375  ARG A O     1  
ATOM   2796   C  CB    A ARG A 1 376 ? 9.548   -15.482 -39.557 0.05 11.48 ? 375  ARG A CB    1  
ATOM   2797   C  CG    A ARG A 1 376 ? 9.119   -16.953 -39.469 0.05 11.60 ? 375  ARG A CG    1  
ATOM   2798   C  CD    A ARG A 1 376 ? 10.332  -17.893 -39.380 0.05 11.74 ? 375  ARG A CD    1  
ATOM   2799   N  NE    A ARG A 1 376 ? 11.083  -17.978 -40.638 0.05 11.81 ? 375  ARG A NE    1  
ATOM   2800   C  CZ    A ARG A 1 376 ? 12.179  -18.717 -40.808 0.05 11.98 ? 375  ARG A CZ    1  
ATOM   2801   N  NH1   A ARG A 1 376 ? 12.803  -18.737 -41.983 0.05 12.08 ? 375  ARG A NH1   1  
ATOM   2802   N  NH2   A ARG A 1 376 ? 12.659  -19.439 -39.802 0.05 12.09 ? 375  ARG A NH2   1  
ATOM   2803   N  N     A ILE A 1 377 ? 7.113   -13.221 -39.152 0.05 11.25 ? 376  ILE A N     1  
ATOM   2804   C  CA    A ILE A 1 377 ? 5.791   -12.857 -38.627 0.05 11.23 ? 376  ILE A CA    1  
ATOM   2805   C  C     A ILE A 1 377 ? 4.746   -12.591 -39.728 0.05 11.27 ? 376  ILE A C     1  
ATOM   2806   O  O     A ILE A 1 377 ? 3.636   -13.101 -39.645 0.05 11.35 ? 376  ILE A O     1  
ATOM   2807   C  CB    A ILE A 1 377 ? 5.840   -11.664 -37.637 0.05 11.13 ? 376  ILE A CB    1  
ATOM   2808   C  CG1   A ILE A 1 377 ? 6.326   -12.126 -36.264 0.05 11.17 ? 376  ILE A CG1   1  
ATOM   2809   C  CG2   A ILE A 1 377 ? 4.457   -11.037 -37.480 0.05 11.14 ? 376  ILE A CG2   1  
ATOM   2810   C  CD1   A ILE A 1 377 ? 6.389   -11.004 -35.233 0.05 11.09 ? 376  ILE A CD1   1  
ATOM   2811   N  N     A GLN A 1 378 ? 5.095   -11.805 -40.749 0.05 11.24 ? 377  GLN A N     1  
ATOM   2812   C  CA    A GLN A 1 378 ? 4.174   -11.559 -41.866 0.05 11.33 ? 377  GLN A CA    1  
ATOM   2813   C  C     A GLN A 1 378 ? 3.735   -12.849 -42.541 0.05 11.48 ? 377  GLN A C     1  
ATOM   2814   O  O     A GLN A 1 378 ? 2.586   -12.981 -42.947 0.05 11.57 ? 377  GLN A O     1  
ATOM   2815   C  CB    A GLN A 1 378 ? 4.824   -10.706 -42.954 0.05 11.32 ? 377  GLN A CB    1  
ATOM   2816   C  CG    A GLN A 1 378 ? 5.331   -9.367  -42.524 0.05 11.20 ? 377  GLN A CG    1  
ATOM   2817   C  CD    A GLN A 1 378 ? 5.923   -8.634  -43.704 0.05 11.21 ? 377  GLN A CD    1  
ATOM   2818   O  OE1   A GLN A 1 378 ? 7.013   -8.971  -44.167 0.05 11.23 ? 377  GLN A OE1   1  
ATOM   2819   N  NE2   A GLN A 1 378 ? 5.196   -7.656  -44.225 0.05 11.23 ? 377  GLN A NE2   1  
ATOM   2820   N  N     A ALA A 1 379 ? 4.678   -13.770 -42.705 0.05 11.51 ? 378  ALA A N     1  
ATOM   2821   C  CA    A ALA A 1 379 ? 4.396   -15.052 -43.335 0.05 11.66 ? 378  ALA A CA    1  
ATOM   2822   C  C     A ALA A 1 379 ? 3.385   -15.803 -42.489 0.05 11.69 ? 378  ALA A C     1  
ATOM   2823   O  O     A ALA A 1 379 ? 2.491   -16.470 -43.016 0.05 11.81 ? 378  ALA A O     1  
ATOM   2824   C  CB    A ALA A 1 379 ? 5.670   -15.865 -43.474 0.05 11.71 ? 378  ALA A CB    1  
ATOM   2825   N  N     A GLU A 1 380 ? 3.540   -15.697 -41.172 0.05 11.60 ? 379  GLU A N     1  
ATOM   2826   C  CA    A GLU A 1 380 ? 2.627   -16.362 -40.255 0.05 11.65 ? 379  GLU A CA    1  
ATOM   2827   C  C     A GLU A 1 380 ? 1.252   -15.684 -40.260 0.05 11.67 ? 379  GLU A C     1  
ATOM   2828   O  O     A GLU A 1 380 ? 0.218   -16.356 -40.246 0.05 11.79 ? 379  GLU A O     1  
ATOM   2829   C  CB    A GLU A 1 380 ? 3.242   -16.471 -38.851 0.05 11.59 ? 379  GLU A CB    1  
ATOM   2830   C  CG    A GLU A 1 380 ? 4.481   -17.374 -38.858 0.05 11.62 ? 379  GLU A CG    1  
ATOM   2831   C  CD    A GLU A 1 380 ? 5.222   -17.452 -37.536 0.05 11.61 ? 379  GLU A CD    1  
ATOM   2832   O  OE1   A GLU A 1 380 ? 5.774   -18.538 -37.234 0.05 11.71 ? 379  GLU A OE1   1  
ATOM   2833   O  OE2   A GLU A 1 380 ? 5.279   -16.442 -36.810 0.05 11.51 ? 379  GLU A OE2   1  
ATOM   2834   N  N     A MET A 1 381 ? 1.236   -14.355 -40.322 0.05 11.59 ? 380  MET A N     1  
ATOM   2835   C  CA    A MET A 1 381 ? -0.028  -13.634 -40.435 0.05 11.65 ? 380  MET A CA    1  
ATOM   2836   C  C     A MET A 1 381 ? -0.756  -13.952 -41.742 0.05 11.79 ? 380  MET A C     1  
ATOM   2837   O  O     A MET A 1 381 ? -1.978  -14.102 -41.760 0.05 11.92 ? 380  MET A O     1  
ATOM   2838   C  CB    A MET A 1 381 ? 0.205   -12.128 -40.313 0.05 11.55 ? 380  MET A CB    1  
ATOM   2839   C  CG    A MET A 1 381 ? 0.705   -11.731 -38.942 0.05 11.45 ? 380  MET A CG    1  
ATOM   2840   S  SD    A MET A 1 381 ? 1.179   -9.996  -38.868 0.05 11.32 ? 380  MET A SD    1  
ATOM   2841   C  CE    A MET A 1 381 ? -0.413  -9.200  -38.970 0.05 11.44 ? 380  MET A CE    1  
ATOM   2842   N  N     A ALA A 1 382 ? -0.004  -14.062 -42.835 0.05 11.80 ? 381  ALA A N     1  
ATOM   2843   C  CA    A ALA A 1 382 ? -0.619  -14.393 -44.121 0.05 11.97 ? 381  ALA A CA    1  
ATOM   2844   C  C     A ALA A 1 382 ? -1.359  -15.726 -44.048 0.05 12.10 ? 381  ALA A C     1  
ATOM   2845   O  O     A ALA A 1 382 ? -2.371  -15.922 -44.725 0.05 12.26 ? 381  ALA A O     1  
ATOM   2846   C  CB    A ALA A 1 382 ? 0.424   -14.423 -45.218 0.05 11.99 ? 381  ALA A CB    1  
ATOM   2847   N  N     A GLN A 1 383 ? -0.859  -16.645 -43.229 0.05 12.10 ? 382  GLN A N     1  
ATOM   2848   C  CA    A GLN A 1 383 ? -1.552  -17.919 -43.048 0.05 12.05 ? 382  GLN A CA    1  
ATOM   2849   C  C     A GLN A 1 383 ? -2.842  -17.740 -42.256 0.05 11.92 ? 382  GLN A C     1  
ATOM   2850   O  O     A GLN A 1 383 ? -3.833  -18.424 -42.501 0.05 11.90 ? 382  GLN A O     1  
ATOM   2851   C  CB    A GLN A 1 383 ? -0.646  -18.964 -42.395 0.05 12.06 ? 382  GLN A CB    1  
ATOM   2852   C  CG    A GLN A 1 383 ? 0.578   -19.323 -43.231 0.05 12.20 ? 382  GLN A CG    1  
ATOM   2853   C  CD    A GLN A 1 383 ? 0.202   -19.848 -44.610 0.05 12.31 ? 382  GLN A CD    1  
ATOM   2854   O  OE1   A GLN A 1 383 ? -0.925  -20.291 -44.833 0.05 12.28 ? 382  GLN A OE1   1  
ATOM   2855   N  NE2   A GLN A 1 383 ? 1.141   -19.773 -45.547 0.05 12.46 ? 382  GLN A NE2   1  
ATOM   2856   N  N     A GLU A 1 384 ? -2.839  -16.798 -41.320 0.05 11.83 ? 383  GLU A N     1  
ATOM   2857   C  CA    A GLU A 1 384 ? -4.064  -16.452 -40.611 0.05 11.71 ? 383  GLU A CA    1  
ATOM   2858   C  C     A GLU A 1 384 ? -5.090  -15.905 -41.607 0.05 11.74 ? 383  GLU A C     1  
ATOM   2859   O  O     A GLU A 1 384 ? -6.299  -15.905 -41.346 0.05 11.67 ? 383  GLU A O     1  
ATOM   2860   C  CB    A GLU A 1 384 ? -3.762  -15.439 -39.508 0.05 11.64 ? 383  GLU A CB    1  
ATOM   2861   C  CG    A GLU A 1 384 ? -2.752  -15.957 -38.495 0.05 11.62 ? 383  GLU A CG    1  
ATOM   2862   C  CD    A GLU A 1 384 ? -2.421  -14.933 -37.426 0.05 11.58 ? 383  GLU A CD    1  
ATOM   2863   O  OE1   A GLU A 1 384 ? -3.105  -13.895 -37.388 0.05 11.57 ? 383  GLU A OE1   1  
ATOM   2864   O  OE2   A GLU A 1 384 ? -1.490  -15.174 -36.625 0.05 11.58 ? 383  GLU A OE2   1  
ATOM   2865   N  N     A GLY A 1 385 ? -4.586  -15.438 -42.748 0.05 11.85 ? 384  GLY A N     1  
ATOM   2866   C  CA    A GLY A 1 385 ? -5.406  -15.139 -43.909 0.05 11.93 ? 384  GLY A CA    1  
ATOM   2867   C  C     A GLY A 1 385 ? -6.007  -13.752 -43.959 0.05 11.91 ? 384  GLY A C     1  
ATOM   2868   O  O     A GLY A 1 385 ? -5.687  -12.951 -44.852 0.05 12.02 ? 384  GLY A O     1  
ATOM   2869   N  N     A GLY A 1 386 ? -6.885  -13.482 -42.994 0.05 11.79 ? 385  GLY A N     1  
ATOM   2870   C  CA    A GLY A 1 386 ? -7.677  -12.268 -42.952 0.05 11.78 ? 385  GLY A CA    1  
ATOM   2871   C  C     A GLY A 1 386 ? -9.156  -12.606 -43.034 0.05 11.76 ? 385  GLY A C     1  
ATOM   2872   O  O     A GLY A 1 386 ? -9.611  -13.613 -42.485 0.05 11.72 ? 385  GLY A O     1  
ATOM   2873   N  N     A THR A 1 387 ? -9.895  -11.779 -43.760 0.05 11.82 ? 386  THR A N     1  
ATOM   2874   C  CA    A THR A 1 387 ? -11.349 -11.876 -43.836 0.05 11.82 ? 386  THR A CA    1  
ATOM   2875   C  C     A THR A 1 387 ? -11.849 -13.152 -44.502 0.05 11.87 ? 386  THR A C     1  
ATOM   2876   O  O     A THR A 1 387 ? -12.326 -14.057 -43.830 0.05 11.81 ? 386  THR A O     1  
ATOM   2877   C  CB    A THR A 1 387 ? -11.907 -10.691 -44.604 0.05 11.94 ? 386  THR A CB    1  
ATOM   2878   O  OG1   A THR A 1 387 ? -11.468 -9.487  -43.973 0.05 11.89 ? 386  THR A OG1   1  
ATOM   2879   C  CG2   A THR A 1 387 ? -13.433 -10.741 -44.635 0.05 11.97 ? 386  THR A CG2   1  
ATOM   2880   N  N     A ARG A 1 388 ? -11.760 -13.199 -45.832 0.05 11.99 ? 387  ARG A N     1  
ATOM   2881   C  CA    A ARG A 1 388 ? -12.109 -14.388 -46.614 0.05 12.07 ? 387  ARG A CA    1  
ATOM   2882   C  C     A ARG A 1 388 ? -11.743 -15.699 -45.888 0.05 11.98 ? 387  ARG A C     1  
ATOM   2883   O  O     A ARG A 1 388 ? -12.462 -16.698 -45.975 0.05 12.00 ? 387  ARG A O     1  
ATOM   2884   C  CB    A ARG A 1 388 ? -11.436 -14.327 -47.994 0.05 12.21 ? 387  ARG A CB    1  
ATOM   2885   C  CG    A ARG A 1 388 ? -11.727 -13.066 -48.795 0.05 12.37 ? 387  ARG A CG    1  
ATOM   2886   C  CD    A ARG A 1 388 ? -11.033 -13.106 -50.165 0.05 12.52 ? 387  ARG A CD    1  
ATOM   2887   N  NE    A ARG A 1 388 ? -9.878  -12.206 -50.247 0.05 12.54 ? 387  ARG A NE    1  
ATOM   2888   C  CZ    A ARG A 1 388 ? -8.614  -12.603 -50.413 0.05 12.61 ? 387  ARG A CZ    1  
ATOM   2889   N  NH1   A ARG A 1 388 ? -8.327  -13.895 -50.519 0.05 12.65 ? 387  ARG A NH1   1  
ATOM   2890   N  NH2   A ARG A 1 388 ? -7.634  -11.705 -50.479 0.05 12.64 ? 387  ARG A NH2   1  
ATOM   2891   N  N     A ARG A 1 389 ? -10.652 -15.684 -45.130 0.05 11.90 ? 388  ARG A N     1  
ATOM   2892   C  CA    A ARG A 1 389 ? -10.320 -16.827 -44.290 0.05 11.85 ? 388  ARG A CA    1  
ATOM   2893   C  C     A ARG A 1 389 ? -11.321 -17.026 -43.149 0.05 11.73 ? 388  ARG A C     1  
ATOM   2894   O  O     A ARG A 1 389 ? -11.792 -18.141 -42.923 0.05 11.73 ? 388  ARG A O     1  
ATOM   2895   C  CB    A ARG A 1 389 ? -8.902  -16.723 -43.729 0.05 11.82 ? 388  ARG A CB    1  
ATOM   2896   C  CG    A ARG A 1 389 ? -8.489  -17.972 -42.963 0.05 11.78 ? 388  ARG A CG    1  
ATOM   2897   C  CD    A ARG A 1 389 ? -7.025  -18.321 -43.160 0.05 11.83 ? 388  ARG A CD    1  
ATOM   2898   N  NE    A ARG A 1 389 ? -6.706  -19.618 -42.572 0.05 11.81 ? 388  ARG A NE    1  
ATOM   2899   C  CZ    A ARG A 1 389 ? -6.442  -19.814 -41.282 0.05 11.70 ? 388  ARG A CZ    1  
ATOM   2900   N  NH1   A ARG A 1 389 ? -6.447  -18.792 -40.425 0.05 11.61 ? 388  ARG A NH1   1  
ATOM   2901   N  NH2   A ARG A 1 389 ? -6.179  -21.037 -40.844 0.05 11.70 ? 388  ARG A NH2   1  
ATOM   2902   N  N     A ALA A 1 390 ? -11.640 -15.957 -42.424 0.05 11.64 ? 389  ALA A N     1  
ATOM   2903   C  CA    A ALA A 1 390 ? -12.611 -16.071 -41.337 0.05 11.54 ? 389  ALA A CA    1  
ATOM   2904   C  C     A ALA A 1 390 ? -13.949 -16.585 -41.872 0.05 11.59 ? 389  ALA A C     1  
ATOM   2905   O  O     A ALA A 1 390 ? -14.641 -17.349 -41.208 0.05 11.54 ? 389  ALA A O     1  
ATOM   2906   C  CB    A ALA A 1 390 ? -12.790 -14.750 -40.640 0.05 11.47 ? 389  ALA A CB    1  
ATOM   2907   N  N     A ALA A 1 391 ? -14.296 -16.190 -43.091 0.05 11.71 ? 390  ALA A N     1  
ATOM   2908   C  CA    A ALA A 1 391 ? -15.526 -16.696 -43.702 0.05 11.78 ? 390  ALA A CA    1  
ATOM   2909   C  C     A ALA A 1 391 ? -15.492 -18.196 -44.003 0.05 11.82 ? 390  ALA A C     1  
ATOM   2910   O  O     A ALA A 1 391 ? -16.495 -18.879 -43.794 0.05 11.82 ? 390  ALA A O     1  
ATOM   2911   C  CB    A ALA A 1 391 ? -15.859 -15.923 -44.942 0.05 11.92 ? 390  ALA A CB    1  
ATOM   2912   N  N     A ASP A 1 392 ? -14.359 -18.694 -44.509 0.05 11.87 ? 391  ASP A N     1  
ATOM   2913   C  CA    A ASP A 1 392 ? -14.176 -20.135 -44.730 0.05 11.92 ? 391  ASP A CA    1  
ATOM   2914   C  C     A ASP A 1 392 ? -14.511 -20.939 -43.475 0.05 11.81 ? 391  ASP A C     1  
ATOM   2915   O  O     A ASP A 1 392 ? -15.278 -21.901 -43.521 0.05 11.85 ? 391  ASP A O     1  
ATOM   2916   C  CB    A ASP A 1 392 ? -12.734 -20.465 -45.142 0.05 11.98 ? 391  ASP A CB    1  
ATOM   2917   C  CG    A ASP A 1 392 ? -12.390 -20.004 -46.548 0.05 12.10 ? 391  ASP A CG    1  
ATOM   2918   O  OD1   A ASP A 1 392 ? -13.297 -19.603 -47.304 0.05 12.17 ? 391  ASP A OD1   1  
ATOM   2919   O  OD2   A ASP A 1 392 ? -11.196 -20.050 -46.911 0.05 12.12 ? 391  ASP A OD2   1  
ATOM   2920   N  N     A LEU A 1 393 ? -13.925 -20.536 -42.348 0.05 11.70 ? 392  LEU A N     1  
ATOM   2921   C  CA    A LEU A 1 393 ? -14.134 -21.242 -41.090 0.05 11.60 ? 392  LEU A CA    1  
ATOM   2922   C  C     A LEU A 1 393 ? -15.587 -21.127 -40.625 0.05 11.56 ? 392  LEU A C     1  
ATOM   2923   O  O     A LEU A 1 393 ? -16.149 -22.091 -40.124 0.05 11.54 ? 392  LEU A O     1  
ATOM   2924   C  CB    A LEU A 1 393 ? -13.159 -20.733 -40.020 0.05 11.51 ? 392  LEU A CB    1  
ATOM   2925   C  CG    A LEU A 1 393 ? -11.694 -20.954 -40.413 0.05 11.56 ? 392  LEU A CG    1  
ATOM   2926   C  CD1   A LEU A 1 393 ? -10.754 -20.114 -39.548 0.05 11.50 ? 392  LEU A CD1   1  
ATOM   2927   C  CD2   A LEU A 1 393 ? -11.349 -22.431 -40.311 0.05 11.59 ? 392  LEU A CD2   1  
ATOM   2928   N  N     A ILE A 1 394 ? -16.192 -19.957 -40.816 0.05 11.55 ? 393  ILE A N     1  
ATOM   2929   C  CA    A ILE A 1 394 ? -17.595 -19.750 -40.439 0.05 11.53 ? 393  ILE A CA    1  
ATOM   2930   C  C     A ILE A 1 394 ? -18.515 -20.532 -41.374 0.05 11.65 ? 393  ILE A C     1  
ATOM   2931   O  O     A ILE A 1 394 ? -19.579 -21.007 -40.973 0.05 11.65 ? 393  ILE A O     1  
ATOM   2932   C  CB    A ILE A 1 394 ? -17.971 -18.254 -40.434 0.05 11.51 ? 393  ILE A CB    1  
ATOM   2933   C  CG1   A ILE A 1 394 ? -17.166 -17.519 -39.360 0.05 11.39 ? 393  ILE A CG1   1  
ATOM   2934   C  CG2   A ILE A 1 394 ? -19.469 -18.063 -40.181 0.05 11.53 ? 393  ILE A CG2   1  
ATOM   2935   C  CD1   A ILE A 1 394 ? -17.457 -16.034 -39.288 0.05 11.38 ? 393  ILE A CD1   1  
ATOM   2936   N  N     A GLU A 1 395 ? -18.086 -20.681 -42.621 0.05 11.76 ? 394  GLU A N     1  
ATOM   2937   C  CA    A GLU A 1 395 ? -18.836 -21.498 -43.566 0.05 11.89 ? 394  GLU A CA    1  
ATOM   2938   C  C     A GLU A 1 395 ? -18.715 -22.960 -43.194 0.05 11.91 ? 394  GLU A C     1  
ATOM   2939   O  O     A GLU A 1 395 ? -19.633 -23.750 -43.409 0.05 11.98 ? 394  GLU A O     1  
ATOM   2940   C  CB    A GLU A 1 395 ? -18.338 -21.272 -44.990 0.05 12.02 ? 394  GLU A CB    1  
ATOM   2941   C  CG    A GLU A 1 395 ? -18.900 -20.020 -45.615 0.05 12.10 ? 394  GLU A CG    1  
ATOM   2942   C  CD    A GLU A 1 395 ? -18.391 -19.769 -47.018 0.05 12.22 ? 394  GLU A CD    1  
ATOM   2943   O  OE1   A GLU A 1 395 ? -17.301 -20.259 -47.376 0.05 12.27 ? 394  GLU A OE1   1  
ATOM   2944   O  OE2   A GLU A 1 395 ? -19.105 -19.080 -47.772 0.05 12.28 ? 394  GLU A OE2   1  
ATOM   2945   N  N     A ALA A 1 396 ? -17.572 -23.318 -42.628 0.05 11.85 ? 395  ALA A N     1  
ATOM   2946   C  CA    A ALA A 1 396 ? -17.333 -24.692 -42.219 0.05 11.87 ? 395  ALA A CA    1  
ATOM   2947   C  C     A ALA A 1 396 ? -18.201 -25.100 -41.025 0.05 11.79 ? 395  ALA A C     1  
ATOM   2948   O  O     A ALA A 1 396 ? -18.573 -26.262 -40.899 0.05 11.85 ? 395  ALA A O     1  
ATOM   2949   C  CB    A ALA A 1 396 ? -15.860 -24.906 -41.913 0.05 11.86 ? 395  ALA A CB    1  
ATOM   2950   N  N     A GLU A 1 397 ? -18.531 -24.143 -40.160 0.05 11.68 ? 396  GLU A N     1  
ATOM   2951   C  CA    A GLU A 1 397 ? -19.321 -24.431 -38.966 0.05 11.61 ? 396  GLU A CA    1  
ATOM   2952   C  C     A GLU A 1 397 ? -20.812 -24.363 -39.261 0.05 11.67 ? 396  GLU A C     1  
ATOM   2953   O  O     A GLU A 1 397 ? -21.635 -24.836 -38.478 0.05 11.66 ? 396  GLU A O     1  
ATOM   2954   C  CB    A GLU A 1 397 ? -19.003 -23.429 -37.850 0.05 11.47 ? 396  GLU A CB    1  
ATOM   2955   C  CG    A GLU A 1 397 ? -17.525 -23.315 -37.500 0.05 11.42 ? 396  GLU A CG    1  
ATOM   2956   C  CD    A GLU A 1 397 ? -16.942 -24.604 -36.976 0.05 11.45 ? 396  GLU A CD    1  
ATOM   2957   O  OE1   A GLU A 1 397 ? -15.709 -24.764 -37.060 0.05 11.46 ? 396  GLU A OE1   1  
ATOM   2958   O  OE2   A GLU A 1 397 ? -17.707 -25.457 -36.473 0.05 11.46 ? 396  GLU A OE2   1  
ATOM   2959   N  N     A LEU A 1 398 ? -21.137 -23.751 -40.394 0.05 11.73 ? 397  LEU A N     1  
ATOM   2960   C  CA    A LEU A 1 398 ? -22.506 -23.461 -40.785 0.05 11.80 ? 397  LEU A CA    1  
ATOM   2961   C  C     A LEU A 1 398 ? -23.126 -24.740 -41.290 0.05 11.94 ? 397  LEU A C     1  
ATOM   2962   O  O     A LEU A 1 398 ? -22.987 -25.043 -42.467 0.05 12.06 ? 397  LEU A O     1  
ATOM   2963   C  CB    A LEU A 1 398 ? -22.467 -22.430 -41.907 0.05 11.85 ? 397  LEU A CB    1  
ATOM   2964   C  CG    A LEU A 1 398 ? -23.707 -22.010 -42.676 0.05 11.97 ? 397  LEU A CG    1  
ATOM   2965   C  CD1   A LEU A 1 398 ? -24.743 -21.406 -41.766 0.05 11.91 ? 397  LEU A CD1   1  
ATOM   2966   C  CD2   A LEU A 1 398 ? -23.305 -21.033 -43.758 0.05 12.03 ? 397  LEU A CD2   1  
ATOM   2967   N  N     A PRO A 1 399 ? -23.825 -25.488 -40.411 0.05 11.93 ? 398  PRO A N     1  
ATOM   2968   C  CA    A PRO A 1 399 ? -24.095 -26.907 -40.687 0.05 12.06 ? 398  PRO A CA    1  
ATOM   2969   C  C     A PRO A 1 399 ? -24.843 -27.178 -42.003 0.05 12.22 ? 398  PRO A C     1  
ATOM   2970   O  O     A PRO A 1 399 ? -25.368 -26.250 -42.614 0.05 12.23 ? 398  PRO A O     1  
ATOM   2971   C  CB    A PRO A 1 399 ? -24.900 -27.370 -39.465 0.05 12.02 ? 398  PRO A CB    1  
ATOM   2972   C  CG    A PRO A 1 399 ? -25.484 -26.120 -38.880 0.05 11.92 ? 398  PRO A CG    1  
ATOM   2973   C  CD    A PRO A 1 399 ? -24.596 -24.979 -39.260 0.05 11.84 ? 398  PRO A CD    1  
ATOM   2974   N  N     A ALA A 1 400 ? -24.867 -28.438 -42.430 0.05 12.36 ? 399  ALA A N     1  
ATOM   2975   C  CA    A ALA A 1 400 ? -25.360 -28.805 -43.770 0.05 12.54 ? 399  ALA A CA    1  
ATOM   2976   C  C     A ALA A 1 400 ? -26.705 -28.179 -44.184 0.05 12.58 ? 399  ALA A C     1  
ATOM   2977   O  O     A ALA A 1 400 ? -27.615 -28.010 -43.372 0.05 12.51 ? 399  ALA A O     1  
ATOM   2978   C  CB    A ALA A 1 400 ? -25.400 -30.321 -43.926 0.05 12.68 ? 399  ALA A CB    1  
ATOM   2979   N  N     A THR B 1 6   ? -66.962 -20.263 17.321  0.05 12.08 ? 5    THR B N     1  
ATOM   2980   C  CA    A THR B 1 6   ? -67.685 -20.622 16.102  0.05 12.05 ? 5    THR B CA    1  
ATOM   2981   C  C     A THR B 1 6   ? -66.678 -21.043 15.029  0.05 11.90 ? 5    THR B C     1  
ATOM   2982   O  O     A THR B 1 6   ? -65.511 -20.640 15.097  0.05 11.85 ? 5    THR B O     1  
ATOM   2983   C  CB    A THR B 1 6   ? -68.566 -19.451 15.602  0.05 12.12 ? 5    THR B CB    1  
ATOM   2984   O  OG1   A THR B 1 6   ? -69.835 -19.486 16.273  0.05 12.27 ? 5    THR B OG1   1  
ATOM   2985   N  N     A PRO B 1 7   ? -67.111 -21.866 14.050  0.05 11.86 ? 6    PRO B N     1  
ATOM   2986   C  CA    A PRO B 1 7   ? -66.186 -22.346 13.016  0.05 11.73 ? 6    PRO B CA    1  
ATOM   2987   C  C     A PRO B 1 7   ? -65.659 -21.223 12.142  0.05 11.69 ? 6    PRO B C     1  
ATOM   2988   O  O     A PRO B 1 7   ? -66.391 -20.274 11.838  0.05 11.76 ? 6    PRO B O     1  
ATOM   2989   C  CB    A PRO B 1 7   ? -67.053 -23.276 12.158  0.05 11.73 ? 6    PRO B CB    1  
ATOM   2990   C  CG    A PRO B 1 7   ? -68.191 -23.655 13.034  0.05 11.84 ? 6    PRO B CG    1  
ATOM   2991   C  CD    A PRO B 1 7   ? -68.453 -22.450 13.886  0.05 11.93 ? 6    PRO B CD    1  
ATOM   2992   N  N     A ALA B 1 8   ? -64.394 -21.334 11.757  0.05 11.59 ? 7    ALA B N     1  
ATOM   2993   C  CA    A ALA B 1 8   ? -63.783 -20.341 10.887  0.05 11.55 ? 7    ALA B CA    1  
ATOM   2994   C  C     A ALA B 1 8   ? -64.542 -20.243 9.578   0.05 11.55 ? 7    ALA B C     1  
ATOM   2995   O  O     A ALA B 1 8   ? -64.945 -21.253 8.998   0.05 11.54 ? 7    ALA B O     1  
ATOM   2996   C  CB    A ALA B 1 8   ? -62.316 -20.679 10.628  0.05 11.44 ? 7    ALA B CB    1  
ATOM   2997   N  N     A HIS B 1 9   ? -64.747 -19.007 9.131   0.05 11.58 ? 8    HIS B N     1  
ATOM   2998   C  CA    A HIS B 1 9   ? -65.256 -18.732 7.799   0.05 11.58 ? 8    HIS B CA    1  
ATOM   2999   C  C     A HIS B 1 9   ? -64.075 -18.349 6.911   0.05 11.48 ? 8    HIS B C     1  
ATOM   3000   O  O     A HIS B 1 9   ? -63.525 -17.256 7.051   0.05 11.47 ? 8    HIS B O     1  
ATOM   3001   C  CB    A HIS B 1 9   ? -66.265 -17.585 7.836   0.05 11.68 ? 8    HIS B CB    1  
ATOM   3002   C  CG    A HIS B 1 9   ? -66.764 -17.175 6.485   0.05 11.68 ? 8    HIS B CG    1  
ATOM   3003   N  ND1   A HIS B 1 9   ? -67.427 -15.986 6.266   0.05 11.76 ? 8    HIS B ND1   1  
ATOM   3004   C  CD2   A HIS B 1 9   ? -66.705 -17.799 5.284   0.05 11.64 ? 8    HIS B CD2   1  
ATOM   3005   C  CE1   A HIS B 1 9   ? -67.757 -15.895 4.990   0.05 11.75 ? 8    HIS B CE1   1  
ATOM   3006   N  NE2   A HIS B 1 9   ? -67.322 -16.977 4.370   0.05 11.68 ? 8    HIS B NE2   1  
ATOM   3007   N  N     A ILE B 1 10  ? -63.670 -19.269 6.042   0.05 11.41 ? 9    ILE B N     1  
ATOM   3008   C  CA    A ILE B 1 10  ? -62.591 -19.031 5.089   0.05 11.32 ? 9    ILE B CA    1  
ATOM   3009   C  C     A ILE B 1 10  ? -63.242 -18.706 3.767   0.05 11.33 ? 9    ILE B C     1  
ATOM   3010   O  O     A ILE B 1 10  ? -64.104 -19.446 3.303   0.05 11.36 ? 9    ILE B O     1  
ATOM   3011   C  CB    A ILE B 1 10  ? -61.727 -20.288 4.864   0.05 11.25 ? 9    ILE B CB    1  
ATOM   3012   C  CG1   A ILE B 1 10  ? -61.128 -20.767 6.180   0.05 11.25 ? 9    ILE B CG1   1  
ATOM   3013   C  CG2   A ILE B 1 10  ? -60.649 -20.012 3.798   0.05 11.17 ? 9    ILE B CG2   1  
ATOM   3014   C  CD1   A ILE B 1 10  ? -60.262 -22.020 6.047   0.05 11.19 ? 9    ILE B CD1   1  
ATOM   3015   N  N     A ALA B 1 11  ? -62.847 -17.589 3.167   0.05 11.31 ? 10   ALA B N     1  
ATOM   3016   C  CA    A ALA B 1 11  ? -63.380 -17.208 1.870   0.05 11.32 ? 10   ALA B CA    1  
ATOM   3017   C  C     A ALA B 1 11  ? -62.286 -17.323 0.825   0.05 11.22 ? 10   ALA B C     1  
ATOM   3018   O  O     A ALA B 1 11  ? -61.316 -16.580 0.860   0.05 11.17 ? 10   ALA B O     1  
ATOM   3019   C  CB    A ALA B 1 11  ? -63.913 -15.786 1.907   0.05 11.37 ? 10   ALA B CB    1  
ATOM   3020   N  N     A MET B 1 12  ? -62.462 -18.253 -0.100  0.05 11.21 ? 11   MET B N     1  
ATOM   3021   C  CA    A MET B 1 12  ? -61.523 -18.437 -1.188  0.05 11.14 ? 11   MET B CA    1  
ATOM   3022   C  C     A MET B 1 12  ? -61.999 -17.648 -2.411  0.05 11.16 ? 11   MET B C     1  
ATOM   3023   O  O     A MET B 1 12  ? -63.199 -17.573 -2.657  0.05 11.23 ? 11   MET B O     1  
ATOM   3024   C  CB    A MET B 1 12  ? -61.427 -19.918 -1.518  0.05 11.13 ? 11   MET B CB    1  
ATOM   3025   C  CG    A MET B 1 12  ? -60.668 -20.235 -2.767  0.05 11.08 ? 11   MET B CG    1  
ATOM   3026   S  SD    A MET B 1 12  ? -58.910 -19.833 -2.695  0.05 10.99 ? 11   MET B SD    1  
ATOM   3027   C  CE    A MET B 1 12  ? -58.358 -20.658 -4.171  0.05 10.97 ? 11   MET B CE    1  
ATOM   3028   N  N     A PHE B 1 13  ? -61.060 -17.073 -3.164  0.05 11.09 ? 12   PHE B N     1  
ATOM   3029   C  CA    A PHE B 1 13  ? -61.383 -16.325 -4.388  0.05 11.10 ? 12   PHE B CA    1  
ATOM   3030   C  C     A PHE B 1 13  ? -60.560 -16.811 -5.581  0.05 11.04 ? 12   PHE B C     1  
ATOM   3031   O  O     A PHE B 1 13  ? -59.337 -16.971 -5.475  0.05 10.98 ? 12   PHE B O     1  
ATOM   3032   C  CB    A PHE B 1 13  ? -61.079 -14.839 -4.200  0.05 11.08 ? 12   PHE B CB    1  
ATOM   3033   C  CG    A PHE B 1 13  ? -61.949 -14.148 -3.188  0.05 11.15 ? 12   PHE B CG    1  
ATOM   3034   C  CD1   A PHE B 1 13  ? -61.779 -14.377 -1.834  0.05 11.16 ? 12   PHE B CD1   1  
ATOM   3035   C  CD2   A PHE B 1 13  ? -62.907 -13.227 -3.593  0.05 11.22 ? 12   PHE B CD2   1  
ATOM   3036   C  CE1   A PHE B 1 13  ? -62.560 -13.737 -0.900  0.05 11.24 ? 12   PHE B CE1   1  
ATOM   3037   C  CE2   A PHE B 1 13  ? -63.699 -12.579 -2.660  0.05 11.30 ? 12   PHE B CE2   1  
ATOM   3038   C  CZ    A PHE B 1 13  ? -63.526 -12.832 -1.309  0.05 11.31 ? 12   PHE B CZ    1  
ATOM   3039   N  N     A SER B 1 14  ? -61.214 -17.033 -6.720  0.05 11.08 ? 13   SER B N     1  
ATOM   3040   C  CA    A SER B 1 14  ? -60.498 -17.280 -7.974  0.05 11.04 ? 13   SER B CA    1  
ATOM   3041   C  C     A SER B 1 14  ? -61.336 -16.942 -9.198  0.05 11.08 ? 13   SER B C     1  
ATOM   3042   O  O     A SER B 1 14  ? -62.423 -16.374 -9.074  0.05 11.14 ? 13   SER B O     1  
ATOM   3043   C  CB    A SER B 1 14  ? -60.009 -18.721 -8.077  0.05 11.03 ? 13   SER B CB    1  
ATOM   3044   O  OG    A SER B 1 14  ? -58.968 -18.834 -9.048  0.05 10.98 ? 13   SER B OG    1  
ATOM   3045   N  N     A ILE B 1 15  ? -60.818 -17.308 -10.368 0.05 11.07 ? 14   ILE B N     1  
ATOM   3046   C  CA    A ILE B 1 15  ? -61.477 -17.040 -11.648 0.05 11.11 ? 14   ILE B CA    1  
ATOM   3047   C  C     A ILE B 1 15  ? -61.766 -18.370 -12.339 0.05 11.17 ? 14   ILE B C     1  
ATOM   3048   O  O     A ILE B 1 15  ? -61.398 -19.434 -11.825 0.05 11.17 ? 14   ILE B O     1  
ATOM   3049   C  CB    A ILE B 1 15  ? -60.614 -16.148 -12.570 0.05 11.05 ? 14   ILE B CB    1  
ATOM   3050   C  CG1   A ILE B 1 15  ? -59.439 -16.940 -13.148 0.05 11.01 ? 14   ILE B CG1   1  
ATOM   3051   C  CG2   A ILE B 1 15  ? -60.114 -14.921 -11.816 0.05 11.00 ? 14   ILE B CG2   1  
ATOM   3052   C  CD1   A ILE B 1 15  ? -58.637 -16.180 -14.195 0.05 10.96 ? 14   ILE B CD1   1  
ATOM   3053   N  N     A ALA B 1 16  ? -62.442 -18.329 -13.482 0.05 11.24 ? 15   ALA B N     1  
ATOM   3054   C  CA    A ALA B 1 16  ? -62.775 -19.564 -14.188 0.05 11.32 ? 15   ALA B CA    1  
ATOM   3055   C  C     A ALA B 1 16  ? -61.689 -19.979 -15.171 0.05 11.28 ? 15   ALA B C     1  
ATOM   3056   O  O     A ALA B 1 16  ? -61.696 -19.583 -16.343 0.05 11.33 ? 15   ALA B O     1  
ATOM   3057   C  CB    A ALA B 1 16  ? -64.134 -19.448 -14.892 0.05 11.42 ? 15   ALA B CB    1  
ATOM   3058   N  N     A ALA B 1 17  ? -60.772 -20.808 -14.685 0.05 11.22 ? 16   ALA B N     1  
ATOM   3059   C  CA    A ALA B 1 17  ? -59.590 -21.209 -15.424 0.05 11.19 ? 16   ALA B CA    1  
ATOM   3060   C  C     A ALA B 1 17  ? -58.986 -22.411 -14.713 0.05 11.17 ? 16   ALA B C     1  
ATOM   3061   O  O     A ALA B 1 17  ? -58.667 -22.346 -13.527 0.05 11.12 ? 16   ALA B O     1  
ATOM   3062   C  CB    A ALA B 1 17  ? -58.578 -20.071 -15.482 0.05 11.11 ? 16   ALA B CB    1  
ATOM   3063   N  N     A HIS B 1 18  ? -58.838 -23.507 -15.438 0.05 11.23 ? 17   HIS B N     1  
ATOM   3064   C  CA    A HIS B 1 18  ? -58.362 -24.756 -14.846 0.05 11.24 ? 17   HIS B CA    1  
ATOM   3065   C  C     A HIS B 1 18  ? -56.974 -24.606 -14.215 0.05 11.15 ? 17   HIS B C     1  
ATOM   3066   O  O     A HIS B 1 18  ? -56.715 -25.133 -13.129 0.05 11.13 ? 17   HIS B O     1  
ATOM   3067   C  CB    A HIS B 1 18  ? -58.349 -25.850 -15.902 0.05 11.32 ? 17   HIS B CB    1  
ATOM   3068   C  CG    A HIS B 1 18  ? -59.572 -25.861 -16.766 0.05 11.43 ? 17   HIS B CG    1  
ATOM   3069   N  ND1   A HIS B 1 18  ? -59.509 -25.850 -18.142 0.05 11.47 ? 17   HIS B ND1   1  
ATOM   3070   C  CD2   A HIS B 1 18  ? -60.888 -25.859 -16.449 0.05 11.51 ? 17   HIS B CD2   1  
ATOM   3071   C  CE1   A HIS B 1 18  ? -60.736 -25.860 -18.636 0.05 11.58 ? 17   HIS B CE1   1  
ATOM   3072   N  NE2   A HIS B 1 18  ? -61.591 -25.863 -17.629 0.05 11.61 ? 17   HIS B NE2   1  
ATOM   3073   N  N     A GLY B 1 19  ? -56.088 -23.872 -14.888 0.05 11.11 ? 18   GLY B N     1  
ATOM   3074   C  CA    A GLY B 1 19  ? -54.741 -23.656 -14.383 0.05 11.04 ? 18   GLY B CA    1  
ATOM   3075   C  C     A GLY B 1 19  ? -54.679 -22.827 -13.113 0.05 10.97 ? 18   GLY B C     1  
ATOM   3076   O  O     A GLY B 1 19  ? -53.628 -22.723 -12.483 0.05 10.92 ? 18   GLY B O     1  
ATOM   3077   N  N     A HIS B 1 20  ? -55.797 -22.224 -12.737 0.05 10.98 ? 19   HIS B N     1  
ATOM   3078   C  CA    A HIS B 1 20  ? -55.846 -21.407 -11.535 0.05 10.93 ? 19   HIS B CA    1  
ATOM   3079   C  C     A HIS B 1 20  ? -56.884 -21.928 -10.557 0.05 10.97 ? 19   HIS B C     1  
ATOM   3080   O  O     A HIS B 1 20  ? -57.134 -21.336 -9.514  0.05 10.95 ? 19   HIS B O     1  
ATOM   3081   C  CB    A HIS B 1 20  ? -56.089 -19.948 -11.899 0.05 10.91 ? 19   HIS B CB    1  
ATOM   3082   C  CG    A HIS B 1 20  ? -54.926 -19.322 -12.603 0.05 10.86 ? 19   HIS B CG    1  
ATOM   3083   N  ND1   A HIS B 1 20  ? -53.765 -18.968 -11.947 0.05 10.80 ? 19   HIS B ND1   1  
ATOM   3084   C  CD2   A HIS B 1 20  ? -54.731 -19.016 -13.907 0.05 10.86 ? 19   HIS B CD2   1  
ATOM   3085   C  CE1   A HIS B 1 20  ? -52.909 -18.462 -12.815 0.05 10.77 ? 19   HIS B CE1   1  
ATOM   3086   N  NE2   A HIS B 1 20  ? -53.471 -18.477 -14.011 0.05 10.80 ? 19   HIS B NE2   1  
ATOM   3087   N  N     A VAL B 1 21  ? -57.491 -23.052 -10.914 0.05 11.04 ? 20   VAL B N     1  
ATOM   3088   C  CA    A VAL B 1 21  ? -58.445 -23.699 -10.025 0.05 11.08 ? 20   VAL B CA    1  
ATOM   3089   C  C     A VAL B 1 21  ? -57.981 -25.114 -9.650  0.05 11.10 ? 20   VAL B C     1  
ATOM   3090   O  O     A VAL B 1 21  ? -57.973 -25.464 -8.476  0.05 11.09 ? 20   VAL B O     1  
ATOM   3091   C  CB    A VAL B 1 21  ? -59.869 -23.690 -10.602 0.05 11.17 ? 20   VAL B CB    1  
ATOM   3092   C  CG1   A VAL B 1 21  ? -60.836 -24.342 -9.622  0.05 11.22 ? 20   VAL B CG1   1  
ATOM   3093   C  CG2   A VAL B 1 21  ? -60.294 -22.250 -10.882 0.05 11.16 ? 20   VAL B CG2   1  
ATOM   3094   N  N     A ASN B 1 22  ? -57.564 -25.918 -10.625 0.05 11.13 ? 21   ASN B N     1  
ATOM   3095   C  CA    A ASN B 1 22  ? -57.003 -27.244 -10.303 0.05 11.15 ? 21   ASN B CA    1  
ATOM   3096   C  C     A ASN B 1 22  ? -55.886 -27.289 -9.238  0.05 11.09 ? 21   ASN B C     1  
ATOM   3097   O  O     A ASN B 1 22  ? -55.861 -28.212 -8.417  0.05 11.12 ? 21   ASN B O     1  
ATOM   3098   C  CB    A ASN B 1 22  ? -56.527 -27.980 -11.558 0.05 11.20 ? 21   ASN B CB    1  
ATOM   3099   C  CG    A ASN B 1 22  ? -57.671 -28.542 -12.373 0.05 11.30 ? 21   ASN B CG    1  
ATOM   3100   O  OD1   A ASN B 1 22  ? -58.767 -28.777 -11.854 0.05 11.33 ? 21   ASN B OD1   1  
ATOM   3101   N  ND2   A ASN B 1 22  ? -57.427 -28.756 -13.655 0.05 11.36 ? 21   ASN B ND2   1  
ATOM   3102   N  N     A PRO B 1 23  ? -54.947 -26.321 -9.265  0.05 11.03 ? 22   PRO B N     1  
ATOM   3103   C  CA    A PRO B 1 23  ? -53.845 -26.322 -8.296  0.05 10.98 ? 22   PRO B CA    1  
ATOM   3104   C  C     A PRO B 1 23  ? -54.223 -26.343 -6.818  0.05 10.97 ? 22   PRO B C     1  
ATOM   3105   O  O     A PRO B 1 23  ? -53.522 -26.996 -6.065  0.05 10.96 ? 22   PRO B O     1  
ATOM   3106   C  CB    A PRO B 1 23  ? -53.128 -25.007 -8.601  0.05 10.92 ? 22   PRO B CB    1  
ATOM   3107   C  CG    A PRO B 1 23  ? -53.308 -24.846 -10.070 0.05 10.94 ? 22   PRO B CG    1  
ATOM   3108   C  CD    A PRO B 1 23  ? -54.705 -25.324 -10.334 0.05 11.00 ? 22   PRO B CD    1  
ATOM   3109   N  N     A SER B 1 24  ? -55.267 -25.623 -6.407  0.05 10.97 ? 23   SER B N     1  
ATOM   3110   C  CA    A SER B 1 24  ? -55.609 -25.549 -4.990  0.05 10.96 ? 23   SER B CA    1  
ATOM   3111   C  C     A SER B 1 24  ? -56.873 -26.342 -4.679  0.05 11.02 ? 23   SER B C     1  
ATOM   3112   O  O     A SER B 1 24  ? -57.402 -26.255 -3.576  0.05 11.03 ? 23   SER B O     1  
ATOM   3113   C  CB    A SER B 1 24  ? -55.742 -24.092 -4.505  0.05 10.92 ? 23   SER B CB    1  
ATOM   3114   O  OG    A SER B 1 24  ? -56.801 -23.395 -5.149  0.05 10.95 ? 23   SER B OG    1  
ATOM   3115   N  N     A LEU B 1 25  ? -57.339 -27.092 -5.678  0.05 11.07 ? 24   LEU B N     1  
ATOM   3116   C  CA    A LEU B 1 25  ? -58.555 -27.909 -5.606  0.05 11.15 ? 24   LEU B CA    1  
ATOM   3117   C  C     A LEU B 1 25  ? -58.702 -28.643 -4.273  0.05 11.16 ? 24   LEU B C     1  
ATOM   3118   O  O     A LEU B 1 25  ? -59.639 -28.407 -3.505  0.05 11.19 ? 24   LEU B O     1  
ATOM   3119   C  CB    A LEU B 1 25  ? -58.528 -28.929 -6.758  0.05 11.20 ? 24   LEU B CB    1  
ATOM   3120   C  CG    A LEU B 1 25  ? -59.772 -29.403 -7.527  0.05 11.30 ? 24   LEU B CG    1  
ATOM   3121   C  CD1   A LEU B 1 25  ? -60.618 -28.254 -8.079  0.05 11.33 ? 24   LEU B CD1   1  
ATOM   3122   C  CD2   A LEU B 1 25  ? -59.362 -30.346 -8.663  0.05 11.35 ? 24   LEU B CD2   1  
ATOM   3123   N  N     A GLU B 1 26  ? -57.760 -29.526 -3.990  0.05 11.14 ? 25   GLU B N     1  
ATOM   3124   C  CA    A GLU B 1 26  ? -57.913 -30.409 -2.846  0.05 11.15 ? 25   GLU B CA    1  
ATOM   3125   C  C     A GLU B 1 26  ? -57.441 -29.762 -1.548  0.05 11.10 ? 25   GLU B C     1  
ATOM   3126   O  O     A GLU B 1 26  ? -57.776 -30.229 -0.462  0.05 11.12 ? 25   GLU B O     1  
ATOM   3127   C  CB    A GLU B 1 26  ? -57.239 -31.757 -3.120  0.05 11.18 ? 25   GLU B CB    1  
ATOM   3128   C  CG    A GLU B 1 26  ? -57.462 -32.240 -4.547  0.05 11.24 ? 25   GLU B CG    1  
ATOM   3129   C  CD    A GLU B 1 26  ? -58.817 -32.880 -4.738  0.05 11.32 ? 25   GLU B CD    1  
ATOM   3130   O  OE1   A GLU B 1 26  ? -59.524 -32.509 -5.699  0.05 11.36 ? 25   GLU B OE1   1  
ATOM   3131   O  OE2   A GLU B 1 26  ? -59.176 -33.750 -3.917  0.05 11.35 ? 25   GLU B OE2   1  
ATOM   3132   N  N     A VAL B 1 27  ? -56.686 -28.668 -1.646  0.05 11.05 ? 26   VAL B N     1  
ATOM   3133   C  CA    A VAL B 1 27  ? -56.465 -27.849 -0.462  0.05 11.02 ? 26   VAL B CA    1  
ATOM   3134   C  C     A VAL B 1 27  ? -57.827 -27.360 0.024   0.05 11.05 ? 26   VAL B C     1  
ATOM   3135   O  O     A VAL B 1 27  ? -58.087 -27.295 1.216   0.05 11.06 ? 26   VAL B O     1  
ATOM   3136   C  CB    A VAL B 1 27  ? -55.522 -26.638 -0.726  0.05 10.96 ? 26   VAL B CB    1  
ATOM   3137   C  CG1   A VAL B 1 27  ? -55.420 -25.756 0.502   0.05 10.95 ? 26   VAL B CG1   1  
ATOM   3138   C  CG2   A VAL B 1 27  ? -54.139 -27.116 -1.124  0.05 10.93 ? 26   VAL B CG2   1  
ATOM   3139   N  N     A ILE B 1 28  ? -58.715 -27.033 -0.909  0.05 11.08 ? 27   ILE B N     1  
ATOM   3140   C  CA    A ILE B 1 28  ? -60.022 -26.518 -0.524  0.05 11.13 ? 27   ILE B CA    1  
ATOM   3141   C  C     A ILE B 1 28  ? -60.873 -27.626 0.092   0.05 11.19 ? 27   ILE B C     1  
ATOM   3142   O  O     A ILE B 1 28  ? -61.475 -27.431 1.155   0.05 11.22 ? 27   ILE B O     1  
ATOM   3143   C  CB    A ILE B 1 28  ? -60.741 -25.860 -1.715  0.05 11.15 ? 27   ILE B CB    1  
ATOM   3144   C  CG1   A ILE B 1 28  ? -59.877 -24.707 -2.233  0.05 11.09 ? 27   ILE B CG1   1  
ATOM   3145   C  CG2   A ILE B 1 28  ? -62.141 -25.388 -1.303  0.05 11.21 ? 27   ILE B CG2   1  
ATOM   3146   C  CD1   A ILE B 1 28  ? -59.447 -23.753 -1.133  0.05 11.05 ? 27   ILE B CD1   1  
ATOM   3147   N  N     A ARG B 1 29  ? -60.894 -28.776 -0.577  0.05 11.21 ? 28   ARG B N     1  
ATOM   3148   C  CA    A ARG B 1 29  ? -61.608 -29.970 -0.108  0.05 11.27 ? 28   ARG B CA    1  
ATOM   3149   C  C     A ARG B 1 29  ? -61.170 -30.325 1.312   0.05 11.25 ? 28   ARG B C     1  
ATOM   3150   O  O     A ARG B 1 29  ? -61.996 -30.500 2.213   0.05 11.30 ? 28   ARG B O     1  
ATOM   3151   C  CB    A ARG B 1 29  ? -61.344 -31.149 -1.057  0.05 11.30 ? 28   ARG B CB    1  
ATOM   3152   C  CG    A ARG B 1 29  ? -62.304 -32.347 -0.895  0.05 11.40 ? 28   ARG B CG    1  
ATOM   3153   C  CD    A ARG B 1 29  ? -61.570 -33.696 -0.950  0.05 11.42 ? 28   ARG B CD    1  
ATOM   3154   N  NE    A ARG B 1 29  ? -61.492 -34.284 -2.282  0.05 11.47 ? 28   ARG B NE    1  
ATOM   3155   C  CZ    A ARG B 1 29  ? -62.369 -35.157 -2.767  0.05 11.57 ? 28   ARG B CZ    1  
ATOM   3156   N  NH1   A ARG B 1 29  ? -63.420 -35.524 -2.042  0.05 11.62 ? 28   ARG B NH1   1  
ATOM   3157   N  NH2   A ARG B 1 29  ? -62.210 -35.634 -3.993  0.05 11.62 ? 28   ARG B NH2   1  
ATOM   3158   N  N     A GLU B 1 30  ? -59.858 -30.393 1.509   0.05 11.19 ? 29   GLU B N     1  
ATOM   3159   C  CA    A GLU B 1 30  ? -59.287 -30.705 2.815   0.05 11.17 ? 29   GLU B CA    1  
ATOM   3160   C  C     A GLU B 1 30  ? -59.676 -29.682 3.886   0.05 11.17 ? 29   GLU B C     1  
ATOM   3161   O  O     A GLU B 1 30  ? -59.922 -30.034 5.038   0.05 11.19 ? 29   GLU B O     1  
ATOM   3162   C  CB    A GLU B 1 30  ? -57.761 -30.851 2.708   0.05 11.11 ? 29   GLU B CB    1  
ATOM   3163   C  CG    A GLU B 1 30  ? -57.048 -31.148 4.019   0.05 11.10 ? 29   GLU B CG    1  
ATOM   3164   C  CD    A GLU B 1 30  ? -57.571 -32.411 4.707   0.05 11.14 ? 29   GLU B CD    1  
ATOM   3165   O  OE1   A GLU B 1 30  ? -57.398 -32.518 5.942   0.05 11.14 ? 29   GLU B OE1   1  
ATOM   3166   O  OE2   A GLU B 1 30  ? -58.146 -33.288 4.024   0.05 11.17 ? 29   GLU B OE2   1  
ATOM   3167   N  N     A LEU B 1 31  ? -59.759 -28.412 3.511   0.05 11.15 ? 30   LEU B N     1  
ATOM   3168   C  CA    A LEU B 1 31  ? -60.166 -27.402 4.473   0.05 11.17 ? 30   LEU B CA    1  
ATOM   3169   C  C     A LEU B 1 31  ? -61.598 -27.619 4.948   0.05 11.24 ? 30   LEU B C     1  
ATOM   3170   O  O     A LEU B 1 31  ? -61.900 -27.423 6.121   0.05 11.27 ? 30   LEU B O     1  
ATOM   3171   C  CB    A LEU B 1 31  ? -60.004 -25.999 3.893   0.05 11.14 ? 30   LEU B CB    1  
ATOM   3172   C  CG    A LEU B 1 31  ? -58.532 -25.607 3.783   0.05 11.07 ? 30   LEU B CG    1  
ATOM   3173   C  CD1   A LEU B 1 31  ? -58.371 -24.435 2.824   0.05 11.05 ? 30   LEU B CD1   1  
ATOM   3174   C  CD2   A LEU B 1 31  ? -57.954 -25.276 5.158   0.05 11.08 ? 30   LEU B CD2   1  
ATOM   3175   N  N     A VAL B 1 32  ? -62.477 -28.015 4.034   0.05 11.29 ? 31   VAL B N     1  
ATOM   3176   C  CA    A VAL B 1 32  ? -63.861 -28.304 4.403   0.05 11.37 ? 31   VAL B CA    1  
ATOM   3177   C  C     A VAL B 1 32  ? -63.936 -29.631 5.171   0.05 11.39 ? 31   VAL B C     1  
ATOM   3178   O  O     A VAL B 1 32  ? -64.832 -29.826 6.002   0.05 11.46 ? 31   VAL B O     1  
ATOM   3179   C  CB    A VAL B 1 32  ? -64.783 -28.317 3.169   0.05 11.42 ? 31   VAL B CB    1  
ATOM   3180   C  CG1   A VAL B 1 32  ? -66.225 -28.643 3.554   0.05 11.53 ? 31   VAL B CG1   1  
ATOM   3181   C  CG2   A VAL B 1 32  ? -64.727 -26.968 2.485   0.05 11.40 ? 31   VAL B CG2   1  
ATOM   3182   N  N     A ALA B 1 33  ? -62.987 -30.528 4.901   0.05 11.34 ? 32   ALA B N     1  
ATOM   3183   C  CA    A ALA B 1 33  ? -62.870 -31.775 5.664   0.05 11.35 ? 32   ALA B CA    1  
ATOM   3184   C  C     A ALA B 1 33  ? -62.137 -31.592 7.002   0.05 11.33 ? 32   ALA B C     1  
ATOM   3185   O  O     A ALA B 1 33  ? -61.650 -32.559 7.596   0.05 11.34 ? 32   ALA B O     1  
ATOM   3186   C  CB    A ALA B 1 33  ? -62.196 -32.866 4.826   0.05 11.33 ? 32   ALA B CB    1  
ATOM   3187   N  N     A ARG B 1 34  ? -62.062 -30.355 7.478   0.05 11.30 ? 33   ARG B N     1  
ATOM   3188   C  CA    A ARG B 1 34  ? -61.462 -30.061 8.779   0.05 11.29 ? 33   ARG B CA    1  
ATOM   3189   C  C     A ARG B 1 34  ? -62.371 -29.186 9.642   0.05 11.34 ? 33   ARG B C     1  
ATOM   3190   O  O     A ARG B 1 34  ? -62.028 -28.830 10.776  0.05 11.34 ? 33   ARG B O     1  
ATOM   3191   C  CB    A ARG B 1 34  ? -60.095 -29.397 8.606   0.05 11.22 ? 33   ARG B CB    1  
ATOM   3192   C  CG    A ARG B 1 34  ? -59.022 -30.319 8.058   0.05 11.18 ? 33   ARG B CG    1  
ATOM   3193   C  CD    A ARG B 1 34  ? -57.718 -29.553 7.906   0.05 11.13 ? 33   ARG B CD    1  
ATOM   3194   N  NE    A ARG B 1 34  ? -56.608 -30.397 7.496   0.05 11.10 ? 33   ARG B NE    1  
ATOM   3195   C  CZ    A ARG B 1 34  ? -55.334 -30.042 7.616   0.05 11.06 ? 33   ARG B CZ    1  
ATOM   3196   N  NH1   A ARG B 1 34  ? -54.366 -30.862 7.225   0.05 11.05 ? 33   ARG B NH1   1  
ATOM   3197   N  NH2   A ARG B 1 34  ? -55.031 -28.864 8.138   0.05 11.06 ? 33   ARG B NH2   1  
ATOM   3198   N  N     A GLY B 1 35  ? -63.524 -28.819 9.090   0.05 11.40 ? 34   GLY B N     1  
ATOM   3199   C  CA    A GLY B 1 35  ? -64.564 -28.175 9.873   0.05 11.48 ? 34   GLY B CA    1  
ATOM   3200   C  C     A GLY B 1 35  ? -64.690 -26.670 9.731   0.05 11.49 ? 34   GLY B C     1  
ATOM   3201   O  O     A GLY B 1 35  ? -65.604 -26.067 10.302  0.05 11.56 ? 34   GLY B O     1  
ATOM   3202   N  N     A HIS B 1 36  ? -63.783 -26.045 8.989   0.05 11.42 ? 35   HIS B N     1  
ATOM   3203   C  CA    A HIS B 1 36  ? -63.936 -24.624 8.711   0.05 11.42 ? 35   HIS B CA    1  
ATOM   3204   C  C     A HIS B 1 36  ? -65.127 -24.462 7.784   0.05 11.49 ? 35   HIS B C     1  
ATOM   3205   O  O     A HIS B 1 36  ? -65.409 -25.355 6.986   0.05 11.50 ? 35   HIS B O     1  
ATOM   3206   C  CB    A HIS B 1 36  ? -62.695 -24.063 8.023   0.05 11.34 ? 35   HIS B CB    1  
ATOM   3207   C  CG    A HIS B 1 36  ? -61.403 -24.594 8.567   0.05 11.28 ? 35   HIS B CG    1  
ATOM   3208   N  ND1   A HIS B 1 36  ? -60.935 -24.276 9.824   0.05 11.30 ? 35   HIS B ND1   1  
ATOM   3209   C  CD2   A HIS B 1 36  ? -60.477 -25.414 8.017   0.05 11.22 ? 35   HIS B CD2   1  
ATOM   3210   C  CE1   A HIS B 1 36  ? -59.779 -24.881 10.026  0.05 11.25 ? 35   HIS B CE1   1  
ATOM   3211   N  NE2   A HIS B 1 36  ? -59.478 -25.575 8.944   0.05 11.20 ? 35   HIS B NE2   1  
ATOM   3212   N  N     A ARG B 1 37  ? -65.824 -23.333 7.869   0.05 11.54 ? 36   ARG B N     1  
ATOM   3213   C  CA    A ARG B 1 37  ? -66.827 -23.047 6.858   0.05 11.60 ? 36   ARG B CA    1  
ATOM   3214   C  C     A ARG B 1 37  ? -66.151 -22.308 5.722   0.05 11.53 ? 36   ARG B C     1  
ATOM   3215   O  O     A ARG B 1 37  ? -65.555 -21.251 5.925   0.05 11.49 ? 36   ARG B O     1  
ATOM   3216   C  CB    A ARG B 1 37  ? -67.993 -22.230 7.397   0.05 11.70 ? 36   ARG B CB    1  
ATOM   3217   C  CG    A ARG B 1 37  ? -68.935 -21.751 6.282   0.05 11.75 ? 36   ARG B CG    1  
ATOM   3218   C  CD    A ARG B 1 37  ? -70.363 -21.622 6.738   0.05 11.88 ? 36   ARG B CD    1  
ATOM   3219   N  NE    A ARG B 1 37  ? -70.588 -20.534 7.692   0.05 11.97 ? 36   ARG B NE    1  
ATOM   3220   C  CZ    A ARG B 1 37  ? -71.757 -19.913 7.814   0.05 12.07 ? 36   ARG B CZ    1  
ATOM   3221   N  NH1   A ARG B 1 37  ? -72.784 -20.284 7.060   0.05 12.09 ? 36   ARG B NH1   1  
ATOM   3222   N  NH2   A ARG B 1 37  ? -71.893 -18.923 8.690   0.05 12.16 ? 36   ARG B NH2   1  
ATOM   3223   N  N     A VAL B 1 38  ? -66.234 -22.879 4.536   0.05 11.52 ? 37   VAL B N     1  
ATOM   3224   C  CA    A VAL B 1 38  ? -65.520 -22.324 3.404   0.05 11.45 ? 37   VAL B CA    1  
ATOM   3225   C  C     A VAL B 1 38  ? -66.489 -21.789 2.364   0.05 11.51 ? 37   VAL B C     1  
ATOM   3226   O  O     A VAL B 1 38  ? -67.334 -22.521 1.852   0.05 11.56 ? 37   VAL B O     1  
ATOM   3227   C  CB    A VAL B 1 38  ? -64.573 -23.366 2.781   0.05 11.38 ? 37   VAL B CB    1  
ATOM   3228   C  CG1   A VAL B 1 38  ? -63.842 -22.796 1.579   0.05 11.31 ? 37   VAL B CG1   1  
ATOM   3229   C  CG2   A VAL B 1 38  ? -63.573 -23.854 3.834   0.05 11.33 ? 37   VAL B CG2   1  
ATOM   3230   N  N     A THR B 1 39  ? -66.374 -20.493 2.082   0.05 11.50 ? 38   THR B N     1  
ATOM   3231   C  CA    A THR B 1 39  ? -67.047 -19.902 0.933   0.05 11.54 ? 38   THR B CA    1  
ATOM   3232   C  C     A THR B 1 39  ? -66.016 -19.698 -0.157  0.05 11.44 ? 38   THR B C     1  
ATOM   3233   O  O     A THR B 1 39  ? -64.821 -19.574 0.120   0.05 11.36 ? 38   THR B O     1  
ATOM   3234   C  CB    A THR B 1 39  ? -67.687 -18.554 1.266   0.05 11.60 ? 38   THR B CB    1  
ATOM   3235   O  OG1   A THR B 1 39  ? -66.695 -17.661 1.787   0.05 11.57 ? 38   THR B OG1   1  
ATOM   3236   C  CG2   A THR B 1 39  ? -68.799 -18.740 2.297   0.05 11.73 ? 38   THR B CG2   1  
ATOM   3237   N  N     A TYR B 1 40  ? -66.482 -19.661 -1.397  0.05 11.46 ? 39   TYR B N     1  
ATOM   3238   C  CA    A TYR B 1 40  ? -65.577 -19.586 -2.537  0.05 11.39 ? 39   TYR B CA    1  
ATOM   3239   C  C     A TYR B 1 40  ? -66.195 -18.665 -3.568  0.05 11.43 ? 39   TYR B C     1  
ATOM   3240   O  O     A TYR B 1 40  ? -67.149 -19.045 -4.257  0.05 11.50 ? 39   TYR B O     1  
ATOM   3241   C  CB    A TYR B 1 40  ? -65.362 -20.983 -3.127  0.05 11.38 ? 39   TYR B CB    1  
ATOM   3242   C  CG    A TYR B 1 40  ? -64.128 -21.158 -3.997  0.05 11.30 ? 39   TYR B CG    1  
ATOM   3243   C  CD1   A TYR B 1 40  ? -63.725 -20.175 -4.896  0.05 11.26 ? 39   TYR B CD1   1  
ATOM   3244   C  CD2   A TYR B 1 40  ? -63.377 -22.333 -3.933  0.05 11.26 ? 39   TYR B CD2   1  
ATOM   3245   C  CE1   A TYR B 1 40  ? -62.606 -20.350 -5.696  0.05 11.20 ? 39   TYR B CE1   1  
ATOM   3246   C  CE2   A TYR B 1 40  ? -62.254 -22.516 -4.725  0.05 11.19 ? 39   TYR B CE2   1  
ATOM   3247   C  CZ    A TYR B 1 40  ? -61.872 -21.517 -5.608  0.05 11.16 ? 39   TYR B CZ    1  
ATOM   3248   O  OH    A TYR B 1 40  ? -60.758 -21.690 -6.402  0.05 11.11 ? 39   TYR B OH    1  
ATOM   3249   N  N     A ALA B 1 41  ? -65.657 -17.453 -3.663  0.05 11.39 ? 40   ALA B N     1  
ATOM   3250   C  CA    A ALA B 1 41  ? -66.141 -16.497 -4.649  0.05 11.43 ? 40   ALA B CA    1  
ATOM   3251   C  C     A ALA B 1 41  ? -65.654 -16.918 -6.024  0.05 11.38 ? 40   ALA B C     1  
ATOM   3252   O  O     A ALA B 1 41  ? -64.459 -17.054 -6.250  0.05 11.29 ? 40   ALA B O     1  
ATOM   3253   C  CB    A ALA B 1 41  ? -65.683 -15.084 -4.307  0.05 11.40 ? 40   ALA B CB    1  
ATOM   3254   N  N     A ILE B 1 42  ? -66.591 -17.131 -6.947  0.05 11.46 ? 41   ILE B N     1  
ATOM   3255   C  CA    A ILE B 1 42  ? -66.276 -17.773 -8.220  0.05 11.44 ? 41   ILE B CA    1  
ATOM   3256   C  C     A ILE B 1 42  ? -67.295 -17.385 -9.298  0.05 11.53 ? 41   ILE B C     1  
ATOM   3257   O  O     A ILE B 1 42  ? -68.471 -17.194 -8.991  0.05 11.63 ? 41   ILE B O     1  
ATOM   3258   C  CB    A ILE B 1 42  ? -66.251 -19.312 -8.041  0.05 11.45 ? 41   ILE B CB    1  
ATOM   3259   C  CG1   A ILE B 1 42  ? -65.563 -20.002 -9.222  0.05 11.42 ? 41   ILE B CG1   1  
ATOM   3260   C  CG2   A ILE B 1 42  ? -67.660 -19.861 -7.781  0.05 11.57 ? 41   ILE B CG2   1  
ATOM   3261   C  CD1   A ILE B 1 42  ? -64.043 -19.834 -9.215  0.05 11.31 ? 41   ILE B CD1   1  
ATOM   3262   N  N     A PRO B 1 43  ? -66.852 -17.238 -10.560 0.05 11.51 ? 42   PRO B N     1  
ATOM   3263   C  CA    A PRO B 1 43  ? -67.852 -16.983 -11.606 0.05 11.61 ? 42   PRO B CA    1  
ATOM   3264   C  C     A PRO B 1 43  ? -68.740 -18.216 -11.780 0.05 11.71 ? 42   PRO B C     1  
ATOM   3265   O  O     A PRO B 1 43  ? -68.260 -19.315 -11.507 0.05 11.68 ? 42   PRO B O     1  
ATOM   3266   C  CB    A PRO B 1 43  ? -66.992 -16.723 -12.851 0.05 11.55 ? 42   PRO B CB    1  
ATOM   3267   C  CG    A PRO B 1 43  ? -65.703 -16.205 -12.300 0.05 11.43 ? 42   PRO B CG    1  
ATOM   3268   C  CD    A PRO B 1 43  ? -65.481 -17.052 -11.069 0.05 11.40 ? 42   PRO B CD    1  
ATOM   3269   N  N     A PRO B 1 44  ? -70.002 -18.030 -12.214 0.05 11.83 ? 43   PRO B N     1  
ATOM   3270   C  CA    A PRO B 1 44  ? -71.044 -19.063 -12.117 0.05 11.95 ? 43   PRO B CA    1  
ATOM   3271   C  C     A PRO B 1 44  ? -70.749 -20.332 -12.900 0.05 11.96 ? 43   PRO B C     1  
ATOM   3272   O  O     A PRO B 1 44  ? -71.255 -21.395 -12.512 0.05 12.02 ? 43   PRO B O     1  
ATOM   3273   C  CB    A PRO B 1 44  ? -72.296 -18.370 -12.687 0.05 12.08 ? 43   PRO B CB    1  
ATOM   3274   C  CG    A PRO B 1 44  ? -72.001 -16.899 -12.620 0.05 12.03 ? 43   PRO B CG    1  
ATOM   3275   C  CD    A PRO B 1 44  ? -70.516 -16.788 -12.823 0.05 11.88 ? 43   PRO B CD    1  
ATOM   3276   N  N     A VAL B 1 45  ? -69.958 -20.251 -13.968 0.05 11.90 ? 44   VAL B N     1  
ATOM   3277   C  CA    A VAL B 1 45  ? -69.666 -21.465 -14.723 0.05 11.92 ? 44   VAL B CA    1  
ATOM   3278   C  C     A VAL B 1 45  ? -68.955 -22.492 -13.853 0.05 11.86 ? 44   VAL B C     1  
ATOM   3279   O  O     A VAL B 1 45  ? -69.253 -23.688 -13.927 0.05 11.92 ? 44   VAL B O     1  
ATOM   3280   C  CB    A VAL B 1 45  ? -68.832 -21.196 -15.991 0.05 11.87 ? 44   VAL B CB    1  
ATOM   3281   C  CG1   A VAL B 1 45  ? -67.676 -20.257 -15.687 0.05 11.74 ? 44   VAL B CG1   1  
ATOM   3282   C  CG2   A VAL B 1 45  ? -68.324 -22.523 -16.579 0.05 11.88 ? 44   VAL B CG2   1  
ATOM   3283   N  N     A PHE B 1 46  ? -68.020 -22.022 -13.025 0.05 11.74 ? 45   PHE B N     1  
ATOM   3284   C  CA    A PHE B 1 46  ? -67.250 -22.924 -12.162 0.05 11.68 ? 45   PHE B CA    1  
ATOM   3285   C  C     A PHE B 1 46  ? -67.911 -23.186 -10.808 0.05 11.71 ? 45   PHE B C     1  
ATOM   3286   O  O     A PHE B 1 46  ? -67.250 -23.686 -9.887  0.05 11.65 ? 45   PHE B O     1  
ATOM   3287   C  CB    A PHE B 1 46  ? -65.820 -22.397 -11.932 0.05 11.54 ? 45   PHE B CB    1  
ATOM   3288   C  CG    A PHE B 1 46  ? -64.779 -22.975 -12.869 0.05 11.51 ? 45   PHE B CG    1  
ATOM   3289   C  CD1   A PHE B 1 46  ? -65.134 -23.808 -13.919 0.05 11.59 ? 45   PHE B CD1   1  
ATOM   3290   C  CD2   A PHE B 1 46  ? -63.433 -22.687 -12.682 0.05 11.40 ? 45   PHE B CD2   1  
ATOM   3291   C  CE1   A PHE B 1 46  ? -64.162 -24.325 -14.772 0.05 11.57 ? 45   PHE B CE1   1  
ATOM   3292   C  CE2   A PHE B 1 46  ? -62.460 -23.210 -13.522 0.05 11.37 ? 45   PHE B CE2   1  
ATOM   3293   C  CZ    A PHE B 1 46  ? -62.821 -24.028 -14.565 0.05 11.46 ? 45   PHE B CZ    1  
ATOM   3294   N  N     A ALA B 1 47  ? -69.195 -22.857 -10.674 0.05 11.81 ? 46   ALA B N     1  
ATOM   3295   C  CA    A ALA B 1 47  ? -69.899 -23.092 -9.414  0.05 11.85 ? 46   ALA B CA    1  
ATOM   3296   C  C     A ALA B 1 47  ? -69.937 -24.567 -9.015  0.05 11.88 ? 46   ALA B C     1  
ATOM   3297   O  O     A ALA B 1 47  ? -69.580 -24.911 -7.893  0.05 11.83 ? 46   ALA B O     1  
ATOM   3298   C  CB    A ALA B 1 47  ? -71.305 -22.513 -9.449  0.05 11.97 ? 46   ALA B CB    1  
ATOM   3299   N  N     A ASP B 1 48  ? -70.377 -25.431 -9.929  0.05 11.97 ? 47   ASP B N     1  
ATOM   3300   C  CA    A ASP B 1 48  ? -70.439 -26.870 -9.644  0.05 12.01 ? 47   ASP B CA    1  
ATOM   3301   C  C     A ASP B 1 48  ? -69.051 -27.407 -9.322  0.05 11.90 ? 47   ASP B C     1  
ATOM   3302   O  O     A ASP B 1 48  ? -68.880 -28.238 -8.425  0.05 11.88 ? 47   ASP B O     1  
ATOM   3303   C  CB    A ASP B 1 48  ? -71.005 -27.642 -10.839 0.05 12.15 ? 47   ASP B CB    1  
ATOM   3304   C  CG    A ASP B 1 48  ? -72.500 -27.859 -10.736 0.05 12.29 ? 47   ASP B CG    1  
ATOM   3305   O  OD1   A ASP B 1 48  ? -72.965 -28.980 -11.055 0.05 12.41 ? 47   ASP B OD1   1  
ATOM   3306   O  OD2   A ASP B 1 48  ? -73.204 -26.916 -10.321 0.05 12.28 ? 47   ASP B OD2   1  
ATOM   3307   N  N     A LYS B 1 49  ? -68.076 -26.930 -10.083 0.05 11.82 ? 48   LYS B N     1  
ATOM   3308   C  CA    A LYS B 1 49  ? -66.687 -27.339 -9.924  0.05 11.72 ? 48   LYS B CA    1  
ATOM   3309   C  C     A LYS B 1 49  ? -66.180 -27.117 -8.506  0.05 11.63 ? 48   LYS B C     1  
ATOM   3310   O  O     A LYS B 1 49  ? -65.653 -28.035 -7.863  0.05 11.60 ? 48   LYS B O     1  
ATOM   3311   C  CB    A LYS B 1 49  ? -65.791 -26.581 -10.909 0.05 11.66 ? 48   LYS B CB    1  
ATOM   3312   C  CG    A LYS B 1 49  ? -64.322 -26.784 -10.624 0.05 11.56 ? 48   LYS B CG    1  
ATOM   3313   C  CD    A LYS B 1 49  ? -63.442 -26.213 -11.732 0.05 11.50 ? 48   LYS B CD    1  
ATOM   3314   C  CE    A LYS B 1 49  ? -62.110 -26.940 -11.767 0.05 11.45 ? 48   LYS B CE    1  
ATOM   3315   N  NZ    A LYS B 1 49  ? -62.281 -28.390 -12.048 0.05 11.54 ? 48   LYS B NZ    1  
ATOM   3316   N  N     A VAL B 1 50  ? -66.336 -25.897 -8.009  0.05 11.60 ? 49   VAL B N     1  
ATOM   3317   C  CA    A VAL B 1 50  ? -65.837 -25.606 -6.674  0.05 11.53 ? 49   VAL B CA    1  
ATOM   3318   C  C     A VAL B 1 50  ? -66.690 -26.272 -5.595  0.05 11.59 ? 49   VAL B C     1  
ATOM   3319   O  O     A VAL B 1 50  ? -66.152 -26.798 -4.624  0.05 11.55 ? 49   VAL B O     1  
ATOM   3320   C  CB    A VAL B 1 50  ? -65.682 -24.092 -6.397  0.05 11.48 ? 49   VAL B CB    1  
ATOM   3321   C  CG1   A VAL B 1 50  ? -64.466 -23.532 -7.140  0.05 11.39 ? 49   VAL B CG1   1  
ATOM   3322   C  CG2   A VAL B 1 50  ? -66.933 -23.330 -6.771  0.05 11.56 ? 49   VAL B CG2   1  
ATOM   3323   N  N     A ALA B 1 51  ? -68.008 -26.278 -5.788  0.05 11.70 ? 50   ALA B N     1  
ATOM   3324   C  CA    A ALA B 1 51  ? -68.940 -26.686 -4.735  0.05 11.77 ? 50   ALA B CA    1  
ATOM   3325   C  C     A ALA B 1 51  ? -68.808 -28.158 -4.373  0.05 11.78 ? 50   ALA B C     1  
ATOM   3326   O  O     A ALA B 1 51  ? -69.184 -28.568 -3.266  0.05 11.81 ? 50   ALA B O     1  
ATOM   3327   C  CB    A ALA B 1 51  ? -70.374 -26.369 -5.135  0.05 11.90 ? 50   ALA B CB    1  
ATOM   3328   N  N     A ALA B 1 52  ? -68.299 -28.942 -5.321  0.05 11.77 ? 51   ALA B N     1  
ATOM   3329   C  CA    A ALA B 1 52  ? -67.978 -30.343 -5.084  0.05 11.79 ? 51   ALA B CA    1  
ATOM   3330   C  C     A ALA B 1 52  ? -67.254 -30.481 -3.755  0.05 11.71 ? 51   ALA B C     1  
ATOM   3331   O  O     A ALA B 1 52  ? -67.679 -31.242 -2.883  0.05 11.74 ? 51   ALA B O     1  
ATOM   3332   C  CB    A ALA B 1 52  ? -67.114 -30.885 -6.225  0.05 11.78 ? 51   ALA B CB    1  
ATOM   3333   N  N     A THR B 1 53  ? -66.188 -29.701 -3.583  0.05 11.61 ? 52   THR B N     1  
ATOM   3334   C  CA    A THR B 1 53  ? -65.337 -29.804 -2.398  0.05 11.54 ? 52   THR B CA    1  
ATOM   3335   C  C     A THR B 1 53  ? -66.090 -29.538 -1.094  0.05 11.56 ? 52   THR B C     1  
ATOM   3336   O  O     A THR B 1 53  ? -65.523 -29.659 -0.006  0.05 11.50 ? 52   THR B O     1  
ATOM   3337   C  CB    A THR B 1 53  ? -64.181 -28.800 -2.472  0.05 11.44 ? 52   THR B CB    1  
ATOM   3338   O  OG1   A THR B 1 53  ? -64.707 -27.473 -2.348  0.05 11.43 ? 52   THR B OG1   1  
ATOM   3339   C  CG2   A THR B 1 53  ? -63.450 -28.906 -3.796  0.05 11.43 ? 52   THR B CG2   1  
ATOM   3340   N  N     A GLY B 1 54  ? -67.361 -29.163 -1.210  0.05 11.64 ? 53   GLY B N     1  
ATOM   3341   C  CA    A GLY B 1 54  ? -68.165 -28.838 -0.048  0.05 11.68 ? 53   GLY B CA    1  
ATOM   3342   C  C     A GLY B 1 54  ? -68.180 -27.350 0.271   0.05 11.66 ? 53   GLY B C     1  
ATOM   3343   O  O     A GLY B 1 54  ? -68.977 -26.900 1.087   0.05 11.73 ? 53   GLY B O     1  
ATOM   3344   N  N     A ALA B 1 55  ? -67.292 -26.586 -0.361  0.05 11.58 ? 54   ALA B N     1  
ATOM   3345   C  CA    A ALA B 1 55  ? -67.289 -25.137 -0.185  0.05 11.57 ? 54   ALA B CA    1  
ATOM   3346   C  C     A ALA B 1 55  ? -68.571 -24.562 -0.779  0.05 11.67 ? 54   ALA B C     1  
ATOM   3347   O  O     A ALA B 1 55  ? -69.115 -25.118 -1.727  0.05 11.72 ? 54   ALA B O     1  
ATOM   3348   C  CB    A ALA B 1 55  ? -66.049 -24.511 -0.858  0.05 11.47 ? 54   ALA B CB    1  
ATOM   3349   N  N     A ARG B 1 56  ? -69.067 -23.459 -0.222  0.05 11.71 ? 55   ARG B N     1  
ATOM   3350   C  CA    A ARG B 1 56  ? -70.251 -22.829 -0.797  0.05 11.81 ? 55   ARG B CA    1  
ATOM   3351   C  C     A ARG B 1 56  ? -69.835 -21.770 -1.795  0.05 11.77 ? 55   ARG B C     1  
ATOM   3352   O  O     A ARG B 1 56  ? -69.054 -20.881 -1.474  0.05 11.70 ? 55   ARG B O     1  
ATOM   3353   C  CB    A ARG B 1 56  ? -71.170 -22.202 0.257   0.05 11.90 ? 55   ARG B CB    1  
ATOM   3354   C  CG    A ARG B 1 56  ? -72.322 -21.426 -0.400  0.05 12.00 ? 55   ARG B CG    1  
ATOM   3355   C  CD    A ARG B 1 56  ? -73.421 -21.039 0.569   0.05 12.11 ? 55   ARG B CD    1  
ATOM   3356   N  NE    A ARG B 1 56  ? -72.939 -20.233 1.684   0.05 12.07 ? 55   ARG B NE    1  
ATOM   3357   C  CZ    A ARG B 1 56  ? -72.786 -18.911 1.650   0.05 12.06 ? 55   ARG B CZ    1  
ATOM   3358   N  NH1   A ARG B 1 56  ? -73.058 -18.229 0.543   0.05 12.09 ? 55   ARG B NH1   1  
ATOM   3359   N  NH2   A ARG B 1 56  ? -72.354 -18.272 2.727   0.05 12.03 ? 55   ARG B NH2   1  
ATOM   3360   N  N     A PRO B 1 57  ? -70.354 -21.860 -3.019  0.05 11.81 ? 56   PRO B N     1  
ATOM   3361   C  CA    A PRO B 1 57  ? -69.944 -20.829 -3.972  0.05 11.77 ? 56   PRO B CA    1  
ATOM   3362   C  C     A PRO B 1 57  ? -70.594 -19.497 -3.641  0.05 11.82 ? 56   PRO B C     1  
ATOM   3363   O  O     A PRO B 1 57  ? -71.722 -19.456 -3.135  0.05 11.93 ? 56   PRO B O     1  
ATOM   3364   C  CB    A PRO B 1 57  ? -70.470 -21.357 -5.314  0.05 11.83 ? 56   PRO B CB    1  
ATOM   3365   C  CG    A PRO B 1 57  ? -70.747 -22.824 -5.085  0.05 11.86 ? 56   PRO B CG    1  
ATOM   3366   C  CD    A PRO B 1 57  ? -71.143 -22.933 -3.651  0.05 11.89 ? 56   PRO B CD    1  
ATOM   3367   N  N     A VAL B 1 58  ? -69.867 -18.421 -3.923  0.05 11.75 ? 57   VAL B N     1  
ATOM   3368   C  CA    A VAL B 1 58  ? -70.398 -17.074 -3.849  0.05 11.80 ? 57   VAL B CA    1  
ATOM   3369   C  C     A VAL B 1 58  ? -70.173 -16.481 -5.227  0.05 11.78 ? 57   VAL B C     1  
ATOM   3370   O  O     A VAL B 1 58  ? -69.091 -15.978 -5.519  0.05 11.68 ? 57   VAL B O     1  
ATOM   3371   C  CB    A VAL B 1 58  ? -69.657 -16.239 -2.786  0.05 11.74 ? 57   VAL B CB    1  
ATOM   3372   C  CG1   A VAL B 1 58  ? -70.188 -14.815 -2.742  0.05 11.78 ? 57   VAL B CG1   1  
ATOM   3373   C  CG2   A VAL B 1 58  ? -69.780 -16.888 -1.420  0.05 11.78 ? 57   VAL B CG2   1  
ATOM   3374   N  N     A LEU B 1 59  ? -71.191 -16.562 -6.079  0.05 11.89 ? 58   LEU B N     1  
ATOM   3375   C  CA    A LEU B 1 59  ? -71.046 -16.248 -7.503  0.05 11.88 ? 58   LEU B CA    1  
ATOM   3376   C  C     A LEU B 1 59  ? -70.817 -14.769 -7.805  0.05 11.88 ? 58   LEU B C     1  
ATOM   3377   O  O     A LEU B 1 59  ? -71.277 -13.888 -7.072  0.05 11.96 ? 58   LEU B O     1  
ATOM   3378   C  CB    A LEU B 1 59  ? -72.273 -16.750 -8.272  0.05 12.01 ? 58   LEU B CB    1  
ATOM   3379   C  CG    A LEU B 1 59  ? -73.211 -17.653 -7.465  0.05 12.14 ? 58   LEU B CG    1  
ATOM   3380   C  CD1   A LEU B 1 59  ? -74.262 -16.817 -6.734  0.05 12.23 ? 58   LEU B CD1   1  
ATOM   3381   C  CD2   A LEU B 1 59  ? -73.882 -18.643 -8.374  0.05 12.25 ? 58   LEU B CD2   1  
ATOM   3382   N  N     A TYR B 1 60  ? -70.091 -14.506 -8.888  0.05 11.79 ? 59   TYR B N     1  
ATOM   3383   C  CA    A TYR B 1 60  ? -69.918 -13.136 -9.364  0.05 11.78 ? 59   TYR B CA    1  
ATOM   3384   C  C     A TYR B 1 60  ? -69.728 -13.073 -10.877 0.05 11.76 ? 59   TYR B C     1  
ATOM   3385   O  O     A TYR B 1 60  ? -69.295 -14.047 -11.498 0.05 11.72 ? 59   TYR B O     1  
ATOM   3386   C  CB    A TYR B 1 60  ? -68.776 -12.425 -8.618  0.05 11.67 ? 59   TYR B CB    1  
ATOM   3387   C  CG    A TYR B 1 60  ? -67.360 -12.853 -8.971  0.05 11.54 ? 59   TYR B CG    1  
ATOM   3388   C  CD1   A TYR B 1 60  ? -66.768 -13.957 -8.364  0.05 11.48 ? 59   TYR B CD1   1  
ATOM   3389   C  CD2   A TYR B 1 60  ? -66.594 -12.115 -9.870  0.05 11.48 ? 59   TYR B CD2   1  
ATOM   3390   C  CE1   A TYR B 1 60  ? -65.462 -14.328 -8.666  0.05 11.37 ? 59   TYR B CE1   1  
ATOM   3391   C  CE2   A TYR B 1 60  ? -65.289 -12.484 -10.182 0.05 11.37 ? 59   TYR B CE2   1  
ATOM   3392   C  CZ    A TYR B 1 60  ? -64.729 -13.594 -9.582  0.05 11.32 ? 59   TYR B CZ    1  
ATOM   3393   O  OH    A TYR B 1 60  ? -63.429 -13.948 -9.902  0.05 11.23 ? 59   TYR B OH    1  
ATOM   3394   N  N     A HIS B 1 61  ? -70.079 -11.925 -11.458 0.05 11.80 ? 60   HIS B N     1  
ATOM   3395   C  CA    A HIS B 1 61  ? -69.926 -11.668 -12.882 0.05 11.78 ? 60   HIS B CA    1  
ATOM   3396   C  C     A HIS B 1 61  ? -68.475 -11.324 -13.237 0.05 11.64 ? 60   HIS B C     1  
ATOM   3397   O  O     A HIS B 1 61  ? -67.942 -10.310 -12.766 0.05 11.59 ? 60   HIS B O     1  
ATOM   3398   C  CB    A HIS B 1 61  ? -70.846 -10.507 -13.298 0.05 11.89 ? 60   HIS B CB    1  
ATOM   3399   C  CG    A HIS B 1 61  ? -70.891 -10.260 -14.774 0.05 11.87 ? 60   HIS B CG    1  
ATOM   3400   N  ND1   A HIS B 1 61  ? -71.726 -10.959 -15.620 0.05 11.92 ? 60   HIS B ND1   1  
ATOM   3401   C  CD2   A HIS B 1 61  ? -70.210 -9.386  -15.554 0.05 11.81 ? 60   HIS B CD2   1  
ATOM   3402   C  CE1   A HIS B 1 61  ? -71.561 -10.523 -16.857 0.05 11.89 ? 60   HIS B CE1   1  
ATOM   3403   N  NE2   A HIS B 1 61  ? -70.640 -9.575  -16.845 0.05 11.82 ? 60   HIS B NE2   1  
ATOM   3404   N  N     A SER B 1 62  ? -67.854 -12.165 -14.071 0.05 11.59 ? 61   SER B N     1  
ATOM   3405   C  CA    A SER B 1 62  ? -66.500 -11.942 -14.563 0.05 11.47 ? 61   SER B CA    1  
ATOM   3406   C  C     A SER B 1 62  ? -66.560 -11.468 -16.004 0.05 11.48 ? 61   SER B C     1  
ATOM   3407   O  O     A SER B 1 62  ? -67.554 -11.701 -16.699 0.05 11.57 ? 61   SER B O     1  
ATOM   3408   C  CB    A SER B 1 62  ? -65.677 -13.237 -14.501 0.05 11.40 ? 61   SER B CB    1  
ATOM   3409   O  OG    A SER B 1 62  ? -65.265 -13.644 -15.804 0.05 11.32 ? 61   SER B OG    1  
ATOM   3410   N  N     A THR B 1 63  ? -65.493 -10.818 -16.453 0.05 11.38 ? 62   THR B N     1  
ATOM   3411   C  CA    A THR B 1 63  ? -65.384 -10.372 -17.838 0.05 11.38 ? 62   THR B CA    1  
ATOM   3412   C  C     A THR B 1 63  ? -64.120 -10.931 -18.506 0.05 11.31 ? 62   THR B C     1  
ATOM   3413   O  O     A THR B 1 63  ? -63.789 -10.565 -19.632 0.05 11.31 ? 62   THR B O     1  
ATOM   3414   C  CB    A THR B 1 63  ? -65.359 -8.838  -17.929 0.05 11.36 ? 62   THR B CB    1  
ATOM   3415   O  OG1   A THR B 1 63  ? -64.176 -8.351  -17.284 0.05 11.25 ? 62   THR B OG1   1  
ATOM   3416   C  CG2   A THR B 1 63  ? -66.584 -8.240  -17.247 0.05 11.46 ? 62   THR B CG2   1  
ATOM   3417   N  N     A LEU B 1 64  ? -63.410 -11.819 -17.808 0.05 11.25 ? 63   LEU B N     1  
ATOM   3418   C  CA    A LEU B 1 64  ? -62.239 -12.479 -18.380 0.05 11.19 ? 63   LEU B CA    1  
ATOM   3419   C  C     A LEU B 1 64  ? -62.641 -13.520 -19.400 0.05 11.26 ? 63   LEU B C     1  
ATOM   3420   O  O     A LEU B 1 64  ? -63.781 -13.974 -19.393 0.05 11.36 ? 63   LEU B O     1  
ATOM   3421   C  CB    A LEU B 1 64  ? -61.428 -13.166 -17.285 0.05 11.13 ? 63   LEU B CB    1  
ATOM   3422   C  CG    A LEU B 1 64  ? -60.924 -12.294 -16.145 0.05 11.06 ? 63   LEU B CG    1  
ATOM   3423   C  CD1   A LEU B 1 64  ? -60.344 -13.151 -15.031 0.05 11.02 ? 63   LEU B CD1   1  
ATOM   3424   C  CD2   A LEU B 1 64  ? -59.872 -11.338 -16.670 0.05 10.99 ? 63   LEU B CD2   1  
ATOM   3425   N  N     A PRO B 1 65  ? -61.704 -13.906 -20.287 0.05 11.23 ? 64   PRO B N     1  
ATOM   3426   C  CA    A PRO B 1 65  ? -61.994 -15.055 -21.143 0.05 11.31 ? 64   PRO B CA    1  
ATOM   3427   C  C     A PRO B 1 65  ? -62.312 -16.235 -20.252 0.05 11.35 ? 64   PRO B C     1  
ATOM   3428   O  O     A PRO B 1 65  ? -61.713 -16.358 -19.185 0.05 11.29 ? 64   PRO B O     1  
ATOM   3429   C  CB    A PRO B 1 65  ? -60.669 -15.303 -21.862 0.05 11.26 ? 64   PRO B CB    1  
ATOM   3430   C  CG    A PRO B 1 65  ? -59.978 -13.981 -21.865 0.05 11.16 ? 64   PRO B CG    1  
ATOM   3431   C  CD    A PRO B 1 65  ? -60.388 -13.308 -20.582 0.05 11.13 ? 64   PRO B CD    1  
ATOM   3432   N  N     A GLY B 1 66  ? -63.243 -17.082 -20.669 0.05 11.46 ? 65   GLY B N     1  
ATOM   3433   C  CA    A GLY B 1 66  ? -63.630 -18.217 -19.852 0.05 11.51 ? 65   GLY B CA    1  
ATOM   3434   C  C     A GLY B 1 66  ? -62.503 -19.214 -19.669 0.05 11.48 ? 65   GLY B C     1  
ATOM   3435   O  O     A GLY B 1 66  ? -61.345 -18.910 -19.955 0.05 11.44 ? 65   GLY B O     1  
ATOM   3436   N  N     A PRO B 1 67  ? -62.837 -20.411 -19.171 0.05 11.50 ? 66   PRO B N     1  
ATOM   3437   C  CA    A PRO B 1 67  ? -61.892 -21.526 -19.023 0.05 11.47 ? 66   PRO B CA    1  
ATOM   3438   C  C     A PRO B 1 67  ? -61.660 -22.270 -20.336 0.05 11.52 ? 66   PRO B C     1  
ATOM   3439   O  O     A PRO B 1 67  ? -60.607 -22.910 -20.527 0.05 11.48 ? 66   PRO B O     1  
ATOM   3440   C  CB    A PRO B 1 67  ? -62.609 -22.448 -18.035 0.05 11.52 ? 66   PRO B CB    1  
ATOM   3441   C  CG    A PRO B 1 67  ? -64.048 -22.187 -18.257 0.05 11.61 ? 66   PRO B CG    1  
ATOM   3442   C  CD    A PRO B 1 67  ? -64.165 -20.734 -18.619 0.05 11.57 ? 66   PRO B CD    1  
ATOM   3443   N  N     A ASP B 1 68  ? -62.641 -22.168 -21.231 0.05 11.63 ? 67   ASP B N     1  
ATOM   3444   C  CA    A ASP B 1 68  ? -62.685 -22.939 -22.475 0.05 11.71 ? 67   ASP B CA    1  
ATOM   3445   C  C     A ASP B 1 68  ? -62.023 -22.237 -23.666 0.05 11.67 ? 67   ASP B C     1  
ATOM   3446   O  O     A ASP B 1 68  ? -62.169 -22.674 -24.812 0.05 11.74 ? 67   ASP B O     1  
ATOM   3447   C  CB    A ASP B 1 68  ? -64.145 -23.223 -22.843 0.05 11.86 ? 67   ASP B CB    1  
ATOM   3448   C  CG    A ASP B 1 68  ? -64.859 -24.102 -21.828 0.05 11.91 ? 67   ASP B CG    1  
ATOM   3449   O  OD1   A ASP B 1 68  ? -64.194 -24.921 -21.150 0.05 11.85 ? 67   ASP B OD1   1  
ATOM   3450   O  OD2   A ASP B 1 68  ? -66.107 -23.992 -21.731 0.05 12.01 ? 67   ASP B OD2   1  
ATOM   3451   N  N     A ALA B 1 69  ? -61.296 -21.159 -23.399 0.05 11.58 ? 68   ALA B N     1  
ATOM   3452   C  CA    A ALA B 1 69  ? -60.930 -20.191 -24.439 0.05 11.55 ? 68   ALA B CA    1  
ATOM   3453   C  C     A ALA B 1 69  ? -59.874 -20.632 -25.451 0.05 11.54 ? 68   ALA B C     1  
ATOM   3454   O  O     A ALA B 1 69  ? -59.367 -21.750 -25.413 0.05 11.52 ? 68   ALA B O     1  
ATOM   3455   C  CB    A ALA B 1 69  ? -60.525 -18.863 -23.799 0.05 11.44 ? 68   ALA B CB    1  
ATOM   3456   N  N     A ASP B 1 70  ? -59.565 -19.731 -26.378 0.05 11.57 ? 69   ASP B N     1  
ATOM   3457   C  CA    A ASP B 1 70  ? -58.432 -19.924 -27.271 0.05 11.56 ? 69   ASP B CA    1  
ATOM   3458   C  C     A ASP B 1 70  ? -57.261 -19.225 -26.587 0.05 11.42 ? 69   ASP B C     1  
ATOM   3459   O  O     A ASP B 1 70  ? -57.460 -18.468 -25.648 0.05 11.36 ? 69   ASP B O     1  
ATOM   3460   N  N     A PRO B 1 71  ? -56.033 -19.505 -27.021 0.05 11.38 ? 70   PRO B N     1  
ATOM   3461   C  CA    A PRO B 1 71  ? -54.943 -18.662 -26.516 0.05 11.25 ? 70   PRO B CA    1  
ATOM   3462   C  C     A PRO B 1 71  ? -55.046 -17.245 -27.087 0.05 11.21 ? 70   PRO B C     1  
ATOM   3463   O  O     A PRO B 1 71  ? -54.789 -16.256 -26.381 0.05 11.12 ? 70   PRO B O     1  
ATOM   3464   C  CB    A PRO B 1 71  ? -53.681 -19.386 -27.009 0.05 11.24 ? 70   PRO B CB    1  
ATOM   3465   C  CG    A PRO B 1 71  ? -54.155 -20.336 -28.069 0.05 11.35 ? 70   PRO B CG    1  
ATOM   3466   C  CD    A PRO B 1 71  ? -55.542 -20.711 -27.703 0.05 11.44 ? 70   PRO B CD    1  
ATOM   3467   N  N     A GLU B 1 72  ? -55.459 -17.165 -28.348 0.05 11.29 ? 71   GLU B N     1  
ATOM   3468   C  CA    A GLU B 1 72  ? -55.621 -15.909 -29.068 0.05 11.26 ? 71   GLU B CA    1  
ATOM   3469   C  C     A GLU B 1 72  ? -56.357 -14.840 -28.254 0.05 11.24 ? 71   GLU B C     1  
ATOM   3470   O  O     A GLU B 1 72  ? -56.029 -13.648 -28.328 0.05 11.21 ? 71   GLU B O     1  
ATOM   3471   C  CB    A GLU B 1 72  ? -56.369 -16.173 -30.371 0.05 11.36 ? 71   GLU B CB    1  
ATOM   3472   N  N     A ALA B 1 73  ? -57.343 -15.282 -27.479 0.05 11.26 ? 72   ALA B N     1  
ATOM   3473   C  CA    A ALA B 1 73  ? -58.118 -14.400 -26.613 0.05 11.24 ? 72   ALA B CA    1  
ATOM   3474   C  C     A ALA B 1 73  ? -57.313 -13.984 -25.382 0.05 11.13 ? 72   ALA B C     1  
ATOM   3475   O  O     A ALA B 1 73  ? -57.478 -12.880 -24.863 0.05 11.09 ? 72   ALA B O     1  
ATOM   3476   C  CB    A ALA B 1 73  ? -59.413 -15.079 -26.193 0.05 11.33 ? 72   ALA B CB    1  
ATOM   3477   N  N     A TRP B 1 74  ? -56.454 -14.867 -24.891 0.05 11.09 ? 73   TRP B N     1  
ATOM   3478   C  CA    A TRP B 1 74  ? -55.530 -14.454 -23.844 0.05 10.99 ? 73   TRP B CA    1  
ATOM   3479   C  C     A TRP B 1 74  ? -54.431 -13.645 -24.548 0.05 10.94 ? 73   TRP B C     1  
ATOM   3480   O  O     A TRP B 1 74  ? -54.710 -12.560 -25.066 0.05 10.93 ? 73   TRP B O     1  
ATOM   3481   C  CB    A TRP B 1 74  ? -55.025 -15.651 -23.037 0.05 10.98 ? 73   TRP B CB    1  
ATOM   3482   C  CG    A TRP B 1 74  ? -56.160 -16.423 -22.354 0.05 11.03 ? 73   TRP B CG    1  
ATOM   3483   C  CD1   A TRP B 1 74  ? -56.976 -17.355 -22.935 0.05 11.12 ? 73   TRP B CD1   1  
ATOM   3484   C  CD2   A TRP B 1 74  ? -56.596 -16.314 -20.987 0.05 11.00 ? 73   TRP B CD2   1  
ATOM   3485   N  NE1   A TRP B 1 74  ? -57.880 -17.837 -22.018 0.05 11.15 ? 73   TRP B NE1   1  
ATOM   3486   C  CE2   A TRP B 1 74  ? -57.666 -17.221 -20.815 0.05 11.08 ? 73   TRP B CE2   1  
ATOM   3487   C  CE3   A TRP B 1 74  ? -56.179 -15.553 -19.890 0.05 10.93 ? 73   TRP B CE3   1  
ATOM   3488   C  CZ2   A TRP B 1 74  ? -58.337 -17.369 -19.599 0.05 11.08 ? 73   TRP B CZ2   1  
ATOM   3489   C  CZ3   A TRP B 1 74  ? -56.847 -15.703 -18.680 0.05 10.94 ? 73   TRP B CZ3   1  
ATOM   3490   C  CH2   A TRP B 1 74  ? -57.908 -16.614 -18.544 0.05 11.01 ? 73   TRP B CH2   1  
ATOM   3491   N  N     A GLY B 1 75  ? -53.201 -14.137 -24.643 0.05 10.91 ? 74   GLY B N     1  
ATOM   3492   C  CA    A GLY B 1 75  ? -52.253 -13.341 -25.405 0.05 10.87 ? 74   GLY B CA    1  
ATOM   3493   C  C     A GLY B 1 75  ? -50.799 -13.730 -25.577 0.05 10.86 ? 74   GLY B C     1  
ATOM   3494   O  O     A GLY B 1 75  ? -50.353 -14.789 -25.146 0.05 10.86 ? 74   GLY B O     1  
ATOM   3495   N  N     A SER B 1 76  ? -50.066 -12.832 -26.233 0.05 10.84 ? 75   SER B N     1  
ATOM   3496   C  CA    A SER B 1 76  ? -48.640 -12.993 -26.504 0.05 10.83 ? 75   SER B CA    1  
ATOM   3497   C  C     A SER B 1 76  ? -47.872 -11.756 -26.045 0.05 10.75 ? 75   SER B C     1  
ATOM   3498   O  O     A SER B 1 76  ? -46.703 -11.858 -25.663 0.05 10.75 ? 75   SER B O     1  
ATOM   3499   C  CB    A SER B 1 76  ? -48.403 -13.209 -27.999 0.05 10.91 ? 75   SER B CB    1  
ATOM   3500   O  OG    A SER B 1 76  ? -49.130 -12.260 -28.752 0.05 10.91 ? 75   SER B OG    1  
ATOM   3501   N  N     A THR B 1 77  ? -48.527 -10.593 -26.101 0.05 10.71 ? 76   THR B N     1  
ATOM   3502   C  CA    A THR B 1 77  ? -47.938 -9.342  -25.608 0.05 10.64 ? 76   THR B CA    1  
ATOM   3503   C  C     A THR B 1 77  ? -48.338 -9.016  -24.165 0.05 10.60 ? 76   THR B C     1  
ATOM   3504   O  O     A THR B 1 77  ? -49.424 -9.382  -23.696 0.05 10.62 ? 76   THR B O     1  
ATOM   3505   C  CB    A THR B 1 77  ? -48.341 -8.127  -26.456 0.05 10.62 ? 76   THR B CB    1  
ATOM   3506   O  OG1   A THR B 1 77  ? -49.328 -7.368  -25.744 0.05 10.61 ? 76   THR B OG1   1  
ATOM   3507   C  CG2   A THR B 1 77  ? -48.884 -8.565  -27.811 0.05 10.68 ? 76   THR B CG2   1  
ATOM   3508   N  N     A LEU B 1 78  ? -47.466 -8.272  -23.490 0.05 10.55 ? 77   LEU B N     1  
ATOM   3509   C  CA    A LEU B 1 78  ? -47.623 -7.952  -22.078 0.05 10.52 ? 77   LEU B CA    1  
ATOM   3510   C  C     A LEU B 1 78  ? -48.960 -7.293  -21.746 0.05 10.53 ? 77   LEU B C     1  
ATOM   3511   O  O     A LEU B 1 78  ? -49.671 -7.713  -20.827 0.05 10.54 ? 77   LEU B O     1  
ATOM   3512   C  CB    A LEU B 1 78  ? -46.474 -7.051  -21.633 0.05 10.48 ? 77   LEU B CB    1  
ATOM   3513   C  CG    A LEU B 1 78  ? -46.311 -6.860  -20.132 0.05 10.46 ? 77   LEU B CG    1  
ATOM   3514   C  CD1   A LEU B 1 78  ? -46.084 -8.197  -19.449 0.05 10.48 ? 77   LEU B CD1   1  
ATOM   3515   C  CD2   A LEU B 1 78  ? -45.157 -5.918  -19.874 0.05 10.44 ? 77   LEU B CD2   1  
ATOM   3516   N  N     A LEU B 1 79  ? -49.311 -6.256  -22.492 0.05 10.52 ? 78   LEU B N     1  
ATOM   3517   C  CA    A LEU B 1 79  ? -50.554 -5.567  -22.210 0.05 10.53 ? 78   LEU B CA    1  
ATOM   3518   C  C     A LEU B 1 79  ? -51.759 -6.431  -22.542 0.05 10.59 ? 78   LEU B C     1  
ATOM   3519   O  O     A LEU B 1 79  ? -52.786 -6.333  -21.870 0.05 10.62 ? 78   LEU B O     1  
ATOM   3520   C  CB    A LEU B 1 79  ? -50.631 -4.230  -22.934 0.05 10.52 ? 78   LEU B CB    1  
ATOM   3521   C  CG    A LEU B 1 79  ? -49.872 -3.141  -22.180 0.05 10.48 ? 78   LEU B CG    1  
ATOM   3522   C  CD1   A LEU B 1 79  ? -49.606 -1.959  -23.103 0.05 10.47 ? 78   LEU B CD1   1  
ATOM   3523   C  CD2   A LEU B 1 79  ? -50.631 -2.700  -20.926 0.05 10.49 ? 78   LEU B CD2   1  
ATOM   3524   N  N     A ASP B 1 80  ? -51.634 -7.288  -23.551 0.05 10.62 ? 79   ASP B N     1  
ATOM   3525   C  CA    A ASP B 1 80  ? -52.722 -8.227  -23.833 0.05 10.68 ? 79   ASP B CA    1  
ATOM   3526   C  C     A ASP B 1 80  ? -52.823 -9.289  -22.740 0.05 10.70 ? 79   ASP B C     1  
ATOM   3527   O  O     A ASP B 1 80  ? -53.901 -9.828  -22.500 0.05 10.75 ? 79   ASP B O     1  
ATOM   3528   C  CB    A ASP B 1 80  ? -52.581 -8.885  -25.202 0.05 10.73 ? 79   ASP B CB    1  
ATOM   3529   C  CG    A ASP B 1 80  ? -52.935 -7.951  -26.337 0.05 10.75 ? 79   ASP B CG    1  
ATOM   3530   O  OD1   A ASP B 1 80  ? -53.667 -6.962  -26.103 0.05 10.74 ? 79   ASP B OD1   1  
ATOM   3531   O  OD2   A ASP B 1 80  ? -52.472 -8.215  -27.465 0.05 10.77 ? 79   ASP B OD2   1  
ATOM   3532   N  N     A ASN B 1 81  ? -51.706 -9.592  -22.088 0.05 10.66 ? 80   ASN B N     1  
ATOM   3533   C  CA    A ASN B 1 81  ? -51.741 -10.510 -20.948 0.05 10.67 ? 80   ASN B CA    1  
ATOM   3534   C  C     A ASN B 1 81  ? -52.401 -9.863  -19.733 0.05 10.65 ? 80   ASN B C     1  
ATOM   3535   O  O     A ASN B 1 81  ? -53.423 -10.339 -19.231 0.05 10.68 ? 80   ASN B O     1  
ATOM   3536   C  CB    A ASN B 1 81  ? -50.335 -11.008 -20.582 0.05 10.64 ? 80   ASN B CB    1  
ATOM   3537   C  CG    A ASN B 1 81  ? -49.702 -11.839 -21.686 0.05 10.68 ? 80   ASN B CG    1  
ATOM   3538   O  OD1   A ASN B 1 81  ? -48.488 -11.983 -21.759 0.05 10.66 ? 80   ASN B OD1   1  
ATOM   3539   N  ND2   A ASN B 1 81  ? -50.534 -12.382 -22.554 0.05 10.74 ? 80   ASN B ND2   1  
ATOM   3540   N  N     A VAL B 1 82  ? -51.831 -8.760  -19.266 0.05 10.60 ? 81   VAL B N     1  
ATOM   3541   C  CA    A VAL B 1 82  ? -52.160 -8.279  -17.922 0.05 10.59 ? 81   VAL B CA    1  
ATOM   3542   C  C     A VAL B 1 82  ? -53.392 -7.376  -17.807 0.05 10.62 ? 81   VAL B C     1  
ATOM   3543   O  O     A VAL B 1 82  ? -54.042 -7.339  -16.761 0.05 10.64 ? 81   VAL B O     1  
ATOM   3544   C  CB    A VAL B 1 82  ? -50.949 -7.603  -17.247 0.05 10.54 ? 81   VAL B CB    1  
ATOM   3545   C  CG1   A VAL B 1 82  ? -49.743 -8.522  -17.321 0.05 10.53 ? 81   VAL B CG1   1  
ATOM   3546   C  CG2   A VAL B 1 82  ? -50.656 -6.274  -17.906 0.05 10.52 ? 81   VAL B CG2   1  
ATOM   3547   N  N     A GLU B 1 83  ? -53.730 -6.645  -18.861 0.05 10.63 ? 82   GLU B N     1  
ATOM   3548   C  CA    A GLU B 1 83  ? -54.871 -5.747  -18.753 0.05 10.67 ? 82   GLU B CA    1  
ATOM   3549   C  C     A GLU B 1 83  ? -56.222 -6.433  -18.484 0.05 10.74 ? 82   GLU B C     1  
ATOM   3550   O  O     A GLU B 1 83  ? -56.999 -5.935  -17.667 0.05 10.77 ? 82   GLU B O     1  
ATOM   3551   C  CB    A GLU B 1 83  ? -54.971 -4.789  -19.953 0.05 10.67 ? 82   GLU B CB    1  
ATOM   3552   C  CG    A GLU B 1 83  ? -55.884 -3.598  -19.678 0.05 10.71 ? 82   GLU B CG    1  
ATOM   3553   C  CD    A GLU B 1 83  ? -55.545 -2.407  -20.548 0.05 10.69 ? 82   GLU B CD    1  
ATOM   3554   O  OE1   A GLU B 1 83  ? -55.766 -1.262  -20.103 0.05 10.71 ? 82   GLU B OE1   1  
ATOM   3555   O  OE2   A GLU B 1 83  ? -55.046 -2.629  -21.669 0.05 10.66 ? 82   GLU B OE2   1  
ATOM   3556   N  N     A PRO B 1 84  ? -56.514 -7.559  -19.167 0.05 10.77 ? 83   PRO B N     1  
ATOM   3557   C  CA    A PRO B 1 84  ? -57.809 -8.180  -18.866 0.05 10.84 ? 83   PRO B CA    1  
ATOM   3558   C  C     A PRO B 1 84  ? -57.984 -8.461  -17.380 0.05 10.84 ? 83   PRO B C     1  
ATOM   3559   O  O     A PRO B 1 84  ? -59.072 -8.239  -16.825 0.05 10.90 ? 83   PRO B O     1  
ATOM   3560   C  CB    A PRO B 1 84  ? -57.754 -9.492  -19.642 0.05 10.87 ? 83   PRO B CB    1  
ATOM   3561   C  CG    A PRO B 1 84  ? -56.888 -9.189  -20.805 0.05 10.84 ? 83   PRO B CG    1  
ATOM   3562   C  CD    A PRO B 1 84  ? -55.828 -8.250  -20.274 0.05 10.76 ? 83   PRO B CD    1  
ATOM   3563   N  N     A PHE B 1 85  ? -56.919 -8.902  -16.722 0.05 10.79 ? 84   PHE B N     1  
ATOM   3564   C  CA    A PHE B 1 85  ? -57.031 -9.180  -15.298 0.05 10.79 ? 84   PHE B CA    1  
ATOM   3565   C  C     A PHE B 1 85  ? -57.489 -7.967  -14.483 0.05 10.81 ? 84   PHE B C     1  
ATOM   3566   O  O     A PHE B 1 85  ? -58.311 -8.120  -13.586 0.05 10.86 ? 84   PHE B O     1  
ATOM   3567   C  CB    A PHE B 1 85  ? -55.732 -9.783  -14.742 0.05 10.74 ? 84   PHE B CB    1  
ATOM   3568   C  CG    A PHE B 1 85  ? -55.423 -11.142 -15.299 0.05 10.74 ? 84   PHE B CG    1  
ATOM   3569   C  CD1   A PHE B 1 85  ? -56.025 -12.274 -14.770 0.05 10.78 ? 84   PHE B CD1   1  
ATOM   3570   C  CD2   A PHE B 1 85  ? -54.556 -11.290 -16.365 0.05 10.71 ? 84   PHE B CD2   1  
ATOM   3571   C  CE1   A PHE B 1 85  ? -55.756 -13.513 -15.285 0.05 10.79 ? 84   PHE B CE1   1  
ATOM   3572   C  CE2   A PHE B 1 85  ? -54.280 -12.530 -16.886 0.05 10.72 ? 84   PHE B CE2   1  
ATOM   3573   C  CZ    A PHE B 1 85  ? -54.884 -13.652 -16.345 0.05 10.76 ? 84   PHE B CZ    1  
ATOM   3574   N  N     A LEU B 1 86  ? -56.986 -6.767  -14.806 0.05 10.79 ? 85   LEU B N     1  
ATOM   3575   C  CA    A LEU B 1 86  ? -57.321 -5.560  -14.037 0.05 10.81 ? 85   LEU B CA    1  
ATOM   3576   C  C     A LEU B 1 86  ? -58.752 -5.091  -14.250 0.05 10.90 ? 85   LEU B C     1  
ATOM   3577   O  O     A LEU B 1 86  ? -59.478 -4.816  -13.293 0.05 10.95 ? 85   LEU B O     1  
ATOM   3578   C  CB    A LEU B 1 86  ? -56.374 -4.386  -14.342 0.05 10.77 ? 85   LEU B CB    1  
ATOM   3579   C  CG    A LEU B 1 86  ? -56.879 -3.008  -13.882 0.05 10.81 ? 85   LEU B CG    1  
ATOM   3580   C  CD1   A LEU B 1 86  ? -57.038 -2.904  -12.360 0.05 10.84 ? 85   LEU B CD1   1  
ATOM   3581   C  CD2   A LEU B 1 86  ? -56.000 -1.863  -14.395 0.05 10.77 ? 85   LEU B CD2   1  
ATOM   3582   N  N     A ASN B 1 87  ? -59.149 -4.969  -15.507 0.05 10.92 ? 86   ASN B N     1  
ATOM   3583   C  CA    A ASN B 1 87  ? -60.479 -4.469  -15.797 0.05 11.01 ? 86   ASN B CA    1  
ATOM   3584   C  C     A ASN B 1 87  ? -61.506 -5.374  -15.143 0.05 11.08 ? 86   ASN B C     1  
ATOM   3585   O  O     A ASN B 1 87  ? -62.583 -4.929  -14.743 0.05 11.16 ? 86   ASN B O     1  
ATOM   3586   C  CB    A ASN B 1 87  ? -60.692 -4.335  -17.304 0.05 11.02 ? 86   ASN B CB    1  
ATOM   3587   C  CG    A ASN B 1 87  ? -59.881 -3.196  -17.896 0.05 10.98 ? 86   ASN B CG    1  
ATOM   3588   O  OD1   A ASN B 1 87  ? -59.760 -3.068  -19.115 0.05 10.98 ? 86   ASN B OD1   1  
ATOM   3589   N  ND2   A ASN B 1 87  ? -59.305 -2.370  -17.028 0.05 10.93 ? 86   ASN B ND2   1  
ATOM   3590   N  N     A ASP B 1 88  ? -61.137 -6.641  -14.985 0.05 11.05 ? 87   ASP B N     1  
ATOM   3591   C  CA    A ASP B 1 88  ? -61.977 -7.556  -14.232 0.05 11.11 ? 87   ASP B CA    1  
ATOM   3592   C  C     A ASP B 1 88  ? -62.101 -7.178  -12.757 0.05 11.12 ? 87   ASP B C     1  
ATOM   3593   O  O     A ASP B 1 88  ? -63.191 -7.211  -12.186 0.05 11.21 ? 87   ASP B O     1  
ATOM   3594   C  CB    A ASP B 1 88  ? -61.510 -8.990  -14.346 0.05 11.08 ? 87   ASP B CB    1  
ATOM   3595   C  CG    A ASP B 1 88  ? -62.509 -9.940  -13.759 0.05 11.15 ? 87   ASP B CG    1  
ATOM   3596   O  OD1   A ASP B 1 88  ? -63.716 -9.628  -13.861 0.05 11.24 ? 87   ASP B OD1   1  
ATOM   3597   O  OD2   A ASP B 1 88  ? -62.097 -10.964 -13.171 0.05 11.14 ? 87   ASP B OD2   1  
ATOM   3598   N  N     A ALA B 1 89  ? -60.979 -6.850  -12.132 0.05 11.05 ? 88   ALA B N     1  
ATOM   3599   C  CA    A ALA B 1 89  ? -61.001 -6.460  -10.729 0.05 11.06 ? 88   ALA B CA    1  
ATOM   3600   C  C     A ALA B 1 89  ? -61.999 -5.339  -10.468 0.05 11.15 ? 88   ALA B C     1  
ATOM   3601   O  O     A ALA B 1 89  ? -62.793 -5.406  -9.535  0.05 11.23 ? 88   ALA B O     1  
ATOM   3602   C  CB    A ALA B 1 89  ? -59.614 -6.056  -10.266 0.05 10.98 ? 88   ALA B CB    1  
ATOM   3603   N  N     A ILE B 1 90  ? -61.986 -4.313  -11.310 0.05 11.14 ? 89   ILE B N     1  
ATOM   3604   C  CA    A ILE B 1 90  ? -62.830 -3.164  -11.024 0.05 11.22 ? 89   ILE B CA    1  
ATOM   3605   C  C     A ILE B 1 90  ? -64.332 -3.442  -11.171 0.05 11.33 ? 89   ILE B C     1  
ATOM   3606   O  O     A ILE B 1 90  ? -65.130 -2.913  -10.401 0.05 11.42 ? 89   ILE B O     1  
ATOM   3607   C  CB    A ILE B 1 90  ? -62.350 -1.885  -11.761 0.05 11.20 ? 89   ILE B CB    1  
ATOM   3608   C  CG1   A ILE B 1 90  ? -61.035 -1.405  -11.134 0.05 11.11 ? 89   ILE B CG1   1  
ATOM   3609   C  CG2   A ILE B 1 90  ? -63.391 -0.775  -11.668 0.05 11.30 ? 89   ILE B CG2   1  
ATOM   3610   C  CD1   A ILE B 1 90  ? -60.388 -0.224  -11.843 0.05 11.07 ? 89   ILE B CD1   1  
ATOM   3611   N  N     A GLN B 1 91  ? -64.731 -4.307  -12.103 0.05 11.34 ? 90   GLN B N     1  
ATOM   3612   C  CA    A GLN B 1 91  ? -66.155 -4.601  -12.195 0.05 11.46 ? 90   GLN B CA    1  
ATOM   3613   C  C     A GLN B 1 91  ? -66.586 -5.763  -11.278 0.05 11.49 ? 90   GLN B C     1  
ATOM   3614   O  O     A GLN B 1 91  ? -67.783 -6.015  -11.107 0.05 11.61 ? 90   GLN B O     1  
ATOM   3615   C  CB    A GLN B 1 91  ? -66.617 -4.740  -13.665 0.05 11.49 ? 90   GLN B CB    1  
ATOM   3616   C  CG    A GLN B 1 91  ? -67.023 -6.121  -14.133 0.05 11.52 ? 90   GLN B CG    1  
ATOM   3617   C  CD    A GLN B 1 91  ? -65.933 -7.111  -13.947 0.05 11.41 ? 90   GLN B CD    1  
ATOM   3618   O  OE1   A GLN B 1 91  ? -64.769 -6.753  -14.064 0.05 11.32 ? 90   GLN B OE1   1  
ATOM   3619   N  NE2   A GLN B 1 91  ? -66.282 -8.358  -13.626 0.05 11.43 ? 90   GLN B NE2   1  
ATOM   3620   N  N     A ALA B 1 92  ? -65.602 -6.426  -10.662 0.05 11.40 ? 91   ALA B N     1  
ATOM   3621   C  CA    A ALA B 1 92  ? -65.851 -7.474  -9.659  0.05 11.43 ? 91   ALA B CA    1  
ATOM   3622   C  C     A ALA B 1 92  ? -65.923 -6.944  -8.218  0.05 11.46 ? 91   ALA B C     1  
ATOM   3623   O  O     A ALA B 1 92  ? -66.841 -7.313  -7.472  0.05 11.53 ? 91   ALA B O     1  
ATOM   3624   C  CB    A ALA B 1 92  ? -64.798 -8.566  -9.760  0.05 11.33 ? 91   ALA B CB    1  
ATOM   3625   N  N     A LEU B 1 93  ? -64.965 -6.088  -7.846  0.05 11.40 ? 92   LEU B N     1  
ATOM   3626   C  CA    A LEU B 1 93  ? -64.840 -5.538  -6.479  0.05 11.43 ? 92   LEU B CA    1  
ATOM   3627   C  C     A LEU B 1 93  ? -66.154 -5.207  -5.751  0.05 11.57 ? 92   LEU B C     1  
ATOM   3628   O  O     A LEU B 1 93  ? -66.347 -5.626  -4.605  0.05 11.60 ? 92   LEU B O     1  
ATOM   3629   C  CB    A LEU B 1 93  ? -63.867 -4.341  -6.435  0.05 11.38 ? 92   LEU B CB    1  
ATOM   3630   C  CG    A LEU B 1 93  ? -63.888 -3.376  -5.240  0.05 11.43 ? 92   LEU B CG    1  
ATOM   3631   C  CD1   A LEU B 1 93  ? -62.495 -3.058  -4.778  0.05 11.34 ? 92   LEU B CD1   1  
ATOM   3632   C  CD2   A LEU B 1 93  ? -64.572 -2.058  -5.591  0.05 11.49 ? 92   LEU B CD2   1  
ATOM   3633   N  N     A PRO B 1 94  ? -67.061 -4.444  -6.392  0.05 11.65 ? 93   PRO B N     1  
ATOM   3634   C  CA    A PRO B 1 94  ? -68.315 -4.210  -5.662  0.05 11.80 ? 93   PRO B CA    1  
ATOM   3635   C  C     A PRO B 1 94  ? -69.279 -5.406  -5.684  0.05 11.86 ? 93   PRO B C     1  
ATOM   3636   O  O     A PRO B 1 94  ? -70.151 -5.480  -4.812  0.05 11.97 ? 93   PRO B O     1  
ATOM   3637   C  CB    A PRO B 1 94  ? -68.937 -3.008  -6.396  0.05 11.87 ? 93   PRO B CB    1  
ATOM   3638   C  CG    A PRO B 1 94  ? -68.361 -3.060  -7.761  0.05 11.78 ? 93   PRO B CG    1  
ATOM   3639   C  CD    A PRO B 1 94  ? -66.961 -3.601  -7.603  0.05 11.64 ? 93   PRO B CD    1  
ATOM   3640   N  N     A GLN B 1 95  ? -69.143 -6.327  -6.641  0.05 11.80 ? 94   GLN B N     1  
ATOM   3641   C  CA    A GLN B 1 95  ? -69.998 -7.519  -6.636  0.05 11.86 ? 94   GLN B CA    1  
ATOM   3642   C  C     A GLN B 1 95  ? -69.697 -8.462  -5.464  0.05 11.85 ? 94   GLN B C     1  
ATOM   3643   O  O     A GLN B 1 95  ? -70.533 -9.296  -5.104  0.05 11.94 ? 94   GLN B O     1  
ATOM   3644   C  CB    A GLN B 1 95  ? -69.844 -8.317  -7.926  0.05 11.80 ? 94   GLN B CB    1  
ATOM   3645   C  CG    A GLN B 1 95  ? -69.931 -7.536  -9.202  0.05 11.88 ? 94   GLN B CG    1  
ATOM   3646   C  CD    A GLN B 1 95  ? -69.984 -8.467  -10.385 0.05 11.82 ? 94   GLN B CD    1  
ATOM   3647   O  OE1   A GLN B 1 95  ? -69.299 -8.269  -11.388 0.05 11.73 ? 94   GLN B OE1   1  
ATOM   3648   N  NE2   A GLN B 1 95  ? -70.791 -9.511  -10.264 0.05 11.88 ? 94   GLN B NE2   1  
ATOM   3649   N  N     A LEU B 1 96  ? -68.502 -8.339  -4.888  0.05 11.73 ? 95   LEU B N     1  
ATOM   3650   C  CA    A LEU B 1 96  ? -68.081 -9.189  -3.787  0.05 11.69 ? 95   LEU B CA    1  
ATOM   3651   C  C     A LEU B 1 96  ? -68.277 -8.467  -2.464  0.05 11.76 ? 95   LEU B C     1  
ATOM   3652   O  O     A LEU B 1 96  ? -68.521 -9.090  -1.424  0.05 11.78 ? 95   LEU B O     1  
ATOM   3653   C  CB    A LEU B 1 96  ? -66.611 -9.590  -3.954  0.05 11.55 ? 95   LEU B CB    1  
ATOM   3654   C  CG    A LEU B 1 96  ? -66.240 -10.199 -5.309  0.05 11.49 ? 95   LEU B CG    1  
ATOM   3655   C  CD1   A LEU B 1 96  ? -64.788 -10.672 -5.309  0.05 11.36 ? 95   LEU B CD1   1  
ATOM   3656   C  CD2   A LEU B 1 96  ? -67.159 -11.342 -5.675  0.05 11.55 ? 95   LEU B CD2   1  
ATOM   3657   N  N     A ALA B 1 97  ? -68.137 -7.147  -2.504  0.05 11.80 ? 96   ALA B N     1  
ATOM   3658   C  CA    A ALA B 1 97  ? -68.560 -6.314  -1.389  0.05 11.89 ? 96   ALA B CA    1  
ATOM   3659   C  C     A ALA B 1 97  ? -70.044 -6.561  -1.137  0.05 12.04 ? 96   ALA B C     1  
ATOM   3660   O  O     A ALA B 1 97  ? -70.475 -6.725  0.012   0.05 12.10 ? 96   ALA B O     1  
ATOM   3661   C  CB    A ALA B 1 97  ? -68.317 -4.847  -1.704  0.05 11.91 ? 96   ALA B CB    1  
ATOM   3662   N  N     A ASP B 1 98  ? -70.810 -6.604  -2.227  0.05 12.10 ? 97   ASP B N     1  
ATOM   3663   C  CA    A ASP B 1 98  ? -72.250 -6.829  -2.163  0.05 12.26 ? 97   ASP B CA    1  
ATOM   3664   C  C     A ASP B 1 98  ? -72.558 -8.123  -1.439  0.05 12.25 ? 97   ASP B C     1  
ATOM   3665   O  O     A ASP B 1 98  ? -73.272 -8.130  -0.436  0.05 12.35 ? 97   ASP B O     1  
ATOM   3666   C  CB    A ASP B 1 98  ? -72.853 -6.885  -3.569  0.05 12.32 ? 97   ASP B CB    1  
ATOM   3667   C  CG    A ASP B 1 98  ? -74.272 -6.329  -3.621  0.05 12.51 ? 97   ASP B CG    1  
ATOM   3668   O  OD1   A ASP B 1 98  ? -74.414 -5.096  -3.484  0.05 12.60 ? 97   ASP B OD1   1  
ATOM   3669   O  OD2   A ASP B 1 98  ? -75.230 -7.110  -3.820  0.05 12.57 ? 97   ASP B OD2   1  
ATOM   3670   N  N     A ALA B 1 99  ? -72.000 -9.215  -1.954  0.05 12.13 ? 98   ALA B N     1  
ATOM   3671   C  CA    A ALA B 1 99  ? -72.271 -10.549 -1.429  0.05 12.11 ? 98   ALA B CA    1  
ATOM   3672   C  C     A ALA B 1 99  ? -71.856 -10.679 0.022   0.05 12.11 ? 98   ALA B C     1  
ATOM   3673   O  O     A ALA B 1 99  ? -72.687 -10.864 0.901   0.05 12.18 ? 98   ALA B O     1  
ATOM   3674   C  CB    A ALA B 1 99  ? -71.553 -11.591 -2.260  0.05 11.98 ? 98   ALA B CB    1  
ATOM   3675   N  N     A TYR B 1 100 ? -70.555 -10.585 0.270   0.05 12.02 ? 99   TYR B N     1  
ATOM   3676   C  CA    A TYR B 1 100 ? -70.035 -10.787 1.617   0.05 12.00 ? 99   TYR B CA    1  
ATOM   3677   C  C     A TYR B 1 100 ? -70.443 -9.688  2.589   0.05 12.10 ? 99   TYR B C     1  
ATOM   3678   O  O     A TYR B 1 100 ? -69.940 -9.650  3.711   0.05 12.09 ? 99   TYR B O     1  
ATOM   3679   C  CB    A TYR B 1 100 ? -68.506 -10.891 1.589   0.05 11.85 ? 99   TYR B CB    1  
ATOM   3680   C  CG    A TYR B 1 100 ? -67.981 -12.209 1.061   0.05 11.75 ? 99   TYR B CG    1  
ATOM   3681   C  CD1   A TYR B 1 100 ? -68.021 -13.353 1.848   0.05 11.74 ? 99   TYR B CD1   1  
ATOM   3682   C  CD2   A TYR B 1 100 ? -67.447 -12.311 -0.218  0.05 11.66 ? 99   TYR B CD2   1  
ATOM   3683   C  CE1   A TYR B 1 100 ? -67.552 -14.560 1.379   0.05 11.66 ? 99   TYR B CE1   1  
ATOM   3684   C  CE2   A TYR B 1 100 ? -66.970 -13.525 -0.700  0.05 11.58 ? 99   TYR B CE2   1  
ATOM   3685   C  CZ    A TYR B 1 100 ? -67.023 -14.643 0.111   0.05 11.58 ? 99   TYR B CZ    1  
ATOM   3686   O  OH    A TYR B 1 100 ? -66.561 -15.853 -0.342  0.05 11.52 ? 99   TYR B OH    1  
ATOM   3687   N  N     A ALA B 1 101 ? -71.349 -8.805  2.164   0.05 12.21 ? 100  ALA B N     1  
ATOM   3688   C  CA    A ALA B 1 101 ? -71.758 -7.651  2.965   0.05 12.32 ? 100  ALA B CA    1  
ATOM   3689   C  C     A ALA B 1 101 ? -71.970 -7.934  4.453   0.05 12.40 ? 100  ALA B C     1  
ATOM   3690   O  O     A ALA B 1 101 ? -71.421 -7.232  5.305   0.05 12.40 ? 100  ALA B O     1  
ATOM   3691   C  CB    A ALA B 1 101 ? -73.008 -7.003  2.372   0.05 12.45 ? 100  ALA B CB    1  
ATOM   3692   N  N     A ASP B 1 102 ? -72.757 -8.958  4.769   0.05 12.46 ? 101  ASP B N     1  
ATOM   3693   C  CA    A ASP B 1 102 ? -73.148 -9.200  6.166   0.05 12.55 ? 101  ASP B CA    1  
ATOM   3694   C  C     A ASP B 1 102 ? -72.584 -10.478 6.765   0.05 12.45 ? 101  ASP B C     1  
ATOM   3695   O  O     A ASP B 1 102 ? -73.143 -11.027 7.719   0.05 12.53 ? 101  ASP B O     1  
ATOM   3696   C  CB    A ASP B 1 102 ? -74.666 -9.224  6.297   0.05 12.72 ? 101  ASP B CB    1  
ATOM   3697   C  CG    A ASP B 1 102 ? -75.259 -7.843  6.318   0.05 12.86 ? 101  ASP B CG    1  
ATOM   3698   O  OD1   A ASP B 1 102 ? -75.762 -7.398  5.269   0.05 12.89 ? 101  ASP B OD1   1  
ATOM   3699   O  OD2   A ASP B 1 102 ? -75.190 -7.200  7.381   0.05 12.93 ? 101  ASP B OD2   1  
ATOM   3700   N  N     A ASP B 1 103 ? -71.474 -10.940 6.202   0.05 12.29 ? 102  ASP B N     1  
ATOM   3701   C  CA    A ASP B 1 103 ? -70.835 -12.168 6.643   0.05 12.20 ? 102  ASP B CA    1  
ATOM   3702   C  C     A ASP B 1 103 ? -69.358 -12.096 6.271   0.05 12.04 ? 102  ASP B C     1  
ATOM   3703   O  O     A ASP B 1 103 ? -68.855 -12.896 5.470   0.05 11.94 ? 102  ASP B O     1  
ATOM   3704   C  CB    A ASP B 1 103 ? -71.504 -13.378 5.989   0.05 12.20 ? 102  ASP B CB    1  
ATOM   3705   C  CG    A ASP B 1 103 ? -71.040 -14.688 6.580   0.05 12.13 ? 102  ASP B CG    1  
ATOM   3706   O  OD1   A ASP B 1 103 ? -70.598 -14.684 7.747   0.05 12.13 ? 102  ASP B OD1   1  
ATOM   3707   O  OD2   A ASP B 1 103 ? -71.131 -15.719 5.880   0.05 12.08 ? 102  ASP B OD2   1  
ATOM   3708   N  N     A ILE B 1 104 ? -68.674 -11.118 6.856   0.05 12.04 ? 103  ILE B N     1  
ATOM   3709   C  CA    A ILE B 1 104 ? -67.254 -10.898 6.610   0.05 11.92 ? 103  ILE B CA    1  
ATOM   3710   C  C     A ILE B 1 104 ? -66.438 -12.069 7.175   0.05 11.83 ? 103  ILE B C     1  
ATOM   3711   O  O     A ILE B 1 104 ? -66.603 -12.439 8.335   0.05 11.88 ? 103  ILE B O     1  
ATOM   3712   C  CB    A ILE B 1 104 ? -66.794 -9.555  7.235   0.05 11.96 ? 103  ILE B CB    1  
ATOM   3713   C  CG1   A ILE B 1 104 ? -67.447 -8.374  6.509   0.05 12.02 ? 103  ILE B CG1   1  
ATOM   3714   C  CG2   A ILE B 1 104 ? -65.276 -9.445  7.212   0.05 11.85 ? 103  ILE B CG2   1  
ATOM   3715   C  CD1   A ILE B 1 104 ? -67.250 -7.020  7.196   0.05 12.11 ? 103  ILE B CD1   1  
ATOM   3716   N  N     A PRO B 1 105 ? -65.559 -12.660 6.349   0.05 11.71 ? 104  PRO B N     1  
ATOM   3717   C  CA    A PRO B 1 105 ? -64.809 -13.865 6.744   0.05 11.63 ? 104  PRO B CA    1  
ATOM   3718   C  C     A PRO B 1 105 ? -63.673 -13.602 7.741   0.05 11.61 ? 104  PRO B C     1  
ATOM   3719   O  O     A PRO B 1 105 ? -63.221 -12.467 7.868   0.05 11.63 ? 104  PRO B O     1  
ATOM   3720   C  CB    A PRO B 1 105 ? -64.249 -14.378 5.416   0.05 11.53 ? 104  PRO B CB    1  
ATOM   3721   C  CG    A PRO B 1 105 ? -64.170 -13.156 4.544   0.05 11.52 ? 104  PRO B CG    1  
ATOM   3722   C  CD    A PRO B 1 105 ? -65.330 -12.291 4.940   0.05 11.65 ? 104  PRO B CD    1  
ATOM   3723   N  N     A ASP B 1 106 ? -63.233 -14.641 8.448   0.05 11.57 ? 105  ASP B N     1  
ATOM   3724   C  CA    A ASP B 1 106 ? -62.096 -14.513 9.356   0.05 11.54 ? 105  ASP B CA    1  
ATOM   3725   C  C     A ASP B 1 106 ? -60.771 -14.506 8.597   0.05 11.43 ? 105  ASP B C     1  
ATOM   3726   O  O     A ASP B 1 106 ? -59.767 -14.003 9.101   0.05 11.42 ? 105  ASP B O     1  
ATOM   3727   C  CB    A ASP B 1 106 ? -62.080 -15.640 10.386  0.05 11.55 ? 105  ASP B CB    1  
ATOM   3728   C  CG    A ASP B 1 106 ? -63.199 -16.634 10.183  0.05 11.58 ? 105  ASP B CG    1  
ATOM   3729   O  OD1   A ASP B 1 106 ? -64.338 -16.372 10.640  0.05 11.68 ? 105  ASP B OD1   1  
ATOM   3730   O  OD2   A ASP B 1 106 ? -62.928 -17.696 9.580   0.05 11.51 ? 105  ASP B OD2   1  
ATOM   3731   N  N     A LEU B 1 107 ? -60.771 -15.085 7.400   0.05 11.37 ? 106  LEU B N     1  
ATOM   3732   C  CA    A LEU B 1 107 ? -59.563 -15.129 6.575   0.05 11.27 ? 106  LEU B CA    1  
ATOM   3733   C  C     A LEU B 1 107 ? -59.919 -15.245 5.102   0.05 11.23 ? 106  LEU B C     1  
ATOM   3734   O  O     A LEU B 1 107 ? -60.916 -15.862 4.748   0.05 11.26 ? 106  LEU B O     1  
ATOM   3735   C  CB    A LEU B 1 107 ? -58.666 -16.302 6.995   0.05 11.22 ? 106  LEU B CB    1  
ATOM   3736   C  CG    A LEU B 1 107 ? -57.352 -16.457 6.217   0.05 11.13 ? 106  LEU B CG    1  
ATOM   3737   C  CD1   A LEU B 1 107 ? -56.247 -16.865 7.159   0.05 11.11 ? 106  LEU B CD1   1  
ATOM   3738   C  CD2   A LEU B 1 107 ? -57.488 -17.473 5.083   0.05 11.09 ? 106  LEU B CD2   1  
ATOM   3739   N  N     A VAL B 1 108 ? -59.088 -14.655 4.244   0.05 11.18 ? 107  VAL B N     1  
ATOM   3740   C  CA    A VAL B 1 108 ? -59.293 -14.732 2.803   0.05 11.14 ? 107  VAL B CA    1  
ATOM   3741   C  C     A VAL B 1 108 ? -58.161 -15.516 2.129   0.05 11.06 ? 107  VAL B C     1  
ATOM   3742   O  O     A VAL B 1 108 ? -56.989 -15.330 2.453   0.05 11.02 ? 107  VAL B O     1  
ATOM   3743   C  CB    A VAL B 1 108 ? -59.382 -13.324 2.171   0.05 11.15 ? 107  VAL B CB    1  
ATOM   3744   C  CG1   A VAL B 1 108 ? -59.435 -13.431 0.652   0.05 11.10 ? 107  VAL B CG1   1  
ATOM   3745   C  CG2   A VAL B 1 108 ? -60.607 -12.566 2.704   0.05 11.25 ? 107  VAL B CG2   1  
ATOM   3746   N  N     A LEU B 1 109 ? -58.535 -16.398 1.211   0.05 11.04 ? 108  LEU B N     1  
ATOM   3747   C  CA    A LEU B 1 109 ? -57.602 -17.207 0.449   0.05 10.98 ? 108  LEU B CA    1  
ATOM   3748   C  C     A LEU B 1 109 ? -57.842 -16.922 -1.031  0.05 10.96 ? 108  LEU B C     1  
ATOM   3749   O  O     A LEU B 1 109 ? -58.986 -16.839 -1.470  0.05 11.00 ? 108  LEU B O     1  
ATOM   3750   C  CB    A LEU B 1 109 ? -57.897 -18.677 0.742   0.05 10.99 ? 108  LEU B CB    1  
ATOM   3751   C  CG    A LEU B 1 109 ? -56.949 -19.785 0.322   0.05 10.94 ? 108  LEU B CG    1  
ATOM   3752   C  CD1   A LEU B 1 109 ? -55.598 -19.589 0.998   0.05 10.90 ? 108  LEU B CD1   1  
ATOM   3753   C  CD2   A LEU B 1 109 ? -57.578 -21.108 0.752   0.05 10.97 ? 108  LEU B CD2   1  
ATOM   3754   N  N     A HIS B 1 110 ? -56.788 -16.767 -1.822  0.05 10.90 ? 109  HIS B N     1  
ATOM   3755   C  CA    A HIS B 1 110 ? -57.021 -16.464 -3.230  0.05 10.89 ? 109  HIS B CA    1  
ATOM   3756   C  C     A HIS B 1 110 ? -55.894 -16.890 -4.151  0.05 10.83 ? 109  HIS B C     1  
ATOM   3757   O  O     A HIS B 1 110 ? -54.723 -16.848 -3.770  0.05 10.80 ? 109  HIS B O     1  
ATOM   3758   C  CB    A HIS B 1 110 ? -57.278 -14.966 -3.402  0.05 10.90 ? 109  HIS B CB    1  
ATOM   3759   C  CG    A HIS B 1 110 ? -56.075 -14.114 -3.136  0.05 10.85 ? 109  HIS B CG    1  
ATOM   3760   N  ND1   A HIS B 1 110 ? -55.177 -13.768 -4.124  0.05 10.80 ? 109  HIS B ND1   1  
ATOM   3761   C  CD2   A HIS B 1 110 ? -55.627 -13.532 -2.000  0.05 10.87 ? 109  HIS B CD2   1  
ATOM   3762   C  CE1   A HIS B 1 110 ? -54.224 -13.014 -3.604  0.05 10.78 ? 109  HIS B CE1   1  
ATOM   3763   N  NE2   A HIS B 1 110 ? -54.472 -12.855 -2.318  0.05 10.82 ? 109  HIS B NE2   1  
ATOM   3764   N  N     A ASP B 1 111 ? -56.257 -17.305 -5.363  0.05 10.84 ? 110  ASP B N     1  
ATOM   3765   C  CA    A ASP B 1 111 ? -55.286 -17.473 -6.445  0.05 10.80 ? 110  ASP B CA    1  
ATOM   3766   C  C     A ASP B 1 111 ? -54.714 -16.094 -6.806  0.05 10.76 ? 110  ASP B C     1  
ATOM   3767   O  O     A ASP B 1 111 ? -55.349 -15.064 -6.562  0.05 10.78 ? 110  ASP B O     1  
ATOM   3768   C  CB    A ASP B 1 111 ? -55.941 -18.142 -7.671  0.05 10.83 ? 110  ASP B CB    1  
ATOM   3769   C  CG    A ASP B 1 111 ? -54.969 -18.337 -8.842  0.05 10.80 ? 110  ASP B CG    1  
ATOM   3770   O  OD1   A ASP B 1 111 ? -53.984 -19.085 -8.689  0.05 10.79 ? 110  ASP B OD1   1  
ATOM   3771   O  OD2   A ASP B 1 111 ? -55.201 -17.754 -9.926  0.05 10.80 ? 110  ASP B OD2   1  
ATOM   3772   N  N     A ILE B 1 112 ? -53.512 -16.090 -7.371  0.05 10.72 ? 111  ILE B N     1  
ATOM   3773   C  CA    A ILE B 1 112 ? -52.818 -14.854 -7.721  0.05 10.69 ? 111  ILE B CA    1  
ATOM   3774   C  C     A ILE B 1 112 ? -53.632 -13.946 -8.648  0.05 10.70 ? 111  ILE B C     1  
ATOM   3775   O  O     A ILE B 1 112 ? -53.463 -12.720 -8.636  0.05 10.68 ? 111  ILE B O     1  
ATOM   3776   C  CB    A ILE B 1 112 ? -51.461 -15.165 -8.388  0.05 10.66 ? 111  ILE B CB    1  
ATOM   3777   C  CG1   A ILE B 1 112 ? -51.643 -16.198 -9.499  0.05 10.67 ? 111  ILE B CG1   1  
ATOM   3778   C  CG2   A ILE B 1 112 ? -50.474 -15.688 -7.360  0.05 10.65 ? 111  ILE B CG2   1  
ATOM   3779   C  CD1   A ILE B 1 112 ? -50.404 -16.463 -10.318 0.05 10.65 ? 111  ILE B CD1   1  
ATOM   3780   N  N     A THR B 1 113 ? -54.519 -14.543 -9.438  0.05 10.73 ? 112  THR B N     1  
ATOM   3781   C  CA    A THR B 1 113 ? -55.236 -13.786 -10.474 0.05 10.75 ? 112  THR B CA    1  
ATOM   3782   C  C     A THR B 1 113 ? -56.391 -12.917 -9.957  0.05 10.79 ? 112  THR B C     1  
ATOM   3783   O  O     A THR B 1 113 ? -56.881 -12.039 -10.678 0.05 10.80 ? 112  THR B O     1  
ATOM   3784   C  CB    A THR B 1 113 ? -55.745 -14.699 -11.620 0.05 10.78 ? 112  THR B CB    1  
ATOM   3785   O  OG1   A THR B 1 113 ? -56.562 -15.750 -11.089 0.05 10.83 ? 112  THR B OG1   1  
ATOM   3786   C  CG2   A THR B 1 113 ? -54.586 -15.299 -12.404 0.05 10.75 ? 112  THR B CG2   1  
ATOM   3787   N  N     A SER B 1 114 ? -56.834 -13.148 -8.721  0.05 10.82 ? 113  SER B N     1  
ATOM   3788   C  CA    A SER B 1 114 ? -57.954 -12.366 -8.178  0.05 10.87 ? 113  SER B CA    1  
ATOM   3789   C  C     A SER B 1 114 ? -57.552 -11.110 -7.394  0.05 10.86 ? 113  SER B C     1  
ATOM   3790   O  O     A SER B 1 114 ? -57.248 -11.173 -6.210  0.05 10.87 ? 113  SER B O     1  
ATOM   3791   C  CB    A SER B 1 114 ? -58.897 -13.249 -7.343  0.05 10.93 ? 113  SER B CB    1  
ATOM   3792   O  OG    A SER B 1 114 ? -59.868 -12.458 -6.663  0.05 11.00 ? 113  SER B OG    1  
ATOM   3793   N  N     A TYR B 1 115 ? -57.559 -9.957  -8.063  0.05 10.86 ? 114  TYR B N     1  
ATOM   3794   C  CA    A TYR B 1 115 ? -57.299 -8.693  -7.381  0.05 10.87 ? 114  TYR B CA    1  
ATOM   3795   C  C     A TYR B 1 115 ? -58.338 -8.299  -6.298  0.05 10.95 ? 114  TYR B C     1  
ATOM   3796   O  O     A TYR B 1 115 ? -57.971 -7.715  -5.283  0.05 10.96 ? 114  TYR B O     1  
ATOM   3797   C  CB    A TYR B 1 115 ? -57.133 -7.546  -8.396  0.05 10.85 ? 114  TYR B CB    1  
ATOM   3798   C  CG    A TYR B 1 115 ? -56.008 -7.720  -9.408  0.05 10.78 ? 114  TYR B CG    1  
ATOM   3799   C  CD1   A TYR B 1 115 ? -54.783 -8.277  -9.050  0.05 10.73 ? 114  TYR B CD1   1  
ATOM   3800   C  CD2   A TYR B 1 115 ? -56.173 -7.304  -10.724 0.05 10.77 ? 114  TYR B CD2   1  
ATOM   3801   C  CE1   A TYR B 1 115 ? -53.749 -8.421  -9.989  0.05 10.68 ? 114  TYR B CE1   1  
ATOM   3802   C  CE2   A TYR B 1 115 ? -55.155 -7.441  -11.666 0.05 10.71 ? 114  TYR B CE2   1  
ATOM   3803   C  CZ    A TYR B 1 115 ? -53.948 -7.996  -11.299 0.05 10.67 ? 114  TYR B CZ    1  
ATOM   3804   O  OH    A TYR B 1 115 ? -52.952 -8.115  -12.256 0.05 10.63 ? 114  TYR B OH    1  
ATOM   3805   N  N     A PRO B 1 116 ? -59.633 -8.597  -6.514  0.05 11.01 ? 115  PRO B N     1  
ATOM   3806   C  CA    A PRO B 1 116 ? -60.596 -8.172  -5.485  0.05 11.09 ? 115  PRO B CA    1  
ATOM   3807   C  C     A PRO B 1 116 ? -60.396 -8.828  -4.118  0.05 11.10 ? 115  PRO B C     1  
ATOM   3808   O  O     A PRO B 1 116 ? -60.841 -8.286  -3.113  0.05 11.16 ? 115  PRO B O     1  
ATOM   3809   C  CB    A PRO B 1 116 ? -61.941 -8.610  -6.067  0.05 11.16 ? 115  PRO B CB    1  
ATOM   3810   C  CG    A PRO B 1 116 ? -61.730 -8.579  -7.542  0.05 11.12 ? 115  PRO B CG    1  
ATOM   3811   C  CD    A PRO B 1 116 ? -60.315 -9.052  -7.739  0.05 11.02 ? 115  PRO B CD    1  
ATOM   3812   N  N     A ALA B 1 117 ? -59.741 -9.982  -4.082  0.05 11.05 ? 116  ALA B N     1  
ATOM   3813   C  CA    A ALA B 1 117 ? -59.486 -10.638 -2.804  0.05 11.06 ? 116  ALA B CA    1  
ATOM   3814   C  C     A ALA B 1 117 ? -58.517 -9.833  -1.939  0.05 11.04 ? 116  ALA B C     1  
ATOM   3815   O  O     A ALA B 1 117 ? -58.715 -9.705  -0.732  0.05 11.09 ? 116  ALA B O     1  
ATOM   3816   C  CB    A ALA B 1 117 ? -58.967 -12.026 -3.031  0.05 11.01 ? 116  ALA B CB    1  
ATOM   3817   N  N     A ARG B 1 118 ? -57.467 -9.304  -2.566  0.05 10.99 ? 117  ARG B N     1  
ATOM   3818   C  CA    A ARG B 1 118 ? -56.473 -8.491  -1.875  0.05 10.98 ? 117  ARG B CA    1  
ATOM   3819   C  C     A ARG B 1 118 ? -57.123 -7.248  -1.281  0.05 11.06 ? 117  ARG B C     1  
ATOM   3820   O  O     A ARG B 1 118 ? -56.854 -6.867  -0.144  0.05 11.10 ? 117  ARG B O     1  
ATOM   3821   C  CB    A ARG B 1 118 ? -55.391 -8.029  -2.856  0.05 10.91 ? 117  ARG B CB    1  
ATOM   3822   C  CG    A ARG B 1 118 ? -54.540 -9.114  -3.519  0.05 10.84 ? 117  ARG B CG    1  
ATOM   3823   C  CD    A ARG B 1 118 ? -53.939 -8.509  -4.790  0.05 10.79 ? 117  ARG B CD    1  
ATOM   3824   N  NE    A ARG B 1 118 ? -52.903 -9.259  -5.509  0.05 10.73 ? 117  ARG B NE    1  
ATOM   3825   C  CZ    A ARG B 1 118 ? -53.119 -10.311 -6.294  0.05 10.71 ? 117  ARG B CZ    1  
ATOM   3826   N  NH1   A ARG B 1 118 ? -54.335 -10.818 -6.422  0.05 10.74 ? 117  ARG B NH1   1  
ATOM   3827   N  NH2   A ARG B 1 118 ? -52.101 -10.868 -6.948  0.05 10.67 ? 117  ARG B NH2   1  
ATOM   3828   N  N     A VAL B 1 119 ? -57.959 -6.601  -2.080  0.05 11.09 ? 118  VAL B N     1  
ATOM   3829   C  CA    A VAL B 1 119 ? -58.567 -5.332  -1.684  0.05 11.17 ? 118  VAL B CA    1  
ATOM   3830   C  C     A VAL B 1 119 ? -59.532 -5.500  -0.519  0.05 11.26 ? 118  VAL B C     1  
ATOM   3831   O  O     A VAL B 1 119 ? -59.518 -4.722  0.442   0.05 11.33 ? 118  VAL B O     1  
ATOM   3832   C  CB    A VAL B 1 119 ? -59.301 -4.687  -2.858  0.05 11.19 ? 118  VAL B CB    1  
ATOM   3833   C  CG1   A VAL B 1 119 ? -59.902 -3.371  -2.425  0.05 11.29 ? 118  VAL B CG1   1  
ATOM   3834   C  CG2   A VAL B 1 119 ? -58.345 -4.485  -4.019  0.05 11.11 ? 118  VAL B CG2   1  
ATOM   3835   N  N     A LEU B 1 120 ? -60.351 -6.538  -0.591  0.05 11.28 ? 119  LEU B N     1  
ATOM   3836   C  CA    A LEU B 1 120 ? -61.309 -6.810  0.474   0.05 11.37 ? 119  LEU B CA    1  
ATOM   3837   C  C     A LEU B 1 120 ? -60.663 -7.234  1.798   0.05 11.37 ? 119  LEU B C     1  
ATOM   3838   O  O     A LEU B 1 120 ? -61.112 -6.812  2.865   0.05 11.46 ? 119  LEU B O     1  
ATOM   3839   C  CB    A LEU B 1 120 ? -62.343 -7.839  0.009   0.05 11.38 ? 119  LEU B CB    1  
ATOM   3840   C  CG    A LEU B 1 120 ? -63.221 -7.312  -1.120  0.05 11.42 ? 119  LEU B CG    1  
ATOM   3841   C  CD1   A LEU B 1 120 ? -64.105 -8.406  -1.713  0.05 11.45 ? 119  LEU B CD1   1  
ATOM   3842   C  CD2   A LEU B 1 120 ? -64.069 -6.140  -0.622  0.05 11.53 ? 119  LEU B CD2   1  
ATOM   3843   N  N     A ALA B 1 121 ? -59.624 -8.067  1.742   0.05 11.28 ? 120  ALA B N     1  
ATOM   3844   C  CA    A ALA B 1 121 ? -58.960 -8.485  2.968   0.05 11.28 ? 120  ALA B CA    1  
ATOM   3845   C  C     A ALA B 1 121 ? -58.445 -7.264  3.714   0.05 11.33 ? 120  ALA B C     1  
ATOM   3846   O  O     A ALA B 1 121 ? -58.568 -7.182  4.922   0.05 11.40 ? 120  ALA B O     1  
ATOM   3847   C  CB    A ALA B 1 121 ? -57.814 -9.451  2.676   0.05 11.18 ? 120  ALA B CB    1  
ATOM   3848   N  N     A ARG B 1 122 ? -57.871 -6.316  2.973   0.05 11.30 ? 121  ARG B N     1  
ATOM   3849   C  CA    A ARG B 1 122 ? -57.394 -5.064  3.559   0.05 11.36 ? 121  ARG B CA    1  
ATOM   3850   C  C     A ARG B 1 122 ? -58.548 -4.269  4.173   0.05 11.48 ? 121  ARG B C     1  
ATOM   3851   O  O     A ARG B 1 122 ? -58.448 -3.777  5.309   0.05 11.56 ? 121  ARG B O     1  
ATOM   3852   C  CB    A ARG B 1 122 ? -56.685 -4.218  2.495   0.05 11.30 ? 121  ARG B CB    1  
ATOM   3853   C  CG    A ARG B 1 122 ? -55.436 -4.866  1.925   0.05 11.19 ? 121  ARG B CG    1  
ATOM   3854   C  CD    A ARG B 1 122 ? -54.732 -3.914  0.972   0.05 11.15 ? 121  ARG B CD    1  
ATOM   3855   N  NE    A ARG B 1 122 ? -53.929 -4.623  -0.018  0.05 11.05 ? 121  ARG B NE    1  
ATOM   3856   C  CZ    A ARG B 1 122 ? -52.663 -4.324  -0.308  0.05 11.00 ? 121  ARG B CZ    1  
ATOM   3857   N  NH1   A ARG B 1 122 ? -52.059 -3.333  0.321   0.05 11.04 ? 121  ARG B NH1   1  
ATOM   3858   N  NH2   A ARG B 1 122 ? -52.001 -5.024  -1.219  0.05 10.93 ? 121  ARG B NH2   1  
ATOM   3859   N  N     A ARG B 1 123 ? -59.639 -4.145  3.414   0.05 11.50 ? 122  ARG B N     1  
ATOM   3860   C  CA    A ARG B 1 123 ? -60.825 -3.419  3.870   0.05 11.63 ? 122  ARG B CA    1  
ATOM   3861   C  C     A ARG B 1 123 ? -61.403 -4.086  5.113   0.05 11.70 ? 122  ARG B C     1  
ATOM   3862   O  O     A ARG B 1 123 ? -61.392 -3.515  6.202   0.05 11.80 ? 122  ARG B O     1  
ATOM   3863   C  CB    A ARG B 1 123 ? -61.889 -3.379  2.763   0.05 11.64 ? 122  ARG B CB    1  
ATOM   3864   C  CG    A ARG B 1 123 ? -63.152 -2.585  3.120   0.05 11.78 ? 122  ARG B CG    1  
ATOM   3865   C  CD    A ARG B 1 123 ? -64.280 -2.776  2.090   0.05 11.80 ? 122  ARG B CD    1  
ATOM   3866   N  NE    A ARG B 1 123 ? -63.934 -2.277  0.759   0.05 11.73 ? 122  ARG B NE    1  
ATOM   3867   C  CZ    A ARG B 1 123 ? -64.781 -2.230  -0.268  0.05 11.74 ? 122  ARG B CZ    1  
ATOM   3868   N  NH1   A ARG B 1 123 ? -66.031 -2.641  -0.116  0.05 11.82 ? 122  ARG B NH1   1  
ATOM   3869   N  NH2   A ARG B 1 123 ? -64.378 -1.770  -1.448  0.05 11.68 ? 122  ARG B NH2   1  
ATOM   3870   N  N     A TRP B 1 124 ? -61.897 -5.306  4.932   0.05 11.67 ? 123  TRP B N     1  
ATOM   3871   C  CA    A TRP B 1 124 ? -62.445 -6.115  6.019   0.05 11.73 ? 123  TRP B CA    1  
ATOM   3872   C  C     A TRP B 1 124 ? -61.480 -6.249  7.202   0.05 11.73 ? 123  TRP B C     1  
ATOM   3873   O  O     A TRP B 1 124 ? -61.902 -6.478  8.344   0.05 11.80 ? 123  TRP B O     1  
ATOM   3874   C  CB    A TRP B 1 124 ? -62.841 -7.494  5.491   0.05 11.67 ? 123  TRP B CB    1  
ATOM   3875   C  CG    A TRP B 1 124 ? -63.966 -7.465  4.499   0.05 11.70 ? 123  TRP B CG    1  
ATOM   3876   C  CD1   A TRP B 1 124 ? -64.939 -6.504  4.383   0.05 11.81 ? 123  TRP B CD1   1  
ATOM   3877   C  CD2   A TRP B 1 124 ? -64.238 -8.431  3.466   0.05 11.64 ? 123  TRP B CD2   1  
ATOM   3878   N  NE1   A TRP B 1 124 ? -65.797 -6.824  3.365   0.05 11.81 ? 123  TRP B NE1   1  
ATOM   3879   C  CE2   A TRP B 1 124 ? -65.387 -7.996  2.782   0.05 11.71 ? 123  TRP B CE2   1  
ATOM   3880   C  CE3   A TRP B 1 124 ? -63.620 -9.623  3.058   0.05 11.54 ? 123  TRP B CE3   1  
ATOM   3881   C  CZ2   A TRP B 1 124 ? -65.932 -8.704  1.717   0.05 11.69 ? 123  TRP B CZ2   1  
ATOM   3882   C  CZ3   A TRP B 1 124 ? -64.165 -10.325 2.004   0.05 11.51 ? 123  TRP B CZ3   1  
ATOM   3883   C  CH2   A TRP B 1 124 ? -65.307 -9.860  1.342   0.05 11.59 ? 123  TRP B CH2   1  
ATOM   3884   N  N     A GLY B 1 125 ? -60.190 -6.097  6.928   0.05 11.65 ? 124  GLY B N     1  
ATOM   3885   C  CA    A GLY B 1 125 ? -59.188 -6.056  7.980   0.05 11.66 ? 124  GLY B CA    1  
ATOM   3886   C  C     A GLY B 1 125 ? -58.855 -7.446  8.474   0.05 11.60 ? 124  GLY B C     1  
ATOM   3887   O  O     A GLY B 1 125 ? -58.816 -7.706  9.675   0.05 11.65 ? 124  GLY B O     1  
ATOM   3888   N  N     A VAL B 1 126 ? -58.594 -8.341  7.529   0.05 11.50 ? 125  VAL B N     1  
ATOM   3889   C  CA    A VAL B 1 126 ? -58.403 -9.749  7.840   0.05 11.44 ? 125  VAL B CA    1  
ATOM   3890   C  C     A VAL B 1 126 ? -57.114 -10.263 7.220   0.05 11.33 ? 125  VAL B C     1  
ATOM   3891   O  O     A VAL B 1 126 ? -56.559 -9.628  6.327   0.05 11.29 ? 125  VAL B O     1  
ATOM   3892   C  CB    A VAL B 1 126 ? -59.593 -10.570 7.311   0.05 11.45 ? 125  VAL B CB    1  
ATOM   3893   C  CG1   A VAL B 1 126 ? -60.596 -10.815 8.422   0.05 11.55 ? 125  VAL B CG1   1  
ATOM   3894   C  CG2   A VAL B 1 126 ? -60.250 -9.841  6.161   0.05 11.45 ? 125  VAL B CG2   1  
ATOM   3895   N  N     A PRO B 1 127 ? -56.625 -11.416 7.701   0.05 11.29 ? 126  PRO B N     1  
ATOM   3896   C  CA    A PRO B 1 127 ? -55.489 -12.046 7.028   0.05 11.20 ? 126  PRO B CA    1  
ATOM   3897   C  C     A PRO B 1 127 ? -55.847 -12.457 5.613   0.05 11.13 ? 126  PRO B C     1  
ATOM   3898   O  O     A PRO B 1 127 ? -56.963 -12.922 5.378   0.05 11.15 ? 126  PRO B O     1  
ATOM   3899   C  CB    A PRO B 1 127 ? -55.262 -13.321 7.840   0.05 11.19 ? 126  PRO B CB    1  
ATOM   3900   C  CG    A PRO B 1 127 ? -55.928 -13.106 9.120   0.05 11.28 ? 126  PRO B CG    1  
ATOM   3901   C  CD    A PRO B 1 127 ? -57.041 -12.159 8.903   0.05 11.34 ? 126  PRO B CD    1  
ATOM   3902   N  N     A ALA B 1 128 ? -54.897 -12.298 4.693   0.05 11.07 ? 127  ALA B N     1  
ATOM   3903   C  CA    A ALA B 1 128 ? -55.029 -12.820 3.340   0.05 11.01 ? 127  ALA B CA    1  
ATOM   3904   C  C     A ALA B 1 128 ? -53.879 -13.784 3.052   0.05 10.95 ? 127  ALA B C     1  
ATOM   3905   O  O     A ALA B 1 128 ? -52.743 -13.539 3.467   0.05 10.93 ? 127  ALA B O     1  
ATOM   3906   C  CB    A ALA B 1 128 ? -55.013 -11.686 2.329   0.05 10.99 ? 127  ALA B CB    1  
ATOM   3907   N  N     A VAL B 1 129 ? -54.180 -14.880 2.361   0.05 10.92 ? 128  VAL B N     1  
ATOM   3908   C  CA    A VAL B 1 129 ? -53.145 -15.806 1.905   0.05 10.87 ? 128  VAL B CA    1  
ATOM   3909   C  C     A VAL B 1 129 ? -53.257 -16.012 0.404   0.05 10.83 ? 128  VAL B C     1  
ATOM   3910   O  O     A VAL B 1 129 ? -54.291 -16.454 -0.098  0.05 10.84 ? 128  VAL B O     1  
ATOM   3911   C  CB    A VAL B 1 129 ? -53.241 -17.181 2.592   0.05 10.88 ? 128  VAL B CB    1  
ATOM   3912   C  CG1   A VAL B 1 129 ? -52.154 -18.119 2.045   0.05 10.84 ? 128  VAL B CG1   1  
ATOM   3913   C  CG2   A VAL B 1 129 ? -53.116 -17.024 4.097   0.05 10.92 ? 128  VAL B CG2   1  
ATOM   3914   N  N     A SER B 1 130 ? -52.182 -15.691 -0.307  0.05 10.79 ? 129  SER B N     1  
ATOM   3915   C  CA    A SER B 1 130 ? -52.131 -15.883 -1.747  0.05 10.76 ? 129  SER B CA    1  
ATOM   3916   C  C     A SER B 1 130 ? -51.652 -17.295 -2.059  0.05 10.74 ? 129  SER B C     1  
ATOM   3917   O  O     A SER B 1 130 ? -50.705 -17.781 -1.442  0.05 10.74 ? 129  SER B O     1  
ATOM   3918   C  CB    A SER B 1 130 ? -51.193 -14.845 -2.382  0.05 10.73 ? 129  SER B CB    1  
ATOM   3919   O  OG    A SER B 1 130 ? -51.041 -15.056 -3.777  0.05 10.70 ? 129  SER B OG    1  
ATOM   3920   N  N     A LEU B 1 131 ? -52.327 -17.963 -2.988  0.05 10.75 ? 130  LEU B N     1  
ATOM   3921   C  CA    A LEU B 1 131 ? -51.909 -19.292 -3.429  0.05 10.75 ? 130  LEU B CA    1  
ATOM   3922   C  C     A LEU B 1 131 ? -51.403 -19.205 -4.857  0.05 10.73 ? 130  LEU B C     1  
ATOM   3923   O  O     A LEU B 1 131 ? -52.174 -18.873 -5.762  0.05 10.73 ? 130  LEU B O     1  
ATOM   3924   C  CB    A LEU B 1 131 ? -53.083 -20.278 -3.377  0.05 10.78 ? 130  LEU B CB    1  
ATOM   3925   C  CG    A LEU B 1 131 ? -53.767 -20.487 -2.024  0.05 10.81 ? 130  LEU B CG    1  
ATOM   3926   C  CD1   A LEU B 1 131 ? -54.932 -21.465 -2.158  0.05 10.85 ? 130  LEU B CD1   1  
ATOM   3927   C  CD2   A LEU B 1 131 ? -52.789 -20.986 -0.974  0.05 10.80 ? 130  LEU B CD2   1  
ATOM   3928   N  N     A SER B 1 132 ? -50.123 -19.517 -5.069  0.05 10.71 ? 131  SER B N     1  
ATOM   3929   C  CA    A SER B 1 132 ? -49.529 -19.393 -6.401  0.05 10.70 ? 131  SER B CA    1  
ATOM   3930   C  C     A SER B 1 132 ? -49.282 -20.738 -7.067  0.05 10.72 ? 131  SER B C     1  
ATOM   3931   O  O     A SER B 1 132 ? -48.520 -21.554 -6.554  0.05 10.74 ? 131  SER B O     1  
ATOM   3932   C  CB    A SER B 1 132 ? -48.205 -18.626 -6.342  0.05 10.67 ? 131  SER B CB    1  
ATOM   3933   O  OG    A SER B 1 132 ? -47.625 -18.523 -7.639  0.05 10.67 ? 131  SER B OG    1  
ATOM   3934   N  N     A PRO B 1 133 ? -49.894 -20.959 -8.237  0.05 10.74 ? 132  PRO B N     1  
ATOM   3935   C  CA    A PRO B 1 133 ? -49.723 -22.235 -8.944  0.05 10.78 ? 132  PRO B CA    1  
ATOM   3936   C  C     A PRO B 1 133 ? -48.391 -22.328 -9.691  0.05 10.78 ? 132  PRO B C     1  
ATOM   3937   O  O     A PRO B 1 133 ? -48.053 -23.383 -10.237 0.05 10.82 ? 132  PRO B O     1  
ATOM   3938   C  CB    A PRO B 1 133 ? -50.881 -22.224 -9.942  0.05 10.80 ? 132  PRO B CB    1  
ATOM   3939   C  CG    A PRO B 1 133 ? -51.025 -20.773 -10.292 0.05 10.77 ? 132  PRO B CG    1  
ATOM   3940   C  CD    A PRO B 1 133 ? -50.716 -20.007 -9.005  0.05 10.73 ? 132  PRO B CD    1  
ATOM   3941   N  N     A ASN B 1 134 ? -47.634 -21.237 -9.705  0.05 10.74 ? 133  ASN B N     1  
ATOM   3942   C  CA    A ASN B 1 134 ? -46.385 -21.193 -10.454 0.05 10.75 ? 133  ASN B CA    1  
ATOM   3943   C  C     A ASN B 1 134 ? -45.350 -20.408 -9.669  0.05 10.72 ? 133  ASN B C     1  
ATOM   3944   O  O     A ASN B 1 134 ? -45.586 -20.064 -8.515  0.05 10.71 ? 133  ASN B O     1  
ATOM   3945   C  CB    A ASN B 1 134 ? -46.615 -20.533 -11.813 0.05 10.74 ? 133  ASN B CB    1  
ATOM   3946   C  CG    A ASN B 1 134 ? -47.335 -19.213 -11.690 0.05 10.70 ? 133  ASN B CG    1  
ATOM   3947   O  OD1   A ASN B 1 134 ? -46.731 -18.199 -11.329 0.05 10.66 ? 133  ASN B OD1   1  
ATOM   3948   N  ND2   A ASN B 1 134 ? -48.637 -19.217 -11.968 0.05 10.71 ? 133  ASN B ND2   1  
ATOM   3949   N  N     A LEU B 1 135 ? -44.216 -20.112 -10.297 0.05 10.73 ? 134  LEU B N     1  
ATOM   3950   C  CA    A LEU B 1 135 ? -43.133 -19.415 -9.608  0.05 10.72 ? 134  LEU B CA    1  
ATOM   3951   C  C     A LEU B 1 135 ? -43.579 -18.058 -9.092  0.05 10.67 ? 134  LEU B C     1  
ATOM   3952   O  O     A LEU B 1 135 ? -44.561 -17.494 -9.572  0.05 10.65 ? 134  LEU B O     1  
ATOM   3953   C  CB    A LEU B 1 135 ? -41.919 -19.254 -10.529 0.05 10.74 ? 134  LEU B CB    1  
ATOM   3954   C  CG    A LEU B 1 135 ? -42.121 -18.349 -11.745 0.05 10.71 ? 134  LEU B CG    1  
ATOM   3955   C  CD1   A LEU B 1 135 ? -41.505 -16.996 -11.470 0.05 10.68 ? 134  LEU B CD1   1  
ATOM   3956   C  CD2   A LEU B 1 135 ? -41.513 -18.979 -12.997 0.05 10.76 ? 134  LEU B CD2   1  
ATOM   3957   N  N     A VAL B 1 136 ? -42.846 -17.546 -8.107  0.05 10.68 ? 135  VAL B N     1  
ATOM   3958   C  CA    A VAL B 1 136 ? -43.138 -16.253 -7.510  0.05 10.65 ? 135  VAL B CA    1  
ATOM   3959   C  C     A VAL B 1 136 ? -41.948 -15.323 -7.661  0.05 10.65 ? 135  VAL B C     1  
ATOM   3960   O  O     A VAL B 1 136 ? -40.888 -15.726 -8.126  0.05 10.68 ? 135  VAL B O     1  
ATOM   3961   C  CB    A VAL B 1 136 ? -43.478 -16.380 -6.023  0.05 10.66 ? 135  VAL B CB    1  
ATOM   3962   C  CG1   A VAL B 1 136 ? -44.770 -17.160 -5.853  0.05 10.66 ? 135  VAL B CG1   1  
ATOM   3963   C  CG2   A VAL B 1 136 ? -42.324 -17.061 -5.263  0.05 10.70 ? 135  VAL B CG2   1  
ATOM   3964   N  N     A ALA B 1 137 ? -42.137 -14.075 -7.254  0.05 10.64 ? 136  ALA B N     1  
ATOM   3965   C  CA    A ALA B 1 137 ? -41.093 -13.074 -7.372  0.05 10.64 ? 136  ALA B CA    1  
ATOM   3966   C  C     A ALA B 1 137 ? -40.011 -13.307 -6.328  0.05 10.69 ? 136  ALA B C     1  
ATOM   3967   O  O     A ALA B 1 137 ? -40.302 -13.577 -5.166  0.05 10.71 ? 136  ALA B O     1  
ATOM   3968   C  CB    A ALA B 1 137 ? -41.684 -11.681 -7.211  0.05 10.62 ? 136  ALA B CB    1  
ATOM   3969   N  N     A TRP B 1 138 ? -38.760 -13.199 -6.756  0.05 10.72 ? 137  TRP B N     1  
ATOM   3970   C  CA    A TRP B 1 138 ? -37.637 -13.232 -5.836  0.05 10.77 ? 137  TRP B CA    1  
ATOM   3971   C  C     A TRP B 1 138 ? -37.209 -11.802 -5.531  0.05 10.78 ? 137  TRP B C     1  
ATOM   3972   O  O     A TRP B 1 138 ? -37.551 -10.887 -6.268  0.05 10.75 ? 137  TRP B O     1  
ATOM   3973   C  CB    A TRP B 1 138 ? -36.483 -14.024 -6.450  0.05 10.82 ? 137  TRP B CB    1  
ATOM   3974   C  CG    A TRP B 1 138 ? -36.052 -13.564 -7.835  0.05 10.80 ? 137  TRP B CG    1  
ATOM   3975   C  CD1   A TRP B 1 138 ? -35.052 -12.679 -8.130  0.05 10.83 ? 137  TRP B CD1   1  
ATOM   3976   C  CD2   A TRP B 1 138 ? -36.591 -13.993 -9.097  0.05 10.77 ? 137  TRP B CD2   1  
ATOM   3977   N  NE1   A TRP B 1 138 ? -34.939 -12.528 -9.499  0.05 10.81 ? 137  TRP B NE1   1  
ATOM   3978   C  CE2   A TRP B 1 138 ? -35.872 -13.323 -10.112 0.05 10.78 ? 137  TRP B CE2   1  
ATOM   3979   C  CE3   A TRP B 1 138 ? -37.609 -14.878 -9.467  0.05 10.75 ? 137  TRP B CE3   1  
ATOM   3980   C  CZ2   A TRP B 1 138 ? -36.136 -13.515 -11.470 0.05 10.76 ? 137  TRP B CZ2   1  
ATOM   3981   C  CZ3   A TRP B 1 138 ? -37.872 -15.064 -10.812 0.05 10.73 ? 137  TRP B CZ3   1  
ATOM   3982   C  CH2   A TRP B 1 138 ? -37.141 -14.379 -11.801 0.05 10.74 ? 137  TRP B CH2   1  
ATOM   3983   N  N     A LYS B 1 139 ? -36.475 -11.601 -4.443  0.05 10.84 ? 138  LYS B N     1  
ATOM   3984   C  CA    A LYS B 1 139 ? -36.012 -10.260 -4.115  0.05 10.87 ? 138  LYS B CA    1  
ATOM   3985   C  C     A LYS B 1 139 ? -35.007 -9.844  -5.181  0.05 10.88 ? 138  LYS B C     1  
ATOM   3986   O  O     A LYS B 1 139 ? -33.921 -10.401 -5.261  0.05 10.92 ? 138  LYS B O     1  
ATOM   3987   C  CB    A LYS B 1 139 ? -35.399 -10.220 -2.715  0.05 10.94 ? 138  LYS B CB    1  
ATOM   3988   C  CG    A LYS B 1 139 ? -36.431 -10.390 -1.587  0.05 10.94 ? 138  LYS B CG    1  
ATOM   3989   N  N     A GLY B 1 140 ? -35.402 -8.889  -6.020  0.05 10.84 ? 139  GLY B N     1  
ATOM   3990   C  CA    A GLY B 1 140 ? -34.639 -8.531  -7.201  0.05 10.84 ? 139  GLY B CA    1  
ATOM   3991   C  C     A GLY B 1 140 ? -35.499 -8.629  -8.451  0.05 10.77 ? 139  GLY B C     1  
ATOM   3992   O  O     A GLY B 1 140 ? -35.066 -8.268  -9.547  0.05 10.76 ? 139  GLY B O     1  
ATOM   3993   N  N     A TYR B 1 141 ? -36.729 -9.112  -8.277  0.05 10.72 ? 140  TYR B N     1  
ATOM   3994   C  CA    A TYR B 1 141 ? -37.642 -9.343  -9.388  0.05 10.67 ? 140  TYR B CA    1  
ATOM   3995   C  C     A TYR B 1 141 ? -38.071 -8.055  -10.088 0.05 10.64 ? 140  TYR B C     1  
ATOM   3996   O  O     A TYR B 1 141 ? -38.260 -8.065  -11.305 0.05 10.61 ? 140  TYR B O     1  
ATOM   3997   C  CB    A TYR B 1 141 ? -38.887 -10.077 -8.903  0.05 10.65 ? 140  TYR B CB    1  
ATOM   3998   C  CG    A TYR B 1 141 ? -39.869 -10.455 -9.992  0.05 10.61 ? 140  TYR B CG    1  
ATOM   3999   C  CD1   A TYR B 1 141 ? -39.737 -11.650 -10.683 0.05 10.62 ? 140  TYR B CD1   1  
ATOM   4000   C  CD2   A TYR B 1 141 ? -40.949 -9.636  -10.299 0.05 10.57 ? 140  TYR B CD2   1  
ATOM   4001   C  CE1   A TYR B 1 141 ? -40.635 -12.013 -11.666 0.05 10.60 ? 140  TYR B CE1   1  
ATOM   4002   C  CE2   A TYR B 1 141 ? -41.859 -9.996  -11.277 0.05 10.55 ? 140  TYR B CE2   1  
ATOM   4003   C  CZ    A TYR B 1 141 ? -41.696 -11.182 -11.960 0.05 10.56 ? 140  TYR B CZ    1  
ATOM   4004   O  OH    A TYR B 1 141 ? -42.608 -11.538 -12.936 0.05 10.55 ? 140  TYR B OH    1  
ATOM   4005   N  N     A GLU B 1 142 ? -38.241 -6.968  -9.330  0.05 10.65 ? 141  GLU B N     1  
ATOM   4006   C  CA    A GLU B 1 142 ? -38.597 -5.679  -9.939  0.05 10.63 ? 141  GLU B CA    1  
ATOM   4007   C  C     A GLU B 1 142 ? -37.667 -5.417  -11.104 0.05 10.62 ? 141  GLU B C     1  
ATOM   4008   O  O     A GLU B 1 142 ? -38.057 -5.394  -12.262 0.05 10.58 ? 141  GLU B O     1  
ATOM   4009   C  CB    A GLU B 1 142 ? -38.403 -4.487  -8.989  0.05 10.67 ? 141  GLU B CB    1  
ATOM   4010   C  CG    A GLU B 1 142 ? -38.771 -4.667  -7.543  0.05 10.70 ? 141  GLU B CG    1  
ATOM   4011   C  CD    A GLU B 1 142 ? -40.255 -4.763  -7.338  0.05 10.66 ? 141  GLU B CD    1  
ATOM   4012   O  OE1   A GLU B 1 142 ? -40.736 -5.848  -6.948  0.05 10.64 ? 141  GLU B OE1   1  
ATOM   4013   O  OE2   A GLU B 1 142 ? -40.942 -3.749  -7.578  0.05 10.66 ? 141  GLU B OE2   1  
ATOM   4014   N  N     A GLU B 1 143 ? -36.408 -5.231  -10.759 0.05 10.67 ? 142  GLU B N     1  
ATOM   4015   C  CA    A GLU B 1 143 ? -35.446 -4.659  -11.683 0.05 10.68 ? 142  GLU B CA    1  
ATOM   4016   C  C     A GLU B 1 143 ? -34.978 -5.664  -12.733 0.05 10.68 ? 142  GLU B C     1  
ATOM   4017   O  O     A GLU B 1 143 ? -34.604 -5.273  -13.828 0.05 10.67 ? 142  GLU B O     1  
ATOM   4018   C  CB    A GLU B 1 143 ? -34.278 -4.039  -10.896 0.05 10.75 ? 142  GLU B CB    1  
ATOM   4019   C  CG    A GLU B 1 143 ? -33.391 -5.031  -10.194 0.05 10.80 ? 142  GLU B CG    1  
ATOM   4020   C  CD    A GLU B 1 143 ? -32.929 -4.567  -8.803  0.05 10.84 ? 142  GLU B CD    1  
ATOM   4021   O  OE1   A GLU B 1 143 ? -32.674 -5.454  -7.947  0.05 10.89 ? 142  GLU B OE1   1  
ATOM   4022   O  OE2   A GLU B 1 143 ? -32.812 -3.335  -8.567  0.05 10.82 ? 142  GLU B OE2   1  
ATOM   4023   N  N     A GLU B 1 144 ? -35.039 -6.959  -12.415 0.05 10.69 ? 143  GLU B N     1  
ATOM   4024   C  CA    A GLU B 1 144 ? -34.535 -7.991  -13.326 0.05 10.71 ? 143  GLU B CA    1  
ATOM   4025   C  C     A GLU B 1 144 ? -35.549 -8.483  -14.350 0.05 10.66 ? 143  GLU B C     1  
ATOM   4026   O  O     A GLU B 1 144 ? -35.181 -8.805  -15.475 0.05 10.67 ? 143  GLU B O     1  
ATOM   4027   C  CB    A GLU B 1 144 ? -33.953 -9.188  -12.547 0.05 10.77 ? 143  GLU B CB    1  
ATOM   4028   C  CG    A GLU B 1 144 ? -32.546 -8.943  -12.021 0.05 10.83 ? 143  GLU B CG    1  
ATOM   4029   C  CD    A GLU B 1 144 ? -31.933 -10.160 -11.347 0.05 10.90 ? 143  GLU B CD    1  
ATOM   4030   O  OE1   A GLU B 1 144 ? -30.689 -10.210 -11.223 0.05 10.96 ? 143  GLU B OE1   1  
ATOM   4031   O  OE2   A GLU B 1 144 ? -32.689 -11.065 -10.927 0.05 10.88 ? 143  GLU B OE2   1  
ATOM   4032   N  N     A VAL B 1 145 ? -36.816 -8.557  -13.957 0.05 10.62 ? 144  VAL B N     1  
ATOM   4033   C  CA    A VAL B 1 145 ? -37.842 -9.129  -14.821 0.05 10.59 ? 144  VAL B CA    1  
ATOM   4034   C  C     A VAL B 1 145 ? -38.888 -8.093  -15.199 0.05 10.54 ? 144  VAL B C     1  
ATOM   4035   O  O     A VAL B 1 145 ? -39.121 -7.844  -16.378 0.05 10.52 ? 144  VAL B O     1  
ATOM   4036   C  CB    A VAL B 1 145 ? -38.575 -10.335 -14.164 0.05 10.59 ? 144  VAL B CB    1  
ATOM   4037   C  CG1   A VAL B 1 145 ? -39.755 -10.776 -15.044 0.05 10.57 ? 144  VAL B CG1   1  
ATOM   4038   C  CG2   A VAL B 1 145 ? -37.616 -11.499 -13.942 0.05 10.65 ? 144  VAL B CG2   1  
ATOM   4039   N  N     A ALA B 1 146 ? -39.510 -7.493  -14.193 0.05 10.53 ? 145  ALA B N     1  
ATOM   4040   C  CA    A ALA B 1 146 ? -40.677 -6.640  -14.412 0.05 10.50 ? 145  ALA B CA    1  
ATOM   4041   C  C     A ALA B 1 146 ? -40.327 -5.277  -15.005 0.05 10.48 ? 145  ALA B C     1  
ATOM   4042   O  O     A ALA B 1 146 ? -41.019 -4.775  -15.895 0.05 10.46 ? 145  ALA B O     1  
ATOM   4043   C  CB    A ALA B 1 146 ? -41.446 -6.457  -13.109 0.05 10.51 ? 145  ALA B CB    1  
ATOM   4044   N  N     A GLU B 1 147 ? -39.271 -4.665  -14.490 0.05 10.50 ? 146  GLU B N     1  
ATOM   4045   C  CA    A GLU B 1 147 ? -38.886 -3.354  -14.987 0.05 10.50 ? 146  GLU B CA    1  
ATOM   4046   C  C     A GLU B 1 147 ? -38.424 -3.403  -16.445 0.05 10.48 ? 146  GLU B C     1  
ATOM   4047   O  O     A GLU B 1 147 ? -38.808 -2.539  -17.233 0.05 10.45 ? 146  GLU B O     1  
ATOM   4048   C  CB    A GLU B 1 147 ? -37.891 -2.663  -14.049 0.05 10.54 ? 146  GLU B CB    1  
ATOM   4049   C  CG    A GLU B 1 147 ? -38.525 -2.328  -12.714 0.05 10.56 ? 146  GLU B CG    1  
ATOM   4050   C  CD    A GLU B 1 147 ? -37.798 -1.251  -11.945 0.05 10.60 ? 146  GLU B CD    1  
ATOM   4051   O  OE1   A GLU B 1 147 ? -38.455 -0.590  -11.113 0.05 10.62 ? 146  GLU B OE1   1  
ATOM   4052   O  OE2   A GLU B 1 147 ? -36.579 -1.077  -12.162 0.05 10.63 ? 146  GLU B OE2   1  
ATOM   4053   N  N     A PRO B 1 148 ? -37.638 -4.428  -16.829 0.05 10.51 ? 147  PRO B N     1  
ATOM   4054   C  CA    A PRO B 1 148 ? -37.372 -4.516  -18.269 0.05 10.50 ? 147  PRO B CA    1  
ATOM   4055   C  C     A PRO B 1 148 ? -38.569 -5.016  -19.080 0.05 10.48 ? 147  PRO B C     1  
ATOM   4056   O  O     A PRO B 1 148 ? -38.652 -4.705  -20.266 0.05 10.46 ? 147  PRO B O     1  
ATOM   4057   C  CB    A PRO B 1 148 ? -36.212 -5.527  -18.358 0.05 10.55 ? 147  PRO B CB    1  
ATOM   4058   C  CG    A PRO B 1 148 ? -35.630 -5.572  -16.986 0.05 10.58 ? 147  PRO B CG    1  
ATOM   4059   C  CD    A PRO B 1 148 ? -36.784 -5.354  -16.065 0.05 10.55 ? 147  PRO B CD    1  
ATOM   4060   N  N     A MET B 1 149 ? -39.474 -5.791  -18.471 0.05 10.48 ? 148  MET B N     1  
ATOM   4061   C  CA    A MET B 1 149 ? -40.644 -6.286  -19.193 0.05 10.47 ? 148  MET B CA    1  
ATOM   4062   C  C     A MET B 1 149 ? -41.545 -5.137  -19.618 0.05 10.43 ? 148  MET B C     1  
ATOM   4063   O  O     A MET B 1 149 ? -42.144 -5.165  -20.694 0.05 10.43 ? 148  MET B O     1  
ATOM   4064   C  CB    A MET B 1 149 ? -41.470 -7.268  -18.339 0.05 10.47 ? 148  MET B CB    1  
ATOM   4065   C  CG    A MET B 1 149 ? -41.305 -8.743  -18.720 0.05 10.51 ? 148  MET B CG    1  
ATOM   4066   S  SD    A MET B 1 149 ? -42.828 -9.719  -18.488 0.05 10.52 ? 148  MET B SD    1  
ATOM   4067   C  CE    A MET B 1 149 ? -42.284 -11.336 -19.060 0.05 10.56 ? 148  MET B CE    1  
ATOM   4068   N  N     A TRP B 1 150 ? -41.633 -4.135  -18.754 0.05 10.42 ? 149  TRP B N     1  
ATOM   4069   C  CA    A TRP B 1 150 ? -42.549 -3.021  -18.945 0.05 10.40 ? 149  TRP B CA    1  
ATOM   4070   C  C     A TRP B 1 150 ? -41.913 -1.855  -19.702 0.05 10.39 ? 149  TRP B C     1  
ATOM   4071   O  O     A TRP B 1 150 ? -42.592 -0.879  -20.013 0.05 10.38 ? 149  TRP B O     1  
ATOM   4072   C  CB    A TRP B 1 150 ? -43.112 -2.554  -17.585 0.05 10.41 ? 149  TRP B CB    1  
ATOM   4073   C  CG    A TRP B 1 150 ? -44.271 -3.383  -17.138 0.05 10.42 ? 149  TRP B CG    1  
ATOM   4074   C  CD1   A TRP B 1 150 ? -44.292 -4.319  -16.141 0.05 10.43 ? 149  TRP B CD1   1  
ATOM   4075   C  CD2   A TRP B 1 150 ? -45.580 -3.383  -17.715 0.05 10.42 ? 149  TRP B CD2   1  
ATOM   4076   N  NE1   A TRP B 1 150 ? -45.550 -4.889  -16.052 0.05 10.44 ? 149  TRP B NE1   1  
ATOM   4077   C  CE2   A TRP B 1 150 ? -46.353 -4.329  -17.012 0.05 10.43 ? 149  TRP B CE2   1  
ATOM   4078   C  CE3   A TRP B 1 150 ? -46.177 -2.659  -18.750 0.05 10.41 ? 149  TRP B CE3   1  
ATOM   4079   C  CZ2   A TRP B 1 150 ? -47.685 -4.573  -17.318 0.05 10.45 ? 149  TRP B CZ2   1  
ATOM   4080   C  CZ3   A TRP B 1 150 ? -47.506 -2.899  -19.049 0.05 10.43 ? 149  TRP B CZ3   1  
ATOM   4081   C  CH2   A TRP B 1 150 ? -48.242 -3.849  -18.339 0.05 10.45 ? 149  TRP B CH2   1  
ATOM   4082   N  N     A ARG B 1 151 ? -40.619 -1.964  -20.012 0.05 10.40 ? 150  ARG B N     1  
ATOM   4083   C  CA    A ARG B 1 151 ? -39.879 -0.831  -20.584 0.05 10.40 ? 150  ARG B CA    1  
ATOM   4084   C  C     A ARG B 1 151 ? -40.511 -0.238  -21.844 0.05 10.38 ? 150  ARG B C     1  
ATOM   4085   O  O     A ARG B 1 151 ? -40.795 0.951   -21.893 0.05 10.36 ? 150  ARG B O     1  
ATOM   4086   C  CB    A ARG B 1 151 ? -38.409 -1.174  -20.855 0.05 10.42 ? 150  ARG B CB    1  
ATOM   4087   C  CG    A ARG B 1 151 ? -37.581 0.045   -21.323 0.05 10.43 ? 150  ARG B CG    1  
ATOM   4088   C  CD    A ARG B 1 151 ? -36.192 -0.367  -21.800 0.05 10.47 ? 150  ARG B CD    1  
ATOM   4089   N  NE    A ARG B 1 151 ? -36.284 -1.541  -22.660 0.05 10.47 ? 150  ARG B NE    1  
ATOM   4090   C  CZ    A ARG B 1 151 ? -36.414 -1.505  -23.983 0.05 10.46 ? 150  ARG B CZ    1  
ATOM   4091   N  NH1   A ARG B 1 151 ? -36.408 -0.346  -24.634 0.05 10.44 ? 150  ARG B NH1   1  
ATOM   4092   N  NH2   A ARG B 1 151 ? -36.525 -2.635  -24.662 0.05 10.48 ? 150  ARG B NH2   1  
ATOM   4093   N  N     A GLU B 1 152 ? -40.726 -1.053  -22.867 0.05 10.38 ? 151  GLU B N     1  
ATOM   4094   C  CA    A GLU B 1 152 ? -41.390 -0.536  -24.060 0.05 10.36 ? 151  GLU B CA    1  
ATOM   4095   C  C     A GLU B 1 152 ? -42.903 -0.284  -23.826 0.05 10.36 ? 151  GLU B C     1  
ATOM   4096   O  O     A GLU B 1 152 ? -43.424 0.760   -24.209 0.05 10.35 ? 151  GLU B O     1  
ATOM   4097   C  CB    A GLU B 1 152 ? -41.116 -1.426  -25.290 0.05 10.38 ? 151  GLU B CB    1  
ATOM   4098   C  CG    A GLU B 1 152 ? -39.690 -2.017  -25.329 0.05 10.41 ? 151  GLU B CG    1  
ATOM   4099   C  CD    A GLU B 1 152 ? -38.833 -1.527  -26.491 0.05 10.42 ? 151  GLU B CD    1  
ATOM   4100   O  OE1   A GLU B 1 152 ? -38.045 -2.334  -27.017 0.05 10.46 ? 151  GLU B OE1   1  
ATOM   4101   O  OE2   A GLU B 1 152 ? -38.916 -0.342  -26.866 0.05 10.40 ? 151  GLU B OE2   1  
ATOM   4102   N  N     A PRO B 1 153 ? -43.610 -1.224  -23.175 0.05 10.37 ? 152  PRO B N     1  
ATOM   4103   C  CA    A PRO B 1 153 ? -45.051 -0.967  -23.040 0.05 10.37 ? 152  PRO B CA    1  
ATOM   4104   C  C     A PRO B 1 153 ? -45.442 0.157   -22.087 0.05 10.37 ? 152  PRO B C     1  
ATOM   4105   O  O     A PRO B 1 153 ? -46.497 0.760   -22.284 0.05 10.38 ? 152  PRO B O     1  
ATOM   4106   C  CB    A PRO B 1 153 ? -45.591 -2.305  -22.524 0.05 10.39 ? 152  PRO B CB    1  
ATOM   4107   C  CG    A PRO B 1 153 ? -44.641 -3.303  -23.038 0.05 10.40 ? 152  PRO B CG    1  
ATOM   4108   C  CD    A PRO B 1 153 ? -43.298 -2.641  -22.917 0.05 10.39 ? 152  PRO B CD    1  
ATOM   4109   N  N     A ARG B 1 154 ? -44.633 0.451   -21.076 0.05 10.37 ? 153  ARG B N     1  
ATOM   4110   C  CA    A ARG B 1 154 ? -45.045 1.468   -20.107 0.05 10.38 ? 153  ARG B CA    1  
ATOM   4111   C  C     A ARG B 1 154 ? -45.022 2.894   -20.671 0.05 10.38 ? 153  ARG B C     1  
ATOM   4112   O  O     A ARG B 1 154 ? -45.532 3.819   -20.042 0.05 10.40 ? 153  ARG B O     1  
ATOM   4113   C  CB    A ARG B 1 154 ? -44.235 1.392   -18.806 0.05 10.40 ? 153  ARG B CB    1  
ATOM   4114   C  CG    A ARG B 1 154 ? -42.902 2.115   -18.833 0.05 10.40 ? 153  ARG B CG    1  
ATOM   4115   C  CD    A ARG B 1 154 ? -42.190 1.993   -17.478 0.05 10.43 ? 153  ARG B CD    1  
ATOM   4116   N  NE    A ARG B 1 154 ? -43.022 1.333   -16.475 0.05 10.45 ? 153  ARG B NE    1  
ATOM   4117   C  CZ    A ARG B 1 154 ? -43.708 1.976   -15.531 0.05 10.48 ? 153  ARG B CZ    1  
ATOM   4118   N  NH1   A ARG B 1 154 ? -43.669 3.301   -15.471 0.05 10.50 ? 153  ARG B NH1   1  
ATOM   4119   N  NH2   A ARG B 1 154 ? -44.445 1.294   -14.659 0.05 10.49 ? 153  ARG B NH2   1  
ATOM   4120   N  N     A GLN B 1 155 ? -44.444 3.069   -21.852 0.05 10.36 ? 154  GLN B N     1  
ATOM   4121   C  CA    A GLN B 1 155 ? -44.398 4.398   -22.460 0.05 10.35 ? 154  GLN B CA    1  
ATOM   4122   C  C     A GLN B 1 155 ? -45.325 4.523   -23.657 0.05 10.35 ? 154  GLN B C     1  
ATOM   4123   O  O     A GLN B 1 155 ? -45.192 5.453   -24.454 0.05 10.34 ? 154  GLN B O     1  
ATOM   4124   C  CB    A GLN B 1 155 ? -42.971 4.781   -22.839 0.05 10.34 ? 154  GLN B CB    1  
ATOM   4125   C  CG    A GLN B 1 155 ? -42.139 5.192   -21.656 0.05 10.36 ? 154  GLN B CG    1  
ATOM   4126   C  CD    A GLN B 1 155 ? -42.238 6.675   -21.370 0.05 10.38 ? 154  GLN B CD    1  
ATOM   4127   O  OE1   A GLN B 1 155 ? -42.586 7.082   -20.262 0.05 10.41 ? 154  GLN B OE1   1  
ATOM   4128   N  NE2   A GLN B 1 155 ? -41.922 7.494   -22.369 0.05 10.37 ? 154  GLN B NE2   1  
ATOM   4129   N  N     A THR B 1 156 ? -46.252 3.576   -23.788 0.05 10.36 ? 155  THR B N     1  
ATOM   4130   C  CA    A THR B 1 156 ? -47.364 3.728   -24.722 0.05 10.38 ? 155  THR B CA    1  
ATOM   4131   C  C     A THR B 1 156 ? -48.479 4.437   -23.975 0.05 10.41 ? 155  THR B C     1  
ATOM   4132   O  O     A THR B 1 156 ? -48.519 4.396   -22.753 0.05 10.42 ? 155  THR B O     1  
ATOM   4133   C  CB    A THR B 1 156 ? -47.908 2.372   -25.213 0.05 10.39 ? 155  THR B CB    1  
ATOM   4134   O  OG1   A THR B 1 156 ? -48.536 1.679   -24.122 0.05 10.41 ? 155  THR B OG1   1  
ATOM   4135   C  CG2   A THR B 1 156 ? -46.794 1.527   -25.804 0.05 10.37 ? 155  THR B CG2   1  
ATOM   4136   N  N     A GLU B 1 157 ? -49.397 5.084   -24.687 0.05 10.43 ? 156  GLU B N     1  
ATOM   4137   C  CA    A GLU B 1 157 ? -50.489 5.746   -23.985 0.05 10.48 ? 156  GLU B CA    1  
ATOM   4138   C  C     A GLU B 1 157 ? -51.449 4.720   -23.356 0.05 10.51 ? 156  GLU B C     1  
ATOM   4139   O  O     A GLU B 1 157 ? -52.048 4.978   -22.309 0.05 10.54 ? 156  GLU B O     1  
ATOM   4140   C  CB    A GLU B 1 157 ? -51.211 6.733   -24.907 0.05 10.50 ? 156  GLU B CB    1  
ATOM   4141   C  CG    A GLU B 1 157 ? -50.253 7.730   -25.584 0.05 10.47 ? 156  GLU B CG    1  
ATOM   4142   C  CD    A GLU B 1 157 ? -49.246 8.346   -24.607 0.05 10.45 ? 156  GLU B CD    1  
ATOM   4143   O  OE1   A GLU B 1 157 ? -48.034 8.376   -24.921 0.05 10.41 ? 156  GLU B OE1   1  
ATOM   4144   O  OE2   A GLU B 1 157 ? -49.666 8.805   -23.525 0.05 10.49 ? 156  GLU B OE2   1  
ATOM   4145   N  N     A ARG B 1 158 ? -51.564 3.555   -23.983 0.05 10.51 ? 157  ARG B N     1  
ATOM   4146   C  CA    A ARG B 1 158 ? -52.356 2.456   -23.433 0.05 10.54 ? 157  ARG B CA    1  
ATOM   4147   C  C     A ARG B 1 158 ? -51.785 2.001   -22.095 0.05 10.52 ? 157  ARG B C     1  
ATOM   4148   O  O     A ARG B 1 158 ? -52.510 1.876   -21.109 0.05 10.55 ? 157  ARG B O     1  
ATOM   4149   C  CB    A ARG B 1 158 ? -52.371 1.271   -24.396 0.05 10.54 ? 157  ARG B CB    1  
ATOM   4150   C  CG    A ARG B 1 158 ? -53.134 0.055   -23.856 0.05 10.58 ? 157  ARG B CG    1  
ATOM   4151   C  CD    A ARG B 1 158 ? -53.067 -1.099  -24.822 0.05 10.59 ? 157  ARG B CD    1  
ATOM   4152   N  NE    A ARG B 1 158 ? -53.708 -2.299  -24.291 0.05 10.63 ? 157  ARG B NE    1  
ATOM   4153   C  CZ    A ARG B 1 158 ? -53.715 -3.466  -24.921 0.05 10.65 ? 157  ARG B CZ    1  
ATOM   4154   N  NH1   A ARG B 1 158 ? -53.109 -3.582  -26.092 0.05 10.64 ? 157  ARG B NH1   1  
ATOM   4155   N  NH2   A ARG B 1 158 ? -54.316 -4.517  -24.377 0.05 10.69 ? 157  ARG B NH2   1  
ATOM   4156   N  N     A GLY B 1 159 ? -50.483 1.751   -22.075 0.05 10.47 ? 158  GLY B N     1  
ATOM   4157   C  CA    A GLY B 1 159 ? -49.825 1.313   -20.852 0.05 10.46 ? 158  GLY B CA    1  
ATOM   4158   C  C     A GLY B 1 159 ? -49.824 2.407   -19.805 0.05 10.48 ? 158  GLY B C     1  
ATOM   4159   O  O     A GLY B 1 159 ? -49.979 2.148   -18.605 0.05 10.49 ? 158  GLY B O     1  
ATOM   4160   N  N     A ARG B 1 160 ? -49.635 3.643   -20.253 0.05 10.48 ? 159  ARG B N     1  
ATOM   4161   C  CA    A ARG B 1 160 ? -49.727 4.796   -19.368 0.05 10.51 ? 159  ARG B CA    1  
ATOM   4162   C  C     A ARG B 1 160 ? -51.109 4.881   -18.743 0.05 10.57 ? 159  ARG B C     1  
ATOM   4163   O  O     A ARG B 1 160 ? -51.243 5.131   -17.543 0.05 10.60 ? 159  ARG B O     1  
ATOM   4164   C  CB    A ARG B 1 160 ? -49.413 6.093   -20.129 0.05 10.50 ? 159  ARG B CB    1  
ATOM   4165   C  CG    A ARG B 1 160 ? -47.923 6.389   -20.262 0.05 10.46 ? 159  ARG B CG    1  
ATOM   4166   C  CD    A ARG B 1 160 ? -47.668 7.404   -21.375 0.05 10.45 ? 159  ARG B CD    1  
ATOM   4167   N  NE    A ARG B 1 160 ? -46.281 7.876   -21.383 0.05 10.43 ? 159  ARG B NE    1  
ATOM   4168   C  CZ    A ARG B 1 160 ? -45.770 8.690   -22.304 0.05 10.41 ? 159  ARG B CZ    1  
ATOM   4169   N  NH1   A ARG B 1 160 ? -44.502 9.063   -22.229 0.05 10.40 ? 159  ARG B NH1   1  
ATOM   4170   N  NH2   A ARG B 1 160 ? -46.522 9.131   -23.301 0.05 10.42 ? 159  ARG B NH2   1  
ATOM   4171   N  N     A ALA B 1 161 ? -52.137 4.665   -19.557 0.05 10.59 ? 160  ALA B N     1  
ATOM   4172   C  CA    A ALA B 1 161 ? -53.509 4.677   -19.070 0.05 10.65 ? 160  ALA B CA    1  
ATOM   4173   C  C     A ALA B 1 161 ? -53.785 3.438   -18.219 0.05 10.66 ? 160  ALA B C     1  
ATOM   4174   O  O     A ALA B 1 161 ? -54.560 3.501   -17.274 0.05 10.72 ? 160  ALA B O     1  
ATOM   4175   C  CB    A ALA B 1 161 ? -54.500 4.754   -20.228 0.05 10.68 ? 160  ALA B CB    1  
ATOM   4176   N  N     A TYR B 1 162 ? -53.158 2.319   -18.582 0.05 10.62 ? 161  TYR B N     1  
ATOM   4177   C  CA    A TYR B 1 162 ? -53.238 1.087   -17.790 0.05 10.62 ? 161  TYR B CA    1  
ATOM   4178   C  C     A TYR B 1 162 ? -52.816 1.336   -16.340 0.05 10.63 ? 161  TYR B C     1  
ATOM   4179   O  O     A TYR B 1 162 ? -53.635 1.222   -15.420 0.05 10.68 ? 161  TYR B O     1  
ATOM   4180   C  CB    A TYR B 1 162 ? -52.397 -0.026  -18.422 0.05 10.57 ? 161  TYR B CB    1  
ATOM   4181   C  CG    A TYR B 1 162 ? -52.250 -1.257  -17.545 0.05 10.57 ? 161  TYR B CG    1  
ATOM   4182   C  CD1   A TYR B 1 162 ? -53.365 -1.945  -17.080 0.05 10.61 ? 161  TYR B CD1   1  
ATOM   4183   C  CD2   A TYR B 1 162 ? -50.993 -1.735  -17.192 0.05 10.53 ? 161  TYR B CD2   1  
ATOM   4184   C  CE1   A TYR B 1 162 ? -53.229 -3.072  -16.279 0.05 10.61 ? 161  TYR B CE1   1  
ATOM   4185   C  CE2   A TYR B 1 162 ? -50.852 -2.857  -16.398 0.05 10.53 ? 161  TYR B CE2   1  
ATOM   4186   C  CZ    A TYR B 1 162 ? -51.968 -3.518  -15.944 0.05 10.57 ? 161  TYR B CZ    1  
ATOM   4187   O  OH    A TYR B 1 162 ? -51.811 -4.634  -15.146 0.05 10.57 ? 161  TYR B OH    1  
ATOM   4188   N  N     A TYR B 1 163 ? -51.552 1.689   -16.128 0.05 10.60 ? 162  TYR B N     1  
ATOM   4189   C  CA    A TYR B 1 163 ? -51.088 2.021   -14.777 0.05 10.62 ? 162  TYR B CA    1  
ATOM   4190   C  C     A TYR B 1 163 ? -51.904 3.148   -14.158 0.05 10.69 ? 162  TYR B C     1  
ATOM   4191   O  O     A TYR B 1 163 ? -51.999 3.259   -12.936 0.05 10.73 ? 162  TYR B O     1  
ATOM   4192   C  CB    A TYR B 1 163 ? -49.609 2.416   -14.773 0.05 10.58 ? 162  TYR B CB    1  
ATOM   4193   C  CG    A TYR B 1 163 ? -48.637 1.265   -14.610 0.05 10.54 ? 162  TYR B CG    1  
ATOM   4194   C  CD1   A TYR B 1 163 ? -48.276 0.803   -13.347 0.05 10.56 ? 162  TYR B CD1   1  
ATOM   4195   C  CD2   A TYR B 1 163 ? -48.060 0.662   -15.715 0.05 10.50 ? 162  TYR B CD2   1  
ATOM   4196   C  CE1   A TYR B 1 163 ? -47.376 -0.239  -13.199 0.05 10.53 ? 162  TYR B CE1   1  
ATOM   4197   C  CE2   A TYR B 1 163 ? -47.160 -0.376  -15.580 0.05 10.48 ? 162  TYR B CE2   1  
ATOM   4198   C  CZ    A TYR B 1 163 ? -46.823 -0.828  -14.322 0.05 10.49 ? 162  TYR B CZ    1  
ATOM   4199   O  OH    A TYR B 1 163 ? -45.918 -1.867  -14.187 0.05 10.48 ? 162  TYR B OH    1  
ATOM   4200   N  N     A ALA B 1 164 ? -52.486 3.991   -15.008 0.05 10.71 ? 163  ALA B N     1  
ATOM   4201   C  CA    A ALA B 1 164 ? -53.270 5.120   -14.530 0.05 10.79 ? 163  ALA B CA    1  
ATOM   4202   C  C     A ALA B 1 164 ? -54.536 4.659   -13.822 0.05 10.85 ? 163  ALA B C     1  
ATOM   4203   O  O     A ALA B 1 164 ? -54.841 5.121   -12.720 0.05 10.92 ? 163  ALA B O     1  
ATOM   4204   C  CB    A ALA B 1 164 ? -53.617 6.061   -15.681 0.05 10.80 ? 163  ALA B CB    1  
ATOM   4205   N  N     A ARG B 1 165 ? -55.277 3.760   -14.464 0.05 10.83 ? 164  ARG B N     1  
ATOM   4206   C  CA    A ARG B 1 165 ? -56.507 3.242   -13.875 0.05 10.90 ? 164  ARG B CA    1  
ATOM   4207   C  C     A ARG B 1 165 ? -56.193 2.484   -12.582 0.05 10.90 ? 164  ARG B C     1  
ATOM   4208   O  O     A ARG B 1 165 ? -56.913 2.604   -11.587 0.05 10.97 ? 164  ARG B O     1  
ATOM   4209   C  CB    A ARG B 1 165 ? -57.264 2.346   -14.865 0.05 10.88 ? 164  ARG B CB    1  
ATOM   4210   C  CG    A ARG B 1 165 ? -58.654 1.902   -14.368 0.05 10.96 ? 164  ARG B CG    1  
ATOM   4211   C  CD    A ARG B 1 165 ? -59.403 1.009   -15.374 0.05 10.95 ? 164  ARG B CD    1  
ATOM   4212   N  NE    A ARG B 1 165 ? -60.019 1.775   -16.452 0.05 10.97 ? 164  ARG B NE    1  
ATOM   4213   C  CZ    A ARG B 1 165 ? -60.701 1.252   -17.474 0.05 11.04 ? 164  ARG B CZ    1  
ATOM   4214   N  NH1   A ARG B 1 165 ? -60.876 -0.058  -17.582 0.05 11.08 ? 164  ARG B NH1   1  
ATOM   4215   N  NH2   A ARG B 1 165 ? -61.209 2.056   -18.399 0.05 11.06 ? 164  ARG B NH2   1  
ATOM   4216   N  N     A PHE B 1 166 ? -55.096 1.730   -12.597 0.05 10.82 ? 165  PHE B N     1  
ATOM   4217   C  CA    A PHE B 1 166 ? -54.708 0.916   -11.438 0.05 10.82 ? 165  PHE B CA    1  
ATOM   4218   C  C     A PHE B 1 166 ? -54.467 1.781   -10.198 0.05 10.88 ? 165  PHE B C     1  
ATOM   4219   O  O     A PHE B 1 166 ? -54.972 1.483   -9.114  0.05 10.93 ? 165  PHE B O     1  
ATOM   4220   C  CB    A PHE B 1 166 ? -53.459 0.094   -11.781 0.05 10.74 ? 165  PHE B CB    1  
ATOM   4221   C  CG    A PHE B 1 166 ? -53.445 -1.299  -11.197 0.05 10.73 ? 165  PHE B CG    1  
ATOM   4222   C  CD1   A PHE B 1 166 ? -53.938 -1.548  -9.924  0.05 10.77 ? 165  PHE B CD1   1  
ATOM   4223   C  CD2   A PHE B 1 166 ? -52.923 -2.356  -11.930 0.05 10.67 ? 165  PHE B CD2   1  
ATOM   4224   C  CE1   A PHE B 1 166 ? -53.914 -2.838  -9.389  0.05 10.76 ? 165  PHE B CE1   1  
ATOM   4225   C  CE2   A PHE B 1 166 ? -52.889 -3.652  -11.404 0.05 10.66 ? 165  PHE B CE2   1  
ATOM   4226   C  CZ    A PHE B 1 166 ? -53.392 -3.890  -10.131 0.05 10.70 ? 165  PHE B CZ    1  
ATOM   4227   N  N     A GLU B 1 167 ? -53.711 2.863   -10.359 0.05 10.87 ? 166  GLU B N     1  
ATOM   4228   C  CA    A GLU B 1 167 ? -53.365 3.734   -9.232  0.05 10.93 ? 166  GLU B CA    1  
ATOM   4229   C  C     A GLU B 1 167 ? -54.572 4.332   -8.511  0.05 11.03 ? 166  GLU B C     1  
ATOM   4230   O  O     A GLU B 1 167 ? -54.674 4.256   -7.287  0.05 11.09 ? 166  GLU B O     1  
ATOM   4231   C  CB    A GLU B 1 167 ? -52.424 4.853   -9.684  0.05 10.91 ? 166  GLU B CB    1  
ATOM   4232   C  CG    A GLU B 1 167 ? -51.052 4.362   -10.117 0.05 10.82 ? 166  GLU B CG    1  
ATOM   4233   C  CD    A GLU B 1 167 ? -49.918 5.177   -9.533  0.05 10.83 ? 166  GLU B CD    1  
ATOM   4234   O  OE1   A GLU B 1 167 ? -48.741 4.835   -9.809  0.05 10.77 ? 166  GLU B OE1   1  
ATOM   4235   O  OE2   A GLU B 1 167 ? -50.201 6.146   -8.783  0.05 10.91 ? 166  GLU B OE2   1  
ATOM   4236   N  N     A ALA B 1 168 ? -55.479 4.927   -9.278  0.05 11.07 ? 167  ALA B N     1  
ATOM   4237   C  CA    A ALA B 1 168 ? -56.630 5.613   -8.700  0.05 11.18 ? 167  ALA B CA    1  
ATOM   4238   C  C     A ALA B 1 168 ? -57.568 4.628   -8.009  0.05 11.23 ? 167  ALA B C     1  
ATOM   4239   O  O     A ALA B 1 168 ? -58.228 4.967   -7.026  0.05 11.33 ? 167  ALA B O     1  
ATOM   4240   C  CB    A ALA B 1 168 ? -57.375 6.374   -9.776  0.05 11.21 ? 167  ALA B CB    1  
ATOM   4241   N  N     A TRP B 1 169 ? -57.638 3.413   -8.540  0.05 11.16 ? 168  TRP B N     1  
ATOM   4242   C  CA    A TRP B 1 169 ? -58.518 2.398   -7.973  0.05 11.19 ? 168  TRP B CA    1  
ATOM   4243   C  C     A TRP B 1 169 ? -58.087 2.037   -6.554  0.05 11.20 ? 168  TRP B C     1  
ATOM   4244   O  O     A TRP B 1 169 ? -58.914 1.907   -5.648  0.05 11.28 ? 168  TRP B O     1  
ATOM   4245   C  CB    A TRP B 1 169 ? -58.511 1.156   -8.855  0.05 11.11 ? 168  TRP B CB    1  
ATOM   4246   C  CG    A TRP B 1 169 ? -59.394 0.061   -8.376  0.05 11.15 ? 168  TRP B CG    1  
ATOM   4247   C  CD1   A TRP B 1 169 ? -60.739 0.133   -8.131  0.05 11.24 ? 168  TRP B CD1   1  
ATOM   4248   C  CD2   A TRP B 1 169 ? -59.008 -1.292  -8.113  0.05 11.09 ? 168  TRP B CD2   1  
ATOM   4249   N  NE1   A TRP B 1 169 ? -61.207 -1.091  -7.717  0.05 11.24 ? 168  TRP B NE1   1  
ATOM   4250   C  CE2   A TRP B 1 169 ? -60.166 -1.984  -7.701  0.05 11.15 ? 168  TRP B CE2   1  
ATOM   4251   C  CE3   A TRP B 1 169 ? -57.794 -1.986  -8.183  0.05 11.00 ? 168  TRP B CE3   1  
ATOM   4252   C  CZ2   A TRP B 1 169 ? -60.148 -3.340  -7.362  0.05 11.12 ? 168  TRP B CZ2   1  
ATOM   4253   C  CZ3   A TRP B 1 169 ? -57.776 -3.341  -7.846  0.05 10.97 ? 168  TRP B CZ3   1  
ATOM   4254   C  CH2   A TRP B 1 169 ? -58.945 -4.000  -7.438  0.05 11.03 ? 168  TRP B CH2   1  
ATOM   4255   N  N     A LEU B 1 170 ? -56.784 1.865   -6.371  0.05 11.13 ? 169  LEU B N     1  
ATOM   4256   C  CA    A LEU B 1 170 ? -56.255 1.531   -5.055  0.05 11.14 ? 169  LEU B CA    1  
ATOM   4257   C  C     A LEU B 1 170 ? -56.545 2.677   -4.061  0.05 11.25 ? 169  LEU B C     1  
ATOM   4258   O  O     A LEU B 1 170 ? -56.887 2.439   -2.903  0.05 11.31 ? 169  LEU B O     1  
ATOM   4259   C  CB    A LEU B 1 170 ? -54.754 1.198   -5.150  0.05 11.06 ? 169  LEU B CB    1  
ATOM   4260   C  CG    A LEU B 1 170 ? -54.367 -0.016  -6.019  0.05 10.96 ? 169  LEU B CG    1  
ATOM   4261   C  CD1   A LEU B 1 170 ? -52.858 -0.236  -6.053  0.05 10.90 ? 169  LEU B CD1   1  
ATOM   4262   C  CD2   A LEU B 1 170 ? -55.069 -1.285  -5.545  0.05 10.98 ? 169  LEU B CD2   1  
ATOM   4263   N  N     A LYS B 1 171 ? -56.436 3.921   -4.522  0.05 11.29 ? 170  LYS B N     1  
ATOM   4264   C  CA    A LYS B 1 171 ? -56.646 5.065   -3.625  0.05 11.41 ? 170  LYS B CA    1  
ATOM   4265   C  C     A LYS B 1 171 ? -58.099 5.192   -3.168  0.05 11.52 ? 170  LYS B C     1  
ATOM   4266   O  O     A LYS B 1 171 ? -58.368 5.606   -2.039  0.05 11.62 ? 170  LYS B O     1  
ATOM   4267   C  CB    A LYS B 1 171 ? -56.177 6.372   -4.273  0.05 11.42 ? 170  LYS B CB    1  
ATOM   4268   C  CG    A LYS B 1 171 ? -56.211 7.568   -3.334  0.05 11.53 ? 170  LYS B CG    1  
ATOM   4269   N  N     A GLU B 1 172 ? -59.033 4.846   -4.044  0.05 11.50 ? 171  GLU B N     1  
ATOM   4270   C  CA    A GLU B 1 172 ? -60.428 4.798   -3.645  0.05 11.60 ? 171  GLU B CA    1  
ATOM   4271   C  C     A GLU B 1 172 ? -60.550 3.828   -2.475  0.05 11.63 ? 171  GLU B C     1  
ATOM   4272   O  O     A GLU B 1 172 ? -61.127 4.157   -1.449  0.05 11.75 ? 171  GLU B O     1  
ATOM   4273   C  CB    A GLU B 1 172 ? -61.315 4.337   -4.803  0.05 11.56 ? 171  GLU B CB    1  
ATOM   4274   C  CG    A GLU B 1 172 ? -61.273 5.218   -6.047  0.05 11.59 ? 171  GLU B CG    1  
ATOM   4275   C  CD    A GLU B 1 172 ? -61.540 4.419   -7.313  0.05 11.51 ? 171  GLU B CD    1  
ATOM   4276   O  OE1   A GLU B 1 172 ? -61.293 4.937   -8.424  0.05 11.47 ? 171  GLU B OE1   1  
ATOM   4277   O  OE2   A GLU B 1 172 ? -61.981 3.256   -7.188  0.05 11.49 ? 171  GLU B OE2   1  
ATOM   4278   N  N     A ASN B 1 173 ? -59.963 2.644   -2.624  0.05 11.53 ? 172  ASN B N     1  
ATOM   4279   C  CA    A ASN B 1 173 ? -60.097 1.591   -1.622  0.05 11.54 ? 172  ASN B CA    1  
ATOM   4280   C  C     A ASN B 1 173 ? -59.166 1.690   -0.415  0.05 11.55 ? 172  ASN B C     1  
ATOM   4281   O  O     A ASN B 1 173 ? -58.890 0.673   0.239   0.05 11.54 ? 172  ASN B O     1  
ATOM   4282   C  CB    A ASN B 1 173 ? -59.896 0.230   -2.286  0.05 11.42 ? 172  ASN B CB    1  
ATOM   4283   C  CG    A ASN B 1 173 ? -61.007 -0.113  -3.234  0.05 11.43 ? 172  ASN B CG    1  
ATOM   4284   O  OD1   A ASN B 1 173 ? -62.084 -0.539  -2.817  0.05 11.50 ? 172  ASN B OD1   1  
ATOM   4285   N  ND2   A ASN B 1 173 ? -60.761 0.075   -4.522  0.05 11.36 ? 172  ASN B ND2   1  
ATOM   4286   N  N     A GLY B 1 174 ? -58.708 2.899   -0.102  0.05 11.58 ? 173  GLY B N     1  
ATOM   4287   C  CA    A GLY B 1 174 ? -57.739 3.092   0.966   0.05 11.61 ? 173  GLY B CA    1  
ATOM   4288   C  C     A GLY B 1 174 ? -56.568 2.136   0.795   0.05 11.49 ? 173  GLY B C     1  
ATOM   4289   O  O     A GLY B 1 174 ? -56.237 1.363   1.691   0.05 11.50 ? 173  GLY B O     1  
ATOM   4290   N  N     A ILE B 1 175 ? -55.956 2.175   -0.379  0.05 11.39 ? 174  ILE B N     1  
ATOM   4291   C  CA    A ILE B 1 175 ? -54.802 1.338   -0.674  0.05 11.28 ? 174  ILE B CA    1  
ATOM   4292   C  C     A ILE B 1 175 ? -53.821 2.190   -1.445  0.05 11.24 ? 174  ILE B C     1  
ATOM   4293   O  O     A ILE B 1 175 ? -54.116 2.617   -2.552  0.05 11.22 ? 174  ILE B O     1  
ATOM   4294   C  CB    A ILE B 1 175 ? -55.188 0.149   -1.553  0.05 11.20 ? 174  ILE B CB    1  
ATOM   4295   C  CG1   A ILE B 1 175 ? -56.035 -0.852  -0.778  0.05 11.23 ? 174  ILE B CG1   1  
ATOM   4296   C  CG2   A ILE B 1 175 ? -53.955 -0.540  -2.083  0.05 11.10 ? 174  ILE B CG2   1  
ATOM   4297   C  CD1   A ILE B 1 175 ? -56.489 -2.011  -1.643  0.05 11.16 ? 174  ILE B CD1   1  
ATOM   4298   N  N     A THR B 1 176 ? -52.658 2.447   -0.863  0.05 11.24 ? 175  THR B N     1  
ATOM   4299   C  CA    A THR B 1 176 ? -51.730 3.393   -1.469  0.05 11.23 ? 175  THR B CA    1  
ATOM   4300   C  C     A THR B 1 176 ? -50.582 2.729   -2.240  0.05 11.13 ? 175  THR B C     1  
ATOM   4301   O  O     A THR B 1 176 ? -50.043 3.324   -3.167  0.05 11.11 ? 175  THR B O     1  
ATOM   4302   C  CB    A THR B 1 176 ? -51.213 4.441   -0.443  0.05 11.34 ? 175  THR B CB    1  
ATOM   4303   O  OG1   A THR B 1 176 ? -50.360 3.822   0.531   0.05 11.36 ? 175  THR B OG1   1  
ATOM   4304   C  CG2   A THR B 1 176 ? -52.389 5.139   0.258   0.05 11.45 ? 175  THR B CG2   1  
ATOM   4305   N  N     A GLU B 1 177 ? -50.242 1.492   -1.871  0.05 11.08 ? 176  GLU B N     1  
ATOM   4306   C  CA    A GLU B 1 177 ? -49.157 0.734   -2.517  0.05 10.99 ? 176  GLU B CA    1  
ATOM   4307   C  C     A GLU B 1 177 ? -49.128 0.844   -4.051  0.05 10.92 ? 176  GLU B C     1  
ATOM   4308   O  O     A GLU B 1 177 ? -50.167 1.002   -4.686  0.05 10.92 ? 176  GLU B O     1  
ATOM   4309   C  CB    A GLU B 1 177 ? -49.231 -0.742  -2.107  0.05 10.96 ? 176  GLU B CB    1  
ATOM   4310   C  CG    A GLU B 1 177 ? -50.603 -1.355  -2.280  0.05 10.94 ? 176  GLU B CG    1  
ATOM   4311   N  N     A HIS B 1 178 ? -47.942 0.764   -4.648  0.05 10.87 ? 177  HIS B N     1  
ATOM   4312   C  CA    A HIS B 1 178 ? -47.848 0.796   -6.104  0.05 10.80 ? 177  HIS B CA    1  
ATOM   4313   C  C     A HIS B 1 178 ? -48.505 -0.458  -6.671  0.05 10.75 ? 177  HIS B C     1  
ATOM   4314   O  O     A HIS B 1 178 ? -48.459 -1.525  -6.049  0.05 10.75 ? 177  HIS B O     1  
ATOM   4315   C  CB    A HIS B 1 178 ? -46.390 0.911   -6.586  0.05 10.76 ? 177  HIS B CB    1  
ATOM   4316   C  CG    A HIS B 1 178 ? -46.265 1.153   -8.061  0.05 10.70 ? 177  HIS B CG    1  
ATOM   4317   N  ND1   A HIS B 1 178 ? -46.185 2.417   -8.607  0.05 10.70 ? 177  HIS B ND1   1  
ATOM   4318   C  CD2   A HIS B 1 178 ? -46.254 0.292   -9.108  0.05 10.64 ? 177  HIS B CD2   1  
ATOM   4319   C  CE1   A HIS B 1 178 ? -46.110 2.325   -9.924  0.05 10.64 ? 177  HIS B CE1   1  
ATOM   4320   N  NE2   A HIS B 1 178 ? -46.155 1.047   -10.253 0.05 10.61 ? 177  HIS B NE2   1  
ATOM   4321   N  N     A PRO B 1 179 ? -49.140 -0.337  -7.844  0.05 10.72 ? 178  PRO B N     1  
ATOM   4322   C  CA    A PRO B 1 179 ? -49.754 -1.517  -8.455  0.05 10.69 ? 178  PRO B CA    1  
ATOM   4323   C  C     A PRO B 1 179 ? -48.784 -2.690  -8.651  0.05 10.64 ? 178  PRO B C     1  
ATOM   4324   O  O     A PRO B 1 179 ? -49.224 -3.833  -8.635  0.05 10.64 ? 178  PRO B O     1  
ATOM   4325   C  CB    A PRO B 1 179 ? -50.231 -0.990  -9.810  0.05 10.67 ? 178  PRO B CB    1  
ATOM   4326   C  CG    A PRO B 1 179 ? -50.521 0.461   -9.546  0.05 10.71 ? 178  PRO B CG    1  
ATOM   4327   C  CD    A PRO B 1 179 ? -49.472 0.903   -8.575  0.05 10.73 ? 178  PRO B CD    1  
ATOM   4328   N  N     A ASP B 1 180 ? -47.497 -2.423  -8.837  0.05 10.62 ? 179  ASP B N     1  
ATOM   4329   C  CA    A ASP B 1 180 ? -46.544 -3.520  -9.027  0.05 10.59 ? 179  ASP B CA    1  
ATOM   4330   C  C     A ASP B 1 180 ? -46.366 -4.318  -7.728  0.05 10.61 ? 179  ASP B C     1  
ATOM   4331   O  O     A ASP B 1 180 ? -46.274 -5.550  -7.747  0.05 10.60 ? 179  ASP B O     1  
ATOM   4332   C  CB    A ASP B 1 180 ? -45.204 -3.006  -9.572  0.05 10.56 ? 179  ASP B CB    1  
ATOM   4333   C  CG    A ASP B 1 180 ? -45.256 -2.705  -11.071 0.05 10.54 ? 179  ASP B CG    1  
ATOM   4334   O  OD1   A ASP B 1 180 ? -46.000 -3.388  -11.805 0.05 10.55 ? 179  ASP B OD1   1  
ATOM   4335   O  OD2   A ASP B 1 180 ? -44.543 -1.792  -11.521 0.05 10.52 ? 179  ASP B OD2   1  
ATOM   4336   N  N     A THR B 1 181 ? -46.350 -3.606  -6.603  0.05 10.66 ? 180  THR B N     1  
ATOM   4337   C  CA    A THR B 1 181 ? -46.292 -4.227  -5.276  0.05 10.70 ? 180  THR B CA    1  
ATOM   4338   C  C     A THR B 1 181 ? -47.570 -4.998  -4.969  0.05 10.70 ? 180  THR B C     1  
ATOM   4339   O  O     A THR B 1 181 ? -47.544 -6.133  -4.475  0.05 10.69 ? 180  THR B O     1  
ATOM   4340   C  CB    A THR B 1 181 ? -46.125 -3.147  -4.194  0.05 10.76 ? 180  THR B CB    1  
ATOM   4341   O  OG1   A THR B 1 181 ? -44.858 -2.502  -4.366  0.05 10.77 ? 180  THR B OG1   1  
ATOM   4342   C  CG2   A THR B 1 181 ? -46.229 -3.746  -2.785  0.05 10.81 ? 180  THR B CG2   1  
ATOM   4343   N  N     A PHE B 1 182 ? -48.694 -4.355  -5.266  0.05 10.72 ? 181  PHE B N     1  
ATOM   4344   C  CA    A PHE B 1 182 ? -50.015 -4.887  -4.963  0.05 10.74 ? 181  PHE B CA    1  
ATOM   4345   C  C     A PHE B 1 182 ? -50.255 -6.174  -5.731  0.05 10.70 ? 181  PHE B C     1  
ATOM   4346   O  O     A PHE B 1 182 ? -50.748 -7.150  -5.182  0.05 10.71 ? 181  PHE B O     1  
ATOM   4347   C  CB    A PHE B 1 182 ? -51.074 -3.840  -5.314  0.05 10.78 ? 181  PHE B CB    1  
ATOM   4348   C  CG    A PHE B 1 182 ? -52.481 -4.362  -5.330  0.05 10.80 ? 181  PHE B CG    1  
ATOM   4349   C  CD1   A PHE B 1 182 ? -53.043 -4.851  -6.503  0.05 10.77 ? 181  PHE B CD1   1  
ATOM   4350   C  CD2   A PHE B 1 182 ? -53.263 -4.321  -4.183  0.05 10.87 ? 181  PHE B CD2   1  
ATOM   4351   C  CE1   A PHE B 1 182 ? -54.341 -5.316  -6.521  0.05 10.81 ? 181  PHE B CE1   1  
ATOM   4352   C  CE2   A PHE B 1 182 ? -54.560 -4.781  -4.199  0.05 10.91 ? 181  PHE B CE2   1  
ATOM   4353   C  CZ    A PHE B 1 182 ? -55.101 -5.278  -5.367  0.05 10.88 ? 181  PHE B CZ    1  
ATOM   4354   N  N     A ALA B 1 183 ? -49.889 -6.182  -7.006  0.05 10.65 ? 182  ALA B N     1  
ATOM   4355   C  CA    A ALA B 1 183 ? -50.158 -7.353  -7.839  0.05 10.62 ? 182  ALA B CA    1  
ATOM   4356   C  C     A ALA B 1 183 ? -49.142 -8.483  -7.654  0.05 10.60 ? 182  ALA B C     1  
ATOM   4357   O  O     A ALA B 1 183 ? -49.515 -9.656  -7.613  0.05 10.61 ? 182  ALA B O     1  
ATOM   4358   C  CB    A ALA B 1 183 ? -50.249 -6.952  -9.314  0.05 10.59 ? 182  ALA B CB    1  
ATOM   4359   N  N     A SER B 1 184 ? -47.866 -8.131  -7.531  0.05 10.59 ? 183  SER B N     1  
ATOM   4360   C  CA    A SER B 1 184 ? -46.810 -9.136  -7.633  0.05 10.58 ? 183  SER B CA    1  
ATOM   4361   C  C     A SER B 1 184 ? -46.131 -9.503  -6.312  0.05 10.60 ? 183  SER B C     1  
ATOM   4362   O  O     A SER B 1 184 ? -45.304 -10.415 -6.280  0.05 10.60 ? 183  SER B O     1  
ATOM   4363   C  CB    A SER B 1 184 ? -45.751 -8.675  -8.647  0.05 10.55 ? 183  SER B CB    1  
ATOM   4364   O  OG    A SER B 1 184 ? -46.330 -8.493  -9.934  0.05 10.53 ? 183  SER B OG    1  
ATOM   4365   N  N     A HIS B 1 185 ? -46.497 -8.818  -5.236  0.05 10.64 ? 184  HIS B N     1  
ATOM   4366   C  CA    A HIS B 1 185 ? -45.767 -8.941  -3.973  0.05 10.67 ? 184  HIS B CA    1  
ATOM   4367   C  C     A HIS B 1 185 ? -46.665 -9.089  -2.754  0.05 10.71 ? 184  HIS B C     1  
ATOM   4368   O  O     A HIS B 1 185 ? -46.768 -8.175  -1.940  0.05 10.75 ? 184  HIS B O     1  
ATOM   4369   C  CB    A HIS B 1 185 ? -44.829 -7.742  -3.829  0.05 10.69 ? 184  HIS B CB    1  
ATOM   4370   C  CG    A HIS B 1 185 ? -43.823 -7.666  -4.928  0.05 10.66 ? 184  HIS B CG    1  
ATOM   4371   N  ND1   A HIS B 1 185 ? -42.702 -8.466  -4.954  0.05 10.66 ? 184  HIS B ND1   1  
ATOM   4372   C  CD2   A HIS B 1 185 ? -43.794 -6.940  -6.071  0.05 10.63 ? 184  HIS B CD2   1  
ATOM   4373   C  CE1   A HIS B 1 185 ? -42.014 -8.225  -6.055  0.05 10.64 ? 184  HIS B CE1   1  
ATOM   4374   N  NE2   A HIS B 1 185 ? -42.655 -7.304  -6.753  0.05 10.62 ? 184  HIS B NE2   1  
ATOM   4375   N  N     A PRO B 1 186 ? -47.311 -10.258 -2.621  0.05 10.70 ? 185  PRO B N     1  
ATOM   4376   C  CA    A PRO B 1 186 ? -48.220 -10.528 -1.504  0.05 10.74 ? 185  PRO B CA    1  
ATOM   4377   C  C     A PRO B 1 186 ? -47.496 -10.515 -0.163  0.05 10.78 ? 185  PRO B C     1  
ATOM   4378   O  O     A PRO B 1 186 ? -46.284 -10.726 -0.120  0.05 10.78 ? 185  PRO B O     1  
ATOM   4379   C  CB    A PRO B 1 186 ? -48.729 -11.946 -1.799  0.05 10.72 ? 185  PRO B CB    1  
ATOM   4380   C  CG    A PRO B 1 186 ? -47.686 -12.555 -2.683  0.05 10.69 ? 185  PRO B CG    1  
ATOM   4381   C  CD    A PRO B 1 186 ? -47.199 -11.413 -3.530  0.05 10.67 ? 185  PRO B CD    1  
ATOM   4382   N  N     A PRO B 1 187 ? -48.231 -10.257 0.924   0.05 10.83 ? 186  PRO B N     1  
ATOM   4383   C  CA    A PRO B 1 187 ? -47.622 -10.297 2.259   0.05 10.88 ? 186  PRO B CA    1  
ATOM   4384   C  C     A PRO B 1 187 ? -47.425 -11.731 2.754   0.05 10.88 ? 186  PRO B C     1  
ATOM   4385   O  O     A PRO B 1 187 ? -46.574 -11.958 3.608   0.05 10.91 ? 186  PRO B O     1  
ATOM   4386   C  CB    A PRO B 1 187 ? -48.651 -9.580  3.132   0.05 10.95 ? 186  PRO B CB    1  
ATOM   4387   C  CG    A PRO B 1 187 ? -49.959 -9.825  2.440   0.05 10.93 ? 186  PRO B CG    1  
ATOM   4388   C  CD    A PRO B 1 187 ? -49.624 -9.782  0.963   0.05 10.86 ? 186  PRO B CD    1  
ATOM   4389   N  N     A ARG B 1 188 ? -48.198 -12.672 2.218   0.05 10.84 ? 187  ARG B N     1  
ATOM   4390   C  CA    A ARG B 1 188 ? -48.123 -14.070 2.634   0.05 10.84 ? 187  ARG B CA    1  
ATOM   4391   C  C     A ARG B 1 188 ? -48.562 -14.950 1.472   0.05 10.80 ? 187  ARG B C     1  
ATOM   4392   O  O     A ARG B 1 188 ? -49.627 -14.728 0.890   0.05 10.79 ? 187  ARG B O     1  
ATOM   4393   C  CB    A ARG B 1 188 ? -49.032 -14.327 3.841   0.05 10.89 ? 187  ARG B CB    1  
ATOM   4394   C  CG    A ARG B 1 188 ? -48.975 -15.764 4.374   0.05 10.89 ? 187  ARG B CG    1  
ATOM   4395   C  CD    A ARG B 1 188 ? -47.578 -16.074 4.888   0.05 10.91 ? 187  ARG B CD    1  
ATOM   4396   N  NE    A ARG B 1 188 ? -47.499 -17.388 5.518   0.05 10.92 ? 187  ARG B NE    1  
ATOM   4397   C  CZ    A ARG B 1 188 ? -46.711 -18.378 5.100   0.05 10.89 ? 187  ARG B CZ    1  
ATOM   4398   N  NH1   A ARG B 1 188 ? -46.708 -19.540 5.744   0.05 10.91 ? 187  ARG B NH1   1  
ATOM   4399   N  NH2   A ARG B 1 188 ? -45.919 -18.209 4.048   0.05 10.87 ? 187  ARG B NH2   1  
ATOM   4400   N  N     A SER B 1 189 ? -47.752 -15.948 1.139   0.05 10.78 ? 188  SER B N     1  
ATOM   4401   C  CA    A SER B 1 189 ? -48.034 -16.776 -0.026  0.05 10.75 ? 188  SER B CA    1  
ATOM   4402   C  C     A SER B 1 189 ? -47.619 -18.226 0.170   0.05 10.75 ? 188  SER B C     1  
ATOM   4403   O  O     A SER B 1 189 ? -46.548 -18.495 0.707   0.05 10.77 ? 188  SER B O     1  
ATOM   4404   C  CB    A SER B 1 189 ? -47.302 -16.216 -1.249  0.05 10.72 ? 188  SER B CB    1  
ATOM   4405   O  OG    A SER B 1 189 ? -47.336 -17.124 -2.340  0.05 10.70 ? 188  SER B OG    1  
ATOM   4406   N  N     A LEU B 1 190 ? -48.479 -19.146 -0.262  0.05 10.75 ? 189  LEU B N     1  
ATOM   4407   C  CA    A LEU B 1 190 ? -48.107 -20.552 -0.376  0.05 10.76 ? 189  LEU B CA    1  
ATOM   4408   C  C     A LEU B 1 190 ? -47.885 -20.848 -1.844  0.05 10.74 ? 189  LEU B C     1  
ATOM   4409   O  O     A LEU B 1 190 ? -48.727 -20.512 -2.676  0.05 10.73 ? 189  LEU B O     1  
ATOM   4410   C  CB    A LEU B 1 190 ? -49.205 -21.467 0.170   0.05 10.78 ? 189  LEU B CB    1  
ATOM   4411   C  CG    A LEU B 1 190 ? -49.569 -21.243 1.635   0.05 10.80 ? 189  LEU B CG    1  
ATOM   4412   C  CD1   A LEU B 1 190 ? -50.640 -22.237 2.077   0.05 10.83 ? 189  LEU B CD1   1  
ATOM   4413   C  CD2   A LEU B 1 190 ? -48.331 -21.332 2.533   0.05 10.82 ? 189  LEU B CD2   1  
ATOM   4414   N  N     A VAL B 1 191 ? -46.755 -21.477 -2.159  0.05 10.75 ? 190  VAL B N     1  
ATOM   4415   C  CA    A VAL B 1 191 ? -46.385 -21.739 -3.548  0.05 10.75 ? 190  VAL B CA    1  
ATOM   4416   C  C     A VAL B 1 191 ? -46.583 -23.211 -3.890  0.05 10.78 ? 190  VAL B C     1  
ATOM   4417   O  O     A VAL B 1 191 ? -46.049 -24.092 -3.224  0.05 10.81 ? 190  VAL B O     1  
ATOM   4418   C  CB    A VAL B 1 191 ? -44.927 -21.335 -3.832  0.05 10.75 ? 190  VAL B CB    1  
ATOM   4419   C  CG1   A VAL B 1 191 ? -44.674 -21.276 -5.347  0.05 10.74 ? 190  VAL B CG1   1  
ATOM   4420   C  CG2   A VAL B 1 191 ? -44.629 -19.984 -3.185  0.05 10.73 ? 190  VAL B CG2   1  
ATOM   4421   N  N     A LEU B 1 192 ? -47.344 -23.455 -4.950  0.05 10.78 ? 191  LEU B N     1  
ATOM   4422   C  CA    A LEU B 1 192 ? -47.855 -24.785 -5.249  0.05 10.82 ? 191  LEU B CA    1  
ATOM   4423   C  C     A LEU B 1 192 ? -46.980 -25.509 -6.272  0.05 10.86 ? 191  LEU B C     1  
ATOM   4424   O  O     A LEU B 1 192 ? -47.461 -26.339 -7.056  0.05 10.89 ? 191  LEU B O     1  
ATOM   4425   C  CB    A LEU B 1 192 ? -49.323 -24.687 -5.709  0.05 10.83 ? 191  LEU B CB    1  
ATOM   4426   C  CG    A LEU B 1 192 ? -50.370 -24.218 -4.682  0.05 10.82 ? 191  LEU B CG    1  
ATOM   4427   C  CD1   A LEU B 1 192 ? -50.161 -22.788 -4.179  0.05 10.78 ? 191  LEU B CD1   1  
ATOM   4428   C  CD2   A LEU B 1 192 ? -51.779 -24.367 -5.236  0.05 10.86 ? 191  LEU B CD2   1  
ATOM   4429   N  N     A ILE B 1 193 ? -45.693 -25.172 -6.267  0.05 10.85 ? 192  ILE B N     1  
ATOM   4430   C  CA    A ILE B 1 193 ? -44.687 -25.898 -7.035  0.05 10.90 ? 192  ILE B CA    1  
ATOM   4431   C  C     A ILE B 1 193 ? -43.529 -26.208 -6.099  0.05 10.92 ? 192  ILE B C     1  
ATOM   4432   O  O     A ILE B 1 193 ? -43.340 -25.513 -5.095  0.05 10.89 ? 192  ILE B O     1  
ATOM   4433   C  CB    A ILE B 1 193 ? -44.153 -25.084 -8.247  0.05 10.88 ? 192  ILE B CB    1  
ATOM   4434   C  CG1   A ILE B 1 193 ? -43.282 -23.907 -7.784  0.05 10.85 ? 192  ILE B CG1   1  
ATOM   4435   C  CG2   A ILE B 1 193 ? -45.296 -24.618 -9.125  0.05 10.86 ? 192  ILE B CG2   1  
ATOM   4436   C  CD1   A ILE B 1 193 ? -42.573 -23.170 -8.930  0.05 10.84 ? 192  ILE B CD1   1  
ATOM   4437   N  N     A PRO B 1 194 ? -42.759 -27.263 -6.402  0.05 10.98 ? 193  PRO B N     1  
ATOM   4438   C  CA    A PRO B 1 194 ? -41.579 -27.499 -5.566  0.05 11.01 ? 193  PRO B CA    1  
ATOM   4439   C  C     A PRO B 1 194 ? -40.563 -26.379 -5.750  0.05 11.00 ? 193  PRO B C     1  
ATOM   4440   O  O     A PRO B 1 194 ? -40.454 -25.834 -6.850  0.05 10.99 ? 193  PRO B O     1  
ATOM   4441   C  CB    A PRO B 1 194 ? -41.015 -28.814 -6.116  0.05 11.09 ? 193  PRO B CB    1  
ATOM   4442   C  CG    A PRO B 1 194 ? -41.473 -28.841 -7.554  0.05 11.10 ? 193  PRO B CG    1  
ATOM   4443   C  CD    A PRO B 1 194 ? -42.847 -28.210 -7.529  0.05 11.03 ? 193  PRO B CD    1  
ATOM   4444   N  N     A LYS B 1 195 ? -39.835 -26.055 -4.685  0.05 11.00 ? 194  LYS B N     1  
ATOM   4445   C  CA    A LYS B 1 195 ? -38.845 -24.978 -4.713  0.05 11.00 ? 194  LYS B CA    1  
ATOM   4446   C  C     A LYS B 1 195 ? -37.788 -25.224 -5.789  0.05 11.06 ? 194  LYS B C     1  
ATOM   4447   O  O     A LYS B 1 195 ? -37.233 -24.280 -6.340  0.05 11.05 ? 194  LYS B O     1  
ATOM   4448   C  CB    A LYS B 1 195 ? -38.186 -24.850 -3.341  0.05 11.02 ? 194  LYS B CB    1  
ATOM   4449   C  CG    A LYS B 1 195 ? -37.745 -23.448 -2.960  0.05 11.00 ? 194  LYS B CG    1  
ATOM   4450   C  CD    A LYS B 1 195 ? -37.488 -23.415 -1.456  0.05 11.02 ? 194  LYS B CD    1  
ATOM   4451   C  CE    A LYS B 1 195 ? -36.241 -22.663 -1.082  0.05 11.07 ? 194  LYS B CE    1  
ATOM   4452   N  NZ    A LYS B 1 195 ? -36.010 -22.741 0.399   0.05 11.09 ? 194  LYS B NZ    1  
ATOM   4453   N  N     A ALA B 1 196 ? -37.514 -26.492 -6.085  0.05 11.12 ? 195  ALA B N     1  
ATOM   4454   C  CA    A ALA B 1 196 ? -36.542 -26.844 -7.124  0.05 11.19 ? 195  ALA B CA    1  
ATOM   4455   C  C     A ALA B 1 196 ? -36.890 -26.246 -8.487  0.05 11.16 ? 195  ALA B C     1  
ATOM   4456   O  O     A ALA B 1 196 ? -36.001 -25.959 -9.291  0.05 11.20 ? 195  ALA B O     1  
ATOM   4457   C  CB    A ALA B 1 196 ? -36.410 -28.364 -7.240  0.05 11.27 ? 195  ALA B CB    1  
ATOM   4458   N  N     A LEU B 1 197 ? -38.182 -26.071 -8.746  0.05 11.10 ? 196  LEU B N     1  
ATOM   4459   C  CA    A LEU B 1 197 ? -38.633 -25.538 -10.029 0.05 11.08 ? 196  LEU B CA    1  
ATOM   4460   C  C     A LEU B 1 197 ? -38.808 -24.013 -10.012 0.05 11.00 ? 196  LEU B C     1  
ATOM   4461   O  O     A LEU B 1 197 ? -39.272 -23.420 -10.993 0.05 10.97 ? 196  LEU B O     1  
ATOM   4462   C  CB    A LEU B 1 197 ? -39.924 -26.233 -10.475 0.05 11.07 ? 196  LEU B CB    1  
ATOM   4463   C  CG    A LEU B 1 197 ? -39.730 -27.689 -10.921 0.05 11.16 ? 196  LEU B CG    1  
ATOM   4464   C  CD1   A LEU B 1 197 ? -41.056 -28.355 -11.266 0.05 11.16 ? 196  LEU B CD1   1  
ATOM   4465   C  CD2   A LEU B 1 197 ? -38.784 -27.772 -12.110 0.05 11.23 ? 196  LEU B CD2   1  
ATOM   4466   N  N     A GLN B 1 198 ? -38.433 -23.389 -8.897  0.05 10.98 ? 197  GLN B N     1  
ATOM   4467   C  CA    A GLN B 1 198 ? -38.457 -21.930 -8.787  0.05 10.92 ? 197  GLN B CA    1  
ATOM   4468   C  C     A GLN B 1 198 ? -37.107 -21.336 -9.177  0.05 10.95 ? 197  GLN B C     1  
ATOM   4469   O  O     A GLN B 1 198 ? -36.092 -21.636 -8.559  0.05 11.00 ? 197  GLN B O     1  
ATOM   4470   C  CB    A GLN B 1 198 ? -38.814 -21.505 -7.353  0.05 10.89 ? 197  GLN B CB    1  
ATOM   4471   C  CG    A GLN B 1 198 ? -38.470 -20.048 -7.018  0.05 10.86 ? 197  GLN B CG    1  
ATOM   4472   C  CD    A GLN B 1 198 ? -39.515 -19.056 -7.515  0.05 10.79 ? 197  GLN B CD    1  
ATOM   4473   O  OE1   A GLN B 1 198 ? -39.180 -17.982 -8.052  0.05 10.77 ? 197  GLN B OE1   1  
ATOM   4474   N  NE2   A GLN B 1 198 ? -40.783 -19.397 -7.325  0.05 10.77 ? 197  GLN B NE2   1  
ATOM   4475   N  N     A PRO B 1 199 ? -37.092 -20.485 -10.214 0.05 10.92 ? 198  PRO B N     1  
ATOM   4476   C  CA    A PRO B 1 199 ? -35.855 -19.785 -10.571 0.05 10.95 ? 198  PRO B CA    1  
ATOM   4477   C  C     A PRO B 1 199 ? -35.408 -18.864 -9.449  0.05 10.94 ? 198  PRO B C     1  
ATOM   4478   O  O     A PRO B 1 199 ? -36.260 -18.300 -8.760  0.05 10.89 ? 198  PRO B O     1  
ATOM   4479   C  CB    A PRO B 1 199 ? -36.267 -18.943 -11.787 0.05 10.91 ? 198  PRO B CB    1  
ATOM   4480   C  CG    A PRO B 1 199 ? -37.457 -19.624 -12.357 0.05 10.89 ? 198  PRO B CG    1  
ATOM   4481   C  CD    A PRO B 1 199 ? -38.181 -20.227 -11.172 0.05 10.88 ? 198  PRO B CD    1  
ATOM   4482   N  N     A HIS B 1 200 ? -34.097 -18.696 -9.273  0.05 11.00 ? 199  HIS B N     1  
ATOM   4483   C  CA    A HIS B 1 200 ? -33.578 -17.793 -8.243  0.05 11.01 ? 199  HIS B CA    1  
ATOM   4484   C  C     A HIS B 1 200 ? -34.158 -18.092 -6.857  0.05 11.00 ? 199  HIS B C     1  
ATOM   4485   O  O     A HIS B 1 200 ? -34.449 -17.182 -6.074  0.05 10.97 ? 199  HIS B O     1  
ATOM   4486   C  CB    A HIS B 1 200 ? -33.833 -16.333 -8.643  0.05 10.96 ? 199  HIS B CB    1  
ATOM   4487   C  CG    A HIS B 1 200 ? -33.276 -15.989 -9.987  0.05 10.97 ? 199  HIS B CG    1  
ATOM   4488   N  ND1   A HIS B 1 200 ? -31.987 -15.535 -10.157 0.05 11.03 ? 199  HIS B ND1   1  
ATOM   4489   C  CD2   A HIS B 1 200 ? -33.812 -16.077 -11.227 0.05 10.93 ? 199  HIS B CD2   1  
ATOM   4490   C  CE1   A HIS B 1 200 ? -31.756 -15.346 -11.444 0.05 11.03 ? 199  HIS B CE1   1  
ATOM   4491   N  NE2   A HIS B 1 200 ? -32.848 -15.665 -12.115 0.05 10.97 ? 199  HIS B NE2   1  
ATOM   4492   N  N     A ALA B 1 201 ? -34.313 -19.377 -6.557  0.05 11.02 ? 200  ALA B N     1  
ATOM   4493   C  CA    A ALA B 1 201 ? -34.993 -19.788 -5.331  0.05 11.01 ? 200  ALA B CA    1  
ATOM   4494   C  C     A ALA B 1 201 ? -34.350 -19.277 -4.041  0.05 11.05 ? 200  ALA B C     1  
ATOM   4495   O  O     A ALA B 1 201 ? -35.050 -18.968 -3.078  0.05 11.02 ? 200  ALA B O     1  
ATOM   4496   C  CB    A ALA B 1 201 ? -35.150 -21.315 -5.289  0.05 11.05 ? 200  ALA B CB    1  
ATOM   4497   N  N     A ASP B 1 202 ? -33.022 -19.173 -4.019  0.05 11.12 ? 201  ASP B N     1  
ATOM   4498   C  CA    A ASP B 1 202 ? -32.339 -18.763 -2.797  0.05 11.17 ? 201  ASP B CA    1  
ATOM   4499   C  C     A ASP B 1 202 ? -32.627 -17.303 -2.431  0.05 11.14 ? 201  ASP B C     1  
ATOM   4500   O  O     A ASP B 1 202 ? -32.398 -16.885 -1.295  0.05 11.18 ? 201  ASP B O     1  
ATOM   4501   C  CB    A ASP B 1 202 ? -30.827 -19.020 -2.900  0.05 11.28 ? 201  ASP B CB    1  
ATOM   4502   N  N     A ARG B 1 203 ? -33.148 -16.534 -3.385  0.05 11.08 ? 202  ARG B N     1  
ATOM   4503   C  CA    A ARG B 1 203 ? -33.491 -15.143 -3.121  0.05 11.04 ? 202  ARG B CA    1  
ATOM   4504   C  C     A ARG B 1 203 ? -34.988 -14.912 -2.906  0.05 10.97 ? 202  ARG B C     1  
ATOM   4505   O  O     A ARG B 1 203 ? -35.421 -13.776 -2.719  0.05 10.95 ? 202  ARG B O     1  
ATOM   4506   C  CB    A ARG B 1 203 ? -32.955 -14.224 -4.226  0.05 11.03 ? 202  ARG B CB    1  
ATOM   4507   C  CG    A ARG B 1 203 ? -31.432 -14.111 -4.202  0.05 11.12 ? 202  ARG B CG    1  
ATOM   4508   C  CD    A ARG B 1 203 ? -30.943 -13.009 -5.117  0.05 11.12 ? 202  ARG B CD    1  
ATOM   4509   N  NE    A ARG B 1 203 ? -31.166 -13.313 -6.520  0.05 11.07 ? 202  ARG B NE    1  
ATOM   4510   C  CZ    A ARG B 1 203 ? -31.372 -12.388 -7.449  0.05 11.03 ? 202  ARG B CZ    1  
ATOM   4511   N  NH1   A ARG B 1 203 ? -31.396 -11.107 -7.109  0.05 11.02 ? 202  ARG B NH1   1  
ATOM   4512   N  NH2   A ARG B 1 203 ? -31.558 -12.740 -8.711  0.05 11.00 ? 202  ARG B NH2   1  
ATOM   4513   N  N     A VAL B 1 204 ? -35.777 -15.981 -2.925  0.05 10.94 ? 203  VAL B N     1  
ATOM   4514   C  CA    A VAL B 1 204 ? -37.193 -15.832 -2.592  0.05 10.89 ? 203  VAL B CA    1  
ATOM   4515   C  C     A VAL B 1 204 ? -37.342 -15.615 -1.084  0.05 10.92 ? 203  VAL B C     1  
ATOM   4516   O  O     A VAL B 1 204 ? -36.791 -16.371 -0.290  0.05 10.97 ? 203  VAL B O     1  
ATOM   4517   C  CB    A VAL B 1 204 ? -38.020 -17.047 -3.033  0.05 10.86 ? 203  VAL B CB    1  
ATOM   4518   C  CG1   A VAL B 1 204 ? -39.446 -16.945 -2.487  0.05 10.82 ? 203  VAL B CG1   1  
ATOM   4519   C  CG2   A VAL B 1 204 ? -38.028 -17.159 -4.561  0.05 10.83 ? 203  VAL B CG2   1  
ATOM   4520   N  N     A ASP B 1 205 ? -38.080 -14.571 -0.701  0.05 10.89 ? 204  ASP B N     1  
ATOM   4521   C  CA    A ASP B 1 205 ? -38.247 -14.194 0.701   0.05 10.93 ? 204  ASP B CA    1  
ATOM   4522   C  C     A ASP B 1 205 ? -38.996 -15.263 1.493   0.05 10.93 ? 204  ASP B C     1  
ATOM   4523   O  O     A ASP B 1 205 ? -40.216 -15.384 1.381   0.05 10.89 ? 204  ASP B O     1  
ATOM   4524   C  CB    A ASP B 1 205 ? -39.009 -12.868 0.795   0.05 10.91 ? 204  ASP B CB    1  
ATOM   4525   C  CG    A ASP B 1 205 ? -39.026 -12.296 2.199   0.05 10.96 ? 204  ASP B CG    1  
ATOM   4526   O  OD1   A ASP B 1 205 ? -39.296 -11.083 2.326   0.05 10.99 ? 204  ASP B OD1   1  
ATOM   4527   O  OD2   A ASP B 1 205 ? -38.778 -13.052 3.169   0.05 10.98 ? 204  ASP B OD2   1  
ATOM   4528   N  N     A GLU B 1 206 ? -38.276 -15.983 2.350   0.05 10.99 ? 205  GLU B N     1  
ATOM   4529   C  CA    A GLU B 1 206 ? -38.837 -17.157 3.017   0.05 11.00 ? 205  GLU B CA    1  
ATOM   4530   C  C     A GLU B 1 206 ? -39.922 -16.850 4.064   0.05 11.00 ? 205  GLU B C     1  
ATOM   4531   O  O     A GLU B 1 206 ? -40.714 -17.727 4.393   0.05 10.99 ? 205  GLU B O     1  
ATOM   4532   C  CB    A GLU B 1 206 ? -37.727 -18.016 3.648   0.05 11.08 ? 205  GLU B CB    1  
ATOM   4533   C  CG    A GLU B 1 206 ? -36.480 -18.187 2.781   0.05 11.10 ? 205  GLU B CG    1  
ATOM   4534   C  CD    A GLU B 1 206 ? -36.408 -19.543 2.082   0.05 11.08 ? 205  GLU B CD    1  
ATOM   4535   O  OE2   A GLU B 1 206 ? -36.437 -20.585 2.773   0.05 11.09 ? 205  GLU B OE2   1  
ATOM   4536   N  N     A ASP B 1 207 ? -39.967 -15.627 4.588   0.05 11.03 ? 206  ASP B N     1  
ATOM   4537   C  CA    A ASP B 1 207 ? -40.996 -15.269 5.580   0.05 11.04 ? 206  ASP B CA    1  
ATOM   4538   C  C     A ASP B 1 207 ? -42.323 -14.945 4.901   0.05 10.99 ? 206  ASP B C     1  
ATOM   4539   O  O     A ASP B 1 207 ? -43.391 -15.055 5.511   0.05 11.00 ? 206  ASP B O     1  
ATOM   4540   C  CB    A ASP B 1 207 ? -40.580 -14.069 6.436   0.05 11.12 ? 206  ASP B CB    1  
ATOM   4541   C  CG    A ASP B 1 207 ? -39.440 -14.381 7.395   0.05 11.19 ? 206  ASP B CG    1  
ATOM   4542   O  OD1   A ASP B 1 207 ? -39.423 -15.480 7.996   0.05 11.21 ? 206  ASP B OD1   1  
ATOM   4543   O  OD2   A ASP B 1 207 ? -38.563 -13.499 7.556   0.05 11.24 ? 206  ASP B OD2   1  
ATOM   4544   N  N     A VAL B 1 208 ? -42.249 -14.527 3.640   0.05 10.93 ? 207  VAL B N     1  
ATOM   4545   C  CA    A VAL B 1 208 ? -43.451 -14.278 2.857   0.05 10.88 ? 207  VAL B CA    1  
ATOM   4546   C  C     A VAL B 1 208 ? -43.943 -15.566 2.215   0.05 10.84 ? 207  VAL B C     1  
ATOM   4547   O  O     A VAL B 1 208 ? -45.115 -15.919 2.334   0.05 10.83 ? 207  VAL B O     1  
ATOM   4548   C  CB    A VAL B 1 208 ? -43.190 -13.248 1.749   0.05 10.85 ? 207  VAL B CB    1  
ATOM   4549   C  CG1   A VAL B 1 208 ? -44.361 -13.204 0.768   0.05 10.80 ? 207  VAL B CG1   1  
ATOM   4550   C  CG2   A VAL B 1 208 ? -42.911 -11.872 2.353   0.05 10.90 ? 207  VAL B CG2   1  
ATOM   4551   N  N     A TYR B 1 209 ? -43.032 -16.263 1.540   0.05 10.83 ? 208  TYR B N     1  
ATOM   4552   C  CA    A TYR B 1 209 ? -43.376 -17.428 0.726   0.05 10.80 ? 208  TYR B CA    1  
ATOM   4553   C  C     A TYR B 1 209 ? -42.990 -18.746 1.368   0.05 10.83 ? 208  TYR B C     1  
ATOM   4554   O  O     A TYR B 1 209 ? -41.853 -18.904 1.821   0.05 10.87 ? 208  TYR B O     1  
ATOM   4555   C  CB    A TYR B 1 209 ? -42.653 -17.359 -0.622  0.05 10.78 ? 208  TYR B CB    1  
ATOM   4556   C  CG    A TYR B 1 209 ? -42.961 -16.118 -1.417  0.05 10.75 ? 208  TYR B CG    1  
ATOM   4557   C  CD1   A TYR B 1 209 ? -44.089 -16.055 -2.220  0.05 10.71 ? 208  TYR B CD1   1  
ATOM   4558   C  CD2   A TYR B 1 209 ? -42.116 -15.018 -1.380  0.05 10.76 ? 208  TYR B CD2   1  
ATOM   4559   C  CE1   A TYR B 1 209 ? -44.378 -14.927 -2.957  0.05 10.69 ? 208  TYR B CE1   1  
ATOM   4560   C  CE2   A TYR B 1 209 ? -42.403 -13.872 -2.114  0.05 10.74 ? 208  TYR B CE2   1  
ATOM   4561   C  CZ    A TYR B 1 209 ? -43.531 -13.841 -2.904  0.05 10.70 ? 208  TYR B CZ    1  
ATOM   4562   O  OH    A TYR B 1 209 ? -43.831 -12.714 -3.639  0.05 10.67 ? 208  TYR B OH    1  
ATOM   4563   N  N     A THR B 1 210 ? -43.928 -19.691 1.378   0.05 10.82 ? 209  THR B N     1  
ATOM   4564   C  CA    A THR B 1 210 ? -43.632 -21.077 1.748   0.05 10.84 ? 209  THR B CA    1  
ATOM   4565   C  C     A THR B 1 210 ? -43.953 -22.001 0.583   0.05 10.83 ? 209  THR B C     1  
ATOM   4566   O  O     A THR B 1 210 ? -45.059 -21.971 0.052   0.05 10.80 ? 209  THR B O     1  
ATOM   4567   C  CB    A THR B 1 210 ? -44.452 -21.544 2.966   0.05 10.86 ? 209  THR B CB    1  
ATOM   4568   O  OG1   A THR B 1 210 ? -44.292 -20.616 4.041   0.05 10.88 ? 209  THR B OG1   1  
ATOM   4569   C  CG2   A THR B 1 210 ? -43.979 -22.927 3.426   0.05 10.89 ? 209  THR B CG2   1  
ATOM   4570   N  N     A PHE B 1 211 ? -42.983 -22.825 0.196   0.05 10.85 ? 210  PHE B N     1  
ATOM   4571   C  CA    A PHE B 1 211 ? -43.175 -23.759 -0.901  0.05 10.85 ? 210  PHE B CA    1  
ATOM   4572   C  C     A PHE B 1 211 ? -43.775 -25.051 -0.394  0.05 10.87 ? 210  PHE B C     1  
ATOM   4573   O  O     A PHE B 1 211 ? -43.168 -25.739 0.410   0.05 10.91 ? 210  PHE B O     1  
ATOM   4574   C  CB    A PHE B 1 211 ? -41.844 -24.017 -1.613  0.05 10.89 ? 210  PHE B CB    1  
ATOM   4575   C  CG    A PHE B 1 211 ? -41.392 -22.853 -2.437  0.05 10.86 ? 210  PHE B CG    1  
ATOM   4576   C  CD1   A PHE B 1 211 ? -40.724 -21.796 -1.852  0.05 10.87 ? 210  PHE B CD1   1  
ATOM   4577   C  CD2   A PHE B 1 211 ? -41.682 -22.793 -3.786  0.05 10.85 ? 210  PHE B CD2   1  
ATOM   4578   C  CE1   A PHE B 1 211 ? -40.322 -20.706 -2.611  0.05 10.85 ? 210  PHE B CE1   1  
ATOM   4579   C  CE2   A PHE B 1 211 ? -41.293 -21.708 -4.543  0.05 10.82 ? 210  PHE B CE2   1  
ATOM   4580   C  CZ    A PHE B 1 211 ? -40.614 -20.663 -3.953  0.05 10.82 ? 210  PHE B CZ    1  
ATOM   4581   N  N     A VAL B 1 212 ? -44.982 -25.370 -0.843  0.05 10.86 ? 211  VAL B N     1  
ATOM   4582   C  CA    A VAL B 1 212 ? -45.618 -26.600 -0.390  0.05 10.88 ? 211  VAL B CA    1  
ATOM   4583   C  C     A VAL B 1 212 ? -45.753 -27.603 -1.519  0.05 10.91 ? 211  VAL B C     1  
ATOM   4584   O  O     A VAL B 1 212 ? -46.053 -28.775 -1.293  0.05 10.94 ? 211  VAL B O     1  
ATOM   4585   C  CB    A VAL B 1 212 ? -46.995 -26.337 0.237   0.05 10.87 ? 211  VAL B CB    1  
ATOM   4586   C  CG1   A VAL B 1 212 ? -46.842 -25.424 1.437   0.05 10.86 ? 211  VAL B CG1   1  
ATOM   4587   C  CG2   A VAL B 1 212 ? -47.958 -25.739 -0.789  0.05 10.84 ? 211  VAL B CG2   1  
ATOM   4588   N  N     A GLY B 1 213 ? -45.531 -27.129 -2.740  0.05 10.90 ? 212  GLY B N     1  
ATOM   4589   C  CA    A GLY B 1 213 ? -45.624 -27.977 -3.917  0.05 10.94 ? 212  GLY B CA    1  
ATOM   4590   C  C     A GLY B 1 213 ? -47.044 -28.332 -4.329  0.05 10.94 ? 212  GLY B C     1  
ATOM   4591   O  O     A GLY B 1 213 ? -48.007 -27.663 -3.953  0.05 10.91 ? 212  GLY B O     1  
ATOM   4592   N  N     A ALA B 1 214 ? -47.157 -29.387 -5.126  0.05 10.99 ? 213  ALA B N     1  
ATOM   4593   C  CA    A ALA B 1 214 ? -48.432 -29.826 -5.661  0.05 11.01 ? 213  ALA B CA    1  
ATOM   4594   C  C     A ALA B 1 214 ? -49.360 -30.407 -4.579  0.05 11.01 ? 213  ALA B C     1  
ATOM   4595   O  O     A ALA B 1 214 ? -48.910 -31.236 -3.758  0.05 11.02 ? 213  ALA B O     1  
ATOM   4596   C  CB    A ALA B 1 214 ? -48.192 -30.841 -6.793  0.05 11.08 ? 213  ALA B CB    1  
ATOM   4597   N  N     A CYS B 1 215 ? -50.595 -29.864 -4.533  0.05 11.00 ? 214  CYS B N     1  
ATOM   4598   C  CA    A CYS B 1 215 ? -51.786 -30.487 -3.942  0.05 11.02 ? 214  CYS B CA    1  
ATOM   4599   C  C     A CYS B 1 215 ? -52.506 -31.209 -5.038  0.05 11.08 ? 214  CYS B C     1  
ATOM   4600   O  O     A CYS B 1 215 ? -53.327 -30.604 -5.720  0.05 11.08 ? 214  CYS B O     1  
ATOM   4601   C  CB    A CYS B 1 215 ? -52.838 -29.475 -3.540  0.05 10.97 ? 214  CYS B CB    1  
ATOM   4602   S  SG    A CYS B 1 215 ? -54.349 -30.298 -2.943  0.05 11.02 ? 214  CYS B SG    1  
ATOM   4603   N  N     A GLN B 1 216 ? -52.251 -32.497 -5.191  0.05 13.57 ? 215  GLN B N     1  
ATOM   4604   C  CA    A GLN B 1 216 ? -53.035 -33.308 -6.101  0.05 13.60 ? 215  GLN B CA    1  
ATOM   4605   C  C     A GLN B 1 216 ? -54.206 -33.892 -5.314  0.05 13.95 ? 215  GLN B C     1  
ATOM   4606   O  O     A GLN B 1 216 ? -54.673 -33.320 -4.320  0.05 14.20 ? 215  GLN B O     1  
ATOM   4607   C  CB    A GLN B 1 216 ? -52.139 -34.415 -6.676  0.05 13.20 ? 215  GLN B CB    1  
ATOM   4608   C  CG    A GLN B 1 216 ? -51.029 -33.859 -7.592  0.05 12.88 ? 215  GLN B CG    1  
ATOM   4609   C  CD    A GLN B 1 216 ? -50.115 -34.939 -8.164  0.05 12.52 ? 215  GLN B CD    1  
ATOM   4610   O  OE1   A GLN B 1 216 ? -50.201 -36.113 -7.794  0.05 12.48 ? 215  GLN B OE1   1  
ATOM   4611   N  NE2   A GLN B 1 216 ? -49.234 -34.540 -9.075  0.05 12.28 ? 215  GLN B NE2   1  
ATOM   4612   N  N     A GLY B 1 217 ? -54.667 -35.052 -5.744  0.05 14.00 ? 216  GLY B N     1  
ATOM   4613   C  CA    A GLY B 1 217 ? -55.634 -35.792 -4.957  0.05 14.34 ? 216  GLY B CA    1  
ATOM   4614   C  C     A GLY B 1 217 ? -54.979 -37.056 -4.437  0.05 14.14 ? 216  GLY B C     1  
ATOM   4615   O  O     A GLY B 1 217 ? -53.812 -37.312 -4.744  0.05 13.81 ? 216  GLY B O     1  
ATOM   4616   N  N     A ASP B 1 218 ? -55.698 -37.844 -3.643  0.05 14.37 ? 217  ASP B N     1  
ATOM   4617   C  CA    A ASP B 1 218 ? -55.226 -39.199 -3.397  0.05 14.18 ? 217  ASP B CA    1  
ATOM   4618   C  C     A ASP B 1 218 ? -55.113 -39.889 -4.744  0.05 13.92 ? 217  ASP B C     1  
ATOM   4619   O  O     A ASP B 1 218 ? -56.080 -39.922 -5.502  0.05 14.07 ? 217  ASP B O     1  
ATOM   4620   C  CB    A ASP B 1 218 ? -56.189 -40.009 -2.532  0.05 14.57 ? 217  ASP B CB    1  
ATOM   4621   C  CG    A ASP B 1 218 ? -55.728 -41.449 -2.372  0.05 14.41 ? 217  ASP B CG    1  
ATOM   4622   O  OD1   A ASP B 1 218 ? -56.535 -42.371 -2.599  0.05 14.58 ? 217  ASP B OD1   1  
ATOM   4623   O  OD2   A ASP B 1 218 ? -54.543 -41.644 -2.025  0.05 14.14 ? 217  ASP B OD2   1  
ATOM   4624   N  N     A ARG B 1 219 ? -53.939 -40.431 -5.053  0.05 13.55 ? 218  ARG B N     1  
ATOM   4625   C  CA    A ARG B 1 219 ? -53.795 -41.219 -6.274  0.05 13.29 ? 218  ARG B CA    1  
ATOM   4626   C  C     A ARG B 1 219 ? -53.897 -42.715 -5.985  0.05 13.32 ? 218  ARG B C     1  
ATOM   4627   O  O     A ARG B 1 219 ? -53.896 -43.533 -6.912  0.05 13.11 ? 218  ARG B O     1  
ATOM   4628   C  CB    A ARG B 1 219 ? -52.500 -40.884 -7.023  0.05 12.88 ? 218  ARG B CB    1  
ATOM   4629   C  CG    A ARG B 1 219 ? -52.480 -39.465 -7.576  0.05 12.88 ? 218  ARG B CG    1  
ATOM   4630   C  CD    A ARG B 1 219 ? -51.422 -39.246 -8.644  0.05 12.51 ? 218  ARG B CD    1  
ATOM   4631   N  NE    A ARG B 1 219 ? -51.522 -37.903 -9.200  0.05 12.53 ? 218  ARG B NE    1  
ATOM   4632   C  CZ    A ARG B 1 219 ? -50.885 -37.480 -10.288 0.05 12.29 ? 218  ARG B CZ    1  
ATOM   4633   N  NH1   A ARG B 1 219 ? -51.063 -36.238 -10.707 0.05 12.38 ? 218  ARG B NH1   1  
ATOM   4634   N  NH2   A ARG B 1 219 ? -50.077 -38.287 -10.957 0.05 11.99 ? 218  ARG B NH2   1  
ATOM   4635   N  N     A ALA B 1 220 ? -54.012 -43.068 -4.704  0.05 13.61 ? 219  ALA B N     1  
ATOM   4636   C  CA    A ALA B 1 220 ? -54.124 -44.474 -4.308  0.05 13.74 ? 219  ALA B CA    1  
ATOM   4637   C  C     A ALA B 1 220 ? -55.465 -45.062 -4.703  0.05 13.97 ? 219  ALA B C     1  
ATOM   4638   O  O     A ALA B 1 220 ? -56.299 -45.362 -3.844  0.05 14.37 ? 219  ALA B O     1  
ATOM   4639   C  CB    A ALA B 1 220 ? -53.932 -44.629 -2.813  0.05 14.04 ? 219  ALA B CB    1  
ATOM   4640   N  N     A GLU B 1 221 ? -55.656 -45.242 -6.003  0.05 13.73 ? 220  GLU B N     1  
ATOM   4641   C  CA    A GLU B 1 221 ? -56.931 -45.669 -6.555  0.05 13.91 ? 220  GLU B CA    1  
ATOM   4642   C  C     A GLU B 1 221 ? -56.720 -45.881 -8.049  0.05 13.54 ? 220  GLU B C     1  
ATOM   4643   O  O     A GLU B 1 221 ? -57.236 -46.831 -8.629  0.05 13.60 ? 220  GLU B O     1  
ATOM   4644   N  N     A GLU B 1 222 ? -55.916 -45.012 -8.661  0.05 13.19 ? 221  GLU B N     1  
ATOM   4645   C  CA    A GLU B 1 222 ? -55.559 -45.148 -10.082 0.05 12.85 ? 221  GLU B CA    1  
ATOM   4646   C  C     A GLU B 1 222 ? -55.054 -46.555 -10.478 0.05 12.70 ? 221  GLU B C     1  
ATOM   4647   O  O     A GLU B 1 222 ? -54.735 -46.803 -11.639 0.05 12.45 ? 221  GLU B O     1  
ATOM   4648   C  CB    A GLU B 1 222 ? -54.532 -44.067 -10.481 0.05 12.59 ? 221  GLU B CB    1  
ATOM   4649   C  CG    A GLU B 1 222 ? -55.149 -42.673 -10.698 0.05 12.77 ? 221  GLU B CG    1  
ATOM   4650   C  CD    A GLU B 1 222 ? -54.120 -41.541 -10.849 0.05 12.56 ? 221  GLU B CD    1  
ATOM   4651   O  OE1   A GLU B 1 222 ? -54.404 -40.410 -10.380 0.05 12.73 ? 221  GLU B OE1   1  
ATOM   4652   O  OE2   A GLU B 1 222 ? -53.044 -41.761 -11.446 0.05 12.25 ? 221  GLU B OE2   1  
ATOM   4653   N  N     A GLY B 1 223 ? -55.031 -47.478 -9.518  0.05 12.90 ? 222  GLY B N     1  
ATOM   4654   C  CA    A GLY B 1 223 ? -54.357 -48.751 -9.680  0.05 12.83 ? 222  GLY B CA    1  
ATOM   4655   C  C     A GLY B 1 223 ? -52.900 -48.599 -9.273  0.05 12.56 ? 222  GLY B C     1  
ATOM   4656   O  O     A GLY B 1 223 ? -52.472 -47.509 -8.865  0.05 12.36 ? 222  GLY B O     1  
ATOM   4657   N  N     A GLY B 1 224 ? -52.141 -49.688 -9.385  0.05 12.59 ? 223  GLY B N     1  
ATOM   4658   C  CA    A GLY B 1 224 ? -50.714 -49.681 -9.088  0.05 12.37 ? 223  GLY B CA    1  
ATOM   4659   C  C     A GLY B 1 224 ? -49.928 -50.319 -10.218 0.05 12.14 ? 223  GLY B C     1  
ATOM   4660   O  O     A GLY B 1 224 ? -50.478 -50.525 -11.299 0.05 12.12 ? 223  GLY B O     1  
ATOM   4661   N  N     A TRP B 1 225 ? -48.660 -50.660 -9.981  0.05 11.99 ? 224  TRP B N     1  
ATOM   4662   C  CA    A TRP B 1 225 ? -47.814 -51.144 -11.077 0.05 11.80 ? 224  TRP B CA    1  
ATOM   4663   C  C     A TRP B 1 225 ? -46.577 -51.904 -10.611 0.05 11.82 ? 224  TRP B C     1  
ATOM   4664   O  O     A TRP B 1 225 ? -45.742 -51.355 -9.904  0.05 11.77 ? 224  TRP B O     1  
ATOM   4665   C  CB    A TRP B 1 225 ? -47.387 -49.962 -11.967 0.05 11.53 ? 224  TRP B CB    1  
ATOM   4666   C  CG    A TRP B 1 225 ? -46.933 -50.372 -13.334 0.05 11.35 ? 224  TRP B CG    1  
ATOM   4667   C  CD1   A TRP B 1 225 ? -47.723 -50.689 -14.397 0.05 11.33 ? 224  TRP B CD1   1  
ATOM   4668   C  CD2   A TRP B 1 225 ? -45.577 -50.497 -13.791 0.05 11.22 ? 224  TRP B CD2   1  
ATOM   4669   N  NE1   A TRP B 1 225 ? -46.944 -51.015 -15.487 0.05 11.19 ? 224  TRP B NE1   1  
ATOM   4670   C  CE2   A TRP B 1 225 ? -45.624 -50.902 -15.138 0.05 11.13 ? 224  TRP B CE2   1  
ATOM   4671   C  CE3   A TRP B 1 225 ? -44.331 -50.305 -13.190 0.05 11.19 ? 224  TRP B CE3   1  
ATOM   4672   C  CZ2   A TRP B 1 225 ? -44.471 -51.118 -15.892 0.05 11.03 ? 224  TRP B CZ2   1  
ATOM   4673   C  CZ3   A TRP B 1 225 ? -43.190 -50.526 -13.942 0.05 11.09 ? 224  TRP B CZ3   1  
ATOM   4674   C  CH2   A TRP B 1 225 ? -43.268 -50.931 -15.270 0.05 11.02 ? 224  TRP B CH2   1  
ATOM   4675   N  N     A GLN B 1 226 ? -46.437 -53.158 -11.031 0.05 11.93 ? 225  GLN B N     1  
ATOM   4676   C  CA    A GLN B 1 226 ? -45.214 -53.894 -10.744 0.05 12.00 ? 225  GLN B CA    1  
ATOM   4677   C  C     A GLN B 1 226 ? -44.365 -54.091 -11.994 0.05 11.78 ? 225  GLN B C     1  
ATOM   4678   O  O     A GLN B 1 226 ? -44.812 -54.699 -12.970 0.05 11.62 ? 225  GLN B O     1  
ATOM   4679   C  CB    A GLN B 1 226 ? -45.532 -55.250 -10.111 0.05 12.30 ? 225  GLN B CB    1  
ATOM   4680   N  N     A ARG B 1 227 ? -43.127 -53.603 -11.952 0.05 11.79 ? 226  ARG B N     1  
ATOM   4681   C  CA    A ARG B 1 227 ? -42.138 -53.955 -12.963 0.05 11.66 ? 226  ARG B CA    1  
ATOM   4682   C  C     A ARG B 1 227 ? -42.061 -55.472 -13.081 0.05 11.87 ? 226  ARG B C     1  
ATOM   4683   O  O     A ARG B 1 227 ? -42.608 -56.195 -12.247 0.05 12.12 ? 226  ARG B O     1  
ATOM   4684   C  CB    A ARG B 1 227 ? -40.748 -53.459 -12.557 0.05 11.60 ? 226  ARG B CB    1  
ATOM   4685   C  CG    A ARG B 1 227 ? -40.593 -51.976 -12.367 0.05 11.39 ? 226  ARG B CG    1  
ATOM   4686   C  CD    A ARG B 1 227 ? -39.398 -51.713 -11.470 0.05 11.36 ? 226  ARG B CD    1  
ATOM   4687   N  NE    A ARG B 1 227 ? -38.166 -52.288 -12.004 0.05 11.41 ? 226  ARG B NE    1  
ATOM   4688   C  CZ    A ARG B 1 227 ? -37.132 -51.561 -12.414 0.05 11.31 ? 226  ARG B CZ    1  
ATOM   4689   N  NH1   A ARG B 1 227 ? -37.195 -50.241 -12.348 0.05 11.15 ? 226  ARG B NH1   1  
ATOM   4690   N  NH2   A ARG B 1 227 ? -36.041 -52.149 -12.890 0.05 11.40 ? 226  ARG B NH2   1  
ATOM   4691   N  N     A PRO B 1 228 ? -41.371 -55.967 -14.113 0.05 11.79 ? 227  PRO B N     1  
ATOM   4692   C  CA    A PRO B 1 228 ? -41.008 -57.383 -14.063 0.05 12.02 ? 227  PRO B CA    1  
ATOM   4693   C  C     A PRO B 1 228 ? -39.552 -57.561 -13.643 0.05 12.18 ? 227  PRO B C     1  
ATOM   4694   O  O     A PRO B 1 228 ? -38.675 -57.011 -14.309 0.05 12.05 ? 227  PRO B O     1  
ATOM   4695   C  CB    A PRO B 1 228 ? -41.187 -57.832 -15.516 0.05 11.88 ? 227  PRO B CB    1  
ATOM   4696   C  CG    A PRO B 1 228 ? -41.274 -56.528 -16.353 0.05 11.59 ? 227  PRO B CG    1  
ATOM   4697   C  CD    A PRO B 1 228 ? -41.064 -55.376 -15.425 0.05 11.54 ? 227  PRO B CD    1  
ATOM   4698   N  N     A ALA B 1 229 ? -39.300 -58.346 -12.590 0.05 12.50 ? 228  ALA B N     1  
ATOM   4699   C  CA    A ALA B 1 229 ? -37.942 -58.601 -12.092 0.05 12.72 ? 228  ALA B CA    1  
ATOM   4700   C  C     A ALA B 1 229 ? -37.013 -59.309 -13.086 0.05 12.78 ? 228  ALA B C     1  
ATOM   4701   O  O     A ALA B 1 229 ? -36.288 -60.233 -12.713 0.05 13.09 ? 228  ALA B O     1  
ATOM   4702   C  CB    A ALA B 1 229 ? -37.999 -59.392 -10.785 0.05 13.10 ? 228  ALA B CB    1  
ATOM   4703   N  N     A GLY B 1 230 ? -37.053 -58.889 -14.346 0.05 12.52 ? 229  GLY B N     1  
ATOM   4704   C  CA    A GLY B 1 230 ? -36.142 -59.388 -15.357 0.05 12.57 ? 229  GLY B CA    1  
ATOM   4705   C  C     A GLY B 1 230 ? -35.640 -58.223 -16.177 0.05 12.26 ? 229  GLY B C     1  
ATOM   4706   O  O     A GLY B 1 230 ? -35.396 -58.332 -17.380 0.05 12.16 ? 229  GLY B O     1  
ATOM   4707   N  N     A ALA B 1 231 ? -35.514 -57.084 -15.512 0.05 12.14 ? 230  ALA B N     1  
ATOM   4708   C  CA    A ALA B 1 231 ? -35.104 -55.854 -16.164 0.05 11.86 ? 230  ALA B CA    1  
ATOM   4709   C  C     A ALA B 1 231 ? -34.065 -55.110 -15.339 0.05 11.83 ? 230  ALA B C     1  
ATOM   4710   O  O     A ALA B 1 231 ? -33.674 -55.550 -14.267 0.05 11.99 ? 230  ALA B O     1  
ATOM   4711   C  CB    A ALA B 1 231 ? -36.315 -54.968 -16.408 0.05 11.63 ? 230  ALA B CB    1  
ATOM   4712   N  N     A GLU B 1 232 ? -33.593 -53.984 -15.854 0.05 11.65 ? 231  GLU B N     1  
ATOM   4713   C  CA    A GLU B 1 232 ? -32.798 -53.087 -15.036 0.05 11.62 ? 231  GLU B CA    1  
ATOM   4714   C  C     A GLU B 1 232 ? -33.473 -51.747 -15.095 0.05 11.35 ? 231  GLU B C     1  
ATOM   4715   O  O     A GLU B 1 232 ? -33.684 -51.097 -14.078 0.05 11.30 ? 231  GLU B O     1  
ATOM   4716   C  CB    A GLU B 1 232 ? -31.387 -52.910 -15.595 0.05 11.79 ? 231  GLU B CB    1  
ATOM   4717   C  CG    A GLU B 1 232 ? -30.932 -53.999 -16.519 0.05 11.93 ? 231  GLU B CG    1  
ATOM   4718   C  CD    A GLU B 1 232 ? -30.534 -55.249 -15.773 0.05 12.27 ? 231  GLU B CD    1  
ATOM   4719   O  OE1   A GLU B 1 232 ? -29.935 -56.137 -16.403 0.05 12.44 ? 231  GLU B OE1   1  
ATOM   4720   O  OE2   A GLU B 1 232 ? -30.807 -55.341 -14.557 0.05 12.40 ? 231  GLU B OE2   1  
ATOM   4721   N  N     A LYS B 1 233 ? -33.813 -51.358 -16.316 0.05 11.20 ? 232  LYS B N     1  
ATOM   4722   C  CA    A LYS B 1 233 ? -34.175 -49.983 -16.614 0.05 10.99 ? 232  LYS B CA    1  
ATOM   4723   C  C     A LYS B 1 233 ? -35.553 -49.919 -17.250 0.05 10.86 ? 232  LYS B C     1  
ATOM   4724   O  O     A LYS B 1 233 ? -35.752 -50.327 -18.404 0.05 10.86 ? 232  LYS B O     1  
ATOM   4725   C  CB    A LYS B 1 233 ? -33.120 -49.347 -17.521 0.05 10.97 ? 232  LYS B CB    1  
ATOM   4726   C  CG    A LYS B 1 233 ? -31.703 -49.384 -16.947 0.05 11.10 ? 232  LYS B CG    1  
ATOM   4727   C  CD    A LYS B 1 233 ? -31.459 -48.219 -16.017 0.05 10.98 ? 232  LYS B CD    1  
ATOM   4728   C  CE    A LYS B 1 233 ? -30.774 -48.662 -14.742 0.05 11.11 ? 232  LYS B CE    1  
ATOM   4729   N  NZ    A LYS B 1 233 ? -31.667 -49.551 -13.929 0.05 11.21 ? 232  LYS B NZ    1  
ATOM   4730   N  N     A VAL B 1 234 ? -36.501 -49.426 -16.461 0.05 10.79 ? 233  VAL B N     1  
ATOM   4731   C  CA    A VAL B 1 234 ? -37.869 -49.214 -16.885 0.05 10.71 ? 233  VAL B CA    1  
ATOM   4732   C  C     A VAL B 1 234 ? -38.017 -47.748 -17.271 0.05 10.56 ? 233  VAL B C     1  
ATOM   4733   O  O     A VAL B 1 234 ? -37.849 -46.859 -16.428 0.05 10.53 ? 233  VAL B O     1  
ATOM   4734   C  CB    A VAL B 1 234 ? -38.845 -49.515 -15.731 0.05 10.78 ? 233  VAL B CB    1  
ATOM   4735   C  CG1   A VAL B 1 234 ? -40.247 -49.035 -16.061 0.05 10.70 ? 233  VAL B CG1   1  
ATOM   4736   C  CG2   A VAL B 1 234 ? -38.840 -51.011 -15.391 0.05 10.96 ? 233  VAL B CG2   1  
ATOM   4737   N  N     A VAL B 1 235 ? -38.305 -47.489 -18.542 0.05 10.50 ? 234  VAL B N     1  
ATOM   4738   C  CA    A VAL B 1 235 ? -38.515 -46.113 -18.988 0.05 10.41 ? 234  VAL B CA    1  
ATOM   4739   C  C     A VAL B 1 235 ? -39.990 -45.835 -19.275 0.05 10.39 ? 234  VAL B C     1  
ATOM   4740   O  O     A VAL B 1 235 ? -40.662 -46.609 -19.951 0.05 10.42 ? 234  VAL B O     1  
ATOM   4741   C  CB    A VAL B 1 235 ? -37.616 -45.738 -20.205 0.05 10.41 ? 234  VAL B CB    1  
ATOM   4742   C  CG1   A VAL B 1 235 ? -37.553 -46.868 -21.219 0.05 10.47 ? 234  VAL B CG1   1  
ATOM   4743   C  CG2   A VAL B 1 235 ? -38.102 -44.441 -20.853 0.05 10.36 ? 234  VAL B CG2   1  
ATOM   4744   N  N     A LEU B 1 236 ? -40.505 -44.745 -18.712 0.05 10.37 ? 235  LEU B N     1  
ATOM   4745   C  CA    A LEU B 1 236 ? -41.868 -44.331 -18.990 0.05 10.39 ? 235  LEU B CA    1  
ATOM   4746   C  C     A LEU B 1 236 ? -41.838 -43.167 -19.964 0.05 10.37 ? 235  LEU B C     1  
ATOM   4747   O  O     A LEU B 1 236 ? -41.142 -42.180 -19.729 0.05 10.36 ? 235  LEU B O     1  
ATOM   4748   C  CB    A LEU B 1 236 ? -42.563 -43.898 -17.701 0.05 10.44 ? 235  LEU B CB    1  
ATOM   4749   C  CG    A LEU B 1 236 ? -43.987 -43.373 -17.827 0.05 10.51 ? 235  LEU B CG    1  
ATOM   4750   C  CD1   A LEU B 1 236 ? -44.897 -44.397 -18.507 0.05 10.56 ? 235  LEU B CD1   1  
ATOM   4751   C  CD2   A LEU B 1 236 ? -44.536 -42.990 -16.451 0.05 10.60 ? 235  LEU B CD2   1  
ATOM   4752   N  N     A VAL B 1 237 ? -42.587 -43.290 -21.057 0.05 10.38 ? 236  VAL B N     1  
ATOM   4753   C  CA    A VAL B 1 237 ? -42.757 -42.187 -21.993 0.05 10.42 ? 236  VAL B CA    1  
ATOM   4754   C  C     A VAL B 1 237 ? -44.178 -41.676 -21.850 0.05 10.49 ? 236  VAL B C     1  
ATOM   4755   O  O     A VAL B 1 237 ? -45.137 -42.407 -22.090 0.05 10.53 ? 236  VAL B O     1  
ATOM   4756   C  CB    A VAL B 1 237 ? -42.500 -42.619 -23.456 0.05 10.44 ? 236  VAL B CB    1  
ATOM   4757   C  CG1   A VAL B 1 237 ? -42.778 -41.460 -24.413 0.05 10.52 ? 236  VAL B CG1   1  
ATOM   4758   C  CG2   A VAL B 1 237 ? -41.079 -43.129 -23.621 0.05 10.41 ? 236  VAL B CG2   1  
ATOM   4759   N  N     A SER B 1 238 ? -44.315 -40.430 -21.422 0.05 10.55 ? 237  SER B N     1  
ATOM   4760   C  CA    A SER B 1 238 ? -45.636 -39.848 -21.239 0.05 10.67 ? 237  SER B CA    1  
ATOM   4761   C  C     A SER B 1 238 ? -45.580 -38.375 -21.577 0.05 10.77 ? 237  SER B C     1  
ATOM   4762   O  O     A SER B 1 238 ? -44.897 -37.600 -20.914 0.05 10.76 ? 237  SER B O     1  
ATOM   4763   C  CB    A SER B 1 238 ? -46.125 -40.049 -19.802 0.05 10.70 ? 237  SER B CB    1  
ATOM   4764   O  OG    A SER B 1 238 ? -47.485 -39.669 -19.652 0.05 10.85 ? 237  SER B OG    1  
ATOM   4765   N  N     A LEU B 1 239 ? -46.300 -37.982 -22.618 0.05 10.90 ? 238  LEU B N     1  
ATOM   4766   C  CA    A LEU B 1 239 ? -46.331 -36.580 -22.979 0.05 11.05 ? 238  LEU B CA    1  
ATOM   4767   C  C     A LEU B 1 239 ? -47.561 -35.957 -22.354 0.05 11.23 ? 238  LEU B C     1  
ATOM   4768   O  O     A LEU B 1 239 ? -48.108 -34.989 -22.875 0.05 11.42 ? 238  LEU B O     1  
ATOM   4769   C  CB    A LEU B 1 239 ? -46.365 -36.404 -24.495 0.05 11.15 ? 238  LEU B CB    1  
ATOM   4770   C  CG    A LEU B 1 239 ? -45.187 -36.971 -25.282 0.05 11.04 ? 238  LEU B CG    1  
ATOM   4771   C  CD1   A LEU B 1 239 ? -45.239 -36.495 -26.730 0.05 11.20 ? 238  LEU B CD1   1  
ATOM   4772   C  CD2   A LEU B 1 239 ? -43.871 -36.592 -24.628 0.05 10.95 ? 238  LEU B CD2   1  
ATOM   4773   N  N     A GLY B 1 240 ? -48.004 -36.529 -21.238 0.05 11.20 ? 239  GLY B N     1  
ATOM   4774   C  CA    A GLY B 1 240 ? -49.179 -36.023 -20.554 0.05 11.40 ? 239  GLY B CA    1  
ATOM   4775   C  C     A GLY B 1 240 ? -50.438 -36.624 -21.140 0.05 11.54 ? 239  GLY B C     1  
ATOM   4776   O  O     A GLY B 1 240 ? -50.414 -37.735 -21.666 0.05 11.44 ? 239  GLY B O     1  
ATOM   4777   N  N     A SER B 1 241 ? -51.544 -35.894 -21.042 0.05 11.80 ? 240  SER B N     1  
ATOM   4778   C  CA    A SER B 1 241 ? -52.795 -36.358 -21.631 0.05 11.99 ? 240  SER B CA    1  
ATOM   4779   C  C     A SER B 1 241 ? -53.244 -35.424 -22.747 0.05 12.20 ? 240  SER B C     1  
ATOM   4780   O  O     A SER B 1 241 ? -54.417 -35.433 -23.144 0.05 12.34 ? 240  SER B O     1  
ATOM   4781   C  CB    A SER B 1 241 ? -53.892 -36.489 -20.569 0.05 12.22 ? 240  SER B CB    1  
ATOM   4782   O  OG    A SER B 1 241 ? -54.398 -35.227 -20.191 0.05 12.48 ? 240  SER B OG    1  
ATOM   4783   N  N     A ALA B 1 242 ? -52.306 -34.623 -23.251 0.05 12.23 ? 241  ALA B N     1  
ATOM   4784   C  CA    A ALA B 1 242 ? -52.617 -33.628 -24.274 0.05 12.50 ? 241  ALA B CA    1  
ATOM   4785   C  C     A ALA B 1 242 ? -51.809 -33.752 -25.570 0.05 12.42 ? 241  ALA B C     1  
ATOM   4786   O  O     A ALA B 1 242 ? -52.309 -34.239 -26.580 0.05 12.53 ? 241  ALA B O     1  
ATOM   4787   C  CB    A ALA B 1 242 ? -52.462 -32.223 -23.700 0.05 12.73 ? 241  ALA B CB    1  
ATOM   4788   N  N     A PHE B 1 243 ? -50.560 -33.298 -25.529 0.05 12.25 ? 242  PHE B N     1  
ATOM   4789   C  CA    A PHE B 1 243 ? -49.806 -32.987 -26.742 0.05 12.24 ? 242  PHE B CA    1  
ATOM   4790   C  C     A PHE B 1 243 ? -49.056 -34.200 -27.248 0.05 11.96 ? 242  PHE B C     1  
ATOM   4791   O  O     A PHE B 1 243 ? -47.827 -34.263 -27.179 0.05 11.80 ? 242  PHE B O     1  
ATOM   4792   C  CB    A PHE B 1 243 ? -48.826 -31.844 -26.461 0.05 12.26 ? 242  PHE B CB    1  
ATOM   4793   C  CG    A PHE B 1 243 ? -49.445 -30.687 -25.729 0.05 12.52 ? 242  PHE B CG    1  
ATOM   4794   C  CD1   A PHE B 1 243 ? -50.207 -29.743 -26.406 0.05 12.88 ? 242  PHE B CD1   1  
ATOM   4795   C  CD2   A PHE B 1 243 ? -49.274 -30.549 -24.363 0.05 12.45 ? 242  PHE B CD2   1  
ATOM   4796   C  CE1   A PHE B 1 243 ? -50.781 -28.674 -25.726 0.05 13.16 ? 242  PHE B CE1   1  
ATOM   4797   C  CE2   A PHE B 1 243 ? -49.846 -29.494 -23.679 0.05 12.73 ? 242  PHE B CE2   1  
ATOM   4798   C  CZ    A PHE B 1 243 ? -50.603 -28.556 -24.359 0.05 13.08 ? 242  PHE B CZ    1  
ATOM   4799   N  N     A THR B 1 244 ? -49.801 -35.161 -27.776 0.05 11.94 ? 243  THR B N     1  
ATOM   4800   C  CA    A THR B 1 244 ? -49.248 -36.484 -27.971 0.05 11.70 ? 243  THR B CA    1  
ATOM   4801   C  C     A THR B 1 244 ? -49.365 -37.062 -29.380 0.05 11.71 ? 243  THR B C     1  
ATOM   4802   O  O     A THR B 1 244 ? -49.015 -38.223 -29.599 0.05 11.54 ? 243  THR B O     1  
ATOM   4803   C  CB    A THR B 1 244 ? -49.911 -37.471 -27.012 0.05 11.68 ? 243  THR B CB    1  
ATOM   4804   O  OG1   A THR B 1 244 ? -49.517 -38.795 -27.369 0.05 11.53 ? 243  THR B OG1   1  
ATOM   4805   C  CG2   A THR B 1 244 ? -51.429 -37.350 -27.095 0.05 11.97 ? 243  THR B CG2   1  
ATOM   4806   N  N     A LYS B 1 245 ? -49.854 -36.289 -30.344 0.05 11.95 ? 244  LYS B N     1  
ATOM   4807   C  CA    A LYS B 1 245 ? -49.966 -36.857 -31.680 0.05 12.01 ? 244  LYS B CA    1  
ATOM   4808   C  C     A LYS B 1 245 ? -48.589 -36.962 -32.337 0.05 11.95 ? 244  LYS B C     1  
ATOM   4809   O  O     A LYS B 1 245 ? -48.340 -36.368 -33.382 0.05 12.16 ? 244  LYS B O     1  
ATOM   4810   C  CB    A LYS B 1 245 ? -50.948 -36.086 -32.562 0.05 12.33 ? 244  LYS B CB    1  
ATOM   4811   C  CG    A LYS B 1 245 ? -51.457 -36.922 -33.725 0.05 12.40 ? 244  LYS B CG    1  
ATOM   4812   C  CD    A LYS B 1 245 ? -52.627 -36.279 -34.458 0.05 12.76 ? 244  LYS B CD    1  
ATOM   4813   C  CE    A LYS B 1 245 ? -52.960 -37.084 -35.711 0.05 12.83 ? 244  LYS B CE    1  
ATOM   4814   N  NZ    A LYS B 1 245 ? -54.136 -36.565 -36.471 0.05 13.20 ? 244  LYS B NZ    1  
ATOM   4815   N  N     A GLN B 1 246 ? -47.713 -37.747 -31.710 0.05 11.70 ? 245  GLN B N     1  
ATOM   4816   C  CA    A GLN B 1 246 ? -46.330 -37.885 -32.131 0.05 11.66 ? 245  GLN B CA    1  
ATOM   4817   C  C     A GLN B 1 246 ? -45.990 -39.330 -32.464 0.05 11.53 ? 245  GLN B C     1  
ATOM   4818   O  O     A GLN B 1 246 ? -45.193 -39.951 -31.769 0.05 11.36 ? 245  GLN B O     1  
ATOM   4819   C  CB    A GLN B 1 246 ? -45.402 -37.376 -31.016 0.05 11.56 ? 245  GLN B CB    1  
ATOM   4820   C  CG    A GLN B 1 246 ? -45.739 -35.975 -30.557 0.05 11.71 ? 245  GLN B CG    1  
ATOM   4821   C  CD    A GLN B 1 246 ? -45.614 -34.960 -31.685 0.05 12.00 ? 245  GLN B CD    1  
ATOM   4822   O  OE1   A GLN B 1 246 ? -44.817 -35.142 -32.607 0.05 12.05 ? 245  GLN B OE1   1  
ATOM   4823   N  NE2   A GLN B 1 246 ? -46.399 -33.892 -31.615 0.05 12.23 ? 245  GLN B NE2   1  
ATOM   4824   N  N     A PRO B 1 247 ? -46.585 -39.880 -33.535 0.05 11.63 ? 246  PRO B N     1  
ATOM   4825   C  CA    A PRO B 1 247 ? -46.299 -41.294 -33.785 0.05 11.53 ? 246  PRO B CA    1  
ATOM   4826   C  C     A PRO B 1 247 ? -44.863 -41.522 -34.229 0.05 11.50 ? 246  PRO B C     1  
ATOM   4827   O  O     A PRO B 1 247 ? -44.267 -42.526 -33.856 0.05 11.35 ? 246  PRO B O     1  
ATOM   4828   C  CB    A PRO B 1 247 ? -47.263 -41.650 -34.920 0.05 11.71 ? 246  PRO B CB    1  
ATOM   4829   C  CG    A PRO B 1 247 ? -47.561 -40.345 -35.600 0.05 11.95 ? 246  PRO B CG    1  
ATOM   4830   C  CD    A PRO B 1 247 ? -47.555 -39.329 -34.502 0.05 11.87 ? 246  PRO B CD    1  
ATOM   4831   N  N     A ALA B 1 248 ? -44.316 -40.614 -35.029 0.05 11.68 ? 247  ALA B N     1  
ATOM   4832   C  CA    A ALA B 1 248 ? -42.924 -40.739 -35.424 0.05 11.71 ? 247  ALA B CA    1  
ATOM   4833   C  C     A ALA B 1 248 ? -42.032 -40.697 -34.182 0.05 11.52 ? 247  ALA B C     1  
ATOM   4834   O  O     A ALA B 1 248 ? -41.125 -41.514 -34.042 0.05 11.46 ? 247  ALA B O     1  
ATOM   4835   C  CB    A ALA B 1 248 ? -42.536 -39.648 -36.418 0.05 11.99 ? 247  ALA B CB    1  
ATOM   4836   N  N     A PHE B 1 249 ? -42.308 -39.761 -33.275 0.05 11.46 ? 248  PHE B N     1  
ATOM   4837   C  CA    A PHE B 1 249 ? -41.560 -39.684 -32.014 0.05 11.30 ? 248  PHE B CA    1  
ATOM   4838   C  C     A PHE B 1 249 ? -41.764 -40.944 -31.174 0.05 11.09 ? 248  PHE B C     1  
ATOM   4839   O  O     A PHE B 1 249 ? -40.816 -41.467 -30.591 0.05 11.00 ? 248  PHE B O     1  
ATOM   4840   C  CB    A PHE B 1 249 ? -41.946 -38.440 -31.201 0.05 11.31 ? 248  PHE B CB    1  
ATOM   4841   C  CG    A PHE B 1 249 ? -41.376 -38.425 -29.803 0.05 11.13 ? 248  PHE B CG    1  
ATOM   4842   C  CD1   A PHE B 1 249 ? -40.012 -38.246 -29.594 0.05 11.12 ? 248  PHE B CD1   1  
ATOM   4843   C  CD2   A PHE B 1 249 ? -42.203 -38.581 -28.701 0.05 11.02 ? 248  PHE B CD2   1  
ATOM   4844   C  CE1   A PHE B 1 249 ? -39.485 -38.232 -28.311 0.05 10.98 ? 248  PHE B CE1   1  
ATOM   4845   C  CE2   A PHE B 1 249 ? -41.678 -38.563 -27.413 0.05 10.89 ? 248  PHE B CE2   1  
ATOM   4846   C  CZ    A PHE B 1 249 ? -40.320 -38.393 -27.223 0.05 10.86 ? 248  PHE B CZ    1  
ATOM   4847   N  N     A TYR B 1 250 ? -43.000 -41.434 -31.107 0.05 11.06 ? 249  TYR B N     1  
ATOM   4848   C  CA    A TYR B 1 250 ? -43.242 -42.708 -30.431 0.05 10.92 ? 249  TYR B CA    1  
ATOM   4849   C  C     A TYR B 1 250 ? -42.511 -43.856 -31.119 0.05 10.93 ? 249  TYR B C     1  
ATOM   4850   O  O     A TYR B 1 250 ? -41.927 -44.707 -30.455 0.05 10.84 ? 249  TYR B O     1  
ATOM   4851   C  CB    A TYR B 1 250 ? -44.738 -43.019 -30.331 0.05 10.93 ? 249  TYR B CB    1  
ATOM   4852   C  CG    A TYR B 1 250 ? -45.515 -42.069 -29.459 0.05 10.95 ? 249  TYR B CG    1  
ATOM   4853   C  CD1   A TYR B 1 250 ? -44.960 -41.537 -28.303 0.05 10.86 ? 249  TYR B CD1   1  
ATOM   4854   C  CD2   A TYR B 1 250 ? -46.803 -41.702 -29.793 0.05 11.08 ? 249  TYR B CD2   1  
ATOM   4855   C  CE1   A TYR B 1 250 ? -45.668 -40.669 -27.508 0.05 10.90 ? 249  TYR B CE1   1  
ATOM   4856   C  CE2   A TYR B 1 250 ? -47.517 -40.843 -29.010 0.05 11.13 ? 249  TYR B CE2   1  
ATOM   4857   C  CZ    A TYR B 1 250 ? -46.941 -40.324 -27.868 0.05 11.05 ? 249  TYR B CZ    1  
ATOM   4858   O  OH    A TYR B 1 250 ? -47.645 -39.469 -27.076 0.05 11.14 ? 249  TYR B OH    1  
ATOM   4859   N  N     A ARG B 1 251 ? -42.539 -43.887 -32.452 0.05 11.08 ? 250  ARG B N     1  
ATOM   4860   C  CA    A ARG B 1 251 ? -41.752 -44.876 -33.168 0.05 11.14 ? 250  ARG B CA    1  
ATOM   4861   C  C     A ARG B 1 251 ? -40.289 -44.613 -32.876 0.05 11.14 ? 250  ARG B C     1  
ATOM   4862   O  O     A ARG B 1 251 ? -39.495 -45.540 -32.746 0.05 11.13 ? 250  ARG B O     1  
ATOM   4863   C  CB    A ARG B 1 251 ? -42.010 -44.834 -34.680 0.05 11.34 ? 250  ARG B CB    1  
ATOM   4864   C  CG    A ARG B 1 251 ? -42.692 -46.085 -35.226 0.05 11.36 ? 250  ARG B CG    1  
ATOM   4865   C  CD    A ARG B 1 251 ? -42.547 -46.156 -36.735 0.05 11.58 ? 250  ARG B CD    1  
ATOM   4866   N  NE    A ARG B 1 251 ? -42.668 -44.832 -37.328 0.05 11.74 ? 250  ARG B NE    1  
ATOM   4867   C  CZ    A ARG B 1 251 ? -43.825 -44.229 -37.574 0.05 11.81 ? 250  ARG B CZ    1  
ATOM   4868   N  NH1   A ARG B 1 251 ? -44.965 -44.838 -37.279 0.05 11.73 ? 250  ARG B NH1   1  
ATOM   4869   N  NH2   A ARG B 1 251 ? -43.839 -43.019 -38.122 0.05 11.99 ? 250  ARG B NH2   1  
ATOM   4870   N  N     A GLU B 1 252 ? -39.934 -43.339 -32.750 0.05 11.19 ? 251  GLU B N     1  
ATOM   4871   C  CA    A GLU B 1 252 ? -38.574 -43.007 -32.362 0.05 11.20 ? 251  GLU B CA    1  
ATOM   4872   C  C     A GLU B 1 252 ? -38.337 -43.488 -30.937 0.05 11.01 ? 251  GLU B C     1  
ATOM   4873   O  O     A GLU B 1 252 ? -37.245 -43.936 -30.606 0.05 11.01 ? 251  GLU B O     1  
ATOM   4874   C  CB    A GLU B 1 252 ? -38.293 -41.511 -32.515 0.05 11.33 ? 251  GLU B CB    1  
ATOM   4875   C  CG    A GLU B 1 252 ? -38.068 -41.096 -33.969 0.05 11.59 ? 251  GLU B CG    1  
ATOM   4876   C  CD    A GLU B 1 252 ? -37.138 -42.058 -34.693 0.05 11.72 ? 251  GLU B CD    1  
ATOM   4877   O  OE1   A GLU B 1 252 ? -35.916 -41.849 -34.622 0.05 11.64 ? 251  GLU B OE1   1  
ATOM   4878   O  OE2   A GLU B 1 252 ? -37.627 -43.024 -35.326 0.05 11.95 ? 251  GLU B OE2   1  
ATOM   4879   N  N     A CYS B 1 253 ? -39.376 -43.432 -30.111 0.05 10.89 ? 252  CYS B N     1  
ATOM   4880   C  CA    A CYS B 1 253 ? -39.294 -43.976 -28.756 0.05 10.74 ? 252  CYS B CA    1  
ATOM   4881   C  C     A CYS B 1 253 ? -39.252 -45.503 -28.773 0.05 10.72 ? 252  CYS B C     1  
ATOM   4882   O  O     A CYS B 1 253 ? -38.465 -46.116 -28.052 0.05 10.66 ? 252  CYS B O     1  
ATOM   4883   C  CB    A CYS B 1 253 ? -40.463 -43.499 -27.894 0.05 10.66 ? 252  CYS B CB    1  
ATOM   4884   S  SG    A CYS B 1 253 ? -40.310 -41.800 -27.311 0.05 10.67 ? 252  CYS B SG    1  
ATOM   4885   N  N     A VAL B 1 254 ? -40.107 -46.113 -29.589 0.05 10.79 ? 253  VAL B N     1  
ATOM   4886   C  CA    A VAL B 1 254 ? -40.094 -47.566 -29.734 0.05 10.81 ? 253  VAL B CA    1  
ATOM   4887   C  C     A VAL B 1 254 ? -38.724 -48.052 -30.163 0.05 10.93 ? 253  VAL B C     1  
ATOM   4888   O  O     A VAL B 1 254 ? -38.190 -49.010 -29.597 0.05 10.93 ? 253  VAL B O     1  
ATOM   4889   C  CB    A VAL B 1 254 ? -41.104 -48.062 -30.775 0.05 10.88 ? 253  VAL B CB    1  
ATOM   4890   C  CG1   A VAL B 1 254 ? -40.905 -49.551 -31.034 0.05 10.95 ? 253  VAL B CG1   1  
ATOM   4891   C  CG2   A VAL B 1 254 ? -42.519 -47.801 -30.314 0.05 10.80 ? 253  VAL B CG2   1  
ATOM   4892   N  N     A ARG B 1 255 ? -38.139 -47.384 -31.151 0.05 11.06 ? 254  ARG B N     1  
ATOM   4893   C  CA    A ARG B 1 255 ? -36.845 -47.839 -31.651 0.05 11.22 ? 254  ARG B CA    1  
ATOM   4894   C  C     A ARG B 1 255 ? -35.682 -47.494 -30.722 0.05 11.21 ? 254  ARG B C     1  
ATOM   4895   O  O     A ARG B 1 255 ? -34.703 -48.241 -30.650 0.05 11.33 ? 254  ARG B O     1  
ATOM   4896   C  CB    A ARG B 1 255 ? -36.582 -47.393 -33.090 0.05 11.41 ? 254  ARG B CB    1  
ATOM   4897   C  CG    A ARG B 1 255 ? -36.770 -48.542 -34.080 0.05 11.52 ? 254  ARG B CG    1  
ATOM   4898   C  CD    A ARG B 1 255 ? -36.014 -48.349 -35.381 0.05 11.78 ? 254  ARG B CD    1  
ATOM   4899   N  NE    A ARG B 1 255 ? -36.468 -47.161 -36.097 0.05 11.83 ? 254  ARG B NE    1  
ATOM   4900   C  CZ    A ARG B 1 255 ? -37.665 -47.035 -36.660 0.05 11.79 ? 254  ARG B CZ    1  
ATOM   4901   N  NH1   A ARG B 1 255 ? -37.985 -45.911 -37.288 0.05 11.89 ? 254  ARG B NH1   1  
ATOM   4902   N  NH2   A ARG B 1 255 ? -38.544 -48.023 -36.589 0.05 11.68 ? 254  ARG B NH2   1  
ATOM   4903   N  N     A ALA B 1 256 ? -35.800 -46.377 -30.011 0.05 11.09 ? 255  ALA B N     1  
ATOM   4904   C  CA    A ALA B 1 256 ? -34.815 -46.017 -28.996 0.05 11.08 ? 255  ALA B CA    1  
ATOM   4905   C  C     A ALA B 1 256 ? -34.589 -47.156 -28.002 0.05 11.03 ? 255  ALA B C     1  
ATOM   4906   O  O     A ALA B 1 256 ? -33.450 -47.499 -27.687 0.05 11.10 ? 255  ALA B O     1  
ATOM   4907   C  CB    A ALA B 1 256 ? -35.251 -44.763 -28.259 0.05 10.96 ? 255  ALA B CB    1  
ATOM   4908   N  N     A PHE B 1 257 ? -35.677 -47.745 -27.514 0.05 10.93 ? 256  PHE B N     1  
ATOM   4909   C  CA    A PHE B 1 257 ? -35.567 -48.745 -26.450 0.05 10.90 ? 256  PHE B CA    1  
ATOM   4910   C  C     A PHE B 1 257 ? -35.964 -50.159 -26.855 0.05 10.98 ? 256  PHE B C     1  
ATOM   4911   O  O     A PHE B 1 257 ? -35.875 -51.086 -26.043 0.05 11.05 ? 256  PHE B O     1  
ATOM   4912   C  CB    A PHE B 1 257 ? -36.406 -48.324 -25.248 0.05 10.73 ? 256  PHE B CB    1  
ATOM   4913   C  CG    A PHE B 1 257 ? -36.092 -46.951 -24.741 0.05 10.67 ? 256  PHE B CG    1  
ATOM   4914   C  CD1   A PHE B 1 257 ? -35.029 -46.740 -23.879 0.05 10.68 ? 256  PHE B CD1   1  
ATOM   4915   C  CD2   A PHE B 1 257 ? -36.877 -45.872 -25.109 0.05 10.63 ? 256  PHE B CD2   1  
ATOM   4916   C  CE1   A PHE B 1 257 ? -34.745 -45.479 -23.405 0.05 10.63 ? 256  PHE B CE1   1  
ATOM   4917   C  CE2   A PHE B 1 257 ? -36.601 -44.599 -24.629 0.05 10.59 ? 256  PHE B CE2   1  
ATOM   4918   C  CZ    A PHE B 1 257 ? -35.528 -44.407 -23.780 0.05 10.58 ? 256  PHE B CZ    1  
ATOM   4919   N  N     A GLY B 1 258 ? -36.420 -50.321 -28.092 0.05 11.00 ? 257  GLY B N     1  
ATOM   4920   C  CA    A GLY B 1 258 ? -36.809 -51.633 -28.578 0.05 11.09 ? 257  GLY B CA    1  
ATOM   4921   C  C     A GLY B 1 258 ? -35.651 -52.610 -28.544 0.05 11.29 ? 257  GLY B C     1  
ATOM   4922   O  O     A GLY B 1 258 ? -34.598 -52.345 -29.119 0.05 11.42 ? 257  GLY B O     1  
ATOM   4923   N  N     A ASN B 1 259 ? -35.847 -53.725 -27.845 0.05 11.34 ? 258  ASN B N     1  
ATOM   4924   C  CA    A ASN B 1 259 ? -34.900 -54.836 -27.854 0.05 11.58 ? 258  ASN B CA    1  
ATOM   4925   C  C     A ASN B 1 259 ? -33.561 -54.511 -27.195 0.05 11.66 ? 258  ASN B C     1  
ATOM   4926   O  O     A ASN B 1 259 ? -32.524 -55.083 -27.550 0.05 11.89 ? 258  ASN B O     1  
ATOM   4927   C  CB    A ASN B 1 259 ? -34.700 -55.370 -29.282 0.05 11.76 ? 258  ASN B CB    1  
ATOM   4928   C  CG    A ASN B 1 259 ? -35.985 -55.915 -29.887 0.05 11.73 ? 258  ASN B CG    1  
ATOM   4929   O  OD1   A ASN B 1 259 ? -36.531 -55.353 -30.847 0.05 11.71 ? 258  ASN B OD1   1  
ATOM   4930   N  ND2   A ASN B 1 259 ? -36.479 -57.010 -29.324 0.05 11.76 ? 258  ASN B ND2   1  
ATOM   4931   N  N     A LEU B 1 260 ? -33.594 -53.601 -26.224 0.05 11.48 ? 259  LEU B N     1  
ATOM   4932   C  CA    A LEU B 1 260 ? -32.399 -53.242 -25.458 0.05 11.55 ? 259  LEU B CA    1  
ATOM   4933   C  C     A LEU B 1 260 ? -32.295 -54.170 -24.243 0.05 11.64 ? 259  LEU B C     1  
ATOM   4934   O  O     A LEU B 1 260 ? -33.123 -54.095 -23.340 0.05 11.50 ? 259  LEU B O     1  
ATOM   4935   C  CB    A LEU B 1 260 ? -32.475 -51.773 -25.016 0.05 11.35 ? 259  LEU B CB    1  
ATOM   4936   C  CG    A LEU B 1 260 ? -31.192 -50.935 -24.874 0.05 11.42 ? 259  LEU B CG    1  
ATOM   4937   C  CD1   A LEU B 1 260 ? -31.480 -49.573 -24.223 0.05 11.23 ? 259  LEU B CD1   1  
ATOM   4938   C  CD2   A LEU B 1 260 ? -30.110 -51.676 -24.112 0.05 11.66 ? 259  LEU B CD2   1  
ATOM   4939   N  N     A PRO B 1 261 ? -31.274 -55.049 -24.224 0.05 11.91 ? 260  PRO B N     1  
ATOM   4940   C  CA    A PRO B 1 261 ? -31.123 -56.134 -23.241 0.05 12.06 ? 260  PRO B CA    1  
ATOM   4941   C  C     A PRO B 1 261 ? -31.405 -55.718 -21.787 0.05 11.92 ? 260  PRO B C     1  
ATOM   4942   O  O     A PRO B 1 261 ? -30.790 -54.778 -21.290 0.05 11.83 ? 260  PRO B O     1  
ATOM   4943   C  CB    A PRO B 1 261 ? -29.660 -56.549 -23.415 0.05 12.38 ? 260  PRO B CB    1  
ATOM   4944   C  CG    A PRO B 1 261 ? -29.394 -56.307 -24.873 0.05 12.44 ? 260  PRO B CG    1  
ATOM   4945   C  CD    A PRO B 1 261 ? -30.203 -55.076 -25.240 0.05 12.13 ? 260  PRO B CD    1  
ATOM   4946   N  N     A GLY B 1 262 ? -32.341 -56.406 -21.133 0.05 11.93 ? 261  GLY B N     1  
ATOM   4947   C  CA    A GLY B 1 262 ? -32.697 -56.103 -19.756 0.05 11.78 ? 261  GLY B CA    1  
ATOM   4948   C  C     A GLY B 1 262 ? -33.775 -55.039 -19.666 0.05 11.52 ? 261  GLY B C     1  
ATOM   4949   O  O     A GLY B 1 262 ? -34.851 -55.271 -19.117 0.05 11.51 ? 261  GLY B O     1  
ATOM   4950   N  N     A TRP B 1 263 ? -33.464 -53.870 -20.220 0.05 11.33 ? 262  TRP B N     1  
ATOM   4951   C  CA    A TRP B 1 263 ? -34.397 -52.758 -20.370 0.05 11.10 ? 262  TRP B CA    1  
ATOM   4952   C  C     A TRP B 1 263 ? -35.841 -53.130 -20.684 0.05 11.04 ? 262  TRP B C     1  
ATOM   4953   O  O     A TRP B 1 263 ? -36.119 -54.110 -21.377 0.05 11.13 ? 262  TRP B O     1  
ATOM   4954   C  CB    A TRP B 1 263 ? -33.893 -51.824 -21.470 0.05 11.04 ? 262  TRP B CB    1  
ATOM   4955   C  CG    A TRP B 1 263 ? -32.684 -51.037 -21.099 0.05 11.05 ? 262  TRP B CG    1  
ATOM   4956   C  CD1   A TRP B 1 263 ? -31.408 -51.495 -20.987 0.05 11.24 ? 262  TRP B CD1   1  
ATOM   4957   C  CD2   A TRP B 1 263 ? -32.637 -49.633 -20.815 0.05 10.91 ? 262  TRP B CD2   1  
ATOM   4958   N  NE1   A TRP B 1 263 ? -30.565 -50.464 -20.638 0.05 11.21 ? 262  TRP B NE1   1  
ATOM   4959   C  CE2   A TRP B 1 263 ? -31.299 -49.312 -20.516 0.05 11.01 ? 262  TRP B CE2   1  
ATOM   4960   C  CE3   A TRP B 1 263 ? -33.603 -48.621 -20.770 0.05 10.74 ? 262  TRP B CE3   1  
ATOM   4961   C  CZ2   A TRP B 1 263 ? -30.899 -48.017 -20.187 0.05 10.93 ? 262  TRP B CZ2   1  
ATOM   4962   C  CZ3   A TRP B 1 263 ? -33.210 -47.342 -20.442 0.05 10.68 ? 262  TRP B CZ3   1  
ATOM   4963   C  CH2   A TRP B 1 263 ? -31.867 -47.047 -20.153 0.05 10.76 ? 262  TRP B CH2   1  
ATOM   4964   N  N     A HIS B 1 264 ? -36.756 -52.315 -20.173 0.05 10.90 ? 263  HIS B N     1  
ATOM   4965   C  CA    A HIS B 1 264 ? -38.165 -52.412 -20.516 0.05 10.85 ? 263  HIS B CA    1  
ATOM   4966   C  C     A HIS B 1 264 ? -38.732 -51.009 -20.705 0.05 10.69 ? 263  HIS B C     1  
ATOM   4967   O  O     A HIS B 1 264 ? -38.443 -50.109 -19.906 0.05 10.62 ? 263  HIS B O     1  
ATOM   4968   C  CB    A HIS B 1 264 ? -38.939 -53.144 -19.418 0.05 10.94 ? 263  HIS B CB    1  
ATOM   4969   C  CG    A HIS B 1 264 ? -40.346 -53.478 -19.802 0.05 10.98 ? 263  HIS B CG    1  
ATOM   4970   N  ND1   A HIS B 1 264 ? -41.425 -52.704 -19.437 0.05 10.95 ? 263  HIS B ND1   1  
ATOM   4971   C  CD2   A HIS B 1 264 ? -40.842 -54.483 -20.559 0.05 11.07 ? 263  HIS B CD2   1  
ATOM   4972   C  CE1   A HIS B 1 264 ? -42.529 -53.232 -19.933 0.05 11.02 ? 263  HIS B CE1   1  
ATOM   4973   N  NE2   A HIS B 1 264 ? -42.202 -54.312 -20.618 0.05 11.09 ? 263  HIS B NE2   1  
ATOM   4974   N  N     A LEU B 1 265 ? -39.545 -50.831 -21.749 0.05 10.65 ? 264  LEU B N     1  
ATOM   4975   C  CA    A LEU B 1 265 ? -40.186 -49.545 -22.046 0.05 10.55 ? 264  LEU B CA    1  
ATOM   4976   C  C     A LEU B 1 265 ? -41.696 -49.572 -21.811 0.05 10.55 ? 264  LEU B C     1  
ATOM   4977   O  O     A LEU B 1 265 ? -42.352 -50.579 -22.067 0.05 10.61 ? 264  LEU B O     1  
ATOM   4978   C  CB    A LEU B 1 265 ? -39.893 -49.129 -23.499 0.05 10.55 ? 264  LEU B CB    1  
ATOM   4979   C  CG    A LEU B 1 265 ? -40.785 -48.078 -24.179 0.05 10.49 ? 264  LEU B CG    1  
ATOM   4980   C  CD1   A LEU B 1 265 ? -40.653 -46.693 -23.527 0.05 10.44 ? 264  LEU B CD1   1  
ATOM   4981   C  CD2   A LEU B 1 265 ? -40.495 -47.997 -25.674 0.05 10.54 ? 264  LEU B CD2   1  
ATOM   4982   N  N     A VAL B 1 266 ? -42.237 -48.461 -21.310 0.05 10.51 ? 265  VAL B N     1  
ATOM   4983   C  CA    A VAL B 1 266 ? -43.676 -48.289 -21.162 0.05 10.55 ? 265  VAL B CA    1  
ATOM   4984   C  C     A VAL B 1 266 ? -44.083 -47.039 -21.936 0.05 10.51 ? 265  VAL B C     1  
ATOM   4985   O  O     A VAL B 1 266 ? -43.635 -45.935 -21.610 0.05 10.48 ? 265  VAL B O     1  
ATOM   4986   C  CB    A VAL B 1 266 ? -44.084 -48.154 -19.679 0.05 10.59 ? 265  VAL B CB    1  
ATOM   4987   C  CG1   A VAL B 1 266 ? -45.597 -48.013 -19.538 0.05 10.68 ? 265  VAL B CG1   1  
ATOM   4988   C  CG2   A VAL B 1 266 ? -43.573 -49.352 -18.875 0.05 10.67 ? 265  VAL B CG2   1  
ATOM   4989   N  N     A LEU B 1 267 ? -44.911 -47.225 -22.970 0.05 10.54 ? 266  LEU B N     1  
ATOM   4990   C  CA    A LEU B 1 267 ? -45.332 -46.136 -23.851 0.05 10.55 ? 266  LEU B CA    1  
ATOM   4991   C  C     A LEU B 1 267 ? -46.754 -45.669 -23.559 0.05 10.64 ? 266  LEU B C     1  
ATOM   4992   O  O     A LEU B 1 267 ? -47.692 -46.464 -23.532 0.05 10.71 ? 266  LEU B O     1  
ATOM   4993   C  CB    A LEU B 1 267 ? -45.244 -46.553 -25.324 0.05 10.58 ? 266  LEU B CB    1  
ATOM   4994   C  CG    A LEU B 1 267 ? -43.919 -46.506 -26.073 0.05 10.55 ? 266  LEU B CG    1  
ATOM   4995   C  CD1   A LEU B 1 267 ? -44.179 -46.875 -27.507 0.05 10.61 ? 266  LEU B CD1   1  
ATOM   4996   C  CD2   A LEU B 1 267 ? -43.309 -45.112 -26.007 0.05 10.55 ? 266  LEU B CD2   1  
ATOM   4997   N  N     A GLN B 1 268 ? -46.912 -44.364 -23.381 0.05 10.66 ? 267  GLN B N     1  
ATOM   4998   C  CA    A GLN B 1 268 ? -48.195 -43.777 -23.045 0.05 10.79 ? 267  GLN B CA    1  
ATOM   4999   C  C     A GLN B 1 268 ? -48.606 -42.866 -24.193 0.05 10.85 ? 267  GLN B C     1  
ATOM   5000   O  O     A GLN B 1 268 ? -48.239 -41.685 -24.218 0.05 10.82 ? 267  GLN B O     1  
ATOM   5001   C  CB    A GLN B 1 268 ? -48.052 -42.985 -21.737 0.05 10.82 ? 267  GLN B CB    1  
ATOM   5002   C  CG    A GLN B 1 268 ? -49.308 -42.336 -21.186 0.05 11.00 ? 267  GLN B CG    1  
ATOM   5003   C  CD    A GLN B 1 268 ? -49.870 -41.223 -22.062 0.05 11.14 ? 267  GLN B CD    1  
ATOM   5004   O  OE1   A GLN B 1 268 ? -50.625 -41.491 -22.998 0.05 11.29 ? 267  GLN B OE1   1  
ATOM   5005   N  NE2   A GLN B 1 268 ? -49.488 -39.979 -21.781 0.05 11.12 ? 267  GLN B NE2   1  
ATOM   5006   N  N     A ILE B 1 269 ? -49.412 -43.391 -25.113 0.05 10.96 ? 268  ILE B N     1  
ATOM   5007   C  CA    A ILE B 1 269 ? -49.645 -42.700 -26.383 0.05 11.05 ? 268  ILE B CA    1  
ATOM   5008   C  C     A ILE B 1 269 ? -50.967 -41.936 -26.524 0.05 11.26 ? 268  ILE B C     1  
ATOM   5009   O  O     A ILE B 1 269 ? -51.223 -41.341 -27.573 0.05 11.38 ? 268  ILE B O     1  
ATOM   5010   C  CB    A ILE B 1 269 ? -49.445 -43.653 -27.589 0.05 11.02 ? 268  ILE B CB    1  
ATOM   5011   C  CG1   A ILE B 1 269 ? -50.566 -44.694 -27.663 0.05 11.08 ? 268  ILE B CG1   1  
ATOM   5012   C  CG2   A ILE B 1 269 ? -48.094 -44.336 -27.503 0.05 10.87 ? 268  ILE B CG2   1  
ATOM   5013   C  CD1   A ILE B 1 269 ? -50.479 -45.580 -28.897 0.05 11.11 ? 268  ILE B CD1   1  
ATOM   5014   N  N     A GLY B 1 270 ? -51.795 -41.931 -25.483 0.05 11.33 ? 269  GLY B N     1  
ATOM   5015   C  CA    A GLY B 1 270 ? -53.028 -41.158 -25.507 0.05 11.57 ? 269  GLY B CA    1  
ATOM   5016   C  C     A GLY B 1 270 ? -54.111 -41.781 -26.373 0.05 11.70 ? 269  GLY B C     1  
ATOM   5017   O  O     A GLY B 1 270 ? -54.228 -43.006 -26.434 0.05 11.62 ? 269  GLY B O     1  
ATOM   5018   N  N     A ARG B 1 271 ? -54.905 -40.952 -27.047 0.05 11.92 ? 270  ARG B N     1  
ATOM   5019   C  CA    A ARG B 1 271 ? -56.038 -41.477 -27.818 0.05 12.09 ? 270  ARG B CA    1  
ATOM   5020   C  C     A ARG B 1 271 ? -56.081 -41.082 -29.282 0.05 12.22 ? 270  ARG B C     1  
ATOM   5021   O  O     A ARG B 1 271 ? -56.665 -41.786 -30.108 0.05 12.35 ? 270  ARG B O     1  
ATOM   5022   C  CB    A ARG B 1 271 ? -57.374 -41.141 -27.149 0.05 12.34 ? 270  ARG B CB    1  
ATOM   5023   C  CG    A ARG B 1 271 ? -57.912 -42.316 -26.384 0.05 12.29 ? 270  ARG B CG    1  
ATOM   5024   C  CD    A ARG B 1 271 ? -57.453 -43.598 -27.074 0.05 12.25 ? 270  ARG B CD    1  
ATOM   5025   N  NE    A ARG B 1 271 ? -57.716 -44.772 -26.262 0.05 12.16 ? 270  ARG B NE    1  
ATOM   5026   C  CZ    A ARG B 1 271 ? -58.907 -45.346 -26.177 0.05 12.35 ? 270  ARG B CZ    1  
ATOM   5027   N  NH1   A ARG B 1 271 ? -59.927 -44.845 -26.864 0.05 12.64 ? 270  ARG B NH1   1  
ATOM   5028   N  NH2   A ARG B 1 271 ? -59.077 -46.411 -25.412 0.05 12.29 ? 270  ARG B NH2   1  
ATOM   5029   N  N     A LYS B 1 272 ? -55.447 -39.966 -29.606 0.05 12.20 ? 271  LYS B N     1  
ATOM   5030   C  CA    A LYS B 1 272 ? -55.409 -39.478 -30.976 0.05 12.33 ? 271  LYS B CA    1  
ATOM   5031   C  C     A LYS B 1 272 ? -54.385 -40.290 -31.760 0.05 12.14 ? 271  LYS B C     1  
ATOM   5032   O  O     A LYS B 1 272 ? -54.224 -40.119 -32.970 0.05 12.25 ? 271  LYS B O     1  
ATOM   5033   C  CB    A LYS B 1 272 ? -55.062 -37.991 -30.976 0.05 12.45 ? 271  LYS B CB    1  
ATOM   5034   C  CG    A LYS B 1 272 ? -55.769 -37.246 -29.857 0.05 12.68 ? 271  LYS B CG    1  
ATOM   5035   C  CD    A LYS B 1 272 ? -54.870 -36.218 -29.185 0.05 12.70 ? 271  LYS B CD    1  
ATOM   5036   C  CE    A LYS B 1 272 ? -55.517 -35.659 -27.914 0.05 12.89 ? 271  LYS B CE    1  
ATOM   5037   N  NZ    A LYS B 1 272 ? -55.281 -34.195 -27.752 0.05 13.03 ? 271  LYS B NZ    1  
ATOM   5038   N  N     A VAL B 1 273 ? -53.698 -41.178 -31.049 0.05 11.88 ? 272  VAL B N     1  
ATOM   5039   C  CA    A VAL B 1 273 ? -52.793 -42.139 -31.658 0.05 11.73 ? 272  VAL B CA    1  
ATOM   5040   C  C     A VAL B 1 273 ? -53.285 -43.538 -31.304 0.05 11.67 ? 272  VAL B C     1  
ATOM   5041   O  O     A VAL B 1 273 ? -53.494 -43.843 -30.131 0.05 11.65 ? 272  VAL B O     1  
ATOM   5042   C  CB    A VAL B 1 273 ? -51.341 -41.962 -31.149 0.05 11.52 ? 272  VAL B CB    1  
ATOM   5043   C  CG1   A VAL B 1 273 ? -50.437 -43.067 -31.692 0.05 11.41 ? 272  VAL B CG1   1  
ATOM   5044   C  CG2   A VAL B 1 273 ? -50.807 -40.590 -31.530 0.05 11.61 ? 272  VAL B CG2   1  
ATOM   5045   N  N     A THR B 1 274 ? -53.491 -44.376 -32.317 0.05 11.69 ? 273  THR B N     1  
ATOM   5046   C  CA    A THR B 1 274 ? -53.827 -45.772 -32.082 0.05 11.64 ? 273  THR B CA    1  
ATOM   5047   C  C     A THR B 1 274 ? -52.539 -46.605 -32.045 0.05 11.44 ? 273  THR B C     1  
ATOM   5048   O  O     A THR B 1 274 ? -51.585 -46.303 -32.756 0.05 11.38 ? 273  THR B O     1  
ATOM   5049   C  CB    A THR B 1 274 ? -54.836 -46.299 -33.136 0.05 11.79 ? 273  THR B CB    1  
ATOM   5050   O  OG1   A THR B 1 274 ? -54.222 -46.329 -34.435 0.05 11.80 ? 273  THR B OG1   1  
ATOM   5051   C  CG2   A THR B 1 274 ? -56.070 -45.406 -33.180 0.05 12.04 ? 273  THR B CG2   1  
ATOM   5052   N  N     A PRO B 1 275 ? -52.495 -47.643 -31.198 0.05 11.36 ? 274  PRO B N     1  
ATOM   5053   C  CA    A PRO B 1 275 ? -51.255 -48.412 -31.040 0.05 11.22 ? 274  PRO B CA    1  
ATOM   5054   C  C     A PRO B 1 275 ? -50.688 -48.960 -32.350 0.05 11.23 ? 274  PRO B C     1  
ATOM   5055   O  O     A PRO B 1 275 ? -49.469 -48.982 -32.535 0.05 11.15 ? 274  PRO B O     1  
ATOM   5056   C  CB    A PRO B 1 275 ? -51.679 -49.572 -30.133 0.05 11.24 ? 274  PRO B CB    1  
ATOM   5057   C  CG    A PRO B 1 275 ? -52.828 -49.039 -29.362 0.05 11.35 ? 274  PRO B CG    1  
ATOM   5058   C  CD    A PRO B 1 275 ? -53.566 -48.151 -30.327 0.05 11.45 ? 274  PRO B CD    1  
ATOM   5059   N  N     A ALA B 1 276 ? -51.564 -49.400 -33.250 0.05 11.36 ? 275  ALA B N     1  
ATOM   5060   C  CA    A ALA B 1 276 ? -51.124 -50.101 -34.462 0.05 11.41 ? 275  ALA B CA    1  
ATOM   5061   C  C     A ALA B 1 276 ? -50.154 -49.291 -35.322 0.05 11.45 ? 275  ALA B C     1  
ATOM   5062   O  O     A ALA B 1 276 ? -49.462 -49.824 -36.188 0.05 11.54 ? 275  ALA B O     1  
ATOM   5063   C  CB    A ALA B 1 276 ? -52.324 -50.574 -35.293 0.05 11.56 ? 275  ALA B CB    1  
ATOM   5064   N  N     A GLU B 1 277 ? -50.110 -47.995 -35.058 0.05 11.39 ? 276  GLU B N     1  
ATOM   5065   C  CA    A GLU B 1 277 ? -49.137 -47.124 -35.668 0.05 11.46 ? 276  GLU B CA    1  
ATOM   5066   C  C     A GLU B 1 277 ? -47.717 -47.662 -35.553 0.05 11.36 ? 276  GLU B C     1  
ATOM   5067   O  O     A GLU B 1 277 ? -46.992 -47.694 -36.543 0.05 11.46 ? 276  GLU B O     1  
ATOM   5068   C  CB    A GLU B 1 277 ? -49.219 -45.766 -35.004 0.05 11.48 ? 276  GLU B CB    1  
ATOM   5069   C  CG    A GLU B 1 277 ? -48.548 -44.717 -35.799 0.05 11.60 ? 276  GLU B CG    1  
ATOM   5070   C  CD    A GLU B 1 277 ? -49.346 -44.321 -37.011 0.05 11.84 ? 276  GLU B CD    1  
ATOM   5071   O  OE1   A GLU B 1 277 ? -48.845 -43.463 -37.772 0.05 12.00 ? 276  GLU B OE1   1  
ATOM   5072   O  OE2   A GLU B 1 277 ? -50.480 -44.834 -37.194 0.05 11.89 ? 276  GLU B OE2   1  
ATOM   5073   N  N     A LEU B 1 278 ? -47.340 -48.111 -34.357 0.05 11.21 ? 277  LEU B N     1  
ATOM   5074   C  CA    A LEU B 1 278 ? -45.958 -48.488 -34.060 0.05 11.14 ? 277  LEU B CA    1  
ATOM   5075   C  C     A LEU B 1 278 ? -45.513 -49.786 -34.753 0.05 11.19 ? 277  LEU B C     1  
ATOM   5076   O  O     A LEU B 1 278 ? -44.316 -50.000 -34.950 0.05 11.17 ? 277  LEU B O     1  
ATOM   5077   C  CB    A LEU B 1 278 ? -45.757 -48.583 -32.545 0.05 10.99 ? 277  LEU B CB    1  
ATOM   5078   C  CG    A LEU B 1 278 ? -46.492 -47.531 -31.701 0.05 10.96 ? 277  LEU B CG    1  
ATOM   5079   C  CD1   A LEU B 1 278 ? -46.526 -47.940 -30.237 0.05 10.85 ? 277  LEU B CD1   1  
ATOM   5080   C  CD2   A LEU B 1 278 ? -45.900 -46.125 -31.842 0.05 10.99 ? 277  LEU B CD2   1  
ATOM   5081   N  N     A GLY B 1 279 ? -46.471 -50.637 -35.121 0.05 11.30 ? 278  GLY B N     1  
ATOM   5082   C  CA    A GLY B 1 279 ? -46.210 -51.827 -35.928 0.05 11.39 ? 278  GLY B CA    1  
ATOM   5083   C  C     A GLY B 1 279 ? -46.416 -53.177 -35.243 0.05 11.35 ? 278  GLY B C     1  
ATOM   5084   O  O     A GLY B 1 279 ? -47.551 -53.597 -34.955 0.05 11.37 ? 278  GLY B O     1  
ATOM   5085   N  N     A GLU B 1 280 ? -45.305 -53.883 -35.049 0.05 11.33 ? 279  GLU B N     1  
ATOM   5086   C  CA    A GLU B 1 280 ? -45.223 -55.009 -34.138 0.05 11.31 ? 279  GLU B CA    1  
ATOM   5087   C  C     A GLU B 1 280 ? -44.285 -54.535 -33.038 0.05 11.24 ? 279  GLU B C     1  
ATOM   5088   O  O     A GLU B 1 280 ? -43.212 -54.004 -33.330 0.05 11.29 ? 279  GLU B O     1  
ATOM   5089   C  CB    A GLU B 1 280 ? -44.628 -56.234 -34.837 0.05 11.46 ? 279  GLU B CB    1  
ATOM   5090   N  N     A LEU B 1 281 ? -44.693 -54.694 -31.782 0.05 11.15 ? 280  LEU B N     1  
ATOM   5091   C  CA    A LEU B 1 281 ? -43.888 -54.208 -30.665 0.05 11.07 ? 280  LEU B CA    1  
ATOM   5092   C  C     A LEU B 1 281 ? -42.990 -55.320 -30.140 0.05 11.17 ? 280  LEU B C     1  
ATOM   5093   O  O     A LEU B 1 281 ? -43.426 -56.467 -30.026 0.05 11.27 ? 280  LEU B O     1  
ATOM   5094   C  CB    A LEU B 1 281 ? -44.781 -53.711 -29.529 0.05 10.98 ? 280  LEU B CB    1  
ATOM   5095   C  CG    A LEU B 1 281 ? -45.929 -52.736 -29.802 0.05 10.92 ? 280  LEU B CG    1  
ATOM   5096   C  CD1   A LEU B 1 281 ? -46.864 -52.715 -28.607 0.05 10.89 ? 280  LEU B CD1   1  
ATOM   5097   C  CD2   A LEU B 1 281 ? -45.416 -51.327 -30.096 0.05 10.86 ? 280  LEU B CD2   1  
ATOM   5098   N  N     A PRO B 1 282 ? -41.738 -54.978 -29.793 0.05 11.16 ? 281  PRO B N     1  
ATOM   5099   C  CA    A PRO B 1 282 ? -40.787 -55.959 -29.256 0.05 11.29 ? 281  PRO B CA    1  
ATOM   5100   C  C     A PRO B 1 282 ? -41.287 -56.518 -27.934 0.05 11.28 ? 281  PRO B C     1  
ATOM   5101   O  O     A PRO B 1 282 ? -42.257 -55.992 -27.379 0.05 11.16 ? 281  PRO B O     1  
ATOM   5102   C  CB    A PRO B 1 282 ? -39.513 -55.134 -29.045 0.05 11.28 ? 281  PRO B CB    1  
ATOM   5103   C  CG    A PRO B 1 282 ? -39.643 -53.986 -29.994 0.05 11.16 ? 281  PRO B CG    1  
ATOM   5104   C  CD    A PRO B 1 282 ? -41.107 -53.665 -30.021 0.05 11.06 ? 281  PRO B CD    1  
ATOM   5105   N  N     A ASP B 1 283 ? -40.652 -57.586 -27.461 0.05 11.44 ? 282  ASP B N     1  
ATOM   5106   C  CA    A ASP B 1 283 ? -41.017 -58.204 -26.198 0.05 11.49 ? 282  ASP B CA    1  
ATOM   5107   C  C     A ASP B 1 283 ? -41.055 -57.146 -25.094 0.05 11.34 ? 282  ASP B C     1  
ATOM   5108   O  O     A ASP B 1 283 ? -42.024 -57.047 -24.337 0.05 11.32 ? 282  ASP B O     1  
ATOM   5109   C  CB    A ASP B 1 283 ? -40.015 -59.314 -25.849 0.05 11.73 ? 282  ASP B CB    1  
ATOM   5110   C  CG    A ASP B 1 283 ? -39.834 -60.338 -26.985 0.05 11.91 ? 282  ASP B CG    1  
ATOM   5111   O  OD1   A ASP B 1 283 ? -38.727 -60.415 -27.564 0.05 12.06 ? 282  ASP B OD1   1  
ATOM   5112   O  OD2   A ASP B 1 283 ? -40.796 -61.072 -27.301 0.05 11.94 ? 282  ASP B OD2   1  
ATOM   5113   N  N     A ASN B 1 284 ? -40.005 -56.333 -25.046 0.05 11.26 ? 283  ASN B N     1  
ATOM   5114   C  CA    A ASN B 1 284 ? -39.770 -55.404 -23.943 0.05 11.14 ? 283  ASN B CA    1  
ATOM   5115   C  C     A ASN B 1 284 ? -40.483 -54.056 -24.047 0.05 10.96 ? 283  ASN B C     1  
ATOM   5116   O  O     A ASN B 1 284 ? -40.050 -53.079 -23.424 0.05 10.86 ? 283  ASN B O     1  
ATOM   5117   C  CB    A ASN B 1 284 ? -38.263 -55.169 -23.791 0.05 11.19 ? 283  ASN B CB    1  
ATOM   5118   C  CG    A ASN B 1 284 ? -37.678 -54.329 -24.924 0.05 11.13 ? 283  ASN B CG    1  
ATOM   5119   O  OD1   A ASN B 1 284 ? -38.136 -54.387 -26.069 0.05 11.14 ? 283  ASN B OD1   1  
ATOM   5120   N  ND2   A ASN B 1 284 ? -36.662 -53.531 -24.600 0.05 11.08 ? 283  ASN B ND2   1  
ATOM   5121   N  N     A VAL B 1 285 ? -41.566 -53.989 -24.819 0.05 10.93 ? 284  VAL B N     1  
ATOM   5122   C  CA    A VAL B 1 285 ? -42.297 -52.725 -24.971 0.05 10.80 ? 284  VAL B CA    1  
ATOM   5123   C  C     A VAL B 1 285 ? -43.817 -52.855 -24.848 0.05 10.81 ? 284  VAL B C     1  
ATOM   5124   O  O     A VAL B 1 285 ? -44.496 -53.309 -25.777 0.05 10.89 ? 284  VAL B O     1  
ATOM   5125   C  CB    A VAL B 1 285 ? -41.975 -52.008 -26.301 0.05 10.76 ? 284  VAL B CB    1  
ATOM   5126   C  CG1   A VAL B 1 285 ? -42.856 -50.760 -26.454 0.05 10.68 ? 284  VAL B CG1   1  
ATOM   5127   C  CG2   A VAL B 1 285 ? -40.494 -51.631 -26.381 0.05 10.77 ? 284  VAL B CG2   1  
ATOM   5128   N  N     A GLU B 1 286 ? -44.349 -52.454 -23.697 0.05 10.77 ? 285  GLU B N     1  
ATOM   5129   C  CA    A GLU B 1 286 ? -45.792 -52.411 -23.506 0.05 10.82 ? 285  GLU B CA    1  
ATOM   5130   C  C     A GLU B 1 286 ? -46.298 -51.013 -23.834 0.05 10.75 ? 285  GLU B C     1  
ATOM   5131   O  O     A GLU B 1 286 ? -45.741 -50.011 -23.379 0.05 10.67 ? 285  GLU B O     1  
ATOM   5132   C  CB    A GLU B 1 286 ? -46.190 -52.811 -22.074 0.05 10.90 ? 285  GLU B CB    1  
ATOM   5133   C  CG    A GLU B 1 286 ? -45.622 -51.910 -20.958 0.05 10.85 ? 285  GLU B CG    1  
ATOM   5134   C  CD    A GLU B 1 286 ? -46.029 -52.358 -19.553 0.05 10.97 ? 285  GLU B CD    1  
ATOM   5135   O  OE1   A GLU B 1 286 ? -47.106 -51.946 -19.060 0.05 11.05 ? 285  GLU B OE1   1  
ATOM   5136   O  OE2   A GLU B 1 286 ? -45.262 -53.117 -18.930 0.05 11.03 ? 285  GLU B OE2   1  
ATOM   5137   N  N     A VAL B 1 287 ? -47.354 -50.949 -24.631 0.05 10.81 ? 286  VAL B N     1  
ATOM   5138   C  CA    A VAL B 1 287 ? -47.967 -49.678 -24.983 0.05 10.80 ? 286  VAL B CA    1  
ATOM   5139   C  C     A VAL B 1 287 ? -49.362 -49.644 -24.389 0.05 10.92 ? 286  VAL B C     1  
ATOM   5140   O  O     A VAL B 1 287 ? -50.103 -50.639 -24.459 0.05 11.02 ? 286  VAL B O     1  
ATOM   5141   C  CB    A VAL B 1 287 ? -48.038 -49.501 -26.505 0.05 10.81 ? 286  VAL B CB    1  
ATOM   5142   C  CG1   A VAL B 1 287 ? -48.751 -48.212 -26.871 0.05 10.87 ? 286  VAL B CG1   1  
ATOM   5143   C  CG2   A VAL B 1 287 ? -46.632 -49.530 -27.090 0.05 10.73 ? 286  VAL B CG2   1  
ATOM   5144   N  N     A HIS B 1 288 ? -49.696 -48.504 -23.788 0.05 10.93 ? 287  HIS B N     1  
ATOM   5145   C  CA    A HIS B 1 288 ? -51.002 -48.263 -23.193 0.05 11.09 ? 287  HIS B CA    1  
ATOM   5146   C  C     A HIS B 1 288 ? -51.531 -46.951 -23.738 0.05 11.16 ? 287  HIS B C     1  
ATOM   5147   O  O     A HIS B 1 288 ? -50.769 -46.162 -24.298 0.05 11.08 ? 287  HIS B O     1  
ATOM   5148   C  CB    A HIS B 1 288 ? -50.881 -48.133 -21.677 0.05 11.12 ? 287  HIS B CB    1  
ATOM   5149   C  CG    A HIS B 1 288 ? -50.188 -49.286 -21.025 0.05 11.09 ? 287  HIS B CG    1  
ATOM   5150   N  ND1   A HIS B 1 288 ? -50.828 -50.472 -20.739 0.05 11.24 ? 287  HIS B ND1   1  
ATOM   5151   C  CD2   A HIS B 1 288 ? -48.911 -49.435 -20.605 0.05 10.97 ? 287  HIS B CD2   1  
ATOM   5152   C  CE1   A HIS B 1 288 ? -49.974 -51.304 -20.170 0.05 11.21 ? 287  HIS B CE1   1  
ATOM   5153   N  NE2   A HIS B 1 288 ? -48.805 -50.698 -20.073 0.05 11.05 ? 287  HIS B NE2   1  
ATOM   5154   N  N     A ASP B 1 289 ? -52.829 -46.717 -23.568 0.05 11.34 ? 288  ASP B N     1  
ATOM   5155   C  CA    A ASP B 1 289 ? -53.410 -45.404 -23.849 0.05 11.48 ? 288  ASP B CA    1  
ATOM   5156   C  C     A ASP B 1 289 ? -53.390 -44.454 -22.633 0.05 11.57 ? 288  ASP B C     1  
ATOM   5157   O  O     A ASP B 1 289 ? -53.000 -43.292 -22.752 0.05 11.64 ? 288  ASP B O     1  
ATOM   5158   C  CB    A ASP B 1 289 ? -54.828 -45.525 -24.414 0.05 11.69 ? 288  ASP B CB    1  
ATOM   5159   C  CG    A ASP B 1 289 ? -55.644 -46.618 -23.752 0.05 11.78 ? 288  ASP B CG    1  
ATOM   5160   O  OD1   A ASP B 1 289 ? -55.232 -47.804 -23.774 0.05 11.66 ? 288  ASP B OD1   1  
ATOM   5161   O  OD2   A ASP B 1 289 ? -56.721 -46.275 -23.222 0.05 12.02 ? 288  ASP B OD2   1  
ATOM   5162   N  N     A TRP B 1 290 ? -53.826 -44.945 -21.478 0.05 11.59 ? 289  TRP B N     1  
ATOM   5163   C  CA    A TRP B 1 290 ? -53.783 -44.172 -20.236 0.05 11.68 ? 289  TRP B CA    1  
ATOM   5164   C  C     A TRP B 1 290 ? -53.205 -45.026 -19.103 0.05 11.59 ? 289  TRP B C     1  
ATOM   5165   O  O     A TRP B 1 290 ? -53.667 -46.143 -18.860 0.05 11.64 ? 289  TRP B O     1  
ATOM   5166   C  CB    A TRP B 1 290 ? -55.167 -43.629 -19.859 0.05 11.99 ? 289  TRP B CB    1  
ATOM   5167   C  CG    A TRP B 1 290 ? -55.187 -42.978 -18.504 0.05 12.12 ? 289  TRP B CG    1  
ATOM   5168   C  CD1   A TRP B 1 290 ? -54.892 -41.676 -18.212 0.05 12.22 ? 289  TRP B CD1   1  
ATOM   5169   C  CD2   A TRP B 1 290 ? -55.510 -43.606 -17.257 0.05 12.21 ? 289  TRP B CD2   1  
ATOM   5170   N  NE1   A TRP B 1 290 ? -55.012 -41.457 -16.857 0.05 12.35 ? 289  TRP B NE1   1  
ATOM   5171   C  CE2   A TRP B 1 290 ? -55.384 -42.627 -16.249 0.05 12.35 ? 289  TRP B CE2   1  
ATOM   5172   C  CE3   A TRP B 1 290 ? -55.887 -44.904 -16.896 0.05 12.22 ? 289  TRP B CE3   1  
ATOM   5173   C  CZ2   A TRP B 1 290 ? -55.629 -42.904 -14.906 0.05 12.50 ? 289  TRP B CZ2   1  
ATOM   5174   C  CZ3   A TRP B 1 290 ? -56.127 -45.178 -15.562 0.05 12.37 ? 289  TRP B CZ3   1  
ATOM   5175   C  CH2   A TRP B 1 290 ? -55.997 -44.183 -14.582 0.05 12.51 ? 289  TRP B CH2   1  
ATOM   5176   N  N     A VAL B 1 291 ? -52.196 -44.495 -18.412 0.05 11.47 ? 290  VAL B N     1  
ATOM   5177   C  CA    A VAL B 1 291 ? -51.362 -45.302 -17.513 0.05 11.38 ? 290  VAL B CA    1  
ATOM   5178   C  C     A VAL B 1 291 ? -51.265 -44.751 -16.076 0.05 11.48 ? 290  VAL B C     1  
ATOM   5179   O  O     A VAL B 1 291 ? -51.430 -43.553 -15.854 0.05 11.55 ? 290  VAL B O     1  
ATOM   5180   C  CB    A VAL B 1 291 ? -49.942 -45.500 -18.111 0.05 11.14 ? 290  VAL B CB    1  
ATOM   5181   C  CG1   A VAL B 1 291 ? -49.993 -45.409 -19.622 0.05 11.07 ? 290  VAL B CG1   1  
ATOM   5182   C  CG2   A VAL B 1 291 ? -48.948 -44.478 -17.544 0.05 11.05 ? 290  VAL B CG2   1  
ATOM   5183   N  N     A PRO B 1 292 ? -51.006 -45.637 -15.091 0.05 11.51 ? 291  PRO B N     1  
ATOM   5184   C  CA    A PRO B 1 292 ? -50.866 -45.199 -13.698 0.05 11.61 ? 291  PRO B CA    1  
ATOM   5185   C  C     A PRO B 1 292 ? -49.528 -44.499 -13.507 0.05 11.42 ? 291  PRO B C     1  
ATOM   5186   O  O     A PRO B 1 292 ? -48.575 -45.112 -13.028 0.05 11.35 ? 291  PRO B O     1  
ATOM   5187   C  CB    A PRO B 1 292 ? -50.872 -46.518 -12.921 0.05 11.72 ? 291  PRO B CB    1  
ATOM   5188   C  CG    A PRO B 1 292 ? -50.330 -47.520 -13.889 0.05 11.55 ? 291  PRO B CG    1  
ATOM   5189   C  CD    A PRO B 1 292 ? -50.879 -47.102 -15.220 0.05 11.49 ? 291  PRO B CD    1  
ATOM   5190   N  N     A GLN B 1 293 ? -49.450 -43.228 -13.884 0.05 11.36 ? 292  GLN B N     1  
ATOM   5191   C  CA    A GLN B 1 293 ? -48.145 -42.576 -14.009 0.05 11.17 ? 292  GLN B CA    1  
ATOM   5192   C  C     A GLN B 1 293 ? -47.374 -42.407 -12.698 0.05 11.19 ? 292  GLN B C     1  
ATOM   5193   O  O     A GLN B 1 293 ? -46.171 -42.631 -12.654 0.05 11.04 ? 292  GLN B O     1  
ATOM   5194   C  CB    A GLN B 1 293 ? -48.261 -41.234 -14.745 0.05 11.15 ? 292  GLN B CB    1  
ATOM   5195   C  CG    A GLN B 1 293 ? -46.927 -40.490 -14.873 0.05 11.00 ? 292  GLN B CG    1  
ATOM   5196   C  CD    A GLN B 1 293 ? -46.980 -39.363 -15.885 0.05 11.00 ? 292  GLN B CD    1  
ATOM   5197   O  OE1   A GLN B 1 293 ? -47.643 -39.472 -16.912 0.05 11.01 ? 292  GLN B OE1   1  
ATOM   5198   N  NE2   A GLN B 1 293 ? -46.294 -38.258 -15.586 0.05 11.01 ? 292  GLN B NE2   1  
ATOM   5199   N  N     A LEU B 1 294 ? -48.046 -41.999 -11.629 0.05 11.39 ? 293  LEU B N     1  
ATOM   5200   C  CA    A LEU B 1 294 ? -47.332 -41.862 -10.366 0.05 11.44 ? 293  LEU B CA    1  
ATOM   5201   C  C     A LEU B 1 294 ? -46.848 -43.234 -9.903  0.05 11.43 ? 293  LEU B C     1  
ATOM   5202   O  O     A LEU B 1 294 ? -45.710 -43.388 -9.445  0.05 11.36 ? 293  LEU B O     1  
ATOM   5203   C  CB    A LEU B 1 294 ? -48.220 -41.222 -9.299  0.05 11.70 ? 293  LEU B CB    1  
ATOM   5204   C  CG    A LEU B 1 294 ? -47.528 -41.037 -7.949  0.05 11.78 ? 293  LEU B CG    1  
ATOM   5205   C  CD1   A LEU B 1 294 ? -46.378 -40.060 -8.064  0.05 11.58 ? 293  LEU B CD1   1  
ATOM   5206   C  CD2   A LEU B 1 294 ? -48.525 -40.562 -6.917  0.05 12.08 ? 293  LEU B CD2   1  
ATOM   5207   N  N     A ALA B 1 295 ? -47.711 -44.232 -10.059 0.05 11.54 ? 294  ALA B N     1  
ATOM   5208   C  CA    A ALA B 1 295 ? -47.399 -45.601 -9.653  0.05 11.61 ? 294  ALA B CA    1  
ATOM   5209   C  C     A ALA B 1 295 ? -46.221 -46.173 -10.440 0.05 11.39 ? 294  ALA B C     1  
ATOM   5210   O  O     A ALA B 1 295 ? -45.368 -46.870 -9.881  0.05 11.42 ? 294  ALA B O     1  
ATOM   5211   C  CB    A ALA B 1 295 ? -48.639 -46.494 -9.790  0.05 11.80 ? 294  ALA B CB    1  
ATOM   5212   N  N     A ILE B 1 296 ? -46.176 -45.876 -11.738 0.05 11.22 ? 295  ILE B N     1  
ATOM   5213   C  CA    A ILE B 1 296 ? -45.058 -46.296 -12.576 0.05 11.04 ? 295  ILE B CA    1  
ATOM   5214   C  C     A ILE B 1 296 ? -43.795 -45.497 -12.265 0.05 10.93 ? 295  ILE B C     1  
ATOM   5215   O  O     A ILE B 1 296 ? -42.713 -46.061 -12.223 0.05 10.89 ? 295  ILE B O     1  
ATOM   5216   C  CB    A ILE B 1 296 ? -45.396 -46.209 -14.091 0.05 10.92 ? 295  ILE B CB    1  
ATOM   5217   C  CG1   A ILE B 1 296 ? -46.543 -47.172 -14.420 0.05 11.04 ? 295  ILE B CG1   1  
ATOM   5218   C  CG2   A ILE B 1 296 ? -44.161 -46.521 -14.950 0.05 10.77 ? 295  ILE B CG2   1  
ATOM   5219   C  CD1   A ILE B 1 296 ? -46.941 -47.201 -15.887 0.05 10.97 ? 295  ILE B CD1   1  
ATOM   5220   N  N     A LEU B 1 297 ? -43.934 -44.197 -12.014 0.05 10.91 ? 296  LEU B N     1  
ATOM   5221   C  CA    A LEU B 1 297 ? -42.756 -43.354 -11.766 0.05 10.81 ? 296  LEU B CA    1  
ATOM   5222   C  C     A LEU B 1 297 ? -42.027 -43.678 -10.472 0.05 10.89 ? 296  LEU B C     1  
ATOM   5223   O  O     A LEU B 1 297 ? -40.797 -43.585 -10.407 0.05 10.82 ? 296  LEU B O     1  
ATOM   5224   C  CB    A LEU B 1 297 ? -43.115 -41.862 -11.783 0.05 10.81 ? 296  LEU B CB    1  
ATOM   5225   C  CG    A LEU B 1 297 ? -43.262 -41.232 -13.166 0.05 10.71 ? 296  LEU B CG    1  
ATOM   5226   C  CD1   A LEU B 1 297 ? -43.734 -39.810 -13.001 0.05 10.78 ? 296  LEU B CD1   1  
ATOM   5227   C  CD2   A LEU B 1 297 ? -41.947 -41.274 -13.912 0.05 10.57 ? 296  LEU B CD2   1  
ATOM   5228   N  N     A ARG B 1 298 ? -42.775 -44.038 -9.431  0.05 11.07 ? 297  ARG B N     1  
ATOM   5229   C  CA    A ARG B 1 298 ? -42.133 -44.368 -8.171  0.05 11.19 ? 297  ARG B CA    1  
ATOM   5230   C  C     A ARG B 1 298 ? -41.155 -45.503 -8.424  0.05 11.18 ? 297  ARG B C     1  
ATOM   5231   O  O     A ARG B 1 298 ? -40.078 -45.558 -7.832  0.05 11.20 ? 297  ARG B O     1  
ATOM   5232   C  CB    A ARG B 1 298 ? -43.155 -44.684 -7.077  0.05 11.45 ? 297  ARG B CB    1  
ATOM   5233   C  CG    A ARG B 1 298 ? -43.730 -43.414 -6.456  0.05 11.53 ? 297  ARG B CG    1  
ATOM   5234   C  CD    A ARG B 1 298 ? -44.434 -43.654 -5.128  0.05 11.83 ? 297  ARG B CD    1  
ATOM   5235   N  NE    A ARG B 1 298 ? -45.869 -43.814 -5.285  0.05 11.94 ? 297  ARG B NE    1  
ATOM   5236   C  CZ    A ARG B 1 298 ? -46.783 -42.899 -4.977  0.05 12.18 ? 297  ARG B CZ    1  
ATOM   5237   N  NH1   A ARG B 1 298 ? -46.428 -41.725 -4.489  0.05 12.34 ? 297  ARG B NH1   1  
ATOM   5238   N  NH2   A ARG B 1 298 ? -48.067 -43.176 -5.163  0.05 12.29 ? 297  ARG B NH2   1  
ATOM   5239   N  N     A GLN B 1 299 ? -41.508 -46.375 -9.363  0.05 11.16 ? 298  GLN B N     1  
ATOM   5240   C  CA    A GLN B 1 299 ? -40.563 -47.388 -9.807  0.05 11.17 ? 298  GLN B CA    1  
ATOM   5241   C  C     A GLN B 1 299 ? -40.232 -47.318 -11.285 0.05 11.00 ? 298  GLN B C     1  
ATOM   5242   O  O     A GLN B 1 299 ? -40.833 -48.010 -12.106 0.05 11.02 ? 298  GLN B O     1  
ATOM   5243   C  CB    A GLN B 1 299 ? -41.015 -48.780 -9.427  0.05 11.40 ? 298  GLN B CB    1  
ATOM   5244   C  CG    A GLN B 1 299 ? -42.494 -48.915 -9.200  0.05 11.48 ? 298  GLN B CG    1  
ATOM   5245   C  CD    A GLN B 1 299 ? -42.795 -50.080 -8.312  0.05 11.73 ? 298  GLN B CD    1  
ATOM   5246   O  OE1   A GLN B 1 299 ? -43.884 -50.645 -8.358  0.05 11.82 ? 298  GLN B OE1   1  
ATOM   5247   N  NE2   A GLN B 1 299 ? -41.827 -50.459 -7.492  0.05 11.87 ? 298  GLN B NE2   1  
ATOM   5248   N  N     A ALA B 1 300 ? -39.263 -46.473 -11.605 0.05 10.86 ? 299  ALA B N     1  
ATOM   5249   C  CA    A ALA B 1 300 ? -38.684 -46.419 -12.933 0.05 10.74 ? 299  ALA B CA    1  
ATOM   5250   C  C     A ALA B 1 300 ? -37.243 -45.946 -12.799 0.05 10.70 ? 299  ALA B C     1  
ATOM   5251   O  O     A ALA B 1 300 ? -36.822 -45.519 -11.720 0.05 10.75 ? 299  ALA B O     1  
ATOM   5252   C  CB    A ALA B 1 300 ? -39.472 -45.479 -13.813 0.05 10.63 ? 299  ALA B CB    1  
ATOM   5253   N  N     A ASP B 1 301 ? -36.490 -46.030 -13.887 0.05 10.62 ? 300  ASP B N     1  
ATOM   5254   C  CA    A ASP B 1 301 ? -35.118 -45.550 -13.902 0.05 10.62 ? 300  ASP B CA    1  
ATOM   5255   C  C     A ASP B 1 301 ? -35.020 -44.302 -14.777 0.05 10.50 ? 300  ASP B C     1  
ATOM   5256   O  O     A ASP B 1 301 ? -34.057 -43.543 -14.681 0.05 10.50 ? 300  ASP B O     1  
ATOM   5257   C  CB    A ASP B 1 301 ? -34.166 -46.631 -14.426 0.05 10.72 ? 300  ASP B CB    1  
ATOM   5258   C  CG    A ASP B 1 301 ? -34.220 -47.917 -13.609 0.05 10.88 ? 300  ASP B CG    1  
ATOM   5259   O  OD1   A ASP B 1 301 ? -33.371 -48.097 -12.702 0.05 10.98 ? 300  ASP B OD1   1  
ATOM   5260   O  OD2   A ASP B 1 301 ? -35.115 -48.754 -13.871 0.05 10.93 ? 300  ASP B OD2   1  
ATOM   5261   N  N     A LEU B 1 302 ? -36.030 -44.087 -15.617 0.05 10.44 ? 301  LEU B N     1  
ATOM   5262   C  CA    A LEU B 1 302 ? -35.994 -42.997 -16.589 0.05 10.38 ? 301  LEU B CA    1  
ATOM   5263   C  C     A LEU B 1 302 ? -37.400 -42.561 -17.012 0.05 10.34 ? 301  LEU B C     1  
ATOM   5264   O  O     A LEU B 1 302 ? -38.308 -43.388 -17.170 0.05 10.34 ? 301  LEU B O     1  
ATOM   5265   C  CB    A LEU B 1 302 ? -35.185 -43.437 -17.812 0.05 10.40 ? 301  LEU B CB    1  
ATOM   5266   C  CG    A LEU B 1 302 ? -34.885 -42.401 -18.884 0.05 10.38 ? 301  LEU B CG    1  
ATOM   5267   C  CD1   A LEU B 1 302 ? -34.131 -41.215 -18.300 0.05 10.38 ? 301  LEU B CD1   1  
ATOM   5268   C  CD2   A LEU B 1 302 ? -34.067 -43.060 -19.958 0.05 10.46 ? 301  LEU B CD2   1  
ATOM   5269   N  N     A PHE B 1 303 ? -37.579 -41.257 -17.198 0.05 10.32 ? 302  PHE B N     1  
ATOM   5270   C  CA    A PHE B 1 303 ? -38.882 -40.702 -17.517 0.05 10.33 ? 302  PHE B CA    1  
ATOM   5271   C  C     A PHE B 1 303 ? -38.732 -39.759 -18.705 0.05 10.34 ? 302  PHE B C     1  
ATOM   5272   O  O     A PHE B 1 303 ? -38.212 -38.656 -18.556 0.05 10.37 ? 302  PHE B O     1  
ATOM   5273   C  CB    A PHE B 1 303 ? -39.413 -39.937 -16.305 0.05 10.37 ? 302  PHE B CB    1  
ATOM   5274   C  CG    A PHE B 1 303 ? -40.779 -39.330 -16.493 0.05 10.43 ? 302  PHE B CG    1  
ATOM   5275   C  CD1   A PHE B 1 303 ? -41.666 -39.823 -17.438 0.05 10.44 ? 302  PHE B CD1   1  
ATOM   5276   C  CD2   A PHE B 1 303 ? -41.181 -38.267 -15.702 0.05 10.50 ? 302  PHE B CD2   1  
ATOM   5277   C  CE1   A PHE B 1 303 ? -42.916 -39.262 -17.593 0.05 10.53 ? 302  PHE B CE1   1  
ATOM   5278   C  CE2   A PHE B 1 303 ? -42.433 -37.700 -15.847 0.05 10.60 ? 302  PHE B CE2   1  
ATOM   5279   C  CZ    A PHE B 1 303 ? -43.308 -38.209 -16.806 0.05 10.62 ? 302  PHE B CZ    1  
ATOM   5280   N  N     A VAL B 1 304 ? -39.174 -40.205 -19.878 0.05 10.35 ? 303  VAL B N     1  
ATOM   5281   C  CA    A VAL B 1 304 ? -39.208 -39.341 -21.054 0.05 10.40 ? 303  VAL B CA    1  
ATOM   5282   C  C     A VAL B 1 304 ? -40.516 -38.567 -20.979 0.05 10.46 ? 303  VAL B C     1  
ATOM   5283   O  O     A VAL B 1 304 ? -41.601 -39.117 -21.208 0.05 10.47 ? 303  VAL B O     1  
ATOM   5284   C  CB    A VAL B 1 304 ? -39.105 -40.158 -22.360 0.05 10.42 ? 303  VAL B CB    1  
ATOM   5285   C  CG1   A VAL B 1 304 ? -39.111 -39.241 -23.574 0.05 10.52 ? 303  VAL B CG1   1  
ATOM   5286   C  CG2   A VAL B 1 304 ? -37.852 -41.013 -22.343 0.05 10.41 ? 303  VAL B CG2   1  
ATOM   5287   N  N     A THR B 1 305 ? -40.408 -37.290 -20.622 0.05 10.53 ? 304  THR B N     1  
ATOM   5288   C  CA    A THR B 1 305 ? -41.562 -36.460 -20.309 0.05 10.63 ? 304  THR B CA    1  
ATOM   5289   C  C     A THR B 1 305 ? -41.636 -35.272 -21.247 0.05 10.76 ? 304  THR B C     1  
ATOM   5290   O  O     A THR B 1 305 ? -40.618 -34.773 -21.726 0.05 10.79 ? 304  THR B O     1  
ATOM   5291   C  CB    A THR B 1 305 ? -41.510 -35.939 -18.838 0.05 10.64 ? 304  THR B CB    1  
ATOM   5292   O  OG1   A THR B 1 305 ? -42.608 -35.051 -18.576 0.05 10.78 ? 304  THR B OG1   1  
ATOM   5293   C  CG2   A THR B 1 305 ? -40.196 -35.208 -18.556 0.05 10.64 ? 304  THR B CG2   1  
ATOM   5294   N  N     A HIS B 1 306 ? -42.845 -34.805 -21.515 0.05 10.90 ? 305  HIS B N     1  
ATOM   5295   C  CA    A HIS B 1 306 ? -42.976 -33.567 -22.262 0.05 11.08 ? 305  HIS B CA    1  
ATOM   5296   C  C     A HIS B 1 306 ? -42.714 -32.413 -21.313 0.05 11.16 ? 305  HIS B C     1  
ATOM   5297   O  O     A HIS B 1 306 ? -42.706 -31.266 -21.730 0.05 11.34 ? 305  HIS B O     1  
ATOM   5298   C  CB    A HIS B 1 306 ? -44.375 -33.428 -22.851 0.05 11.25 ? 305  HIS B CB    1  
ATOM   5299   C  CG    A HIS B 1 306 ? -45.431 -33.176 -21.823 0.05 11.33 ? 305  HIS B CG    1  
ATOM   5300   N  ND1   A HIS B 1 306 ? -45.545 -33.927 -20.669 0.05 11.20 ? 305  HIS B ND1   1  
ATOM   5301   C  CD2   A HIS B 1 306 ? -46.428 -32.264 -21.778 0.05 11.56 ? 305  HIS B CD2   1  
ATOM   5302   C  CE1   A HIS B 1 306 ? -46.563 -33.479 -19.957 0.05 11.35 ? 305  HIS B CE1   1  
ATOM   5303   N  NE2   A HIS B 1 306 ? -47.116 -32.470 -20.607 0.05 11.57 ? 305  HIS B NE2   1  
ATOM   5304   N  N     A ALA B 1 307 ? -42.524 -32.734 -20.033 0.05 11.05 ? 306  ALA B N     1  
ATOM   5305   C  CA    A ALA B 1 307 ? -42.250 -31.764 -18.974 0.05 11.13 ? 306  ALA B CA    1  
ATOM   5306   C  C     A ALA B 1 307 ? -43.417 -30.844 -18.639 0.05 11.35 ? 306  ALA B C     1  
ATOM   5307   O  O     A ALA B 1 307 ? -43.233 -29.655 -18.403 0.05 11.50 ? 306  ALA B O     1  
ATOM   5308   C  CB    A ALA B 1 307 ? -40.968 -30.944 -19.263 0.05 11.15 ? 306  ALA B CB    1  
ATOM   5309   N  N     A GLY B 1 308 ? -44.621 -31.400 -18.583 0.05 11.39 ? 307  GLY B N     1  
ATOM   5310   C  CA    A GLY B 1 308 ? -45.748 -30.657 -18.059 0.05 11.63 ? 307  GLY B CA    1  
ATOM   5311   C  C     A GLY B 1 308 ? -45.524 -30.270 -16.607 0.05 11.65 ? 307  GLY B C     1  
ATOM   5312   O  O     A GLY B 1 308 ? -44.607 -30.772 -15.951 0.05 11.46 ? 307  GLY B O     1  
ATOM   5313   N  N     A ALA B 1 309 ? -46.355 -29.360 -16.106 0.05 11.91 ? 308  ALA B N     1  
ATOM   5314   C  CA    A ALA B 1 309 ? -46.264 -28.916 -14.719 0.05 11.97 ? 308  ALA B CA    1  
ATOM   5315   C  C     A ALA B 1 309 ? -46.382 -30.096 -13.750 0.05 11.83 ? 308  ALA B C     1  
ATOM   5316   O  O     A ALA B 1 309 ? -45.587 -30.229 -12.809 0.05 11.72 ? 308  ALA B O     1  
ATOM   5317   C  CB    A ALA B 1 309 ? -47.338 -27.887 -14.428 0.05 12.32 ? 308  ALA B CB    1  
ATOM   5318   N  N     A GLY B 1 310 ? -47.374 -30.950 -13.997 0.05 11.86 ? 309  GLY B N     1  
ATOM   5319   C  CA    A GLY B 1 310 ? -47.572 -32.152 -13.199 0.05 11.78 ? 309  GLY B CA    1  
ATOM   5320   C  C     A GLY B 1 310 ? -46.458 -33.174 -13.336 0.05 11.49 ? 309  GLY B C     1  
ATOM   5321   O  O     A GLY B 1 310 ? -45.928 -33.666 -12.338 0.05 11.42 ? 309  GLY B O     1  
ATOM   5322   N  N     A GLY B 1 311 ? -46.106 -33.503 -14.575 0.05 11.35 ? 310  GLY B N     1  
ATOM   5323   C  CA    A GLY B 1 311 ? -45.056 -34.470 -14.840 0.05 11.11 ? 310  GLY B CA    1  
ATOM   5324   C  C     A GLY B 1 311 ? -43.686 -34.061 -14.328 0.05 11.02 ? 310  GLY B C     1  
ATOM   5325   O  O     A GLY B 1 311 ? -42.929 -34.899 -13.842 0.05 10.89 ? 310  GLY B O     1  
ATOM   5326   N  N     A SER B 1 312 ? -43.360 -32.778 -14.446 0.05 11.11 ? 311  SER B N     1  
ATOM   5327   C  CA    A SER B 1 312 ? -42.075 -32.281 -13.964 0.05 11.06 ? 311  SER B CA    1  
ATOM   5328   C  C     A SER B 1 312 ? -41.898 -32.559 -12.476 0.05 11.06 ? 311  SER B C     1  
ATOM   5329   O  O     A SER B 1 312 ? -40.852 -33.047 -12.046 0.05 10.94 ? 311  SER B O     1  
ATOM   5330   C  CB    A SER B 1 312 ? -41.941 -30.776 -14.216 0.05 11.21 ? 311  SER B CB    1  
ATOM   5331   O  OG    A SER B 1 312 ? -41.938 -30.489 -15.604 0.05 11.23 ? 311  SER B OG    1  
ATOM   5332   N  N     A GLN B 1 313 ? -42.920 -32.253 -11.681 0.05 11.24 ? 312  GLN B N     1  
ATOM   5333   C  CA    A GLN B 1 313 ? -42.765 -32.438 -10.246 0.05 11.29 ? 312  GLN B CA    1  
ATOM   5334   C  C     A GLN B 1 313 ? -42.848 -33.920 -9.863  0.05 11.21 ? 312  GLN B C     1  
ATOM   5335   O  O     A GLN B 1 313 ? -42.188 -34.352 -8.922  0.05 11.19 ? 312  GLN B O     1  
ATOM   5336   C  CB    A GLN B 1 313 ? -43.721 -31.546 -9.432  0.05 11.55 ? 312  GLN B CB    1  
ATOM   5337   C  CG    A GLN B 1 313 ? -45.165 -32.011 -9.341  0.05 11.72 ? 312  GLN B CG    1  
ATOM   5338   C  CD    A GLN B 1 313 ? -45.390 -33.010 -8.217  0.05 11.77 ? 312  GLN B CD    1  
ATOM   5339   O  OE1   A GLN B 1 313 ? -46.432 -33.666 -8.141  0.05 11.88 ? 312  GLN B OE1   1  
ATOM   5340   N  NE2   A GLN B 1 313 ? -44.412 -33.132 -7.339  0.05 11.71 ? 312  GLN B NE2   1  
ATOM   5341   N  N     A GLU B 1 314 ? -43.635 -34.696 -10.606 0.05 11.18 ? 313  GLU B N     1  
ATOM   5342   C  CA    A GLU B 1 314 ? -43.726 -36.136 -10.360 0.05 11.12 ? 313  GLU B CA    1  
ATOM   5343   C  C     A GLU B 1 314 ? -42.386 -36.842 -10.583 0.05 10.93 ? 313  GLU B C     1  
ATOM   5344   O  O     A GLU B 1 314 ? -42.010 -37.742 -9.823  0.05 10.93 ? 313  GLU B O     1  
ATOM   5345   C  CB    A GLU B 1 314 ? -44.829 -36.771 -11.222 0.05 11.14 ? 313  GLU B CB    1  
ATOM   5346   C  CG    A GLU B 1 314 ? -46.221 -36.402 -10.757 0.05 11.38 ? 313  GLU B CG    1  
ATOM   5347   C  CD    A GLU B 1 314 ? -47.305 -36.633 -11.804 0.05 11.44 ? 313  GLU B CD    1  
ATOM   5348   O  OE1   A GLU B 1 314 ? -47.030 -37.262 -12.844 0.05 11.28 ? 313  GLU B OE1   1  
ATOM   5349   O  OE2   A GLU B 1 314 ? -48.443 -36.169 -11.577 0.05 11.67 ? 313  GLU B OE2   1  
ATOM   5350   N  N     A GLY B 1 315 ? -41.667 -36.432 -11.625 0.05 10.81 ? 314  GLY B N     1  
ATOM   5351   C  CA    A GLY B 1 315 ? -40.356 -36.991 -11.893 0.05 10.67 ? 314  GLY B CA    1  
ATOM   5352   C  C     A GLY B 1 315 ? -39.376 -36.653 -10.783 0.05 10.69 ? 314  GLY B C     1  
ATOM   5353   O  O     A GLY B 1 315 ? -38.624 -37.508 -10.319 0.05 10.65 ? 314  GLY B O     1  
ATOM   5354   N  N     A LEU B 1 316 ? -39.384 -35.394 -10.358 0.05 10.77 ? 315  LEU B N     1  
ATOM   5355   C  CA    A LEU B 1 316 ? -38.526 -34.967 -9.256  0.05 10.80 ? 315  LEU B CA    1  
ATOM   5356   C  C     A LEU B 1 316 ? -38.876 -35.690 -7.957  0.05 10.90 ? 315  LEU B C     1  
ATOM   5357   O  O     A LEU B 1 316 ? -37.996 -36.127 -7.216  0.05 10.90 ? 315  LEU B O     1  
ATOM   5358   C  CB    A LEU B 1 316 ? -38.666 -33.458 -9.047  0.05 10.91 ? 315  LEU B CB    1  
ATOM   5359   C  CG    A LEU B 1 316 ? -37.583 -32.489 -9.539  0.05 10.87 ? 315  LEU B CG    1  
ATOM   5360   C  CD1   A LEU B 1 316 ? -36.503 -33.102 -10.415 0.05 10.74 ? 315  LEU B CD1   1  
ATOM   5361   C  CD2   A LEU B 1 316 ? -38.217 -31.254 -10.188 0.05 10.97 ? 315  LEU B CD2   1  
ATOM   5362   N  N     A ALA B 1 317 ? -40.168 -35.807 -7.683  0.05 11.02 ? 316  ALA B N     1  
ATOM   5363   C  CA    A ALA B 1 317 ? -40.629 -36.324 -6.398  0.05 11.17 ? 316  ALA B CA    1  
ATOM   5364   C  C     A ALA B 1 317 ? -40.404 -37.823 -6.274  0.05 11.14 ? 316  ALA B C     1  
ATOM   5365   O  O     A ALA B 1 317 ? -40.496 -38.384 -5.182  0.05 11.28 ? 316  ALA B O     1  
ATOM   5366   C  CB    A ALA B 1 317 ? -42.096 -35.992 -6.186  0.05 11.35 ? 316  ALA B CB    1  
ATOM   5367   N  N     A THR B 1 318 ? -40.114 -38.461 -7.400  0.05 10.99 ? 317  THR B N     1  
ATOM   5368   C  CA    A THR B 1 318 ? -39.807 -39.885 -7.426  0.05 10.98 ? 317  THR B CA    1  
ATOM   5369   C  C     A THR B 1 318 ? -38.328 -40.122 -7.753  0.05 10.86 ? 317  THR B C     1  
ATOM   5370   O  O     A THR B 1 318 ? -37.906 -41.255 -7.986  0.05 10.85 ? 317  THR B O     1  
ATOM   5371   C  CB    A THR B 1 318 ? -40.711 -40.630 -8.442  0.05 10.94 ? 317  THR B CB    1  
ATOM   5372   O  OG1   A THR B 1 318 ? -40.559 -40.042 -9.742  0.05 10.79 ? 317  THR B OG1   1  
ATOM   5373   C  CG2   A THR B 1 318 ? -42.164 -40.540 -8.028  0.05 11.10 ? 317  THR B CG2   1  
ATOM   5374   N  N     A ALA B 1 319 ? -37.543 -39.046 -7.752  0.05 10.81 ? 318  ALA B N     1  
ATOM   5375   C  CA    A ALA B 1 319 ? -36.105 -39.102 -8.029  0.05 10.74 ? 318  ALA B CA    1  
ATOM   5376   C  C     A ALA B 1 319 ? -35.798 -39.799 -9.350  0.05 10.64 ? 318  ALA B C     1  
ATOM   5377   O  O     A ALA B 1 319 ? -34.896 -40.630 -9.432  0.05 10.65 ? 318  ALA B O     1  
ATOM   5378   C  CB    A ALA B 1 319 ? -35.349 -39.765 -6.875  0.05 10.86 ? 318  ALA B CB    1  
ATOM   5379   N  N     A THR B 1 320 ? -36.568 -39.458 -10.378 0.05 10.57 ? 319  THR B N     1  
ATOM   5380   C  CA    A THR B 1 320 ? -36.418 -40.108 -11.671 0.05 10.49 ? 319  THR B CA    1  
ATOM   5381   C  C     A THR B 1 320 ? -35.785 -39.167 -12.688 0.05 10.43 ? 319  THR B C     1  
ATOM   5382   O  O     A THR B 1 320 ? -36.332 -38.102 -12.956 0.05 10.43 ? 319  THR B O     1  
ATOM   5383   C  CB    A THR B 1 320 ? -37.777 -40.559 -12.230 0.05 10.49 ? 319  THR B CB    1  
ATOM   5384   O  OG1   A THR B 1 320 ? -38.499 -41.296 -11.229 0.05 10.59 ? 319  THR B OG1   1  
ATOM   5385   C  CG2   A THR B 1 320 ? -37.567 -41.438 -13.445 0.05 10.43 ? 319  THR B CG2   1  
ATOM   5386   N  N     A PRO B 1 321 ? -34.635 -39.560 -13.255 0.05 10.42 ? 320  PRO B N     1  
ATOM   5387   C  CA    A PRO B 1 321 ? -33.984 -38.733 -14.277 0.05 10.41 ? 320  PRO B CA    1  
ATOM   5388   C  C     A PRO B 1 321 ? -34.934 -38.525 -15.444 0.05 10.37 ? 320  PRO B C     1  
ATOM   5389   O  O     A PRO B 1 321 ? -35.749 -39.404 -15.724 0.05 10.35 ? 320  PRO B O     1  
ATOM   5390   C  CB    A PRO B 1 321 ? -32.796 -39.587 -14.721 0.05 10.44 ? 320  PRO B CB    1  
ATOM   5391   C  CG    A PRO B 1 321 ? -32.583 -40.578 -13.622 0.05 10.49 ? 320  PRO B CG    1  
ATOM   5392   C  CD    A PRO B 1 321 ? -33.925 -40.828 -13.024 0.05 10.47 ? 320  PRO B CD    1  
ATOM   5393   N  N     A MET B 1 322 ? -34.837 -37.383 -16.116 0.05 10.40 ? 321  MET B N     1  
ATOM   5394   C  CA    A MET B 1 322 ? -35.799 -37.069 -17.162 0.05 10.41 ? 321  MET B CA    1  
ATOM   5395   C  C     A MET B 1 322 ? -35.155 -36.713 -18.491 0.05 10.46 ? 321  MET B C     1  
ATOM   5396   O  O     A MET B 1 322 ? -34.101 -36.090 -18.539 0.05 10.52 ? 321  MET B O     1  
ATOM   5397   C  CB    A MET B 1 322 ? -36.743 -35.959 -16.700 0.05 10.46 ? 321  MET B CB    1  
ATOM   5398   C  CG    A MET B 1 322 ? -37.817 -36.471 -15.751 0.05 10.45 ? 321  MET B CG    1  
ATOM   5399   S  SD    A MET B 1 322 ? -38.666 -35.192 -14.823 0.05 10.56 ? 321  MET B SD    1  
ATOM   5400   C  CE    A MET B 1 322 ? -37.479 -34.896 -13.518 0.05 10.56 ? 321  MET B CE    1  
ATOM   5401   N  N     A ILE B 1 323 ? -35.780 -37.163 -19.572 0.05 10.46 ? 322  ILE B N     1  
ATOM   5402   C  CA    A ILE B 1 323 ? -35.486 -36.621 -20.887 0.05 10.56 ? 322  ILE B CA    1  
ATOM   5403   C  C     A ILE B 1 323 ? -36.687 -35.760 -21.179 0.05 10.61 ? 322  ILE B C     1  
ATOM   5404   O  O     A ILE B 1 323 ? -37.797 -36.262 -21.339 0.05 10.58 ? 322  ILE B O     1  
ATOM   5405   C  CB    A ILE B 1 323 ? -35.323 -37.725 -21.953 0.05 10.56 ? 322  ILE B CB    1  
ATOM   5406   C  CG1   A ILE B 1 323 ? -34.260 -38.737 -21.503 0.05 10.54 ? 322  ILE B CG1   1  
ATOM   5407   C  CG2   A ILE B 1 323 ? -34.993 -37.109 -23.333 0.05 10.70 ? 322  ILE B CG2   1  
ATOM   5408   C  CD1   A ILE B 1 323 ? -33.947 -39.830 -22.519 0.05 10.59 ? 322  ILE B CD1   1  
ATOM   5409   N  N     A ALA B 1 324 ? -36.486 -34.447 -21.187 0.05 10.73 ? 323  ALA B N     1  
ATOM   5410   C  CA    A ALA B 1 324 ? -37.596 -33.538 -21.397 0.05 10.83 ? 323  ALA B CA    1  
ATOM   5411   C  C     A ALA B 1 324 ? -37.719 -33.228 -22.880 0.05 10.97 ? 323  ALA B C     1  
ATOM   5412   O  O     A ALA B 1 324 ? -36.805 -32.678 -23.489 0.05 11.10 ? 323  ALA B O     1  
ATOM   5413   C  CB    A ALA B 1 324 ? -37.406 -32.259 -20.590 0.05 10.92 ? 323  ALA B CB    1  
ATOM   5414   N  N     A VAL B 1 325 ? -38.860 -33.599 -23.447 0.05 10.98 ? 324  VAL B N     1  
ATOM   5415   C  CA    A VAL B 1 325 ? -39.138 -33.439 -24.867 0.05 11.13 ? 324  VAL B CA    1  
ATOM   5416   C  C     A VAL B 1 325 ? -40.352 -32.525 -24.992 0.05 11.28 ? 324  VAL B C     1  
ATOM   5417   O  O     A VAL B 1 325 ? -41.444 -32.984 -25.321 0.05 11.29 ? 324  VAL B O     1  
ATOM   5418   C  CB    A VAL B 1 325 ? -39.457 -34.810 -25.497 0.05 11.04 ? 324  VAL B CB    1  
ATOM   5419   C  CG1   A VAL B 1 325 ? -39.312 -34.769 -27.021 0.05 11.21 ? 324  VAL B CG1   1  
ATOM   5420   C  CG2   A VAL B 1 325 ? -38.546 -35.875 -24.902 0.05 10.89 ? 324  VAL B CG2   1  
ATOM   5421   N  N     A PRO B 1 326 ? -40.167 -31.226 -24.712 0.05 11.44 ? 325  PRO B N     1  
ATOM   5422   C  CA    A PRO B 1 326 ? -41.288 -30.282 -24.671 0.05 11.63 ? 325  PRO B CA    1  
ATOM   5423   C  C     A PRO B 1 326 ? -42.009 -30.187 -26.008 0.05 11.85 ? 325  PRO B C     1  
ATOM   5424   O  O     A PRO B 1 326 ? -41.384 -30.248 -27.071 0.05 11.93 ? 325  PRO B O     1  
ATOM   5425   C  CB    A PRO B 1 326 ? -40.614 -28.952 -24.323 0.05 11.77 ? 325  PRO B CB    1  
ATOM   5426   C  CG    A PRO B 1 326 ? -39.213 -29.128 -24.733 0.05 11.74 ? 325  PRO B CG    1  
ATOM   5427   C  CD    A PRO B 1 326 ? -38.881 -30.550 -24.470 0.05 11.49 ? 325  PRO B CD    1  
ATOM   5428   N  N     A GLN B 1 327 ? -43.328 -30.051 -25.940 0.05 11.97 ? 326  GLN B N     1  
ATOM   5429   C  CA    A GLN B 1 327 ? -44.168 -30.071 -27.123 0.05 12.18 ? 326  GLN B CA    1  
ATOM   5430   C  C     A GLN B 1 327 ? -44.733 -28.697 -27.363 0.05 12.54 ? 326  GLN B C     1  
ATOM   5431   O  O     A GLN B 1 327 ? -44.617 -28.128 -28.456 0.05 12.79 ? 326  GLN B O     1  
ATOM   5432   C  CB    A GLN B 1 327 ? -45.339 -31.013 -26.889 0.05 12.07 ? 326  GLN B CB    1  
ATOM   5433   C  CG    A GLN B 1 327 ? -44.910 -32.427 -26.644 0.05 11.79 ? 326  GLN B CG    1  
ATOM   5434   C  CD    A GLN B 1 327 ? -44.201 -32.985 -27.852 0.05 11.82 ? 326  GLN B CD    1  
ATOM   5435   O  OE1   A GLN B 1 327 ? -44.807 -33.152 -28.912 0.05 12.02 ? 326  GLN B OE1   1  
ATOM   5436   N  NE2   A GLN B 1 327 ? -42.906 -33.240 -27.717 0.05 11.66 ? 326  GLN B NE2   1  
ATOM   5437   N  N     A ALA B 1 328 ? -45.370 -28.178 -26.325 0.05 12.60 ? 327  ALA B N     1  
ATOM   5438   C  CA    A ALA B 1 328 ? -46.125 -26.955 -26.449 0.05 12.98 ? 327  ALA B CA    1  
ATOM   5439   C  C     A ALA B 1 328 ? -45.496 -25.812 -25.680 0.05 13.14 ? 327  ALA B C     1  
ATOM   5440   O  O     A ALA B 1 328 ? -44.477 -25.959 -25.002 0.05 12.95 ? 327  ALA B O     1  
ATOM   5441   C  CB    A ALA B 1 328 ? -47.566 -27.164 -26.017 0.05 13.04 ? 327  ALA B CB    1  
ATOM   5442   N  N     A VAL B 1 329 ? -46.161 -24.677 -25.785 0.05 13.52 ? 328  VAL B N     1  
ATOM   5443   C  CA    A VAL B 1 329 ? -45.618 -23.373 -25.449 0.05 13.79 ? 328  VAL B CA    1  
ATOM   5444   C  C     A VAL B 1 329 ? -45.088 -23.208 -24.018 0.05 13.62 ? 328  VAL B C     1  
ATOM   5445   O  O     A VAL B 1 329 ? -44.187 -22.415 -23.776 0.05 13.83 ? 328  VAL B O     1  
ATOM   5446   C  CB    A VAL B 1 329 ? -46.653 -22.279 -25.832 0.05 14.25 ? 328  VAL B CB    1  
ATOM   5447   C  CG1   A VAL B 1 329 ? -46.407 -21.802 -27.253 0.05 14.62 ? 328  VAL B CG1   1  
ATOM   5448   C  CG2   A VAL B 1 329 ? -48.072 -22.849 -25.739 0.05 14.24 ? 328  VAL B CG2   1  
ATOM   5449   N  N     A ASP B 1 330 ? -45.611 -23.987 -23.084 0.05 13.28 ? 329  ASP B N     1  
ATOM   5450   C  CA    A ASP B 1 330 ? -45.295 -23.785 -21.682 0.05 13.15 ? 329  ASP B CA    1  
ATOM   5451   C  C     A ASP B 1 330 ? -44.283 -24.833 -21.153 0.05 12.73 ? 329  ASP B C     1  
ATOM   5452   O  O     A ASP B 1 330 ? -43.691 -24.687 -20.083 0.05 12.61 ? 329  ASP B O     1  
ATOM   5453   C  CB    A ASP B 1 330 ? -46.600 -23.770 -20.892 0.05 13.36 ? 329  ASP B CB    1  
ATOM   5454   C  CG    A ASP B 1 330 ? -47.821 -23.593 -21.799 0.05 13.58 ? 329  ASP B CG    1  
ATOM   5455   O  OD1   A ASP B 1 330 ? -48.654 -22.690 -21.556 0.05 13.87 ? 329  ASP B OD1   1  
ATOM   5456   O  OD2   A ASP B 1 330 ? -47.942 -24.367 -22.766 0.05 13.48 ? 329  ASP B OD2   1  
ATOM   5457   N  N     A GLN B 1 331 ? -44.043 -25.862 -21.952 0.05 12.54 ? 330  GLN B N     1  
ATOM   5458   C  CA    A GLN B 1 331 ? -43.173 -26.945 -21.524 0.05 12.18 ? 330  GLN B CA    1  
ATOM   5459   C  C     A GLN B 1 331 ? -41.687 -26.710 -21.764 0.05 12.09 ? 330  GLN B C     1  
ATOM   5460   O  O     A GLN B 1 331 ? -40.839 -27.392 -21.184 0.05 11.86 ? 330  GLN B O     1  
ATOM   5461   C  CB    A GLN B 1 331 ? -43.602 -28.243 -22.176 0.05 12.05 ? 330  GLN B CB    1  
ATOM   5462   C  CG    A GLN B 1 331 ? -44.393 -29.049 -21.213 0.05 11.84 ? 330  GLN B CG    1  
ATOM   5463   C  CD    A GLN B 1 331 ? -45.802 -29.202 -21.613 0.05 11.96 ? 330  GLN B CD    1  
ATOM   5464   O  OE1   A GLN B 1 331 ? -46.639 -29.587 -20.795 0.05 11.94 ? 330  GLN B OE1   1  
ATOM   5465   N  NE2   A GLN B 1 331 ? -46.099 -28.916 -22.882 0.05 12.13 ? 330  GLN B NE2   1  
ATOM   5466   N  N     A PHE B 1 332 ? -41.371 -25.744 -22.618 0.05 12.31 ? 331  PHE B N     1  
ATOM   5467   C  CA    A PHE B 1 332 ? -39.981 -25.454 -22.897 0.05 12.30 ? 331  PHE B CA    1  
ATOM   5468   C  C     A PHE B 1 332 ? -39.352 -24.902 -21.623 0.05 12.27 ? 331  PHE B C     1  
ATOM   5469   O  O     A PHE B 1 332 ? -38.301 -25.371 -21.195 0.05 12.11 ? 331  PHE B O     1  
ATOM   5470   C  CB    A PHE B 1 332 ? -39.859 -24.474 -24.066 0.05 12.63 ? 331  PHE B CB    1  
ATOM   5471   C  CG    A PHE B 1 332 ? -40.752 -24.811 -25.226 0.05 12.72 ? 331  PHE B CG    1  
ATOM   5472   C  CD1   A PHE B 1 332 ? -40.466 -25.883 -26.054 0.05 12.55 ? 331  PHE B CD1   1  
ATOM   5473   C  CD2   A PHE B 1 332 ? -41.875 -24.053 -25.491 0.05 12.99 ? 331  PHE B CD2   1  
ATOM   5474   C  CE1   A PHE B 1 332 ? -41.300 -26.197 -27.128 0.05 12.64 ? 331  PHE B CE1   1  
ATOM   5475   C  CE2   A PHE B 1 332 ? -42.692 -24.351 -26.559 0.05 13.09 ? 331  PHE B CE2   1  
ATOM   5476   C  CZ    A PHE B 1 332 ? -42.417 -25.430 -27.371 0.05 12.90 ? 331  PHE B CZ    1  
ATOM   5477   N  N     A GLY B 1 333 ? -40.028 -23.945 -20.997 0.05 12.45 ? 332  GLY B N     1  
ATOM   5478   C  CA    A GLY B 1 333 ? -39.556 -23.361 -19.752 0.05 12.46 ? 332  GLY B CA    1  
ATOM   5479   C  C     A GLY B 1 333 ? -39.300 -24.401 -18.679 0.05 12.14 ? 332  GLY B C     1  
ATOM   5480   O  O     A GLY B 1 333 ? -38.235 -24.436 -18.060 0.05 12.03 ? 332  GLY B O     1  
ATOM   5481   N  N     A ASN B 1 334 ? -40.287 -25.260 -18.465 0.05 12.03 ? 333  ASN B N     1  
ATOM   5482   C  CA    A ASN B 1 334 ? -40.158 -26.319 -17.483 0.05 11.78 ? 333  ASN B CA    1  
ATOM   5483   C  C     A ASN B 1 334 ? -38.986 -27.246 -17.799 0.05 11.54 ? 333  ASN B C     1  
ATOM   5484   O  O     A ASN B 1 334 ? -38.247 -27.649 -16.904 0.05 11.40 ? 333  ASN B O     1  
ATOM   5485   C  CB    A ASN B 1 334 ? -41.477 -27.094 -17.372 0.05 11.75 ? 333  ASN B CB    1  
ATOM   5486   C  CG    A ASN B 1 334 ? -42.665 -26.182 -17.089 0.05 12.03 ? 333  ASN B CG    1  
ATOM   5487   O  OD1   A ASN B 1 334 ? -42.493 -25.013 -16.733 0.05 12.20 ? 333  ASN B OD1   1  
ATOM   5488   N  ND2   A ASN B 1 334 ? -43.877 -26.713 -17.242 0.05 12.09 ? 333  ASN B ND2   1  
ATOM   5489   N  N     A ALA B 1 335 ? -38.803 -27.558 -19.080 0.05 11.54 ? 334  ALA B N     1  
ATOM   5490   C  CA    A ALA B 1 335 ? -37.682 -28.391 -19.512 0.05 11.38 ? 334  ALA B CA    1  
ATOM   5491   C  C     A ALA B 1 335 ? -36.345 -27.734 -19.160 0.05 11.41 ? 334  ALA B C     1  
ATOM   5492   O  O     A ALA B 1 335 ? -35.408 -28.406 -18.749 0.05 11.27 ? 334  ALA B O     1  
ATOM   5493   C  CB    A ALA B 1 335 ? -37.761 -28.652 -21.008 0.05 11.44 ? 334  ALA B CB    1  
ATOM   5494   N  N     A ASP B 1 336 ? -36.260 -26.417 -19.327 0.05 11.64 ? 335  ASP B N     1  
ATOM   5495   C  CA    A ASP B 1 336 ? -35.037 -25.711 -18.961 0.05 11.71 ? 335  ASP B CA    1  
ATOM   5496   C  C     A ASP B 1 336 ? -34.763 -25.745 -17.449 0.05 11.61 ? 335  ASP B C     1  
ATOM   5497   O  O     A ASP B 1 336 ? -33.621 -25.943 -17.037 0.05 11.57 ? 335  ASP B O     1  
ATOM   5498   C  CB    A ASP B 1 336 ? -35.037 -24.280 -19.518 0.05 12.01 ? 335  ASP B CB    1  
ATOM   5499   C  CG    A ASP B 1 336 ? -34.912 -24.263 -21.034 0.05 12.13 ? 335  ASP B CG    1  
ATOM   5500   O  OD1   A ASP B 1 336 ? -35.881 -24.665 -21.707 0.05 12.32 ? 335  ASP B OD1   1  
ATOM   5501   O  OD2   A ASP B 1 336 ? -33.840 -23.886 -21.555 0.05 12.05 ? 335  ASP B OD2   1  
ATOM   5502   N  N     A MET B 1 337 ? -35.796 -25.572 -16.627 0.05 11.61 ? 336  MET B N     1  
ATOM   5503   C  CA    A MET B 1 337 ? -35.617 -25.713 -15.180 0.05 11.53 ? 336  MET B CA    1  
ATOM   5504   C  C     A MET B 1 337 ? -35.047 -27.095 -14.839 0.05 11.28 ? 336  MET B C     1  
ATOM   5505   O  O     A MET B 1 337 ? -34.087 -27.212 -14.073 0.05 11.23 ? 336  MET B O     1  
ATOM   5506   C  CB    A MET B 1 337 ? -36.927 -25.466 -14.412 0.05 11.60 ? 336  MET B CB    1  
ATOM   5507   C  CG    A MET B 1 337 ? -37.333 -24.009 -14.307 0.05 11.89 ? 336  MET B CG    1  
ATOM   5508   S  SD    A MET B 1 337 ? -36.014 -22.964 -13.623 0.05 12.07 ? 336  MET B SD    1  
ATOM   5509   C  CE    A MET B 1 337 ? -35.960 -23.497 -11.917 0.05 11.86 ? 336  MET B CE    1  
ATOM   5510   N  N     A LEU B 1 338 ? -35.614 -28.135 -15.444 0.05 11.16 ? 337  LEU B N     1  
ATOM   5511   C  CA    A LEU B 1 338 ? -35.158 -29.498 -15.174 0.05 10.97 ? 337  LEU B CA    1  
ATOM   5512   C  C     A LEU B 1 338 ? -33.720 -29.726 -15.622 0.05 10.95 ? 337  LEU B C     1  
ATOM   5513   O  O     A LEU B 1 338 ? -32.925 -30.319 -14.901 0.05 10.87 ? 337  LEU B O     1  
ATOM   5514   C  CB    A LEU B 1 338 ? -36.067 -30.523 -15.851 0.05 10.88 ? 337  LEU B CB    1  
ATOM   5515   C  CG    A LEU B 1 338 ? -37.480 -30.625 -15.284 0.05 10.91 ? 337  LEU B CG    1  
ATOM   5516   C  CD1   A LEU B 1 338 ? -38.305 -31.553 -16.163 0.05 10.86 ? 337  LEU B CD1   1  
ATOM   5517   C  CD2   A LEU B 1 338 ? -37.465 -31.114 -13.841 0.05 10.86 ? 337  LEU B CD2   1  
ATOM   5518   N  N     A GLN B 1 339 ? -33.387 -29.258 -16.818 0.05 11.05 ? 338  GLN B N     1  
ATOM   5519   C  CA    A GLN B 1 339 ? -32.031 -29.453 -17.305 0.05 11.08 ? 338  GLN B CA    1  
ATOM   5520   C  C     A GLN B 1 339 ? -31.057 -28.634 -16.473 0.05 11.16 ? 338  GLN B C     1  
ATOM   5521   O  O     A GLN B 1 339 ? -29.971 -29.101 -16.164 0.05 11.13 ? 338  GLN B O     1  
ATOM   5522   C  CB    A GLN B 1 339 ? -31.906 -29.083 -18.781 0.05 11.22 ? 338  GLN B CB    1  
ATOM   5523   C  CG    A GLN B 1 339 ? -30.501 -29.331 -19.327 0.05 11.29 ? 338  GLN B CG    1  
ATOM   5524   C  CD    A GLN B 1 339 ? -30.443 -29.262 -20.839 0.05 11.45 ? 338  GLN B CD    1  
ATOM   5525   O  OE1   A GLN B 1 339 ? -30.585 -30.275 -21.518 0.05 11.38 ? 338  GLN B OE1   1  
ATOM   5526   N  NE2   A GLN B 1 339 ? -30.239 -28.062 -21.374 0.05 11.68 ? 338  GLN B NE2   1  
ATOM   5527   N  N     A GLY B 1 340 ? -31.472 -27.432 -16.084 0.05 11.27 ? 339  GLY B N     1  
ATOM   5528   C  CA    A GLY B 1 340 ? -30.633 -26.559 -15.274 0.05 11.37 ? 339  GLY B CA    1  
ATOM   5529   C  C     A GLY B 1 340 ? -30.299 -27.158 -13.920 0.05 11.24 ? 339  GLY B C     1  
ATOM   5530   O  O     A GLY B 1 340 ? -29.237 -26.893 -13.345 0.05 11.29 ? 339  GLY B O     1  
ATOM   5531   N  N     A LEU B 1 341 ? -31.215 -27.973 -13.404 0.05 11.11 ? 340  LEU B N     1  
ATOM   5532   C  CA    A LEU B 1 341 ? -30.999 -28.662 -12.141 0.05 11.02 ? 340  LEU B CA    1  
ATOM   5533   C  C     A LEU B 1 341 ? -29.964 -29.768 -12.246 0.05 10.94 ? 340  LEU B C     1  
ATOM   5534   O  O     A LEU B 1 341 ? -29.513 -30.279 -11.233 0.05 10.90 ? 340  LEU B O     1  
ATOM   5535   C  CB    A LEU B 1 341 ? -32.303 -29.280 -11.638 0.05 10.94 ? 340  LEU B CB    1  
ATOM   5536   C  CG    A LEU B 1 341 ? -33.275 -28.338 -10.943 0.05 11.06 ? 340  LEU B CG    1  
ATOM   5537   C  CD1   A LEU B 1 341 ? -34.630 -29.025 -10.788 0.05 11.02 ? 340  LEU B CD1   1  
ATOM   5538   C  CD2   A LEU B 1 341 ? -32.720 -27.912 -9.584  0.05 11.12 ? 340  LEU B CD2   1  
ATOM   5539   N  N     A GLY B 1 342 ? -29.633 -30.167 -13.471 0.05 10.94 ? 341  GLY B N     1  
ATOM   5540   C  CA    A GLY B 1 342 ? -28.680 -31.235 -13.694 0.05 10.90 ? 341  GLY B CA    1  
ATOM   5541   C  C     A GLY B 1 342 ? -29.305 -32.598 -13.461 0.05 10.78 ? 341  GLY B C     1  
ATOM   5542   O  O     A GLY B 1 342 ? -28.614 -33.562 -13.109 0.05 10.77 ? 341  GLY B O     1  
ATOM   5543   N  N     A VAL B 1 343 ? -30.615 -32.684 -13.666 0.05 10.71 ? 342  VAL B N     1  
ATOM   5544   C  CA    A VAL B 1 343 ? -31.324 -33.950 -13.470 0.05 10.62 ? 342  VAL B CA    1  
ATOM   5545   C  C     A VAL B 1 343 ? -32.053 -34.403 -14.734 0.05 10.58 ? 342  VAL B C     1  
ATOM   5546   O  O     A VAL B 1 343 ? -32.820 -35.373 -14.703 0.05 10.51 ? 342  VAL B O     1  
ATOM   5547   C  CB    A VAL B 1 343 ? -32.337 -33.868 -12.298 0.05 10.60 ? 342  VAL B CB    1  
ATOM   5548   C  CG1   A VAL B 1 343 ? -31.627 -33.456 -11.007 0.05 10.65 ? 342  VAL B CG1   1  
ATOM   5549   C  CG2   A VAL B 1 343 ? -33.472 -32.914 -12.623 0.05 10.64 ? 342  VAL B CG2   1  
ATOM   5550   N  N     A ALA B 1 344 ? -31.801 -33.715 -15.842 0.05 10.64 ? 343  ALA B N     1  
ATOM   5551   C  CA    A ALA B 1 344 ? -32.529 -33.984 -17.075 0.05 10.64 ? 343  ALA B CA    1  
ATOM   5552   C  C     A ALA B 1 344 ? -31.810 -33.456 -18.313 0.05 10.76 ? 343  ALA B C     1  
ATOM   5553   O  O     A ALA B 1 344 ? -30.921 -32.616 -18.215 0.05 10.86 ? 343  ALA B O     1  
ATOM   5554   C  CB    A ALA B 1 344 ? -33.908 -33.366 -16.996 0.05 10.65 ? 343  ALA B CB    1  
ATOM   5555   N  N     A ARG B 1 345 ? -32.215 -33.958 -19.477 0.05 10.77 ? 344  ARG B N     1  
ATOM   5556   C  CA    A ARG B 1 345 ? -31.806 -33.369 -20.744 0.05 10.92 ? 344  ARG B CA    1  
ATOM   5557   C  C     A ARG B 1 345 ? -33.043 -32.922 -21.496 0.05 10.96 ? 344  ARG B C     1  
ATOM   5558   O  O     A ARG B 1 345 ? -34.018 -33.663 -21.598 0.05 10.86 ? 344  ARG B O     1  
ATOM   5559   C  CB    A ARG B 1 345 ? -31.037 -34.364 -21.612 0.05 10.96 ? 344  ARG B CB    1  
ATOM   5560   C  CG    A ARG B 1 345 ? -30.895 -33.889 -23.068 0.05 11.14 ? 344  ARG B CG    1  
ATOM   5561   C  CD    A ARG B 1 345 ? -29.957 -32.692 -23.144 0.05 11.33 ? 344  ARG B CD    1  
ATOM   5562   N  NE    A ARG B 1 345 ? -30.359 -31.698 -24.142 0.05 11.53 ? 344  ARG B NE    1  
ATOM   5563   N  N     A LYS B 1 346 ? -33.003 -31.703 -22.013 0.05 11.13 ? 345  LYS B N     1  
ATOM   5564   C  CA    A LYS B 1 346 ? -34.064 -31.206 -22.860 0.05 11.23 ? 345  LYS B CA    1  
ATOM   5565   C  C     A LYS B 1 346 ? -33.722 -31.516 -24.310 0.05 11.35 ? 345  LYS B C     1  
ATOM   5566   O  O     A LYS B 1 346 ? -32.567 -31.398 -24.719 0.05 11.47 ? 345  LYS B O     1  
ATOM   5567   C  CB    A LYS B 1 346 ? -34.254 -29.698 -22.648 0.05 11.41 ? 345  LYS B CB    1  
ATOM   5568   C  CG    A LYS B 1 346 ? -35.208 -29.040 -23.637 0.05 11.59 ? 345  LYS B CG    1  
ATOM   5569   C  CD    A LYS B 1 346 ? -34.471 -28.477 -24.837 0.05 11.84 ? 345  LYS B CD    1  
ATOM   5570   C  CE    A LYS B 1 346 ? -35.288 -28.640 -26.092 0.05 11.97 ? 345  LYS B CE    1  
ATOM   5571   N  NZ    A LYS B 1 346 ? -36.623 -28.064 -25.894 0.05 11.97 ? 345  LYS B NZ    1  
ATOM   5572   N  N     A LEU B 1 347 ? -34.732 -31.915 -25.080 0.05 11.35 ? 346  LEU B N     1  
ATOM   5573   C  CA    A LEU B 1 347 ? -34.557 -32.206 -26.499 0.05 11.49 ? 346  LEU B CA    1  
ATOM   5574   C  C     A LEU B 1 347 ? -35.771 -31.747 -27.279 0.05 11.63 ? 346  LEU B C     1  
ATOM   5575   O  O     A LEU B 1 347 ? -36.907 -31.970 -26.860 0.05 11.52 ? 346  LEU B O     1  
ATOM   5576   C  CB    A LEU B 1 347 ? -34.373 -33.708 -26.728 0.05 11.36 ? 346  LEU B CB    1  
ATOM   5577   C  CG    A LEU B 1 347 ? -33.063 -34.363 -26.289 0.05 11.29 ? 346  LEU B CG    1  
ATOM   5578   C  CD1   A LEU B 1 347 ? -33.076 -35.846 -26.662 0.05 11.18 ? 346  LEU B CD1   1  
ATOM   5579   C  CD2   A LEU B 1 347 ? -31.872 -33.644 -26.897 0.05 11.51 ? 346  LEU B CD2   1  
ATOM   5580   N  N     A ALA B 1 348 ? -35.531 -31.094 -28.412 0.05 11.89 ? 347  ALA B N     1  
ATOM   5581   C  CA    A ALA B 1 348 ? -36.590 -30.858 -29.382 0.05 12.06 ? 347  ALA B CA    1  
ATOM   5582   C  C     A ALA B 1 348 ? -37.094 -32.202 -29.913 0.05 11.93 ? 347  ALA B C     1  
ATOM   5583   O  O     A ALA B 1 348 ? -36.297 -33.102 -30.201 0.05 11.86 ? 347  ALA B O     1  
ATOM   5584   C  CB    A ALA B 1 348 ? -36.073 -29.994 -30.523 0.05 12.40 ? 347  ALA B CB    1  
ATOM   5585   N  N     A THR B 1 349 ? -38.414 -32.338 -30.029 0.05 11.91 ? 348  THR B N     1  
ATOM   5586   C  CA    A THR B 1 349 ? -39.014 -33.579 -30.510 0.05 11.81 ? 348  THR B CA    1  
ATOM   5587   C  C     A THR B 1 349 ? -38.505 -33.874 -31.896 0.05 12.01 ? 348  THR B C     1  
ATOM   5588   O  O     A THR B 1 349 ? -38.018 -34.975 -32.173 0.05 11.94 ? 348  THR B O     1  
ATOM   5589   C  CB    A THR B 1 349 ? -40.541 -33.480 -30.606 0.05 11.84 ? 348  THR B CB    1  
ATOM   5590   O  OG1   A THR B 1 349 ? -41.081 -33.208 -29.313 0.05 11.71 ? 348  THR B OG1   1  
ATOM   5591   C  CG2   A THR B 1 349 ? -41.122 -34.795 -31.146 0.05 11.74 ? 348  THR B CG2   1  
ATOM   5592   N  N     A GLU B 1 350 ? -38.611 -32.857 -32.748 0.05 12.31 ? 349  GLU B N     1  
ATOM   5593   C  CA    A GLU B 1 350 ? -38.173 -32.930 -34.133 0.05 12.59 ? 349  GLU B CA    1  
ATOM   5594   C  C     A GLU B 1 350 ? -36.835 -33.649 -34.221 0.05 12.58 ? 349  GLU B C     1  
ATOM   5595   O  O     A GLU B 1 350 ? -36.626 -34.451 -35.113 0.05 12.74 ? 349  GLU B O     1  
ATOM   5596   C  CB    A GLU B 1 350 ? -38.092 -31.523 -34.746 0.05 12.94 ? 349  GLU B CB    1  
ATOM   5597   C  CG    A GLU B 1 350 ? -37.295 -30.522 -33.912 0.05 12.96 ? 349  GLU B CG    1  
ATOM   5598   C  CD    A GLU B 1 350 ? -37.494 -29.076 -34.342 0.05 13.30 ? 349  GLU B CD    1  
ATOM   5599   O  OE1   A GLU B 1 350 ? -37.061 -28.703 -35.458 0.05 13.56 ? 349  GLU B OE1   1  
ATOM   5600   O  OE2   A GLU B 1 350 ? -38.076 -28.305 -33.549 0.05 13.34 ? 349  GLU B OE2   1  
ATOM   5601   N  N     A GLU B 1 351 ? -35.954 -33.400 -33.252 0.05 12.41 ? 350  GLU B N     1  
ATOM   5602   C  CA    A GLU B 1 351 ? -34.694 -34.129 -33.187 0.05 12.43 ? 350  GLU B CA    1  
ATOM   5603   C  C     A GLU B 1 351 ? -34.476 -34.972 -31.920 0.05 12.12 ? 350  GLU B C     1  
ATOM   5604   O  O     A GLU B 1 351 ? -33.373 -35.053 -31.399 0.05 12.14 ? 350  GLU B O     1  
ATOM   5605   C  CB    A GLU B 1 351 ? -33.513 -33.201 -33.458 0.05 12.69 ? 350  GLU B CB    1  
ATOM   5606   C  CG    A GLU B 1 351 ? -33.743 -31.756 -33.084 0.05 12.72 ? 350  GLU B CG    1  
ATOM   5607   C  CD    A GLU B 1 351 ? -32.680 -31.262 -32.145 0.05 12.82 ? 350  GLU B CD    1  
ATOM   5608   O  OE1   A GLU B 1 351 ? -31.501 -31.587 -32.388 0.05 12.93 ? 350  GLU B OE1   1  
ATOM   5609   O  OE2   A GLU B 1 351 ? -33.016 -30.578 -31.149 0.05 12.81 ? 350  GLU B OE2   1  
ATOM   5610   N  N     A ALA B 1 352 ? -35.532 -35.612 -31.440 0.05 11.88 ? 351  ALA B N     1  
ATOM   5611   C  CA    A ALA B 1 352 ? -35.386 -36.658 -30.441 0.05 11.62 ? 351  ALA B CA    1  
ATOM   5612   C  C     A ALA B 1 352 ? -35.500 -38.013 -31.142 0.05 11.56 ? 351  ALA B C     1  
ATOM   5613   O  O     A ALA B 1 352 ? -36.603 -38.550 -31.296 0.05 11.42 ? 351  ALA B O     1  
ATOM   5614   C  CB    A ALA B 1 352 ? -36.443 -36.511 -29.359 0.05 11.42 ? 351  ALA B CB    1  
ATOM   5615   N  N     A THR B 1 353 ? -34.349 -38.551 -31.552 0.05 11.70 ? 352  THR B N     1  
ATOM   5616   C  CA    A THR B 1 353 ? -34.259 -39.712 -32.444 0.05 11.73 ? 352  THR B CA    1  
ATOM   5617   C  C     A THR B 1 353 ? -33.741 -40.951 -31.722 0.05 11.55 ? 352  THR B C     1  
ATOM   5618   O  O     A THR B 1 353 ? -33.126 -40.835 -30.668 0.05 11.43 ? 352  THR B O     1  
ATOM   5619   C  CB    A THR B 1 353 ? -33.315 -39.412 -33.643 0.05 12.02 ? 352  THR B CB    1  
ATOM   5620   O  OG1   A THR B 1 353 ? -31.944 -39.361 -33.209 0.05 12.03 ? 352  THR B OG1   1  
ATOM   5621   C  CG2   A THR B 1 353 ? -33.698 -38.081 -34.303 0.05 12.24 ? 352  THR B CG2   1  
ATOM   5622   N  N     A ALA B 1 354 ? -33.953 -42.127 -32.317 0.05 11.57 ? 353  ALA B N     1  
ATOM   5623   C  CA    A ALA B 1 354 ? -33.671 -43.392 -31.642 0.05 11.45 ? 353  ALA B CA    1  
ATOM   5624   C  C     A ALA B 1 354 ? -32.331 -43.448 -30.898 0.05 11.51 ? 353  ALA B C     1  
ATOM   5625   O  O     A ALA B 1 354 ? -32.282 -43.906 -29.759 0.05 11.36 ? 353  ALA B O     1  
ATOM   5626   C  CB    A ALA B 1 354 ? -33.811 -44.577 -32.610 0.05 11.53 ? 353  ALA B CB    1  
ATOM   5627   N  N     A ASP B 1 355 ? -31.261 -42.960 -31.525 0.05 11.74 ? 354  ASP B N     1  
ATOM   5628   C  CA    A ASP B 1 355 ? -29.941 -43.018 -30.898 0.05 11.85 ? 354  ASP B CA    1  
ATOM   5629   C  C     A ASP B 1 355 ? -29.761 -41.965 -29.798 0.05 11.74 ? 354  ASP B C     1  
ATOM   5630   O  O     A ASP B 1 355 ? -29.309 -42.282 -28.700 0.05 11.69 ? 354  ASP B O     1  
ATOM   5631   C  CB    A ASP B 1 355 ? -28.824 -42.896 -31.937 0.05 12.19 ? 354  ASP B CB    1  
ATOM   5632   C  CG    A ASP B 1 355 ? -29.004 -43.845 -33.104 0.05 12.32 ? 354  ASP B CG    1  
ATOM   5633   O  OD1   A ASP B 1 355 ? -28.720 -45.059 -32.951 0.05 12.29 ? 354  ASP B OD1   1  
ATOM   5634   O  OD2   A ASP B 1 355 ? -29.424 -43.373 -34.182 0.05 12.49 ? 354  ASP B OD2   1  
ATOM   5635   N  N     A LEU B 1 356 ? -30.103 -40.716 -30.104 0.05 11.73 ? 355  LEU B N     1  
ATOM   5636   C  CA    A LEU B 1 356 ? -29.928 -39.626 -29.147 0.05 11.65 ? 355  LEU B CA    1  
ATOM   5637   C  C     A LEU B 1 356 ? -30.776 -39.860 -27.896 0.05 11.36 ? 355  LEU B C     1  
ATOM   5638   O  O     A LEU B 1 356 ? -30.333 -39.591 -26.787 0.05 11.28 ? 355  LEU B O     1  
ATOM   5639   C  CB    A LEU B 1 356 ? -30.218 -38.262 -29.790 0.05 11.77 ? 355  LEU B CB    1  
ATOM   5640   C  CG    A LEU B 1 356 ? -30.176 -36.997 -28.917 0.05 11.71 ? 355  LEU B CG    1  
ATOM   5641   C  CD1   A LEU B 1 356 ? -28.856 -36.846 -28.162 0.05 11.78 ? 355  LEU B CD1   1  
ATOM   5642   C  CD2   A LEU B 1 356 ? -30.433 -35.758 -29.758 0.05 11.89 ? 355  LEU B CD2   1  
ATOM   5643   N  N     A LEU B 1 357 ? -31.987 -40.382 -28.071 0.05 11.24 ? 356  LEU B N     1  
ATOM   5644   C  CA    A LEU B 1 357 ? -32.793 -40.757 -26.915 0.05 11.02 ? 356  LEU B CA    1  
ATOM   5645   C  C     A LEU B 1 357 ? -32.110 -41.895 -26.129 0.05 11.00 ? 356  LEU B C     1  
ATOM   5646   O  O     A LEU B 1 357 ? -31.952 -41.808 -24.912 0.05 10.90 ? 356  LEU B O     1  
ATOM   5647   C  CB    A LEU B 1 357 ? -34.233 -41.123 -27.325 0.05 10.94 ? 356  LEU B CB    1  
ATOM   5648   C  CG    A LEU B 1 357 ? -35.119 -40.062 -27.995 0.05 10.94 ? 356  LEU B CG    1  
ATOM   5649   C  CD1   A LEU B 1 357 ? -36.359 -40.698 -28.605 0.05 10.94 ? 356  LEU B CD1   1  
ATOM   5650   C  CD2   A LEU B 1 357 ? -35.532 -38.981 -26.999 0.05 10.80 ? 356  LEU B CD2   1  
ATOM   5651   N  N     A ARG B 1 358 ? -31.687 -42.940 -26.844 0.05 11.13 ? 357  ARG B N     1  
ATOM   5652   C  CA    A ARG B 1 358 ? -31.112 -44.168 -26.267 0.05 11.18 ? 357  ARG B CA    1  
ATOM   5653   C  C     A ARG B 1 358 ? -29.777 -43.964 -25.539 0.05 11.26 ? 357  ARG B C     1  
ATOM   5654   O  O     A ARG B 1 358 ? -29.615 -44.347 -24.377 0.05 11.18 ? 357  ARG B O     1  
ATOM   5655   C  CB    A ARG B 1 358 ? -30.927 -45.218 -27.376 0.05 11.37 ? 357  ARG B CB    1  
ATOM   5656   C  CG    A ARG B 1 358 ? -30.456 -46.596 -26.878 0.05 11.54 ? 357  ARG B CG    1  
ATOM   5657   C  CD    A ARG B 1 358 ? -30.242 -47.556 -28.023 0.05 11.77 ? 357  ARG B CD    1  
ATOM   5658   N  NE    A ARG B 1 358 ? -29.378 -48.659 -27.604 0.05 11.70 ? 357  ARG B NE    1  
ATOM   5659   N  N     A GLU B 1 359 ? -28.828 -43.375 -26.260 0.05 11.46 ? 358  GLU B N     1  
ATOM   5660   C  CA    A GLU B 1 359 ? -27.564 -42.907 -25.701 0.05 11.59 ? 358  GLU B CA    1  
ATOM   5661   C  C     A GLU B 1 359 ? -27.777 -42.077 -24.436 0.05 11.42 ? 358  GLU B C     1  
ATOM   5662   O  O     A GLU B 1 359 ? -27.197 -42.357 -23.382 0.05 11.49 ? 358  GLU B O     1  
ATOM   5663   C  CB    A GLU B 1 359 ? -26.829 -42.082 -26.763 0.05 11.79 ? 358  GLU B CB    1  
ATOM   5664   C  CG    A GLU B 1 359 ? -25.856 -41.038 -26.244 0.05 11.99 ? 358  GLU B CG    1  
ATOM   5665   C  CD    A GLU B 1 359 ? -25.044 -40.396 -27.367 0.05 12.18 ? 358  GLU B CD    1  
ATOM   5666   O  OE1   A GLU B 1 359 ? -24.915 -39.157 -27.380 0.05 12.11 ? 358  GLU B OE1   1  
ATOM   5667   O  OE2   A GLU B 1 359 ? -24.545 -41.127 -28.248 0.05 12.42 ? 358  GLU B OE2   1  
ATOM   5668   N  N     A THR B 1 360 ? -28.596 -41.042 -24.553 0.05 11.22 ? 359  THR B N     1  
ATOM   5669   C  CA    A THR B 1 360 ? -28.936 -40.201 -23.414 0.05 11.08 ? 359  THR B CA    1  
ATOM   5670   C  C     A THR B 1 360 ? -29.448 -41.043 -22.246 0.05 10.92 ? 359  THR B C     1  
ATOM   5671   O  O     A THR B 1 360 ? -29.226 -40.709 -21.087 0.05 10.87 ? 359  THR B O     1  
ATOM   5672   C  CB    A THR B 1 360 ? -29.998 -39.172 -23.817 0.05 11.01 ? 359  THR B CB    1  
ATOM   5673   O  OG1   A THR B 1 360 ? -29.522 -38.427 -24.950 0.05 11.20 ? 359  THR B OG1   1  
ATOM   5674   C  CG2   A THR B 1 360 ? -30.341 -38.232 -22.668 0.05 10.90 ? 359  THR B CG2   1  
ATOM   5675   N  N     A ALA B 1 361 ? -30.128 -42.142 -22.559 0.05 10.87 ? 360  ALA B N     1  
ATOM   5676   C  CA    A ALA B 1 361 ? -30.712 -42.997 -21.527 0.05 10.78 ? 360  ALA B CA    1  
ATOM   5677   C  C     A ALA B 1 361 ? -29.661 -43.723 -20.697 0.05 10.89 ? 360  ALA B C     1  
ATOM   5678   O  O     A ALA B 1 361 ? -29.595 -43.539 -19.475 0.05 10.85 ? 360  ALA B O     1  
ATOM   5679   C  CB    A ALA B 1 361 ? -31.665 -43.995 -22.150 0.05 10.76 ? 360  ALA B CB    1  
ATOM   5680   N  N     A LEU B 1 362 ? -28.864 -44.558 -21.365 0.05 11.07 ? 361  LEU B N     1  
ATOM   5681   C  CA    A LEU B 1 362 ? -27.790 -45.307 -20.719 0.05 11.25 ? 361  LEU B CA    1  
ATOM   5682   C  C     A LEU B 1 362 ? -26.872 -44.374 -19.935 0.05 11.30 ? 361  LEU B C     1  
ATOM   5683   O  O     A LEU B 1 362 ? -26.371 -44.728 -18.869 0.05 11.43 ? 361  LEU B O     1  
ATOM   5684   C  CB    A LEU B 1 362 ? -26.963 -46.065 -21.761 0.05 11.47 ? 361  LEU B CB    1  
ATOM   5685   C  CG    A LEU B 1 362 ? -27.388 -47.437 -22.305 0.05 11.49 ? 361  LEU B CG    1  
ATOM   5686   C  CD1   A LEU B 1 362 ? -28.771 -47.402 -22.909 0.05 11.32 ? 361  LEU B CD1   1  
ATOM   5687   C  CD2   A LEU B 1 362 ? -26.376 -47.912 -23.356 0.05 11.78 ? 361  LEU B CD2   1  
ATOM   5688   N  N     A ALA B 1 363 ? -26.663 -43.177 -20.481 0.05 11.22 ? 362  ALA B N     1  
ATOM   5689   C  CA    A ALA B 1 363 ? -25.705 -42.223 -19.931 0.05 11.26 ? 362  ALA B CA    1  
ATOM   5690   C  C     A ALA B 1 363 ? -26.293 -41.371 -18.809 0.05 11.09 ? 362  ALA B C     1  
ATOM   5691   O  O     A ALA B 1 363 ? -25.555 -40.740 -18.049 0.05 11.14 ? 362  ALA B O     1  
ATOM   5692   C  CB    A ALA B 1 363 ? -25.180 -41.331 -21.036 0.05 11.31 ? 362  ALA B CB    1  
ATOM   5693   N  N     A LEU B 1 364 ? -27.617 -41.325 -18.726 0.05 10.92 ? 363  LEU B N     1  
ATOM   5694   C  CA    A LEU B 1 364 ? -28.284 -40.588 -17.655 0.05 10.79 ? 363  LEU B CA    1  
ATOM   5695   C  C     A LEU B 1 364 ? -28.474 -41.488 -16.448 0.05 10.79 ? 363  LEU B C     1  
ATOM   5696   O  O     A LEU B 1 364 ? -28.265 -41.070 -15.304 0.05 10.79 ? 363  LEU B O     1  
ATOM   5697   C  CB    A LEU B 1 364 ? -29.655 -40.067 -18.104 0.05 10.66 ? 363  LEU B CB    1  
ATOM   5698   C  CG    A LEU B 1 364 ? -29.823 -38.602 -18.528 0.05 10.67 ? 363  LEU B CG    1  
ATOM   5699   C  CD1   A LEU B 1 364 ? -31.212 -38.384 -19.105 0.05 10.59 ? 363  LEU B CD1   1  
ATOM   5700   C  CD2   A LEU B 1 364 ? -29.584 -37.647 -17.360 0.05 10.67 ? 363  LEU B CD2   1  
ATOM   5701   N  N     A VAL B 1 365 ? -28.875 -42.729 -16.701 0.05 10.82 ? 364  VAL B N     1  
ATOM   5702   C  CA    A VAL B 1 365 ? -29.205 -43.637 -15.604 0.05 10.85 ? 364  VAL B CA    1  
ATOM   5703   C  C     A VAL B 1 365 ? -27.963 -44.116 -14.856 0.05 11.02 ? 364  VAL B C     1  
ATOM   5704   O  O     A VAL B 1 365 ? -28.060 -44.712 -13.783 0.05 11.06 ? 364  VAL B O     1  
ATOM   5705   C  CB    A VAL B 1 365 ? -30.048 -44.846 -16.071 0.05 10.88 ? 364  VAL B CB    1  
ATOM   5706   C  CG1   A VAL B 1 365 ? -31.385 -44.373 -16.624 0.05 10.73 ? 364  VAL B CG1   1  
ATOM   5707   C  CG2   A VAL B 1 365 ? -29.295 -45.657 -17.109 0.05 11.04 ? 364  VAL B CG2   1  
ATOM   5708   N  N     A ASP B 1 366 ? -26.789 -43.855 -15.408 0.05 11.14 ? 365  ASP B N     1  
ATOM   5709   C  CA    A ASP B 1 366 ? -25.580 -44.310 -14.738 0.05 11.34 ? 365  ASP B CA    1  
ATOM   5710   C  C     A ASP B 1 366 ? -24.770 -43.162 -14.145 0.05 11.38 ? 365  ASP B C     1  
ATOM   5711   O  O     A ASP B 1 366 ? -23.725 -43.365 -13.537 0.05 11.57 ? 365  ASP B O     1  
ATOM   5712   C  CB    A ASP B 1 366 ? -24.759 -45.225 -15.654 0.05 11.55 ? 365  ASP B CB    1  
ATOM   5713   C  CG    A ASP B 1 366 ? -25.304 -46.654 -15.679 0.05 11.58 ? 365  ASP B CG    1  
ATOM   5714   O  OD1   A ASP B 1 366 ? -25.971 -47.048 -14.698 0.05 11.48 ? 365  ASP B OD1   1  
ATOM   5715   O  OD2   A ASP B 1 366 ? -25.068 -47.389 -16.665 0.05 11.73 ? 365  ASP B OD2   1  
ATOM   5716   N  N     A ASP B 1 367 ? -25.298 -41.955 -14.284 0.05 11.23 ? 366  ASP B N     1  
ATOM   5717   C  CA    A ASP B 1 367 ? -24.648 -40.770 -13.754 0.05 11.25 ? 366  ASP B CA    1  
ATOM   5718   C  C     A ASP B 1 367 ? -24.917 -40.623 -12.252 0.05 11.20 ? 366  ASP B C     1  
ATOM   5719   O  O     A ASP B 1 367 ? -26.054 -40.396 -11.838 0.05 11.05 ? 366  ASP B O     1  
ATOM   5720   C  CB    A ASP B 1 367 ? -25.156 -39.538 -14.509 0.05 11.13 ? 366  ASP B CB    1  
ATOM   5721   C  CG    A ASP B 1 367 ? -24.306 -38.316 -14.268 0.05 11.18 ? 366  ASP B CG    1  
ATOM   5722   O  OD1   A ASP B 1 367 ? -24.103 -37.535 -15.224 0.05 11.23 ? 366  ASP B OD1   1  
ATOM   5723   O  OD2   A ASP B 1 367 ? -23.839 -38.134 -13.124 0.05 11.20 ? 366  ASP B OD2   1  
ATOM   5724   N  N     A PRO B 1 368 ? -23.863 -40.732 -11.430 0.05 11.37 ? 367  PRO B N     1  
ATOM   5725   C  CA    A PRO B 1 368 ? -24.048 -40.691 -9.974  0.05 11.37 ? 367  PRO B CA    1  
ATOM   5726   C  C     A PRO B 1 368 ? -24.465 -39.312 -9.480  0.05 11.25 ? 367  PRO B C     1  
ATOM   5727   O  O     A PRO B 1 368 ? -25.201 -39.210 -8.495  0.05 11.20 ? 367  PRO B O     1  
ATOM   5728   C  CB    A PRO B 1 368 ? -22.661 -41.070 -9.430  0.05 11.61 ? 367  PRO B CB    1  
ATOM   5729   C  CG    A PRO B 1 368 ? -21.708 -40.687 -10.513 0.05 11.71 ? 367  PRO B CG    1  
ATOM   5730   C  CD    A PRO B 1 368 ? -22.451 -40.893 -11.814 0.05 11.59 ? 367  PRO B CD    1  
ATOM   5731   N  N     A GLU B 1 369 ? -24.013 -38.261 -10.155 0.05 11.23 ? 368  GLU B N     1  
ATOM   5732   C  CA    A GLU B 1 369 ? -24.346 -36.908 -9.721  0.05 11.16 ? 368  GLU B CA    1  
ATOM   5733   C  C     A GLU B 1 369 ? -25.809 -36.567 -9.993  0.05 10.99 ? 368  GLU B C     1  
ATOM   5734   O  O     A GLU B 1 369 ? -26.472 -35.931 -9.173  0.05 10.94 ? 368  GLU B O     1  
ATOM   5735   C  CB    A GLU B 1 369 ? -23.403 -35.886 -10.361 0.05 11.25 ? 368  GLU B CB    1  
ATOM   5736   C  CG    A GLU B 1 369 ? -23.676 -34.443 -9.961  0.05 11.21 ? 368  GLU B CG    1  
ATOM   5737   C  CD    A GLU B 1 369 ? -23.504 -34.154 -8.469  0.05 11.24 ? 368  GLU B CD    1  
ATOM   5738   O  OE1   A GLU B 1 369 ? -22.938 -34.999 -7.740  0.05 11.33 ? 368  GLU B OE1   1  
ATOM   5739   O  OE2   A GLU B 1 369 ? -23.933 -33.061 -8.023  0.05 11.21 ? 368  GLU B OE2   1  
ATOM   5740   N  N     A VAL B 1 370 ? -26.315 -37.005 -11.142 0.05 10.92 ? 369  VAL B N     1  
ATOM   5741   C  CA    A VAL B 1 370 ? -27.743 -36.914 -11.415 0.05 10.78 ? 369  VAL B CA    1  
ATOM   5742   C  C     A VAL B 1 370 ? -28.532 -37.584 -10.293 0.05 10.76 ? 369  VAL B C     1  
ATOM   5743   O  O     A VAL B 1 370 ? -29.504 -37.029 -9.791  0.05 10.71 ? 369  VAL B O     1  
ATOM   5744   C  CB    A VAL B 1 370 ? -28.091 -37.569 -12.767 0.05 10.74 ? 369  VAL B CB    1  
ATOM   5745   C  CG1   A VAL B 1 370 ? -29.603 -37.665 -12.952 0.05 10.63 ? 369  VAL B CG1   1  
ATOM   5746   C  CG2   A VAL B 1 370 ? -27.450 -36.782 -13.898 0.05 10.80 ? 369  VAL B CG2   1  
ATOM   5747   N  N     A ALA B 1 371 ? -28.081 -38.763 -9.877  0.05 10.83 ? 370  ALA B N     1  
ATOM   5748   C  CA    A ALA B 1 371 ? -28.753 -39.494 -8.801  0.05 10.86 ? 370  ALA B CA    1  
ATOM   5749   C  C     A ALA B 1 371 ? -28.686 -38.749 -7.467  0.05 10.92 ? 370  ALA B C     1  
ATOM   5750   O  O     A ALA B 1 371 ? -29.695 -38.595 -6.786  0.05 10.92 ? 370  ALA B O     1  
ATOM   5751   C  CB    A ALA B 1 371 ? -28.169 -40.904 -8.665  0.05 10.97 ? 370  ALA B CB    1  
ATOM   5752   N  N     A ARG B 1 372 ? -27.495 -38.293 -7.098  0.05 11.01 ? 371  ARG B N     1  
ATOM   5753   C  CA    A ARG B 1 372 ? -27.328 -37.560 -5.849  0.05 11.08 ? 371  ARG B CA    1  
ATOM   5754   C  C     A ARG B 1 372 ? -28.181 -36.294 -5.831  0.05 11.00 ? 371  ARG B C     1  
ATOM   5755   O  O     A ARG B 1 372 ? -28.745 -35.931 -4.801  0.05 11.04 ? 371  ARG B O     1  
ATOM   5756   C  CB    A ARG B 1 372 ? -25.856 -37.222 -5.602  0.05 11.19 ? 371  ARG B CB    1  
ATOM   5757   C  CG    A ARG B 1 372 ? -25.623 -36.302 -4.400  0.05 11.26 ? 371  ARG B CG    1  
ATOM   5758   C  CD    A ARG B 1 372 ? -24.141 -36.042 -4.206  0.05 11.39 ? 371  ARG B CD    1  
ATOM   5759   N  NE    A ARG B 1 372 ? -23.467 -37.225 -3.675  0.05 11.56 ? 371  ARG B NE    1  
ATOM   5760   C  CZ    A ARG B 1 372 ? -23.027 -37.337 -2.424  0.05 11.68 ? 371  ARG B CZ    1  
ATOM   5761   N  NH1   A ARG B 1 372 ? -23.167 -36.326 -1.569  0.05 11.65 ? 371  ARG B NH1   1  
ATOM   5762   N  NH2   A ARG B 1 372 ? -22.448 -38.463 -2.029  0.05 11.88 ? 371  ARG B NH2   1  
ATOM   5763   N  N     A ARG B 1 373 ? -28.299 -35.637 -6.980  0.05 10.91 ? 372  ARG B N     1  
ATOM   5764   C  CA    A ARG B 1 373 ? -29.134 -34.442 -7.069  0.05 10.87 ? 372  ARG B CA    1  
ATOM   5765   C  C     A ARG B 1 373 ? -30.619 -34.761 -6.937  0.05 10.82 ? 372  ARG B C     1  
ATOM   5766   O  O     A ARG B 1 373 ? -31.343 -34.070 -6.234  0.05 10.87 ? 372  ARG B O     1  
ATOM   5767   C  CB    A ARG B 1 373 ? -28.871 -33.681 -8.367  0.05 10.83 ? 372  ARG B CB    1  
ATOM   5768   C  CG    A ARG B 1 373 ? -27.492 -33.065 -8.443  0.05 10.91 ? 372  ARG B CG    1  
ATOM   5769   C  CD    A ARG B 1 373 ? -27.490 -31.900 -9.412  0.05 10.93 ? 372  ARG B CD    1  
ATOM   5770   N  NE    A ARG B 1 373 ? -26.171 -31.294 -9.549  0.05 11.04 ? 372  ARG B NE    1  
ATOM   5771   C  CZ    A ARG B 1 373 ? -25.309 -31.632 -10.497 0.05 11.08 ? 372  ARG B CZ    1  
ATOM   5772   N  NH1   A ARG B 1 373 ? -25.636 -32.566 -11.376 0.05 11.01 ? 372  ARG B NH1   1  
ATOM   5773   N  NH2   A ARG B 1 373 ? -24.122 -31.042 -10.563 0.05 11.22 ? 372  ARG B NH2   1  
ATOM   5774   N  N     A LEU B 1 374 ? -31.066 -35.811 -7.619  0.05 10.76 ? 373  LEU B N     1  
ATOM   5775   C  CA    A LEU B 1 374 ? -32.464 -36.211 -7.569  0.05 10.74 ? 373  LEU B CA    1  
ATOM   5776   C  C     A LEU B 1 374 ? -32.887 -36.662 -6.169  0.05 10.85 ? 373  LEU B C     1  
ATOM   5777   O  O     A LEU B 1 374 ? -34.003 -36.389 -5.729  0.05 10.90 ? 373  LEU B O     1  
ATOM   5778   C  CB    A LEU B 1 374 ? -32.733 -37.320 -8.593  0.05 10.67 ? 373  LEU B CB    1  
ATOM   5779   C  CG    A LEU B 1 374 ? -32.914 -36.816 -10.029 0.05 10.58 ? 373  LEU B CG    1  
ATOM   5780   C  CD1   A LEU B 1 374 ? -32.686 -37.954 -11.025 0.05 10.54 ? 373  LEU B CD1   1  
ATOM   5781   C  CD2   A LEU B 1 374 ? -34.300 -36.224 -10.201 0.05 10.57 ? 373  LEU B CD2   1  
ATOM   5782   N  N     A ARG B 1 375 ? -32.000 -37.358 -5.469  0.05 10.93 ? 374  ARG B N     1  
ATOM   5783   C  CA    A ARG B 1 375 ? -32.326 -37.784 -4.107  0.05 11.07 ? 374  ARG B CA    1  
ATOM   5784   C  C     A ARG B 1 375 ? -32.467 -36.577 -3.187  0.05 11.15 ? 374  ARG B C     1  
ATOM   5785   O  O     A ARG B 1 375 ? -33.386 -36.505 -2.369  0.05 11.26 ? 374  ARG B O     1  
ATOM   5786   C  CB    A ARG B 1 375 ? -31.276 -38.764 -3.570  0.05 11.19 ? 374  ARG B CB    1  
ATOM   5787   C  CG    A ARG B 1 375 ? -31.229 -40.063 -4.343  0.05 11.16 ? 374  ARG B CG    1  
ATOM   5788   C  CD    A ARG B 1 375 ? -30.786 -41.241 -3.466  0.05 11.36 ? 374  ARG B CD    1  
ATOM   5789   N  NE    A ARG B 1 375 ? -29.340 -41.441 -3.489  0.05 11.43 ? 374  ARG B NE    1  
ATOM   5790   C  CZ    A ARG B 1 375 ? -28.681 -41.909 -4.545  0.05 11.39 ? 374  ARG B CZ    1  
ATOM   5791   N  NH1   A ARG B 1 375 ? -29.340 -42.201 -5.651  0.05 11.27 ? 374  ARG B NH1   1  
ATOM   5792   N  NH2   A ARG B 1 375 ? -27.364 -42.079 -4.502  0.05 11.49 ? 374  ARG B NH2   1  
ATOM   5793   N  N     A ARG B 1 376 ? -31.567 -35.617 -3.353  0.05 11.12 ? 375  ARG B N     1  
ATOM   5794   C  CA    A ARG B 1 376 ? -31.608 -34.376 -2.580  0.05 11.19 ? 375  ARG B CA    1  
ATOM   5795   C  C     A ARG B 1 376 ? -32.913 -33.599 -2.806  0.05 11.20 ? 375  ARG B C     1  
ATOM   5796   O  O     A ARG B 1 376 ? -33.516 -33.085 -1.859  0.05 11.33 ? 375  ARG B O     1  
ATOM   5797   C  CB    A ARG B 1 376 ? -30.390 -33.517 -2.932  0.05 11.16 ? 375  ARG B CB    1  
ATOM   5798   C  CG    A ARG B 1 376 ? -30.380 -32.104 -2.351  0.05 11.25 ? 375  ARG B CG    1  
ATOM   5799   C  CD    A ARG B 1 376 ? -29.284 -31.276 -3.043  0.05 11.23 ? 375  ARG B CD    1  
ATOM   5800   N  NE    A ARG B 1 376 ? -29.820 -30.291 -3.993  0.05 11.16 ? 375  ARG B NE    1  
ATOM   5801   C  CZ    A ARG B 1 376 ? -30.253 -30.568 -5.221  0.05 11.06 ? 375  ARG B CZ    1  
ATOM   5802   N  NH1   A ARG B 1 376 ? -30.713 -29.595 -5.995  0.05 11.04 ? 375  ARG B NH1   1  
ATOM   5803   N  NH2   A ARG B 1 376 ? -30.243 -31.809 -5.672  0.05 10.99 ? 375  ARG B NH2   1  
ATOM   5804   N  N     A ILE B 1 377 ? -33.347 -33.517 -4.063  0.05 11.08 ? 376  ILE B N     1  
ATOM   5805   C  CA    A ILE B 1 377 ? -34.602 -32.847 -4.390  0.05 11.10 ? 376  ILE B CA    1  
ATOM   5806   C  C     A ILE B 1 377 ? -35.808 -33.617 -3.864  0.05 11.19 ? 376  ILE B C     1  
ATOM   5807   O  O     A ILE B 1 377 ? -36.738 -33.030 -3.315  0.05 11.32 ? 376  ILE B O     1  
ATOM   5808   C  CB    A ILE B 1 377 ? -34.732 -32.626 -5.911  0.05 10.98 ? 376  ILE B CB    1  
ATOM   5809   C  CG1   A ILE B 1 377 ? -33.694 -31.595 -6.376  0.05 10.96 ? 376  ILE B CG1   1  
ATOM   5810   C  CG2   A ILE B 1 377 ? -36.138 -32.192 -6.267  0.05 11.04 ? 376  ILE B CG2   1  
ATOM   5811   C  CD1   A ILE B 1 377 ? -33.421 -31.615 -7.879  0.05 10.86 ? 376  ILE B CD1   1  
ATOM   5812   N  N     A GLN B 1 378 ? -35.782 -34.937 -4.019  0.05 11.15 ? 377  GLN B N     1  
ATOM   5813   C  CA    A GLN B 1 378 ? -36.852 -35.792 -3.523  0.05 11.26 ? 377  GLN B CA    1  
ATOM   5814   C  C     A GLN B 1 378 ? -36.995 -35.609 -2.016  0.05 11.47 ? 377  GLN B C     1  
ATOM   5815   O  O     A GLN B 1 378 ? -38.106 -35.495 -1.488  0.05 11.62 ? 377  GLN B O     1  
ATOM   5816   C  CB    A GLN B 1 378 ? -36.553 -37.255 -3.864  0.05 11.22 ? 377  GLN B CB    1  
ATOM   5817   C  CG    A GLN B 1 378 ? -37.470 -38.265 -3.194  0.05 11.36 ? 377  GLN B CG    1  
ATOM   5818   C  CD    A GLN B 1 378 ? -37.110 -39.691 -3.564  0.05 11.32 ? 377  GLN B CD    1  
ATOM   5819   O  OE1   A GLN B 1 378 ? -36.119 -40.236 -3.076  0.05 11.34 ? 377  GLN B OE1   1  
ATOM   5820   N  NE2   A GLN B 1 378 ? -37.901 -40.299 -4.442  0.05 11.29 ? 377  GLN B NE2   1  
ATOM   5821   N  N     A ALA B 1 379 ? -35.859 -35.541 -1.334  0.05 11.51 ? 378  ALA B N     1  
ATOM   5822   C  CA    A ALA B 1 379 ? -35.856 -35.324 0.113   0.05 11.73 ? 378  ALA B CA    1  
ATOM   5823   C  C     A ALA B 1 379 ? -36.400 -33.944 0.506   0.05 11.83 ? 378  ALA B C     1  
ATOM   5824   O  O     A ALA B 1 379 ? -37.049 -33.790 1.546   0.05 12.04 ? 378  ALA B O     1  
ATOM   5825   C  CB    A ALA B 1 379 ? -34.456 -35.521 0.663   0.05 11.74 ? 378  ALA B CB    1  
ATOM   5826   N  N     A GLU B 1 380 ? -36.115 -32.942 -0.318  0.05 11.71 ? 379  GLU B N     1  
ATOM   5827   C  CA    A GLU B 1 380 ? -36.609 -31.584 -0.082  0.05 11.82 ? 379  GLU B CA    1  
ATOM   5828   C  C     A GLU B 1 380 ? -38.124 -31.521 -0.287  0.05 11.93 ? 379  GLU B C     1  
ATOM   5829   O  O     A GLU B 1 380 ? -38.836 -30.920 0.511   0.05 12.17 ? 379  GLU B O     1  
ATOM   5830   C  CB    A GLU B 1 380 ? -35.875 -30.588 -0.989  0.05 11.68 ? 379  GLU B CB    1  
ATOM   5831   C  CG    A GLU B 1 380 ? -36.210 -29.108 -0.781  0.05 11.82 ? 379  GLU B CG    1  
ATOM   5832   C  CD    A GLU B 1 380 ? -35.293 -28.195 -1.590  0.05 11.72 ? 379  GLU B CD    1  
ATOM   5833   O  OE1   A GLU B 1 380 ? -35.388 -26.941 -1.456  0.05 11.85 ? 379  GLU B OE1   1  
ATOM   5834   O  OE2   A GLU B 1 380 ? -34.473 -28.745 -2.362  0.05 11.53 ? 379  GLU B OE2   1  
ATOM   5835   N  N     A MET B 1 381 ? -38.613 -32.163 -1.346  0.05 11.79 ? 380  MET B N     1  
ATOM   5836   C  CA    A MET B 1 381 ? -40.040 -32.179 -1.641  0.05 11.89 ? 380  MET B CA    1  
ATOM   5837   C  C     A MET B 1 381 ? -40.809 -32.982 -0.603  0.05 12.11 ? 380  MET B C     1  
ATOM   5838   O  O     A MET B 1 381 ? -41.948 -32.656 -0.279  0.05 12.33 ? 380  MET B O     1  
ATOM   5839   C  CB    A MET B 1 381 ? -40.298 -32.740 -3.041  0.05 11.69 ? 380  MET B CB    1  
ATOM   5840   C  CG    A MET B 1 381 ? -39.585 -31.962 -4.124  0.05 11.53 ? 380  MET B CG    1  
ATOM   5841   S  SD    A MET B 1 381 ? -39.898 -32.619 -5.770  0.05 11.34 ? 380  MET B SD    1  
ATOM   5842   C  CE    A MET B 1 381 ? -41.651 -32.302 -5.930  0.05 11.53 ? 380  MET B CE    1  
ATOM   5843   N  N     A ALA B 1 382 ? -40.171 -34.021 -0.070  0.05 12.08 ? 381  ALA B N     1  
ATOM   5844   C  CA    A ALA B 1 382 ? -40.797 -34.861 0.944   0.05 12.32 ? 381  ALA B CA    1  
ATOM   5845   C  C     A ALA B 1 382 ? -40.998 -34.111 2.262   0.05 12.61 ? 381  ALA B C     1  
ATOM   5846   O  O     A ALA B 1 382 ? -41.606 -34.639 3.195   0.05 12.88 ? 381  ALA B O     1  
ATOM   5847   C  CB    A ALA B 1 382 ? -39.988 -36.130 1.167   0.05 12.28 ? 381  ALA B CB    1  
ATOM   5848   N  N     A GLN B 1 383 ? -40.493 -32.883 2.332   0.05 11.23 ? 382  GLN B N     1  
ATOM   5849   C  CA    A GLN B 1 383 ? -40.705 -32.042 3.504   0.05 11.19 ? 382  GLN B CA    1  
ATOM   5850   C  C     A GLN B 1 383 ? -41.544 -30.809 3.199   0.05 11.12 ? 382  GLN B C     1  
ATOM   5851   O  O     A GLN B 1 383 ? -41.989 -30.124 4.118   0.05 11.09 ? 382  GLN B O     1  
ATOM   5852   C  CB    A GLN B 1 383 ? -39.374 -31.621 4.125   0.05 11.23 ? 382  GLN B CB    1  
ATOM   5853   C  CG    A GLN B 1 383 ? -38.507 -32.784 4.571   0.05 11.31 ? 382  GLN B CG    1  
ATOM   5854   C  CD    A GLN B 1 383 ? -39.210 -33.706 5.557   0.05 11.32 ? 382  GLN B CD    1  
ATOM   5855   O  OE1   A GLN B 1 383 ? -40.046 -33.264 6.344   0.05 11.28 ? 382  GLN B OE1   1  
ATOM   5856   N  NE2   A GLN B 1 383 ? -38.876 -35.002 5.511   0.05 11.39 ? 382  GLN B NE2   1  
ATOM   5857   N  N     A GLU B 1 384 ? -41.756 -30.519 1.917   0.05 11.10 ? 383  GLU B N     1  
ATOM   5858   C  CA    A GLU B 1 384 ? -42.568 -29.357 1.548   0.05 11.03 ? 383  GLU B CA    1  
ATOM   5859   C  C     A GLU B 1 384 ? -43.971 -29.463 2.140   0.05 11.00 ? 383  GLU B C     1  
ATOM   5860   O  O     A GLU B 1 384 ? -44.498 -28.486 2.676   0.05 10.97 ? 383  GLU B O     1  
ATOM   5861   C  CB    A GLU B 1 384 ? -42.566 -29.116 0.030   0.05 11.02 ? 383  GLU B CB    1  
ATOM   5862   C  CG    A GLU B 1 384 ? -41.181 -28.719 -0.465  0.05 11.04 ? 383  GLU B CG    1  
ATOM   5863   C  CD    A GLU B 1 384 ? -41.100 -28.510 -1.971  0.05 11.04 ? 383  GLU B CD    1  
ATOM   5864   O  OE1   A GLU B 1 384 ? -41.968 -29.030 -2.702  0.05 11.05 ? 383  GLU B OE1   1  
ATOM   5865   O  OE2   A GLU B 1 384 ? -40.148 -27.835 -2.418  0.05 11.05 ? 383  GLU B OE2   1  
ATOM   5866   N  N     A GLY B 1 385 ? -44.548 -30.659 2.090   0.05 11.03 ? 384  GLY B N     1  
ATOM   5867   C  CA    A GLY B 1 385 ? -45.726 -30.964 2.886   0.05 11.02 ? 384  GLY B CA    1  
ATOM   5868   C  C     A GLY B 1 385 ? -47.028 -31.144 2.125   0.05 11.00 ? 384  GLY B C     1  
ATOM   5869   O  O     A GLY B 1 385 ? -47.972 -31.758 2.637   0.05 11.01 ? 384  GLY B O     1  
ATOM   5870   N  N     A GLY B 1 386 ? -47.092 -30.592 0.916   0.05 10.99 ? 385  GLY B N     1  
ATOM   5871   C  CA    A GLY B 1 386 ? -48.243 -30.782 0.051   0.05 10.99 ? 385  GLY B CA    1  
ATOM   5872   C  C     A GLY B 1 386 ? -49.559 -30.291 0.621   0.05 10.97 ? 385  GLY B C     1  
ATOM   5873   O  O     A GLY B 1 386 ? -49.603 -29.312 1.368   0.05 10.94 ? 385  GLY B O     1  
ATOM   5874   N  N     A THR B 1 387 ? -50.634 -30.999 0.278   0.05 11.00 ? 386  THR B N     1  
ATOM   5875   C  CA    A THR B 1 387 ? -51.992 -30.584 0.618   0.05 10.99 ? 386  THR B CA    1  
ATOM   5876   C  C     A THR B 1 387 ? -52.200 -30.363 2.120   0.05 10.98 ? 386  THR B C     1  
ATOM   5877   O  O     A THR B 1 387 ? -52.748 -29.341 2.525   0.05 10.97 ? 386  THR B O     1  
ATOM   5878   C  CB    A THR B 1 387 ? -53.041 -31.585 0.045   0.05 11.03 ? 386  THR B CB    1  
ATOM   5879   O  OG1   A THR B 1 387 ? -54.329 -31.362 0.643   0.05 11.03 ? 386  THR B OG1   1  
ATOM   5880   C  CG2   A THR B 1 387 ? -52.599 -33.015 0.308   0.05 11.08 ? 386  THR B CG2   1  
ATOM   5881   N  N     A ARG B 1 388 ? -51.753 -31.312 2.942   0.05 11.01 ? 387  ARG B N     1  
ATOM   5882   C  CA    A ARG B 1 388 ? -51.970 -31.224 4.385   0.05 11.01 ? 387  ARG B CA    1  
ATOM   5883   C  C     A ARG B 1 388 ? -51.191 -30.072 5.044   0.05 10.98 ? 387  ARG B C     1  
ATOM   5884   O  O     A ARG B 1 388 ? -51.684 -29.435 5.981   0.05 10.98 ? 387  ARG B O     1  
ATOM   5885   C  CB    A ARG B 1 388 ? -51.645 -32.561 5.073   0.05 11.04 ? 387  ARG B CB    1  
ATOM   5886   C  CG    A ARG B 1 388 ? -50.169 -32.765 5.399   0.05 11.05 ? 387  ARG B CG    1  
ATOM   5887   C  CD    A ARG B 1 388 ? -49.851 -34.188 5.854   0.05 11.09 ? 387  ARG B CD    1  
ATOM   5888   N  NE    A ARG B 1 388 ? -49.759 -35.095 4.710   0.05 11.13 ? 387  ARG B NE    1  
ATOM   5889   C  CZ    A ARG B 1 388 ? -49.672 -36.418 4.800   0.05 11.18 ? 387  ARG B CZ    1  
ATOM   5890   N  NH1   A ARG B 1 388 ? -49.597 -37.154 3.694   0.05 11.22 ? 387  ARG B NH1   1  
ATOM   5891   N  NH2   A ARG B 1 388 ? -49.662 -37.000 5.988   0.05 11.19 ? 387  ARG B NH2   1  
ATOM   5892   N  N     A ARG B 1 389 ? -49.970 -29.809 4.583   0.05 10.97 ? 388  ARG B N     1  
ATOM   5893   C  CA    A ARG B 1 389 ? -49.210 -28.721 5.181   0.05 10.95 ? 388  ARG B CA    1  
ATOM   5894   C  C     A ARG B 1 389 ? -49.777 -27.382 4.721   0.05 10.92 ? 388  ARG B C     1  
ATOM   5895   O  O     A ARG B 1 389 ? -49.823 -26.428 5.494   0.05 10.92 ? 388  ARG B O     1  
ATOM   5896   C  CB    A ARG B 1 389 ? -47.708 -28.813 4.875   0.05 10.95 ? 388  ARG B CB    1  
ATOM   5897   C  CG    A ARG B 1 389 ? -46.898 -27.667 5.481   0.05 10.95 ? 388  ARG B CG    1  
ATOM   5898   C  CD    A ARG B 1 389 ? -45.480 -28.088 5.869   0.05 10.98 ? 388  ARG B CD    1  
ATOM   5899   N  NE    A ARG B 1 389 ? -44.684 -26.961 6.357   0.05 10.99 ? 388  ARG B NE    1  
ATOM   5900   C  CZ    A ARG B 1 389 ? -43.830 -26.280 5.598   0.05 10.98 ? 388  ARG B CZ    1  
ATOM   5901   N  NH1   A ARG B 1 389 ? -43.663 -26.622 4.329   0.05 10.97 ? 388  ARG B NH1   1  
ATOM   5902   N  NH2   A ARG B 1 389 ? -43.140 -25.268 6.104   0.05 10.99 ? 388  ARG B NH2   1  
ATOM   5903   N  N     A ALA B 1 390 ? -50.216 -27.319 3.465   0.05 10.91 ? 389  ALA B N     1  
ATOM   5904   C  CA    A ALA B 1 390 ? -50.834 -26.096 2.973   0.05 10.89 ? 389  ALA B CA    1  
ATOM   5905   C  C     A ALA B 1 390 ? -52.042 -25.762 3.836   0.05 10.90 ? 389  ALA B C     1  
ATOM   5906   O  O     A ALA B 1 390 ? -52.200 -24.634 4.295   0.05 10.90 ? 389  ALA B O     1  
ATOM   5907   C  CB    A ALA B 1 390 ? -51.233 -26.226 1.513   0.05 10.88 ? 389  ALA B CB    1  
ATOM   5908   N  N     A ALA B 1 391 ? -52.878 -26.762 4.093   0.05 10.93 ? 390  ALA B N     1  
ATOM   5909   C  CA    A ALA B 1 391 ? -54.038 -26.542 4.948   0.05 10.96 ? 390  ALA B CA    1  
ATOM   5910   C  C     A ALA B 1 391 ? -53.616 -26.182 6.373   0.05 10.97 ? 390  ALA B C     1  
ATOM   5911   O  O     A ALA B 1 391 ? -54.233 -25.340 7.008   0.05 10.99 ? 390  ALA B O     1  
ATOM   5912   C  CB    A ALA B 1 391 ? -54.960 -27.759 4.932   0.05 11.00 ? 390  ALA B CB    1  
ATOM   5913   N  N     A ASP B 1 392 ? -52.551 -26.814 6.867   0.05 10.97 ? 391  ASP B N     1  
ATOM   5914   C  CA    A ASP B 1 392 ? -51.990 -26.463 8.170   0.05 10.99 ? 391  ASP B CA    1  
ATOM   5915   C  C     A ASP B 1 392 ? -51.526 -25.007 8.238   0.05 10.98 ? 391  ASP B C     1  
ATOM   5916   O  O     A ASP B 1 392 ? -51.761 -24.307 9.230   0.05 11.01 ? 391  ASP B O     1  
ATOM   5917   C  CB    A ASP B 1 392 ? -50.786 -27.352 8.491   0.05 11.00 ? 391  ASP B CB    1  
ATOM   5918   C  CG    A ASP B 1 392 ? -51.147 -28.558 9.328   0.05 11.02 ? 391  ASP B CG    1  
ATOM   5919   O  OD1   A ASP B 1 392 ? -52.264 -29.095 9.169   0.05 11.04 ? 391  ASP B OD1   1  
ATOM   5920   O  OD2   A ASP B 1 392 ? -50.286 -28.982 10.132  0.05 11.03 ? 391  ASP B OD2   1  
ATOM   5921   N  N     A LEU B 1 393 ? -50.831 -24.565 7.196   0.05 10.95 ? 392  LEU B N     1  
ATOM   5922   C  CA    A LEU B 1 393 ? -50.234 -23.232 7.204   0.05 10.94 ? 392  LEU B CA    1  
ATOM   5923   C  C     A LEU B 1 393 ? -51.303 -22.162 7.063   0.05 10.95 ? 392  LEU B C     1  
ATOM   5924   O  O     A LEU B 1 393 ? -51.154 -21.052 7.564   0.05 10.97 ? 392  LEU B O     1  
ATOM   5925   C  CB    A LEU B 1 393 ? -49.195 -23.105 6.093   0.05 10.91 ? 392  LEU B CB    1  
ATOM   5926   C  CG    A LEU B 1 393 ? -47.915 -23.892 6.352   0.05 10.92 ? 392  LEU B CG    1  
ATOM   5927   C  CD1   A LEU B 1 393 ? -47.093 -24.047 5.072   0.05 10.90 ? 392  LEU B CD1   1  
ATOM   5928   C  CD2   A LEU B 1 393 ? -47.105 -23.221 7.445   0.05 10.96 ? 392  LEU B CD2   1  
ATOM   5929   N  N     A ILE B 1 394 ? -52.383 -22.507 6.381   0.05 10.94 ? 393  ILE B N     1  
ATOM   5930   C  CA    A ILE B 1 394 ? -53.520 -21.604 6.301   0.05 10.96 ? 393  ILE B CA    1  
ATOM   5931   C  C     A ILE B 1 394 ? -54.176 -21.479 7.674   0.05 11.02 ? 393  ILE B C     1  
ATOM   5932   O  O     A ILE B 1 394 ? -54.503 -20.384 8.116   0.05 11.05 ? 393  ILE B O     1  
ATOM   5933   C  CB    A ILE B 1 394 ? -54.530 -22.067 5.253   0.05 10.96 ? 393  ILE B CB    1  
ATOM   5934   C  CG1   A ILE B 1 394 ? -53.933 -21.895 3.849   0.05 10.91 ? 393  ILE B CG1   1  
ATOM   5935   C  CG2   A ILE B 1 394 ? -55.845 -21.286 5.390   0.05 11.00 ? 393  ILE B CG2   1  
ATOM   5936   C  CD1   A ILE B 1 394 ? -54.645 -22.680 2.781   0.05 10.91 ? 393  ILE B CD1   1  
ATOM   5937   N  N     A GLU B 1 395 ? -54.344 -22.601 8.364   0.05 11.03 ? 394  GLU B N     1  
ATOM   5938   C  CA    A GLU B 1 395 ? -54.930 -22.556 9.702   0.05 11.09 ? 394  GLU B CA    1  
ATOM   5939   C  C     A GLU B 1 395 ? -54.049 -21.739 10.648  0.05 11.11 ? 394  GLU B C     1  
ATOM   5940   O  O     A GLU B 1 395 ? -54.554 -21.035 11.521  0.05 11.17 ? 394  GLU B O     1  
ATOM   5941   C  CB    A GLU B 1 395 ? -55.169 -23.972 10.243  0.05 11.10 ? 394  GLU B CB    1  
ATOM   5942   C  CG    A GLU B 1 395 ? -56.288 -24.708 9.521   0.05 11.11 ? 394  GLU B CG    1  
ATOM   5943   C  CD    A GLU B 1 395 ? -56.354 -26.189 9.870   0.05 11.13 ? 394  GLU B CD    1  
ATOM   5944   O  OE1   A GLU B 1 395 ? -55.423 -26.673 10.540  0.05 11.11 ? 394  GLU B OE1   1  
ATOM   5945   O  OE2   A GLU B 1 395 ? -57.332 -26.860 9.468   0.05 11.16 ? 394  GLU B OE2   1  
ATOM   5946   N  N     A ALA B 1 396 ? -52.735 -21.806 10.450  0.05 11.08 ? 395  ALA B N     1  
ATOM   5947   C  CA    A ALA B 1 396 ? -51.800 -20.998 11.230  0.05 11.11 ? 395  ALA B CA    1  
ATOM   5948   C  C     A ALA B 1 396 ? -52.099 -19.508 11.084  0.05 11.13 ? 395  ALA B C     1  
ATOM   5949   O  O     A ALA B 1 396 ? -51.730 -18.709 11.949  0.05 11.17 ? 395  ALA B O     1  
ATOM   5950   C  CB    A ALA B 1 396 ? -50.367 -21.291 10.815  0.05 11.08 ? 395  ALA B CB    1  
ATOM   5951   N  N     A GLU B 1 397 ? -52.783 -19.147 9.998   0.05 11.10 ? 396  GLU B N     1  
ATOM   5952   C  CA    A GLU B 1 397 ? -53.088 -17.739 9.704   0.05 11.12 ? 396  GLU B CA    1  
ATOM   5953   C  C     A GLU B 1 397 ? -54.465 -17.279 10.178  0.05 11.18 ? 396  GLU B C     1  
ATOM   5954   O  O     A GLU B 1 397 ? -54.801 -16.095 10.069  0.05 11.21 ? 396  GLU B O     1  
ATOM   5955   C  CB    A GLU B 1 397 ? -52.957 -17.441 8.207   0.05 11.06 ? 396  GLU B CB    1  
ATOM   5956   C  CG    A GLU B 1 397 ? -51.572 -17.661 7.631   0.05 11.01 ? 396  GLU B CG    1  
ATOM   5957   C  CD    A GLU B 1 397 ? -50.548 -16.700 8.181   0.05 11.04 ? 396  GLU B CD    1  
ATOM   5958   O  OE1   A GLU B 1 397 ? -49.343 -17.020 8.107   0.05 11.02 ? 396  GLU B OE1   1  
ATOM   5959   O  OE2   A GLU B 1 397 ? -50.942 -15.624 8.680   0.05 11.09 ? 396  GLU B OE2   1  
ATOM   5960   N  N     A LEU B 1 398 ? -55.274 -18.203 10.685  0.05 11.22 ? 397  LEU B N     1  
ATOM   5961   C  CA    A LEU B 1 398 ? -56.546 -17.815 11.287  0.05 11.29 ? 397  LEU B CA    1  
ATOM   5962   C  C     A LEU B 1 398 ? -56.257 -16.885 12.465  0.05 11.37 ? 397  LEU B C     1  
ATOM   5963   O  O     A LEU B 1 398 ? -55.228 -17.033 13.123  0.05 11.37 ? 397  LEU B O     1  
ATOM   5964   C  CB    A LEU B 1 398 ? -57.326 -19.059 11.721  0.05 11.31 ? 397  LEU B CB    1  
ATOM   5965   C  CG    A LEU B 1 398 ? -57.869 -19.854 10.537  0.05 11.25 ? 397  LEU B CG    1  
ATOM   5966   C  CD1   A LEU B 1 398 ? -58.491 -21.165 10.992  0.05 11.26 ? 397  LEU B CD1   1  
ATOM   5967   C  CD2   A LEU B 1 398 ? -58.869 -19.009 9.772   0.05 11.26 ? 397  LEU B CD2   1  
ATOM   5968   N  N     A PRO B 1 399 ? -57.150 -15.908 12.724  0.05 11.45 ? 398  PRO B N     1  
ATOM   5969   C  CA    A PRO B 1 399 ? -56.880 -14.908 13.763  0.05 11.54 ? 398  PRO B CA    1  
ATOM   5970   C  C     A PRO B 1 399 ? -56.907 -15.538 15.149  0.05 11.59 ? 398  PRO B C     1  
ATOM   5971   O  O     A PRO B 1 399 ? -57.685 -16.467 15.340  0.05 11.58 ? 398  PRO B O     1  
ATOM   5972   C  CB    A PRO B 1 399 ? -58.045 -13.926 13.606  0.05 11.62 ? 398  PRO B CB    1  
ATOM   5973   C  CG    A PRO B 1 399 ? -59.169 -14.778 13.126  0.05 11.57 ? 398  PRO B CG    1  
ATOM   5974   C  CD    A PRO B 1 399 ? -58.520 -15.795 12.196  0.05 11.46 ? 398  PRO B CD    1  
HETATM 5975   C  C10   A ERY C 2 .   ? -15.370 -11.818 -20.672 0.05 10.63 ? 1400 ERY A C10   1  
HETATM 5976   C  C11   A ERY C 2 .   ? -13.900 -12.090 -20.483 0.05 10.65 ? 1400 ERY A C11   1  
HETATM 5977   C  C12   A ERY C 2 .   ? -13.285 -13.099 -21.470 0.05 10.66 ? 1400 ERY A C12   1  
HETATM 5978   C  C13   A ERY C 2 .   ? -11.772 -13.008 -21.352 0.05 10.70 ? 1400 ERY A C13   1  
HETATM 5979   O  O2    A ERY C 2 .   ? -11.381 -11.836 -22.039 0.05 10.72 ? 1400 ERY A O2    1  
HETATM 5980   C  C2    A ERY C 2 .   ? -10.427 -9.581  -22.050 0.05 10.79 ? 1400 ERY A C2    1  
HETATM 5981   C  C3    A ERY C 2 .   ? -11.045 -8.342  -21.401 0.05 10.79 ? 1400 ERY A C3    1  
HETATM 5982   C  C4    A ERY C 2 .   ? -12.424 -8.165  -21.962 0.05 10.76 ? 1400 ERY A C4    1  
HETATM 5983   C  C5    A ERY C 2 .   ? -13.288 -7.191  -21.120 0.05 10.76 ? 1400 ERY A C5    1  
HETATM 5984   C  C6    A ERY C 2 .   ? -14.258 -7.997  -20.245 0.05 10.72 ? 1400 ERY A C6    1  
HETATM 5985   C  C7    A ERY C 2 .   ? -15.355 -8.626  -21.128 0.05 10.68 ? 1400 ERY A C7    1  
HETATM 5986   C  C8    A ERY C 2 .   ? -16.396 -9.406  -20.282 0.05 10.65 ? 1400 ERY A C8    1  
HETATM 5987   C  C9    A ERY C 2 .   ? -15.843 -10.707 -19.733 0.05 10.64 ? 1400 ERY A C9    1  
HETATM 5988   O  O11   A ERY C 2 .   ? -15.802 -10.891 -18.519 0.05 10.65 ? 1400 ERY A O11   1  
HETATM 5989   C  C1    A ERY C 2 .   ? -10.872 -10.778 -21.229 0.05 10.75 ? 1400 ERY A C1    1  
HETATM 5990   O  O1    A ERY C 2 .   ? -10.417 -10.996 -20.119 0.05 10.76 ? 1400 ERY A O1    1  
HETATM 5991   O  O3    A ERY C 2 .   ? -10.268 -7.180  -21.670 0.05 10.86 ? 1400 ERY A O3    1  
HETATM 5992   O  O7    A ERY C 2 .   ? -14.024 -6.329  -21.987 0.05 10.78 ? 1400 ERY A O7    1  
HETATM 5993   C  C34   A ERY C 2 .   ? -16.207 -13.055 -20.349 0.05 10.61 ? 1400 ERY A C34   1  
HETATM 5994   C  C33   A ERY C 2 .   ? -17.601 -9.721  -21.132 0.05 10.63 ? 1400 ERY A C33   1  
HETATM 5995   C  C35   A ERY C 2 .   ? -13.701 -12.760 -22.873 0.05 10.66 ? 1400 ERY A C35   1  
HETATM 5996   O  O12   A ERY C 2 .   ? -13.675 -12.539 -19.151 0.05 10.67 ? 1400 ERY A O12   1  
HETATM 5997   O  O13   A ERY C 2 .   ? -13.659 -14.408 -21.196 0.05 10.65 ? 1400 ERY A O13   1  
HETATM 5998   C  C36   A ERY C 2 .   ? -11.065 -14.158 -22.044 0.05 10.72 ? 1400 ERY A C36   1  
HETATM 5999   C  C30   A ERY C 2 .   ? -8.931  -9.649  -22.140 0.05 10.84 ? 1400 ERY A C30   1  
HETATM 6000   C  C32   A ERY C 2 .   ? -14.893 -7.130  -19.194 0.05 10.74 ? 1400 ERY A C32   1  
HETATM 6001   O  O10   A ERY C 2 .   ? -13.547 -9.013  -19.606 0.05 10.71 ? 1400 ERY A O10   1  
HETATM 6002   C  C22   A ERY C 2 .   ? -13.720 -4.921  -21.882 0.05 10.84 ? 1400 ERY A C22   1  
HETATM 6003   C  C23   A ERY C 2 .   ? -14.343 -4.148  -23.063 0.05 10.87 ? 1400 ERY A C23   1  
HETATM 6004   C  C24   A ERY C 2 .   ? -14.196 -2.660  -22.849 0.05 10.95 ? 1400 ERY A C24   1  
HETATM 6005   C  C25   A ERY C 2 .   ? -14.724 -2.291  -21.474 0.05 10.94 ? 1400 ERY A C25   1  
HETATM 6006   C  C26   A ERY C 2 .   ? -13.991 -3.112  -20.407 0.05 10.92 ? 1400 ERY A C26   1  
HETATM 6007   O  O9    A ERY C 2 .   ? -14.196 -4.457  -20.681 0.05 10.85 ? 1400 ERY A O9    1  
HETATM 6008   N  N1    A ERY C 2 .   ? -14.857 -1.924  -23.928 0.05 11.00 ? 1400 ERY A N1    1  
HETATM 6009   C  C27   A ERY C 2 .   ? -14.539 -2.807  -19.027 0.05 10.93 ? 1400 ERY A C27   1  
HETATM 6010   O  O8    A ERY C 2 .   ? -13.670 -4.483  -24.240 0.05 10.89 ? 1400 ERY A O8    1  
HETATM 6011   C  C28   A ERY C 2 .   ? -14.719 -0.468  -23.721 0.05 11.09 ? 1400 ERY A C28   1  
HETATM 6012   C  C14   A ERY C 2 .   ? -9.383  -6.800  -20.607 0.05 10.90 ? 1400 ERY A C14   1  
HETATM 6013   C  C15   A ERY C 2 .   ? -8.440  -5.728  -21.179 0.05 10.99 ? 1400 ERY A C15   1  
HETATM 6014   C  C16   A ERY C 2 .   ? -9.115  -4.354  -21.271 0.05 11.03 ? 1400 ERY A C16   1  
HETATM 6015   C  C17   A ERY C 2 .   ? -9.690  -4.045  -19.921 0.05 11.02 ? 1400 ERY A C17   1  
HETATM 6016   C  C18   A ERY C 2 .   ? -10.729 -5.078  -19.581 0.05 10.93 ? 1400 ERY A C18   1  
HETATM 6017   O  O4    A ERY C 2 .   ? -10.110 -6.381  -19.506 0.05 10.89 ? 1400 ERY A O4    1  
HETATM 6018   O  O5    A ERY C 2 .   ? -10.157 -4.381  -22.271 0.05 11.00 ? 1400 ERY A O5    1  
HETATM 6019   O  O6    A ERY C 2 .   ? -10.230 -2.724  -19.939 0.05 11.06 ? 1400 ERY A O6    1  
HETATM 6020   C  C20   A ERY C 2 .   ? -9.698  -4.417  -23.631 0.05 11.02 ? 1400 ERY A C20   1  
HETATM 6021   C  C29   A ERY C 2 .   ? -16.247 -2.264  -24.059 0.05 10.96 ? 1400 ERY A C29   1  
HETATM 6022   C  C21   A ERY C 2 .   ? -11.342 -4.791  -18.242 0.05 10.92 ? 1400 ERY A C21   1  
HETATM 6023   C  C37   A ERY C 2 .   ? -9.543  -13.858 -22.071 0.05 10.77 ? 1400 ERY A C37   1  
HETATM 6024   C  C31   A ERY C 2 .   ? -12.285 -7.671  -23.419 0.05 10.79 ? 1400 ERY A C31   1  
HETATM 6025   C  C19   A ERY C 2 .   ? -8.098  -3.319  -21.633 0.05 11.13 ? 1400 ERY A C19   1  
HETATM 6026   N  N1    A UDP D 3 .   ? -5.202  5.601   -37.260 0.05 12.20 ? 1401 UDP A N1    1  
HETATM 6027   C  C2    A UDP D 3 .   ? -4.967  6.236   -38.462 0.05 12.18 ? 1401 UDP A C2    1  
HETATM 6028   N  N3    A UDP D 3 .   ? -4.470  7.525   -38.466 0.05 12.09 ? 1401 UDP A N3    1  
HETATM 6029   C  C4    A UDP D 3 .   ? -4.213  8.191   -37.286 0.05 12.03 ? 1401 UDP A C4    1  
HETATM 6030   C  C5    A UDP D 3 .   ? -4.457  7.542   -36.090 0.05 12.07 ? 1401 UDP A C5    1  
HETATM 6031   C  C6    A UDP D 3 .   ? -5.098  6.307   -36.098 0.05 12.14 ? 1401 UDP A C6    1  
HETATM 6032   O  O2    A UDP D 3 .   ? -5.193  5.652   -39.520 0.05 12.24 ? 1401 UDP A O2    1  
HETATM 6033   O  O4    A UDP D 3 .   ? -3.770  9.351   -37.280 0.05 11.96 ? 1401 UDP A O4    1  
HETATM 6034   C  "C1'" A UDP D 3 .   ? -5.737  4.230   -37.230 0.05 12.30 ? 1401 UDP A "C1'" 1  
HETATM 6035   C  "C2'" A UDP D 3 .   ? -4.638  3.213   -37.000 0.05 12.03 ? 1401 UDP A "C2'" 1  
HETATM 6036   O  "O2'" A UDP D 3 .   ? -4.113  2.739   -38.221 0.05 11.91 ? 1401 UDP A "O2'" 1  
HETATM 6037   C  "C3'" A UDP D 3 .   ? -5.347  2.131   -36.209 0.05 12.19 ? 1401 UDP A "C3'" 1  
HETATM 6038   C  "C4'" A UDP D 3 .   ? -6.433  2.881   -35.455 0.05 12.47 ? 1401 UDP A "C4'" 1  
HETATM 6039   O  "O4'" A UDP D 3 .   ? -6.605  4.112   -36.123 0.05 12.51 ? 1401 UDP A "O4'" 1  
HETATM 6040   O  "O3'" A UDP D 3 .   ? -5.953  1.213   -37.091 0.05 12.30 ? 1401 UDP A "O3'" 1  
HETATM 6041   C  "C5'" A UDP D 3 .   ? -6.040  3.131   -34.006 0.05 12.45 ? 1401 UDP A "C5'" 1  
HETATM 6042   O  "O5'" A UDP D 3 .   ? -6.207  1.950   -33.256 0.05 12.50 ? 1401 UDP A "O5'" 1  
HETATM 6043   P  PA    A UDP D 3 .   ? -5.167  1.550   -32.101 0.05 12.33 ? 1401 UDP A PA    1  
HETATM 6044   O  O1A   A UDP D 3 .   ? -5.647  0.316   -31.420 0.05 12.47 ? 1401 UDP A O1A   1  
HETATM 6045   O  O2A   A UDP D 3 .   ? -3.807  1.429   -32.673 0.05 12.00 ? 1401 UDP A O2A   1  
HETATM 6046   O  O3A   A UDP D 3 .   ? -5.110  2.764   -31.051 0.05 12.40 ? 1401 UDP A O3A   1  
HETATM 6047   P  PB    A UDP D 3 .   ? -6.348  3.356   -30.218 0.05 12.77 ? 1401 UDP A PB    1  
HETATM 6048   O  O1B   A UDP D 3 .   ? -6.701  4.646   -30.851 0.05 12.85 ? 1401 UDP A O1B   1  
HETATM 6049   O  O2B   A UDP D 3 .   ? -5.864  3.547   -28.838 0.05 12.75 ? 1401 UDP A O2B   1  
HETATM 6050   O  O3B   A UDP D 3 .   ? -7.507  2.442   -30.252 0.05 13.05 ? 1401 UDP A O3B   1  
HETATM 6051   C  C10   A ERY E 2 .   ? -49.800 -11.299 -11.854 0.05 10.56 ? 501  ERY B C10   1  
HETATM 6052   C  C11   A ERY E 2 .   ? -48.316 -11.568 -12.037 0.05 10.54 ? 501  ERY B C11   1  
HETATM 6053   C  C12   A ERY E 2 .   ? -47.637 -12.188 -10.811 0.05 10.55 ? 501  ERY B C12   1  
HETATM 6054   C  C13   A ERY E 2 .   ? -46.315 -12.799 -11.261 0.05 10.55 ? 501  ERY B C13   1  
HETATM 6055   O  O2    A ERY E 2 .   ? -46.554 -14.082 -11.826 0.05 10.57 ? 501  ERY B O2    1  
HETATM 6056   C  C2    A ERY E 2 .   ? -46.769 -15.586 -13.824 0.05 10.62 ? 501  ERY B C2    1  
HETATM 6057   C  C3    A ERY E 2 .   ? -47.656 -15.429 -15.069 0.05 10.63 ? 501  ERY B C3    1  
HETATM 6058   C  C4    A ERY E 2 .   ? -49.078 -15.268 -14.610 0.05 10.63 ? 501  ERY B C4    1  
HETATM 6059   C  C5    A ERY E 2 .   ? -49.985 -14.631 -15.693 0.05 10.64 ? 501  ERY B C5    1  
HETATM 6060   C  C6    A ERY E 2 .   ? -50.278 -13.177 -15.313 0.05 10.61 ? 501  ERY B C6    1  
HETATM 6061   C  C7    A ERY E 2 .   ? -51.261 -13.127 -14.125 0.05 10.62 ? 501  ERY B C7    1  
HETATM 6062   C  C8    A ERY E 2 .   ? -51.658 -11.683 -13.717 0.05 10.60 ? 501  ERY B C8    1  
HETATM 6063   C  C9    A ERY E 2 .   ? -50.497 -10.888 -13.150 0.05 10.57 ? 501  ERY B C9    1  
HETATM 6064   O  O11   A ERY E 2 .   ? -50.120 -9.878  -13.737 0.05 10.55 ? 501  ERY B O11   1  
HETATM 6065   C  C1    A ERY E 2 .   ? -46.492 -14.199 -13.258 0.05 10.58 ? 501  ERY B C1    1  
HETATM 6066   O  O1    A ERY E 2 .   ? -45.866 -13.388 -13.921 0.05 10.57 ? 501  ERY B O1    1  
HETATM 6067   O  O3    A ERY E 2 .   ? -47.605 -16.573 -15.935 0.05 10.67 ? 501  ERY B O3    1  
HETATM 6068   O  O7    A ERY E 2 .   ? -51.223 -15.341 -15.889 0.05 10.69 ? 501  ERY B O7    1  
HETATM 6069   C  C34   A ERY E 2 .   ? -50.080 -10.166 -10.871 0.05 10.57 ? 501  ERY B C34   1  
HETATM 6070   C  C33   A ERY E 2 .   ? -52.772 -11.737 -12.697 0.05 10.64 ? 501  ERY B C33   1  
HETATM 6071   C  C35   A ERY E 2 .   ? -48.497 -13.261 -10.189 0.05 10.58 ? 501  ERY B C35   1  
HETATM 6072   O  O12   A ERY E 2 .   ? -47.578 -10.396 -12.400 0.05 10.52 ? 501  ERY B O12   1  
HETATM 6073   O  O13   A ERY E 2 .   ? -47.393 -11.199 -9.866  0.05 10.55 ? 501  ERY B O13   1  
HETATM 6074   C  C36   A ERY E 2 .   ? -45.343 -12.961 -10.103 0.05 10.56 ? 501  ERY B C36   1  
HETATM 6075   C  C30   A ERY E 2 .   ? -45.416 -16.207 -13.998 0.05 10.64 ? 501  ERY B C30   1  
HETATM 6076   C  C32   A ERY E 2 .   ? -50.840 -12.471 -16.508 0.05 10.62 ? 501  ERY B C32   1  
HETATM 6077   O  O10   A ERY E 2 .   ? -49.077 -12.553 -14.949 0.05 10.57 ? 501  ERY B O10   1  
HETATM 6078   C  C22   A ERY E 2 .   ? -51.258 -16.146 -17.087 0.05 10.73 ? 501  ERY B C22   1  
HETATM 6079   C  C23   A ERY E 2 .   ? -52.451 -17.121 -17.089 0.05 10.79 ? 501  ERY B C23   1  
HETATM 6080   C  C24   A ERY E 2 .   ? -52.310 -18.006 -18.306 0.05 10.85 ? 501  ERY B C24   1  
HETATM 6081   C  C25   A ERY E 2 .   ? -52.254 -17.142 -19.551 0.05 10.85 ? 501  ERY B C25   1  
HETATM 6082   C  C26   A ERY E 2 .   ? -51.184 -16.055 -19.403 0.05 10.78 ? 501  ERY B C26   1  
HETATM 6083   O  O9    A ERY E 2 .   ? -51.346 -15.353 -18.210 0.05 10.73 ? 501  ERY B O9    1  
HETATM 6084   N  N1    A ERY E 2 .   ? -53.401 -18.966 -18.365 0.05 10.92 ? 501  ERY B N1    1  
HETATM 6085   C  C27   A ERY E 2 .   ? -51.257 -15.098 -20.573 0.05 10.77 ? 501  ERY B C27   1  
HETATM 6086   O  O8    A ERY E 2 .   ? -52.458 -17.925 -15.940 0.05 10.80 ? 501  ERY B O8    1  
HETATM 6087   C  C28   A ERY E 2 .   ? -54.695 -18.293 -18.187 0.05 10.93 ? 501  ERY B C28   1  
HETATM 6088   C  C14   A ERY E 2 .   ? -46.651 -16.515 -17.003 0.05 10.68 ? 501  ERY B C14   1  
HETATM 6089   C  C15   A ERY E 2 .   ? -46.532 -17.912 -17.638 0.05 10.75 ? 501  ERY B C15   1  
HETATM 6090   C  C16   A ERY E 2 .   ? -47.441 -18.172 -18.845 0.05 10.79 ? 501  ERY B C16   1  
HETATM 6091   C  C17   A ERY E 2 .   ? -47.421 -17.001 -19.760 0.05 10.77 ? 501  ERY B C17   1  
HETATM 6092   C  C18   A ERY E 2 .   ? -47.805 -15.755 -19.026 0.05 10.71 ? 501  ERY B C18   1  
HETATM 6093   O  O4    A ERY E 2 .   ? -46.973 -15.498 -17.885 0.05 10.67 ? 501  ERY B O4    1  
HETATM 6094   O  O5    A ERY E 2 .   ? -48.805 -18.400 -18.420 0.05 10.80 ? 501  ERY B O5    1  
HETATM 6095   O  O6    A ERY E 2 .   ? -48.391 -17.265 -20.763 0.05 10.82 ? 501  ERY B O6    1  
HETATM 6096   C  C20   A ERY E 2 .   ? -48.963 -19.263 -17.290 0.05 10.81 ? 501  ERY B C20   1  
HETATM 6097   C  C29   A ERY E 2 .   ? -53.405 -19.621 -19.636 0.05 10.99 ? 501  ERY B C29   1  
HETATM 6098   C  C21   A ERY E 2 .   ? -47.682 -14.598 -19.967 0.05 10.69 ? 501  ERY B C21   1  
HETATM 6099   C  C37   A ERY E 2 .   ? -44.285 -14.013 -10.509 0.05 10.58 ? 501  ERY B C37   1  
HETATM 6100   C  C31   A ERY E 2 .   ? -49.621 -16.645 -14.156 0.05 10.67 ? 501  ERY B C31   1  
HETATM 6101   C  C19   A ERY E 2 .   ? -46.919 -19.334 -19.635 0.05 10.87 ? 501  ERY B C19   1  
HETATM 6102   N  N1    A UDP F 3 .   ? -50.938 -38.946 -16.468 0.05 11.58 ? 502  UDP B N1    1  
HETATM 6103   C  C2    A UDP F 3 .   ? -51.357 -40.185 -16.029 0.05 11.58 ? 502  UDP B C2    1  
HETATM 6104   N  N3    A UDP F 3 .   ? -51.408 -41.239 -16.905 0.05 11.47 ? 502  UDP B N3    1  
HETATM 6105   C  C4    A UDP F 3 .   ? -51.060 -41.055 -18.223 0.05 11.37 ? 502  UDP B C4    1  
HETATM 6106   C  C5    A UDP F 3 .   ? -50.654 -39.800 -18.678 0.05 11.40 ? 502  UDP B C5    1  
HETATM 6107   C  C6    A UDP F 3 .   ? -50.676 -38.721 -17.797 0.05 11.53 ? 502  UDP B C6    1  
HETATM 6108   O  O2    A UDP F 3 .   ? -51.673 -40.353 -14.848 0.05 11.69 ? 502  UDP B O2    1  
HETATM 6109   O  O4    A UDP F 3 .   ? -51.122 -42.015 -18.979 0.05 11.30 ? 502  UDP B O4    1  
HETATM 6110   C  "C1'" A UDP F 3 .   ? -50.946 -37.842 -15.494 0.05 11.73 ? 502  UDP B "C1'" 1  
HETATM 6111   C  "C2'" A UDP F 3 .   ? -49.592 -37.390 -14.993 0.05 11.55 ? 502  UDP B "C2'" 1  
HETATM 6112   O  "O2'" A UDP F 3 .   ? -49.268 -38.064 -13.803 0.05 11.50 ? 502  UDP B "O2'" 1  
HETATM 6113   C  "C3'" A UDP F 3 .   ? -49.855 -35.934 -14.694 0.05 11.74 ? 502  UDP B "C3'" 1  
HETATM 6114   C  "C4'" A UDP F 3 .   ? -50.973 -35.534 -15.638 0.05 11.91 ? 502  UDP B "C4'" 1  
HETATM 6115   O  "O4'" A UDP F 3 .   ? -51.563 -36.728 -16.102 0.05 11.89 ? 502  UDP B "O4'" 1  
HETATM 6116   O  "O3'" A UDP F 3 .   ? -50.338 -35.826 -13.379 0.05 11.93 ? 502  UDP B "O3'" 1  
HETATM 6117   C  "C5'" A UDP F 3 .   ? -50.462 -34.721 -16.816 0.05 11.83 ? 502  UDP B "C5'" 1  
HETATM 6118   O  "O5'" A UDP F 3 .   ? -50.352 -33.375 -16.390 0.05 11.99 ? 502  UDP B "O5'" 1  
HETATM 6119   P  PA    A UDP F 3 .   ? -49.102 -32.501 -16.912 0.05 11.87 ? 502  UDP B PA    1  
HETATM 6120   O  O1A   A UDP F 3 .   ? -49.123 -31.189 -16.221 0.05 12.07 ? 502  UDP B O1A   1  
HETATM 6121   O  O2A   A UDP F 3 .   ? -47.845 -33.247 -16.712 0.05 11.58 ? 502  UDP B O2A   1  
HETATM 6122   O  O3A   A UDP F 3 .   ? -49.292 -32.389 -18.524 0.05 11.92 ? 502  UDP B O3A   1  
HETATM 6123   P  PB    A UDP F 3 .   ? -50.577 -31.829 -19.350 0.05 12.24 ? 502  UDP B PB    1  
HETATM 6124   O  O1B   A UDP F 3 .   ? -50.057 -31.314 -20.637 0.05 12.24 ? 502  UDP B O1B   1  
HETATM 6125   O  O2B   A UDP F 3 .   ? -51.241 -30.760 -18.558 0.05 12.53 ? 502  UDP B O2B   1  
HETATM 6126   O  O3B   A UDP F 3 .   ? -51.523 -32.951 -19.571 0.05 12.25 ? 502  UDP B O3B   1  
HETATM 6127   MG MG    A MG  G 4 .   ? -37.661 -45.553 -8.740  0.05 11.04 ? 503  MG  B MG    1  
HETATM 6128   O  O     A HOH H 5 .   ? -18.044 -2.953  -17.885 0.05 10.88 ? 1501 HOH A O     1  
HETATM 6129   O  O     A HOH H 5 .   ? -15.518 1.264   -10.862 0.05 11.37 ? 1502 HOH A O     1  
HETATM 6130   O  O     A HOH H 5 .   ? -20.490 -10.814 -16.421 0.05 10.65 ? 1503 HOH A O     1  
HETATM 6131   O  O     A HOH H 5 .   ? -0.191  -18.680 -38.942 0.05 11.96 ? 1504 HOH A O     1  
HETATM 6132   O  O     A HOH H 5 .   ? -33.042 -12.828 -18.934 0.05 11.02 ? 1505 HOH A O     1  
HETATM 6133   O  O     A HOH H 5 .   ? -13.750 -6.393  -7.469  0.05 11.19 ? 1506 HOH A O     1  
HETATM 6134   O  O     A HOH H 5 .   ? -15.577 -9.365  -31.996 0.05 10.94 ? 1507 HOH A O     1  
HETATM 6135   O  O     A HOH H 5 .   ? -24.002 -9.742  -22.409 0.05 10.69 ? 1508 HOH A O     1  
HETATM 6136   O  O     A HOH H 5 .   ? -35.991 -15.577 -22.845 0.05 11.30 ? 1509 HOH A O     1  
HETATM 6137   O  O     A HOH H 5 .   ? -15.004 0.119   -27.802 0.05 11.23 ? 1510 HOH A O     1  
HETATM 6138   O  O     A HOH H 5 .   ? -18.907 -18.094 -26.187 0.05 10.73 ? 1511 HOH A O     1  
HETATM 6139   O  O     A HOH H 5 .   ? -17.448 -16.226 -26.233 0.05 10.69 ? 1512 HOH A O     1  
HETATM 6140   O  O     A HOH H 5 .   ? -11.461 -13.252 -25.708 0.05 10.74 ? 1513 HOH A O     1  
HETATM 6141   O  O     A HOH H 5 .   ? -5.500  -8.628  -26.807 0.05 11.08 ? 1514 HOH A O     1  
HETATM 6142   O  O     A HOH H 5 .   ? -6.997  -22.359 -24.995 0.05 11.07 ? 1515 HOH A O     1  
HETATM 6143   O  O     A HOH H 5 .   ? -18.680 -20.920 -29.697 0.05 10.91 ? 1516 HOH A O     1  
HETATM 6144   O  O     A HOH H 5 .   ? -17.226 -13.031 -14.249 0.05 10.71 ? 1517 HOH A O     1  
HETATM 6145   O  O     A HOH H 5 .   ? -32.614 -20.407 -11.227 0.05 11.33 ? 1518 HOH A O     1  
HETATM 6146   O  O     A HOH H 5 .   ? -25.862 -8.146  -23.596 0.05 10.79 ? 1519 HOH A O     1  
HETATM 6147   O  O     A HOH H 5 .   ? -18.563 -25.956 -16.567 0.05 11.11 ? 1520 HOH A O     1  
HETATM 6148   O  O     A HOH H 5 .   ? -25.041 -23.014 -14.364 0.05 11.06 ? 1521 HOH A O     1  
HETATM 6149   O  O     A HOH H 5 .   ? -15.513 -15.664 -24.454 0.05 10.66 ? 1522 HOH A O     1  
HETATM 6150   O  O     A HOH H 5 .   ? -13.135 -23.383 -24.638 0.05 10.93 ? 1523 HOH A O     1  
HETATM 6151   O  O     A HOH H 5 .   ? -13.664 -16.094 -28.235 0.05 10.76 ? 1524 HOH A O     1  
HETATM 6152   O  O     A HOH H 5 .   ? 2.127   -16.116 -17.611 0.05 11.61 ? 1525 HOH A O     1  
HETATM 6153   O  O     A HOH H 5 .   ? -19.510 -6.763  -0.497  0.05 11.58 ? 1526 HOH A O     1  
HETATM 6154   O  O     A HOH H 5 .   ? -2.865  -8.568  -27.738 0.05 12.44 ? 1527 HOH A O     1  
HETATM 6155   O  O     A HOH H 5 .   ? 7.286   -0.684  -43.249 0.05 10.70 ? 1528 HOH A O     1  
HETATM 6156   O  O     A HOH H 5 .   ? -11.387 -17.423 -24.154 0.05 10.76 ? 1529 HOH A O     1  
HETATM 6157   O  O     A HOH H 5 .   ? -11.041 -22.131 -23.721 0.05 10.91 ? 1530 HOH A O     1  
HETATM 6158   O  O     A HOH H 5 .   ? 13.404  -1.110  -41.122 0.05 10.43 ? 1531 HOH A O     1  
HETATM 6159   O  O     A HOH H 5 .   ? -11.215 -17.361 -7.280  0.05 11.29 ? 1532 HOH A O     1  
HETATM 6160   O  O     A HOH H 5 .   ? -20.195 -19.356 -28.242 0.05 10.81 ? 1533 HOH A O     1  
HETATM 6161   O  O     A HOH H 5 .   ? 0.272   3.567   -32.352 0.05 11.29 ? 1534 HOH A O     1  
HETATM 6162   O  O     A HOH H 5 .   ? 0.922   -13.871 -35.977 0.05 11.70 ? 1535 HOH A O     1  
HETATM 6163   O  O     A HOH H 5 .   ? 3.199   -18.140 -45.104 0.05 12.54 ? 1536 HOH A O     1  
HETATM 6164   O  O     A HOH H 5 .   ? -7.847  -24.519 -35.366 0.05 11.44 ? 1537 HOH A O     1  
HETATM 6165   O  O     A HOH H 5 .   ? 1.093   -17.797 -16.409 0.05 11.53 ? 1538 HOH A O     1  
HETATM 6166   O  O     A HOH H 5 .   ? -3.564  -9.348  -38.946 0.05 11.87 ? 1539 HOH A O     1  
HETATM 6167   O  O     A HOH H 5 .   ? -28.843 2.371   -28.206 0.05 11.63 ? 1540 HOH A O     1  
HETATM 6168   O  O     A HOH H 5 .   ? -0.495  -17.883 -36.234 0.05 11.63 ? 1541 HOH A O     1  
HETATM 6169   O  O     A HOH H 5 .   ? -4.564  -20.715 -34.828 0.05 11.40 ? 1542 HOH A O     1  
HETATM 6170   O  O     A HOH H 5 .   ? -19.331 -6.878  -36.949 0.05 11.36 ? 1543 HOH A O     1  
HETATM 6171   O  O     A HOH H 5 .   ? -24.258 -3.792  -13.417 0.05 10.92 ? 1544 HOH A O     1  
HETATM 6172   O  O     A HOH H 5 .   ? -13.446 -9.892  -16.666 0.05 10.76 ? 1545 HOH A O     1  
HETATM 6173   O  O     A HOH H 5 .   ? 11.791  -5.322  -41.541 0.05 10.75 ? 1546 HOH A O     1  
HETATM 6174   O  O     A HOH H 5 .   ? -3.746  -6.681  -32.427 0.05 12.06 ? 1547 HOH A O     1  
HETATM 6175   O  O     A HOH H 5 .   ? 16.042  1.181   -23.561 0.05 11.27 ? 1548 HOH A O     1  
HETATM 6176   O  O     A HOH H 5 .   ? -15.905 -12.901 -16.671 0.05 10.66 ? 1549 HOH A O     1  
HETATM 6177   O  O     A HOH H 5 .   ? -11.936 -7.815  -3.474  0.05 11.57 ? 1550 HOH A O     1  
HETATM 6178   O  O     A HOH H 5 .   ? -11.746 -1.563  -33.186 0.05 11.44 ? 1551 HOH A O     1  
HETATM 6179   O  O     A HOH H 5 .   ? -34.688 0.081   -28.627 0.05 11.85 ? 1552 HOH A O     1  
HETATM 6180   O  O     A HOH H 5 .   ? -25.346 -24.356 -11.995 0.05 11.25 ? 1553 HOH A O     1  
HETATM 6181   O  O     A HOH H 5 .   ? -4.685  6.141   -29.308 0.05 12.57 ? 1554 HOH A O     1  
HETATM 6182   O  O     A HOH H 5 .   ? 3.772   -8.947  -20.356 0.05 13.01 ? 1555 HOH A O     1  
HETATM 6183   O  O     A HOH H 5 .   ? -8.120  -11.762 -5.661  0.05 11.49 ? 1556 HOH A O     1  
HETATM 6184   O  O     A HOH H 5 .   ? -37.634 -18.280 -27.226 0.05 11.62 ? 1557 HOH A O     1  
HETATM 6185   O  O     A HOH H 5 .   ? -25.727 -8.622  -26.249 0.05 10.85 ? 1558 HOH A O     1  
HETATM 6186   O  O     A HOH H 5 .   ? -21.340 -17.359 -5.571  0.05 11.19 ? 1559 HOH A O     1  
HETATM 6187   O  O     A HOH H 5 .   ? 15.676  23.555  -46.922 0.05 10.07 ? 1560 HOH A O     1  
HETATM 6188   O  O     A HOH H 5 .   ? -11.571 0.980   -22.219 0.05 11.27 ? 1561 HOH A O     1  
HETATM 6189   O  O     A HOH H 5 .   ? 3.331   -3.957  -46.406 0.05 11.41 ? 1562 HOH A O     1  
HETATM 6190   O  O     A HOH H 5 .   ? -11.451 -3.495  -6.176  0.05 11.45 ? 1563 HOH A O     1  
HETATM 6191   O  O     A HOH H 5 .   ? -29.902 0.841   -26.664 0.05 11.47 ? 1564 HOH A O     1  
HETATM 6192   O  O     A HOH H 5 .   ? 1.824   -20.667 -31.453 0.05 11.61 ? 1565 HOH A O     1  
HETATM 6193   O  O     A HOH H 5 .   ? -17.084 2.271   -28.564 0.05 11.42 ? 1566 HOH A O     1  
HETATM 6194   O  O     A HOH H 5 .   ? 9.351   -14.434 -35.817 0.05 11.33 ? 1567 HOH A O     1  
HETATM 6195   O  O     A HOH H 5 .   ? -30.043 -24.415 -23.170 0.05 11.27 ? 1568 HOH A O     1  
HETATM 6196   O  O     A HOH H 5 .   ? 3.313   14.429  -22.902 0.05 11.91 ? 1569 HOH A O     1  
HETATM 6197   O  O     A HOH H 5 .   ? -14.235 -23.842 -38.647 0.05 11.52 ? 1570 HOH A O     1  
HETATM 6198   O  O     A HOH H 5 .   ? -5.908  -2.127  -38.149 0.05 12.16 ? 1571 HOH A O     1  
HETATM 6199   O  O     A HOH H 5 .   ? -4.954  3.119   -41.758 0.05 12.21 ? 1572 HOH A O     1  
HETATM 6200   O  O     A HOH H 5 .   ? 13.764  -3.758  -41.156 0.05 10.63 ? 1573 HOH A O     1  
HETATM 6201   O  O     A HOH H 5 .   ? 8.338   -0.363  -45.432 0.05 10.85 ? 1574 HOH A O     1  
HETATM 6202   O  O     A HOH H 5 .   ? 11.961  -1.450  -42.893 0.05 10.63 ? 1575 HOH A O     1  
HETATM 6203   O  O     A HOH H 5 .   ? 15.723  -9.738  -32.551 0.05 11.28 ? 1576 HOH A O     1  
HETATM 6204   O  O     A HOH H 5 .   ? -5.140  -6.967  -24.362 0.05 11.05 ? 1577 HOH A O     1  
HETATM 6205   O  O     A HOH H 5 .   ? -9.467  -5.543  -32.738 0.05 11.23 ? 1578 HOH A O     1  
HETATM 6206   O  O     A HOH H 5 .   ? -4.385  -19.623 -38.127 0.05 11.56 ? 1579 HOH A O     1  
HETATM 6207   O  O     A HOH H 5 .   ? -4.173  -6.975  -29.875 0.05 12.33 ? 1580 HOH A O     1  
HETATM 6208   O  O     A HOH H 5 .   ? 5.310   -20.775 -20.572 0.05 11.97 ? 1581 HOH A O     1  
HETATM 6209   O  O     A HOH H 5 .   ? 6.251   12.409  -48.097 0.05 11.21 ? 1582 HOH A O     1  
HETATM 6210   O  O     A HOH H 5 .   ? 5.009   19.729  -41.946 0.05 10.84 ? 1583 HOH A O     1  
HETATM 6211   O  O     A HOH H 5 .   ? -7.938  -5.978  -16.338 0.05 11.06 ? 1584 HOH A O     1  
HETATM 6212   O  O     A HOH H 5 .   ? 11.208  -7.011  -43.445 0.05 10.97 ? 1585 HOH A O     1  
HETATM 6213   O  O     A HOH H 5 .   ? 10.504  -13.707 -33.919 0.05 11.38 ? 1586 HOH A O     1  
HETATM 6214   O  O     A HOH H 5 .   ? 4.436   -10.899 -20.900 0.05 12.88 ? 1587 HOH A O     1  
HETATM 6215   O  O     A HOH H 5 .   ? -7.122  -4.453  -15.132 0.05 11.21 ? 1588 HOH A O     1  
HETATM 6216   O  O     A HOH H 5 .   ? -10.425 -4.767  -9.305  0.05 11.28 ? 1589 HOH A O     1  
HETATM 6217   O  O     A HOH H 5 .   ? -27.359 -25.999 -22.635 0.05 12.36 ? 1590 HOH A O     1  
HETATM 6218   O  O     A HOH H 5 .   ? 18.505  -8.508  -32.381 0.05 11.38 ? 1591 HOH A O     1  
HETATM 6219   O  O     A HOH H 5 .   ? 7.486   5.602   -51.098 0.05 11.60 ? 1592 HOH A O     1  
HETATM 6220   O  O     A HOH H 5 .   ? -31.939 0.393   -38.711 0.05 12.41 ? 1593 HOH A O     1  
HETATM 6221   O  O     A HOH H 5 .   ? 8.049   -7.921  -46.423 0.05 11.29 ? 1594 HOH A O     1  
HETATM 6222   O  O     A HOH H 5 .   ? -0.527  22.399  -26.122 0.05 12.41 ? 1595 HOH A O     1  
HETATM 6223   O  O     A HOH H 5 .   ? -20.261 -1.445  -18.608 0.05 10.94 ? 1596 HOH A O     1  
HETATM 6224   O  O     A HOH H 5 .   ? -35.335 -17.802 -19.130 0.05 11.27 ? 1597 HOH A O     1  
HETATM 6225   O  O     A HOH H 5 .   ? 17.295  -9.915  -42.793 0.05 11.61 ? 1598 HOH A O     1  
HETATM 6226   O  O     A HOH H 5 .   ? 9.729   20.001  -45.019 0.05 10.37 ? 1599 HOH A O     1  
HETATM 6227   O  O     A HOH H 5 .   ? -35.334 -14.495 -20.128 0.05 11.19 ? 1600 HOH A O     1  
HETATM 6228   O  O     A HOH H 5 .   ? -21.460 -25.205 -30.159 0.05 11.16 ? 1601 HOH A O     1  
HETATM 6229   O  O     A HOH H 5 .   ? 8.695   20.922  -40.929 0.05 10.06 ? 1602 HOH A O     1  
HETATM 6230   O  O     A HOH H 5 .   ? -20.785 0.633   -15.974 0.05 11.06 ? 1603 HOH A O     1  
HETATM 6231   O  O     A HOH H 5 .   ? -33.068 -22.979 -11.189 0.05 11.76 ? 1604 HOH A O     1  
HETATM 6232   O  O     A HOH H 5 .   ? -24.920 2.920   -37.076 0.05 12.13 ? 1605 HOH A O     1  
HETATM 6233   O  O     A HOH H 5 .   ? 13.637  2.802   -20.845 0.05 11.63 ? 1606 HOH A O     1  
HETATM 6234   O  O     A HOH H 5 .   ? -12.554 -19.750 -6.582  0.05 11.37 ? 1607 HOH A O     1  
HETATM 6235   O  O     A HOH H 5 .   ? 19.183  12.438  -22.401 0.05 10.69 ? 1608 HOH A O     1  
HETATM 6236   O  O     A HOH H 5 .   ? -7.187  -23.347 -18.090 0.05 11.15 ? 1609 HOH A O     1  
HETATM 6237   O  O     A HOH H 5 .   ? -23.842 -27.794 -12.314 0.05 11.47 ? 1610 HOH A O     1  
HETATM 6238   O  O     A HOH H 5 .   ? 24.267  6.744   -28.534 0.05 10.55 ? 1611 HOH A O     1  
HETATM 6239   O  O     A HOH H 5 .   ? -4.883  -21.699 -32.079 0.05 11.29 ? 1612 HOH A O     1  
HETATM 6240   O  O     A HOH H 5 .   ? 15.767  -4.144  -39.181 0.05 10.65 ? 1613 HOH A O     1  
HETATM 6241   O  O     A HOH H 5 .   ? 15.574  1.733   -18.677 0.05 12.25 ? 1614 HOH A O     1  
HETATM 6242   O  O     A HOH H 5 .   ? 10.364  17.523  -24.026 0.05 10.84 ? 1615 HOH A O     1  
HETATM 6243   O  O     A HOH H 5 .   ? -32.659 -22.937 -37.102 0.05 12.04 ? 1616 HOH A O     1  
HETATM 6244   O  O     A HOH H 5 .   ? 21.741  -0.079  -28.624 0.05 11.06 ? 1617 HOH A O     1  
HETATM 6245   O  O     A HOH H 5 .   ? -12.666 -25.594 -40.058 0.05 11.69 ? 1618 HOH A O     1  
HETATM 6246   O  O     A HOH H 5 .   ? -19.179 -2.168  -5.130  0.05 11.39 ? 1619 HOH A O     1  
HETATM 6247   O  O     A HOH H 5 .   ? -6.606  -8.612  -19.436 0.05 11.01 ? 1620 HOH A O     1  
HETATM 6248   O  O     A HOH H 5 .   ? -28.937 -18.083 -5.239  0.05 11.35 ? 1621 HOH A O     1  
HETATM 6249   O  O     A HOH H 5 .   ? -34.300 -25.506 -26.315 0.05 11.69 ? 1622 HOH A O     1  
HETATM 6250   O  O     A HOH H 5 .   ? -2.573  -22.926 -30.180 0.05 11.39 ? 1623 HOH A O     1  
HETATM 6251   O  O     A HOH H 5 .   ? 19.787  0.309   -42.126 0.05 10.64 ? 1624 HOH A O     1  
HETATM 6252   O  O     A HOH H 5 .   ? -12.888 -15.580 -25.571 0.05 10.71 ? 1625 HOH A O     1  
HETATM 6253   O  O     A HOH H 5 .   ? -31.989 -24.188 -9.808  0.05 11.60 ? 1626 HOH A O     1  
HETATM 6254   O  O     A HOH H 5 .   ? -4.739  -20.913 -8.898  0.05 11.65 ? 1627 HOH A O     1  
HETATM 6255   O  O     A HOH H 5 .   ? -17.648 3.647   -24.724 0.05 11.39 ? 1628 HOH A O     1  
HETATM 6256   O  O     A HOH H 5 .   ? -7.851  -9.443  -5.097  0.05 11.56 ? 1629 HOH A O     1  
HETATM 6257   O  O     A HOH H 5 .   ? -29.384 -29.866 -43.450 0.05 12.85 ? 1630 HOH A O     1  
HETATM 6258   O  O     A HOH H 5 .   ? -9.866  -29.491 -26.931 0.05 11.39 ? 1631 HOH A O     1  
HETATM 6259   O  O     A HOH H 5 .   ? -3.868  -27.257 -29.940 0.05 11.54 ? 1632 HOH A O     1  
HETATM 6260   O  O     A HOH H 5 .   ? -5.901  18.323  -29.075 0.05 13.35 ? 1633 HOH A O     1  
HETATM 6261   O  O     A HOH H 5 .   ? -9.274  -11.857 -46.938 0.05 12.17 ? 1634 HOH A O     1  
HETATM 6262   O  O     A HOH H 5 .   ? -15.340 -7.745  -46.818 0.05 12.27 ? 1635 HOH A O     1  
HETATM 6263   O  O     A HOH H 5 .   ? 9.760   -2.151  -42.787 0.05 10.64 ? 1636 HOH A O     1  
HETATM 6264   O  O     A HOH H 5 .   ? -5.156  -11.497 -40.795 0.05 11.73 ? 1637 HOH A O     1  
HETATM 6265   O  O     A HOH H 5 .   ? -36.957 -6.532  -29.676 0.05 11.72 ? 1638 HOH A O     1  
HETATM 6266   O  O     A HOH H 5 .   ? -0.074  -15.224 -17.342 0.05 11.43 ? 1639 HOH A O     1  
HETATM 6267   O  O     A HOH H 5 .   ? -22.288 -3.002  -11.968 0.05 11.00 ? 1640 HOH A O     1  
HETATM 6268   O  O     A HOH H 5 .   ? -10.152 -6.893  -7.700  0.05 11.32 ? 1641 HOH A O     1  
HETATM 6269   O  O     A HOH H 5 .   ? -11.069 -5.700  -26.628 0.05 10.96 ? 1642 HOH A O     1  
HETATM 6270   O  O     A HOH H 5 .   ? -2.852  -11.706 -39.315 0.05 11.72 ? 1643 HOH A O     1  
HETATM 6271   O  O     A HOH H 5 .   ? 22.451  10.095  -39.680 0.05 9.91  ? 1644 HOH A O     1  
HETATM 6272   O  O     A HOH H 5 .   ? -23.554 -8.479  -6.497  0.05 11.07 ? 1645 HOH A O     1  
HETATM 6273   O  O     A HOH H 5 .   ? 7.723   -19.107 -37.499 0.05 11.82 ? 1646 HOH A O     1  
HETATM 6274   O  O     A HOH H 5 .   ? -15.753 -10.718 -51.881 0.05 12.84 ? 1647 HOH A O     1  
HETATM 6275   O  O     A HOH H 5 .   ? -27.802 -10.732 -45.808 0.05 12.44 ? 1648 HOH A O     1  
HETATM 6276   O  O     A HOH H 5 .   ? 11.595  -15.813 -36.622 0.05 11.58 ? 1649 HOH A O     1  
HETATM 6277   O  O     A HOH H 5 .   ? 12.186  -2.144  -22.208 0.05 11.79 ? 1650 HOH A O     1  
HETATM 6278   O  O     A HOH H 5 .   ? -24.883 -14.422 -2.207  0.05 11.41 ? 1651 HOH A O     1  
HETATM 6279   O  O     A HOH H 5 .   ? 13.683  -21.189 -40.737 0.05 12.50 ? 1652 HOH A O     1  
HETATM 6280   O  O     A HOH H 5 .   ? -20.112 -26.741 -35.968 0.05 11.53 ? 1653 HOH A O     1  
HETATM 6281   O  O     A HOH H 5 .   ? -8.367  -22.880 -20.967 0.05 11.05 ? 1654 HOH A O     1  
HETATM 6282   O  O     A HOH H 5 .   ? 23.018  0.645   -30.468 0.05 10.92 ? 1655 HOH A O     1  
HETATM 6283   O  O     A HOH H 5 .   ? -38.157 -12.838 -19.201 0.05 10.64 ? 1656 HOH A O     1  
HETATM 6284   O  O     A HOH H 5 .   ? 19.291  11.562  -20.423 0.05 11.14 ? 1657 HOH A O     1  
HETATM 6285   O  O     A HOH H 5 .   ? 6.961   -10.172 -47.401 0.05 11.56 ? 1658 HOH A O     1  
HETATM 6286   O  O     A HOH H 5 .   ? -9.581  -26.307 -24.129 0.05 11.19 ? 1659 HOH A O     1  
HETATM 6287   O  O     A HOH H 5 .   ? 1.942   -25.523 -29.609 0.05 11.72 ? 1660 HOH A O     1  
HETATM 6288   O  O     A HOH H 5 .   ? 10.496  23.200  -41.011 0.05 9.90  ? 1661 HOH A O     1  
HETATM 6289   O  O     A HOH H 5 .   ? 10.938  -2.589  -45.404 0.05 10.92 ? 1662 HOH A O     1  
HETATM 6290   O  O     A HOH H 5 .   ? 16.995  18.972  -42.128 0.05 9.53  ? 1663 HOH A O     1  
HETATM 6291   O  O     A HOH H 5 .   ? 2.235   -9.381  -22.445 0.05 12.85 ? 1664 HOH A O     1  
HETATM 6292   O  O     A HOH H 5 .   ? -13.562 -12.876 -15.438 0.05 10.75 ? 1665 HOH A O     1  
HETATM 6293   O  O     A HOH H 5 .   ? 23.220  11.989  -33.467 0.05 9.66  ? 1666 HOH A O     1  
HETATM 6294   O  O     A HOH H 5 .   ? -10.254 4.030   -14.975 0.05 11.62 ? 1667 HOH A O     1  
HETATM 6295   O  O     A HOH H 5 .   ? -19.432 -23.585 -33.624 0.05 11.23 ? 1668 HOH A O     1  
HETATM 6296   O  O     A HOH H 5 .   ? -7.318  13.362  -22.765 0.05 14.55 ? 1669 HOH A O     1  
HETATM 6297   O  O     A HOH H 5 .   ? -37.350 -18.817 -19.561 0.05 11.45 ? 1670 HOH A O     1  
HETATM 6298   O  O     A HOH H 5 .   ? -8.172  -9.570  -44.736 0.05 12.05 ? 1671 HOH A O     1  
HETATM 6299   O  O     A HOH H 5 .   ? -2.166  3.326   -33.903 0.05 11.62 ? 1672 HOH A O     1  
HETATM 6300   O  O     A HOH H 5 .   ? -25.128 -24.276 -29.493 0.05 11.22 ? 1673 HOH A O     1  
HETATM 6301   O  O     A HOH H 5 .   ? 22.243  2.623   -32.009 0.05 10.54 ? 1674 HOH A O     1  
HETATM 6302   O  O     A HOH H 5 .   ? -25.095 -25.620 -22.491 0.05 11.15 ? 1675 HOH A O     1  
HETATM 6303   O  O     A HOH H 5 .   ? -26.925 0.590   -46.695 0.05 13.08 ? 1676 HOH A O     1  
HETATM 6304   O  O     A HOH H 5 .   ? -27.571 -13.917 -3.671  0.05 11.36 ? 1677 HOH A O     1  
HETATM 6305   O  O     A HOH H 5 .   ? -27.053 -21.655 -50.227 0.05 12.95 ? 1678 HOH A O     1  
HETATM 6306   O  O     A HOH H 5 .   ? -5.517  -9.532  -18.014 0.05 11.08 ? 1679 HOH A O     1  
HETATM 6307   O  O     A HOH H 5 .   ? 12.045  -14.588 -42.440 0.05 11.66 ? 1680 HOH A O     1  
HETATM 6308   O  O     A HOH H 5 .   ? -22.181 6.198   -32.941 0.05 12.08 ? 1681 HOH A O     1  
HETATM 6309   O  O     A HOH H 5 .   ? -14.674 3.890   -13.696 0.05 11.49 ? 1682 HOH A O     1  
HETATM 6310   O  O     A HOH H 5 .   ? -20.196 -19.926 -50.131 0.05 12.66 ? 1683 HOH A O     1  
HETATM 6311   O  O     A HOH H 5 .   ? -5.654  -1.702  -27.886 0.05 12.83 ? 1684 HOH A O     1  
HETATM 6312   O  O     A HOH H 5 .   ? -9.304  1.010   -29.621 0.05 13.58 ? 1685 HOH A O     1  
HETATM 6313   O  O     A HOH H 5 .   ? -36.526 -14.789 -15.430 0.05 11.28 ? 1686 HOH A O     1  
HETATM 6314   O  O     A HOH H 5 .   ? -11.446 -2.647  -35.831 0.05 11.55 ? 1687 HOH A O     1  
HETATM 6315   O  O     A HOH H 5 .   ? -12.300 7.180   -19.513 0.05 11.82 ? 1688 HOH A O     1  
HETATM 6316   O  O     A HOH H 5 .   ? -9.695  -22.685 -11.246 0.05 11.32 ? 1689 HOH A O     1  
HETATM 6317   O  O     A HOH H 5 .   ? -10.267 -7.200  -37.586 0.05 11.43 ? 1690 HOH A O     1  
HETATM 6318   O  O     A HOH H 5 .   ? -12.523 0.476   -33.134 0.05 11.57 ? 1691 HOH A O     1  
HETATM 6319   O  O     A HOH H 5 .   ? 4.401   -13.276 -28.748 0.05 11.74 ? 1692 HOH A O     1  
HETATM 6320   O  O     A HOH H 5 .   ? 6.774   7.412   -18.034 0.05 12.60 ? 1693 HOH A O     1  
HETATM 6321   O  O     A HOH H 5 .   ? -0.047  10.433  -31.744 0.05 11.46 ? 1694 HOH A O     1  
HETATM 6322   O  O     A HOH H 5 .   ? 16.742  24.282  -39.655 0.05 9.30  ? 1695 HOH A O     1  
HETATM 6323   O  O     A HOH H 5 .   ? -14.810 -22.986 -13.883 0.05 11.05 ? 1696 HOH A O     1  
HETATM 6324   O  O     A HOH H 5 .   ? 8.070   17.861  -44.731 0.05 10.54 ? 1697 HOH A O     1  
HETATM 6325   O  O     A HOH H 5 .   ? -24.971 -19.964 -3.354  0.05 11.51 ? 1698 HOH A O     1  
HETATM 6326   O  O     A HOH H 5 .   ? 6.602   -5.551  -46.057 0.05 11.25 ? 1699 HOH A O     1  
HETATM 6327   O  O     A HOH H 5 .   ? -24.763 -8.215  -12.474 0.05 10.82 ? 1700 HOH A O     1  
HETATM 6328   O  O     A HOH H 5 .   ? 19.443  13.229  -32.949 0.05 9.51  ? 1701 HOH A O     1  
HETATM 6329   O  O     A HOH H 5 .   ? -4.865  -23.474 -38.496 0.05 11.67 ? 1702 HOH A O     1  
HETATM 6330   O  O     A HOH H 5 .   ? -40.865 -15.007 -40.040 0.05 12.83 ? 1703 HOH A O     1  
HETATM 6331   O  O     A HOH H 5 .   ? -32.361 -21.792 -43.154 0.05 12.55 ? 1704 HOH A O     1  
HETATM 6332   O  O     A HOH H 5 .   ? -36.777 -3.797  -30.909 0.05 11.88 ? 1705 HOH A O     1  
HETATM 6333   O  O     A HOH H 5 .   ? 16.946  11.836  -19.075 0.05 11.43 ? 1706 HOH A O     1  
HETATM 6334   O  O     A HOH H 5 .   ? -6.397  -4.504  -35.283 0.05 12.36 ? 1707 HOH A O     1  
HETATM 6335   O  O     A HOH H 5 .   ? -8.605  -9.244  -8.364  0.05 11.31 ? 1708 HOH A O     1  
HETATM 6336   O  O     A HOH H 5 .   ? -17.244 -28.365 -27.038 0.05 11.26 ? 1709 HOH A O     1  
HETATM 6337   O  O     A HOH H 5 .   ? -3.593  18.539  -29.379 0.05 12.73 ? 1710 HOH A O     1  
HETATM 6338   O  O     A HOH H 5 .   ? -8.622  -27.867 -21.835 0.05 11.35 ? 1711 HOH A O     1  
HETATM 6339   O  O     A HOH H 5 .   ? -1.095  19.100  -37.223 0.05 11.79 ? 1712 HOH A O     1  
HETATM 6340   O  O     A HOH H 5 .   ? -10.655 -19.081 -5.436  0.05 11.51 ? 1713 HOH A O     1  
HETATM 6341   O  O     A HOH H 5 .   ? -19.893 -24.642 -31.853 0.05 11.20 ? 1714 HOH A O     1  
HETATM 6342   O  O     A HOH H 5 .   ? -13.648 -7.211  -4.146  0.05 11.39 ? 1715 HOH A O     1  
HETATM 6343   O  O     A HOH H 5 .   ? 1.397   2.949   -49.165 0.05 11.92 ? 1716 HOH A O     1  
HETATM 6344   O  O     A HOH H 5 .   ? 9.134   11.849  -23.719 0.05 10.98 ? 1717 HOH A O     1  
HETATM 6345   O  O     A HOH H 5 .   ? -26.260 -20.113 -48.455 0.05 12.74 ? 1718 HOH A O     1  
HETATM 6346   O  O     A HOH H 5 .   ? -28.774 -24.542 -38.605 0.05 11.97 ? 1719 HOH A O     1  
HETATM 6347   O  O     A HOH H 5 .   ? -11.762 -19.019 -16.625 0.05 10.87 ? 1720 HOH A O     1  
HETATM 6348   O  O     A HOH H 5 .   ? -35.607 -12.463 -38.984 0.05 12.18 ? 1721 HOH A O     1  
HETATM 6349   O  O     A HOH H 5 .   ? 6.725   16.855  -47.032 0.05 10.95 ? 1722 HOH A O     1  
HETATM 6350   O  O     A HOH H 5 .   ? 3.508   -14.372 -17.972 0.05 11.70 ? 1723 HOH A O     1  
HETATM 6351   O  O     A HOH H 5 .   ? -28.619 -8.898  -12.087 0.05 10.92 ? 1724 HOH A O     1  
HETATM 6352   O  O     A HOH H 5 .   ? 5.781   20.566  -32.177 0.05 10.68 ? 1725 HOH A O     1  
HETATM 6353   O  O     A HOH H 5 .   ? 22.979  7.232   -31.258 0.05 10.15 ? 1726 HOH A O     1  
HETATM 6354   O  O     A HOH H 5 .   ? 16.414  7.983   -21.051 0.05 11.31 ? 1727 HOH A O     1  
HETATM 6355   O  O     A HOH H 5 .   ? 0.594   5.593   -50.706 0.05 12.27 ? 1728 HOH A O     1  
HETATM 6356   O  O     A HOH H 5 .   ? 23.959  12.245  -31.082 0.05 9.88  ? 1729 HOH A O     1  
HETATM 6357   O  O     A HOH H 5 .   ? -19.344 9.264   -20.597 0.05 11.89 ? 1730 HOH A O     1  
HETATM 6358   O  O     A HOH H 5 .   ? -4.812  -11.836 -19.631 0.05 11.06 ? 1731 HOH A O     1  
HETATM 6359   O  O     A HOH H 5 .   ? 1.684   -7.111  -46.012 0.05 11.69 ? 1732 HOH A O     1  
HETATM 6360   O  O     A HOH H 5 .   ? 16.099  22.647  -37.110 0.05 9.25  ? 1733 HOH A O     1  
HETATM 6361   O  O     A HOH H 5 .   ? -1.521  1.867   -49.295 0.05 12.39 ? 1734 HOH A O     1  
HETATM 6362   O  O     A HOH H 5 .   ? -28.821 -0.614  -45.821 0.05 12.96 ? 1735 HOH A O     1  
HETATM 6363   O  O     A HOH H 5 .   ? 23.802  4.794   -32.081 0.05 10.47 ? 1736 HOH A O     1  
HETATM 6364   O  O     A HOH H 5 .   ? -33.639 -19.095 -40.212 0.05 12.25 ? 1737 HOH A O     1  
HETATM 6365   O  O     A HOH H 5 .   ? -28.471 -21.030 -48.245 0.05 12.69 ? 1738 HOH A O     1  
HETATM 6366   O  O     A HOH H 5 .   ? -9.998  -4.107  -37.502 0.05 11.59 ? 1739 HOH A O     1  
HETATM 6367   O  O     A HOH H 5 .   ? -39.508 -13.228 -35.529 0.05 12.24 ? 1740 HOH A O     1  
HETATM 6368   O  O     A HOH H 5 .   ? -26.293 -12.705 -49.494 0.05 12.79 ? 1741 HOH A O     1  
HETATM 6369   O  O     A HOH H 5 .   ? -14.298 -2.052  -26.574 0.05 11.07 ? 1742 HOH A O     1  
HETATM 6370   O  O     A HOH H 5 .   ? -12.080 -27.339 -14.281 0.05 11.19 ? 1743 HOH A O     1  
HETATM 6371   O  O     A HOH H 5 .   ? -24.425 -26.439 -19.889 0.05 11.18 ? 1744 HOH A O     1  
HETATM 6372   O  O     A HOH H 5 .   ? 3.492   -20.520 -24.914 0.05 11.71 ? 1745 HOH A O     1  
HETATM 6373   O  O     A HOH H 5 .   ? 12.035  5.225   -15.530 0.05 12.92 ? 1746 HOH A O     1  
HETATM 6374   O  O     A HOH H 5 .   ? -16.534 -6.826  -3.678  0.05 11.38 ? 1747 HOH A O     1  
HETATM 6375   O  O     A HOH H 5 .   ? -8.116  -0.935  -24.473 0.05 13.94 ? 1748 HOH A O     1  
HETATM 6376   O  O     A HOH H 5 .   ? 4.738   22.520  -29.038 0.05 11.08 ? 1749 HOH A O     1  
HETATM 6377   O  O     A HOH H 5 .   ? -1.498  -22.092 -34.311 0.05 11.58 ? 1750 HOH A O     1  
HETATM 6378   O  O     A HOH H 5 .   ? -15.814 -3.506  -6.819  0.05 11.30 ? 1751 HOH A O     1  
HETATM 6379   O  O     A HOH H 5 .   ? -19.617 6.681   -32.364 0.05 12.06 ? 1752 HOH A O     1  
HETATM 6380   O  O     A HOH H 5 .   ? -27.481 -19.519 -7.617  0.05 11.22 ? 1753 HOH A O     1  
HETATM 6381   O  O     A HOH H 5 .   ? 10.297  0.517   -46.333 0.05 10.86 ? 1754 HOH A O     1  
HETATM 6382   O  O     A HOH H 5 .   ? -17.201 -17.945 -2.921  0.05 11.48 ? 1755 HOH A O     1  
HETATM 6383   O  O     A HOH H 5 .   ? -5.353  -8.403  -44.657 0.05 12.41 ? 1756 HOH A O     1  
HETATM 6384   O  O     A HOH H 5 .   ? 6.526   -12.104 -27.574 0.05 11.79 ? 1757 HOH A O     1  
HETATM 6385   O  O     A HOH H 5 .   ? 8.982   -5.885  -20.363 0.05 12.43 ? 1758 HOH A O     1  
HETATM 6386   O  O     A HOH H 5 .   ? -25.403 -5.815  2.844   0.05 11.89 ? 1759 HOH A O     1  
HETATM 6387   O  O     A HOH H 5 .   ? 21.610  -2.800  -34.470 0.05 10.94 ? 1760 HOH A O     1  
HETATM 6388   O  O     A HOH H 5 .   ? -12.250 -4.044  -27.910 0.05 11.02 ? 1761 HOH A O     1  
HETATM 6389   O  O     A HOH H 5 .   ? -37.715 -14.381 -42.957 0.05 12.84 ? 1762 HOH A O     1  
HETATM 6390   O  O     A HOH H 5 .   ? -16.702 -7.700  -33.733 0.05 11.08 ? 1763 HOH A O     1  
HETATM 6391   O  O     A HOH H 5 .   ? -14.648 -3.975  -48.260 0.05 12.66 ? 1764 HOH A O     1  
HETATM 6392   O  O     A HOH H 5 .   ? -2.309  -19.763 -35.841 0.05 11.54 ? 1765 HOH A O     1  
HETATM 6393   O  O     A HOH H 5 .   ? -8.404  -3.265  -13.678 0.05 11.24 ? 1766 HOH A O     1  
HETATM 6394   O  O     A HOH H 5 .   ? -1.274  26.366  -28.528 0.05 12.64 ? 1767 HOH A O     1  
HETATM 6395   O  O     A HOH H 5 .   ? 3.108   -14.598 -26.789 0.05 11.57 ? 1768 HOH A O     1  
HETATM 6396   O  O     A HOH H 5 .   ? 3.485   -20.489 -22.475 0.05 11.67 ? 1769 HOH A O     1  
HETATM 6397   O  O     A HOH H 5 .   ? -9.018  6.917   -50.175 0.05 14.06 ? 1770 HOH A O     1  
HETATM 6398   O  O     A HOH H 5 .   ? -11.687 4.317   -48.761 0.05 14.11 ? 1771 HOH A O     1  
HETATM 6399   O  O     A HOH I 5 .   ? -32.807 -21.659 -22.987 0.05 11.27 ? 601  HOH B O     1  
HETATM 6400   O  O     A HOH I 5 .   ? -50.531 -7.900  -2.599  0.05 10.78 ? 602  HOH B O     1  
HETATM 6401   O  O     A HOH I 5 .   ? -73.924 -16.549 -3.653  0.05 12.22 ? 603  HOH B O     1  
HETATM 6402   O  O     A HOH I 5 .   ? -44.430 -28.049 -10.828 0.05 12.04 ? 604  HOH B O     1  
HETATM 6403   O  O     A HOH I 5 .   ? -55.259 0.666   -21.335 0.05 10.67 ? 605  HOH B O     1  
HETATM 6404   O  O     A HOH I 5 .   ? -50.676 -43.377 -10.405 0.05 11.95 ? 606  HOH B O     1  
HETATM 6405   O  O     A HOH I 5 .   ? -30.793 -16.107 -7.566  0.05 11.15 ? 607  HOH B O     1  
HETATM 6406   O  O     A HOH I 5 .   ? -48.839 -6.598  -1.416  0.05 10.82 ? 608  HOH B O     1  
HETATM 6407   O  O     A HOH I 5 .   ? -48.012 -39.347 -24.222 0.05 11.00 ? 609  HOH B O     1  
HETATM 6408   O  O     A HOH I 5 .   ? -25.658 -41.556 -6.239  0.05 11.45 ? 610  HOH B O     1  
HETATM 6409   O  O     A HOH I 5 .   ? -47.239 -14.260 -6.594  0.05 10.61 ? 611  HOH B O     1  
HETATM 6410   O  O     A HOH I 5 .   ? -58.764 -24.874 -6.623  0.05 11.08 ? 612  HOH B O     1  
HETATM 6411   O  O     A HOH I 5 .   ? -53.398 -6.122  -14.031 0.05 10.62 ? 613  HOH B O     1  
HETATM 6412   O  O     A HOH I 5 .   ? -30.706 -41.782 -11.209 0.05 10.73 ? 614  HOH B O     1  
HETATM 6413   O  O     A HOH I 5 .   ? -48.052 -4.932  -24.782 0.05 10.48 ? 615  HOH B O     1  
HETATM 6414   O  O     A HOH I 5 .   ? -51.333 -10.526 -2.782  0.05 10.75 ? 616  HOH B O     1  
HETATM 6415   O  O     A HOH I 5 .   ? -58.677 -1.929  0.729   0.05 11.41 ? 617  HOH B O     1  
HETATM 6416   O  O     A HOH I 5 .   ? -51.253 -12.538 1.201   0.05 10.84 ? 618  HOH B O     1  
HETATM 6417   O  O     A HOH I 5 .   ? -66.739 -1.826  -3.398  0.05 11.79 ? 619  HOH B O     1  
HETATM 6418   O  O     A HOH I 5 .   ? -53.243 -8.422  3.418   0.05 11.07 ? 620  HOH B O     1  
HETATM 6419   O  O     A HOH I 5 .   ? -48.469 -15.795 -4.510  0.05 10.66 ? 621  HOH B O     1  
HETATM 6420   O  O     A HOH I 5 .   ? -40.352 -36.849 -2.519  0.05 11.65 ? 622  HOH B O     1  
HETATM 6421   O  O     A HOH I 5 .   ? -56.330 -22.485 -17.639 0.05 11.13 ? 623  HOH B O     1  
HETATM 6422   O  O     A HOH I 5 .   ? -51.157 -12.308 -4.546  0.05 10.68 ? 624  HOH B O     1  
HETATM 6423   O  O     A HOH I 5 .   ? -46.968 -16.216 -8.677  0.05 10.62 ? 625  HOH B O     1  
HETATM 6424   O  O     A HOH I 5 .   ? -54.055 -20.859 -7.119  0.05 10.81 ? 626  HOH B O     1  
HETATM 6425   O  O     A HOH I 5 .   ? -28.879 -15.023 -7.080  0.05 11.27 ? 627  HOH B O     1  
HETATM 6426   O  O     A HOH I 5 .   ? -39.224 -12.897 -2.689  0.05 10.79 ? 628  HOH B O     1  
HETATM 6427   O  O     A HOH I 5 .   ? -44.745 -13.046 -6.218  0.05 10.61 ? 629  HOH B O     1  
HETATM 6428   O  O     A HOH I 5 .   ? -34.619 -23.803 -8.533  0.05 11.16 ? 630  HOH B O     1  
HETATM 6429   O  O     A HOH I 5 .   ? -44.308 -30.378 -5.567  0.05 11.08 ? 631  HOH B O     1  
HETATM 6430   O  O     A HOH I 5 .   ? -49.187 -12.308 -6.677  0.05 10.62 ? 632  HOH B O     1  
HETATM 6431   O  O     A HOH I 5 .   ? -69.028 -25.817 -12.381 0.05 11.93 ? 633  HOH B O     1  
HETATM 6432   O  O     A HOH I 5 .   ? -64.404 -1.268  -8.646  0.05 11.45 ? 634  HOH B O     1  
HETATM 6433   O  O     A HOH I 5 .   ? -52.853 -11.519 -0.973  0.05 10.84 ? 635  HOH B O     1  
HETATM 6434   O  O     A HOH I 5 .   ? -40.272 -22.901 1.822   0.05 10.95 ? 636  HOH B O     1  
HETATM 6435   O  O     A HOH I 5 .   ? -42.376 -10.468 -3.180  0.05 10.71 ? 637  HOH B O     1  
HETATM 6436   O  O     A HOH I 5 .   ? -43.906 -9.795  -0.935  0.05 10.79 ? 638  HOH B O     1  
HETATM 6437   O  O     A HOH I 5 .   ? -30.071 -29.614 -8.596  0.05 10.97 ? 639  HOH B O     1  
HETATM 6438   O  O     A HOH I 5 .   ? -26.383 -39.828 -1.942  0.05 11.55 ? 640  HOH B O     1  
HETATM 6439   O  O     A HOH I 5 .   ? -44.932 -26.157 -11.943 0.05 11.00 ? 641  HOH B O     1  
HETATM 6440   O  O     A HOH I 5 .   ? -54.089 7.172   -11.616 0.05 10.99 ? 642  HOH B O     1  
HETATM 6441   O  O     A HOH I 5 .   ? -32.562 -44.045 -12.457 0.05 10.68 ? 643  HOH B O     1  
HETATM 6442   O  O     A HOH I 5 .   ? -45.055 -35.906 -18.893 0.05 10.93 ? 644  HOH B O     1  
HETATM 6443   O  O     A HOH I 5 .   ? -62.575 1.164   -6.033  0.05 11.51 ? 645  HOH B O     1  
HETATM 6444   O  O     A HOH I 5 .   ? -61.361 -10.281 -10.741 0.05 11.05 ? 646  HOH B O     1  
HETATM 6445   O  O     A HOH I 5 .   ? -39.459 -21.117 -14.576 0.05 10.91 ? 647  HOH B O     1  
HETATM 6446   O  O     A HOH I 5 .   ? -33.656 -27.697 -4.793  0.05 11.34 ? 648  HOH B O     1  
HETATM 6447   O  O     A HOH I 5 .   ? -35.463 -9.877  -17.862 0.05 10.68 ? 649  HOH B O     1  
HETATM 6448   O  O     A HOH I 5 .   ? -52.197 2.922   -6.145  0.05 10.93 ? 650  HOH B O     1  
HETATM 6449   O  O     A HOH I 5 .   ? -32.373 -40.582 -9.067  0.05 10.77 ? 651  HOH B O     1  
HETATM 6450   O  O     A HOH I 5 .   ? -32.826 -24.869 -13.212 0.05 11.52 ? 652  HOH B O     1  
HETATM 6451   O  O     A HOH I 5 .   ? -49.970 -31.696 -10.295 0.05 12.36 ? 653  HOH B O     1  
HETATM 6452   O  O     A HOH I 5 .   ? -30.852 -17.873 -5.707  0.05 11.19 ? 654  HOH B O     1  
HETATM 6453   O  O     A HOH I 5 .   ? -45.871 -6.074  -24.836 0.05 10.48 ? 655  HOH B O     1  
HETATM 6454   O  O     A HOH I 5 .   ? -52.387 -50.943 -26.200 0.05 11.24 ? 656  HOH B O     1  
HETATM 6455   O  O     A HOH I 5 .   ? -44.600 -6.424  -0.081  0.05 10.87 ? 657  HOH B O     1  
HETATM 6456   O  O     A HOH I 5 .   ? -73.640 -10.688 3.308   0.05 12.46 ? 658  HOH B O     1  
HETATM 6457   O  O     A HOH I 5 .   ? -61.368 -12.869 -9.795  0.05 11.05 ? 659  HOH B O     1  
HETATM 6458   O  O     A HOH I 5 .   ? -54.027 -8.835  0.358   0.05 10.96 ? 660  HOH B O     1  
HETATM 6459   O  O     A HOH I 5 .   ? -46.274 7.018   -27.965 0.05 10.34 ? 661  HOH B O     1  
HETATM 6460   O  O     A HOH I 5 .   ? -38.462 -8.484  -21.025 0.05 10.56 ? 662  HOH B O     1  
HETATM 6461   O  O     A HOH I 5 .   ? -68.577 -14.747 8.762   0.05 11.98 ? 663  HOH B O     1  
HETATM 6462   O  O     A HOH I 5 .   ? -51.773 -25.427 11.410  0.05 11.08 ? 664  HOH B O     1  
HETATM 6463   O  O     A HOH I 5 .   ? -55.949 -22.468 -7.264  0.05 10.92 ? 665  HOH B O     1  
HETATM 6464   O  O     A HOH I 5 .   ? -49.943 -33.028 -30.189 0.05 12.54 ? 666  HOH B O     1  
HETATM 6465   O  O     A HOH I 5 .   ? -28.751 -41.248 -12.468 0.05 10.80 ? 667  HOH B O     1  
HETATM 6466   O  O     A HOH I 5 .   ? -51.945 -43.799 -35.475 0.05 11.90 ? 668  HOH B O     1  
HETATM 6467   O  O     A HOH I 5 .   ? -39.978 -3.438  -22.540 0.05 10.43 ? 669  HOH B O     1  
HETATM 6468   O  O     A HOH I 5 .   ? -53.397 -20.880 -16.680 0.05 10.96 ? 670  HOH B O     1  
HETATM 6469   O  O     A HOH I 5 .   ? -39.059 -11.040 6.287   0.05 11.23 ? 671  HOH B O     1  
HETATM 6470   O  O     A HOH I 5 .   ? -33.283 -32.090 0.898   0.05 11.71 ? 672  HOH B O     1  
HETATM 6471   O  O     A HOH I 5 .   ? -28.459 -36.827 -2.157  0.05 11.35 ? 673  HOH B O     1  
HETATM 6472   O  O     A HOH I 5 .   ? -47.401 -35.929 -17.430 0.05 11.25 ? 674  HOH B O     1  
HETATM 6473   O  O     A HOH I 5 .   ? -36.766 -42.947 -5.691  0.05 11.19 ? 675  HOH B O     1  
HETATM 6474   O  O     A HOH I 5 .   ? -58.408 -32.725 -0.365  0.05 11.23 ? 676  HOH B O     1  
HETATM 6475   O  O     A HOH I 5 .   ? -62.364 -23.351 12.213  0.05 11.48 ? 677  HOH B O     1  
HETATM 6476   O  O     A HOH I 5 .   ? -60.590 -26.161 12.913  0.05 11.35 ? 678  HOH B O     1  
HETATM 6477   O  O     A HOH I 5 .   ? -38.171 -28.662 1.694   0.05 12.38 ? 679  HOH B O     1  
HETATM 6478   O  O     A HOH I 5 .   ? -55.022 -7.767  5.623   0.05 11.23 ? 680  HOH B O     1  
HETATM 6479   O  O     A HOH I 5 .   ? -23.653 -41.982 -16.918 0.05 11.49 ? 681  HOH B O     1  
HETATM 6480   O  O     A HOH I 5 .   ? -21.046 -39.690 -14.850 0.05 11.75 ? 682  HOH B O     1  
HETATM 6481   O  O     A HOH I 5 .   ? -32.280 -31.539 -29.357 0.05 12.16 ? 683  HOH B O     1  
HETATM 6482   O  O     A HOH I 5 .   ? -37.377 -43.369 -7.683  0.05 10.96 ? 684  HOH B O     1  
HETATM 6483   O  O     A HOH I 5 .   ? -63.289 -15.807 -14.953 0.05 11.26 ? 685  HOH B O     1  
HETATM 6484   O  O     A HOH I 5 .   ? -24.099 -35.106 -13.684 0.05 11.20 ? 686  HOH B O     1  
HETATM 6485   O  O     A HOH I 5 .   ? -71.469 -24.534 -12.510 0.05 12.13 ? 687  HOH B O     1  
HETATM 6486   O  O     A HOH I 5 .   ? -37.793 -28.595 -3.941  0.05 11.63 ? 688  HOH B O     1  
HETATM 6487   O  O     A HOH I 5 .   ? -44.300 -12.961 -17.190 0.05 10.55 ? 689  HOH B O     1  
HETATM 6488   O  O     A HOH I 5 .   ? -49.606 -53.404 -23.654 0.05 11.06 ? 690  HOH B O     1  
HETATM 6489   O  O     A HOH I 5 .   ? -68.612 -17.138 -16.980 0.05 11.82 ? 691  HOH B O     1  
HETATM 6490   O  O     A HOH I 5 .   ? -58.327 -5.649  -21.255 0.05 10.92 ? 692  HOH B O     1  
HETATM 6491   O  O     A HOH I 5 .   ? -52.414 -14.062 10.120  0.05 11.22 ? 693  HOH B O     1  
HETATM 6492   O  O     A HOH I 5 .   ? -32.637 -29.694 -2.034  0.05 11.44 ? 694  HOH B O     1  
HETATM 6493   O  O     A HOH I 5 .   ? -41.995 -5.204  -24.856 0.05 10.47 ? 695  HOH B O     1  
HETATM 6494   O  O     A HOH I 5 .   ? -63.105 1.995   -15.202 0.05 11.23 ? 696  HOH B O     1  
HETATM 6495   O  O     A HOH I 5 .   ? -30.417 -34.400 1.023   0.05 11.69 ? 697  HOH B O     1  
HETATM 6496   O  O     A HOH I 5 .   ? -45.491 -37.326 -35.669 0.05 12.22 ? 698  HOH B O     1  
HETATM 6497   O  O     A HOH I 5 .   ? -48.963 -28.154 -10.877 0.05 11.04 ? 699  HOH B O     1  
HETATM 6498   O  O     A HOH I 5 .   ? -51.448 -40.776 -35.531 0.05 12.15 ? 700  HOH B O     1  
HETATM 6499   O  O     A HOH I 5 .   ? -49.676 -27.137 -8.624  0.05 10.95 ? 701  HOH B O     1  
HETATM 6500   O  O     A HOH I 5 .   ? -55.471 -33.122 -20.515 0.05 13.03 ? 702  HOH B O     1  
HETATM 6501   O  O     A HOH I 5 .   ? -72.020 -14.083 -14.491 0.05 12.01 ? 703  HOH B O     1  
HETATM 6502   O  O     A HOH I 5 .   ? -56.691 7.705   -13.652 0.05 11.02 ? 704  HOH B O     1  
HETATM 6503   O  O     A HOH I 5 .   ? -44.501 -30.624 -2.773  0.05 11.07 ? 705  HOH B O     1  
HETATM 6504   O  O     A HOH I 5 .   ? -22.011 -37.158 -6.505  0.05 11.63 ? 706  HOH B O     1  
HETATM 6505   O  O     A HOH I 5 .   ? -74.457 -17.724 7.938   0.05 12.41 ? 707  HOH B O     1  
HETATM 6506   O  O     A HOH I 5 .   ? -44.162 -58.254 -28.378 0.05 11.45 ? 708  HOH B O     1  
HETATM 6507   O  O     A HOH I 5 .   ? -34.607 -2.586  -18.816 0.05 10.57 ? 709  HOH B O     1  
HETATM 6508   O  O     A HOH I 5 .   ? -20.599 -44.400 -10.148 0.05 12.26 ? 710  HOH B O     1  
HETATM 6509   O  O     A HOH I 5 .   ? -22.482 -33.201 -12.787 0.05 11.44 ? 711  HOH B O     1  
HETATM 6510   O  O     A HOH I 5 .   ? -47.056 -36.026 -6.208  0.05 12.05 ? 712  HOH B O     1  
HETATM 6511   O  O     A HOH I 5 .   ? -64.718 -15.625 -17.123 0.05 11.42 ? 713  HOH B O     1  
HETATM 6512   O  O     A HOH I 5 .   ? -38.533 -38.062 -32.639 0.05 11.60 ? 714  HOH B O     1  
HETATM 6513   O  O     A HOH I 5 .   ? -25.040 -30.054 -13.203 0.05 11.23 ? 715  HOH B O     1  
HETATM 6514   O  O     A HOH I 5 .   ? -57.506 -0.075  -17.542 0.05 10.82 ? 716  HOH B O     1  
HETATM 6515   O  O     A HOH I 5 .   ? -53.903 -51.829 -8.320  0.05 13.33 ? 717  HOH B O     1  
HETATM 6516   O  O     A HOH I 5 .   ? -23.282 -45.061 -11.624 0.05 11.82 ? 718  HOH B O     1  
HETATM 6517   O  O     A HOH I 5 .   ? -69.418 -20.361 10.959  0.05 11.96 ? 719  HOH B O     1  
HETATM 6518   O  O     A HOH I 5 .   ? -43.647 -21.775 -12.625 0.05 10.82 ? 720  HOH B O     1  
HETATM 6519   O  O     A HOH I 5 .   ? -30.433 -44.247 -8.644  0.05 11.09 ? 721  HOH B O     1  
HETATM 6520   O  O     A HOH I 5 .   ? -43.566 -36.977 -33.810 0.05 11.91 ? 722  HOH B O     1  
HETATM 6521   O  O     A HOH I 5 .   ? -63.929 -2.715  -15.718 0.05 11.26 ? 723  HOH B O     1  
HETATM 6522   O  O     A HOH I 5 .   ? -54.048 -31.735 -16.992 0.05 12.93 ? 724  HOH B O     1  
HETATM 6523   O  O     A HOH I 5 .   ? -64.258 -30.139 -8.813  0.05 11.64 ? 725  HOH B O     1  
HETATM 6524   O  O     A HOH I 5 .   ? -24.753 -43.123 -7.270  0.05 11.62 ? 726  HOH B O     1  
HETATM 6525   O  O     A HOH I 5 .   ? -56.771 -40.252 -9.836  0.05 13.41 ? 727  HOH B O     1  
HETATM 6526   O  O     A HOH I 5 .   ? -51.526 -28.715 -18.843 0.05 13.02 ? 728  HOH B O     1  
HETATM 6527   O  O     A HOH I 5 .   ? -34.517 -38.922 -1.090  0.05 11.54 ? 729  HOH B O     1  
HETATM 6528   O  O     A HOH I 5 .   ? -56.573 -29.149 11.479  0.05 11.16 ? 730  HOH B O     1  
HETATM 6529   O  O     A HOH I 5 .   ? -27.347 -49.080 -11.814 0.05 11.79 ? 731  HOH B O     1  
HETATM 6530   O  O     A HOH I 5 .   ? -53.047 -39.423 -28.639 0.05 11.92 ? 732  HOH B O     1  
HETATM 6531   O  O     A HOH I 5 .   ? -51.064 -18.966 14.545  0.05 11.29 ? 733  HOH B O     1  
HETATM 6532   O  O     A HOH I 5 .   ? -46.585 6.621   -26.074 0.05 10.36 ? 734  HOH B O     1  
HETATM 6533   O  O     A HOH I 5 .   ? -52.482 -39.555 -22.603 0.05 11.63 ? 735  HOH B O     1  
HETATM 6534   O  O     A HOH I 5 .   ? -35.174 -50.893 -31.437 0.05 11.46 ? 736  HOH B O     1  
HETATM 6535   O  O     A HOH I 5 .   ? -42.417 -22.552 -21.839 0.05 13.09 ? 737  HOH B O     1  
HETATM 6536   O  O     A HOH I 5 .   ? -63.145 -13.028 -12.730 0.05 11.18 ? 738  HOH B O     1  
HETATM 6537   O  O     A HOH I 5 .   ? -49.513 -25.343 -11.067 0.05 10.96 ? 739  HOH B O     1  
HETATM 6538   O  O     A HOH I 5 .   ? -48.742 -19.963 7.825   0.05 10.97 ? 740  HOH B O     1  
HETATM 6539   O  O     A HOH I 5 .   ? -39.481 -43.554 -6.574  0.05 11.15 ? 741  HOH B O     1  
HETATM 6540   O  O     A HOH I 5 .   ? -39.763 3.672   -23.157 0.05 10.36 ? 742  HOH B O     1  
HETATM 6541   O  O     A HOH I 5 .   ? -62.030 -22.015 14.375  0.05 11.62 ? 743  HOH B O     1  
HETATM 6542   O  O     A HOH I 5 .   ? -40.875 -23.802 5.688   0.05 11.03 ? 744  HOH B O     1  
HETATM 6543   O  O     A HOH I 5 .   ? -30.179 -7.570  -9.915  0.05 10.99 ? 745  HOH B O     1  
HETATM 6544   O  O     A HOH I 5 .   ? -55.685 -5.153  -27.260 0.05 10.81 ? 746  HOH B O     1  
HETATM 6545   O  O     A HOH I 5 .   ? -46.799 4.139   -17.730 0.05 10.47 ? 747  HOH B O     1  
HETATM 6546   O  O     A HOH I 5 .   ? -46.269 -33.311 0.069   0.05 11.10 ? 748  HOH B O     1  
HETATM 6547   O  O     A HOH I 5 .   ? -36.920 -37.020 -36.116 0.05 12.47 ? 749  HOH B O     1  
HETATM 6548   O  O     A HOH I 5 .   ? -58.861 -22.195 -18.355 0.05 11.30 ? 750  HOH B O     1  
HETATM 6549   O  O     A HOH I 5 .   ? -67.352 -10.741 11.239  0.05 12.08 ? 751  HOH B O     1  
HETATM 6550   O  O     A HOH I 5 .   ? -74.429 -24.665 -2.555  0.05 12.22 ? 752  HOH B O     1  
HETATM 6551   O  O     A HOH I 5 .   ? -70.382 -5.586  -14.628 0.05 11.84 ? 753  HOH B O     1  
HETATM 6552   O  O     A HOH I 5 .   ? -37.945 -35.585 3.534   0.05 11.49 ? 754  HOH B O     1  
HETATM 6553   O  O     A HOH I 5 .   ? -52.819 -2.173  -28.289 0.05 10.62 ? 755  HOH B O     1  
HETATM 6554   O  O     A HOH I 5 .   ? -75.340 -8.921  -8.327  0.05 12.42 ? 756  HOH B O     1  
HETATM 6555   O  O     A HOH I 5 .   ? -56.825 -0.764  2.609   0.05 11.49 ? 757  HOH B O     1  
HETATM 6556   O  O     A HOH I 5 .   ? -23.906 -44.774 -25.349 0.05 12.18 ? 758  HOH B O     1  
HETATM 6557   O  O     A HOH I 5 .   ? -30.633 -35.670 -33.566 0.05 12.57 ? 759  HOH B O     1  
HETATM 6558   O  O     A HOH I 5 .   ? -64.087 -29.201 13.221  0.05 11.52 ? 760  HOH B O     1  
HETATM 6559   O  O     A HOH I 5 .   ? -71.844 -11.202 10.460  0.05 12.50 ? 761  HOH B O     1  
HETATM 6560   O  O     A HOH I 5 .   ? -74.770 -22.032 -9.068  0.05 12.35 ? 762  HOH B O     1  
HETATM 6561   O  O     A HOH I 5 .   ? -34.198 -24.801 -3.336  0.05 11.81 ? 763  HOH B O     1  
HETATM 6562   O  O     A HOH I 5 .   ? -31.587 -42.651 -6.549  0.05 11.08 ? 764  HOH B O     1  
HETATM 6563   O  O     A HOH I 5 .   ? -41.388 -36.241 -35.037 0.05 12.16 ? 765  HOH B O     1  
HETATM 6564   O  O     A HOH I 5 .   ? -37.172 -38.735 0.482   0.05 11.93 ? 766  HOH B O     1  
HETATM 6565   O  O     A HOH I 5 .   ? -32.381 -3.316  -17.101 0.05 11.16 ? 767  HOH B O     1  
HETATM 6566   O  O     A HOH I 5 .   ? -33.512 -25.173 -6.329  0.05 11.29 ? 768  HOH B O     1  
HETATM 6567   O  O     A HOH I 5 .   ? -25.798 -43.788 -9.630  0.05 11.39 ? 769  HOH B O     1  
HETATM 6568   O  O     A HOH I 5 .   ? -55.409 -29.573 -6.026  0.05 11.10 ? 770  HOH B O     1  
HETATM 6569   O  O     A HOH I 5 .   ? -51.645 -26.466 -18.942 0.05 13.47 ? 771  HOH B O     1  
HETATM 6570   O  O     A HOH I 5 .   ? -21.835 -31.551 -8.412  0.05 11.47 ? 772  HOH B O     1  
HETATM 6571   O  O     A HOH I 5 .   ? -20.312 -36.509 -3.898  0.05 11.94 ? 773  HOH B O     1  
HETATM 6572   O  O     A HOH I 5 .   ? -39.810 -10.447 -2.348  0.05 10.80 ? 774  HOH B O     1  
HETATM 6573   O  O     A HOH I 5 .   ? -26.391 -37.826 -17.905 0.05 11.05 ? 775  HOH B O     1  
HETATM 6574   O  O     A HOH I 5 .   ? -34.045 -44.181 -36.073 0.05 12.11 ? 776  HOH B O     1  
HETATM 6575   O  O     A HOH I 5 .   ? -49.271 -0.799  -26.116 0.05 10.47 ? 777  HOH B O     1  
HETATM 6576   O  O     A HOH I 5 .   ? -43.945 -1.328  -14.293 0.05 10.46 ? 778  HOH B O     1  
HETATM 6577   O  O     A HOH I 5 .   ? -46.566 9.016   -28.423 0.05 10.36 ? 779  HOH B O     1  
HETATM 6578   O  O     A HOH I 5 .   ? -47.004 -46.727 -2.963  0.05 12.76 ? 780  HOH B O     1  
HETATM 6579   O  O     A HOH I 5 .   ? -65.682 -20.725 -21.701 0.05 11.81 ? 781  HOH B O     1  
HETATM 6580   O  O     A HOH I 5 .   ? -50.232 -50.007 -17.105 0.05 11.37 ? 782  HOH B O     1  
HETATM 6581   O  O     A HOH I 5 .   ? -54.449 -34.823 -16.664 0.05 12.60 ? 783  HOH B O     1  
HETATM 6582   O  O     A HOH I 5 .   ? -61.200 -0.803  0.488   0.05 11.60 ? 784  HOH B O     1  
HETATM 6583   O  O     A HOH I 5 .   ? -31.717 -42.511 -34.757 0.05 12.22 ? 785  HOH B O     1  
HETATM 6584   O  O     A HOH I 5 .   ? -73.742 -18.635 -2.222  0.05 12.16 ? 786  HOH B O     1  
HETATM 6585   O  O     A HOH I 5 .   ? -39.562 -57.067 -20.339 0.05 11.47 ? 787  HOH B O     1  
HETATM 6586   O  O     A HOH I 5 .   ? -54.910 -0.650  3.435   0.05 11.44 ? 788  HOH B O     1  
HETATM 6587   O  O     A HOH I 5 .   ? -43.859 -31.393 5.982   0.05 11.09 ? 789  HOH B O     1  
HETATM 6588   O  O     A HOH I 5 .   ? -73.899 -21.070 -4.080  0.05 12.17 ? 790  HOH B O     1  
HETATM 6589   O  O     A HOH I 5 .   ? -70.705 -7.005  8.561   0.05 12.52 ? 791  HOH B O     1  
HETATM 6590   O  O     A HOH I 5 .   ? -49.177 -4.579  -13.978 0.05 10.51 ? 792  HOH B O     1  
HETATM 6591   O  O     A HOH I 5 .   ? -74.329 -24.768 -5.069  0.05 12.26 ? 793  HOH B O     1  
HETATM 6592   O  O     A HOH I 5 .   ? -27.161 -44.722 -29.496 0.05 12.09 ? 794  HOH B O     1  
HETATM 6593   O  O     A HOH I 5 .   ? -42.438 -40.686 -39.499 0.05 12.46 ? 795  HOH B O     1  
HETATM 6594   O  O     A HOH I 5 .   ? -34.092 -13.583 -14.564 0.05 11.12 ? 796  HOH B O     1  
HETATM 6595   O  O     A HOH I 5 .   ? -42.727 5.226   -15.785 0.05 10.49 ? 797  HOH B O     1  
HETATM 6596   O  O     A HOH I 5 .   ? -47.667 -51.411 -32.294 0.05 11.08 ? 798  HOH B O     1  
HETATM 6597   O  O     A HOH I 5 .   ? -25.432 -48.169 -12.391 0.05 11.89 ? 799  HOH B O     1  
HETATM 6598   O  O     A HOH I 5 .   ? -63.754 -10.687 10.190  0.05 11.84 ? 800  HOH B O     1  
HETATM 6599   O  O     A HOH I 5 .   ? -47.117 -11.089 -17.029 0.05 10.53 ? 801  HOH B O     1  
HETATM 6600   O  O     A HOH I 5 .   ? -50.771 -27.955 -2.322  0.05 10.92 ? 802  HOH B O     1  
HETATM 6601   O  O     A HOH I 5 .   ? -37.801 -7.162  -6.336  0.05 10.74 ? 803  HOH B O     1  
HETATM 6602   O  O     A HOH I 5 .   ? -40.669 -42.270 -4.723  0.05 11.47 ? 804  HOH B O     1  
HETATM 6603   O  O     A HOH I 5 .   ? -69.704 -17.220 7.868   0.05 11.97 ? 805  HOH B O     1  
HETATM 6604   O  O     A HOH I 5 .   ? -48.562 -6.822  -13.510 0.05 10.50 ? 806  HOH B O     1  
HETATM 6605   O  O     A HOH I 5 .   ? -36.874 -39.041 3.079   0.05 11.69 ? 807  HOH B O     1  
HETATM 6606   O  O     A HOH I 5 .   ? -72.022 -15.696 3.028   0.05 12.09 ? 808  HOH B O     1  
HETATM 6607   O  O     A HOH I 5 .   ? -38.097 -43.560 -9.936  0.05 10.79 ? 809  HOH B O     1  
HETATM 6608   O  O     A HOH I 5 .   ? -52.639 -48.992 -17.746 0.05 11.56 ? 810  HOH B O     1  
HETATM 6609   O  O     A HOH I 5 .   ? -41.906 -20.214 4.919   0.05 10.96 ? 811  HOH B O     1  
HETATM 6610   O  O     A HOH I 5 .   ? -67.584 -25.543 4.358   0.05 11.59 ? 812  HOH B O     1  
HETATM 6611   O  O     A HOH I 5 .   ? -39.675 -39.347 -0.716  0.05 11.96 ? 813  HOH B O     1  
HETATM 6612   O  O     A HOH I 5 .   ? -20.927 -30.196 -10.588 0.05 11.63 ? 814  HOH B O     1  
HETATM 6613   O  O     A HOH I 5 .   ? -72.545 -15.158 0.635   0.05 12.08 ? 815  HOH B O     1  
HETATM 6614   O  O     A HOH I 5 .   ? -45.727 6.111   -30.398 0.05 27.67 ? 816  HOH B O     1  
HETATM 6615   O  O     A HOH I 5 .   ? -70.247 -28.455 2.815   0.05 11.84 ? 817  HOH B O     1  
HETATM 6616   O  O     A HOH I 5 .   ? -45.403 -24.023 -12.768 0.05 10.88 ? 818  HOH B O     1  
HETATM 6617   O  O     A HOH I 5 .   ? -32.785 -25.405 -23.805 0.05 12.25 ? 819  HOH B O     1  
HETATM 6618   O  O     A HOH I 5 .   ? -73.787 -21.710 -11.439 0.05 12.27 ? 820  HOH B O     1  
HETATM 6619   O  O     A HOH I 5 .   ? -60.731 -19.699 14.391  0.05 11.54 ? 821  HOH B O     1  
HETATM 6620   O  O     A HOH I 5 .   ? -58.575 -43.704 -16.298 0.05 12.90 ? 822  HOH B O     1  
HETATM 6621   O  O     A HOH I 5 .   ? -43.342 -6.362  -22.770 0.05 10.45 ? 823  HOH B O     1  
HETATM 6622   O  O     A HOH I 5 .   ? -27.352 -43.921 -10.969 0.05 11.23 ? 824  HOH B O     1  
HETATM 6623   O  O     A HOH I 5 .   ? -62.620 -32.929 -5.432  0.05 11.48 ? 825  HOH B O     1  
HETATM 6624   O  O     A HOH I 5 .   ? -25.157 -45.717 -27.075 0.05 11.94 ? 826  HOH B O     1  
HETATM 6625   O  O     A HOH I 5 .   ? -58.560 -9.580  -10.739 0.05 10.89 ? 827  HOH B O     1  
HETATM 6626   O  O     A HOH I 5 .   ? -34.084 -2.941  -14.573 0.05 10.67 ? 828  HOH B O     1  
HETATM 6627   O  O     A HOH I 5 .   ? -42.224 -51.569 -34.148 0.05 11.26 ? 829  HOH B O     1  
HETATM 6628   O  O     A HOH I 5 .   ? -36.824 -47.318 -9.554  0.05 11.08 ? 830  HOH B O     1  
HETATM 6629   O  O     A HOH I 5 .   ? -39.801 -27.471 3.416   0.05 11.10 ? 831  HOH B O     1  
HETATM 6630   O  O     A HOH I 5 .   ? -43.137 -35.839 -2.138  0.05 12.01 ? 832  HOH B O     1  
HETATM 6631   O  O     A HOH I 5 .   ? -54.488 -49.392 -33.493 0.05 11.66 ? 833  HOH B O     1  
HETATM 6632   O  O     A HOH I 5 .   ? -46.343 -25.140 -17.621 0.05 12.77 ? 834  HOH B O     1  
HETATM 6633   O  O     A HOH I 5 .   ? -33.355 -58.383 -22.014 0.05 12.25 ? 835  HOH B O     1  
HETATM 6634   O  O     A HOH I 5 .   ? -27.303 -43.755 -6.901  0.05 11.45 ? 836  HOH B O     1  
HETATM 6635   O  O     A HOH I 5 .   ? -41.122 -4.989  -4.600  0.05 10.73 ? 837  HOH B O     1  
HETATM 6636   O  O     A HOH I 5 .   ? -56.450 -49.993 -24.869 0.05 11.80 ? 838  HOH B O     1  
HETATM 6637   O  O     A HOH I 5 .   ? -41.509 -2.387  -11.457 0.05 10.53 ? 839  HOH B O     1  
HETATM 6638   O  O     A HOH I 5 .   ? -66.755 -28.037 6.696   0.05 11.56 ? 840  HOH B O     1  
HETATM 6639   O  O     A HOH I 5 .   ? -43.294 -41.969 -42.029 0.05 15.54 ? 841  HOH B O     1  
HETATM 6640   O  O     A HOH I 5 .   ? -21.225 -39.278 -3.630  0.05 12.05 ? 842  HOH B O     1  
HETATM 6641   O  O     A HOH I 5 .   ? -51.031 -28.350 -6.919  0.05 10.98 ? 843  HOH B O     1  
HETATM 6642   O  O     A HOH I 5 .   ? -50.476 -29.305 -16.376 0.05 12.64 ? 844  HOH B O     1  
HETATM 6643   O  O     A HOH I 5 .   ? -46.560 -28.387 -9.022  0.05 11.01 ? 845  HOH B O     1  
HETATM 6644   O  O     A HOH I 5 .   ? -19.704 -40.993 -13.705 0.05 12.05 ? 846  HOH B O     1  
HETATM 6645   O  O     A HOH I 5 .   ? -39.530 -9.312  0.420   0.05 10.92 ? 847  HOH B O     1  
HETATM 6646   O  O     A HOH I 5 .   ? -46.633 -9.193  -15.219 0.05 10.49 ? 848  HOH B O     1  
HETATM 6647   O  O     A HOH I 5 .   ? -41.544 -25.493 -13.991 0.05 11.96 ? 849  HOH B O     1  
HETATM 6648   O  O     A HOH I 5 .   ? -25.361 -32.129 -5.408  0.05 11.23 ? 850  HOH B O     1  
ATOM   6649   N  N     B ALA A 1 8   ? -28.838 -20.973 -45.507 0.05 12.47 ? 7    ALA A N     2  
ATOM   6650   C  CA    B ALA A 1 8   ? -27.912 -20.287 -44.615 0.05 12.36 ? 7    ALA A CA    2  
ATOM   6651   C  C     B ALA A 1 8   ? -28.443 -18.939 -44.111 0.05 12.26 ? 7    ALA A C     2  
ATOM   6652   O  O     B ALA A 1 8   ? -28.301 -17.913 -44.773 0.05 12.27 ? 7    ALA A O     2  
ATOM   6653   C  CB    B ALA A 1 8   ? -26.599 -20.105 -45.314 0.05 12.49 ? 7    ALA A CB    2  
ATOM   6654   N  N     B HIS A 1 9   ? -29.069 -18.947 -42.939 0.05 12.20 ? 8    HIS A N     2  
ATOM   6655   C  CA    B HIS A 1 9   ? -29.371 -17.708 -42.224 0.05 12.10 ? 8    HIS A CA    2  
ATOM   6656   C  C     B HIS A 1 9   ? -28.360 -17.581 -41.087 0.05 11.92 ? 8    HIS A C     2  
ATOM   6657   O  O     B HIS A 1 9   ? -28.268 -18.459 -40.235 0.05 11.85 ? 8    HIS A O     2  
ATOM   6658   C  CB    B HIS A 1 9   ? -30.806 -17.733 -41.678 0.05 12.13 ? 8    HIS A CB    2  
ATOM   6659   C  CG    B HIS A 1 9   ? -31.152 -16.596 -40.756 0.05 12.05 ? 8    HIS A CG    2  
ATOM   6660   N  ND1   B HIS A 1 9   ? -30.293 -15.552 -40.467 0.05 11.98 ? 8    HIS A ND1   2  
ATOM   6661   C  CD2   B HIS A 1 9   ? -32.286 -16.344 -40.062 0.05 12.05 ? 8    HIS A CD2   2  
ATOM   6662   C  CE1   B HIS A 1 9   ? -30.882 -14.723 -39.624 0.05 11.93 ? 8    HIS A CE1   2  
ATOM   6663   N  NE2   B HIS A 1 9   ? -32.090 -15.181 -39.361 0.05 11.98 ? 8    HIS A NE2   2  
ATOM   6664   N  N     B ILE A 1 10  ? -27.601 -16.490 -41.088 0.05 11.86 ? 9    ILE A N     2  
ATOM   6665   C  CA    B ILE A 1 10  ? -26.582 -16.267 -40.064 0.05 11.71 ? 9    ILE A CA    2  
ATOM   6666   C  C     B ILE A 1 10  ? -26.935 -15.017 -39.278 0.05 11.64 ? 9    ILE A C     2  
ATOM   6667   O  O     B ILE A 1 10  ? -27.091 -13.940 -39.846 0.05 11.70 ? 9    ILE A O     2  
ATOM   6668   C  CB    B ILE A 1 10  ? -25.182 -16.119 -40.686 0.05 11.70 ? 9    ILE A CB    2  
ATOM   6669   C  CG1   B ILE A 1 10  ? -24.696 -17.461 -41.245 0.05 11.78 ? 9    ILE A CG1   2  
ATOM   6670   C  CG2   B ILE A 1 10  ? -24.193 -15.586 -39.645 0.05 11.55 ? 9    ILE A CG2   2  
ATOM   6671   C  CD1   B ILE A 1 10  ? -23.479 -17.354 -42.148 0.05 11.81 ? 9    ILE A CD1   2  
ATOM   6672   N  N     B ALA A 1 11  ? -27.076 -15.154 -37.963 0.05 11.54 ? 10   ALA A N     2  
ATOM   6673   C  CA    B ALA A 1 11  ? -27.381 -14.001 -37.129 0.05 11.48 ? 10   ALA A CA    2  
ATOM   6674   C  C     B ALA A 1 11  ? -26.160 -13.622 -36.309 0.05 11.36 ? 10   ALA A C     2  
ATOM   6675   O  O     B ALA A 1 11  ? -25.629 -14.443 -35.567 0.05 11.28 ? 10   ALA A O     2  
ATOM   6676   C  CB    B ALA A 1 11  ? -28.552 -14.293 -36.206 0.05 11.47 ? 10   ALA A CB    2  
ATOM   6677   N  N     B MET A 1 12  ? -25.733 -12.375 -36.441 0.05 11.36 ? 11   MET A N     2  
ATOM   6678   C  CA    B MET A 1 12  ? -24.604 -11.865 -35.670 0.05 11.26 ? 11   MET A CA    2  
ATOM   6679   C  C     B MET A 1 12  ? -25.130 -11.093 -34.465 0.05 11.21 ? 11   MET A C     2  
ATOM   6680   O  O     B MET A 1 12  ? -26.158 -10.423 -34.549 0.05 11.27 ? 11   MET A O     2  
ATOM   6681   C  CB    B MET A 1 12  ? -23.728 -10.975 -36.559 0.05 11.32 ? 11   MET A CB    2  
ATOM   6682   C  CG    B MET A 1 12  ? -22.602 -10.244 -35.836 0.05 11.25 ? 11   MET A CG    2  
ATOM   6683   S  SD    B MET A 1 12  ? -21.341 -11.324 -35.142 0.05 11.14 ? 11   MET A SD    2  
ATOM   6684   C  CE    B MET A 1 12  ? -20.218 -10.100 -34.470 0.05 11.10 ? 11   MET A CE    2  
ATOM   6685   N  N     B PHE A 1 13  ? -24.437 -11.210 -33.335 0.05 11.11 ? 12   PHE A N     2  
ATOM   6686   C  CA    B PHE A 1 13  ? -24.822 -10.521 -32.113 0.05 11.06 ? 12   PHE A CA    2  
ATOM   6687   C  C     B PHE A 1 13  ? -23.619 -9.741  -31.615 0.05 11.00 ? 12   PHE A C     2  
ATOM   6688   O  O     B PHE A 1 13  ? -22.537 -10.309 -31.458 0.05 10.96 ? 12   PHE A O     2  
ATOM   6689   C  CB    B PHE A 1 13  ? -25.220 -11.528 -31.012 0.05 10.99 ? 12   PHE A CB    2  
ATOM   6690   C  CG    B PHE A 1 13  ? -26.463 -12.328 -31.317 0.05 11.05 ? 12   PHE A CG    2  
ATOM   6691   C  CD1   B PHE A 1 13  ? -26.437 -13.356 -32.245 0.05 11.10 ? 12   PHE A CD1   2  
ATOM   6692   C  CD2   B PHE A 1 13  ? -27.652 -12.068 -30.648 0.05 11.07 ? 12   PHE A CD2   2  
ATOM   6693   C  CE1   B PHE A 1 13  ? -27.582 -14.091 -32.520 0.05 11.17 ? 12   PHE A CE1   2  
ATOM   6694   C  CE2   B PHE A 1 13  ? -28.800 -12.796 -30.922 0.05 11.13 ? 12   PHE A CE2   2  
ATOM   6695   C  CZ    B PHE A 1 13  ? -28.760 -13.814 -31.858 0.05 11.18 ? 12   PHE A CZ    2  
ATOM   6696   N  N     B SER A 1 14  ? -23.805 -8.451  -31.366 0.05 11.02 ? 13   SER A N     2  
ATOM   6697   C  CA    B SER A 1 14  ? -22.829 -7.698  -30.597 0.05 10.98 ? 13   SER A CA    2  
ATOM   6698   C  C     B SER A 1 14  ? -23.487 -6.577  -29.793 0.05 10.99 ? 13   SER A C     2  
ATOM   6699   O  O     B SER A 1 14  ? -24.722 -6.526  -29.656 0.05 11.02 ? 13   SER A O     2  
ATOM   6700   C  CB    B SER A 1 14  ? -21.703 -7.149  -31.481 0.05 11.02 ? 13   SER A CB    2  
ATOM   6701   O  OG    B SER A 1 14  ? -20.622 -6.712  -30.660 0.05 10.98 ? 13   SER A OG    2  
ATOM   6702   N  N     B ILE A 1 15  ? -22.649 -5.701  -29.250 0.05 10.98 ? 14   ILE A N     2  
ATOM   6703   C  CA    B ILE A 1 15  ? -23.094 -4.568  -28.454 0.05 11.00 ? 14   ILE A CA    2  
ATOM   6704   C  C     B ILE A 1 15  ? -22.692 -3.279  -29.164 0.05 11.09 ? 14   ILE A C     2  
ATOM   6705   O  O     B ILE A 1 15  ? -21.952 -3.317  -30.152 0.05 11.12 ? 14   ILE A O     2  
ATOM   6706   C  CB    B ILE A 1 15  ? -22.470 -4.590  -27.041 0.05 10.93 ? 14   ILE A CB    2  
ATOM   6707   C  CG1   B ILE A 1 15  ? -20.944 -4.544  -27.122 0.05 10.92 ? 14   ILE A CG1   2  
ATOM   6708   C  CG2   B ILE A 1 15  ? -22.900 -5.839  -26.272 0.05 10.86 ? 14   ILE A CG2   2  
ATOM   6709   C  CD1   B ILE A 1 15  ? -20.276 -4.227  -25.799 0.05 10.88 ? 14   ILE A CD1   2  
ATOM   6710   N  N     B ALA A 1 16  ? -23.173 -2.141  -28.677 0.05 11.14 ? 15   ALA A N     2  
ATOM   6711   C  CA    B ALA A 1 16  ? -22.859 -0.866  -29.320 0.05 11.25 ? 15   ALA A CA    2  
ATOM   6712   C  C     B ALA A 1 16  ? -21.539 -0.314  -28.812 0.05 11.24 ? 15   ALA A C     2  
ATOM   6713   O  O     B ALA A 1 16  ? -21.506 0.713   -28.149 0.05 11.28 ? 15   ALA A O     2  
ATOM   6714   C  CB    B ALA A 1 16  ? -23.974 0.148   -29.099 0.05 11.33 ? 15   ALA A CB    2  
ATOM   6715   N  N     B ALA A 1 17  ? -20.455 -1.016  -29.116 0.05 11.20 ? 16   ALA A N     2  
ATOM   6716   C  CA    B ALA A 1 17  ? -19.117 -0.573  -28.744 0.05 11.20 ? 16   ALA A CA    2  
ATOM   6717   C  C     B ALA A 1 17  ? -18.227 -0.740  -29.957 0.05 11.25 ? 16   ALA A C     2  
ATOM   6718   O  O     B ALA A 1 17  ? -18.222 -1.795  -30.587 0.05 11.20 ? 16   ALA A O     2  
ATOM   6719   C  CB    B ALA A 1 17  ? -18.580 -1.398  -27.565 0.05 11.10 ? 16   ALA A CB    2  
ATOM   6720   N  N     B HIS A 1 18  ? -17.480 0.304   -30.298 0.05 11.35 ? 17   HIS A N     2  
ATOM   6721   C  CA    B HIS A 1 18  ? -16.690 0.269   -31.520 0.05 11.41 ? 17   HIS A CA    2  
ATOM   6722   C  C     B HIS A 1 18  ? -15.738 -0.919  -31.543 0.05 11.33 ? 17   HIS A C     2  
ATOM   6723   O  O     B HIS A 1 18  ? -15.613 -1.595  -32.553 0.05 11.33 ? 17   HIS A O     2  
ATOM   6724   C  CB    B HIS A 1 18  ? -15.943 1.595   -31.722 0.05 11.53 ? 17   HIS A CB    2  
ATOM   6725   C  CG    B HIS A 1 18  ? -16.852 2.758   -31.974 0.05 11.65 ? 17   HIS A CG    2  
ATOM   6726   N  ND1   B HIS A 1 18  ? -17.108 3.727   -31.025 0.05 11.64 ? 17   HIS A ND1   2  
ATOM   6727   C  CD2   B HIS A 1 18  ? -17.580 3.097   -33.066 0.05 11.79 ? 17   HIS A CD2   2  
ATOM   6728   C  CE1   B HIS A 1 18  ? -17.951 4.614   -31.524 0.05 11.77 ? 17   HIS A CE1   2  
ATOM   6729   N  NE2   B HIS A 1 18  ? -18.257 4.254   -32.758 0.05 11.87 ? 17   HIS A NE2   2  
ATOM   6730   N  N     B GLY A 1 19  ? -15.114 -1.201  -30.407 0.05 11.26 ? 18   GLY A N     2  
ATOM   6731   C  CA    B GLY A 1 19  ? -14.134 -2.266  -30.326 0.05 11.20 ? 18   GLY A CA    2  
ATOM   6732   C  C     B GLY A 1 19  ? -14.697 -3.677  -30.352 0.05 11.11 ? 18   GLY A C     2  
ATOM   6733   O  O     B GLY A 1 19  ? -13.933 -4.642  -30.291 0.05 11.07 ? 18   GLY A O     2  
ATOM   6734   N  N     B HIS A 1 20  ? -16.021 -3.798  -30.439 0.05 11.09 ? 19   HIS A N     2  
ATOM   6735   C  CA    B HIS A 1 20  ? -16.676 -5.102  -30.521 0.05 11.02 ? 19   HIS A CA    2  
ATOM   6736   C  C     B HIS A 1 20  ? -17.537 -5.269  -31.773 0.05 11.07 ? 19   HIS A C     2  
ATOM   6737   O  O     B HIS A 1 20  ? -18.195 -6.291  -31.949 0.05 11.04 ? 19   HIS A O     2  
ATOM   6738   C  CB    B HIS A 1 20  ? -17.487 -5.378  -29.250 0.05 10.95 ? 19   HIS A CB    2  
ATOM   6739   C  CG    B HIS A 1 20  ? -16.629 -5.561  -28.040 0.05 10.90 ? 19   HIS A CG    2  
ATOM   6740   N  ND1   B HIS A 1 20  ? -15.933 -6.726  -27.795 0.05 10.85 ? 19   HIS A ND1   2  
ATOM   6741   C  CD2   B HIS A 1 20  ? -16.312 -4.713  -27.034 0.05 10.91 ? 19   HIS A CD2   2  
ATOM   6742   C  CE1   B HIS A 1 20  ? -15.237 -6.594  -26.679 0.05 10.83 ? 19   HIS A CE1   2  
ATOM   6743   N  NE2   B HIS A 1 20  ? -15.450 -5.382  -26.197 0.05 10.86 ? 19   HIS A NE2   2  
ATOM   6744   N  N     B VAL A 1 21  ? -17.511 -4.267  -32.649 0.05 11.17 ? 20   VAL A N     2  
ATOM   6745   C  CA    B VAL A 1 21  ? -18.253 -4.339  -33.904 0.05 11.25 ? 20   VAL A CA    2  
ATOM   6746   C  C     B VAL A 1 21  ? -17.320 -4.063  -35.074 0.05 11.33 ? 20   VAL A C     2  
ATOM   6747   O  O     B VAL A 1 21  ? -17.242 -4.850  -36.022 0.05 11.36 ? 20   VAL A O     2  
ATOM   6748   C  CB    B VAL A 1 21  ? -19.428 -3.346  -33.929 0.05 11.32 ? 20   VAL A CB    2  
ATOM   6749   C  CG1   B VAL A 1 21  ? -20.057 -3.284  -35.325 0.05 11.42 ? 20   VAL A CG1   2  
ATOM   6750   C  CG2   B VAL A 1 21  ? -20.467 -3.742  -32.896 0.05 11.25 ? 20   VAL A CG2   2  
ATOM   6751   N  N     B ASN A 1 22  ? -16.604 -2.948  -34.996 0.05 11.39 ? 21   ASN A N     2  
ATOM   6752   C  CA    B ASN A 1 22  ? -15.630 -2.608  -36.029 0.05 11.49 ? 21   ASN A CA    2  
ATOM   6753   C  C     B ASN A 1 22  ? -14.705 -3.767  -36.434 0.05 11.45 ? 21   ASN A C     2  
ATOM   6754   O  O     B ASN A 1 22  ? -14.475 -3.973  -37.631 0.05 11.54 ? 21   ASN A O     2  
ATOM   6755   C  CB    B ASN A 1 22  ? -14.828 -1.349  -35.654 0.05 11.55 ? 21   ASN A CB    2  
ATOM   6756   C  CG    B ASN A 1 22  ? -15.698 -0.104  -35.550 0.05 11.65 ? 21   ASN A CG    2  
ATOM   6757   O  OD1   B ASN A 1 22  ? -16.828 -0.077  -36.042 0.05 11.71 ? 21   ASN A OD1   2  
ATOM   6758   N  ND2   B ASN A 1 22  ? -15.174 0.932   -34.911 0.05 11.67 ? 21   ASN A ND2   2  
ATOM   6759   N  N     B PRO A 1 23  ? -14.194 -4.549  -35.453 0.05 11.35 ? 22   PRO A N     2  
ATOM   6760   C  CA    B PRO A 1 23  ? -13.279 -5.629  -35.842 0.05 11.33 ? 22   PRO A CA    2  
ATOM   6761   C  C     B PRO A 1 23  ? -13.875 -6.710  -36.738 0.05 11.35 ? 22   PRO A C     2  
ATOM   6762   O  O     B PRO A 1 23  ? -13.101 -7.399  -37.396 0.05 11.40 ? 22   PRO A O     2  
ATOM   6763   C  CB    B PRO A 1 23  ? -12.860 -6.235  -34.497 0.05 11.22 ? 22   PRO A CB    2  
ATOM   6764   C  CG    B PRO A 1 23  ? -12.992 -5.126  -33.542 0.05 11.21 ? 22   PRO A CG    2  
ATOM   6765   C  CD    B PRO A 1 23  ? -14.217 -4.382  -33.986 0.05 11.26 ? 22   PRO A CD    2  
ATOM   6766   N  N     B SER A 1 24  ? -15.198 -6.875  -36.763 0.05 11.32 ? 23   SER A N     2  
ATOM   6767   C  CA    B SER A 1 24  ? -15.788 -7.887  -37.640 0.05 11.34 ? 23   SER A CA    2  
ATOM   6768   C  C     B SER A 1 24  ? -16.669 -7.325  -38.753 0.05 11.46 ? 23   SER A C     2  
ATOM   6769   O  O     B SER A 1 24  ? -17.224 -8.102  -39.525 0.05 11.50 ? 23   SER A O     2  
ATOM   6770   C  CB    B SER A 1 24  ? -16.557 -8.962  -36.850 0.05 11.25 ? 23   SER A CB    2  
ATOM   6771   O  OG    B SER A 1 24  ? -17.509 -8.378  -35.983 0.05 11.22 ? 23   SER A OG    2  
ATOM   6772   N  N     B LEU A 1 25  ? -16.783 -5.998  -38.841 0.05 11.52 ? 24   LEU A N     2  
ATOM   6773   C  CA    B LEU A 1 25  ? -17.630 -5.372  -39.868 0.05 11.64 ? 24   LEU A CA    2  
ATOM   6774   C  C     B LEU A 1 25  ? -17.312 -5.895  -41.264 0.05 11.75 ? 24   LEU A C     2  
ATOM   6775   O  O     B LEU A 1 25  ? -18.219 -6.154  -42.054 0.05 11.82 ? 24   LEU A O     2  
ATOM   6776   C  CB    B LEU A 1 25  ? -17.537 -3.838  -39.842 0.05 11.72 ? 24   LEU A CB    2  
ATOM   6777   C  CG    B LEU A 1 25  ? -18.332 -3.025  -38.814 0.05 11.68 ? 24   LEU A CG    2  
ATOM   6778   C  CD1   B LEU A 1 25  ? -17.797 -1.607  -38.723 0.05 11.82 ? 24   LEU A CD1   2  
ATOM   6779   C  CD2   B LEU A 1 25  ? -19.822 -2.995  -39.139 0.05 11.65 ? 24   LEU A CD2   2  
ATOM   6780   N  N     B GLU A 1 26  ? -16.030 -6.085  -41.561 0.05 11.78 ? 25   GLU A N     2  
ATOM   6781   C  CA    B GLU A 1 26  ? -15.645 -6.515  -42.901 0.05 11.89 ? 25   GLU A CA    2  
ATOM   6782   C  C     B GLU A 1 26  ? -15.842 -8.013  -43.123 0.05 11.85 ? 25   GLU A C     2  
ATOM   6783   O  O     B GLU A 1 26  ? -15.897 -8.470  -44.264 0.05 11.96 ? 25   GLU A O     2  
ATOM   6784   C  CB    B GLU A 1 26  ? -14.213 -6.074  -43.221 0.05 11.94 ? 25   GLU A CB    2  
ATOM   6785   C  CG    B GLU A 1 26  ? -14.029 -4.569  -43.125 0.05 12.02 ? 25   GLU A CG    2  
ATOM   6786   C  CD    B GLU A 1 26  ? -14.273 -3.857  -44.438 0.05 12.20 ? 25   GLU A CD    2  
ATOM   6787   O  OE1   B GLU A 1 26  ? -15.341 -3.238  -44.573 0.05 12.30 ? 25   GLU A OE1   2  
ATOM   6788   O  OE2   B GLU A 1 26  ? -13.395 -3.905  -45.328 0.05 12.26 ? 25   GLU A OE2   2  
ATOM   6789   N  N     B VAL A 1 27  ? -15.958 -8.778  -42.035 0.05 11.72 ? 26   VAL A N     2  
ATOM   6790   C  CA    B VAL A 1 27  ? -16.291 -10.195 -42.145 0.05 11.69 ? 26   VAL A CA    2  
ATOM   6791   C  C     B VAL A 1 27  ? -17.776 -10.303 -42.468 0.05 11.73 ? 26   VAL A C     2  
ATOM   6792   O  O     B VAL A 1 27  ? -18.182 -11.093 -43.331 0.05 11.81 ? 26   VAL A O     2  
ATOM   6793   C  CB    B VAL A 1 27  ? -15.985 -10.968 -40.841 0.05 11.54 ? 26   VAL A CB    2  
ATOM   6794   C  CG1   B VAL A 1 27  ? -16.124 -12.480 -41.049 0.05 11.47 ? 26   VAL A CG1   2  
ATOM   6795   C  CG2   B VAL A 1 27  ? -14.586 -10.637 -40.355 0.05 11.55 ? 26   VAL A CG2   2  
ATOM   6796   N  N     B ILE A 1 28  ? -18.577 -9.508  -41.763 0.05 11.71 ? 27   ILE A N     2  
ATOM   6797   C  CA    B ILE A 1 28  ? -20.016 -9.448  -41.999 0.05 11.75 ? 27   ILE A CA    2  
ATOM   6798   C  C     B ILE A 1 28  ? -20.247 -9.092  -43.459 0.05 11.92 ? 27   ILE A C     2  
ATOM   6799   O  O     B ILE A 1 28  ? -20.943 -9.815  -44.164 0.05 12.01 ? 27   ILE A O     2  
ATOM   6800   C  CB    B ILE A 1 28  ? -20.718 -8.404  -41.109 0.05 11.70 ? 27   ILE A CB    2  
ATOM   6801   C  CG1   B ILE A 1 28  ? -20.483 -8.718  -39.632 0.05 11.54 ? 27   ILE A CG1   2  
ATOM   6802   C  CG2   B ILE A 1 28  ? -22.202 -8.399  -41.390 0.05 11.75 ? 27   ILE A CG2   2  
ATOM   6803   C  CD1   B ILE A 1 28  ? -21.034 -10.049 -39.209 0.05 11.47 ? 27   ILE A CD1   2  
ATOM   6804   N  N     B ARG A 1 29  ? -19.632 -7.992  -43.906 0.05 11.99 ? 28   ARG A N     2  
ATOM   6805   C  CA    B ARG A 1 29  ? -19.719 -7.555  -45.314 0.05 12.16 ? 28   ARG A CA    2  
ATOM   6806   C  C     B ARG A 1 29  ? -19.472 -8.698  -46.280 0.05 12.24 ? 28   ARG A C     2  
ATOM   6807   O  O     B ARG A 1 29  ? -20.211 -8.885  -47.254 0.05 12.38 ? 28   ARG A O     2  
ATOM   6808   C  CB    B ARG A 1 29  ? -18.680 -6.475  -45.649 0.05 12.22 ? 28   ARG A CB    2  
ATOM   6809   C  CG    B ARG A 1 29  ? -18.940 -5.117  -45.030 0.05 12.22 ? 28   ARG A CG    2  
ATOM   6810   C  CD    B ARG A 1 29  ? -18.212 -3.964  -45.726 0.05 12.26 ? 28   ARG A CD    2  
ATOM   6811   N  NE    B ARG A 1 29  ? -18.196 -2.830  -44.818 0.05 12.20 ? 28   ARG A NE    2  
ATOM   6812   C  CZ    B ARG A 1 29  ? -17.610 -1.664  -45.035 0.05 12.31 ? 28   ARG A CZ    2  
ATOM   6813   N  NH1   B ARG A 1 29  ? -16.948 -1.454  -46.160 0.05 12.49 ? 28   ARG A NH1   2  
ATOM   6814   N  NH2   B ARG A 1 29  ? -17.684 -0.719  -44.096 0.05 12.26 ? 28   ARG A NH2   2  
ATOM   6815   N  N     B GLU A 1 30  ? -18.418 -9.457  -46.005 0.05 12.17 ? 29   GLU A N     2  
ATOM   6816   C  CA    B GLU A 1 30  ? -17.987 -10.523 -46.881 0.05 12.24 ? 29   GLU A CA    2  
ATOM   6817   C  C     B GLU A 1 30  ? -19.011 -11.654 -46.907 0.05 12.23 ? 29   GLU A C     2  
ATOM   6818   O  O     B GLU A 1 30  ? -19.277 -12.224 -47.949 0.05 12.37 ? 29   GLU A O     2  
ATOM   6819   C  CB    B GLU A 1 30  ? -16.607 -11.018 -46.446 0.05 12.15 ? 29   GLU A CB    2  
ATOM   6820   C  CG    B GLU A 1 30  ? -16.007 -12.074 -47.345 0.05 12.22 ? 29   GLU A CG    2  
ATOM   6821   C  CD    B GLU A 1 30  ? -15.677 -11.566 -48.744 0.05 12.41 ? 29   GLU A CD    2  
ATOM   6822   O  OE1   B GLU A 1 30  ? -15.375 -12.419 -49.605 0.05 12.49 ? 29   GLU A OE1   2  
ATOM   6823   O  OE2   B GLU A 1 30  ? -15.715 -10.334 -48.988 0.05 12.47 ? 29   GLU A OE2   2  
ATOM   6824   N  N     B LEU A 1 31  ? -19.583 -11.973 -45.753 0.05 12.09 ? 30   LEU A N     2  
ATOM   6825   C  CA    B LEU A 1 31  ? -20.684 -12.932 -45.691 0.05 12.09 ? 30   LEU A CA    2  
ATOM   6826   C  C     B LEU A 1 31  ? -21.882 -12.488 -46.542 0.05 12.23 ? 30   LEU A C     2  
ATOM   6827   O  O     B LEU A 1 31  ? -22.447 -13.278 -47.313 0.05 12.33 ? 30   LEU A O     2  
ATOM   6828   C  CB    B LEU A 1 31  ? -21.144 -13.114 -44.245 0.05 11.93 ? 30   LEU A CB    2  
ATOM   6829   C  CG    B LEU A 1 31  ? -20.007 -13.529 -43.314 0.05 11.81 ? 30   LEU A CG    2  
ATOM   6830   C  CD1   B LEU A 1 31  ? -20.388 -13.255 -41.868 0.05 11.68 ? 30   LEU A CD1   2  
ATOM   6831   C  CD2   B LEU A 1 31  ? -19.640 -14.983 -43.517 0.05 11.86 ? 30   LEU A CD2   2  
ATOM   6832   N  N     B VAL A 1 32  ? -22.272 -11.228 -46.385 0.05 12.26 ? 31   VAL A N     2  
ATOM   6833   C  CA    B VAL A 1 32  ? -23.394 -10.652 -47.131 0.05 12.41 ? 31   VAL A CA    2  
ATOM   6834   C  C     B VAL A 1 32  ? -23.099 -10.620 -48.619 0.05 12.59 ? 31   VAL A C     2  
ATOM   6835   O  O     B VAL A 1 32  ? -23.929 -11.016 -49.439 0.05 12.73 ? 31   VAL A O     2  
ATOM   6836   C  CB    B VAL A 1 32  ? -23.708 -9.215  -46.661 0.05 12.42 ? 31   VAL A CB    2  
ATOM   6837   C  CG1   B VAL A 1 32  ? -24.436 -8.414  -47.750 0.05 12.60 ? 31   VAL A CG1   2  
ATOM   6838   C  CG2   B VAL A 1 32  ? -24.525 -9.240  -45.389 0.05 12.26 ? 31   VAL A CG2   2  
ATOM   6839   N  N     B ALA A 1 33  ? -21.911 -10.139 -48.962 0.05 12.60 ? 32   ALA A N     2  
ATOM   6840   C  CA    B ALA A 1 33  ? -21.529 -10.026 -50.360 0.05 12.76 ? 32   ALA A CA    2  
ATOM   6841   C  C     B ALA A 1 33  ? -21.475 -11.400 -51.016 0.05 12.82 ? 32   ALA A C     2  
ATOM   6842   O  O     B ALA A 1 33  ? -21.696 -11.528 -52.220 0.05 13.00 ? 32   ALA A O     2  
ATOM   6843   C  CB    B ALA A 1 33  ? -20.204 -9.312  -50.491 0.05 12.73 ? 32   ALA A CB    2  
ATOM   6844   N  N     B ARG A 1 34  ? -21.200 -12.429 -50.212 0.05 12.68 ? 33   ARG A N     2  
ATOM   6845   C  CA    B ARG A 1 34  ? -21.121 -13.801 -50.704 0.05 12.73 ? 33   ARG A CA    2  
ATOM   6846   C  C     B ARG A 1 34  ? -22.502 -14.395 -50.957 0.05 12.82 ? 33   ARG A C     2  
ATOM   6847   O  O     B ARG A 1 34  ? -22.639 -15.384 -51.676 0.05 12.94 ? 33   ARG A O     2  
ATOM   6848   C  CB    B ARG A 1 34  ? -20.315 -14.695 -49.754 0.05 12.57 ? 33   ARG A CB    2  
ATOM   6849   C  CG    B ARG A 1 34  ? -18.796 -14.623 -49.953 0.05 12.51 ? 33   ARG A CG    2  
ATOM   6850   C  CD    B ARG A 1 34  ? -18.043 -15.535 -48.984 0.05 12.38 ? 33   ARG A CD    2  
ATOM   6851   N  NE    B ARG A 1 34  ? -16.589 -15.355 -49.043 0.05 12.35 ? 33   ARG A NE    2  
ATOM   6852   C  CZ    B ARG A 1 34  ? -15.710 -16.211 -48.525 0.05 12.29 ? 33   ARG A CZ    2  
ATOM   6853   N  NH1   B ARG A 1 34  ? -16.134 -17.315 -47.916 0.05 12.24 ? 33   ARG A NH1   2  
ATOM   6854   N  NH2   B ARG A 1 34  ? -14.406 -15.972 -48.617 0.05 12.28 ? 33   ARG A NH2   2  
ATOM   6855   N  N     B GLY A 1 35  ? -23.529 -13.793 -50.374 0.05 12.77 ? 34   GLY A N     2  
ATOM   6856   C  CA    B GLY A 1 35  ? -24.886 -14.237 -50.631 0.05 12.86 ? 34   GLY A CA    2  
ATOM   6857   C  C     B GLY A 1 35  ? -25.589 -14.812 -49.422 0.05 12.74 ? 34   GLY A C     2  
ATOM   6858   O  O     B GLY A 1 35  ? -26.616 -15.472 -49.546 0.05 12.83 ? 34   GLY A O     2  
ATOM   6859   N  N     B HIS A 1 36  ? -25.038 -14.558 -48.242 0.05 12.55 ? 35   HIS A N     2  
ATOM   6860   C  CA    B HIS A 1 36  ? -25.625 -15.092 -47.025 0.05 12.45 ? 35   HIS A CA    2  
ATOM   6861   C  C     B HIS A 1 36  ? -26.743 -14.216 -46.493 0.05 12.44 ? 35   HIS A C     2  
ATOM   6862   O  O     B HIS A 1 36  ? -26.686 -12.984 -46.592 0.05 12.48 ? 35   HIS A O     2  
ATOM   6863   C  CB    B HIS A 1 36  ? -24.546 -15.296 -45.961 0.05 12.26 ? 35   HIS A CB    2  
ATOM   6864   C  CG    B HIS A 1 36  ? -23.567 -16.369 -46.312 0.05 12.27 ? 35   HIS A CG    2  
ATOM   6865   N  ND1   B HIS A 1 36  ? -23.885 -17.708 -46.257 0.05 12.30 ? 35   HIS A ND1   2  
ATOM   6866   C  CD2   B HIS A 1 36  ? -22.283 -16.304 -46.734 0.05 12.26 ? 35   HIS A CD2   2  
ATOM   6867   C  CE1   B HIS A 1 36  ? -22.838 -18.421 -46.627 0.05 12.31 ? 35   HIS A CE1   2  
ATOM   6868   N  NE2   B HIS A 1 36  ? -21.854 -17.593 -46.922 0.05 12.28 ? 35   HIS A NE2   2  
ATOM   6869   N  N     B ARG A 1 37  ? -27.764 -14.867 -45.938 0.05 12.41 ? 36   ARG A N     2  
ATOM   6870   C  CA    B ARG A 1 37  ? -28.834 -14.174 -45.238 0.05 12.39 ? 36   ARG A CA    2  
ATOM   6871   C  C     B ARG A 1 37  ? -28.284 -13.769 -43.880 0.05 12.20 ? 36   ARG A C     2  
ATOM   6872   O  O     B ARG A 1 37  ? -28.288 -14.567 -42.950 0.05 12.10 ? 36   ARG A O     2  
ATOM   6873   C  CB    B ARG A 1 37  ? -30.045 -15.104 -45.066 0.05 12.47 ? 36   ARG A CB    2  
ATOM   6874   C  CG    B ARG A 1 37  ? -31.185 -14.529 -44.222 0.05 12.47 ? 36   ARG A CG    2  
ATOM   6875   C  CD    B ARG A 1 37  ? -32.578 -14.973 -44.733 0.05 12.63 ? 36   ARG A CD    2  
ATOM   6876   N  NE    B ARG A 1 37  ? -32.971 -16.315 -44.299 0.05 12.60 ? 36   ARG A NE    2  
ATOM   6877   C  CZ    B ARG A 1 37  ? -33.728 -16.575 -43.232 0.05 12.54 ? 36   ARG A CZ    2  
ATOM   6878   N  NH1   B ARG A 1 37  ? -34.179 -15.585 -42.471 0.05 12.50 ? 36   ARG A NH1   2  
ATOM   6879   N  NH2   B ARG A 1 37  ? -34.031 -17.829 -42.922 0.05 12.52 ? 36   ARG A NH2   2  
ATOM   6880   N  N     B VAL A 1 38  ? -27.785 -12.541 -43.777 0.05 12.16 ? 37   VAL A N     2  
ATOM   6881   C  CA    B VAL A 1 38  ? -27.144 -12.090 -42.545 0.05 11.99 ? 37   VAL A CA    2  
ATOM   6882   C  C     B VAL A 1 38  ? -27.987 -11.059 -41.801 0.05 11.97 ? 37   VAL A C     2  
ATOM   6883   O  O     B VAL A 1 38  ? -28.310 -9.995  -42.339 0.05 12.08 ? 37   VAL A O     2  
ATOM   6884   C  CB    B VAL A 1 38  ? -25.751 -11.492 -42.812 0.05 11.95 ? 37   VAL A CB    2  
ATOM   6885   C  CG1   B VAL A 1 38  ? -25.042 -11.177 -41.494 0.05 11.78 ? 37   VAL A CG1   2  
ATOM   6886   C  CG2   B VAL A 1 38  ? -24.917 -12.446 -43.650 0.05 12.00 ? 37   VAL A CG2   2  
ATOM   6887   N  N     B THR A 1 39  ? -28.353 -11.403 -40.569 0.05 11.85 ? 38   THR A N     2  
ATOM   6888   C  CA    B THR A 1 39  ? -29.007 -10.483 -39.654 0.05 11.82 ? 38   THR A CA    2  
ATOM   6889   C  C     B THR A 1 39  ? -28.015 -10.190 -38.538 0.05 11.67 ? 38   THR A C     2  
ATOM   6890   O  O     B THR A 1 39  ? -27.126 -10.995 -38.269 0.05 11.58 ? 38   THR A O     2  
ATOM   6891   C  CB    B THR A 1 39  ? -30.304 -11.080 -39.066 0.05 11.83 ? 38   THR A CB    2  
ATOM   6892   O  OG1   B THR A 1 39  ? -29.998 -12.258 -38.312 0.05 11.74 ? 38   THR A OG1   2  
ATOM   6893   C  CG2   B THR A 1 39  ? -31.267 -11.447 -40.181 0.05 12.00 ? 38   THR A CG2   2  
ATOM   6894   N  N     B TYR A 1 40  ? -28.163 -9.040  -37.898 0.05 11.65 ? 39   TYR A N     2  
ATOM   6895   C  CA    B TYR A 1 40  ? -27.155 -8.570  -36.952 0.05 11.54 ? 39   TYR A CA    2  
ATOM   6896   C  C     B TYR A 1 40  ? -27.841 -7.896  -35.767 0.05 11.50 ? 39   TYR A C     2  
ATOM   6897   O  O     B TYR A 1 40  ? -28.211 -6.726  -35.834 0.05 11.56 ? 39   TYR A O     2  
ATOM   6898   C  CB    B TYR A 1 40  ? -26.185 -7.608  -37.662 0.05 11.59 ? 39   TYR A CB    2  
ATOM   6899   C  CG    B TYR A 1 40  ? -24.858 -7.330  -36.954 0.05 11.48 ? 39   TYR A CG    2  
ATOM   6900   C  CD1   B TYR A 1 40  ? -24.786 -7.201  -35.572 0.05 11.38 ? 39   TYR A CD1   2  
ATOM   6901   C  CD2   B TYR A 1 40  ? -23.680 -7.188  -37.684 0.05 11.50 ? 39   TYR A CD2   2  
ATOM   6902   C  CE1   B TYR A 1 40  ? -23.578 -6.942  -34.936 0.05 11.30 ? 39   TYR A CE1   2  
ATOM   6903   C  CE2   B TYR A 1 40  ? -22.467 -6.925  -37.058 0.05 11.42 ? 39   TYR A CE2   2  
ATOM   6904   C  CZ    B TYR A 1 40  ? -22.425 -6.802  -35.682 0.05 11.32 ? 39   TYR A CZ    2  
ATOM   6905   O  OH    B TYR A 1 40  ? -21.229 -6.546  -35.049 0.05 11.26 ? 39   TYR A OH    2  
ATOM   6906   N  N     B ALA A 1 41  ? -28.002 -8.651  -34.686 0.05 11.39 ? 40   ALA A N     2  
ATOM   6907   C  CA    B ALA A 1 41  ? -28.557 -8.123  -33.451 0.05 11.35 ? 40   ALA A CA    2  
ATOM   6908   C  C     B ALA A 1 41  ? -27.650 -7.033  -32.905 0.05 11.30 ? 40   ALA A C     2  
ATOM   6909   O  O     B ALA A 1 41  ? -26.499 -7.289  -32.557 0.05 11.22 ? 40   ALA A O     2  
ATOM   6910   C  CB    B ALA A 1 41  ? -28.708 -9.239  -32.428 0.05 11.26 ? 40   ALA A CB    2  
ATOM   6911   N  N     B ILE A 1 42  ? -28.183 -5.822  -32.807 0.05 11.36 ? 41   ILE A N     2  
ATOM   6912   C  CA    B ILE A 1 42  ? -27.360 -4.663  -32.501 0.05 11.35 ? 41   ILE A CA    2  
ATOM   6913   C  C     B ILE A 1 42  ? -28.229 -3.585  -31.857 0.05 11.40 ? 41   ILE A C     2  
ATOM   6914   O  O     B ILE A 1 42  ? -29.418 -3.480  -32.158 0.05 11.49 ? 41   ILE A O     2  
ATOM   6915   C  CB    B ILE A 1 42  ? -26.705 -4.135  -33.808 0.05 11.44 ? 41   ILE A CB    2  
ATOM   6916   C  CG1   B ILE A 1 42  ? -25.505 -3.232  -33.527 0.05 11.43 ? 41   ILE A CG1   2  
ATOM   6917   C  CG2   B ILE A 1 42  ? -27.744 -3.439  -34.709 0.05 11.58 ? 41   ILE A CG2   2  
ATOM   6918   C  CD1   B ILE A 1 42  ? -24.273 -3.976  -33.044 0.05 11.31 ? 41   ILE A CD1   2  
ATOM   6919   N  N     B PRO A 1 43  ? -27.655 -2.800  -30.939 0.05 11.37 ? 42   PRO A N     2  
ATOM   6920   C  CA    B PRO A 1 43  ? -28.392 -1.669  -30.368 0.05 11.44 ? 42   PRO A CA    2  
ATOM   6921   C  C     B PRO A 1 43  ? -28.666 -0.578  -31.416 0.05 11.58 ? 42   PRO A C     2  
ATOM   6922   O  O     B PRO A 1 43  ? -28.001 -0.575  -32.463 0.05 11.61 ? 42   PRO A O     2  
ATOM   6923   C  CB    B PRO A 1 43  ? -27.448 -1.170  -29.269 0.05 11.38 ? 42   PRO A CB    2  
ATOM   6924   C  CG    B PRO A 1 43  ? -26.676 -2.393  -28.873 0.05 11.25 ? 42   PRO A CG    2  
ATOM   6925   C  CD    B PRO A 1 43  ? -26.425 -3.088  -30.178 0.05 11.26 ? 42   PRO A CD    2  
ATOM   6926   N  N     B PRO A 1 44  ? -29.639 0.319   -31.146 0.05 11.69 ? 43   PRO A N     2  
ATOM   6927   C  CA    B PRO A 1 44  ? -30.109 1.292   -32.139 0.05 11.84 ? 43   PRO A CA    2  
ATOM   6928   C  C     B PRO A 1 44  ? -28.988 2.092   -32.769 0.05 11.89 ? 43   PRO A C     2  
ATOM   6929   O  O     B PRO A 1 44  ? -28.925 2.218   -33.992 0.05 12.01 ? 43   PRO A O     2  
ATOM   6930   C  CB    B PRO A 1 44  ? -30.985 2.239   -31.312 0.05 11.94 ? 43   PRO A CB    2  
ATOM   6931   C  CG    B PRO A 1 44  ? -31.474 1.424   -30.202 0.05 11.83 ? 43   PRO A CG    2  
ATOM   6932   C  CD    B PRO A 1 44  ? -30.381 0.447   -29.877 0.05 11.68 ? 43   PRO A CD    2  
ATOM   6933   N  N     B VAL A 1 45  ? -28.096 2.608   -31.934 0.05 11.82 ? 44   VAL A N     2  
ATOM   6934   C  CA    B VAL A 1 45  ? -27.119 3.589   -32.382 0.05 11.89 ? 44   VAL A CA    2  
ATOM   6935   C  C     B VAL A 1 45  ? -26.169 3.030   -33.453 0.05 11.88 ? 44   VAL A C     2  
ATOM   6936   O  O     B VAL A 1 45  ? -25.546 3.784   -34.206 0.05 11.99 ? 44   VAL A O     2  
ATOM   6937   C  CB    B VAL A 1 45  ? -26.339 4.168   -31.170 0.05 11.82 ? 44   VAL A CB    2  
ATOM   6938   C  CG1   B VAL A 1 45  ? -25.459 3.088   -30.523 0.05 11.66 ? 44   VAL A CG1   2  
ATOM   6939   C  CG2   B VAL A 1 45  ? -25.528 5.388   -31.572 0.05 11.93 ? 44   VAL A CG2   2  
ATOM   6940   N  N     B PHE A 1 46  ? -26.084 1.706   -33.540 0.05 11.78 ? 45   PHE A N     2  
ATOM   6941   C  CA    B PHE A 1 46  ? -25.174 1.068   -34.486 0.05 11.77 ? 45   PHE A CA    2  
ATOM   6942   C  C     B PHE A 1 46  ? -25.891 0.371   -35.648 0.05 11.83 ? 45   PHE A C     2  
ATOM   6943   O  O     B PHE A 1 46  ? -25.295 -0.447  -36.344 0.05 11.79 ? 45   PHE A O     2  
ATOM   6944   C  CB    B PHE A 1 46  ? -24.252 0.064   -33.766 0.05 11.62 ? 45   PHE A CB    2  
ATOM   6945   C  CG    B PHE A 1 46  ? -22.963 0.665   -33.228 0.05 11.59 ? 45   PHE A CG    2  
ATOM   6946   C  CD1   B PHE A 1 46  ? -22.845 2.024   -32.997 0.05 11.69 ? 45   PHE A CD1   2  
ATOM   6947   C  CD2   B PHE A 1 46  ? -21.867 -0.147  -32.975 0.05 11.49 ? 45   PHE A CD2   2  
ATOM   6948   C  CE1   B PHE A 1 46  ? -21.661 2.568   -32.505 0.05 11.68 ? 45   PHE A CE1   2  
ATOM   6949   C  CE2   B PHE A 1 46  ? -20.676 0.380   -32.482 0.05 11.47 ? 45   PHE A CE2   2  
ATOM   6950   C  CZ    B PHE A 1 46  ? -20.570 1.740   -32.248 0.05 11.57 ? 45   PHE A CZ    2  
ATOM   6951   N  N     B ALA A 1 47  ? -27.166 0.682   -35.861 0.05 11.94 ? 46   ALA A N     2  
ATOM   6952   C  CA    B ALA A 1 47  ? -27.890 0.115   -36.999 0.05 12.01 ? 46   ALA A CA    2  
ATOM   6953   C  C     B ALA A 1 47  ? -27.242 0.491   -38.345 0.05 12.12 ? 46   ALA A C     2  
ATOM   6954   O  O     B ALA A 1 47  ? -26.823 -0.391  -39.096 0.05 12.11 ? 46   ALA A O     2  
ATOM   6955   C  CB    B ALA A 1 47  ? -29.365 0.518   -36.964 0.05 12.13 ? 46   ALA A CB    2  
ATOM   6956   N  N     B ASP A 1 48  ? -27.144 1.789   -38.627 0.05 12.24 ? 47   ASP A N     2  
ATOM   6957   C  CA    B ASP A 1 48  ? -26.557 2.288   -39.881 0.05 12.37 ? 47   ASP A CA    2  
ATOM   6958   C  C     B ASP A 1 48  ? -25.217 1.610   -40.126 0.05 12.29 ? 47   ASP A C     2  
ATOM   6959   O  O     B ASP A 1 48  ? -24.937 1.100   -41.212 0.05 12.35 ? 47   ASP A O     2  
ATOM   6960   C  CB    B ASP A 1 48  ? -26.344 3.805   -39.810 0.05 12.54 ? 47   ASP A CB    2  
ATOM   6961   C  CG    B ASP A 1 48  ? -27.639 4.594   -39.917 0.05 12.67 ? 47   ASP A CG    2  
ATOM   6962   O  OD1   B ASP A 1 48  ? -27.591 5.837   -39.830 0.05 12.84 ? 47   ASP A OD1   2  
ATOM   6963   O  OD2   B ASP A 1 48  ? -28.705 3.982   -40.111 0.05 12.62 ? 47   ASP A OD2   2  
ATOM   6964   N  N     B LYS A 1 49  ? -24.412 1.609   -39.069 0.05 12.17 ? 48   LYS A N     2  
ATOM   6965   C  CA    B LYS A 1 49  ? -23.155 0.885   -39.003 0.05 12.08 ? 48   LYS A CA    2  
ATOM   6966   C  C     B LYS A 1 49  ? -23.242 -0.527  -39.591 0.05 12.01 ? 48   LYS A C     2  
ATOM   6967   O  O     B LYS A 1 49  ? -22.687 -0.784  -40.661 0.05 12.05 ? 48   LYS A O     2  
ATOM   6968   C  CB    B LYS A 1 49  ? -22.691 0.832   -37.546 0.05 11.94 ? 48   LYS A CB    2  
ATOM   6969   C  CG    B LYS A 1 49  ? -21.479 -0.024  -37.319 0.05 11.86 ? 48   LYS A CG    2  
ATOM   6970   C  CD    B LYS A 1 49  ? -20.217 0.800   -37.410 0.05 11.95 ? 48   LYS A CD    2  
ATOM   6971   C  CE    B LYS A 1 49  ? -19.709 1.187   -36.033 0.05 11.84 ? 48   LYS A CE    2  
ATOM   6972   N  NZ    B LYS A 1 49  ? -20.186 2.523   -35.532 0.05 11.71 ? 48   LYS A NZ    2  
ATOM   6973   N  N     B VAL A 1 50  ? -23.941 -1.441  -38.921 0.05 11.91 ? 49   VAL A N     2  
ATOM   6974   C  CA    B VAL A 1 50  ? -23.956 -2.826  -39.394 0.05 11.86 ? 49   VAL A CA    2  
ATOM   6975   C  C     B VAL A 1 50  ? -24.714 -3.021  -40.718 0.05 12.01 ? 49   VAL A C     2  
ATOM   6976   O  O     B VAL A 1 50  ? -24.408 -3.943  -41.474 0.05 12.02 ? 49   VAL A O     2  
ATOM   6977   C  CB    B VAL A 1 50  ? -24.446 -3.848  -38.316 0.05 11.72 ? 49   VAL A CB    2  
ATOM   6978   C  CG1   B VAL A 1 50  ? -23.756 -3.599  -36.980 0.05 11.60 ? 49   VAL A CG1   2  
ATOM   6979   C  CG2   B VAL A 1 50  ? -25.949 -3.811  -38.153 0.05 11.77 ? 49   VAL A CG2   2  
ATOM   6980   N  N     B ALA A 1 51  ? -25.688 -2.159  -41.000 0.05 12.13 ? 50   ALA A N     2  
ATOM   6981   C  CA    B ALA A 1 51  ? -26.462 -2.289  -42.235 0.05 12.29 ? 50   ALA A CA    2  
ATOM   6982   C  C     B ALA A 1 51  ? -25.568 -2.049  -43.442 0.05 12.39 ? 50   ALA A C     2  
ATOM   6983   O  O     B ALA A 1 51  ? -25.790 -2.614  -44.509 0.05 12.50 ? 50   ALA A O     2  
ATOM   6984   C  CB    B ALA A 1 51  ? -27.646 -1.330  -42.250 0.05 12.42 ? 50   ALA A CB    2  
ATOM   6985   N  N     B ALA A 1 52  ? -24.549 -1.218  -43.253 0.05 12.38 ? 51   ALA A N     2  
ATOM   6986   C  CA    B ALA A 1 52  ? -23.614 -0.886  -44.322 0.05 12.48 ? 51   ALA A CA    2  
ATOM   6987   C  C     B ALA A 1 52  ? -22.965 -2.147  -44.867 0.05 12.44 ? 51   ALA A C     2  
ATOM   6988   O  O     B ALA A 1 52  ? -22.548 -2.198  -46.027 0.05 12.55 ? 51   ALA A O     2  
ATOM   6989   C  CB    B ALA A 1 52  ? -22.559 0.075   -43.816 0.05 12.46 ? 51   ALA A CB    2  
ATOM   6990   N  N     B THR A 1 53  ? -22.885 -3.174  -44.030 0.05 12.29 ? 52   THR A N     2  
ATOM   6991   C  CA    B THR A 1 53  ? -22.359 -4.456  -44.468 0.05 12.25 ? 52   THR A CA    2  
ATOM   6992   C  C     B THR A 1 53  ? -23.372 -5.162  -45.355 0.05 12.35 ? 52   THR A C     2  
ATOM   6993   O  O     B THR A 1 53  ? -23.050 -6.146  -46.012 0.05 12.37 ? 52   THR A O     2  
ATOM   6994   C  CB    B THR A 1 53  ? -22.049 -5.367  -43.289 0.05 12.06 ? 52   THR A CB    2  
ATOM   6995   O  OG1   B THR A 1 53  ? -23.277 -5.797  -42.693 0.05 12.02 ? 52   THR A OG1   2  
ATOM   6996   C  CG2   B THR A 1 53  ? -21.204 -4.635  -42.251 0.05 11.96 ? 52   THR A CG2   2  
ATOM   6997   N  N     B GLY A 1 54  ? -24.597 -4.651  -45.363 0.05 12.44 ? 53   GLY A N     2  
ATOM   6998   C  CA    B GLY A 1 54  ? -25.684 -5.295  -46.073 0.05 12.54 ? 53   GLY A CA    2  
ATOM   6999   C  C     B GLY A 1 54  ? -26.553 -6.064  -45.104 0.05 12.42 ? 53   GLY A C     2  
ATOM   7000   O  O     B GLY A 1 54  ? -27.738 -6.265  -45.353 0.05 12.49 ? 53   GLY A O     2  
ATOM   7001   N  N     B ALA A 1 55  ? -25.952 -6.500  -43.999 0.05 12.25 ? 54   ALA A N     2  
ATOM   7002   C  CA    B ALA A 1 55  ? -26.652 -7.305  -42.995 0.05 12.15 ? 54   ALA A CA    2  
ATOM   7003   C  C     B ALA A 1 55  ? -27.891 -6.586  -42.481 0.05 12.19 ? 54   ALA A C     2  
ATOM   7004   O  O     B ALA A 1 55  ? -27.880 -5.372  -42.346 0.05 12.25 ? 54   ALA A O     2  
ATOM   7005   C  CB    B ALA A 1 55  ? -25.726 -7.607  -41.836 0.05 11.96 ? 54   ALA A CB    2  
ATOM   7006   N  N     B ARG A 1 56  ? -28.949 -7.341  -42.184 0.05 12.16 ? 55   ARG A N     2  
ATOM   7007   C  CA    B ARG A 1 56  ? -30.191 -6.749  -41.693 0.05 12.21 ? 55   ARG A CA    2  
ATOM   7008   C  C     B ARG A 1 56  ? -30.150 -6.508  -40.192 0.05 12.07 ? 55   ARG A C     2  
ATOM   7009   O  O     B ARG A 1 56  ? -30.101 -7.462  -39.416 0.05 11.95 ? 55   ARG A O     2  
ATOM   7010   C  CB    B ARG A 1 56  ? -31.385 -7.647  -42.024 0.05 12.31 ? 55   ARG A CB    2  
ATOM   7011   C  CG    B ARG A 1 56  ? -32.324 -7.054  -43.067 0.05 12.49 ? 55   ARG A CG    2  
ATOM   7012   C  CD    B ARG A 1 56  ? -33.633 -7.826  -43.170 0.05 12.58 ? 55   ARG A CD    2  
ATOM   7013   N  NE    B ARG A 1 56  ? -34.039 -8.408  -41.894 0.05 12.45 ? 55   ARG A NE    2  
ATOM   7014   C  CZ    B ARG A 1 56  ? -34.518 -7.707  -40.874 0.05 12.41 ? 55   ARG A CZ    2  
ATOM   7015   N  NH1   B ARG A 1 56  ? -34.635 -6.389  -40.979 0.05 12.47 ? 55   ARG A NH1   2  
ATOM   7016   N  NH2   B ARG A 1 56  ? -34.862 -8.317  -39.742 0.05 12.30 ? 55   ARG A NH2   2  
ATOM   7017   N  N     B PRO A 1 57  ? -30.197 -5.233  -39.774 0.05 12.08 ? 56   PRO A N     2  
ATOM   7018   C  CA    B PRO A 1 57  ? -30.122 -4.935  -38.339 0.05 11.96 ? 56   PRO A CA    2  
ATOM   7019   C  C     B PRO A 1 57  ? -31.397 -5.301  -37.594 0.05 11.94 ? 56   PRO A C     2  
ATOM   7020   O  O     B PRO A 1 57  ? -32.502 -4.920  -38.001 0.05 12.07 ? 56   PRO A O     2  
ATOM   7021   C  CB    B PRO A 1 57  ? -29.906 -3.415  -38.293 0.05 12.02 ? 56   PRO A CB    2  
ATOM   7022   C  CG    B PRO A 1 57  ? -29.607 -2.995  -39.692 0.05 12.16 ? 56   PRO A CG    2  
ATOM   7023   C  CD    B PRO A 1 57  ? -30.250 -4.007  -40.588 0.05 12.23 ? 56   PRO A CD    2  
ATOM   7024   N  N     B VAL A 1 58  ? -31.225 -6.047  -36.504 0.05 11.80 ? 57   VAL A N     2  
ATOM   7025   C  CA    B VAL A 1 58  ? -32.315 -6.412  -35.611 0.05 11.78 ? 57   VAL A CA    2  
ATOM   7026   C  C     B VAL A 1 58  ? -32.068 -5.716  -34.277 0.05 11.68 ? 57   VAL A C     2  
ATOM   7027   O  O     B VAL A 1 58  ? -31.147 -6.073  -33.537 0.05 11.56 ? 57   VAL A O     2  
ATOM   7028   C  CB    B VAL A 1 58  ? -32.366 -7.923  -35.391 0.05 11.71 ? 57   VAL A CB    2  
ATOM   7029   C  CG1   B VAL A 1 58  ? -33.452 -8.273  -34.385 0.05 11.69 ? 57   VAL A CG1   2  
ATOM   7030   C  CG2   B VAL A 1 58  ? -32.587 -8.664  -36.717 0.05 11.81 ? 57   VAL A CG2   2  
ATOM   7031   N  N     B LEU A 1 59  ? -32.882 -4.708  -33.978 0.05 11.75 ? 58   LEU A N     2  
ATOM   7032   C  CA    B LEU A 1 59  ? -32.586 -3.796  -32.875 0.05 11.70 ? 58   LEU A CA    2  
ATOM   7033   C  C     B LEU A 1 59  ? -32.984 -4.305  -31.493 0.05 11.61 ? 58   LEU A C     2  
ATOM   7034   O  O     B LEU A 1 59  ? -33.971 -5.025  -31.338 0.05 11.63 ? 58   LEU A O     2  
ATOM   7035   C  CB    B LEU A 1 59  ? -33.232 -2.433  -33.122 0.05 11.83 ? 58   LEU A CB    2  
ATOM   7036   C  CG    B LEU A 1 59  ? -32.882 -1.827  -34.484 0.05 11.96 ? 58   LEU A CG    2  
ATOM   7037   C  CD1   B LEU A 1 59  ? -33.367 -0.397  -34.582 0.05 12.11 ? 58   LEU A CD1   2  
ATOM   7038   C  CD2   B LEU A 1 59  ? -31.381 -1.922  -34.761 0.05 11.91 ? 58   LEU A CD2   2  
ATOM   7039   N  N     B TYR A 1 60  ? -32.198 -3.915  -30.493 0.05 11.52 ? 59   TYR A N     2  
ATOM   7040   C  CA    B TYR A 1 60  ? -32.512 -4.205  -29.096 0.05 11.44 ? 59   TYR A CA    2  
ATOM   7041   C  C     B TYR A 1 60  ? -31.940 -3.121  -28.185 0.05 11.41 ? 59   TYR A C     2  
ATOM   7042   O  O     B TYR A 1 60  ? -30.891 -2.532  -28.469 0.05 11.41 ? 59   TYR A O     2  
ATOM   7043   C  CB    B TYR A 1 60  ? -32.043 -5.612  -28.681 0.05 11.33 ? 59   TYR A CB    2  
ATOM   7044   C  CG    B TYR A 1 60  ? -30.548 -5.766  -28.439 0.05 11.23 ? 59   TYR A CG    2  
ATOM   7045   C  CD1   B TYR A 1 60  ? -29.666 -5.959  -29.494 0.05 11.23 ? 59   TYR A CD1   2  
ATOM   7046   C  CD2   B TYR A 1 60  ? -30.033 -5.758  -27.149 0.05 11.15 ? 59   TYR A CD2   2  
ATOM   7047   C  CE1   B TYR A 1 60  ? -28.302 -6.112  -29.271 0.05 11.15 ? 59   TYR A CE1   2  
ATOM   7048   C  CE2   B TYR A 1 60  ? -28.673 -5.905  -26.913 0.05 11.07 ? 59   TYR A CE2   2  
ATOM   7049   C  CZ    B TYR A 1 60  ? -27.813 -6.079  -27.978 0.05 11.07 ? 59   TYR A CZ    2  
ATOM   7050   O  OH    B TYR A 1 60  ? -26.464 -6.236  -27.746 0.05 11.00 ? 59   TYR A OH    2  
ATOM   7051   N  N     B HIS A 1 61  ? -32.660 -2.833  -27.112 0.05 11.41 ? 60   HIS A N     2  
ATOM   7052   C  CA    B HIS A 1 61  ? -32.244 -1.803  -26.168 0.05 11.39 ? 60   HIS A CA    2  
ATOM   7053   C  C     B HIS A 1 61  ? -31.098 -2.319  -25.302 0.05 11.27 ? 60   HIS A C     2  
ATOM   7054   O  O     B HIS A 1 61  ? -31.139 -3.455  -24.830 0.05 11.20 ? 60   HIS A O     2  
ATOM   7055   C  CB    B HIS A 1 61  ? -33.432 -1.396  -25.291 0.05 11.44 ? 60   HIS A CB    2  
ATOM   7056   C  CG    B HIS A 1 61  ? -33.042 -0.774  -23.987 0.05 11.42 ? 60   HIS A CG    2  
ATOM   7057   N  ND1   B HIS A 1 61  ? -32.791 0.576   -23.847 0.05 11.50 ? 60   HIS A ND1   2  
ATOM   7058   C  CD2   B HIS A 1 61  ? -32.878 -1.316  -22.757 0.05 11.36 ? 60   HIS A CD2   2  
ATOM   7059   C  CE1   B HIS A 1 61  ? -32.479 0.834   -22.589 0.05 11.48 ? 60   HIS A CE1   2  
ATOM   7060   N  NE2   B HIS A 1 61  ? -32.525 -0.296  -21.908 0.05 11.39 ? 60   HIS A NE2   2  
ATOM   7061   N  N     B SER A 1 62  ? -30.091 -1.474  -25.095 0.05 11.26 ? 61   SER A N     2  
ATOM   7062   C  CA    B SER A 1 62  ? -28.916 -1.821  -24.293 0.05 11.16 ? 61   SER A CA    2  
ATOM   7063   C  C     B SER A 1 62  ? -28.858 -1.005  -23.017 0.05 11.18 ? 61   SER A C     2  
ATOM   7064   O  O     B SER A 1 62  ? -29.260 0.161   -23.000 0.05 11.27 ? 61   SER A O     2  
ATOM   7065   C  CB    B SER A 1 62  ? -27.637 -1.567  -25.096 0.05 11.15 ? 61   SER A CB    2  
ATOM   7066   O  OG    B SER A 1 62  ? -26.475 -1.942  -24.369 0.05 11.09 ? 61   SER A OG    2  
ATOM   7067   N  N     B THR A 1 63  ? -28.341 -1.612  -21.953 0.05 11.10 ? 62   THR A N     2  
ATOM   7068   C  CA    B THR A 1 63  ? -28.138 -0.906  -20.692 0.05 11.12 ? 62   THR A CA    2  
ATOM   7069   C  C     B THR A 1 63  ? -26.663 -0.565  -20.452 0.05 11.09 ? 62   THR A C     2  
ATOM   7070   O  O     B THR A 1 63  ? -26.302 -0.008  -19.417 0.05 11.11 ? 62   THR A O     2  
ATOM   7071   C  CB    B THR A 1 63  ? -28.682 -1.702  -19.497 0.05 11.08 ? 62   THR A CB    2  
ATOM   7072   O  OG1   B THR A 1 63  ? -27.925 -2.912  -19.337 0.05 10.99 ? 62   THR A OG1   2  
ATOM   7073   C  CG2   B THR A 1 63  ? -30.161 -2.045  -19.709 0.05 11.12 ? 62   THR A CG2   2  
ATOM   7074   N  N     B LEU A 1 64  ? -25.821 -0.889  -21.426 0.05 11.06 ? 63   LEU A N     2  
ATOM   7075   C  CA    B LEU A 1 64  ? -24.386 -0.628  -21.327 0.05 11.04 ? 63   LEU A CA    2  
ATOM   7076   C  C     B LEU A 1 64  ? -24.056 0.814   -21.747 0.05 11.14 ? 63   LEU A C     2  
ATOM   7077   O  O     B LEU A 1 64  ? -24.889 1.486   -22.363 0.05 11.22 ? 63   LEU A O     2  
ATOM   7078   C  CB    B LEU A 1 64  ? -23.639 -1.646  -22.193 0.05 10.99 ? 63   LEU A CB    2  
ATOM   7079   C  CG    B LEU A 1 64  ? -23.728 -3.112  -21.755 0.05 10.90 ? 63   LEU A CG    2  
ATOM   7080   C  CD1   B LEU A 1 64  ? -23.175 -4.024  -22.847 0.05 10.87 ? 63   LEU A CD1   2  
ATOM   7081   C  CD2   B LEU A 1 64  ? -23.002 -3.337  -20.426 0.05 10.86 ? 63   LEU A CD2   2  
ATOM   7082   N  N     B PRO A 1 65  ? -22.846 1.302   -21.406 0.05 11.16 ? 64   PRO A N     2  
ATOM   7083   C  CA    B PRO A 1 65  ? -22.439 2.652   -21.821 0.05 11.27 ? 64   PRO A CA    2  
ATOM   7084   C  C     B PRO A 1 65  ? -22.439 2.827   -23.337 0.05 11.33 ? 64   PRO A C     2  
ATOM   7085   O  O     B PRO A 1 65  ? -22.272 1.852   -24.073 0.05 11.27 ? 64   PRO A O     2  
ATOM   7086   C  CB    B PRO A 1 65  ? -21.009 2.762   -21.286 0.05 11.27 ? 64   PRO A CB    2  
ATOM   7087   C  CG    B PRO A 1 65  ? -21.002 1.828   -20.074 0.05 11.18 ? 64   PRO A CG    2  
ATOM   7088   C  CD    B PRO A 1 65  ? -21.850 0.674   -20.515 0.05 11.10 ? 64   PRO A CD    2  
ATOM   7089   N  N     B GLY A 1 66  ? -22.630 4.062   -23.791 0.05 11.45 ? 65   GLY A N     2  
ATOM   7090   C  CA    B GLY A 1 66  ? -22.614 4.364   -25.211 0.05 11.52 ? 65   GLY A CA    2  
ATOM   7091   C  C     B GLY A 1 66  ? -21.258 4.166   -25.857 0.05 11.51 ? 65   GLY A C     2  
ATOM   7092   O  O     B GLY A 1 66  ? -20.227 4.196   -25.180 0.05 11.47 ? 65   GLY A O     2  
ATOM   7093   N  N     B PRO A 1 67  ? -21.251 3.962   -27.184 0.05 11.54 ? 66   PRO A N     2  
ATOM   7094   C  CA    B PRO A 1 67  ? -20.040 3.760   -27.991 0.05 11.54 ? 66   PRO A CA    2  
ATOM   7095   C  C     B PRO A 1 67  ? -19.047 4.921   -27.924 0.05 11.63 ? 66   PRO A C     2  
ATOM   7096   O  O     B PRO A 1 67  ? -17.873 4.783   -28.292 0.05 11.60 ? 66   PRO A O     2  
ATOM   7097   C  CB    B PRO A 1 67  ? -20.589 3.623   -29.419 0.05 11.60 ? 66   PRO A CB    2  
ATOM   7098   C  CG    B PRO A 1 67  ? -21.997 4.129   -29.367 0.05 11.67 ? 66   PRO A CG    2  
ATOM   7099   C  CD    B PRO A 1 67  ? -22.476 3.824   -27.991 0.05 11.59 ? 66   PRO A CD    2  
ATOM   7100   N  N     B ASP A 1 68  ? -19.517 6.064   -27.452 0.05 11.75 ? 67   ASP A N     2  
ATOM   7101   C  CA    B ASP A 1 68  ? -18.682 7.249   -27.414 0.05 11.85 ? 67   ASP A CA    2  
ATOM   7102   C  C     B ASP A 1 68  ? -18.482 7.723   -25.965 0.05 11.86 ? 67   ASP A C     2  
ATOM   7103   O  O     B ASP A 1 68  ? -17.844 8.740   -25.704 0.05 11.98 ? 67   ASP A O     2  
ATOM   7104   C  CB    B ASP A 1 68  ? -19.254 8.318   -28.362 0.05 12.02 ? 67   ASP A CB    2  
ATOM   7105   C  CG    B ASP A 1 68  ? -19.144 7.906   -29.837 0.05 12.03 ? 67   ASP A CG    2  
ATOM   7106   O  OD1   B ASP A 1 68  ? -19.988 8.316   -30.666 0.05 11.96 ? 67   ASP A OD1   2  
ATOM   7107   O  OD2   B ASP A 1 68  ? -18.204 7.152   -30.165 0.05 12.11 ? 67   ASP A OD2   2  
ATOM   7108   N  N     B ALA A 1 69  ? -19.007 6.953   -25.015 0.05 11.75 ? 68   ALA A N     2  
ATOM   7109   C  CA    B ALA A 1 69  ? -18.695 7.175   -23.611 0.05 11.74 ? 68   ALA A CA    2  
ATOM   7110   C  C     B ALA A 1 69  ? -17.216 6.884   -23.386 0.05 11.68 ? 68   ALA A C     2  
ATOM   7111   O  O     B ALA A 1 69  ? -16.622 6.098   -24.110 0.05 11.63 ? 68   ALA A O     2  
ATOM   7112   C  CB    B ALA A 1 69  ? -19.559 6.277   -22.715 0.05 11.64 ? 68   ALA A CB    2  
ATOM   7113   N  N     B ASP A 1 70  ? -16.609 7.530   -22.397 0.05 11.70 ? 69   ASP A N     2  
ATOM   7114   C  CA    B ASP A 1 70  ? -15.244 7.171   -22.014 0.05 11.68 ? 69   ASP A CA    2  
ATOM   7115   C  C     B ASP A 1 70  ? -15.312 5.781   -21.397 0.05 11.54 ? 69   ASP A C     2  
ATOM   7116   O  O     B ASP A 1 70  ? -16.374 5.399   -20.894 0.05 11.46 ? 69   ASP A O     2  
ATOM   7117   C  CB    B ASP A 1 70  ? -14.698 8.181   -21.010 0.05 11.80 ? 69   ASP A CB    2  
ATOM   7118   C  CG    B ASP A 1 70  ? -14.821 9.613   -21.506 0.05 11.93 ? 69   ASP A CG    2  
ATOM   7119   O  OD1   B ASP A 1 70  ? -15.780 10.318  -21.114 0.05 11.92 ? 69   ASP A OD1   2  
ATOM   7120   O  OD2   B ASP A 1 70  ? -13.964 10.028  -22.315 0.05 12.06 ? 69   ASP A OD2   2  
ATOM   7121   N  N     B PRO A 1 71  ? -14.201 5.008   -21.436 0.05 11.51 ? 70   PRO A N     2  
ATOM   7122   C  CA    B PRO A 1 71  ? -14.247 3.659   -20.853 0.05 11.41 ? 70   PRO A CA    2  
ATOM   7123   C  C     B PRO A 1 71  ? -14.516 3.747   -19.355 0.05 11.41 ? 70   PRO A C     2  
ATOM   7124   O  O     B PRO A 1 71  ? -14.831 2.747   -18.716 0.05 11.32 ? 70   PRO A O     2  
ATOM   7125   C  CB    B PRO A 1 71  ? -12.831 3.106   -21.092 0.05 11.47 ? 70   PRO A CB    2  
ATOM   7126   C  CG    B PRO A 1 71  ? -12.193 4.023   -22.067 0.05 11.53 ? 70   PRO A CG    2  
ATOM   7127   C  CD    B PRO A 1 71  ? -12.847 5.359   -21.897 0.05 11.58 ? 70   PRO A CD    2  
ATOM   7128   N  N     B GLU A 1 72  ? -14.381 4.954   -18.811 0.05 11.53 ? 71   GLU A N     2  
ATOM   7129   C  CA    B GLU A 1 72  ? -14.657 5.219   -17.409 0.05 11.55 ? 71   GLU A CA    2  
ATOM   7130   C  C     B GLU A 1 72  ? -16.052 4.725   -17.084 0.05 11.47 ? 71   GLU A C     2  
ATOM   7131   O  O     B GLU A 1 72  ? -16.293 4.174   -16.011 0.05 11.43 ? 71   GLU A O     2  
ATOM   7132   C  CB    B GLU A 1 72  ? -14.561 6.724   -17.113 0.05 11.71 ? 71   GLU A CB    2  
ATOM   7133   C  CG    B GLU A 1 72  ? -13.134 7.298   -17.084 0.05 11.81 ? 71   GLU A CG    2  
ATOM   7134   C  CD    B GLU A 1 72  ? -12.188 6.600   -18.041 0.05 11.78 ? 71   GLU A CD    2  
ATOM   7135   O  OE1   B GLU A 1 72  ? -11.577 5.586   -17.627 0.05 11.74 ? 71   GLU A OE1   2  
ATOM   7136   O  OE2   B GLU A 1 72  ? -12.066 7.052   -19.202 0.05 11.81 ? 71   GLU A OE2   2  
ATOM   7137   N  N     B ALA A 1 73  ? -16.960 4.915   -18.035 0.05 11.46 ? 72   ALA A N     2  
ATOM   7138   C  CA    B ALA A 1 73  ? -18.351 4.519   -17.869 0.05 11.40 ? 72   ALA A CA    2  
ATOM   7139   C  C     B ALA A 1 73  ? -18.475 3.010   -17.699 0.05 11.27 ? 72   ALA A C     2  
ATOM   7140   O  O     B ALA A 1 73  ? -19.443 2.519   -17.121 0.05 11.23 ? 72   ALA A O     2  
ATOM   7141   C  CB    B ALA A 1 73  ? -19.175 4.992   -19.055 0.05 11.43 ? 72   ALA A CB    2  
ATOM   7142   N  N     B TRP A 1 74  ? -17.485 2.282   -18.200 0.05 11.22 ? 73   TRP A N     2  
ATOM   7143   C  CA    B TRP A 1 74  ? -17.506 0.820   -18.156 0.05 11.11 ? 73   TRP A CA    2  
ATOM   7144   C  C     B TRP A 1 74  ? -16.992 0.264   -16.833 0.05 11.10 ? 73   TRP A C     2  
ATOM   7145   O  O     B TRP A 1 74  ? -16.912 -0.956  -16.651 0.05 11.02 ? 73   TRP A O     2  
ATOM   7146   C  CB    B TRP A 1 74  ? -16.706 0.248   -19.333 0.05 11.08 ? 73   TRP A CB    2  
ATOM   7147   C  CG    B TRP A 1 74  ? -17.302 0.624   -20.659 0.05 11.10 ? 73   TRP A CG    2  
ATOM   7148   C  CD1   B TRP A 1 74  ? -17.144 1.813   -21.332 0.05 11.19 ? 73   TRP A CD1   2  
ATOM   7149   C  CD2   B TRP A 1 74  ? -18.173 -0.180  -21.468 0.05 11.04 ? 73   TRP A CD2   2  
ATOM   7150   N  NE1   B TRP A 1 74  ? -17.862 1.788   -22.505 0.05 11.20 ? 73   TRP A NE1   2  
ATOM   7151   C  CE2   B TRP A 1 74  ? -18.503 0.579   -22.612 0.05 11.10 ? 73   TRP A CE2   2  
ATOM   7152   C  CE3   B TRP A 1 74  ? -18.700 -1.469  -21.339 0.05 10.95 ? 73   TRP A CE3   2  
ATOM   7153   C  CZ2   B TRP A 1 74  ? -19.334 0.088   -23.621 0.05 11.08 ? 73   TRP A CZ2   2  
ATOM   7154   C  CZ3   B TRP A 1 74  ? -19.526 -1.953  -22.339 0.05 10.93 ? 73   TRP A CZ3   2  
ATOM   7155   C  CH2   B TRP A 1 74  ? -19.831 -1.181  -23.466 0.05 10.99 ? 73   TRP A CH2   2  
ATOM   7156   N  N     B GLY A 1 75  ? -16.636 1.155   -15.909 0.05 11.18 ? 74   GLY A N     2  
ATOM   7157   C  CA    B GLY A 1 75  ? -16.180 0.736   -14.596 0.05 11.19 ? 74   GLY A CA    2  
ATOM   7158   C  C     B GLY A 1 75  ? -14.671 0.646   -14.438 0.05 11.22 ? 74   GLY A C     2  
ATOM   7159   O  O     B GLY A 1 75  ? -13.922 0.620   -15.421 0.05 11.21 ? 74   GLY A O     2  
ATOM   7160   N  N     B SER A 1 76  ? -14.226 0.583   -13.186 0.05 11.27 ? 75   SER A N     2  
ATOM   7161   C  CA    B SER A 1 76  ? -12.806 0.623   -12.875 0.05 11.32 ? 75   SER A CA    2  
ATOM   7162   C  C     B SER A 1 76  ? -12.426 -0.383  -11.802 0.05 11.31 ? 75   SER A C     2  
ATOM   7163   O  O     B SER A 1 76  ? -11.400 -0.223  -11.142 0.05 11.39 ? 75   SER A O     2  
ATOM   7164   C  CB    B SER A 1 76  ? -12.424 2.020   -12.383 0.05 11.46 ? 75   SER A CB    2  
ATOM   7165   O  OG    B SER A 1 76  ? -13.031 3.014   -13.181 0.05 11.48 ? 75   SER A OG    2  
ATOM   7166   N  N     B THR A 1 77  ? -13.265 -1.393  -11.597 0.05 11.23 ? 76   THR A N     2  
ATOM   7167   C  CA    B THR A 1 77  ? -12.924 -2.508  -10.722 0.05 11.21 ? 76   THR A CA    2  
ATOM   7168   C  C     B THR A 1 77  ? -13.360 -3.790  -11.425 0.05 11.10 ? 76   THR A C     2  
ATOM   7169   O  O     B THR A 1 77  ? -14.142 -3.743  -12.370 0.05 11.04 ? 76   THR A O     2  
ATOM   7170   C  CB    B THR A 1 77  ? -13.642 -2.428  -9.363  0.05 11.26 ? 76   THR A CB    2  
ATOM   7171   O  OG1   B THR A 1 77  ? -15.054 -2.547  -9.560  0.05 11.20 ? 76   THR A OG1   2  
ATOM   7172   C  CG2   B THR A 1 77  ? -13.348 -1.098  -8.659  0.05 11.38 ? 76   THR A CG2   2  
ATOM   7173   N  N     B LEU A 1 78  ? -12.860 -4.928  -10.959 0.05 11.09 ? 77   LEU A N     2  
ATOM   7174   C  CA    B LEU A 1 78  ? -13.192 -6.198  -11.588 0.05 11.01 ? 77   LEU A CA    2  
ATOM   7175   C  C     B LEU A 1 78  ? -14.702 -6.420  -11.634 0.05 10.95 ? 77   LEU A C     2  
ATOM   7176   O  O     B LEU A 1 78  ? -15.271 -6.698  -12.685 0.05 10.89 ? 77   LEU A O     2  
ATOM   7177   C  CB    B LEU A 1 78  ? -12.516 -7.342  -10.839 0.05 11.03 ? 77   LEU A CB    2  
ATOM   7178   C  CG    B LEU A 1 78  ? -12.836 -8.720  -11.404 0.05 10.96 ? 77   LEU A CG    2  
ATOM   7179   C  CD1   B LEU A 1 78  ? -12.281 -8.834  -12.810 0.05 10.92 ? 77   LEU A CD1   2  
ATOM   7180   C  CD2   B LEU A 1 78  ? -12.291 -9.803  -10.494 0.05 11.01 ? 77   LEU A CD2   2  
ATOM   7181   N  N     B LEU A 1 79  ? -15.356 -6.292  -10.489 0.05 10.99 ? 78   LEU A N     2  
ATOM   7182   C  CA    B LEU A 1 79  ? -16.797 -6.486  -10.466 0.05 10.95 ? 78   LEU A CA    2  
ATOM   7183   C  C     B LEU A 1 79  ? -17.566 -5.394  -11.230 0.05 10.94 ? 78   LEU A C     2  
ATOM   7184   O  O     B LEU A 1 79  ? -18.563 -5.681  -11.891 0.05 10.89 ? 78   LEU A O     2  
ATOM   7185   C  CB    B LEU A 1 79  ? -17.293 -6.684  -9.026  0.05 11.01 ? 78   LEU A CB    2  
ATOM   7186   C  CG    B LEU A 1 79  ? -17.079 -8.145  -8.629  0.05 11.01 ? 78   LEU A CG    2  
ATOM   7187   C  CD1   B LEU A 1 79  ? -16.936 -8.367  -7.121  0.05 11.10 ? 78   LEU A CD1   2  
ATOM   7188   C  CD2   B LEU A 1 79  ? -18.248 -8.955  -9.174  0.05 10.95 ? 78   LEU A CD2   2  
ATOM   7189   N  N     B ASP A 1 80  ? -17.111 -4.145  -11.170 0.05 11.00 ? 79   ASP A N     2  
ATOM   7190   C  CA    B ASP A 1 80  ? -17.790 -3.113  -11.954 0.05 11.01 ? 79   ASP A CA    2  
ATOM   7191   C  C     B ASP A 1 80  ? -17.585 -3.297  -13.459 0.05 10.95 ? 79   ASP A C     2  
ATOM   7192   O  O     B ASP A 1 80  ? -18.374 -2.801  -14.263 0.05 10.94 ? 79   ASP A O     2  
ATOM   7193   C  CB    B ASP A 1 80  ? -17.377 -1.708  -11.514 0.05 11.10 ? 79   ASP A CB    2  
ATOM   7194   C  CG    B ASP A 1 80  ? -18.423 -1.053  -10.644 0.05 11.16 ? 79   ASP A CG    2  
ATOM   7195   O  OD1   B ASP A 1 80  ? -19.587 -0.947  -11.099 0.05 11.13 ? 79   ASP A OD1   2  
ATOM   7196   O  OD2   B ASP A 1 80  ? -18.089 -0.651  -9.510  0.05 11.26 ? 79   ASP A OD2   2  
ATOM   7197   N  N     B ASN A 1 81  ? -16.531 -4.012  -13.837 0.05 10.92 ? 80   ASN A N     2  
ATOM   7198   C  CA    B ASN A 1 81  ? -16.314 -4.316  -15.249 0.05 10.88 ? 80   ASN A CA    2  
ATOM   7199   C  C     B ASN A 1 81  ? -17.232 -5.432  -15.742 0.05 10.81 ? 80   ASN A C     2  
ATOM   7200   O  O     B ASN A 1 81  ? -17.816 -5.327  -16.816 0.05 10.78 ? 80   ASN A O     2  
ATOM   7201   C  CB    B ASN A 1 81  ? -14.867 -4.729  -15.524 0.05 10.88 ? 80   ASN A CB    2  
ATOM   7202   C  CG    B ASN A 1 81  ? -13.894 -3.585  -15.390 0.05 10.96 ? 80   ASN A CG    2  
ATOM   7203   O  OD1   B ASN A 1 81  ? -14.268 -2.408  -15.503 0.05 11.00 ? 80   ASN A OD1   2  
ATOM   7204   N  ND2   B ASN A 1 81  ? -12.635 -3.921  -15.151 0.05 10.99 ? 80   ASN A ND2   2  
ATOM   7205   N  N     B VAL A 1 82  ? -17.337 -6.512  -14.973 0.05 10.79 ? 81   VAL A N     2  
ATOM   7206   C  CA    B VAL A 1 82  ? -18.058 -7.693  -15.473 0.05 10.73 ? 81   VAL A CA    2  
ATOM   7207   C  C     B VAL A 1 82  ? -19.567 -7.667  -15.228 0.05 10.73 ? 81   VAL A C     2  
ATOM   7208   O  O     B VAL A 1 82  ? -20.339 -8.123  -16.067 0.05 10.70 ? 81   VAL A O     2  
ATOM   7209   C  CB    B VAL A 1 82  ? -17.468 -9.031  -14.944 0.05 10.72 ? 81   VAL A CB    2  
ATOM   7210   C  CG1   B VAL A 1 82  ? -16.000 -9.146  -15.314 0.05 10.73 ? 81   VAL A CG1   2  
ATOM   7211   C  CG2   B VAL A 1 82  ? -17.672 -9.181  -13.430 0.05 10.76 ? 81   VAL A CG2   2  
ATOM   7212   N  N     B GLU A 1 83  ? -19.992 -7.154  -14.080 0.05 10.77 ? 82   GLU A N     2  
ATOM   7213   C  CA    B GLU A 1 83  ? -21.420 -7.162  -13.757 0.05 10.78 ? 82   GLU A CA    2  
ATOM   7214   C  C     B GLU A 1 83  ? -22.348 -6.532  -14.804 0.05 10.78 ? 82   GLU A C     2  
ATOM   7215   O  O     B GLU A 1 83  ? -23.438 -7.062  -15.053 0.05 10.77 ? 82   GLU A O     2  
ATOM   7216   C  CB    B GLU A 1 83  ? -21.684 -6.576  -12.361 0.05 10.84 ? 82   GLU A CB    2  
ATOM   7217   C  CG    B GLU A 1 83  ? -21.032 -7.384  -11.248 0.05 10.86 ? 82   GLU A CG    2  
ATOM   7218   C  CD    B GLU A 1 83  ? -21.736 -7.230  -9.911  0.05 10.92 ? 82   GLU A CD    2  
ATOM   7219   O  OE1   B GLU A 1 83  ? -22.881 -7.714  -9.788  0.05 10.91 ? 82   GLU A OE1   2  
ATOM   7220   O  OE2   B GLU A 1 83  ? -21.149 -6.631  -8.979  0.05 10.98 ? 82   GLU A OE2   2  
ATOM   7221   N  N     B PRO A 1 84  ? -21.935 -5.414  -15.431 0.05 10.80 ? 83   PRO A N     2  
ATOM   7222   C  CA    B PRO A 1 84  ? -22.841 -4.846  -16.434 0.05 10.81 ? 83   PRO A CA    2  
ATOM   7223   C  C     B PRO A 1 84  ? -23.162 -5.789  -17.597 0.05 10.77 ? 83   PRO A C     2  
ATOM   7224   O  O     B PRO A 1 84  ? -24.236 -5.686  -18.187 0.05 10.78 ? 83   PRO A O     2  
ATOM   7225   C  CB    B PRO A 1 84  ? -22.071 -3.623  -16.937 0.05 10.85 ? 83   PRO A CB    2  
ATOM   7226   C  CG    B PRO A 1 84  ? -21.264 -3.201  -15.758 0.05 10.88 ? 83   PRO A CG    2  
ATOM   7227   C  CD    B PRO A 1 84  ? -20.824 -4.489  -15.121 0.05 10.83 ? 83   PRO A CD    2  
ATOM   7228   N  N     B PHE A 1 85  ? -22.250 -6.696  -17.923 0.05 10.72 ? 84   PHE A N     2  
ATOM   7229   C  CA    B PHE A 1 85  ? -22.503 -7.597  -19.041 0.05 10.70 ? 84   PHE A CA    2  
ATOM   7230   C  C     B PHE A 1 85  ? -23.563 -8.629  -18.699 0.05 10.69 ? 84   PHE A C     2  
ATOM   7231   O  O     B PHE A 1 85  ? -24.334 -9.046  -19.565 0.05 10.70 ? 84   PHE A O     2  
ATOM   7232   C  CB    B PHE A 1 85  ? -21.214 -8.249  -19.515 0.05 10.67 ? 84   PHE A CB    2  
ATOM   7233   C  CG    B PHE A 1 85  ? -20.277 -7.281  -20.156 0.05 10.68 ? 84   PHE A CG    2  
ATOM   7234   C  CD1   B PHE A 1 85  ? -20.488 -6.867  -21.459 0.05 10.70 ? 84   PHE A CD1   2  
ATOM   7235   C  CD2   B PHE A 1 85  ? -19.212 -6.754  -19.447 0.05 10.70 ? 84   PHE A CD2   2  
ATOM   7236   C  CE1   B PHE A 1 85  ? -19.634 -5.956  -22.053 0.05 10.74 ? 84   PHE A CE1   2  
ATOM   7237   C  CE2   B PHE A 1 85  ? -18.356 -5.847  -20.035 0.05 10.73 ? 84   PHE A CE2   2  
ATOM   7238   C  CZ    B PHE A 1 85  ? -18.562 -5.449  -21.331 0.05 10.75 ? 84   PHE A CZ    2  
ATOM   7239   N  N     B LEU A 1 86  ? -23.612 -9.021  -17.431 0.05 10.69 ? 85   LEU A N     2  
ATOM   7240   C  CA    B LEU A 1 86  ? -24.662 -9.921  -16.981 0.05 10.70 ? 85   LEU A CA    2  
ATOM   7241   C  C     B LEU A 1 86  ? -25.979 -9.167  -16.884 0.05 10.74 ? 85   LEU A C     2  
ATOM   7242   O  O     B LEU A 1 86  ? -27.024 -9.677  -17.283 0.05 10.76 ? 85   LEU A O     2  
ATOM   7243   C  CB    B LEU A 1 86  ? -24.306 -10.550 -15.631 0.05 10.71 ? 85   LEU A CB    2  
ATOM   7244   C  CG    B LEU A 1 86  ? -25.404 -11.426 -15.017 0.05 10.74 ? 85   LEU A CG    2  
ATOM   7245   C  CD1   B LEU A 1 86  ? -25.687 -12.655 -15.884 0.05 10.73 ? 85   LEU A CD1   2  
ATOM   7246   C  CD2   B LEU A 1 86  ? -25.006 -11.844 -13.602 0.05 10.76 ? 85   LEU A CD2   2  
ATOM   7247   N  N     B ASN A 1 87  ? -25.932 -7.944  -16.359 0.05 10.77 ? 86   ASN A N     2  
ATOM   7248   C  CA    B ASN A 1 87  ? -27.147 -7.129  -16.282 0.05 10.82 ? 86   ASN A CA    2  
ATOM   7249   C  C     B ASN A 1 87  ? -27.763 -6.860  -17.650 0.05 10.84 ? 86   ASN A C     2  
ATOM   7250   O  O     B ASN A 1 87  ? -28.974 -6.986  -17.828 0.05 10.88 ? 86   ASN A O     2  
ATOM   7251   C  CB    B ASN A 1 87  ? -26.882 -5.793  -15.577 0.05 10.87 ? 86   ASN A CB    2  
ATOM   7252   C  CG    B ASN A 1 87  ? -26.554 -5.959  -14.111 0.05 10.87 ? 86   ASN A CG    2  
ATOM   7253   O  OD1   B ASN A 1 87  ? -27.030 -6.881  -13.453 0.05 10.87 ? 86   ASN A OD1   2  
ATOM   7254   N  ND2   B ASN A 1 87  ? -25.738 -5.054  -13.587 0.05 10.88 ? 86   ASN A ND2   2  
ATOM   7255   N  N     B ASP A 1 88  ? -26.936 -6.469  -18.615 0.05 10.82 ? 87   ASP A N     2  
ATOM   7256   C  CA    B ASP A 1 88  ? -27.440 -6.252  -19.969 0.05 10.85 ? 87   ASP A CA    2  
ATOM   7257   C  C     B ASP A 1 88  ? -28.046 -7.539  -20.539 0.05 10.84 ? 87   ASP A C     2  
ATOM   7258   O  O     B ASP A 1 88  ? -29.122 -7.520  -21.137 0.05 10.89 ? 87   ASP A O     2  
ATOM   7259   C  CB    B ASP A 1 88  ? -26.334 -5.729  -20.892 0.05 10.84 ? 87   ASP A CB    2  
ATOM   7260   C  CG    B ASP A 1 88  ? -26.876 -5.195  -22.204 0.05 10.88 ? 87   ASP A CG    2  
ATOM   7261   O  OD1   B ASP A 1 88  ? -27.371 -4.050  -22.217 0.05 10.94 ? 87   ASP A OD1   2  
ATOM   7262   O  OD2   B ASP A 1 88  ? -26.814 -5.911  -23.222 0.05 10.86 ? 87   ASP A OD2   2  
ATOM   7263   N  N     B ALA A 1 89  ? -27.354 -8.653  -20.330 0.05 10.79 ? 88   ALA A N     2  
ATOM   7264   C  CA    B ALA A 1 89  ? -27.800 -9.950  -20.838 0.05 10.79 ? 88   ALA A CA    2  
ATOM   7265   C  C     B ALA A 1 89  ? -29.184 -10.325 -20.329 0.05 10.83 ? 88   ALA A C     2  
ATOM   7266   O  O     B ALA A 1 89  ? -30.010 -10.835 -21.083 0.05 10.88 ? 88   ALA A O     2  
ATOM   7267   C  CB    B ALA A 1 89  ? -26.818 -11.029 -20.451 0.05 10.74 ? 88   ALA A CB    2  
ATOM   7268   N  N     B ILE A 1 90  ? -29.416 -10.095 -19.043 0.05 10.84 ? 89   ILE A N     2  
ATOM   7269   C  CA    B ILE A 1 90  ? -30.702 -10.428 -18.436 0.05 10.89 ? 89   ILE A CA    2  
ATOM   7270   C  C     B ILE A 1 90  ? -31.856 -9.761  -19.185 0.05 10.96 ? 89   ILE A C     2  
ATOM   7271   O  O     B ILE A 1 90  ? -32.876 -10.401 -19.464 0.05 11.01 ? 89   ILE A O     2  
ATOM   7272   C  CB    B ILE A 1 90  ? -30.744 -10.012 -16.958 0.05 10.90 ? 89   ILE A CB    2  
ATOM   7273   C  CG1   B ILE A 1 90  ? -29.797 -10.880 -16.131 0.05 10.86 ? 89   ILE A CG1   2  
ATOM   7274   C  CG2   B ILE A 1 90  ? -32.157 -10.121 -16.408 0.05 10.97 ? 89   ILE A CG2   2  
ATOM   7275   C  CD1   B ILE A 1 90  ? -29.557 -10.326 -14.734 0.05 10.87 ? 89   ILE A CD1   2  
ATOM   7276   N  N     B GLN A 1 91  ? -31.694 -8.485  -19.529 0.05 10.97 ? 90   GLN A N     2  
ATOM   7277   C  CA    B GLN A 1 91  ? -32.788 -7.750  -20.158 0.05 11.05 ? 90   GLN A CA    2  
ATOM   7278   C  C     B GLN A 1 91  ? -32.777 -7.868  -21.681 0.05 11.07 ? 90   GLN A C     2  
ATOM   7279   O  O     B GLN A 1 91  ? -33.797 -7.620  -22.324 0.05 11.15 ? 90   GLN A O     2  
ATOM   7280   C  CB    B GLN A 1 91  ? -32.821 -6.274  -19.716 0.05 11.09 ? 90   GLN A CB    2  
ATOM   7281   C  CG    B GLN A 1 91  ? -31.623 -5.434  -20.137 0.05 11.06 ? 90   GLN A CG    2  
ATOM   7282   C  CD    B GLN A 1 91  ? -31.766 -4.850  -21.530 0.05 11.10 ? 90   GLN A CD    2  
ATOM   7283   O  OE1   B GLN A 1 91  ? -32.856 -4.454  -21.942 0.05 11.18 ? 90   GLN A OE1   2  
ATOM   7284   N  NE2   B GLN A 1 91  ? -30.658 -4.798  -22.269 0.05 11.05 ? 90   GLN A NE2   2  
ATOM   7285   N  N     B ALA A 1 92  ? -31.635 -8.256  -22.252 0.05 11.01 ? 91   ALA A N     2  
ATOM   7286   C  CA    B ALA A 1 92  ? -31.529 -8.396  -23.700 0.05 11.04 ? 91   ALA A CA    2  
ATOM   7287   C  C     B ALA A 1 92  ? -32.080 -9.720  -24.202 0.05 11.06 ? 91   ALA A C     2  
ATOM   7288   O  O     B ALA A 1 92  ? -32.694 -9.785  -25.273 0.05 11.12 ? 91   ALA A O     2  
ATOM   7289   C  CB    B ALA A 1 92  ? -30.077 -8.226  -24.161 0.05 10.98 ? 91   ALA A CB    2  
ATOM   7290   N  N     B LEU A 1 93  ? -31.837 -10.775 -23.434 0.05 11.01 ? 92   LEU A N     2  
ATOM   7291   C  CA    B LEU A 1 93  ? -32.139 -12.127 -23.876 0.05 11.03 ? 92   LEU A CA    2  
ATOM   7292   C  C     B LEU A 1 93  ? -33.606 -12.308 -24.288 0.05 11.14 ? 92   LEU A C     2  
ATOM   7293   O  O     B LEU A 1 93  ? -33.867 -12.824 -25.374 0.05 11.19 ? 92   LEU A O     2  
ATOM   7294   C  CB    B LEU A 1 93  ? -31.706 -13.163 -22.828 0.05 10.99 ? 92   LEU A CB    2  
ATOM   7295   C  CG    B LEU A 1 93  ? -32.228 -14.587 -23.008 0.05 11.03 ? 92   LEU A CG    2  
ATOM   7296   C  CD1   B LEU A 1 93  ? -31.685 -15.220 -24.288 0.05 11.03 ? 92   LEU A CD1   2  
ATOM   7297   C  CD2   B LEU A 1 93  ? -31.886 -15.443 -21.805 0.05 11.00 ? 92   LEU A CD2   2  
ATOM   7298   N  N     B PRO A 1 94  ? -34.560 -11.872 -23.441 0.05 11.18 ? 93   PRO A N     2  
ATOM   7299   C  CA    B PRO A 1 94  ? -35.939 -12.001 -23.925 0.05 11.29 ? 93   PRO A CA    2  
ATOM   7300   C  C     B PRO A 1 94  ? -36.249 -11.099 -25.119 0.05 11.36 ? 93   PRO A C     2  
ATOM   7301   O  O     B PRO A 1 94  ? -36.936 -11.574 -26.012 0.05 11.45 ? 93   PRO A O     2  
ATOM   7302   C  CB    B PRO A 1 94  ? -36.803 -11.651 -22.700 0.05 11.32 ? 93   PRO A CB    2  
ATOM   7303   C  CG    B PRO A 1 94  ? -35.895 -11.000 -21.729 0.05 11.24 ? 93   PRO A CG    2  
ATOM   7304   C  CD    B PRO A 1 94  ? -34.499 -11.444 -22.030 0.05 11.14 ? 93   PRO A CD    2  
ATOM   7305   N  N     B GLN A 1 95  ? -35.749 -9.863  -25.159 0.05 11.33 ? 94   GLN A N     2  
ATOM   7306   C  CA    B GLN A 1 95  ? -35.986 -9.012  -26.327 0.05 11.41 ? 94   GLN A CA    2  
ATOM   7307   C  C     B GLN A 1 95  ? -35.499 -9.726  -27.573 0.05 11.42 ? 94   GLN A C     2  
ATOM   7308   O  O     B GLN A 1 95  ? -36.122 -9.651  -28.621 0.05 11.52 ? 94   GLN A O     2  
ATOM   7309   C  CB    B GLN A 1 95  ? -35.233 -7.687  -26.242 0.05 11.38 ? 94   GLN A CB    2  
ATOM   7310   C  CG    B GLN A 1 95  ? -35.566 -6.797  -25.070 0.05 11.39 ? 94   GLN A CG    2  
ATOM   7311   C  CD    B GLN A 1 95  ? -34.728 -5.539  -25.091 0.05 11.37 ? 94   GLN A CD    2  
ATOM   7312   O  OE1   B GLN A 1 95  ? -34.848 -4.716  -26.001 0.05 11.44 ? 94   GLN A OE1   2  
ATOM   7313   N  NE2   B GLN A 1 95  ? -33.857 -5.393  -24.103 0.05 11.28 ? 94   GLN A NE2   2  
ATOM   7314   N  N     B LEU A 1 96  ? -34.361 -10.402 -27.460 0.05 11.32 ? 95   LEU A N     2  
ATOM   7315   C  CA    B LEU A 1 96  ? -33.801 -11.101 -28.603 0.05 11.33 ? 95   LEU A CA    2  
ATOM   7316   C  C     B LEU A 1 96  ? -34.496 -12.436 -28.841 0.05 11.38 ? 95   LEU A C     2  
ATOM   7317   O  O     B LEU A 1 96  ? -34.630 -12.873 -29.980 0.05 11.45 ? 95   LEU A O     2  
ATOM   7318   C  CB    B LEU A 1 96  ? -32.293 -11.283 -28.444 0.05 11.22 ? 95   LEU A CB    2  
ATOM   7319   C  CG    B LEU A 1 96  ? -31.534 -9.958  -28.501 0.05 11.18 ? 95   LEU A CG    2  
ATOM   7320   C  CD1   B LEU A 1 96  ? -30.119 -10.148 -27.961 0.05 11.08 ? 95   LEU A CD1   2  
ATOM   7321   C  CD2   B LEU A 1 96  ? -31.508 -9.428  -29.922 0.05 11.26 ? 95   LEU A CD2   2  
ATOM   7322   N  N     B ALA A 1 97  ? -34.936 -13.084 -27.769 0.05 11.36 ? 96   ALA A N     2  
ATOM   7323   C  CA    B ALA A 1 97  ? -35.774 -14.262 -27.927 0.05 11.44 ? 96   ALA A CA    2  
ATOM   7324   C  C     B ALA A 1 97  ? -37.090 -13.817 -28.545 0.05 11.57 ? 96   ALA A C     2  
ATOM   7325   O  O     B ALA A 1 97  ? -37.489 -14.331 -29.586 0.05 11.67 ? 96   ALA A O     2  
ATOM   7326   C  CB    B ALA A 1 97  ? -36.022 -14.946 -26.593 0.05 11.41 ? 96   ALA A CB    2  
ATOM   7327   N  N     B ASP A 1 98  ? -37.729 -12.838 -27.904 0.05 11.59 ? 97   ASP A N     2  
ATOM   7328   C  CA    B ASP A 1 98  ? -39.083 -12.392 -28.272 0.05 11.73 ? 97   ASP A CA    2  
ATOM   7329   C  C     B ASP A 1 98  ? -39.129 -11.488 -29.499 0.05 11.80 ? 97   ASP A C     2  
ATOM   7330   O  O     B ASP A 1 98  ? -40.181 -10.894 -29.792 0.05 11.93 ? 97   ASP A O     2  
ATOM   7331   C  CB    B ASP A 1 98  ? -39.779 -11.668 -27.104 0.05 11.75 ? 97   ASP A CB    2  
ATOM   7332   C  CG    B ASP A 1 98  ? -40.019 -12.567 -25.893 0.05 11.73 ? 97   ASP A CG    2  
ATOM   7333   O  OD1   B ASP A 1 98  ? -39.053 -13.179 -25.375 0.05 11.62 ? 97   ASP A OD1   2  
ATOM   7334   O  OD2   B ASP A 1 98  ? -41.180 -12.642 -25.442 0.05 11.83 ? 97   ASP A OD2   2  
ATOM   7335   N  N     B ALA A 1 99  ? -37.999 -11.376 -30.200 0.05 11.72 ? 98   ALA A N     2  
ATOM   7336   C  CA    B ALA A 1 99  ? -37.932 -10.664 -31.477 0.05 11.79 ? 98   ALA A CA    2  
ATOM   7337   C  C     B ALA A 1 99  ? -37.186 -11.463 -32.542 0.05 11.84 ? 98   ALA A C     2  
ATOM   7338   O  O     B ALA A 1 99  ? -36.899 -10.944 -33.614 0.05 11.96 ? 98   ALA A O     2  
ATOM   7339   C  CB    B ALA A 1 99  ? -37.303 -9.298  -31.314 0.05 11.71 ? 98   ALA A CB    2  
ATOM   7340   N  N     B TYR A 1 100 ? -36.876 -12.719 -32.235 0.05 11.75 ? 99   TYR A N     2  
ATOM   7341   C  CA    B TYR A 1 100 ? -36.244 -13.631 -33.192 0.05 11.78 ? 99   TYR A CA    2  
ATOM   7342   C  C     B TYR A 1 100 ? -37.046 -14.932 -33.367 0.05 11.87 ? 99   TYR A C     2  
ATOM   7343   O  O     B TYR A 1 100 ? -36.689 -15.778 -34.184 0.05 11.92 ? 99   TYR A O     2  
ATOM   7344   C  CB    B TYR A 1 100 ? -34.816 -13.992 -32.747 0.05 11.64 ? 99   TYR A CB    2  
ATOM   7345   C  CG    B TYR A 1 100 ? -33.681 -13.360 -33.539 0.05 11.61 ? 99   TYR A CG    2  
ATOM   7346   C  CD1   B TYR A 1 100 ? -32.824 -12.444 -32.947 0.05 11.51 ? 99   TYR A CD1   2  
ATOM   7347   C  CD2   B TYR A 1 100 ? -33.447 -13.708 -34.862 0.05 11.68 ? 99   TYR A CD2   2  
ATOM   7348   C  CE1   B TYR A 1 100 ? -31.781 -11.871 -33.652 0.05 11.49 ? 99   TYR A CE1   2  
ATOM   7349   C  CE2   B TYR A 1 100 ? -32.402 -13.139 -35.582 0.05 11.66 ? 99   TYR A CE2   2  
ATOM   7350   C  CZ    B TYR A 1 100 ? -31.572 -12.219 -34.970 0.05 11.56 ? 99   TYR A CZ    2  
ATOM   7351   O  OH    B TYR A 1 100 ? -30.533 -11.652 -35.682 0.05 11.56 ? 99   TYR A OH    2  
ATOM   7352   N  N     B ALA A 1 101 ? -38.108 -15.100 -32.586 0.05 11.91 ? 100  ALA A N     2  
ATOM   7353   C  CA    B ALA A 1 101 ? -38.815 -16.379 -32.534 0.05 11.99 ? 100  ALA A CA    2  
ATOM   7354   C  C     B ALA A 1 101 ? -39.485 -16.789 -33.846 0.05 12.16 ? 100  ALA A C     2  
ATOM   7355   O  O     B ALA A 1 101 ? -39.649 -17.980 -34.119 0.05 12.23 ? 100  ALA A O     2  
ATOM   7356   C  CB    B ALA A 1 101 ? -39.827 -16.392 -31.395 0.05 12.00 ? 100  ALA A CB    2  
ATOM   7357   N  N     B ASP A 1 102 ? -39.871 -15.810 -34.655 0.05 12.24 ? 101  ASP A N     2  
ATOM   7358   C  CA    B ASP A 1 102 ? -40.582 -16.113 -35.891 0.05 12.42 ? 101  ASP A CA    2  
ATOM   7359   C  C     B ASP A 1 102 ? -39.601 -16.298 -37.056 0.05 12.42 ? 101  ASP A C     2  
ATOM   7360   O  O     B ASP A 1 102 ? -40.007 -16.643 -38.167 0.05 12.58 ? 101  ASP A O     2  
ATOM   7361   C  CB    B ASP A 1 102 ? -41.631 -15.023 -36.198 0.05 12.56 ? 101  ASP A CB    2  
ATOM   7362   C  CG    B ASP A 1 102 ? -42.507 -14.692 -34.991 0.05 12.61 ? 101  ASP A CG    2  
ATOM   7363   O  OD1   B ASP A 1 102 ? -42.173 -15.128 -33.871 0.05 12.63 ? 101  ASP A OD1   2  
ATOM   7364   O  OD2   B ASP A 1 102 ? -43.527 -13.988 -35.159 0.05 12.63 ? 101  ASP A OD2   2  
ATOM   7365   N  N     B ASP A 1 103 ? -38.310 -16.077 -36.802 0.05 12.27 ? 102  ASP A N     2  
ATOM   7366   C  CA    B ASP A 1 103 ? -37.275 -16.261 -37.832 0.05 12.27 ? 102  ASP A CA    2  
ATOM   7367   C  C     B ASP A 1 103 ? -35.921 -16.712 -37.257 0.05 12.10 ? 102  ASP A C     2  
ATOM   7368   O  O     B ASP A 1 103 ? -34.930 -15.969 -37.274 0.05 12.00 ? 102  ASP A O     2  
ATOM   7369   C  CB    B ASP A 1 103 ? -37.115 -14.987 -38.680 0.05 12.34 ? 102  ASP A CB    2  
ATOM   7370   C  CG    B ASP A 1 103 ? -35.998 -15.097 -39.715 0.05 12.35 ? 102  ASP A CG    2  
ATOM   7371   O  OD1   B ASP A 1 103 ? -35.691 -16.226 -40.155 0.05 12.38 ? 102  ASP A OD1   2  
ATOM   7372   O  OD2   B ASP A 1 103 ? -35.421 -14.048 -40.081 0.05 12.35 ? 102  ASP A OD2   2  
ATOM   7373   N  N     B ILE A 1 104 ? -35.883 -17.954 -36.785 0.05 12.08 ? 103  ILE A N     2  
ATOM   7374   C  CA    B ILE A 1 104 ? -34.710 -18.520 -36.128 0.05 11.93 ? 103  ILE A CA    2  
ATOM   7375   C  C     B ILE A 1 104 ? -33.560 -18.772 -37.098 0.05 11.93 ? 103  ILE A C     2  
ATOM   7376   O  O     B ILE A 1 104 ? -33.696 -19.549 -38.045 0.05 12.06 ? 103  ILE A O     2  
ATOM   7377   C  CB    B ILE A 1 104 ? -35.073 -19.851 -35.446 0.05 11.94 ? 103  ILE A CB    2  
ATOM   7378   C  CG1   B ILE A 1 104 ? -36.406 -19.717 -34.703 0.05 11.96 ? 103  ILE A CG1   2  
ATOM   7379   C  CG2   B ILE A 1 104 ? -33.937 -20.335 -34.537 0.05 11.80 ? 103  ILE A CG2   2  
ATOM   7380   C  CD1   B ILE A 1 104 ? -37.557 -20.451 -35.375 0.05 12.14 ? 103  ILE A CD1   2  
ATOM   7381   N  N     B PRO A 1 105 ? -32.404 -18.136 -36.845 0.05 11.80 ? 104  PRO A N     2  
ATOM   7382   C  CA    B PRO A 1 105 ? -31.247 -18.261 -37.738 0.05 11.80 ? 104  PRO A CA    2  
ATOM   7383   C  C     B PRO A 1 105 ? -30.681 -19.674 -37.739 0.05 11.81 ? 104  PRO A C     2  
ATOM   7384   O  O     B PRO A 1 105 ? -31.029 -20.451 -36.851 0.05 11.79 ? 104  PRO A O     2  
ATOM   7385   C  CB    B PRO A 1 105 ? -30.248 -17.269 -37.144 0.05 11.67 ? 104  PRO A CB    2  
ATOM   7386   C  CG    B PRO A 1 105 ? -30.577 -17.259 -35.689 0.05 11.58 ? 104  PRO A CG    2  
ATOM   7387   C  CD    B PRO A 1 105 ? -32.078 -17.388 -35.617 0.05 11.67 ? 104  PRO A CD    2  
ATOM   7388   N  N     B ASP A 1 106 ? -29.861 -20.006 -38.740 0.05 11.85 ? 105  ASP A N     2  
ATOM   7389   C  CA    B ASP A 1 106 ? -29.208 -21.314 -38.819 0.05 11.87 ? 105  ASP A CA    2  
ATOM   7390   C  C     B ASP A 1 106 ? -27.941 -21.403 -37.987 0.05 11.73 ? 105  ASP A C     2  
ATOM   7391   O  O     B ASP A 1 106 ? -27.600 -22.464 -37.482 0.05 11.73 ? 105  ASP A O     2  
ATOM   7392   C  CB    B ASP A 1 106 ? -28.845 -21.656 -40.261 0.05 12.00 ? 105  ASP A CB    2  
ATOM   7393   C  CG    B ASP A 1 106 ? -30.015 -22.193 -41.038 0.05 12.17 ? 105  ASP A CG    2  
ATOM   7394   O  OD1   B ASP A 1 106 ? -30.497 -21.461 -41.922 0.05 12.26 ? 105  ASP A OD1   2  
ATOM   7395   O  OD2   B ASP A 1 106 ? -30.441 -23.330 -40.748 0.05 12.22 ? 105  ASP A OD2   2  
ATOM   7396   N  N     B LEU A 1 107 ? -27.233 -20.285 -37.876 0.05 11.64 ? 106  LEU A N     2  
ATOM   7397   C  CA    B LEU A 1 107 ? -26.010 -20.239 -37.087 0.05 11.52 ? 106  LEU A CA    2  
ATOM   7398   C  C     B LEU A 1 107 ? -25.891 -18.877 -36.427 0.05 11.42 ? 106  LEU A C     2  
ATOM   7399   O  O     B LEU A 1 107 ? -26.272 -17.854 -37.005 0.05 11.46 ? 106  LEU A O     2  
ATOM   7400   C  CB    B LEU A 1 107 ? -24.777 -20.553 -37.947 0.05 11.55 ? 106  LEU A CB    2  
ATOM   7401   C  CG    B LEU A 1 107 ? -23.396 -20.468 -37.274 0.05 11.45 ? 106  LEU A CG    2  
ATOM   7402   C  CD1   B LEU A 1 107 ? -22.473 -21.586 -37.732 0.05 11.51 ? 106  LEU A CD1   2  
ATOM   7403   C  CD2   B LEU A 1 107 ? -22.759 -19.121 -37.534 0.05 11.39 ? 106  LEU A CD2   2  
ATOM   7404   N  N     B VAL A 1 108 ? -25.367 -18.884 -35.205 0.05 11.31 ? 107  VAL A N     2  
ATOM   7405   C  CA    B VAL A 1 108 ? -25.166 -17.676 -34.424 0.05 11.23 ? 107  VAL A CA    2  
ATOM   7406   C  C     B VAL A 1 108 ? -23.671 -17.338 -34.311 0.05 11.16 ? 107  VAL A C     2  
ATOM   7407   O  O     B VAL A 1 108 ? -22.884 -18.125 -33.795 0.05 11.13 ? 107  VAL A O     2  
ATOM   7408   C  CB    B VAL A 1 108 ? -25.762 -17.832 -33.006 0.05 11.16 ? 107  VAL A CB    2  
ATOM   7409   C  CG1   B VAL A 1 108 ? -25.281 -16.712 -32.095 0.05 11.07 ? 107  VAL A CG1   2  
ATOM   7410   C  CG2   B VAL A 1 108 ? -27.287 -17.859 -33.062 0.05 11.23 ? 107  VAL A CG2   2  
ATOM   7411   N  N     B LEU A 1 109 ? -23.290 -16.176 -34.824 0.05 11.16 ? 108  LEU A N     2  
ATOM   7412   C  CA    B LEU A 1 109 ? -21.940 -15.658 -34.644 0.05 11.10 ? 108  LEU A CA    2  
ATOM   7413   C  C     B LEU A 1 109 ? -22.068 -14.563 -33.609 0.05 11.04 ? 108  LEU A C     2  
ATOM   7414   O  O     B LEU A 1 109 ? -23.075 -13.872 -33.580 0.05 11.06 ? 108  LEU A O     2  
ATOM   7415   C  CB    B LEU A 1 109 ? -21.421 -15.037 -35.941 0.05 11.18 ? 108  LEU A CB    2  
ATOM   7416   C  CG    B LEU A 1 109 ? -21.182 -15.935 -37.155 0.05 11.28 ? 108  LEU A CG    2  
ATOM   7417   C  CD1   B LEU A 1 109 ? -20.807 -15.052 -38.347 0.05 11.35 ? 108  LEU A CD1   2  
ATOM   7418   C  CD2   B LEU A 1 109 ? -20.094 -16.962 -36.888 0.05 11.25 ? 108  LEU A CD2   2  
ATOM   7419   N  N     B HIS A 1 110 ? -21.065 -14.380 -32.761 0.05 10.96 ? 109  HIS A N     2  
ATOM   7420   C  CA    B HIS A 1 110 ? -21.212 -13.347 -31.750 0.05 10.91 ? 109  HIS A CA    2  
ATOM   7421   C  C     B HIS A 1 110 ? -19.896 -12.842 -31.212 0.05 10.86 ? 109  HIS A C     2  
ATOM   7422   O  O     B HIS A 1 110 ? -18.930 -13.583 -31.099 0.05 10.85 ? 109  HIS A O     2  
ATOM   7423   C  CB    B HIS A 1 110 ? -22.057 -13.852 -30.581 0.05 10.87 ? 109  HIS A CB    2  
ATOM   7424   C  CG    B HIS A 1 110 ? -21.414 -14.947 -29.789 0.05 10.82 ? 109  HIS A CG    2  
ATOM   7425   N  ND1   B HIS A 1 110 ? -20.642 -14.705 -28.672 0.05 10.77 ? 109  HIS A ND1   2  
ATOM   7426   C  CD2   B HIS A 1 110 ? -21.440 -16.293 -29.944 0.05 10.85 ? 109  HIS A CD2   2  
ATOM   7427   C  CE1   B HIS A 1 110 ? -20.216 -15.854 -28.176 0.05 10.75 ? 109  HIS A CE1   2  
ATOM   7428   N  NE2   B HIS A 1 110 ? -20.686 -16.833 -28.928 0.05 10.80 ? 109  HIS A NE2   2  
ATOM   7429   N  N     B ASP A 1 111 ? -19.885 -11.565 -30.876 0.05 10.86 ? 110  ASP A N     2  
ATOM   7430   C  CA    B ASP A 1 111 ? -18.766 -11.000 -30.156 0.05 10.82 ? 110  ASP A CA    2  
ATOM   7431   C  C     B ASP A 1 111 ? -18.782 -11.566 -28.737 0.05 10.76 ? 110  ASP A C     2  
ATOM   7432   O  O     B ASP A 1 111 ? -19.840 -11.932 -28.219 0.05 10.74 ? 110  ASP A O     2  
ATOM   7433   C  CB    B ASP A 1 111 ? -18.872 -9.478  -30.131 0.05 10.85 ? 110  ASP A CB    2  
ATOM   7434   C  CG    B ASP A 1 111 ? -17.861 -8.851  -29.205 0.05 10.82 ? 110  ASP A CG    2  
ATOM   7435   O  OD1   B ASP A 1 111 ? -16.673 -8.795  -29.586 0.05 10.84 ? 110  ASP A OD1   2  
ATOM   7436   O  OD2   B ASP A 1 111 ? -18.249 -8.442  -28.091 0.05 10.79 ? 110  ASP A OD2   2  
ATOM   7437   N  N     B ILE A 1 112 ? -17.607 -11.637 -28.117 0.05 10.73 ? 111  ILE A N     2  
ATOM   7438   C  CA    B ILE A 1 112 ? -17.460 -12.191 -26.776 0.05 10.68 ? 111  ILE A CA    2  
ATOM   7439   C  C     B ILE A 1 112 ? -18.374 -11.570 -25.718 0.05 10.66 ? 111  ILE A C     2  
ATOM   7440   O  O     B ILE A 1 112 ? -18.681 -12.215 -24.718 0.05 10.64 ? 111  ILE A O     2  
ATOM   7441   C  CB    B ILE A 1 112 ? -15.997 -12.071 -26.279 0.05 10.68 ? 111  ILE A CB    2  
ATOM   7442   C  CG1   B ILE A 1 112 ? -15.497 -10.638 -26.436 0.05 10.71 ? 111  ILE A CG1   2  
ATOM   7443   C  CG2   B ILE A 1 112 ? -15.089 -13.027 -27.034 0.05 10.70 ? 111  ILE A CG2   2  
ATOM   7444   C  CD1   B ILE A 1 112 ? -14.142 -10.404 -25.803 0.05 10.71 ? 111  ILE A CD1   2  
ATOM   7445   N  N     B THR A 1 113 ? -18.808 -10.330 -25.927 0.05 10.69 ? 112  THR A N     2  
ATOM   7446   C  CA    B THR A 1 113 ? -19.581 -9.636  -24.892 0.05 10.68 ? 112  THR A CA    2  
ATOM   7447   C  C     B THR A 1 113 ? -21.044 -10.066 -24.835 0.05 10.68 ? 112  THR A C     2  
ATOM   7448   O  O     B THR A 1 113 ? -21.747 -9.746  -23.881 0.05 10.68 ? 112  THR A O     2  
ATOM   7449   C  CB    B THR A 1 113 ? -19.557 -8.106  -25.080 0.05 10.72 ? 112  THR A CB    2  
ATOM   7450   O  OG1   B THR A 1 113 ? -20.066 -7.780  -26.375 0.05 10.76 ? 112  THR A OG1   2  
ATOM   7451   C  CG2   B THR A 1 113 ? -18.136 -7.583  -24.958 0.05 10.73 ? 112  THR A CG2   2  
ATOM   7452   N  N     B SER A 1 114 ? -21.510 -10.782 -25.851 0.05 10.70 ? 113  SER A N     2  
ATOM   7453   C  CA    B SER A 1 114 ? -22.939 -11.086 -25.921 0.05 10.73 ? 113  SER A CA    2  
ATOM   7454   C  C     B SER A 1 114 ? -23.300 -12.423 -25.274 0.05 10.71 ? 113  SER A C     2  
ATOM   7455   O  O     B SER A 1 114 ? -23.246 -13.465 -25.916 0.05 10.72 ? 113  SER A O     2  
ATOM   7456   C  CB    B SER A 1 114 ? -23.450 -11.038 -27.368 0.05 10.78 ? 113  SER A CB    2  
ATOM   7457   O  OG    B SER A 1 114 ? -24.848 -11.293 -27.416 0.05 10.82 ? 113  SER A OG    2  
ATOM   7458   N  N     B TYR A 1 115 ? -23.659 -12.390 -23.996 0.05 10.69 ? 114  TYR A N     2  
ATOM   7459   C  CA    B TYR A 1 115 ? -24.170 -13.591 -23.337 0.05 10.69 ? 114  TYR A CA    2  
ATOM   7460   C  C     B TYR A 1 115 ? -25.487 -14.102 -23.953 0.05 10.74 ? 114  TYR A C     2  
ATOM   7461   O  O     B TYR A 1 115 ? -25.687 -15.307 -24.023 0.05 10.76 ? 114  TYR A O     2  
ATOM   7462   C  CB    B TYR A 1 115 ? -24.381 -13.364 -21.838 0.05 10.67 ? 114  TYR A CB    2  
ATOM   7463   C  CG    B TYR A 1 115 ? -23.135 -13.020 -21.047 0.05 10.64 ? 114  TYR A CG    2  
ATOM   7464   C  CD1   B TYR A 1 115 ? -21.865 -13.316 -21.528 0.05 10.62 ? 114  TYR A CD1   2  
ATOM   7465   C  CD2   B TYR A 1 115 ? -23.239 -12.408 -19.806 0.05 10.64 ? 114  TYR A CD2   2  
ATOM   7466   C  CE1   B TYR A 1 115 ? -20.723 -12.996 -20.781 0.05 10.61 ? 114  TYR A CE1   2  
ATOM   7467   C  CE2   B TYR A 1 115 ? -22.120 -12.096 -19.059 0.05 10.63 ? 114  TYR A CE2   2  
ATOM   7468   C  CZ    B TYR A 1 115 ? -20.867 -12.383 -19.549 0.05 10.61 ? 114  TYR A CZ    2  
ATOM   7469   O  OH    B TYR A 1 115 ? -19.766 -12.050 -18.788 0.05 10.61 ? 114  TYR A OH    2  
ATOM   7470   N  N     B PRO A 1 116 ? -26.395 -13.193 -24.375 0.05 10.77 ? 115  PRO A N     2  
ATOM   7471   C  CA    B PRO A 1 116 ? -27.615 -13.747 -24.981 0.05 10.84 ? 115  PRO A CA    2  
ATOM   7472   C  C     B PRO A 1 116 ? -27.354 -14.652 -26.186 0.05 10.87 ? 115  PRO A C     2  
ATOM   7473   O  O     B PRO A 1 116 ? -28.058 -15.653 -26.361 0.05 10.92 ? 115  PRO A O     2  
ATOM   7474   C  CB    B PRO A 1 116 ? -28.383 -12.501 -25.405 0.05 10.88 ? 115  PRO A CB    2  
ATOM   7475   C  CG    B PRO A 1 116 ? -27.998 -11.479 -24.387 0.05 10.84 ? 115  PRO A CG    2  
ATOM   7476   C  CD    B PRO A 1 116 ? -26.533 -11.747 -24.120 0.05 10.78 ? 115  PRO A CD    2  
ATOM   7477   N  N     B ALA A 1 117 ? -26.358 -14.321 -27.002 0.05 10.85 ? 116  ALA A N     2  
ATOM   7478   C  CA    B ALA A 1 117 ? -26.068 -15.145 -28.169 0.05 10.89 ? 116  ALA A CA    2  
ATOM   7479   C  C     B ALA A 1 117 ? -25.711 -16.571 -27.769 0.05 10.88 ? 116  ALA A C     2  
ATOM   7480   O  O     B ALA A 1 117 ? -26.111 -17.531 -28.427 0.05 10.94 ? 116  ALA A O     2  
ATOM   7481   C  CB    B ALA A 1 117 ? -24.948 -14.535 -28.987 0.05 10.88 ? 116  ALA A CB    2  
ATOM   7482   N  N     B ARG A 1 118 ? -24.953 -16.703 -26.684 0.05 10.82 ? 117  ARG A N     2  
ATOM   7483   C  CA    B ARG A 1 118 ? -24.563 -18.014 -26.188 0.05 10.83 ? 117  ARG A CA    2  
ATOM   7484   C  C     B ARG A 1 118 ? -25.804 -18.787 -25.759 0.05 10.88 ? 117  ARG A C     2  
ATOM   7485   O  O     B ARG A 1 118 ? -25.978 -19.955 -26.113 0.05 10.94 ? 117  ARG A O     2  
ATOM   7486   C  CB    B ARG A 1 118 ? -23.632 -17.881 -24.983 0.05 10.77 ? 117  ARG A CB    2  
ATOM   7487   C  CG    B ARG A 1 118 ? -22.260 -17.223 -25.242 0.05 10.73 ? 117  ARG A CG    2  
ATOM   7488   C  CD    B ARG A 1 118 ? -21.709 -16.850 -23.870 0.05 10.69 ? 117  ARG A CD    2  
ATOM   7489   N  NE    B ARG A 1 118 ? -20.312 -16.413 -23.758 0.05 10.66 ? 117  ARG A NE    2  
ATOM   7490   C  CZ    B ARG A 1 118 ? -19.852 -15.215 -24.112 0.05 10.64 ? 117  ARG A CZ    2  
ATOM   7491   N  NH1   B ARG A 1 118 ? -20.648 -14.341 -24.712 0.05 10.65 ? 117  ARG A NH1   2  
ATOM   7492   N  NH2   B ARG A 1 118 ? -18.577 -14.907 -23.889 0.05 10.63 ? 117  ARG A NH2   2  
ATOM   7493   N  N     B VAL A 1 119 ? -26.662 -18.130 -24.992 0.05 10.87 ? 118  VAL A N     2  
ATOM   7494   C  CA    B VAL A 1 119 ? -27.855 -18.805 -24.488 0.05 10.93 ? 118  VAL A CA    2  
ATOM   7495   C  C     B VAL A 1 119 ? -28.744 -19.226 -25.659 0.05 11.01 ? 118  VAL A C     2  
ATOM   7496   O  O     B VAL A 1 119 ? -29.184 -20.375 -25.736 0.05 11.08 ? 118  VAL A O     2  
ATOM   7497   C  CB    B VAL A 1 119 ? -28.640 -17.906 -23.522 0.05 10.92 ? 118  VAL A CB    2  
ATOM   7498   C  CG1   B VAL A 1 119 ? -29.918 -18.605 -23.056 0.05 10.99 ? 118  VAL A CG1   2  
ATOM   7499   C  CG2   B VAL A 1 119 ? -27.776 -17.528 -22.324 0.05 10.85 ? 118  VAL A CG2   2  
ATOM   7500   N  N     B LEU A 1 120 ? -28.999 -18.296 -26.572 0.05 11.02 ? 119  LEU A N     2  
ATOM   7501   C  CA    B LEU A 1 120 ? -29.882 -18.583 -27.708 0.05 11.12 ? 119  LEU A CA    2  
ATOM   7502   C  C     B LEU A 1 120 ? -29.378 -19.712 -28.611 0.05 11.16 ? 119  LEU A C     2  
ATOM   7503   O  O     B LEU A 1 120 ? -30.150 -20.595 -28.987 0.05 11.26 ? 119  LEU A O     2  
ATOM   7504   C  CB    B LEU A 1 120 ? -30.170 -17.311 -28.509 0.05 11.13 ? 119  LEU A CB    2  
ATOM   7505   C  CG    B LEU A 1 120 ? -31.037 -16.311 -27.746 0.05 11.13 ? 119  LEU A CG    2  
ATOM   7506   C  CD1   B LEU A 1 120 ? -31.126 -14.971 -28.488 0.05 11.14 ? 119  LEU A CD1   2  
ATOM   7507   C  CD2   B LEU A 1 120 ? -32.445 -16.889 -27.475 0.05 11.21 ? 119  LEU A CD2   2  
ATOM   7508   N  N     B ALA A 1 121 ? -28.092 -19.700 -28.944 0.05 11.11 ? 120  ALA A N     2  
ATOM   7509   C  CA    B ALA A 1 121 ? -27.537 -20.748 -29.803 0.05 11.16 ? 120  ALA A CA    2  
ATOM   7510   C  C     B ALA A 1 121 ? -27.784 -22.154 -29.228 0.05 11.20 ? 120  ALA A C     2  
ATOM   7511   O  O     B ALA A 1 121 ? -28.217 -23.072 -29.943 0.05 11.29 ? 120  ALA A O     2  
ATOM   7512   C  CB    B ALA A 1 121 ? -26.053 -20.513 -30.044 0.05 11.10 ? 120  ALA A CB    2  
ATOM   7513   N  N     B ARG A 1 122 ? -27.530 -22.308 -27.932 0.05 11.15 ? 121  ARG A N     2  
ATOM   7514   C  CA    B ARG A 1 122 ? -27.754 -23.578 -27.250 0.05 11.20 ? 121  ARG A CA    2  
ATOM   7515   C  C     B ARG A 1 122 ? -29.242 -23.938 -27.221 0.05 11.30 ? 121  ARG A C     2  
ATOM   7516   O  O     B ARG A 1 122 ? -29.614 -25.087 -27.477 0.05 11.40 ? 121  ARG A O     2  
ATOM   7517   C  CB    B ARG A 1 122 ? -27.215 -23.521 -25.821 0.05 11.14 ? 121  ARG A CB    2  
ATOM   7518   C  CG    B ARG A 1 122 ? -25.706 -23.279 -25.715 0.05 11.07 ? 121  ARG A CG    2  
ATOM   7519   C  CD    B ARG A 1 122 ? -25.390 -22.435 -24.482 0.05 10.98 ? 121  ARG A CD    2  
ATOM   7520   N  NE    B ARG A 1 122 ? -24.734 -23.152 -23.394 0.05 10.93 ? 121  ARG A NE    2  
ATOM   7521   C  CZ    B ARG A 1 122 ? -23.445 -23.009 -23.081 0.05 10.91 ? 121  ARG A CZ    2  
ATOM   7522   N  NH1   B ARG A 1 122 ? -22.660 -22.216 -23.797 0.05 10.93 ? 121  ARG A NH1   2  
ATOM   7523   N  NH2   B ARG A 1 122 ? -22.929 -23.681 -22.076 0.05 10.89 ? 121  ARG A NH2   2  
ATOM   7524   N  N     B ARG A 1 123 ? -30.085 -22.959 -26.899 0.05 11.28 ? 122  ARG A N     2  
ATOM   7525   C  CA    B ARG A 1 123 ? -31.531 -23.191 -26.838 0.05 11.38 ? 122  ARG A CA    2  
ATOM   7526   C  C     B ARG A 1 123 ? -32.128 -23.510 -28.204 0.05 11.49 ? 122  ARG A C     2  
ATOM   7527   O  O     B ARG A 1 123 ? -32.751 -24.563 -28.391 0.05 11.60 ? 122  ARG A O     2  
ATOM   7528   C  CB    B ARG A 1 123 ? -32.261 -21.990 -26.241 0.05 11.35 ? 122  ARG A CB    2  
ATOM   7529   C  CG    B ARG A 1 123 ? -33.775 -22.164 -26.196 0.05 11.45 ? 122  ARG A CG    2  
ATOM   7530   C  CD    B ARG A 1 123 ? -34.465 -20.842 -25.938 0.05 11.42 ? 122  ARG A CD    2  
ATOM   7531   N  NE    B ARG A 1 123 ? -33.990 -20.197 -24.718 0.05 11.33 ? 122  ARG A NE    2  
ATOM   7532   C  CZ    B ARG A 1 123 ? -34.367 -18.981 -24.336 0.05 11.30 ? 122  ARG A CZ    2  
ATOM   7533   N  NH1   B ARG A 1 123 ? -35.206 -18.288 -25.087 0.05 11.35 ? 122  ARG A NH1   2  
ATOM   7534   N  NH2   B ARG A 1 123 ? -33.903 -18.455 -23.207 0.05 11.23 ? 122  ARG A NH2   2  
ATOM   7535   N  N     B TRP A 1 124 ? -31.950 -22.590 -29.151 0.05 11.47 ? 123  TRP A N     2  
ATOM   7536   C  CA    B TRP A 1 124 ? -32.474 -22.766 -30.504 0.05 11.57 ? 123  TRP A CA    2  
ATOM   7537   C  C     B TRP A 1 124 ? -31.879 -24.013 -31.150 0.05 11.64 ? 123  TRP A C     2  
ATOM   7538   O  O     B TRP A 1 124 ? -32.407 -24.533 -32.138 0.05 11.76 ? 123  TRP A O     2  
ATOM   7539   C  CB    B TRP A 1 124 ? -32.141 -21.550 -31.367 0.05 11.54 ? 123  TRP A CB    2  
ATOM   7540   C  CG    B TRP A 1 124 ? -32.867 -20.285 -31.023 0.05 11.52 ? 123  TRP A CG    2  
ATOM   7541   C  CD1   B TRP A 1 124 ? -34.050 -20.157 -30.337 0.05 11.57 ? 123  TRP A CD1   2  
ATOM   7542   C  CD2   B TRP A 1 124 ? -32.458 -18.960 -31.364 0.05 11.45 ? 123  TRP A CD2   2  
ATOM   7543   N  NE1   B TRP A 1 124 ? -34.391 -18.828 -30.230 0.05 11.54 ? 123  TRP A NE1   2  
ATOM   7544   C  CE2   B TRP A 1 124 ? -33.429 -18.074 -30.852 0.05 11.47 ? 123  TRP A CE2   2  
ATOM   7545   C  CE3   B TRP A 1 124 ? -31.357 -18.433 -32.046 0.05 11.39 ? 123  TRP A CE3   2  
ATOM   7546   C  CZ2   B TRP A 1 124 ? -33.330 -16.696 -31.005 0.05 11.44 ? 123  TRP A CZ2   2  
ATOM   7547   C  CZ3   B TRP A 1 124 ? -31.262 -17.071 -32.197 0.05 11.36 ? 123  TRP A CZ3   2  
ATOM   7548   C  CH2   B TRP A 1 124 ? -32.241 -16.214 -31.682 0.05 11.38 ? 123  TRP A CH2   2  
ATOM   7549   N  N     B GLY A 1 125 ? -30.768 -24.480 -30.592 0.05 11.56 ? 124  GLY A N     2  
ATOM   7550   C  CA    B GLY A 1 125 ? -30.086 -25.657 -31.090 0.05 11.62 ? 124  GLY A CA    2  
ATOM   7551   C  C     B GLY A 1 125 ? -29.345 -25.421 -32.390 0.05 11.62 ? 124  GLY A C     2  
ATOM   7552   O  O     B GLY A 1 125 ? -29.571 -26.122 -33.378 0.05 11.72 ? 124  GLY A O     2  
ATOM   7553   N  N     B VAL A 1 126 ? -28.453 -24.435 -32.395 0.05 11.53 ? 125  VAL A N     2  
ATOM   7554   C  CA    B VAL A 1 126 ? -27.651 -24.126 -33.580 0.05 11.54 ? 125  VAL A CA    2  
ATOM   7555   C  C     B VAL A 1 126 ? -26.177 -23.977 -33.196 0.05 11.42 ? 125  VAL A C     2  
ATOM   7556   O  O     B VAL A 1 126 ? -25.862 -23.804 -32.016 0.05 11.33 ? 125  VAL A O     2  
ATOM   7557   C  CB    B VAL A 1 126 ? -28.163 -22.846 -34.290 0.05 11.56 ? 125  VAL A CB    2  
ATOM   7558   C  CG1   B VAL A 1 126 ? -29.604 -23.039 -34.764 0.05 11.69 ? 125  VAL A CG1   2  
ATOM   7559   C  CG2   B VAL A 1 126 ? -28.073 -21.647 -33.372 0.05 11.45 ? 125  VAL A CG2   2  
ATOM   7560   N  N     B PRO A 1 127 ? -25.266 -24.063 -34.180 0.05 11.44 ? 126  PRO A N     2  
ATOM   7561   C  CA    B PRO A 1 127 ? -23.849 -23.871 -33.845 0.05 11.35 ? 126  PRO A CA    2  
ATOM   7562   C  C     B PRO A 1 127 ? -23.576 -22.435 -33.402 0.05 11.25 ? 126  PRO A C     2  
ATOM   7563   O  O     B PRO A 1 127 ? -24.250 -21.513 -33.856 0.05 11.26 ? 126  PRO A O     2  
ATOM   7564   C  CB    B PRO A 1 127 ? -23.130 -24.150 -35.169 0.05 11.41 ? 126  PRO A CB    2  
ATOM   7565   C  CG    B PRO A 1 127 ? -24.076 -24.965 -35.958 0.05 11.54 ? 126  PRO A CG    2  
ATOM   7566   C  CD    B PRO A 1 127 ? -25.444 -24.508 -35.577 0.05 11.56 ? 126  PRO A CD    2  
ATOM   7567   N  N     B ALA A 1 128 ? -22.609 -22.261 -32.506 0.05 11.16 ? 127  ALA A N     2  
ATOM   7568   C  CA    B ALA A 1 128 ? -22.192 -20.927 -32.089 0.05 11.08 ? 127  ALA A CA    2  
ATOM   7569   C  C     B ALA A 1 128 ? -20.720 -20.773 -32.411 0.05 11.05 ? 127  ALA A C     2  
ATOM   7570   O  O     B ALA A 1 128 ? -19.935 -21.677 -32.147 0.05 11.05 ? 127  ALA A O     2  
ATOM   7571   C  CB    B ALA A 1 128 ? -22.413 -20.734 -30.594 0.05 11.00 ? 127  ALA A CB    2  
ATOM   7572   N  N     B VAL A 1 129 ? -20.350 -19.635 -32.981 0.05 11.05 ? 128  VAL A N     2  
ATOM   7573   C  CA    B VAL A 1 129 ? -18.937 -19.305 -33.147 0.05 11.02 ? 128  VAL A CA    2  
ATOM   7574   C  C     B VAL A 1 129 ? -18.670 -17.922 -32.568 0.05 10.96 ? 128  VAL A C     2  
ATOM   7575   O  O     B VAL A 1 129 ? -19.295 -16.937 -32.958 0.05 10.97 ? 128  VAL A O     2  
ATOM   7576   C  CB    B VAL A 1 129 ? -18.490 -19.376 -34.618 0.05 11.11 ? 128  VAL A CB    2  
ATOM   7577   C  CG1   B VAL A 1 129 ? -17.075 -18.790 -34.803 0.05 11.09 ? 128  VAL A CG1   2  
ATOM   7578   C  CG2   B VAL A 1 129 ? -18.528 -20.809 -35.097 0.05 11.19 ? 128  VAL A CG2   2  
ATOM   7579   N  N     B SER A 1 130 ? -17.750 -17.878 -31.613 0.05 10.90 ? 129  SER A N     2  
ATOM   7580   C  CA    B SER A 1 130 ? -17.396 -16.648 -30.904 0.05 10.85 ? 129  SER A CA    2  
ATOM   7581   C  C     B SER A 1 130 ? -16.320 -15.928 -31.700 0.05 10.87 ? 129  SER A C     2  
ATOM   7582   O  O     B SER A 1 130 ? -15.425 -16.570 -32.230 0.05 10.90 ? 129  SER A O     2  
ATOM   7583   C  CB    B SER A 1 130 ? -16.868 -17.009 -29.509 0.05 10.79 ? 129  SER A CB    2  
ATOM   7584   O  OG    B SER A 1 130 ? -16.425 -15.873 -28.773 0.05 10.75 ? 129  SER A OG    2  
ATOM   7585   N  N     B LEU A 1 131 ? -16.418 -14.606 -31.800 0.05 10.87 ? 130  LEU A N     2  
ATOM   7586   C  CA    B LEU A 1 131 ? -15.416 -13.804 -32.500 0.05 10.91 ? 130  LEU A CA    2  
ATOM   7587   C  C     B LEU A 1 131 ? -14.755 -12.881 -31.482 0.05 10.87 ? 130  LEU A C     2  
ATOM   7588   O  O     B LEU A 1 131 ? -15.412 -12.009 -30.916 0.05 10.84 ? 130  LEU A O     2  
ATOM   7589   C  CB    B LEU A 1 131 ? -16.060 -12.970 -33.604 0.05 10.97 ? 130  LEU A CB    2  
ATOM   7590   C  CG    B LEU A 1 131 ? -16.849 -13.726 -34.675 0.05 11.03 ? 130  LEU A CG    2  
ATOM   7591   C  CD1   B LEU A 1 131 ? -17.351 -12.751 -35.723 0.05 11.10 ? 130  LEU A CD1   2  
ATOM   7592   C  CD2   B LEU A 1 131 ? -15.995 -14.822 -35.306 0.05 11.07 ? 130  LEU A CD2   2  
ATOM   7593   N  N     B SER A 1 132 ? -13.469 -13.097 -31.225 0.05 10.87 ? 131  SER A N     2  
ATOM   7594   C  CA    B SER A 1 132 ? -12.777 -12.352 -30.172 0.05 10.84 ? 131  SER A CA    2  
ATOM   7595   C  C     B SER A 1 132 ? -11.844 -11.301 -30.745 0.05 10.90 ? 131  SER A C     2  
ATOM   7596   O  O     B SER A 1 132 ? -10.933 -11.634 -31.488 0.05 10.95 ? 131  SER A O     2  
ATOM   7597   C  CB    B SER A 1 132 ? -11.947 -13.290 -29.301 0.05 10.82 ? 131  SER A CB    2  
ATOM   7598   O  OG    B SER A 1 132 ? -11.232 -12.545 -28.325 0.05 10.81 ? 131  SER A OG    2  
ATOM   7599   N  N     B PRO A 1 133 ? -12.049 -10.032 -30.368 0.05 10.90 ? 132  PRO A N     2  
ATOM   7600   C  CA    B PRO A 1 133 ? -11.222 -8.933  -30.878 0.05 10.97 ? 132  PRO A CA    2  
ATOM   7601   C  C     B PRO A 1 133 ? -9.969  -8.736  -30.029 0.05 10.98 ? 132  PRO A C     2  
ATOM   7602   O  O     B PRO A 1 133 ? -9.285  -7.720  -30.161 0.05 11.04 ? 132  PRO A O     2  
ATOM   7603   C  CB    B PRO A 1 133 ? -12.143 -7.726  -30.729 0.05 10.98 ? 132  PRO A CB    2  
ATOM   7604   C  CG    B PRO A 1 133 ? -12.942 -8.043  -29.508 0.05 10.90 ? 132  PRO A CG    2  
ATOM   7605   C  CD    B PRO A 1 133 ? -13.132 -9.543  -29.495 0.05 10.86 ? 132  PRO A CD    2  
ATOM   7606   N  N     B ASN A 1 134 ? -9.677  -9.701  -29.170 0.05 10.93 ? 133  ASN A N     2  
ATOM   7607   C  CA    B ASN A 1 134 ? -8.515  -9.629  -28.294 0.05 10.95 ? 133  ASN A CA    2  
ATOM   7608   C  C     B ASN A 1 134 ? -8.073  -11.026 -27.916 0.05 10.92 ? 133  ASN A C     2  
ATOM   7609   O  O     B ASN A 1 134 ? -8.622  -12.011 -28.409 0.05 10.90 ? 133  ASN A O     2  
ATOM   7610   C  CB    B ASN A 1 134 ? -8.849  -8.848  -27.025 0.05 10.92 ? 133  ASN A CB    2  
ATOM   7611   C  CG    B ASN A 1 134 ? -10.160 -9.287  -26.410 0.05 10.85 ? 133  ASN A CG    2  
ATOM   7612   O  OD1   B ASN A 1 134 ? -10.242 -10.348 -25.782 0.05 10.81 ? 133  ASN A OD1   2  
ATOM   7613   N  ND2   B ASN A 1 134 ? -11.192 -8.483  -26.594 0.05 10.84 ? 133  ASN A ND2   2  
ATOM   7614   N  N     B LEU A 1 135 ? -7.087  -11.110 -27.029 0.05 10.95 ? 134  LEU A N     2  
ATOM   7615   C  CA    B LEU A 1 135 ? -6.538  -12.408 -26.646 0.05 10.95 ? 134  LEU A CA    2  
ATOM   7616   C  C     B LEU A 1 135 ? -7.601  -13.294 -26.001 0.05 10.88 ? 134  LEU A C     2  
ATOM   7617   O  O     B LEU A 1 135 ? -8.603  -12.799 -25.477 0.05 10.83 ? 134  LEU A O     2  
ATOM   7618   C  CB    B LEU A 1 135 ? -5.340  -12.237 -25.703 0.05 10.99 ? 134  LEU A CB    2  
ATOM   7619   C  CG    B LEU A 1 135 ? -5.659  -11.509 -24.394 0.05 10.97 ? 134  LEU A CG    2  
ATOM   7620   C  CD1   B LEU A 1 135 ? -5.935  -12.492 -23.266 0.05 10.94 ? 134  LEU A CD1   2  
ATOM   7621   C  CD2   B LEU A 1 135 ? -4.523  -10.552 -24.016 0.05 11.04 ? 134  LEU A CD2   2  
ATOM   7622   N  N     B VAL A 1 136 ? -7.357  -14.600 -26.038 0.05 10.89 ? 135  VAL A N     2  
ATOM   7623   C  CA    B VAL A 1 136 ? -8.276  -15.577 -25.474 0.05 10.85 ? 135  VAL A CA    2  
ATOM   7624   C  C     B VAL A 1 136 ? -7.578  -16.390 -24.391 0.05 10.88 ? 135  VAL A C     2  
ATOM   7625   O  O     B VAL A 1 136 ? -6.373  -16.264 -24.186 0.05 10.93 ? 135  VAL A O     2  
ATOM   7626   C  CB    B VAL A 1 136 ? -8.778  -16.554 -26.559 0.05 10.85 ? 135  VAL A CB    2  
ATOM   7627   C  CG1   B VAL A 1 136 ? -9.573  -15.814 -27.626 0.05 10.84 ? 135  VAL A CG1   2  
ATOM   7628   C  CG2   B VAL A 1 136 ? -7.603  -17.288 -27.186 0.05 10.92 ? 135  VAL A CG2   2  
ATOM   7629   N  N     B ALA A 1 137 ? -8.345  -17.232 -23.703 0.05 10.85 ? 136  ALA A N     2  
ATOM   7630   C  CA    B ALA A 1 137 ? -7.783  -18.124 -22.694 0.05 10.89 ? 136  ALA A CA    2  
ATOM   7631   C  C     B ALA A 1 137 ? -6.885  -19.188 -23.314 0.05 10.96 ? 136  ALA A C     2  
ATOM   7632   O  O     B ALA A 1 137 ? -7.195  -19.720 -24.376 0.05 10.96 ? 136  ALA A O     2  
ATOM   7633   C  CB    B ALA A 1 137 ? -8.914  -18.807 -21.920 0.05 10.87 ? 136  ALA A CB    2  
ATOM   7634   N  N     B TRP A 1 138 ? -5.777  -19.497 -22.640 0.05 11.02 ? 137  TRP A N     2  
ATOM   7635   C  CA    B TRP A 1 138 ? -4.947  -20.638 -23.000 0.05 11.10 ? 137  TRP A CA    2  
ATOM   7636   C  C     B TRP A 1 138 ? -5.262  -21.767 -22.027 0.05 11.13 ? 137  TRP A C     2  
ATOM   7637   O  O     B TRP A 1 138 ? -5.937  -21.528 -21.021 0.05 11.10 ? 137  TRP A O     2  
ATOM   7638   C  CB    B TRP A 1 138 ? -3.467  -20.264 -22.907 0.05 11.18 ? 137  TRP A CB    2  
ATOM   7639   C  CG    B TRP A 1 138 ? -3.082  -19.618 -21.603 0.05 11.19 ? 137  TRP A CG    2  
ATOM   7640   C  CD1   B TRP A 1 138 ? -2.517  -20.226 -20.520 0.05 11.26 ? 137  TRP A CD1   2  
ATOM   7641   C  CD2   B TRP A 1 138 ? -3.231  -18.235 -21.252 0.05 11.15 ? 137  TRP A CD2   2  
ATOM   7642   N  NE1   B TRP A 1 138 ? -2.308  -19.306 -19.511 0.05 11.27 ? 137  TRP A NE1   2  
ATOM   7643   C  CE2   B TRP A 1 138 ? -2.739  -18.079 -19.939 0.05 11.20 ? 137  TRP A CE2   2  
ATOM   7644   C  CE3   B TRP A 1 138 ? -3.738  -17.118 -21.917 0.05 11.09 ? 137  TRP A CE3   2  
ATOM   7645   C  CZ2   B TRP A 1 138 ? -2.736  -16.849 -19.286 0.05 11.19 ? 137  TRP A CZ2   2  
ATOM   7646   C  CZ3   B TRP A 1 138 ? -3.731  -15.900 -21.268 0.05 11.09 ? 137  TRP A CZ3   2  
ATOM   7647   C  CH2   B TRP A 1 138 ? -3.230  -15.775 -19.968 0.05 11.13 ? 137  TRP A CH2   2  
ATOM   7648   N  N     B LYS A 1 139 ? -4.796  -22.987 -22.303 0.05 11.20 ? 138  LYS A N     2  
ATOM   7649   C  CA    B LYS A 1 139 ? -5.013  -24.038 -21.305 0.05 11.25 ? 138  LYS A CA    2  
ATOM   7650   C  C     B LYS A 1 139 ? -4.097  -23.790 -20.101 0.05 11.31 ? 138  LYS A C     2  
ATOM   7651   O  O     B LYS A 1 139 ? -2.880  -23.624 -20.247 0.05 11.37 ? 138  LYS A O     2  
ATOM   7652   C  CB    B LYS A 1 139 ? -4.879  -25.463 -21.866 0.05 11.33 ? 138  LYS A CB    2  
ATOM   7653   C  CG    B LYS A 1 139 ? -3.559  -25.783 -22.525 0.05 11.42 ? 138  LYS A CG    2  
ATOM   7654   C  CD    B LYS A 1 139 ? -3.353  -27.319 -22.587 0.05 11.50 ? 138  LYS A CD    2  
ATOM   7655   C  CE    B LYS A 1 139 ? -4.467  -28.011 -23.422 0.05 11.45 ? 138  LYS A CE    2  
ATOM   7656   N  NZ    B LYS A 1 139 ? -4.526  -27.545 -24.851 0.05 11.52 ? 138  LYS A NZ    2  
ATOM   7657   N  N     B GLY A 1 140 ? -4.700  -23.741 -18.918 0.05 11.30 ? 139  GLY A N     2  
ATOM   7658   C  CA    B GLY A 1 140 ? -4.007  -23.280 -17.731 0.05 11.36 ? 139  GLY A CA    2  
ATOM   7659   C  C     B GLY A 1 140 ? -4.576  -21.970 -17.213 0.05 11.28 ? 139  GLY A C     2  
ATOM   7660   O  O     B GLY A 1 140 ? -4.544  -21.720 -16.016 0.05 11.32 ? 139  GLY A O     2  
ATOM   7661   N  N     B TYR A 1 141 ? -5.118  -21.144 -18.110 0.05 11.19 ? 140  TYR A N     2  
ATOM   7662   C  CA    B TYR A 1 141 ? -5.671  -19.839 -17.741 0.05 11.12 ? 140  TYR A CA    2  
ATOM   7663   C  C     B TYR A 1 141 ? -6.591  -19.895 -16.521 0.05 11.11 ? 140  TYR A C     2  
ATOM   7664   O  O     B TYR A 1 141 ? -6.578  -18.995 -15.685 0.05 11.11 ? 140  TYR A O     2  
ATOM   7665   C  CB    B TYR A 1 141 ? -6.439  -19.240 -18.924 0.05 11.03 ? 140  TYR A CB    2  
ATOM   7666   C  CG    B TYR A 1 141 ? -7.251  -17.997 -18.607 0.05 10.97 ? 140  TYR A CG    2  
ATOM   7667   C  CD1   B TYR A 1 141 ? -6.689  -16.739 -18.708 0.05 10.97 ? 140  TYR A CD1   2  
ATOM   7668   C  CD2   B TYR A 1 141 ? -8.595  -18.089 -18.235 0.05 10.91 ? 140  TYR A CD2   2  
ATOM   7669   C  CE1   B TYR A 1 141 ? -7.424  -15.607 -18.432 0.05 10.93 ? 140  TYR A CE1   2  
ATOM   7670   C  CE2   B TYR A 1 141 ? -9.333  -16.962 -17.952 0.05 10.86 ? 140  TYR A CE2   2  
ATOM   7671   C  CZ    B TYR A 1 141 ? -8.740  -15.725 -18.057 0.05 10.87 ? 140  TYR A CZ    2  
ATOM   7672   O  OH    B TYR A 1 141 ? -9.453  -14.592 -17.784 0.05 10.83 ? 140  TYR A OH    2  
ATOM   7673   N  N     B GLU A 1 142 ? -7.391  -20.952 -16.442 0.05 11.12 ? 141  GLU A N     2  
ATOM   7674   C  CA    B GLU A 1 142 ? -8.394  -21.088 -15.389 0.05 11.12 ? 141  GLU A CA    2  
ATOM   7675   C  C     B GLU A 1 142 ? -7.764  -21.055 -14.005 0.05 11.21 ? 141  GLU A C     2  
ATOM   7676   O  O     B GLU A 1 142 ? -8.273  -20.397 -13.096 0.05 11.20 ? 141  GLU A O     2  
ATOM   7677   C  CB    B GLU A 1 142 ? -9.199  -22.380 -15.594 0.05 11.14 ? 141  GLU A CB    2  
ATOM   7678   C  CG    B GLU A 1 142 ? -10.007 -22.855 -14.401 0.05 11.18 ? 141  GLU A CG    2  
ATOM   7679   C  CD    B GLU A 1 142 ? -10.952 -21.812 -13.852 0.05 11.11 ? 141  GLU A CD    2  
ATOM   7680   O  OE1   B GLU A 1 142 ? -11.577 -21.075 -14.647 0.05 11.03 ? 141  GLU A OE1   2  
ATOM   7681   O  OE2   B GLU A 1 142 ? -11.073 -21.732 -12.610 0.05 11.15 ? 141  GLU A OE2   2  
ATOM   7682   N  N     B GLU A 1 143 ? -6.650  -21.762 -13.851 0.05 11.30 ? 142  GLU A N     2  
ATOM   7683   C  CA    B GLU A 1 143 ? -5.954  -21.792 -12.573 0.05 11.41 ? 142  GLU A CA    2  
ATOM   7684   C  C     B GLU A 1 143 ? -4.816  -20.769 -12.526 0.05 11.42 ? 142  GLU A C     2  
ATOM   7685   O  O     B GLU A 1 143 ? -4.465  -20.261 -11.458 0.05 11.47 ? 142  GLU A O     2  
ATOM   7686   C  CB    B GLU A 1 143 ? -5.456  -23.210 -12.264 0.05 11.53 ? 142  GLU A CB    2  
ATOM   7687   C  CG    B GLU A 1 143 ? -6.584  -24.216 -11.991 0.05 11.56 ? 142  GLU A CG    2  
ATOM   7688   C  CD    B GLU A 1 143 ? -6.954  -25.066 -13.203 0.05 11.48 ? 142  GLU A CD    2  
ATOM   7689   O  OE1   B GLU A 1 143 ? -6.054  -25.719 -13.765 0.05 11.47 ? 142  GLU A OE1   2  
ATOM   7690   O  OE2   B GLU A 1 143 ? -8.146  -25.098 -13.586 0.05 11.44 ? 142  GLU A OE2   2  
ATOM   7691   N  N     B GLU A 1 144 ? -4.253  -20.448 -13.684 0.05 11.38 ? 143  GLU A N     2  
ATOM   7692   C  CA    B GLU A 1 144 ? -3.123  -19.527 -13.727 0.05 11.42 ? 143  GLU A CA    2  
ATOM   7693   C  C     B GLU A 1 144 ? -3.506  -18.060 -13.515 0.05 11.36 ? 143  GLU A C     2  
ATOM   7694   O  O     B GLU A 1 144 ? -2.805  -17.340 -12.803 0.05 11.43 ? 143  GLU A O     2  
ATOM   7695   C  CB    B GLU A 1 144 ? -2.300  -19.710 -15.016 0.05 11.43 ? 143  GLU A CB    2  
ATOM   7696   C  CG    B GLU A 1 144 ? -1.518  -21.028 -15.064 0.05 11.52 ? 143  GLU A CG    2  
ATOM   7697   C  CD    B GLU A 1 144 ? -0.602  -21.150 -16.285 0.05 11.52 ? 143  GLU A CD    2  
ATOM   7698   O  OE1   B GLU A 1 144 ? 0.037   -22.213 -16.447 0.05 11.55 ? 143  GLU A OE1   2  
ATOM   7699   O  OE2   B GLU A 1 144 ? -0.528  -20.195 -17.082 0.05 11.49 ? 143  GLU A OE2   2  
ATOM   7700   N  N     B VAL A 1 145 ? -4.612  -17.615 -14.116 0.05 11.25 ? 144  VAL A N     2  
ATOM   7701   C  CA    B VAL A 1 145 ? -4.993  -16.200 -14.061 0.05 11.20 ? 144  VAL A CA    2  
ATOM   7702   C  C     B VAL A 1 145 ? -6.394  -15.914 -13.492 0.05 11.14 ? 144  VAL A C     2  
ATOM   7703   O  O     B VAL A 1 145 ? -6.562  -14.979 -12.703 0.05 11.16 ? 144  VAL A O     2  
ATOM   7704   C  CB    B VAL A 1 145 ? -4.839  -15.510 -15.444 0.05 11.14 ? 144  VAL A CB    2  
ATOM   7705   C  CG1   B VAL A 1 145 ? -5.207  -14.027 -15.353 0.05 11.11 ? 144  VAL A CG1   2  
ATOM   7706   C  CG2   B VAL A 1 145 ? -3.411  -15.672 -15.961 0.05 11.22 ? 144  VAL A CG2   2  
ATOM   7707   N  N     B ALA A 1 146 ? -7.395  -16.703 -13.883 0.05 11.08 ? 145  ALA A N     2  
ATOM   7708   C  CA    B ALA A 1 146 ? -8.762  -16.474 -13.402 0.05 11.03 ? 145  ALA A CA    2  
ATOM   7709   C  C     B ALA A 1 146 ? -8.876  -16.647 -11.888 0.05 11.09 ? 145  ALA A C     2  
ATOM   7710   O  O     B ALA A 1 146 ? -9.481  -15.816 -11.198 0.05 11.08 ? 145  ALA A O     2  
ATOM   7711   C  CB    B ALA A 1 146 ? -9.759  -17.388 -14.116 0.05 10.97 ? 145  ALA A CB    2  
ATOM   7712   N  N     B GLU A 1 147 ? -8.296  -17.726 -11.368 0.05 11.16 ? 146  GLU A N     2  
ATOM   7713   C  CA    B GLU A 1 147 ? -8.400  -17.986 -9.931  0.05 11.24 ? 146  GLU A CA    2  
ATOM   7714   C  C     B GLU A 1 147 ? -7.819  -16.877 -9.023  0.05 11.31 ? 146  GLU A C     2  
ATOM   7715   O  O     B GLU A 1 147 ? -8.471  -16.485 -8.055  0.05 11.33 ? 146  GLU A O     2  
ATOM   7716   C  CB    B GLU A 1 147 ? -7.867  -19.382 -9.569  0.05 11.32 ? 146  GLU A CB    2  
ATOM   7717   C  CG    B GLU A 1 147 ? -8.310  -19.900 -8.188  0.05 11.41 ? 146  GLU A CG    2  
ATOM   7718   C  CD    B GLU A 1 147 ? -7.516  -19.287 -7.058  0.05 11.53 ? 146  GLU A CD    2  
ATOM   7719   O  OE1   B GLU A 1 147 ? -6.391  -18.817 -7.325  0.05 11.56 ? 146  GLU A OE1   2  
ATOM   7720   O  OE2   B GLU A 1 147 ? -8.004  -19.258 -5.905  0.05 11.60 ? 146  GLU A OE2   2  
ATOM   7721   N  N     B PRO A 1 148 ? -6.600  -16.374 -9.312  0.05 11.36 ? 147  PRO A N     2  
ATOM   7722   C  CA    B PRO A 1 148 ? -6.078  -15.332 -8.415  0.05 11.43 ? 147  PRO A CA    2  
ATOM   7723   C  C     B PRO A 1 148 ? -6.848  -14.019 -8.504  0.05 11.37 ? 147  PRO A C     2  
ATOM   7724   O  O     B PRO A 1 148 ? -7.048  -13.333 -7.499  0.05 11.43 ? 147  PRO A O     2  
ATOM   7725   C  CB    B PRO A 1 148 ? -4.645  -15.116 -8.916  0.05 11.50 ? 147  PRO A CB    2  
ATOM   7726   C  CG    B PRO A 1 148 ? -4.309  -16.347 -9.670  0.05 11.50 ? 147  PRO A CG    2  
ATOM   7727   C  CD    B PRO A 1 148 ? -5.584  -16.804 -10.288 0.05 11.38 ? 147  PRO A CD    2  
ATOM   7728   N  N     B MET A 1 149 ? -7.268  -13.663 -9.709  0.05 11.26 ? 148  MET A N     2  
ATOM   7729   C  CA    B MET A 1 149 ? -7.979  -12.412 -9.901  0.05 11.20 ? 148  MET A CA    2  
ATOM   7730   C  C     B MET A 1 149 ? -9.291  -12.401 -9.118  0.05 11.19 ? 148  MET A C     2  
ATOM   7731   O  O     B MET A 1 149 ? -9.674  -11.390 -8.525  0.05 11.21 ? 148  MET A O     2  
ATOM   7732   C  CB    B MET A 1 149 ? -8.243  -12.195 -11.383 0.05 11.10 ? 148  MET A CB    2  
ATOM   7733   C  CG    B MET A 1 149 ? -9.485  -11.394 -11.640 0.05 11.07 ? 148  MET A CG    2  
ATOM   7734   S  SD    B MET A 1 149 ? -9.651  -10.928 -13.356 0.05 11.00 ? 148  MET A SD    2  
ATOM   7735   C  CE    B MET A 1 149 ? -9.899  -12.507 -14.142 0.05 10.92 ? 148  MET A CE    2  
ATOM   7736   N  N     B TRP A 1 150 ? -9.960  -13.545 -9.094  0.05 11.17 ? 149  TRP A N     2  
ATOM   7737   C  CA    B TRP A 1 150 ? -11.301 -13.633 -8.519  0.05 11.15 ? 149  TRP A CA    2  
ATOM   7738   C  C     B TRP A 1 150 ? -11.357 -13.990 -7.037  0.05 11.26 ? 149  TRP A C     2  
ATOM   7739   O  O     B TRP A 1 150 ? -12.343 -13.682 -6.371  0.05 11.27 ? 149  TRP A O     2  
ATOM   7740   C  CB    B TRP A 1 150 ? -12.147 -14.633 -9.309  0.05 11.08 ? 149  TRP A CB    2  
ATOM   7741   C  CG    B TRP A 1 150 ? -12.863 -13.985 -10.442 0.05 10.98 ? 149  TRP A CG    2  
ATOM   7742   C  CD1   B TRP A 1 150 ? -12.629 -14.154 -11.773 0.05 10.92 ? 149  TRP A CD1   2  
ATOM   7743   C  CD2   B TRP A 1 150 ? -13.922 -13.036 -10.332 0.05 10.95 ? 149  TRP A CD2   2  
ATOM   7744   N  NE1   B TRP A 1 150 ? -13.491 -13.371 -12.503 0.05 10.86 ? 149  TRP A NE1   2  
ATOM   7745   C  CE2   B TRP A 1 150 ? -14.299 -12.679 -11.639 0.05 10.87 ? 149  TRP A CE2   2  
ATOM   7746   C  CE3   B TRP A 1 150 ? -14.599 -12.462 -9.251  0.05 10.99 ? 149  TRP A CE3   2  
ATOM   7747   C  CZ2   B TRP A 1 150 ? -15.316 -11.768 -11.895 0.05 10.84 ? 149  TRP A CZ2   2  
ATOM   7748   C  CZ3   B TRP A 1 150 ? -15.609 -11.568 -9.505  0.05 10.95 ? 149  TRP A CZ3   2  
ATOM   7749   C  CH2   B TRP A 1 150 ? -15.960 -11.224 -10.817 0.05 10.88 ? 149  TRP A CH2   2  
ATOM   7750   N  N     B ARG A 1 151 ? -10.307 -14.634 -6.531  0.05 11.35 ? 150  ARG A N     2  
ATOM   7751   C  CA    B ARG A 1 151 ? -10.360 -15.294 -5.223  0.05 11.47 ? 150  ARG A CA    2  
ATOM   7752   C  C     B ARG A 1 151 ? -10.888 -14.397 -4.100  0.05 11.52 ? 150  ARG A C     2  
ATOM   7753   O  O     B ARG A 1 151 ? -11.835 -14.756 -3.395  0.05 11.57 ? 150  ARG A O     2  
ATOM   7754   C  CB    B ARG A 1 151 ? -8.987  -15.866 -4.871  0.05 11.58 ? 150  ARG A CB    2  
ATOM   7755   C  CG    B ARG A 1 151 ? -8.943  -16.741 -3.632  0.05 11.72 ? 150  ARG A CG    2  
ATOM   7756   C  CD    B ARG A 1 151 ? -7.495  -17.086 -3.294  0.05 11.83 ? 150  ARG A CD    2  
ATOM   7757   N  NE    B ARG A 1 151 ? -6.808  -17.684 -4.436  0.05 11.80 ? 150  ARG A NE    2  
ATOM   7758   C  CZ    B ARG A 1 151 ? -5.575  -18.181 -4.396  0.05 11.88 ? 150  ARG A CZ    2  
ATOM   7759   N  NH1   B ARG A 1 151 ? -4.878  -18.142 -3.272  0.05 12.01 ? 150  ARG A NH1   2  
ATOM   7760   N  NH2   B ARG A 1 151 ? -5.029  -18.707 -5.485  0.05 11.85 ? 150  ARG A NH2   2  
ATOM   7761   N  N     B GLU A 1 152 ? -10.303 -13.217 -3.954  0.05 11.52 ? 151  GLU A N     2  
ATOM   7762   C  CA    B GLU A 1 152 ? -10.781 -12.277 -2.939  0.05 11.58 ? 151  GLU A CA    2  
ATOM   7763   C  C     B GLU A 1 152 ? -12.139 -11.612 -3.248  0.05 11.49 ? 151  GLU A C     2  
ATOM   7764   O  O     B GLU A 1 152 ? -12.999 -11.564 -2.372  0.05 11.53 ? 151  GLU A O     2  
ATOM   7765   C  CB    B GLU A 1 152 ? -9.692  -11.253 -2.554  0.05 11.67 ? 151  GLU A CB    2  
ATOM   7766   C  CG    B GLU A 1 152 ? -8.726  -11.741 -1.462  0.05 11.78 ? 151  GLU A CG    2  
ATOM   7767   C  CD    B GLU A 1 152 ? -7.555  -10.793 -1.238  0.05 11.94 ? 151  GLU A CD    2  
ATOM   7768   O  OE1   B GLU A 1 152 ? -7.249  -10.443 -0.074  0.05 12.04 ? 151  GLU A OE1   2  
ATOM   7769   O  OE2   B GLU A 1 152 ? -6.926  -10.400 -2.233  0.05 11.97 ? 151  GLU A OE2   2  
ATOM   7770   N  N     B PRO A 1 153 ? -12.341 -11.096 -4.479  0.05 11.38 ? 152  PRO A N     2  
ATOM   7771   C  CA    B PRO A 1 153 ? -13.673 -10.553 -4.797  0.05 11.31 ? 152  PRO A CA    2  
ATOM   7772   C  C     B PRO A 1 153 ? -14.811 -11.573 -4.711  0.05 11.27 ? 152  PRO A C     2  
ATOM   7773   O  O     B PRO A 1 153 ? -15.835 -11.275 -4.102  0.05 11.28 ? 152  PRO A O     2  
ATOM   7774   C  CB    B PRO A 1 153 ? -13.506 -10.049 -6.235  0.05 11.22 ? 152  PRO A CB    2  
ATOM   7775   C  CG    B PRO A 1 153 ? -12.063 -9.650  -6.302  0.05 11.27 ? 152  PRO A CG    2  
ATOM   7776   C  CD    B PRO A 1 153 ? -11.348 -10.718 -5.505  0.05 11.35 ? 152  PRO A CD    2  
ATOM   7777   N  N     B ARG A 1 154 ? -14.637 -12.754 -5.301  0.05 11.25 ? 153  ARG A N     2  
ATOM   7778   C  CA    B ARG A 1 154 ? -15.719 -13.741 -5.368  0.05 11.23 ? 153  ARG A CA    2  
ATOM   7779   C  C     B ARG A 1 154 ? -16.129 -14.220 -3.971  0.05 11.33 ? 153  ARG A C     2  
ATOM   7780   O  O     B ARG A 1 154 ? -17.207 -14.780 -3.799  0.05 11.32 ? 153  ARG A O     2  
ATOM   7781   C  CB    B ARG A 1 154 ? -15.349 -14.905 -6.317  0.05 11.21 ? 153  ARG A CB    2  
ATOM   7782   C  CG    B ARG A 1 154 ? -16.076 -16.238 -6.104  0.05 11.27 ? 153  ARG A CG    2  
ATOM   7783   C  CD    B ARG A 1 154 ? -17.588 -16.163 -6.408  0.05 11.21 ? 153  ARG A CD    2  
ATOM   7784   N  NE    B ARG A 1 154 ? -18.377 -17.212 -5.739  0.05 11.24 ? 153  ARG A NE    2  
ATOM   7785   C  CZ    B ARG A 1 154 ? -18.352 -18.505 -6.059  0.05 11.20 ? 153  ARG A CZ    2  
ATOM   7786   N  NH1   B ARG A 1 154 ? -17.552 -18.949 -7.019  0.05 11.13 ? 153  ARG A NH1   2  
ATOM   7787   N  NH2   B ARG A 1 154 ? -19.113 -19.368 -5.398  0.05 11.25 ? 153  ARG A NH2   2  
ATOM   7788   N  N     B GLN A 1 155 ? -15.294 -13.953 -2.966  0.05 11.43 ? 154  GLN A N     2  
ATOM   7789   C  CA    B GLN A 1 155 ? -15.625 -14.305 -1.579  0.05 11.55 ? 154  GLN A CA    2  
ATOM   7790   C  C     B GLN A 1 155 ? -16.306 -13.166 -0.805  0.05 11.58 ? 154  GLN A C     2  
ATOM   7791   O  O     B GLN A 1 155 ? -16.917 -13.405 0.244   0.05 11.66 ? 154  GLN A O     2  
ATOM   7792   C  CB    B GLN A 1 155 ? -14.389 -14.795 -0.815  0.05 11.67 ? 154  GLN A CB    2  
ATOM   7793   C  CG    B GLN A 1 155 ? -14.001 -16.240 -1.095  0.05 11.65 ? 154  GLN A CG    2  
ATOM   7794   C  CD    B GLN A 1 155 ? -12.834 -16.714 -0.241  0.05 11.80 ? 154  GLN A CD    2  
ATOM   7795   O  OE1   B GLN A 1 155 ? -11.945 -15.935 0.102   0.05 11.92 ? 154  GLN A OE1   2  
ATOM   7796   N  NE2   B GLN A 1 155 ? -12.840 -17.996 0.114   0.05 11.80 ? 154  GLN A NE2   2  
ATOM   7797   N  N     B THR A 1 156 ? -16.206 -11.937 -1.313  0.05 11.52 ? 155  THR A N     2  
ATOM   7798   C  CA    B THR A 1 156 ? -16.987 -10.822 -0.760  0.05 11.55 ? 155  THR A CA    2  
ATOM   7799   C  C     B THR A 1 156 ? -18.454 -11.180 -0.883  0.05 11.50 ? 155  THR A C     2  
ATOM   7800   O  O     B THR A 1 156 ? -18.802 -12.125 -1.589  0.05 11.40 ? 155  THR A O     2  
ATOM   7801   C  CB    B THR A 1 156 ? -16.759 -9.494  -1.519  0.05 11.51 ? 155  THR A CB    2  
ATOM   7802   O  OG1   B THR A 1 156 ? -17.427 -9.526  -2.787  0.05 11.39 ? 155  THR A OG1   2  
ATOM   7803   C  CG2   B THR A 1 156 ? -15.284 -9.244  -1.744  0.05 11.56 ? 155  THR A CG2   2  
ATOM   7804   N  N     B GLU A 1 157 ? -19.325 -10.448 -0.198  0.05 11.57 ? 156  GLU A N     2  
ATOM   7805   C  CA    B GLU A 1 157 ? -20.749 -10.686 -0.373  0.05 11.55 ? 156  GLU A CA    2  
ATOM   7806   C  C     B GLU A 1 157 ? -21.205 -10.247 -1.780  0.05 11.42 ? 156  GLU A C     2  
ATOM   7807   O  O     B GLU A 1 157 ? -22.021 -10.914 -2.396  0.05 11.36 ? 156  GLU A O     2  
ATOM   7808   C  CB    B GLU A 1 157 ? -21.577 -10.002 0.734   0.05 11.64 ? 156  GLU A CB    2  
ATOM   7809   C  CG    B GLU A 1 157 ? -21.121 -10.288 2.171   0.05 11.69 ? 156  GLU A CG    2  
ATOM   7810   C  CD    B GLU A 1 157 ? -22.078 -9.712  3.226   0.05 11.83 ? 156  GLU A CD    2  
ATOM   7811   O  OE1   B GLU A 1 157 ? -22.241 -10.335 4.296   0.05 11.93 ? 156  GLU A OE1   2  
ATOM   7812   O  OE2   B GLU A 1 157 ? -22.662 -8.634  2.989   0.05 11.86 ? 156  GLU A OE2   2  
ATOM   7813   N  N     B ARG A 1 158 ? -20.677 -9.140  -2.297  0.05 11.38 ? 157  ARG A N     2  
ATOM   7814   C  CA    B ARG A 1 158 ? -21.046 -8.725  -3.655  0.05 11.28 ? 157  ARG A CA    2  
ATOM   7815   C  C     B ARG A 1 158 ? -20.569 -9.759  -4.685  0.05 11.19 ? 157  ARG A C     2  
ATOM   7816   O  O     B ARG A 1 158 ? -21.300 -10.099 -5.615  0.05 11.12 ? 157  ARG A O     2  
ATOM   7817   C  CB    B ARG A 1 158 ? -20.509 -7.325  -3.998  0.05 11.28 ? 157  ARG A CB    2  
ATOM   7818   C  CG    B ARG A 1 158 ? -20.623 -6.974  -5.475  0.05 11.18 ? 157  ARG A CG    2  
ATOM   7819   C  CD    B ARG A 1 158 ? -20.247 -5.513  -5.767  0.05 11.21 ? 157  ARG A CD    2  
ATOM   7820   N  NE    B ARG A 1 158 ? -20.271 -5.208  -7.196  0.05 11.14 ? 157  ARG A NE    2  
ATOM   7821   C  CZ    B ARG A 1 158 ? -19.851 -4.058  -7.723  0.05 11.15 ? 157  ARG A CZ    2  
ATOM   7822   N  NH1   B ARG A 1 158 ? -19.369 -3.097  -6.937  0.05 11.24 ? 157  ARG A NH1   2  
ATOM   7823   N  NH2   B ARG A 1 158 ? -19.905 -3.871  -9.033  0.05 11.09 ? 157  ARG A NH2   2  
ATOM   7824   N  N     B GLY A 1 159 ? -19.352 -10.263 -4.498  0.05 11.20 ? 158  GLY A N     2  
ATOM   7825   C  CA    B GLY A 1 159 ? -18.781 -11.270 -5.383  0.05 11.14 ? 158  GLY A CA    2  
ATOM   7826   C  C     B GLY A 1 159 ? -19.476 -12.619 -5.287  0.05 11.14 ? 158  GLY A C     2  
ATOM   7827   O  O     B GLY A 1 159 ? -19.894 -13.171 -6.309  0.05 11.07 ? 158  GLY A O     2  
ATOM   7828   N  N     B ARG A 1 160 ? -19.593 -13.149 -4.067  0.05 11.23 ? 159  ARG A N     2  
ATOM   7829   C  CA    B ARG A 1 160 ? -20.342 -14.385 -3.818  0.05 11.26 ? 159  ARG A CA    2  
ATOM   7830   C  C     B ARG A 1 160 ? -21.717 -14.321 -4.454  0.05 11.20 ? 159  ARG A C     2  
ATOM   7831   O  O     B ARG A 1 160 ? -22.210 -15.315 -4.988  0.05 11.16 ? 159  ARG A O     2  
ATOM   7832   C  CB    B ARG A 1 160 ? -20.549 -14.614 -2.316  0.05 11.38 ? 159  ARG A CB    2  
ATOM   7833   C  CG    B ARG A 1 160 ? -19.421 -15.315 -1.576  0.05 11.47 ? 159  ARG A CG    2  
ATOM   7834   C  CD    B ARG A 1 160 ? -19.774 -15.471 -0.099  0.05 11.54 ? 159  ARG A CD    2  
ATOM   7835   N  NE    B ARG A 1 160 ? -18.644 -15.158 0.775   0.05 11.64 ? 159  ARG A NE    2  
ATOM   7836   C  CZ    B ARG A 1 160 ? -17.881 -16.068 1.373   0.05 11.77 ? 159  ARG A CZ    2  
ATOM   7837   N  N     B ALA A 1 161 ? -22.333 -13.144 -4.379  0.05 11.20 ? 160  ALA A N     2  
ATOM   7838   C  CA    B ALA A 1 161 ? -23.700 -12.944 -4.844  0.05 11.17 ? 160  ALA A CA    2  
ATOM   7839   C  C     B ALA A 1 161 ? -23.782 -12.787 -6.356  0.05 11.07 ? 160  ALA A C     2  
ATOM   7840   O  O     B ALA A 1 161 ? -24.696 -13.310 -6.982  0.05 11.04 ? 160  ALA A O     2  
ATOM   7841   C  CB    B ALA A 1 161 ? -24.339 -11.739 -4.151  0.05 11.21 ? 160  ALA A CB    2  
ATOM   7842   N  N     B TYR A 1 162 ? -22.838 -12.051 -6.939  0.05 11.02 ? 161  TYR A N     2  
ATOM   7843   C  CA    B TYR A 1 162 ? -22.810 -11.887 -8.392  0.05 10.94 ? 161  TYR A CA    2  
ATOM   7844   C  C     B TYR A 1 162 ? -22.747 -13.250 -9.085  0.05 10.92 ? 161  TYR A C     2  
ATOM   7845   O  O     B TYR A 1 162 ? -23.487 -13.512 -10.042 0.05 10.88 ? 161  TYR A O     2  
ATOM   7846   C  CB    B TYR A 1 162 ? -21.632 -11.001 -8.809  0.05 10.92 ? 161  TYR A CB    2  
ATOM   7847   C  CG    B TYR A 1 162 ? -21.136 -11.250 -10.211 0.05 10.85 ? 161  TYR A CG    2  
ATOM   7848   C  CD1   B TYR A 1 162 ? -21.851 -10.807 -11.319 0.05 10.80 ? 161  TYR A CD1   2  
ATOM   7849   C  CD2   B TYR A 1 162 ? -19.943 -11.922 -10.426 0.05 10.84 ? 161  TYR A CD2   2  
ATOM   7850   C  CE1   B TYR A 1 162 ? -21.388 -11.045 -12.606 0.05 10.75 ? 161  TYR A CE1   2  
ATOM   7851   C  CE2   B TYR A 1 162 ? -19.478 -12.160 -11.693 0.05 10.79 ? 161  TYR A CE2   2  
ATOM   7852   C  CZ    B TYR A 1 162 ? -20.199 -11.722 -12.781 0.05 10.74 ? 161  TYR A CZ    2  
ATOM   7853   O  OH    B TYR A 1 162 ? -19.712 -11.971 -14.040 0.05 10.70 ? 161  TYR A OH    2  
ATOM   7854   N  N     B TYR A 1 163 ? -21.893 -14.130 -8.577  0.05 10.95 ? 162  TYR A N     2  
ATOM   7855   C  CA    B TYR A 1 163 ? -21.775 -15.469 -9.161  0.05 10.94 ? 162  TYR A CA    2  
ATOM   7856   C  C     B TYR A 1 163 ? -22.991 -16.357 -8.908  0.05 10.98 ? 162  TYR A C     2  
ATOM   7857   O  O     B TYR A 1 163 ? -23.345 -17.184 -9.752  0.05 10.96 ? 162  TYR A O     2  
ATOM   7858   C  CB    B TYR A 1 163 ? -20.467 -16.156 -8.757  0.05 10.98 ? 162  TYR A CB    2  
ATOM   7859   C  CG    B TYR A 1 163 ? -19.364 -15.826 -9.737  0.05 10.93 ? 162  TYR A CG    2  
ATOM   7860   C  CD1   B TYR A 1 163 ? -19.217 -16.551 -10.908 0.05 10.88 ? 162  TYR A CD1   2  
ATOM   7861   C  CD2   B TYR A 1 163 ? -18.513 -14.752 -9.522  0.05 10.94 ? 162  TYR A CD2   2  
ATOM   7862   C  CE1   B TYR A 1 163 ? -18.227 -16.242 -11.823 0.05 10.84 ? 162  TYR A CE1   2  
ATOM   7863   C  CE2   B TYR A 1 163 ? -17.517 -14.435 -10.432 0.05 10.91 ? 162  TYR A CE2   2  
ATOM   7864   C  CZ    B TYR A 1 163 ? -17.384 -15.176 -11.584 0.05 10.85 ? 162  TYR A CZ    2  
ATOM   7865   O  OH    B TYR A 1 163 ? -16.401 -14.864 -12.502 0.05 10.83 ? 162  TYR A OH    2  
ATOM   7866   N  N     B ALA A 1 164 ? -23.631 -16.185 -7.757  0.05 11.05 ? 163  ALA A N     2  
ATOM   7867   C  CA    B ALA A 1 164 ? -24.854 -16.928 -7.486  0.05 11.10 ? 163  ALA A CA    2  
ATOM   7868   C  C     B ALA A 1 164 ? -25.961 -16.503 -8.445  0.05 11.06 ? 163  ALA A C     2  
ATOM   7869   O  O     B ALA A 1 164 ? -26.718 -17.346 -8.945  0.05 11.07 ? 163  ALA A O     2  
ATOM   7870   C  CB    B ALA A 1 164 ? -25.295 -16.748 -6.027  0.05 11.19 ? 163  ALA A CB    2  
ATOM   7871   N  N     B ARG A 1 165 ? -26.049 -15.198 -8.709  0.05 11.01 ? 164  ARG A N     2  
ATOM   7872   C  CA    B ARG A 1 165 ? -27.061 -14.665 -9.624  0.05 10.98 ? 164  ARG A CA    2  
ATOM   7873   C  C     B ARG A 1 165 ? -26.800 -15.138 -11.057 0.05 10.92 ? 164  ARG A C     2  
ATOM   7874   O  O     B ARG A 1 165 ? -27.726 -15.461 -11.797 0.05 10.93 ? 164  ARG A O     2  
ATOM   7875   C  CB    B ARG A 1 165 ? -27.116 -13.120 -9.565  0.05 10.96 ? 164  ARG A CB    2  
ATOM   7876   C  CG    B ARG A 1 165 ? -27.439 -12.543 -8.180  0.05 11.04 ? 164  ARG A CG    2  
ATOM   7877   C  CD    B ARG A 1 165 ? -27.736 -11.023 -8.182  0.05 11.03 ? 164  ARG A CD    2  
ATOM   7878   N  NE    B ARG A 1 165 ? -27.621 -10.401 -9.500  0.05 10.97 ? 164  ARG A NE    2  
ATOM   7879   C  CZ    B ARG A 1 165 ? -26.724 -9.472  -9.823  0.05 10.95 ? 164  ARG A CZ    2  
ATOM   7880   N  NH1   B ARG A 1 165 ? -25.840 -9.047  -8.919  0.05 10.99 ? 164  ARG A NH1   2  
ATOM   7881   N  NH2   B ARG A 1 165 ? -26.703 -8.968  -11.051 0.05 10.90 ? 164  ARG A NH2   2  
ATOM   7882   N  N     B PHE A 1 166 ? -25.524 -15.181 -11.434 0.05 10.88 ? 165  PHE A N     2  
ATOM   7883   C  CA    B PHE A 1 166 ? -25.121 -15.582 -12.772 0.05 10.83 ? 165  PHE A CA    2  
ATOM   7884   C  C     B PHE A 1 166 ? -25.457 -17.070 -12.942 0.05 10.87 ? 165  PHE A C     2  
ATOM   7885   O  O     B PHE A 1 166 ? -26.076 -17.474 -13.930 0.05 10.86 ? 165  PHE A O     2  
ATOM   7886   C  CB    B PHE A 1 166 ? -23.613 -15.303 -12.935 0.05 10.79 ? 165  PHE A CB    2  
ATOM   7887   C  CG    B PHE A 1 166 ? -23.122 -15.239 -14.368 0.05 10.74 ? 165  PHE A CG    2  
ATOM   7888   C  CD1   B PHE A 1 166 ? -23.765 -15.912 -15.393 0.05 10.73 ? 165  PHE A CD1   2  
ATOM   7889   C  CD2   B PHE A 1 166 ? -21.976 -14.516 -14.669 0.05 10.71 ? 165  PHE A CD2   2  
ATOM   7890   C  CE1   B PHE A 1 166 ? -23.282 -15.851 -16.698 0.05 10.70 ? 165  PHE A CE1   2  
ATOM   7891   C  CE2   B PHE A 1 166 ? -21.483 -14.451 -15.963 0.05 10.67 ? 165  PHE A CE2   2  
ATOM   7892   C  CZ    B PHE A 1 166 ? -22.140 -15.118 -16.983 0.05 10.67 ? 165  PHE A CZ    2  
ATOM   7893   N  N     B GLU A 1 167 ? -25.080 -17.877 -11.959 0.05 10.92 ? 166  GLU A N     2  
ATOM   7894   C  CA    B GLU A 1 167 ? -25.378 -19.309 -12.000 0.05 10.98 ? 166  GLU A CA    2  
ATOM   7895   C  C     B GLU A 1 167 ? -26.885 -19.593 -12.052 0.05 11.02 ? 166  GLU A C     2  
ATOM   7896   O  O     B GLU A 1 167 ? -27.335 -20.508 -12.747 0.05 11.05 ? 166  GLU A O     2  
ATOM   7897   C  CB    B GLU A 1 167 ? -24.758 -20.020 -10.793 0.05 11.05 ? 166  GLU A CB    2  
ATOM   7898   C  CG    B GLU A 1 167 ? -24.925 -21.533 -10.821 0.05 11.13 ? 166  GLU A CG    2  
ATOM   7899   C  CD    B GLU A 1 167 ? -23.600 -22.259 -10.812 0.05 11.13 ? 166  GLU A CD    2  
ATOM   7900   O  OE1   B GLU A 1 167 ? -22.823 -22.074 -9.841  0.05 11.11 ? 166  GLU A OE1   2  
ATOM   7901   O  OE2   B GLU A 1 167 ? -23.333 -23.005 -11.787 0.05 11.17 ? 166  GLU A OE2   2  
ATOM   7902   N  N     B ALA A 1 168 ? -27.659 -18.809 -11.312 0.05 11.05 ? 167  ALA A N     2  
ATOM   7903   C  CA    B ALA A 1 168 ? -29.109 -19.007 -11.266 0.05 11.11 ? 167  ALA A CA    2  
ATOM   7904   C  C     B ALA A 1 168 ? -29.758 -18.636 -12.594 0.05 11.07 ? 167  ALA A C     2  
ATOM   7905   O  O     B ALA A 1 168 ? -30.731 -19.256 -13.018 0.05 11.13 ? 167  ALA A O     2  
ATOM   7906   C  CB    B ALA A 1 168 ? -29.722 -18.207 -10.126 0.05 11.15 ? 167  ALA A CB    2  
ATOM   7907   N  N     B TRP A 1 169 ? -29.214 -17.621 -13.254 0.05 10.99 ? 168  TRP A N     2  
ATOM   7908   C  CA    B TRP A 1 169 ? -29.736 -17.201 -14.553 0.05 10.97 ? 168  TRP A CA    2  
ATOM   7909   C  C     B TRP A 1 169 ? -29.436 -18.252 -15.619 0.05 10.97 ? 168  TRP A C     2  
ATOM   7910   O  O     B TRP A 1 169 ? -30.272 -18.546 -16.471 0.05 11.00 ? 168  TRP A O     2  
ATOM   7911   C  CB    B TRP A 1 169 ? -29.144 -15.846 -14.951 0.05 10.90 ? 168  TRP A CB    2  
ATOM   7912   C  CG    B TRP A 1 169 ? -29.562 -15.338 -16.310 0.05 10.88 ? 168  TRP A CG    2  
ATOM   7913   C  CD1   B TRP A 1 169 ? -30.809 -14.939 -16.690 0.05 10.93 ? 168  TRP A CD1   2  
ATOM   7914   C  CD2   B TRP A 1 169 ? -28.714 -15.138 -17.450 0.05 10.83 ? 168  TRP A CD2   2  
ATOM   7915   N  NE1   B TRP A 1 169 ? -30.795 -14.521 -18.001 0.05 10.91 ? 168  TRP A NE1   2  
ATOM   7916   C  CE2   B TRP A 1 169 ? -29.520 -14.634 -18.490 0.05 10.85 ? 168  TRP A CE2   2  
ATOM   7917   C  CE3   B TRP A 1 169 ? -27.356 -15.346 -17.692 0.05 10.78 ? 168  TRP A CE3   2  
ATOM   7918   C  CZ2   B TRP A 1 169 ? -29.009 -14.326 -19.751 0.05 10.83 ? 168  TRP A CZ2   2  
ATOM   7919   C  CZ3   B TRP A 1 169 ? -26.847 -15.040 -18.950 0.05 10.75 ? 168  TRP A CZ3   2  
ATOM   7920   C  CH2   B TRP A 1 169 ? -27.671 -14.537 -19.960 0.05 10.78 ? 168  TRP A CH2   2  
ATOM   7921   N  N     B LEU A 1 170 ? -28.234 -18.815 -15.573 0.05 10.94 ? 169  LEU A N     2  
ATOM   7922   C  CA    B LEU A 1 170 ? -27.890 -19.900 -16.487 0.05 10.95 ? 169  LEU A CA    2  
ATOM   7923   C  C     B LEU A 1 170 ? -28.797 -21.109 -16.240 0.05 11.05 ? 169  LEU A C     2  
ATOM   7924   O  O     B LEU A 1 170 ? -29.335 -21.694 -17.180 0.05 11.09 ? 169  LEU A O     2  
ATOM   7925   C  CB    B LEU A 1 170 ? -26.428 -20.300 -16.328 0.05 10.92 ? 169  LEU A CB    2  
ATOM   7926   C  CG    B LEU A 1 170 ? -25.421 -19.260 -16.812 0.05 10.84 ? 169  LEU A CG    2  
ATOM   7927   C  CD1   B LEU A 1 170 ? -24.011 -19.804 -16.650 0.05 10.83 ? 169  LEU A CD1   2  
ATOM   7928   C  CD2   B LEU A 1 170 ? -25.695 -18.883 -18.269 0.05 10.82 ? 169  LEU A CD2   2  
ATOM   7929   N  N     B LYS A 1 171 ? -28.968 -21.465 -14.971 0.05 11.10 ? 170  LYS A N     2  
ATOM   7930   C  CA    B LYS A 1 171 ? -29.766 -22.642 -14.618 0.05 11.21 ? 170  LYS A CA    2  
ATOM   7931   C  C     B LYS A 1 171 ? -31.227 -22.492 -15.049 0.05 11.26 ? 170  LYS A C     2  
ATOM   7932   O  O     B LYS A 1 171 ? -31.854 -23.463 -15.474 0.05 11.34 ? 170  LYS A O     2  
ATOM   7933   C  CB    B LYS A 1 171 ? -29.648 -22.956 -13.121 0.05 11.26 ? 170  LYS A CB    2  
ATOM   7934   C  CG    B LYS A 1 171 ? -28.374 -23.755 -12.768 0.05 11.26 ? 170  LYS A CG    2  
ATOM   7935   C  CD    B LYS A 1 171 ? -28.193 -23.948 -11.261 0.05 11.32 ? 170  LYS A CD    2  
ATOM   7936   C  CE    B LYS A 1 171 ? -29.504 -24.305 -10.562 0.05 11.44 ? 170  LYS A CE    2  
ATOM   7937   N  NZ    B LYS A 1 171 ? -29.412 -24.185 -9.071  0.05 11.52 ? 170  LYS A NZ    2  
ATOM   7938   N  N     B GLU A 1 172 ? -31.769 -21.280 -14.952 0.05 11.22 ? 171  GLU A N     2  
ATOM   7939   C  CA    B GLU A 1 172 ? -33.147 -21.081 -15.388 0.05 11.28 ? 171  GLU A CA    2  
ATOM   7940   C  C     B GLU A 1 172 ? -33.245 -21.225 -16.908 0.05 11.28 ? 171  GLU A C     2  
ATOM   7941   O  O     B GLU A 1 172 ? -34.324 -21.463 -17.450 0.05 11.35 ? 171  GLU A O     2  
ATOM   7942   C  CB    B GLU A 1 172 ? -33.742 -19.753 -14.884 0.05 11.27 ? 171  GLU A CB    2  
ATOM   7943   C  CG    B GLU A 1 172 ? -33.160 -18.480 -15.490 0.05 11.18 ? 171  GLU A CG    2  
ATOM   7944   C  CD    B GLU A 1 172 ? -33.919 -17.223 -15.067 0.05 11.20 ? 171  GLU A CD    2  
ATOM   7945   O  OE1   B GLU A 1 172 ? -33.271 -16.210 -14.722 0.05 11.14 ? 171  GLU A OE1   2  
ATOM   7946   O  OE2   B GLU A 1 172 ? -35.167 -17.242 -15.085 0.05 11.29 ? 171  GLU A OE2   2  
ATOM   7947   N  N     B ASN A 1 173 ? -32.101 -21.098 -17.582 0.05 11.20 ? 172  ASN A N     2  
ATOM   7948   C  CA    B ASN A 1 173 ? -32.021 -21.297 -19.023 0.05 11.19 ? 172  ASN A CA    2  
ATOM   7949   C  C     B ASN A 1 173 ? -31.521 -22.671 -19.460 0.05 11.24 ? 172  ASN A C     2  
ATOM   7950   O  O     B ASN A 1 173 ? -31.195 -22.874 -20.631 0.05 11.23 ? 172  ASN A O     2  
ATOM   7951   C  CB    B ASN A 1 173 ? -31.149 -20.218 -19.650 0.05 11.10 ? 172  ASN A CB    2  
ATOM   7952   C  CG    B ASN A 1 173 ? -31.890 -18.926 -19.823 0.05 11.08 ? 172  ASN A CG    2  
ATOM   7953   O  OD1   B ASN A 1 173 ? -32.646 -18.757 -20.787 0.05 11.14 ? 172  ASN A OD1   2  
ATOM   7954   N  ND2   B ASN A 1 173 ? -31.710 -18.010 -18.881 0.05 11.03 ? 172  ASN A ND2   2  
ATOM   7955   N  N     B GLY A 1 174 ? -31.454 -23.608 -18.522 0.05 11.29 ? 173  GLY A N     2  
ATOM   7956   C  CA    B GLY A 1 174 ? -31.088 -24.977 -18.847 0.05 11.36 ? 173  GLY A CA    2  
ATOM   7957   C  C     B GLY A 1 174 ? -29.598 -25.231 -18.947 0.05 11.30 ? 173  GLY A C     2  
ATOM   7958   O  O     B GLY A 1 174 ? -29.164 -26.274 -19.431 0.05 11.35 ? 173  GLY A O     2  
ATOM   7959   N  N     B ILE A 1 175 ? -28.807 -24.276 -18.473 0.05 11.20 ? 174  ILE A N     2  
ATOM   7960   C  CA    B ILE A 1 175 ? -27.353 -24.379 -18.578 0.05 11.14 ? 174  ILE A CA    2  
ATOM   7961   C  C     B ILE A 1 175 ? -26.740 -24.649 -17.203 0.05 11.15 ? 174  ILE A C     2  
ATOM   7962   O  O     B ILE A 1 175 ? -26.948 -23.876 -16.278 0.05 11.13 ? 174  ILE A O     2  
ATOM   7963   C  CB    B ILE A 1 175 ? -26.768 -23.093 -19.190 0.05 11.04 ? 174  ILE A CB    2  
ATOM   7964   C  CG1   B ILE A 1 175 ? -27.335 -22.872 -20.597 0.05 11.04 ? 174  ILE A CG1   2  
ATOM   7965   C  CG2   B ILE A 1 175 ? -25.226 -23.141 -19.209 0.05 10.98 ? 174  ILE A CG2   2  
ATOM   7966   C  CD1   B ILE A 1 175 ? -26.972 -21.511 -21.214 0.05 10.96 ? 174  ILE A CD1   2  
ATOM   7967   N  N     B THR A 1 176 ? -25.984 -25.742 -17.073 0.05 11.21 ? 175  THR A N     2  
ATOM   7968   C  CA    B THR A 1 176 ? -25.485 -26.171 -15.761 0.05 11.25 ? 175  THR A CA    2  
ATOM   7969   C  C     B THR A 1 176 ? -24.030 -25.818 -15.462 0.05 11.18 ? 175  THR A C     2  
ATOM   7970   O  O     B THR A 1 176 ? -23.641 -25.714 -14.298 0.05 11.21 ? 175  THR A O     2  
ATOM   7971   C  CB    B THR A 1 176 ? -25.642 -27.694 -15.549 0.05 11.38 ? 175  THR A CB    2  
ATOM   7972   O  OG1   B THR A 1 176 ? -24.997 -28.398 -16.618 0.05 11.39 ? 175  THR A OG1   2  
ATOM   7973   C  CG2   B THR A 1 176 ? -27.109 -28.068 -15.502 0.05 11.47 ? 175  THR A CG2   2  
ATOM   7974   N  N     B GLU A 1 177 ? -23.227 -25.644 -16.503 0.05 11.12 ? 176  GLU A N     2  
ATOM   7975   C  CA    B GLU A 1 177 ? -21.812 -25.347 -16.292 0.05 11.07 ? 176  GLU A CA    2  
ATOM   7976   C  C     B GLU A 1 177 ? -21.619 -23.991 -15.630 0.05 11.01 ? 176  GLU A C     2  
ATOM   7977   O  O     B GLU A 1 177 ? -22.508 -23.143 -15.652 0.05 10.98 ? 176  GLU A O     2  
ATOM   7978   C  CB    B GLU A 1 177 ? -21.014 -25.454 -17.590 0.05 11.02 ? 176  GLU A CB    2  
ATOM   7979   C  CG    B GLU A 1 177 ? -21.453 -24.541 -18.708 0.05 10.94 ? 176  GLU A CG    2  
ATOM   7980   C  CD    B GLU A 1 177 ? -21.364 -25.251 -20.036 0.05 10.93 ? 176  GLU A CD    2  
ATOM   7981   O  OE1   B GLU A 1 177 ? -22.137 -26.198 -20.223 0.05 10.97 ? 176  GLU A OE1   2  
ATOM   7982   O  OE2   B GLU A 1 177 ? -20.517 -24.898 -20.877 0.05 10.89 ? 176  GLU A OE2   2  
ATOM   7983   N  N     B HIS A 1 178 ? -20.459 -23.804 -15.020 0.05 11.02 ? 177  HIS A N     2  
ATOM   7984   C  CA    B HIS A 1 178 ? -20.227 -22.611 -14.231 0.05 10.98 ? 177  HIS A CA    2  
ATOM   7985   C  C     B HIS A 1 178 ? -20.207 -21.396 -15.135 0.05 10.89 ? 177  HIS A C     2  
ATOM   7986   O  O     B HIS A 1 178 ? -19.841 -21.500 -16.296 0.05 10.86 ? 177  HIS A O     2  
ATOM   7987   C  CB    B HIS A 1 178 ? -18.900 -22.697 -13.482 0.05 11.02 ? 177  HIS A CB    2  
ATOM   7988   C  CG    B HIS A 1 178 ? -18.801 -21.742 -12.331 0.05 11.00 ? 177  HIS A CG    2  
ATOM   7989   N  ND1   B HIS A 1 178 ? -18.230 -20.489 -12.442 0.05 10.93 ? 177  HIS A ND1   2  
ATOM   7990   C  CD2   B HIS A 1 178 ? -19.222 -21.852 -11.048 0.05 11.07 ? 177  HIS A CD2   2  
ATOM   7991   C  CE1   B HIS A 1 178 ? -18.300 -19.874 -11.274 0.05 10.96 ? 177  HIS A CE1   2  
ATOM   7992   N  NE2   B HIS A 1 178 ? -18.900 -20.679 -10.413 0.05 11.04 ? 177  HIS A NE2   2  
ATOM   7993   N  N     B PRO A 1 179 ? -20.622 -20.247 -14.602 0.05 10.86 ? 178  PRO A N     2  
ATOM   7994   C  CA    B PRO A 1 179 ? -20.517 -18.993 -15.346 0.05 10.79 ? 178  PRO A CA    2  
ATOM   7995   C  C     B PRO A 1 179 ? -19.136 -18.762 -15.972 0.05 10.76 ? 178  PRO A C     2  
ATOM   7996   O  O     B PRO A 1 179 ? -19.089 -18.213 -17.060 0.05 10.71 ? 178  PRO A O     2  
ATOM   7997   C  CB    B PRO A 1 179 ? -20.824 -17.944 -14.279 0.05 10.78 ? 178  PRO A CB    2  
ATOM   7998   C  CG    B PRO A 1 179 ? -21.854 -18.634 -13.415 0.05 10.85 ? 178  PRO A CG    2  
ATOM   7999   C  CD    B PRO A 1 179 ? -21.407 -20.083 -13.359 0.05 10.90 ? 178  PRO A CD    2  
ATOM   8000   N  N     B ASP A 1 180 ? -18.054 -19.155 -15.307 0.05 10.79 ? 179  ASP A N     2  
ATOM   8001   C  CA    B ASP A 1 180 ? -16.710 -18.967 -15.877 0.05 10.77 ? 179  ASP A CA    2  
ATOM   8002   C  C     B ASP A 1 180 ? -16.530 -19.733 -17.187 0.05 10.77 ? 179  ASP A C     2  
ATOM   8003   O  O     B ASP A 1 180 ? -15.896 -19.244 -18.127 0.05 10.75 ? 179  ASP A O     2  
ATOM   8004   C  CB    B ASP A 1 180 ? -15.618 -19.385 -14.893 0.05 10.83 ? 179  ASP A CB    2  
ATOM   8005   C  CG    B ASP A 1 180 ? -15.442 -18.397 -13.755 0.05 10.83 ? 179  ASP A CG    2  
ATOM   8006   O  OD1   B ASP A 1 180 ? -15.977 -17.273 -13.841 0.05 10.78 ? 179  ASP A OD1   2  
ATOM   8007   O  OD2   B ASP A 1 180 ? -14.746 -18.751 -12.781 0.05 10.89 ? 179  ASP A OD2   2  
ATOM   8008   N  N     B THR A 1 181 ? -17.076 -20.943 -17.237 0.05 10.82 ? 180  THR A N     2  
ATOM   8009   C  CA    B THR A 1 181 ? -16.987 -21.761 -18.442 0.05 10.83 ? 180  THR A CA    2  
ATOM   8010   C  C     B THR A 1 181 ? -17.822 -21.114 -19.545 0.05 10.78 ? 180  THR A C     2  
ATOM   8011   O  O     B THR A 1 181 ? -17.361 -20.929 -20.671 0.05 10.77 ? 180  THR A O     2  
ATOM   8012   C  CB    B THR A 1 181 ? -17.494 -23.209 -18.176 0.05 10.91 ? 180  THR A CB    2  
ATOM   8013   O  OG1   B THR A 1 181 ? -16.796 -23.771 -17.055 0.05 10.97 ? 180  THR A OG1   2  
ATOM   8014   C  CG2   B THR A 1 181 ? -17.297 -24.098 -19.403 0.05 10.94 ? 180  THR A CG2   2  
ATOM   8015   N  N     B PHE A 1 182 ? -19.055 -20.768 -19.192 0.05 10.77 ? 181  PHE A N     2  
ATOM   8016   C  CA    B PHE A 1 182 ? -20.013 -20.160 -20.106 0.05 10.75 ? 181  PHE A CA    2  
ATOM   8017   C  C     B PHE A 1 182 ? -19.449 -18.892 -20.729 0.05 10.69 ? 181  PHE A C     2  
ATOM   8018   O  O     B PHE A 1 182 ? -19.566 -18.671 -21.936 0.05 10.69 ? 181  PHE A O     2  
ATOM   8019   C  CB    B PHE A 1 182 ? -21.310 -19.851 -19.339 0.05 10.75 ? 181  PHE A CB    2  
ATOM   8020   C  CG    B PHE A 1 182 ? -22.279 -18.973 -20.080 0.05 10.73 ? 181  PHE A CG    2  
ATOM   8021   C  CD1   B PHE A 1 182 ? -23.202 -19.524 -20.952 0.05 10.77 ? 181  PHE A CD1   2  
ATOM   8022   C  CD2   B PHE A 1 182 ? -22.292 -17.605 -19.875 0.05 10.69 ? 181  PHE A CD2   2  
ATOM   8023   C  CE1   B PHE A 1 182 ? -24.108 -18.728 -21.617 0.05 10.76 ? 181  PHE A CE1   2  
ATOM   8024   C  CE2   B PHE A 1 182 ? -23.193 -16.794 -20.546 0.05 10.69 ? 181  PHE A CE2   2  
ATOM   8025   C  CZ    B PHE A 1 182 ? -24.103 -17.359 -21.416 0.05 10.72 ? 181  PHE A CZ    2  
ATOM   8026   N  N     B ALA A 1 183 ? -18.821 -18.069 -19.892 0.05 10.67 ? 182  ALA A N     2  
ATOM   8027   C  CA    B ALA A 1 183 ? -18.351 -16.758 -20.325 0.05 10.64 ? 182  ALA A CA    2  
ATOM   8028   C  C     B ALA A 1 183 ? -16.991 -16.789 -21.029 0.05 10.64 ? 182  ALA A C     2  
ATOM   8029   O  O     B ALA A 1 183 ? -16.823 -16.155 -22.067 0.05 10.63 ? 182  ALA A O     2  
ATOM   8030   C  CB    B ALA A 1 183 ? -18.313 -15.780 -19.132 0.05 10.63 ? 182  ALA A CB    2  
ATOM   8031   N  N     B SER A 1 184 ? -16.027 -17.514 -20.467 0.05 10.67 ? 183  SER A N     2  
ATOM   8032   C  CA    B SER A 1 184 ? -14.637 -17.379 -20.917 0.05 10.68 ? 183  SER A CA    2  
ATOM   8033   C  C     B SER A 1 184 ? -14.128 -18.527 -21.778 0.05 10.71 ? 183  SER A C     2  
ATOM   8034   O  O     B SER A 1 184 ? -13.006 -18.465 -22.288 0.05 10.73 ? 183  SER A O     2  
ATOM   8035   C  CB    B SER A 1 184 ? -13.694 -17.200 -19.721 0.05 10.71 ? 183  SER A CB    2  
ATOM   8036   O  OG    B SER A 1 184 ? -14.011 -16.026 -18.983 0.05 10.69 ? 183  SER A OG    2  
ATOM   8037   N  N     B HIS A 1 185 ? -14.941 -19.570 -21.940 0.05 10.73 ? 184  HIS A N     2  
ATOM   8038   C  CA    B HIS A 1 185 ? -14.487 -20.755 -22.660 0.05 10.78 ? 184  HIS A CA    2  
ATOM   8039   C  C     B HIS A 1 185 ? -15.473 -21.229 -23.718 0.05 10.79 ? 184  HIS A C     2  
ATOM   8040   O  O     B HIS A 1 185 ? -16.191 -22.213 -23.517 0.05 10.83 ? 184  HIS A O     2  
ATOM   8041   C  CB    B HIS A 1 185 ? -14.138 -21.871 -21.673 0.05 10.83 ? 184  HIS A CB    2  
ATOM   8042   C  CG    B HIS A 1 185 ? -13.087 -21.464 -20.693 0.05 10.84 ? 184  HIS A CG    2  
ATOM   8043   N  ND1   B HIS A 1 185 ? -13.390 -20.941 -19.456 0.05 10.83 ? 184  HIS A ND1   2  
ATOM   8044   C  CD2   B HIS A 1 185 ? -11.738 -21.429 -20.799 0.05 10.87 ? 184  HIS A CD2   2  
ATOM   8045   C  CE1   B HIS A 1 185 ? -12.270 -20.631 -18.827 0.05 10.86 ? 184  HIS A CE1   2  
ATOM   8046   N  NE2   B HIS A 1 185 ? -11.256 -20.917 -19.618 0.05 10.88 ? 184  HIS A NE2   2  
ATOM   8047   N  N     B PRO A 1 186 ? -15.494 -20.528 -24.856 0.05 10.78 ? 185  PRO A N     2  
ATOM   8048   C  CA    B PRO A 1 186 ? -16.388 -20.896 -25.956 0.05 10.80 ? 185  PRO A CA    2  
ATOM   8049   C  C     B PRO A 1 186 ? -15.980 -22.236 -26.550 0.05 10.87 ? 185  PRO A C     2  
ATOM   8050   O  O     B PRO A 1 186 ? -14.812 -22.593 -26.516 0.05 10.89 ? 185  PRO A O     2  
ATOM   8051   C  CB    B PRO A 1 186 ? -16.169 -19.776 -26.980 0.05 10.79 ? 185  PRO A CB    2  
ATOM   8052   C  CG    B PRO A 1 186 ? -14.805 -19.262 -26.694 0.05 10.78 ? 185  PRO A CG    2  
ATOM   8053   C  CD    B PRO A 1 186 ? -14.603 -19.405 -25.211 0.05 10.75 ? 185  PRO A CD    2  
ATOM   8054   N  N     B PRO A 1 187 ? -16.948 -22.985 -27.082 0.05 10.92 ? 186  PRO A N     2  
ATOM   8055   C  CA    B PRO A 1 187 ? -16.608 -24.257 -27.732 0.05 11.00 ? 186  PRO A CA    2  
ATOM   8056   C  C     B PRO A 1 187 ? -15.890 -24.054 -29.066 0.05 11.02 ? 186  PRO A C     2  
ATOM   8057   O  O     B PRO A 1 187 ? -15.125 -24.925 -29.490 0.05 11.09 ? 186  PRO A O     2  
ATOM   8058   C  CB    B PRO A 1 187 ? -17.973 -24.926 -27.933 0.05 11.05 ? 186  PRO A CB    2  
ATOM   8059   C  CG    B PRO A 1 187 ? -18.963 -23.825 -27.874 0.05 10.99 ? 186  PRO A CG    2  
ATOM   8060   C  CD    B PRO A 1 187 ? -18.398 -22.805 -26.916 0.05 10.91 ? 186  PRO A CD    2  
ATOM   8061   N  N     B ARG A 1 188 ? -16.120 -22.912 -29.707 0.05 10.99 ? 187  ARG A N     2  
ATOM   8062   C  CA    B ARG A 1 188 ? -15.468 -22.587 -30.974 0.05 11.02 ? 187  ARG A CA    2  
ATOM   8063   C  C     B ARG A 1 188 ? -15.295 -21.076 -31.114 0.05 10.97 ? 187  ARG A C     2  
ATOM   8064   O  O     B ARG A 1 188 ? -16.234 -20.309 -30.928 0.05 10.93 ? 187  ARG A O     2  
ATOM   8065   C  CB    B ARG A 1 188 ? -16.278 -23.123 -32.157 0.05 11.10 ? 187  ARG A CB    2  
ATOM   8066   C  CG    B ARG A 1 188 ? -15.652 -22.840 -33.532 0.05 11.15 ? 187  ARG A CG    2  
ATOM   8067   C  CD    B ARG A 1 188 ? -14.445 -23.739 -33.786 0.05 11.20 ? 187  ARG A CD    2  
ATOM   8068   N  NE    B ARG A 1 188 ? -13.866 -23.550 -35.119 0.05 11.27 ? 187  ARG A NE    2  
ATOM   8069   C  CZ    B ARG A 1 188 ? -12.634 -23.106 -35.348 0.05 11.28 ? 187  ARG A CZ    2  
ATOM   8070   N  NH1   B ARG A 1 188 ? -11.840 -22.788 -34.330 0.05 11.22 ? 187  ARG A NH1   2  
ATOM   8071   N  NH2   B ARG A 1 188 ? -12.194 -22.974 -36.599 0.05 11.35 ? 187  ARG A NH2   2  
ATOM   8072   N  N     B SER A 1 189 ? -14.087 -20.651 -31.456 0.05 10.97 ? 188  SER A N     2  
ATOM   8073   C  CA    B SER A 1 189 ? -13.783 -19.229 -31.500 0.05 10.94 ? 188  SER A CA    2  
ATOM   8074   C  C     B SER A 1 189 ? -12.808 -18.912 -32.619 0.05 10.99 ? 188  SER A C     2  
ATOM   8075   O  O     B SER A 1 189 ? -11.882 -19.681 -32.868 0.05 11.04 ? 188  SER A O     2  
ATOM   8076   C  CB    B SER A 1 189 ? -13.189 -18.782 -30.159 0.05 10.88 ? 188  SER A CB    2  
ATOM   8077   O  OG    B SER A 1 189 ? -12.561 -17.513 -30.253 0.05 10.87 ? 188  SER A OG    2  
ATOM   8078   N  N     B LEU A 1 190 ? -13.048 -17.792 -33.299 0.05 11.00 ? 189  LEU A N     2  
ATOM   8079   C  CA    B LEU A 1 190 ? -12.079 -17.208 -34.221 0.05 11.05 ? 189  LEU A CA    2  
ATOM   8080   C  C     B LEU A 1 190 ? -11.529 -15.950 -33.571 0.05 11.02 ? 189  LEU A C     2  
ATOM   8081   O  O     B LEU A 1 190 ? -12.286 -15.138 -33.042 0.05 10.97 ? 189  LEU A O     2  
ATOM   8082   C  CB    B LEU A 1 190 ? -12.727 -16.847 -35.556 0.05 11.12 ? 189  LEU A CB    2  
ATOM   8083   C  CG    B LEU A 1 190 ? -13.318 -18.019 -36.341 0.05 11.18 ? 189  LEU A CG    2  
ATOM   8084   C  CD1   B LEU A 1 190 ? -13.913 -17.511 -37.650 0.05 11.27 ? 189  LEU A CD1   2  
ATOM   8085   C  CD2   B LEU A 1 190 ? -12.250 -19.072 -36.597 0.05 11.23 ? 189  LEU A CD2   2  
ATOM   8086   N  N     B VAL A 1 191 ? -10.212 -15.792 -33.610 0.05 11.05 ? 190  VAL A N     2  
ATOM   8087   C  CA    B VAL A 1 191 ? -9.570  -14.700 -32.887 0.05 11.02 ? 190  VAL A CA    2  
ATOM   8088   C  C     B VAL A 1 191 ? -9.026  -13.672 -33.871 0.05 11.09 ? 190  VAL A C     2  
ATOM   8089   O  O     B VAL A 1 191 ? -8.193  -13.997 -34.720 0.05 11.16 ? 190  VAL A O     2  
ATOM   8090   C  CB    B VAL A 1 191 ? -8.423  -15.218 -31.990 0.05 11.02 ? 190  VAL A CB    2  
ATOM   8091   C  CG1   B VAL A 1 191 ? -7.970  -14.128 -31.012 0.05 11.00 ? 190  VAL A CG1   2  
ATOM   8092   C  CG2   B VAL A 1 191 ? -8.847  -16.481 -31.230 0.05 10.98 ? 190  VAL A CG2   2  
ATOM   8093   N  N     B LEU A 1 192 ? -9.500  -12.435 -33.745 0.05 11.08 ? 191  LEU A N     2  
ATOM   8094   C  CA    B LEU A 1 192 ? -9.186  -11.381 -34.711 0.05 11.16 ? 191  LEU A CA    2  
ATOM   8095   C  C     B LEU A 1 192 ? -7.954  -10.560 -34.326 0.05 11.20 ? 191  LEU A C     2  
ATOM   8096   O  O     B LEU A 1 192 ? -7.910  -9.346  -34.546 0.05 11.25 ? 191  LEU A O     2  
ATOM   8097   C  CB    B LEU A 1 192 ? -10.378 -10.432 -34.911 0.05 11.15 ? 191  LEU A CB    2  
ATOM   8098   C  CG    B LEU A 1 192 ? -11.763 -10.979 -35.287 0.05 11.13 ? 191  LEU A CG    2  
ATOM   8099   C  CD1   B LEU A 1 192 ? -11.671 -12.210 -36.148 0.05 11.22 ? 191  LEU A CD1   2  
ATOM   8100   C  CD2   B LEU A 1 192 ? -12.602 -11.242 -34.062 0.05 11.05 ? 191  LEU A CD2   2  
ATOM   8101   N  N     B ILE A 1 193 ? -6.970  -11.213 -33.730 0.05 11.19 ? 192  ILE A N     2  
ATOM   8102   C  CA    B ILE A 1 193 ? -5.665  -10.589 -33.539 0.05 11.25 ? 192  ILE A CA    2  
ATOM   8103   C  C     B ILE A 1 193 ? -4.618  -11.565 -34.044 0.05 11.31 ? 192  ILE A C     2  
ATOM   8104   O  O     B ILE A 1 193 ? -4.886  -12.751 -34.149 0.05 11.28 ? 192  ILE A O     2  
ATOM   8105   C  CB    B ILE A 1 193 ? -5.387  -10.239 -32.059 0.05 11.20 ? 192  ILE A CB    2  
ATOM   8106   C  CG1   B ILE A 1 193 ? -5.304  -11.503 -31.207 0.05 11.15 ? 192  ILE A CG1   2  
ATOM   8107   C  CG2   B ILE A 1 193 ? -6.461  -9.297  -31.517 0.05 11.15 ? 192  ILE A CG2   2  
ATOM   8108   C  CD1   B ILE A 1 193 ? -4.678  -11.280 -29.850 0.05 11.14 ? 192  ILE A CD1   2  
ATOM   8109   N  N     B PRO A 1 194 ? -3.421  -11.073 -34.380 0.05 11.40 ? 193  PRO A N     2  
ATOM   8110   C  CA    B PRO A 1 194 ? -2.407  -12.067 -34.745 0.05 11.45 ? 193  PRO A CA    2  
ATOM   8111   C  C     B PRO A 1 194 ? -1.952  -12.878 -33.530 0.05 11.41 ? 193  PRO A C     2  
ATOM   8112   O  O     B PRO A 1 194 ? -1.912  -12.365 -32.406 0.05 11.37 ? 193  PRO A O     2  
ATOM   8113   C  CB    B PRO A 1 194 ? -1.257  -11.222 -35.305 0.05 11.57 ? 193  PRO A CB    2  
ATOM   8114   C  CG    B PRO A 1 194 ? -1.467  -9.852  -34.748 0.05 11.56 ? 193  PRO A CG    2  
ATOM   8115   C  CD    B PRO A 1 194 ? -2.943  -9.686  -34.522 0.05 11.47 ? 193  PRO A CD    2  
ATOM   8116   N  N     B LYS A 1 195 ? -1.612  -14.143 -33.762 0.05 11.43 ? 194  LYS A N     2  
ATOM   8117   C  CA    B LYS A 1 195 ? -1.201  -15.028 -32.686 0.05 11.40 ? 194  LYS A CA    2  
ATOM   8118   C  C     B LYS A 1 195 ? 0.067   -14.522 -31.998 0.05 11.46 ? 194  LYS A C     2  
ATOM   8119   O  O     B LYS A 1 195 ? 0.327   -14.845 -30.840 0.05 11.44 ? 194  LYS A O     2  
ATOM   8120   C  CB    B LYS A 1 195 ? -0.977  -16.436 -33.225 0.05 11.43 ? 194  LYS A CB    2  
ATOM   8121   C  CG    B LYS A 1 195 ? -1.277  -17.538 -32.236 0.05 11.39 ? 194  LYS A CG    2  
ATOM   8122   C  CD    B LYS A 1 195 ? -1.074  -18.878 -32.923 0.05 11.41 ? 194  LYS A CD    2  
ATOM   8123   C  CE    B LYS A 1 195 ? -1.843  -19.987 -32.242 0.05 11.36 ? 194  LYS A CE    2  
ATOM   8124   N  NZ    B LYS A 1 195 ? -1.898  -21.169 -33.143 0.05 11.38 ? 194  LYS A NZ    2  
ATOM   8125   N  N     B ALA A 1 196 ? 0.836   -13.711 -32.718 0.05 11.55 ? 195  ALA A N     2  
ATOM   8126   C  CA    B ALA A 1 196 ? 2.047   -13.104 -32.181 0.05 11.63 ? 195  ALA A CA    2  
ATOM   8127   C  C     B ALA A 1 196 ? 1.741   -12.190 -30.995 0.05 11.58 ? 195  ALA A C     2  
ATOM   8128   O  O     B ALA A 1 196 ? 2.618   -11.910 -30.177 0.05 11.63 ? 195  ALA A O     2  
ATOM   8129   C  CB    B ALA A 1 196 ? 2.770   -12.326 -33.275 0.05 11.74 ? 195  ALA A CB    2  
ATOM   8130   N  N     B LEU A 1 197 ? 0.497   -11.723 -30.913 0.05 11.49 ? 196  LEU A N     2  
ATOM   8131   C  CA    B LEU A 1 197 ? 0.080   -10.843 -29.825 0.05 11.45 ? 196  LEU A CA    2  
ATOM   8132   C  C     B LEU A 1 197 ? -0.812  -11.561 -28.807 0.05 11.34 ? 196  LEU A C     2  
ATOM   8133   O  O     B LEU A 1 197 ? -1.547  -10.924 -28.055 0.05 11.29 ? 196  LEU A O     2  
ATOM   8134   C  CB    B LEU A 1 197 ? -0.643  -9.616  -30.374 0.05 11.44 ? 196  LEU A CB    2  
ATOM   8135   C  CG    B LEU A 1 197 ? 0.240   -8.690  -31.207 0.05 11.56 ? 196  LEU A CG    2  
ATOM   8136   C  CD1   B LEU A 1 197 ? -0.574  -7.532  -31.779 0.05 11.57 ? 196  LEU A CD1   2  
ATOM   8137   C  CD2   B LEU A 1 197 ? 1.399   -8.179  -30.351 0.05 11.64 ? 196  LEU A CD2   2  
ATOM   8138   N  N     B GLN A 1 198 ? -0.750  -12.885 -28.805 0.05 11.33 ? 197  GLN A N     2  
ATOM   8139   C  CA    B GLN A 1 198 ? -1.473  -13.685 -27.825 0.05 11.25 ? 197  GLN A CA    2  
ATOM   8140   C  C     B GLN A 1 198 ? -0.502  -14.232 -26.781 0.05 11.30 ? 197  GLN A C     2  
ATOM   8141   O  O     B GLN A 1 198 ? 0.440   -14.932 -27.126 0.05 11.37 ? 197  GLN A O     2  
ATOM   8142   C  CB    B GLN A 1 198 ? -2.184  -14.846 -28.527 0.05 11.21 ? 197  GLN A CB    2  
ATOM   8143   C  CG    B GLN A 1 198 ? -2.602  -15.977 -27.602 0.05 11.17 ? 197  GLN A CG    2  
ATOM   8144   C  CD    B GLN A 1 198 ? -3.842  -15.659 -26.781 0.05 11.08 ? 197  GLN A CD    2  
ATOM   8145   O  OE1   B GLN A 1 198 ? -3.876  -15.892 -25.564 0.05 11.06 ? 197  GLN A OE1   2  
ATOM   8146   N  NE2   B GLN A 1 198 ? -4.870  -15.154 -27.437 0.05 11.03 ? 197  GLN A NE2   2  
ATOM   8147   N  N     B PRO A 1 199 ? -0.726  -13.913 -25.495 0.05 11.27 ? 198  PRO A N     2  
ATOM   8148   C  CA    B PRO A 1 199 ? 0.141   -14.483 -24.458 0.05 11.33 ? 198  PRO A CA    2  
ATOM   8149   C  C     B PRO A 1 199 ? 0.016   -16.003 -24.431 0.05 11.32 ? 198  PRO A C     2  
ATOM   8150   O  O     B PRO A 1 199 ? -1.077  -16.509 -24.687 0.05 11.25 ? 198  PRO A O     2  
ATOM   8151   C  CB    B PRO A 1 199 ? -0.433  -13.899 -23.158 0.05 11.29 ? 198  PRO A CB    2  
ATOM   8152   C  CG    B PRO A 1 199 ? -1.166  -12.670 -23.570 0.05 11.25 ? 198  PRO A CG    2  
ATOM   8153   C  CD    B PRO A 1 199 ? -1.714  -12.969 -24.945 0.05 11.21 ? 198  PRO A CD    2  
ATOM   8154   N  N     B HIS A 1 200 ? 1.106   -16.708 -24.137 0.05 11.42 ? 199  HIS A N     2  
ATOM   8155   C  CA    B HIS A 1 200 ? 1.063   -18.169 -24.026 0.05 11.44 ? 199  HIS A CA    2  
ATOM   8156   C  C     B HIS A 1 200 ? 0.429   -18.818 -25.242 0.05 11.40 ? 199  HIS A C     2  
ATOM   8157   O  O     B HIS A 1 200 ? -0.330  -19.772 -25.117 0.05 11.37 ? 199  HIS A O     2  
ATOM   8158   C  CB    B HIS A 1 200 ? 0.303   -18.567 -22.762 0.05 11.39 ? 199  HIS A CB    2  
ATOM   8159   C  CG    B HIS A 1 200 ? 0.837   -17.914 -21.533 0.05 11.44 ? 199  HIS A CG    2  
ATOM   8160   N  ND1   B HIS A 1 200 ? 2.004   -18.323 -20.930 0.05 11.56 ? 199  HIS A ND1   2  
ATOM   8161   C  CD2   B HIS A 1 200 ? 0.389   -16.857 -20.817 0.05 11.40 ? 199  HIS A CD2   2  
ATOM   8162   C  CE1   B HIS A 1 200 ? 2.251   -17.548 -19.891 0.05 11.59 ? 199  HIS A CE1   2  
ATOM   8163   N  NE2   B HIS A 1 200 ? 1.286   -16.651 -19.801 0.05 11.49 ? 199  HIS A NE2   2  
ATOM   8164   N  N     B ALA A 1 201 ? 0.752   -18.303 -26.422 0.05 11.42 ? 200  ALA A N     2  
ATOM   8165   C  CA    B ALA A 1 201 ? 0.112   -18.780 -27.646 0.05 11.39 ? 200  ALA A CA    2  
ATOM   8166   C  C     B ALA A 1 201 ? 0.285   -20.283 -27.848 0.05 11.45 ? 200  ALA A C     2  
ATOM   8167   O  O     B ALA A 1 201 ? -0.610  -20.941 -28.373 0.05 11.41 ? 200  ALA A O     2  
ATOM   8168   C  CB    B ALA A 1 201 ? 0.641   -18.033 -28.851 0.05 11.44 ? 200  ALA A CB    2  
ATOM   8169   N  N     B ASP A 1 202 ? 1.427   -20.821 -27.427 0.05 11.54 ? 201  ASP A N     2  
ATOM   8170   C  CA    B ASP A 1 202 ? 1.710   -22.231 -27.668 0.05 11.62 ? 201  ASP A CA    2  
ATOM   8171   C  C     B ASP A 1 202 ? 0.759   -23.167 -26.930 0.05 11.58 ? 201  ASP A C     2  
ATOM   8172   O  O     B ASP A 1 202 ? 0.585   -24.313 -27.336 0.05 11.62 ? 201  ASP A O     2  
ATOM   8173   C  CB    B ASP A 1 202 ? 3.177   -22.582 -27.383 0.05 11.74 ? 201  ASP A CB    2  
ATOM   8174   C  CG    B ASP A 1 202 ? 4.106   -22.188 -28.533 0.05 11.82 ? 201  ASP A CG    2  
ATOM   8175   O  OD1   B ASP A 1 202 ? 3.600   -21.646 -29.540 0.05 11.78 ? 201  ASP A OD1   2  
ATOM   8176   O  OD2   B ASP A 1 202 ? 5.338   -22.422 -28.439 0.05 11.92 ? 201  ASP A OD2   2  
ATOM   8177   N  N     B ARG A 1 203 ? 0.126   -22.695 -25.860 0.05 11.50 ? 202  ARG A N     2  
ATOM   8178   C  CA    B ARG A 1 203 ? -0.860  -23.551 -25.200 0.05 11.47 ? 202  ARG A CA    2  
ATOM   8179   C  C     B ARG A 1 203 ? -2.310  -23.118 -25.343 0.05 11.36 ? 202  ARG A C     2  
ATOM   8180   O  O     B ARG A 1 203 ? -3.168  -23.523 -24.558 0.05 11.33 ? 202  ARG A O     2  
ATOM   8181   C  CB    B ARG A 1 203 ? -0.524  -23.801 -23.741 0.05 11.52 ? 202  ARG A CB    2  
ATOM   8182   C  CG    B ARG A 1 203 ? 0.170   -22.688 -23.097 0.05 11.56 ? 202  ARG A CG    2  
ATOM   8183   C  CD    B ARG A 1 203 ? 1.121   -23.196 -22.033 0.05 11.49 ? 202  ARG A CD    2  
ATOM   8184   N  NE    B ARG A 1 203 ? 1.384   -22.060 -21.187 0.05 11.55 ? 202  ARG A NE    2  
ATOM   8185   C  CZ    B ARG A 1 203 ? 0.924   -21.927 -19.953 0.05 11.59 ? 202  ARG A CZ    2  
ATOM   8186   N  NH1   B ARG A 1 203 ? 0.231   -22.906 -19.396 0.05 11.60 ? 202  ARG A NH1   2  
ATOM   8187   N  NH2   B ARG A 1 203 ? 1.187   -20.823 -19.272 0.05 11.65 ? 202  ARG A NH2   2  
ATOM   8188   N  N     B VAL A 1 204 ? -2.587  -22.311 -26.350 0.05 11.31 ? 203  VAL A N     2  
ATOM   8189   C  CA    B VAL A 1 204 ? -3.976  -22.080 -26.709 0.05 11.22 ? 203  VAL A CA    2  
ATOM   8190   C  C     B VAL A 1 204 ? -4.427  -23.265 -27.537 0.05 11.26 ? 203  VAL A C     2  
ATOM   8191   O  O     B VAL A 1 204 ? -3.691  -23.758 -28.386 0.05 11.34 ? 203  VAL A O     2  
ATOM   8192   C  CB    B VAL A 1 204 ? -4.169  -20.785 -27.487 0.05 11.18 ? 203  VAL A CB    2  
ATOM   8193   C  CG1   B VAL A 1 204 ? -5.600  -20.679 -28.001 0.05 11.11 ? 203  VAL A CG1   2  
ATOM   8194   C  CG2   B VAL A 1 204 ? -3.851  -19.603 -26.583 0.05 11.15 ? 203  VAL A CG2   2  
ATOM   8195   N  N     B ASP A 1 205 ? -5.644  -23.712 -27.274 0.05 11.22 ? 204  ASP A N     2  
ATOM   8196   C  CA    B ASP A 1 205 ? -6.178  -24.928 -27.856 0.05 11.27 ? 204  ASP A CA    2  
ATOM   8197   C  C     B ASP A 1 205 ? -6.726  -24.690 -29.276 0.05 11.27 ? 204  ASP A C     2  
ATOM   8198   O  O     B ASP A 1 205 ? -7.791  -24.096 -29.444 0.05 11.20 ? 204  ASP A O     2  
ATOM   8199   C  CB    B ASP A 1 205 ? -7.259  -25.454 -26.904 0.05 11.24 ? 204  ASP A CB    2  
ATOM   8200   C  CG    B ASP A 1 205 ? -7.690  -26.852 -27.240 0.05 11.34 ? 204  ASP A CG    2  
ATOM   8201   O  OD1   B ASP A 1 205 ? -7.994  -27.074 -28.420 0.05 11.42 ? 204  ASP A OD1   2  
ATOM   8202   O  OD2   B ASP A 1 205 ? -7.694  -27.708 -26.333 0.05 11.35 ? 204  ASP A OD2   2  
ATOM   8203   N  N     B GLU A 1 206 ? -6.002  -25.171 -30.290 0.05 11.35 ? 205  GLU A N     2  
ATOM   8204   C  CA    B GLU A 1 206 ? -6.423  -25.001 -31.690 0.05 11.38 ? 205  GLU A CA    2  
ATOM   8205   C  C     B GLU A 1 206 ? -7.697  -25.788 -32.015 0.05 11.37 ? 205  GLU A C     2  
ATOM   8206   O  O     B GLU A 1 206 ? -8.401  -25.471 -32.978 0.05 11.38 ? 205  GLU A O     2  
ATOM   8207   C  CB    B GLU A 1 206 ? -5.293  -25.366 -32.675 0.05 11.49 ? 205  GLU A CB    2  
ATOM   8208   C  CG    B GLU A 1 206 ? -4.908  -26.844 -32.710 0.05 11.58 ? 205  GLU A CG    2  
ATOM   8209   C  CD    B GLU A 1 206 ? -3.657  -27.116 -33.552 0.05 11.66 ? 205  GLU A CD    2  
ATOM   8210   O  OE1   B GLU A 1 206 ? -2.678  -26.341 -33.484 0.05 11.67 ? 205  GLU A OE1   2  
ATOM   8211   O  OE2   B GLU A 1 206 ? -3.661  -28.115 -34.296 0.05 11.74 ? 205  GLU A OE2   2  
ATOM   8212   N  N     B ASP A 1 207 ? -7.998  -26.806 -31.212 0.05 11.38 ? 206  ASP A N     2  
ATOM   8213   C  CA    B ASP A 1 207 ? -9.275  -27.509 -31.367 0.05 11.39 ? 206  ASP A CA    2  
ATOM   8214   C  C     B ASP A 1 207 ? -10.447 -26.531 -31.201 0.05 11.29 ? 206  ASP A C     2  
ATOM   8215   O  O     B ASP A 1 207 ? -11.472 -26.681 -31.853 0.05 11.30 ? 206  ASP A O     2  
ATOM   8216   C  CB    B ASP A 1 207 ? -9.408  -28.714 -30.412 0.05 11.43 ? 206  ASP A CB    2  
ATOM   8217   C  CG    B ASP A 1 207 ? -8.657  -29.948 -30.908 0.05 11.49 ? 206  ASP A CG    2  
ATOM   8218   O  OD1   B ASP A 1 207 ? -8.292  -30.815 -30.082 0.05 11.50 ? 206  ASP A OD1   2  
ATOM   8219   O  OD2   B ASP A 1 207 ? -8.425  -30.032 -32.128 0.05 11.53 ? 206  ASP A OD2   2  
ATOM   8220   N  N     B VAL A 1 208 ? -10.270 -25.514 -30.357 0.05 11.21 ? 207  VAL A N     2  
ATOM   8221   C  CA    B VAL A 1 208 ? -11.305 -24.505 -30.120 0.05 11.12 ? 207  VAL A CA    2  
ATOM   8222   C  C     B VAL A 1 208 ? -11.053 -23.191 -30.865 0.05 11.09 ? 207  VAL A C     2  
ATOM   8223   O  O     B VAL A 1 208 ? -11.951 -22.649 -31.508 0.05 11.08 ? 207  VAL A O     2  
ATOM   8224   C  CB    B VAL A 1 208 ? -11.443 -24.186 -28.613 0.05 11.06 ? 207  VAL A CB    2  
ATOM   8225   C  CG1   B VAL A 1 208 ? -12.315 -22.940 -28.389 0.05 10.98 ? 207  VAL A CG1   2  
ATOM   8226   C  CG2   B VAL A 1 208 ? -12.041 -25.373 -27.874 0.05 11.09 ? 207  VAL A CG2   2  
ATOM   8227   N  N     B TYR A 1 209 ? -9.827  -22.684 -30.768 0.05 11.10 ? 208  TYR A N     2  
ATOM   8228   C  CA    B TYR A 1 209 ? -9.504  -21.357 -31.285 0.05 11.07 ? 208  TYR A CA    2  
ATOM   8229   C  C     B TYR A 1 209 ? -8.697  -21.398 -32.568 0.05 11.15 ? 208  TYR A C     2  
ATOM   8230   O  O     B TYR A 1 209 ? -7.695  -22.099 -32.647 0.05 11.21 ? 208  TYR A O     2  
ATOM   8231   C  CB    B TYR A 1 209 ? -8.676  -20.583 -30.261 0.05 11.04 ? 208  TYR A CB    2  
ATOM   8232   C  CG    B TYR A 1 209 ? -9.355  -20.405 -28.929 0.05 10.97 ? 208  TYR A CG    2  
ATOM   8233   C  CD1   B TYR A 1 209 ? -10.252 -19.372 -28.728 0.05 10.91 ? 208  TYR A CD1   2  
ATOM   8234   C  CD2   B TYR A 1 209 ? -9.090  -21.265 -27.872 0.05 10.98 ? 208  TYR A CD2   2  
ATOM   8235   C  CE1   B TYR A 1 209 ? -10.879 -19.197 -27.509 0.05 10.86 ? 208  TYR A CE1   2  
ATOM   8236   C  CE2   B TYR A 1 209 ? -9.710  -21.099 -26.646 0.05 10.94 ? 208  TYR A CE2   2  
ATOM   8237   C  CZ    B TYR A 1 209 ? -10.600 -20.057 -26.470 0.05 10.87 ? 208  TYR A CZ    2  
ATOM   8238   O  OH    B TYR A 1 209 ? -11.219 -19.886 -25.254 0.05 10.83 ? 208  TYR A OH    2  
ATOM   8239   N  N     B THR A 1 210 ? -9.112  -20.608 -33.549 0.05 11.16 ? 209  THR A N     2  
ATOM   8240   C  CA    B THR A 1 210 ? -8.290  -20.380 -34.728 0.05 11.24 ? 209  THR A CA    2  
ATOM   8241   C  C     B THR A 1 210 ? -8.007  -18.890 -34.856 0.05 11.22 ? 209  THR A C     2  
ATOM   8242   O  O     B THR A 1 210 ? -8.928  -18.082 -34.842 0.05 11.17 ? 209  THR A O     2  
ATOM   8243   C  CB    B THR A 1 210 ? -8.987  -20.834 -36.014 0.05 11.31 ? 209  THR A CB    2  
ATOM   8244   O  OG1   B THR A 1 210 ? -9.437  -22.187 -35.868 0.05 11.33 ? 209  THR A OG1   2  
ATOM   8245   C  CG2   B THR A 1 210 ? -8.005  -20.746 -37.185 0.05 11.40 ? 209  THR A CG2   2  
ATOM   8246   N  N     B PHE A 1 211 ? -6.733  -18.539 -34.976 0.05 11.26 ? 210  PHE A N     2  
ATOM   8247   C  CA    B PHE A 1 211 ? -6.340  -17.150 -35.166 0.05 11.26 ? 210  PHE A CA    2  
ATOM   8248   C  C     B PHE A 1 211 ? -6.377  -16.773 -36.634 0.05 11.34 ? 210  PHE A C     2  
ATOM   8249   O  O     B PHE A 1 211 ? -5.734  -17.423 -37.460 0.05 11.43 ? 210  PHE A O     2  
ATOM   8250   C  CB    B PHE A 1 211 ? -4.934  -16.913 -34.605 0.05 11.29 ? 210  PHE A CB    2  
ATOM   8251   C  CG    B PHE A 1 211 ? -4.885  -16.915 -33.114 0.05 11.22 ? 210  PHE A CG    2  
ATOM   8252   C  CD1   B PHE A 1 211 ? -4.942  -18.102 -32.411 0.05 11.20 ? 210  PHE A CD1   2  
ATOM   8253   C  CD2   B PHE A 1 211 ? -4.810  -15.724 -32.409 0.05 11.19 ? 210  PHE A CD2   2  
ATOM   8254   C  CE1   B PHE A 1 211 ? -4.912  -18.106 -31.015 0.05 11.15 ? 210  PHE A CE1   2  
ATOM   8255   C  CE2   B PHE A 1 211 ? -4.778  -15.721 -31.027 0.05 11.14 ? 210  PHE A CE2   2  
ATOM   8256   C  CZ    B PHE A 1 211 ? -4.832  -16.911 -30.328 0.05 11.12 ? 210  PHE A CZ    2  
ATOM   8257   N  N     B VAL A 1 212 ? -7.131  -15.723 -36.949 0.05 11.33 ? 211  VAL A N     2  
ATOM   8258   C  CA    B VAL A 1 212 ? -7.212  -15.221 -38.312 0.05 11.42 ? 211  VAL A CA    2  
ATOM   8259   C  C     B VAL A 1 212 ? -6.636  -13.814 -38.457 0.05 11.46 ? 211  VAL A C     2  
ATOM   8260   O  O     B VAL A 1 212 ? -6.700  -13.233 -39.528 0.05 11.56 ? 211  VAL A O     2  
ATOM   8261   C  CB    B VAL A 1 212 ? -8.665  -15.227 -38.837 0.05 11.40 ? 211  VAL A CB    2  
ATOM   8262   C  CG1   B VAL A 1 212 ? -9.173  -16.654 -38.947 0.05 11.40 ? 211  VAL A CG1   2  
ATOM   8263   C  CG2   B VAL A 1 212 ? -9.566  -14.400 -37.937 0.05 11.31 ? 211  VAL A CG2   2  
ATOM   8264   N  N     B GLY A 1 213 ? -6.069  -13.273 -37.384 0.05 11.40 ? 212  GLY A N     2  
ATOM   8265   C  CA    B GLY A 1 213 ? -5.521  -11.928 -37.428 0.05 11.44 ? 212  GLY A CA    2  
ATOM   8266   C  C     B GLY A 1 213 ? -6.618  -10.914 -37.691 0.05 11.44 ? 212  GLY A C     2  
ATOM   8267   O  O     B GLY A 1 213 ? -7.803  -11.240 -37.603 0.05 11.39 ? 212  GLY A O     2  
ATOM   8268   N  N     B ALA A 1 214 ? -6.236  -9.685  -38.019 0.05 11.50 ? 213  ALA A N     2  
ATOM   8269   C  CA    B ALA A 1 214 ? -7.222  -8.637  -38.282 0.05 11.52 ? 213  ALA A CA    2  
ATOM   8270   C  C     B ALA A 1 214 ? -7.927  -8.867  -39.606 0.05 11.60 ? 213  ALA A C     2  
ATOM   8271   O  O     B ALA A 1 214 ? -7.396  -9.513  -40.503 0.05 11.69 ? 213  ALA A O     2  
ATOM   8272   C  CB    B ALA A 1 214 ? -6.578  -7.253  -38.263 0.05 11.59 ? 213  ALA A CB    2  
ATOM   8273   N  N     B CYS A 1 215 ? -9.137  -8.335  -39.713 0.05 11.58 ? 214  CYS A N     2  
ATOM   8274   C  CA    B CYS A 1 215 ? -9.928  -8.490  -40.918 0.05 11.66 ? 214  CYS A CA    2  
ATOM   8275   C  C     B CYS A 1 215 ? -10.252 -7.107  -41.466 0.05 11.76 ? 214  CYS A C     2  
ATOM   8276   O  O     B CYS A 1 215 ? -9.831  -6.760  -42.571 0.05 11.89 ? 214  CYS A O     2  
ATOM   8277   C  CB    B CYS A 1 215 ? -11.190 -9.294  -40.613 0.05 11.59 ? 214  CYS A CB    2  
ATOM   8278   S  SG    B CYS A 1 215 ? -10.824 -10.851 -39.750 0.05 11.50 ? 214  CYS A SG    2  
ATOM   8279   N  N     B GLN A 1 216 ? -10.963 -6.320  -40.664 0.05 13.40 ? 215  GLN A N     2  
ATOM   8280   C  CA    B GLN A 1 216 ? -11.241 -4.906  -40.936 0.05 13.52 ? 215  GLN A CA    2  
ATOM   8281   C  C     B GLN A 1 216 ? -10.380 -4.106  -41.915 0.05 13.38 ? 215  GLN A C     2  
ATOM   8282   O  O     B GLN A 1 216 ? -10.711 -4.014  -43.108 0.05 13.56 ? 215  GLN A O     2  
ATOM   8283   N  N     B GLY A 1 217 ? -9.292  -3.526  -41.400 0.05 13.08 ? 216  GLY A N     2  
ATOM   8284   C  CA    B GLY A 1 217 ? -8.511  -2.519  -42.111 0.05 12.97 ? 216  GLY A CA    2  
ATOM   8285   C  C     B GLY A 1 217 ? -7.521  -2.994  -43.164 0.05 12.75 ? 216  GLY A C     2  
ATOM   8286   O  O     B GLY A 1 217 ? -7.384  -2.383  -44.220 0.05 12.66 ? 216  GLY A O     2  
ATOM   8287   N  N     B ASP A 1 218 ? -6.801  -4.064  -42.859 0.05 12.71 ? 217  ASP A N     2  
ATOM   8288   C  CA    B ASP A 1 218 ? -6.027  -4.796  -43.847 0.05 12.54 ? 217  ASP A CA    2  
ATOM   8289   C  C     B ASP A 1 218 ? -7.007  -5.385  -44.867 0.05 12.74 ? 217  ASP A C     2  
ATOM   8290   O  O     B ASP A 1 218 ? -8.172  -5.619  -44.518 0.05 12.96 ? 217  ASP A O     2  
ATOM   8291   C  CB    B ASP A 1 218 ? -5.365  -5.956  -43.139 0.05 12.32 ? 217  ASP A CB    2  
ATOM   8292   C  CG    B ASP A 1 218 ? -6.367  -6.813  -42.418 0.05 12.43 ? 217  ASP A CG    2  
ATOM   8293   O  OD1   B ASP A 1 218 ? -6.406  -8.027  -42.686 0.05 12.61 ? 217  ASP A OD1   2  
ATOM   8294   O  OD2   B ASP A 1 218 ? -7.115  -6.252  -41.592 0.05 12.36 ? 217  ASP A OD2   2  
ATOM   8295   N  N     B ARG A 1 219 ? -6.585  -5.612  -46.117 0.05 12.71 ? 218  ARG A N     2  
ATOM   8296   C  CA    B ARG A 1 219 ? -5.309  -5.137  -46.675 0.05 12.53 ? 218  ARG A CA    2  
ATOM   8297   C  C     B ARG A 1 219 ? -5.357  -4.939  -48.206 0.05 12.74 ? 218  ARG A C     2  
ATOM   8298   O  O     B ARG A 1 219 ? -4.858  -5.803  -48.941 0.05 12.76 ? 218  ARG A O     2  
ATOM   8299   C  CB    B ARG A 1 219 ? -4.126  -6.058  -46.317 0.05 12.31 ? 218  ARG A CB    2  
ATOM   8300   C  CG    B ARG A 1 219 ? -4.330  -7.560  -46.529 0.05 12.42 ? 218  ARG A CG    2  
ATOM   8301   C  CD    B ARG A 1 219 ? -2.995  -8.284  -46.759 0.05 12.24 ? 218  ARG A CD    2  
ATOM   8302   N  NE    B ARG A 1 219 ? -2.375  -7.916  -48.033 0.05 12.38 ? 218  ARG A NE    2  
ATOM   8303   C  CZ    B ARG A 1 219 ? -1.468  -8.657  -48.669 0.05 12.30 ? 218  ARG A CZ    2  
ATOM   8304   N  NH1   B ARG A 1 219 ? -1.081  -9.818  -48.155 0.05 12.07 ? 218  ARG A NH1   2  
ATOM   8305   N  NH2   B ARG A 1 219 ? -0.966  -8.251  -49.826 0.05 12.49 ? 218  ARG A NH2   2  
ATOM   8306   N  N     B ALA A 1 220 ? -5.897  -3.814  -48.704 0.05 12.91 ? 219  ALA A N     2  
ATOM   8307   C  CA    B ALA A 1 220 ? -6.290  -2.646  -47.902 0.05 12.90 ? 219  ALA A CA    2  
ATOM   8308   C  C     B ALA A 1 220 ? -7.185  -1.627  -48.627 0.05 13.23 ? 219  ALA A C     2  
ATOM   8309   O  O     B ALA A 1 220 ? -7.930  -1.968  -49.559 0.05 13.51 ? 219  ALA A O     2  
ATOM   8310   C  CB    B ALA A 1 220 ? -5.044  -1.923  -47.378 0.05 12.64 ? 219  ALA A CB    2  
ATOM   8311   N  N     B GLU A 1 221 ? -7.019  -0.361  -48.220 0.05 13.22 ? 220  GLU A N     2  
ATOM   8312   C  CA    B GLU A 1 221 ? -8.013  0.700   -48.394 0.05 13.52 ? 220  GLU A CA    2  
ATOM   8313   C  C     B GLU A 1 221 ? -7.753  1.653   -47.230 0.05 13.41 ? 220  GLU A C     2  
ATOM   8314   O  O     B GLU A 1 221 ? -8.196  1.329   -46.142 0.05 13.44 ? 220  GLU A O     2  
ATOM   8315   C  CB    B GLU A 1 221 ? -9.396  0.068   -48.171 0.05 13.87 ? 220  GLU A CB    2  
ATOM   8316   C  CG    B GLU A 1 221 ? -10.630 0.927   -48.372 0.05 14.20 ? 220  GLU A CG    2  
ATOM   8317   C  CD    B GLU A 1 221 ? -11.860 0.307   -47.712 0.05 14.39 ? 220  GLU A CD    2  
ATOM   8318   O  OE1   B GLU A 1 221 ? -11.678 -0.546  -46.805 0.05 14.32 ? 220  GLU A OE1   2  
ATOM   8319   O  OE2   B GLU A 1 221 ? -12.999 0.680   -48.090 0.05 14.61 ? 220  GLU A OE2   2  
ATOM   8320   N  N     B GLU A 1 222 ? -7.090  2.813   -47.374 0.05 13.32 ? 221  GLU A N     2  
ATOM   8321   C  CA    B GLU A 1 222 ? -6.715  3.504   -48.603 0.05 13.41 ? 221  GLU A CA    2  
ATOM   8322   C  C     B GLU A 1 222 ? -5.304  4.113   -48.550 0.05 13.09 ? 221  GLU A C     2  
ATOM   8323   O  O     B GLU A 1 222 ? -4.526  3.887   -47.617 0.05 12.79 ? 221  GLU A O     2  
ATOM   8324   C  CB    B GLU A 1 222 ? -7.644  4.699   -48.807 0.05 13.69 ? 221  GLU A CB    2  
ATOM   8325   C  CG    B GLU A 1 222 ? -9.042  4.385   -49.255 0.05 14.12 ? 221  GLU A CG    2  
ATOM   8326   C  CD    B GLU A 1 222 ? -9.855  5.649   -49.417 0.05 14.35 ? 221  GLU A CD    2  
ATOM   8327   O  OE1   B GLU A 1 222 ? -9.605  6.403   -50.381 0.05 14.19 ? 221  GLU A OE1   2  
ATOM   8328   O  OE2   B GLU A 1 222 ? -10.726 5.902   -48.571 0.05 14.71 ? 221  GLU A OE2   2  
ATOM   8329   N  N     B GLY A 1 223 ? -5.010  4.947   -49.544 0.05 13.19 ? 222  GLY A N     2  
ATOM   8330   C  CA    B GLY A 1 223 ? -3.727  5.629   -49.604 0.05 12.93 ? 222  GLY A CA    2  
ATOM   8331   C  C     B GLY A 1 223 ? -3.781  7.139   -49.443 0.05 12.96 ? 222  GLY A C     2  
ATOM   8332   O  O     B GLY A 1 223 ? -4.851  7.759   -49.524 0.05 13.17 ? 222  GLY A O     2  
ATOM   8333   N  N     B GLY A 1 224 ? -2.609  7.726   -49.205 0.05 12.75 ? 223  GLY A N     2  
ATOM   8334   C  CA    B GLY A 1 224 ? -2.467  9.168   -49.098 0.05 12.75 ? 223  GLY A CA    2  
ATOM   8335   C  C     B GLY A 1 224 ? -1.148  9.606   -48.488 0.05 12.40 ? 223  GLY A C     2  
ATOM   8336   O  O     B GLY A 1 224 ? -1.133  10.479  -47.618 0.05 12.31 ? 223  GLY A O     2  
ATOM   8337   N  N     B TRP A 1 225 ? -0.047  8.999   -48.928 0.05 12.23 ? 224  TRP A N     2  
ATOM   8338   C  CA    B TRP A 1 225 ? 1.279   9.402   -48.458 0.05 11.96 ? 224  TRP A CA    2  
ATOM   8339   C  C     B TRP A 1 225 ? 2.442   8.793   -49.254 0.05 11.95 ? 224  TRP A C     2  
ATOM   8340   O  O     B TRP A 1 225 ? 2.448   7.605   -49.565 0.05 12.15 ? 224  TRP A O     2  
ATOM   8341   C  CB    B TRP A 1 225 ? 1.457   9.085   -46.973 0.05 11.67 ? 224  TRP A CB    2  
ATOM   8342   C  CG    B TRP A 1 225 ? 2.593   9.859   -46.384 0.05 11.43 ? 224  TRP A CG    2  
ATOM   8343   C  CD1   B TRP A 1 225 ? 2.542   11.112  -45.854 0.05 11.43 ? 224  TRP A CD1   2  
ATOM   8344   C  CD2   B TRP A 1 225 ? 3.958   9.447   -46.312 0.05 11.18 ? 224  TRP A CD2   2  
ATOM   8345   N  NE1   B TRP A 1 225 ? 3.789   11.499  -45.432 0.05 11.19 ? 224  TRP A NE1   2  
ATOM   8346   C  CE2   B TRP A 1 225 ? 4.678   10.494  -45.707 0.05 11.04 ? 224  TRP A CE2   2  
ATOM   8347   C  CE3   B TRP A 1 225 ? 4.642   8.288   -46.693 0.05 11.09 ? 224  TRP A CE3   2  
ATOM   8348   C  CZ2   B TRP A 1 225 ? 6.049   10.420  -45.474 0.05 10.82 ? 224  TRP A CZ2   2  
ATOM   8349   C  CZ3   B TRP A 1 225 ? 5.994   8.209   -46.452 0.05 10.89 ? 224  TRP A CZ3   2  
ATOM   8350   C  CH2   B TRP A 1 225 ? 6.687   9.270   -45.847 0.05 10.75 ? 224  TRP A CH2   2  
ATOM   8351   N  N     B GLN A 1 226 ? 3.432   9.627   -49.564 0.05 11.74 ? 225  GLN A N     2  
ATOM   8352   C  CA    B GLN A 1 226 ? 4.628   9.198   -50.281 0.05 11.73 ? 225  GLN A CA    2  
ATOM   8353   C  C     B GLN A 1 226 ? 5.894   9.715   -49.602 0.05 11.43 ? 225  GLN A C     2  
ATOM   8354   O  O     B GLN A 1 226 ? 5.937   10.865  -49.164 0.05 11.32 ? 225  GLN A O     2  
ATOM   8355   C  CB    B GLN A 1 226 ? 4.586   9.714   -51.715 0.05 11.97 ? 225  GLN A CB    2  
ATOM   8356   N  N     B ARG A 1 227 ? 6.929   8.883   -49.516 0.05 11.32 ? 226  ARG A N     2  
ATOM   8357   C  CA    B ARG A 1 227 ? 8.162   9.352   -48.901 0.05 11.08 ? 226  ARG A CA    2  
ATOM   8358   C  C     B ARG A 1 227 ? 8.873   10.327  -49.826 0.05 11.15 ? 226  ARG A C     2  
ATOM   8359   O  O     B ARG A 1 227 ? 8.788   10.199  -51.056 0.05 11.38 ? 226  ARG A O     2  
ATOM   8360   C  CB    B ARG A 1 227 ? 9.091   8.209   -48.431 0.05 10.96 ? 226  ARG A CB    2  
ATOM   8361   C  CG    B ARG A 1 227 ? 9.298   7.073   -49.410 0.05 11.13 ? 226  ARG A CG    2  
ATOM   8362   C  CD    B ARG A 1 227 ? 9.816   5.810   -48.729 0.05 11.05 ? 226  ARG A CD    2  
ATOM   8363   N  NE    B ARG A 1 227 ? 11.221  5.882   -48.349 0.05 10.91 ? 226  ARG A NE    2  
ATOM   8364   C  CZ    B ARG A 1 227 ? 11.766  5.139   -47.390 0.05 10.75 ? 226  ARG A CZ    2  
ATOM   8365   N  NH1   B ARG A 1 227 ? 13.049  5.262   -47.109 0.05 10.67 ? 226  ARG A NH1   2  
ATOM   8366   N  NH2   B ARG A 1 227 ? 11.021  4.275   -46.707 0.05 10.71 ? 226  ARG A NH2   2  
ATOM   8367   N  N     B PRO A 1 228 ? 9.533   11.329  -49.226 0.05 10.99 ? 227  PRO A N     2  
ATOM   8368   C  CA    B PRO A 1 228 ? 10.413  12.264  -49.922 0.05 11.04 ? 227  PRO A CA    2  
ATOM   8369   C  C     B PRO A 1 228 ? 11.423  11.510  -50.769 0.05 11.12 ? 227  PRO A C     2  
ATOM   8370   O  O     B PRO A 1 228 ? 11.892  10.431  -50.387 0.05 10.99 ? 227  PRO A O     2  
ATOM   8371   C  CB    B PRO A 1 228 ? 11.129  12.971  -48.774 0.05 10.78 ? 227  PRO A CB    2  
ATOM   8372   C  CG    B PRO A 1 228 ? 10.137  12.939  -47.650 0.05 10.69 ? 227  PRO A CG    2  
ATOM   8373   C  CD    B PRO A 1 228 ? 9.471   11.607  -47.778 0.05 10.76 ? 227  PRO A CD    2  
ATOM   8374   N  N     B ALA A 1 229 ? 11.738  12.073  -51.927 0.05 11.36 ? 228  ALA A N     2  
ATOM   8375   C  CA    B ALA A 1 229 ? 12.782  11.525  -52.764 0.05 11.51 ? 228  ALA A CA    2  
ATOM   8376   C  C     B ALA A 1 229 ? 14.083  11.484  -51.971 0.05 11.30 ? 228  ALA A C     2  
ATOM   8377   O  O     B ALA A 1 229 ? 14.449  12.451  -51.293 0.05 11.14 ? 228  ALA A O     2  
ATOM   8378   C  CB    B ALA A 1 229 ? 12.946  12.366  -54.018 0.05 11.79 ? 228  ALA A CB    2  
ATOM   8379   N  N     B GLY A 1 230 ? 14.760  10.343  -52.025 0.05 11.30 ? 229  GLY A N     2  
ATOM   8380   C  CA    B GLY A 1 230 ? 16.071  10.217  -51.423 0.05 11.17 ? 229  GLY A CA    2  
ATOM   8381   C  C     B GLY A 1 230 ? 16.095  10.021  -49.917 0.05 10.88 ? 229  GLY A C     2  
ATOM   8382   O  O     B GLY A 1 230 ? 17.166  9.881   -49.334 0.05 10.80 ? 229  GLY A O     2  
ATOM   8383   N  N     B ALA A 1 231 ? 14.931  10.016  -49.274 0.05 10.76 ? 230  ALA A N     2  
ATOM   8384   C  CA    B ALA A 1 231 ? 14.877  9.662   -47.858 0.05 10.54 ? 230  ALA A CA    2  
ATOM   8385   C  C     B ALA A 1 231 ? 15.203  8.182   -47.711 0.05 10.58 ? 230  ALA A C     2  
ATOM   8386   O  O     B ALA A 1 231 ? 14.565  7.339   -48.341 0.05 10.72 ? 230  ALA A O     2  
ATOM   8387   C  CB    B ALA A 1 231 ? 13.500  9.960   -47.273 0.05 10.46 ? 230  ALA A CB    2  
ATOM   8388   N  N     B GLU A 1 232 ? 16.203  7.875   -46.895 0.05 10.47 ? 231  GLU A N     2  
ATOM   8389   C  CA    B GLU A 1 232 ? 16.633  6.491   -46.679 0.05 10.52 ? 231  GLU A CA    2  
ATOM   8390   C  C     B GLU A 1 232 ? 15.834  5.791   -45.581 0.05 10.42 ? 231  GLU A C     2  
ATOM   8391   O  O     B GLU A 1 232 ? 15.491  4.608   -45.705 0.05 10.51 ? 231  GLU A O     2  
ATOM   8392   C  CB    B GLU A 1 232 ? 18.123  6.450   -46.346 0.05 10.49 ? 231  GLU A CB    2  
ATOM   8393   C  CG    B GLU A 1 232 ? 18.994  6.938   -47.479 0.05 10.62 ? 231  GLU A CG    2  
ATOM   8394   N  N     B LYS A 1 233 ? 15.558  6.514   -44.500 0.05 10.24 ? 232  LYS A N     2  
ATOM   8395   C  CA    B LYS A 1 233 ? 14.737  5.980   -43.424 0.05 10.17 ? 232  LYS A CA    2  
ATOM   8396   C  C     B LYS A 1 233 ? 13.530  6.883   -43.186 0.05 10.11 ? 232  LYS A C     2  
ATOM   8397   O  O     B LYS A 1 233 ? 13.669  8.097   -43.058 0.05 10.03 ? 232  LYS A O     2  
ATOM   8398   C  CB    B LYS A 1 233 ? 15.548  5.850   -42.130 0.05 10.07 ? 232  LYS A CB    2  
ATOM   8399   C  CG    B LYS A 1 233 ? 16.771  4.923   -42.218 0.05 10.16 ? 232  LYS A CG    2  
ATOM   8400   C  CD    B LYS A 1 233 ? 16.392  3.527   -42.704 0.05 10.29 ? 232  LYS A CD    2  
ATOM   8401   C  CE    B LYS A 1 233 ? 17.623  2.615   -42.809 0.05 10.42 ? 232  LYS A CE    2  
ATOM   8402   N  NZ    B LYS A 1 233 ? 17.308  1.345   -43.530 0.05 10.58 ? 232  LYS A NZ    2  
ATOM   8403   N  N     B VAL A 1 234 ? 12.343  6.288   -43.133 0.05 10.17 ? 233  VAL A N     2  
ATOM   8404   C  CA    B VAL A 1 234 ? 11.142  7.028   -42.772 0.05 10.15 ? 233  VAL A CA    2  
ATOM   8405   C  C     B VAL A 1 234 ? 10.634  6.511   -41.432 0.05 10.10 ? 233  VAL A C     2  
ATOM   8406   O  O     B VAL A 1 234 ? 10.506  5.301   -41.248 0.05 10.14 ? 233  VAL A O     2  
ATOM   8407   C  CB    B VAL A 1 234 ? 10.042  6.881   -43.852 0.05 10.32 ? 233  VAL A CB    2  
ATOM   8408   C  CG1   B VAL A 1 234 ? 8.698   7.407   -43.350 0.05 10.34 ? 233  VAL A CG1   2  
ATOM   8409   C  CG2   B VAL A 1 234 ? 10.456  7.621   -45.132 0.05 10.41 ? 233  VAL A CG2   2  
ATOM   8410   N  N     B VAL A 1 235 ? 10.379  7.421   -40.494 0.05 10.02 ? 234  VAL A N     2  
ATOM   8411   C  CA    B VAL A 1 235 ? 9.813   7.022   -39.208 0.05 10.01 ? 234  VAL A CA    2  
ATOM   8412   C  C     B VAL A 1 235 ? 8.470   7.706   -38.997 0.05 10.09 ? 234  VAL A C     2  
ATOM   8413   O  O     B VAL A 1 235 ? 8.352   8.913   -39.181 0.05 10.08 ? 234  VAL A O     2  
ATOM   8414   C  CB    B VAL A 1 235 ? 10.772  7.309   -38.019 0.05 9.91  ? 234  VAL A CB    2  
ATOM   8415   C  CG1   B VAL A 1 235 ? 11.275  8.743   -38.064 0.05 9.84  ? 234  VAL A CG1   2  
ATOM   8416   C  CG2   B VAL A 1 235 ? 10.079  7.026   -36.687 0.05 9.95  ? 234  VAL A CG2   2  
ATOM   8417   N  N     B LEU A 1 236 ? 7.459   6.912   -38.649 0.05 10.18 ? 235  LEU A N     2  
ATOM   8418   C  CA    B LEU A 1 236 ? 6.151   7.425   -38.266 0.05 10.30 ? 235  LEU A CA    2  
ATOM   8419   C  C     B LEU A 1 236 ? 6.022   7.375   -36.746 0.05 10.30 ? 235  LEU A C     2  
ATOM   8420   O  O     B LEU A 1 236 ? 6.353   6.366   -36.132 0.05 10.28 ? 235  LEU A O     2  
ATOM   8421   C  CB    B LEU A 1 236 ? 5.046   6.559   -38.885 0.05 10.45 ? 235  LEU A CB    2  
ATOM   8422   C  CG    B LEU A 1 236 ? 3.629   6.845   -38.389 0.05 10.61 ? 235  LEU A CG    2  
ATOM   8423   C  CD1   B LEU A 1 236 ? 3.224   8.260   -38.760 0.05 10.67 ? 235  LEU A CD1   2  
ATOM   8424   C  CD2   B LEU A 1 236 ? 2.617   5.830   -38.951 0.05 10.77 ? 235  LEU A CD2   2  
ATOM   8425   N  N     B VAL A 1 237 ? 5.561   8.461   -36.137 0.05 10.34 ? 236  VAL A N     2  
ATOM   8426   C  CA    B VAL A 1 237 ? 5.236   8.437   -34.712 0.05 10.41 ? 236  VAL A CA    2  
ATOM   8427   C  C     B VAL A 1 237 ? 3.733   8.566   -34.545 0.05 10.62 ? 236  VAL A C     2  
ATOM   8428   O  O     B VAL A 1 237 ? 3.153   9.547   -34.990 0.05 10.68 ? 236  VAL A O     2  
ATOM   8429   C  CB    B VAL A 1 237 ? 5.926   9.587   -33.950 0.05 10.34 ? 236  VAL A CB    2  
ATOM   8430   C  CG1   B VAL A 1 237 ? 5.404   9.678   -32.505 0.05 10.47 ? 236  VAL A CG1   2  
ATOM   8431   C  CG2   B VAL A 1 237 ? 7.440   9.420   -33.979 0.05 10.17 ? 236  VAL A CG2   2  
ATOM   8432   N  N     B SER A 1 238 ? 3.106   7.574   -33.915 0.05 10.74 ? 237  SER A N     2  
ATOM   8433   C  CA    B SER A 1 238 ? 1.658   7.583   -33.715 0.05 10.98 ? 237  SER A CA    2  
ATOM   8434   C  C     B SER A 1 238 ? 1.282   6.949   -32.374 0.05 11.12 ? 237  SER A C     2  
ATOM   8435   O  O     B SER A 1 238 ? 1.854   5.944   -31.963 0.05 11.05 ? 237  SER A O     2  
ATOM   8436   C  CB    B SER A 1 238 ? 0.950   6.860   -34.867 0.05 11.05 ? 237  SER A CB    2  
ATOM   8437   O  OG    B SER A 1 238 ? -0.456  7.026   -34.776 0.05 11.31 ? 237  SER A OG    2  
ATOM   8438   N  N     B LEU A 1 239 ? 0.329   7.547   -31.675 0.05 11.34 ? 238  LEU A N     2  
ATOM   8439   C  CA    B LEU A 1 239 ? -0.051  7.012   -30.375 0.05 11.52 ? 238  LEU A CA    2  
ATOM   8440   C  C     B LEU A 1 239 ? -1.500  6.537   -30.288 0.05 11.81 ? 238  LEU A C     2  
ATOM   8441   O  O     B LEU A 1 239 ? -1.959  6.140   -29.223 0.05 12.05 ? 238  LEU A O     2  
ATOM   8442   C  CB    B LEU A 1 239 ? 0.250   8.036   -29.282 0.05 11.59 ? 238  LEU A CB    2  
ATOM   8443   C  CG    B LEU A 1 239 ? 1.706   8.492   -29.309 0.05 11.36 ? 238  LEU A CG    2  
ATOM   8444   C  CD1   B LEU A 1 239 ? 1.913   9.649   -28.365 0.05 11.49 ? 238  LEU A CD1   2  
ATOM   8445   C  CD2   B LEU A 1 239 ? 2.640   7.341   -28.961 0.05 11.24 ? 238  LEU A CD2   2  
ATOM   8446   N  N     B GLY A 1 240 ? -2.236  6.587   -31.394 0.05 11.81 ? 239  GLY A N     2  
ATOM   8447   C  CA    B GLY A 1 240 ? -3.561  5.993   -31.401 0.05 12.09 ? 239  GLY A CA    2  
ATOM   8448   C  C     B GLY A 1 240 ? -4.711  6.819   -31.959 0.05 12.31 ? 239  GLY A C     2  
ATOM   8449   O  O     B GLY A 1 240 ? -4.525  7.960   -32.390 0.05 12.20 ? 239  GLY A O     2  
ATOM   8450   N  N     B SER A 1 241 ? -5.899  6.209   -31.942 0.05 12.62 ? 240  SER A N     2  
ATOM   8451   C  CA    B SER A 1 241 ? -7.125  6.758   -32.531 0.05 12.89 ? 240  SER A CA    2  
ATOM   8452   C  C     B SER A 1 241 ? -7.604  8.008   -31.822 0.05 13.16 ? 240  SER A C     2  
ATOM   8453   O  O     B SER A 1 241 ? -8.393  8.785   -32.372 0.05 13.38 ? 240  SER A O     2  
ATOM   8454   C  CB    B SER A 1 241 ? -8.258  5.732   -32.406 0.05 13.12 ? 240  SER A CB    2  
ATOM   8455   O  OG    B SER A 1 241 ? -8.973  5.545   -33.612 0.05 12.96 ? 240  SER A OG    2  
ATOM   8456   N  N     B ALA A 1 242 ? -7.150  8.185   -30.587 0.05 13.20 ? 241  ALA A N     2  
ATOM   8457   C  CA    B ALA A 1 242 ? -7.883  9.004   -29.642 0.05 13.51 ? 241  ALA A CA    2  
ATOM   8458   C  C     B ALA A 1 242 ? -6.992  9.780   -28.689 0.05 13.32 ? 241  ALA A C     2  
ATOM   8459   O  O     B ALA A 1 242 ? -7.473  10.636  -27.949 0.05 13.54 ? 241  ALA A O     2  
ATOM   8460   C  CB    B ALA A 1 242 ? -8.811  8.102   -28.839 0.05 13.84 ? 241  ALA A CB    2  
ATOM   8461   N  N     B PHE A 1 243 ? -5.696  9.487   -28.710 0.05 12.95 ? 242  PHE A N     2  
ATOM   8462   C  CA    B PHE A 1 243 ? -4.836  9.838   -27.589 0.05 12.79 ? 242  PHE A CA    2  
ATOM   8463   C  C     B PHE A 1 243 ? -3.758  10.881  -27.833 0.05 12.63 ? 242  PHE A C     2  
ATOM   8464   O  O     B PHE A 1 243 ? -3.393  11.599  -26.915 0.05 12.67 ? 242  PHE A O     2  
ATOM   8465   N  N     B THR A 1 244 ? -3.250  10.950  -29.060 0.05 12.45 ? 243  THR A N     2  
ATOM   8466   C  CA    B THR A 1 244 ? -2.084  11.766  -29.395 0.05 12.27 ? 243  THR A CA    2  
ATOM   8467   C  C     B THR A 1 244 ? -2.113  13.168  -28.775 0.05 12.52 ? 243  THR A C     2  
ATOM   8468   O  O     B THR A 1 244 ? -3.084  13.892  -28.980 0.05 12.84 ? 243  THR A O     2  
ATOM   8469   C  CB    B THR A 1 244 ? -1.972  11.920  -30.913 0.05 12.16 ? 243  THR A CB    2  
ATOM   8470   O  OG1   B THR A 1 244 ? -3.198  12.465  -31.409 0.05 12.49 ? 243  THR A OG1   2  
ATOM   8471   C  CG2   B THR A 1 244 ? -1.714  10.563  -31.578 0.05 11.94 ? 243  THR A CG2   2  
ATOM   8472   N  N     B LYS A 1 245 ? -1.075  13.550  -28.029 0.05 12.40 ? 244  LYS A N     2  
ATOM   8473   C  CA    B LYS A 1 245 ? -1.168  14.740  -27.157 0.05 12.66 ? 244  LYS A CA    2  
ATOM   8474   C  C     B LYS A 1 245 ? 0.127   15.164  -26.411 0.05 12.46 ? 244  LYS A C     2  
ATOM   8475   O  O     B LYS A 1 245 ? 0.216   16.288  -25.907 0.05 12.63 ? 244  LYS A O     2  
ATOM   8476   C  CB    B LYS A 1 245 ? -2.322  14.505  -26.157 0.05 13.00 ? 244  LYS A CB    2  
ATOM   8477   C  CG    B LYS A 1 245 ? -2.425  15.398  -24.912 0.05 13.30 ? 244  LYS A CG    2  
ATOM   8478   C  CD    B LYS A 1 245 ? -2.987  16.775  -25.237 0.05 13.53 ? 244  LYS A CD    2  
ATOM   8479   C  CE    B LYS A 1 245 ? -3.996  17.252  -24.205 0.05 13.65 ? 244  LYS A CE    2  
ATOM   8480   N  NZ    B LYS A 1 245 ? -4.271  18.706  -24.376 0.05 13.77 ? 244  LYS A NZ    2  
ATOM   8481   N  N     B GLN A 1 246 ? 1.124   14.278  -26.383 0.05 12.12 ? 245  GLN A N     2  
ATOM   8482   C  CA    B GLN A 1 246 ? 2.276   14.325  -25.457 0.05 11.96 ? 245  GLN A CA    2  
ATOM   8483   C  C     B GLN A 1 246 ? 3.399   15.345  -25.714 0.05 11.67 ? 245  GLN A C     2  
ATOM   8484   O  O     B GLN A 1 246 ? 4.429   14.965  -26.274 0.05 11.40 ? 245  GLN A O     2  
ATOM   8485   C  CB    B GLN A 1 246 ? 2.944   12.944  -25.484 0.05 11.84 ? 245  GLN A CB    2  
ATOM   8486   C  CG    B GLN A 1 246 ? 1.981   11.781  -25.478 0.05 12.11 ? 245  GLN A CG    2  
ATOM   8487   C  CD    B GLN A 1 246 ? 1.632   11.337  -24.078 0.05 12.27 ? 245  GLN A CD    2  
ATOM   8488   O  OE1   B GLN A 1 246 ? 2.265   11.760  -23.103 0.05 12.12 ? 245  GLN A OE1   2  
ATOM   8489   N  NE2   B GLN A 1 246 ? 0.623   10.483  -23.963 0.05 12.62 ? 245  GLN A NE2   2  
ATOM   8490   N  N     B PRO A 1 247 ? 3.262   16.601  -25.233 0.05 11.73 ? 246  PRO A N     2  
ATOM   8491   C  CA    B PRO A 1 247 ? 4.224   17.632  -25.661 0.05 11.47 ? 246  PRO A CA    2  
ATOM   8492   C  C     B PRO A 1 247 ? 5.692   17.264  -25.400 0.05 11.25 ? 246  PRO A C     2  
ATOM   8493   O  O     B PRO A 1 247 ? 6.482   17.251  -26.349 0.05 10.99 ? 246  PRO A O     2  
ATOM   8494   C  CB    B PRO A 1 247 ? 3.803   18.870  -24.854 0.05 11.66 ? 246  PRO A CB    2  
ATOM   8495   C  CG    B PRO A 1 247 ? 3.136   18.331  -23.650 0.05 11.99 ? 246  PRO A CG    2  
ATOM   8496   C  CD    B PRO A 1 247 ? 2.456   17.047  -24.080 0.05 12.07 ? 246  PRO A CD    2  
ATOM   8497   N  N     B ALA A 1 248 ? 6.021   16.935  -24.152 0.05 11.39 ? 247  ALA A N     2  
ATOM   8498   C  CA    B ALA A 1 248 ? 7.362   16.490  -23.766 0.05 11.26 ? 247  ALA A CA    2  
ATOM   8499   C  C     B ALA A 1 248 ? 7.866   15.317  -24.606 0.05 11.02 ? 247  ALA A C     2  
ATOM   8500   O  O     B ALA A 1 248 ? 9.017   15.284  -25.006 0.05 10.80 ? 247  ALA A O     2  
ATOM   8501   C  CB    B ALA A 1 248 ? 7.397   16.123  -22.301 0.05 11.54 ? 247  ALA A CB    2  
ATOM   8502   N  N     B PHE A 1 249 ? 7.009   14.341  -24.854 0.05 11.10 ? 248  PHE A N     2  
ATOM   8503   C  CA    B PHE A 1 249 ? 7.398   13.206  -25.684 0.05 10.91 ? 248  PHE A CA    2  
ATOM   8504   C  C     B PHE A 1 249 ? 7.405   13.644  -27.161 0.05 10.68 ? 248  PHE A C     2  
ATOM   8505   O  O     B PHE A 1 249 ? 8.303   13.293  -27.936 0.05 10.48 ? 248  PHE A O     2  
ATOM   8506   C  CB    B PHE A 1 249 ? 6.455   12.022  -25.392 0.05 11.06 ? 248  PHE A CB    2  
ATOM   8507   C  CG    B PHE A 1 249 ? 6.680   10.813  -26.262 0.05 10.88 ? 248  PHE A CG    2  
ATOM   8508   C  CD1   B PHE A 1 249 ? 5.616   10.224  -26.931 0.05 10.91 ? 248  PHE A CD1   2  
ATOM   8509   C  CD2   B PHE A 1 249 ? 7.937   10.249  -26.389 0.05 10.73 ? 248  PHE A CD2   2  
ATOM   8510   C  CE1   B PHE A 1 249 ? 5.807   9.098   -27.739 0.05 10.77 ? 248  PHE A CE1   2  
ATOM   8511   C  CE2   B PHE A 1 249 ? 8.136   9.126   -27.199 0.05 10.60 ? 248  PHE A CE2   2  
ATOM   8512   C  CZ    B PHE A 1 249 ? 7.069   8.556   -27.876 0.05 10.62 ? 248  PHE A CZ    2  
ATOM   8513   N  N     B TYR A 1 250 ? 6.434   14.469  -27.535 0.05 10.73 ? 249  TYR A N     2  
ATOM   8514   C  CA    B TYR A 1 250 ? 6.342   14.979  -28.907 0.05 10.56 ? 249  TYR A CA    2  
ATOM   8515   C  C     B TYR A 1 250 ? 7.501   15.862  -29.283 0.05 10.37 ? 249  TYR A C     2  
ATOM   8516   O  O     B TYR A 1 250 ? 8.039   15.748  -30.390 0.05 10.20 ? 249  TYR A O     2  
ATOM   8517   C  CB    B TYR A 1 250 ? 5.065   15.771  -29.105 0.05 10.71 ? 249  TYR A CB    2  
ATOM   8518   C  CG    B TYR A 1 250 ? 3.885   14.871  -29.207 0.05 10.90 ? 249  TYR A CG    2  
ATOM   8519   C  CD1   B TYR A 1 250 ? 4.064   13.498  -29.215 0.05 10.92 ? 249  TYR A CD1   2  
ATOM   8520   C  CD2   B TYR A 1 250 ? 2.600   15.378  -29.313 0.05 11.08 ? 249  TYR A CD2   2  
ATOM   8521   C  CE1   B TYR A 1 250 ? 3.014   12.659  -29.315 0.05 11.11 ? 249  TYR A CE1   2  
ATOM   8522   C  CE2   B TYR A 1 250 ? 1.525   14.531  -29.418 0.05 11.29 ? 249  TYR A CE2   2  
ATOM   8523   C  CZ    B TYR A 1 250 ? 1.753   13.170  -29.415 0.05 11.29 ? 249  TYR A CZ    2  
ATOM   8524   O  OH    B TYR A 1 250 ? 0.729   12.293  -29.518 0.05 11.50 ? 249  TYR A OH    2  
ATOM   8525   N  N     B ARG A 1 251 ? 7.848   16.764  -28.368 0.05 10.42 ? 250  ARG A N     2  
ATOM   8526   C  CA    B ARG A 1 251 ? 9.053   17.564  -28.515 0.05 10.25 ? 250  ARG A CA    2  
ATOM   8527   C  C     B ARG A 1 251 ? 10.275  16.662  -28.701 0.05 10.12 ? 250  ARG A C     2  
ATOM   8528   O  O     B ARG A 1 251 ? 11.079  16.894  -29.607 0.05 9.96  ? 250  ARG A O     2  
ATOM   8529   C  CB    B ARG A 1 251 ? 9.248   18.559  -27.348 0.05 10.36 ? 250  ARG A CB    2  
ATOM   8530   C  CG    B ARG A 1 251 ? 9.539   17.913  -25.999 0.05 10.42 ? 250  ARG A CG    2  
ATOM   8531   C  CD    B ARG A 1 251 ? 9.987   18.843  -24.876 0.05 10.48 ? 250  ARG A CD    2  
ATOM   8532   N  NE    B ARG A 1 251 ? 8.859   19.507  -24.237 0.05 10.75 ? 250  ARG A NE    2  
ATOM   8533   C  CZ    B ARG A 1 251 ? 8.359   20.664  -24.645 0.05 10.82 ? 250  ARG A CZ    2  
ATOM   8534   N  NH1   B ARG A 1 251 ? 8.905   21.290  -25.678 0.05 10.64 ? 250  ARG A NH1   2  
ATOM   8535   N  NH2   B ARG A 1 251 ? 7.314   21.199  -24.025 0.05 11.10 ? 250  ARG A NH2   2  
ATOM   8536   N  N     B GLU A 1 252 ? 10.401  15.620  -27.875 0.05 10.22 ? 251  GLU A N     2  
ATOM   8537   C  CA    B GLU A 1 252 ? 11.590  14.769  -27.927 0.05 10.14 ? 251  GLU A CA    2  
ATOM   8538   C  C     B GLU A 1 252 ? 11.663  14.033  -29.259 0.05 10.00 ? 251  GLU A C     2  
ATOM   8539   O  O     B GLU A 1 252 ? 12.753  13.720  -29.729 0.05 9.89  ? 251  GLU A O     2  
ATOM   8540   C  CB    B GLU A 1 252 ? 11.646  13.751  -26.777 0.05 10.31 ? 251  GLU A CB    2  
ATOM   8541   C  CG    B GLU A 1 252 ? 11.814  14.317  -25.359 0.05 10.49 ? 251  GLU A CG    2  
ATOM   8542   C  CD    B GLU A 1 252 ? 13.030  15.207  -25.177 0.05 10.42 ? 251  GLU A CD    2  
ATOM   8543   O  OE1   B GLU A 1 252 ? 12.902  16.227  -24.463 0.05 10.57 ? 251  GLU A OE1   2  
ATOM   8544   O  OE2   B GLU A 1 252 ? 14.112  14.892  -25.711 0.05 10.23 ? 251  GLU A OE2   2  
ATOM   8545   N  N     B CYS A 1 253 ? 10.506  13.763  -29.862 0.05 10.04 ? 252  CYS A N     2  
ATOM   8546   C  CA    B CYS A 1 253 ? 10.483  13.057  -31.144 0.05 9.95  ? 252  CYS A CA    2  
ATOM   8547   C  C     B CYS A 1 253 ? 11.041  13.907  -32.278 0.05 9.81  ? 252  CYS A C     2  
ATOM   8548   O  O     B CYS A 1 253 ? 11.838  13.416  -33.068 0.05 9.71  ? 252  CYS A O     2  
ATOM   8549   C  CB    B CYS A 1 253 ? 9.083   12.546  -31.493 0.05 10.05 ? 252  CYS A CB    2  
ATOM   8550   S  SG    B CYS A 1 253 ? 8.665   11.009  -30.615 0.05 10.21 ? 252  CYS A SG    2  
ATOM   8551   N  N     B VAL A 1 254 ? 10.621  15.170  -32.365 0.05 9.83  ? 253  VAL A N     2  
ATOM   8552   C  CA    B VAL A 1 254 ? 11.190  16.063  -33.374 0.05 9.72  ? 253  VAL A CA    2  
ATOM   8553   C  C     B VAL A 1 254 ? 12.676  16.224  -33.103 0.05 9.61  ? 253  VAL A C     2  
ATOM   8554   O  O     B VAL A 1 254 ? 13.504  16.247  -34.020 0.05 9.52  ? 253  VAL A O     2  
ATOM   8555   C  CB    B VAL A 1 254 ? 10.514  17.448  -33.378 0.05 9.79  ? 253  VAL A CB    2  
ATOM   8556   C  CG1   B VAL A 1 254 ? 11.389  18.471  -34.066 0.05 9.68  ? 253  VAL A CG1   2  
ATOM   8557   C  CG2   B VAL A 1 254 ? 9.184   17.372  -34.070 0.05 9.93  ? 253  VAL A CG2   2  
ATOM   8558   N  N     B ARG A 1 255 ? 13.010  16.298  -31.824 0.05 9.64  ? 254  ARG A N     2  
ATOM   8559   C  CA    B ARG A 1 255 ? 14.384  16.527  -31.416 0.05 9.57  ? 254  ARG A CA    2  
ATOM   8560   C  C     B ARG A 1 255 ? 15.251  15.300  -31.656 0.05 9.55  ? 254  ARG A C     2  
ATOM   8561   O  O     B ARG A 1 255 ? 16.442  15.410  -31.915 0.05 9.50  ? 254  ARG A O     2  
ATOM   8562   C  CB    B ARG A 1 255 ? 14.442  16.961  -29.951 0.05 9.66  ? 254  ARG A CB    2  
ATOM   8563   C  CG    B ARG A 1 255 ? 15.742  17.659  -29.591 0.05 9.63  ? 254  ARG A CG    2  
ATOM   8564   C  CD    B ARG A 1 255 ? 15.681  18.243  -28.188 0.05 9.75  ? 254  ARG A CD    2  
ATOM   8565   N  NE    B ARG A 1 255 ? 17.022  18.399  -27.642 0.05 9.73  ? 254  ARG A NE    2  
ATOM   8566   C  CZ    B ARG A 1 255 ? 17.833  19.397  -27.971 0.05 9.62  ? 254  ARG A CZ    2  
ATOM   8567   N  NH1   B ARG A 1 255 ? 17.434  20.313  -28.836 0.05 9.51  ? 254  ARG A NH1   2  
ATOM   8568   N  NH2   B ARG A 1 255 ? 19.049  19.472  -27.447 0.05 9.64  ? 254  ARG A NH2   2  
ATOM   8569   N  N     B ALA A 1 256 ? 14.646  14.123  -31.578 0.05 9.62  ? 255  ALA A N     2  
ATOM   8570   C  CA    B ALA A 1 256 ? 15.371  12.900  -31.897 0.05 9.62  ? 255  ALA A CA    2  
ATOM   8571   C  C     B ALA A 1 256 ? 15.714  12.820  -33.379 0.05 9.55  ? 255  ALA A C     2  
ATOM   8572   O  O     B ALA A 1 256 ? 16.838  12.522  -33.747 0.05 9.54  ? 255  ALA A O     2  
ATOM   8573   C  CB    B ALA A 1 256 ? 14.554  11.679  -31.490 0.05 9.72  ? 255  ALA A CB    2  
ATOM   8574   N  N     B PHE A 1 257 ? 14.735  13.063  -34.240 0.05 9.54  ? 256  PHE A N     2  
ATOM   8575   C  CA    B PHE A 1 257 ? 14.934  12.775  -35.657 0.05 9.52  ? 256  PHE A CA    2  
ATOM   8576   C  C     B PHE A 1 257 ? 15.260  13.995  -36.526 0.05 9.47  ? 256  PHE A C     2  
ATOM   8577   O  O     B PHE A 1 257 ? 15.610  13.847  -37.690 0.05 9.47  ? 256  PHE A O     2  
ATOM   8578   C  CB    B PHE A 1 257 ? 13.725  12.025  -36.211 0.05 9.59  ? 256  PHE A CB    2  
ATOM   8579   C  CG    B PHE A 1 257 ? 13.443  10.729  -35.496 0.05 9.65  ? 256  PHE A CG    2  
ATOM   8580   C  CD1   B PHE A 1 257 ? 14.193  9.597   -35.775 0.05 9.67  ? 256  PHE A CD1   2  
ATOM   8581   C  CD2   B PHE A 1 257 ? 12.433  10.647  -34.552 0.05 9.72  ? 256  PHE A CD2   2  
ATOM   8582   C  CE1   B PHE A 1 257 ? 13.942  8.395   -35.123 0.05 9.74  ? 256  PHE A CE1   2  
ATOM   8583   C  CE2   B PHE A 1 257 ? 12.172  9.452   -33.883 0.05 9.80  ? 256  PHE A CE2   2  
ATOM   8584   C  CZ    B PHE A 1 257 ? 12.928  8.323   -34.176 0.05 9.80  ? 256  PHE A CZ    2  
ATOM   8585   N  N     B GLY A 1 258 ? 15.171  15.187  -35.950 0.05 9.44  ? 257  GLY A N     2  
ATOM   8586   C  CA    B GLY A 1 258 ? 15.437  16.398  -36.716 0.05 9.39  ? 257  GLY A CA    2  
ATOM   8587   C  C     B GLY A 1 258 ? 16.887  16.498  -37.150 0.05 9.34  ? 257  GLY A C     2  
ATOM   8588   O  O     B GLY A 1 258 ? 17.781  16.293  -36.337 0.05 9.32  ? 257  GLY A O     2  
ATOM   8589   N  N     B ASN A 1 259 ? 17.121  16.802  -38.427 0.05 9.36  ? 258  ASN A N     2  
ATOM   8590   C  CA    B ASN A 1 259 ? 18.479  16.956  -38.976 0.05 9.34  ? 258  ASN A CA    2  
ATOM   8591   C  C     B ASN A 1 259 ? 19.393  15.716  -38.967 0.05 9.38  ? 258  ASN A C     2  
ATOM   8592   O  O     B ASN A 1 259 ? 20.556  15.795  -39.372 0.05 9.39  ? 258  ASN A O     2  
ATOM   8593   C  CB    B ASN A 1 259 ? 19.202  18.142  -38.318 0.05 9.27  ? 258  ASN A CB    2  
ATOM   8594   C  CG    B ASN A 1 259 ? 18.442  19.440  -38.469 0.05 9.25  ? 258  ASN A CG    2  
ATOM   8595   O  OD1   B ASN A 1 259 ? 18.434  20.272  -37.572 0.05 9.22  ? 258  ASN A OD1   2  
ATOM   8596   N  ND2   B ASN A 1 259 ? 17.774  19.605  -39.599 0.05 9.30  ? 258  ASN A ND2   2  
ATOM   8597   N  N     B LEU A 1 260 ? 18.873  14.580  -38.506 0.05 9.43  ? 259  LEU A N     2  
ATOM   8598   C  CA    B LEU A 1 260 ? 19.613  13.321  -38.550 0.05 9.49  ? 259  LEU A CA    2  
ATOM   8599   C  C     B LEU A 1 260 ? 19.653  12.868  -40.005 0.05 9.59  ? 259  LEU A C     2  
ATOM   8600   O  O     B LEU A 1 260 ? 18.610  12.616  -40.601 0.05 9.63  ? 259  LEU A O     2  
ATOM   8601   C  CB    B LEU A 1 260 ? 18.915  12.268  -37.675 0.05 9.51  ? 259  LEU A CB    2  
ATOM   8602   C  CG    B LEU A 1 260 ? 19.633  10.943  -37.400 0.05 9.60  ? 259  LEU A CG    2  
ATOM   8603   C  CD1   B LEU A 1 260 ? 20.715  11.107  -36.342 0.05 9.62  ? 259  LEU A CD1   2  
ATOM   8604   C  CD2   B LEU A 1 260 ? 18.625  9.872   -36.967 0.05 9.62  ? 259  LEU A CD2   2  
ATOM   8605   N  N     B PRO A 1 261 ? 20.858  12.797  -40.593 0.05 9.65  ? 260  PRO A N     2  
ATOM   8606   C  CA    B PRO A 1 261 ? 21.046  12.478  -42.015 0.05 9.78  ? 260  PRO A CA    2  
ATOM   8607   C  C     B PRO A 1 261 ? 20.324  11.215  -42.498 0.05 9.88  ? 260  PRO A C     2  
ATOM   8608   O  O     B PRO A 1 261 ? 20.501  10.132  -41.947 0.05 9.89  ? 260  PRO A O     2  
ATOM   8609   C  CB    B PRO A 1 261 ? 22.561  12.285  -42.124 0.05 9.86  ? 260  PRO A CB    2  
ATOM   8610   C  CG    B PRO A 1 261 ? 23.116  13.184  -41.094 0.05 9.74  ? 260  PRO A CG    2  
ATOM   8611   C  CD    B PRO A 1 261 ? 22.133  13.150  -39.939 0.05 9.63  ? 260  PRO A CD    2  
ATOM   8612   N  N     B GLY A 1 262 ? 19.512  11.361  -43.537 0.05 9.96  ? 261  GLY A N     2  
ATOM   8613   C  CA    B GLY A 1 262 ? 18.865  10.212  -44.138 0.05 10.07 ? 261  GLY A CA    2  
ATOM   8614   C  C     B GLY A 1 262 ? 17.484  9.901   -43.582 0.05 10.00 ? 261  GLY A C     2  
ATOM   8615   O  O     B GLY A 1 262 ? 16.763  9.098   -44.162 0.05 10.10 ? 261  GLY A O     2  
ATOM   8616   N  N     B TRP A 1 263 ? 17.117  10.540  -42.475 0.05 9.86  ? 262  TRP A N     2  
ATOM   8617   C  CA    B TRP A 1 263 ? 15.833  10.273  -41.813 0.05 9.82  ? 262  TRP A CA    2  
ATOM   8618   C  C     B TRP A 1 263 ? 14.774  11.319  -42.108 0.05 9.82  ? 262  TRP A C     2  
ATOM   8619   O  O     B TRP A 1 263 ? 15.062  12.507  -42.190 0.05 9.78  ? 262  TRP A O     2  
ATOM   8620   C  CB    B TRP A 1 263 ? 16.016  10.181  -40.298 0.05 9.72  ? 262  TRP A CB    2  
ATOM   8621   C  CG    B TRP A 1 263 ? 16.784  8.984   -39.876 0.05 9.76  ? 262  TRP A CG    2  
ATOM   8622   C  CD1   B TRP A 1 263 ? 18.119  8.761   -40.063 0.05 9.79  ? 262  TRP A CD1   2  
ATOM   8623   C  CD2   B TRP A 1 263 ? 16.272  7.830   -39.194 0.05 9.79  ? 262  TRP A CD2   2  
ATOM   8624   N  NE1   B TRP A 1 263 ? 18.473  7.538   -39.529 0.05 9.86  ? 262  TRP A NE1   2  
ATOM   8625   C  CE2   B TRP A 1 263 ? 17.355  6.949   -38.993 0.05 9.85  ? 262  TRP A CE2   2  
ATOM   8626   C  CE3   B TRP A 1 263 ? 15.004  7.461   -38.730 0.05 9.80  ? 262  TRP A CE3   2  
ATOM   8627   C  CZ2   B TRP A 1 263 ? 17.206  5.711   -38.356 0.05 9.90  ? 262  TRP A CZ2   2  
ATOM   8628   C  CZ3   B TRP A 1 263 ? 14.856  6.235   -38.095 0.05 9.85  ? 262  TRP A CZ3   2  
ATOM   8629   C  CH2   B TRP A 1 263 ? 15.952  5.376   -37.916 0.05 9.89  ? 262  TRP A CH2   2  
ATOM   8630   N  N     B HIS A 1 264 ? 13.535  10.859  -42.229 0.05 9.88  ? 263  HIS A N     2  
ATOM   8631   C  CA    B HIS A 1 264 ? 12.399  11.747  -42.376 0.05 9.93  ? 263  HIS A CA    2  
ATOM   8632   C  C     B HIS A 1 264 ? 11.334  11.315  -41.387 0.05 9.92  ? 263  HIS A C     2  
ATOM   8633   O  O     B HIS A 1 264 ? 11.002  10.130  -41.314 0.05 9.97  ? 263  HIS A O     2  
ATOM   8634   C  CB    B HIS A 1 264 ? 11.843  11.684  -43.796 0.05 10.09 ? 263  HIS A CB    2  
ATOM   8635   C  CG    B HIS A 1 264 ? 10.662  12.576  -44.009 0.05 10.19 ? 263  HIS A CG    2  
ATOM   8636   N  ND1   B HIS A 1 264 ? 10.787  13.907  -44.349 0.05 10.18 ? 263  HIS A ND1   2  
ATOM   8637   C  CD2   B HIS A 1 264 ? 9.333   12.338  -43.901 0.05 10.31 ? 263  HIS A CD2   2  
ATOM   8638   C  CE1   B HIS A 1 264 ? 9.584   14.445  -44.457 0.05 10.31 ? 263  HIS A CE1   2  
ATOM   8639   N  NE2   B HIS A 1 264 ? 8.686   13.516  -44.181 0.05 10.39 ? 263  HIS A NE2   2  
ATOM   8640   N  N     B LEU A 1 265 ? 10.815  12.278  -40.634 0.05 9.89  ? 264  LEU A N     2  
ATOM   8641   C  CA    B LEU A 1 265 ? 9.839   12.014  -39.583 0.05 9.91  ? 264  LEU A CA    2  
ATOM   8642   C  C     B LEU A 1 265 ? 8.440   12.463  -39.973 0.05 10.05 ? 264  LEU A C     2  
ATOM   8643   O  O     B LEU A 1 265 ? 8.217   13.644  -40.256 0.05 10.08 ? 264  LEU A O     2  
ATOM   8644   C  CB    B LEU A 1 265 ? 10.247  12.711  -38.280 0.05 9.81  ? 264  LEU A CB    2  
ATOM   8645   C  CG    B LEU A 1 265 ? 9.153   12.836  -37.214 0.05 9.88  ? 264  LEU A CG    2  
ATOM   8646   C  CD1   B LEU A 1 265 ? 8.642   11.472  -36.769 0.05 9.94  ? 264  LEU A CD1   2  
ATOM   8647   C  CD2   B LEU A 1 265 ? 9.654   13.648  -36.019 0.05 9.82  ? 264  LEU A CD2   2  
ATOM   8648   N  N     B VAL A 1 266 ? 7.509   11.512  -39.983 0.05 10.15 ? 265  VAL A N     2  
ATOM   8649   C  CA    B VAL A 1 266 ? 6.082   11.807  -40.083 0.05 10.32 ? 265  VAL A CA    2  
ATOM   8650   C  C     B VAL A 1 266 ? 5.542   11.851  -38.665 0.05 10.34 ? 265  VAL A C     2  
ATOM   8651   O  O     B VAL A 1 266 ? 5.353   10.807  -38.035 0.05 10.32 ? 265  VAL A O     2  
ATOM   8652   C  CB    B VAL A 1 266 ? 5.329   10.702  -40.825 0.05 10.47 ? 265  VAL A CB    2  
ATOM   8653   C  CG1   B VAL A 1 266 ? 3.871   11.119  -41.083 0.05 10.68 ? 265  VAL A CG1   2  
ATOM   8654   C  CG2   B VAL A 1 266 ? 6.026   10.378  -42.121 0.05 10.48 ? 265  VAL A CG2   2  
ATOM   8655   N  N     B LEU A 1 267 ? 5.318   13.055  -38.155 0.05 10.41 ? 266  LEU A N     2  
ATOM   8656   C  CA    B LEU A 1 267 ? 4.875   13.218  -36.787 0.05 10.47 ? 266  LEU A CA    2  
ATOM   8657   C  C     B LEU A 1 267 ? 3.367   13.405  -36.739 0.05 10.71 ? 266  LEU A C     2  
ATOM   8658   O  O     B LEU A 1 267 ? 2.807   14.320  -37.367 0.05 10.79 ? 266  LEU A O     2  
ATOM   8659   C  CB    B LEU A 1 267 ? 5.613   14.374  -36.112 0.05 10.35 ? 266  LEU A CB    2  
ATOM   8660   C  CG    B LEU A 1 267 ? 5.446   14.457  -34.599 0.05 10.42 ? 266  LEU A CG    2  
ATOM   8661   C  CD1   B LEU A 1 267 ? 5.833   13.152  -33.959 0.05 10.50 ? 266  LEU A CD1   2  
ATOM   8662   C  CD2   B LEU A 1 267 ? 6.309   15.573  -34.047 0.05 10.27 ? 266  LEU A CD2   2  
ATOM   8663   N  N     B GLN A 1 268 ? 2.715   12.524  -35.987 0.05 10.85 ? 267  GLN A N     2  
ATOM   8664   C  CA    B GLN A 1 268 ? 1.266   12.468  -35.978 0.05 11.12 ? 267  GLN A CA    2  
ATOM   8665   C  C     B GLN A 1 268 ? 0.718   12.760  -34.571 0.05 11.23 ? 267  GLN A C     2  
ATOM   8666   O  O     B GLN A 1 268 ? 1.073   12.098  -33.597 0.05 11.19 ? 267  GLN A O     2  
ATOM   8667   C  CB    B GLN A 1 268 ? 0.818   11.130  -36.570 0.05 11.27 ? 267  GLN A CB    2  
ATOM   8668   C  CG    B GLN A 1 268 ? 0.249   10.154  -35.617 0.05 11.33 ? 267  GLN A CG    2  
ATOM   8669   C  CD    B GLN A 1 268 ? -1.245  10.231  -35.622 0.05 11.63 ? 267  GLN A CD    2  
ATOM   8670   O  OE1   B GLN A 1 268 ? -1.817  10.965  -36.422 0.05 11.81 ? 267  GLN A OE1   2  
ATOM   8671   N  NE2   B GLN A 1 268 ? -1.885  9.491   -34.731 0.05 11.70 ? 267  GLN A NE2   2  
ATOM   8672   N  N     B ILE A 1 269 ? -0.091  13.814  -34.451 0.05 11.39 ? 268  ILE A N     2  
ATOM   8673   C  CA    B ILE A 1 269 ? -0.476  14.307  -33.127 0.05 11.50 ? 268  ILE A CA    2  
ATOM   8674   C  C     B ILE A 1 269 ? -1.952  14.731  -32.959 0.05 11.86 ? 268  ILE A C     2  
ATOM   8675   O  O     B ILE A 1 269 ? -2.215  15.771  -32.371 0.05 12.02 ? 268  ILE A O     2  
ATOM   8676   C  CB    B ILE A 1 269 ? 0.440   15.506  -32.675 0.05 11.37 ? 268  ILE A CB    2  
ATOM   8677   C  CG1   B ILE A 1 269 ? 0.199   16.744  -33.541 0.05 11.42 ? 268  ILE A CG1   2  
ATOM   8678   C  CG2   B ILE A 1 269 ? 1.923   15.146  -32.747 0.05 11.05 ? 268  ILE A CG2   2  
ATOM   8679   C  CD1   B ILE A 1 269 ? 0.772   18.022  -32.973 0.05 11.70 ? 268  ILE A CD1   2  
ATOM   8680   N  N     B GLY A 1 270 ? -2.914  13.937  -33.438 0.05 12.02 ? 269  GLY A N     2  
ATOM   8681   C  CA    B GLY A 1 270 ? -4.334  14.324  -33.388 0.05 12.39 ? 269  GLY A CA    2  
ATOM   8682   C  C     B GLY A 1 270 ? -4.864  15.076  -32.157 0.05 12.71 ? 269  GLY A C     2  
ATOM   8683   O  O     B GLY A 1 270 ? -4.413  14.808  -31.034 0.05 12.90 ? 269  GLY A O     2  
ATOM   8684   N  N     B ARG A 1 271 ? -5.811  16.010  -32.366 0.05 12.80 ? 270  ARG A N     2  
ATOM   8685   C  CA    B ARG A 1 271 ? -6.363  16.864  -31.284 0.05 13.16 ? 270  ARG A CA    2  
ATOM   8686   C  C     B ARG A 1 271 ? -7.302  18.018  -31.686 0.05 13.52 ? 270  ARG A C     2  
ATOM   8687   O  O     B ARG A 1 271 ? -8.377  17.798  -32.244 0.05 13.67 ? 270  ARG A O     2  
ATOM   8688   C  CB    B ARG A 1 271 ? -5.243  17.504  -30.490 0.05 13.07 ? 270  ARG A CB    2  
ATOM   8689   C  CG    B ARG A 1 271 ? -5.226  17.196  -29.029 0.05 13.29 ? 270  ARG A CG    2  
ATOM   8690   C  CD    B ARG A 1 271 ? -3.986  17.844  -28.476 0.05 13.08 ? 270  ARG A CD    2  
ATOM   8691   N  NE    B ARG A 1 271 ? -2.994  17.954  -29.539 0.05 12.64 ? 270  ARG A NE    2  
ATOM   8692   C  CZ    B ARG A 1 271 ? -1.762  18.432  -29.394 0.05 12.41 ? 270  ARG A CZ    2  
ATOM   8693   N  NH1   B ARG A 1 271 ? -1.344  18.881  -28.218 0.05 12.57 ? 270  ARG A NH1   2  
ATOM   8694   N  NH2   B ARG A 1 271 ? -0.950  18.471  -30.438 0.05 12.05 ? 270  ARG A NH2   2  
ATOM   8695   N  N     B LYS A 1 272 ? -6.891  19.254  -31.372 0.05 13.67 ? 271  LYS A N     2  
ATOM   8696   C  CA    B LYS A 1 272 ? -7.779  20.415  -31.563 0.05 14.02 ? 271  LYS A CA    2  
ATOM   8697   C  C     B LYS A 1 272 ? -7.296  21.686  -32.325 0.05 13.90 ? 271  LYS A C     2  
ATOM   8698   O  O     B LYS A 1 272 ? -8.050  22.144  -33.195 0.05 13.94 ? 271  LYS A O     2  
ATOM   8699   C  CB    B LYS A 1 272 ? -8.574  20.745  -30.291 0.05 14.51 ? 271  LYS A CB    2  
ATOM   8700   C  CG    B LYS A 1 272 ? -10.042 20.360  -30.391 0.05 14.84 ? 271  LYS A CG    2  
ATOM   8701   C  CD    B LYS A 1 272 ? -10.545 20.515  -31.828 0.05 15.13 ? 271  LYS A CD    2  
ATOM   8702   C  CE    B LYS A 1 272 ? -11.548 19.424  -32.184 0.05 15.03 ? 271  LYS A CE    2  
ATOM   8703   N  NZ    B LYS A 1 272 ? -11.026 18.509  -33.243 0.05 14.50 ? 271  LYS A NZ    2  
ATOM   8704   N  N     B VAL A 1 273 ? -6.158  22.339  -32.015 0.05 13.77 ? 272  VAL A N     2  
ATOM   8705   C  CA    B VAL A 1 273 ? -5.482  22.475  -30.706 0.05 13.78 ? 272  VAL A CA    2  
ATOM   8706   C  C     B VAL A 1 273 ? -4.826  21.232  -30.069 0.05 13.54 ? 272  VAL A C     2  
ATOM   8707   O  O     B VAL A 1 273 ? -5.522  20.374  -29.540 0.05 13.77 ? 272  VAL A O     2  
ATOM   8708   C  CB    B VAL A 1 273 ? -6.394  23.209  -29.673 0.05 14.31 ? 272  VAL A CB    2  
ATOM   8709   C  CG1   B VAL A 1 273 ? -5.617  23.602  -28.430 0.05 14.34 ? 272  VAL A CG1   2  
ATOM   8710   C  CG2   B VAL A 1 273 ? -7.041  24.437  -30.299 0.05 14.58 ? 272  VAL A CG2   2  
ATOM   8711   N  N     B THR A 1 274 ? -3.488  21.161  -30.064 0.05 13.13 ? 273  THR A N     2  
ATOM   8712   C  CA    B THR A 1 274 ? -2.602  22.233  -30.504 0.05 12.89 ? 273  THR A CA    2  
ATOM   8713   C  C     B THR A 1 274 ? -1.340  21.707  -31.183 0.05 12.44 ? 273  THR A C     2  
ATOM   8714   O  O     B THR A 1 274 ? -0.475  21.133  -30.522 0.05 12.21 ? 273  THR A O     2  
ATOM   8715   C  CB    B THR A 1 274 ? -2.093  23.076  -29.313 0.05 12.96 ? 273  THR A CB    2  
ATOM   8716   O  OG1   B THR A 1 274 ? -2.652  22.579  -28.091 0.05 13.16 ? 273  THR A OG1   2  
ATOM   8717   C  CG2   B THR A 1 274 ? -2.455  24.543  -29.491 0.05 13.25 ? 273  THR A CG2   2  
ATOM   8718   N  N     B PRO A 1 275 ? -1.227  21.916  -32.502 0.05 12.33 ? 274  PRO A N     2  
ATOM   8719   C  CA    B PRO A 1 275 ? 0.010   21.739  -33.276 0.05 11.97 ? 274  PRO A CA    2  
ATOM   8720   C  C     B PRO A 1 275 ? 1.094   22.744  -32.898 0.05 11.72 ? 274  PRO A C     2  
ATOM   8721   O  O     B PRO A 1 275 ? 1.900   23.128  -33.761 0.05 11.42 ? 274  PRO A O     2  
ATOM   8722   C  CB    B PRO A 1 275 ? -0.454  21.996  -34.714 0.05 12.08 ? 274  PRO A CB    2  
ATOM   8723   C  CG    B PRO A 1 275 ? -1.876  21.559  -34.719 0.05 12.41 ? 274  PRO A CG    2  
ATOM   8724   C  CD    B PRO A 1 275 ? -2.404  22.021  -33.385 0.05 12.63 ? 274  PRO A CD    2  
ATOM   8725   N  N     B ALA A 1 276 ? 1.119   23.161  -31.636 0.05 11.87 ? 275  ALA A N     2  
ATOM   8726   C  CA    B ALA A 1 276 ? 2.032   24.214  -31.181 0.05 11.69 ? 275  ALA A CA    2  
ATOM   8727   C  C     B ALA A 1 276 ? 2.869   23.799  -29.981 0.05 11.55 ? 275  ALA A C     2  
ATOM   8728   O  O     B ALA A 1 276 ? 3.240   24.632  -29.156 0.05 11.54 ? 275  ALA A O     2  
ATOM   8729   C  CB    B ALA A 1 276 ? 1.271   25.493  -30.866 0.05 11.94 ? 275  ALA A CB    2  
ATOM   8730   N  N     B GLU A 1 277 ? 3.186   22.515  -29.897 0.05 11.46 ? 276  GLU A N     2  
ATOM   8731   C  CA    B GLU A 1 277 ? 4.024   22.033  -28.812 0.05 11.35 ? 276  GLU A CA    2  
ATOM   8732   C  C     B GLU A 1 277 ? 5.482   22.398  -29.121 0.05 11.02 ? 276  GLU A C     2  
ATOM   8733   O  O     B GLU A 1 277 ? 6.135   23.095  -28.350 0.05 10.97 ? 276  GLU A O     2  
ATOM   8734   C  CB    B GLU A 1 277 ? 3.868   20.516  -28.636 0.05 11.42 ? 276  GLU A CB    2  
ATOM   8735   N  N     B LEU A 1 278 ? 5.982   21.922  -30.261 0.05 10.83 ? 277  LEU A N     2  
ATOM   8736   C  CA    B LEU A 1 278 ? 7.341   22.232  -30.684 0.05 10.54 ? 277  LEU A CA    2  
ATOM   8737   C  C     B LEU A 1 278 ? 7.320   23.430  -31.639 0.05 10.47 ? 277  LEU A C     2  
ATOM   8738   O  O     B LEU A 1 278 ? 7.399   24.586  -31.214 0.05 10.58 ? 277  LEU A O     2  
ATOM   8739   N  N     B GLY A 1 279 ? 7.220   23.150  -32.937 0.05 10.31 ? 278  GLY A N     2  
ATOM   8740   C  CA    B GLY A 1 279 ? 6.915   24.189  -33.901 0.05 10.24 ? 278  GLY A CA    2  
ATOM   8741   C  C     B GLY A 1 279 ? 8.043   24.726  -34.745 0.05 10.02 ? 278  GLY A C     2  
ATOM   8742   O  O     B GLY A 1 279 ? 7.931   24.798  -35.976 0.05 10.01 ? 278  GLY A O     2  
ATOM   8743   N  N     B GLU A 1 280 ? 9.114   25.161  -34.091 0.05 9.86  ? 279  GLU A N     2  
ATOM   8744   C  CA    B GLU A 1 280 ? 10.352  25.420  -34.812 0.05 9.68  ? 279  GLU A CA    2  
ATOM   8745   C  C     B GLU A 1 280 ? 10.690  24.035  -35.358 0.05 9.68  ? 279  GLU A C     2  
ATOM   8746   O  O     B GLU A 1 280 ? 11.216  23.186  -34.631 0.05 9.63  ? 279  GLU A O     2  
ATOM   8747   C  CB    B GLU A 1 280 ? 11.435  25.941  -33.858 0.05 9.55  ? 279  GLU A CB    2  
ATOM   8748   N  N     B LEU A 1 281 ? 10.304  23.789  -36.615 0.05 9.77  ? 280  LEU A N     2  
ATOM   8749   C  CA    B LEU A 1 281 ? 10.489  22.475  -37.243 0.05 9.81  ? 280  LEU A CA    2  
ATOM   8750   C  C     B LEU A 1 281 ? 11.729  22.348  -38.136 0.05 9.71  ? 280  LEU A C     2  
ATOM   8751   O  O     B LEU A 1 281 ? 11.942  23.156  -39.042 0.05 9.76  ? 280  LEU A O     2  
ATOM   8752   C  CB    B LEU A 1 281 ? 9.277   22.098  -38.085 0.05 10.01 ? 280  LEU A CB    2  
ATOM   8753   C  CG    B LEU A 1 281 ? 7.953   21.766  -37.402 0.05 10.19 ? 280  LEU A CG    2  
ATOM   8754   C  CD1   B LEU A 1 281 ? 6.872   21.723  -38.439 0.05 10.42 ? 280  LEU A CD1   2  
ATOM   8755   C  CD2   B LEU A 1 281 ? 8.039   20.448  -36.665 0.05 10.15 ? 280  LEU A CD2   2  
ATOM   8756   N  N     B PRO A 1 282 ? 12.534  21.300  -37.903 0.05 9.59  ? 281  PRO A N     2  
ATOM   8757   C  CA    B PRO A 1 282 ? 13.547  20.986  -38.914 0.05 9.52  ? 281  PRO A CA    2  
ATOM   8758   C  C     B PRO A 1 282 ? 12.827  20.623  -40.205 0.05 9.64  ? 281  PRO A C     2  
ATOM   8759   O  O     B PRO A 1 282 ? 11.635  20.317  -40.185 0.05 9.75  ? 281  PRO A O     2  
ATOM   8760   C  CB    B PRO A 1 282 ? 14.248  19.754  -38.345 0.05 9.44  ? 281  PRO A CB    2  
ATOM   8761   C  CG    B PRO A 1 282 ? 13.955  19.780  -36.866 0.05 9.42  ? 281  PRO A CG    2  
ATOM   8762   C  CD    B PRO A 1 282 ? 12.578  20.373  -36.761 0.05 9.55  ? 281  PRO A CD    2  
ATOM   8763   N  N     B ASP A 1 283 ? 13.526  20.651  -41.327 0.05 9.64  ? 282  ASP A N     2  
ATOM   8764   C  CA    B ASP A 1 283 ? 12.828  20.470  -42.584 0.05 9.79  ? 282  ASP A CA    2  
ATOM   8765   C  C     B ASP A 1 283 ? 12.601  19.016  -42.987 0.05 9.85  ? 282  ASP A C     2  
ATOM   8766   O  O     B ASP A 1 283 ? 11.928  18.741  -43.980 0.05 10.00 ? 282  ASP A O     2  
ATOM   8767   C  CB    B ASP A 1 283 ? 13.485  21.294  -43.679 0.05 9.82  ? 282  ASP A CB    2  
ATOM   8768   C  CG    B ASP A 1 283 ? 13.279  22.773  -43.453 0.05 9.80  ? 282  ASP A CG    2  
ATOM   8769   O  OD1   B ASP A 1 283 ? 13.633  23.276  -42.367 0.05 9.68  ? 282  ASP A OD1   2  
ATOM   8770   O  OD2   B ASP A 1 283 ? 12.701  23.426  -44.322 0.05 9.93  ? 282  ASP A OD2   2  
ATOM   8771   N  N     B ASN A 1 284 ? 13.126  18.089  -42.191 0.05 9.74  ? 283  ASN A N     2  
ATOM   8772   C  CA    B ASN A 1 284 ? 12.860  16.674  -42.434 0.05 9.79  ? 283  ASN A CA    2  
ATOM   8773   C  C     B ASN A 1 284 ? 11.734  16.138  -41.553 0.05 9.81  ? 283  ASN A C     2  
ATOM   8774   O  O     B ASN A 1 284 ? 11.721  14.959  -41.204 0.05 9.81  ? 283  ASN A O     2  
ATOM   8775   C  CB    B ASN A 1 284 ? 14.125  15.830  -42.247 0.05 9.71  ? 283  ASN A CB    2  
ATOM   8776   C  CG    B ASN A 1 284 ? 14.587  15.785  -40.797 0.05 9.59  ? 283  ASN A CG    2  
ATOM   8777   O  OD1   B ASN A 1 284 ? 14.554  16.790  -40.100 0.05 9.53  ? 283  ASN A OD1   2  
ATOM   8778   N  ND2   B ASN A 1 284 ? 15.002  14.606  -40.338 0.05 9.58  ? 283  ASN A ND2   2  
ATOM   8779   N  N     B VAL A 1 285 ? 10.785  17.006  -41.207 0.05 9.85  ? 284  VAL A N     2  
ATOM   8780   C  CA    B VAL A 1 285 ? 9.657   16.620  -40.358 0.05 9.91  ? 284  VAL A CA    2  
ATOM   8781   C  C     B VAL A 1 285 ? 8.312   17.001  -40.992 0.05 10.10 ? 284  VAL A C     2  
ATOM   8782   O  O     B VAL A 1 285 ? 8.226   17.923  -41.799 0.05 10.15 ? 284  VAL A O     2  
ATOM   8783   C  CB    B VAL A 1 285 ? 9.773   17.274  -38.951 0.05 9.83  ? 284  VAL A CB    2  
ATOM   8784   C  CG1   B VAL A 1 285 ? 8.631   16.824  -38.012 0.05 9.94  ? 284  VAL A CG1   2  
ATOM   8785   C  CG2   B VAL A 1 285 ? 11.113  16.938  -38.317 0.05 9.68  ? 284  VAL A CG2   2  
ATOM   8786   N  N     B GLU A 1 286 ? 7.268   16.261  -40.638 0.05 10.21 ? 285  GLU A N     2  
ATOM   8787   C  CA    B GLU A 1 286 ? 5.897   16.656  -40.921 0.05 10.42 ? 285  GLU A CA    2  
ATOM   8788   C  C     B GLU A 1 286 ? 5.153   16.598  -39.593 0.05 10.49 ? 285  GLU A C     2  
ATOM   8789   O  O     B GLU A 1 286 ? 5.320   15.632  -38.846 0.05 10.43 ? 285  GLU A O     2  
ATOM   8790   C  CB    B GLU A 1 286 ? 5.255   15.661  -41.883 0.05 10.58 ? 285  GLU A CB    2  
ATOM   8791   C  CG    B GLU A 1 286 ? 6.172   15.150  -42.994 0.05 10.54 ? 285  GLU A CG    2  
ATOM   8792   C  CD    B GLU A 1 286 ? 5.403   14.366  -44.046 0.05 10.75 ? 285  GLU A CD    2  
ATOM   8793   O  OE1   B GLU A 1 286 ? 4.172   14.240  -43.893 0.05 10.95 ? 285  GLU A OE1   2  
ATOM   8794   O  OE2   B GLU A 1 286 ? 6.015   13.881  -45.025 0.05 10.74 ? 285  GLU A OE2   2  
ATOM   8795   N  N     B VAL A 1 287 ? 4.336   17.601  -39.278 0.05 10.65 ? 286  VAL A N     2  
ATOM   8796   C  CA    B VAL A 1 287 ? 3.513   17.510  -38.070 0.05 10.78 ? 286  VAL A CA    2  
ATOM   8797   C  C     B VAL A 1 287 ? 2.000   17.544  -38.357 0.05 11.07 ? 286  VAL A C     2  
ATOM   8798   O  O     B VAL A 1 287 ? 1.448   18.573  -38.740 0.05 11.20 ? 286  VAL A O     2  
ATOM   8799   C  CB    B VAL A 1 287 ? 3.940   18.528  -36.972 0.05 10.77 ? 286  VAL A CB    2  
ATOM   8800   C  CG1   B VAL A 1 287 ? 3.899   19.957  -37.489 0.05 10.81 ? 286  VAL A CG1   2  
ATOM   8801   C  CG2   B VAL A 1 287 ? 3.067   18.370  -35.727 0.05 11.00 ? 286  VAL A CG2   2  
ATOM   8802   N  N     B HIS A 1 288 ? 1.352   16.392  -38.168 0.05 11.17 ? 287  HIS A N     2  
ATOM   8803   C  CA    B HIS A 1 288 ? -0.052  16.167  -38.538 0.05 11.46 ? 287  HIS A CA    2  
ATOM   8804   C  C     B HIS A 1 288 ? -0.929  15.839  -37.340 0.05 11.64 ? 287  HIS A C     2  
ATOM   8805   O  O     B HIS A 1 288 ? -0.474  15.187  -36.392 0.05 11.52 ? 287  HIS A O     2  
ATOM   8806   C  CB    B HIS A 1 288 ? -0.170  14.936  -39.432 0.05 11.46 ? 287  HIS A CB    2  
ATOM   8807   C  CG    B HIS A 1 288 ? 0.398   15.099  -40.802 0.05 11.39 ? 287  HIS A CG    2  
ATOM   8808   N  ND1   B HIS A 1 288 ? -0.231  15.829  -41.785 0.05 11.56 ? 287  HIS A ND1   2  
ATOM   8809   C  CD2   B HIS A 1 288 ? 1.516   14.586  -41.368 0.05 11.22 ? 287  HIS A CD2   2  
ATOM   8810   C  CE1   B HIS A 1 288 ? 0.484   15.774  -42.895 0.05 11.49 ? 287  HIS A CE1   2  
ATOM   8811   N  NE2   B HIS A 1 288 ? 1.548   15.025  -42.669 0.05 11.29 ? 287  HIS A NE2   2  
ATOM   8812   N  N     B ASP A 1 289 ? -2.200  16.240  -37.401 0.05 11.95 ? 288  ASP A N     2  
ATOM   8813   C  CA    B ASP A 1 289 ? -3.193  15.645  -36.508 0.05 12.20 ? 288  ASP A CA    2  
ATOM   8814   C  C     B ASP A 1 289 ? -3.552  14.207  -36.945 0.05 12.26 ? 288  ASP A C     2  
ATOM   8815   O  O     B ASP A 1 289 ? -3.263  13.264  -36.219 0.05 12.34 ? 288  ASP A O     2  
ATOM   8816   C  CB    B ASP A 1 289 ? -4.422  16.555  -36.291 0.05 12.56 ? 288  ASP A CB    2  
ATOM   8817   C  CG    B ASP A 1 289 ? -5.227  16.786  -37.557 0.05 12.72 ? 288  ASP A CG    2  
ATOM   8818   O  OD1   B ASP A 1 289 ? -6.375  17.280  -37.464 0.05 13.09 ? 288  ASP A OD1   2  
ATOM   8819   O  OD2   B ASP A 1 289 ? -4.722  16.466  -38.649 0.05 12.51 ? 288  ASP A OD2   2  
ATOM   8820   N  N     B TRP A 1 290 ? -4.135  14.035  -38.131 0.05 12.23 ? 289  TRP A N     2  
ATOM   8821   C  CA    B TRP A 1 290 ? -4.478  12.703  -38.646 0.05 12.27 ? 289  TRP A CA    2  
ATOM   8822   C  C     B TRP A 1 290 ? -3.633  12.295  -39.853 0.05 12.09 ? 289  TRP A C     2  
ATOM   8823   O  O     B TRP A 1 290 ? -3.311  13.123  -40.703 0.05 12.09 ? 289  TRP A O     2  
ATOM   8824   C  CB    B TRP A 1 290 ? -5.965  12.631  -39.033 0.05 12.67 ? 289  TRP A CB    2  
ATOM   8825   C  CG    B TRP A 1 290 ? -6.400  11.277  -39.562 0.05 12.73 ? 289  TRP A CG    2  
ATOM   8826   C  CD1   B TRP A 1 290 ? -6.947  10.253  -38.841 0.05 12.80 ? 289  TRP A CD1   2  
ATOM   8827   C  CD2   B TRP A 1 290 ? -6.331  10.814  -40.920 0.05 12.76 ? 289  TRP A CD2   2  
ATOM   8828   N  NE1   B TRP A 1 290 ? -7.216  9.181   -39.662 0.05 12.84 ? 289  TRP A NE1   2  
ATOM   8829   C  CE2   B TRP A 1 290 ? -6.844  9.499   -40.942 0.05 12.83 ? 289  TRP A CE2   2  
ATOM   8830   C  CE3   B TRP A 1 290 ? -5.880  11.379  -42.115 0.05 12.75 ? 289  TRP A CE3   2  
ATOM   8831   C  CZ2   B TRP A 1 290 ? -6.921  8.746   -42.113 0.05 12.89 ? 289  TRP A CZ2   2  
ATOM   8832   C  CZ3   B TRP A 1 290 ? -5.958  10.627  -43.279 0.05 12.83 ? 289  TRP A CZ3   2  
ATOM   8833   C  CH2   B TRP A 1 290 ? -6.470  9.324   -43.267 0.05 12.90 ? 289  TRP A CH2   2  
ATOM   8834   N  N     B VAL A 1 291 ? -3.290  11.008  -39.935 0.05 11.97 ? 290  VAL A N     2  
ATOM   8835   C  CA    B VAL A 1 291 ? -2.563  10.476  -41.084 0.05 11.84 ? 290  VAL A CA    2  
ATOM   8836   C  C     B VAL A 1 291 ? -3.157  9.152   -41.559 0.05 11.97 ? 290  VAL A C     2  
ATOM   8837   O  O     B VAL A 1 291 ? -3.820  8.452   -40.789 0.05 12.05 ? 290  VAL A O     2  
ATOM   8838   C  CB    B VAL A 1 291 ? -1.052  10.263  -40.766 0.05 11.51 ? 290  VAL A CB    2  
ATOM   8839   C  CG1   B VAL A 1 291 ? -0.419  11.545  -40.262 0.05 11.38 ? 290  VAL A CG1   2  
ATOM   8840   C  CG2   B VAL A 1 291 ? -0.861  9.131   -39.759 0.05 11.41 ? 290  VAL A CG2   2  
ATOM   8841   N  N     B PRO A 1 292 ? -2.924  8.807   -42.836 0.05 12.01 ? 291  PRO A N     2  
ATOM   8842   C  CA    B PRO A 1 292 ? -3.302  7.489   -43.361 0.05 12.08 ? 291  PRO A CA    2  
ATOM   8843   C  C     B PRO A 1 292 ? -2.243  6.454   -42.967 0.05 11.80 ? 291  PRO A C     2  
ATOM   8844   O  O     B PRO A 1 292 ? -1.284  6.217   -43.706 0.05 11.65 ? 291  PRO A O     2  
ATOM   8845   C  CB    B PRO A 1 292 ? -3.323  7.714   -44.872 0.05 12.22 ? 291  PRO A CB    2  
ATOM   8846   C  CG    B PRO A 1 292 ? -2.332  8.818   -45.093 0.05 12.09 ? 291  PRO A CG    2  
ATOM   8847   C  CD    B PRO A 1 292 ? -2.439  9.711   -43.898 0.05 12.04 ? 291  PRO A CD    2  
ATOM   8848   N  N     B GLN A 1 293 ? -2.438  5.842   -41.802 0.05 11.76 ? 292  GLN A N     2  
ATOM   8849   C  CA    B GLN A 1 293 ? -1.376  5.115   -41.109 0.05 11.51 ? 292  GLN A CA    2  
ATOM   8850   C  C     B GLN A 1 293 ? -0.851  3.881   -41.836 0.05 11.44 ? 292  GLN A C     2  
ATOM   8851   O  O     B GLN A 1 293 ? 0.360   3.701   -41.962 0.05 11.25 ? 292  GLN A O     2  
ATOM   8852   C  CB    B GLN A 1 293 ? -1.822  4.734   -39.694 0.05 11.54 ? 292  GLN A CB    2  
ATOM   8853   C  CG    B GLN A 1 293 ? -0.734  4.047   -38.876 0.05 11.32 ? 292  GLN A CG    2  
ATOM   8854   C  CD    B GLN A 1 293 ? -1.017  4.063   -37.385 0.05 11.35 ? 292  GLN A CD    2  
ATOM   8855   O  OE1   B GLN A 1 293 ? -1.099  5.124   -36.765 0.05 11.37 ? 292  GLN A OE1   2  
ATOM   8856   N  NE2   B GLN A 1 293 ? -1.171  2.877   -36.802 0.05 11.37 ? 292  GLN A NE2   2  
ATOM   8857   N  N     B LEU A 1 294 ? -1.755  3.027   -42.303 0.05 11.62 ? 293  LEU A N     2  
ATOM   8858   C  CA    B LEU A 1 294 ? -1.337  1.807   -42.976 0.05 11.59 ? 293  LEU A CA    2  
ATOM   8859   C  C     B LEU A 1 294 ? -0.587  2.165   -44.251 0.05 11.59 ? 293  LEU A C     2  
ATOM   8860   O  O     B LEU A 1 294 ? 0.364   1.493   -44.628 0.05 11.48 ? 293  LEU A O     2  
ATOM   8861   C  CB    B LEU A 1 294 ? -2.540  0.923   -43.297 0.05 11.80 ? 293  LEU A CB    2  
ATOM   8862   C  CG    B LEU A 1 294 ? -2.232  -0.533  -43.644 0.05 11.77 ? 293  LEU A CG    2  
ATOM   8863   C  CD1   B LEU A 1 294 ? -1.802  -1.316  -42.401 0.05 11.54 ? 293  LEU A CD1   2  
ATOM   8864   C  CD2   B LEU A 1 294 ? -3.439  -1.190  -44.299 0.05 11.98 ? 293  LEU A CD2   2  
ATOM   8865   N  N     B ALA A 1 295 ? -1.024  3.236   -44.906 0.05 11.74 ? 294  ALA A N     2  
ATOM   8866   C  CA    B ALA A 1 295 ? -0.352  3.730   -46.097 0.05 11.77 ? 294  ALA A CA    2  
ATOM   8867   C  C     B ALA A 1 295 ? 1.085   4.137   -45.787 0.05 11.51 ? 294  ALA A C     2  
ATOM   8868   O  O     B ALA A 1 295 ? 2.013   3.769   -46.515 0.05 11.48 ? 294  ALA A O     2  
ATOM   8869   C  CB    B ALA A 1 295 ? -1.122  4.905   -46.694 0.05 11.97 ? 294  ALA A CB    2  
ATOM   8870   N  N     B ILE A 1 296 ? 1.263   4.891   -44.705 0.05 11.36 ? 295  ILE A N     2  
ATOM   8871   C  CA    B ILE A 1 296 ? 2.595   5.348   -44.304 0.05 11.13 ? 295  ILE A CA    2  
ATOM   8872   C  C     B ILE A 1 296 ? 3.478   4.201   -43.819 0.05 10.98 ? 295  ILE A C     2  
ATOM   8873   O  O     B ILE A 1 296 ? 4.646   4.118   -44.187 0.05 10.89 ? 295  ILE A O     2  
ATOM   8874   C  CB    B ILE A 1 296 ? 2.531   6.465   -43.240 0.05 11.03 ? 295  ILE A CB    2  
ATOM   8875   C  CG1   B ILE A 1 296 ? 1.714   7.649   -43.771 0.05 11.19 ? 295  ILE A CG1   2  
ATOM   8876   C  CG2   B ILE A 1 296 ? 3.936   6.900   -42.843 0.05 10.80 ? 295  ILE A CG2   2  
ATOM   8877   C  CD1   B ILE A 1 296 ? 1.681   8.868   -42.860 0.05 11.16 ? 295  ILE A CD1   2  
ATOM   8878   N  N     B LEU A 1 297 ? 2.921   3.308   -43.005 0.05 10.99 ? 296  LEU A N     2  
ATOM   8879   C  CA    B LEU A 1 297 ? 3.679   2.143   -42.549 0.05 10.88 ? 296  LEU A CA    2  
ATOM   8880   C  C     B LEU A 1 297 ? 4.175   1.297   -43.722 0.05 10.94 ? 296  LEU A C     2  
ATOM   8881   O  O     B LEU A 1 297 ? 5.205   0.641   -43.622 0.05 10.84 ? 296  LEU A O     2  
ATOM   8882   C  CB    B LEU A 1 297 ? 2.848   1.290   -41.585 0.05 10.92 ? 296  LEU A CB    2  
ATOM   8883   C  CG    B LEU A 1 297 ? 2.643   1.907   -40.199 0.05 10.86 ? 296  LEU A CG    2  
ATOM   8884   C  CD1   B LEU A 1 297 ? 1.672   1.079   -39.363 0.05 10.96 ? 296  LEU A CD1   2  
ATOM   8885   C  CD2   B LEU A 1 297 ? 3.978   2.032   -39.480 0.05 10.67 ? 296  LEU A CD2   2  
ATOM   8886   N  N     B ARG A 1 298 ? 3.443   1.324   -44.835 0.05 11.13 ? 297  ARG A N     2  
ATOM   8887   C  CA    B ARG A 1 298 ? 3.871   0.615   -46.030 0.05 11.23 ? 297  ARG A CA    2  
ATOM   8888   C  C     B ARG A 1 298 ? 5.081   1.254   -46.719 0.05 11.15 ? 297  ARG A C     2  
ATOM   8889   O  O     B ARG A 1 298 ? 5.718   0.623   -47.570 0.05 11.17 ? 297  ARG A O     2  
ATOM   8890   C  CB    B ARG A 1 298 ? 2.720   0.498   -47.027 0.05 11.48 ? 297  ARG A CB    2  
ATOM   8891   C  CG    B ARG A 1 298 ? 1.698   -0.569  -46.677 0.05 11.61 ? 297  ARG A CG    2  
ATOM   8892   C  CD    B ARG A 1 298 ? 0.788   -0.791  -47.861 0.05 11.89 ? 297  ARG A CD    2  
ATOM   8893   N  NE    B ARG A 1 298 ? 0.117   0.438   -48.275 0.05 12.04 ? 297  ARG A NE    2  
ATOM   8894   C  CZ    B ARG A 1 298 ? -1.195  0.638   -48.195 0.05 12.19 ? 297  ARG A CZ    2  
ATOM   8895   N  NH1   B ARG A 1 298 ? -1.989  -0.319  -47.718 0.05 12.20 ? 297  ARG A NH1   2  
ATOM   8896   N  NH2   B ARG A 1 298 ? -1.712  1.795   -48.597 0.05 12.35 ? 297  ARG A NH2   2  
ATOM   8897   N  N     B GLN A 1 299 ? 5.384   2.503   -46.369 0.05 11.07 ? 298  GLN A N     2  
ATOM   8898   C  CA    B GLN A 1 299 ? 6.560   3.177   -46.915 0.05 10.99 ? 298  GLN A CA    2  
ATOM   8899   C  C     B GLN A 1 299 ? 7.522   3.591   -45.792 0.05 10.77 ? 298  GLN A C     2  
ATOM   8900   O  O     B GLN A 1 299 ? 8.387   4.450   -45.989 0.05 10.71 ? 298  GLN A O     2  
ATOM   8901   C  CB    B GLN A 1 299 ? 6.159   4.376   -47.806 0.05 11.14 ? 298  GLN A CB    2  
ATOM   8902   C  CG    B GLN A 1 299 ? 6.819   4.359   -49.217 0.05 11.34 ? 298  GLN A CG    2  
ATOM   8903   C  CD    B GLN A 1 299 ? 6.173   5.293   -50.255 0.05 11.45 ? 298  GLN A CD    2  
ATOM   8904   O  OE1   B GLN A 1 299 ? 6.840   5.758   -51.194 0.05 11.62 ? 298  GLN A OE1   2  
ATOM   8905   N  NE2   B GLN A 1 299 ? 4.876   5.541   -50.107 0.05 11.38 ? 298  GLN A NE2   2  
ATOM   8906   N  N     B ALA A 1 300 ? 7.369   2.965   -44.620 0.05 10.67 ? 299  ALA A N     2  
ATOM   8907   C  CA    B ALA A 1 300 ? 8.143   3.336   -43.430 0.05 10.49 ? 299  ALA A CA    2  
ATOM   8908   C  C     B ALA A 1 300 ? 9.215   2.312   -43.052 0.05 10.43 ? 299  ALA A C     2  
ATOM   8909   O  O     B ALA A 1 300 ? 9.172   1.159   -43.482 0.05 10.50 ? 299  ALA A O     2  
ATOM   8910   C  CB    B ALA A 1 300 ? 7.212   3.579   -42.240 0.05 10.47 ? 299  ALA A CB    2  
ATOM   8911   N  N     B ASP A 1 301 ? 10.163  2.744   -42.226 0.05 10.33 ? 300  ASP A N     2  
ATOM   8912   C  CA    B ASP A 1 301 ? 11.230  1.869   -41.753 0.05 10.30 ? 300  ASP A CA    2  
ATOM   8913   C  C     B ASP A 1 301 ? 11.216  1.720   -40.244 0.05 10.22 ? 300  ASP A C     2  
ATOM   8914   O  O     B ASP A 1 301 ? 11.869  0.838   -39.690 0.05 10.23 ? 300  ASP A O     2  
ATOM   8915   C  CB    B ASP A 1 301 ? 12.580  2.419   -42.189 0.05 10.30 ? 300  ASP A CB    2  
ATOM   8916   C  CG    B ASP A 1 301 ? 12.641  2.641   -43.671 0.05 10.42 ? 300  ASP A CG    2  
ATOM   8917   O  OD1   B ASP A 1 301 ? 12.905  1.649   -44.393 0.05 10.55 ? 300  ASP A OD1   2  
ATOM   8918   O  OD2   B ASP A 1 301 ? 12.384  3.790   -44.106 0.05 10.40 ? 300  ASP A OD2   2  
ATOM   8919   N  N     B LEU A 1 302 ? 10.489  2.605   -39.581 0.05 10.17 ? 301  LEU A N     2  
ATOM   8920   C  CA    B LEU A 1 302 ? 10.395  2.562   -38.135 0.05 10.13 ? 301  LEU A CA    2  
ATOM   8921   C  C     B LEU A 1 302 ? 9.051   3.105   -37.712 0.05 10.16 ? 301  LEU A C     2  
ATOM   8922   O  O     B LEU A 1 302 ? 8.548   4.051   -38.311 0.05 10.17 ? 301  LEU A O     2  
ATOM   8923   C  CB    B LEU A 1 302 ? 11.506  3.391   -37.504 0.05 10.04 ? 301  LEU A CB    2  
ATOM   8924   C  CG    B LEU A 1 302 ? 11.583  3.278   -35.985 0.05 10.04 ? 301  LEU A CG    2  
ATOM   8925   C  CD1   B LEU A 1 302 ? 11.979  1.849   -35.571 0.05 10.11 ? 301  LEU A CD1   2  
ATOM   8926   C  CD2   B LEU A 1 302 ? 12.566  4.286   -35.432 0.05 9.96  ? 301  LEU A CD2   2  
ATOM   8927   N  N     B PHE A 1 303 ? 8.470   2.506   -36.679 0.05 10.22 ? 302  PHE A N     2  
ATOM   8928   C  CA    B PHE A 1 303 ? 7.180   2.959   -36.172 0.05 10.29 ? 302  PHE A CA    2  
ATOM   8929   C  C     B PHE A 1 303 ? 7.295   3.196   -34.663 0.05 10.31 ? 302  PHE A C     2  
ATOM   8930   O  O     B PHE A 1 303 ? 7.555   2.267   -33.905 0.05 10.35 ? 302  PHE A O     2  
ATOM   8931   C  CB    B PHE A 1 303 ? 6.142   1.880   -36.494 0.05 10.41 ? 302  PHE A CB    2  
ATOM   8932   C  CG    B PHE A 1 303 ? 4.737   2.194   -36.048 0.05 10.54 ? 302  PHE A CG    2  
ATOM   8933   C  CD1   B PHE A 1 303 ? 4.308   3.497   -35.853 0.05 10.56 ? 302  PHE A CD1   2  
ATOM   8934   C  CD2   B PHE A 1 303 ? 3.834   1.156   -35.844 0.05 10.67 ? 302  PHE A CD2   2  
ATOM   8935   C  CE1   B PHE A 1 303 ? 3.002   3.764   -35.449 0.05 10.73 ? 302  PHE A CE1   2  
ATOM   8936   C  CE2   B PHE A 1 303 ? 2.530   1.407   -35.446 0.05 10.82 ? 302  PHE A CE2   2  
ATOM   8937   C  CZ    B PHE A 1 303 ? 2.108   2.712   -35.247 0.05 10.87 ? 302  PHE A CZ    2  
ATOM   8938   N  N     B VAL A 1 304 ? 7.133   4.447   -34.234 0.05 10.30 ? 303  VAL A N     2  
ATOM   8939   C  CA    B VAL A 1 304 ? 7.057   4.748   -32.809 0.05 10.36 ? 303  VAL A CA    2  
ATOM   8940   C  C     B VAL A 1 304 ? 5.576   4.726   -32.437 0.05 10.53 ? 303  VAL A C     2  
ATOM   8941   O  O     B VAL A 1 304 ? 4.805   5.575   -32.883 0.05 10.57 ? 303  VAL A O     2  
ATOM   8942   C  CB    B VAL A 1 304 ? 7.681   6.116   -32.470 0.05 10.28 ? 303  VAL A CB    2  
ATOM   8943   C  CG1   B VAL A 1 304 ? 7.613   6.382   -30.966 0.05 10.39 ? 303  VAL A CG1   2  
ATOM   8944   C  CG2   B VAL A 1 304 ? 9.112   6.173   -32.945 0.05 10.14 ? 303  VAL A CG2   2  
ATOM   8945   N  N     B THR A 1 305 ? 5.186   3.726   -31.653 0.05 10.65 ? 304  THR A N     2  
ATOM   8946   C  CA    B THR A 1 305 ? 3.775   3.415   -31.420 0.05 10.84 ? 304  THR A CA    2  
ATOM   8947   C  C     B THR A 1 305 ? 3.460   3.337   -29.925 0.05 11.00 ? 304  THR A C     2  
ATOM   8948   O  O     B THR A 1 305 ? 4.338   3.049   -29.119 0.05 10.98 ? 304  THR A O     2  
ATOM   8949   C  CB    B THR A 1 305 ? 3.415   2.057   -32.080 0.05 10.86 ? 304  THR A CB    2  
ATOM   8950   O  OG1   B THR A 1 305 ? 2.039   1.736   -31.838 0.05 11.07 ? 304  THR A OG1   2  
ATOM   8951   C  CG2   B THR A 1 305 ? 4.312   0.941   -31.543 0.05 10.82 ? 304  THR A CG2   2  
ATOM   8952   N  N     B HIS A 1 306 ? 2.211   3.597   -29.547 0.05 11.21 ? 305  HIS A N     2  
ATOM   8953   C  CA    B HIS A 1 306 ? 1.801   3.366   -28.163 0.05 11.43 ? 305  HIS A CA    2  
ATOM   8954   C  C     B HIS A 1 306 ? 1.403   1.906   -27.939 0.05 11.53 ? 305  HIS A C     2  
ATOM   8955   O  O     B HIS A 1 306 ? 1.077   1.512   -26.819 0.05 11.73 ? 305  HIS A O     2  
ATOM   8956   C  CB    B HIS A 1 306 ? 0.649   4.283   -27.755 0.05 11.66 ? 305  HIS A CB    2  
ATOM   8957   C  CG    B HIS A 1 306 ? -0.678  3.873   -28.309 0.05 11.82 ? 305  HIS A CG    2  
ATOM   8958   N  ND1   B HIS A 1 306 ? -0.873  3.594   -29.646 0.05 11.70 ? 305  HIS A ND1   2  
ATOM   8959   C  CD2   B HIS A 1 306 ? -1.886  3.726   -27.713 0.05 12.12 ? 305  HIS A CD2   2  
ATOM   8960   C  CE1   B HIS A 1 306 ? -2.141  3.279   -29.846 0.05 11.91 ? 305  HIS A CE1   2  
ATOM   8961   N  NE2   B HIS A 1 306 ? -2.779  3.357   -28.691 0.05 12.17 ? 305  HIS A NE2   2  
ATOM   8962   N  N     B ALA A 1 307 ? 1.436   1.125   -29.014 0.05 11.41 ? 306  ALA A N     2  
ATOM   8963   C  CA    B ALA A 1 307 ? 1.187   -0.318  -28.970 0.05 11.48 ? 306  ALA A CA    2  
ATOM   8964   C  C     B ALA A 1 307 ? -0.265  -0.693  -28.667 0.05 11.74 ? 306  ALA A C     2  
ATOM   8965   O  O     B ALA A 1 307 ? -0.530  -1.704  -28.012 0.05 11.88 ? 306  ALA A O     2  
ATOM   8966   C  CB    B ALA A 1 307 ? 2.145   -1.018  -28.000 0.05 11.48 ? 306  ALA A CB    2  
ATOM   8967   N  N     B GLY A 1 308 ? -1.201  0.117   -29.157 0.05 11.83 ? 307  GLY A N     2  
ATOM   8968   C  CA    B GLY A 1 308 ? -2.589  -0.308  -29.226 0.05 12.07 ? 307  GLY A CA    2  
ATOM   8969   C  C     B GLY A 1 308 ? -2.725  -1.484  -30.186 0.05 12.00 ? 307  GLY A C     2  
ATOM   8970   O  O     B GLY A 1 308 ? -1.791  -1.805  -30.927 0.05 11.76 ? 307  GLY A O     2  
ATOM   8971   N  N     B ALA A 1 309 ? -3.889  -2.130  -30.188 0.05 12.21 ? 308  ALA A N     2  
ATOM   8972   C  CA    B ALA A 1 309 ? -4.081  -3.330  -31.011 0.05 12.17 ? 308  ALA A CA    2  
ATOM   8973   C  C     B ALA A 1 309 ? -3.886  -3.102  -32.511 0.05 12.02 ? 308  ALA A C     2  
ATOM   8974   O  O     B ALA A 1 309 ? -3.276  -3.919  -33.194 0.05 11.88 ? 308  ALA A O     2  
ATOM   8975   C  CB    B ALA A 1 309 ? -5.459  -3.946  -30.754 0.05 12.46 ? 308  ALA A CB    2  
ATOM   8976   N  N     B GLY A 1 310 ? -4.432  -2.006  -33.025 0.05 12.09 ? 309  GLY A N     2  
ATOM   8977   C  CA    B GLY A 1 310 ? -4.329  -1.702  -34.440 0.05 12.00 ? 309  GLY A CA    2  
ATOM   8978   C  C     B GLY A 1 310 ? -2.905  -1.361  -34.825 0.05 11.72 ? 309  GLY A C     2  
ATOM   8979   O  O     B GLY A 1 310 ? -2.365  -1.904  -35.779 0.05 11.60 ? 309  GLY A O     2  
ATOM   8980   N  N     B GLY A 1 311 ? -2.292  -0.457  -34.072 0.05 11.63 ? 310  GLY A N     2  
ATOM   8981   C  CA    B GLY A 1 311 ? -0.910  -0.081  -34.318 0.05 11.38 ? 310  GLY A CA    2  
ATOM   8982   C  C     B GLY A 1 311 ? 0.026   -1.272  -34.241 0.05 11.25 ? 310  GLY A C     2  
ATOM   8983   O  O     B GLY A 1 311 ? 0.864   -1.468  -35.120 0.05 11.11 ? 310  GLY A O     2  
ATOM   8984   N  N     B SER A 1 312 ? -0.124  -2.078  -33.195 0.05 11.34 ? 311  SER A N     2  
ATOM   8985   C  CA    B SER A 1 312 ? 0.744   -3.234  -33.020 0.05 11.25 ? 311  SER A CA    2  
ATOM   8986   C  C     B SER A 1 312 ? 0.566   -4.167  -34.209 0.05 11.24 ? 311  SER A C     2  
ATOM   8987   O  O     B SER A 1 312 ? 1.539   -4.579  -34.840 0.05 11.12 ? 311  SER A O     2  
ATOM   8988   C  CB    B SER A 1 312 ? 0.432   -3.970  -31.712 0.05 11.40 ? 311  SER A CB    2  
ATOM   8989   O  OG    B SER A 1 312 ? 0.592   -3.114  -30.590 0.05 11.46 ? 311  SER A OG    2  
ATOM   8990   N  N     B GLN A 1 313 ? -0.682  -4.477  -34.535 0.05 11.40 ? 312  GLN A N     2  
ATOM   8991   C  CA    B GLN A 1 313 ? -0.935  -5.416  -35.622 0.05 11.43 ? 312  GLN A CA    2  
ATOM   8992   C  C     B GLN A 1 313 ? -0.477  -4.888  -36.990 0.05 11.33 ? 312  GLN A C     2  
ATOM   8993   O  O     B GLN A 1 313 ? 0.049   -5.646  -37.804 0.05 11.28 ? 312  GLN A O     2  
ATOM   8994   C  CB    B GLN A 1 313 ? -2.401  -5.860  -35.635 0.05 11.66 ? 312  GLN A CB    2  
ATOM   8995   C  CG    B GLN A 1 313 ? -3.361  -4.852  -36.190 0.05 11.77 ? 312  GLN A CG    2  
ATOM   8996   C  CD    B GLN A 1 313 ? -3.809  -5.206  -37.600 0.05 11.76 ? 312  GLN A CD    2  
ATOM   8997   O  OE1   B GLN A 1 313 ? -4.829  -4.712  -38.075 0.05 11.83 ? 312  GLN A OE1   2  
ATOM   8998   N  NE2   B GLN A 1 313 ? -3.053  -6.078  -38.266 0.05 11.71 ? 312  GLN A NE2   2  
ATOM   8999   N  N     B GLU A 1 314 ? -0.649  -3.588  -37.232 0.05 11.31 ? 313  GLU A N     2  
ATOM   9000   C  CA    B GLU A 1 314 ? -0.256  -2.992  -38.509 0.05 11.25 ? 313  GLU A CA    2  
ATOM   9001   C  C     B GLU A 1 314 ? 1.262   -2.910  -38.657 0.05 11.06 ? 313  GLU A C     2  
ATOM   9002   O  O     B GLU A 1 314 ? 1.798   -3.045  -39.759 0.05 11.03 ? 313  GLU A O     2  
ATOM   9003   C  CB    B GLU A 1 314 ? -0.864  -1.593  -38.658 0.05 11.31 ? 313  GLU A CB    2  
ATOM   9004   C  CG    B GLU A 1 314 ? -2.376  -1.614  -38.850 0.05 11.55 ? 313  GLU A CG    2  
ATOM   9005   C  CD    B GLU A 1 314 ? -3.081  -0.418  -38.229 0.05 11.64 ? 313  GLU A CD    2  
ATOM   9006   O  OE1   B GLU A 1 314 ? -2.504  0.693   -38.221 0.05 11.54 ? 313  GLU A OE1   2  
ATOM   9007   O  OE2   B GLU A 1 314 ? -4.219  -0.599  -37.748 0.05 11.82 ? 313  GLU A OE2   2  
ATOM   9008   N  N     B GLY A 1 315 ? 1.945   -2.658  -37.545 0.05 10.96 ? 314  GLY A N     2  
ATOM   9009   C  CA    B GLY A 1 315 ? 3.396   -2.662  -37.541 0.05 10.81 ? 314  GLY A CA    2  
ATOM   9010   C  C     B GLY A 1 315 ? 3.913   -4.028  -37.954 0.05 10.82 ? 314  GLY A C     2  
ATOM   9011   O  O     B GLY A 1 315 ? 4.802   -4.142  -38.792 0.05 10.76 ? 314  GLY A O     2  
ATOM   9012   N  N     B LEU A 1 316 ? 3.340   -5.077  -37.371 0.05 10.90 ? 315  LEU A N     2  
ATOM   9013   C  CA    B LEU A 1 316 ? 3.735   -6.435  -37.728 0.05 10.93 ? 315  LEU A CA    2  
ATOM   9014   C  C     B LEU A 1 316 ? 3.377   -6.750  -39.181 0.05 11.00 ? 315  LEU A C     2  
ATOM   9015   O  O     B LEU A 1 316 ? 4.190   -7.302  -39.917 0.05 10.99 ? 315  LEU A O     2  
ATOM   9016   C  CB    B LEU A 1 316 ? 3.052   -7.448  -36.810 0.05 11.03 ? 315  LEU A CB    2  
ATOM   9017   C  CG    B LEU A 1 316 ? 3.424   -7.374  -35.331 0.05 11.03 ? 315  LEU A CG    2  
ATOM   9018   C  CD1   B LEU A 1 316 ? 2.668   -8.448  -34.540 0.05 11.17 ? 315  LEU A CD1   2  
ATOM   9019   C  CD2   B LEU A 1 316 ? 4.926   -7.524  -35.155 0.05 10.94 ? 315  LEU A CD2   2  
ATOM   9020   N  N     B ALA A 1 317 ? 2.153   -6.407  -39.576 0.05 11.10 ? 316  ALA A N     2  
ATOM   9021   C  CA    B ALA A 1 317 ? 1.657   -6.705  -40.919 0.05 11.21 ? 316  ALA A CA    2  
ATOM   9022   C  C     B ALA A 1 317 ? 2.528   -6.097  -42.014 0.05 11.17 ? 316  ALA A C     2  
ATOM   9023   O  O     B ALA A 1 317 ? 2.605   -6.625  -43.132 0.05 11.26 ? 316  ALA A O     2  
ATOM   9024   C  CB    B ALA A 1 317 ? 0.218   -6.225  -41.071 0.05 11.36 ? 316  ALA A CB    2  
ATOM   9025   N  N     B THR A 1 318 ? 3.162   -4.975  -41.683 0.05 11.05 ? 317  THR A N     2  
ATOM   9026   C  CA    B THR A 1 318 ? 3.994   -4.234  -42.620 0.05 11.01 ? 317  THR A CA    2  
ATOM   9027   C  C     B THR A 1 318 ? 5.487   -4.432  -42.361 0.05 10.90 ? 317  THR A C     2  
ATOM   9028   O  O     B THR A 1 318 ? 6.320   -3.742  -42.954 0.05 10.87 ? 317  THR A O     2  
ATOM   9029   C  CB    B THR A 1 318 ? 3.690   -2.725  -42.556 0.05 10.98 ? 317  THR A CB    2  
ATOM   9030   O  OG1   B THR A 1 318 ? 3.954   -2.237  -41.237 0.05 10.86 ? 317  THR A OG1   2  
ATOM   9031   C  CG2   B THR A 1 318 ? 2.228   -2.459  -42.899 0.05 11.14 ? 317  THR A CG2   2  
ATOM   9032   N  N     B ALA A 1 319 ? 5.813   -5.377  -41.481 0.05 10.87 ? 318  ALA A N     2  
ATOM   9033   C  CA    B ALA A 1 319 ? 7.204   -5.674  -41.114 0.05 10.80 ? 318  ALA A CA    2  
ATOM   9034   C  C     B ALA A 1 319 ? 7.994   -4.408  -40.762 0.05 10.68 ? 318  ALA A C     2  
ATOM   9035   O  O     B ALA A 1 319 ? 9.119   -4.201  -41.226 0.05 10.66 ? 318  ALA A O     2  
ATOM   9036   C  CB    B ALA A 1 319 ? 7.909   -6.472  -42.221 0.05 10.90 ? 318  ALA A CB    2  
ATOM   9037   N  N     B THR A 1 320 ? 7.394   -3.558  -39.941 0.05 10.62 ? 319  THR A N     2  
ATOM   9038   C  CA    B THR A 1 320 ? 8.031   -2.296  -39.584 0.05 10.51 ? 319  THR A CA    2  
ATOM   9039   C  C     B THR A 1 320 ? 8.494   -2.382  -38.143 0.05 10.46 ? 319  THR A C     2  
ATOM   9040   O  O     B THR A 1 320 ? 7.664   -2.507  -37.254 0.05 10.49 ? 319  THR A O     2  
ATOM   9041   C  CB    B THR A 1 320 ? 7.051   -1.123  -39.707 0.05 10.51 ? 319  THR A CB    2  
ATOM   9042   O  OG1   B THR A 1 320 ? 6.462   -1.115  -41.012 0.05 10.61 ? 319  THR A OG1   2  
ATOM   9043   C  CG2   B THR A 1 320 ? 7.774   0.207   -39.480 0.05 10.40 ? 319  THR A CG2   2  
ATOM   9044   N  N     B PRO A 1 321 ? 9.819   -2.323  -37.906 0.05 10.41 ? 320  PRO A N     2  
ATOM   9045   C  CA    B PRO A 1 321 ? 10.284  -2.416  -36.517 0.05 10.40 ? 320  PRO A CA    2  
ATOM   9046   C  C     B PRO A 1 321 ? 9.708   -1.286  -35.665 0.05 10.35 ? 320  PRO A C     2  
ATOM   9047   O  O     B PRO A 1 321 ? 9.408   -0.203  -36.184 0.05 10.30 ? 320  PRO A O     2  
ATOM   9048   C  CB    B PRO A 1 321 ? 11.814  -2.324  -36.621 0.05 10.37 ? 320  PRO A CB    2  
ATOM   9049   C  CG    B PRO A 1 321 ? 12.151  -2.221  -38.053 0.05 10.35 ? 320  PRO A CG    2  
ATOM   9050   C  CD    B PRO A 1 321 ? 10.913  -2.365  -38.889 0.05 10.40 ? 320  PRO A CD    2  
ATOM   9051   N  N     B MET A 1 322 ? 9.532   -1.542  -34.373 0.05 10.40 ? 321  MET A N     2  
ATOM   9052   C  CA    B MET A 1 322 ? 8.793   -0.605  -33.540 0.05 10.41 ? 321  MET A CA    2  
ATOM   9053   C  C     B MET A 1 322 ? 9.520   -0.152  -32.283 0.05 10.42 ? 321  MET A C     2  
ATOM   9054   O  O     B MET A 1 322 ? 10.250  -0.916  -31.665 0.05 10.48 ? 321  MET A O     2  
ATOM   9055   C  CB    B MET A 1 322 ? 7.427   -1.194  -33.157 0.05 10.54 ? 321  MET A CB    2  
ATOM   9056   C  CG    B MET A 1 322 ? 6.415   -1.160  -34.296 0.05 10.55 ? 321  MET A CG    2  
ATOM   9057   S  SD    B MET A 1 322 ? 5.010   -2.270  -34.022 0.05 10.72 ? 321  MET A SD    2  
ATOM   9058   C  CE    B MET A 1 322 ? 5.749   -3.836  -34.485 0.05 10.72 ? 321  MET A CE    2  
ATOM   9059   N  N     B ILE A 1 323 ? 9.295   1.109   -31.918 0.05 10.39 ? 322  ILE A N     2  
ATOM   9060   C  CA    B ILE A 1 323 ? 9.593   1.582   -30.579 0.05 10.45 ? 322  ILE A CA    2  
ATOM   9061   C  C     B ILE A 1 323 ? 8.248   1.720   -29.896 0.05 10.59 ? 322  ILE A C     2  
ATOM   9062   O  O     B ILE A 1 323 ? 7.420   2.522   -30.310 0.05 10.58 ? 322  ILE A O     2  
ATOM   9063   C  CB    B ILE A 1 323 ? 10.341  2.932   -30.601 0.05 10.35 ? 322  ILE A CB    2  
ATOM   9064   C  CG1   B ILE A 1 323 ? 11.676  2.768   -31.322 0.05 10.25 ? 322  ILE A CG1   2  
ATOM   9065   C  CG2   B ILE A 1 323 ? 10.574  3.441   -29.191 0.05 10.45 ? 322  ILE A CG2   2  
ATOM   9066   C  CD1   B ILE A 1 323 ? 12.497  4.036   -31.382 0.05 10.15 ? 322  ILE A CD1   2  
ATOM   9067   N  N     B ALA A 1 324 ? 8.019   0.888   -28.886 0.05 10.74 ? 323  ALA A N     2  
ATOM   9068   C  CA    B ALA A 1 324 ? 6.730   0.825   -28.213 0.05 10.91 ? 323  ALA A CA    2  
ATOM   9069   C  C     B ALA A 1 324 ? 6.778   1.662   -26.952 0.05 11.03 ? 323  ALA A C     2  
ATOM   9070   O  O     B ALA A 1 324 ? 7.602   1.416   -26.078 0.05 11.11 ? 323  ALA A O     2  
ATOM   9071   C  CB    B ALA A 1 324 ? 6.377   -0.631  -27.873 0.05 11.05 ? 323  ALA A CB    2  
ATOM   9072   N  N     B VAL A 1 325 ? 5.896   2.655   -26.873 0.05 11.08 ? 324  VAL A N     2  
ATOM   9073   C  CA    B VAL A 1 325 ? 5.869   3.582   -25.751 0.05 11.22 ? 324  VAL A CA    2  
ATOM   9074   C  C     B VAL A 1 325 ? 4.445   3.628   -25.193 0.05 11.46 ? 324  VAL A C     2  
ATOM   9075   O  O     B VAL A 1 325 ? 3.684   4.550   -25.477 0.05 11.49 ? 324  VAL A O     2  
ATOM   9076   C  CB    B VAL A 1 325 ? 6.331   4.999   -26.179 0.05 11.07 ? 324  VAL A CB    2  
ATOM   9077   C  CG1   B VAL A 1 325 ? 6.564   5.878   -24.960 0.05 11.20 ? 324  VAL A CG1   2  
ATOM   9078   C  CG2   B VAL A 1 325 ? 7.608   4.920   -27.003 0.05 10.83 ? 324  VAL A CG2   2  
ATOM   9079   N  N     B PRO A 1 326 ? 4.071   2.611   -24.405 0.05 11.65 ? 325  PRO A N     2  
ATOM   9080   C  CA    B PRO A 1 326 ? 2.677   2.492   -23.971 0.05 11.92 ? 325  PRO A CA    2  
ATOM   9081   C  C     B PRO A 1 326 ? 2.253   3.607   -23.019 0.05 12.12 ? 325  PRO A C     2  
ATOM   9082   O  O     B PRO A 1 326 ? 3.031   4.033   -22.164 0.05 12.18 ? 325  PRO A O     2  
ATOM   9083   C  CB    B PRO A 1 326 ? 2.644   1.131   -23.263 0.05 12.08 ? 325  PRO A CB    2  
ATOM   9084   C  CG    B PRO A 1 326 ? 4.051   0.908   -22.818 0.05 11.97 ? 325  PRO A CG    2  
ATOM   9085   C  CD    B PRO A 1 326 ? 4.908   1.512   -23.897 0.05 11.66 ? 325  PRO A CD    2  
ATOM   9086   N  N     B GLN A 1 327 ? 1.019   4.071   -23.180 0.05 12.25 ? 326  GLN A N     2  
ATOM   9087   C  CA    B GLN A 1 327 ? 0.549   5.242   -22.448 0.05 12.45 ? 326  GLN A CA    2  
ATOM   9088   C  C     B GLN A 1 327 ? -0.426  4.857   -21.343 0.05 12.86 ? 326  GLN A C     2  
ATOM   9089   O  O     B GLN A 1 327 ? -0.685  5.643   -20.439 0.05 13.11 ? 326  GLN A O     2  
ATOM   9090   C  CB    B GLN A 1 327 ? -0.101  6.251   -23.402 0.05 12.35 ? 326  GLN A CB    2  
ATOM   9091   C  CG    B GLN A 1 327 ? 0.487   6.302   -24.819 0.05 11.98 ? 326  GLN A CG    2  
ATOM   9092   C  CD    B GLN A 1 327 ? 1.820   7.041   -24.940 0.05 11.78 ? 326  GLN A CD    2  
ATOM   9093   O  OE1   B GLN A 1 327 ? 1.984   7.880   -25.825 0.05 11.69 ? 326  GLN A OE1   2  
ATOM   9094   N  NE2   B GLN A 1 327 ? 2.780   6.712   -24.084 0.05 11.72 ? 326  GLN A NE2   2  
ATOM   9095   N  N     B ALA A 1 328 ? -0.963  3.644   -21.429 0.05 12.95 ? 327  ALA A N     2  
ATOM   9096   C  CA    B ALA A 1 328 ? -1.907  3.144   -20.437 0.05 13.35 ? 327  ALA A CA    2  
ATOM   9097   C  C     B ALA A 1 328 ? -1.633  1.679   -20.132 0.05 13.40 ? 327  ALA A C     2  
ATOM   9098   O  O     B ALA A 1 328 ? -1.113  0.950   -20.980 0.05 13.13 ? 327  ALA A O     2  
ATOM   9099   C  CB    B ALA A 1 328 ? -3.331  3.317   -20.932 0.05 13.53 ? 327  ALA A CB    2  
ATOM   9100   N  N     B VAL A 1 329 ? -2.010  1.244   -18.931 0.05 13.78 ? 328  VAL A N     2  
ATOM   9101   C  CA    B VAL A 1 329 ? -1.774  -0.132  -18.504 0.05 13.88 ? 328  VAL A CA    2  
ATOM   9102   C  C     B VAL A 1 329 ? -2.233  -1.159  -19.539 0.05 13.73 ? 328  VAL A C     2  
ATOM   9103   O  O     B VAL A 1 329 ? -1.660  -2.237  -19.655 0.05 13.61 ? 328  VAL A O     2  
ATOM   9104   N  N     B ASP A 1 330 ? -3.268  -0.797  -20.283 0.05 13.76 ? 329  ASP A N     2  
ATOM   9105   C  CA    B ASP A 1 330 ? -3.867  -1.634  -21.313 0.05 13.63 ? 329  ASP A CA    2  
ATOM   9106   C  C     B ASP A 1 330 ? -2.855  -2.094  -22.378 0.05 13.23 ? 329  ASP A C     2  
ATOM   9107   O  O     B ASP A 1 330 ? -2.865  -3.255  -22.793 0.05 13.20 ? 329  ASP A O     2  
ATOM   9108   C  CB    B ASP A 1 330 ? -5.006  -0.841  -21.962 0.05 13.65 ? 329  ASP A CB    2  
ATOM   9109   C  CG    B ASP A 1 330 ? -6.135  -1.717  -22.445 0.05 13.85 ? 329  ASP A CG    2  
ATOM   9110   O  OD1   B ASP A 1 330 ? -7.298  -1.252  -22.430 0.05 14.25 ? 329  ASP A OD1   2  
ATOM   9111   O  OD2   B ASP A 1 330 ? -5.869  -2.862  -22.846 0.05 13.65 ? 329  ASP A OD2   2  
ATOM   9112   N  N     B GLN A 1 331 ? -1.974  -1.180  -22.787 0.05 12.96 ? 330  GLN A N     2  
ATOM   9113   C  CA    B GLN A 1 331 ? -1.023  -1.389  -23.883 0.05 12.60 ? 330  GLN A CA    2  
ATOM   9114   C  C     B GLN A 1 331 ? 0.292   -2.009  -23.424 0.05 12.48 ? 330  GLN A C     2  
ATOM   9115   O  O     B GLN A 1 331 ? 1.134   -2.367  -24.254 0.05 12.22 ? 330  GLN A O     2  
ATOM   9116   C  CB    B GLN A 1 331 ? -0.699  -0.050  -24.564 0.05 12.38 ? 330  GLN A CB    2  
ATOM   9117   C  CG    B GLN A 1 331 ? -1.883  0.673   -25.197 0.05 12.47 ? 330  GLN A CG    2  
ATOM   9118   C  CD    B GLN A 1 331 ? -2.135  2.041   -24.573 0.05 12.62 ? 330  GLN A CD    2  
ATOM   9119   O  OE1   B GLN A 1 331 ? -3.202  2.295   -24.008 0.05 12.90 ? 330  GLN A OE1   2  
ATOM   9120   N  NE2   B GLN A 1 331 ? -1.155  2.922   -24.668 0.05 12.46 ? 330  GLN A NE2   2  
ATOM   9121   N  N     B PHE A 1 332 ? 0.483   -2.089  -22.109 0.05 12.70 ? 331  PHE A N     2  
ATOM   9122   C  CA    B PHE A 1 332 ? 1.703   -2.646  -21.534 0.05 12.65 ? 331  PHE A CA    2  
ATOM   9123   C  C     B PHE A 1 332 ? 1.979   -4.043  -22.093 0.05 12.57 ? 331  PHE A C     2  
ATOM   9124   O  O     B PHE A 1 332 ? 3.100   -4.350  -22.494 0.05 12.38 ? 331  PHE A O     2  
ATOM   9125   C  CB    B PHE A 1 332 ? 1.607   -2.722  -20.004 0.05 12.99 ? 331  PHE A CB    2  
ATOM   9126   C  CG    B PHE A 1 332 ? 1.810   -1.399  -19.305 0.05 13.05 ? 331  PHE A CG    2  
ATOM   9127   C  CD1   B PHE A 1 332 ? 2.172   -0.267  -20.009 0.05 12.76 ? 331  PHE A CD1   2  
ATOM   9128   C  CD2   B PHE A 1 332 ? 1.653   -1.304  -17.931 0.05 13.42 ? 331  PHE A CD2   2  
ATOM   9129   C  CE1   B PHE A 1 332 ? 2.371   0.933   -19.363 0.05 12.82 ? 331  PHE A CE1   2  
ATOM   9130   C  CE2   B PHE A 1 332 ? 1.843   -0.098  -17.276 0.05 13.50 ? 331  PHE A CE2   2  
ATOM   9131   C  CZ    B PHE A 1 332 ? 2.197   1.017   -17.994 0.05 13.18 ? 331  PHE A CZ    2  
ATOM   9132   N  N     B GLY A 1 333 ? 0.944   -4.876  -22.114 0.05 12.73 ? 332  GLY A N     2  
ATOM   9133   C  CA    B GLY A 1 333 ? 1.060   -6.241  -22.602 0.05 12.68 ? 332  GLY A CA    2  
ATOM   9134   C  C     B GLY A 1 333 ? 1.562   -6.339  -24.033 0.05 12.35 ? 332  GLY A C     2  
ATOM   9135   O  O     B GLY A 1 333 ? 2.486   -7.100  -24.316 0.05 12.24 ? 332  GLY A O     2  
ATOM   9136   N  N     B ASN A 1 334 ? 0.954   -5.577  -24.939 0.05 12.23 ? 333  ASN A N     2  
ATOM   9137   C  CA    B ASN A 1 334 ? 1.381   -5.601  -26.336 0.05 11.95 ? 333  ASN A CA    2  
ATOM   9138   C  C     B ASN A 1 334 ? 2.819   -5.153  -26.488 0.05 11.76 ? 333  ASN A C     2  
ATOM   9139   O  O     B ASN A 1 334 ? 3.561   -5.714  -27.282 0.05 11.60 ? 333  ASN A O     2  
ATOM   9140   C  CB    B ASN A 1 334 ? 0.495   -4.724  -27.224 0.05 11.89 ? 333  ASN A CB    2  
ATOM   9141   C  CG    B ASN A 1 334 ? -0.904  -5.277  -27.386 0.05 12.07 ? 333  ASN A CG    2  
ATOM   9142   O  OD1   B ASN A 1 334 ? -1.134  -6.481  -27.237 0.05 12.14 ? 333  ASN A OD1   2  
ATOM   9143   N  ND2   B ASN A 1 334 ? -1.851  -4.395  -27.701 0.05 12.16 ? 333  ASN A ND2   2  
ATOM   9144   N  N     B ALA A 1 335 ? 3.211   -4.136  -25.729 0.05 11.80 ? 334  ALA A N     2  
ATOM   9145   C  CA    B ALA A 1 335 ? 4.578   -3.635  -25.828 0.05 11.64 ? 334  ALA A CA    2  
ATOM   9146   C  C     B ALA A 1 335 ? 5.577   -4.708  -25.397 0.05 11.68 ? 334  ALA A C     2  
ATOM   9147   O  O     B ALA A 1 335 ? 6.612   -4.892  -26.022 0.05 11.53 ? 334  ALA A O     2  
ATOM   9148   C  CB    B ALA A 1 335 ? 4.746   -2.360  -24.987 0.05 11.71 ? 334  ALA A CB    2  
ATOM   9149   N  N     B ASP A 1 336 ? 5.251   -5.420  -24.324 0.05 11.93 ? 335  ASP A N     2  
ATOM   9150   C  CA    B ASP A 1 336 ? 6.108   -6.500  -23.856 0.05 12.03 ? 335  ASP A CA    2  
ATOM   9151   C  C     B ASP A 1 336 ? 6.205   -7.609  -24.900 0.05 11.89 ? 335  ASP A C     2  
ATOM   9152   O  O     B ASP A 1 336 ? 7.281   -8.138  -25.159 0.05 11.83 ? 335  ASP A O     2  
ATOM   9153   C  CB    B ASP A 1 336 ? 5.578   -7.065  -22.543 0.05 12.34 ? 335  ASP A CB    2  
ATOM   9154   C  CG    B ASP A 1 336 ? 5.539   -6.029  -21.436 0.05 12.54 ? 335  ASP A CG    2  
ATOM   9155   O  OD1   B ASP A 1 336 ? 5.808   -4.837  -21.712 0.05 12.45 ? 335  ASP A OD1   2  
ATOM   9156   O  OD2   B ASP A 1 336 ? 5.218   -6.410  -20.297 0.05 12.82 ? 335  ASP A OD2   2  
ATOM   9157   N  N     B MET A 1 337 ? 5.079   -7.954  -25.512 0.05 11.88 ? 336  MET A N     2  
ATOM   9158   C  CA    B MET A 1 337 ? 5.096   -9.020  -26.503 0.05 11.79 ? 336  MET A CA    2  
ATOM   9159   C  C     B MET A 1 337 ? 5.868   -8.612  -27.746 0.05 11.55 ? 336  MET A C     2  
ATOM   9160   O  O     B MET A 1 337 ? 6.610   -9.415  -28.304 0.05 11.51 ? 336  MET A O     2  
ATOM   9161   C  CB    B MET A 1 337 ? 3.686   -9.494  -26.858 0.05 11.87 ? 336  MET A CB    2  
ATOM   9162   C  CG    B MET A 1 337 ? 3.127   -10.494 -25.851 0.05 12.15 ? 336  MET A CG    2  
ATOM   9163   S  SD    B MET A 1 337 ? 1.507   -11.032 -26.383 0.05 12.28 ? 336  MET A SD    2  
ATOM   9164   C  CE    B MET A 1 337 ? 0.673   -9.434  -26.449 0.05 12.19 ? 336  MET A CE    2  
ATOM   9165   N  N     B LEU A 1 338 ? 5.700   -7.362  -28.164 0.05 11.42 ? 337  LEU A N     2  
ATOM   9166   C  CA    B LEU A 1 338 ? 6.460   -6.858  -29.303 0.05 11.22 ? 337  LEU A CA    2  
ATOM   9167   C  C     B LEU A 1 338 ? 7.964   -6.974  -29.054 0.05 11.19 ? 337  LEU A C     2  
ATOM   9168   O  O     B LEU A 1 338 ? 8.700   -7.464  -29.913 0.05 11.11 ? 337  LEU A O     2  
ATOM   9169   C  CB    B LEU A 1 338 ? 6.055   -5.423  -29.637 0.05 11.12 ? 337  LEU A CB    2  
ATOM   9170   C  CG    B LEU A 1 338 ? 4.665   -5.284  -30.269 0.05 11.14 ? 337  LEU A CG    2  
ATOM   9171   C  CD1   B LEU A 1 338 ? 4.258   -3.826  -30.368 0.05 11.10 ? 337  LEU A CD1   2  
ATOM   9172   C  CD2   B LEU A 1 338 ? 4.622   -5.947  -31.650 0.05 11.06 ? 337  LEU A CD2   2  
ATOM   9173   N  N     B GLN A 1 339 ? 8.422   -6.537  -27.882 0.05 11.28 ? 338  GLN A N     2  
ATOM   9174   C  CA    B GLN A 1 339 ? 9.839   -6.688  -27.553 0.05 11.30 ? 338  GLN A CA    2  
ATOM   9175   C  C     B GLN A 1 339 ? 10.203  -8.169  -27.504 0.05 11.42 ? 338  GLN A C     2  
ATOM   9176   O  O     B GLN A 1 339 ? 11.283  -8.563  -27.938 0.05 11.40 ? 338  GLN A O     2  
ATOM   9177   C  CB    B GLN A 1 339 ? 10.206  -6.018  -26.221 0.05 11.41 ? 338  GLN A CB    2  
ATOM   9178   C  CG    B GLN A 1 339 ? 10.832  -6.993  -25.197 0.05 11.67 ? 338  GLN A CG    2  
ATOM   9179   C  CD    B GLN A 1 339 ? 12.281  -6.683  -24.850 0.05 11.74 ? 338  GLN A CD    2  
ATOM   9180   O  OE1   B GLN A 1 339 ? 13.201  -7.340  -25.339 0.05 11.77 ? 338  GLN A OE1   2  
ATOM   9181   N  NE2   B GLN A 1 339 ? 12.487  -5.702  -23.975 0.05 11.80 ? 338  GLN A NE2   2  
ATOM   9182   N  N     B GLY A 1 340 ? 9.282   -8.986  -26.999 0.05 11.56 ? 339  GLY A N     2  
ATOM   9183   C  CA    B GLY A 1 340 ? 9.532   -10.408 -26.826 0.05 11.70 ? 339  GLY A CA    2  
ATOM   9184   C  C     B GLY A 1 340 ? 9.627   -11.170 -28.134 0.05 11.60 ? 339  GLY A C     2  
ATOM   9185   O  O     B GLY A 1 340 ? 10.121  -12.310 -28.174 0.05 11.69 ? 339  GLY A O     2  
ATOM   9186   N  N     B LEU A 1 341 ? 9.140   -10.552 -29.204 0.05 11.43 ? 340  LEU A N     2  
ATOM   9187   C  CA    B LEU A 1 341 ? 9.247   -11.134 -30.539 0.05 11.35 ? 340  LEU A CA    2  
ATOM   9188   C  C     B LEU A 1 341 ? 10.584  -10.752 -31.171 0.05 11.26 ? 340  LEU A C     2  
ATOM   9189   O  O     B LEU A 1 341 ? 10.949  -11.261 -32.230 0.05 11.24 ? 340  LEU A O     2  
ATOM   9190   C  CB    B LEU A 1 341 ? 8.093   -10.665 -31.430 0.05 11.25 ? 340  LEU A CB    2  
ATOM   9191   C  CG    B LEU A 1 341 ? 6.658   -10.998 -31.000 0.05 11.35 ? 340  LEU A CG    2  
ATOM   9192   C  CD1   B LEU A 1 341 ? 5.655   -10.149 -31.778 0.05 11.27 ? 340  LEU A CD1   2  
ATOM   9193   C  CD2   B LEU A 1 341 ? 6.365   -12.476 -31.185 0.05 11.46 ? 340  LEU A CD2   2  
ATOM   9194   N  N     B GLY A 1 342 ? 11.303  -9.847  -30.514 0.05 11.24 ? 341  GLY A N     2  
ATOM   9195   C  CA    B GLY A 1 342 ? 12.592  -9.387  -31.003 0.05 11.19 ? 341  GLY A CA    2  
ATOM   9196   C  C     B GLY A 1 342 ? 12.470  -8.384  -32.136 0.05 11.01 ? 341  GLY A C     2  
ATOM   9197   O  O     B GLY A 1 342 ? 13.367  -8.255  -32.966 0.05 10.98 ? 341  GLY A O     2  
ATOM   9198   N  N     B VAL A 1 343 ? 11.354  -7.666  -32.179 0.05 10.92 ? 342  VAL A N     2  
ATOM   9199   C  CA    B VAL A 1 343 ? 11.114  -6.770  -33.299 0.05 10.78 ? 342  VAL A CA    2  
ATOM   9200   C  C     B VAL A 1 343 ? 10.831  -5.358  -32.834 0.05 10.70 ? 342  VAL A C     2  
ATOM   9201   O  O     B VAL A 1 343 ? 10.438  -4.505  -33.617 0.05 10.60 ? 342  VAL A O     2  
ATOM   9202   C  CB    B VAL A 1 343 ? 9.944   -7.271  -34.164 0.05 10.79 ? 342  VAL A CB    2  
ATOM   9203   C  CG1   B VAL A 1 343 ? 10.239  -8.693  -34.650 0.05 10.88 ? 342  VAL A CG1   2  
ATOM   9204   C  CG2   B VAL A 1 343 ? 8.648   -7.234  -33.374 0.05 10.84 ? 342  VAL A CG2   2  
ATOM   9205   N  N     B ALA A 1 344 ? 11.032  -5.115  -31.549 0.05 10.76 ? 343  ALA A N     2  
ATOM   9206   C  CA    B ALA A 1 344 ? 10.690  -3.827  -30.983 0.05 10.71 ? 343  ALA A CA    2  
ATOM   9207   C  C     B ALA A 1 344 ? 11.467  -3.595  -29.712 0.05 10.81 ? 343  ALA A C     2  
ATOM   9208   O  O     B ALA A 1 344 ? 12.041  -4.519  -29.141 0.05 10.93 ? 343  ALA A O     2  
ATOM   9209   C  CB    B ALA A 1 344 ? 9.199   -3.751  -30.699 0.05 10.76 ? 343  ALA A CB    2  
ATOM   9210   N  N     B ARG A 1 345 ? 11.455  -2.351  -29.265 0.05 10.76 ? 344  ARG A N     2  
ATOM   9211   C  CA    B ARG A 1 345 ? 12.055  -1.988  -28.001 0.05 10.88 ? 344  ARG A CA    2  
ATOM   9212   C  C     B ARG A 1 345 ? 10.998  -1.243  -27.208 0.05 10.92 ? 344  ARG A C     2  
ATOM   9213   O  O     B ARG A 1 345 ? 10.343  -0.341  -27.738 0.05 10.80 ? 344  ARG A O     2  
ATOM   9214   C  CB    B ARG A 1 345 ? 13.251  -1.075  -28.251 0.05 10.79 ? 344  ARG A CB    2  
ATOM   9215   C  CG    B ARG A 1 345 ? 14.217  -0.958  -27.104 0.05 10.94 ? 344  ARG A CG    2  
ATOM   9216   C  CD    B ARG A 1 345 ? 14.960  -2.273  -26.898 0.05 11.12 ? 344  ARG A CD    2  
ATOM   9217   N  NE    B ARG A 1 345 ? 15.285  -2.877  -28.183 0.05 11.06 ? 344  ARG A NE    2  
ATOM   9218   N  N     B LYS A 1 346 ? 10.824  -1.627  -25.947 0.05 11.12 ? 345  LYS A N     2  
ATOM   9219   C  CA    B LYS A 1 346 ? 9.912   -0.932  -25.053 0.05 11.22 ? 345  LYS A CA    2  
ATOM   9220   C  C     B LYS A 1 346 ? 10.655  0.166   -24.316 0.05 11.28 ? 345  LYS A C     2  
ATOM   9221   O  O     B LYS A 1 346 ? 11.621  -0.098  -23.609 0.05 11.37 ? 345  LYS A O     2  
ATOM   9222   C  CB    B LYS A 1 346 ? 9.312   -1.897  -24.030 0.05 11.44 ? 345  LYS A CB    2  
ATOM   9223   C  CG    B LYS A 1 346 ? 8.180   -1.292  -23.216 0.05 11.70 ? 345  LYS A CG    2  
ATOM   9224   C  CD    B LYS A 1 346 ? 7.725   -2.266  -22.154 0.05 11.94 ? 345  LYS A CD    2  
ATOM   9225   C  CE    B LYS A 1 346 ? 6.518   -1.740  -21.402 0.05 12.05 ? 345  LYS A CE    2  
ATOM   9226   N  NZ    B LYS A 1 346 ? 6.782   -1.575  -19.940 0.05 12.40 ? 345  LYS A NZ    2  
ATOM   9227   N  N     B LEU A 1 347 ? 10.203  1.400   -24.495 0.05 11.25 ? 346  LEU A N     2  
ATOM   9228   C  CA    B LEU A 1 347 ? 10.764  2.530   -23.776 0.05 11.32 ? 346  LEU A CA    2  
ATOM   9229   C  C     B LEU A 1 347 ? 9.710   3.093   -22.826 0.05 11.51 ? 346  LEU A C     2  
ATOM   9230   O  O     B LEU A 1 347 ? 8.517   3.079   -23.137 0.05 11.49 ? 346  LEU A O     2  
ATOM   9231   C  CB    B LEU A 1 347 ? 11.200  3.619   -24.760 0.05 11.08 ? 346  LEU A CB    2  
ATOM   9232   C  CG    B LEU A 1 347 ? 12.440  3.501   -25.649 0.05 10.94 ? 346  LEU A CG    2  
ATOM   9233   C  CD1   B LEU A 1 347 ? 12.540  4.782   -26.476 0.05 10.74 ? 346  LEU A CD1   2  
ATOM   9234   C  CD2   B LEU A 1 347 ? 13.688  3.322   -24.803 0.05 11.11 ? 346  LEU A CD2   2  
ATOM   9235   N  N     B ALA A 1 348 ? 10.136  3.593   -21.669 0.05 11.74 ? 347  ALA A N     2  
ATOM   9236   C  CA    B ALA A 1 348 ? 9.228   4.381   -20.835 0.05 11.95 ? 347  ALA A CA    2  
ATOM   9237   C  C     B ALA A 1 348 ? 9.164   5.815   -21.358 0.05 11.80 ? 347  ALA A C     2  
ATOM   9238   O  O     B ALA A 1 348 ? 10.196  6.395   -21.687 0.05 11.65 ? 347  ALA A O     2  
ATOM   9239   C  CB    B ALA A 1 348 ? 9.686   4.378   -19.379 0.05 12.27 ? 347  ALA A CB    2  
ATOM   9240   N  N     B THR A 1 349 ? 7.967   6.391   -21.438 0.05 11.85 ? 348  THR A N     2  
ATOM   9241   C  CA    B THR A 1 349 ? 7.883   7.816   -21.730 0.05 11.75 ? 348  THR A CA    2  
ATOM   9242   C  C     B THR A 1 349 ? 8.553   8.530   -20.577 0.05 11.78 ? 348  THR A C     2  
ATOM   9243   O  O     B THR A 1 349 ? 9.484   9.300   -20.768 0.05 11.54 ? 348  THR A O     2  
ATOM   9244   C  CB    B THR A 1 349 ? 6.451   8.354   -21.795 0.05 11.96 ? 348  THR A CB    2  
ATOM   9245   O  OG1   B THR A 1 349 ? 5.583   7.387   -22.389 0.05 11.94 ? 348  THR A OG1   2  
ATOM   9246   C  CG2   B THR A 1 349 ? 6.421   9.648   -22.592 0.05 11.88 ? 348  THR A CG2   2  
ATOM   9247   N  N     B GLU A 1 350 ? 8.096   8.231   -19.367 0.05 12.09 ? 349  GLU A N     2  
ATOM   9248   C  CA    B GLU A 1 350 ? 8.581   8.901   -18.168 0.05 12.17 ? 349  GLU A CA    2  
ATOM   9249   O  O     B GLU A 1 350 ? 13.779  10.660  -18.533 0.05 11.79 ? 349  GLU A O     2  
ATOM   9250   C  CB    B GLU A 1 350 ? 7.401   9.469   -17.374 0.05 12.59 ? 349  GLU A CB    2  
ATOM   9251   N  N     B GLU A 1 351 ? 11.329  8.497   -19.921 0.05 11.77 ? 350  GLU A N     2  
ATOM   9252   C  CA    B GLU A 1 351 ? 12.658  8.044   -20.275 0.05 11.59 ? 350  GLU A CA    2  
ATOM   9253   C  C     B GLU A 1 351 ? 13.047  8.307   -21.727 0.05 11.26 ? 350  GLU A C     2  
ATOM   9254   O  O     B GLU A 1 351 ? 14.228  8.407   -22.035 0.05 11.14 ? 350  GLU A O     2  
ATOM   9255   C  CB    B GLU A 1 351 ? 12.816  6.570   -19.931 0.05 11.71 ? 350  GLU A CB    2  
ATOM   9256   C  CG    B GLU A 1 351 ? 12.684  6.329   -18.447 0.05 12.07 ? 350  GLU A CG    2  
ATOM   9257   C  CD    B GLU A 1 351 ? 13.432  5.098   -17.995 0.05 12.24 ? 350  GLU A CD    2  
ATOM   9258   O  OE1   B GLU A 1 351 ? 13.689  4.217   -18.831 0.05 12.18 ? 350  GLU A OE1   2  
ATOM   9259   O  OE2   B GLU A 1 351 ? 13.779  5.030   -16.802 0.05 12.46 ? 350  GLU A OE2   2  
ATOM   9260   N  N     B ALA A 1 352 ? 12.062  8.427   -22.609 0.05 11.16 ? 351  ALA A N     2  
ATOM   9261   C  CA    B ALA A 1 352 ? 12.340  8.575   -24.042 0.05 10.90 ? 351  ALA A CA    2  
ATOM   9262   C  C     B ALA A 1 352 ? 12.988  9.912   -24.419 0.05 10.72 ? 351  ALA A C     2  
ATOM   9263   O  O     B ALA A 1 352 ? 12.315  10.823  -24.897 0.05 10.66 ? 351  ALA A O     2  
ATOM   9264   C  CB    B ALA A 1 352 ? 11.066  8.340   -24.868 0.05 10.92 ? 351  ALA A CB    2  
ATOM   9265   N  N     B THR A 1 353 ? 14.300  10.012  -24.211 0.05 10.66 ? 352  THR A N     2  
ATOM   9266   C  CA    B THR A 1 353 ? 15.041  11.203  -24.608 0.05 10.51 ? 352  THR A CA    2  
ATOM   9267   C  C     B THR A 1 353 ? 15.393  11.159  -26.084 0.05 10.31 ? 352  THR A C     2  
ATOM   9268   O  O     B THR A 1 353 ? 15.177  10.152  -26.755 0.05 10.30 ? 352  THR A O     2  
ATOM   9269   C  CB    B THR A 1 353 ? 16.330  11.393  -23.786 0.05 10.65 ? 352  THR A CB    2  
ATOM   9270   O  OG1   B THR A 1 353 ? 17.352  10.496  -24.247 0.05 10.74 ? 352  THR A OG1   2  
ATOM   9271   C  CG2   B THR A 1 353 ? 16.049  11.156  -22.315 0.05 10.90 ? 352  THR A CG2   2  
ATOM   9272   N  N     B ALA A 1 354 ? 15.940  12.258  -26.584 0.05 10.17 ? 353  ALA A N     2  
ATOM   9273   C  CA    B ALA A 1 354 ? 16.264  12.353  -27.998 0.05 9.98  ? 353  ALA A CA    2  
ATOM   9274   C  C     B ALA A 1 354 ? 17.334  11.335  -28.320 0.05 9.98  ? 353  ALA A C     2  
ATOM   9275   O  O     B ALA A 1 354 ? 17.271  10.660  -29.339 0.05 9.91  ? 353  ALA A O     2  
ATOM   9276   C  CB    B ALA A 1 354 ? 16.756  13.753  -28.338 0.05 9.88  ? 353  ALA A CB    2  
ATOM   9277   N  N     B ASP A 1 355 ? 18.313  11.238  -27.431 0.05 10.07 ? 354  ASP A N     2  
ATOM   9278   C  CA    B ASP A 1 355 ? 19.459  10.374  -27.636 0.05 10.10 ? 354  ASP A CA    2  
ATOM   9279   C  C     B ASP A 1 355 ? 19.061  8.909   -27.540 0.05 10.20 ? 354  ASP A C     2  
ATOM   9280   O  O     B ASP A 1 355 ? 19.559  8.081   -28.292 0.05 10.18 ? 354  ASP A O     2  
ATOM   9281   C  CB    B ASP A 1 355 ? 20.549  10.685  -26.611 0.05 10.23 ? 354  ASP A CB    2  
ATOM   9282   N  N     B LEU A 1 356 ? 18.173  8.594   -26.604 0.05 10.34 ? 355  LEU A N     2  
ATOM   9283   C  CA    B LEU A 1 356 ? 17.730  7.213   -26.432 0.05 10.44 ? 355  LEU A CA    2  
ATOM   9284   C  C     B LEU A 1 356 ? 16.783  6.814   -27.567 0.05 10.30 ? 355  LEU A C     2  
ATOM   9285   O  O     B LEU A 1 356 ? 16.902  5.727   -28.122 0.05 10.31 ? 355  LEU A O     2  
ATOM   9286   C  CB    B LEU A 1 356 ? 17.069  7.022   -25.059 0.05 10.64 ? 355  LEU A CB    2  
ATOM   9287   C  CG    B LEU A 1 356 ? 16.641  5.598   -24.690 0.05 10.77 ? 355  LEU A CG    2  
ATOM   9288   C  CD1   B LEU A 1 356 ? 17.766  4.589   -24.927 0.05 10.84 ? 355  LEU A CD1   2  
ATOM   9289   C  CD2   B LEU A 1 356 ? 16.180  5.551   -23.240 0.05 11.00 ? 355  LEU A CD2   2  
ATOM   9290   N  N     B LEU A 1 357 ? 15.850  7.697   -27.914 0.05 10.20 ? 356  LEU A N     2  
ATOM   9291   C  CA    B LEU A 1 357 ? 14.984  7.445   -29.066 0.05 10.10 ? 356  LEU A CA    2  
ATOM   9292   C  C     B LEU A 1 357 ? 15.837  7.301   -30.313 0.05 10.00 ? 356  LEU A C     2  
ATOM   9293   O  O     B LEU A 1 357 ? 15.632  6.376   -31.093 0.05 9.99  ? 356  LEU A O     2  
ATOM   9294   C  CB    B LEU A 1 357 ? 13.950  8.559   -29.254 0.05 10.05 ? 356  LEU A CB    2  
ATOM   9295   C  CG    B LEU A 1 357 ? 12.755  8.555   -28.300 0.05 10.19 ? 356  LEU A CG    2  
ATOM   9296   C  CD1   B LEU A 1 357 ? 12.175  9.948   -28.164 0.05 10.16 ? 356  LEU A CD1   2  
ATOM   9297   C  CD2   B LEU A 1 357 ? 11.671  7.581   -28.775 0.05 10.25 ? 356  LEU A CD2   2  
ATOM   9298   N  N     B ARG A 1 358 ? 16.800  8.208   -30.491 0.05 9.93  ? 357  ARG A N     2  
ATOM   9299   C  CA    B ARG A 1 358 ? 17.722  8.140   -31.630 0.05 9.87  ? 357  ARG A CA    2  
ATOM   9300   C  C     B ARG A 1 358 ? 18.494  6.834   -31.647 0.05 9.98  ? 357  ARG A C     2  
ATOM   9301   O  O     B ARG A 1 358 ? 18.551  6.147   -32.660 0.05 9.98  ? 357  ARG A O     2  
ATOM   9302   C  CB    B ARG A 1 358 ? 18.748  9.283   -31.607 0.05 9.82  ? 357  ARG A CB    2  
ATOM   9303   C  CG    B ARG A 1 358 ? 18.263  10.576  -32.172 0.05 9.72  ? 357  ARG A CG    2  
ATOM   9304   C  CD    B ARG A 1 358 ? 19.356  11.662  -32.246 0.05 9.68  ? 357  ARG A CD    2  
ATOM   9305   N  NE    B ARG A 1 358 ? 19.611  12.359  -30.975 0.05 9.73  ? 357  ARG A NE    2  
ATOM   9306   C  CZ    B ARG A 1 358 ? 20.728  12.204  -30.272 0.05 9.78  ? 357  ARG A CZ    2  
ATOM   9307   N  NH1   B ARG A 1 358 ? 20.920  12.868  -29.131 0.05 9.85  ? 357  ARG A NH1   2  
ATOM   9308   N  NH2   B ARG A 1 358 ? 21.660  11.376  -30.714 0.05 9.80  ? 357  ARG A NH2   2  
ATOM   9309   N  N     B GLU A 1 359 ? 19.117  6.509   -30.520 0.05 10.10 ? 358  GLU A N     2  
ATOM   9310   C  CA    B GLU A 1 359 ? 19.963  5.330   -30.476 0.05 10.24 ? 358  GLU A CA    2  
ATOM   9311   C  C     B GLU A 1 359 ? 19.142  4.081   -30.722 0.05 10.28 ? 358  GLU A C     2  
ATOM   9312   O  O     B GLU A 1 359 ? 19.566  3.182   -31.437 0.05 10.32 ? 358  GLU A O     2  
ATOM   9313   C  CB    B GLU A 1 359 ? 20.669  5.208   -29.135 0.05 10.40 ? 358  GLU A CB    2  
ATOM   9314   C  CG    B GLU A 1 359 ? 21.575  4.003   -29.070 0.05 10.58 ? 358  GLU A CG    2  
ATOM   9315   C  CD    B GLU A 1 359 ? 22.352  3.970   -27.791 0.05 10.79 ? 358  GLU A CD    2  
ATOM   9316   O  OE1   B GLU A 1 359 ? 22.022  3.140   -26.914 0.05 10.88 ? 358  GLU A OE1   2  
ATOM   9317   O  OE2   B GLU A 1 359 ? 23.264  4.808   -27.642 0.05 10.88 ? 358  GLU A OE2   2  
ATOM   9318   N  N     B THR A 1 360 ? 17.956  4.048   -30.134 0.05 10.28 ? 359  THR A N     2  
ATOM   9319   C  CA    B THR A 1 360 ? 17.088  2.889   -30.266 0.05 10.33 ? 359  THR A CA    2  
ATOM   9320   C  C     B THR A 1 360 ? 16.655  2.727   -31.717 0.05 10.22 ? 359  THR A C     2  
ATOM   9321   O  O     B THR A 1 360 ? 16.697  1.631   -32.278 0.05 10.27 ? 359  THR A O     2  
ATOM   9322   C  CB    B THR A 1 360 ? 15.868  3.019   -29.358 0.05 10.37 ? 359  THR A CB    2  
ATOM   9323   O  OG1   B THR A 1 360 ? 16.307  3.100   -27.994 0.05 10.51 ? 359  THR A OG1   2  
ATOM   9324   C  CG2   B THR A 1 360 ? 14.949  1.811   -29.522 0.05 10.43 ? 359  THR A CG2   2  
ATOM   9325   N  N     B ALA A 1 361 ? 16.271  3.846   -32.319 0.05 10.09 ? 360  ALA A N     2  
ATOM   9326   C  CA    B ALA A 1 361 ? 15.900  3.887   -33.729 0.05 10.02 ? 360  ALA A CA    2  
ATOM   9327   C  C     B ALA A 1 361 ? 16.988  3.320   -34.624 0.05 10.05 ? 360  ALA A C     2  
ATOM   9328   O  O     B ALA A 1 361 ? 16.716  2.488   -35.490 0.05 10.09 ? 360  ALA A O     2  
ATOM   9329   C  CB    B ALA A 1 361 ? 15.583  5.323   -34.138 0.05 9.91  ? 360  ALA A CB    2  
ATOM   9330   N  N     B LEU A 1 362 ? 18.213  3.798   -34.437 0.05 10.06 ? 361  LEU A N     2  
ATOM   9331   C  CA    B LEU A 1 362 ? 19.351  3.323   -35.214 0.05 10.13 ? 361  LEU A CA    2  
ATOM   9332   C  C     B LEU A 1 362 ? 19.464  1.809   -35.111 0.05 10.28 ? 361  LEU A C     2  
ATOM   9333   O  O     B LEU A 1 362 ? 19.368  1.103   -36.109 0.05 10.34 ? 361  LEU A O     2  
ATOM   9334   C  CB    B LEU A 1 362 ? 20.648  3.994   -34.738 0.05 10.15 ? 361  LEU A CB    2  
ATOM   9335   C  CG    B LEU A 1 362 ? 20.729  5.480   -35.096 0.05 10.02 ? 361  LEU A CG    2  
ATOM   9336   C  CD1   B LEU A 1 362 ? 21.852  6.180   -34.339 0.05 10.03 ? 361  LEU A CD1   2  
ATOM   9337   C  CD2   B LEU A 1 362 ? 20.890  5.665   -36.607 0.05 10.05 ? 361  LEU A CD2   2  
ATOM   9338   N  N     B ALA A 1 363 ? 19.602  1.317   -33.886 0.05 10.36 ? 362  ALA A N     2  
ATOM   9339   C  CA    B ALA A 1 363 ? 19.832  -0.104  -33.642 0.05 10.51 ? 362  ALA A CA    2  
ATOM   9340   C  C     B ALA A 1 363 ? 18.684  -1.019  -34.085 0.05 10.50 ? 362  ALA A C     2  
ATOM   9341   O  O     B ALA A 1 363 ? 18.866  -2.228  -34.202 0.05 10.60 ? 362  ALA A O     2  
ATOM   9342   C  CB    B ALA A 1 363 ? 20.169  -0.336  -32.171 0.05 10.61 ? 362  ALA A CB    2  
ATOM   9343   N  N     B LEU A 1 364 ? 17.502  -0.455  -34.322 0.05 10.40 ? 363  LEU A N     2  
ATOM   9344   C  CA    B LEU A 1 364 ? 16.392  -1.258  -34.830 0.05 10.40 ? 363  LEU A CA    2  
ATOM   9345   C  C     B LEU A 1 364 ? 16.384  -1.322  -36.351 0.05 10.39 ? 363  LEU A C     2  
ATOM   9346   O  O     B LEU A 1 364 ? 16.200  -2.396  -36.930 0.05 10.48 ? 363  LEU A O     2  
ATOM   9347   C  CB    B LEU A 1 364 ? 15.049  -0.735  -34.311 0.05 10.33 ? 363  LEU A CB    2  
ATOM   9348   C  CG    B LEU A 1 364 ? 14.663  -1.170  -32.901 0.05 10.41 ? 363  LEU A CG    2  
ATOM   9349   C  CD1   B LEU A 1 364 ? 13.521  -0.314  -32.396 0.05 10.36 ? 363  LEU A CD1   2  
ATOM   9350   C  CD2   B LEU A 1 364 ? 14.247  -2.638  -32.900 0.05 10.53 ? 363  LEU A CD2   2  
ATOM   9351   N  N     B VAL A 1 365 ? 16.569  -0.183  -37.013 0.05 10.31 ? 364  VAL A N     2  
ATOM   9352   C  CA    B VAL A 1 365 ? 16.629  -0.217  -38.468 0.05 10.34 ? 364  VAL A CA    2  
ATOM   9353   C  C     B VAL A 1 365 ? 17.952  -0.870  -38.885 0.05 10.48 ? 364  VAL A C     2  
ATOM   9354   O  O     B VAL A 1 365 ? 18.048  -1.457  -39.965 0.05 10.58 ? 364  VAL A O     2  
ATOM   9355   C  CB    B VAL A 1 365 ? 16.466  1.176   -39.125 0.05 10.25 ? 364  VAL A CB    2  
ATOM   9356   C  CG1   B VAL A 1 365 ? 15.325  1.927   -38.480 0.05 10.15 ? 364  VAL A CG1   2  
ATOM   9357   C  CG2   B VAL A 1 365 ? 17.763  1.977   -39.045 0.05 10.20 ? 364  VAL A CG2   2  
ATOM   9358   N  N     B ASP A 1 366 ? 18.953  -0.767  -38.011 0.05 10.52 ? 365  ASP A N     2  
ATOM   9359   C  CA    B ASP A 1 366 ? 20.241  -1.427  -38.207 0.05 10.70 ? 365  ASP A CA    2  
ATOM   9360   C  C     B ASP A 1 366 ? 20.215  -2.759  -37.458 0.05 10.84 ? 365  ASP A C     2  
ATOM   9361   O  O     B ASP A 1 366 ? 20.843  -2.899  -36.401 0.05 10.98 ? 365  ASP A O     2  
ATOM   9362   C  CB    B ASP A 1 366 ? 21.419  -0.580  -37.688 0.05 10.70 ? 365  ASP A CB    2  
ATOM   9363   C  CG    B ASP A 1 366 ? 21.645  0.714   -38.491 0.05 10.63 ? 365  ASP A CG    2  
ATOM   9364   O  OD1   B ASP A 1 366 ? 22.092  1.718   -37.883 0.05 10.47 ? 365  ASP A OD1   2  
ATOM   9365   O  OD2   B ASP A 1 366 ? 21.390  0.734   -39.719 0.05 10.77 ? 365  ASP A OD2   2  
ATOM   9366   N  N     B ASP A 1 367 ? 19.462  -3.715  -37.998 0.05 10.82 ? 366  ASP A N     2  
ATOM   9367   C  CA    B ASP A 1 367 ? 19.411  -5.069  -37.458 0.05 10.96 ? 366  ASP A CA    2  
ATOM   9368   C  C     B ASP A 1 367 ? 18.749  -6.043  -38.449 0.05 11.03 ? 366  ASP A C     2  
ATOM   9369   O  O     B ASP A 1 367 ? 17.530  -6.035  -38.631 0.05 10.94 ? 366  ASP A O     2  
ATOM   9370   C  CB    B ASP A 1 367 ? 18.702  -5.072  -36.102 0.05 10.90 ? 366  ASP A CB    2  
ATOM   9371   C  CG    B ASP A 1 367 ? 18.950  -6.342  -35.310 0.05 11.08 ? 366  ASP A CG    2  
ATOM   9372   O  OD1   B ASP A 1 367 ? 18.836  -7.437  -35.893 0.05 11.24 ? 366  ASP A OD1   2  
ATOM   9373   O  OD2   B ASP A 1 367 ? 19.265  -6.242  -34.106 0.05 11.08 ? 366  ASP A OD2   2  
ATOM   9374   N  N     B PRO A 1 368 ? 19.566  -6.892  -39.103 0.05 11.23 ? 367  PRO A N     2  
ATOM   9375   C  CA    B PRO A 1 368 ? 19.074  -7.915  -40.035 0.05 11.33 ? 367  PRO A CA    2  
ATOM   9376   C  C     B PRO A 1 368 ? 18.228  -8.983  -39.349 0.05 11.35 ? 367  PRO A C     2  
ATOM   9377   O  O     B PRO A 1 368 ? 17.346  -9.573  -39.981 0.05 11.36 ? 367  PRO A O     2  
ATOM   9378   C  CB    B PRO A 1 368 ? 20.364  -8.544  -40.582 0.05 11.58 ? 367  PRO A CB    2  
ATOM   9379   C  CG    B PRO A 1 368 ? 21.410  -8.212  -39.574 0.05 11.63 ? 367  PRO A CG    2  
ATOM   9380   C  CD    B PRO A 1 368 ? 21.037  -6.873  -39.031 0.05 11.39 ? 367  PRO A CD    2  
ATOM   9381   N  N     B GLU A 1 369 ? 18.491  -9.228  -38.074 0.05 11.37 ? 368  GLU A N     2  
ATOM   9382   C  CA    B GLU A 1 369 ? 17.735  -10.229 -37.333 0.05 11.41 ? 368  GLU A CA    2  
ATOM   9383   C  C     B GLU A 1 369 ? 16.322  -9.729  -37.092 0.05 11.22 ? 368  GLU A C     2  
ATOM   9384   O  O     B GLU A 1 369 ? 15.352  -10.477 -37.220 0.05 11.23 ? 368  GLU A O     2  
ATOM   9385   C  CB    B GLU A 1 369 ? 18.419  -10.567 -36.009 0.05 11.56 ? 368  GLU A CB    2  
ATOM   9386   C  CG    B GLU A 1 369 ? 19.819  -11.136 -36.164 0.05 11.80 ? 368  GLU A CG    2  
ATOM   9387   N  N     B VAL A 1 370 ? 16.216  -8.450  -36.748 0.05 11.08 ? 369  VAL A N     2  
ATOM   9388   C  CA    B VAL A 1 370 ? 14.917  -7.807  -36.594 0.05 10.93 ? 369  VAL A CA    2  
ATOM   9389   C  C     B VAL A 1 370 ? 14.103  -7.949  -37.879 0.05 10.90 ? 369  VAL A C     2  
ATOM   9390   O  O     B VAL A 1 370 ? 12.943  -8.355  -37.844 0.05 10.88 ? 369  VAL A O     2  
ATOM   9391   C  CB    B VAL A 1 370 ? 15.088  -6.316  -36.185 0.05 10.79 ? 369  VAL A CB    2  
ATOM   9392   C  CG1   B VAL A 1 370 ? 13.790  -5.541  -36.355 0.05 10.66 ? 369  VAL A CG1   2  
ATOM   9393   C  CG2   B VAL A 1 370 ? 15.583  -6.233  -34.745 0.05 10.84 ? 369  VAL A CG2   2  
ATOM   9394   N  N     B ALA A 1 371 ? 14.715  -7.640  -39.019 0.05 10.93 ? 370  ALA A N     2  
ATOM   9395   C  CA    B ALA A 1 371 ? 14.014  -7.761  -40.295 0.05 10.95 ? 370  ALA A CA    2  
ATOM   9396   C  C     B ALA A 1 371 ? 13.641  -9.217  -40.583 0.05 11.08 ? 370  ALA A C     2  
ATOM   9397   O  O     B ALA A 1 371 ? 12.563  -9.497  -41.108 0.05 11.06 ? 370  ALA A O     2  
ATOM   9398   C  CB    B ALA A 1 371 ? 14.849  -7.187  -41.427 0.05 11.02 ? 370  ALA A CB    2  
ATOM   9399   N  N     B ARG A 1 372 ? 14.532  -10.140 -40.230 0.05 11.23 ? 371  ARG A N     2  
ATOM   9400   C  CA    B ARG A 1 372 ? 14.238  -11.558 -40.416 0.05 11.36 ? 371  ARG A CA    2  
ATOM   9401   C  C     B ARG A 1 372 ? 13.031  -11.982 -39.574 0.05 11.29 ? 371  ARG A C     2  
ATOM   9402   O  O     B ARG A 1 372 ? 12.099  -12.619 -40.076 0.05 11.32 ? 371  ARG A O     2  
ATOM   9403   C  CB    B ARG A 1 372 ? 15.448  -12.411 -40.052 0.05 11.54 ? 371  ARG A CB    2  
ATOM   9404   C  CG    B ARG A 1 372 ? 15.238  -13.906 -40.275 0.05 11.70 ? 371  ARG A CG    2  
ATOM   9405   C  CD    B ARG A 1 372 ? 16.303  -14.696 -39.511 0.05 11.89 ? 371  ARG A CD    2  
ATOM   9406   N  NE    B ARG A 1 372 ? 16.259  -14.413 -38.076 0.05 11.84 ? 371  ARG A NE    2  
ATOM   9407   C  CZ    B ARG A 1 372 ? 17.191  -13.728 -37.407 0.05 11.80 ? 371  ARG A CZ    2  
ATOM   9408   N  NH1   B ARG A 1 372 ? 17.058  -13.523 -36.104 0.05 11.80 ? 371  ARG A NH1   2  
ATOM   9409   N  NH2   B ARG A 1 372 ? 18.262  -13.261 -38.033 0.05 11.79 ? 371  ARG A NH2   2  
ATOM   9410   N  N     B ARG A 1 373 ? 13.047  -11.612 -38.302 0.05 11.23 ? 372  ARG A N     2  
ATOM   9411   C  CA    B ARG A 1 373 ? 11.977  -12.001 -37.389 0.05 11.20 ? 372  ARG A CA    2  
ATOM   9412   C  C     B ARG A 1 373 ? 10.653  -11.350 -37.782 0.05 11.09 ? 372  ARG A C     2  
ATOM   9413   O  O     B ARG A 1 373 ? 9.599   -11.977 -37.676 0.05 11.12 ? 372  ARG A O     2  
ATOM   9414   C  CB    B ARG A 1 373 ? 12.383  -11.734 -35.929 0.05 11.19 ? 372  ARG A CB    2  
ATOM   9415   C  CG    B ARG A 1 373 ? 13.678  -12.486 -35.560 0.05 11.35 ? 372  ARG A CG    2  
ATOM   9416   C  CD    B ARG A 1 373 ? 14.068  -12.456 -34.080 0.05 11.40 ? 372  ARG A CD    2  
ATOM   9417   N  NE    B ARG A 1 373 ? 14.541  -11.150 -33.648 0.05 11.32 ? 372  ARG A NE    2  
ATOM   9418   C  CZ    B ARG A 1 373 ? 15.737  -10.903 -33.113 0.05 11.37 ? 372  ARG A CZ    2  
ATOM   9419   N  NH1   B ARG A 1 373 ? 16.620  -11.877 -32.928 0.05 11.51 ? 372  ARG A NH1   2  
ATOM   9420   N  NH2   B ARG A 1 373 ? 16.043  -9.665  -32.757 0.05 11.29 ? 372  ARG A NH2   2  
ATOM   9421   N  N     B LEU A 1 374 ? 10.712  -10.113 -38.277 0.05 10.99 ? 373  LEU A N     2  
ATOM   9422   C  CA    B LEU A 1 374 ? 9.526   -9.451  -38.828 0.05 10.93 ? 373  LEU A CA    2  
ATOM   9423   C  C     B LEU A 1 374 ? 9.010   -10.139 -40.088 0.05 11.03 ? 373  LEU A C     2  
ATOM   9424   O  O     B LEU A 1 374 ? 7.800   -10.260 -40.296 0.05 11.06 ? 373  LEU A O     2  
ATOM   9425   C  CB    B LEU A 1 374 ? 9.816   -7.971  -39.109 0.05 10.83 ? 373  LEU A CB    2  
ATOM   9426   C  CG    B LEU A 1 374 ? 9.841   -7.097  -37.855 0.05 10.73 ? 373  LEU A CG    2  
ATOM   9427   C  CD1   B LEU A 1 374 ? 10.527  -5.772  -38.137 0.05 10.63 ? 373  LEU A CD1   2  
ATOM   9428   C  CD2   B LEU A 1 374 ? 8.419   -6.871  -37.342 0.05 10.73 ? 373  LEU A CD2   2  
ATOM   9429   N  N     B ARG A 1 375 ? 9.926   -10.599 -40.933 0.05 11.12 ? 374  ARG A N     2  
ATOM   9430   C  CA    B ARG A 1 375 ? 9.520   -11.282 -42.156 0.05 11.24 ? 374  ARG A CA    2  
ATOM   9431   C  C     B ARG A 1 375 ? 8.808   -12.576 -41.802 0.05 11.32 ? 374  ARG A C     2  
ATOM   9432   O  O     B ARG A 1 375 ? 7.787   -12.912 -42.397 0.05 11.39 ? 374  ARG A O     2  
ATOM   9433   C  CB    B ARG A 1 375 ? 10.722  -11.571 -43.058 0.05 11.37 ? 374  ARG A CB    2  
ATOM   9434   C  CG    B ARG A 1 375 ? 10.342  -12.014 -44.466 0.05 11.49 ? 374  ARG A CG    2  
ATOM   9435   C  CD    B ARG A 1 375 ? 11.554  -11.956 -45.402 0.05 11.59 ? 374  ARG A CD    2  
ATOM   9436   N  NE    B ARG A 1 375 ? 12.707  -11.283 -44.791 0.05 11.47 ? 374  ARG A NE    2  
ATOM   9437   C  CZ    B ARG A 1 375 ? 13.969  -11.650 -44.987 0.05 11.55 ? 374  ARG A CZ    2  
ATOM   9438   N  NH1   B ARG A 1 375 ? 14.234  -12.669 -45.784 0.05 11.77 ? 374  ARG A NH1   2  
ATOM   9439   N  NH2   B ARG A 1 375 ? 14.972  -11.004 -44.394 0.05 11.45 ? 374  ARG A NH2   2  
ATOM   9440   N  N     B ARG A 1 376 ? 9.333   -13.297 -40.820 0.05 11.33 ? 375  ARG A N     2  
ATOM   9441   C  CA    B ARG A 1 376 ? 8.706   -14.564 -40.454 0.05 11.42 ? 375  ARG A CA    2  
ATOM   9442   C  C     B ARG A 1 376 ? 7.313   -14.333 -39.865 0.05 11.36 ? 375  ARG A C     2  
ATOM   9443   O  O     B ARG A 1 376 ? 6.363   -15.016 -40.233 0.05 11.44 ? 375  ARG A O     2  
ATOM   9444   C  CB    B ARG A 1 376 ? 9.602   -15.389 -39.523 0.05 11.48 ? 375  ARG A CB    2  
ATOM   9445   C  CG    B ARG A 1 376 ? 9.037   -16.765 -39.136 0.05 11.60 ? 375  ARG A CG    2  
ATOM   9446   C  CD    B ARG A 1 376 ? 8.301   -17.481 -40.293 0.05 11.69 ? 375  ARG A CD    2  
ATOM   9447   N  NE    B ARG A 1 376 ? 9.172   -18.032 -41.332 0.05 11.83 ? 375  ARG A NE    2  
ATOM   9448   C  CZ    B ARG A 1 376 ? 9.790   -19.207 -41.239 0.05 11.98 ? 375  ARG A CZ    2  
ATOM   9449   N  NH1   B ARG A 1 376 ? 10.553  -19.650 -42.239 0.05 12.14 ? 375  ARG A NH1   2  
ATOM   9450   N  NH2   B ARG A 1 376 ? 9.658   -19.935 -40.136 0.05 11.99 ? 375  ARG A NH2   2  
ATOM   9451   N  N     B ILE A 1 377 ? 7.179   -13.355 -38.976 0.05 11.25 ? 376  ILE A N     2  
ATOM   9452   C  CA    B ILE A 1 377 ? 5.857   -13.043 -38.426 0.05 11.24 ? 376  ILE A CA    2  
ATOM   9453   C  C     B ILE A 1 377 ? 4.873   -12.632 -39.528 0.05 11.27 ? 376  ILE A C     2  
ATOM   9454   O  O     B ILE A 1 377 ? 3.716   -13.048 -39.532 0.05 11.34 ? 376  ILE A O     2  
ATOM   9455   C  CB    B ILE A 1 377 ? 5.933   -11.961 -37.326 0.05 11.15 ? 376  ILE A CB    2  
ATOM   9456   C  CG1   B ILE A 1 377 ? 6.759   -12.478 -36.147 0.05 11.18 ? 376  ILE A CG1   2  
ATOM   9457   C  CG2   B ILE A 1 377 ? 4.530   -11.573 -36.857 0.05 11.18 ? 376  ILE A CG2   2  
ATOM   9458   C  CD1   B ILE A 1 377 ? 7.469   -11.386 -35.360 0.05 11.12 ? 376  ILE A CD1   2  
ATOM   9459   N  N     B GLN A 1 378 ? 5.348   -11.830 -40.473 0.05 11.24 ? 377  GLN A N     2  
ATOM   9460   C  CA    B GLN A 1 378 ? 4.561   -11.481 -41.641 0.05 11.31 ? 377  GLN A CA    2  
ATOM   9461   C  C     B GLN A 1 378 ? 4.059   -12.719 -42.405 0.05 11.46 ? 377  GLN A C     2  
ATOM   9462   O  O     B GLN A 1 378 ? 2.916   -12.764 -42.852 0.05 11.55 ? 377  GLN A O     2  
ATOM   9463   C  CB    B GLN A 1 378 ? 5.390   -10.600 -42.575 0.05 11.31 ? 377  GLN A CB    2  
ATOM   9464   C  CG    B GLN A 1 378 ? 5.076   -9.125  -42.504 0.05 11.19 ? 377  GLN A CG    2  
ATOM   9465   C  CD    B GLN A 1 378 ? 5.353   -8.450  -43.833 0.05 11.25 ? 377  GLN A CD    2  
ATOM   9466   O  OE1   B GLN A 1 378 ? 6.184   -8.920  -44.608 0.05 11.33 ? 377  GLN A OE1   2  
ATOM   9467   N  NE2   B GLN A 1 378 ? 4.632   -7.373  -44.122 0.05 11.25 ? 377  GLN A NE2   2  
ATOM   9468   N  N     B ALA A 1 379 ? 4.921   -13.716 -42.562 0.05 11.51 ? 378  ALA A N     2  
ATOM   9469   C  CA    B ALA A 1 379 ? 4.537   -14.928 -43.273 0.05 11.67 ? 378  ALA A CA    2  
ATOM   9470   C  C     B ALA A 1 379 ? 3.544   -15.727 -42.440 0.05 11.69 ? 378  ALA A C     2  
ATOM   9471   O  O     B ALA A 1 379 ? 2.668   -16.405 -42.981 0.05 11.81 ? 378  ALA A O     2  
ATOM   9472   C  CB    B ALA A 1 379 ? 5.764   -15.766 -43.602 0.05 11.74 ? 378  ALA A CB    2  
ATOM   9473   N  N     B GLU A 1 380 ? 3.693   -15.649 -41.120 0.05 11.60 ? 379  GLU A N     2  
ATOM   9474   C  CA    B GLU A 1 380 ? 2.782   -16.338 -40.216 0.05 11.65 ? 379  GLU A CA    2  
ATOM   9475   C  C     B GLU A 1 380 ? 1.401   -15.677 -40.217 0.05 11.67 ? 379  GLU A C     2  
ATOM   9476   O  O     B GLU A 1 380 ? 0.372   -16.358 -40.214 0.05 11.78 ? 379  GLU A O     2  
ATOM   9477   C  CB    B GLU A 1 380 ? 3.398   -16.459 -38.815 0.05 11.60 ? 379  GLU A CB    2  
ATOM   9478   C  CG    B GLU A 1 380 ? 4.542   -17.477 -38.807 0.05 11.63 ? 379  GLU A CG    2  
ATOM   9479   C  CD    B GLU A 1 380 ? 5.491   -17.371 -37.620 0.05 11.63 ? 379  GLU A CD    2  
ATOM   9480   O  OE1   B GLU A 1 380 ? 6.513   -18.092 -37.620 0.05 11.69 ? 379  GLU A OE1   2  
ATOM   9481   O  OE2   B GLU A 1 380 ? 5.224   -16.596 -36.691 0.05 11.60 ? 379  GLU A OE2   2  
ATOM   9482   N  N     B MET A 1 381 ? 1.376   -14.351 -40.270 0.05 11.59 ? 380  MET A N     2  
ATOM   9483   C  CA    B MET A 1 381 ? 0.112   -13.638 -40.395 0.05 11.65 ? 380  MET A CA    2  
ATOM   9484   C  C     B MET A 1 381 ? -0.598  -13.972 -41.704 0.05 11.79 ? 380  MET A C     2  
ATOM   9485   O  O     B MET A 1 381 ? -1.824  -14.009 -41.763 0.05 11.92 ? 380  MET A O     2  
ATOM   9486   C  CB    B MET A 1 381 ? 0.351   -12.134 -40.277 0.05 11.54 ? 380  MET A CB    2  
ATOM   9487   C  CG    B MET A 1 381 ? 0.736   -11.732 -38.874 0.05 11.45 ? 380  MET A CG    2  
ATOM   9488   S  SD    B MET A 1 381 ? 1.165   -9.986  -38.753 0.05 11.32 ? 380  MET A SD    2  
ATOM   9489   C  CE    B MET A 1 381 ? -0.422  -9.218  -39.052 0.05 11.45 ? 380  MET A CE    2  
ATOM   9490   N  N     B ALA A 1 382 ? 0.177   -14.221 -42.755 0.05 11.80 ? 381  ALA A N     2  
ATOM   9491   C  CA    B ALA A 1 382 ? -0.413  -14.636 -44.025 0.05 11.97 ? 381  ALA A CA    2  
ATOM   9492   C  C     B ALA A 1 382 ? -1.193  -15.940 -43.875 0.05 12.11 ? 381  ALA A C     2  
ATOM   9493   O  O     B ALA A 1 382 ? -2.248  -16.117 -44.490 0.05 12.27 ? 381  ALA A O     2  
ATOM   9494   C  CB    B ALA A 1 382 ? 0.660   -14.779 -45.086 0.05 12.00 ? 381  ALA A CB    2  
ATOM   9495   N  N     B GLN A 1 383 ? -0.669  -16.862 -43.075 0.05 12.10 ? 382  GLN A N     2  
ATOM   9496   C  CA    B GLN A 1 383 ? -1.353  -18.139 -42.861 0.05 12.05 ? 382  GLN A CA    2  
ATOM   9497   C  C     B GLN A 1 383 ? -2.640  -17.967 -42.054 0.05 11.92 ? 382  GLN A C     2  
ATOM   9498   O  O     B GLN A 1 383 ? -3.612  -18.701 -42.251 0.05 11.89 ? 382  GLN A O     2  
ATOM   9499   C  CB    B GLN A 1 383 ? -0.421  -19.156 -42.205 0.05 12.05 ? 382  GLN A CB    2  
ATOM   9500   C  CG    B GLN A 1 383 ? 0.806   -19.479 -43.055 0.05 12.20 ? 382  GLN A CG    2  
ATOM   9501   C  CD    B GLN A 1 383 ? 0.429   -20.086 -44.398 0.05 12.31 ? 382  GLN A CD    2  
ATOM   9502   O  OE1   B GLN A 1 383 ? -0.603  -20.739 -44.521 0.05 12.28 ? 382  GLN A OE1   2  
ATOM   9503   N  NE2   B GLN A 1 383 ? 1.252   -19.842 -45.416 0.05 12.45 ? 382  GLN A NE2   2  
ATOM   9504   N  N     B GLU A 1 384 ? -2.652  -16.985 -41.157 0.05 11.84 ? 383  GLU A N     2  
ATOM   9505   C  CA    B GLU A 1 384 ? -3.873  -16.653 -40.433 0.05 11.72 ? 383  GLU A CA    2  
ATOM   9506   C  C     B GLU A 1 384 ? -4.990  -16.254 -41.398 0.05 11.75 ? 383  GLU A C     2  
ATOM   9507   O  O     B GLU A 1 384 ? -6.155  -16.579 -41.174 0.05 11.68 ? 383  GLU A O     2  
ATOM   9508   C  CB    B GLU A 1 384 ? -3.599  -15.559 -39.397 0.05 11.65 ? 383  GLU A CB    2  
ATOM   9509   C  CG    B GLU A 1 384 ? -2.726  -16.052 -38.258 0.05 11.62 ? 383  GLU A CG    2  
ATOM   9510   C  CD    B GLU A 1 384 ? -2.262  -14.936 -37.336 0.05 11.59 ? 383  GLU A CD    2  
ATOM   9511   O  OE1   B GLU A 1 384 ? -2.702  -13.787 -37.531 0.05 11.61 ? 383  GLU A OE1   2  
ATOM   9512   O  OE2   B GLU A 1 384 ? -1.454  -15.215 -36.425 0.05 11.57 ? 383  GLU A OE2   2  
ATOM   9513   N  N     B GLY A 1 385 ? -4.631  -15.550 -42.470 0.05 11.86 ? 384  GLY A N     2  
ATOM   9514   C  CA    B GLY A 1 385 ? -5.530  -15.351 -43.602 0.05 11.94 ? 384  GLY A CA    2  
ATOM   9515   C  C     B GLY A 1 385 ? -6.560  -14.228 -43.558 0.05 11.89 ? 384  GLY A C     2  
ATOM   9516   O  O     B GLY A 1 385 ? -7.055  -13.794 -44.599 0.05 11.96 ? 384  GLY A O     2  
ATOM   9517   N  N     B GLY A 1 386 ? -6.910  -13.760 -42.368 0.05 11.77 ? 385  GLY A N     2  
ATOM   9518   C  CA    B GLY A 1 386 ? -7.891  -12.696 -42.263 0.05 11.74 ? 385  GLY A CA    2  
ATOM   9519   C  C     B GLY A 1 386 ? -9.295  -13.126 -42.632 0.05 11.75 ? 385  GLY A C     2  
ATOM   9520   O  O     B GLY A 1 386 ? -9.708  -14.246 -42.352 0.05 11.71 ? 385  GLY A O     2  
ATOM   9521   N  N     B THR A 1 387 ? -10.009 -12.224 -43.293 0.05 11.81 ? 386  THR A N     2  
ATOM   9522   C  CA    B THR A 1 387 ? -11.444 -12.352 -43.522 0.05 11.81 ? 386  THR A CA    2  
ATOM   9523   C  C     B THR A 1 387 ? -11.866 -13.622 -44.241 0.05 11.86 ? 386  THR A C     2  
ATOM   9524   O  O     B THR A 1 387 ? -12.799 -14.304 -43.835 0.05 11.80 ? 386  THR A O     2  
ATOM   9525   C  CB    B THR A 1 387 ? -11.944 -11.178 -44.361 0.05 11.92 ? 386  THR A CB    2  
ATOM   9526   O  OG1   B THR A 1 387 ? -11.590 -9.953  -43.716 0.05 11.88 ? 386  THR A OG1   2  
ATOM   9527   C  CG2   B THR A 1 387 ? -13.461 -11.247 -44.567 0.05 11.93 ? 386  THR A CG2   2  
ATOM   9528   N  N     B ARG A 1 388 ? -11.199 -13.934 -45.340 0.05 11.97 ? 387  ARG A N     2  
ATOM   9529   C  CA    B ARG A 1 388 ? -11.723 -14.998 -46.171 0.05 12.04 ? 387  ARG A CA    2  
ATOM   9530   C  C     B ARG A 1 388 ? -11.440 -16.373 -45.565 0.05 11.97 ? 387  ARG A C     2  
ATOM   9531   O  O     B ARG A 1 388 ? -12.174 -17.328 -45.803 0.05 11.99 ? 387  ARG A O     2  
ATOM   9532   C  CB    B ARG A 1 388 ? -11.320 -14.794 -47.640 0.05 12.22 ? 387  ARG A CB    2  
ATOM   9533   C  CG    B ARG A 1 388 ? -11.874 -13.446 -48.119 0.05 12.30 ? 387  ARG A CG    2  
ATOM   9534   C  CD    B ARG A 1 388 ? -11.878 -13.260 -49.630 0.05 12.50 ? 387  ARG A CD    2  
ATOM   9535   N  NE    B ARG A 1 388 ? -10.705 -12.515 -50.058 0.05 12.56 ? 387  ARG A NE    2  
ATOM   9536   C  CZ    B ARG A 1 388 ? -9.819  -12.973 -50.932 0.05 12.66 ? 387  ARG A CZ    2  
ATOM   9537   N  NH1   B ARG A 1 388 ? -9.988  -14.167 -51.485 0.05 12.71 ? 387  ARG A NH1   2  
ATOM   9538   N  NH2   B ARG A 1 388 ? -8.772  -12.233 -51.256 0.05 12.71 ? 387  ARG A NH2   2  
ATOM   9539   N  N     B ARG A 1 389 ? -10.425 -16.445 -44.709 0.05 11.91 ? 388  ARG A N     2  
ATOM   9540   C  CA    B ARG A 1 389 ? -10.246 -17.630 -43.888 0.05 11.85 ? 388  ARG A CA    2  
ATOM   9541   C  C     B ARG A 1 389 ? -11.319 -17.647 -42.807 0.05 11.72 ? 388  ARG A C     2  
ATOM   9542   O  O     B ARG A 1 389 ? -11.880 -18.701 -42.486 0.05 11.71 ? 388  ARG A O     2  
ATOM   9543   C  CB    B ARG A 1 389 ? -8.857  -17.665 -43.251 0.05 11.82 ? 388  ARG A CB    2  
ATOM   9544   C  CG    B ARG A 1 389 ? -8.584  -18.935 -42.461 0.05 11.76 ? 388  ARG A CG    2  
ATOM   9545   C  CD    B ARG A 1 389 ? -7.120  -19.331 -42.550 0.05 11.84 ? 388  ARG A CD    2  
ATOM   9546   N  NE    B ARG A 1 389 ? -6.856  -20.634 -41.938 0.05 11.82 ? 388  ARG A NE    2  
ATOM   9547   C  CZ    B ARG A 1 389 ? -6.359  -20.801 -40.714 0.05 11.75 ? 388  ARG A CZ    2  
ATOM   9548   N  NH1   B ARG A 1 389 ? -6.063  -19.747 -39.959 0.05 11.69 ? 388  ARG A NH1   2  
ATOM   9549   N  NH2   B ARG A 1 389 ? -6.143  -22.025 -40.248 0.05 11.76 ? 388  ARG A NH2   2  
ATOM   9550   N  N     B ALA A 1 390 ? -11.595 -16.473 -42.245 0.05 11.64 ? 389  ALA A N     2  
ATOM   9551   C  CA    B ALA A 1 390 ? -12.644 -16.344 -41.243 0.05 11.54 ? 389  ALA A CA    2  
ATOM   9552   C  C     B ALA A 1 390 ? -13.991 -16.654 -41.881 0.05 11.59 ? 389  ALA A C     2  
ATOM   9553   O  O     B ALA A 1 390 ? -14.846 -17.275 -41.269 0.05 11.54 ? 389  ALA A O     2  
ATOM   9554   C  CB    B ALA A 1 390 ? -12.651 -14.951 -40.646 0.05 11.47 ? 389  ALA A CB    2  
ATOM   9555   N  N     B ALA A 1 391 ? -14.181 -16.215 -43.119 0.05 11.70 ? 390  ALA A N     2  
ATOM   9556   C  CA    B ALA A 1 391 ? -15.393 -16.601 -43.828 0.05 11.77 ? 390  ALA A CA    2  
ATOM   9557   C  C     B ALA A 1 391 ? -15.401 -18.112 -44.059 0.05 11.81 ? 390  ALA A C     2  
ATOM   9558   O  O     B ALA A 1 391 ? -16.429 -18.760 -43.893 0.05 11.82 ? 390  ALA A O     2  
ATOM   9559   C  CB    B ALA A 1 391 ? -15.517 -15.853 -45.126 0.05 11.90 ? 390  ALA A CB    2  
ATOM   9560   N  N     B ASP A 1 392 ? -14.250 -18.671 -44.417 0.05 11.85 ? 391  ASP A N     2  
ATOM   9561   C  CA    B ASP A 1 392 ? -14.125 -20.118 -44.590 0.05 11.92 ? 391  ASP A CA    2  
ATOM   9562   C  C     B ASP A 1 392 ? -14.502 -20.932 -43.350 0.05 11.82 ? 391  ASP A C     2  
ATOM   9563   O  O     B ASP A 1 392 ? -15.362 -21.812 -43.410 0.05 11.86 ? 391  ASP A O     2  
ATOM   9564   C  CB    B ASP A 1 392 ? -12.702 -20.484 -45.013 0.05 12.02 ? 391  ASP A CB    2  
ATOM   9565   C  CG    B ASP A 1 392 ? -12.509 -20.420 -46.503 0.05 12.15 ? 391  ASP A CG    2  
ATOM   9566   O  OD1   B ASP A 1 392 ? -13.435 -19.958 -47.196 0.05 12.25 ? 391  ASP A OD1   2  
ATOM   9567   O  OD2   B ASP A 1 392 ? -11.420 -20.794 -46.984 0.05 12.17 ? 391  ASP A OD2   2  
ATOM   9568   N  N     B LEU A 1 393 ? -13.861 -20.621 -42.225 0.05 11.70 ? 392  LEU A N     2  
ATOM   9569   C  CA    B LEU A 1 393 ? -13.984 -21.429 -41.012 0.05 11.61 ? 392  LEU A CA    2  
ATOM   9570   C  C     B LEU A 1 393 ? -15.377 -21.379 -40.390 0.05 11.56 ? 392  LEU A C     2  
ATOM   9571   O  O     B LEU A 1 393 ? -15.795 -22.321 -39.718 0.05 11.55 ? 392  LEU A O     2  
ATOM   9572   C  CB    B LEU A 1 393 ? -12.916 -21.017 -39.997 0.05 11.51 ? 392  LEU A CB    2  
ATOM   9573   C  CG    B LEU A 1 393 ? -11.527 -21.436 -40.488 0.05 11.57 ? 392  LEU A CG    2  
ATOM   9574   C  CD1   B LEU A 1 393 ? -10.418 -20.758 -39.707 0.05 11.50 ? 392  LEU A CD1   2  
ATOM   9575   C  CD2   B LEU A 1 393 ? -11.401 -22.936 -40.391 0.05 11.62 ? 392  LEU A CD2   2  
ATOM   9576   N  N     B ILE A 1 394 ? -16.084 -20.274 -40.611 0.05 11.55 ? 393  ILE A N     2  
ATOM   9577   C  CA    B ILE A 1 394 ? -17.478 -20.169 -40.201 0.05 11.53 ? 393  ILE A CA    2  
ATOM   9578   C  C     B ILE A 1 394 ? -18.286 -21.086 -41.106 0.05 11.64 ? 393  ILE A C     2  
ATOM   9579   O  O     B ILE A 1 394 ? -19.083 -21.881 -40.630 0.05 11.64 ? 393  ILE A O     2  
ATOM   9580   C  CB    B ILE A 1 394 ? -17.997 -18.717 -40.289 0.05 11.52 ? 393  ILE A CB    2  
ATOM   9581   C  CG1   B ILE A 1 394 ? -17.335 -17.855 -39.207 0.05 11.40 ? 393  ILE A CG1   2  
ATOM   9582   C  CG2   B ILE A 1 394 ? -19.515 -18.664 -40.123 0.05 11.54 ? 393  ILE A CG2   2  
ATOM   9583   C  CD1   B ILE A 1 394 ? -17.558 -16.351 -39.371 0.05 11.40 ? 393  ILE A CD1   2  
ATOM   9584   N  N     B GLU A 1 395 ? -18.052 -20.988 -42.412 0.05 11.76 ? 394  GLU A N     2  
ATOM   9585   C  CA    B GLU A 1 395 ? -18.718 -21.881 -43.356 0.05 11.89 ? 394  GLU A CA    2  
ATOM   9586   C  C     B GLU A 1 395 ? -18.359 -23.331 -43.057 0.05 11.92 ? 394  GLU A C     2  
ATOM   9587   O  O     B GLU A 1 395 ? -19.186 -24.223 -43.238 0.05 11.98 ? 394  GLU A O     2  
ATOM   9588   C  CB    B GLU A 1 395 ? -18.397 -21.503 -44.811 0.05 12.03 ? 394  GLU A CB    2  
ATOM   9589   C  CG    B GLU A 1 395 ? -19.168 -20.294 -45.340 0.05 12.06 ? 394  GLU A CG    2  
ATOM   9590   C  CD    B GLU A 1 395 ? -18.765 -19.896 -46.762 0.05 12.21 ? 394  GLU A CD    2  
ATOM   9591   O  OE1   B GLU A 1 395 ? -17.613 -20.157 -47.163 0.05 12.27 ? 394  GLU A OE1   2  
ATOM   9592   O  OE2   B GLU A 1 395 ? -19.603 -19.313 -47.486 0.05 12.27 ? 394  GLU A OE2   2  
ATOM   9593   N  N     B ALA A 1 396 ? -17.139 -23.566 -42.574 0.05 11.87 ? 395  ALA A N     2  
ATOM   9594   C  CA    B ALA A 1 396 ? -16.777 -24.878 -42.047 0.05 11.90 ? 395  ALA A CA    2  
ATOM   9595   C  C     B ALA A 1 396 ? -17.726 -25.330 -40.924 0.05 11.81 ? 395  ALA A C     2  
ATOM   9596   O  O     B ALA A 1 396 ? -17.898 -26.530 -40.711 0.05 11.84 ? 395  ALA A O     2  
ATOM   9597   C  CB    B ALA A 1 396 ? -15.333 -24.891 -41.560 0.05 11.90 ? 395  ALA A CB    2  
ATOM   9598   N  N     B GLU A 1 397 ? -18.334 -24.369 -40.219 0.05 11.71 ? 396  GLU A N     2  
ATOM   9599   C  CA    B GLU A 1 397 ? -19.214 -24.656 -39.078 0.05 11.64 ? 396  GLU A CA    2  
ATOM   9600   C  C     B GLU A 1 397 ? -20.704 -24.633 -39.439 0.05 11.72 ? 396  GLU A C     2  
ATOM   9601   O  O     B GLU A 1 397 ? -21.536 -25.108 -38.669 0.05 11.73 ? 396  GLU A O     2  
ATOM   9602   C  CB    B GLU A 1 397 ? -18.952 -23.677 -37.922 0.05 11.50 ? 396  GLU A CB    2  
ATOM   9603   C  CG    B GLU A 1 397 ? -19.551 -24.103 -36.585 0.05 11.44 ? 396  GLU A CG    2  
ATOM   9604   C  CD    B GLU A 1 397 ? -19.057 -25.470 -36.133 0.05 11.49 ? 396  GLU A CD    2  
ATOM   9605   O  OE1   B GLU A 1 397 ? -17.877 -25.574 -35.713 0.05 11.48 ? 396  GLU A OE1   2  
ATOM   9606   O  OE2   B GLU A 1 397 ? -19.851 -26.444 -36.195 0.05 11.55 ? 396  GLU A OE2   2  
ATOM   9607   N  N     B LEU A 1 398 ? -21.037 -24.048 -40.590 0.05 11.78 ? 397  LEU A N     2  
ATOM   9608   C  CA    B LEU A 1 398 ? -22.388 -24.144 -41.142 0.05 11.90 ? 397  LEU A CA    2  
ATOM   9609   C  C     B LEU A 1 398 ? -22.601 -25.585 -41.584 0.05 12.01 ? 397  LEU A C     2  
ATOM   9610   O  O     B LEU A 1 398 ? -22.062 -26.001 -42.599 0.05 12.09 ? 397  LEU A O     2  
ATOM   9611   C  CB    B LEU A 1 398 ? -22.530 -23.235 -42.360 0.05 11.99 ? 397  LEU A CB    2  
ATOM   9612   C  CG    B LEU A 1 398 ? -22.965 -21.778 -42.253 0.05 11.96 ? 397  LEU A CG    2  
ATOM   9613   C  CD1   B LEU A 1 398 ? -24.441 -21.682 -41.949 0.05 11.90 ? 397  LEU A CD1   2  
ATOM   9614   C  CD2   B LEU A 1 398 ? -22.140 -21.033 -41.210 0.05 11.87 ? 397  LEU A CD2   2  
ATOM   9615   N  N     B PRO A 1 399 ? -23.398 -26.352 -40.829 0.05 12.01 ? 398  PRO A N     2  
ATOM   9616   C  CA    B PRO A 1 399 ? -23.472 -27.802 -41.046 0.05 12.10 ? 398  PRO A CA    2  
ATOM   9617   C  C     B PRO A 1 399 ? -24.541 -28.251 -42.047 0.05 12.28 ? 398  PRO A C     2  
ATOM   9618   O  O     B PRO A 1 399 ? -25.699 -27.881 -41.902 0.05 12.32 ? 398  PRO A O     2  
ATOM   9619   C  CB    B PRO A 1 399 ? -23.822 -28.340 -39.648 0.05 12.01 ? 398  PRO A CB    2  
ATOM   9620   C  CG    B PRO A 1 399 ? -24.129 -27.101 -38.777 0.05 11.94 ? 398  PRO A CG    2  
ATOM   9621   C  CD    B PRO A 1 399 ? -24.270 -25.939 -39.723 0.05 11.93 ? 398  PRO A CD    2  
ATOM   9622   N  N     B ALA A 1 400 ? -24.122 -29.015 -43.055 0.05 12.40 ? 399  ALA A N     2  
ATOM   9623   C  CA    B ALA A 1 400 ? -25.007 -29.826 -43.906 0.05 12.60 ? 399  ALA A CA    2  
ATOM   9624   C  C     B ALA A 1 400 ? -26.325 -29.184 -44.369 0.05 12.64 ? 399  ALA A C     2  
ATOM   9625   O  O     B ALA A 1 400 ? -27.293 -29.892 -44.714 0.05 12.81 ? 399  ALA A O     2  
ATOM   9626   C  CB    B ALA A 1 400 ? -25.276 -31.181 -43.234 0.05 12.68 ? 399  ALA A CB    2  
ATOM   9627   N  N     B THR B 1 6   ? -68.742 -23.725 16.028  0.05 12.02 ? 5    THR B N     2  
ATOM   9628   C  CA    B THR B 1 6   ? -68.802 -22.800 14.895  0.05 12.01 ? 5    THR B CA    2  
ATOM   9629   C  C     B THR B 1 6   ? -67.443 -22.679 14.225  0.05 11.89 ? 5    THR B C     2  
ATOM   9630   O  O     B THR B 1 6   ? -66.491 -22.159 14.813  0.05 11.88 ? 5    THR B O     2  
ATOM   9631   C  CB    B THR B 1 6   ? -69.300 -21.401 15.314  0.05 12.13 ? 5    THR B CB    2  
ATOM   9632   O  OG1   B THR B 1 6   ? -69.008 -20.445 14.285  0.05 12.15 ? 5    THR B OG1   2  
ATOM   9633   N  N     B PRO B 1 7   ? -67.350 -23.176 12.989  0.05 11.82 ? 6    PRO B N     2  
ATOM   9634   C  CA    B PRO B 1 7   ? -66.142 -23.164 12.158  0.05 11.71 ? 6    PRO B CA    2  
ATOM   9635   C  C     B PRO B 1 7   ? -65.755 -21.751 11.740  0.05 11.69 ? 6    PRO B C     2  
ATOM   9636   O  O     B PRO B 1 7   ? -66.648 -21.024 11.307  0.05 11.77 ? 6    PRO B O     2  
ATOM   9637   C  CB    B PRO B 1 7   ? -66.599 -23.887 10.910  0.05 11.69 ? 6    PRO B CB    2  
ATOM   9638   C  CG    B PRO B 1 7   ? -67.796 -24.682 11.313  0.05 11.77 ? 6    PRO B CG    2  
ATOM   9639   C  CD    B PRO B 1 7   ? -68.474 -23.845 12.313  0.05 11.86 ? 6    PRO B CD    2  
ATOM   9640   N  N     B ALA B 1 8   ? -64.478 -21.379 11.875  0.05 11.60 ? 7    ALA B N     2  
ATOM   9641   C  CA    B ALA B 1 8   ? -63.948 -20.143 11.287  0.05 11.57 ? 7    ALA B CA    2  
ATOM   9642   C  C     B ALA B 1 8   ? -64.470 -20.006 9.862   0.05 11.56 ? 7    ALA B C     2  
ATOM   9643   O  O     B ALA B 1 8   ? -64.652 -21.014 9.181   0.05 11.54 ? 7    ALA B O     2  
ATOM   9644   C  CB    B ALA B 1 8   ? -62.416 -20.185 11.281  0.05 11.48 ? 7    ALA B CB    2  
ATOM   9645   N  N     B HIS B 1 9   ? -64.720 -18.775 9.410   0.05 11.59 ? 8    HIS B N     2  
ATOM   9646   C  CA    B HIS B 1 9   ? -65.164 -18.554 8.033   0.05 11.58 ? 8    HIS B CA    2  
ATOM   9647   C  C     B HIS B 1 9   ? -63.981 -18.176 7.147   0.05 11.48 ? 8    HIS B C     2  
ATOM   9648   O  O     B HIS B 1 9   ? -63.387 -17.123 7.326   0.05 11.47 ? 8    HIS B O     2  
ATOM   9649   C  CB    B HIS B 1 9   ? -66.252 -17.474 7.955   0.05 11.69 ? 8    HIS B CB    2  
ATOM   9650   C  CG    B HIS B 1 9   ? -66.662 -17.113 6.554   0.05 11.72 ? 8    HIS B CG    2  
ATOM   9651   N  ND1   B HIS B 1 9   ? -67.455 -16.020 6.276   0.05 11.77 ? 8    HIS B ND1   2  
ATOM   9652   C  CD2   B HIS B 1 9   ? -66.410 -17.707 5.362   0.05 11.73 ? 8    HIS B CD2   2  
ATOM   9653   C  CE1   B HIS B 1 9   ? -67.664 -15.950 4.972   0.05 11.81 ? 8    HIS B CE1   2  
ATOM   9654   N  NE2   B HIS B 1 9   ? -67.035 -16.959 4.393   0.05 11.79 ? 8    HIS B NE2   2  
ATOM   9655   N  N     B ILE B 1 10  ? -63.657 -19.058 6.205   0.05 11.42 ? 9    ILE B N     2  
ATOM   9656   C  CA    B ILE B 1 10  ? -62.556 -18.847 5.273   0.05 11.32 ? 9    ILE B CA    2  
ATOM   9657   C  C     B ILE B 1 10  ? -63.143 -18.619 3.885   0.05 11.33 ? 9    ILE B C     2  
ATOM   9658   O  O     B ILE B 1 10  ? -63.908 -19.440 3.388   0.05 11.37 ? 9    ILE B O     2  
ATOM   9659   C  CB    B ILE B 1 10  ? -61.601 -20.065 5.230   0.05 11.26 ? 9    ILE B CB    2  
ATOM   9660   C  CG1   B ILE B 1 10  ? -60.969 -20.297 6.606   0.05 11.24 ? 9    ILE B CG1   2  
ATOM   9661   C  CG2   B ILE B 1 10  ? -60.546 -19.874 4.150   0.05 11.18 ? 9    ILE B CG2   2  
ATOM   9662   C  CD1   B ILE B 1 10  ? -60.096 -21.578 6.689   0.05 11.19 ? 9    ILE B CD1   2  
ATOM   9663   N  N     B ALA B 1 11  ? -62.810 -17.487 3.273   0.05 11.30 ? 10   ALA B N     2  
ATOM   9664   C  CA    B ALA B 1 11  ? -63.343 -17.163 1.952   0.05 11.31 ? 10   ALA B CA    2  
ATOM   9665   C  C     B ALA B 1 11  ? -62.252 -17.248 0.903   0.05 11.22 ? 10   ALA B C     2  
ATOM   9666   O  O     B ALA B 1 11  ? -61.289 -16.502 0.956   0.05 11.17 ? 10   ALA B O     2  
ATOM   9667   C  CB    B ALA B 1 11  ? -63.955 -15.774 1.943   0.05 11.37 ? 10   ALA B CB    2  
ATOM   9668   N  N     B MET B 1 12  ? -62.430 -18.160 -0.046  0.05 11.21 ? 11   MET B N     2  
ATOM   9669   C  CA    B MET B 1 12  ? -61.493 -18.349 -1.138  0.05 11.14 ? 11   MET B CA    2  
ATOM   9670   C  C     B MET B 1 12  ? -61.984 -17.590 -2.366  0.05 11.16 ? 11   MET B C     2  
ATOM   9671   O  O     B MET B 1 12  ? -63.181 -17.568 -2.632  0.05 11.23 ? 11   MET B O     2  
ATOM   9672   C  CB    B MET B 1 12  ? -61.400 -19.833 -1.465  0.05 11.13 ? 11   MET B CB    2  
ATOM   9673   C  CG    B MET B 1 12  ? -60.698 -20.146 -2.753  0.05 11.08 ? 11   MET B CG    2  
ATOM   9674   S  SD    B MET B 1 12  ? -58.926 -19.793 -2.689  0.05 10.99 ? 11   MET B SD    2  
ATOM   9675   C  CE    B MET B 1 12  ? -58.441 -20.506 -4.250  0.05 10.97 ? 11   MET B CE    2  
ATOM   9676   N  N     B PHE B 1 13  ? -61.057 -16.995 -3.116  0.05 11.09 ? 12   PHE B N     2  
ATOM   9677   C  CA    B PHE B 1 13  ? -61.399 -16.257 -4.336  0.05 11.10 ? 12   PHE B CA    2  
ATOM   9678   C  C     B PHE B 1 13  ? -60.574 -16.743 -5.524  0.05 11.05 ? 12   PHE B C     2  
ATOM   9679   O  O     B PHE B 1 13  ? -59.347 -16.881 -5.426  0.05 10.98 ? 12   PHE B O     2  
ATOM   9680   C  CB    B PHE B 1 13  ? -61.089 -14.773 -4.169  0.05 11.09 ? 12   PHE B CB    2  
ATOM   9681   C  CG    B PHE B 1 13  ? -61.910 -14.074 -3.126  0.05 11.16 ? 12   PHE B CG    2  
ATOM   9682   C  CD1   B PHE B 1 13  ? -61.732 -14.346 -1.780  0.05 11.16 ? 12   PHE B CD1   2  
ATOM   9683   C  CD2   B PHE B 1 13  ? -62.826 -13.097 -3.496  0.05 11.23 ? 12   PHE B CD2   2  
ATOM   9684   C  CE1   B PHE B 1 13  ? -62.468 -13.694 -0.822  0.05 11.23 ? 12   PHE B CE1   2  
ATOM   9685   C  CE2   B PHE B 1 13  ? -63.568 -12.434 -2.544  0.05 11.31 ? 12   PHE B CE2   2  
ATOM   9686   C  CZ    B PHE B 1 13  ? -63.394 -12.732 -1.200  0.05 11.31 ? 12   PHE B CZ    2  
ATOM   9687   N  N     B SER B 1 14  ? -61.229 -16.983 -6.653  0.05 11.08 ? 13   SER B N     2  
ATOM   9688   C  CA    B SER B 1 14  ? -60.502 -17.203 -7.899  0.05 11.04 ? 13   SER B CA    2  
ATOM   9689   C  C     B SER B 1 14  ? -61.299 -16.739 -9.103  0.05 11.08 ? 13   SER B C     2  
ATOM   9690   O  O     B SER B 1 14  ? -62.226 -15.933 -8.975  0.05 11.14 ? 13   SER B O     2  
ATOM   9691   C  CB    B SER B 1 14  ? -60.099 -18.664 -8.077  0.05 11.03 ? 13   SER B CB    2  
ATOM   9692   O  OG    B SER B 1 14  ? -58.992 -18.769 -8.974  0.05 10.98 ? 13   SER B OG    2  
ATOM   9693   N  N     B ILE B 1 15  ? -60.925 -17.263 -10.265 0.05 11.06 ? 14   ILE B N     2  
ATOM   9694   C  CA    B ILE B 1 15  ? -61.549 -16.897 -11.534 0.05 11.11 ? 14   ILE B CA    2  
ATOM   9695   C  C     B ILE B 1 15  ? -61.999 -18.182 -12.220 0.05 11.16 ? 14   ILE B C     2  
ATOM   9696   O  O     B ILE B 1 15  ? -61.805 -19.274 -11.682 0.05 11.13 ? 14   ILE B O     2  
ATOM   9697   C  CB    B ILE B 1 15  ? -60.569 -16.120 -12.449 0.05 11.04 ? 14   ILE B CB    2  
ATOM   9698   C  CG1   B ILE B 1 15  ? -59.349 -16.987 -12.788 0.05 10.99 ? 14   ILE B CG1   2  
ATOM   9699   C  CG2   B ILE B 1 15  ? -60.140 -14.807 -11.777 0.05 11.00 ? 14   ILE B CG2   2  
ATOM   9700   C  CD1   B ILE B 1 15  ? -58.346 -16.344 -13.754 0.05 10.95 ? 14   ILE B CD1   2  
ATOM   9701   N  N     B ALA B 1 16  ? -62.624 -18.065 -13.385 0.05 11.24 ? 15   ALA B N     2  
ATOM   9702   C  CA    B ALA B 1 16  ? -63.009 -19.257 -14.129 0.05 11.30 ? 15   ALA B CA    2  
ATOM   9703   C  C     B ALA B 1 16  ? -61.906 -19.698 -15.070 0.05 11.27 ? 15   ALA B C     2  
ATOM   9704   O  O     B ALA B 1 16  ? -62.049 -19.618 -16.302 0.05 11.32 ? 15   ALA B O     2  
ATOM   9705   C  CB    B ALA B 1 16  ? -64.312 -19.030 -14.893 0.05 11.42 ? 15   ALA B CB    2  
ATOM   9706   N  N     B ALA B 1 17  ? -60.803 -20.154 -14.484 0.05 11.19 ? 16   ALA B N     2  
ATOM   9707   C  CA    B ALA B 1 17  ? -59.691 -20.732 -15.232 0.05 11.16 ? 16   ALA B CA    2  
ATOM   9708   C  C     B ALA B 1 17  ? -59.229 -22.000 -14.548 0.05 11.16 ? 16   ALA B C     2  
ATOM   9709   O  O     B ALA B 1 17  ? -58.993 -21.991 -13.347 0.05 11.12 ? 16   ALA B O     2  
ATOM   9710   C  CB    B ALA B 1 17  ? -58.541 -19.740 -15.357 0.05 11.06 ? 16   ALA B CB    2  
ATOM   9711   N  N     B HIS B 1 18  ? -59.115 -23.090 -15.302 0.05 11.22 ? 17   HIS B N     2  
ATOM   9712   C  CA    B HIS B 1 18  ? -58.708 -24.371 -14.721 0.05 11.24 ? 17   HIS B CA    2  
ATOM   9713   C  C     B HIS B 1 18  ? -57.365 -24.249 -14.000 0.05 11.15 ? 17   HIS B C     2  
ATOM   9714   O  O     B HIS B 1 18  ? -57.200 -24.743 -12.886 0.05 11.14 ? 17   HIS B O     2  
ATOM   9715   C  CB    B HIS B 1 18  ? -58.590 -25.450 -15.804 0.05 11.32 ? 17   HIS B CB    2  
ATOM   9716   C  CG    B HIS B 1 18  ? -59.857 -26.214 -16.049 0.05 11.43 ? 17   HIS B CG    2  
ATOM   9717   N  ND1   B HIS B 1 18  ? -60.461 -26.276 -17.287 0.05 11.51 ? 17   HIS B ND1   2  
ATOM   9718   C  CD2   B HIS B 1 18  ? -60.624 -26.962 -15.220 0.05 11.47 ? 17   HIS B CD2   2  
ATOM   9719   C  CE1   B HIS B 1 18  ? -61.542 -27.030 -17.210 0.05 11.61 ? 17   HIS B CE1   2  
ATOM   9720   N  NE2   B HIS B 1 18  ? -61.662 -27.462 -15.967 0.05 11.59 ? 17   HIS B NE2   2  
ATOM   9721   N  N     B GLY B 1 19  ? -56.407 -23.595 -14.655 0.05 11.11 ? 18   GLY B N     2  
ATOM   9722   C  CA    B GLY B 1 19  ? -55.054 -23.487 -14.134 0.05 11.04 ? 18   GLY B CA    2  
ATOM   9723   C  C     B GLY B 1 19  ? -54.929 -22.622 -12.901 0.05 10.97 ? 18   GLY B C     2  
ATOM   9724   O  O     B GLY B 1 19  ? -53.870 -22.564 -12.265 0.05 10.92 ? 18   GLY B O     2  
ATOM   9725   N  N     B HIS B 1 20  ? -56.002 -21.923 -12.566 0.05 10.98 ? 19   HIS B N     2  
ATOM   9726   C  CA    B HIS B 1 20  ? -56.028 -21.149 -11.337 0.05 10.93 ? 19   HIS B CA    2  
ATOM   9727   C  C     B HIS B 1 20  ? -57.028 -21.730 -10.364 0.05 10.97 ? 19   HIS B C     2  
ATOM   9728   O  O     B HIS B 1 20  ? -57.386 -21.109 -9.372  0.05 10.95 ? 19   HIS B O     2  
ATOM   9729   C  CB    B HIS B 1 20  ? -56.293 -19.677 -11.646 0.05 10.90 ? 19   HIS B CB    2  
ATOM   9730   C  CG    B HIS B 1 20  ? -55.169 -19.037 -12.397 0.05 10.86 ? 19   HIS B CG    2  
ATOM   9731   N  ND1   B HIS B 1 20  ? -53.966 -18.726 -11.799 0.05 10.80 ? 19   HIS B ND1   2  
ATOM   9732   C  CD2   B HIS B 1 20  ? -55.038 -18.706 -13.702 0.05 10.86 ? 19   HIS B CD2   2  
ATOM   9733   C  CE1   B HIS B 1 20  ? -53.151 -18.207 -12.699 0.05 10.77 ? 19   HIS B CE1   2  
ATOM   9734   N  NE2   B HIS B 1 20  ? -53.778 -18.182 -13.862 0.05 10.81 ? 19   HIS B NE2   2  
ATOM   9735   N  N     B VAL B 1 21  ? -57.483 -22.939 -10.663 0.05 11.04 ? 20   VAL B N     2  
ATOM   9736   C  CA    B VAL B 1 21  ? -58.411 -23.629 -9.777  0.05 11.08 ? 20   VAL B CA    2  
ATOM   9737   C  C     B VAL B 1 21  ? -57.914 -25.047 -9.469  0.05 11.10 ? 20   VAL B C     2  
ATOM   9738   O  O     B VAL B 1 21  ? -57.876 -25.460 -8.316  0.05 11.09 ? 20   VAL B O     2  
ATOM   9739   C  CB    B VAL B 1 21  ? -59.843 -23.653 -10.351 0.05 11.17 ? 20   VAL B CB    2  
ATOM   9740   C  CG1   B VAL B 1 21  ? -60.770 -24.436 -9.422  0.05 11.22 ? 20   VAL B CG1   2  
ATOM   9741   C  CG2   B VAL B 1 21  ? -60.360 -22.228 -10.539 0.05 11.16 ? 20   VAL B CG2   2  
ATOM   9742   N  N     B ASN B 1 22  ? -57.508 -25.786 -10.492 0.05 11.12 ? 21   ASN B N     2  
ATOM   9743   C  CA    B ASN B 1 22  ? -57.046 -27.164 -10.267 0.05 11.15 ? 21   ASN B CA    2  
ATOM   9744   C  C     B ASN B 1 22  ? -55.756 -27.378 -9.443  0.05 11.09 ? 21   ASN B C     2  
ATOM   9745   O  O     B ASN B 1 22  ? -55.572 -28.448 -8.859  0.05 11.11 ? 21   ASN B O     2  
ATOM   9746   C  CB    B ASN B 1 22  ? -56.988 -27.944 -11.580 0.05 11.20 ? 21   ASN B CB    2  
ATOM   9747   C  CG    B ASN B 1 22  ? -58.365 -28.122 -12.206 0.05 11.30 ? 21   ASN B CG    2  
ATOM   9748   O  OD1   B ASN B 1 22  ? -59.394 -27.940 -11.547 0.05 11.34 ? 21   ASN B OD1   2  
ATOM   9749   N  ND2   B ASN B 1 22  ? -58.388 -28.472 -13.483 0.05 11.34 ? 21   ASN B ND2   2  
ATOM   9750   N  N     B PRO B 1 23  ? -54.854 -26.384 -9.402  0.05 11.03 ? 22   PRO B N     2  
ATOM   9751   C  CA    B PRO B 1 23  ? -53.725 -26.533 -8.472  0.05 10.99 ? 22   PRO B CA    2  
ATOM   9752   C  C     B PRO B 1 23  ? -54.109 -26.571 -6.989  0.05 10.97 ? 22   PRO B C     2  
ATOM   9753   O  O     B PRO B 1 23  ? -53.430 -27.231 -6.207  0.05 10.96 ? 22   PRO B O     2  
ATOM   9754   C  CB    B PRO B 1 23  ? -52.896 -25.278 -8.742  0.05 10.93 ? 22   PRO B CB    2  
ATOM   9755   C  CG    B PRO B 1 23  ? -53.145 -24.994 -10.193 0.05 10.95 ? 22   PRO B CG    2  
ATOM   9756   C  CD    B PRO B 1 23  ? -54.580 -25.350 -10.425 0.05 11.00 ? 22   PRO B CD    2  
ATOM   9757   N  N     B SER B 1 24  ? -55.169 -25.872 -6.609  0.05 10.97 ? 23   SER B N     2  
ATOM   9758   C  CA    B SER B 1 24  ? -55.503 -25.723 -5.195  0.05 10.96 ? 23   SER B CA    2  
ATOM   9759   C  C     B SER B 1 24  ? -56.766 -26.478 -4.808  0.05 11.02 ? 23   SER B C     2  
ATOM   9760   O  O     B SER B 1 24  ? -57.245 -26.345 -3.682  0.05 11.02 ? 23   SER B O     2  
ATOM   9761   C  CB    B SER B 1 24  ? -55.646 -24.245 -4.835  0.05 10.92 ? 23   SER B CB    2  
ATOM   9762   O  OG    B SER B 1 24  ? -56.488 -23.577 -5.761  0.05 10.95 ? 23   SER B OG    2  
ATOM   9763   N  N     B LEU B 1 25  ? -57.294 -27.264 -5.746  0.05 11.07 ? 24   LEU B N     2  
ATOM   9764   C  CA    B LEU B 1 25  ? -58.570 -27.952 -5.552  0.05 11.14 ? 24   LEU B CA    2  
ATOM   9765   C  C     B LEU B 1 25  ? -58.638 -28.697 -4.226  0.05 11.15 ? 24   LEU B C     2  
ATOM   9766   O  O     B LEU B 1 25  ? -59.558 -28.514 -3.428  0.05 11.18 ? 24   LEU B O     2  
ATOM   9767   C  CB    B LEU B 1 25  ? -58.824 -28.935 -6.693  0.05 11.21 ? 24   LEU B CB    2  
ATOM   9768   C  CG    B LEU B 1 25  ? -60.262 -28.884 -7.199  0.05 11.29 ? 24   LEU B CG    2  
ATOM   9769   C  CD1   B LEU B 1 25  ? -60.621 -27.464 -7.545  0.05 11.29 ? 24   LEU B CD1   2  
ATOM   9770   C  CD2   B LEU B 1 25  ? -60.475 -29.792 -8.398  0.05 11.37 ? 24   LEU B CD2   2  
ATOM   9771   N  N     B GLU B 1 26  ? -57.633 -29.524 -3.997  0.05 11.13 ? 25   GLU B N     2  
ATOM   9772   C  CA    B GLU B 1 26  ? -57.606 -30.400 -2.838  0.05 11.14 ? 25   GLU B CA    2  
ATOM   9773   C  C     B GLU B 1 26  ? -57.417 -29.667 -1.519  0.05 11.09 ? 25   GLU B C     2  
ATOM   9774   O  O     B GLU B 1 26  ? -57.920 -30.108 -0.480  0.05 11.11 ? 25   GLU B O     2  
ATOM   9775   C  CB    B GLU B 1 26  ? -56.504 -31.430 -3.033  0.05 11.14 ? 25   GLU B CB    2  
ATOM   9776   C  CG    B GLU B 1 26  ? -56.634 -32.154 -4.353  0.05 11.20 ? 25   GLU B CG    2  
ATOM   9777   C  CD    B GLU B 1 26  ? -57.563 -33.345 -4.272  0.05 11.27 ? 25   GLU B CD    2  
ATOM   9778   O  OE1   B GLU B 1 26  ? -58.107 -33.602 -3.176  0.05 11.28 ? 25   GLU B OE1   2  
ATOM   9779   O  OE2   B GLU B 1 26  ? -57.738 -34.025 -5.301  0.05 11.33 ? 25   GLU B OE2   2  
ATOM   9780   N  N     B VAL B 1 27  ? -56.691 -28.548 -1.553  0.05 11.05 ? 26   VAL B N     2  
ATOM   9781   C  CA    B VAL B 1 27  ? -56.473 -27.768 -0.343  0.05 11.02 ? 26   VAL B CA    2  
ATOM   9782   C  C     B VAL B 1 27  ? -57.805 -27.222 0.149   0.05 11.06 ? 26   VAL B C     2  
ATOM   9783   O  O     B VAL B 1 27  ? -58.042 -27.128 1.345   0.05 11.07 ? 26   VAL B O     2  
ATOM   9784   C  CB    B VAL B 1 27  ? -55.492 -26.588 -0.565  0.05 10.97 ? 26   VAL B CB    2  
ATOM   9785   C  CG1   B VAL B 1 27  ? -55.102 -25.958 0.767   0.05 10.96 ? 26   VAL B CG1   2  
ATOM   9786   C  CG2   B VAL B 1 27  ? -54.261 -27.053 -1.320  0.05 10.93 ? 26   VAL B CG2   2  
ATOM   9787   N  N     B ILE B 1 28  ? -58.679 -26.847 -0.781  0.05 11.09 ? 27   ILE B N     2  
ATOM   9788   C  CA    B ILE B 1 28  ? -60.013 -26.414 -0.391  0.05 11.14 ? 27   ILE B CA    2  
ATOM   9789   C  C     B ILE B 1 28  ? -60.808 -27.615 0.138   0.05 11.20 ? 27   ILE B C     2  
ATOM   9790   O  O     B ILE B 1 28  ? -61.475 -27.518 1.168   0.05 11.23 ? 27   ILE B O     2  
ATOM   9791   C  CB    B ILE B 1 28  ? -60.755 -25.739 -1.564  0.05 11.17 ? 27   ILE B CB    2  
ATOM   9792   C  CG1   B ILE B 1 28  ? -59.877 -24.634 -2.165  0.05 11.10 ? 27   ILE B CG1   2  
ATOM   9793   C  CG2   B ILE B 1 28  ? -62.114 -25.202 -1.112  0.05 11.22 ? 27   ILE B CG2   2  
ATOM   9794   C  CD1   B ILE B 1 28  ? -59.337 -23.669 -1.152  0.05 11.05 ? 27   ILE B CD1   2  
ATOM   9795   N  N     B ARG B 1 29  ? -60.706 -28.744 -0.559  0.05 11.21 ? 28   ARG B N     2  
ATOM   9796   C  CA    B ARG B 1 29  ? -61.368 -29.982 -0.134  0.05 11.27 ? 28   ARG B CA    2  
ATOM   9797   C  C     B ARG B 1 29  ? -60.943 -30.377 1.273   0.05 11.25 ? 28   ARG B C     2  
ATOM   9798   O  O     B ARG B 1 29  ? -61.785 -30.675 2.130   0.05 11.30 ? 28   ARG B O     2  
ATOM   9799   C  CB    B ARG B 1 29  ? -61.045 -31.123 -1.091  0.05 11.30 ? 28   ARG B CB    2  
ATOM   9800   C  CG    B ARG B 1 29  ? -61.905 -32.359 -0.879  0.05 11.38 ? 28   ARG B CG    2  
ATOM   9801   C  CD    B ARG B 1 29  ? -61.419 -33.533 -1.700  0.05 11.40 ? 28   ARG B CD    2  
ATOM   9802   N  NE    B ARG B 1 29  ? -60.811 -33.126 -2.965  0.05 11.40 ? 28   ARG B NE    2  
ATOM   9803   C  CZ    B ARG B 1 29  ? -61.493 -32.815 -4.064  0.05 11.45 ? 28   ARG B CZ    2  
ATOM   9804   N  NH1   B ARG B 1 29  ? -62.818 -32.846 -4.057  0.05 11.52 ? 28   ARG B NH1   2  
ATOM   9805   N  NH2   B ARG B 1 29  ? -60.845 -32.461 -5.168  0.05 11.45 ? 28   ARG B NH2   2  
ATOM   9806   N  N     B GLU B 1 30  ? -59.633 -30.372 1.500   0.05 11.19 ? 29   GLU B N     2  
ATOM   9807   C  CA    B GLU B 1 30  ? -59.075 -30.668 2.814   0.05 11.17 ? 29   GLU B CA    2  
ATOM   9808   C  C     B GLU B 1 30  ? -59.585 -29.679 3.863   0.05 11.17 ? 29   GLU B C     2  
ATOM   9809   O  O     B GLU B 1 30  ? -59.889 -30.061 4.993   0.05 11.20 ? 29   GLU B O     2  
ATOM   9810   C  CB    B GLU B 1 30  ? -57.541 -30.667 2.753   0.05 11.11 ? 29   GLU B CB    2  
ATOM   9811   C  CG    B GLU B 1 30  ? -56.837 -30.986 4.075   0.05 11.10 ? 29   GLU B CG    2  
ATOM   9812   C  CD    B GLU B 1 30  ? -57.062 -32.419 4.544   0.05 11.14 ? 29   GLU B CD    2  
ATOM   9813   O  OE1   B GLU B 1 30  ? -56.745 -32.699 5.721   0.05 11.14 ? 29   GLU B OE1   2  
ATOM   9814   O  OE2   B GLU B 1 30  ? -57.546 -33.261 3.747   0.05 11.18 ? 29   GLU B OE2   2  
ATOM   9815   N  N     B LEU B 1 31  ? -59.701 -28.409 3.484   0.05 11.15 ? 30   LEU B N     2  
ATOM   9816   C  CA    B LEU B 1 31  ? -60.145 -27.383 4.419   0.05 11.16 ? 30   LEU B CA    2  
ATOM   9817   C  C     B LEU B 1 31  ? -61.579 -27.575 4.904   0.05 11.24 ? 30   LEU B C     2  
ATOM   9818   O  O     B LEU B 1 31  ? -61.872 -27.363 6.079   0.05 11.27 ? 30   LEU B O     2  
ATOM   9819   C  CB    B LEU B 1 31  ? -59.987 -25.985 3.818   0.05 11.14 ? 30   LEU B CB    2  
ATOM   9820   C  CG    B LEU B 1 31  ? -58.573 -25.424 3.955   0.05 11.08 ? 30   LEU B CG    2  
ATOM   9821   C  CD1   B LEU B 1 31  ? -58.512 -24.007 3.392   0.05 11.06 ? 30   LEU B CD1   2  
ATOM   9822   C  CD2   B LEU B 1 31  ? -58.123 -25.434 5.403   0.05 11.08 ? 30   LEU B CD2   2  
ATOM   9823   N  N     B VAL B 1 32  ? -62.467 -27.951 3.992   0.05 11.28 ? 31   VAL B N     2  
ATOM   9824   C  CA    B VAL B 1 32  ? -63.843 -28.260 4.358   0.05 11.36 ? 31   VAL B CA    2  
ATOM   9825   C  C     B VAL B 1 32  ? -63.854 -29.443 5.321   0.05 11.40 ? 31   VAL B C     2  
ATOM   9826   O  O     B VAL B 1 32  ? -64.439 -29.368 6.405   0.05 11.45 ? 31   VAL B O     2  
ATOM   9827   C  CB    B VAL B 1 32  ? -64.679 -28.593 3.118   0.05 11.41 ? 31   VAL B CB    2  
ATOM   9828   C  CG1   B VAL B 1 32  ? -66.053 -29.117 3.509   0.05 11.51 ? 31   VAL B CG1   2  
ATOM   9829   C  CG2   B VAL B 1 32  ? -64.808 -27.348 2.238   0.05 11.42 ? 31   VAL B CG2   2  
ATOM   9830   N  N     B ALA B 1 33  ? -63.195 -30.527 4.921   0.05 11.36 ? 32   ALA B N     2  
ATOM   9831   C  CA    B ALA B 1 33  ? -63.134 -31.741 5.739   0.05 11.39 ? 32   ALA B CA    2  
ATOM   9832   C  C     B ALA B 1 33  ? -62.694 -31.489 7.188   0.05 11.37 ? 32   ALA B C     2  
ATOM   9833   O  O     B ALA B 1 33  ? -63.159 -32.164 8.108   0.05 11.41 ? 32   ALA B O     2  
ATOM   9834   C  CB    B ALA B 1 33  ? -62.232 -32.785 5.080   0.05 11.36 ? 32   ALA B CB    2  
ATOM   9835   N  N     B ARG B 1 34  ? -61.810 -30.515 7.389   0.05 11.31 ? 33   ARG B N     2  
ATOM   9836   C  CA    B ARG B 1 34  ? -61.339 -30.164 8.731   0.05 11.30 ? 33   ARG B CA    2  
ATOM   9837   C  C     B ARG B 1 34  ? -62.337 -29.332 9.521   0.05 11.36 ? 33   ARG B C     2  
ATOM   9838   O  O     B ARG B 1 34  ? -62.068 -28.925 10.658  0.05 11.38 ? 33   ARG B O     2  
ATOM   9839   C  CB    B ARG B 1 34  ? -60.018 -29.414 8.651   0.05 11.24 ? 33   ARG B CB    2  
ATOM   9840   C  CG    B ARG B 1 34  ? -58.893 -30.247 8.117   0.05 11.19 ? 33   ARG B CG    2  
ATOM   9841   C  CD    B ARG B 1 34  ? -57.603 -29.462 8.181   0.05 11.14 ? 33   ARG B CD    2  
ATOM   9842   N  NE    B ARG B 1 34  ? -56.473 -30.244 7.708   0.05 11.10 ? 33   ARG B NE    2  
ATOM   9843   C  CZ    B ARG B 1 34  ? -55.210 -29.884 7.890   0.05 11.07 ? 33   ARG B CZ    2  
ATOM   9844   N  NH1   B ARG B 1 34  ? -54.223 -30.649 7.441   0.05 11.05 ? 33   ARG B NH1   2  
ATOM   9845   N  NH2   B ARG B 1 34  ? -54.941 -28.755 8.531   0.05 11.07 ? 33   ARG B NH2   2  
ATOM   9846   N  N     B GLY B 1 35  ? -63.471 -29.045 8.900   0.05 11.40 ? 34   GLY B N     2  
ATOM   9847   C  CA    B GLY B 1 35  ? -64.574 -28.435 9.604   0.05 11.48 ? 34   GLY B CA    2  
ATOM   9848   C  C     B GLY B 1 35  ? -64.670 -26.926 9.595   0.05 11.49 ? 34   GLY B C     2  
ATOM   9849   O  O     B GLY B 1 35  ? -65.568 -26.409 10.223  0.05 11.57 ? 34   GLY B O     2  
ATOM   9850   N  N     B HIS B 1 36  ? -63.775 -26.216 8.908   0.05 11.42 ? 35   HIS B N     2  
ATOM   9851   C  CA    B HIS B 1 36  ? -63.912 -24.761 8.783   0.05 11.43 ? 35   HIS B CA    2  
ATOM   9852   C  C     B HIS B 1 36  ? -65.121 -24.451 7.891   0.05 11.50 ? 35   HIS B C     2  
ATOM   9853   O  O     B HIS B 1 36  ? -65.535 -25.299 7.106   0.05 11.52 ? 35   HIS B O     2  
ATOM   9854   C  CB    B HIS B 1 36  ? -62.660 -24.129 8.157   0.05 11.35 ? 35   HIS B CB    2  
ATOM   9855   C  CG    B HIS B 1 36  ? -61.372 -24.490 8.838   0.05 11.29 ? 35   HIS B CG    2  
ATOM   9856   N  ND1   B HIS B 1 36  ? -60.959 -23.904 10.016  0.05 11.31 ? 35   HIS B ND1   2  
ATOM   9857   C  CD2   B HIS B 1 36  ? -60.388 -25.352 8.484   0.05 11.23 ? 35   HIS B CD2   2  
ATOM   9858   C  CE1   B HIS B 1 36  ? -59.786 -24.400 10.366  0.05 11.26 ? 35   HIS B CE1   2  
ATOM   9859   N  NE2   B HIS B 1 36  ? -59.416 -25.280 9.452   0.05 11.21 ? 35   HIS B NE2   2  
ATOM   9860   N  N     B ARG B 1 37  ? -65.677 -23.243 7.983   0.05 11.54 ? 36   ARG B N     2  
ATOM   9861   C  CA    B ARG B 1 37  ? -66.756 -22.861 7.074   0.05 11.61 ? 36   ARG B CA    2  
ATOM   9862   C  C     B ARG B 1 37  ? -66.164 -22.083 5.906   0.05 11.55 ? 36   ARG B C     2  
ATOM   9863   O  O     B ARG B 1 37  ? -65.689 -20.964 6.084   0.05 11.52 ? 36   ARG B O     2  
ATOM   9864   C  CB    B ARG B 1 37  ? -67.844 -22.040 7.774   0.05 11.71 ? 36   ARG B CB    2  
ATOM   9865   C  CG    B ARG B 1 37  ? -68.918 -21.509 6.814   0.05 11.79 ? 36   ARG B CG    2  
ATOM   9866   C  CD    B ARG B 1 37  ? -70.122 -20.951 7.557   0.05 11.92 ? 36   ARG B CD    2  
ATOM   9867   N  NE    B ARG B 1 37  ? -69.810 -19.724 8.285   0.05 11.94 ? 36   ARG B NE    2  
ATOM   9868   C  CZ    B ARG B 1 37  ? -70.033 -18.505 7.809   0.05 11.98 ? 36   ARG B CZ    2  
ATOM   9869   N  NH1   B ARG B 1 37  ? -70.556 -18.357 6.608   0.05 11.99 ? 36   ARG B NH1   2  
ATOM   9870   N  NH2   B ARG B 1 37  ? -69.729 -17.441 8.534   0.05 12.00 ? 36   ARG B NH2   2  
ATOM   9871   N  N     B VAL B 1 38  ? -66.202 -22.683 4.722   0.05 11.52 ? 37   VAL B N     2  
ATOM   9872   C  CA    B VAL B 1 38  ? -65.503 -22.127 3.570   0.05 11.46 ? 37   VAL B CA    2  
ATOM   9873   C  C     B VAL B 1 38  ? -66.433 -21.693 2.443   0.05 11.52 ? 37   VAL B C     2  
ATOM   9874   O  O     B VAL B 1 38  ? -67.200 -22.495 1.917   0.05 11.59 ? 37   VAL B O     2  
ATOM   9875   C  CB    B VAL B 1 38  ? -64.488 -23.133 3.005   0.05 11.37 ? 37   VAL B CB    2  
ATOM   9876   C  CG1   B VAL B 1 38  ? -63.679 -22.508 1.888   0.05 11.31 ? 37   VAL B CG1   2  
ATOM   9877   C  CG2   B VAL B 1 38  ? -63.580 -23.645 4.115   0.05 11.32 ? 37   VAL B CG2   2  
ATOM   9878   N  N     B THR B 1 39  ? -66.348 -20.420 2.067   0.05 11.49 ? 38   THR B N     2  
ATOM   9879   C  CA    B THR B 1 39  ? -67.046 -19.919 0.888   0.05 11.54 ? 38   THR B CA    2  
ATOM   9880   C  C     B THR B 1 39  ? -66.035 -19.778 -0.240  0.05 11.45 ? 38   THR B C     2  
ATOM   9881   O  O     B THR B 1 39  ? -64.830 -19.750 0.011   0.05 11.37 ? 38   THR B O     2  
ATOM   9882   C  CB    B THR B 1 39  ? -67.716 -18.560 1.159   0.05 11.60 ? 38   THR B CB    2  
ATOM   9883   O  OG1   B THR B 1 39  ? -66.756 -17.653 1.707   0.05 11.53 ? 38   THR B OG1   2  
ATOM   9884   C  CG2   B THR B 1 39  ? -68.865 -18.714 2.155   0.05 11.70 ? 38   THR B CG2   2  
ATOM   9885   N  N     B TYR B 1 40  ? -66.518 -19.692 -1.475  0.05 11.49 ? 39   TYR B N     2  
ATOM   9886   C  CA    B TYR B 1 40  ? -65.629 -19.630 -2.638  0.05 11.41 ? 39   TYR B CA    2  
ATOM   9887   C  C     B TYR B 1 40  ? -66.207 -18.661 -3.662  0.05 11.45 ? 39   TYR B C     2  
ATOM   9888   O  O     B TYR B 1 40  ? -67.095 -19.032 -4.440  0.05 11.54 ? 39   TYR B O     2  
ATOM   9889   C  CB    B TYR B 1 40  ? -65.458 -21.030 -3.259  0.05 11.40 ? 39   TYR B CB    2  
ATOM   9890   C  CG    B TYR B 1 40  ? -64.214 -21.236 -4.118  0.05 11.31 ? 39   TYR B CG    2  
ATOM   9891   C  CD1   B TYR B 1 40  ? -63.775 -20.258 -5.004  0.05 11.27 ? 39   TYR B CD1   2  
ATOM   9892   C  CD2   B TYR B 1 40  ? -63.492 -22.428 -4.051  0.05 11.28 ? 39   TYR B CD2   2  
ATOM   9893   C  CE1   B TYR B 1 40  ? -62.646 -20.449 -5.789  0.05 11.20 ? 39   TYR B CE1   2  
ATOM   9894   C  CE2   B TYR B 1 40  ? -62.352 -22.629 -4.828  0.05 11.21 ? 39   TYR B CE2   2  
ATOM   9895   C  CZ    B TYR B 1 40  ? -61.936 -21.628 -5.699  0.05 11.17 ? 39   TYR B CZ    2  
ATOM   9896   O  OH    B TYR B 1 40  ? -60.818 -21.806 -6.485  0.05 11.11 ? 39   TYR B OH    2  
ATOM   9897   N  N     B ALA B 1 41  ? -65.711 -17.424 -3.652  0.05 11.39 ? 40   ALA B N     2  
ATOM   9898   C  CA    B ALA B 1 41  ? -66.117 -16.430 -4.641  0.05 11.42 ? 40   ALA B CA    2  
ATOM   9899   C  C     B ALA B 1 41  ? -65.592 -16.842 -6.003  0.05 11.37 ? 40   ALA B C     2  
ATOM   9900   O  O     B ALA B 1 41  ? -64.390 -16.931 -6.203  0.05 11.28 ? 40   ALA B O     2  
ATOM   9901   C  CB    B ALA B 1 41  ? -65.601 -15.037 -4.257  0.05 11.39 ? 40   ALA B CB    2  
ATOM   9902   N  N     B ILE B 1 42  ? -66.504 -17.090 -6.941  0.05 11.44 ? 41   ILE B N     2  
ATOM   9903   C  CA    B ILE B 1 42  ? -66.161 -17.717 -8.216  0.05 11.43 ? 41   ILE B CA    2  
ATOM   9904   C  C     B ILE B 1 42  ? -67.158 -17.250 -9.277  0.05 11.52 ? 41   ILE B C     2  
ATOM   9905   O  O     B ILE B 1 42  ? -68.286 -16.893 -8.935  0.05 11.62 ? 41   ILE B O     2  
ATOM   9906   C  CB    B ILE B 1 42  ? -66.239 -19.257 -8.068  0.05 11.44 ? 41   ILE B CB    2  
ATOM   9907   C  CG1   B ILE B 1 42  ? -65.616 -19.983 -9.266  0.05 11.43 ? 41   ILE B CG1   2  
ATOM   9908   C  CG2   B ILE B 1 42  ? -67.683 -19.694 -7.835  0.05 11.56 ? 41   ILE B CG2   2  
ATOM   9909   C  CD1   B ILE B 1 42  ? -64.085 -19.897 -9.328  0.05 11.32 ? 41   ILE B CD1   2  
ATOM   9910   N  N     B PRO B 1 43  ? -66.758 -17.222 -10.561 0.05 11.50 ? 42   PRO B N     2  
ATOM   9911   C  CA    B PRO B 1 43  ? -67.766 -16.941 -11.593 0.05 11.60 ? 42   PRO B CA    2  
ATOM   9912   C  C     B PRO B 1 43  ? -68.804 -18.066 -11.651 0.05 11.70 ? 42   PRO B C     2  
ATOM   9913   O  O     B PRO B 1 43  ? -68.583 -19.096 -11.013 0.05 11.67 ? 42   PRO B O     2  
ATOM   9914   C  CB    B PRO B 1 43  ? -66.932 -16.875 -12.881 0.05 11.54 ? 42   PRO B CB    2  
ATOM   9915   C  CG    B PRO B 1 43  ? -65.593 -16.463 -12.425 0.05 11.41 ? 42   PRO B CG    2  
ATOM   9916   C  CD    B PRO B 1 43  ? -65.393 -17.161 -11.113 0.05 11.39 ? 42   PRO B CD    2  
ATOM   9917   N  N     B PRO B 1 44  ? -69.910 -17.871 -12.395 0.05 11.82 ? 43   PRO B N     2  
ATOM   9918   C  CA    B PRO B 1 44  ? -71.042 -18.800 -12.330 0.05 11.94 ? 43   PRO B CA    2  
ATOM   9919   C  C     B PRO B 1 44  ? -70.728 -20.131 -12.953 0.05 11.95 ? 43   PRO B C     2  
ATOM   9920   O  O     B PRO B 1 44  ? -71.220 -21.164 -12.479 0.05 12.02 ? 43   PRO B O     2  
ATOM   9921   C  CB    B PRO B 1 44  ? -72.123 -18.105 -13.176 0.05 12.07 ? 43   PRO B CB    2  
ATOM   9922   C  CG    B PRO B 1 44  ? -71.709 -16.683 -13.245 0.05 12.03 ? 43   PRO B CG    2  
ATOM   9923   C  CD    B PRO B 1 44  ? -70.219 -16.705 -13.243 0.05 11.87 ? 43   PRO B CD    2  
ATOM   9924   N  N     B VAL B 1 45  ? -69.923 -20.105 -14.010 0.05 11.90 ? 44   VAL B N     2  
ATOM   9925   C  CA    B VAL B 1 45  ? -69.682 -21.309 -14.786 0.05 11.93 ? 44   VAL B CA    2  
ATOM   9926   C  C     B VAL B 1 45  ? -68.952 -22.380 -13.978 0.05 11.86 ? 44   VAL B C     2  
ATOM   9927   O  O     B VAL B 1 45  ? -69.147 -23.577 -14.215 0.05 11.92 ? 44   VAL B O     2  
ATOM   9928   C  CB    B VAL B 1 45  ? -68.935 -20.999 -16.108 0.05 11.89 ? 44   VAL B CB    2  
ATOM   9929   C  CG1   B VAL B 1 45  ? -67.427 -20.865 -15.876 0.05 11.75 ? 44   VAL B CG1   2  
ATOM   9930   C  CG2   B VAL B 1 45  ? -69.218 -22.071 -17.126 0.05 11.92 ? 44   VAL B CG2   2  
ATOM   9931   N  N     B PHE B 1 46  ? -68.120 -21.949 -13.027 0.05 11.74 ? 45   PHE B N     2  
ATOM   9932   C  CA    B PHE B 1 46  ? -67.382 -22.895 -12.177 0.05 11.68 ? 45   PHE B CA    2  
ATOM   9933   C  C     B PHE B 1 46  ? -68.123 -23.217 -10.877 0.05 11.71 ? 45   PHE B C     2  
ATOM   9934   O  O     B PHE B 1 46  ? -67.506 -23.611 -9.877  0.05 11.64 ? 45   PHE B O     2  
ATOM   9935   C  CB    B PHE B 1 46  ? -65.961 -22.392 -11.866 0.05 11.54 ? 45   PHE B CB    2  
ATOM   9936   C  CG    B PHE B 1 46  ? -64.914 -22.819 -12.876 0.05 11.50 ? 45   PHE B CG    2  
ATOM   9937   C  CD1   B PHE B 1 46  ? -65.269 -23.439 -14.067 0.05 11.59 ? 45   PHE B CD1   2  
ATOM   9938   C  CD2   B PHE B 1 46  ? -63.566 -22.607 -12.617 0.05 11.39 ? 45   PHE B CD2   2  
ATOM   9939   C  CE1   B PHE B 1 46  ? -64.299 -23.821 -14.986 0.05 11.56 ? 45   PHE B CE1   2  
ATOM   9940   C  CE2   B PHE B 1 46  ? -62.594 -22.997 -13.521 0.05 11.37 ? 45   PHE B CE2   2  
ATOM   9941   C  CZ    B PHE B 1 46  ? -62.958 -23.603 -14.706 0.05 11.45 ? 45   PHE B CZ    2  
ATOM   9942   N  N     B ALA B 1 47  ? -69.444 -23.045 -10.895 0.05 11.82 ? 46   ALA B N     2  
ATOM   9943   C  CA    B ALA B 1 47  ? -70.298 -23.487 -9.802  0.05 11.86 ? 46   ALA B CA    2  
ATOM   9944   C  C     B ALA B 1 47  ? -69.986 -24.933 -9.420  0.05 11.89 ? 46   ALA B C     2  
ATOM   9945   O  O     B ALA B 1 47  ? -69.505 -25.200 -8.313  0.05 11.84 ? 46   ALA B O     2  
ATOM   9946   C  CB    B ALA B 1 47  ? -71.767 -23.351 -10.190 0.05 11.99 ? 46   ALA B CB    2  
ATOM   9947   N  N     B ASP B 1 48  ? -70.253 -25.858 -10.344 0.05 11.97 ? 47   ASP B N     2  
ATOM   9948   C  CA    B ASP B 1 48  ? -70.103 -27.292 -10.073 0.05 12.01 ? 47   ASP B CA    2  
ATOM   9949   C  C     B ASP B 1 48  ? -68.703 -27.625 -9.567  0.05 11.89 ? 47   ASP B C     2  
ATOM   9950   O  O     B ASP B 1 48  ? -68.528 -28.418 -8.634  0.05 11.88 ? 47   ASP B O     2  
ATOM   9951   C  CB    B ASP B 1 48  ? -70.380 -28.134 -11.328 0.05 12.13 ? 47   ASP B CB    2  
ATOM   9952   C  CG    B ASP B 1 48  ? -71.854 -28.187 -11.696 0.05 12.27 ? 47   ASP B CG    2  
ATOM   9953   O  OD1   B ASP B 1 48  ? -72.163 -28.469 -12.873 0.05 12.36 ? 47   ASP B OD1   2  
ATOM   9954   O  OD2   B ASP B 1 48  ? -72.703 -27.949 -10.815 0.05 12.31 ? 47   ASP B OD2   2  
ATOM   9955   N  N     B LYS B 1 49  ? -67.712 -27.021 -10.203 0.05 11.81 ? 48   LYS B N     2  
ATOM   9956   C  CA    B LYS B 1 49  ? -66.317 -27.339 -9.927  0.05 11.70 ? 48   LYS B CA    2  
ATOM   9957   C  C     B LYS B 1 49  ? -65.932 -27.063 -8.483  0.05 11.62 ? 48   LYS B C     2  
ATOM   9958   O  O     B LYS B 1 49  ? -65.309 -27.903 -7.822  0.05 11.59 ? 48   LYS B O     2  
ATOM   9959   C  CB    B LYS B 1 49  ? -65.407 -26.563 -10.877 0.05 11.63 ? 48   LYS B CB    2  
ATOM   9960   C  CG    B LYS B 1 49  ? -63.940 -26.679 -10.542 0.05 11.54 ? 48   LYS B CG    2  
ATOM   9961   C  CD    B LYS B 1 49  ? -63.081 -26.065 -11.639 0.05 11.48 ? 48   LYS B CD    2  
ATOM   9962   C  CE    B LYS B 1 49  ? -63.062 -26.951 -12.872 0.05 11.51 ? 48   LYS B CE    2  
ATOM   9963   N  NZ    B LYS B 1 49  ? -62.556 -28.333 -12.560 0.05 11.49 ? 48   LYS B NZ    2  
ATOM   9964   N  N     B VAL B 1 50  ? -66.316 -25.897 -7.976  0.05 11.60 ? 49   VAL B N     2  
ATOM   9965   C  CA    B VAL B 1 50  ? -65.959 -25.562 -6.603  0.05 11.53 ? 49   VAL B CA    2  
ATOM   9966   C  C     B VAL B 1 50  ? -66.884 -26.199 -5.553  0.05 11.60 ? 49   VAL B C     2  
ATOM   9967   O  O     B VAL B 1 50  ? -66.421 -26.588 -4.487  0.05 11.56 ? 49   VAL B O     2  
ATOM   9968   C  CB    B VAL B 1 50  ? -65.797 -24.037 -6.381  0.05 11.48 ? 49   VAL B CB    2  
ATOM   9969   C  CG1   B VAL B 1 50  ? -64.648 -23.498 -7.237  0.05 11.41 ? 49   VAL B CG1   2  
ATOM   9970   C  CG2   B VAL B 1 50  ? -67.072 -23.300 -6.701  0.05 11.56 ? 49   VAL B CG2   2  
ATOM   9971   N  N     B ALA B 1 51  ? -68.175 -26.332 -5.864  0.05 11.72 ? 50   ALA B N     2  
ATOM   9972   C  CA    B ALA B 1 51  ? -69.153 -26.834 -4.889  0.05 11.80 ? 50   ALA B CA    2  
ATOM   9973   C  C     B ALA B 1 51  ? -68.818 -28.247 -4.428  0.05 11.79 ? 50   ALA B C     2  
ATOM   9974   O  O     B ALA B 1 51  ? -69.158 -28.651 -3.310  0.05 11.80 ? 50   ALA B O     2  
ATOM   9975   C  CB    B ALA B 1 51  ? -70.573 -26.796 -5.471  0.05 11.94 ? 50   ALA B CB    2  
ATOM   9976   N  N     B ALA B 1 52  ? -68.152 -28.985 -5.307  0.05 11.79 ? 51   ALA B N     2  
ATOM   9977   C  CA    B ALA B 1 52  ? -67.764 -30.369 -5.046  0.05 11.79 ? 51   ALA B CA    2  
ATOM   9978   C  C     B ALA B 1 52  ? -66.870 -30.532 -3.812  0.05 11.70 ? 51   ALA B C     2  
ATOM   9979   O  O     B ALA B 1 52  ? -66.817 -31.610 -3.215  0.05 11.72 ? 51   ALA B O     2  
ATOM   9980   C  CB    B ALA B 1 52  ? -67.078 -30.953 -6.277  0.05 11.79 ? 51   ALA B CB    2  
ATOM   9981   N  N     B THR B 1 53  ? -66.155 -29.475 -3.435  0.05 11.60 ? 52   THR B N     2  
ATOM   9982   C  CA    B THR B 1 53  ? -65.332 -29.528 -2.224  0.05 11.51 ? 52   THR B CA    2  
ATOM   9983   C  C     B THR B 1 53  ? -66.180 -29.403 -0.956  0.05 11.54 ? 52   THR B C     2  
ATOM   9984   O  O     B THR B 1 53  ? -65.684 -29.606 0.152   0.05 11.50 ? 52   THR B O     2  
ATOM   9985   C  CB    B THR B 1 53  ? -64.254 -28.417 -2.216  0.05 11.42 ? 52   THR B CB    2  
ATOM   9986   O  OG1   B THR B 1 53  ? -64.878 -27.140 -2.015  0.05 11.43 ? 52   THR B OG1   2  
ATOM   9987   C  CG2   B THR B 1 53  ? -63.495 -28.404 -3.525  0.05 11.39 ? 52   THR B CG2   2  
ATOM   9988   N  N     B GLY B 1 54  ? -67.454 -29.067 -1.120  0.05 11.62 ? 53   GLY B N     2  
ATOM   9989   C  CA    B GLY B 1 54  ? -68.312 -28.766 0.014   0.05 11.66 ? 53   GLY B CA    2  
ATOM   9990   C  C     B GLY B 1 54  ? -68.288 -27.291 0.371   0.05 11.65 ? 53   GLY B C     2  
ATOM   9991   O  O     B GLY B 1 54  ? -69.081 -26.827 1.202   0.05 11.72 ? 53   GLY B O     2  
ATOM   9992   N  N     B ALA B 1 55  ? -67.364 -26.551 -0.243  0.05 11.57 ? 54   ALA B N     2  
ATOM   9993   C  CA    B ALA B 1 55  ? -67.361 -25.100 -0.119  0.05 11.56 ? 54   ALA B CA    2  
ATOM   9994   C  C     B ALA B 1 55  ? -68.594 -24.582 -0.836  0.05 11.65 ? 54   ALA B C     2  
ATOM   9995   O  O     B ALA B 1 55  ? -69.025 -25.167 -1.820  0.05 11.70 ? 54   ALA B O     2  
ATOM   9996   C  CB    B ALA B 1 55  ? -66.103 -24.506 -0.746  0.05 11.46 ? 54   ALA B CB    2  
ATOM   9997   N  N     B ARG B 1 56  ? -69.155 -23.482 -0.347  0.05 11.69 ? 55   ARG B N     2  
ATOM   9998   C  CA    B ARG B 1 56  ? -70.313 -22.886 -1.000  0.05 11.79 ? 55   ARG B CA    2  
ATOM   9999   C  C     B ARG B 1 56  ? -69.844 -21.835 -1.997  0.05 11.74 ? 55   ARG B C     2  
ATOM   10000  O  O     B ARG B 1 56  ? -69.160 -20.891 -1.623  0.05 11.68 ? 55   ARG B O     2  
ATOM   10001  C  CB    B ARG B 1 56  ? -71.264 -22.257 0.017   0.05 11.88 ? 55   ARG B CB    2  
ATOM   10002  C  CG    B ARG B 1 56  ? -72.537 -21.714 -0.628  0.05 11.98 ? 55   ARG B CG    2  
ATOM   10003  C  CD    B ARG B 1 56  ? -73.541 -21.264 0.400   0.05 12.11 ? 55   ARG B CD    2  
ATOM   10004  N  NE    B ARG B 1 56  ? -72.995 -20.295 1.346   0.05 12.08 ? 55   ARG B NE    2  
ATOM   10005  C  CZ    B ARG B 1 56  ? -72.750 -19.022 1.062   0.05 12.07 ? 55   ARG B CZ    2  
ATOM   10006  N  NH1   B ARG B 1 56  ? -72.982 -18.554 -0.156  0.05 12.08 ? 55   ARG B NH1   2  
ATOM   10007  N  NH2   B ARG B 1 56  ? -72.264 -18.214 1.996   0.05 12.05 ? 55   ARG B NH2   2  
ATOM   10008  N  N     B PRO B 1 57  ? -70.211 -21.998 -3.273  0.05 11.78 ? 56   PRO B N     2  
ATOM   10009  C  CA    B PRO B 1 57  ? -69.753 -21.066 -4.313  0.05 11.74 ? 56   PRO B CA    2  
ATOM   10010  C  C     B PRO B 1 57  ? -70.484 -19.744 -4.254  0.05 11.81 ? 56   PRO B C     2  
ATOM   10011  O  O     B PRO B 1 57  ? -71.657 -19.698 -3.862  0.05 11.92 ? 56   PRO B O     2  
ATOM   10012  C  CB    B PRO B 1 57  ? -70.100 -21.786 -5.617  0.05 11.80 ? 56   PRO B CB    2  
ATOM   10013  C  CG    B PRO B 1 57  ? -70.444 -23.203 -5.217  0.05 11.83 ? 56   PRO B CG    2  
ATOM   10014  C  CD    B PRO B 1 57  ? -70.978 -23.120 -3.838  0.05 11.86 ? 56   PRO B CD    2  
ATOM   10015  N  N     B VAL B 1 58  ? -69.788 -18.684 -4.660  0.05 11.74 ? 57   VAL B N     2  
ATOM   10016  C  CA    B VAL B 1 58  ? -70.305 -17.328 -4.587  0.05 11.80 ? 57   VAL B CA    2  
ATOM   10017  C  C     B VAL B 1 58  ? -70.100 -16.665 -5.943  0.05 11.79 ? 57   VAL B C     2  
ATOM   10018  O  O     B VAL B 1 58  ? -68.997 -16.211 -6.261  0.05 11.68 ? 57   VAL B O     2  
ATOM   10019  C  CB    B VAL B 1 58  ? -69.589 -16.532 -3.480  0.05 11.73 ? 57   VAL B CB    2  
ATOM   10020  C  CG1   B VAL B 1 58  ? -70.103 -15.112 -3.431  0.05 11.79 ? 57   VAL B CG1   2  
ATOM   10021  C  CG2   B VAL B 1 58  ? -69.776 -17.216 -2.131  0.05 11.75 ? 57   VAL B CG2   2  
ATOM   10022  N  N     B LEU B 1 59  ? -71.172 -16.613 -6.733  0.05 11.90 ? 58   LEU B N     2  
ATOM   10023  C  CA    B LEU B 1 59  ? -71.099 -16.275 -8.164  0.05 11.90 ? 58   LEU B CA    2  
ATOM   10024  C  C     B LEU B 1 59  ? -70.972 -14.789 -8.486  0.05 11.87 ? 58   LEU B C     2  
ATOM   10025  O  O     B LEU B 1 59  ? -71.931 -14.027 -8.341  0.05 11.93 ? 58   LEU B O     2  
ATOM   10026  C  CB    B LEU B 1 59  ? -72.320 -16.827 -8.918  0.05 12.04 ? 58   LEU B CB    2  
ATOM   10027  C  CG    B LEU B 1 59  ? -72.794 -18.267 -8.689  0.05 12.07 ? 58   LEU B CG    2  
ATOM   10028  C  CD1   B LEU B 1 59  ? -73.706 -18.355 -7.473  0.05 12.08 ? 58   LEU B CD1   2  
ATOM   10029  C  CD2   B LEU B 1 59  ? -73.542 -18.787 -9.901  0.05 12.22 ? 58   LEU B CD2   2  
ATOM   10030  N  N     B TYR B 1 60  ? -69.800 -14.368 -8.948  0.05 11.78 ? 59   TYR B N     2  
ATOM   10031  C  CA    B TYR B 1 60  ? -69.722 -13.034 -9.540  0.05 11.77 ? 59   TYR B CA    2  
ATOM   10032  C  C     B TYR B 1 60  ? -69.617 -13.119 -11.058 0.05 11.75 ? 59   TYR B C     2  
ATOM   10033  O  O     B TYR B 1 60  ? -69.267 -14.163 -11.605 0.05 11.71 ? 59   TYR B O     2  
ATOM   10034  C  CB    B TYR B 1 60  ? -68.590 -12.192 -8.931  0.05 11.66 ? 59   TYR B CB    2  
ATOM   10035  C  CG    B TYR B 1 60  ? -67.177 -12.668 -9.211  0.05 11.53 ? 59   TYR B CG    2  
ATOM   10036  C  CD1   B TYR B 1 60  ? -66.625 -13.745 -8.517  0.05 11.47 ? 59   TYR B CD1   2  
ATOM   10037  C  CD2   B TYR B 1 60  ? -66.381 -12.012 -10.137 0.05 11.46 ? 59   TYR B CD2   2  
ATOM   10038  C  CE1   B TYR B 1 60  ? -65.322 -14.164 -8.763  0.05 11.36 ? 59   TYR B CE1   2  
ATOM   10039  C  CE2   B TYR B 1 60  ? -65.082 -12.424 -10.392 0.05 11.35 ? 59   TYR B CE2   2  
ATOM   10040  C  CZ    B TYR B 1 60  ? -64.559 -13.501 -9.710  0.05 11.30 ? 59   TYR B CZ    2  
ATOM   10041  O  OH    B TYR B 1 60  ? -63.262 -13.901 -9.970  0.05 11.21 ? 59   TYR B OH    2  
ATOM   10042  N  N     B HIS B 1 61  ? -69.968 -12.025 -11.731 0.05 11.79 ? 60   HIS B N     2  
ATOM   10043  C  CA    B HIS B 1 61  ? -69.762 -11.903 -13.161 0.05 11.77 ? 60   HIS B CA    2  
ATOM   10044  C  C     B HIS B 1 61  ? -68.288 -11.643 -13.495 0.05 11.63 ? 60   HIS B C     2  
ATOM   10045  O  O     B HIS B 1 61  ? -67.680 -10.708 -12.967 0.05 11.57 ? 60   HIS B O     2  
ATOM   10046  C  CB    B HIS B 1 61  ? -70.608 -10.762 -13.736 0.05 11.86 ? 60   HIS B CB    2  
ATOM   10047  C  CG    B HIS B 1 61  ? -70.416 -10.561 -15.203 0.05 11.85 ? 60   HIS B CG    2  
ATOM   10048  N  ND1   B HIS B 1 61  ? -70.907 -11.441 -16.147 0.05 11.92 ? 60   HIS B ND1   2  
ATOM   10049  C  CD2   B HIS B 1 61  ? -69.782 -9.583  -15.893 0.05 11.78 ? 60   HIS B CD2   2  
ATOM   10050  C  CE1   B HIS B 1 61  ? -70.580 -11.011 -17.353 0.05 11.90 ? 60   HIS B CE1   2  
ATOM   10051  N  NE2   B HIS B 1 61  ? -69.896 -9.888  -17.227 0.05 11.81 ? 60   HIS B NE2   2  
ATOM   10052  N  N     B SER B 1 62  ? -67.733 -12.452 -14.393 0.05 11.58 ? 61   SER B N     2  
ATOM   10053  C  CA    B SER B 1 62  ? -66.364 -12.274 -14.849 0.05 11.46 ? 61   SER B CA    2  
ATOM   10054  C  C     B SER B 1 62  ? -66.355 -11.730 -16.268 0.05 11.47 ? 61   SER B C     2  
ATOM   10055  O  O     B SER B 1 62  ? -67.155 -12.154 -17.111 0.05 11.55 ? 61   SER B O     2  
ATOM   10056  C  CB    B SER B 1 62  ? -65.601 -13.603 -14.788 0.05 11.41 ? 61   SER B CB    2  
ATOM   10057  O  OG    B SER B 1 62  ? -64.267 -13.457 -15.244 0.05 11.30 ? 61   SER B OG    2  
ATOM   10058  N  N     B THR B 1 63  ? -65.459 -10.785 -16.531 0.05 11.39 ? 62   THR B N     2  
ATOM   10059  C  CA    B THR B 1 63  ? -65.285 -10.259 -17.881 0.05 11.38 ? 62   THR B CA    2  
ATOM   10060  C  C     B THR B 1 63  ? -64.098 -10.939 -18.580 0.05 11.29 ? 62   THR B C     2  
ATOM   10061  O  O     B THR B 1 63  ? -63.832 -10.698 -19.758 0.05 11.26 ? 62   THR B O     2  
ATOM   10062  C  CB    B THR B 1 63  ? -65.111 -8.723  -17.874 0.05 11.36 ? 62   THR B CB    2  
ATOM   10063  O  OG1   B THR B 1 63  ? -63.936 -8.369  -17.129 0.05 11.26 ? 62   THR B OG1   2  
ATOM   10064  C  CG2   B THR B 1 63  ? -66.324 -8.059  -17.238 0.05 11.47 ? 62   THR B CG2   2  
ATOM   10065  N  N     B LEU B 1 64  ? -63.391 -11.799 -17.844 0.05 11.26 ? 63   LEU B N     2  
ATOM   10066  C  CA    B LEU B 1 64  ? -62.319 -12.618 -18.416 0.05 11.19 ? 63   LEU B CA    2  
ATOM   10067  C  C     B LEU B 1 64  ? -62.875 -13.707 -19.337 0.05 11.26 ? 63   LEU B C     2  
ATOM   10068  O  O     B LEU B 1 64  ? -64.083 -13.936 -19.353 0.05 11.36 ? 63   LEU B O     2  
ATOM   10069  C  CB    B LEU B 1 64  ? -61.497 -13.268 -17.296 0.05 11.13 ? 63   LEU B CB    2  
ATOM   10070  C  CG    B LEU B 1 64  ? -60.731 -12.378 -16.324 0.05 11.05 ? 63   LEU B CG    2  
ATOM   10071  C  CD1   B LEU B 1 64  ? -60.095 -13.218 -15.213 0.05 11.00 ? 63   LEU B CD1   2  
ATOM   10072  C  CD2   B LEU B 1 64  ? -59.670 -11.572 -17.039 0.05 10.99 ? 63   LEU B CD2   2  
ATOM   10073  N  N     B PRO B 1 65  ? -61.995 -14.375 -20.119 0.05 11.23 ? 64   PRO B N     2  
ATOM   10074  C  CA    B PRO B 1 65  ? -62.329 -15.553 -20.942 0.05 11.29 ? 64   PRO B CA    2  
ATOM   10075  C  C     B PRO B 1 65  ? -62.334 -16.894 -20.184 0.05 11.33 ? 64   PRO B C     2  
ATOM   10076  O  O     B PRO B 1 65  ? -62.728 -16.914 -19.020 0.05 11.34 ? 64   PRO B O     2  
ATOM   10077  C  CB    B PRO B 1 65  ? -61.208 -15.587 -21.988 0.05 11.23 ? 64   PRO B CB    2  
ATOM   10078  C  CG    B PRO B 1 65  ? -60.491 -14.287 -21.872 0.05 11.16 ? 64   PRO B CG    2  
ATOM   10079  C  CD    B PRO B 1 65  ? -60.665 -13.847 -20.462 0.05 11.13 ? 64   PRO B CD    2  
ATOM   10080  N  N     B GLY B 1 66  ? -61.878 -17.977 -20.835 0.05 11.35 ? 65   GLY B N     2  
ATOM   10081  C  CA    B GLY B 1 66  ? -62.028 -19.334 -20.313 0.05 11.42 ? 65   GLY B CA    2  
ATOM   10082  C  C     B GLY B 1 66  ? -60.968 -20.398 -20.624 0.05 11.43 ? 65   GLY B C     2  
ATOM   10083  O  O     B GLY B 1 66  ? -59.830 -20.072 -21.004 0.05 11.41 ? 65   GLY B O     2  
ATOM   10084  N  N     B PRO B 1 67  ? -61.335 -21.688 -20.446 0.05 11.48 ? 66   PRO B N     2  
ATOM   10085  C  CA    B PRO B 1 67  ? -60.429 -22.844 -20.500 0.05 11.49 ? 66   PRO B CA    2  
ATOM   10086  C  C     B PRO B 1 67  ? -60.550 -23.659 -21.785 0.05 11.59 ? 66   PRO B C     2  
ATOM   10087  O  O     B PRO B 1 67  ? -59.638 -24.399 -22.161 0.05 11.64 ? 66   PRO B O     2  
ATOM   10088  C  CB    B PRO B 1 67  ? -60.936 -23.696 -19.343 0.05 11.53 ? 66   PRO B CB    2  
ATOM   10089  C  CG    B PRO B 1 67  ? -62.448 -23.483 -19.389 0.05 11.60 ? 66   PRO B CG    2  
ATOM   10090  C  CD    B PRO B 1 67  ? -62.675 -22.085 -19.961 0.05 11.55 ? 66   PRO B CD    2  
ATOM   10091  N  N     B ASP B 1 68  ? -61.693 -23.499 -22.435 0.05 11.62 ? 67   ASP B N     2  
ATOM   10092  C  CA    B ASP B 1 68  ? -62.146 -24.293 -23.556 0.05 11.75 ? 67   ASP B CA    2  
ATOM   10093  C  C     B ASP B 1 68  ? -61.983 -23.351 -24.736 0.05 11.74 ? 67   ASP B C     2  
ATOM   10094  O  O     B ASP B 1 68  ? -62.907 -23.160 -25.512 0.05 11.82 ? 67   ASP B O     2  
ATOM   10095  C  CB    B ASP B 1 68  ? -63.630 -24.621 -23.304 0.05 11.85 ? 67   ASP B CB    2  
ATOM   10096  C  CG    B ASP B 1 68  ? -64.238 -25.536 -24.354 0.05 12.01 ? 67   ASP B CG    2  
ATOM   10097  O  OD1   B ASP B 1 68  ? -64.138 -26.771 -24.202 0.05 12.08 ? 67   ASP B OD1   2  
ATOM   10098  O  OD2   B ASP B 1 68  ? -64.837 -25.015 -25.319 0.05 12.07 ? 67   ASP B OD2   2  
ATOM   10099  N  N     B ALA B 1 69  ? -60.796 -22.760 -24.868 0.05 11.64 ? 68   ALA B N     2  
ATOM   10100  C  CA    B ALA B 1 69  ? -60.646 -21.562 -25.701 0.05 11.61 ? 68   ALA B CA    2  
ATOM   10101  C  C     B ALA B 1 69  ? -59.306 -21.335 -26.416 0.05 11.57 ? 68   ALA B C     2  
ATOM   10102  O  O     B ALA B 1 69  ? -59.263 -20.613 -27.409 0.05 11.63 ? 68   ALA B O     2  
ATOM   10103  C  CB    B ALA B 1 69  ? -61.019 -20.321 -24.888 0.05 11.50 ? 68   ALA B CB    2  
ATOM   10104  N  N     B ASP B 1 70  ? -58.215 -21.916 -25.927 0.05 11.49 ? 69   ASP B N     2  
ATOM   10105  C  CA    B ASP B 1 70  ? -56.908 -21.628 -26.524 0.05 11.45 ? 69   ASP B CA    2  
ATOM   10106  C  C     B ASP B 1 70  ? -56.473 -20.171 -26.289 0.05 11.36 ? 69   ASP B C     2  
ATOM   10107  O  O     B ASP B 1 70  ? -57.262 -19.237 -26.470 0.05 11.34 ? 69   ASP B O     2  
ATOM   10108  N  N     B PRO B 1 71  ? -55.212 -19.969 -25.866 0.05 11.31 ? 70   PRO B N     2  
ATOM   10109  C  CA    B PRO B 1 71  ? -54.679 -18.612 -25.698 0.05 11.22 ? 70   PRO B CA    2  
ATOM   10110  C  C     B PRO B 1 71  ? -54.813 -17.739 -26.948 0.05 11.23 ? 70   PRO B C     2  
ATOM   10111  O  O     B PRO B 1 71  ? -53.929 -17.724 -27.807 0.05 11.21 ? 70   PRO B O     2  
ATOM   10112  C  CB    B PRO B 1 71  ? -53.187 -18.855 -25.409 0.05 11.25 ? 70   PRO B CB    2  
ATOM   10113  C  CG    B PRO B 1 71  ? -53.125 -20.218 -24.829 0.05 11.28 ? 70   PRO B CG    2  
ATOM   10114  C  CD    B PRO B 1 71  ? -54.222 -21.007 -25.502 0.05 11.35 ? 70   PRO B CD    2  
ATOM   10115  N  N     B GLU B 1 72  ? -55.918 -17.025 -27.076 0.05 11.26 ? 71   GLU B N     2  
ATOM   10116  C  CA    B GLU B 1 72  ? -55.978 -15.944 -28.049 0.05 11.25 ? 71   GLU B CA    2  
ATOM   10117  C  C     B GLU B 1 72  ? -56.821 -14.876 -27.397 0.05 11.21 ? 71   GLU B C     2  
ATOM   10118  O  O     B GLU B 1 72  ? -56.745 -13.695 -27.738 0.05 11.13 ? 71   GLU B O     2  
ATOM   10119  C  CB    B GLU B 1 72  ? -56.605 -16.402 -29.363 0.05 11.37 ? 71   GLU B CB    2  
ATOM   10120  N  N     B ALA B 1 73  ? -57.611 -15.325 -26.429 0.05 11.27 ? 72   ALA B N     2  
ATOM   10121  C  CA    B ALA B 1 73  ? -58.545 -14.480 -25.709 0.05 11.24 ? 72   ALA B CA    2  
ATOM   10122  C  C     B ALA B 1 73  ? -57.877 -13.703 -24.581 0.05 11.13 ? 72   ALA B C     2  
ATOM   10123  O  O     B ALA B 1 73  ? -58.254 -12.576 -24.293 0.05 11.09 ? 72   ALA B O     2  
ATOM   10124  C  CB    B ALA B 1 73  ? -59.667 -15.326 -25.160 0.05 11.32 ? 72   ALA B CB    2  
ATOM   10125  N  N     B TRP B 1 74  ? -56.884 -14.318 -23.947 0.05 11.09 ? 73   TRP B N     2  
ATOM   10126  C  CA    B TRP B 1 74  ? -56.281 -13.798 -22.725 0.05 11.00 ? 73   TRP B CA    2  
ATOM   10127  C  C     B TRP B 1 74  ? -55.153 -12.822 -22.973 0.05 10.92 ? 73   TRP B C     2  
ATOM   10128  O  O     B TRP B 1 74  ? -54.673 -12.161 -22.047 0.05 10.87 ? 73   TRP B O     2  
ATOM   10129  C  CB    B TRP B 1 74  ? -55.704 -14.948 -21.922 0.05 11.00 ? 73   TRP B CB    2  
ATOM   10130  C  CG    B TRP B 1 74  ? -56.722 -15.762 -21.281 0.05 11.05 ? 73   TRP B CG    2  
ATOM   10131  C  CD1   B TRP B 1 74  ? -57.328 -16.868 -21.788 0.05 11.13 ? 73   TRP B CD1   2  
ATOM   10132  C  CD2   B TRP B 1 74  ? -57.278 -15.546 -19.989 0.05 11.05 ? 73   TRP B CD2   2  
ATOM   10133  N  NE1   B TRP B 1 74  ? -58.239 -17.357 -20.886 0.05 11.17 ? 73   TRP B NE1   2  
ATOM   10134  C  CE2   B TRP B 1 74  ? -58.224 -16.562 -19.769 0.05 11.12 ? 73   TRP B CE2   2  
ATOM   10135  C  CE3   B TRP B 1 74  ? -57.063 -14.593 -18.989 0.05 11.00 ? 73   TRP B CE3   2  
ATOM   10136  C  CZ2   B TRP B 1 74  ? -58.951 -16.652 -18.594 0.05 11.13 ? 73   TRP B CZ2   2  
ATOM   10137  C  CZ3   B TRP B 1 74  ? -57.786 -14.678 -17.840 0.05 11.02 ? 73   TRP B CZ3   2  
ATOM   10138  C  CH2   B TRP B 1 74  ? -58.724 -15.701 -17.645 0.05 11.09 ? 73   TRP B CH2   2  
ATOM   10139  N  N     B GLY B 1 75  ? -54.696 -12.762 -24.214 0.05 10.93 ? 74   GLY B N     2  
ATOM   10140  C  CA    B GLY B 1 75  ? -53.537 -11.954 -24.521 0.05 10.87 ? 74   GLY B CA    2  
ATOM   10141  C  C     B GLY B 1 75  ? -52.623 -12.539 -25.575 0.05 10.86 ? 74   GLY B C     2  
ATOM   10142  O  O     B GLY B 1 75  ? -53.022 -13.449 -26.317 0.05 10.88 ? 74   GLY B O     2  
ATOM   10143  N  N     B SER B 1 76  ? -51.392 -12.013 -25.609 0.05 10.83 ? 75   SER B N     2  
ATOM   10144  C  CA    B SER B 1 76  ? -50.430 -12.214 -26.696 0.05 10.83 ? 75   SER B CA    2  
ATOM   10145  C  C     B SER B 1 76  ? -49.220 -11.257 -26.601 0.05 10.74 ? 75   SER B C     2  
ATOM   10146  O  O     B SER B 1 76  ? -48.206 -11.450 -27.268 0.05 10.74 ? 75   SER B O     2  
ATOM   10147  C  CB    B SER B 1 76  ? -51.118 -12.025 -28.042 0.05 10.85 ? 75   SER B CB    2  
ATOM   10148  O  OG    B SER B 1 76  ? -52.132 -11.044 -27.948 0.05 10.80 ? 75   SER B OG    2  
ATOM   10149  N  N     B THR B 1 77  ? -49.351 -10.214 -25.787 0.05 10.69 ? 76   THR B N     2  
ATOM   10150  C  CA    B THR B 1 77  ? -48.252 -9.299  -25.490 0.05 10.63 ? 76   THR B CA    2  
ATOM   10151  C  C     B THR B 1 77  ? -48.264 -9.111  -23.978 0.05 10.59 ? 76   THR B C     2  
ATOM   10152  O  O     B THR B 1 77  ? -49.082 -9.726  -23.302 0.05 10.62 ? 76   THR B O     2  
ATOM   10153  C  CB    B THR B 1 77  ? -48.452 -7.950  -26.188 0.05 10.60 ? 76   THR B CB    2  
ATOM   10154  O  OG1   B THR B 1 77  ? -49.743 -7.424  -25.843 0.05 10.62 ? 76   THR B OG1   2  
ATOM   10155  C  CG2   B THR B 1 77  ? -48.362 -8.113  -27.700 0.05 10.61 ? 76   THR B CG2   2  
ATOM   10156  N  N     B LEU B 1 78  ? -47.378 -8.285  -23.428 0.05 10.55 ? 77   LEU B N     2  
ATOM   10157  C  CA    B LEU B 1 78  ? -47.472 -8.015  -21.995 0.05 10.52 ? 77   LEU B CA    2  
ATOM   10158  C  C     B LEU B 1 78  ? -48.813 -7.343  -21.679 0.05 10.52 ? 77   LEU B C     2  
ATOM   10159  O  O     B LEU B 1 78  ? -49.553 -7.764  -20.781 0.05 10.54 ? 77   LEU B O     2  
ATOM   10160  C  CB    B LEU B 1 78  ? -46.303 -7.158  -21.500 0.05 10.48 ? 77   LEU B CB    2  
ATOM   10161  C  CG    B LEU B 1 78  ? -46.445 -6.694  -20.048 0.05 10.46 ? 77   LEU B CG    2  
ATOM   10162  C  CD1   B LEU B 1 78  ? -46.453 -7.871  -19.080 0.05 10.48 ? 77   LEU B CD1   2  
ATOM   10163  C  CD2   B LEU B 1 78  ? -45.342 -5.713  -19.691 0.05 10.44 ? 77   LEU B CD2   2  
ATOM   10164  N  N     B LEU B 1 79  ? -49.148 -6.311  -22.438 0.05 10.52 ? 78   LEU B N     2  
ATOM   10165  C  CA    B LEU B 1 79  ? -50.387 -5.595  -22.189 0.05 10.53 ? 78   LEU B CA    2  
ATOM   10166  C  C     B LEU B 1 79  ? -51.651 -6.399  -22.487 0.05 10.59 ? 78   LEU B C     2  
ATOM   10167  O  O     B LEU B 1 79  ? -52.642 -6.284  -21.762 0.05 10.61 ? 78   LEU B O     2  
ATOM   10168  C  CB    B LEU B 1 79  ? -50.419 -4.282  -22.957 0.05 10.52 ? 78   LEU B CB    2  
ATOM   10169  C  CG    B LEU B 1 79  ? -49.757 -3.129  -22.209 0.05 10.48 ? 78   LEU B CG    2  
ATOM   10170  C  CD1   B LEU B 1 79  ? -49.573 -1.956  -23.171 0.05 10.47 ? 78   LEU B CD1   2  
ATOM   10171  C  CD2   B LEU B 1 79  ? -50.585 -2.719  -20.994 0.05 10.49 ? 78   LEU B CD2   2  
ATOM   10172  N  N     B ASP B 1 80  ? -51.631 -7.193  -23.553 0.05 10.62 ? 79   ASP B N     2  
ATOM   10173  C  CA    B ASP B 1 80  ? -52.792 -8.030  -23.857 0.05 10.69 ? 79   ASP B CA    2  
ATOM   10174  C  C     B ASP B 1 80  ? -52.979 -9.063  -22.743 0.05 10.69 ? 79   ASP B C     2  
ATOM   10175  O  O     B ASP B 1 80  ? -54.090 -9.529  -22.503 0.05 10.74 ? 79   ASP B O     2  
ATOM   10176  C  CB    B ASP B 1 80  ? -52.633 -8.750  -25.196 0.05 10.73 ? 79   ASP B CB    2  
ATOM   10177  C  CG    B ASP B 1 80  ? -52.963 -7.875  -26.401 0.05 10.74 ? 79   ASP B CG    2  
ATOM   10178  O  OD1   B ASP B 1 80  ? -53.741 -6.903  -26.284 0.05 10.74 ? 79   ASP B OD1   2  
ATOM   10179  O  OD2   B ASP B 1 80  ? -52.443 -8.200  -27.487 0.05 10.75 ? 79   ASP B OD2   2  
ATOM   10180  N  N     B ASN B 1 81  ? -51.882 -9.415  -22.077 0.05 10.66 ? 80   ASN B N     2  
ATOM   10181  C  CA    B ASN B 1 81  ? -51.914 -10.427 -21.014 0.05 10.67 ? 80   ASN B CA    2  
ATOM   10182  C  C     B ASN B 1 81  ? -52.382 -9.882  -19.657 0.05 10.64 ? 80   ASN B C     2  
ATOM   10183  O  O     B ASN B 1 81  ? -53.186 -10.518 -18.969 0.05 10.67 ? 80   ASN B O     2  
ATOM   10184  C  CB    B ASN B 1 81  ? -50.545 -11.119 -20.876 0.05 10.64 ? 80   ASN B CB    2  
ATOM   10185  C  CG    B ASN B 1 81  ? -50.294 -12.170 -21.964 0.05 10.69 ? 80   ASN B CG    2  
ATOM   10186  O  OD1   B ASN B 1 81  ? -50.404 -13.363 -21.718 0.05 10.70 ? 80   ASN B OD1   2  
ATOM   10187  N  ND2   B ASN B 1 81  ? -49.943 -11.727 -23.158 0.05 10.74 ? 80   ASN B ND2   2  
ATOM   10188  N  N     B VAL B 1 82  ? -51.891 -8.712  -19.257 0.05 10.61 ? 81   VAL B N     2  
ATOM   10189  C  CA    B VAL B 1 82  ? -52.202 -8.225  -17.901 0.05 10.59 ? 81   VAL B CA    2  
ATOM   10190  C  C     B VAL B 1 82  ? -53.482 -7.399  -17.792 0.05 10.62 ? 81   VAL B C     2  
ATOM   10191  O  O     B VAL B 1 82  ? -54.146 -7.405  -16.753 0.05 10.64 ? 81   VAL B O     2  
ATOM   10192  C  CB    B VAL B 1 82  ? -51.029 -7.447  -17.252 0.05 10.55 ? 81   VAL B CB    2  
ATOM   10193  C  CG1   B VAL B 1 82  ? -49.742 -8.232  -17.387 0.05 10.53 ? 81   VAL B CG1   2  
ATOM   10194  C  CG2   B VAL B 1 82  ? -50.889 -6.067  -17.875 0.05 10.52 ? 81   VAL B CG2   2  
ATOM   10195  N  N     B GLU B 1 83  ? -53.835 -6.677  -18.848 0.05 10.63 ? 82   GLU B N     2  
ATOM   10196  C  CA    B GLU B 1 83  ? -54.990 -5.802  -18.753 0.05 10.66 ? 82   GLU B CA    2  
ATOM   10197  C  C     B GLU B 1 83  ? -56.323 -6.502  -18.420 0.05 10.73 ? 82   GLU B C     2  
ATOM   10198  O  O     B GLU B 1 83  ? -57.088 -5.987  -17.615 0.05 10.76 ? 82   GLU B O     2  
ATOM   10199  C  CB    B GLU B 1 83  ? -55.127 -4.897  -19.989 0.05 10.66 ? 82   GLU B CB    2  
ATOM   10200  C  CG    B GLU B 1 83  ? -55.940 -3.650  -19.700 0.05 10.71 ? 82   GLU B CG    2  
ATOM   10201  C  CD    B GLU B 1 83  ? -55.576 -2.498  -20.611 0.05 10.69 ? 82   GLU B CD    2  
ATOM   10202  O  OE1   B GLU B 1 83  ? -55.082 -2.761  -21.729 0.05 10.66 ? 82   GLU B OE1   2  
ATOM   10203  O  OE2   B GLU B 1 83  ? -55.785 -1.339  -20.197 0.05 10.71 ? 82   GLU B OE2   2  
ATOM   10204  N  N     B PRO B 1 84  ? -56.606 -7.665  -19.033 0.05 10.76 ? 83   PRO B N     2  
ATOM   10205  C  CA    B PRO B 1 84  ? -57.879 -8.307  -18.671 0.05 10.84 ? 83   PRO B CA    2  
ATOM   10206  C  C     B PRO B 1 84  ? -58.093 -8.508  -17.161 0.05 10.84 ? 83   PRO B C     2  
ATOM   10207  O  O     B PRO B 1 84  ? -59.239 -8.479  -16.698 0.05 10.91 ? 83   PRO B O     2  
ATOM   10208  C  CB    B PRO B 1 84  ? -57.804 -9.650  -19.397 0.05 10.87 ? 83   PRO B CB    2  
ATOM   10209  C  CG    B PRO B 1 84  ? -56.982 -9.357  -20.616 0.05 10.84 ? 83   PRO B CG    2  
ATOM   10210  C  CD    B PRO B 1 84  ? -55.928 -8.385  -20.130 0.05 10.76 ? 83   PRO B CD    2  
ATOM   10211  N  N     B PHE B 1 85  ? -57.018 -8.665  -16.392 0.05 10.79 ? 84   PHE B N     2  
ATOM   10212  C  CA    B PHE B 1 85  ? -57.172 -8.894  -14.957 0.05 10.80 ? 84   PHE B CA    2  
ATOM   10213  C  C     B PHE B 1 85  ? -57.591 -7.658  -14.153 0.05 10.82 ? 84   PHE B C     2  
ATOM   10214  O  O     B PHE B 1 85  ? -58.360 -7.774  -13.189 0.05 10.87 ? 84   PHE B O     2  
ATOM   10215  C  CB    B PHE B 1 85  ? -55.906 -9.542  -14.375 0.05 10.74 ? 84   PHE B CB    2  
ATOM   10216  C  CG    B PHE B 1 85  ? -55.602 -10.892 -14.963 0.05 10.74 ? 84   PHE B CG    2  
ATOM   10217  C  CD1   B PHE B 1 85  ? -56.231 -12.028 -14.479 0.05 10.78 ? 84   PHE B CD1   2  
ATOM   10218  C  CD2   B PHE B 1 85  ? -54.703 -11.027 -16.004 0.05 10.71 ? 84   PHE B CD2   2  
ATOM   10219  C  CE1   B PHE B 1 85  ? -55.965 -13.264 -15.018 0.05 10.79 ? 84   PHE B CE1   2  
ATOM   10220  C  CE2   B PHE B 1 85  ? -54.430 -12.268 -16.553 0.05 10.73 ? 84   PHE B CE2   2  
ATOM   10221  C  CZ    B PHE B 1 85  ? -55.063 -13.391 -16.054 0.05 10.77 ? 84   PHE B CZ    2  
ATOM   10222  N  N     B LEU B 1 86  ? -57.100 -6.477  -14.536 0.05 10.79 ? 85   LEU B N     2  
ATOM   10223  C  CA    B LEU B 1 86  ? -57.435 -5.252  -13.803 0.05 10.82 ? 85   LEU B CA    2  
ATOM   10224  C  C     B LEU B 1 86  ? -58.878 -4.810  -14.027 0.05 10.90 ? 85   LEU B C     2  
ATOM   10225  O  O     B LEU B 1 86  ? -59.592 -4.468  -13.085 0.05 10.96 ? 85   LEU B O     2  
ATOM   10226  C  CB    B LEU B 1 86  ? -56.494 -4.092  -14.163 0.05 10.77 ? 85   LEU B CB    2  
ATOM   10227  C  CG    B LEU B 1 86  ? -56.859 -2.755  -13.506 0.05 10.81 ? 85   LEU B CG    2  
ATOM   10228  C  CD1   B LEU B 1 86  ? -56.878 -2.843  -11.975 0.05 10.84 ? 85   LEU B CD1   2  
ATOM   10229  C  CD2   B LEU B 1 86  ? -55.925 -1.634  -13.959 0.05 10.77 ? 85   LEU B CD2   2  
ATOM   10230  N  N     B ASN B 1 87  ? -59.305 -4.795  -15.280 0.05 10.91 ? 86   ASN B N     2  
ATOM   10231  C  CA    B ASN B 1 87  ? -60.629 -4.279  -15.582 0.05 11.00 ? 86   ASN B CA    2  
ATOM   10232  C  C     B ASN B 1 87  ? -61.703 -5.193  -15.005 0.05 11.07 ? 86   ASN B C     2  
ATOM   10233  O  O     B ASN B 1 87  ? -62.776 -4.742  -14.596 0.05 11.15 ? 86   ASN B O     2  
ATOM   10234  C  CB    B ASN B 1 87  ? -60.781 -4.052  -17.086 0.05 10.99 ? 86   ASN B CB    2  
ATOM   10235  C  CG    B ASN B 1 87  ? -59.908 -2.905  -17.582 0.05 10.95 ? 86   ASN B CG    2  
ATOM   10236  O  OD1   B ASN B 1 87  ? -59.666 -1.935  -16.854 0.05 10.92 ? 86   ASN B OD1   2  
ATOM   10237  N  ND2   B ASN B 1 87  ? -59.411 -3.021  -18.810 0.05 10.95 ? 86   ASN B ND2   2  
ATOM   10238  N  N     B ASP B 1 88  ? -61.392 -6.482  -14.945 0.05 11.04 ? 87   ASP B N     2  
ATOM   10239  C  CA    B ASP B 1 88  ? -62.282 -7.445  -14.313 0.05 11.10 ? 87   ASP B CA    2  
ATOM   10240  C  C     B ASP B 1 88  ? -62.424 -7.142  -12.824 0.05 11.12 ? 87   ASP B C     2  
ATOM   10241  O  O     B ASP B 1 88  ? -63.529 -7.160  -12.280 0.05 11.21 ? 87   ASP B O     2  
ATOM   10242  C  CB    B ASP B 1 88  ? -61.753 -8.861  -14.520 0.05 11.07 ? 87   ASP B CB    2  
ATOM   10243  C  CG    B ASP B 1 88  ? -62.768 -9.916  -14.163 0.05 11.14 ? 87   ASP B CG    2  
ATOM   10244  O  OD1   B ASP B 1 88  ? -63.913 -9.543  -13.838 0.05 11.23 ? 87   ASP B OD1   2  
ATOM   10245  O  OD2   B ASP B 1 88  ? -62.424 -11.116 -14.217 0.05 11.12 ? 87   ASP B OD2   2  
ATOM   10246  N  N     B ALA B 1 89  ? -61.300 -6.876  -12.167 0.05 11.05 ? 88   ALA B N     2  
ATOM   10247  C  CA    B ALA B 1 89  ? -61.312 -6.567  -10.741 0.05 11.07 ? 88   ALA B CA    2  
ATOM   10248  C  C     B ALA B 1 89  ? -62.194 -5.366  -10.419 0.05 11.15 ? 88   ALA B C     2  
ATOM   10249  O  O     B ALA B 1 89  ? -63.011 -5.419  -9.511  0.05 11.21 ? 88   ALA B O     2  
ATOM   10250  C  CB    B ALA B 1 89  ? -59.890 -6.342  -10.224 0.05 10.98 ? 88   ALA B CB    2  
ATOM   10251  N  N     B ILE B 1 90  ? -62.031 -4.283  -11.172 0.05 11.16 ? 89   ILE B N     2  
ATOM   10252  C  CA    B ILE B 1 90  ? -62.830 -3.089  -10.933 0.05 11.24 ? 89   ILE B CA    2  
ATOM   10253  C  C     B ILE B 1 90  ? -64.317 -3.417  -11.032 0.05 11.36 ? 89   ILE B C     2  
ATOM   10254  O  O     B ILE B 1 90  ? -65.133 -2.934  -10.244 0.05 11.44 ? 89   ILE B O     2  
ATOM   10255  C  CB    B ILE B 1 90  ? -62.450 -1.974  -11.923 0.05 11.21 ? 89   ILE B CB    2  
ATOM   10256  C  CG1   B ILE B 1 90  ? -61.040 -1.467  -11.604 0.05 11.12 ? 89   ILE B CG1   2  
ATOM   10257  C  CG2   B ILE B 1 90  ? -63.477 -0.841  -11.888 0.05 11.32 ? 89   ILE B CG2   2  
ATOM   10258  C  CD1   B ILE B 1 90  ? -60.509 -0.420  -12.589 0.05 11.09 ? 89   ILE B CD1   2  
ATOM   10259  N  N     B GLN B 1 91  ? -64.639 -4.280  -11.990 0.05 11.37 ? 90   GLN B N     2  
ATOM   10260  C  CA    B GLN B 1 91  ? -65.989 -4.748  -12.218 0.05 11.50 ? 90   GLN B CA    2  
ATOM   10261  C  C     B GLN B 1 91  ? -66.437 -5.709  -11.105 0.05 11.52 ? 90   GLN B C     2  
ATOM   10262  O  O     B GLN B 1 91  ? -67.573 -5.635  -10.615 0.05 11.63 ? 90   GLN B O     2  
ATOM   10263  C  CB    B GLN B 1 91  ? -66.015 -5.435  -13.597 0.05 11.53 ? 90   GLN B CB    2  
ATOM   10264  C  CG    B GLN B 1 91  ? -67.342 -5.898  -14.094 0.05 11.64 ? 90   GLN B CG    2  
ATOM   10265  C  CD    B GLN B 1 91  ? -67.807 -7.157  -13.394 0.05 11.59 ? 90   GLN B CD    2  
ATOM   10266  O  OE1   B GLN B 1 91  ? -68.997 -7.412  -13.294 0.05 11.63 ? 90   GLN B OE1   2  
ATOM   10267  N  NE2   B GLN B 1 91  ? -66.853 -7.950  -12.905 0.05 11.49 ? 90   GLN B NE2   2  
ATOM   10268  N  N     B ALA B 1 92  ? -65.541 -6.618  -10.728 0.05 11.42 ? 91   ALA B N     2  
ATOM   10269  C  CA    B ALA B 1 92  ? -65.859 -7.696  -9.782  0.05 11.43 ? 91   ALA B CA    2  
ATOM   10270  C  C     B ALA B 1 92  ? -65.998 -7.209  -8.347  0.05 11.47 ? 91   ALA B C     2  
ATOM   10271  O  O     B ALA B 1 92  ? -66.912 -7.621  -7.620  0.05 11.55 ? 91   ALA B O     2  
ATOM   10272  C  CB    B ALA B 1 92  ? -64.800 -8.783  -9.861  0.05 11.33 ? 91   ALA B CB    2  
ATOM   10273  N  N     B LEU B 1 93  ? -65.090 -6.326  -7.950  0.05 11.42 ? 92   LEU B N     2  
ATOM   10274  C  CA    B LEU B 1 93  ? -65.013 -5.841  -6.573  0.05 11.45 ? 92   LEU B CA    2  
ATOM   10275  C  C     B LEU B 1 93  ? -66.350 -5.463  -5.903  0.05 11.59 ? 92   LEU B C     2  
ATOM   10276  O  O     B LEU B 1 93  ? -66.637 -5.937  -4.798  0.05 11.63 ? 92   LEU B O     2  
ATOM   10277  C  CB    B LEU B 1 93  ? -64.009 -4.699  -6.482  0.05 11.40 ? 92   LEU B CB    2  
ATOM   10278  C  CG    B LEU B 1 93  ? -63.805 -4.037  -5.135  0.05 11.44 ? 92   LEU B CG    2  
ATOM   10279  C  CD1   B LEU B 1 93  ? -63.370 -5.069  -4.098  0.05 11.39 ? 92   LEU B CD1   2  
ATOM   10280  C  CD2   B LEU B 1 93  ? -62.741 -2.989  -5.334  0.05 11.40 ? 92   LEU B CD2   2  
ATOM   10281  N  N     B PRO B 1 94  ? -67.174 -4.618  -6.554  0.05 11.67 ? 93   PRO B N     2  
ATOM   10282  C  CA    B PRO B 1 94  ? -68.442 -4.278  -5.888  0.05 11.81 ? 93   PRO B CA    2  
ATOM   10283  C  C     B PRO B 1 94  ? -69.420 -5.447  -5.748  0.05 11.89 ? 93   PRO B C     2  
ATOM   10284  O  O     B PRO B 1 94  ? -70.178 -5.479  -4.772  0.05 12.00 ? 93   PRO B O     2  
ATOM   10285  C  CB    B PRO B 1 94  ? -69.048 -3.186  -6.793  0.05 11.88 ? 93   PRO B CB    2  
ATOM   10286  C  CG    B PRO B 1 94  ? -68.335 -3.310  -8.086  0.05 11.79 ? 93   PRO B CG    2  
ATOM   10287  C  CD    B PRO B 1 94  ? -66.963 -3.811  -7.773  0.05 11.64 ? 93   PRO B CD    2  
ATOM   10288  N  N     B GLN B 1 95  ? -69.428 -6.382  -6.696  0.05 11.84 ? 94   GLN B N     2  
ATOM   10289  C  CA    B GLN B 1 95  ? -70.300 -7.550  -6.561  0.05 11.91 ? 94   GLN B CA    2  
ATOM   10290  C  C     B GLN B 1 95  ? -69.934 -8.349  -5.311  0.05 11.87 ? 94   GLN B C     2  
ATOM   10291  O  O     B GLN B 1 95  ? -70.809 -8.802  -4.558  0.05 11.97 ? 94   GLN B O     2  
ATOM   10292  C  CB    B GLN B 1 95  ? -70.158 -8.474  -7.765  0.05 11.86 ? 94   GLN B CB    2  
ATOM   10293  C  CG    B GLN B 1 95  ? -70.353 -7.824  -9.095  0.05 11.90 ? 94   GLN B CG    2  
ATOM   10294  C  CD    B GLN B 1 95  ? -70.137 -8.816  -10.207 0.05 11.81 ? 94   GLN B CD    2  
ATOM   10295  O  OE1   B GLN B 1 95  ? -69.208 -8.686  -10.993 0.05 11.70 ? 94   GLN B OE1   2  
ATOM   10296  N  NE2   B GLN B 1 95  ? -70.977 -9.829  -10.261 0.05 11.88 ? 94   GLN B NE2   2  
ATOM   10297  N  N     B LEU B 1 96  ? -68.630 -8.517  -5.107  0.05 11.74 ? 95   LEU B N     2  
ATOM   10298  C  CA    B LEU B 1 96  ? -68.105 -9.300  -4.004  0.05 11.70 ? 95   LEU B CA    2  
ATOM   10299  C  C     B LEU B 1 96  ? -68.235 -8.584  -2.667  0.05 11.76 ? 95   LEU B C     2  
ATOM   10300  O  O     B LEU B 1 96  ? -68.572 -9.201  -1.650  0.05 11.79 ? 95   LEU B O     2  
ATOM   10301  C  CB    B LEU B 1 96  ? -66.630 -9.642  -4.250  0.05 11.55 ? 95   LEU B CB    2  
ATOM   10302  C  CG    B LEU B 1 96  ? -66.314 -10.365 -5.559  0.05 11.49 ? 95   LEU B CG    2  
ATOM   10303  C  CD1   B LEU B 1 96  ? -64.874 -10.848 -5.561  0.05 11.37 ? 95   LEU B CD1   2  
ATOM   10304  C  CD2   B LEU B 1 96  ? -67.244 -11.530 -5.783  0.05 11.54 ? 95   LEU B CD2   2  
ATOM   10305  N  N     B ALA B 1 97  ? -67.927 -7.293  -2.657  0.05 11.79 ? 96   ALA B N     2  
ATOM   10306  C  CA    B ALA B 1 97  ? -68.072 -6.510  -1.436  0.05 11.88 ? 96   ALA B CA    2  
ATOM   10307  C  C     B ALA B 1 97  ? -69.501 -6.636  -0.893  0.05 12.04 ? 96   ALA B C     2  
ATOM   10308  O  O     B ALA B 1 97  ? -69.705 -6.788  0.317   0.05 12.10 ? 96   ALA B O     2  
ATOM   10309  C  CB    B ALA B 1 97  ? -67.706 -5.045  -1.688  0.05 11.90 ? 96   ALA B CB    2  
ATOM   10310  N  N     B ASP B 1 98  ?