data_4M8B
# 
_entry.id   4M8B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4M8B         
NDB   NA2687       
RCSB  RCSB081592   
WWPDB D_1000081592 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4M8B 
_pdbx_database_status.recvd_initial_deposition_date   2013-08-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rosenberg, O.S.' 1 
'Lohse, M.L.'     2 
'Stroud, R.M.'    3 
'Johnson, A.D.'   4 
# 
_citation.id                        primary 
_citation.title                     
'Structure of a new DNA-binding domain which regulates pathogenesis in a wide variety of fungi.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            111 
_citation.page_first                10404 
_citation.page_last                 10410 
_citation.year                      2014 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24994900 
_citation.pdbx_database_id_DOI      10.1073/pnas.1410110111 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lohse, M.B.'       1 
primary 'Rosenberg, O.S.'   2 
primary 'Cox, J.S.'         3 
primary 'Stroud, R.M.'      4 
primary 'Finer-Moore, J.S.' 5 
primary 'Johnson, A.D.'     6 
# 
_cell.entry_id           4M8B 
_cell.length_a           90.293 
_cell.length_b           103.401 
_cell.length_c           73.178 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4M8B 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'Chain A of dsDNA containing the cis-regulatory element' 6196.987  1  ? ? 'UNP residues 6-201' ? 
2 polymer     syn 'Chain B of dsDNA containing the cis-regulatory element' 6072.946  1  ? ? ?                    ? 
3 polymer     man YHR177W                                                  23404.328 1  ? ? ?                    ? 
4 non-polymer syn 1,2-ETHANEDIOL                                           62.068    1  ? ? ?                    ? 
5 water       nat water                                                    18.015    92 ? ? ?                    ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DC)(DG)(DT)(DT)(DA)(DG)(DT)(DG)(DT)(DT)(DT)(DA)(DC)(DG)(DC)(DG)(DG)' 
GCGCGTTAGTGTTTACGCGG A ? 
2 polydeoxyribonucleotide no no '(DC)(DG)(DC)(DG)(DT)(DA)(DA)(DA)(DC)(DA)(DC)(DT)(DA)(DA)(DC)(DG)(DC)(DG)(DC)(DC)' 
CGCGTAAACACTAACGCGCC B ? 
3 'polypeptide(L)'        no no 
;GPSSPGPTCYGYIDDEQDLALVFQGVFNGNLRCIERRPYDAEKVELVNPGNIFVFNEEKSGIKRWTDGFSWSPSRISGKF
LVYREYNRLGSTHDLPLHNVPEYNIFERAHRKYFYTGLLKKTFSLKFNMDPTDSTKLETFHLIAYYTEKDIHQGSLRRPS
ENPFFHKFRPSQKLLDALQKVAVGNGRSNPSKNNERGRTKAH
;
;GPSSPGPTCYGYIDDEQDLALVFQGVFNGNLRCIERRPYDAEKVELVNPGNIFVFNEEKSGIKRWTDGFSWSPSRISGKF
LVYREYNRLGSTHDLPLHNVPEYNIFERAHRKYFYTGLLKKTFSLKFNMDPTDSTKLETFHLIAYYTEKDIHQGSLRRPS
ENPFFHKFRPSQKLLDALQKVAVGNGRSNPSKNNERGRTKAH
;
R ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DC  n 
1 3   DG  n 
1 4   DC  n 
1 5   DG  n 
1 6   DT  n 
1 7   DT  n 
1 8   DA  n 
1 9   DG  n 
1 10  DT  n 
1 11  DG  n 
1 12  DT  n 
1 13  DT  n 
1 14  DT  n 
1 15  DA  n 
1 16  DC  n 
1 17  DG  n 
1 18  DC  n 
1 19  DG  n 
1 20  DG  n 
2 1   DC  n 
2 2   DG  n 
2 3   DC  n 
2 4   DG  n 
2 5   DT  n 
2 6   DA  n 
2 7   DA  n 
2 8   DA  n 
2 9   DC  n 
2 10  DA  n 
2 11  DC  n 
2 12  DT  n 
2 13  DA  n 
2 14  DA  n 
2 15  DC  n 
2 16  DG  n 
2 17  DC  n 
2 18  DG  n 
2 19  DC  n 
2 20  DC  n 
3 1   GLY n 
3 2   PRO n 
3 3   SER n 
3 4   SER n 
3 5   PRO n 
3 6   GLY n 
3 7   PRO n 
3 8   THR n 
3 9   CYS n 
3 10  TYR n 
3 11  GLY n 
3 12  TYR n 
3 13  ILE n 
3 14  ASP n 
3 15  ASP n 
3 16  GLU n 
3 17  GLN n 
3 18  ASP n 
3 19  LEU n 
3 20  ALA n 
3 21  LEU n 
3 22  VAL n 
3 23  PHE n 
3 24  GLN n 
3 25  GLY n 
3 26  VAL n 
3 27  PHE n 
3 28  ASN n 
3 29  GLY n 
3 30  ASN n 
3 31  LEU n 
3 32  ARG n 
3 33  CYS n 
3 34  ILE n 
3 35  GLU n 
3 36  ARG n 
3 37  ARG n 
3 38  PRO n 
3 39  TYR n 
3 40  ASP n 
3 41  ALA n 
3 42  GLU n 
3 43  LYS n 
3 44  VAL n 
3 45  GLU n 
3 46  LEU n 
3 47  VAL n 
3 48  ASN n 
3 49  PRO n 
3 50  GLY n 
3 51  ASN n 
3 52  ILE n 
3 53  PHE n 
3 54  VAL n 
3 55  PHE n 
3 56  ASN n 
3 57  GLU n 
3 58  GLU n 
3 59  LYS n 
3 60  SER n 
3 61  GLY n 
3 62  ILE n 
3 63  LYS n 
3 64  ARG n 
3 65  TRP n 
3 66  THR n 
3 67  ASP n 
3 68  GLY n 
3 69  PHE n 
3 70  SER n 
3 71  TRP n 
3 72  SER n 
3 73  PRO n 
3 74  SER n 
3 75  ARG n 
3 76  ILE n 
3 77  SER n 
3 78  GLY n 
3 79  LYS n 
3 80  PHE n 
3 81  LEU n 
3 82  VAL n 
3 83  TYR n 
3 84  ARG n 
3 85  GLU n 
3 86  TYR n 
3 87  ASN n 
3 88  ARG n 
3 89  LEU n 
3 90  GLY n 
3 91  SER n 
3 92  THR n 
3 93  HIS n 
3 94  ASP n 
3 95  LEU n 
3 96  PRO n 
3 97  LEU n 
3 98  HIS n 
3 99  ASN n 
3 100 VAL n 
3 101 PRO n 
3 102 GLU n 
3 103 TYR n 
3 104 ASN n 
3 105 ILE n 
3 106 PHE n 
3 107 GLU n 
3 108 ARG n 
3 109 ALA n 
3 110 HIS n 
3 111 ARG n 
3 112 LYS n 
3 113 TYR n 
3 114 PHE n 
3 115 TYR n 
3 116 THR n 
3 117 GLY n 
3 118 LEU n 
3 119 LEU n 
3 120 LYS n 
3 121 LYS n 
3 122 THR n 
3 123 PHE n 
3 124 SER n 
3 125 LEU n 
3 126 LYS n 
3 127 PHE n 
3 128 ASN n 
3 129 MET n 
3 130 ASP n 
3 131 PRO n 
3 132 THR n 
3 133 ASP n 
3 134 SER n 
3 135 THR n 
3 136 LYS n 
3 137 LEU n 
3 138 GLU n 
3 139 THR n 
3 140 PHE n 
3 141 HIS n 
3 142 LEU n 
3 143 ILE n 
3 144 ALA n 
3 145 TYR n 
3 146 TYR n 
3 147 THR n 
3 148 GLU n 
3 149 LYS n 
3 150 ASP n 
3 151 ILE n 
3 152 HIS n 
3 153 GLN n 
3 154 GLY n 
3 155 SER n 
3 156 LEU n 
3 157 ARG n 
3 158 ARG n 
3 159 PRO n 
3 160 SER n 
3 161 GLU n 
3 162 ASN n 
3 163 PRO n 
3 164 PHE n 
3 165 PHE n 
3 166 HIS n 
3 167 LYS n 
3 168 PHE n 
3 169 ARG n 
3 170 PRO n 
3 171 SER n 
3 172 GLN n 
3 173 LYS n 
3 174 LEU n 
3 175 LEU n 
3 176 ASP n 
3 177 ALA n 
3 178 LEU n 
3 179 GLN n 
3 180 LYS n 
3 181 VAL n 
3 182 ALA n 
3 183 VAL n 
3 184 GLY n 
3 185 ASN n 
3 186 GLY n 
3 187 ARG n 
3 188 SER n 
3 189 ASN n 
3 190 PRO n 
3 191 SER n 
3 192 LYS n 
3 193 ASN n 
3 194 ASN n 
3 195 GLU n 
3 196 ARG n 
3 197 GLY n 
3 198 ARG n 
3 199 THR n 
3 200 LYS n 
3 201 ALA n 
3 202 HIS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;Baker's yeast
;
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'YHR177W, Yhr177wp' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    S288c 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   
'a pET21 based vector with an N-terminal 8-his tag followed by a 3C protease cleavage site' 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     559292 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Bl21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          pET 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       H3C 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 'DNA synthesis through standard methods and annealing of double stranded DNA.' 
2 1 sample ? ? ? ? ? 'DNA synthesis through standard methods and annealing of double stranded DNA.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP YHX7_YEAST P38867 3 
;PTCYGYIDDEQDLALVFQGVFNGNLRCIERRPYDAEKVELVNPGNIFVFNEEKSGIKRWTDGFSWSPSRISGKFLVYREY
NRLGSTHDLPLHNVPEYNIFERAHRKYFYTGLLKKTFSLKFNMDPTDSTKLETFHLIAYYTEKDIHQGSLRRPSENPFFH
KFRPSQKLLDALQKVAVGNGRSNPSKNNERGRTKAH
;
6 ? 
2 PDB 4M8B       4M8B   1 GCGCGTTAGTGTTTACGCGG ? ? 
3 PDB 4M8B       4M8B   2 CGCGTAAACACTAACGCGCC ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4M8B R 7 ? 202 ? P38867 6 ? 201 ? 5 200 
2 2 4M8B A 1 ? 20  ? 4M8B   1 ? 20  ? 1 20  
3 3 4M8B B 1 ? 20  ? 4M8B   2 ? 21  ? 2 21  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4M8B GLY R 1 ? UNP P38867 ? ? 'EXPRESSION TAG' -1 1 
1 4M8B PRO R 2 ? UNP P38867 ? ? 'EXPRESSION TAG' 0  2 
1 4M8B SER R 3 ? UNP P38867 ? ? 'EXPRESSION TAG' 1  3 
1 4M8B SER R 4 ? UNP P38867 ? ? 'EXPRESSION TAG' 2  4 
1 4M8B PRO R 5 ? UNP P38867 ? ? 'EXPRESSION TAG' 3  5 
1 4M8B GLY R 6 ? UNP P38867 ? ? 'EXPRESSION TAG' 4  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                 'C10 H15 N2 O8 P' 322.208 
EDO non-polymer         . 1,2-ETHANEDIOL                       'ETHYLENE GLYCOL' 'C2 H6 O2'        62.068  
GLN 'L-peptide linking' y GLUTAMINE                            ?                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?                 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4M8B 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.79 
_exptl_crystal.density_percent_sol   74.31 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
;2 uL drops were a 1 to 1 mixture of protein with a well solution of 9 mM Calcium chloride, 10 mM Spermine, 50 mM Sodium cacodylate pH 7, 4.5% Isopropanol, 3.5% Ethylene glycol.   
Cryoprotection involved a 4 to 6 mixture of 25% Glucose/Ethylene Glycol and well solution., VAPOR DIFFUSION, HANGING DROP, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           80 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2013-01-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.115869 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.3.1' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.3.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.115869 
# 
_reflns.entry_id                     4M8B 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             68.012 
_reflns.d_resolution_high            2.610 
_reflns.number_obs                   19969 
_reflns.number_all                   19969 
_reflns.percent_possible_obs         93.600 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.057 
_reflns.pdbx_netI_over_sigmaI        9.700 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.600 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.610 
_reflns_shell.d_res_low              2.750 
_reflns_shell.percent_possible_all   87.900 
_reflns_shell.Rmerge_I_obs           0.512 
_reflns_shell.pdbx_Rsym_value        0.512 
_reflns_shell.meanI_over_sigI_obs    1.500 
_reflns_shell.pdbx_redundancy        3.400 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2684 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4M8B 
_refine.ls_number_reflns_obs                     18341 
_refine.ls_number_reflns_all                     19835 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.25 
_refine.ls_d_res_high                            2.61 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1977 
_refine.ls_R_factor_R_free                       0.2354 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  2159 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      
'The starting model was a poor initial model built from MAD phases of a SeMet derivative.' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1484 
_refine_hist.pdbx_number_atoms_nucleic_acid   817 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             92 
_refine_hist.number_atoms_total               2397 
_refine_hist.d_res_high                       2.61 
_refine_hist.d_res_low                        38.25 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
fhenix_bonds  0.003 ? ? ? ? 'X-RAY DIFFRACTION' 
fhenix_angles 0.897 ? ? ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.610 
_refine_ls_shell.d_res_low                        2.6753 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.3228 
_refine_ls_shell.percent_reflns_obs               85.9 
_refine_ls_shell.R_factor_R_free                  0.3682 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             130 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                1168 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4M8B 
_struct.title                     'Fungal Protein' 
_struct.pdbx_descriptor           'PROTEIN/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4M8B 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
'WOPR fungal-pathogenesis transcription, WOPR domain, transcription factor, TRANSCRIPTION, TRANSCRIPTION-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP C 15  ? ASN C 28  ? ASP R 13  ASN R 26  1 ? 14 
HELX_P HELX_P2 2 TYR C 39  ? VAL C 47  ? TYR R 37  VAL R 45  1 ? 9  
HELX_P HELX_P3 3 GLU C 57  ? GLY C 61  ? GLU R 55  GLY R 59  1 ? 5  
HELX_P HELX_P4 4 GLU C 148 ? GLY C 154 ? GLU R 146 GLY R 152 1 ? 7  
HELX_P HELX_P5 5 ARG C 158 ? ARG C 169 ? ARG R 156 ARG R 167 5 ? 12 
HELX_P HELX_P6 6 SER C 171 ? LYS C 180 ? SER R 169 LYS R 178 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DG 1  N1 ? ? ? 1_555 B DC 19 N3 ? ? A DG 1  B DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DG 1  N2 ? ? ? 1_555 B DC 19 O2 ? ? A DG 1  B DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DG 1  O6 ? ? ? 1_555 B DC 19 N4 ? ? A DG 1  B DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DC 2  N3 ? ? ? 1_555 B DG 18 N1 ? ? A DC 2  B DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DC 2  N4 ? ? ? 1_555 B DG 18 O6 ? ? A DC 2  B DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DC 2  O2 ? ? ? 1_555 B DG 18 N2 ? ? A DC 2  B DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC 17 N3 ? ? A DG 3  B DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC 17 O2 ? ? A DG 3  B DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC 17 N4 ? ? A DG 3  B DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DC 4  N3 ? ? ? 1_555 B DG 16 N1 ? ? A DC 4  B DG 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DC 4  N4 ? ? ? 1_555 B DG 16 O6 ? ? A DC 4  B DG 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DC 4  O2 ? ? ? 1_555 B DG 16 N2 ? ? A DC 4  B DG 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DG 5  N1 ? ? ? 1_555 B DC 15 N3 ? ? A DG 5  B DC 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DG 5  N2 ? ? ? 1_555 B DC 15 O2 ? ? A DG 5  B DC 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DG 5  O6 ? ? ? 1_555 B DC 15 N4 ? ? A DG 5  B DC 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 14 N1 ? ? A DT 6  B DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 14 N6 ? ? A DT 6  B DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 13 N1 ? ? A DT 7  B DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 13 N6 ? ? A DT 7  B DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT 12 N3 ? ? A DA 8  B DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT 12 O4 ? ? A DA 8  B DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC 11 N3 ? ? A DG 9  B DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC 11 O2 ? ? A DG 9  B DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC 11 N4 ? ? A DG 9  B DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA 10 N1 ? ? A DT 10 B DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA 10 N6 ? ? A DT 10 B DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DG 11 N1 ? ? ? 1_555 B DC 9  N3 ? ? A DG 11 B DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DG 11 N2 ? ? ? 1_555 B DC 9  O2 ? ? A DG 11 B DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DG 11 O6 ? ? ? 1_555 B DC 9  N4 ? ? A DG 11 B DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DT 12 N3 ? ? ? 1_555 B DA 8  N1 ? ? A DT 12 B DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DT 12 O4 ? ? ? 1_555 B DA 8  N6 ? ? A DT 12 B DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? A DT 13 N3 ? ? ? 1_555 B DA 7  N1 ? ? A DT 13 B DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? A DT 13 O4 ? ? ? 1_555 B DA 7  N6 ? ? A DT 13 B DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? A DT 14 N3 ? ? ? 1_555 B DA 6  N1 ? ? A DT 14 B DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? A DT 14 O4 ? ? ? 1_555 B DA 6  N6 ? ? A DT 14 B DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? A DA 15 N1 ? ? ? 1_555 B DT 5  N3 ? ? A DA 15 B DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? A DA 15 N6 ? ? ? 1_555 B DT 5  O4 ? ? A DA 15 B DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? A DC 16 N3 ? ? ? 1_555 B DG 4  N1 ? ? A DC 16 B DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? A DC 16 N4 ? ? ? 1_555 B DG 4  O6 ? ? A DC 16 B DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? A DC 16 O2 ? ? ? 1_555 B DG 4  N2 ? ? A DC 16 B DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? A DG 17 N1 ? ? ? 1_555 B DC 3  N3 ? ? A DG 17 B DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? A DG 17 N2 ? ? ? 1_555 B DC 3  O2 ? ? A DG 17 B DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? A DG 17 O6 ? ? ? 1_555 B DC 3  N4 ? ? A DG 17 B DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? A DC 18 N3 ? ? ? 1_555 B DG 2  N1 ? ? A DC 18 B DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? A DC 18 N4 ? ? ? 1_555 B DG 2  O6 ? ? A DC 18 B DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? A DC 18 O2 ? ? ? 1_555 B DG 2  N2 ? ? A DC 18 B DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? A DG 19 N1 ? ? ? 1_555 B DC 1  N3 ? ? A DG 19 B DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? A DG 19 N2 ? ? ? 1_555 B DC 1  O2 ? ? A DG 19 B DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? A DG 19 O6 ? ? ? 1_555 B DC 1  N4 ? ? A DG 19 B DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 90  C . ? GLY 88  R SER 91  C ? SER 89  R 1 0.88 
2 ALA 109 C . ? ALA 107 R HIS 110 C ? HIS 108 R 1 3.90 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS C 9   ? TYR C 10  ? CYS R 7   TYR R 8   
A 2 ASN C 51  ? ASN C 56  ? ASN R 49  ASN R 54  
A 3 LEU C 137 ? THR C 147 ? LEU R 135 THR R 145 
A 4 TYR C 113 ? ASN C 128 ? TYR R 111 ASN R 126 
A 5 PHE C 80  ? ARG C 88  ? PHE R 78  ARG R 86  
A 6 ARG C 75  ? SER C 77  ? ARG R 73  SER R 75  
B 1 CYS C 9   ? TYR C 10  ? CYS R 7   TYR R 8   
B 2 ASN C 51  ? ASN C 56  ? ASN R 49  ASN R 54  
B 3 LEU C 137 ? THR C 147 ? LEU R 135 THR R 145 
B 4 TYR C 113 ? ASN C 128 ? TYR R 111 ASN R 126 
B 5 ILE C 105 ? PHE C 106 ? ILE R 103 PHE R 104 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS C 9   ? N CYS R 7   O ILE C 52  ? O ILE R 50  
A 2 3 N PHE C 53  ? N PHE R 51  O ILE C 143 ? O ILE R 141 
A 3 4 O TYR C 146 ? O TYR R 144 N LEU C 119 ? N LEU R 117 
A 4 5 O PHE C 114 ? O PHE R 112 N ASN C 87  ? N ASN R 85  
A 5 6 O VAL C 82  ? O VAL R 80  N ARG C 75  ? N ARG R 73  
B 1 2 N CYS C 9   ? N CYS R 7   O ILE C 52  ? O ILE R 50  
B 2 3 N PHE C 53  ? N PHE R 51  O ILE C 143 ? O ILE R 141 
B 3 4 O TYR C 146 ? O TYR R 144 N LEU C 119 ? N LEU R 117 
B 4 5 O TYR C 113 ? O TYR R 111 N PHE C 106 ? N PHE R 104 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'BINDING SITE FOR RESIDUE EDO R 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 DT  A 10  ? DT  A 10  . ? 1_555 ? 
2 AC1 5 DG  A 11  ? DG  A 11  . ? 1_555 ? 
3 AC1 5 PHE C 123 ? PHE R 121 . ? 1_555 ? 
4 AC1 5 SER C 124 ? SER R 122 . ? 1_555 ? 
5 AC1 5 HIS C 141 ? HIS R 139 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4M8B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4M8B 
_atom_sites.fract_transf_matrix[1][1]   0.011075 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009671 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013665 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DG  A 1 1   ? 21.368  3.114   -6.048  1.00 59.22  ? 1   DG  A "O5'" 1 
ATOM   2    C "C5'" . DG  A 1 1   ? 22.021  3.504   -7.246  1.00 44.76  ? 1   DG  A "C5'" 1 
ATOM   3    C "C4'" . DG  A 1 1   ? 21.027  3.625   -8.389  1.00 42.30  ? 1   DG  A "C4'" 1 
ATOM   4    O "O4'" . DG  A 1 1   ? 20.410  2.333   -8.620  1.00 64.97  ? 1   DG  A "O4'" 1 
ATOM   5    C "C3'" . DG  A 1 1   ? 19.906  4.626   -8.140  1.00 56.56  ? 1   DG  A "C3'" 1 
ATOM   6    O "O3'" . DG  A 1 1   ? 20.020  5.721   -9.055  1.00 69.56  ? 1   DG  A "O3'" 1 
ATOM   7    C "C2'" . DG  A 1 1   ? 18.602  3.847   -8.320  1.00 56.19  ? 1   DG  A "C2'" 1 
ATOM   8    C "C1'" . DG  A 1 1   ? 18.997  2.401   -8.588  1.00 48.92  ? 1   DG  A "C1'" 1 
ATOM   9    N N9    . DG  A 1 1   ? 18.498  1.442   -7.600  1.00 38.55  ? 1   DG  A N9    1 
ATOM   10   C C8    . DG  A 1 1   ? 19.162  0.921   -6.513  1.00 37.19  ? 1   DG  A C8    1 
ATOM   11   N N7    . DG  A 1 1   ? 18.444  0.073   -5.823  1.00 26.78  ? 1   DG  A N7    1 
ATOM   12   C C5    . DG  A 1 1   ? 17.228  0.027   -6.496  1.00 19.10  ? 1   DG  A C5    1 
ATOM   13   C C6    . DG  A 1 1   ? 16.051  -0.717  -6.225  1.00 23.08  ? 1   DG  A C6    1 
ATOM   14   O O6    . DG  A 1 1   ? 15.831  -1.515  -5.300  1.00 39.05  ? 1   DG  A O6    1 
ATOM   15   N N1    . DG  A 1 1   ? 15.053  -0.465  -7.161  1.00 21.97  ? 1   DG  A N1    1 
ATOM   16   C C2    . DG  A 1 1   ? 15.173  0.397   -8.227  1.00 30.91  ? 1   DG  A C2    1 
ATOM   17   N N2    . DG  A 1 1   ? 14.106  0.519   -9.033  1.00 20.85  ? 1   DG  A N2    1 
ATOM   18   N N3    . DG  A 1 1   ? 16.268  1.096   -8.490  1.00 23.62  ? 1   DG  A N3    1 
ATOM   19   C C4    . DG  A 1 1   ? 17.248  0.862   -7.589  1.00 18.96  ? 1   DG  A C4    1 
ATOM   20   P P     . DC  A 1 2   ? 19.269  7.110   -8.758  1.00 101.84 ? 2   DC  A P     1 
ATOM   21   O OP1   . DC  A 1 2   ? 19.675  8.080   -9.799  1.00 79.30  ? 2   DC  A OP1   1 
ATOM   22   O OP2   . DC  A 1 2   ? 19.461  7.442   -7.327  1.00 60.99  ? 2   DC  A OP2   1 
ATOM   23   O "O5'" . DC  A 1 2   ? 17.727  6.761   -8.978  1.00 62.92  ? 2   DC  A "O5'" 1 
ATOM   24   C "C5'" . DC  A 1 2   ? 17.231  6.497   -10.282 1.00 50.87  ? 2   DC  A "C5'" 1 
ATOM   25   C "C4'" . DC  A 1 2   ? 15.727  6.321   -10.226 1.00 52.98  ? 2   DC  A "C4'" 1 
ATOM   26   O "O4'" . DC  A 1 2   ? 15.388  5.105   -9.511  1.00 63.47  ? 2   DC  A "O4'" 1 
ATOM   27   C "C3'" . DC  A 1 2   ? 15.016  7.457   -9.503  1.00 60.15  ? 2   DC  A "C3'" 1 
ATOM   28   O "O3'" . DC  A 1 2   ? 13.987  7.988   -10.329 1.00 79.68  ? 2   DC  A "O3'" 1 
ATOM   29   C "C2'" . DC  A 1 2   ? 14.462  6.820   -8.234  1.00 49.95  ? 2   DC  A "C2'" 1 
ATOM   30   C "C1'" . DC  A 1 2   ? 14.320  5.356   -8.619  1.00 44.85  ? 2   DC  A "C1'" 1 
ATOM   31   N N1    . DC  A 1 2   ? 14.429  4.391   -7.475  1.00 36.69  ? 2   DC  A N1    1 
ATOM   32   C C2    . DC  A 1 2   ? 13.406  3.474   -7.203  1.00 30.70  ? 2   DC  A C2    1 
ATOM   33   O O2    . DC  A 1 2   ? 12.391  3.461   -7.913  1.00 43.12  ? 2   DC  A O2    1 
ATOM   34   N N3    . DC  A 1 2   ? 13.548  2.616   -6.164  1.00 28.12  ? 2   DC  A N3    1 
ATOM   35   C C4    . DC  A 1 2   ? 14.646  2.647   -5.414  1.00 25.13  ? 2   DC  A C4    1 
ATOM   36   N N4    . DC  A 1 2   ? 14.734  1.775   -4.404  1.00 21.96  ? 2   DC  A N4    1 
ATOM   37   C C5    . DC  A 1 2   ? 15.700  3.569   -5.673  1.00 28.78  ? 2   DC  A C5    1 
ATOM   38   C C6    . DC  A 1 2   ? 15.550  4.410   -6.700  1.00 35.95  ? 2   DC  A C6    1 
ATOM   39   P P     . DG  A 1 3   ? 13.233  9.344   -9.911  1.00 79.51  ? 3   DG  A P     1 
ATOM   40   O OP1   . DG  A 1 3   ? 13.058  10.140  -11.146 1.00 83.71  ? 3   DG  A OP1   1 
ATOM   41   O OP2   . DG  A 1 3   ? 13.937  9.926   -8.744  1.00 56.18  ? 3   DG  A OP2   1 
ATOM   42   O "O5'" . DG  A 1 3   ? 11.798  8.845   -9.417  1.00 58.22  ? 3   DG  A "O5'" 1 
ATOM   43   C "C5'" . DG  A 1 3   ? 10.980  8.156   -10.347 1.00 64.12  ? 3   DG  A "C5'" 1 
ATOM   44   C "C4'" . DG  A 1 3   ? 9.723   7.607   -9.698  1.00 51.63  ? 3   DG  A "C4'" 1 
ATOM   45   O "O4'" . DG  A 1 3   ? 10.059  6.588   -8.722  1.00 62.18  ? 3   DG  A "O4'" 1 
ATOM   46   C "C3'" . DG  A 1 3   ? 8.881   8.647   -8.977  1.00 55.66  ? 3   DG  A "C3'" 1 
ATOM   47   O "O3'" . DG  A 1 3   ? 7.539   8.494   -9.437  1.00 69.61  ? 3   DG  A "O3'" 1 
ATOM   48   C "C2'" . DG  A 1 3   ? 9.090   8.345   -7.492  1.00 58.66  ? 3   DG  A "C2'" 1 
ATOM   49   C "C1'" . DG  A 1 3   ? 9.473   6.871   -7.467  1.00 53.17  ? 3   DG  A "C1'" 1 
ATOM   50   N N9    . DG  A 1 3   ? 10.457  6.482   -6.464  1.00 41.89  ? 3   DG  A N9    1 
ATOM   51   C C8    . DG  A 1 3   ? 11.677  7.067   -6.216  1.00 45.82  ? 3   DG  A C8    1 
ATOM   52   N N7    . DG  A 1 3   ? 12.348  6.477   -5.265  1.00 45.09  ? 3   DG  A N7    1 
ATOM   53   C C5    . DG  A 1 3   ? 11.523  5.433   -4.864  1.00 31.68  ? 3   DG  A C5    1 
ATOM   54   C C6    . DG  A 1 3   ? 11.718  4.449   -3.867  1.00 30.26  ? 3   DG  A C6    1 
ATOM   55   O O6    . DG  A 1 3   ? 12.695  4.303   -3.116  1.00 27.72  ? 3   DG  A O6    1 
ATOM   56   N N1    . DG  A 1 3   ? 10.633  3.576   -3.784  1.00 32.06  ? 3   DG  A N1    1 
ATOM   57   C C2    . DG  A 1 3   ? 9.502   3.647   -4.569  1.00 36.30  ? 3   DG  A C2    1 
ATOM   58   N N2    . DG  A 1 3   ? 8.549   2.727   -4.359  1.00 37.55  ? 3   DG  A N2    1 
ATOM   59   N N3    . DG  A 1 3   ? 9.310   4.566   -5.506  1.00 25.48  ? 3   DG  A N3    1 
ATOM   60   C C4    . DG  A 1 3   ? 10.358  5.420   -5.595  1.00 35.71  ? 3   DG  A C4    1 
ATOM   61   P P     . DC  A 1 4   ? 6.392   9.521   -8.982  1.00 70.09  ? 4   DC  A P     1 
ATOM   62   O OP1   . DC  A 1 4   ? 5.323   9.473   -10.004 1.00 66.82  ? 4   DC  A OP1   1 
ATOM   63   O OP2   . DC  A 1 4   ? 7.030   10.816  -8.647  1.00 64.29  ? 4   DC  A OP2   1 
ATOM   64   O "O5'" . DC  A 1 4   ? 5.826   8.871   -7.642  1.00 61.69  ? 4   DC  A "O5'" 1 
ATOM   65   C "C5'" . DC  A 1 4   ? 5.292   7.556   -7.695  1.00 55.08  ? 4   DC  A "C5'" 1 
ATOM   66   C "C4'" . DC  A 1 4   ? 4.958   7.066   -6.300  1.00 68.40  ? 4   DC  A "C4'" 1 
ATOM   67   O "O4'" . DC  A 1 4   ? 6.163   6.653   -5.595  1.00 66.40  ? 4   DC  A "O4'" 1 
ATOM   68   C "C3'" . DC  A 1 4   ? 4.301   8.120   -5.416  1.00 69.22  ? 4   DC  A "C3'" 1 
ATOM   69   O "O3'" . DC  A 1 4   ? 3.175   7.561   -4.776  1.00 65.63  ? 4   DC  A "O3'" 1 
ATOM   70   C "C2'" . DC  A 1 4   ? 5.399   8.483   -4.427  1.00 58.10  ? 4   DC  A "C2'" 1 
ATOM   71   C "C1'" . DC  A 1 4   ? 6.093   7.139   -4.270  1.00 52.27  ? 4   DC  A "C1'" 1 
ATOM   72   N N1    . DC  A 1 4   ? 7.460   7.212   -3.659  1.00 38.80  ? 4   DC  A N1    1 
ATOM   73   C C2    . DC  A 1 4   ? 7.873   6.259   -2.716  1.00 43.02  ? 4   DC  A C2    1 
ATOM   74   O O2    . DC  A 1 4   ? 7.101   5.346   -2.388  1.00 42.65  ? 4   DC  A O2    1 
ATOM   75   N N3    . DC  A 1 4   ? 9.118   6.357   -2.183  1.00 35.66  ? 4   DC  A N3    1 
ATOM   76   C C4    . DC  A 1 4   ? 9.928   7.348   -2.556  1.00 40.74  ? 4   DC  A C4    1 
ATOM   77   N N4    . DC  A 1 4   ? 11.145  7.407   -2.005  1.00 36.11  ? 4   DC  A N4    1 
ATOM   78   C C5    . DC  A 1 4   ? 9.526   8.326   -3.511  1.00 30.74  ? 4   DC  A C5    1 
ATOM   79   C C6    . DC  A 1 4   ? 8.301   8.219   -4.028  1.00 32.35  ? 4   DC  A C6    1 
ATOM   80   P P     . DG  A 1 5   ? 1.983   8.511   -4.275  1.00 71.26  ? 5   DG  A P     1 
ATOM   81   O OP1   . DG  A 1 5   ? 0.916   8.474   -5.302  1.00 73.15  ? 5   DG  A OP1   1 
ATOM   82   O OP2   . DG  A 1 5   ? 2.580   9.808   -3.877  1.00 53.34  ? 5   DG  A OP2   1 
ATOM   83   O "O5'" . DG  A 1 5   ? 1.453   7.775   -2.962  1.00 54.68  ? 5   DG  A "O5'" 1 
ATOM   84   C "C5'" . DG  A 1 5   ? 1.018   6.428   -3.059  1.00 52.82  ? 5   DG  A "C5'" 1 
ATOM   85   C "C4'" . DG  A 1 5   ? 1.358   5.670   -1.789  1.00 58.76  ? 5   DG  A "C4'" 1 
ATOM   86   O "O4'" . DG  A 1 5   ? 2.786   5.758   -1.537  1.00 55.27  ? 5   DG  A "O4'" 1 
ATOM   87   C "C3'" . DG  A 1 5   ? 0.678   6.207   -0.538  1.00 48.89  ? 5   DG  A "C3'" 1 
ATOM   88   O "O3'" . DG  A 1 5   ? 0.261   5.121   0.279   1.00 50.66  ? 5   DG  A "O3'" 1 
ATOM   89   C "C2'" . DG  A 1 5   ? 1.755   7.069   0.111   1.00 50.35  ? 5   DG  A "C2'" 1 
ATOM   90   C "C1'" . DG  A 1 5   ? 3.029   6.327   -0.264  1.00 52.60  ? 5   DG  A "C1'" 1 
ATOM   91   N N9    . DG  A 1 5   ? 4.230   7.158   -0.331  1.00 42.98  ? 5   DG  A N9    1 
ATOM   92   C C8    . DG  A 1 5   ? 4.434   8.297   -1.069  1.00 48.20  ? 5   DG  A C8    1 
ATOM   93   N N7    . DG  A 1 5   ? 5.628   8.808   -0.915  1.00 42.42  ? 5   DG  A N7    1 
ATOM   94   C C5    . DG  A 1 5   ? 6.255   7.951   -0.015  1.00 42.50  ? 5   DG  A C5    1 
ATOM   95   C C6    . DG  A 1 5   ? 7.561   7.985   0.535   1.00 36.53  ? 5   DG  A C6    1 
ATOM   96   O O6    . DG  A 1 5   ? 8.467   8.811   0.334   1.00 29.70  ? 5   DG  A O6    1 
ATOM   97   N N1    . DG  A 1 5   ? 7.781   6.918   1.405   1.00 27.02  ? 5   DG  A N1    1 
ATOM   98   C C2    . DG  A 1 5   ? 6.857   5.942   1.709   1.00 39.51  ? 5   DG  A C2    1 
ATOM   99   N N2    . DG  A 1 5   ? 7.233   4.985   2.574   1.00 26.48  ? 5   DG  A N2    1 
ATOM   100  N N3    . DG  A 1 5   ? 5.634   5.903   1.199   1.00 36.25  ? 5   DG  A N3    1 
ATOM   101  C C4    . DG  A 1 5   ? 5.405   6.933   0.350   1.00 37.78  ? 5   DG  A C4    1 
ATOM   102  P P     . DT  A 1 6   ? -0.543  5.400   1.641   1.00 69.45  ? 6   DT  A P     1 
ATOM   103  O OP1   . DT  A 1 6   ? -1.561  4.337   1.808   1.00 51.21  ? 6   DT  A OP1   1 
ATOM   104  O OP2   . DT  A 1 6   ? -0.949  6.825   1.621   1.00 54.11  ? 6   DT  A OP2   1 
ATOM   105  O "O5'" . DT  A 1 6   ? 0.564   5.206   2.775   1.00 68.46  ? 6   DT  A "O5'" 1 
ATOM   106  C "C5'" . DT  A 1 6   ? 1.251   3.965   2.833   1.00 56.82  ? 6   DT  A "C5'" 1 
ATOM   107  C "C4'" . DT  A 1 6   ? 2.279   3.942   3.946   1.00 50.82  ? 6   DT  A "C4'" 1 
ATOM   108  O "O4'" . DT  A 1 6   ? 3.373   4.835   3.629   1.00 52.87  ? 6   DT  A "O4'" 1 
ATOM   109  C "C3'" . DT  A 1 6   ? 1.752   4.373   5.310   1.00 57.88  ? 6   DT  A "C3'" 1 
ATOM   110  O "O3'" . DT  A 1 6   ? 1.859   3.261   6.197   1.00 43.53  ? 6   DT  A "O3'" 1 
ATOM   111  C "C2'" . DT  A 1 6   ? 2.614   5.576   5.700   1.00 48.15  ? 6   DT  A "C2'" 1 
ATOM   112  C "C1'" . DT  A 1 6   ? 3.846   5.417   4.824   1.00 41.59  ? 6   DT  A "C1'" 1 
ATOM   113  N N1    . DT  A 1 6   ? 4.537   6.678   4.444   1.00 40.15  ? 6   DT  A N1    1 
ATOM   114  C C2    . DT  A 1 6   ? 5.848   6.884   4.821   1.00 35.69  ? 6   DT  A C2    1 
ATOM   115  O O2    . DT  A 1 6   ? 6.512   6.098   5.480   1.00 40.90  ? 6   DT  A O2    1 
ATOM   116  N N3    . DT  A 1 6   ? 6.366   8.079   4.389   1.00 25.05  ? 6   DT  A N3    1 
ATOM   117  C C4    . DT  A 1 6   ? 5.731   9.060   3.641   1.00 37.73  ? 6   DT  A C4    1 
ATOM   118  O O4    . DT  A 1 6   ? 6.296   10.100  3.308   1.00 41.73  ? 6   DT  A O4    1 
ATOM   119  C C5    . DT  A 1 6   ? 4.365   8.771   3.283   1.00 31.63  ? 6   DT  A C5    1 
ATOM   120  C C7    . DT  A 1 6   ? 3.559   9.746   2.473   1.00 36.53  ? 6   DT  A C7    1 
ATOM   121  C C6    . DT  A 1 6   ? 3.843   7.608   3.694   1.00 31.64  ? 6   DT  A C6    1 
ATOM   122  P P     . DT  A 1 7   ? 1.468   3.417   7.746   1.00 67.67  ? 7   DT  A P     1 
ATOM   123  O OP1   . DT  A 1 7   ? 1.058   2.087   8.252   1.00 60.46  ? 7   DT  A OP1   1 
ATOM   124  O OP2   . DT  A 1 7   ? 0.557   4.579   7.869   1.00 52.97  ? 7   DT  A OP2   1 
ATOM   125  O "O5'" . DT  A 1 7   ? 2.848   3.812   8.435   1.00 66.10  ? 7   DT  A "O5'" 1 
ATOM   126  C "C5'" . DT  A 1 7   ? 4.001   3.048   8.131   1.00 42.22  ? 7   DT  A "C5'" 1 
ATOM   127  C "C4'" . DT  A 1 7   ? 5.214   3.655   8.801   1.00 40.57  ? 7   DT  A "C4'" 1 
ATOM   128  O "O4'" . DT  A 1 7   ? 5.572   4.903   8.155   1.00 42.69  ? 7   DT  A "O4'" 1 
ATOM   129  C "C3'" . DT  A 1 7   ? 5.025   3.982   10.276  1.00 37.85  ? 7   DT  A "C3'" 1 
ATOM   130  O "O3'" . DT  A 1 7   ? 6.124   3.399   10.966  1.00 45.64  ? 7   DT  A "O3'" 1 
ATOM   131  C "C2'" . DT  A 1 7   ? 4.994   5.509   10.303  1.00 38.89  ? 7   DT  A "C2'" 1 
ATOM   132  C "C1'" . DT  A 1 7   ? 5.930   5.839   9.153   1.00 34.47  ? 7   DT  A "C1'" 1 
ATOM   133  N N1    . DT  A 1 7   ? 5.826   7.207   8.559   1.00 24.35  ? 7   DT  A N1    1 
ATOM   134  C C2    . DT  A 1 7   ? 6.951   7.998   8.488   1.00 31.81  ? 7   DT  A C2    1 
ATOM   135  O O2    . DT  A 1 7   ? 8.052   7.670   8.899   1.00 48.57  ? 7   DT  A O2    1 
ATOM   136  N N3    . DT  A 1 7   ? 6.737   9.221   7.906   1.00 31.69  ? 7   DT  A N3    1 
ATOM   137  C C4    . DT  A 1 7   ? 5.556   9.728   7.396   1.00 34.12  ? 7   DT  A C4    1 
ATOM   138  O O4    . DT  A 1 7   ? 5.488   10.849  6.896   1.00 42.39  ? 7   DT  A O4    1 
ATOM   139  C C5    . DT  A 1 7   ? 4.426   8.845   7.499   1.00 24.07  ? 7   DT  A C5    1 
ATOM   140  C C7    . DT  A 1 7   ? 3.086   9.279   6.980   1.00 28.03  ? 7   DT  A C7    1 
ATOM   141  C C6    . DT  A 1 7   ? 4.612   7.643   8.064   1.00 25.85  ? 7   DT  A C6    1 
ATOM   142  P P     . DA  A 1 8   ? 6.213   3.432   12.569  1.00 48.31  ? 8   DA  A P     1 
ATOM   143  O OP1   . DA  A 1 8   ? 6.937   2.206   12.967  1.00 36.04  ? 8   DA  A OP1   1 
ATOM   144  O OP2   . DA  A 1 8   ? 4.876   3.725   13.139  1.00 44.75  ? 8   DA  A OP2   1 
ATOM   145  O "O5'" . DA  A 1 8   ? 7.164   4.678   12.858  1.00 46.35  ? 8   DA  A "O5'" 1 
ATOM   146  C "C5'" . DA  A 1 8   ? 8.459   4.648   12.287  1.00 34.75  ? 8   DA  A "C5'" 1 
ATOM   147  C "C4'" . DA  A 1 8   ? 9.193   5.964   12.462  1.00 31.12  ? 8   DA  A "C4'" 1 
ATOM   148  O "O4'" . DA  A 1 8   ? 8.536   7.040   11.741  1.00 35.42  ? 8   DA  A "O4'" 1 
ATOM   149  C "C3'" . DA  A 1 8   ? 9.300   6.442   13.896  1.00 35.12  ? 8   DA  A "C3'" 1 
ATOM   150  O "O3'" . DA  A 1 8   ? 10.615  6.916   14.057  1.00 36.65  ? 8   DA  A "O3'" 1 
ATOM   151  C "C2'" . DA  A 1 8   ? 8.249   7.542   14.008  1.00 33.81  ? 8   DA  A "C2'" 1 
ATOM   152  C "C1'" . DA  A 1 8   ? 8.240   8.126   12.604  1.00 35.05  ? 8   DA  A "C1'" 1 
ATOM   153  N N9    . DA  A 1 8   ? 6.974   8.704   12.156  1.00 36.16  ? 8   DA  A N9    1 
ATOM   154  C C8    . DA  A 1 8   ? 5.711   8.216   12.346  1.00 31.60  ? 8   DA  A C8    1 
ATOM   155  N N7    . DA  A 1 8   ? 4.766   8.950   11.803  1.00 35.31  ? 8   DA  A N7    1 
ATOM   156  C C5    . DA  A 1 8   ? 5.458   9.992   11.210  1.00 27.72  ? 8   DA  A C5    1 
ATOM   157  C C6    . DA  A 1 8   ? 5.036   11.111  10.472  1.00 30.50  ? 8   DA  A C6    1 
ATOM   158  N N6    . DA  A 1 8   ? 3.753   11.371  10.201  1.00 41.69  ? 8   DA  A N6    1 
ATOM   159  N N1    . DA  A 1 8   ? 5.988   11.955  10.027  1.00 31.45  ? 8   DA  A N1    1 
ATOM   160  C C2    . DA  A 1 8   ? 7.269   11.686  10.308  1.00 31.09  ? 8   DA  A C2    1 
ATOM   161  N N3    . DA  A 1 8   ? 7.785   10.668  10.992  1.00 27.85  ? 8   DA  A N3    1 
ATOM   162  C C4    . DA  A 1 8   ? 6.816   9.851   11.418  1.00 21.48  ? 8   DA  A C4    1 
ATOM   163  P P     . DG  A 1 9   ? 11.252  7.078   15.518  1.00 27.65  ? 9   DG  A P     1 
ATOM   164  O OP1   . DG  A 1 9   ? 12.412  6.166   15.589  1.00 35.38  ? 9   DG  A OP1   1 
ATOM   165  O OP2   . DG  A 1 9   ? 10.164  6.963   16.518  1.00 25.68  ? 9   DG  A OP2   1 
ATOM   166  O "O5'" . DG  A 1 9   ? 11.776  8.587   15.512  1.00 26.14  ? 9   DG  A "O5'" 1 
ATOM   167  C "C5'" . DG  A 1 9   ? 12.492  9.027   14.369  1.00 22.90  ? 9   DG  A "C5'" 1 
ATOM   168  C "C4'" . DG  A 1 9   ? 12.976  10.458  14.506  1.00 32.33  ? 9   DG  A "C4'" 1 
ATOM   169  O "O4'" . DG  A 1 9   ? 11.943  11.377  14.062  1.00 35.09  ? 9   DG  A "O4'" 1 
ATOM   170  C "C3'" . DG  A 1 9   ? 13.343  10.934  15.900  1.00 27.66  ? 9   DG  A "C3'" 1 
ATOM   171  O "O3'" . DG  A 1 9   ? 14.399  11.880  15.737  1.00 37.35  ? 9   DG  A "O3'" 1 
ATOM   172  C "C2'" . DG  A 1 9   ? 12.033  11.527  16.418  1.00 34.46  ? 9   DG  A "C2'" 1 
ATOM   173  C "C1'" . DG  A 1 9   ? 11.370  12.076  15.156  1.00 30.24  ? 9   DG  A "C1'" 1 
ATOM   174  N N9    . DG  A 1 9   ? 9.919   11.928  15.023  1.00 25.08  ? 9   DG  A N9    1 
ATOM   175  C C8    . DG  A 1 9   ? 9.091   10.949  15.519  1.00 35.12  ? 9   DG  A C8    1 
ATOM   176  N N7    . DG  A 1 9   ? 7.836   11.116  15.185  1.00 22.65  ? 9   DG  A N7    1 
ATOM   177  C C5    . DG  A 1 9   ? 7.835   12.272  14.408  1.00 30.85  ? 9   DG  A C5    1 
ATOM   178  C C6    . DG  A 1 9   ? 6.778   12.958  13.757  1.00 37.60  ? 9   DG  A C6    1 
ATOM   179  O O6    . DG  A 1 9   ? 5.570   12.673  13.730  1.00 31.84  ? 9   DG  A O6    1 
ATOM   180  N N1    . DG  A 1 9   ? 7.231   14.090  13.080  1.00 27.12  ? 9   DG  A N1    1 
ATOM   181  C C2    . DG  A 1 9   ? 8.543   14.508  13.038  1.00 25.04  ? 9   DG  A C2    1 
ATOM   182  N N2    . DG  A 1 9   ? 8.835   15.618  12.344  1.00 30.49  ? 9   DG  A N2    1 
ATOM   183  N N3    . DG  A 1 9   ? 9.531   13.874  13.642  1.00 24.25  ? 9   DG  A N3    1 
ATOM   184  C C4    . DG  A 1 9   ? 9.108   12.774  14.302  1.00 21.72  ? 9   DG  A C4    1 
ATOM   185  P P     . DT  A 1 10  ? 15.011  12.666  16.997  1.00 29.16  ? 10  DT  A P     1 
ATOM   186  O OP1   . DT  A 1 10  ? 16.412  13.012  16.658  1.00 22.82  ? 10  DT  A OP1   1 
ATOM   187  O OP2   . DT  A 1 10  ? 14.714  11.880  18.213  1.00 31.71  ? 10  DT  A OP2   1 
ATOM   188  O "O5'" . DT  A 1 10  ? 14.167  14.017  17.047  1.00 23.84  ? 10  DT  A "O5'" 1 
ATOM   189  C "C5'" . DT  A 1 10  ? 14.237  14.899  15.939  1.00 26.15  ? 10  DT  A "C5'" 1 
ATOM   190  C "C4'" . DT  A 1 10  ? 13.322  16.107  16.095  1.00 29.98  ? 10  DT  A "C4'" 1 
ATOM   191  O "O4'" . DT  A 1 10  ? 11.943  15.742  15.812  1.00 34.12  ? 10  DT  A "O4'" 1 
ATOM   192  C "C3'" . DT  A 1 10  ? 13.288  16.773  17.474  1.00 27.68  ? 10  DT  A "C3'" 1 
ATOM   193  O "O3'" . DT  A 1 10  ? 13.526  18.190  17.336  1.00 34.02  ? 10  DT  A "O3'" 1 
ATOM   194  C "C2'" . DT  A 1 10  ? 11.870  16.463  17.954  1.00 28.84  ? 10  DT  A "C2'" 1 
ATOM   195  C "C1'" . DT  A 1 10  ? 11.120  16.539  16.635  1.00 29.22  ? 10  DT  A "C1'" 1 
ATOM   196  N N1    . DT  A 1 10  ? 9.705   16.026  16.604  1.00 26.96  ? 10  DT  A N1    1 
ATOM   197  C C2    . DT  A 1 10  ? 8.747   16.703  15.860  1.00 45.23  ? 10  DT  A C2    1 
ATOM   198  O O2    . DT  A 1 10  ? 8.964   17.717  15.213  1.00 51.35  ? 10  DT  A O2    1 
ATOM   199  N N3    . DT  A 1 10  ? 7.492   16.145  15.894  1.00 24.28  ? 10  DT  A N3    1 
ATOM   200  C C4    . DT  A 1 10  ? 7.103   15.006  16.577  1.00 33.64  ? 10  DT  A C4    1 
ATOM   201  O O4    . DT  A 1 10  ? 5.944   14.596  16.535  1.00 20.79  ? 10  DT  A O4    1 
ATOM   202  C C5    . DT  A 1 10  ? 8.153   14.351  17.330  1.00 24.93  ? 10  DT  A C5    1 
ATOM   203  C C7    . DT  A 1 10  ? 7.867   13.105  18.119  1.00 35.61  ? 10  DT  A C7    1 
ATOM   204  C C6    . DT  A 1 10  ? 9.384   14.882  17.307  1.00 11.22  ? 10  DT  A C6    1 
ATOM   205  P P     . DG  A 1 11  ? 14.268  19.036  18.491  1.00 32.03  ? 11  DG  A P     1 
ATOM   206  O OP1   . DG  A 1 11  ? 14.526  20.385  17.947  1.00 28.07  ? 11  DG  A OP1   1 
ATOM   207  O OP2   . DG  A 1 11  ? 15.407  18.243  19.003  1.00 44.47  ? 11  DG  A OP2   1 
ATOM   208  O "O5'" . DG  A 1 11  ? 13.180  19.162  19.655  1.00 33.76  ? 11  DG  A "O5'" 1 
ATOM   209  C "C5'" . DG  A 1 11  ? 12.421  20.361  19.848  1.00 40.92  ? 11  DG  A "C5'" 1 
ATOM   210  C "C4'" . DG  A 1 11  ? 11.276  20.504  18.856  1.00 44.89  ? 11  DG  A "C4'" 1 
ATOM   211  O "O4'" . DG  A 1 11  ? 10.593  19.244  18.686  1.00 39.48  ? 11  DG  A "O4'" 1 
ATOM   212  C "C3'" . DG  A 1 11  ? 10.160  21.447  19.282  1.00 49.63  ? 11  DG  A "C3'" 1 
ATOM   213  O "O3'" . DG  A 1 11  ? 10.478  22.783  18.915  1.00 40.65  ? 11  DG  A "O3'" 1 
ATOM   214  C "C2'" . DG  A 1 11  ? 8.927   20.910  18.552  1.00 36.70  ? 11  DG  A "C2'" 1 
ATOM   215  C "C1'" . DG  A 1 11  ? 9.282   19.468  18.211  1.00 27.12  ? 11  DG  A "C1'" 1 
ATOM   216  N N9    . DG  A 1 11  ? 8.401   18.437  18.767  1.00 23.71  ? 11  DG  A N9    1 
ATOM   217  C C8    . DG  A 1 11  ? 8.748   17.431  19.637  1.00 34.46  ? 11  DG  A C8    1 
ATOM   218  N N7    . DG  A 1 11  ? 7.753   16.641  19.949  1.00 32.21  ? 11  DG  A N7    1 
ATOM   219  C C5    . DG  A 1 11  ? 6.677   17.151  19.237  1.00 25.22  ? 11  DG  A C5    1 
ATOM   220  C C6    . DG  A 1 11  ? 5.334   16.711  19.175  1.00 31.00  ? 11  DG  A C6    1 
ATOM   221  O O6    . DG  A 1 11  ? 4.804   15.750  19.755  1.00 21.97  ? 11  DG  A O6    1 
ATOM   222  N N1    . DG  A 1 11  ? 4.572   17.515  18.330  1.00 29.74  ? 11  DG  A N1    1 
ATOM   223  C C2    . DG  A 1 11  ? 5.047   18.604  17.636  1.00 35.86  ? 11  DG  A C2    1 
ATOM   224  N N2    . DG  A 1 11  ? 4.160   19.258  16.869  1.00 34.24  ? 11  DG  A N2    1 
ATOM   225  N N3    . DG  A 1 11  ? 6.304   19.024  17.686  1.00 34.18  ? 11  DG  A N3    1 
ATOM   226  C C4    . DG  A 1 11  ? 7.060   18.254  18.504  1.00 27.93  ? 11  DG  A C4    1 
ATOM   227  P P     . DT  A 1 12  ? 9.878   24.016  19.752  1.00 49.74  ? 12  DT  A P     1 
ATOM   228  O OP1   . DT  A 1 12  ? 10.583  25.233  19.291  1.00 38.11  ? 12  DT  A OP1   1 
ATOM   229  O OP2   . DT  A 1 12  ? 9.901   23.661  21.189  1.00 56.40  ? 12  DT  A OP2   1 
ATOM   230  O "O5'" . DT  A 1 12  ? 8.348   24.087  19.286  1.00 44.65  ? 12  DT  A "O5'" 1 
ATOM   231  C "C5'" . DT  A 1 12  ? 8.053   24.494  17.953  1.00 48.38  ? 12  DT  A "C5'" 1 
ATOM   232  C "C4'" . DT  A 1 12  ? 6.565   24.457  17.661  1.00 37.42  ? 12  DT  A "C4'" 1 
ATOM   233  O "O4'" . DT  A 1 12  ? 6.038   23.142  17.973  1.00 38.93  ? 12  DT  A "O4'" 1 
ATOM   234  C "C3'" . DT  A 1 12  ? 5.722   25.454  18.447  1.00 38.63  ? 12  DT  A "C3'" 1 
ATOM   235  O "O3'" . DT  A 1 12  ? 4.893   26.176  17.535  1.00 67.42  ? 12  DT  A "O3'" 1 
ATOM   236  C "C2'" . DT  A 1 12  ? 4.928   24.587  19.421  1.00 37.35  ? 12  DT  A "C2'" 1 
ATOM   237  C "C1'" . DT  A 1 12  ? 4.827   23.260  18.687  1.00 29.82  ? 12  DT  A "C1'" 1 
ATOM   238  N N1    . DT  A 1 12  ? 4.715   22.068  19.569  1.00 29.20  ? 12  DT  A N1    1 
ATOM   239  C C2    . DT  A 1 12  ? 3.570   21.304  19.566  1.00 36.27  ? 12  DT  A C2    1 
ATOM   240  O O2    . DT  A 1 12  ? 2.591   21.535  18.872  1.00 39.98  ? 12  DT  A O2    1 
ATOM   241  N N3    . DT  A 1 12  ? 3.618   20.234  20.426  1.00 33.22  ? 12  DT  A N3    1 
ATOM   242  C C4    . DT  A 1 12  ? 4.655   19.855  21.263  1.00 32.83  ? 12  DT  A C4    1 
ATOM   243  O O4    . DT  A 1 12  ? 4.585   18.870  21.994  1.00 31.33  ? 12  DT  A O4    1 
ATOM   244  C C5    . DT  A 1 12  ? 5.816   20.702  21.211  1.00 32.81  ? 12  DT  A C5    1 
ATOM   245  C C7    . DT  A 1 12  ? 7.011   20.409  22.072  1.00 34.16  ? 12  DT  A C7    1 
ATOM   246  C C6    . DT  A 1 12  ? 5.790   21.752  20.378  1.00 35.75  ? 12  DT  A C6    1 
ATOM   247  P P     . DT  A 1 13  ? 3.971   27.388  18.050  1.00 53.89  ? 13  DT  A P     1 
ATOM   248  O OP1   . DT  A 1 13  ? 3.699   28.261  16.887  1.00 47.43  ? 13  DT  A OP1   1 
ATOM   249  O OP2   . DT  A 1 13  ? 4.607   27.955  19.260  1.00 61.70  ? 13  DT  A OP2   1 
ATOM   250  O "O5'" . DT  A 1 13  ? 2.601   26.675  18.472  1.00 35.51  ? 13  DT  A "O5'" 1 
ATOM   251  C "C5'" . DT  A 1 13  ? 1.842   26.011  17.470  1.00 31.67  ? 13  DT  A "C5'" 1 
ATOM   252  C "C4'" . DT  A 1 13  ? 0.661   25.242  18.041  1.00 38.59  ? 13  DT  A "C4'" 1 
ATOM   253  O "O4'" . DT  A 1 13  ? 1.116   24.179  18.910  1.00 56.08  ? 13  DT  A "O4'" 1 
ATOM   254  C "C3'" . DT  A 1 13  ? -0.315  26.068  18.869  1.00 65.54  ? 13  DT  A "C3'" 1 
ATOM   255  O "O3'" . DT  A 1 13  ? -1.571  26.072  18.198  1.00 81.08  ? 13  DT  A "O3'" 1 
ATOM   256  C "C2'" . DT  A 1 13  ? -0.372  25.373  20.229  1.00 61.92  ? 13  DT  A "C2'" 1 
ATOM   257  C "C1'" . DT  A 1 13  ? 0.153   23.980  19.922  1.00 40.78  ? 13  DT  A "C1'" 1 
ATOM   258  N N1    . DT  A 1 13  ? 0.840   23.311  21.054  1.00 32.43  ? 13  DT  A N1    1 
ATOM   259  C C2    . DT  A 1 13  ? 0.330   22.150  21.593  1.00 36.71  ? 13  DT  A C2    1 
ATOM   260  O O2    . DT  A 1 13  ? -0.694  21.612  21.203  1.00 41.67  ? 13  DT  A O2    1 
ATOM   261  N N3    . DT  A 1 13  ? 1.081   21.641  22.626  1.00 25.76  ? 13  DT  A N3    1 
ATOM   262  C C4    . DT  A 1 13  ? 2.254   22.159  23.154  1.00 34.16  ? 13  DT  A C4    1 
ATOM   263  O O4    . DT  A 1 13  ? 2.844   21.614  24.083  1.00 37.90  ? 13  DT  A O4    1 
ATOM   264  C C5    . DT  A 1 13  ? 2.726   23.373  22.534  1.00 27.35  ? 13  DT  A C5    1 
ATOM   265  C C7    . DT  A 1 13  ? 3.982   24.047  23.009  1.00 35.77  ? 13  DT  A C7    1 
ATOM   266  C C6    . DT  A 1 13  ? 2.004   23.881  21.528  1.00 27.85  ? 13  DT  A C6    1 
ATOM   267  P P     . DT  A 1 14  ? -2.742  27.069  18.661  1.00 61.21  ? 14  DT  A P     1 
ATOM   268  O OP1   . DT  A 1 14  ? -3.681  27.181  17.524  1.00 51.13  ? 14  DT  A OP1   1 
ATOM   269  O OP2   . DT  A 1 14  ? -2.113  28.289  19.222  1.00 60.77  ? 14  DT  A OP2   1 
ATOM   270  O "O5'" . DT  A 1 14  ? -3.474  26.278  19.842  1.00 52.41  ? 14  DT  A "O5'" 1 
ATOM   271  C "C5'" . DT  A 1 14  ? -4.201  25.101  19.518  1.00 37.90  ? 14  DT  A "C5'" 1 
ATOM   272  C "C4'" . DT  A 1 14  ? -4.395  24.186  20.718  1.00 59.63  ? 14  DT  A "C4'" 1 
ATOM   273  O "O4'" . DT  A 1 14  ? -3.146  23.943  21.410  1.00 52.48  ? 14  DT  A "O4'" 1 
ATOM   274  C "C3'" . DT  A 1 14  ? -5.335  24.711  21.801  1.00 79.50  ? 14  DT  A "C3'" 1 
ATOM   275  O "O3'" . DT  A 1 14  ? -6.582  24.030  21.702  1.00 71.38  ? 14  DT  A "O3'" 1 
ATOM   276  C "C2'" . DT  A 1 14  ? -4.615  24.424  23.122  1.00 59.90  ? 14  DT  A "C2'" 1 
ATOM   277  C "C1'" . DT  A 1 14  ? -3.496  23.485  22.699  1.00 51.59  ? 14  DT  A "C1'" 1 
ATOM   278  N N1    . DT  A 1 14  ? -2.303  23.504  23.597  1.00 33.71  ? 14  DT  A N1    1 
ATOM   279  C C2    . DT  A 1 14  ? -2.047  22.429  24.423  1.00 33.80  ? 14  DT  A C2    1 
ATOM   280  O O2    . DT  A 1 14  ? -2.743  21.427  24.484  1.00 27.35  ? 14  DT  A O2    1 
ATOM   281  N N3    . DT  A 1 14  ? -0.919  22.576  25.193  1.00 31.68  ? 14  DT  A N3    1 
ATOM   282  C C4    . DT  A 1 14  ? -0.045  23.653  25.220  1.00 41.98  ? 14  DT  A C4    1 
ATOM   283  O O4    . DT  A 1 14  ? 0.942   23.675  25.953  1.00 44.52  ? 14  DT  A O4    1 
ATOM   284  C C5    . DT  A 1 14  ? -0.379  24.737  24.329  1.00 32.05  ? 14  DT  A C5    1 
ATOM   285  C C7    . DT  A 1 14  ? 0.473   25.974  24.251  1.00 38.04  ? 14  DT  A C7    1 
ATOM   286  C C6    . DT  A 1 14  ? -1.477  24.610  23.574  1.00 30.69  ? 14  DT  A C6    1 
ATOM   287  P P     . DA  A 1 15  ? -7.806  24.439  22.658  1.00 69.65  ? 15  DA  A P     1 
ATOM   288  O OP1   . DA  A 1 15  ? -9.058  24.046  21.971  1.00 69.45  ? 15  DA  A OP1   1 
ATOM   289  O OP2   . DA  A 1 15  ? -7.600  25.846  23.076  1.00 71.86  ? 15  DA  A OP2   1 
ATOM   290  O "O5'" . DA  A 1 15  ? -7.626  23.497  23.935  1.00 56.00  ? 15  DA  A "O5'" 1 
ATOM   291  C "C5'" . DA  A 1 15  ? -7.851  22.107  23.782  1.00 53.53  ? 15  DA  A "C5'" 1 
ATOM   292  C "C4'" . DA  A 1 15  ? -7.319  21.315  24.964  1.00 46.33  ? 15  DA  A "C4'" 1 
ATOM   293  O "O4'" . DA  A 1 15  ? -5.957  21.717  25.255  1.00 52.31  ? 15  DA  A "O4'" 1 
ATOM   294  C "C3'" . DA  A 1 15  ? -8.092  21.497  26.268  1.00 57.45  ? 15  DA  A "C3'" 1 
ATOM   295  O "O3'" . DA  A 1 15  ? -8.599  20.237  26.701  1.00 62.26  ? 15  DA  A "O3'" 1 
ATOM   296  C "C2'" . DA  A 1 15  ? -7.069  22.071  27.247  1.00 67.72  ? 15  DA  A "C2'" 1 
ATOM   297  C "C1'" . DA  A 1 15  ? -5.756  21.597  26.646  1.00 52.54  ? 15  DA  A "C1'" 1 
ATOM   298  N N9    . DA  A 1 15  ? -4.575  22.367  27.033  1.00 42.87  ? 15  DA  A N9    1 
ATOM   299  C C8    . DA  A 1 15  ? -4.217  23.619  26.614  1.00 43.53  ? 15  DA  A C8    1 
ATOM   300  N N7    . DA  A 1 15  ? -3.091  24.053  27.135  1.00 27.49  ? 15  DA  A N7    1 
ATOM   301  C C5    . DA  A 1 15  ? -2.683  23.009  27.947  1.00 24.48  ? 15  DA  A C5    1 
ATOM   302  C C6    . DA  A 1 15  ? -1.562  22.842  28.774  1.00 24.66  ? 15  DA  A C6    1 
ATOM   303  N N6    . DA  A 1 15  ? -0.621  23.781  28.907  1.00 28.87  ? 15  DA  A N6    1 
ATOM   304  N N1    . DA  A 1 15  ? -1.452  21.681  29.453  1.00 24.50  ? 15  DA  A N1    1 
ATOM   305  C C2    . DA  A 1 15  ? -2.413  20.759  29.304  1.00 35.54  ? 15  DA  A C2    1 
ATOM   306  N N3    . DA  A 1 15  ? -3.511  20.800  28.550  1.00 33.00  ? 15  DA  A N3    1 
ATOM   307  C C4    . DA  A 1 15  ? -3.583  21.964  27.894  1.00 29.28  ? 15  DA  A C4    1 
ATOM   308  P P     . DC  A 1 16  ? -9.589  20.152  27.964  1.00 75.86  ? 16  DC  A P     1 
ATOM   309  O OP1   . DC  A 1 16  ? -10.461 18.973  27.760  1.00 76.00  ? 16  DC  A OP1   1 
ATOM   310  O OP2   . DC  A 1 16  ? -10.192 21.490  28.168  1.00 68.86  ? 16  DC  A OP2   1 
ATOM   311  O "O5'" . DC  A 1 16  ? -8.618  19.842  29.196  1.00 57.81  ? 16  DC  A "O5'" 1 
ATOM   312  C "C5'" . DC  A 1 16  ? -8.043  18.549  29.291  1.00 49.50  ? 16  DC  A "C5'" 1 
ATOM   313  C "C4'" . DC  A 1 16  ? -7.119  18.422  30.487  1.00 57.03  ? 16  DC  A "C4'" 1 
ATOM   314  O "O4'" . DC  A 1 16  ? -6.022  19.369  30.404  1.00 57.42  ? 16  DC  A "O4'" 1 
ATOM   315  C "C3'" . DC  A 1 16  ? -7.781  18.677  31.835  1.00 57.90  ? 16  DC  A "C3'" 1 
ATOM   316  O "O3'" . DC  A 1 16  ? -7.545  17.542  32.651  1.00 53.12  ? 16  DC  A "O3'" 1 
ATOM   317  C "C2'" . DC  A 1 16  ? -7.092  19.942  32.341  1.00 58.25  ? 16  DC  A "C2'" 1 
ATOM   318  C "C1'" . DC  A 1 16  ? -5.716  19.785  31.717  1.00 47.40  ? 16  DC  A "C1'" 1 
ATOM   319  N N1    . DC  A 1 16  ? -4.887  21.029  31.651  1.00 33.06  ? 16  DC  A N1    1 
ATOM   320  C C2    . DC  A 1 16  ? -3.718  21.166  32.417  1.00 32.71  ? 16  DC  A C2    1 
ATOM   321  O O2    . DC  A 1 16  ? -3.369  20.243  33.167  1.00 38.30  ? 16  DC  A O2    1 
ATOM   322  N N3    . DC  A 1 16  ? -2.995  22.312  32.322  1.00 18.18  ? 16  DC  A N3    1 
ATOM   323  C C4    . DC  A 1 16  ? -3.400  23.285  31.504  1.00 31.19  ? 16  DC  A C4    1 
ATOM   324  N N4    . DC  A 1 16  ? -2.667  24.402  31.424  1.00 28.84  ? 16  DC  A N4    1 
ATOM   325  C C5    . DC  A 1 16  ? -4.582  23.164  30.719  1.00 29.77  ? 16  DC  A C5    1 
ATOM   326  C C6    . DC  A 1 16  ? -5.286  22.033  30.821  1.00 39.56  ? 16  DC  A C6    1 
ATOM   327  P P     . DG  A 1 17  ? -8.386  17.319  34.001  1.00 64.50  ? 17  DG  A P     1 
ATOM   328  O OP1   . DG  A 1 17  ? -9.156  16.063  33.850  1.00 80.79  ? 17  DG  A OP1   1 
ATOM   329  O OP2   . DG  A 1 17  ? -9.093  18.582  34.315  1.00 67.28  ? 17  DG  A OP2   1 
ATOM   330  O "O5'" . DG  A 1 17  ? -7.252  17.108  35.103  1.00 59.59  ? 17  DG  A "O5'" 1 
ATOM   331  C "C5'" . DG  A 1 17  ? -6.152  18.004  35.084  1.00 51.99  ? 17  DG  A "C5'" 1 
ATOM   332  C "C4'" . DG  A 1 17  ? -5.359  17.954  36.368  1.00 61.51  ? 17  DG  A "C4'" 1 
ATOM   333  O "O4'" . DG  A 1 17  ? -4.356  19.001  36.325  1.00 61.64  ? 17  DG  A "O4'" 1 
ATOM   334  C "C3'" . DG  A 1 17  ? -6.184  18.257  37.603  1.00 59.79  ? 17  DG  A "C3'" 1 
ATOM   335  O "O3'" . DG  A 1 17  ? -5.578  17.713  38.760  1.00 59.77  ? 17  DG  A "O3'" 1 
ATOM   336  C "C2'" . DG  A 1 17  ? -6.188  19.781  37.608  1.00 60.92  ? 17  DG  A "C2'" 1 
ATOM   337  C "C1'" . DG  A 1 17  ? -4.810  20.131  37.053  1.00 54.49  ? 17  DG  A "C1'" 1 
ATOM   338  N N9    . DG  A 1 17  ? -4.789  21.318  36.196  1.00 32.96  ? 17  DG  A N9    1 
ATOM   339  C C8    . DG  A 1 17  ? -5.668  21.677  35.199  1.00 43.48  ? 17  DG  A C8    1 
ATOM   340  N N7    . DG  A 1 17  ? -5.361  22.812  34.624  1.00 39.84  ? 17  DG  A N7    1 
ATOM   341  C C5    . DG  A 1 17  ? -4.206  23.229  35.281  1.00 20.04  ? 17  DG  A C5    1 
ATOM   342  C C6    . DG  A 1 17  ? -3.406  24.385  35.098  1.00 31.65  ? 17  DG  A C6    1 
ATOM   343  O O6    . DG  A 1 17  ? -3.559  25.314  34.287  1.00 28.08  ? 17  DG  A O6    1 
ATOM   344  N N1    . DG  A 1 17  ? -2.326  24.407  35.983  1.00 27.99  ? 17  DG  A N1    1 
ATOM   345  C C2    . DG  A 1 17  ? -2.056  23.438  36.924  1.00 29.77  ? 17  DG  A C2    1 
ATOM   346  N N2    . DG  A 1 17  ? -0.975  23.613  37.696  1.00 33.92  ? 17  DG  A N2    1 
ATOM   347  N N3    . DG  A 1 17  ? -2.797  22.356  37.101  1.00 26.84  ? 17  DG  A N3    1 
ATOM   348  C C4    . DG  A 1 17  ? -3.847  22.320  36.248  1.00 24.81  ? 17  DG  A C4    1 
ATOM   349  P P     . DC  A 1 18  ? -6.330  17.800  40.176  1.00 75.14  ? 18  DC  A P     1 
ATOM   350  O OP1   . DC  A 1 18  ? -5.942  16.599  40.950  1.00 58.18  ? 18  DC  A OP1   1 
ATOM   351  O OP2   . DC  A 1 18  ? -7.760  18.103  39.925  1.00 62.38  ? 18  DC  A OP2   1 
ATOM   352  O "O5'" . DC  A 1 18  ? -5.669  19.073  40.873  1.00 69.95  ? 18  DC  A "O5'" 1 
ATOM   353  C "C5'" . DC  A 1 18  ? -4.298  19.002  41.215  1.00 52.02  ? 18  DC  A "C5'" 1 
ATOM   354  C "C4'" . DC  A 1 18  ? -3.806  20.330  41.750  1.00 58.62  ? 18  DC  A "C4'" 1 
ATOM   355  O "O4'" . DC  A 1 18  ? -3.729  21.303  40.677  1.00 59.66  ? 18  DC  A "O4'" 1 
ATOM   356  C "C3'" . DC  A 1 18  ? -4.687  20.969  42.817  1.00 51.68  ? 18  DC  A "C3'" 1 
ATOM   357  O "O3'" . DC  A 1 18  ? -3.855  21.413  43.860  1.00 49.43  ? 18  DC  A "O3'" 1 
ATOM   358  C "C2'" . DC  A 1 18  ? -5.322  22.144  42.092  1.00 39.05  ? 18  DC  A "C2'" 1 
ATOM   359  C "C1'" . DC  A 1 18  ? -4.162  22.540  41.198  1.00 39.57  ? 18  DC  A "C1'" 1 
ATOM   360  N N1    . DC  A 1 18  ? -4.505  23.458  40.074  1.00 36.40  ? 18  DC  A N1    1 
ATOM   361  C C2    . DC  A 1 18  ? -3.719  24.589  39.808  1.00 32.50  ? 18  DC  A C2    1 
ATOM   362  O O2    . DC  A 1 18  ? -2.731  24.826  40.517  1.00 37.62  ? 18  DC  A O2    1 
ATOM   363  N N3    . DC  A 1 18  ? -4.061  25.399  38.774  1.00 24.96  ? 18  DC  A N3    1 
ATOM   364  C C4    . DC  A 1 18  ? -5.133  25.112  38.034  1.00 33.31  ? 18  DC  A C4    1 
ATOM   365  N N4    . DC  A 1 18  ? -5.438  25.938  37.027  1.00 35.56  ? 18  DC  A N4    1 
ATOM   366  C C5    . DC  A 1 18  ? -5.943  23.966  38.291  1.00 26.21  ? 18  DC  A C5    1 
ATOM   367  C C6    . DC  A 1 18  ? -5.595  23.176  39.308  1.00 26.62  ? 18  DC  A C6    1 
ATOM   368  P P     . DG  A 1 19  ? -4.284  21.213  45.392  1.00 66.11  ? 19  DG  A P     1 
ATOM   369  O OP1   . DG  A 1 19  ? -3.944  19.826  45.788  1.00 59.81  ? 19  DG  A OP1   1 
ATOM   370  O OP2   . DG  A 1 19  ? -5.677  21.700  45.536  1.00 63.31  ? 19  DG  A OP2   1 
ATOM   371  O "O5'" . DG  A 1 19  ? -3.313  22.213  46.171  1.00 53.93  ? 19  DG  A "O5'" 1 
ATOM   372  C "C5'" . DG  A 1 19  ? -1.907  22.113  45.973  1.00 46.47  ? 19  DG  A "C5'" 1 
ATOM   373  C "C4'" . DG  A 1 19  ? -1.259  23.485  45.966  1.00 56.12  ? 19  DG  A "C4'" 1 
ATOM   374  O "O4'" . DG  A 1 19  ? -1.684  24.242  44.798  1.00 55.68  ? 19  DG  A "O4'" 1 
ATOM   375  C "C3'" . DG  A 1 19  ? -1.612  24.342  47.171  1.00 50.60  ? 19  DG  A "C3'" 1 
ATOM   376  O "O3'" . DG  A 1 19  ? -0.449  25.036  47.616  1.00 50.17  ? 19  DG  A "O3'" 1 
ATOM   377  C "C2'" . DG  A 1 19  ? -2.699  25.265  46.628  1.00 46.00  ? 19  DG  A "C2'" 1 
ATOM   378  C "C1'" . DG  A 1 19  ? -2.280  25.470  45.180  1.00 36.05  ? 19  DG  A "C1'" 1 
ATOM   379  N N9    . DG  A 1 19  ? -3.371  25.767  44.249  1.00 43.82  ? 19  DG  A N9    1 
ATOM   380  C C8    . DG  A 1 19  ? -4.528  25.043  44.081  1.00 46.03  ? 19  DG  A C8    1 
ATOM   381  N N7    . DG  A 1 19  ? -5.321  25.538  43.168  1.00 40.62  ? 19  DG  A N7    1 
ATOM   382  C C5    . DG  A 1 19  ? -4.646  26.658  42.697  1.00 24.68  ? 19  DG  A C5    1 
ATOM   383  C C6    . DG  A 1 19  ? -5.017  27.590  41.699  1.00 34.20  ? 19  DG  A C6    1 
ATOM   384  O O6    . DG  A 1 19  ? -6.052  27.609  41.015  1.00 39.71  ? 19  DG  A O6    1 
ATOM   385  N N1    . DG  A 1 19  ? -4.050  28.577  41.523  1.00 27.68  ? 19  DG  A N1    1 
ATOM   386  C C2    . DG  A 1 19  ? -2.869  28.653  42.226  1.00 28.18  ? 19  DG  A C2    1 
ATOM   387  N N2    . DG  A 1 19  ? -2.049  29.675  41.928  1.00 30.76  ? 19  DG  A N2    1 
ATOM   388  N N3    . DG  A 1 19  ? -2.513  27.784  43.164  1.00 26.22  ? 19  DG  A N3    1 
ATOM   389  C C4    . DG  A 1 19  ? -3.444  26.814  43.348  1.00 28.06  ? 19  DG  A C4    1 
ATOM   390  P P     . DG  A 1 20  ? -0.396  25.674  49.090  1.00 58.43  ? 20  DG  A P     1 
ATOM   391  O OP1   . DG  A 1 20  ? 1.010   26.054  49.355  1.00 52.81  ? 20  DG  A OP1   1 
ATOM   392  O OP2   . DG  A 1 20  ? -1.098  24.755  50.016  1.00 42.97  ? 20  DG  A OP2   1 
ATOM   393  O "O5'" . DG  A 1 20  ? -1.268  27.007  48.958  1.00 54.20  ? 20  DG  A "O5'" 1 
ATOM   394  C "C5'" . DG  A 1 20  ? -0.903  27.993  47.996  1.00 47.30  ? 20  DG  A "C5'" 1 
ATOM   395  C "C4'" . DG  A 1 20  ? -2.008  29.021  47.816  1.00 52.82  ? 20  DG  A "C4'" 1 
ATOM   396  O "O4'" . DG  A 1 20  ? -3.146  28.426  47.130  1.00 58.85  ? 20  DG  A "O4'" 1 
ATOM   397  C "C3'" . DG  A 1 20  ? -2.561  29.598  49.116  1.00 69.99  ? 20  DG  A "C3'" 1 
ATOM   398  O "O3'" . DG  A 1 20  ? -2.742  31.009  49.003  1.00 74.41  ? 20  DG  A "O3'" 1 
ATOM   399  C "C2'" . DG  A 1 20  ? -3.886  28.866  49.298  1.00 38.52  ? 20  DG  A "C2'" 1 
ATOM   400  C "C1'" . DG  A 1 20  ? -4.338  28.667  47.856  1.00 41.31  ? 20  DG  A "C1'" 1 
ATOM   401  N N9    . DG  A 1 20  ? -5.296  27.580  47.648  1.00 27.55  ? 20  DG  A N9    1 
ATOM   402  C C8    . DG  A 1 20  ? -5.466  26.454  48.417  1.00 27.14  ? 20  DG  A C8    1 
ATOM   403  N N7    . DG  A 1 20  ? -6.408  25.664  47.978  1.00 27.04  ? 20  DG  A N7    1 
ATOM   404  C C5    . DG  A 1 20  ? -6.897  26.308  46.848  1.00 24.25  ? 20  DG  A C5    1 
ATOM   405  C C6    . DG  A 1 20  ? -7.927  25.928  45.956  1.00 23.22  ? 20  DG  A C6    1 
ATOM   406  O O6    . DG  A 1 20  ? -8.638  24.914  45.987  1.00 39.55  ? 20  DG  A O6    1 
ATOM   407  N N1    . DG  A 1 20  ? -8.106  26.865  44.943  1.00 23.83  ? 20  DG  A N1    1 
ATOM   408  C C2    . DG  A 1 20  ? -7.378  28.026  44.804  1.00 32.76  ? 20  DG  A C2    1 
ATOM   409  N N2    . DG  A 1 20  ? -7.683  28.823  43.764  1.00 33.73  ? 20  DG  A N2    1 
ATOM   410  N N3    . DG  A 1 20  ? -6.410  28.391  45.636  1.00 25.59  ? 20  DG  A N3    1 
ATOM   411  C C4    . DG  A 1 20  ? -6.225  27.488  46.631  1.00 32.09  ? 20  DG  A C4    1 
ATOM   412  P P     . DC  B 2 1   ? -4.976  34.235  34.131  1.00 137.87 ? 2   DC  B P     1 
ATOM   413  O OP1   . DC  B 2 1   ? -4.596  32.819  34.336  1.00 102.31 ? 2   DC  B OP1   1 
ATOM   414  O OP2   . DC  B 2 1   ? -4.958  34.810  32.767  1.00 110.60 ? 2   DC  B OP2   1 
ATOM   415  O "O5'" . DC  B 2 1   ? -4.065  35.156  35.071  1.00 88.78  ? 2   DC  B "O5'" 1 
ATOM   416  C "C5'" . DC  B 2 1   ? -4.587  35.758  36.250  1.00 44.96  ? 2   DC  B "C5'" 1 
ATOM   417  C "C4'" . DC  B 2 1   ? -3.517  35.782  37.325  1.00 50.14  ? 2   DC  B "C4'" 1 
ATOM   418  O "O4'" . DC  B 2 1   ? -3.832  34.821  38.364  1.00 65.34  ? 2   DC  B "O4'" 1 
ATOM   419  C "C3'" . DC  B 2 1   ? -2.128  35.404  36.836  1.00 58.70  ? 2   DC  B "C3'" 1 
ATOM   420  O "O3'" . DC  B 2 1   ? -1.144  36.085  37.598  1.00 61.34  ? 2   DC  B "O3'" 1 
ATOM   421  C "C2'" . DC  B 2 1   ? -2.089  33.897  37.068  1.00 48.89  ? 2   DC  B "C2'" 1 
ATOM   422  C "C1'" . DC  B 2 1   ? -2.930  33.731  38.327  1.00 40.86  ? 2   DC  B "C1'" 1 
ATOM   423  N N1    . DC  B 2 1   ? -3.724  32.468  38.359  1.00 32.02  ? 2   DC  B N1    1 
ATOM   424  C C2    . DC  B 2 1   ? -3.496  31.517  39.362  1.00 37.78  ? 2   DC  B C2    1 
ATOM   425  O O2    . DC  B 2 1   ? -2.630  31.732  40.217  1.00 40.72  ? 2   DC  B O2    1 
ATOM   426  N N3    . DC  B 2 1   ? -4.234  30.379  39.373  1.00 31.04  ? 2   DC  B N3    1 
ATOM   427  C C4    . DC  B 2 1   ? -5.163  30.177  38.435  1.00 35.47  ? 2   DC  B C4    1 
ATOM   428  N N4    . DC  B 2 1   ? -5.867  29.038  38.483  1.00 31.59  ? 2   DC  B N4    1 
ATOM   429  C C5    . DC  B 2 1   ? -5.409  31.136  37.406  1.00 29.07  ? 2   DC  B C5    1 
ATOM   430  C C6    . DC  B 2 1   ? -4.676  32.255  37.407  1.00 32.35  ? 2   DC  B C6    1 
ATOM   431  P P     . DG  B 2 2   ? 0.332   36.301  37.002  1.00 78.72  ? 3   DG  B P     1 
ATOM   432  O OP1   . DG  B 2 2   ? 0.924   37.464  37.698  1.00 65.32  ? 3   DG  B OP1   1 
ATOM   433  O OP2   . DG  B 2 2   ? 0.234   36.291  35.524  1.00 63.17  ? 3   DG  B OP2   1 
ATOM   434  O "O5'" . DG  B 2 2   ? 1.121   34.989  37.455  1.00 54.65  ? 3   DG  B "O5'" 1 
ATOM   435  C "C5'" . DG  B 2 2   ? 1.282   34.742  38.842  1.00 48.18  ? 3   DG  B "C5'" 1 
ATOM   436  C "C4'" . DG  B 2 2   ? 1.754   33.322  39.095  1.00 53.41  ? 3   DG  B "C4'" 1 
ATOM   437  O "O4'" . DG  B 2 2   ? 0.668   32.383  38.891  1.00 60.19  ? 3   DG  B "O4'" 1 
ATOM   438  C "C3'" . DG  B 2 2   ? 2.893   32.860  38.195  1.00 64.74  ? 3   DG  B "C3'" 1 
ATOM   439  O "O3'" . DG  B 2 2   ? 3.960   32.422  39.028  1.00 75.56  ? 3   DG  B "O3'" 1 
ATOM   440  C "C2'" . DG  B 2 2   ? 2.291   31.742  37.340  1.00 59.56  ? 3   DG  B "C2'" 1 
ATOM   441  C "C1'" . DG  B 2 2   ? 1.129   31.244  38.189  1.00 44.77  ? 3   DG  B "C1'" 1 
ATOM   442  N N9    . DG  B 2 2   ? -0.012  30.681  37.466  1.00 31.28  ? 3   DG  B N9    1 
ATOM   443  C C8    . DG  B 2 2   ? -0.598  31.152  36.315  1.00 34.76  ? 3   DG  B C8    1 
ATOM   444  N N7    . DG  B 2 2   ? -1.619  30.435  35.925  1.00 39.02  ? 3   DG  B N7    1 
ATOM   445  C C5    . DG  B 2 2   ? -1.722  29.431  36.884  1.00 18.07  ? 3   DG  B C5    1 
ATOM   446  C C6    . DG  B 2 2   ? -2.638  28.355  36.993  1.00 28.81  ? 3   DG  B C6    1 
ATOM   447  O O6    . DG  B 2 2   ? -3.579  28.068  36.235  1.00 29.05  ? 3   DG  B O6    1 
ATOM   448  N N1    . DG  B 2 2   ? -2.384  27.568  38.118  1.00 26.00  ? 3   DG  B N1    1 
ATOM   449  C C2    . DG  B 2 2   ? -1.369  27.795  39.021  1.00 29.90  ? 3   DG  B C2    1 
ATOM   450  N N2    . DG  B 2 2   ? -1.264  26.937  40.048  1.00 31.25  ? 3   DG  B N2    1 
ATOM   451  N N3    . DG  B 2 2   ? -0.504  28.797  38.926  1.00 23.71  ? 3   DG  B N3    1 
ATOM   452  C C4    . DG  B 2 2   ? -0.741  29.570  37.838  1.00 21.52  ? 3   DG  B C4    1 
ATOM   453  P P     . DC  B 2 3   ? 5.371   31.993  38.392  1.00 54.50  ? 4   DC  B P     1 
ATOM   454  O OP1   . DC  B 2 3   ? 6.419   32.331  39.381  1.00 55.94  ? 4   DC  B OP1   1 
ATOM   455  O OP2   . DC  B 2 3   ? 5.435   32.524  37.011  1.00 51.01  ? 4   DC  B OP2   1 
ATOM   456  O "O5'" . DC  B 2 3   ? 5.274   30.405  38.313  1.00 50.43  ? 4   DC  B "O5'" 1 
ATOM   457  C "C5'" . DC  B 2 3   ? 5.115   29.703  39.532  1.00 51.96  ? 4   DC  B "C5'" 1 
ATOM   458  C "C4'" . DC  B 2 3   ? 4.585   28.310  39.279  1.00 51.17  ? 4   DC  B "C4'" 1 
ATOM   459  O "O4'" . DC  B 2 3   ? 3.323   28.370  38.578  1.00 54.88  ? 4   DC  B "O4'" 1 
ATOM   460  C "C3'" . DC  B 2 3   ? 5.481   27.445  38.402  1.00 56.60  ? 4   DC  B "C3'" 1 
ATOM   461  O "O3'" . DC  B 2 3   ? 6.210   26.543  39.239  1.00 61.20  ? 4   DC  B "O3'" 1 
ATOM   462  C "C2'" . DC  B 2 3   ? 4.509   26.745  37.449  1.00 58.71  ? 4   DC  B "C2'" 1 
ATOM   463  C "C1'" . DC  B 2 3   ? 3.144   27.085  38.031  1.00 45.56  ? 4   DC  B "C1'" 1 
ATOM   464  N N1    . DC  B 2 3   ? 2.019   27.113  37.043  1.00 27.53  ? 4   DC  B N1    1 
ATOM   465  C C2    . DC  B 2 3   ? 0.988   26.170  37.129  1.00 26.65  ? 4   DC  B C2    1 
ATOM   466  O O2    . DC  B 2 3   ? 1.013   25.315  38.026  1.00 37.66  ? 4   DC  B O2    1 
ATOM   467  N N3    . DC  B 2 3   ? -0.024  26.211  36.227  1.00 24.59  ? 4   DC  B N3    1 
ATOM   468  C C4    . DC  B 2 3   ? -0.029  27.141  35.271  1.00 34.91  ? 4   DC  B C4    1 
ATOM   469  N N4    . DC  B 2 3   ? -1.054  27.135  34.407  1.00 27.87  ? 4   DC  B N4    1 
ATOM   470  C C5    . DC  B 2 3   ? 1.012   28.114  35.165  1.00 21.73  ? 4   DC  B C5    1 
ATOM   471  C C6    . DC  B 2 3   ? 2.005   28.062  36.062  1.00 32.05  ? 4   DC  B C6    1 
ATOM   472  P P     . DG  B 2 4   ? 7.339   25.653  38.669  1.00 57.77  ? 5   DG  B P     1 
ATOM   473  O OP1   . DG  B 2 4   ? 7.992   24.954  39.730  1.00 61.98  ? 5   DG  B OP1   1 
ATOM   474  O OP2   . DG  B 2 4   ? 8.108   26.515  37.814  1.00 45.17  ? 5   DG  B OP2   1 
ATOM   475  O "O5'" . DG  B 2 4   ? 6.495   24.537  37.948  1.00 51.65  ? 5   DG  B "O5'" 1 
ATOM   476  C "C5'" . DG  B 2 4   ? 6.021   23.429  38.703  1.00 39.90  ? 5   DG  B "C5'" 1 
ATOM   477  C "C4'" . DG  B 2 4   ? 5.105   22.556  37.882  1.00 54.88  ? 5   DG  B "C4'" 1 
ATOM   478  O "O4'" . DG  B 2 4   ? 4.169   23.387  37.192  1.00 48.81  ? 5   DG  B "O4'" 1 
ATOM   479  C "C3'" . DG  B 2 4   ? 5.772   21.721  36.790  1.00 48.11  ? 5   DG  B "C3'" 1 
ATOM   480  O "O3'" . DG  B 2 4   ? 5.796   20.328  37.045  1.00 46.42  ? 5   DG  B "O3'" 1 
ATOM   481  C "C2'" . DG  B 2 4   ? 4.850   21.877  35.602  1.00 54.95  ? 5   DG  B "C2'" 1 
ATOM   482  C "C1'" . DG  B 2 4   ? 3.657   22.593  36.174  1.00 45.34  ? 5   DG  B "C1'" 1 
ATOM   483  N N9    . DG  B 2 4   ? 2.988   23.450  35.219  1.00 38.95  ? 5   DG  B N9    1 
ATOM   484  C C8    . DG  B 2 4   ? 3.434   24.611  34.648  1.00 38.19  ? 5   DG  B C8    1 
ATOM   485  N N7    . DG  B 2 4   ? 2.585   25.122  33.807  1.00 31.26  ? 5   DG  B N7    1 
ATOM   486  C C5    . DG  B 2 4   ? 1.527   24.232  33.813  1.00 26.46  ? 5   DG  B C5    1 
ATOM   487  C C6    . DG  B 2 4   ? 0.322   24.249  33.097  1.00 30.86  ? 5   DG  B C6    1 
ATOM   488  O O6    . DG  B 2 4   ? -0.071  25.077  32.282  1.00 31.61  ? 5   DG  B O6    1 
ATOM   489  N N1    . DG  B 2 4   ? -0.461  23.149  33.396  1.00 21.21  ? 5   DG  B N1    1 
ATOM   490  C C2    . DG  B 2 4   ? -0.127  22.165  34.280  1.00 31.62  ? 5   DG  B C2    1 
ATOM   491  N N2    . DG  B 2 4   ? -1.004  21.176  34.419  1.00 24.01  ? 5   DG  B N2    1 
ATOM   492  N N3    . DG  B 2 4   ? 0.989   22.144  34.966  1.00 28.46  ? 5   DG  B N3    1 
ATOM   493  C C4    . DG  B 2 4   ? 1.769   23.194  34.675  1.00 25.46  ? 5   DG  B C4    1 
ATOM   494  P P     . DT  B 2 5   ? 6.482   19.401  36.044  1.00 54.34  ? 6   DT  B P     1 
ATOM   495  O OP1   . DT  B 2 5   ? 7.157   18.300  36.769  1.00 50.67  ? 6   DT  B OP1   1 
ATOM   496  O OP2   . DT  B 2 5   ? 7.213   20.162  35.005  1.00 46.30  ? 6   DT  B OP2   1 
ATOM   497  O "O5'" . DT  B 2 5   ? 5.154   18.811  35.380  1.00 38.47  ? 6   DT  B "O5'" 1 
ATOM   498  C "C5'" . DT  B 2 5   ? 4.235   18.102  36.200  1.00 35.39  ? 6   DT  B "C5'" 1 
ATOM   499  C "C4'" . DT  B 2 5   ? 2.964   17.757  35.446  1.00 35.01  ? 6   DT  B "C4'" 1 
ATOM   500  O "O4'" . DT  B 2 5   ? 2.460   18.925  34.755  1.00 42.78  ? 6   DT  B "O4'" 1 
ATOM   501  C "C3'" . DT  B 2 5   ? 3.120   16.675  34.384  1.00 38.92  ? 6   DT  B "C3'" 1 
ATOM   502  O "O3'" . DT  B 2 5   ? 2.340   15.546  34.782  1.00 40.16  ? 6   DT  B "O3'" 1 
ATOM   503  C "C2'" . DT  B 2 5   ? 2.635   17.320  33.084  1.00 34.77  ? 6   DT  B "C2'" 1 
ATOM   504  C "C1'" . DT  B 2 5   ? 1.826   18.513  33.563  1.00 36.69  ? 6   DT  B "C1'" 1 
ATOM   505  N N1    . DT  B 2 5   ? 1.797   19.680  32.636  1.00 27.44  ? 6   DT  B N1    1 
ATOM   506  C C2    . DT  B 2 5   ? 0.718   19.874  31.801  1.00 31.59  ? 6   DT  B C2    1 
ATOM   507  O O2    . DT  B 2 5   ? -0.248  19.128  31.752  1.00 35.72  ? 6   DT  B O2    1 
ATOM   508  N N3    . DT  B 2 5   ? 0.817   20.996  31.012  1.00 28.97  ? 6   DT  B N3    1 
ATOM   509  C C4    . DT  B 2 5   ? 1.855   21.918  30.978  1.00 30.45  ? 6   DT  B C4    1 
ATOM   510  O O4    . DT  B 2 5   ? 1.848   22.893  30.230  1.00 36.46  ? 6   DT  B O4    1 
ATOM   511  C C5    . DT  B 2 5   ? 2.942   21.648  31.884  1.00 24.03  ? 6   DT  B C5    1 
ATOM   512  C C7    . DT  B 2 5   ? 4.138   22.554  31.956  1.00 36.37  ? 6   DT  B C7    1 
ATOM   513  C C6    . DT  B 2 5   ? 2.860   20.559  32.657  1.00 22.15  ? 6   DT  B C6    1 
ATOM   514  P P     . DA  B 2 6   ? 2.566   14.111  34.094  1.00 49.44  ? 7   DA  B P     1 
ATOM   515  O OP1   . DA  B 2 6   ? 1.794   13.113  34.867  1.00 45.04  ? 7   DA  B OP1   1 
ATOM   516  O OP2   . DA  B 2 6   ? 4.022   13.915  33.898  1.00 66.63  ? 7   DA  B OP2   1 
ATOM   517  O "O5'" . DA  B 2 6   ? 1.833   14.254  32.688  1.00 42.84  ? 7   DA  B "O5'" 1 
ATOM   518  C "C5'" . DA  B 2 6   ? 0.427   14.397  32.711  1.00 40.18  ? 7   DA  B "C5'" 1 
ATOM   519  C "C4'" . DA  B 2 6   ? -0.145  14.791  31.361  1.00 36.37  ? 7   DA  B "C4'" 1 
ATOM   520  O "O4'" . DA  B 2 6   ? 0.213   16.154  31.007  1.00 44.87  ? 7   DA  B "O4'" 1 
ATOM   521  C "C3'" . DA  B 2 6   ? 0.302   13.934  30.184  1.00 49.68  ? 7   DA  B "C3'" 1 
ATOM   522  O "O3'" . DA  B 2 6   ? -0.870  13.422  29.584  1.00 51.97  ? 7   DA  B "O3'" 1 
ATOM   523  C "C2'" . DA  B 2 6   ? 1.024   14.908  29.258  1.00 45.64  ? 7   DA  B "C2'" 1 
ATOM   524  C "C1'" . DA  B 2 6   ? 0.321   16.212  29.599  1.00 33.41  ? 7   DA  B "C1'" 1 
ATOM   525  N N9    . DA  B 2 6   ? 1.017   17.434  29.202  1.00 24.61  ? 7   DA  B N9    1 
ATOM   526  C C8    . DA  B 2 6   ? 2.252   17.859  29.605  1.00 37.08  ? 7   DA  B C8    1 
ATOM   527  N N7    . DA  B 2 6   ? 2.617   19.008  29.084  1.00 35.18  ? 7   DA  B N7    1 
ATOM   528  C C5    . DA  B 2 6   ? 1.545   19.364  28.285  1.00 26.40  ? 7   DA  B C5    1 
ATOM   529  C C6    . DA  B 2 6   ? 1.308   20.478  27.463  1.00 29.23  ? 7   DA  B C6    1 
ATOM   530  N N6    . DA  B 2 6   ? 2.189   21.471  27.311  1.00 31.81  ? 7   DA  B N6    1 
ATOM   531  N N1    . DA  B 2 6   ? 0.136   20.527  26.799  1.00 29.78  ? 7   DA  B N1    1 
ATOM   532  C C2    . DA  B 2 6   ? -0.733  19.523  26.958  1.00 31.74  ? 7   DA  B C2    1 
ATOM   533  N N3    . DA  B 2 6   ? -0.622  18.425  27.704  1.00 37.83  ? 7   DA  B N3    1 
ATOM   534  C C4    . DA  B 2 6   ? 0.553   18.407  28.348  1.00 26.55  ? 7   DA  B C4    1 
ATOM   535  P P     . DA  B 2 7   ? -0.880  11.971  28.900  1.00 56.49  ? 8   DA  B P     1 
ATOM   536  O OP1   . DA  B 2 7   ? -1.660  11.067  29.776  1.00 45.20  ? 8   DA  B OP1   1 
ATOM   537  O OP2   . DA  B 2 7   ? 0.507   11.620  28.514  1.00 74.96  ? 8   DA  B OP2   1 
ATOM   538  O "O5'" . DA  B 2 7   ? -1.728  12.206  27.575  1.00 52.81  ? 8   DA  B "O5'" 1 
ATOM   539  C "C5'" . DA  B 2 7   ? -3.057  12.654  27.733  1.00 43.62  ? 8   DA  B "C5'" 1 
ATOM   540  C "C4'" . DA  B 2 7   ? -3.395  13.732  26.726  1.00 31.54  ? 8   DA  B "C4'" 1 
ATOM   541  O "O4'" . DA  B 2 7   ? -2.411  14.801  26.741  1.00 46.15  ? 8   DA  B "O4'" 1 
ATOM   542  C "C3'" . DA  B 2 7   ? -3.450  13.228  25.294  1.00 49.11  ? 8   DA  B "C3'" 1 
ATOM   543  O "O3'" . DA  B 2 7   ? -4.738  13.554  24.812  1.00 47.22  ? 8   DA  B "O3'" 1 
ATOM   544  C "C2'" . DA  B 2 7   ? -2.310  13.969  24.595  1.00 59.43  ? 8   DA  B "C2'" 1 
ATOM   545  C "C1'" . DA  B 2 7   ? -2.223  15.248  25.412  1.00 45.42  ? 8   DA  B "C1'" 1 
ATOM   546  N N9    . DA  B 2 7   ? -0.962  15.986  25.317  1.00 39.32  ? 8   DA  B N9    1 
ATOM   547  C C8    . DA  B 2 7   ? 0.240   15.667  25.885  1.00 43.73  ? 8   DA  B C8    1 
ATOM   548  N N7    . DA  B 2 7   ? 1.200   16.528  25.633  1.00 36.69  ? 8   DA  B N7    1 
ATOM   549  C C5    . DA  B 2 7   ? 0.585   17.482  24.845  1.00 27.25  ? 8   DA  B C5    1 
ATOM   550  C C6    . DA  B 2 7   ? 1.060   18.663  24.250  1.00 30.47  ? 8   DA  B C6    1 
ATOM   551  N N6    . DA  B 2 7   ? 2.322   19.085  24.376  1.00 24.31  ? 8   DA  B N6    1 
ATOM   552  N N1    . DA  B 2 7   ? 0.186   19.388  23.526  1.00 29.99  ? 8   DA  B N1    1 
ATOM   553  C C2    . DA  B 2 7   ? -1.076  18.955  23.419  1.00 38.89  ? 8   DA  B C2    1 
ATOM   554  N N3    . DA  B 2 7   ? -1.638  17.862  23.933  1.00 44.20  ? 8   DA  B N3    1 
ATOM   555  C C4    . DA  B 2 7   ? -0.743  17.164  24.643  1.00 31.02  ? 8   DA  B C4    1 
ATOM   556  P P     . DA  B 2 8   ? -5.319  12.858  23.489  1.00 65.03  ? 9   DA  B P     1 
ATOM   557  O OP1   . DA  B 2 8   ? -6.559  12.143  23.872  1.00 68.02  ? 9   DA  B OP1   1 
ATOM   558  O OP2   . DA  B 2 8   ? -4.219  12.108  22.841  1.00 51.74  ? 9   DA  B OP2   1 
ATOM   559  O "O5'" . DA  B 2 8   ? -5.680  14.107  22.561  1.00 49.24  ? 9   DA  B "O5'" 1 
ATOM   560  C "C5'" . DA  B 2 8   ? -4.712  15.140  22.471  1.00 38.20  ? 9   DA  B "C5'" 1 
ATOM   561  C "C4'" . DA  B 2 8   ? -5.081  16.206  21.469  1.00 40.03  ? 9   DA  B "C4'" 1 
ATOM   562  O "O4'" . DA  B 2 8   ? -3.994  17.165  21.419  1.00 56.15  ? 9   DA  B "O4'" 1 
ATOM   563  C "C3'" . DA  B 2 8   ? -5.229  15.726  20.037  1.00 48.31  ? 9   DA  B "C3'" 1 
ATOM   564  O "O3'" . DA  B 2 8   ? -6.069  16.639  19.324  1.00 51.53  ? 9   DA  B "O3'" 1 
ATOM   565  C "C2'" . DA  B 2 8   ? -3.773  15.705  19.570  1.00 51.77  ? 9   DA  B "C2'" 1 
ATOM   566  C "C1'" . DA  B 2 8   ? -3.141  16.874  20.321  1.00 59.48  ? 9   DA  B "C1'" 1 
ATOM   567  N N9    . DA  B 2 8   ? -1.782  16.627  20.816  1.00 49.01  ? 9   DA  B N9    1 
ATOM   568  C C8    . DA  B 2 8   ? -1.307  15.564  21.536  1.00 38.68  ? 9   DA  B C8    1 
ATOM   569  N N7    . DA  B 2 8   ? -0.028  15.648  21.829  1.00 33.09  ? 9   DA  B N7    1 
ATOM   570  C C5    . DA  B 2 8   ? 0.366   16.849  21.265  1.00 24.51  ? 9   DA  B C5    1 
ATOM   571  C C6    . DA  B 2 8   ? 1.600   17.525  21.219  1.00 32.81  ? 9   DA  B C6    1 
ATOM   572  N N6    . DA  B 2 8   ? 2.723   17.064  21.778  1.00 33.98  ? 9   DA  B N6    1 
ATOM   573  N N1    . DA  B 2 8   ? 1.634   18.705  20.575  1.00 24.61  ? 9   DA  B N1    1 
ATOM   574  C C2    . DA  B 2 8   ? 0.512   19.167  20.017  1.00 35.31  ? 9   DA  B C2    1 
ATOM   575  N N3    . DA  B 2 8   ? -0.700  18.625  19.995  1.00 38.00  ? 9   DA  B N3    1 
ATOM   576  C C4    . DA  B 2 8   ? -0.702  17.456  20.640  1.00 21.41  ? 9   DA  B C4    1 
ATOM   577  P P     . DC  B 2 9   ? -6.489  16.353  17.799  1.00 59.38  ? 10  DC  B P     1 
ATOM   578  O OP1   . DC  B 2 9   ? -7.699  17.153  17.509  1.00 73.18  ? 10  DC  B OP1   1 
ATOM   579  O OP2   . DC  B 2 9   ? -6.513  14.886  17.590  1.00 67.49  ? 10  DC  B OP2   1 
ATOM   580  O "O5'" . DC  B 2 9   ? -5.293  16.991  16.957  1.00 57.14  ? 10  DC  B "O5'" 1 
ATOM   581  C "C5'" . DC  B 2 9   ? -5.171  18.401  17.006  1.00 48.03  ? 10  DC  B "C5'" 1 
ATOM   582  C "C4'" . DC  B 2 9   ? -3.831  18.884  16.488  1.00 56.79  ? 10  DC  B "C4'" 1 
ATOM   583  O "O4'" . DC  B 2 9   ? -2.757  18.303  17.260  1.00 57.56  ? 10  DC  B "O4'" 1 
ATOM   584  C "C3'" . DC  B 2 9   ? -3.505  18.530  15.042  1.00 45.87  ? 10  DC  B "C3'" 1 
ATOM   585  O "O3'" . DC  B 2 9   ? -3.779  19.658  14.219  1.00 49.55  ? 10  DC  B "O3'" 1 
ATOM   586  C "C2'" . DC  B 2 9   ? -2.018  18.169  15.070  1.00 53.75  ? 10  DC  B "C2'" 1 
ATOM   587  C "C1'" . DC  B 2 9   ? -1.588  18.488  16.496  1.00 50.00  ? 10  DC  B "C1'" 1 
ATOM   588  N N1    . DC  B 2 9   ? -0.511  17.611  17.041  1.00 39.15  ? 10  DC  B N1    1 
ATOM   589  C C2    . DC  B 2 9   ? 0.824   18.046  17.078  1.00 42.39  ? 10  DC  B C2    1 
ATOM   590  O O2    . DC  B 2 9   ? 1.117   19.174  16.654  1.00 50.50  ? 10  DC  B O2    1 
ATOM   591  N N3    . DC  B 2 9   ? 1.768   17.216  17.588  1.00 28.48  ? 10  DC  B N3    1 
ATOM   592  C C4    . DC  B 2 9   ? 1.421   16.011  18.038  1.00 38.29  ? 10  DC  B C4    1 
ATOM   593  N N4    . DC  B 2 9   ? 2.384   15.228  18.532  1.00 39.08  ? 10  DC  B N4    1 
ATOM   594  C C5    . DC  B 2 9   ? 0.071   15.552  18.007  1.00 32.54  ? 10  DC  B C5    1 
ATOM   595  C C6    . DC  B 2 9   ? -0.852  16.377  17.505  1.00 38.99  ? 10  DC  B C6    1 
ATOM   596  P P     . DA  B 2 10  ? -3.568  19.578  12.629  1.00 60.23  ? 11  DA  B P     1 
ATOM   597  O OP1   . DA  B 2 10  ? -4.395  20.641  12.012  1.00 75.42  ? 11  DA  B OP1   1 
ATOM   598  O OP2   . DA  B 2 10  ? -3.758  18.163  12.230  1.00 54.35  ? 11  DA  B OP2   1 
ATOM   599  O "O5'" . DA  B 2 10  ? -2.030  19.966  12.422  1.00 42.20  ? 11  DA  B "O5'" 1 
ATOM   600  C "C5'" . DA  B 2 10  ? -1.569  21.203  12.940  1.00 44.53  ? 11  DA  B "C5'" 1 
ATOM   601  C "C4'" . DA  B 2 10  ? -0.125  21.482  12.556  1.00 55.83  ? 11  DA  B "C4'" 1 
ATOM   602  O "O4'" . DA  B 2 10  ? 0.778   20.629  13.309  1.00 52.87  ? 11  DA  B "O4'" 1 
ATOM   603  C "C3'" . DA  B 2 10  ? 0.217   21.246  11.093  1.00 54.20  ? 11  DA  B "C3'" 1 
ATOM   604  O "O3'" . DA  B 2 10  ? 1.109   22.254  10.650  1.00 38.84  ? 11  DA  B "O3'" 1 
ATOM   605  C "C2'" . DA  B 2 10  ? 0.865   19.866  11.083  1.00 51.89  ? 11  DA  B "C2'" 1 
ATOM   606  C "C1'" . DA  B 2 10  ? 1.542   19.805  12.446  1.00 49.04  ? 11  DA  B "C1'" 1 
ATOM   607  N N9    . DA  B 2 10  ? 1.583   18.478  13.051  1.00 44.38  ? 11  DA  B N9    1 
ATOM   608  C C8    . DA  B 2 10  ? 0.552   17.587  13.152  1.00 60.89  ? 11  DA  B C8    1 
ATOM   609  N N7    . DA  B 2 10  ? 0.864   16.465  13.757  1.00 32.91  ? 11  DA  B N7    1 
ATOM   610  C C5    . DA  B 2 10  ? 2.194   16.638  14.078  1.00 30.04  ? 11  DA  B C5    1 
ATOM   611  C C6    . DA  B 2 10  ? 3.103   15.800  14.734  1.00 35.84  ? 11  DA  B C6    1 
ATOM   612  N N6    . DA  B 2 10  ? 2.765   14.588  15.187  1.00 36.48  ? 11  DA  B N6    1 
ATOM   613  N N1    . DA  B 2 10  ? 4.356   16.268  14.899  1.00 46.82  ? 11  DA  B N1    1 
ATOM   614  C C2    . DA  B 2 10  ? 4.662   17.489  14.434  1.00 47.47  ? 11  DA  B C2    1 
ATOM   615  N N3    . DA  B 2 10  ? 3.890   18.370  13.801  1.00 22.51  ? 11  DA  B N3    1 
ATOM   616  C C4    . DA  B 2 10  ? 2.655   17.872  13.655  1.00 35.96  ? 11  DA  B C4    1 
ATOM   617  P P     . DC  B 2 11  ? 1.519   22.339  9.101   1.00 49.43  ? 12  DC  B P     1 
ATOM   618  O OP1   . DC  B 2 11  ? 1.670   23.770  8.753   1.00 46.65  ? 12  DC  B OP1   1 
ATOM   619  O OP2   . DC  B 2 11  ? 0.582   21.478  8.341   1.00 58.67  ? 12  DC  B OP2   1 
ATOM   620  O "O5'" . DC  B 2 11  ? 2.965   21.664  9.051   1.00 64.80  ? 12  DC  B "O5'" 1 
ATOM   621  C "C5'" . DC  B 2 11  ? 4.081   22.379  9.559   1.00 60.48  ? 12  DC  B "C5'" 1 
ATOM   622  C "C4'" . DC  B 2 11  ? 5.330   21.522  9.510   1.00 48.55  ? 12  DC  B "C4'" 1 
ATOM   623  O "O4'" . DC  B 2 11  ? 5.118   20.327  10.295  1.00 45.86  ? 12  DC  B "O4'" 1 
ATOM   624  C "C3'" . DC  B 2 11  ? 5.723   21.043  8.117   1.00 35.30  ? 12  DC  B "C3'" 1 
ATOM   625  O "O3'" . DC  B 2 11  ? 6.972   21.626  7.755   1.00 35.23  ? 12  DC  B "O3'" 1 
ATOM   626  C "C2'" . DC  B 2 11  ? 5.791   19.520  8.225   1.00 36.83  ? 12  DC  B "C2'" 1 
ATOM   627  C "C1'" . DC  B 2 11  ? 5.876   19.285  9.725   1.00 44.56  ? 12  DC  B "C1'" 1 
ATOM   628  N N1    . DC  B 2 11  ? 5.303   17.997  10.210  1.00 42.08  ? 12  DC  B N1    1 
ATOM   629  C C2    . DC  B 2 11  ? 6.064   17.139  11.018  1.00 35.74  ? 12  DC  B C2    1 
ATOM   630  O O2    . DC  B 2 11  ? 7.222   17.455  11.316  1.00 39.79  ? 12  DC  B O2    1 
ATOM   631  N N3    . DC  B 2 11  ? 5.514   15.979  11.451  1.00 26.49  ? 12  DC  B N3    1 
ATOM   632  C C4    . DC  B 2 11  ? 4.264   15.671  11.110  1.00 40.71  ? 12  DC  B C4    1 
ATOM   633  N N4    . DC  B 2 11  ? 3.763   14.518  11.566  1.00 38.76  ? 12  DC  B N4    1 
ATOM   634  C C5    . DC  B 2 11  ? 3.471   16.532  10.292  1.00 33.00  ? 12  DC  B C5    1 
ATOM   635  C C6    . DC  B 2 11  ? 4.024   17.673  9.873   1.00 34.70  ? 12  DC  B C6    1 
ATOM   636  P P     . DT  B 2 12  ? 7.512   21.523  6.245   1.00 53.08  ? 13  DT  B P     1 
ATOM   637  O OP1   . DT  B 2 12  ? 8.565   22.549  6.078   1.00 35.58  ? 13  DT  B OP1   1 
ATOM   638  O OP2   . DT  B 2 12  ? 6.343   21.510  5.337   1.00 62.62  ? 13  DT  B OP2   1 
ATOM   639  O "O5'" . DT  B 2 12  ? 8.202   20.084  6.186   1.00 50.71  ? 13  DT  B "O5'" 1 
ATOM   640  C "C5'" . DT  B 2 12  ? 9.304   19.823  7.039   1.00 36.61  ? 13  DT  B "C5'" 1 
ATOM   641  C "C4'" . DT  B 2 12  ? 9.650   18.347  7.062   1.00 36.86  ? 13  DT  B "C4'" 1 
ATOM   642  O "O4'" . DT  B 2 12  ? 8.578   17.581  7.677   1.00 29.81  ? 13  DT  B "O4'" 1 
ATOM   643  C "C3'" . DT  B 2 12  ? 9.882   17.703  5.698   1.00 35.72  ? 13  DT  B "C3'" 1 
ATOM   644  O "O3'" . DT  B 2 12  ? 11.085  16.958  5.737   1.00 37.07  ? 13  DT  B "O3'" 1 
ATOM   645  C "C2'" . DT  B 2 12  ? 8.680   16.782  5.537   1.00 23.32  ? 13  DT  B "C2'" 1 
ATOM   646  C "C1'" . DT  B 2 12  ? 8.489   16.356  6.984   1.00 33.58  ? 13  DT  B "C1'" 1 
ATOM   647  N N1    . DT  B 2 12  ? 7.200   15.679  7.311   1.00 31.90  ? 13  DT  B N1    1 
ATOM   648  C C2    . DT  B 2 12  ? 7.179   14.698  8.276   1.00 43.75  ? 13  DT  B C2    1 
ATOM   649  O O2    . DT  B 2 12  ? 8.166   14.336  8.895   1.00 52.87  ? 13  DT  B O2    1 
ATOM   650  N N3    . DT  B 2 12  ? 5.940   14.147  8.496   1.00 33.02  ? 13  DT  B N3    1 
ATOM   651  C C4    . DT  B 2 12  ? 4.753   14.469  7.868   1.00 29.94  ? 13  DT  B C4    1 
ATOM   652  O O4    . DT  B 2 12  ? 3.699   13.906  8.148   1.00 41.63  ? 13  DT  B O4    1 
ATOM   653  C C5    . DT  B 2 12  ? 4.852   15.505  6.873   1.00 34.23  ? 13  DT  B C5    1 
ATOM   654  C C7    . DT  B 2 12  ? 3.647   15.959  6.106   1.00 35.30  ? 13  DT  B C7    1 
ATOM   655  C C6    . DT  B 2 12  ? 6.052   16.051  6.646   1.00 35.96  ? 13  DT  B C6    1 
ATOM   656  P P     . DA  B 2 13  ? 12.328  17.348  4.798   1.00 42.83  ? 14  DA  B P     1 
ATOM   657  O OP1   . DA  B 2 13  ? 12.669  18.772  5.020   1.00 26.39  ? 14  DA  B OP1   1 
ATOM   658  O OP2   . DA  B 2 13  ? 12.032  16.843  3.437   1.00 61.11  ? 14  DA  B OP2   1 
ATOM   659  O "O5'" . DA  B 2 13  ? 13.518  16.480  5.402   1.00 55.02  ? 14  DA  B "O5'" 1 
ATOM   660  C "C5'" . DA  B 2 13  ? 13.948  16.782  6.717   1.00 35.58  ? 14  DA  B "C5'" 1 
ATOM   661  C "C4'" . DA  B 2 13  ? 14.147  15.527  7.544   1.00 27.13  ? 14  DA  B "C4'" 1 
ATOM   662  O "O4'" . DA  B 2 13  ? 12.884  14.836  7.733   1.00 23.94  ? 14  DA  B "O4'" 1 
ATOM   663  C "C3'" . DA  B 2 13  ? 15.089  14.494  6.948   1.00 34.65  ? 14  DA  B "C3'" 1 
ATOM   664  O "O3'" . DA  B 2 13  ? 15.851  13.948  8.024   1.00 30.51  ? 14  DA  B "O3'" 1 
ATOM   665  C "C2'" . DA  B 2 13  ? 14.151  13.490  6.280   1.00 27.83  ? 14  DA  B "C2'" 1 
ATOM   666  C "C1'" . DA  B 2 13  ? 12.926  13.529  7.179   1.00 32.09  ? 14  DA  B "C1'" 1 
ATOM   667  N N9    . DA  B 2 13  ? 11.636  13.297  6.531   1.00 38.11  ? 14  DA  B N9    1 
ATOM   668  C C8    . DA  B 2 13  ? 11.111  13.913  5.428   1.00 37.43  ? 14  DA  B C8    1 
ATOM   669  N N7    . DA  B 2 13  ? 9.908   13.491  5.108   1.00 45.15  ? 14  DA  B N7    1 
ATOM   670  C C5    . DA  B 2 13  ? 9.620   12.541  6.071   1.00 31.11  ? 14  DA  B C5    1 
ATOM   671  C C6    . DA  B 2 13  ? 8.499   11.723  6.298   1.00 39.85  ? 14  DA  B C6    1 
ATOM   672  N N6    . DA  B 2 13  ? 7.408   11.741  5.526   1.00 41.46  ? 14  DA  B N6    1 
ATOM   673  N N1    . DA  B 2 13  ? 8.547   10.887  7.353   1.00 24.87  ? 14  DA  B N1    1 
ATOM   674  C C2    . DA  B 2 13  ? 9.644   10.877  8.120   1.00 21.61  ? 14  DA  B C2    1 
ATOM   675  N N3    . DA  B 2 13  ? 10.756  11.599  8.006   1.00 20.31  ? 14  DA  B N3    1 
ATOM   676  C C4    . DA  B 2 13  ? 10.674  12.416  6.952   1.00 22.77  ? 14  DA  B C4    1 
ATOM   677  P P     . DA  B 2 14  ? 17.162  13.064  7.742   1.00 30.80  ? 15  DA  B P     1 
ATOM   678  O OP1   . DA  B 2 14  ? 17.956  13.063  8.991   1.00 37.58  ? 15  DA  B OP1   1 
ATOM   679  O OP2   . DA  B 2 14  ? 17.792  13.517  6.481   1.00 35.46  ? 15  DA  B OP2   1 
ATOM   680  O "O5'" . DA  B 2 14  ? 16.583  11.595  7.535   1.00 21.52  ? 15  DA  B "O5'" 1 
ATOM   681  C "C5'" . DA  B 2 14  ? 16.024  10.954  8.662   1.00 21.48  ? 15  DA  B "C5'" 1 
ATOM   682  C "C4'" . DA  B 2 14  ? 15.198  9.737   8.290   1.00 29.46  ? 15  DA  B "C4'" 1 
ATOM   683  O "O4'" . DA  B 2 14  ? 14.043  10.132  7.519   1.00 31.87  ? 15  DA  B "O4'" 1 
ATOM   684  C "C3'" . DA  B 2 14  ? 15.909  8.680   7.452   1.00 38.39  ? 15  DA  B "C3'" 1 
ATOM   685  O "O3'" . DA  B 2 14  ? 16.196  7.594   8.336   1.00 35.68  ? 15  DA  B "O3'" 1 
ATOM   686  C "C2'" . DA  B 2 14  ? 14.925  8.345   6.323   1.00 29.86  ? 15  DA  B "C2'" 1 
ATOM   687  C "C1'" . DA  B 2 14  ? 13.628  9.007   6.776   1.00 38.63  ? 15  DA  B "C1'" 1 
ATOM   688  N N9    . DA  B 2 14  ? 12.719  9.492   5.740   1.00 32.58  ? 15  DA  B N9    1 
ATOM   689  C C8    . DA  B 2 14  ? 12.965  10.430  4.777   1.00 28.13  ? 15  DA  B C8    1 
ATOM   690  N N7    . DA  B 2 14  ? 11.938  10.673  3.998   1.00 32.77  ? 15  DA  B N7    1 
ATOM   691  C C5    . DA  B 2 14  ? 10.948  9.843   4.494   1.00 28.29  ? 15  DA  B C5    1 
ATOM   692  C C6    . DA  B 2 14  ? 9.615   9.623   4.109   1.00 30.81  ? 15  DA  B C6    1 
ATOM   693  N N6    . DA  B 2 14  ? 9.028   10.257  3.091   1.00 36.24  ? 15  DA  B N6    1 
ATOM   694  N N1    . DA  B 2 14  ? 8.907   8.724   4.819   1.00 29.79  ? 15  DA  B N1    1 
ATOM   695  C C2    . DA  B 2 14  ? 9.495   8.092   5.842   1.00 28.27  ? 15  DA  B C2    1 
ATOM   696  N N3    . DA  B 2 14  ? 10.739  8.213   6.296   1.00 24.28  ? 15  DA  B N3    1 
ATOM   697  C C4    . DA  B 2 14  ? 11.413  9.113   5.568   1.00 19.07  ? 15  DA  B C4    1 
ATOM   698  P P     . DC  B 2 15  ? 16.924  6.263   7.809   1.00 36.54  ? 16  DC  B P     1 
ATOM   699  O OP1   . DC  B 2 15  ? 17.564  5.615   8.978   1.00 39.59  ? 16  DC  B OP1   1 
ATOM   700  O OP2   . DC  B 2 15  ? 17.744  6.623   6.627   1.00 40.18  ? 16  DC  B OP2   1 
ATOM   701  O "O5'" . DC  B 2 15  ? 15.713  5.332   7.346   1.00 25.12  ? 16  DC  B "O5'" 1 
ATOM   702  C "C5'" . DC  B 2 15  ? 14.748  4.972   8.311   1.00 21.26  ? 16  DC  B "C5'" 1 
ATOM   703  C "C4'" . DC  B 2 15  ? 13.459  4.476   7.680   1.00 37.02  ? 16  DC  B "C4'" 1 
ATOM   704  O "O4'" . DC  B 2 15  ? 12.956  5.425   6.712   1.00 37.61  ? 16  DC  B "O4'" 1 
ATOM   705  C "C3'" . DC  B 2 15  ? 13.562  3.154   6.931   1.00 31.02  ? 16  DC  B "C3'" 1 
ATOM   706  O "O3'" . DC  B 2 15  ? 12.876  2.171   7.700   1.00 36.63  ? 16  DC  B "O3'" 1 
ATOM   707  C "C2'" . DC  B 2 15  ? 12.900  3.417   5.577   1.00 45.65  ? 16  DC  B "C2'" 1 
ATOM   708  C "C1'" . DC  B 2 15  ? 12.125  4.699   5.834   1.00 37.02  ? 16  DC  B "C1'" 1 
ATOM   709  N N1    . DC  B 2 15  ? 11.853  5.568   4.649   1.00 32.11  ? 16  DC  B N1    1 
ATOM   710  C C2    . DC  B 2 15  ? 10.588  5.585   4.040   1.00 34.09  ? 16  DC  B C2    1 
ATOM   711  O O2    . DC  B 2 15  ? 9.683   4.857   4.476   1.00 31.61  ? 16  DC  B O2    1 
ATOM   712  N N3    . DC  B 2 15  ? 10.390  6.404   2.977   1.00 33.73  ? 16  DC  B N3    1 
ATOM   713  C C4    . DC  B 2 15  ? 11.381  7.176   2.530   1.00 28.98  ? 16  DC  B C4    1 
ATOM   714  N N4    . DC  B 2 15  ? 11.125  7.968   1.483   1.00 27.13  ? 16  DC  B N4    1 
ATOM   715  C C5    . DC  B 2 15  ? 12.668  7.175   3.138   1.00 23.90  ? 16  DC  B C5    1 
ATOM   716  C C6    . DC  B 2 15  ? 12.856  6.366   4.186   1.00 34.09  ? 16  DC  B C6    1 
ATOM   717  P P     . DG  B 2 16  ? 13.149  0.607   7.458   1.00 38.77  ? 17  DG  B P     1 
ATOM   718  O OP1   . DG  B 2 16  ? 12.604  -0.122  8.626   1.00 46.74  ? 17  DG  B OP1   1 
ATOM   719  O OP2   . DG  B 2 16  ? 14.570  0.443   7.069   1.00 42.90  ? 17  DG  B OP2   1 
ATOM   720  O "O5'" . DG  B 2 16  ? 12.231  0.248   6.203   1.00 51.06  ? 17  DG  B "O5'" 1 
ATOM   721  C "C5'" . DG  B 2 16  ? 10.826  0.123   6.381   1.00 38.20  ? 17  DG  B "C5'" 1 
ATOM   722  C "C4'" . DG  B 2 16  ? 10.132  -0.009  5.039   1.00 44.52  ? 17  DG  B "C4'" 1 
ATOM   723  O "O4'" . DG  B 2 16  ? 10.289  1.207   4.257   1.00 45.31  ? 17  DG  B "O4'" 1 
ATOM   724  C "C3'" . DG  B 2 16  ? 10.681  -1.131  4.167   1.00 51.05  ? 17  DG  B "C3'" 1 
ATOM   725  O "O3'" . DG  B 2 16  ? 9.607   -1.824  3.567   1.00 70.19  ? 17  DG  B "O3'" 1 
ATOM   726  C "C2'" . DG  B 2 16  ? 11.506  -0.396  3.121   1.00 31.67  ? 17  DG  B "C2'" 1 
ATOM   727  C "C1'" . DG  B 2 16  ? 10.652  0.846   2.940   1.00 31.03  ? 17  DG  B "C1'" 1 
ATOM   728  N N9    . DG  B 2 16  ? 11.327  1.948   2.268   1.00 28.59  ? 17  DG  B N9    1 
ATOM   729  C C8    . DG  B 2 16  ? 12.638  2.340   2.397   1.00 34.27  ? 17  DG  B C8    1 
ATOM   730  N N7    . DG  B 2 16  ? 12.943  3.368   1.652   1.00 37.48  ? 17  DG  B N7    1 
ATOM   731  C C5    . DG  B 2 16  ? 11.757  3.669   0.990   1.00 28.61  ? 17  DG  B C5    1 
ATOM   732  C C6    . DG  B 2 16  ? 11.469  4.684   0.052   1.00 26.31  ? 17  DG  B C6    1 
ATOM   733  O O6    . DG  B 2 16  ? 12.239  5.549   -0.392  1.00 31.34  ? 17  DG  B O6    1 
ATOM   734  N N1    . DG  B 2 16  ? 10.141  4.636   -0.371  1.00 30.21  ? 17  DG  B N1    1 
ATOM   735  C C2    . DG  B 2 16  ? 9.202   3.721   0.060   1.00 42.44  ? 17  DG  B C2    1 
ATOM   736  N N2    . DG  B 2 16  ? 7.962   3.813   -0.450  1.00 35.81  ? 17  DG  B N2    1 
ATOM   737  N N3    . DG  B 2 16  ? 9.463   2.765   0.941   1.00 23.35  ? 17  DG  B N3    1 
ATOM   738  C C4    . DG  B 2 16  ? 10.753  2.804   1.358   1.00 29.97  ? 17  DG  B C4    1 
ATOM   739  P P     . DC  B 2 17  ? 9.382   -3.387  3.852   1.00 66.66  ? 18  DC  B P     1 
ATOM   740  O OP1   . DC  B 2 17  ? 8.585   -3.512  5.093   1.00 48.14  ? 18  DC  B OP1   1 
ATOM   741  O OP2   . DC  B 2 17  ? 10.694  -4.066  3.735   1.00 73.30  ? 18  DC  B OP2   1 
ATOM   742  O "O5'" . DC  B 2 17  ? 8.463   -3.848  2.633   1.00 67.53  ? 18  DC  B "O5'" 1 
ATOM   743  C "C5'" . DC  B 2 17  ? 7.240   -3.158  2.420   1.00 71.23  ? 18  DC  B "C5'" 1 
ATOM   744  C "C4'" . DC  B 2 17  ? 7.164   -2.558  1.029   1.00 60.93  ? 18  DC  B "C4'" 1 
ATOM   745  O "O4'" . DC  B 2 17  ? 8.095   -1.466  0.864   1.00 46.78  ? 18  DC  B "O4'" 1 
ATOM   746  C "C3'" . DC  B 2 17  ? 7.526   -3.512  -0.097  1.00 61.35  ? 18  DC  B "C3'" 1 
ATOM   747  O "O3'" . DC  B 2 17  ? 6.354   -4.197  -0.519  1.00 75.56  ? 18  DC  B "O3'" 1 
ATOM   748  C "C2'" . DC  B 2 17  ? 8.130   -2.602  -1.166  1.00 54.47  ? 18  DC  B "C2'" 1 
ATOM   749  C "C1'" . DC  B 2 17  ? 8.134   -1.221  -0.525  1.00 49.68  ? 18  DC  B "C1'" 1 
ATOM   750  N N1    . DC  B 2 17  ? 9.341   -0.406  -0.871  1.00 33.60  ? 18  DC  B N1    1 
ATOM   751  C C2    . DC  B 2 17  ? 9.278   0.553   -1.891  1.00 28.37  ? 18  DC  B C2    1 
ATOM   752  O O2    . DC  B 2 17  ? 8.215   0.723   -2.501  1.00 42.91  ? 18  DC  B O2    1 
ATOM   753  N N3    . DC  B 2 17  ? 10.383  1.281   -2.184  1.00 28.47  ? 18  DC  B N3    1 
ATOM   754  C C4    . DC  B 2 17  ? 11.512  1.075   -1.507  1.00 28.56  ? 18  DC  B C4    1 
ATOM   755  N N4    . DC  B 2 17  ? 12.578  1.816   -1.829  1.00 22.31  ? 18  DC  B N4    1 
ATOM   756  C C5    . DC  B 2 17  ? 11.601  0.100   -0.471  1.00 24.55  ? 18  DC  B C5    1 
ATOM   757  C C6    . DC  B 2 17  ? 10.504  -0.611  -0.190  1.00 31.68  ? 18  DC  B C6    1 
ATOM   758  P P     . DG  B 2 18  ? 6.446   -5.327  -1.655  1.00 71.11  ? 19  DG  B P     1 
ATOM   759  O OP1   . DG  B 2 18  ? 5.250   -6.191  -1.530  1.00 75.03  ? 19  DG  B OP1   1 
ATOM   760  O OP2   . DG  B 2 18  ? 7.800   -5.926  -1.583  1.00 53.63  ? 19  DG  B OP2   1 
ATOM   761  O "O5'" . DG  B 2 18  ? 6.352   -4.494  -3.014  1.00 56.52  ? 19  DG  B "O5'" 1 
ATOM   762  C "C5'" . DG  B 2 18  ? 5.339   -3.504  -3.186  1.00 45.20  ? 19  DG  B "C5'" 1 
ATOM   763  C "C4'" . DG  B 2 18  ? 5.517   -2.816  -4.525  1.00 34.73  ? 19  DG  B "C4'" 1 
ATOM   764  O "O4'" . DG  B 2 18  ? 6.660   -1.916  -4.495  1.00 41.35  ? 19  DG  B "O4'" 1 
ATOM   765  C "C3'" . DG  B 2 18  ? 5.760   -3.786  -5.670  1.00 26.85  ? 19  DG  B "C3'" 1 
ATOM   766  O "O3'" . DG  B 2 18  ? 4.946   -3.399  -6.778  1.00 42.07  ? 19  DG  B "O3'" 1 
ATOM   767  C "C2'" . DG  B 2 18  ? 7.262   -3.678  -5.930  1.00 36.00  ? 19  DG  B "C2'" 1 
ATOM   768  C "C1'" . DG  B 2 18  ? 7.611   -2.262  -5.488  1.00 33.73  ? 19  DG  B "C1'" 1 
ATOM   769  N N9    . DG  B 2 18  ? 8.954   -2.092  -4.928  1.00 26.09  ? 19  DG  B N9    1 
ATOM   770  C C8    . DG  B 2 18  ? 9.589   -2.864  -3.985  1.00 28.75  ? 19  DG  B C8    1 
ATOM   771  N N7    . DG  B 2 18  ? 10.789  -2.438  -3.684  1.00 28.45  ? 19  DG  B N7    1 
ATOM   772  C C5    . DG  B 2 18  ? 10.962  -1.309  -4.476  1.00 23.96  ? 19  DG  B C5    1 
ATOM   773  C C6    . DG  B 2 18  ? 12.062  -0.423  -4.593  1.00 27.37  ? 19  DG  B C6    1 
ATOM   774  O O6    . DG  B 2 18  ? 13.153  -0.446  -3.999  1.00 26.38  ? 19  DG  B O6    1 
ATOM   775  N N1    . DG  B 2 18  ? 11.809  0.586   -5.518  1.00 28.51  ? 19  DG  B N1    1 
ATOM   776  C C2    . DG  B 2 18  ? 10.643  0.720   -6.239  1.00 29.03  ? 19  DG  B C2    1 
ATOM   777  N N2    . DG  B 2 18  ? 10.556  1.749   -7.093  1.00 24.59  ? 19  DG  B N2    1 
ATOM   778  N N3    . DG  B 2 18  ? 9.612   -0.102  -6.138  1.00 24.68  ? 19  DG  B N3    1 
ATOM   779  C C4    . DG  B 2 18  ? 9.842   -1.088  -5.243  1.00 23.33  ? 19  DG  B C4    1 
ATOM   780  P P     . DC  B 2 19  ? 4.654   -4.424  -7.983  1.00 36.32  ? 20  DC  B P     1 
ATOM   781  O OP1   . DC  B 2 19  ? 3.473   -3.910  -8.706  1.00 38.53  ? 20  DC  B OP1   1 
ATOM   782  O OP2   . DC  B 2 19  ? 4.647   -5.809  -7.452  1.00 36.47  ? 20  DC  B OP2   1 
ATOM   783  O "O5'" . DC  B 2 19  ? 5.917   -4.242  -8.939  1.00 36.43  ? 20  DC  B "O5'" 1 
ATOM   784  C "C5'" . DC  B 2 19  ? 6.081   -2.970  -9.542  1.00 27.76  ? 20  DC  B "C5'" 1 
ATOM   785  C "C4'" . DC  B 2 19  ? 7.493   -2.723  -10.046 1.00 31.40  ? 20  DC  B "C4'" 1 
ATOM   786  O "O4'" . DC  B 2 19  ? 8.430   -2.554  -8.953  1.00 31.96  ? 20  DC  B "O4'" 1 
ATOM   787  C "C3'" . DC  B 2 19  ? 8.094   -3.829  -10.907 1.00 34.23  ? 20  DC  B "C3'" 1 
ATOM   788  O "O3'" . DC  B 2 19  ? 8.010   -3.440  -12.271 1.00 35.05  ? 20  DC  B "O3'" 1 
ATOM   789  C "C2'" . DC  B 2 19  ? 9.545   -3.931  -10.435 1.00 37.98  ? 20  DC  B "C2'" 1 
ATOM   790  C "C1'" . DC  B 2 19  ? 9.705   -2.717  -9.528  1.00 31.50  ? 20  DC  B "C1'" 1 
ATOM   791  N N1    . DC  B 2 19  ? 10.754  -2.869  -8.463  1.00 26.98  ? 20  DC  B N1    1 
ATOM   792  C C2    . DC  B 2 19  ? 11.756  -1.899  -8.319  1.00 31.56  ? 20  DC  B C2    1 
ATOM   793  O O2    . DC  B 2 19  ? 11.760  -0.914  -9.072  1.00 38.93  ? 20  DC  B O2    1 
ATOM   794  N N3    . DC  B 2 19  ? 12.698  -2.057  -7.355  1.00 24.37  ? 20  DC  B N3    1 
ATOM   795  C C4    . DC  B 2 19  ? 12.667  -3.124  -6.561  1.00 20.28  ? 20  DC  B C4    1 
ATOM   796  N N4    . DC  B 2 19  ? 13.617  -3.227  -5.629  1.00 21.33  ? 20  DC  B N4    1 
ATOM   797  C C5    . DC  B 2 19  ? 11.660  -4.125  -6.689  1.00 25.17  ? 20  DC  B C5    1 
ATOM   798  C C6    . DC  B 2 19  ? 10.736  -3.960  -7.643  1.00 32.68  ? 20  DC  B C6    1 
ATOM   799  P P     . DC  B 2 20  ? 7.246   -4.370  -13.334 1.00 36.42  ? 21  DC  B P     1 
ATOM   800  O OP1   . DC  B 2 20  ? 7.365   -3.698  -14.646 1.00 49.15  ? 21  DC  B OP1   1 
ATOM   801  O OP2   . DC  B 2 20  ? 5.914   -4.718  -12.785 1.00 47.22  ? 21  DC  B OP2   1 
ATOM   802  O "O5'" . DC  B 2 20  ? 8.127   -5.693  -13.381 1.00 37.72  ? 21  DC  B "O5'" 1 
ATOM   803  C "C5'" . DC  B 2 20  ? 9.447   -5.578  -13.882 1.00 43.57  ? 21  DC  B "C5'" 1 
ATOM   804  C "C4'" . DC  B 2 20  ? 10.313  -6.720  -13.384 1.00 31.72  ? 21  DC  B "C4'" 1 
ATOM   805  O "O4'" . DC  B 2 20  ? 10.440  -6.634  -11.945 1.00 30.28  ? 21  DC  B "O4'" 1 
ATOM   806  C "C3'" . DC  B 2 20  ? 9.756   -8.109  -13.674 1.00 31.05  ? 21  DC  B "C3'" 1 
ATOM   807  O "O3'" . DC  B 2 20  ? 10.685  -8.870  -14.444 1.00 34.84  ? 21  DC  B "O3'" 1 
ATOM   808  C "C2'" . DC  B 2 20  ? 9.523   -8.732  -12.298 1.00 21.77  ? 21  DC  B "C2'" 1 
ATOM   809  C "C1'" . DC  B 2 20  ? 10.432  -7.926  -11.377 1.00 25.42  ? 21  DC  B "C1'" 1 
ATOM   810  N N1    . DC  B 2 20  ? 9.982   -7.794  -9.940  1.00 37.40  ? 21  DC  B N1    1 
ATOM   811  C C2    . DC  B 2 20  ? 10.841  -8.067  -8.858  1.00 43.26  ? 21  DC  B C2    1 
ATOM   812  O O2    . DC  B 2 20  ? 12.004  -8.441  -9.066  1.00 44.53  ? 21  DC  B O2    1 
ATOM   813  N N3    . DC  B 2 20  ? 10.381  -7.920  -7.588  1.00 46.02  ? 21  DC  B N3    1 
ATOM   814  C C4    . DC  B 2 20  ? 9.130   -7.518  -7.372  1.00 41.29  ? 21  DC  B C4    1 
ATOM   815  N N4    . DC  B 2 20  ? 8.733   -7.389  -6.099  1.00 65.33  ? 21  DC  B N4    1 
ATOM   816  C C5    . DC  B 2 20  ? 8.242   -7.228  -8.450  1.00 28.31  ? 21  DC  B C5    1 
ATOM   817  C C6    . DC  B 2 20  ? 8.706   -7.376  -9.697  1.00 43.18  ? 21  DC  B C6    1 
ATOM   818  N N     . SER C 3 3   ? 28.243  -3.946  13.579  1.00 30.00  ? 1   SER R N     1 
ATOM   819  C CA    . SER C 3 3   ? 29.443  -3.203  13.211  1.00 30.00  ? 1   SER R CA    1 
ATOM   820  C C     . SER C 3 3   ? 29.772  -2.105  14.228  1.00 30.00  ? 1   SER R C     1 
ATOM   821  O O     . SER C 3 3   ? 29.019  -1.883  15.153  1.00 30.00  ? 1   SER R O     1 
ATOM   822  C CB    . SER C 3 3   ? 29.345  -2.687  11.776  1.00 20.00  ? 1   SER R CB    1 
ATOM   823  O OG    . SER C 3 3   ? 28.521  -3.541  10.997  1.00 20.00  ? 1   SER R OG    1 
ATOM   824  N N     . SER C 3 4   ? 30.916  -1.445  14.087  1.00 121.74 ? 2   SER R N     1 
ATOM   825  C CA    . SER C 3 4   ? 31.617  -0.930  15.258  1.00 108.91 ? 2   SER R CA    1 
ATOM   826  C C     . SER C 3 4   ? 31.772  0.548   15.791  1.00 103.20 ? 2   SER R C     1 
ATOM   827  O O     . SER C 3 4   ? 32.148  0.655   16.967  1.00 102.10 ? 2   SER R O     1 
ATOM   828  C CB    . SER C 3 4   ? 32.922  -1.730  15.412  1.00 20.00  ? 2   SER R CB    1 
ATOM   829  O OG    . SER C 3 4   ? 32.657  -3.115  15.616  1.00 20.00  ? 2   SER R OG    1 
ATOM   830  N N     . PRO C 3 5   ? 31.503  1.675   14.975  1.00 30.00  ? 3   PRO R N     1 
ATOM   831  C CA    . PRO C 3 5   ? 31.496  2.945   15.723  1.00 30.00  ? 3   PRO R CA    1 
ATOM   832  C C     . PRO C 3 5   ? 30.411  3.012   16.792  1.00 30.00  ? 3   PRO R C     1 
ATOM   833  O O     . PRO C 3 5   ? 29.272  2.648   16.617  1.00 30.00  ? 3   PRO R O     1 
ATOM   834  C CB    . PRO C 3 5   ? 31.312  4.027   14.655  1.00 20.00  ? 3   PRO R CB    1 
ATOM   835  C CG    . PRO C 3 5   ? 30.663  3.380   13.559  1.00 20.00  ? 3   PRO R CG    1 
ATOM   836  C CD    . PRO C 3 5   ? 31.415  2.094   13.505  1.00 20.00  ? 3   PRO R CD    1 
ATOM   837  N N     . GLY C 3 6   ? 30.818  3.521   17.931  1.00 47.71  ? 4   GLY R N     1 
ATOM   838  C CA    . GLY C 3 6   ? 30.041  3.414   19.115  1.00 42.26  ? 4   GLY R CA    1 
ATOM   839  C C     . GLY C 3 6   ? 29.769  4.709   19.751  1.00 26.53  ? 4   GLY R C     1 
ATOM   840  O O     . GLY C 3 6   ? 29.867  5.701   19.145  1.00 31.79  ? 4   GLY R O     1 
ATOM   841  N N     . PRO C 3 7   ? 29.397  4.673   20.995  1.00 32.17  ? 5   PRO R N     1 
ATOM   842  C CA    . PRO C 3 7   ? 28.916  5.877   21.629  1.00 26.33  ? 5   PRO R CA    1 
ATOM   843  C C     . PRO C 3 7   ? 29.929  6.925   21.851  1.00 20.66  ? 5   PRO R C     1 
ATOM   844  O O     . PRO C 3 7   ? 31.046  6.661   21.820  1.00 23.78  ? 5   PRO R O     1 
ATOM   845  C CB    . PRO C 3 7   ? 28.443  5.368   22.943  1.00 34.74  ? 5   PRO R CB    1 
ATOM   846  C CG    . PRO C 3 7   ? 29.307  4.274   23.226  1.00 34.67  ? 5   PRO R CG    1 
ATOM   847  C CD    . PRO C 3 7   ? 29.134  3.554   22.017  1.00 25.68  ? 5   PRO R CD    1 
ATOM   848  N N     . THR C 3 8   ? 29.491  8.142   22.004  1.00 21.63  ? 6   THR R N     1 
ATOM   849  C CA    . THR C 3 8   ? 30.358  9.268   22.136  1.00 22.51  ? 6   THR R CA    1 
ATOM   850  C C     . THR C 3 8   ? 30.904  9.391   23.510  1.00 25.08  ? 6   THR R C     1 
ATOM   851  O O     . THR C 3 8   ? 31.915  9.893   23.731  1.00 35.62  ? 6   THR R O     1 
ATOM   852  C CB    . THR C 3 8   ? 29.595  10.508  21.773  1.00 22.05  ? 6   THR R CB    1 
ATOM   853  O OG1   . THR C 3 8   ? 29.379  10.462  20.399  1.00 25.08  ? 6   THR R OG1   1 
ATOM   854  C CG2   . THR C 3 8   ? 30.336  11.716  21.988  1.00 28.61  ? 6   THR R CG2   1 
ATOM   855  N N     . CYS C 3 9   ? 30.145  8.978   24.442  1.00 24.59  ? 7   CYS R N     1 
ATOM   856  C CA    . CYS C 3 9   ? 30.608  8.767   25.806  1.00 15.84  ? 7   CYS R CA    1 
ATOM   857  C C     . CYS C 3 9   ? 29.622  7.895   26.570  1.00 23.47  ? 7   CYS R C     1 
ATOM   858  O O     . CYS C 3 9   ? 28.574  7.519   26.041  1.00 23.16  ? 7   CYS R O     1 
ATOM   859  C CB    . CYS C 3 9   ? 30.818  10.101  26.520  1.00 15.64  ? 7   CYS R CB    1 
ATOM   860  S SG    . CYS C 3 9   ? 29.384  11.182  26.525  1.00 27.27  ? 7   CYS R SG    1 
ATOM   861  N N     . TYR C 3 10  ? 29.964  7.574   27.812  1.00 21.45  ? 8   TYR R N     1 
ATOM   862  C CA    . TYR C 3 10  ? 29.125  6.711   28.631  1.00 19.23  ? 8   TYR R CA    1 
ATOM   863  C C     . TYR C 3 10  ? 28.675  7.437   29.889  1.00 26.87  ? 8   TYR R C     1 
ATOM   864  O O     . TYR C 3 10  ? 29.470  8.122   30.533  1.00 32.81  ? 8   TYR R O     1 
ATOM   865  C CB    . TYR C 3 10  ? 29.886  5.439   29.013  1.00 15.07  ? 8   TYR R CB    1 
ATOM   866  C CG    . TYR C 3 10  ? 30.337  4.626   27.828  1.00 21.59  ? 8   TYR R CG    1 
ATOM   867  C CD1   . TYR C 3 10  ? 31.464  4.985   27.103  1.00 27.14  ? 8   TYR R CD1   1 
ATOM   868  C CD2   . TYR C 3 10  ? 29.636  3.496   27.430  1.00 24.67  ? 8   TYR R CD2   1 
ATOM   869  C CE1   . TYR C 3 10  ? 31.880  4.244   26.014  1.00 18.84  ? 8   TYR R CE1   1 
ATOM   870  C CE2   . TYR C 3 10  ? 30.045  2.748   26.343  1.00 20.22  ? 8   TYR R CE2   1 
ATOM   871  C CZ    . TYR C 3 10  ? 31.167  3.128   25.638  1.00 29.06  ? 8   TYR R CZ    1 
ATOM   872  O OH    . TYR C 3 10  ? 31.579  2.390   24.553  1.00 31.71  ? 8   TYR R OH    1 
ATOM   873  N N     . GLY C 3 11  ? 27.401  7.282   30.237  1.00 21.12  ? 9   GLY R N     1 
ATOM   874  C CA    . GLY C 3 11  ? 26.878  7.859   31.459  1.00 23.88  ? 9   GLY R CA    1 
ATOM   875  C C     . GLY C 3 11  ? 25.398  8.182   31.409  1.00 35.70  ? 9   GLY R C     1 
ATOM   876  O O     . GLY C 3 11  ? 24.647  7.595   30.627  1.00 25.04  ? 9   GLY R O     1 
ATOM   877  N N     . TYR C 3 12  ? 24.985  9.121   32.256  1.00 26.33  ? 10  TYR R N     1 
ATOM   878  C CA    . TYR C 3 12  ? 23.593  9.546   32.333  1.00 24.50  ? 10  TYR R CA    1 
ATOM   879  C C     . TYR C 3 12  ? 23.490  11.065  32.438  1.00 31.33  ? 10  TYR R C     1 
ATOM   880  O O     . TYR C 3 12  ? 24.158  11.682  33.268  1.00 24.65  ? 10  TYR R O     1 
ATOM   881  C CB    . TYR C 3 12  ? 22.904  8.900   33.534  1.00 27.11  ? 10  TYR R CB    1 
ATOM   882  C CG    . TYR C 3 12  ? 21.508  9.417   33.772  1.00 35.61  ? 10  TYR R CG    1 
ATOM   883  C CD1   . TYR C 3 12  ? 20.448  8.982   32.991  1.00 39.90  ? 10  TYR R CD1   1 
ATOM   884  C CD2   . TYR C 3 12  ? 21.248  10.340  34.776  1.00 33.29  ? 10  TYR R CD2   1 
ATOM   885  C CE1   . TYR C 3 12  ? 19.164  9.452   33.201  1.00 52.01  ? 10  TYR R CE1   1 
ATOM   886  C CE2   . TYR C 3 12  ? 19.967  10.818  34.994  1.00 37.01  ? 10  TYR R CE2   1 
ATOM   887  C CZ    . TYR C 3 12  ? 18.928  10.369  34.203  1.00 49.28  ? 10  TYR R CZ    1 
ATOM   888  O OH    . TYR C 3 12  ? 17.649  10.836  34.407  1.00 47.40  ? 10  TYR R OH    1 
ATOM   889  N N     . ILE C 3 13  ? 22.651  11.663  31.598  1.00 26.22  ? 11  ILE R N     1 
ATOM   890  C CA    . ILE C 3 13  ? 22.472  13.110  31.603  1.00 24.57  ? 11  ILE R CA    1 
ATOM   891  C C     . ILE C 3 13  ? 21.282  13.500  32.476  1.00 37.94  ? 11  ILE R C     1 
ATOM   892  O O     . ILE C 3 13  ? 20.166  13.028  32.256  1.00 36.65  ? 11  ILE R O     1 
ATOM   893  C CB    . ILE C 3 13  ? 22.251  13.654  30.179  1.00 27.50  ? 11  ILE R CB    1 
ATOM   894  C CG1   . ILE C 3 13  ? 23.366  13.174  29.244  1.00 26.79  ? 11  ILE R CG1   1 
ATOM   895  C CG2   . ILE C 3 13  ? 22.150  15.171  30.194  1.00 28.39  ? 11  ILE R CG2   1 
ATOM   896  C CD1   . ILE C 3 13  ? 24.762  13.352  29.800  1.00 24.24  ? 11  ILE R CD1   1 
ATOM   897  N N     . ASP C 3 14  ? 21.520  14.358  33.466  1.00 32.66  ? 12  ASP R N     1 
ATOM   898  C CA    . ASP C 3 14  ? 20.450  14.799  34.357  1.00 38.03  ? 12  ASP R CA    1 
ATOM   899  C C     . ASP C 3 14  ? 20.115  16.280  34.181  1.00 44.98  ? 12  ASP R C     1 
ATOM   900  O O     . ASP C 3 14  ? 18.944  16.650  34.084  1.00 43.27  ? 12  ASP R O     1 
ATOM   901  C CB    . ASP C 3 14  ? 20.801  14.507  35.817  1.00 38.39  ? 12  ASP R CB    1 
ATOM   902  C CG    . ASP C 3 14  ? 19.640  14.770  36.754  1.00 52.59  ? 12  ASP R CG    1 
ATOM   903  O OD1   . ASP C 3 14  ? 18.785  13.872  36.906  1.00 70.39  ? 12  ASP R OD1   1 
ATOM   904  O OD2   . ASP C 3 14  ? 19.577  15.874  37.335  1.00 59.47  ? 12  ASP R OD2   1 
ATOM   905  N N     . ASP C 3 15  ? 21.145  17.121  34.135  1.00 33.42  ? 13  ASP R N     1 
ATOM   906  C CA    . ASP C 3 15  ? 20.949  18.564  34.015  1.00 32.59  ? 13  ASP R CA    1 
ATOM   907  C C     . ASP C 3 15  ? 21.905  19.207  33.009  1.00 34.97  ? 13  ASP R C     1 
ATOM   908  O O     . ASP C 3 15  ? 22.647  18.514  32.314  1.00 41.96  ? 13  ASP R O     1 
ATOM   909  C CB    . ASP C 3 15  ? 21.087  19.242  35.381  1.00 35.14  ? 13  ASP R CB    1 
ATOM   910  C CG    . ASP C 3 15  ? 22.507  19.196  35.917  1.00 49.86  ? 13  ASP R CG    1 
ATOM   911  O OD1   . ASP C 3 15  ? 23.234  18.231  35.603  1.00 51.32  ? 13  ASP R OD1   1 
ATOM   912  O OD2   . ASP C 3 15  ? 22.898  20.124  36.654  1.00 52.98  ? 13  ASP R OD2   1 
ATOM   913  N N     . GLU C 3 16  ? 21.883  20.535  32.942  1.00 35.91  ? 14  GLU R N     1 
ATOM   914  C CA    . GLU C 3 16  ? 22.673  21.268  31.956  1.00 33.28  ? 14  GLU R CA    1 
ATOM   915  C C     . GLU C 3 16  ? 24.178  21.166  32.202  1.00 41.10  ? 14  GLU R C     1 
ATOM   916  O O     . GLU C 3 16  ? 24.975  21.326  31.278  1.00 42.47  ? 14  GLU R O     1 
ATOM   917  C CB    . GLU C 3 16  ? 22.237  22.737  31.893  1.00 25.97  ? 14  GLU R CB    1 
ATOM   918  C CG    . GLU C 3 16  ? 20.770  22.935  31.534  1.00 62.24  ? 14  GLU R CG    1 
ATOM   919  C CD    . GLU C 3 16  ? 20.395  24.397  31.353  1.00 75.28  ? 14  GLU R CD    1 
ATOM   920  O OE1   . GLU C 3 16  ? 21.283  25.211  31.018  1.00 74.23  ? 14  GLU R OE1   1 
ATOM   921  O OE2   . GLU C 3 16  ? 19.206  24.731  31.546  1.00 65.11  ? 14  GLU R OE2   1 
ATOM   922  N N     . GLN C 3 17  ? 24.565  20.901  33.445  1.00 34.82  ? 15  GLN R N     1 
ATOM   923  C CA    . GLN C 3 17  ? 25.978  20.751  33.764  1.00 36.38  ? 15  GLN R CA    1 
ATOM   924  C C     . GLN C 3 17  ? 26.526  19.474  33.134  1.00 36.12  ? 15  GLN R C     1 
ATOM   925  O O     . GLN C 3 17  ? 27.653  19.447  32.641  1.00 34.49  ? 15  GLN R O     1 
ATOM   926  C CB    . GLN C 3 17  ? 26.206  20.756  35.277  1.00 37.69  ? 15  GLN R CB    1 
ATOM   927  C CG    . GLN C 3 17  ? 27.675  20.730  35.677  1.00 55.53  ? 15  GLN R CG    1 
ATOM   928  C CD    . GLN C 3 17  ? 28.482  21.850  35.035  1.00 67.36  ? 15  GLN R CD    1 
ATOM   929  O OE1   . GLN C 3 17  ? 27.929  22.866  34.609  1.00 60.25  ? 15  GLN R OE1   1 
ATOM   930  N NE2   . GLN C 3 17  ? 29.798  21.665  34.961  1.00 50.72  ? 15  GLN R NE2   1 
ATOM   931  N N     . ASP C 3 18  ? 25.715  18.422  33.147  1.00 32.99  ? 16  ASP R N     1 
ATOM   932  C CA    . ASP C 3 18  ? 26.070  17.177  32.480  1.00 26.84  ? 16  ASP R CA    1 
ATOM   933  C C     . ASP C 3 18  ? 26.191  17.381  30.967  1.00 34.44  ? 16  ASP R C     1 
ATOM   934  O O     . ASP C 3 18  ? 27.146  16.916  30.347  1.00 28.87  ? 16  ASP R O     1 
ATOM   935  C CB    . ASP C 3 18  ? 25.048  16.082  32.800  1.00 24.75  ? 16  ASP R CB    1 
ATOM   936  C CG    . ASP C 3 18  ? 25.166  15.569  34.228  1.00 39.38  ? 16  ASP R CG    1 
ATOM   937  O OD1   . ASP C 3 18  ? 26.296  15.546  34.759  1.00 38.15  ? 16  ASP R OD1   1 
ATOM   938  O OD2   . ASP C 3 18  ? 24.134  15.182  34.817  1.00 30.59  ? 16  ASP R OD2   1 
ATOM   939  N N     . LEU C 3 19  ? 25.226  18.088  30.385  1.00 25.91  ? 17  LEU R N     1 
ATOM   940  C CA    . LEU C 3 19  ? 25.245  18.400  28.957  1.00 22.40  ? 17  LEU R CA    1 
ATOM   941  C C     . LEU C 3 19  ? 26.482  19.192  28.563  1.00 29.40  ? 17  LEU R C     1 
ATOM   942  O O     . LEU C 3 19  ? 27.118  18.905  27.549  1.00 36.99  ? 17  LEU R O     1 
ATOM   943  C CB    . LEU C 3 19  ? 24.010  19.211  28.567  1.00 30.08  ? 17  LEU R CB    1 
ATOM   944  C CG    . LEU C 3 19  ? 22.698  18.480  28.305  1.00 36.24  ? 17  LEU R CG    1 
ATOM   945  C CD1   . LEU C 3 19  ? 21.577  19.487  28.097  1.00 28.48  ? 17  LEU R CD1   1 
ATOM   946  C CD2   . LEU C 3 19  ? 22.843  17.587  27.089  1.00 46.50  ? 17  LEU R CD2   1 
ATOM   947  N N     . ALA C 3 20  ? 26.810  20.195  29.371  1.00 24.14  ? 18  ALA R N     1 
ATOM   948  C CA    . ALA C 3 20  ? 27.884  21.125  29.047  1.00 25.90  ? 18  ALA R CA    1 
ATOM   949  C C     . ALA C 3 20  ? 29.225  20.414  28.951  1.00 31.83  ? 18  ALA R C     1 
ATOM   950  O O     . ALA C 3 20  ? 30.032  20.705  28.068  1.00 29.77  ? 18  ALA R O     1 
ATOM   951  C CB    . ALA C 3 20  ? 27.944  22.236  30.073  1.00 23.81  ? 18  ALA R CB    1 
ATOM   952  N N     . LEU C 3 21  ? 29.451  19.472  29.858  1.00 23.11  ? 19  LEU R N     1 
ATOM   953  C CA    . LEU C 3 21  ? 30.691  18.707  29.875  1.00 28.05  ? 19  LEU R CA    1 
ATOM   954  C C     . LEU C 3 21  ? 30.837  17.845  28.619  1.00 34.18  ? 19  LEU R C     1 
ATOM   955  O O     . LEU C 3 21  ? 31.906  17.805  28.009  1.00 30.42  ? 19  LEU R O     1 
ATOM   956  C CB    . LEU C 3 21  ? 30.770  17.852  31.143  1.00 32.08  ? 19  LEU R CB    1 
ATOM   957  C CG    . LEU C 3 21  ? 30.926  18.652  32.442  1.00 28.69  ? 19  LEU R CG    1 
ATOM   958  C CD1   . LEU C 3 21  ? 30.654  17.790  33.668  1.00 17.04  ? 19  LEU R CD1   1 
ATOM   959  C CD2   . LEU C 3 21  ? 32.316  19.258  32.519  1.00 21.91  ? 19  LEU R CD2   1 
ATOM   960  N N     . VAL C 3 22  ? 29.758  17.171  28.230  1.00 32.34  ? 20  VAL R N     1 
ATOM   961  C CA    . VAL C 3 22  ? 29.768  16.330  27.035  1.00 26.59  ? 20  VAL R CA    1 
ATOM   962  C C     . VAL C 3 22  ? 30.048  17.152  25.779  1.00 25.92  ? 20  VAL R C     1 
ATOM   963  O O     . VAL C 3 22  ? 30.933  16.820  24.993  1.00 31.53  ? 20  VAL R O     1 
ATOM   964  C CB    . VAL C 3 22  ? 28.437  15.574  26.864  1.00 28.61  ? 20  VAL R CB    1 
ATOM   965  C CG1   . VAL C 3 22  ? 28.459  14.741  25.588  1.00 17.52  ? 20  VAL R CG1   1 
ATOM   966  C CG2   . VAL C 3 22  ? 28.167  14.696  28.075  1.00 19.01  ? 20  VAL R CG2   1 
ATOM   967  N N     . PHE C 3 23  ? 29.291  18.229  25.604  1.00 23.56  ? 21  PHE R N     1 
ATOM   968  C CA    . PHE C 3 23  ? 29.475  19.130  24.474  1.00 23.66  ? 21  PHE R CA    1 
ATOM   969  C C     . PHE C 3 23  ? 30.892  19.698  24.424  1.00 35.55  ? 21  PHE R C     1 
ATOM   970  O O     . PHE C 3 23  ? 31.527  19.694  23.370  1.00 30.36  ? 21  PHE R O     1 
ATOM   971  C CB    . PHE C 3 23  ? 28.449  20.263  24.528  1.00 27.15  ? 21  PHE R CB    1 
ATOM   972  C CG    . PHE C 3 23  ? 27.075  19.867  24.052  1.00 27.96  ? 21  PHE R CG    1 
ATOM   973  C CD1   . PHE C 3 23  ? 26.915  19.065  22.935  1.00 27.97  ? 21  PHE R CD1   1 
ATOM   974  C CD2   . PHE C 3 23  ? 25.943  20.298  24.721  1.00 30.07  ? 21  PHE R CD2   1 
ATOM   975  C CE1   . PHE C 3 23  ? 25.649  18.706  22.493  1.00 27.96  ? 21  PHE R CE1   1 
ATOM   976  C CE2   . PHE C 3 23  ? 24.677  19.940  24.285  1.00 25.09  ? 21  PHE R CE2   1 
ATOM   977  C CZ    . PHE C 3 23  ? 24.531  19.144  23.171  1.00 24.75  ? 21  PHE R CZ    1 
ATOM   978  N N     . GLN C 3 24  ? 31.385  20.182  25.562  1.00 39.06  ? 22  GLN R N     1 
ATOM   979  C CA    . GLN C 3 24  ? 32.730  20.746  25.624  1.00 25.43  ? 22  GLN R CA    1 
ATOM   980  C C     . GLN C 3 24  ? 33.761  19.686  25.253  1.00 32.59  ? 22  GLN R C     1 
ATOM   981  O O     . GLN C 3 24  ? 34.720  19.963  24.533  1.00 33.71  ? 22  GLN R O     1 
ATOM   982  C CB    . GLN C 3 24  ? 33.027  21.316  27.013  1.00 39.41  ? 22  GLN R CB    1 
ATOM   983  C CG    . GLN C 3 24  ? 34.331  22.100  27.100  1.00 34.71  ? 22  GLN R CG    1 
ATOM   984  C CD    . GLN C 3 24  ? 34.334  23.334  26.212  1.00 39.10  ? 22  GLN R CD    1 
ATOM   985  O OE1   . GLN C 3 24  ? 33.428  24.164  26.283  1.00 32.71  ? 22  GLN R OE1   1 
ATOM   986  N NE2   . GLN C 3 24  ? 35.354  23.456  25.365  1.00 26.21  ? 22  GLN R NE2   1 
ATOM   987  N N     . GLY C 3 25  ? 33.543  18.467  25.734  1.00 27.17  ? 23  GLY R N     1 
ATOM   988  C CA    . GLY C 3 25  ? 34.413  17.353  25.407  1.00 28.17  ? 23  GLY R CA    1 
ATOM   989  C C     . GLY C 3 25  ? 34.423  17.056  23.921  1.00 38.99  ? 23  GLY R C     1 
ATOM   990  O O     . GLY C 3 25  ? 35.428  16.599  23.374  1.00 41.00  ? 23  GLY R O     1 
ATOM   991  N N     . VAL C 3 26  ? 33.297  17.318  23.265  1.00 28.73  ? 24  VAL R N     1 
ATOM   992  C CA    . VAL C 3 26  ? 33.189  17.125  21.824  1.00 38.61  ? 24  VAL R CA    1 
ATOM   993  C C     . VAL C 3 26  ? 33.869  18.265  21.067  1.00 32.30  ? 24  VAL R C     1 
ATOM   994  O O     . VAL C 3 26  ? 34.553  18.036  20.070  1.00 34.79  ? 24  VAL R O     1 
ATOM   995  C CB    . VAL C 3 26  ? 31.718  17.004  21.374  1.00 29.65  ? 24  VAL R CB    1 
ATOM   996  C CG1   . VAL C 3 26  ? 31.621  17.054  19.868  1.00 15.39  ? 24  VAL R CG1   1 
ATOM   997  C CG2   . VAL C 3 26  ? 31.102  15.718  21.905  1.00 23.76  ? 24  VAL R CG2   1 
ATOM   998  N N     . PHE C 3 27  ? 33.674  19.491  21.546  1.00 30.75  ? 25  PHE R N     1 
ATOM   999  C CA    . PHE C 3 27  ? 34.305  20.664  20.948  1.00 34.44  ? 25  PHE R CA    1 
ATOM   1000 C C     . PHE C 3 27  ? 35.831  20.564  21.001  1.00 41.32  ? 25  PHE R C     1 
ATOM   1001 O O     . PHE C 3 27  ? 36.520  20.971  20.068  1.00 44.76  ? 25  PHE R O     1 
ATOM   1002 C CB    . PHE C 3 27  ? 33.845  21.947  21.650  1.00 34.59  ? 25  PHE R CB    1 
ATOM   1003 C CG    . PHE C 3 27  ? 32.371  22.231  21.511  1.00 31.21  ? 25  PHE R CG    1 
ATOM   1004 C CD1   . PHE C 3 27  ? 31.599  21.562  20.575  1.00 29.61  ? 25  PHE R CD1   1 
ATOM   1005 C CD2   . PHE C 3 27  ? 31.761  23.179  22.318  1.00 29.28  ? 25  PHE R CD2   1 
ATOM   1006 C CE1   . PHE C 3 27  ? 30.239  21.831  20.448  1.00 23.08  ? 25  PHE R CE1   1 
ATOM   1007 C CE2   . PHE C 3 27  ? 30.406  23.451  22.198  1.00 30.30  ? 25  PHE R CE2   1 
ATOM   1008 C CZ    . PHE C 3 27  ? 29.645  22.776  21.262  1.00 35.01  ? 25  PHE R CZ    1 
ATOM   1009 N N     . ASN C 3 28  ? 36.349  20.025  22.102  1.00 42.26  ? 26  ASN R N     1 
ATOM   1010 C CA    . ASN C 3 28  ? 37.788  19.847  22.275  1.00 41.11  ? 26  ASN R CA    1 
ATOM   1011 C C     . ASN C 3 28  ? 38.347  18.720  21.402  1.00 43.55  ? 26  ASN R C     1 
ATOM   1012 O O     . ASN C 3 28  ? 39.510  18.755  21.002  1.00 50.72  ? 26  ASN R O     1 
ATOM   1013 C CB    . ASN C 3 28  ? 38.129  19.599  23.751  1.00 35.01  ? 26  ASN R CB    1 
ATOM   1014 C CG    . ASN C 3 28  ? 37.869  20.817  24.630  1.00 42.77  ? 26  ASN R CG    1 
ATOM   1015 O OD1   . ASN C 3 28  ? 37.398  21.853  24.160  1.00 37.17  ? 26  ASN R OD1   1 
ATOM   1016 N ND2   . ASN C 3 28  ? 38.171  20.689  25.919  1.00 34.71  ? 26  ASN R ND2   1 
ATOM   1017 N N     . GLY C 3 29  ? 37.516  17.722  21.115  1.00 38.00  ? 27  GLY R N     1 
ATOM   1018 C CA    . GLY C 3 29  ? 37.916  16.621  20.257  1.00 31.95  ? 27  GLY R CA    1 
ATOM   1019 C C     . GLY C 3 29  ? 38.196  15.323  20.991  1.00 36.17  ? 27  GLY R C     1 
ATOM   1020 O O     . GLY C 3 29  ? 38.532  14.315  20.369  1.00 33.91  ? 27  GLY R O     1 
ATOM   1021 N N     . ASN C 3 30  ? 38.064  15.344  22.313  1.00 30.44  ? 28  ASN R N     1 
ATOM   1022 C CA    . ASN C 3 30  ? 38.279  14.148  23.121  1.00 33.90  ? 28  ASN R CA    1 
ATOM   1023 C C     . ASN C 3 30  ? 37.150  13.149  22.931  1.00 32.72  ? 28  ASN R C     1 
ATOM   1024 O O     . ASN C 3 30  ? 37.375  11.942  22.859  1.00 40.35  ? 28  ASN R O     1 
ATOM   1025 C CB    . ASN C 3 30  ? 38.385  14.515  24.600  1.00 34.62  ? 28  ASN R CB    1 
ATOM   1026 C CG    . ASN C 3 30  ? 39.523  15.471  24.882  1.00 45.19  ? 28  ASN R CG    1 
ATOM   1027 O OD1   . ASN C 3 30  ? 39.496  16.632  24.462  1.00 40.58  ? 28  ASN R OD1   1 
ATOM   1028 N ND2   . ASN C 3 30  ? 40.528  14.994  25.610  1.00 34.91  ? 28  ASN R ND2   1 
ATOM   1029 N N     . LEU C 3 31  ? 35.931  13.670  22.860  1.00 39.39  ? 29  LEU R N     1 
ATOM   1030 C CA    . LEU C 3 31  ? 34.745  12.852  22.661  1.00 29.55  ? 29  LEU R CA    1 
ATOM   1031 C C     . LEU C 3 31  ? 34.347  12.909  21.191  1.00 38.38  ? 29  LEU R C     1 
ATOM   1032 O O     . LEU C 3 31  ? 34.101  13.987  20.645  1.00 34.77  ? 29  LEU R O     1 
ATOM   1033 C CB    . LEU C 3 31  ? 33.605  13.359  23.542  1.00 24.51  ? 29  LEU R CB    1 
ATOM   1034 C CG    . LEU C 3 31  ? 33.964  13.494  25.021  1.00 25.36  ? 29  LEU R CG    1 
ATOM   1035 C CD1   . LEU C 3 31  ? 32.771  13.974  25.834  1.00 29.51  ? 29  LEU R CD1   1 
ATOM   1036 C CD2   . LEU C 3 31  ? 34.483  12.167  25.546  1.00 27.49  ? 29  LEU R CD2   1 
ATOM   1037 N N     . ARG C 3 32  ? 34.288  11.749  20.547  1.00 28.76  ? 30  ARG R N     1 
ATOM   1038 C CA    . ARG C 3 32  ? 34.065  11.709  19.108  1.00 27.87  ? 30  ARG R CA    1 
ATOM   1039 C C     . ARG C 3 32  ? 32.588  11.676  18.729  1.00 31.29  ? 30  ARG R C     1 
ATOM   1040 O O     . ARG C 3 32  ? 31.819  10.864  19.247  1.00 32.59  ? 30  ARG R O     1 
ATOM   1041 C CB    . ARG C 3 32  ? 34.830  10.539  18.482  1.00 40.81  ? 30  ARG R CB    1 
ATOM   1042 C CG    . ARG C 3 32  ? 36.344  10.714  18.562  1.00 45.30  ? 30  ARG R CG    1 
ATOM   1043 C CD    . ARG C 3 32  ? 37.090  9.620   17.822  1.00 63.54  ? 30  ARG R CD    1 
ATOM   1044 N NE    . ARG C 3 32  ? 36.845  8.304   18.402  1.00 86.48  ? 30  ARG R NE    1 
ATOM   1045 C CZ    . ARG C 3 32  ? 37.494  7.818   19.455  1.00 76.71  ? 30  ARG R CZ    1 
ATOM   1046 N NH1   . ARG C 3 32  ? 38.431  8.542   20.054  1.00 77.69  ? 30  ARG R NH1   1 
ATOM   1047 N NH2   . ARG C 3 32  ? 37.203  6.607   19.910  1.00 56.90  ? 30  ARG R NH2   1 
ATOM   1048 N N     A CYS C 3 33  ? 32.189  12.574  17.834  0.58 30.76  ? 31  CYS R N     1 
ATOM   1049 N N     B CYS C 3 33  ? 32.212  12.569  17.815  0.42 30.88  ? 31  CYS R N     1 
ATOM   1050 C CA    A CYS C 3 33  ? 30.804  12.633  17.385  0.58 31.49  ? 31  CYS R CA    1 
ATOM   1051 C CA    B CYS C 3 33  ? 30.851  12.648  17.295  0.42 31.55  ? 31  CYS R CA    1 
ATOM   1052 C C     A CYS C 3 33  ? 30.507  11.536  16.365  0.58 33.44  ? 31  CYS R C     1 
ATOM   1053 C C     B CYS C 3 33  ? 30.498  11.428  16.456  0.42 33.35  ? 31  CYS R C     1 
ATOM   1054 O O     A CYS C 3 33  ? 31.421  10.896  15.846  0.58 35.52  ? 31  CYS R O     1 
ATOM   1055 O O     B CYS C 3 33  ? 31.359  10.607  16.142  0.42 35.75  ? 31  CYS R O     1 
ATOM   1056 C CB    A CYS C 3 33  ? 30.489  14.012  16.799  0.58 35.06  ? 31  CYS R CB    1 
ATOM   1057 C CB    B CYS C 3 33  ? 30.689  13.894  16.418  0.42 36.02  ? 31  CYS R CB    1 
ATOM   1058 S SG    A CYS C 3 33  ? 31.634  14.569  15.515  0.58 47.90  ? 31  CYS R SG    1 
ATOM   1059 S SG    B CYS C 3 33  ? 30.649  15.473  17.282  0.42 25.68  ? 31  CYS R SG    1 
ATOM   1060 N N     . ILE C 3 34  ? 29.224  11.319  16.093  1.00 35.89  ? 32  ILE R N     1 
ATOM   1061 C CA    . ILE C 3 34  ? 28.795  10.347  15.092  1.00 31.33  ? 32  ILE R CA    1 
ATOM   1062 C C     . ILE C 3 34  ? 28.863  11.025  13.723  1.00 34.62  ? 32  ILE R C     1 
ATOM   1063 O O     . ILE C 3 34  ? 28.274  12.088  13.520  1.00 39.55  ? 32  ILE R O     1 
ATOM   1064 C CB    . ILE C 3 34  ? 27.360  9.860   15.356  1.00 31.34  ? 32  ILE R CB    1 
ATOM   1065 C CG1   . ILE C 3 34  ? 27.324  8.963   16.594  1.00 32.89  ? 32  ILE R CG1   1 
ATOM   1066 C CG2   . ILE C 3 34  ? 26.825  9.099   14.155  1.00 27.41  ? 32  ILE R CG2   1 
ATOM   1067 C CD1   . ILE C 3 34  ? 27.939  7.598   16.378  1.00 18.18  ? 32  ILE R CD1   1 
ATOM   1068 N N     . GLU C 3 35  ? 29.586  10.422  12.786  1.00 44.71  ? 33  GLU R N     1 
ATOM   1069 C CA    . GLU C 3 35  ? 29.853  11.076  11.505  1.00 44.42  ? 33  GLU R CA    1 
ATOM   1070 C C     . GLU C 3 35  ? 28.966  10.591  10.354  1.00 40.11  ? 33  GLU R C     1 
ATOM   1071 O O     . GLU C 3 35  ? 28.896  11.226  9.303   1.00 36.57  ? 33  GLU R O     1 
ATOM   1072 C CB    . GLU C 3 35  ? 31.334  10.941  11.144  1.00 41.83  ? 33  GLU R CB    1 
ATOM   1073 C CG    . GLU C 3 35  ? 32.263  11.605  12.147  1.00 55.97  ? 33  GLU R CG    1 
ATOM   1074 C CD    . GLU C 3 35  ? 33.728  11.421  11.807  1.00 82.87  ? 33  GLU R CD    1 
ATOM   1075 O OE1   . GLU C 3 35  ? 34.075  10.380  11.209  1.00 79.42  ? 33  GLU R OE1   1 
ATOM   1076 O OE2   . GLU C 3 35  ? 34.533  12.319  12.138  1.00 76.36  ? 33  GLU R OE2   1 
ATOM   1077 N N     . ARG C 3 36  ? 28.288  9.467   10.560  1.00 33.94  ? 34  ARG R N     1 
ATOM   1078 C CA    . ARG C 3 36  ? 27.392  8.919   9.550   1.00 35.21  ? 34  ARG R CA    1 
ATOM   1079 C C     . ARG C 3 36  ? 26.260  8.144   10.211  1.00 27.17  ? 34  ARG R C     1 
ATOM   1080 O O     . ARG C 3 36  ? 26.409  7.646   11.324  1.00 38.06  ? 34  ARG R O     1 
ATOM   1081 C CB    . ARG C 3 36  ? 28.150  7.989   8.598   1.00 28.88  ? 34  ARG R CB    1 
ATOM   1082 C CG    . ARG C 3 36  ? 28.651  6.715   9.263   1.00 41.01  ? 34  ARG R CG    1 
ATOM   1083 C CD    . ARG C 3 36  ? 28.843  5.590   8.263   1.00 27.24  ? 34  ARG R CD    1 
ATOM   1084 N NE    . ARG C 3 36  ? 29.409  4.400   8.894   1.00 40.04  ? 34  ARG R NE    1 
ATOM   1085 C CZ    . ARG C 3 36  ? 28.702  3.502   9.573   1.00 31.39  ? 34  ARG R CZ    1 
ATOM   1086 N NH1   . ARG C 3 36  ? 27.395  3.655   9.711   1.00 29.78  ? 34  ARG R NH1   1 
ATOM   1087 N NH2   . ARG C 3 36  ? 29.301  2.452   10.115  1.00 32.47  ? 34  ARG R NH2   1 
ATOM   1088 N N     . ARG C 3 37  ? 25.134  8.034   9.515   1.00 29.88  ? 35  ARG R N     1 
ATOM   1089 C CA    . ARG C 3 37  ? 24.004  7.271   10.024  1.00 33.02  ? 35  ARG R CA    1 
ATOM   1090 C C     . ARG C 3 37  ? 24.387  5.811   10.191  1.00 22.94  ? 35  ARG R C     1 
ATOM   1091 O O     . ARG C 3 37  ? 25.036  5.233   9.320   1.00 38.83  ? 35  ARG R O     1 
ATOM   1092 C CB    . ARG C 3 37  ? 22.802  7.381   9.083   1.00 30.25  ? 35  ARG R CB    1 
ATOM   1093 C CG    . ARG C 3 37  ? 21.542  6.708   9.619   1.00 47.50  ? 35  ARG R CG    1 
ATOM   1094 C CD    . ARG C 3 37  ? 20.321  7.095   8.807   1.00 30.14  ? 35  ARG R CD    1 
ATOM   1095 N NE    . ARG C 3 37  ? 20.222  8.541   8.640   1.00 33.22  ? 35  ARG R NE    1 
ATOM   1096 C CZ    . ARG C 3 37  ? 19.579  9.349   9.475   1.00 38.55  ? 35  ARG R CZ    1 
ATOM   1097 N NH1   . ARG C 3 37  ? 18.972  8.852   10.543  1.00 29.66  ? 35  ARG R NH1   1 
ATOM   1098 N NH2   . ARG C 3 37  ? 19.542  10.653  9.238   1.00 32.96  ? 35  ARG R NH2   1 
ATOM   1099 N N     . PRO C 3 38  ? 23.995  5.213   11.322  1.00 22.72  ? 36  PRO R N     1 
ATOM   1100 C CA    . PRO C 3 38  ? 24.239  3.791   11.578  1.00 26.95  ? 36  PRO R CA    1 
ATOM   1101 C C     . PRO C 3 38  ? 23.551  2.912   10.537  1.00 29.69  ? 36  PRO R C     1 
ATOM   1102 O O     . PRO C 3 38  ? 22.526  3.309   9.983   1.00 42.70  ? 36  PRO R O     1 
ATOM   1103 C CB    . PRO C 3 38  ? 23.592  3.568   12.949  1.00 25.73  ? 36  PRO R CB    1 
ATOM   1104 C CG    . PRO C 3 38  ? 23.594  4.919   13.597  1.00 22.66  ? 36  PRO R CG    1 
ATOM   1105 C CD    . PRO C 3 38  ? 23.384  5.895   12.477  1.00 27.56  ? 36  PRO R CD    1 
ATOM   1106 N N     . TYR C 3 39  ? 24.111  1.736   10.272  1.00 33.27  ? 37  TYR R N     1 
ATOM   1107 C CA    . TYR C 3 39  ? 23.469  0.763   9.396   1.00 31.08  ? 37  TYR R CA    1 
ATOM   1108 C C     . TYR C 3 39  ? 22.432  -0.010  10.202  1.00 37.77  ? 37  TYR R C     1 
ATOM   1109 O O     . TYR C 3 39  ? 22.395  0.094   11.429  1.00 36.01  ? 37  TYR R O     1 
ATOM   1110 C CB    . TYR C 3 39  ? 24.505  -0.193  8.799   1.00 32.90  ? 37  TYR R CB    1 
ATOM   1111 C CG    . TYR C 3 39  ? 25.638  0.507   8.087   1.00 35.55  ? 37  TYR R CG    1 
ATOM   1112 C CD1   . TYR C 3 39  ? 25.415  1.673   7.366   1.00 37.57  ? 37  TYR R CD1   1 
ATOM   1113 C CD2   . TYR C 3 39  ? 26.933  0.011   8.143   1.00 40.48  ? 37  TYR R CD2   1 
ATOM   1114 C CE1   . TYR C 3 39  ? 26.450  2.322   6.713   1.00 34.78  ? 37  TYR R CE1   1 
ATOM   1115 C CE2   . TYR C 3 39  ? 27.975  0.655   7.492   1.00 43.77  ? 37  TYR R CE2   1 
ATOM   1116 C CZ    . TYR C 3 39  ? 27.725  1.810   6.779   1.00 45.30  ? 37  TYR R CZ    1 
ATOM   1117 O OH    . TYR C 3 39  ? 28.750  2.459   6.129   1.00 58.11  ? 37  TYR R OH    1 
ATOM   1118 N N     . ASP C 3 40  ? 21.599  -0.786  9.515   1.00 30.81  ? 38  ASP R N     1 
ATOM   1119 C CA    . ASP C 3 40  ? 20.515  -1.516  10.170  1.00 47.68  ? 38  ASP R CA    1 
ATOM   1120 C C     . ASP C 3 40  ? 20.998  -2.404  11.318  1.00 41.82  ? 38  ASP R C     1 
ATOM   1121 O O     . ASP C 3 40  ? 20.368  -2.453  12.376  1.00 41.29  ? 38  ASP R O     1 
ATOM   1122 C CB    . ASP C 3 40  ? 19.729  -2.345  9.148   1.00 38.57  ? 38  ASP R CB    1 
ATOM   1123 C CG    . ASP C 3 40  ? 18.904  -1.483  8.209   1.00 53.90  ? 38  ASP R CG    1 
ATOM   1124 O OD1   . ASP C 3 40  ? 19.134  -0.256  8.168   1.00 77.85  ? 38  ASP R OD1   1 
ATOM   1125 O OD2   . ASP C 3 40  ? 18.028  -2.033  7.509   1.00 91.34  ? 38  ASP R OD2   1 
ATOM   1126 N N     . ALA C 3 41  ? 22.116  -3.093  11.107  1.00 37.23  ? 39  ALA R N     1 
ATOM   1127 C CA    . ALA C 3 41  ? 22.669  -3.993  12.117  1.00 46.18  ? 39  ALA R CA    1 
ATOM   1128 C C     . ALA C 3 41  ? 23.372  -3.229  13.237  1.00 58.76  ? 39  ALA R C     1 
ATOM   1129 O O     . ALA C 3 41  ? 23.503  -3.730  14.356  1.00 57.29  ? 39  ALA R O     1 
ATOM   1130 C CB    . ALA C 3 41  ? 23.618  -4.989  11.476  1.00 54.06  ? 39  ALA R CB    1 
ATOM   1131 N N     . GLU C 3 42  ? 23.827  -2.019  12.928  1.00 40.45  ? 40  GLU R N     1 
ATOM   1132 C CA    . GLU C 3 42  ? 24.464  -1.160  13.920  1.00 45.02  ? 40  GLU R CA    1 
ATOM   1133 C C     . GLU C 3 42  ? 23.433  -0.557  14.873  1.00 46.35  ? 40  GLU R C     1 
ATOM   1134 O O     . GLU C 3 42  ? 23.743  -0.252  16.023  1.00 48.98  ? 40  GLU R O     1 
ATOM   1135 C CB    . GLU C 3 42  ? 25.253  -0.040  13.233  1.00 32.50  ? 40  GLU R CB    1 
ATOM   1136 C CG    . GLU C 3 42  ? 26.523  -0.494  12.534  1.00 38.51  ? 40  GLU R CG    1 
ATOM   1137 C CD    . GLU C 3 42  ? 27.241  0.643   11.824  1.00 35.78  ? 40  GLU R CD    1 
ATOM   1138 O OE1   . GLU C 3 42  ? 26.598  1.676   11.541  1.00 35.17  ? 40  GLU R OE1   1 
ATOM   1139 O OE2   . GLU C 3 42  ? 28.450  0.507   11.546  1.00 52.73  ? 40  GLU R OE2   1 
ATOM   1140 N N     . LYS C 3 43  ? 22.208  -0.387  14.385  1.00 43.14  ? 41  LYS R N     1 
ATOM   1141 C CA    . LYS C 3 43  ? 21.149  0.255   15.157  1.00 42.80  ? 41  LYS R CA    1 
ATOM   1142 C C     . LYS C 3 43  ? 20.783  -0.528  16.413  1.00 40.86  ? 41  LYS R C     1 
ATOM   1143 O O     . LYS C 3 43  ? 20.499  0.060   17.456  1.00 45.58  ? 41  LYS R O     1 
ATOM   1144 C CB    . LYS C 3 43  ? 19.906  0.481   14.288  1.00 30.13  ? 41  LYS R CB    1 
ATOM   1145 C CG    . LYS C 3 43  ? 20.118  1.459   13.138  1.00 27.10  ? 41  LYS R CG    1 
ATOM   1146 C CD    . LYS C 3 43  ? 18.798  1.836   12.474  1.00 25.74  ? 41  LYS R CD    1 
ATOM   1147 C CE    . LYS C 3 43  ? 19.010  2.858   11.365  1.00 26.95  ? 41  LYS R CE    1 
ATOM   1148 N NZ    . LYS C 3 43  ? 17.739  3.189   10.659  1.00 50.59  ? 41  LYS R NZ    1 
ATOM   1149 N N     . VAL C 3 44  ? 20.797  -1.852  16.309  1.00 44.18  ? 42  VAL R N     1 
ATOM   1150 C CA    . VAL C 3 44  ? 20.431  -2.716  17.425  1.00 44.51  ? 42  VAL R CA    1 
ATOM   1151 C C     . VAL C 3 44  ? 21.345  -2.507  18.630  1.00 40.47  ? 42  VAL R C     1 
ATOM   1152 O O     . VAL C 3 44  ? 20.911  -2.610  19.775  1.00 33.40  ? 42  VAL R O     1 
ATOM   1153 C CB    . VAL C 3 44  ? 20.485  -4.199  17.019  1.00 43.01  ? 42  VAL R CB    1 
ATOM   1154 C CG1   . VAL C 3 44  ? 19.853  -5.066  18.097  1.00 29.43  ? 42  VAL R CG1   1 
ATOM   1155 C CG2   . VAL C 3 44  ? 19.788  -4.405  15.683  1.00 38.62  ? 42  VAL R CG2   1 
ATOM   1156 N N     . GLU C 3 45  ? 22.611  -2.208  18.361  1.00 37.56  ? 43  GLU R N     1 
ATOM   1157 C CA    . GLU C 3 45  ? 23.610  -2.069  19.414  1.00 48.02  ? 43  GLU R CA    1 
ATOM   1158 C C     . GLU C 3 45  ? 23.607  -0.674  20.039  1.00 53.55  ? 43  GLU R C     1 
ATOM   1159 O O     . GLU C 3 45  ? 24.186  -0.464  21.105  1.00 48.76  ? 43  GLU R O     1 
ATOM   1160 C CB    . GLU C 3 45  ? 25.005  -2.383  18.864  1.00 53.35  ? 43  GLU R CB    1 
ATOM   1161 C CG    . GLU C 3 45  ? 25.163  -3.770  18.254  1.00 55.40  ? 43  GLU R CG    1 
ATOM   1162 C CD    . GLU C 3 45  ? 25.281  -4.862  19.299  1.00 73.99  ? 43  GLU R CD    1 
ATOM   1163 O OE1   . GLU C 3 45  ? 24.632  -4.746  20.360  1.00 85.51  ? 43  GLU R OE1   1 
ATOM   1164 O OE2   . GLU C 3 45  ? 26.028  -5.835  19.063  1.00 81.87  ? 43  GLU R OE2   1 
ATOM   1165 N N     . LEU C 3 46  ? 22.972  0.284   19.421  1.00 30.48  ? 44  LEU R N     1 
ATOM   1166 C CA    . LEU C 3 46  ? 23.032  1.642   19.853  1.00 33.83  ? 44  LEU R CA    1 
ATOM   1167 C C     . LEU C 3 46  ? 22.457  1.823   21.186  1.00 41.46  ? 44  LEU R C     1 
ATOM   1168 O O     . LEU C 3 46  ? 22.809  2.647   21.951  1.00 31.32  ? 44  LEU R O     1 
ATOM   1169 C CB    . LEU C 3 46  ? 22.208  2.470   18.938  1.00 28.22  ? 44  LEU R CB    1 
ATOM   1170 C CG    . LEU C 3 46  ? 22.710  2.547   17.542  1.00 30.53  ? 44  LEU R CG    1 
ATOM   1171 C CD1   . LEU C 3 46  ? 21.948  3.575   16.788  1.00 35.93  ? 44  LEU R CD1   1 
ATOM   1172 C CD2   . LEU C 3 46  ? 24.155  2.908   17.553  1.00 28.14  ? 44  LEU R CD2   1 
ATOM   1173 N N     . VAL C 3 47  ? 21.481  1.035   21.424  1.00 30.00  ? 45  VAL R N     1 
ATOM   1174 C CA    . VAL C 3 47  ? 20.440  1.348   22.288  1.00 30.00  ? 45  VAL R CA    1 
ATOM   1175 C C     . VAL C 3 47  ? 20.737  0.932   23.688  1.00 30.00  ? 45  VAL R C     1 
ATOM   1176 O O     . VAL C 3 47  ? 19.882  0.893   24.469  1.00 30.00  ? 45  VAL R O     1 
ATOM   1177 C CB    . VAL C 3 47  ? 19.186  0.759   21.674  1.00 20.00  ? 45  VAL R CB    1 
ATOM   1178 C CG1   . VAL C 3 47  ? 18.603  -0.417  22.390  1.00 20.00  ? 45  VAL R CG1   1 
ATOM   1179 C CG2   . VAL C 3 47  ? 18.190  1.822   21.442  1.00 20.00  ? 45  VAL R CG2   1 
ATOM   1180 N N     . ASN C 3 48  ? 21.952  0.545   23.954  1.00 26.13  ? 46  ASN R N     1 
ATOM   1181 C CA    . ASN C 3 48  ? 22.352  0.125   25.258  1.00 23.49  ? 46  ASN R CA    1 
ATOM   1182 C C     . ASN C 3 48  ? 22.331  1.207   26.265  1.00 23.24  ? 46  ASN R C     1 
ATOM   1183 O O     . ASN C 3 48  ? 22.701  2.275   25.997  1.00 26.24  ? 46  ASN R O     1 
ATOM   1184 C CB    . ASN C 3 48  ? 23.734  -0.392  25.196  1.00 30.60  ? 46  ASN R CB    1 
ATOM   1185 C CG    . ASN C 3 48  ? 23.831  -1.664  24.453  1.00 37.86  ? 46  ASN R CG    1 
ATOM   1186 O OD1   . ASN C 3 48  ? 22.899  -2.369  24.340  1.00 37.51  ? 46  ASN R OD1   1 
ATOM   1187 N ND2   . ASN C 3 48  ? 24.972  -1.960  23.967  1.00 22.63  ? 46  ASN R ND2   1 
ATOM   1188 N N     . PRO C 3 49  ? 21.854  0.835   27.523  1.00 26.98  ? 47  PRO R N     1 
ATOM   1189 C CA    . PRO C 3 49  ? 21.873  1.886   28.530  1.00 29.25  ? 47  PRO R CA    1 
ATOM   1190 C C     . PRO C 3 49  ? 23.198  2.473   28.877  1.00 18.41  ? 47  PRO R C     1 
ATOM   1191 O O     . PRO C 3 49  ? 24.110  1.772   28.969  1.00 27.30  ? 47  PRO R O     1 
ATOM   1192 C CB    . PRO C 3 49  ? 21.415  1.151   29.735  1.00 24.87  ? 47  PRO R CB    1 
ATOM   1193 C CG    . PRO C 3 49  ? 20.344  0.391   29.212  1.00 34.35  ? 47  PRO R CG    1 
ATOM   1194 C CD    . PRO C 3 49  ? 21.097  -0.318  28.203  1.00 32.77  ? 47  PRO R CD    1 
ATOM   1195 N N     . GLY C 3 50  ? 23.272  3.758   29.101  1.00 19.78  ? 48  GLY R N     1 
ATOM   1196 C CA    . GLY C 3 50  ? 24.538  4.423   29.340  1.00 20.78  ? 48  GLY R CA    1 
ATOM   1197 C C     . GLY C 3 50  ? 25.140  5.009   28.075  1.00 23.82  ? 48  GLY R C     1 
ATOM   1198 O O     . GLY C 3 50  ? 26.048  5.839   28.136  1.00 26.51  ? 48  GLY R O     1 
ATOM   1199 N N     . ASN C 3 51  ? 24.641  4.573   26.924  1.00 18.98  ? 49  ASN R N     1 
ATOM   1200 C CA    . ASN C 3 51  ? 25.123  5.088   25.648  1.00 23.25  ? 49  ASN R CA    1 
ATOM   1201 C C     . ASN C 3 51  ? 24.686  6.528   25.402  1.00 26.96  ? 49  ASN R C     1 
ATOM   1202 O O     . ASN C 3 51  ? 23.505  6.861   25.516  1.00 24.71  ? 49  ASN R O     1 
ATOM   1203 C CB    . ASN C 3 51  ? 24.658  4.195   24.495  1.00 25.27  ? 49  ASN R CB    1 
ATOM   1204 C CG    . ASN C 3 51  ? 25.513  2.954   24.337  1.00 27.30  ? 49  ASN R CG    1 
ATOM   1205 O OD1   . ASN C 3 51  ? 26.320  2.627   25.204  1.00 41.58  ? 49  ASN R OD1   1 
ATOM   1206 N ND2   . ASN C 3 51  ? 25.341  2.259   23.220  1.00 36.73  ? 49  ASN R ND2   1 
ATOM   1207 N N     . ILE C 3 52  ? 25.647  7.381   25.068  1.00 16.26  ? 50  ILE R N     1 
ATOM   1208 C CA    . ILE C 3 52  ? 25.348  8.759   24.711  1.00 17.87  ? 50  ILE R CA    1 
ATOM   1209 C C     . ILE C 3 52  ? 25.919  9.055   23.334  1.00 21.34  ? 50  ILE R C     1 
ATOM   1210 O O     . ILE C 3 52  ? 27.055  8.685   23.034  1.00 26.93  ? 50  ILE R O     1 
ATOM   1211 C CB    . ILE C 3 52  ? 25.939  9.743   25.729  1.00 18.80  ? 50  ILE R CB    1 
ATOM   1212 C CG1   . ILE C 3 52  ? 25.285  9.541   27.097  1.00 27.61  ? 50  ILE R CG1   1 
ATOM   1213 C CG2   . ILE C 3 52  ? 25.752  11.173  25.259  1.00 13.15  ? 50  ILE R CG2   1 
ATOM   1214 C CD1   . ILE C 3 52  ? 25.879  10.401  28.193  1.00 23.37  ? 50  ILE R CD1   1 
ATOM   1215 N N     . PHE C 3 53  ? 25.131  9.715   22.494  1.00 19.77  ? 51  PHE R N     1 
ATOM   1216 C CA    . PHE C 3 53  ? 25.582  10.060  21.152  1.00 15.40  ? 51  PHE R CA    1 
ATOM   1217 C C     . PHE C 3 53  ? 25.453  11.549  20.909  1.00 17.26  ? 51  PHE R C     1 
ATOM   1218 O O     . PHE C 3 53  ? 24.467  12.170  21.303  1.00 26.01  ? 51  PHE R O     1 
ATOM   1219 C CB    . PHE C 3 53  ? 24.766  9.313   20.095  1.00 15.46  ? 51  PHE R CB    1 
ATOM   1220 C CG    . PHE C 3 53  ? 24.864  7.820   20.193  1.00 12.46  ? 51  PHE R CG    1 
ATOM   1221 C CD1   . PHE C 3 53  ? 23.983  7.106   20.988  1.00 11.55  ? 51  PHE R CD1   1 
ATOM   1222 C CD2   . PHE C 3 53  ? 25.829  7.128   19.482  1.00 14.49  ? 51  PHE R CD2   1 
ATOM   1223 C CE1   . PHE C 3 53  ? 24.066  5.724   21.077  1.00 24.47  ? 51  PHE R CE1   1 
ATOM   1224 C CE2   . PHE C 3 53  ? 25.918  5.745   19.567  1.00 24.19  ? 51  PHE R CE2   1 
ATOM   1225 C CZ    . PHE C 3 53  ? 25.034  5.043   20.366  1.00 20.27  ? 51  PHE R CZ    1 
ATOM   1226 N N     . VAL C 3 54  ? 26.454  12.115  20.248  1.00 25.21  ? 52  VAL R N     1 
ATOM   1227 C CA    . VAL C 3 54  ? 26.400  13.500  19.814  1.00 22.78  ? 52  VAL R CA    1 
ATOM   1228 C C     . VAL C 3 54  ? 26.801  13.561  18.352  1.00 22.28  ? 52  VAL R C     1 
ATOM   1229 O O     . VAL C 3 54  ? 27.770  12.921  17.941  1.00 28.69  ? 52  VAL R O     1 
ATOM   1230 C CB    . VAL C 3 54  ? 27.342  14.395  20.638  1.00 15.58  ? 52  VAL R CB    1 
ATOM   1231 C CG1   . VAL C 3 54  ? 27.365  15.808  20.068  1.00 12.94  ? 52  VAL R CG1   1 
ATOM   1232 C CG2   . VAL C 3 54  ? 26.912  14.412  22.095  1.00 16.67  ? 52  VAL R CG2   1 
ATOM   1233 N N     . PHE C 3 55  ? 26.046  14.315  17.563  1.00 22.34  ? 53  PHE R N     1 
ATOM   1234 C CA    . PHE C 3 55  ? 26.401  14.518  16.164  1.00 38.12  ? 53  PHE R CA    1 
ATOM   1235 C C     . PHE C 3 55  ? 26.105  15.933  15.690  1.00 31.53  ? 53  PHE R C     1 
ATOM   1236 O O     . PHE C 3 55  ? 25.132  16.555  16.114  1.00 34.57  ? 53  PHE R O     1 
ATOM   1237 C CB    . PHE C 3 55  ? 25.727  13.482  15.248  1.00 18.41  ? 53  PHE R CB    1 
ATOM   1238 C CG    . PHE C 3 55  ? 24.222  13.468  15.328  1.00 23.95  ? 53  PHE R CG    1 
ATOM   1239 C CD1   . PHE C 3 55  ? 23.571  12.679  16.265  1.00 28.34  ? 53  PHE R CD1   1 
ATOM   1240 C CD2   . PHE C 3 55  ? 23.457  14.221  14.451  1.00 30.65  ? 53  PHE R CD2   1 
ATOM   1241 C CE1   . PHE C 3 55  ? 22.186  12.652  16.337  1.00 22.28  ? 53  PHE R CE1   1 
ATOM   1242 C CE2   . PHE C 3 55  ? 22.070  14.198  14.516  1.00 29.39  ? 53  PHE R CE2   1 
ATOM   1243 C CZ    . PHE C 3 55  ? 21.435  13.412  15.461  1.00 27.87  ? 53  PHE R CZ    1 
ATOM   1244 N N     . ASN C 3 56  ? 26.972  16.435  14.819  1.00 38.69  ? 54  ASN R N     1 
ATOM   1245 C CA    . ASN C 3 56  ? 26.757  17.713  14.162  1.00 32.76  ? 54  ASN R CA    1 
ATOM   1246 C C     . ASN C 3 56  ? 25.800  17.506  12.993  1.00 33.29  ? 54  ASN R C     1 
ATOM   1247 O O     . ASN C 3 56  ? 26.052  16.674  12.122  1.00 29.32  ? 54  ASN R O     1 
ATOM   1248 C CB    . ASN C 3 56  ? 28.090  18.268  13.660  1.00 38.85  ? 54  ASN R CB    1 
ATOM   1249 C CG    . ASN C 3 56  ? 27.995  19.709  13.216  1.00 43.41  ? 54  ASN R CG    1 
ATOM   1250 O OD1   . ASN C 3 56  ? 27.004  20.128  12.618  1.00 60.22  ? 54  ASN R OD1   1 
ATOM   1251 N ND2   . ASN C 3 56  ? 29.035  20.482  13.507  1.00 50.37  ? 54  ASN R ND2   1 
ATOM   1252 N N     . GLU C 3 57  ? 24.699  18.251  12.982  1.00 32.03  ? 55  GLU R N     1 
ATOM   1253 C CA    . GLU C 3 57  ? 23.686  18.104  11.939  1.00 38.48  ? 55  GLU R CA    1 
ATOM   1254 C C     . GLU C 3 57  ? 24.244  18.395  10.547  1.00 41.74  ? 55  GLU R C     1 
ATOM   1255 O O     . GLU C 3 57  ? 24.028  17.627  9.610   1.00 41.44  ? 55  GLU R O     1 
ATOM   1256 C CB    . GLU C 3 57  ? 22.480  19.002  12.232  1.00 38.89  ? 55  GLU R CB    1 
ATOM   1257 C CG    . GLU C 3 57  ? 21.481  19.103  11.094  1.00 34.80  ? 55  GLU R CG    1 
ATOM   1258 C CD    . GLU C 3 57  ? 20.197  19.803  11.506  1.00 61.69  ? 55  GLU R CD    1 
ATOM   1259 O OE1   . GLU C 3 57  ? 19.577  20.466  10.647  1.00 79.54  ? 55  GLU R OE1   1 
ATOM   1260 O OE2   . GLU C 3 57  ? 19.804  19.683  12.686  1.00 55.78  ? 55  GLU R OE2   1 
ATOM   1261 N N     . GLU C 3 58  ? 24.974  19.498  10.423  1.00 44.99  ? 56  GLU R N     1 
ATOM   1262 C CA    . GLU C 3 58  ? 25.533  19.913  9.140   1.00 49.07  ? 56  GLU R CA    1 
ATOM   1263 C C     . GLU C 3 58  ? 26.625  18.972  8.630   1.00 49.36  ? 56  GLU R C     1 
ATOM   1264 O O     . GLU C 3 58  ? 26.612  18.572  7.468   1.00 71.84  ? 56  GLU R O     1 
ATOM   1265 C CB    . GLU C 3 58  ? 26.072  21.347  9.222   1.00 54.04  ? 56  GLU R CB    1 
ATOM   1266 C CG    . GLU C 3 58  ? 24.998  22.429  9.345   1.00 72.35  ? 56  GLU R CG    1 
ATOM   1267 C CD    . GLU C 3 58  ? 24.379  22.509  10.733  1.00 83.65  ? 56  GLU R CD    1 
ATOM   1268 O OE1   . GLU C 3 58  ? 23.239  23.014  10.846  1.00 64.51  ? 56  GLU R OE1   1 
ATOM   1269 O OE2   . GLU C 3 58  ? 25.030  22.077  11.709  1.00 69.26  ? 56  GLU R OE2   1 
ATOM   1270 N N     . LYS C 3 59  ? 27.565  18.619  9.502   1.00 54.32  ? 57  LYS R N     1 
ATOM   1271 C CA    . LYS C 3 59  ? 28.720  17.817  9.105   1.00 46.48  ? 57  LYS R CA    1 
ATOM   1272 C C     . LYS C 3 59  ? 28.411  16.336  8.888   1.00 52.62  ? 57  LYS R C     1 
ATOM   1273 O O     . LYS C 3 59  ? 29.206  15.620  8.283   1.00 59.12  ? 57  LYS R O     1 
ATOM   1274 C CB    . LYS C 3 59  ? 29.853  17.956  10.128  1.00 52.79  ? 57  LYS R CB    1 
ATOM   1275 C CG    . LYS C 3 59  ? 30.455  19.351  10.226  1.00 64.79  ? 57  LYS R CG    1 
ATOM   1276 C CD    . LYS C 3 59  ? 31.702  19.348  11.102  1.00 78.39  ? 57  LYS R CD    1 
ATOM   1277 C CE    . LYS C 3 59  ? 32.369  20.715  11.130  1.00 85.78  ? 57  LYS R CE    1 
ATOM   1278 N NZ    . LYS C 3 59  ? 33.640  20.703  11.909  1.00 78.12  ? 57  LYS R NZ    1 
ATOM   1279 N N     . SER C 3 60  ? 27.267  15.874  9.382   1.00 48.30  ? 58  SER R N     1 
ATOM   1280 C CA    . SER C 3 60  ? 26.934  14.455  9.289   1.00 42.34  ? 58  SER R CA    1 
ATOM   1281 C C     . SER C 3 60  ? 25.742  14.198  8.379   1.00 42.16  ? 58  SER R C     1 
ATOM   1282 O O     . SER C 3 60  ? 25.578  13.096  7.860   1.00 50.88  ? 58  SER R O     1 
ATOM   1283 C CB    . SER C 3 60  ? 26.662  13.867  10.675  1.00 45.63  ? 58  SER R CB    1 
ATOM   1284 O OG    . SER C 3 60  ? 25.454  14.371  11.220  1.00 38.01  ? 58  SER R OG    1 
ATOM   1285 N N     . GLY C 3 61  ? 24.906  15.214  8.197   1.00 41.75  ? 59  GLY R N     1 
ATOM   1286 C CA    . GLY C 3 61  ? 23.727  15.075  7.363   1.00 38.01  ? 59  GLY R CA    1 
ATOM   1287 C C     . GLY C 3 61  ? 22.568  14.411  8.082   1.00 41.41  ? 59  GLY R C     1 
ATOM   1288 O O     . GLY C 3 61  ? 21.557  14.076  7.465   1.00 49.59  ? 59  GLY R O     1 
ATOM   1289 N N     . ILE C 3 62  ? 22.714  14.218  9.390   1.00 42.56  ? 60  ILE R N     1 
ATOM   1290 C CA    . ILE C 3 62  ? 21.641  13.661  10.203  1.00 23.42  ? 60  ILE R CA    1 
ATOM   1291 C C     . ILE C 3 62  ? 20.825  14.780  10.840  1.00 31.20  ? 60  ILE R C     1 
ATOM   1292 O O     . ILE C 3 62  ? 21.365  15.621  11.560  1.00 29.36  ? 60  ILE R O     1 
ATOM   1293 C CB    . ILE C 3 62  ? 22.184  12.746  11.317  1.00 28.87  ? 60  ILE R CB    1 
ATOM   1294 C CG1   . ILE C 3 62  ? 23.083  11.662  10.725  1.00 31.93  ? 60  ILE R CG1   1 
ATOM   1295 C CG2   . ILE C 3 62  ? 21.041  12.110  12.088  1.00 17.10  ? 60  ILE R CG2   1 
ATOM   1296 C CD1   . ILE C 3 62  ? 23.668  10.729  11.755  1.00 20.38  ? 60  ILE R CD1   1 
ATOM   1297 N N     . LYS C 3 63  ? 19.524  14.789  10.567  1.00 35.91  ? 61  LYS R N     1 
ATOM   1298 C CA    . LYS C 3 63  ? 18.621  15.777  11.147  1.00 37.37  ? 61  LYS R CA    1 
ATOM   1299 C C     . LYS C 3 63  ? 17.692  15.121  12.156  1.00 26.49  ? 61  LYS R C     1 
ATOM   1300 O O     . LYS C 3 63  ? 17.225  15.765  13.094  1.00 30.94  ? 61  LYS R O     1 
ATOM   1301 C CB    . LYS C 3 63  ? 17.806  16.465  10.055  1.00 50.39  ? 61  LYS R CB    1 
ATOM   1302 C CG    . LYS C 3 63  ? 18.645  17.252  9.073   1.00 52.82  ? 61  LYS R CG    1 
ATOM   1303 C CD    . LYS C 3 63  ? 17.791  17.816  7.954   1.00 53.40  ? 61  LYS R CD    1 
ATOM   1304 C CE    . LYS C 3 63  ? 18.651  18.503  6.909   1.00 52.07  ? 61  LYS R CE    1 
ATOM   1305 N NZ    . LYS C 3 63  ? 17.856  18.877  5.709   1.00 57.70  ? 61  LYS R NZ    1 
ATOM   1306 N N     . ARG C 3 64  ? 17.427  13.836  11.950  1.00 24.75  ? 62  ARG R N     1 
ATOM   1307 C CA    . ARG C 3 64  ? 16.637  13.051  12.887  1.00 16.40  ? 62  ARG R CA    1 
ATOM   1308 C C     . ARG C 3 64  ? 17.315  11.714  13.167  1.00 30.25  ? 62  ARG R C     1 
ATOM   1309 O O     . ARG C 3 64  ? 17.680  10.985  12.247  1.00 29.53  ? 62  ARG R O     1 
ATOM   1310 C CB    . ARG C 3 64  ? 15.230  12.818  12.343  1.00 22.15  ? 62  ARG R CB    1 
ATOM   1311 C CG    . ARG C 3 64  ? 14.517  14.076  11.889  1.00 27.68  ? 62  ARG R CG    1 
ATOM   1312 C CD    . ARG C 3 64  ? 13.095  13.762  11.476  1.00 29.14  ? 62  ARG R CD    1 
ATOM   1313 N NE    . ARG C 3 64  ? 12.432  14.901  10.848  1.00 28.33  ? 62  ARG R NE    1 
ATOM   1314 C CZ    . ARG C 3 64  ? 11.210  14.852  10.328  1.00 35.96  ? 62  ARG R CZ    1 
ATOM   1315 N NH1   . ARG C 3 64  ? 10.520  13.720  10.368  1.00 23.21  ? 62  ARG R NH1   1 
ATOM   1316 N NH2   . ARG C 3 64  ? 10.680  15.933  9.772   1.00 27.36  ? 62  ARG R NH2   1 
ATOM   1317 N N     . TRP C 3 65  ? 17.473  11.401  14.448  1.00 25.64  ? 63  TRP R N     1 
ATOM   1318 C CA    . TRP C 3 65  ? 18.154  10.188  14.876  1.00 18.71  ? 63  TRP R CA    1 
ATOM   1319 C C     . TRP C 3 65  ? 17.198  9.000   14.811  1.00 24.10  ? 63  TRP R C     1 
ATOM   1320 O O     . TRP C 3 65  ? 16.108  9.044   15.382  1.00 30.02  ? 63  TRP R O     1 
ATOM   1321 C CB    . TRP C 3 65  ? 18.677  10.383  16.301  1.00 23.76  ? 63  TRP R CB    1 
ATOM   1322 C CG    . TRP C 3 65  ? 19.413  9.213   16.886  1.00 21.30  ? 63  TRP R CG    1 
ATOM   1323 C CD1   . TRP C 3 65  ? 18.939  8.326   17.806  1.00 20.33  ? 63  TRP R CD1   1 
ATOM   1324 C CD2   . TRP C 3 65  ? 20.766  8.820   16.615  1.00 19.36  ? 63  TRP R CD2   1 
ATOM   1325 N NE1   . TRP C 3 65  ? 19.904  7.401   18.117  1.00 21.49  ? 63  TRP R NE1   1 
ATOM   1326 C CE2   . TRP C 3 65  ? 21.035  7.684   17.397  1.00 21.12  ? 63  TRP R CE2   1 
ATOM   1327 C CE3   . TRP C 3 65  ? 21.769  9.321   15.780  1.00 23.26  ? 63  TRP R CE3   1 
ATOM   1328 C CZ2   . TRP C 3 65  ? 22.268  7.037   17.371  1.00 16.37  ? 63  TRP R CZ2   1 
ATOM   1329 C CZ3   . TRP C 3 65  ? 22.990  8.678   15.757  1.00 14.50  ? 63  TRP R CZ3   1 
ATOM   1330 C CH2   . TRP C 3 65  ? 23.230  7.549   16.545  1.00 20.05  ? 63  TRP R CH2   1 
ATOM   1331 N N     . THR C 3 66  ? 17.608  7.941   14.115  1.00 22.57  ? 64  THR R N     1 
ATOM   1332 C CA    . THR C 3 66  ? 16.780  6.743   13.967  1.00 27.95  ? 64  THR R CA    1 
ATOM   1333 C C     . THR C 3 66  ? 17.484  5.493   14.482  1.00 26.49  ? 64  THR R C     1 
ATOM   1334 O O     . THR C 3 66  ? 18.566  5.143   14.008  1.00 28.64  ? 64  THR R O     1 
ATOM   1335 C CB    . THR C 3 66  ? 16.364  6.513   12.496  1.00 17.75  ? 64  THR R CB    1 
ATOM   1336 O OG1   . THR C 3 66  ? 17.522  6.568   11.653  1.00 27.83  ? 64  THR R OG1   1 
ATOM   1337 C CG2   . THR C 3 66  ? 15.371  7.572   12.050  1.00 27.90  ? 64  THR R CG2   1 
ATOM   1338 N N     . ASP C 3 67  ? 16.863  4.818   15.447  1.00 25.22  ? 65  ASP R N     1 
ATOM   1339 C CA    . ASP C 3 67  ? 17.442  3.609   16.023  1.00 22.89  ? 65  ASP R CA    1 
ATOM   1340 C C     . ASP C 3 67  ? 16.625  2.357   15.709  1.00 26.19  ? 65  ASP R C     1 
ATOM   1341 O O     . ASP C 3 67  ? 16.978  1.255   16.129  1.00 38.56  ? 65  ASP R O     1 
ATOM   1342 C CB    . ASP C 3 67  ? 17.642  3.760   17.537  1.00 27.09  ? 65  ASP R CB    1 
ATOM   1343 C CG    . ASP C 3 67  ? 16.379  4.199   18.262  1.00 36.41  ? 65  ASP R CG    1 
ATOM   1344 O OD1   . ASP C 3 67  ? 15.266  3.812   17.844  1.00 25.87  ? 65  ASP R OD1   1 
ATOM   1345 O OD2   . ASP C 3 67  ? 16.505  4.937   19.264  1.00 26.29  ? 65  ASP R OD2   1 
ATOM   1346 N N     . GLY C 3 68  ? 15.532  2.533   14.974  1.00 30.41  ? 66  GLY R N     1 
ATOM   1347 C CA    . GLY C 3 68  ? 14.720  1.414   14.531  1.00 23.03  ? 66  GLY R CA    1 
ATOM   1348 C C     . GLY C 3 68  ? 13.834  0.782   15.591  1.00 29.67  ? 66  GLY R C     1 
ATOM   1349 O O     . GLY C 3 68  ? 13.206  -0.245  15.345  1.00 28.06  ? 66  GLY R O     1 
ATOM   1350 N N     . PHE C 3 69  ? 13.773  1.385   16.773  1.00 31.69  ? 67  PHE R N     1 
ATOM   1351 C CA    . PHE C 3 69  ? 12.929  0.851   17.839  1.00 31.84  ? 67  PHE R CA    1 
ATOM   1352 C C     . PHE C 3 69  ? 11.580  1.561   17.894  1.00 31.47  ? 67  PHE R C     1 
ATOM   1353 O O     . PHE C 3 69  ? 11.370  2.562   17.210  1.00 34.92  ? 67  PHE R O     1 
ATOM   1354 C CB    . PHE C 3 69  ? 13.642  0.943   19.191  1.00 34.71  ? 67  PHE R CB    1 
ATOM   1355 C CG    . PHE C 3 69  ? 14.750  -0.059  19.362  1.00 40.76  ? 67  PHE R CG    1 
ATOM   1356 C CD1   . PHE C 3 69  ? 15.990  0.150   18.776  1.00 34.45  ? 67  PHE R CD1   1 
ATOM   1357 C CD2   . PHE C 3 69  ? 14.554  -1.210  20.112  1.00 31.32  ? 67  PHE R CD2   1 
ATOM   1358 C CE1   . PHE C 3 69  ? 17.015  -0.773  18.932  1.00 30.18  ? 67  PHE R CE1   1 
ATOM   1359 C CE2   . PHE C 3 69  ? 15.576  -2.136  20.271  1.00 38.21  ? 67  PHE R CE2   1 
ATOM   1360 C CZ    . PHE C 3 69  ? 16.807  -1.916  19.679  1.00 38.53  ? 67  PHE R CZ    1 
ATOM   1361 N N     . SER C 3 70  ? 10.667  1.034   18.705  1.00 19.56  ? 68  SER R N     1 
ATOM   1362 C CA    . SER C 3 70  ? 9.344   1.634   18.866  1.00 32.87  ? 68  SER R CA    1 
ATOM   1363 C C     . SER C 3 70  ? 9.309   2.572   20.066  1.00 35.08  ? 68  SER R C     1 
ATOM   1364 O O     . SER C 3 70  ? 9.584   2.165   21.195  1.00 31.96  ? 68  SER R O     1 
ATOM   1365 C CB    . SER C 3 70  ? 8.270   0.557   19.018  1.00 26.93  ? 68  SER R CB    1 
ATOM   1366 O OG    . SER C 3 70  ? 7.985   -0.052  17.773  1.00 53.43  ? 68  SER R OG    1 
ATOM   1367 N N     . TRP C 3 71  ? 8.954   3.826   19.816  1.00 33.17  ? 69  TRP R N     1 
ATOM   1368 C CA    . TRP C 3 71  ? 8.974   4.843   20.857  1.00 33.41  ? 69  TRP R CA    1 
ATOM   1369 C C     . TRP C 3 71  ? 7.609   5.471   21.092  1.00 31.01  ? 69  TRP R C     1 
ATOM   1370 O O     . TRP C 3 71  ? 6.810   5.610   20.166  1.00 37.96  ? 69  TRP R O     1 
ATOM   1371 C CB    . TRP C 3 71  ? 9.990   5.930   20.500  1.00 31.26  ? 69  TRP R CB    1 
ATOM   1372 C CG    . TRP C 3 71  ? 11.384  5.404   20.384  1.00 28.82  ? 69  TRP R CG    1 
ATOM   1373 C CD1   . TRP C 3 71  ? 12.090  5.190   19.236  1.00 20.35  ? 69  TRP R CD1   1 
ATOM   1374 C CD2   . TRP C 3 71  ? 12.241  5.004   21.460  1.00 26.32  ? 69  TRP R CD2   1 
ATOM   1375 N NE1   . TRP C 3 71  ? 13.333  4.692   19.533  1.00 26.60  ? 69  TRP R NE1   1 
ATOM   1376 C CE2   . TRP C 3 71  ? 13.448  4.569   20.893  1.00 26.29  ? 69  TRP R CE2   1 
ATOM   1377 C CE3   . TRP C 3 71  ? 12.094  4.980   22.850  1.00 26.31  ? 69  TRP R CE3   1 
ATOM   1378 C CZ2   . TRP C 3 71  ? 14.513  4.112   21.668  1.00 23.10  ? 69  TRP R CZ2   1 
ATOM   1379 C CZ3   . TRP C 3 71  ? 13.148  4.527   23.615  1.00 22.99  ? 69  TRP R CZ3   1 
ATOM   1380 C CH2   . TRP C 3 71  ? 14.343  4.099   23.024  1.00 27.29  ? 69  TRP R CH2   1 
ATOM   1381 N N     . SER C 3 72  ? 7.355   5.859   22.337  1.00 30.59  ? 70  SER R N     1 
ATOM   1382 C CA    . SER C 3 72  ? 6.141   6.583   22.682  1.00 28.97  ? 70  SER R CA    1 
ATOM   1383 C C     . SER C 3 72  ? 6.196   7.971   22.070  1.00 27.57  ? 70  SER R C     1 
ATOM   1384 O O     . SER C 3 72  ? 7.231   8.380   21.540  1.00 38.44  ? 70  SER R O     1 
ATOM   1385 C CB    . SER C 3 72  ? 6.008   6.707   24.197  1.00 30.07  ? 70  SER R CB    1 
ATOM   1386 O OG    . SER C 3 72  ? 6.908   7.672   24.706  1.00 37.48  ? 70  SER R OG    1 
ATOM   1387 N N     . PRO C 3 73  ? 5.074   8.699   22.125  1.00 28.18  ? 71  PRO R N     1 
ATOM   1388 C CA    . PRO C 3 73  ? 5.090   10.105  21.714  1.00 26.72  ? 71  PRO R CA    1 
ATOM   1389 C C     . PRO C 3 73  ? 5.998   10.880  22.658  1.00 44.32  ? 71  PRO R C     1 
ATOM   1390 O O     . PRO C 3 73  ? 6.152   10.476  23.814  1.00 37.06  ? 71  PRO R O     1 
ATOM   1391 C CB    . PRO C 3 73  ? 3.637   10.543  21.907  1.00 33.96  ? 71  PRO R CB    1 
ATOM   1392 C CG    . PRO C 3 73  ? 2.841   9.273   21.857  1.00 29.31  ? 71  PRO R CG    1 
ATOM   1393 C CD    . PRO C 3 73  ? 3.723   8.234   22.479  1.00 28.02  ? 71  PRO R CD    1 
ATOM   1394 N N     . SER C 3 74  ? 6.589   11.969  22.179  1.00 33.17  ? 72  SER R N     1 
ATOM   1395 C CA    . SER C 3 74  ? 7.519   12.750  22.988  1.00 23.61  ? 72  SER R CA    1 
ATOM   1396 C C     . SER C 3 74  ? 6.844   13.415  24.185  1.00 36.21  ? 72  SER R C     1 
ATOM   1397 O O     . SER C 3 74  ? 5.732   13.931  24.076  1.00 36.47  ? 72  SER R O     1 
ATOM   1398 C CB    . SER C 3 74  ? 8.191   13.822  22.133  1.00 22.88  ? 72  SER R CB    1 
ATOM   1399 O OG    . SER C 3 74  ? 7.261   14.815  21.742  1.00 31.69  ? 72  SER R OG    1 
ATOM   1400 N N     . ARG C 3 75  ? 7.527   13.390  25.326  1.00 28.64  ? 73  ARG R N     1 
ATOM   1401 C CA    . ARG C 3 75  ? 7.132   14.182  26.487  1.00 39.27  ? 73  ARG R CA    1 
ATOM   1402 C C     . ARG C 3 75  ? 8.273   15.131  26.841  1.00 38.42  ? 73  ARG R C     1 
ATOM   1403 O O     . ARG C 3 75  ? 9.424   14.872  26.494  1.00 46.80  ? 73  ARG R O     1 
ATOM   1404 C CB    . ARG C 3 75  ? 6.798   13.281  27.680  1.00 33.94  ? 73  ARG R CB    1 
ATOM   1405 C CG    . ARG C 3 75  ? 5.529   12.458  27.508  1.00 38.59  ? 73  ARG R CG    1 
ATOM   1406 C CD    . ARG C 3 75  ? 4.290   13.341  27.477  1.00 40.16  ? 73  ARG R CD    1 
ATOM   1407 N NE    . ARG C 3 75  ? 3.069   12.568  27.255  1.00 39.85  ? 73  ARG R NE    1 
ATOM   1408 C CZ    . ARG C 3 75  ? 2.430   12.495  26.093  1.00 34.67  ? 73  ARG R CZ    1 
ATOM   1409 N NH1   . ARG C 3 75  ? 2.890   13.155  25.040  1.00 43.60  ? 73  ARG R NH1   1 
ATOM   1410 N NH2   . ARG C 3 75  ? 1.328   11.767  25.985  1.00 44.37  ? 73  ARG R NH2   1 
ATOM   1411 N N     . ILE C 3 76  ? 7.961   16.230  27.519  1.00 37.56  ? 74  ILE R N     1 
ATOM   1412 C CA    . ILE C 3 76  ? 8.993   17.191  27.898  1.00 27.91  ? 74  ILE R CA    1 
ATOM   1413 C C     . ILE C 3 76  ? 9.434   16.990  29.347  1.00 26.66  ? 74  ILE R C     1 
ATOM   1414 O O     . ILE C 3 76  ? 8.612   16.768  30.235  1.00 38.35  ? 74  ILE R O     1 
ATOM   1415 C CB    . ILE C 3 76  ? 8.525   18.647  27.709  1.00 31.88  ? 74  ILE R CB    1 
ATOM   1416 C CG1   . ILE C 3 76  ? 7.806   18.811  26.370  1.00 25.21  ? 74  ILE R CG1   1 
ATOM   1417 C CG2   . ILE C 3 76  ? 9.703   19.603  27.805  1.00 25.44  ? 74  ILE R CG2   1 
ATOM   1418 C CD1   . ILE C 3 76  ? 7.380   20.238  26.085  1.00 34.03  ? 74  ILE R CD1   1 
ATOM   1419 N N     . SER C 3 77  ? 10.740  17.053  29.572  1.00 30.80  ? 75  SER R N     1 
ATOM   1420 C CA    . SER C 3 77  ? 11.299  16.982  30.913  1.00 35.59  ? 75  SER R CA    1 
ATOM   1421 C C     . SER C 3 77  ? 12.387  18.036  31.013  1.00 33.87  ? 75  SER R C     1 
ATOM   1422 O O     . SER C 3 77  ? 13.545  17.779  30.687  1.00 28.11  ? 75  SER R O     1 
ATOM   1423 C CB    . SER C 3 77  ? 11.869  15.591  31.197  1.00 32.60  ? 75  SER R CB    1 
ATOM   1424 O OG    . SER C 3 77  ? 12.375  15.503  32.519  1.00 43.73  ? 75  SER R OG    1 
ATOM   1425 N N     . GLY C 3 78  ? 12.003  19.230  31.452  1.00 40.42  ? 76  GLY R N     1 
ATOM   1426 C CA    . GLY C 3 78  ? 12.912  20.357  31.463  1.00 36.34  ? 76  GLY R CA    1 
ATOM   1427 C C     . GLY C 3 78  ? 13.126  20.860  30.050  1.00 38.67  ? 76  GLY R C     1 
ATOM   1428 O O     . GLY C 3 78  ? 12.194  21.342  29.404  1.00 39.47  ? 76  GLY R O     1 
ATOM   1429 N N     . LYS C 3 79  ? 14.356  20.746  29.566  1.00 36.09  ? 77  LYS R N     1 
ATOM   1430 C CA    . LYS C 3 79  ? 14.670  21.134  28.201  1.00 34.21  ? 77  LYS R CA    1 
ATOM   1431 C C     . LYS C 3 79  ? 14.921  19.896  27.349  1.00 36.70  ? 77  LYS R C     1 
ATOM   1432 O O     . LYS C 3 79  ? 15.309  20.001  26.186  1.00 27.30  ? 77  LYS R O     1 
ATOM   1433 C CB    . LYS C 3 79  ? 15.884  22.064  28.182  1.00 34.02  ? 77  LYS R CB    1 
ATOM   1434 C CG    . LYS C 3 79  ? 15.718  23.305  29.045  1.00 40.60  ? 77  LYS R CG    1 
ATOM   1435 C CD    . LYS C 3 79  ? 16.939  24.212  28.973  1.00 48.24  ? 77  LYS R CD    1 
ATOM   1436 C CE    . LYS C 3 79  ? 16.742  25.462  29.817  1.00 41.17  ? 77  LYS R CE    1 
ATOM   1437 N NZ    . LYS C 3 79  ? 17.909  26.383  29.729  1.00 45.64  ? 77  LYS R NZ    1 
ATOM   1438 N N     . PHE C 3 80  ? 14.694  18.726  27.939  1.00 32.37  ? 78  PHE R N     1 
ATOM   1439 C CA    . PHE C 3 80  ? 14.878  17.459  27.239  1.00 25.28  ? 78  PHE R CA    1 
ATOM   1440 C C     . PHE C 3 80  ? 13.566  16.938  26.671  1.00 31.38  ? 78  PHE R C     1 
ATOM   1441 O O     . PHE C 3 80  ? 12.492  17.233  27.192  1.00 38.95  ? 78  PHE R O     1 
ATOM   1442 C CB    . PHE C 3 80  ? 15.443  16.394  28.181  1.00 23.54  ? 78  PHE R CB    1 
ATOM   1443 C CG    . PHE C 3 80  ? 16.833  16.677  28.666  1.00 29.07  ? 78  PHE R CG    1 
ATOM   1444 C CD1   . PHE C 3 80  ? 17.925  16.473  27.839  1.00 35.10  ? 78  PHE R CD1   1 
ATOM   1445 C CD2   . PHE C 3 80  ? 17.052  17.124  29.959  1.00 46.81  ? 78  PHE R CD2   1 
ATOM   1446 C CE1   . PHE C 3 80  ? 19.210  16.726  28.287  1.00 33.61  ? 78  PHE R CE1   1 
ATOM   1447 C CE2   . PHE C 3 80  ? 18.333  17.377  30.414  1.00 46.83  ? 78  PHE R CE2   1 
ATOM   1448 C CZ    . PHE C 3 80  ? 19.414  17.177  29.577  1.00 36.20  ? 78  PHE R CZ    1 
ATOM   1449 N N     . LEU C 3 81  ? 13.664  16.159  25.600  1.00 27.18  ? 79  LEU R N     1 
ATOM   1450 C CA    . LEU C 3 81  ? 12.540  15.359  25.138  1.00 23.90  ? 79  LEU R CA    1 
ATOM   1451 C C     . LEU C 3 81  ? 12.769  13.927  25.607  1.00 27.55  ? 79  LEU R C     1 
ATOM   1452 O O     . LEU C 3 81  ? 13.895  13.432  25.576  1.00 34.14  ? 79  LEU R O     1 
ATOM   1453 C CB    . LEU C 3 81  ? 12.408  15.420  23.614  1.00 27.35  ? 79  LEU R CB    1 
ATOM   1454 C CG    . LEU C 3 81  ? 11.859  16.740  23.071  1.00 33.81  ? 79  LEU R CG    1 
ATOM   1455 C CD1   . LEU C 3 81  ? 11.747  16.718  21.554  1.00 22.16  ? 79  LEU R CD1   1 
ATOM   1456 C CD2   . LEU C 3 81  ? 10.511  17.037  23.703  1.00 34.83  ? 79  LEU R CD2   1 
ATOM   1457 N N     . VAL C 3 82  ? 11.709  13.269  26.061  1.00 24.11  ? 80  VAL R N     1 
ATOM   1458 C CA    . VAL C 3 82  ? 11.819  11.901  26.554  1.00 24.64  ? 80  VAL R CA    1 
ATOM   1459 C C     . VAL C 3 82  ? 10.888  10.957  25.797  1.00 27.90  ? 80  VAL R C     1 
ATOM   1460 O O     . VAL C 3 82  ? 9.761   11.318  25.460  1.00 30.31  ? 80  VAL R O     1 
ATOM   1461 C CB    . VAL C 3 82  ? 11.520  11.820  28.064  1.00 22.07  ? 80  VAL R CB    1 
ATOM   1462 C CG1   . VAL C 3 82  ? 11.543  10.376  28.535  1.00 25.62  ? 80  VAL R CG1   1 
ATOM   1463 C CG2   . VAL C 3 82  ? 12.527  12.641  28.840  1.00 29.84  ? 80  VAL R CG2   1 
ATOM   1464 N N     . TYR C 3 83  ? 11.367  9.746   25.533  1.00 21.42  ? 81  TYR R N     1 
ATOM   1465 C CA    . TYR C 3 83  ? 10.576  8.750   24.824  1.00 21.04  ? 81  TYR R CA    1 
ATOM   1466 C C     . TYR C 3 83  ? 10.668  7.399   25.529  1.00 29.91  ? 81  TYR R C     1 
ATOM   1467 O O     . TYR C 3 83  ? 11.673  7.094   26.171  1.00 28.08  ? 81  TYR R O     1 
ATOM   1468 C CB    . TYR C 3 83  ? 11.066  8.611   23.384  1.00 21.69  ? 81  TYR R CB    1 
ATOM   1469 C CG    . TYR C 3 83  ? 11.177  9.910   22.617  1.00 18.33  ? 81  TYR R CG    1 
ATOM   1470 C CD1   . TYR C 3 83  ? 12.264  10.752  22.792  1.00 18.52  ? 81  TYR R CD1   1 
ATOM   1471 C CD2   . TYR C 3 83  ? 10.210  10.280  21.695  1.00 12.13  ? 81  TYR R CD2   1 
ATOM   1472 C CE1   . TYR C 3 83  ? 12.376  11.933  22.080  1.00 20.20  ? 81  TYR R CE1   1 
ATOM   1473 C CE2   . TYR C 3 83  ? 10.315  11.459  20.980  1.00 11.98  ? 81  TYR R CE2   1 
ATOM   1474 C CZ    . TYR C 3 83  ? 11.400  12.280  21.177  1.00 18.22  ? 81  TYR R CZ    1 
ATOM   1475 O OH    . TYR C 3 83  ? 11.508  13.455  20.469  1.00 24.62  ? 81  TYR R OH    1 
ATOM   1476 N N     . ARG C 3 84  ? 9.624   6.587   25.400  1.00 31.31  ? 82  ARG R N     1 
ATOM   1477 C CA    . ARG C 3 84  ? 9.592   5.279   26.044  1.00 26.49  ? 82  ARG R CA    1 
ATOM   1478 C C     . ARG C 3 84  ? 9.440   4.157   25.025  1.00 29.93  ? 82  ARG R C     1 
ATOM   1479 O O     . ARG C 3 84  ? 8.606   4.239   24.126  1.00 36.32  ? 82  ARG R O     1 
ATOM   1480 C CB    . ARG C 3 84  ? 8.458   5.224   27.069  1.00 33.62  ? 82  ARG R CB    1 
ATOM   1481 C CG    . ARG C 3 84  ? 8.541   6.323   28.112  1.00 40.79  ? 82  ARG R CG    1 
ATOM   1482 C CD    . ARG C 3 84  ? 8.202   5.799   29.489  1.00 42.04  ? 82  ARG R CD    1 
ATOM   1483 N NE    . ARG C 3 84  ? 6.767   5.621   29.663  1.00 57.14  ? 82  ARG R NE    1 
ATOM   1484 C CZ    . ARG C 3 84  ? 6.221   4.756   30.510  1.00 57.90  ? 82  ARG R CZ    1 
ATOM   1485 N NH1   . ARG C 3 84  ? 6.993   3.978   31.256  1.00 55.16  ? 82  ARG R NH1   1 
ATOM   1486 N NH2   . ARG C 3 84  ? 4.904   4.666   30.603  1.00 58.82  ? 82  ARG R NH2   1 
ATOM   1487 N N     . GLU C 3 85  ? 10.253  3.114   25.161  1.00 30.05  ? 83  GLU R N     1 
ATOM   1488 C CA    . GLU C 3 85  ? 10.160  1.969   24.263  1.00 35.56  ? 83  GLU R CA    1 
ATOM   1489 C C     . GLU C 3 85  ? 8.995   1.069   24.660  1.00 45.59  ? 83  GLU R C     1 
ATOM   1490 O O     . GLU C 3 85  ? 8.761   0.830   25.847  1.00 50.93  ? 83  GLU R O     1 
ATOM   1491 C CB    . GLU C 3 85  ? 11.455  1.155   24.263  1.00 37.86  ? 83  GLU R CB    1 
ATOM   1492 C CG    . GLU C 3 85  ? 11.480  0.075   23.189  1.00 48.36  ? 83  GLU R CG    1 
ATOM   1493 C CD    . GLU C 3 85  ? 12.395  -1.085  23.530  1.00 47.75  ? 83  GLU R CD    1 
ATOM   1494 O OE1   . GLU C 3 85  ? 12.932  -1.113  24.656  1.00 53.45  ? 83  GLU R OE1   1 
ATOM   1495 O OE2   . GLU C 3 85  ? 12.573  -1.974  22.670  1.00 60.31  ? 83  GLU R OE2   1 
ATOM   1496 N N     . TYR C 3 86  ? 8.268   0.571   23.663  1.00 54.96  ? 84  TYR R N     1 
ATOM   1497 C CA    . TYR C 3 86  ? 7.142   -0.324  23.907  1.00 54.04  ? 84  TYR R CA    1 
ATOM   1498 C C     . TYR C 3 86  ? 7.109   -1.493  22.923  1.00 61.91  ? 84  TYR R C     1 
ATOM   1499 O O     . TYR C 3 86  ? 7.469   -1.346  21.755  1.00 58.08  ? 84  TYR R O     1 
ATOM   1500 C CB    . TYR C 3 86  ? 5.817   0.446   23.857  1.00 45.64  ? 84  TYR R CB    1 
ATOM   1501 C CG    . TYR C 3 86  ? 5.460   0.989   22.490  1.00 50.39  ? 84  TYR R CG    1 
ATOM   1502 C CD1   . TYR C 3 86  ? 4.804   0.200   21.557  1.00 53.88  ? 84  TYR R CD1   1 
ATOM   1503 C CD2   . TYR C 3 86  ? 5.765   2.294   22.138  1.00 56.67  ? 84  TYR R CD2   1 
ATOM   1504 C CE1   . TYR C 3 86  ? 4.473   0.692   20.310  1.00 59.87  ? 84  TYR R CE1   1 
ATOM   1505 C CE2   . TYR C 3 86  ? 5.435   2.795   20.892  1.00 53.20  ? 84  TYR R CE2   1 
ATOM   1506 C CZ    . TYR C 3 86  ? 4.790   1.990   19.983  1.00 54.40  ? 84  TYR R CZ    1 
ATOM   1507 O OH    . TYR C 3 86  ? 4.460   2.484   18.741  1.00 54.15  ? 84  TYR R OH    1 
ATOM   1508 N N     . ASN C 3 87  ? 6.674   -2.653  23.410  1.00 83.06  ? 85  ASN R N     1 
ATOM   1509 C CA    . ASN C 3 87  ? 6.482   -3.830  22.569  1.00 75.70  ? 85  ASN R CA    1 
ATOM   1510 C C     . ASN C 3 87  ? 5.087   -4.416  22.755  1.00 82.73  ? 85  ASN R C     1 
ATOM   1511 O O     . ASN C 3 87  ? 4.286   -3.896  23.533  1.00 74.98  ? 85  ASN R O     1 
ATOM   1512 C CB    . ASN C 3 87  ? 7.537   -4.897  22.875  1.00 62.60  ? 85  ASN R CB    1 
ATOM   1513 C CG    . ASN C 3 87  ? 8.928   -4.482  22.449  1.00 70.01  ? 85  ASN R CG    1 
ATOM   1514 O OD1   . ASN C 3 87  ? 9.093   -3.645  21.562  1.00 85.52  ? 85  ASN R OD1   1 
ATOM   1515 N ND2   . ASN C 3 87  ? 9.941   -5.071  23.076  1.00 70.95  ? 85  ASN R ND2   1 
ATOM   1516 N N     . ARG C 3 88  ? 4.801   -5.500  22.041  1.00 90.19  ? 86  ARG R N     1 
ATOM   1517 C CA    . ARG C 3 88  ? 3.529   -6.199  22.188  1.00 94.17  ? 86  ARG R CA    1 
ATOM   1518 C C     . ARG C 3 88  ? 3.717   -7.516  22.938  1.00 98.70  ? 86  ARG R C     1 
ATOM   1519 O O     . ARG C 3 88  ? 4.817   -8.070  22.964  1.00 89.47  ? 86  ARG R O     1 
ATOM   1520 C CB    . ARG C 3 88  ? 2.883   -6.433  20.822  1.00 94.24  ? 86  ARG R CB    1 
ATOM   1521 C CG    . ARG C 3 88  ? 3.865   -6.824  19.731  1.00 92.64  ? 86  ARG R CG    1 
ATOM   1522 C CD    . ARG C 3 88  ? 3.180   -6.864  18.375  1.00 102.02 ? 86  ARG R CD    1 
ATOM   1523 N NE    . ARG C 3 88  ? 2.067   -7.807  18.361  1.00 129.98 ? 86  ARG R NE    1 
ATOM   1524 C CZ    . ARG C 3 88  ? 1.241   -7.972  17.333  1.00 120.73 ? 86  ARG R CZ    1 
ATOM   1525 N NH1   . ARG C 3 88  ? 1.399   -7.251  16.232  1.00 102.91 ? 86  ARG R NH1   1 
ATOM   1526 N NH2   . ARG C 3 88  ? 0.254   -8.855  17.409  1.00 109.07 ? 86  ARG R NH2   1 
ATOM   1527 N N     . LEU C 3 89  ? 2.642   -8.009  23.546  1.00 99.02  ? 87  LEU R N     1 
ATOM   1528 C CA    . LEU C 3 89  ? 2.713   -9.183  24.417  1.00 105.95 ? 87  LEU R CA    1 
ATOM   1529 C C     . LEU C 3 89  ? 2.899   -10.499 23.657  1.00 118.10 ? 87  LEU R C     1 
ATOM   1530 O O     . LEU C 3 89  ? 3.100   -10.504 22.442  1.00 123.94 ? 87  LEU R O     1 
ATOM   1531 C CB    . LEU C 3 89  ? 1.474   -9.258  25.315  1.00 114.35 ? 87  LEU R CB    1 
ATOM   1532 C CG    . LEU C 3 89  ? 1.342   -8.218  26.433  1.00 87.20  ? 87  LEU R CG    1 
ATOM   1533 C CD1   . LEU C 3 89  ? 2.537   -8.286  27.370  1.00 67.85  ? 87  LEU R CD1   1 
ATOM   1534 C CD2   . LEU C 3 89  ? 1.167   -6.809  25.878  1.00 92.12  ? 87  LEU R CD2   1 
ATOM   1535 N N     . GLY C 3 90  ? 2.837   -11.610 24.385  1.00 114.81 ? 88  GLY R N     1 
ATOM   1536 C CA    . GLY C 3 90  ? 3.035   -12.927 23.803  1.00 125.52 ? 88  GLY R CA    1 
ATOM   1537 C C     . GLY C 3 90  ? 1.793   -13.494 23.142  1.00 128.52 ? 88  GLY R C     1 
ATOM   1538 O O     . GLY C 3 90  ? 1.425   -13.084 22.041  1.00 115.31 ? 88  GLY R O     1 
ATOM   1539 N N     . SER C 3 91  ? 1.143   -14.442 23.813  1.00 135.71 ? 89  SER R N     1 
ATOM   1540 C CA    . SER C 3 91  ? 1.582   -14.905 25.125  1.00 131.11 ? 89  SER R CA    1 
ATOM   1541 C C     . SER C 3 91  ? 2.520   -16.102 25.011  1.00 108.55 ? 89  SER R C     1 
ATOM   1542 O O     . SER C 3 91  ? 2.399   -17.071 25.760  1.00 105.29 ? 89  SER R O     1 
ATOM   1543 C CB    . SER C 3 91  ? 0.377   -15.267 25.999  1.00 121.77 ? 89  SER R CB    1 
ATOM   1544 O OG    . SER C 3 91  ? -0.343  -16.360 25.456  1.00 117.52 ? 89  SER R OG    1 
ATOM   1545 N N     . HIS C 3 98  ? 6.680   -15.281 30.873  1.00 96.30  ? 96  HIS R N     1 
ATOM   1546 C CA    . HIS C 3 98  ? 6.754   -13.895 30.422  1.00 132.68 ? 96  HIS R CA    1 
ATOM   1547 C C     . HIS C 3 98  ? 5.709   -13.020 31.109  1.00 137.70 ? 96  HIS R C     1 
ATOM   1548 O O     . HIS C 3 98  ? 4.507   -13.243 30.961  1.00 130.46 ? 96  HIS R O     1 
ATOM   1549 C CB    . HIS C 3 98  ? 6.583   -13.818 28.902  1.00 138.51 ? 96  HIS R CB    1 
ATOM   1550 C CG    . HIS C 3 98  ? 6.284   -12.440 28.398  1.00 146.35 ? 96  HIS R CG    1 
ATOM   1551 N ND1   . HIS C 3 98  ? 7.146   -11.379 28.565  1.00 146.50 ? 96  HIS R ND1   1 
ATOM   1552 C CD2   . HIS C 3 98  ? 5.210   -11.951 27.730  1.00 132.95 ? 96  HIS R CD2   1 
ATOM   1553 C CE1   . HIS C 3 98  ? 6.620   -10.296 28.023  1.00 124.63 ? 96  HIS R CE1   1 
ATOM   1554 N NE2   . HIS C 3 98  ? 5.446   -10.614 27.509  1.00 124.09 ? 96  HIS R NE2   1 
ATOM   1555 N N     . ASN C 3 99  ? 6.173   -12.025 31.861  1.00 138.86 ? 97  ASN R N     1 
ATOM   1556 C CA    . ASN C 3 99  ? 5.271   -11.089 32.523  1.00 136.55 ? 97  ASN R CA    1 
ATOM   1557 C C     . ASN C 3 99  ? 5.931   -9.747  32.832  1.00 136.85 ? 97  ASN R C     1 
ATOM   1558 O O     . ASN C 3 99  ? 7.149   -9.663  33.000  1.00 130.72 ? 97  ASN R O     1 
ATOM   1559 C CB    . ASN C 3 99  ? 4.699   -11.699 33.806  1.00 126.65 ? 97  ASN R CB    1 
ATOM   1560 C CG    . ASN C 3 99  ? 5.597   -11.478 35.008  1.00 120.47 ? 97  ASN R CG    1 
ATOM   1561 O OD1   . ASN C 3 99  ? 5.440   -10.503 35.744  1.00 123.20 ? 97  ASN R OD1   1 
ATOM   1562 N ND2   . ASN C 3 99  ? 6.544   -12.386 35.215  1.00 109.65 ? 97  ASN R ND2   1 
ATOM   1563 N N     . VAL C 3 100 ? 5.113   -8.703  32.904  1.00 134.60 ? 98  VAL R N     1 
ATOM   1564 C CA    . VAL C 3 100 ? 5.587   -7.362  33.224  1.00 124.57 ? 98  VAL R CA    1 
ATOM   1565 C C     . VAL C 3 100 ? 4.561   -6.639  34.089  1.00 113.82 ? 98  VAL R C     1 
ATOM   1566 O O     . VAL C 3 100 ? 3.389   -7.017  34.106  1.00 116.00 ? 98  VAL R O     1 
ATOM   1567 C CB    . VAL C 3 100 ? 5.850   -6.536  31.950  1.00 111.31 ? 98  VAL R CB    1 
ATOM   1568 C CG1   . VAL C 3 100 ? 6.936   -7.187  31.107  1.00 98.85  ? 98  VAL R CG1   1 
ATOM   1569 C CG2   . VAL C 3 100 ? 4.567   -6.378  31.147  1.00 93.12  ? 98  VAL R CG2   1 
ATOM   1570 N N     . PRO C 3 101 ? 5.004   -5.600  34.814  1.00 116.75 ? 99  PRO R N     1 
ATOM   1571 C CA    . PRO C 3 101 ? 4.157   -4.783  35.693  1.00 109.63 ? 99  PRO R CA    1 
ATOM   1572 C C     . PRO C 3 101 ? 2.863   -4.324  35.017  1.00 102.68 ? 99  PRO R C     1 
ATOM   1573 O O     . PRO C 3 101 ? 2.836   -4.139  33.802  1.00 107.99 ? 99  PRO R O     1 
ATOM   1574 C CB    . PRO C 3 101 ? 5.046   -3.578  35.996  1.00 97.84  ? 99  PRO R CB    1 
ATOM   1575 C CG    . PRO C 3 101 ? 6.428   -4.125  35.941  1.00 106.92 ? 99  PRO R CG    1 
ATOM   1576 C CD    . PRO C 3 101 ? 6.413   -5.168  34.852  1.00 103.95 ? 99  PRO R CD    1 
ATOM   1577 N N     . GLU C 3 102 ? 1.809   -4.141  35.809  1.00 97.37  ? 100 GLU R N     1 
ATOM   1578 C CA    . GLU C 3 102 ? 0.491   -3.784  35.287  1.00 105.51 ? 100 GLU R CA    1 
ATOM   1579 C C     . GLU C 3 102 ? 0.435   -2.373  34.699  1.00 109.39 ? 100 GLU R C     1 
ATOM   1580 O O     . GLU C 3 102 ? -0.001  -2.183  33.563  1.00 100.57 ? 100 GLU R O     1 
ATOM   1581 C CB    . GLU C 3 102 ? -0.571  -3.935  36.380  1.00 100.27 ? 100 GLU R CB    1 
ATOM   1582 C CG    . GLU C 3 102 ? -1.963  -3.498  35.954  1.00 105.34 ? 100 GLU R CG    1 
ATOM   1583 C CD    . GLU C 3 102 ? -2.470  -4.270  34.752  1.00 109.35 ? 100 GLU R CD    1 
ATOM   1584 O OE1   . GLU C 3 102 ? -3.217  -3.685  33.940  1.00 103.75 ? 100 GLU R OE1   1 
ATOM   1585 O OE2   . GLU C 3 102 ? -2.122  -5.463  34.621  1.00 88.21  ? 100 GLU R OE2   1 
ATOM   1586 N N     . TYR C 3 103 ? 0.869   -1.392  35.485  1.00 111.02 ? 101 TYR R N     1 
ATOM   1587 C CA    . TYR C 3 103 ? 0.852   0.015   35.080  1.00 103.18 ? 101 TYR R CA    1 
ATOM   1588 C C     . TYR C 3 103 ? 1.611   0.281   33.780  1.00 106.06 ? 101 TYR R C     1 
ATOM   1589 O O     . TYR C 3 103 ? 1.298   1.224   33.053  1.00 108.80 ? 101 TYR R O     1 
ATOM   1590 C CB    . TYR C 3 103 ? 1.382   0.914   36.210  1.00 105.28 ? 101 TYR R CB    1 
ATOM   1591 C CG    . TYR C 3 103 ? 2.767   0.558   36.727  1.00 114.86 ? 101 TYR R CG    1 
ATOM   1592 C CD1   . TYR C 3 103 ? 3.045   -0.712  37.220  1.00 109.05 ? 101 TYR R CD1   1 
ATOM   1593 C CD2   . TYR C 3 103 ? 3.786   1.502   36.754  1.00 110.27 ? 101 TYR R CD2   1 
ATOM   1594 C CE1   . TYR C 3 103 ? 4.297   -1.039  37.697  1.00 104.26 ? 101 TYR R CE1   1 
ATOM   1595 C CE2   . TYR C 3 103 ? 5.046   1.182   37.235  1.00 108.32 ? 101 TYR R CE2   1 
ATOM   1596 C CZ    . TYR C 3 103 ? 5.294   -0.091  37.704  1.00 110.84 ? 101 TYR R CZ    1 
ATOM   1597 O OH    . TYR C 3 103 ? 6.542   -0.420  38.183  1.00 107.92 ? 101 TYR R OH    1 
ATOM   1598 N N     . ASN C 3 104 ? 2.603   -0.556  33.491  1.00 104.15 ? 102 ASN R N     1 
ATOM   1599 C CA    . ASN C 3 104 ? 3.408   -0.411  32.281  1.00 99.41  ? 102 ASN R CA    1 
ATOM   1600 C C     . ASN C 3 104 ? 2.759   -1.037  31.048  1.00 93.66  ? 102 ASN R C     1 
ATOM   1601 O O     . ASN C 3 104 ? 3.309   -0.974  29.949  1.00 85.64  ? 102 ASN R O     1 
ATOM   1602 C CB    . ASN C 3 104 ? 4.806   -0.998  32.495  1.00 91.52  ? 102 ASN R CB    1 
ATOM   1603 C CG    . ASN C 3 104 ? 5.755   -0.023  33.166  1.00 91.88  ? 102 ASN R CG    1 
ATOM   1604 O OD1   . ASN C 3 104 ? 5.367   1.085   33.539  1.00 94.15  ? 102 ASN R OD1   1 
ATOM   1605 N ND2   . ASN C 3 104 ? 7.009   -0.433  33.323  1.00 78.38  ? 102 ASN R ND2   1 
ATOM   1606 N N     . ILE C 3 105 ? 1.590   -1.642  31.235  1.00 91.31  ? 103 ILE R N     1 
ATOM   1607 C CA    . ILE C 3 105 ? 0.868   -2.256  30.126  1.00 93.03  ? 103 ILE R CA    1 
ATOM   1608 C C     . ILE C 3 105 ? -0.279  -1.362  29.665  1.00 78.00  ? 103 ILE R C     1 
ATOM   1609 O O     . ILE C 3 105 ? -1.038  -0.836  30.480  1.00 85.39  ? 103 ILE R O     1 
ATOM   1610 C CB    . ILE C 3 105 ? 0.307   -3.642  30.504  1.00 95.28  ? 103 ILE R CB    1 
ATOM   1611 C CG1   . ILE C 3 105 ? 1.370   -4.471  31.228  1.00 101.18 ? 103 ILE R CG1   1 
ATOM   1612 C CG2   . ILE C 3 105 ? -0.191  -4.370  29.264  1.00 72.80  ? 103 ILE R CG2   1 
ATOM   1613 C CD1   . ILE C 3 105 ? 0.830   -5.731  31.872  1.00 89.72  ? 103 ILE R CD1   1 
ATOM   1614 N N     . PHE C 3 106 ? -0.394  -1.187  28.353  1.00 77.58  ? 104 PHE R N     1 
ATOM   1615 C CA    . PHE C 3 106 ? -1.468  -0.386  27.779  1.00 83.33  ? 104 PHE R CA    1 
ATOM   1616 C C     . PHE C 3 106 ? -1.997  -1.053  26.516  1.00 91.52  ? 104 PHE R C     1 
ATOM   1617 O O     . PHE C 3 106 ? -1.444  -2.047  26.053  1.00 88.14  ? 104 PHE R O     1 
ATOM   1618 C CB    . PHE C 3 106 ? -0.985  1.034   27.470  1.00 71.63  ? 104 PHE R CB    1 
ATOM   1619 C CG    . PHE C 3 106 ? -0.040  1.116   26.304  1.00 86.54  ? 104 PHE R CG    1 
ATOM   1620 C CD1   . PHE C 3 106 ? 1.321   0.926   26.482  1.00 77.06  ? 104 PHE R CD1   1 
ATOM   1621 C CD2   . PHE C 3 106 ? -0.511  1.392   25.030  1.00 96.89  ? 104 PHE R CD2   1 
ATOM   1622 C CE1   . PHE C 3 106 ? 2.192   1.004   25.410  1.00 74.11  ? 104 PHE R CE1   1 
ATOM   1623 C CE2   . PHE C 3 106 ? 0.355   1.471   23.956  1.00 77.96  ? 104 PHE R CE2   1 
ATOM   1624 C CZ    . PHE C 3 106 ? 1.709   1.277   24.146  1.00 71.06  ? 104 PHE R CZ    1 
ATOM   1625 N N     . GLU C 3 107 ? -3.067  -0.503  25.957  1.00 95.97  ? 105 GLU R N     1 
ATOM   1626 C CA    . GLU C 3 107 ? -3.692  -1.114  24.793  1.00 102.61 ? 105 GLU R CA    1 
ATOM   1627 C C     . GLU C 3 107 ? -4.195  -0.089  23.785  1.00 102.46 ? 105 GLU R C     1 
ATOM   1628 O O     . GLU C 3 107 ? -5.291  0.450   23.926  1.00 113.98 ? 105 GLU R O     1 
ATOM   1629 C CB    . GLU C 3 107 ? -4.832  -2.038  25.228  1.00 117.19 ? 105 GLU R CB    1 
ATOM   1630 C CG    . GLU C 3 107 ? -5.728  -1.448  26.307  1.00 111.73 ? 105 GLU R CG    1 
ATOM   1631 C CD    . GLU C 3 107 ? -6.711  -2.456  26.874  1.00 116.32 ? 105 GLU R CD    1 
ATOM   1632 O OE1   . GLU C 3 107 ? -6.867  -3.541  26.276  1.00 115.51 ? 105 GLU R OE1   1 
ATOM   1633 O OE2   . GLU C 3 107 ? -7.324  -2.164  27.923  1.00 125.37 ? 105 GLU R OE2   1 
ATOM   1634 N N     . ARG C 3 108 ? -3.379  0.182   22.773  1.00 100.31 ? 106 ARG R N     1 
ATOM   1635 C CA    . ARG C 3 108 ? -3.821  0.977   21.641  1.00 107.35 ? 106 ARG R CA    1 
ATOM   1636 C C     . ARG C 3 108 ? -4.666  0.058   20.776  1.00 121.22 ? 106 ARG R C     1 
ATOM   1637 O O     . ARG C 3 108 ? -4.128  -0.803  20.078  1.00 116.13 ? 106 ARG R O     1 
ATOM   1638 C CB    . ARG C 3 108 ? -2.622  1.491   20.845  1.00 102.19 ? 106 ARG R CB    1 
ATOM   1639 C CG    . ARG C 3 108 ? -2.908  2.729   20.013  1.00 101.26 ? 106 ARG R CG    1 
ATOM   1640 C CD    . ARG C 3 108 ? -3.379  3.871   20.895  1.00 102.70 ? 106 ARG R CD    1 
ATOM   1641 N NE    . ARG C 3 108 ? -2.723  3.844   22.200  1.00 103.99 ? 106 ARG R NE    1 
ATOM   1642 C CZ    . ARG C 3 108 ? -2.756  4.842   23.076  1.00 102.31 ? 106 ARG R CZ    1 
ATOM   1643 N NH1   . ARG C 3 108 ? -3.406  5.961   22.787  1.00 95.63  ? 106 ARG R NH1   1 
ATOM   1644 N NH2   . ARG C 3 108 ? -2.131  4.723   24.240  1.00 81.72  ? 106 ARG R NH2   1 
ATOM   1645 N N     . ALA C 3 109 ? -5.985  0.230   20.846  1.00 122.78 ? 107 ALA R N     1 
ATOM   1646 C CA    . ALA C 3 109 ? -6.932  -0.659  20.171  1.00 133.27 ? 107 ALA R CA    1 
ATOM   1647 C C     . ALA C 3 109 ? -6.527  -0.964  18.731  1.00 131.19 ? 107 ALA R C     1 
ATOM   1648 O O     . ALA C 3 109 ? -6.120  -0.069  17.990  1.00 114.29 ? 107 ALA R O     1 
ATOM   1649 C CB    . ALA C 3 109 ? -8.338  -0.072  20.220  1.00 118.87 ? 107 ALA R CB    1 
ATOM   1650 N N     . HIS C 3 110 ? -6.635  -2.232  18.341  1.00 126.27 ? 108 HIS R N     1 
ATOM   1651 C CA    . HIS C 3 110 ? -7.192  -3.268  19.207  1.00 134.13 ? 108 HIS R CA    1 
ATOM   1652 C C     . HIS C 3 110 ? -6.136  -3.993  20.046  1.00 134.20 ? 108 HIS R C     1 
ATOM   1653 O O     . HIS C 3 110 ? -6.445  -4.531  21.110  1.00 121.58 ? 108 HIS R O     1 
ATOM   1654 C CB    . HIS C 3 110 ? -7.975  -4.289  18.375  1.00 135.61 ? 108 HIS R CB    1 
ATOM   1655 C CG    . HIS C 3 110 ? -9.204  -3.728  17.727  1.00 136.45 ? 108 HIS R CG    1 
ATOM   1656 N ND1   . HIS C 3 110 ? -9.242  -2.475  17.160  1.00 130.31 ? 108 HIS R ND1   1 
ATOM   1657 C CD2   . HIS C 3 110 ? -10.440 -4.257  17.555  1.00 119.79 ? 108 HIS R CD2   1 
ATOM   1658 C CE1   . HIS C 3 110 ? -10.449 -2.251  16.667  1.00 118.84 ? 108 HIS R CE1   1 
ATOM   1659 N NE2   . HIS C 3 110 ? -11.193 -3.318  16.895  1.00 115.07 ? 108 HIS R NE2   1 
ATOM   1660 N N     . ARG C 3 111 ? -4.894  -4.002  19.569  1.00 132.76 ? 109 ARG R N     1 
ATOM   1661 C CA    . ARG C 3 111 ? -3.829  -4.784  20.199  1.00 121.36 ? 109 ARG R CA    1 
ATOM   1662 C C     . ARG C 3 111 ? -3.317  -4.214  21.526  1.00 119.94 ? 109 ARG R C     1 
ATOM   1663 O O     . ARG C 3 111 ? -3.507  -3.035  21.827  1.00 113.03 ? 109 ARG R O     1 
ATOM   1664 C CB    . ARG C 3 111 ? -2.655  -4.926  19.228  1.00 20.00  ? 109 ARG R CB    1 
ATOM   1665 N N     . LYS C 3 112 ? -2.662  -5.068  22.309  1.00 107.92 ? 110 LYS R N     1 
ATOM   1666 C CA    . LYS C 3 112 ? -2.126  -4.679  23.613  1.00 112.67 ? 110 LYS R CA    1 
ATOM   1667 C C     . LYS C 3 112 ? -0.601  -4.558  23.608  1.00 111.90 ? 110 LYS R C     1 
ATOM   1668 O O     . LYS C 3 112 ? 0.101   -5.429  23.091  1.00 94.39  ? 110 LYS R O     1 
ATOM   1669 C CB    . LYS C 3 112 ? -2.562  -5.674  24.694  1.00 114.97 ? 110 LYS R CB    1 
ATOM   1670 C CG    . LYS C 3 112 ? -3.728  -5.200  25.552  1.00 110.41 ? 110 LYS R CG    1 
ATOM   1671 C CD    . LYS C 3 112 ? -3.859  -6.044  26.814  1.00 105.48 ? 110 LYS R CD    1 
ATOM   1672 C CE    . LYS C 3 112 ? -4.843  -5.432  27.800  1.00 99.34  ? 110 LYS R CE    1 
ATOM   1673 N NZ    . LYS C 3 112 ? -4.822  -6.129  29.119  1.00 64.10  ? 110 LYS R NZ    1 
ATOM   1674 N N     . TYR C 3 113 ? -0.096  -3.479  24.201  1.00 111.75 ? 111 TYR R N     1 
ATOM   1675 C CA    . TYR C 3 113 ? 1.342   -3.224  24.254  1.00 94.20  ? 111 TYR R CA    1 
ATOM   1676 C C     . TYR C 3 113 ? 1.837   -3.003  25.685  1.00 93.62  ? 111 TYR R C     1 
ATOM   1677 O O     . TYR C 3 113 ? 1.044   -2.922  26.623  1.00 99.57  ? 111 TYR R O     1 
ATOM   1678 C CB    . TYR C 3 113 ? 1.701   -2.016  23.385  1.00 84.22  ? 111 TYR R CB    1 
ATOM   1679 C CG    . TYR C 3 113 ? 1.368   -2.187  21.920  1.00 85.73  ? 111 TYR R CG    1 
ATOM   1680 C CD1   . TYR C 3 113 ? 2.161   -2.971  21.097  1.00 84.22  ? 111 TYR R CD1   1 
ATOM   1681 C CD2   . TYR C 3 113 ? 0.266   -1.555  21.358  1.00 91.16  ? 111 TYR R CD2   1 
ATOM   1682 C CE1   . TYR C 3 113 ? 1.865   -3.128  19.757  1.00 92.73  ? 111 TYR R CE1   1 
ATOM   1683 C CE2   . TYR C 3 113 ? -0.039  -1.707  20.017  1.00 84.77  ? 111 TYR R CE2   1 
ATOM   1684 C CZ    . TYR C 3 113 ? 0.765   -2.495  19.222  1.00 88.99  ? 111 TYR R CZ    1 
ATOM   1685 O OH    . TYR C 3 113 ? 0.470   -2.652  17.887  1.00 85.24  ? 111 TYR R OH    1 
ATOM   1686 N N     . PHE C 3 114 ? 3.154   -2.910  25.848  1.00 78.41  ? 112 PHE R N     1 
ATOM   1687 C CA    . PHE C 3 114 ? 3.742   -2.667  27.163  1.00 72.81  ? 112 PHE R CA    1 
ATOM   1688 C C     . PHE C 3 114 ? 5.049   -1.889  27.064  1.00 74.69  ? 112 PHE R C     1 
ATOM   1689 O O     . PHE C 3 114 ? 5.750   -1.955  26.055  1.00 66.95  ? 112 PHE R O     1 
ATOM   1690 C CB    . PHE C 3 114 ? 3.976   -3.986  27.907  1.00 72.41  ? 112 PHE R CB    1 
ATOM   1691 C CG    . PHE C 3 114 ? 5.124   -4.797  27.368  1.00 67.75  ? 112 PHE R CG    1 
ATOM   1692 C CD1   . PHE C 3 114 ? 5.019   -5.454  26.154  1.00 72.75  ? 112 PHE R CD1   1 
ATOM   1693 C CD2   . PHE C 3 114 ? 6.305   -4.912  28.085  1.00 56.86  ? 112 PHE R CD2   1 
ATOM   1694 C CE1   . PHE C 3 114 ? 6.073   -6.204  25.659  1.00 69.87  ? 112 PHE R CE1   1 
ATOM   1695 C CE2   . PHE C 3 114 ? 7.361   -5.662  27.595  1.00 61.42  ? 112 PHE R CE2   1 
ATOM   1696 C CZ    . PHE C 3 114 ? 7.245   -6.308  26.380  1.00 61.06  ? 112 PHE R CZ    1 
ATOM   1697 N N     . TYR C 3 115 ? 5.372   -1.149  28.120  1.00 79.99  ? 113 TYR R N     1 
ATOM   1698 C CA    . TYR C 3 115 ? 6.622   -0.404  28.174  1.00 49.63  ? 113 TYR R CA    1 
ATOM   1699 C C     . TYR C 3 115 ? 7.749   -1.277  28.719  1.00 54.27  ? 113 TYR R C     1 
ATOM   1700 O O     . TYR C 3 115 ? 7.599   -1.934  29.749  1.00 67.33  ? 113 TYR R O     1 
ATOM   1701 C CB    . TYR C 3 115 ? 6.452   0.871   29.003  1.00 48.67  ? 113 TYR R CB    1 
ATOM   1702 C CG    . TYR C 3 115 ? 5.520   1.877   28.361  1.00 56.88  ? 113 TYR R CG    1 
ATOM   1703 C CD1   . TYR C 3 115 ? 5.867   2.511   27.178  1.00 60.87  ? 113 TYR R CD1   1 
ATOM   1704 C CD2   . TYR C 3 115 ? 4.296   2.188   28.933  1.00 47.95  ? 113 TYR R CD2   1 
ATOM   1705 C CE1   . TYR C 3 115 ? 5.022   3.427   26.581  1.00 54.39  ? 113 TYR R CE1   1 
ATOM   1706 C CE2   . TYR C 3 115 ? 3.444   3.108   28.341  1.00 53.57  ? 113 TYR R CE2   1 
ATOM   1707 C CZ    . TYR C 3 115 ? 3.814   3.723   27.166  1.00 49.26  ? 113 TYR R CZ    1 
ATOM   1708 O OH    . TYR C 3 115 ? 2.978   4.637   26.568  1.00 61.79  ? 113 TYR R OH    1 
ATOM   1709 N N     . THR C 3 116 ? 8.876   -1.282  28.014  1.00 44.57  ? 114 THR R N     1 
ATOM   1710 C CA    . THR C 3 116 ? 9.988   -2.171  28.336  1.00 43.44  ? 114 THR R CA    1 
ATOM   1711 C C     . THR C 3 116 ? 10.831  -1.668  29.506  1.00 50.74  ? 114 THR R C     1 
ATOM   1712 O O     . THR C 3 116 ? 11.412  -2.459  30.247  1.00 50.50  ? 114 THR R O     1 
ATOM   1713 C CB    . THR C 3 116 ? 10.898  -2.384  27.115  1.00 37.13  ? 114 THR R CB    1 
ATOM   1714 O OG1   . THR C 3 116 ? 11.535  -1.148  26.772  1.00 55.69  ? 114 THR R OG1   1 
ATOM   1715 C CG2   . THR C 3 116 ? 10.082  -2.875  25.927  1.00 53.09  ? 114 THR R CG2   1 
ATOM   1716 N N     . GLY C 3 117 ? 10.897  -0.352  29.665  1.00 49.47  ? 115 GLY R N     1 
ATOM   1717 C CA    . GLY C 3 117 ? 11.711  0.240   30.708  1.00 40.34  ? 115 GLY R CA    1 
ATOM   1718 C C     . GLY C 3 117 ? 12.869  1.024   30.123  1.00 44.76  ? 115 GLY R C     1 
ATOM   1719 O O     . GLY C 3 117 ? 13.443  1.890   30.784  1.00 50.42  ? 115 GLY R O     1 
ATOM   1720 N N     . LEU C 3 118 ? 13.216  0.714   28.878  1.00 41.79  ? 116 LEU R N     1 
ATOM   1721 C CA    . LEU C 3 118 ? 14.248  1.460   28.170  1.00 37.82  ? 116 LEU R CA    1 
ATOM   1722 C C     . LEU C 3 118 ? 13.739  2.867   27.870  1.00 38.21  ? 116 LEU R C     1 
ATOM   1723 O O     . LEU C 3 118 ? 12.564  3.058   27.552  1.00 34.50  ? 116 LEU R O     1 
ATOM   1724 C CB    . LEU C 3 118 ? 14.633  0.754   26.871  1.00 31.02  ? 116 LEU R CB    1 
ATOM   1725 C CG    . LEU C 3 118 ? 15.730  1.437   26.050  1.00 41.20  ? 116 LEU R CG    1 
ATOM   1726 C CD1   . LEU C 3 118 ? 17.067  1.351   26.768  1.00 21.98  ? 116 LEU R CD1   1 
ATOM   1727 C CD2   . LEU C 3 118 ? 15.825  0.847   24.648  1.00 20.36  ? 116 LEU R CD2   1 
ATOM   1728 N N     . LEU C 3 119 ? 14.626  3.848   27.980  1.00 30.22  ? 117 LEU R N     1 
ATOM   1729 C CA    . LEU C 3 119 ? 14.253  5.243   27.787  1.00 26.90  ? 117 LEU R CA    1 
ATOM   1730 C C     . LEU C 3 119 ? 15.279  5.988   26.937  1.00 27.74  ? 117 LEU R C     1 
ATOM   1731 O O     . LEU C 3 119 ? 16.457  5.632   26.911  1.00 28.97  ? 117 LEU R O     1 
ATOM   1732 C CB    . LEU C 3 119 ? 14.098  5.938   29.142  1.00 33.39  ? 117 LEU R CB    1 
ATOM   1733 C CG    . LEU C 3 119 ? 12.944  5.476   30.033  1.00 35.59  ? 117 LEU R CG    1 
ATOM   1734 C CD1   . LEU C 3 119 ? 13.197  5.866   31.477  1.00 31.57  ? 117 LEU R CD1   1 
ATOM   1735 C CD2   . LEU C 3 119 ? 11.639  6.076   29.549  1.00 28.08  ? 117 LEU R CD2   1 
ATOM   1736 N N     . LYS C 3 120 ? 14.821  7.024   26.242  1.00 24.51  ? 118 LYS R N     1 
ATOM   1737 C CA    . LYS C 3 120 ? 15.705  7.889   25.470  1.00 18.35  ? 118 LYS R CA    1 
ATOM   1738 C C     . LYS C 3 120 ? 15.382  9.350   25.749  1.00 22.08  ? 118 LYS R C     1 
ATOM   1739 O O     . LYS C 3 120 ? 14.213  9.739   25.778  1.00 33.31  ? 118 LYS R O     1 
ATOM   1740 C CB    . LYS C 3 120 ? 15.581  7.595   23.969  1.00 21.76  ? 118 LYS R CB    1 
ATOM   1741 C CG    . LYS C 3 120 ? 16.033  8.737   23.066  1.00 22.98  ? 118 LYS R CG    1 
ATOM   1742 C CD    . LYS C 3 120 ? 16.107  8.313   21.601  1.00 20.34  ? 118 LYS R CD    1 
ATOM   1743 C CE    . LYS C 3 120 ? 14.759  7.848   21.077  1.00 30.06  ? 118 LYS R CE    1 
ATOM   1744 N NZ    . LYS C 3 120 ? 14.831  7.453   19.640  1.00 21.78  ? 118 LYS R NZ    1 
ATOM   1745 N N     . LYS C 3 121 ? 16.417  10.153  25.969  1.00 18.68  ? 119 LYS R N     1 
ATOM   1746 C CA    . LYS C 3 121 ? 16.236  11.593  26.116  1.00 28.22  ? 119 LYS R CA    1 
ATOM   1747 C C     . LYS C 3 121 ? 17.120  12.329  25.117  1.00 26.24  ? 119 LYS R C     1 
ATOM   1748 O O     . LYS C 3 121 ? 18.244  11.909  24.845  1.00 28.82  ? 119 LYS R O     1 
ATOM   1749 C CB    . LYS C 3 121 ? 16.510  12.046  27.554  1.00 16.76  ? 119 LYS R CB    1 
ATOM   1750 C CG    . LYS C 3 121 ? 17.954  11.943  27.994  1.00 29.11  ? 119 LYS R CG    1 
ATOM   1751 C CD    . LYS C 3 121 ? 18.052  11.946  29.514  1.00 28.39  ? 119 LYS R CD    1 
ATOM   1752 C CE    . LYS C 3 121 ? 17.248  13.078  30.115  1.00 34.75  ? 119 LYS R CE    1 
ATOM   1753 N NZ    . LYS C 3 121 ? 17.265  13.033  31.605  1.00 46.92  ? 119 LYS R NZ    1 
ATOM   1754 N N     . THR C 3 122 ? 16.601  13.417  24.559  1.00 19.70  ? 120 THR R N     1 
ATOM   1755 C CA    . THR C 3 122 ? 17.295  14.125  23.492  1.00 29.36  ? 120 THR R CA    1 
ATOM   1756 C C     . THR C 3 122 ? 17.430  15.602  23.818  1.00 26.36  ? 120 THR R C     1 
ATOM   1757 O O     . THR C 3 122 ? 16.639  16.156  24.579  1.00 37.66  ? 120 THR R O     1 
ATOM   1758 C CB    . THR C 3 122 ? 16.561  13.977  22.139  1.00 38.68  ? 120 THR R CB    1 
ATOM   1759 O OG1   . THR C 3 122 ? 15.255  14.559  22.235  1.00 37.17  ? 120 THR R OG1   1 
ATOM   1760 C CG2   . THR C 3 122 ? 16.431  12.510  21.755  1.00 24.24  ? 120 THR R CG2   1 
ATOM   1761 N N     . PHE C 3 123 ? 18.436  16.232  23.225  1.00 24.43  ? 121 PHE R N     1 
ATOM   1762 C CA    . PHE C 3 123 ? 18.687  17.649  23.421  1.00 26.49  ? 121 PHE R CA    1 
ATOM   1763 C C     . PHE C 3 123 ? 19.367  18.206  22.180  1.00 27.40  ? 121 PHE R C     1 
ATOM   1764 O O     . PHE C 3 123 ? 20.249  17.565  21.609  1.00 32.57  ? 121 PHE R O     1 
ATOM   1765 C CB    . PHE C 3 123 ? 19.576  17.864  24.650  1.00 20.59  ? 121 PHE R CB    1 
ATOM   1766 C CG    . PHE C 3 123 ? 19.835  19.309  24.969  1.00 18.01  ? 121 PHE R CG    1 
ATOM   1767 C CD1   . PHE C 3 123 ? 20.845  20.007  24.324  1.00 26.23  ? 121 PHE R CD1   1 
ATOM   1768 C CD2   . PHE C 3 123 ? 19.073  19.969  25.918  1.00 30.87  ? 121 PHE R CD2   1 
ATOM   1769 C CE1   . PHE C 3 123 ? 21.085  21.338  24.616  1.00 31.01  ? 121 PHE R CE1   1 
ATOM   1770 C CE2   . PHE C 3 123 ? 19.307  21.301  26.216  1.00 22.35  ? 121 PHE R CE2   1 
ATOM   1771 C CZ    . PHE C 3 123 ? 20.315  21.987  25.564  1.00 26.07  ? 121 PHE R CZ    1 
ATOM   1772 N N     . SER C 3 124 ? 18.950  19.393  21.754  1.00 26.82  ? 122 SER R N     1 
ATOM   1773 C CA    . SER C 3 124 ? 19.571  20.046  20.608  1.00 31.86  ? 122 SER R CA    1 
ATOM   1774 C C     . SER C 3 124 ? 20.154  21.393  21.010  1.00 28.69  ? 122 SER R C     1 
ATOM   1775 O O     . SER C 3 124 ? 19.518  22.170  21.721  1.00 29.24  ? 122 SER R O     1 
ATOM   1776 C CB    . SER C 3 124 ? 18.574  20.214  19.459  1.00 28.97  ? 122 SER R CB    1 
ATOM   1777 O OG    . SER C 3 124 ? 17.450  20.973  19.864  1.00 65.11  ? 122 SER R OG    1 
ATOM   1778 N N     . LEU C 3 125 ? 21.372  21.658  20.552  1.00 33.11  ? 123 LEU R N     1 
ATOM   1779 C CA    . LEU C 3 125 ? 22.057  22.902  20.869  1.00 23.00  ? 123 LEU R CA    1 
ATOM   1780 C C     . LEU C 3 125 ? 22.555  23.579  19.602  1.00 36.82  ? 123 LEU R C     1 
ATOM   1781 O O     . LEU C 3 125 ? 23.330  22.998  18.841  1.00 45.74  ? 123 LEU R O     1 
ATOM   1782 C CB    . LEU C 3 125 ? 23.239  22.634  21.801  1.00 34.43  ? 123 LEU R CB    1 
ATOM   1783 C CG    . LEU C 3 125 ? 24.158  23.825  22.079  1.00 36.02  ? 123 LEU R CG    1 
ATOM   1784 C CD1   . LEU C 3 125 ? 23.472  24.827  22.992  1.00 40.56  ? 123 LEU R CD1   1 
ATOM   1785 C CD2   . LEU C 3 125 ? 25.479  23.365  22.677  1.00 34.78  ? 123 LEU R CD2   1 
ATOM   1786 N N     . LYS C 3 126 ? 22.099  24.805  19.376  1.00 46.36  ? 124 LYS R N     1 
ATOM   1787 C CA    . LYS C 3 126 ? 22.602  25.616  18.278  1.00 46.12  ? 124 LYS R CA    1 
ATOM   1788 C C     . LYS C 3 126 ? 23.683  26.530  18.834  1.00 49.45  ? 124 LYS R C     1 
ATOM   1789 O O     . LYS C 3 126 ? 23.434  27.301  19.759  1.00 55.25  ? 124 LYS R O     1 
ATOM   1790 C CB    . LYS C 3 126 ? 21.468  26.424  17.651  1.00 48.91  ? 124 LYS R CB    1 
ATOM   1791 C CG    . LYS C 3 126 ? 20.352  25.555  17.094  1.00 54.51  ? 124 LYS R CG    1 
ATOM   1792 C CD    . LYS C 3 126 ? 19.136  26.371  16.694  1.00 71.66  ? 124 LYS R CD    1 
ATOM   1793 C CE    . LYS C 3 126 ? 18.038  25.472  16.150  1.00 79.68  ? 124 LYS R CE    1 
ATOM   1794 N NZ    . LYS C 3 126 ? 18.519  24.661  14.997  1.00 83.03  ? 124 LYS R NZ    1 
ATOM   1795 N N     . PHE C 3 127 ? 24.883  26.437  18.275  1.00 46.12  ? 125 PHE R N     1 
ATOM   1796 C CA    . PHE C 3 127 ? 26.048  27.066  18.881  1.00 48.90  ? 125 PHE R CA    1 
ATOM   1797 C C     . PHE C 3 127 ? 27.055  27.508  17.822  1.00 64.01  ? 125 PHE R C     1 
ATOM   1798 O O     . PHE C 3 127 ? 27.390  26.743  16.917  1.00 54.46  ? 125 PHE R O     1 
ATOM   1799 C CB    . PHE C 3 127 ? 26.688  26.075  19.855  1.00 49.78  ? 125 PHE R CB    1 
ATOM   1800 C CG    . PHE C 3 127 ? 27.779  26.659  20.701  1.00 46.63  ? 125 PHE R CG    1 
ATOM   1801 C CD1   . PHE C 3 127 ? 27.478  27.388  21.840  1.00 50.64  ? 125 PHE R CD1   1 
ATOM   1802 C CD2   . PHE C 3 127 ? 29.108  26.454  20.374  1.00 48.68  ? 125 PHE R CD2   1 
ATOM   1803 C CE1   . PHE C 3 127 ? 28.486  27.917  22.626  1.00 49.86  ? 125 PHE R CE1   1 
ATOM   1804 C CE2   . PHE C 3 127 ? 30.119  26.978  21.156  1.00 47.91  ? 125 PHE R CE2   1 
ATOM   1805 C CZ    . PHE C 3 127 ? 29.808  27.710  22.284  1.00 46.91  ? 125 PHE R CZ    1 
ATOM   1806 N N     . ASN C 3 128 ? 27.528  28.747  17.937  1.00 66.95  ? 126 ASN R N     1 
ATOM   1807 C CA    . ASN C 3 128 ? 28.499  29.295  16.992  1.00 66.32  ? 126 ASN R CA    1 
ATOM   1808 C C     . ASN C 3 128 ? 29.823  28.536  16.994  1.00 68.92  ? 126 ASN R C     1 
ATOM   1809 O O     . ASN C 3 128 ? 30.417  28.305  18.047  1.00 71.06  ? 126 ASN R O     1 
ATOM   1810 C CB    . ASN C 3 128 ? 28.746  30.778  17.274  1.00 77.79  ? 126 ASN R CB    1 
ATOM   1811 C CG    . ASN C 3 128 ? 29.968  31.311  16.551  1.00 89.45  ? 126 ASN R CG    1 
ATOM   1812 O OD1   . ASN C 3 128 ? 31.057  31.383  17.121  1.00 103.65 ? 126 ASN R OD1   1 
ATOM   1813 N ND2   . ASN C 3 128 ? 29.794  31.686  15.290  1.00 97.17  ? 126 ASN R ND2   1 
ATOM   1814 N N     . MET C 3 129 ? 30.282  28.155  15.807  1.00 72.85  ? 127 MET R N     1 
ATOM   1815 C CA    . MET C 3 129 ? 31.509  27.382  15.675  1.00 91.46  ? 127 MET R CA    1 
ATOM   1816 C C     . MET C 3 129 ? 32.278  27.809  14.428  1.00 82.32  ? 127 MET R C     1 
ATOM   1817 O O     . MET C 3 129 ? 33.475  28.089  14.488  1.00 74.00  ? 127 MET R O     1 
ATOM   1818 C CB    . MET C 3 129 ? 31.186  25.887  15.611  1.00 76.32  ? 127 MET R CB    1 
ATOM   1819 C CG    . MET C 3 129 ? 32.323  24.979  16.052  1.00 80.23  ? 127 MET R CG    1 
ATOM   1820 S SD    . MET C 3 129 ? 32.697  25.163  17.807  1.00 106.33 ? 127 MET R SD    1 
ATOM   1821 C CE    . MET C 3 129 ? 31.109  24.756  18.526  1.00 49.39  ? 127 MET R CE    1 
ATOM   1822 N N     . THR C 3 132 ? 32.617  29.792  13.887  1.00 88.97  ? 130 THR R N     1 
ATOM   1823 C CA    . THR C 3 132 ? 33.702  30.757  13.736  1.00 112.10 ? 130 THR R CA    1 
ATOM   1824 C C     . THR C 3 132 ? 33.165  32.182  13.686  1.00 114.78 ? 130 THR R C     1 
ATOM   1825 O O     . THR C 3 132 ? 32.265  32.531  14.432  1.00 112.70 ? 130 THR R O     1 
ATOM   1826 C CB    . THR C 3 132 ? 34.593  30.421  12.517  1.00 114.41 ? 130 THR R CB    1 
ATOM   1827 O OG1   . THR C 3 132 ? 34.546  29.018  12.248  1.00 98.70  ? 130 THR R OG1   1 
ATOM   1828 C CG2   . THR C 3 132 ? 36.007  30.797  12.805  1.00 88.07  ? 130 THR R CG2   1 
ATOM   1829 N N     . ASP C 3 133 ? 33.703  32.977  12.777  1.00 116.46 ? 131 ASP R N     1 
ATOM   1830 C CA    . ASP C 3 133 ? 33.296  34.349  12.507  1.00 115.03 ? 131 ASP R CA    1 
ATOM   1831 C C     . ASP C 3 133 ? 31.880  34.429  11.933  1.00 118.69 ? 131 ASP R C     1 
ATOM   1832 O O     . ASP C 3 133 ? 31.339  33.451  11.422  1.00 119.35 ? 131 ASP R O     1 
ATOM   1833 C CB    . ASP C 3 133 ? 34.276  35.003  11.529  1.00 103.43 ? 131 ASP R CB    1 
ATOM   1834 C CG    . ASP C 3 133 ? 34.937  34.011  10.583  1.00 110.19 ? 131 ASP R CG    1 
ATOM   1835 O OD1   . ASP C 3 133 ? 34.290  33.572  9.635   1.00 104.05 ? 131 ASP R OD1   1 
ATOM   1836 O OD2   . ASP C 3 133 ? 36.103  33.662  10.786  1.00 93.22  ? 131 ASP R OD2   1 
ATOM   1837 N N     . SER C 3 134 ? 31.254  35.587  12.062  1.00 110.94 ? 132 SER R N     1 
ATOM   1838 C CA    . SER C 3 134 ? 29.834  35.740  11.753  1.00 103.05 ? 132 SER R CA    1 
ATOM   1839 C C     . SER C 3 134 ? 28.977  35.079  12.825  1.00 102.59 ? 132 SER R C     1 
ATOM   1840 O O     . SER C 3 134 ? 29.370  34.957  13.981  1.00 77.27  ? 132 SER R O     1 
ATOM   1841 C CB    . SER C 3 134 ? 29.418  35.271  10.338  1.00 91.35  ? 132 SER R CB    1 
ATOM   1842 O OG    . SER C 3 134 ? 30.267  34.303  9.759   1.00 103.63 ? 132 SER R OG    1 
ATOM   1843 N N     . THR C 3 135 ? 27.772  34.708  12.441  1.00 110.30 ? 133 THR R N     1 
ATOM   1844 C CA    . THR C 3 135 ? 26.885  34.032  13.351  1.00 102.17 ? 133 THR R CA    1 
ATOM   1845 C C     . THR C 3 135 ? 26.122  32.930  12.635  1.00 102.09 ? 133 THR R C     1 
ATOM   1846 O O     . THR C 3 135 ? 24.960  32.687  12.904  1.00 84.39  ? 133 THR R O     1 
ATOM   1847 C CB    . THR C 3 135 ? 25.959  35.017  14.059  1.00 94.25  ? 133 THR R CB    1 
ATOM   1848 O OG1   . THR C 3 135 ? 24.801  34.328  14.536  1.00 74.74  ? 133 THR R OG1   1 
ATOM   1849 C CG2   . THR C 3 135 ? 25.560  36.157  13.115  1.00 77.77  ? 133 THR R CG2   1 
ATOM   1850 N N     . LYS C 3 136 ? 26.813  32.257  11.723  1.00 94.38  ? 134 LYS R N     1 
ATOM   1851 C CA    . LYS C 3 136 ? 26.362  30.980  11.223  1.00 88.88  ? 134 LYS R CA    1 
ATOM   1852 C C     . LYS C 3 136 ? 26.407  29.989  12.404  1.00 100.96 ? 134 LYS R C     1 
ATOM   1853 O O     . LYS C 3 136 ? 27.393  29.902  13.118  1.00 82.34  ? 134 LYS R O     1 
ATOM   1854 C CB    . LYS C 3 136 ? 27.232  30.546  10.033  1.00 69.93  ? 134 LYS R CB    1 
ATOM   1855 C CG    . LYS C 3 136 ? 27.811  29.133  10.077  1.00 89.70  ? 134 LYS R CG    1 
ATOM   1856 C CD    . LYS C 3 136 ? 28.324  28.650  8.721   1.00 97.22  ? 134 LYS R CD    1 
ATOM   1857 C CE    . LYS C 3 136 ? 27.346  27.689  8.042   1.00 99.19  ? 134 LYS R CE    1 
ATOM   1858 N NZ    . LYS C 3 136 ? 27.903  26.862  6.930   1.00 109.60 ? 134 LYS R NZ    1 
ATOM   1859 N N     . LEU C 3 137 ? 25.342  29.217  12.568  1.00 83.86  ? 135 LEU R N     1 
ATOM   1860 C CA    . LEU C 3 137 ? 25.144  28.381  13.724  1.00 63.67  ? 135 LEU R CA    1 
ATOM   1861 C C     . LEU C 3 137 ? 25.094  26.943  13.357  1.00 57.52  ? 135 LEU R C     1 
ATOM   1862 O O     . LEU C 3 137 ? 24.405  26.592  12.450  1.00 69.41  ? 135 LEU R O     1 
ATOM   1863 C CB    . LEU C 3 137 ? 23.830  28.751  14.342  1.00 40.97  ? 135 LEU R CB    1 
ATOM   1864 C CG    . LEU C 3 137 ? 23.910  29.454  15.664  1.00 56.96  ? 135 LEU R CG    1 
ATOM   1865 C CD1   . LEU C 3 137 ? 25.061  30.420  15.715  1.00 75.22  ? 135 LEU R CD1   1 
ATOM   1866 C CD2   . LEU C 3 137 ? 22.615  30.168  15.902  1.00 49.87  ? 135 LEU R CD2   1 
ATOM   1867 N N     . GLU C 3 138 ? 25.828  26.115  14.070  1.00 49.39  ? 136 GLU R N     1 
ATOM   1868 C CA    . GLU C 3 138 ? 25.798  24.707  13.825  1.00 59.26  ? 136 GLU R CA    1 
ATOM   1869 C C     . GLU C 3 138 ? 24.880  24.095  14.826  1.00 53.66  ? 136 GLU R C     1 
ATOM   1870 O O     . GLU C 3 138 ? 24.630  24.671  15.831  1.00 47.68  ? 136 GLU R O     1 
ATOM   1871 C CB    . GLU C 3 138 ? 27.192  24.120  13.848  1.00 48.05  ? 136 GLU R CB    1 
ATOM   1872 C CG    . GLU C 3 138 ? 27.940  24.424  12.569  1.00 59.51  ? 136 GLU R CG    1 
ATOM   1873 C CD    . GLU C 3 138 ? 29.367  23.961  12.546  1.00 72.46  ? 136 GLU R CD    1 
ATOM   1874 O OE1   . GLU C 3 138 ? 29.783  23.230  13.433  1.00 75.71  ? 136 GLU R OE1   1 
ATOM   1875 O OE2   . GLU C 3 138 ? 30.095  24.326  11.633  1.00 76.20  ? 136 GLU R OE2   1 
ATOM   1876 N N     . THR C 3 139 ? 24.302  22.967  14.487  1.00 35.72  ? 137 THR R N     1 
ATOM   1877 C CA    . THR C 3 139 ? 23.354  22.303  15.372  1.00 47.25  ? 137 THR R CA    1 
ATOM   1878 C C     . THR C 3 139 ? 23.898  20.974  15.890  1.00 46.73  ? 137 THR R C     1 
ATOM   1879 O O     . THR C 3 139 ? 24.239  20.084  15.109  1.00 42.26  ? 137 THR R O     1 
ATOM   1880 C CB    . THR C 3 139 ? 22.009  22.068  14.665  1.00 35.66  ? 137 THR R CB    1 
ATOM   1881 O OG1   . THR C 3 139 ? 21.489  23.320  14.203  1.00 51.79  ? 137 THR R OG1   1 
ATOM   1882 C CG2   . THR C 3 139 ? 21.009  21.427  15.614  1.00 35.42  ? 137 THR R CG2   1 
ATOM   1883 N N     . PHE C 3 140 ? 23.980  20.846  17.211  1.00 32.71  ? 138 PHE R N     1 
ATOM   1884 C CA    . PHE C 3 140 ? 24.470  19.618  17.826  1.00 29.27  ? 138 PHE R CA    1 
ATOM   1885 C C     . PHE C 3 140 ? 23.333  18.836  18.465  1.00 32.44  ? 138 PHE R C     1 
ATOM   1886 O O     . PHE C 3 140 ? 22.567  19.371  19.266  1.00 32.16  ? 138 PHE R O     1 
ATOM   1887 C CB    . PHE C 3 140 ? 25.558  19.929  18.855  1.00 28.50  ? 138 PHE R CB    1 
ATOM   1888 C CG    . PHE C 3 140 ? 26.782  20.563  18.260  1.00 35.43  ? 138 PHE R CG    1 
ATOM   1889 C CD1   . PHE C 3 140 ? 26.894  21.942  18.175  1.00 41.57  ? 138 PHE R CD1   1 
ATOM   1890 C CD2   . PHE C 3 140 ? 27.816  19.782  17.770  1.00 28.68  ? 138 PHE R CD2   1 
ATOM   1891 C CE1   . PHE C 3 140 ? 28.019  22.531  17.618  1.00 38.31  ? 138 PHE R CE1   1 
ATOM   1892 C CE2   . PHE C 3 140 ? 28.943  20.365  17.211  1.00 35.25  ? 138 PHE R CE2   1 
ATOM   1893 C CZ    . PHE C 3 140 ? 29.043  21.741  17.136  1.00 30.41  ? 138 PHE R CZ    1 
ATOM   1894 N N     . HIS C 3 141 ? 23.225  17.567  18.093  1.00 30.14  ? 139 HIS R N     1 
ATOM   1895 C CA    . HIS C 3 141 ? 22.184  16.702  18.621  1.00 28.05  ? 139 HIS R CA    1 
ATOM   1896 C C     . HIS C 3 141 ? 22.768  15.799  19.690  1.00 25.36  ? 139 HIS R C     1 
ATOM   1897 O O     . HIS C 3 141 ? 23.880  15.294  19.544  1.00 26.02  ? 139 HIS R O     1 
ATOM   1898 C CB    . HIS C 3 141 ? 21.589  15.845  17.507  1.00 32.10  ? 139 HIS R CB    1 
ATOM   1899 C CG    . HIS C 3 141 ? 20.963  16.633  16.407  1.00 35.47  ? 139 HIS R CG    1 
ATOM   1900 N ND1   . HIS C 3 141 ? 19.622  16.531  16.081  1.00 35.47  ? 139 HIS R ND1   1 
ATOM   1901 C CD2   . HIS C 3 141 ? 21.481  17.538  15.540  1.00 36.23  ? 139 HIS R CD2   1 
ATOM   1902 C CE1   . HIS C 3 141 ? 19.350  17.333  15.076  1.00 43.92  ? 139 HIS R CE1   1 
ATOM   1903 N NE2   . HIS C 3 141 ? 20.465  17.959  14.726  1.00 53.56  ? 139 HIS R NE2   1 
ATOM   1904 N N     . LEU C 3 142 ? 22.020  15.593  20.767  1.00 19.11  ? 140 LEU R N     1 
ATOM   1905 C CA    . LEU C 3 142 ? 22.460  14.687  21.815  1.00 15.99  ? 140 LEU R CA    1 
ATOM   1906 C C     . LEU C 3 142 ? 21.389  13.646  22.115  1.00 25.17  ? 140 LEU R C     1 
ATOM   1907 O O     . LEU C 3 142 ? 20.239  13.984  22.401  1.00 21.94  ? 140 LEU R O     1 
ATOM   1908 C CB    . LEU C 3 142 ? 22.852  15.463  23.078  1.00 22.59  ? 140 LEU R CB    1 
ATOM   1909 C CG    . LEU C 3 142 ? 23.501  14.632  24.187  1.00 25.47  ? 140 LEU R CG    1 
ATOM   1910 C CD1   . LEU C 3 142 ? 24.453  15.474  25.021  1.00 27.83  ? 140 LEU R CD1   1 
ATOM   1911 C CD2   . LEU C 3 142 ? 22.432  14.010  25.070  1.00 16.27  ? 140 LEU R CD2   1 
ATOM   1912 N N     . ILE C 3 143 ? 21.776  12.377  22.036  1.00 24.19  ? 141 ILE R N     1 
ATOM   1913 C CA    . ILE C 3 143 ? 20.876  11.273  22.343  1.00 14.70  ? 141 ILE R CA    1 
ATOM   1914 C C     . ILE C 3 143 ? 21.462  10.449  23.486  1.00 28.34  ? 141 ILE R C     1 
ATOM   1915 O O     . ILE C 3 143 ? 22.639  10.086  23.459  1.00 22.08  ? 141 ILE R O     1 
ATOM   1916 C CB    . ILE C 3 143 ? 20.669  10.357  21.124  1.00 18.75  ? 141 ILE R CB    1 
ATOM   1917 C CG1   . ILE C 3 143 ? 20.463  11.187  19.856  1.00 30.82  ? 141 ILE R CG1   1 
ATOM   1918 C CG2   . ILE C 3 143 ? 19.490  9.427   21.346  1.00 23.75  ? 141 ILE R CG2   1 
ATOM   1919 C CD1   . ILE C 3 143 ? 19.148  11.933  19.819  1.00 29.00  ? 141 ILE R CD1   1 
ATOM   1920 N N     . ALA C 3 144 ? 20.644  10.161  24.493  1.00 23.03  ? 142 ALA R N     1 
ATOM   1921 C CA    . ALA C 3 144 ? 21.098  9.368   25.629  1.00 16.73  ? 142 ALA R CA    1 
ATOM   1922 C C     . ALA C 3 144 ? 20.113  8.253   25.944  1.00 19.40  ? 142 ALA R C     1 
ATOM   1923 O O     . ALA C 3 144 ? 18.917  8.495   26.092  1.00 27.96  ? 142 ALA R O     1 
ATOM   1924 C CB    . ALA C 3 144 ? 21.315  10.254  26.848  1.00 12.99  ? 142 ALA R CB    1 
ATOM   1925 N N     . TYR C 3 145 ? 20.622  7.029   26.041  1.00 22.13  ? 143 TYR R N     1 
ATOM   1926 C CA    . TYR C 3 145 ? 19.786  5.887   26.376  1.00 20.14  ? 143 TYR R CA    1 
ATOM   1927 C C     . TYR C 3 145 ? 20.019  5.456   27.815  1.00 29.10  ? 143 TYR R C     1 
ATOM   1928 O O     . TYR C 3 145 ? 21.146  5.480   28.313  1.00 22.21  ? 143 TYR R O     1 
ATOM   1929 C CB    . TYR C 3 145 ? 20.060  4.716   25.432  1.00 15.46  ? 143 TYR R CB    1 
ATOM   1930 C CG    . TYR C 3 145 ? 19.727  5.003   23.990  1.00 26.72  ? 143 TYR R CG    1 
ATOM   1931 C CD1   . TYR C 3 145 ? 18.467  4.731   23.481  1.00 20.58  ? 143 TYR R CD1   1 
ATOM   1932 C CD2   . TYR C 3 145 ? 20.673  5.546   23.137  1.00 23.94  ? 143 TYR R CD2   1 
ATOM   1933 C CE1   . TYR C 3 145 ? 18.161  4.989   22.160  1.00 20.10  ? 143 TYR R CE1   1 
ATOM   1934 C CE2   . TYR C 3 145 ? 20.375  5.807   21.816  1.00 25.24  ? 143 TYR R CE2   1 
ATOM   1935 C CZ    . TYR C 3 145 ? 19.119  5.527   21.333  1.00 18.91  ? 143 TYR R CZ    1 
ATOM   1936 O OH    . TYR C 3 145 ? 18.823  5.792   20.016  1.00 20.44  ? 143 TYR R OH    1 
ATOM   1937 N N     . TYR C 3 146 ? 18.942  5.056   28.476  1.00 19.82  ? 144 TYR R N     1 
ATOM   1938 C CA    . TYR C 3 146 ? 19.018  4.600   29.854  1.00 34.75  ? 144 TYR R CA    1 
ATOM   1939 C C     . TYR C 3 146 ? 17.762  3.816   30.194  1.00 35.78  ? 144 TYR R C     1 
ATOM   1940 O O     . TYR C 3 146 ? 16.901  3.612   29.338  1.00 39.26  ? 144 TYR R O     1 
ATOM   1941 C CB    . TYR C 3 146 ? 19.196  5.784   30.806  1.00 22.82  ? 144 TYR R CB    1 
ATOM   1942 C CG    . TYR C 3 146 ? 18.072  6.791   30.756  1.00 33.18  ? 144 TYR R CG    1 
ATOM   1943 C CD1   . TYR C 3 146 ? 17.961  7.683   29.700  1.00 30.28  ? 144 TYR R CD1   1 
ATOM   1944 C CD2   . TYR C 3 146 ? 17.129  6.858   31.771  1.00 30.16  ? 144 TYR R CD2   1 
ATOM   1945 C CE1   . TYR C 3 146 ? 16.937  8.605   29.650  1.00 26.98  ? 144 TYR R CE1   1 
ATOM   1946 C CE2   . TYR C 3 146 ? 16.102  7.780   31.731  1.00 35.09  ? 144 TYR R CE2   1 
ATOM   1947 C CZ    . TYR C 3 146 ? 16.013  8.651   30.669  1.00 38.72  ? 144 TYR R CZ    1 
ATOM   1948 O OH    . TYR C 3 146 ? 14.993  9.570   30.624  1.00 41.51  ? 144 TYR R OH    1 
ATOM   1949 N N     . THR C 3 147 ? 17.657  3.369   31.438  1.00 40.77  ? 145 THR R N     1 
ATOM   1950 C CA    . THR C 3 147 ? 16.503  2.582   31.850  1.00 44.81  ? 145 THR R CA    1 
ATOM   1951 C C     . THR C 3 147 ? 16.030  2.980   33.240  1.00 39.88  ? 145 THR R C     1 
ATOM   1952 O O     . THR C 3 147 ? 16.822  3.441   34.061  1.00 47.54  ? 145 THR R O     1 
ATOM   1953 C CB    . THR C 3 147 ? 16.814  1.075   31.821  1.00 28.07  ? 145 THR R CB    1 
ATOM   1954 O OG1   . THR C 3 147 ? 15.635  0.333   32.153  1.00 72.27  ? 145 THR R OG1   1 
ATOM   1955 C CG2   . THR C 3 147 ? 17.913  0.744   32.814  1.00 39.64  ? 145 THR R CG2   1 
ATOM   1956 N N     . GLU C 3 148 ? 14.732  2.810   33.483  1.00 48.38  ? 146 GLU R N     1 
ATOM   1957 C CA    . GLU C 3 148 ? 14.130  3.107   34.778  1.00 58.17  ? 146 GLU R CA    1 
ATOM   1958 C C     . GLU C 3 148 ? 14.910  2.415   35.891  1.00 49.73  ? 146 GLU R C     1 
ATOM   1959 O O     . GLU C 3 148 ? 15.192  3.009   36.930  1.00 40.00  ? 146 GLU R O     1 
ATOM   1960 C CB    . GLU C 3 148 ? 12.667  2.650   34.791  1.00 55.57  ? 146 GLU R CB    1 
ATOM   1961 C CG    . GLU C 3 148 ? 11.850  3.146   33.598  1.00 68.42  ? 146 GLU R CG    1 
ATOM   1962 C CD    . GLU C 3 148 ? 10.474  2.501   33.507  1.00 81.56  ? 146 GLU R CD    1 
ATOM   1963 O OE1   . GLU C 3 148 ? 9.719   2.836   32.568  1.00 81.69  ? 146 GLU R OE1   1 
ATOM   1964 O OE2   . GLU C 3 148 ? 10.148  1.659   34.370  1.00 89.49  ? 146 GLU R OE2   1 
ATOM   1965 N N     . LYS C 3 149 ? 15.266  1.160   35.642  1.00 53.98  ? 147 LYS R N     1 
ATOM   1966 C CA    . LYS C 3 149 ? 16.035  0.346   36.576  1.00 46.44  ? 147 LYS R CA    1 
ATOM   1967 C C     . LYS C 3 149 ? 17.330  1.036   36.999  1.00 59.19  ? 147 LYS R C     1 
ATOM   1968 O O     . LYS C 3 149 ? 17.704  1.007   38.171  1.00 67.25  ? 147 LYS R O     1 
ATOM   1969 C CB    . LYS C 3 149 ? 16.348  -1.007  35.930  1.00 63.25  ? 147 LYS R CB    1 
ATOM   1970 C CG    . LYS C 3 149 ? 16.825  -2.086  36.884  1.00 75.45  ? 147 LYS R CG    1 
ATOM   1971 C CD    . LYS C 3 149 ? 16.989  -3.404  36.142  1.00 79.98  ? 147 LYS R CD    1 
ATOM   1972 C CE    . LYS C 3 149 ? 17.254  -4.562  37.088  1.00 93.50  ? 147 LYS R CE    1 
ATOM   1973 N NZ    . LYS C 3 149 ? 17.351  -5.851  36.346  1.00 95.11  ? 147 LYS R NZ    1 
ATOM   1974 N N     . ASP C 3 150 ? 18.005  1.662   36.039  1.00 62.39  ? 148 ASP R N     1 
ATOM   1975 C CA    . ASP C 3 150 ? 19.270  2.343   36.303  1.00 64.22  ? 148 ASP R CA    1 
ATOM   1976 C C     . ASP C 3 150 ? 19.081  3.643   37.084  1.00 58.24  ? 148 ASP R C     1 
ATOM   1977 O O     . ASP C 3 150 ? 20.046  4.219   37.588  1.00 59.97  ? 148 ASP R O     1 
ATOM   1978 C CB    . ASP C 3 150 ? 20.021  2.614   34.994  1.00 60.73  ? 148 ASP R CB    1 
ATOM   1979 C CG    . ASP C 3 150 ? 20.676  1.367   34.425  1.00 61.63  ? 148 ASP R CG    1 
ATOM   1980 O OD1   . ASP C 3 150 ? 20.141  0.258   34.631  1.00 80.70  ? 148 ASP R OD1   1 
ATOM   1981 O OD2   . ASP C 3 150 ? 21.733  1.495   33.773  1.00 67.28  ? 148 ASP R OD2   1 
ATOM   1982 N N     . ILE C 3 151 ? 17.835  4.101   37.176  1.00 56.16  ? 149 ILE R N     1 
ATOM   1983 C CA    . ILE C 3 151 ? 17.510  5.290   37.960  1.00 76.74  ? 149 ILE R CA    1 
ATOM   1984 C C     . ILE C 3 151 ? 17.379  4.930   39.442  1.00 80.39  ? 149 ILE R C     1 
ATOM   1985 O O     . ILE C 3 151 ? 17.749  5.712   40.319  1.00 65.07  ? 149 ILE R O     1 
ATOM   1986 C CB    . ILE C 3 151 ? 16.209  5.957   37.466  1.00 62.83  ? 149 ILE R CB    1 
ATOM   1987 C CG1   . ILE C 3 151 ? 16.312  6.293   35.977  1.00 52.36  ? 149 ILE R CG1   1 
ATOM   1988 C CG2   . ILE C 3 151 ? 15.901  7.205   38.281  1.00 52.84  ? 149 ILE R CG2   1 
ATOM   1989 C CD1   . ILE C 3 151 ? 17.403  7.296   35.645  1.00 46.30  ? 149 ILE R CD1   1 
ATOM   1990 N N     . HIS C 3 152 ? 16.855  3.737   39.706  1.00 74.84  ? 150 HIS R N     1 
ATOM   1991 C CA    . HIS C 3 152 ? 16.746  3.216   41.063  1.00 75.39  ? 150 HIS R CA    1 
ATOM   1992 C C     . HIS C 3 152 ? 18.129  2.876   41.600  1.00 71.01  ? 150 HIS R C     1 
ATOM   1993 O O     . HIS C 3 152 ? 18.585  3.443   42.593  1.00 76.47  ? 150 HIS R O     1 
ATOM   1994 C CB    . HIS C 3 152 ? 15.887  1.949   41.077  1.00 77.55  ? 150 HIS R CB    1 
ATOM   1995 C CG    . HIS C 3 152 ? 14.561  2.103   40.401  1.00 77.98  ? 150 HIS R CG    1 
ATOM   1996 N ND1   . HIS C 3 152 ? 13.939  1.066   39.743  1.00 63.81  ? 150 HIS R ND1   1 
ATOM   1997 C CD2   . HIS C 3 152 ? 13.732  3.170   40.290  1.00 87.81  ? 150 HIS R CD2   1 
ATOM   1998 C CE1   . HIS C 3 152 ? 12.787  1.486   39.248  1.00 80.37  ? 150 HIS R CE1   1 
ATOM   1999 N NE2   . HIS C 3 152 ? 12.639  2.759   39.568  1.00 98.08  ? 150 HIS R NE2   1 
ATOM   2000 N N     . GLN C 3 153 ? 18.785  1.936   40.927  1.00 60.29  ? 151 GLN R N     1 
ATOM   2001 C CA    . GLN C 3 153 ? 20.090  1.442   41.343  1.00 57.81  ? 151 GLN R CA    1 
ATOM   2002 C C     . GLN C 3 153 ? 21.158  2.526   41.263  1.00 65.24  ? 151 GLN R C     1 
ATOM   2003 O O     . GLN C 3 153 ? 22.118  2.516   42.033  1.00 75.68  ? 151 GLN R O     1 
ATOM   2004 C CB    . GLN C 3 153 ? 20.496  0.239   40.484  1.00 66.45  ? 151 GLN R CB    1 
ATOM   2005 C CG    . GLN C 3 153 ? 19.481  -0.896  40.485  1.00 62.89  ? 151 GLN R CG    1 
ATOM   2006 C CD    . GLN C 3 153 ? 19.889  -2.055  39.591  1.00 89.76  ? 151 GLN R CD    1 
ATOM   2007 O OE1   . GLN C 3 153 ? 20.915  -2.001  38.911  1.00 92.38  ? 151 GLN R OE1   1 
ATOM   2008 N NE2   . GLN C 3 153 ? 19.083  -3.111  39.588  1.00 76.47  ? 151 GLN R NE2   1 
ATOM   2009 N N     . GLY C 3 154 ? 20.985  3.459   40.332  1.00 60.95  ? 152 GLY R N     1 
ATOM   2010 C CA    . GLY C 3 154 ? 21.964  4.509   40.117  1.00 54.75  ? 152 GLY R CA    1 
ATOM   2011 C C     . GLY C 3 154 ? 23.273  3.938   39.612  1.00 54.73  ? 152 GLY R C     1 
ATOM   2012 O O     . GLY C 3 154 ? 24.349  4.328   40.063  1.00 58.13  ? 152 GLY R O     1 
ATOM   2013 N N     . SER C 3 155 ? 23.176  3.012   38.664  1.00 62.24  ? 153 SER R N     1 
ATOM   2014 C CA    . SER C 3 155 ? 24.342  2.300   38.150  1.00 57.51  ? 153 SER R CA    1 
ATOM   2015 C C     . SER C 3 155 ? 25.071  3.050   37.034  1.00 67.58  ? 153 SER R C     1 
ATOM   2016 O O     . SER C 3 155 ? 26.183  2.681   36.654  1.00 69.50  ? 153 SER R O     1 
ATOM   2017 C CB    . SER C 3 155 ? 23.934  0.906   37.669  1.00 63.18  ? 153 SER R CB    1 
ATOM   2018 O OG    . SER C 3 155 ? 22.787  0.971   36.842  1.00 79.07  ? 153 SER R OG    1 
ATOM   2019 N N     . LEU C 3 156 ? 24.444  4.098   36.510  1.00 58.87  ? 154 LEU R N     1 
ATOM   2020 C CA    . LEU C 3 156 ? 25.070  4.922   35.480  1.00 53.63  ? 154 LEU R CA    1 
ATOM   2021 C C     . LEU C 3 156 ? 25.657  6.194   36.094  1.00 41.76  ? 154 LEU R C     1 
ATOM   2022 O O     . LEU C 3 156 ? 25.072  6.781   37.005  1.00 38.90  ? 154 LEU R O     1 
ATOM   2023 C CB    . LEU C 3 156 ? 24.065  5.270   34.378  1.00 36.41  ? 154 LEU R CB    1 
ATOM   2024 C CG    . LEU C 3 156 ? 23.522  4.086   33.573  1.00 28.29  ? 154 LEU R CG    1 
ATOM   2025 C CD1   . LEU C 3 156 ? 22.392  4.517   32.649  1.00 24.32  ? 154 LEU R CD1   1 
ATOM   2026 C CD2   . LEU C 3 156 ? 24.638  3.433   32.780  1.00 34.21  ? 154 LEU R CD2   1 
ATOM   2027 N N     . ARG C 3 157 ? 26.816  6.611   35.596  1.00 33.44  ? 155 ARG R N     1 
ATOM   2028 C CA    . ARG C 3 157 ? 27.506  7.779   36.134  1.00 26.22  ? 155 ARG R CA    1 
ATOM   2029 C C     . ARG C 3 157 ? 27.205  9.053   35.348  1.00 39.98  ? 155 ARG R C     1 
ATOM   2030 O O     . ARG C 3 157 ? 27.253  9.066   34.117  1.00 33.41  ? 155 ARG R O     1 
ATOM   2031 C CB    . ARG C 3 157 ? 29.019  7.544   36.155  1.00 33.66  ? 155 ARG R CB    1 
ATOM   2032 C CG    . ARG C 3 157 ? 29.452  6.315   36.934  1.00 62.23  ? 155 ARG R CG    1 
ATOM   2033 C CD    . ARG C 3 157 ? 30.964  6.248   37.047  1.00 55.08  ? 155 ARG R CD    1 
ATOM   2034 N NE    . ARG C 3 157 ? 31.505  7.387   37.783  1.00 61.19  ? 155 ARG R NE    1 
ATOM   2035 C CZ    . ARG C 3 157 ? 32.800  7.664   37.886  1.00 67.83  ? 155 ARG R CZ    1 
ATOM   2036 N NH1   . ARG C 3 157 ? 33.695  6.885   37.294  1.00 52.91  ? 155 ARG R NH1   1 
ATOM   2037 N NH2   . ARG C 3 157 ? 33.199  8.723   38.578  1.00 65.70  ? 155 ARG R NH2   1 
ATOM   2038 N N     . ARG C 3 158 ? 26.899  10.124  36.071  1.00 27.00  ? 156 ARG R N     1 
ATOM   2039 C CA    . ARG C 3 158 ? 26.746  11.432  35.456  1.00 26.28  ? 156 ARG R CA    1 
ATOM   2040 C C     . ARG C 3 158 ? 28.124  11.984  35.119  1.00 28.21  ? 156 ARG R C     1 
ATOM   2041 O O     . ARG C 3 158 ? 29.075  11.779  35.873  1.00 32.08  ? 156 ARG R O     1 
ATOM   2042 C CB    . ARG C 3 158 ? 26.021  12.382  36.406  1.00 25.49  ? 156 ARG R CB    1 
ATOM   2043 C CG    . ARG C 3 158 ? 24.659  11.889  36.859  1.00 33.55  ? 156 ARG R CG    1 
ATOM   2044 C CD    . ARG C 3 158 ? 24.045  12.849  37.859  1.00 32.55  ? 156 ARG R CD    1 
ATOM   2045 N NE    . ARG C 3 158 ? 24.160  14.235  37.413  1.00 38.51  ? 156 ARG R NE    1 
ATOM   2046 C CZ    . ARG C 3 158 ? 23.863  15.290  38.163  1.00 39.37  ? 156 ARG R CZ    1 
ATOM   2047 N NH1   . ARG C 3 158 ? 23.429  15.124  39.404  1.00 35.00  ? 156 ARG R NH1   1 
ATOM   2048 N NH2   . ARG C 3 158 ? 24.005  16.513  37.670  1.00 30.63  ? 156 ARG R NH2   1 
ATOM   2049 N N     . PRO C 3 159 ? 28.242  12.670  33.972  1.00 28.41  ? 157 PRO R N     1 
ATOM   2050 C CA    . PRO C 3 159 ? 29.508  13.305  33.596  1.00 42.09  ? 157 PRO R CA    1 
ATOM   2051 C C     . PRO C 3 159 ? 30.018  14.246  34.689  1.00 35.60  ? 157 PRO R C     1 
ATOM   2052 O O     . PRO C 3 159 ? 31.217  14.271  34.957  1.00 35.94  ? 157 PRO R O     1 
ATOM   2053 C CB    . PRO C 3 159 ? 29.140  14.097  32.337  1.00 32.76  ? 157 PRO R CB    1 
ATOM   2054 C CG    . PRO C 3 159 ? 27.991  13.340  31.747  1.00 29.84  ? 157 PRO R CG    1 
ATOM   2055 C CD    . PRO C 3 159 ? 27.216  12.805  32.921  1.00 28.61  ? 157 PRO R CD    1 
ATOM   2056 N N     . SER C 3 160 ? 29.114  14.993  35.316  1.00 25.58  ? 158 SER R N     1 
ATOM   2057 C CA    . SER C 3 160 ? 29.489  15.967  36.341  1.00 30.31  ? 158 SER R CA    1 
ATOM   2058 C C     . SER C 3 160 ? 29.982  15.325  37.638  1.00 31.43  ? 158 SER R C     1 
ATOM   2059 O O     . SER C 3 160 ? 30.516  16.010  38.508  1.00 35.91  ? 158 SER R O     1 
ATOM   2060 C CB    . SER C 3 160 ? 28.328  16.924  36.631  1.00 30.69  ? 158 SER R CB    1 
ATOM   2061 O OG    . SER C 3 160 ? 27.188  16.224  37.094  1.00 39.77  ? 158 SER R OG    1 
ATOM   2062 N N     . GLU C 3 161 ? 29.800  14.015  37.765  1.00 29.84  ? 159 GLU R N     1 
ATOM   2063 C CA    . GLU C 3 161 ? 30.307  13.274  38.917  1.00 22.32  ? 159 GLU R CA    1 
ATOM   2064 C C     . GLU C 3 161 ? 31.341  12.250  38.464  1.00 34.37  ? 159 GLU R C     1 
ATOM   2065 O O     . GLU C 3 161 ? 31.601  11.261  39.149  1.00 38.04  ? 159 GLU R O     1 
ATOM   2066 C CB    . GLU C 3 161 ? 29.161  12.582  39.659  1.00 19.80  ? 159 GLU R CB    1 
ATOM   2067 C CG    . GLU C 3 161 ? 28.089  13.538  40.159  1.00 33.72  ? 159 GLU R CG    1 
ATOM   2068 C CD    . GLU C 3 161 ? 26.942  12.826  40.853  1.00 51.56  ? 159 GLU R CD    1 
ATOM   2069 O OE1   . GLU C 3 161 ? 27.017  11.589  41.016  1.00 60.89  ? 159 GLU R OE1   1 
ATOM   2070 O OE2   . GLU C 3 161 ? 25.964  13.503  41.235  1.00 58.97  ? 159 GLU R OE2   1 
ATOM   2071 N N     . ASN C 3 162 ? 31.924  12.502  37.297  1.00 32.71  ? 160 ASN R N     1 
ATOM   2072 C CA    . ASN C 3 162 ? 32.895  11.600  36.692  1.00 32.91  ? 160 ASN R CA    1 
ATOM   2073 C C     . ASN C 3 162 ? 34.178  12.355  36.380  1.00 35.47  ? 160 ASN R C     1 
ATOM   2074 O O     . ASN C 3 162 ? 34.212  13.177  35.461  1.00 40.12  ? 160 ASN R O     1 
ATOM   2075 C CB    . ASN C 3 162 ? 32.313  10.979  35.415  1.00 28.91  ? 160 ASN R CB    1 
ATOM   2076 C CG    . ASN C 3 162 ? 33.201  9.890   34.818  1.00 30.27  ? 160 ASN R CG    1 
ATOM   2077 O OD1   . ASN C 3 162 ? 34.419  9.881   35.002  1.00 48.41  ? 160 ASN R OD1   1 
ATOM   2078 N ND2   . ASN C 3 162 ? 32.584  8.973   34.082  1.00 34.73  ? 160 ASN R ND2   1 
ATOM   2079 N N     . PRO C 3 163 ? 35.237  12.080  37.154  1.00 40.07  ? 161 PRO R N     1 
ATOM   2080 C CA    . PRO C 3 163 ? 36.550  12.719  37.019  1.00 28.04  ? 161 PRO R CA    1 
ATOM   2081 C C     . PRO C 3 163 ? 37.042  12.804  35.574  1.00 38.79  ? 161 PRO R C     1 
ATOM   2082 O O     . PRO C 3 163 ? 37.802  13.718  35.254  1.00 40.80  ? 161 PRO R O     1 
ATOM   2083 C CB    . PRO C 3 163 ? 37.477  11.813  37.847  1.00 33.20  ? 161 PRO R CB    1 
ATOM   2084 C CG    . PRO C 3 163 ? 36.590  10.735  38.464  1.00 32.79  ? 161 PRO R CG    1 
ATOM   2085 C CD    . PRO C 3 163 ? 35.179  11.197  38.330  1.00 32.68  ? 161 PRO R CD    1 
ATOM   2086 N N     . PHE C 3 164 ? 36.618  11.880  34.716  1.00 28.83  ? 162 PHE R N     1 
ATOM   2087 C CA    . PHE C 3 164 ? 37.058  11.901  33.322  1.00 22.12  ? 162 PHE R CA    1 
ATOM   2088 C C     . PHE C 3 164 ? 36.616  13.166  32.593  1.00 23.79  ? 162 PHE R C     1 
ATOM   2089 O O     . PHE C 3 164 ? 37.299  13.639  31.688  1.00 33.05  ? 162 PHE R O     1 
ATOM   2090 C CB    . PHE C 3 164 ? 36.569  10.663  32.564  1.00 32.91  ? 162 PHE R CB    1 
ATOM   2091 C CG    . PHE C 3 164 ? 36.858  10.709  31.085  1.00 33.64  ? 162 PHE R CG    1 
ATOM   2092 C CD1   . PHE C 3 164 ? 38.102  10.343  30.594  1.00 33.08  ? 162 PHE R CD1   1 
ATOM   2093 C CD2   . PHE C 3 164 ? 35.889  11.129  30.186  1.00 30.97  ? 162 PHE R CD2   1 
ATOM   2094 C CE1   . PHE C 3 164 ? 38.373  10.391  29.236  1.00 39.69  ? 162 PHE R CE1   1 
ATOM   2095 C CE2   . PHE C 3 164 ? 36.153  11.181  28.826  1.00 38.97  ? 162 PHE R CE2   1 
ATOM   2096 C CZ    . PHE C 3 164 ? 37.397  10.812  28.350  1.00 43.44  ? 162 PHE R CZ    1 
ATOM   2097 N N     . PHE C 3 165 ? 35.475  13.713  32.993  1.00 26.31  ? 163 PHE R N     1 
ATOM   2098 C CA    . PHE C 3 165 ? 34.908  14.878  32.321  1.00 29.62  ? 163 PHE R CA    1 
ATOM   2099 C C     . PHE C 3 165 ? 35.370  16.209  32.917  1.00 38.84  ? 163 PHE R C     1 
ATOM   2100 O O     . PHE C 3 165 ? 35.031  17.272  32.398  1.00 35.74  ? 163 PHE R O     1 
ATOM   2101 C CB    . PHE C 3 165 ? 33.378  14.805  32.340  1.00 34.41  ? 163 PHE R CB    1 
ATOM   2102 C CG    . PHE C 3 165 ? 32.810  13.680  31.517  1.00 32.26  ? 163 PHE R CG    1 
ATOM   2103 C CD1   . PHE C 3 165 ? 32.769  12.387  32.015  1.00 28.47  ? 163 PHE R CD1   1 
ATOM   2104 C CD2   . PHE C 3 165 ? 32.310  13.917  30.247  1.00 27.90  ? 163 PHE R CD2   1 
ATOM   2105 C CE1   . PHE C 3 165 ? 32.245  11.349  31.260  1.00 33.06  ? 163 PHE R CE1   1 
ATOM   2106 C CE2   . PHE C 3 165 ? 31.784  12.884  29.486  1.00 31.15  ? 163 PHE R CE2   1 
ATOM   2107 C CZ    . PHE C 3 165 ? 31.751  11.599  29.992  1.00 35.65  ? 163 PHE R CZ    1 
ATOM   2108 N N     . HIS C 3 166 ? 36.141  16.147  34.001  1.00 33.41  ? 164 HIS R N     1 
ATOM   2109 C CA    . HIS C 3 166 ? 36.568  17.354  34.713  1.00 32.49  ? 164 HIS R CA    1 
ATOM   2110 C C     . HIS C 3 166 ? 37.295  18.350  33.815  1.00 36.10  ? 164 HIS R C     1 
ATOM   2111 O O     . HIS C 3 166 ? 37.082  19.558  33.918  1.00 34.62  ? 164 HIS R O     1 
ATOM   2112 C CB    . HIS C 3 166 ? 37.436  16.995  35.922  1.00 44.36  ? 164 HIS R CB    1 
ATOM   2113 C CG    . HIS C 3 166 ? 36.656  16.499  37.102  1.00 44.61  ? 164 HIS R CG    1 
ATOM   2114 N ND1   . HIS C 3 166 ? 37.247  15.870  38.174  1.00 39.03  ? 164 HIS R ND1   1 
ATOM   2115 C CD2   . HIS C 3 166 ? 35.330  16.550  37.377  1.00 38.20  ? 164 HIS R CD2   1 
ATOM   2116 C CE1   . HIS C 3 166 ? 36.320  15.549  39.061  1.00 61.49  ? 164 HIS R CE1   1 
ATOM   2117 N NE2   . HIS C 3 166 ? 35.149  15.950  38.601  1.00 55.71  ? 164 HIS R NE2   1 
ATOM   2118 N N     . LYS C 3 167 ? 38.144  17.835  32.930  1.00 33.17  ? 165 LYS R N     1 
ATOM   2119 C CA    . LYS C 3 167 ? 38.894  18.672  31.998  1.00 36.52  ? 165 LYS R CA    1 
ATOM   2120 C C     . LYS C 3 167 ? 38.006  19.255  30.901  1.00 37.20  ? 165 LYS R C     1 
ATOM   2121 O O     . LYS C 3 167 ? 38.467  20.037  30.071  1.00 36.31  ? 165 LYS R O     1 
ATOM   2122 C CB    . LYS C 3 167 ? 40.034  17.872  31.369  1.00 41.86  ? 165 LYS R CB    1 
ATOM   2123 C CG    . LYS C 3 167 ? 39.582  16.571  30.730  1.00 42.50  ? 165 LYS R CG    1 
ATOM   2124 C CD    . LYS C 3 167 ? 40.733  15.844  30.060  1.00 40.21  ? 165 LYS R CD    1 
ATOM   2125 C CE    . LYS C 3 167 ? 40.304  14.461  29.603  1.00 59.45  ? 165 LYS R CE    1 
ATOM   2126 N NZ    . LYS C 3 167 ? 39.853  13.625  30.751  1.00 40.31  ? 165 LYS R NZ    1 
ATOM   2127 N N     . PHE C 3 168 ? 36.733  18.873  30.901  1.00 35.04  ? 166 PHE R N     1 
ATOM   2128 C CA    . PHE C 3 168 ? 35.783  19.380  29.916  1.00 37.21  ? 166 PHE R CA    1 
ATOM   2129 C C     . PHE C 3 168 ? 34.940  20.503  30.503  1.00 42.86  ? 166 PHE R C     1 
ATOM   2130 O O     . PHE C 3 168 ? 33.797  20.712  30.095  1.00 42.04  ? 166 PHE R O     1 
ATOM   2131 C CB    . PHE C 3 168 ? 34.886  18.251  29.408  1.00 33.48  ? 166 PHE R CB    1 
ATOM   2132 C CG    . PHE C 3 168 ? 35.642  17.121  28.775  1.00 29.12  ? 166 PHE R CG    1 
ATOM   2133 C CD1   . PHE C 3 168 ? 36.702  17.375  27.921  1.00 30.20  ? 166 PHE R CD1   1 
ATOM   2134 C CD2   . PHE C 3 168 ? 35.306  15.806  29.044  1.00 31.38  ? 166 PHE R CD2   1 
ATOM   2135 C CE1   . PHE C 3 168 ? 37.410  16.335  27.338  1.00 33.26  ? 166 PHE R CE1   1 
ATOM   2136 C CE2   . PHE C 3 168 ? 36.008  14.762  28.465  1.00 36.60  ? 166 PHE R CE2   1 
ATOM   2137 C CZ    . PHE C 3 168 ? 37.063  15.028  27.611  1.00 34.65  ? 166 PHE R CZ    1 
ATOM   2138 N N     . ARG C 3 169 ? 35.516  21.214  31.469  1.00 38.94  ? 167 ARG R N     1 
ATOM   2139 C CA    . ARG C 3 169 ? 34.872  22.369  32.084  1.00 37.10  ? 167 ARG R CA    1 
ATOM   2140 C C     . ARG C 3 169 ? 34.373  23.314  30.995  1.00 38.93  ? 167 ARG R C     1 
ATOM   2141 O O     . ARG C 3 169 ? 35.140  23.716  30.119  1.00 39.12  ? 167 ARG R O     1 
ATOM   2142 C CB    . ARG C 3 169 ? 35.861  23.092  33.001  1.00 35.53  ? 167 ARG R CB    1 
ATOM   2143 C CG    . ARG C 3 169 ? 35.261  24.221  33.823  1.00 33.66  ? 167 ARG R CG    1 
ATOM   2144 C CD    . ARG C 3 169 ? 36.335  25.223  34.216  1.00 38.83  ? 167 ARG R CD    1 
ATOM   2145 N NE    . ARG C 3 169 ? 37.015  25.750  33.036  1.00 37.55  ? 167 ARG R NE    1 
ATOM   2146 C CZ    . ARG C 3 169 ? 36.599  26.804  32.344  1.00 35.55  ? 167 ARG R CZ    1 
ATOM   2147 N NH1   . ARG C 3 169 ? 35.507  27.454  32.718  1.00 34.20  ? 167 ARG R NH1   1 
ATOM   2148 N NH2   . ARG C 3 169 ? 37.277  27.207  31.278  1.00 39.79  ? 167 ARG R NH2   1 
ATOM   2149 N N     . PRO C 3 170 ? 33.077  23.660  31.047  1.00 36.36  ? 168 PRO R N     1 
ATOM   2150 C CA    . PRO C 3 170 ? 32.357  24.386  29.990  1.00 43.87  ? 168 PRO R CA    1 
ATOM   2151 C C     . PRO C 3 170 ? 32.748  25.859  29.864  1.00 39.56  ? 168 PRO R C     1 
ATOM   2152 O O     . PRO C 3 170 ? 32.837  26.552  30.875  1.00 40.83  ? 168 PRO R O     1 
ATOM   2153 C CB    . PRO C 3 170 ? 30.888  24.294  30.436  1.00 29.04  ? 168 PRO R CB    1 
ATOM   2154 C CG    . PRO C 3 170 ? 30.852  23.248  31.516  1.00 38.72  ? 168 PRO R CG    1 
ATOM   2155 C CD    . PRO C 3 170 ? 32.192  23.307  32.168  1.00 26.21  ? 168 PRO R CD    1 
ATOM   2156 N N     . SER C 3 171 ? 32.959  26.330  28.637  1.00 39.03  ? 169 SER R N     1 
ATOM   2157 C CA    . SER C 3 171 ? 33.163  27.754  28.390  1.00 29.79  ? 169 SER R CA    1 
ATOM   2158 C C     . SER C 3 171 ? 31.870  28.495  28.703  1.00 44.28  ? 169 SER R C     1 
ATOM   2159 O O     . SER C 3 171 ? 30.785  27.920  28.608  1.00 51.05  ? 169 SER R O     1 
ATOM   2160 C CB    . SER C 3 171 ? 33.562  28.002  26.936  1.00 33.02  ? 169 SER R CB    1 
ATOM   2161 O OG    . SER C 3 171 ? 32.472  27.770  26.061  1.00 44.69  ? 169 SER R OG    1 
ATOM   2162 N N     . GLN C 3 172 ? 31.979  29.765  29.078  1.00 51.67  ? 170 GLN R N     1 
ATOM   2163 C CA    . GLN C 3 172 ? 30.801  30.543  29.446  1.00 50.99  ? 170 GLN R CA    1 
ATOM   2164 C C     . GLN C 3 172 ? 29.839  30.702  28.271  1.00 60.50  ? 170 GLN R C     1 
ATOM   2165 O O     . GLN C 3 172 ? 28.622  30.747  28.460  1.00 57.43  ? 170 GLN R O     1 
ATOM   2166 C CB    . GLN C 3 172 ? 31.196  31.916  29.995  1.00 48.93  ? 170 GLN R CB    1 
ATOM   2167 C CG    . GLN C 3 172 ? 30.033  32.689  30.603  1.00 52.22  ? 170 GLN R CG    1 
ATOM   2168 C CD    . GLN C 3 172 ? 29.443  31.997  31.819  1.00 52.74  ? 170 GLN R CD    1 
ATOM   2169 O OE1   . GLN C 3 172 ? 30.164  31.407  32.623  1.00 51.48  ? 170 GLN R OE1   1 
ATOM   2170 N NE2   . GLN C 3 172 ? 28.123  32.064  31.957  1.00 51.98  ? 170 GLN R NE2   1 
ATOM   2171 N N     . LYS C 3 173 ? 30.388  30.783  27.062  1.00 48.86  ? 171 LYS R N     1 
ATOM   2172 C CA    . LYS C 3 173 ? 29.565  30.914  25.864  1.00 50.22  ? 171 LYS R CA    1 
ATOM   2173 C C     . LYS C 3 173 ? 28.647  29.706  25.710  1.00 54.74  ? 171 LYS R C     1 
ATOM   2174 O O     . LYS C 3 173 ? 27.519  29.827  25.231  1.00 58.36  ? 171 LYS R O     1 
ATOM   2175 C CB    . LYS C 3 173 ? 30.434  31.092  24.613  1.00 46.09  ? 171 LYS R CB    1 
ATOM   2176 C CG    . LYS C 3 173 ? 29.631  31.361  23.345  1.00 73.46  ? 171 LYS R CG    1 
ATOM   2177 C CD    . LYS C 3 173 ? 30.513  31.711  22.147  1.00 74.27  ? 171 LYS R CD    1 
ATOM   2178 C CE    . LYS C 3 173 ? 31.226  30.492  21.582  1.00 67.03  ? 171 LYS R CE    1 
ATOM   2179 N NZ    . LYS C 3 173 ? 31.507  30.636  20.122  1.00 61.58  ? 171 LYS R NZ    1 
ATOM   2180 N N     . LEU C 3 174 ? 29.137  28.544  26.130  1.00 45.36  ? 172 LEU R N     1 
ATOM   2181 C CA    . LEU C 3 174 ? 28.354  27.316  26.089  1.00 40.82  ? 172 LEU R CA    1 
ATOM   2182 C C     . LEU C 3 174 ? 27.266  27.342  27.157  1.00 45.20  ? 172 LEU R C     1 
ATOM   2183 O O     . LEU C 3 174 ? 26.115  26.995  26.893  1.00 46.24  ? 172 LEU R O     1 
ATOM   2184 C CB    . LEU C 3 174 ? 29.261  26.098  26.283  1.00 43.25  ? 172 LEU R CB    1 
ATOM   2185 C CG    . LEU C 3 174 ? 28.611  24.719  26.161  1.00 29.61  ? 172 LEU R CG    1 
ATOM   2186 C CD1   . LEU C 3 174 ? 27.931  24.579  24.813  1.00 37.38  ? 172 LEU R CD1   1 
ATOM   2187 C CD2   . LEU C 3 174 ? 29.639  23.612  26.359  1.00 26.88  ? 172 LEU R CD2   1 
ATOM   2188 N N     . LEU C 3 175 ? 27.640  27.763  28.361  1.00 36.43  ? 173 LEU R N     1 
ATOM   2189 C CA    . LEU C 3 175 ? 26.691  27.877  29.462  1.00 50.14  ? 173 LEU R CA    1 
ATOM   2190 C C     . LEU C 3 175 ? 25.558  28.853  29.137  1.00 49.43  ? 173 LEU R C     1 
ATOM   2191 O O     . LEU C 3 175 ? 24.395  28.594  29.451  1.00 47.37  ? 173 LEU R O     1 
ATOM   2192 C CB    . LEU C 3 175 ? 27.409  28.284  30.753  1.00 45.68  ? 173 LEU R CB    1 
ATOM   2193 C CG    . LEU C 3 175 ? 28.176  27.164  31.464  1.00 44.06  ? 173 LEU R CG    1 
ATOM   2194 C CD1   . LEU C 3 175 ? 28.930  27.683  32.680  1.00 44.60  ? 173 LEU R CD1   1 
ATOM   2195 C CD2   . LEU C 3 175 ? 27.221  26.056  31.866  1.00 41.64  ? 173 LEU R CD2   1 
ATOM   2196 N N     . ASP C 3 176 ? 25.900  29.968  28.498  1.00 47.37  ? 174 ASP R N     1 
ATOM   2197 C CA    . ASP C 3 176 ? 24.902  30.961  28.112  1.00 59.61  ? 174 ASP R CA    1 
ATOM   2198 C C     . ASP C 3 176 ? 23.964  30.398  27.050  1.00 61.04  ? 174 ASP R C     1 
ATOM   2199 O O     . ASP C 3 176 ? 22.744  30.526  27.155  1.00 58.76  ? 174 ASP R O     1 
ATOM   2200 C CB    . ASP C 3 176 ? 25.574  32.241  27.605  1.00 65.81  ? 174 ASP R CB    1 
ATOM   2201 C CG    . ASP C 3 176 ? 26.292  33.001  28.706  1.00 71.21  ? 174 ASP R CG    1 
ATOM   2202 O OD1   . ASP C 3 176 ? 25.871  32.894  29.877  1.00 53.50  ? 174 ASP R OD1   1 
ATOM   2203 O OD2   . ASP C 3 176 ? 27.275  33.709  28.397  1.00 62.53  ? 174 ASP R OD2   1 
ATOM   2204 N N     . ALA C 3 177 ? 24.546  29.770  26.033  1.00 47.96  ? 175 ALA R N     1 
ATOM   2205 C CA    . ALA C 3 177 ? 23.775  29.145  24.964  1.00 46.73  ? 175 ALA R CA    1 
ATOM   2206 C C     . ALA C 3 177 ? 22.808  28.091  25.503  1.00 54.91  ? 175 ALA R C     1 
ATOM   2207 O O     . ALA C 3 177 ? 21.681  27.961  25.022  1.00 51.27  ? 175 ALA R O     1 
ATOM   2208 C CB    . ALA C 3 177 ? 24.708  28.532  23.933  1.00 31.59  ? 175 ALA R CB    1 
ATOM   2209 N N     . LEU C 3 178 ? 23.255  27.345  26.508  1.00 46.87  ? 176 LEU R N     1 
ATOM   2210 C CA    . LEU C 3 178 ? 22.451  26.274  27.088  1.00 45.21  ? 176 LEU R CA    1 
ATOM   2211 C C     . LEU C 3 178 ? 21.249  26.787  27.875  1.00 49.32  ? 176 LEU R C     1 
ATOM   2212 O O     . LEU C 3 178 ? 20.196  26.152  27.894  1.00 51.11  ? 176 LEU R O     1 
ATOM   2213 C CB    . LEU C 3 178 ? 23.316  25.373  27.973  1.00 34.96  ? 176 LEU R CB    1 
ATOM   2214 C CG    . LEU C 3 178 ? 24.247  24.424  27.220  1.00 40.14  ? 176 LEU R CG    1 
ATOM   2215 C CD1   . LEU C 3 178 ? 25.159  23.678  28.181  1.00 22.50  ? 176 LEU R CD1   1 
ATOM   2216 C CD2   . LEU C 3 178 ? 23.426  23.449  26.395  1.00 30.12  ? 176 LEU R CD2   1 
ATOM   2217 N N     . GLN C 3 179 ? 21.403  27.933  28.527  1.00 51.38  ? 177 GLN R N     1 
ATOM   2218 C CA    . GLN C 3 179 ? 20.315  28.486  29.324  1.00 65.36  ? 177 GLN R CA    1 
ATOM   2219 C C     . GLN C 3 179 ? 19.277  29.187  28.442  1.00 65.58  ? 177 GLN R C     1 
ATOM   2220 O O     . GLN C 3 179 ? 18.109  29.300  28.817  1.00 63.82  ? 177 GLN R O     1 
ATOM   2221 C CB    . GLN C 3 179 ? 20.857  29.420  30.413  1.00 62.71  ? 177 GLN R CB    1 
ATOM   2222 C CG    . GLN C 3 179 ? 21.435  30.728  29.899  1.00 86.98  ? 177 GLN R CG    1 
ATOM   2223 C CD    . GLN C 3 179 ? 20.426  31.861  29.929  1.00 90.48  ? 177 GLN R CD    1 
ATOM   2224 O OE1   . GLN C 3 179 ? 19.395  31.772  30.598  1.00 73.58  ? 177 GLN R OE1   1 
ATOM   2225 N NE2   . GLN C 3 179 ? 20.720  32.935  29.203  1.00 71.78  ? 177 GLN R NE2   1 
ATOM   2226 N N     . LYS C 3 180 ? 19.707  29.638  27.265  1.00 37.89  ? 178 LYS R N     1 
ATOM   2227 C CA    . LYS C 3 180 ? 18.810  30.289  26.310  1.00 54.34  ? 178 LYS R CA    1 
ATOM   2228 C C     . LYS C 3 180 ? 17.836  29.302  25.671  1.00 56.90  ? 178 LYS R C     1 
ATOM   2229 O O     . LYS C 3 180 ? 16.859  29.705  25.040  1.00 59.78  ? 178 LYS R O     1 
ATOM   2230 C CB    . LYS C 3 180 ? 19.606  30.991  25.202  1.00 65.08  ? 178 LYS R CB    1 
ATOM   2231 C CG    . LYS C 3 180 ? 20.361  32.235  25.639  1.00 77.03  ? 178 LYS R CG    1 
ATOM   2232 C CD    . LYS C 3 180 ? 20.824  33.043  24.430  1.00 68.99  ? 178 LYS R CD    1 
ATOM   2233 C CE    . LYS C 3 180 ? 21.790  32.256  23.554  1.00 78.76  ? 178 LYS R CE    1 
ATOM   2234 N NZ    . LYS C 3 180 ? 23.127  32.084  24.191  1.00 60.94  ? 178 LYS R NZ    1 
ATOM   2235 N N     . VAL C 3 181 ? 18.112  28.012  25.829  1.00 49.16  ? 179 VAL R N     1 
ATOM   2236 C CA    . VAL C 3 181 ? 17.323  26.970  25.176  1.00 44.10  ? 179 VAL R CA    1 
ATOM   2237 C C     . VAL C 3 181 ? 16.000  26.682  25.890  1.00 50.12  ? 179 VAL R C     1 
ATOM   2238 O O     . VAL C 3 181 ? 15.953  26.600  27.118  1.00 56.02  ? 179 VAL R O     1 
ATOM   2239 C CB    . VAL C 3 181 ? 18.131  25.665  25.043  1.00 41.93  ? 179 VAL R CB    1 
ATOM   2240 C CG1   . VAL C 3 181 ? 17.240  24.527  24.572  1.00 40.69  ? 179 VAL R CG1   1 
ATOM   2241 C CG2   . VAL C 3 181 ? 19.300  25.865  24.093  1.00 31.20  ? 179 VAL R CG2   1 
ATOM   2242 N N     . ALA C 3 182 ? 14.932  26.530  25.108  1.00 50.04  ? 180 ALA R N     1 
ATOM   2243 C CA    . ALA C 3 182 ? 13.606  26.225  25.643  1.00 38.32  ? 180 ALA R CA    1 
ATOM   2244 C C     . ALA C 3 182 ? 12.814  25.336  24.686  1.00 44.29  ? 180 ALA R C     1 
ATOM   2245 O O     . ALA C 3 182 ? 13.100  25.292  23.491  1.00 51.79  ? 180 ALA R O     1 
ATOM   2246 C CB    . ALA C 3 182 ? 12.843  27.504  25.932  1.00 45.86  ? 180 ALA R CB    1 
ATOM   2247 N N     . VAL C 3 183 ? 11.814  24.637  25.217  1.00 35.40  ? 181 VAL R N     1 
ATOM   2248 C CA    . VAL C 3 183 ? 11.024  23.691  24.436  1.00 43.26  ? 181 VAL R CA    1 
ATOM   2249 C C     . VAL C 3 183 ? 9.535   23.923  24.679  1.00 40.55  ? 181 VAL R C     1 
ATOM   2250 O O     . VAL C 3 183 ? 9.107   24.001  25.828  1.00 45.30  ? 181 VAL R O     1 
ATOM   2251 C CB    . VAL C 3 183 ? 11.374  22.235  24.817  1.00 41.60  ? 181 VAL R CB    1 
ATOM   2252 C CG1   . VAL C 3 183 ? 10.645  21.249  23.914  1.00 35.51  ? 181 VAL R CG1   1 
ATOM   2253 C CG2   . VAL C 3 183 ? 12.874  22.014  24.747  1.00 41.56  ? 181 VAL R CG2   1 
ATOM   2254 N N     . GLY C 3 184 ? 8.752   24.025  23.605  1.00 47.16  ? 182 GLY R N     1 
ATOM   2255 C CA    . GLY C 3 184 ? 7.331   24.321  23.715  1.00 43.87  ? 182 GLY R CA    1 
ATOM   2256 C C     . GLY C 3 184 ? 7.113   25.559  24.564  1.00 39.92  ? 182 GLY R C     1 
ATOM   2257 O O     . GLY C 3 184 ? 7.807   26.561  24.384  1.00 35.79  ? 182 GLY R O     1 
ATOM   2258 N N     . ASN C 3 185 ? 6.163   25.502  25.493  1.00 32.60  ? 183 ASN R N     1 
ATOM   2259 C CA    . ASN C 3 185 ? 6.109   26.530  26.526  1.00 45.48  ? 183 ASN R CA    1 
ATOM   2260 C C     . ASN C 3 185 ? 7.239   26.283  27.523  1.00 59.41  ? 183 ASN R C     1 
ATOM   2261 O O     . ASN C 3 185 ? 7.562   25.136  27.829  1.00 75.09  ? 183 ASN R O     1 
ATOM   2262 C CB    . ASN C 3 185 ? 4.728   26.623  27.201  1.00 30.37  ? 183 ASN R CB    1 
ATOM   2263 C CG    . ASN C 3 185 ? 4.316   25.345  27.929  1.00 45.78  ? 183 ASN R CG    1 
ATOM   2264 O OD1   . ASN C 3 185 ? 5.097   24.742  28.665  1.00 54.77  ? 183 ASN R OD1   1 
ATOM   2265 N ND2   . ASN C 3 185 ? 3.062   24.949  27.745  1.00 47.45  ? 183 ASN R ND2   1 
ATOM   2266 N N     . GLY C 3 186 ? 7.863   27.350  28.007  1.00 46.05  ? 184 GLY R N     1 
ATOM   2267 C CA    . GLY C 3 186 ? 9.024   27.205  28.868  1.00 50.60  ? 184 GLY R CA    1 
ATOM   2268 C C     . GLY C 3 186 ? 8.680   26.821  30.294  1.00 51.66  ? 184 GLY R C     1 
ATOM   2269 O O     . GLY C 3 186 ? 9.429   27.131  31.219  1.00 62.90  ? 184 GLY R O     1 
ATOM   2270 N N     . ARG C 3 187 ? 7.589   26.090  30.425  1.00 43.55  ? 185 ARG R N     1 
ATOM   2271 C CA    . ARG C 3 187 ? 6.996   25.816  31.697  1.00 51.48  ? 185 ARG R CA    1 
ATOM   2272 C C     . ARG C 3 187 ? 7.303   24.489  32.319  1.00 48.04  ? 185 ARG R C     1 
ATOM   2273 O O     . ARG C 3 187 ? 6.965   24.259  33.429  1.00 57.01  ? 185 ARG R O     1 
ATOM   2274 C CB    . ARG C 3 187 ? 5.495   26.019  31.602  1.00 52.48  ? 185 ARG R CB    1 
ATOM   2275 C CG    . ARG C 3 187 ? 5.072   27.457  31.361  1.00 54.89  ? 185 ARG R CG    1 
ATOM   2276 C CD    . ARG C 3 187 ? 3.866   27.830  32.154  1.00 37.26  ? 185 ARG R CD    1 
ATOM   2277 N NE    . ARG C 3 187 ? 2.727   27.044  31.777  1.00 38.30  ? 185 ARG R NE    1 
ATOM   2278 C CZ    . ARG C 3 187 ? 1.979   27.306  30.741  1.00 33.77  ? 185 ARG R CZ    1 
ATOM   2279 N NH1   . ARG C 3 187 ? 2.262   28.319  30.002  1.00 32.13  ? 185 ARG R NH1   1 
ATOM   2280 N NH2   . ARG C 3 187 ? 0.957   26.563  30.468  1.00 33.97  ? 185 ARG R NH2   1 
ATOM   2281 N N     . SER C 3 188 ? 7.962   23.624  31.594  1.00 57.39  ? 186 SER R N     1 
ATOM   2282 C CA    . SER C 3 188 ? 8.360   22.307  32.093  1.00 58.80  ? 186 SER R CA    1 
ATOM   2283 C C     . SER C 3 188 ? 9.515   22.425  33.088  1.00 48.25  ? 186 SER R C     1 
ATOM   2284 O O     . SER C 3 188 ? 10.555  23.005  32.776  1.00 41.49  ? 186 SER R O     1 
ATOM   2285 C CB    . SER C 3 188 ? 8.751   21.381  30.939  1.00 45.32  ? 186 SER R CB    1 
ATOM   2286 O OG    . SER C 3 188 ? 9.090   20.091  31.418  1.00 43.85  ? 186 SER R OG    1 
ATOM   2287 N N     . ASN C 3 189 ? 9.328   21.876  34.285  1.00 36.07  ? 187 ASN R N     1 
ATOM   2288 C CA    . ASN C 3 189 ? 10.331  21.985  35.342  1.00 53.83  ? 187 ASN R CA    1 
ATOM   2289 C C     . ASN C 3 189 ? 10.141  20.941  36.440  1.00 51.65  ? 187 ASN R C     1 
ATOM   2290 O O     . ASN C 3 189 ? 9.681   21.266  37.534  1.00 47.15  ? 187 ASN R O     1 
ATOM   2291 C CB    . ASN C 3 189 ? 10.306  23.392  35.948  1.00 48.66  ? 187 ASN R CB    1 
ATOM   2292 C CG    . ASN C 3 189 ? 11.500  23.667  36.845  1.00 65.47  ? 187 ASN R CG    1 
ATOM   2293 O OD1   . ASN C 3 189 ? 12.558  23.055  36.697  1.00 61.32  ? 187 ASN R OD1   1 
ATOM   2294 N ND2   . ASN C 3 189 ? 11.334  24.598  37.780  1.00 68.46  ? 187 ASN R ND2   1 
ATOM   2295 N N     . PRO C 3 190 ? 10.497  19.679  36.146  1.00 57.43  ? 188 PRO R N     1 
ATOM   2296 C CA    . PRO C 3 190 ? 10.357  18.552  37.081  1.00 60.70  ? 188 PRO R CA    1 
ATOM   2297 C C     . PRO C 3 190 ? 11.145  18.739  38.379  1.00 60.29  ? 188 PRO R C     1 
ATOM   2298 O O     . PRO C 3 190 ? 12.086  19.532  38.427  1.00 51.95  ? 188 PRO R O     1 
ATOM   2299 C CB    . PRO C 3 190 ? 10.933  17.370  36.292  1.00 53.89  ? 188 PRO R CB    1 
ATOM   2300 C CG    . PRO C 3 190 ? 10.784  17.759  34.860  1.00 49.35  ? 188 PRO R CG    1 
ATOM   2301 C CD    . PRO C 3 190 ? 10.998  19.245  34.831  1.00 51.81  ? 188 PRO R CD    1 
ATOM   2302 N N     . SER C 3 191 ? 10.759  18.001  39.416  1.00 69.72  ? 189 SER R N     1 
ATOM   2303 C CA    . SER C 3 191 ? 11.421  18.074  40.716  1.00 75.27  ? 189 SER R CA    1 
ATOM   2304 C C     . SER C 3 191 ? 12.672  17.202  40.766  1.00 79.15  ? 189 SER R C     1 
ATOM   2305 O O     . SER C 3 191 ? 12.656  16.104  41.326  1.00 75.89  ? 189 SER R O     1 
ATOM   2306 C CB    . SER C 3 191 ? 10.452  17.665  41.828  1.00 74.85  ? 189 SER R CB    1 
ATOM   2307 O OG    . SER C 3 191 ? 9.890   16.389  41.572  1.00 61.36  ? 189 SER R OG    1 
HETATM 2308 C C1    . EDO D 4 .   ? 17.989  15.994  19.323  1.00 36.45  ? 301 EDO R C1    1 
HETATM 2309 O O1    . EDO D 4 .   ? 18.884  17.083  19.063  1.00 58.14  ? 301 EDO R O1    1 
HETATM 2310 C C2    . EDO D 4 .   ? 17.375  15.542  18.006  1.00 48.76  ? 301 EDO R C2    1 
HETATM 2311 O O2    . EDO D 4 .   ? 18.302  14.700  17.310  1.00 44.03  ? 301 EDO R O2    1 
HETATM 2312 O O     . HOH E 5 .   ? 15.345  5.067   -2.180  1.00 27.27  ? 101 HOH A O     1 
HETATM 2313 O O     . HOH E 5 .   ? 11.902  17.296  13.320  1.00 36.45  ? 102 HOH A O     1 
HETATM 2314 O O     . HOH E 5 .   ? 5.910   9.566   15.765  1.00 38.39  ? 103 HOH A O     1 
HETATM 2315 O O     . HOH E 5 .   ? 17.216  1.843   -2.809  1.00 39.37  ? 104 HOH A O     1 
HETATM 2316 O O     . HOH E 5 .   ? -8.255  25.546  35.200  1.00 45.73  ? 105 HOH A O     1 
HETATM 2317 O O     . HOH E 5 .   ? 14.500  7.206   -4.026  1.00 38.54  ? 106 HOH A O     1 
HETATM 2318 O O     . HOH E 5 .   ? 9.334   10.981  -0.990  1.00 36.95  ? 107 HOH A O     1 
HETATM 2319 O O     . HOH E 5 .   ? 3.894   11.114  14.191  1.00 35.40  ? 108 HOH A O     1 
HETATM 2320 O O     . HOH E 5 .   ? 14.081  17.908  12.377  1.00 47.82  ? 109 HOH A O     1 
HETATM 2321 O O     . HOH E 5 .   ? 15.035  23.220  19.319  1.00 49.31  ? 110 HOH A O     1 
HETATM 2322 O O     . HOH E 5 .   ? 2.337   9.141   11.992  1.00 48.97  ? 111 HOH A O     1 
HETATM 2323 O O     . HOH E 5 .   ? 1.390   7.840   15.008  1.00 52.72  ? 112 HOH A O     1 
HETATM 2324 O O     . HOH E 5 .   ? 3.211   11.803  -4.743  1.00 54.22  ? 113 HOH A O     1 
HETATM 2325 O O     . HOH E 5 .   ? 8.175   11.553  -10.486 1.00 56.79  ? 114 HOH A O     1 
HETATM 2326 O O     . HOH E 5 .   ? 1.887   0.343   6.997   1.00 51.64  ? 115 HOH A O     1 
HETATM 2327 O O     . HOH E 5 .   ? 4.163   14.236  21.736  1.00 31.29  ? 116 HOH A O     1 
HETATM 2328 O O     . HOH E 5 .   ? 15.511  17.475  21.655  1.00 33.93  ? 117 HOH A O     1 
HETATM 2329 O O     . HOH E 5 .   ? 16.205  9.601   18.209  1.00 28.50  ? 118 HOH A O     1 
HETATM 2330 O O     . HOH F 5 .   ? 12.364  10.169  10.063  1.00 24.95  ? 101 HOH B O     1 
HETATM 2331 O O     . HOH F 5 .   ? 4.720   21.689  28.010  1.00 37.79  ? 102 HOH B O     1 
HETATM 2332 O O     . HOH F 5 .   ? 14.509  -1.780  -2.529  1.00 35.77  ? 103 HOH B O     1 
HETATM 2333 O O     . HOH F 5 .   ? 3.995   16.150  25.801  1.00 33.91  ? 104 HOH B O     1 
HETATM 2334 O O     . HOH F 5 .   ? 12.125  -3.983  -1.963  1.00 36.12  ? 105 HOH B O     1 
HETATM 2335 O O     . HOH F 5 .   ? 13.715  -5.290  -3.618  1.00 43.22  ? 106 HOH B O     1 
HETATM 2336 O O     . HOH F 5 .   ? -5.187  28.880  34.086  1.00 41.17  ? 107 HOH B O     1 
HETATM 2337 O O     . HOH F 5 .   ? 5.114   19.524  29.812  1.00 35.13  ? 108 HOH B O     1 
HETATM 2338 O O     . HOH F 5 .   ? 12.026  12.332  1.140   1.00 43.15  ? 109 HOH B O     1 
HETATM 2339 O O     . HOH F 5 .   ? 5.577   19.259  4.404   1.00 43.56  ? 110 HOH B O     1 
HETATM 2340 O O     . HOH F 5 .   ? 0.140   20.140  36.738  1.00 47.17  ? 111 HOH B O     1 
HETATM 2341 O O     . HOH F 5 .   ? 10.255  -2.069  10.264  1.00 52.39  ? 112 HOH B O     1 
HETATM 2342 O O     . HOH F 5 .   ? 4.136   -3.616  -0.376  1.00 50.46  ? 113 HOH B O     1 
HETATM 2343 O O     . HOH F 5 .   ? 4.356   13.864  30.876  1.00 32.09  ? 114 HOH B O     1 
HETATM 2344 O O     . HOH F 5 .   ? 12.732  7.243   10.206  1.00 34.25  ? 115 HOH B O     1 
HETATM 2345 O O     . HOH F 5 .   ? 20.307  4.829   5.809   1.00 41.81  ? 116 HOH B O     1 
HETATM 2346 O O     . HOH G 5 .   ? 5.919   16.820  23.762  1.00 38.81  ? 401 HOH R O     1 
HETATM 2347 O O     . HOH G 5 .   ? 6.815   7.030   17.554  1.00 43.03  ? 402 HOH R O     1 
HETATM 2348 O O     . HOH G 5 .   ? 4.755   16.032  30.046  1.00 38.33  ? 403 HOH R O     1 
HETATM 2349 O O     . HOH G 5 .   ? 15.571  19.682  23.572  1.00 23.74  ? 404 HOH R O     1 
HETATM 2350 O O     . HOH G 5 .   ? 20.670  10.133  30.034  1.00 23.31  ? 405 HOH R O     1 
HETATM 2351 O O     . HOH G 5 .   ? 22.276  8.070   29.555  1.00 24.92  ? 406 HOH R O     1 
HETATM 2352 O O     . HOH G 5 .   ? 32.555  7.775   30.611  1.00 22.22  ? 407 HOH R O     1 
HETATM 2353 O O     . HOH G 5 .   ? 20.219  7.264   13.380  1.00 28.38  ? 408 HOH R O     1 
HETATM 2354 O O     . HOH G 5 .   ? 27.375  -0.014  25.187  1.00 37.81  ? 409 HOH R O     1 
HETATM 2355 O O     . HOH G 5 .   ? 28.690  14.443  13.551  1.00 31.78  ? 410 HOH R O     1 
HETATM 2356 O O     . HOH G 5 .   ? 16.692  -1.808  15.653  1.00 29.95  ? 411 HOH R O     1 
HETATM 2357 O O     . HOH G 5 .   ? 5.516   17.106  28.095  1.00 29.57  ? 412 HOH R O     1 
HETATM 2358 O O     . HOH G 5 .   ? 7.697   9.772   26.748  1.00 35.78  ? 413 HOH R O     1 
HETATM 2359 O O     . HOH G 5 .   ? 27.185  1.655   19.432  1.00 42.43  ? 414 HOH R O     1 
HETATM 2360 O O     . HOH G 5 .   ? 17.749  -2.918  13.141  1.00 36.25  ? 415 HOH R O     1 
HETATM 2361 O O     . HOH G 5 .   ? 14.609  -2.765  24.980  1.00 39.38  ? 416 HOH R O     1 
HETATM 2362 O O     . HOH G 5 .   ? 31.529  7.145   17.815  1.00 38.92  ? 417 HOH R O     1 
HETATM 2363 O O     . HOH G 5 .   ? 32.314  27.158  33.161  1.00 45.29  ? 418 HOH R O     1 
HETATM 2364 O O     . HOH G 5 .   ? 39.459  15.047  33.552  1.00 38.39  ? 419 HOH R O     1 
HETATM 2365 O O     . HOH G 5 .   ? 33.497  6.926   19.079  1.00 41.39  ? 420 HOH R O     1 
HETATM 2366 O O     . HOH G 5 .   ? 1.417   13.026  22.808  1.00 43.11  ? 421 HOH R O     1 
HETATM 2367 O O     . HOH G 5 .   ? 6.940   18.877  32.218  1.00 42.63  ? 422 HOH R O     1 
HETATM 2368 O O     . HOH G 5 .   ? 21.138  11.683  6.963   1.00 49.10  ? 423 HOH R O     1 
HETATM 2369 O O     . HOH G 5 .   ? 22.481  7.756   37.717  1.00 40.74  ? 424 HOH R O     1 
HETATM 2370 O O     . HOH G 5 .   ? 5.894   4.655   17.288  1.00 41.82  ? 425 HOH R O     1 
HETATM 2371 O O     . HOH G 5 .   ? 28.681  5.206   33.471  1.00 46.47  ? 426 HOH R O     1 
HETATM 2372 O O     . HOH G 5 .   ? 18.037  2.587   6.077   1.00 42.47  ? 427 HOH R O     1 
HETATM 2373 O O     . HOH G 5 .   ? 20.247  3.325   7.518   1.00 35.52  ? 428 HOH R O     1 
HETATM 2374 O O     . HOH G 5 .   ? 27.019  -0.930  17.300  1.00 57.80  ? 429 HOH R O     1 
HETATM 2375 O O     . HOH G 5 .   ? 32.964  25.949  24.375  1.00 42.56  ? 430 HOH R O     1 
HETATM 2376 O O     . HOH G 5 .   ? 14.949  12.411  32.796  1.00 45.25  ? 431 HOH R O     1 
HETATM 2377 O O     . HOH G 5 .   ? 15.905  21.493  22.279  1.00 44.97  ? 432 HOH R O     1 
HETATM 2378 O O     . HOH G 5 .   ? 10.842  -1.253  20.126  1.00 41.61  ? 433 HOH R O     1 
HETATM 2379 O O     . HOH G 5 .   ? 16.561  15.528  33.354  1.00 45.18  ? 434 HOH R O     1 
HETATM 2380 O O     . HOH G 5 .   ? 16.319  20.405  31.803  1.00 43.78  ? 435 HOH R O     1 
HETATM 2381 O O     . HOH G 5 .   ? 22.954  12.763  41.206  1.00 44.21  ? 436 HOH R O     1 
HETATM 2382 O O     . HOH G 5 .   ? 0.849   27.099  27.151  1.00 43.53  ? 437 HOH R O     1 
HETATM 2383 O O     . HOH G 5 .   ? 16.862  -5.536  21.261  1.00 52.29  ? 438 HOH R O     1 
HETATM 2384 O O     . HOH G 5 .   ? 7.669   9.799   29.103  1.00 49.72  ? 439 HOH R O     1 
HETATM 2385 O O     . HOH G 5 .   ? 16.213  -4.038  23.628  1.00 46.07  ? 440 HOH R O     1 
HETATM 2386 O O     . HOH G 5 .   ? 19.274  -4.209  21.166  1.00 50.95  ? 441 HOH R O     1 
HETATM 2387 O O     . HOH G 5 .   ? 26.224  1.032   16.515  1.00 51.27  ? 442 HOH R O     1 
HETATM 2388 O O     . HOH G 5 .   ? 15.330  18.560  33.303  1.00 44.49  ? 443 HOH R O     1 
HETATM 2389 O O     . HOH G 5 .   ? 5.138   23.007  26.063  1.00 34.56  ? 444 HOH R O     1 
HETATM 2390 O O     . HOH G 5 .   ? 14.385  -4.581  22.330  1.00 53.75  ? 445 HOH R O     1 
HETATM 2391 O O     . HOH G 5 .   ? 22.747  9.274   39.500  1.00 50.63  ? 446 HOH R O     1 
HETATM 2392 O O     . HOH G 5 .   ? 24.141  10.800  41.537  1.00 54.88  ? 447 HOH R O     1 
HETATM 2393 O O     . HOH G 5 .   ? 13.818  24.331  21.050  1.00 56.17  ? 448 HOH R O     1 
HETATM 2394 O O     . HOH G 5 .   ? 34.629  26.170  22.610  1.00 51.93  ? 449 HOH R O     1 
HETATM 2395 O O     . HOH G 5 .   ? 10.757  14.382  33.895  1.00 49.52  ? 450 HOH R O     1 
HETATM 2396 O O     . HOH G 5 .   ? 23.616  27.115  31.049  1.00 51.09  ? 451 HOH R O     1 
HETATM 2397 O O     . HOH G 5 .   ? 17.145  19.936  13.137  1.00 55.35  ? 452 HOH R O     1 
HETATM 2398 O O     . HOH G 5 .   ? 20.594  8.136   39.093  1.00 55.38  ? 453 HOH R O     1 
HETATM 2399 O O     . HOH G 5 .   ? 23.570  -7.576  18.574  1.00 53.59  ? 454 HOH R O     1 
HETATM 2400 O O     . HOH G 5 .   ? 17.461  32.788  29.853  1.00 68.34  ? 455 HOH R O     1 
HETATM 2401 O O     . HOH G 5 .   ? 13.864  13.884  20.041  1.00 21.75  ? 456 HOH R O     1 
HETATM 2402 O O     . HOH G 5 .   ? 26.926  -0.051  22.099  1.00 39.62  ? 457 HOH R O     1 
HETATM 2403 O O     . HOH G 5 .   ? 14.840  6.729   16.954  1.00 32.92  ? 458 HOH R O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   1   1   DG  DG  A . n 
A 1 2   DC  2   2   2   DC  DC  A . n 
A 1 3   DG  3   3   3   DG  DG  A . n 
A 1 4   DC  4   4   4   DC  DC  A . n 
A 1 5   DG  5   5   5   DG  DG  A . n 
A 1 6   DT  6   6   6   DT  DT  A . n 
A 1 7   DT  7   7   7   DT  DT  A . n 
A 1 8   DA  8   8   8   DA  DA  A . n 
A 1 9   DG  9   9   9   DG  DG  A . n 
A 1 10  DT  10  10  10  DT  DT  A . n 
A 1 11  DG  11  11  11  DG  DG  A . n 
A 1 12  DT  12  12  12  DT  DT  A . n 
A 1 13  DT  13  13  13  DT  DT  A . n 
A 1 14  DT  14  14  14  DT  DT  A . n 
A 1 15  DA  15  15  15  DA  DA  A . n 
A 1 16  DC  16  16  16  DC  DC  A . n 
A 1 17  DG  17  17  17  DG  DG  A . n 
A 1 18  DC  18  18  18  DC  DC  A . n 
A 1 19  DG  19  19  19  DG  DG  A . n 
A 1 20  DG  20  20  20  DG  DG  A . n 
B 2 1   DC  1   2   2   DC  DC  B . n 
B 2 2   DG  2   3   3   DG  DG  B . n 
B 2 3   DC  3   4   4   DC  DC  B . n 
B 2 4   DG  4   5   5   DG  DG  B . n 
B 2 5   DT  5   6   6   DT  DT  B . n 
B 2 6   DA  6   7   7   DA  DA  B . n 
B 2 7   DA  7   8   8   DA  DA  B . n 
B 2 8   DA  8   9   9   DA  DA  B . n 
B 2 9   DC  9   10  10  DC  DC  B . n 
B 2 10  DA  10  11  11  DA  DA  B . n 
B 2 11  DC  11  12  12  DC  DC  B . n 
B 2 12  DT  12  13  13  DT  DT  B . n 
B 2 13  DA  13  14  14  DA  DA  B . n 
B 2 14  DA  14  15  15  DA  DA  B . n 
B 2 15  DC  15  16  16  DC  DC  B . n 
B 2 16  DG  16  17  17  DG  DG  B . n 
B 2 17  DC  17  18  18  DC  DC  B . n 
B 2 18  DG  18  19  19  DG  DG  B . n 
B 2 19  DC  19  20  20  DC  DC  B . n 
B 2 20  DC  20  21  21  DC  DC  B . n 
C 3 1   GLY 1   -1  ?   ?   ?   R . n 
C 3 2   PRO 2   0   ?   ?   ?   R . n 
C 3 3   SER 3   1   1   SER SER R . n 
C 3 4   SER 4   2   2   SER SER R . n 
C 3 5   PRO 5   3   3   PRO PRO R . n 
C 3 6   GLY 6   4   4   GLY GLY R . n 
C 3 7   PRO 7   5   5   PRO PRO R . n 
C 3 8   THR 8   6   6   THR THR R . n 
C 3 9   CYS 9   7   7   CYS CYS R . n 
C 3 10  TYR 10  8   8   TYR TYR R . n 
C 3 11  GLY 11  9   9   GLY GLY R . n 
C 3 12  TYR 12  10  10  TYR TYR R . n 
C 3 13  ILE 13  11  11  ILE ILE R . n 
C 3 14  ASP 14  12  12  ASP ASP R . n 
C 3 15  ASP 15  13  13  ASP ASP R . n 
C 3 16  GLU 16  14  14  GLU GLU R . n 
C 3 17  GLN 17  15  15  GLN GLN R . n 
C 3 18  ASP 18  16  16  ASP ASP R . n 
C 3 19  LEU 19  17  17  LEU LEU R . n 
C 3 20  ALA 20  18  18  ALA ALA R . n 
C 3 21  LEU 21  19  19  LEU LEU R . n 
C 3 22  VAL 22  20  20  VAL VAL R . n 
C 3 23  PHE 23  21  21  PHE PHE R . n 
C 3 24  GLN 24  22  22  GLN GLN R . n 
C 3 25  GLY 25  23  23  GLY GLY R . n 
C 3 26  VAL 26  24  24  VAL VAL R . n 
C 3 27  PHE 27  25  25  PHE PHE R . n 
C 3 28  ASN 28  26  26  ASN ASN R . n 
C 3 29  GLY 29  27  27  GLY GLY R . n 
C 3 30  ASN 30  28  28  ASN ASN R . n 
C 3 31  LEU 31  29  29  LEU LEU R . n 
C 3 32  ARG 32  30  30  ARG ARG R . n 
C 3 33  CYS 33  31  31  CYS CYS R . n 
C 3 34  ILE 34  32  32  ILE ILE R . n 
C 3 35  GLU 35  33  33  GLU GLU R . n 
C 3 36  ARG 36  34  34  ARG ARG R . n 
C 3 37  ARG 37  35  35  ARG ARG R . n 
C 3 38  PRO 38  36  36  PRO PRO R . n 
C 3 39  TYR 39  37  37  TYR TYR R . n 
C 3 40  ASP 40  38  38  ASP ASP R . n 
C 3 41  ALA 41  39  39  ALA ALA R . n 
C 3 42  GLU 42  40  40  GLU GLU R . n 
C 3 43  LYS 43  41  41  LYS LYS R . n 
C 3 44  VAL 44  42  42  VAL VAL R . n 
C 3 45  GLU 45  43  43  GLU GLU R . n 
C 3 46  LEU 46  44  44  LEU LEU R . n 
C 3 47  VAL 47  45  45  VAL VAL R . n 
C 3 48  ASN 48  46  46  ASN ASN R . n 
C 3 49  PRO 49  47  47  PRO PRO R . n 
C 3 50  GLY 50  48  48  GLY GLY R . n 
C 3 51  ASN 51  49  49  ASN ASN R . n 
C 3 52  ILE 52  50  50  ILE ILE R . n 
C 3 53  PHE 53  51  51  PHE PHE R . n 
C 3 54  VAL 54  52  52  VAL VAL R . n 
C 3 55  PHE 55  53  53  PHE PHE R . n 
C 3 56  ASN 56  54  54  ASN ASN R . n 
C 3 57  GLU 57  55  55  GLU GLU R . n 
C 3 58  GLU 58  56  56  GLU GLU R . n 
C 3 59  LYS 59  57  57  LYS LYS R . n 
C 3 60  SER 60  58  58  SER SER R . n 
C 3 61  GLY 61  59  59  GLY GLY R . n 
C 3 62  ILE 62  60  60  ILE ILE R . n 
C 3 63  LYS 63  61  61  LYS LYS R . n 
C 3 64  ARG 64  62  62  ARG ARG R . n 
C 3 65  TRP 65  63  63  TRP TRP R . n 
C 3 66  THR 66  64  64  THR THR R . n 
C 3 67  ASP 67  65  65  ASP ASP R . n 
C 3 68  GLY 68  66  66  GLY GLY R . n 
C 3 69  PHE 69  67  67  PHE PHE R . n 
C 3 70  SER 70  68  68  SER SER R . n 
C 3 71  TRP 71  69  69  TRP TRP R . n 
C 3 72  SER 72  70  70  SER SER R . n 
C 3 73  PRO 73  71  71  PRO PRO R . n 
C 3 74  SER 74  72  72  SER SER R . n 
C 3 75  ARG 75  73  73  ARG ARG R . n 
C 3 76  ILE 76  74  74  ILE ILE R . n 
C 3 77  SER 77  75  75  SER SER R . n 
C 3 78  GLY 78  76  76  GLY GLY R . n 
C 3 79  LYS 79  77  77  LYS LYS R . n 
C 3 80  PHE 80  78  78  PHE PHE R . n 
C 3 81  LEU 81  79  79  LEU LEU R . n 
C 3 82  VAL 82  80  80  VAL VAL R . n 
C 3 83  TYR 83  81  81  TYR TYR R . n 
C 3 84  ARG 84  82  82  ARG ARG R . n 
C 3 85  GLU 85  83  83  GLU GLU R . n 
C 3 86  TYR 86  84  84  TYR TYR R . n 
C 3 87  ASN 87  85  85  ASN ASN R . n 
C 3 88  ARG 88  86  86  ARG ARG R . n 
C 3 89  LEU 89  87  87  LEU LEU R . n 
C 3 90  GLY 90  88  88  GLY GLY R . n 
C 3 91  SER 91  89  89  SER SER R . n 
C 3 92  THR 92  90  ?   ?   ?   R . n 
C 3 93  HIS 93  91  ?   ?   ?   R . n 
C 3 94  ASP 94  92  ?   ?   ?   R . n 
C 3 95  LEU 95  93  ?   ?   ?   R . n 
C 3 96  PRO 96  94  ?   ?   ?   R . n 
C 3 97  LEU 97  95  ?   ?   ?   R . n 
C 3 98  HIS 98  96  96  HIS HIS R . n 
C 3 99  ASN 99  97  97  ASN ASN R . n 
C 3 100 VAL 100 98  98  VAL VAL R . n 
C 3 101 PRO 101 99  99  PRO PRO R . n 
C 3 102 GLU 102 100 100 GLU GLU R . n 
C 3 103 TYR 103 101 101 TYR TYR R . n 
C 3 104 ASN 104 102 102 ASN ASN R . n 
C 3 105 ILE 105 103 103 ILE ILE R . n 
C 3 106 PHE 106 104 104 PHE PHE R . n 
C 3 107 GLU 107 105 105 GLU GLU R . n 
C 3 108 ARG 108 106 106 ARG ARG R . n 
C 3 109 ALA 109 107 107 ALA ALA R . n 
C 3 110 HIS 110 108 108 HIS HIS R . n 
C 3 111 ARG 111 109 109 ARG ARG R . n 
C 3 112 LYS 112 110 110 LYS LYS R . n 
C 3 113 TYR 113 111 111 TYR TYR R . n 
C 3 114 PHE 114 112 112 PHE PHE R . n 
C 3 115 TYR 115 113 113 TYR TYR R . n 
C 3 116 THR 116 114 114 THR THR R . n 
C 3 117 GLY 117 115 115 GLY GLY R . n 
C 3 118 LEU 118 116 116 LEU LEU R . n 
C 3 119 LEU 119 117 117 LEU LEU R . n 
C 3 120 LYS 120 118 118 LYS LYS R . n 
C 3 121 LYS 121 119 119 LYS LYS R . n 
C 3 122 THR 122 120 120 THR THR R . n 
C 3 123 PHE 123 121 121 PHE PHE R . n 
C 3 124 SER 124 122 122 SER SER R . n 
C 3 125 LEU 125 123 123 LEU LEU R . n 
C 3 126 LYS 126 124 124 LYS LYS R . n 
C 3 127 PHE 127 125 125 PHE PHE R . n 
C 3 128 ASN 128 126 126 ASN ASN R . n 
C 3 129 MET 129 127 127 MET MET R . n 
C 3 130 ASP 130 128 ?   ?   ?   R . n 
C 3 131 PRO 131 129 ?   ?   ?   R . n 
C 3 132 THR 132 130 130 THR THR R . n 
C 3 133 ASP 133 131 131 ASP ASP R . n 
C 3 134 SER 134 132 132 SER SER R . n 
C 3 135 THR 135 133 133 THR THR R . n 
C 3 136 LYS 136 134 134 LYS LYS R . n 
C 3 137 LEU 137 135 135 LEU LEU R . n 
C 3 138 GLU 138 136 136 GLU GLU R . n 
C 3 139 THR 139 137 137 THR THR R . n 
C 3 140 PHE 140 138 138 PHE PHE R . n 
C 3 141 HIS 141 139 139 HIS HIS R . n 
C 3 142 LEU 142 140 140 LEU LEU R . n 
C 3 143 ILE 143 141 141 ILE ILE R . n 
C 3 144 ALA 144 142 142 ALA ALA R . n 
C 3 145 TYR 145 143 143 TYR TYR R . n 
C 3 146 TYR 146 144 144 TYR TYR R . n 
C 3 147 THR 147 145 145 THR THR R . n 
C 3 148 GLU 148 146 146 GLU GLU R . n 
C 3 149 LYS 149 147 147 LYS LYS R . n 
C 3 150 ASP 150 148 148 ASP ASP R . n 
C 3 151 ILE 151 149 149 ILE ILE R . n 
C 3 152 HIS 152 150 150 HIS HIS R . n 
C 3 153 GLN 153 151 151 GLN GLN R . n 
C 3 154 GLY 154 152 152 GLY GLY R . n 
C 3 155 SER 155 153 153 SER SER R . n 
C 3 156 LEU 156 154 154 LEU LEU R . n 
C 3 157 ARG 157 155 155 ARG ARG R . n 
C 3 158 ARG 158 156 156 ARG ARG R . n 
C 3 159 PRO 159 157 157 PRO PRO R . n 
C 3 160 SER 160 158 158 SER SER R . n 
C 3 161 GLU 161 159 159 GLU GLU R . n 
C 3 162 ASN 162 160 160 ASN ASN R . n 
C 3 163 PRO 163 161 161 PRO PRO R . n 
C 3 164 PHE 164 162 162 PHE PHE R . n 
C 3 165 PHE 165 163 163 PHE PHE R . n 
C 3 166 HIS 166 164 164 HIS HIS R . n 
C 3 167 LYS 167 165 165 LYS LYS R . n 
C 3 168 PHE 168 166 166 PHE PHE R . n 
C 3 169 ARG 169 167 167 ARG ARG R . n 
C 3 170 PRO 170 168 168 PRO PRO R . n 
C 3 171 SER 171 169 169 SER SER R . n 
C 3 172 GLN 172 170 170 GLN GLN R . n 
C 3 173 LYS 173 171 171 LYS LYS R . n 
C 3 174 LEU 174 172 172 LEU LEU R . n 
C 3 175 LEU 175 173 173 LEU LEU R . n 
C 3 176 ASP 176 174 174 ASP ASP R . n 
C 3 177 ALA 177 175 175 ALA ALA R . n 
C 3 178 LEU 178 176 176 LEU LEU R . n 
C 3 179 GLN 179 177 177 GLN GLN R . n 
C 3 180 LYS 180 178 178 LYS LYS R . n 
C 3 181 VAL 181 179 179 VAL VAL R . n 
C 3 182 ALA 182 180 180 ALA ALA R . n 
C 3 183 VAL 183 181 181 VAL VAL R . n 
C 3 184 GLY 184 182 182 GLY GLY R . n 
C 3 185 ASN 185 183 183 ASN ASN R . n 
C 3 186 GLY 186 184 184 GLY GLY R . n 
C 3 187 ARG 187 185 185 ARG ARG R . n 
C 3 188 SER 188 186 186 SER SER R . n 
C 3 189 ASN 189 187 187 ASN ASN R . n 
C 3 190 PRO 190 188 188 PRO PRO R . n 
C 3 191 SER 191 189 189 SER SER R . n 
C 3 192 LYS 192 190 ?   ?   ?   R . n 
C 3 193 ASN 193 191 ?   ?   ?   R . n 
C 3 194 ASN 194 192 ?   ?   ?   R . n 
C 3 195 GLU 195 193 ?   ?   ?   R . n 
C 3 196 ARG 196 194 ?   ?   ?   R . n 
C 3 197 GLY 197 195 ?   ?   ?   R . n 
C 3 198 ARG 198 196 ?   ?   ?   R . n 
C 3 199 THR 199 197 ?   ?   ?   R . n 
C 3 200 LYS 200 198 ?   ?   ?   R . n 
C 3 201 ALA 201 199 ?   ?   ?   R . n 
C 3 202 HIS 202 200 ?   ?   ?   R . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4330  ? 
1 MORE         -19   ? 
1 'SSA (A^2)'  16080 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-06-25 
2 'Structure model' 1 1 2014-07-02 
3 'Structure model' 1 2 2014-07-23 
4 'Structure model' 1 3 2014-08-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
3 4 'Structure model' 'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC   'data collection' Quantum ? 1 
SOLVE  phasing           .       ? 2 
PHENIX refinement        .       ? 3 
MOSFLM 'data reduction'  .       ? 4 
SCALA  'data scaling'    .       ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   R 
_pdbx_validate_close_contact.auth_comp_id_1   MET 
_pdbx_validate_close_contact.auth_seq_id_1    127 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   N 
_pdbx_validate_close_contact.auth_asym_id_2   R 
_pdbx_validate_close_contact.auth_comp_id_2   THR 
_pdbx_validate_close_contact.auth_seq_id_2    130 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.00 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            "O3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             5 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            P 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DT 
_pdbx_validate_rmsd_bond.auth_seq_id_2             6 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.527 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.080 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" A DC  4  ? ? "C1'" A DC  4  ? ? N1    A DC  4  ? ? 110.72 108.30 2.42  0.30 N 
2  1 "O4'" A DT  10 ? ? "C1'" A DT  10 ? ? "C2'" A DT  10 ? ? 100.97 105.90 -4.93 0.80 N 
3  1 "O4'" A DT  10 ? ? "C1'" A DT  10 ? ? N1    A DT  10 ? ? 110.11 108.30 1.81  0.30 N 
4  1 "O4'" A DT  14 ? ? "C1'" A DT  14 ? ? N1    A DT  14 ? ? 110.29 108.30 1.99  0.30 N 
5  1 "O4'" A DG  20 ? ? "C1'" A DG  20 ? ? N9    A DG  20 ? ? 110.59 108.30 2.29  0.30 N 
6  1 "O4'" B DG  17 ? ? "C1'" B DG  17 ? ? N9    B DG  17 ? ? 110.84 108.30 2.54  0.30 N 
7  1 "O4'" B DC  18 ? ? "C1'" B DC  18 ? ? N1    B DC  18 ? ? 110.14 108.30 1.84  0.30 N 
8  1 "O4'" B DC  20 ? ? "C1'" B DC  20 ? ? N1    B DC  20 ? ? 110.76 108.30 2.46  0.30 N 
9  1 N     R SER 2  ? ? CA    R SER 2  ? ? C     R SER 2  ? ? 130.44 111.00 19.44 2.70 N 
10 1 C     R SER 2  ? ? N     R PRO 3  ? ? CD    R PRO 3  ? ? 141.39 128.40 12.99 2.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO R 99  ? ? -48.37  150.21  
2 1 SER R 132 ? ? 72.98   -155.55 
3 1 THR R 133 ? ? -140.47 37.72   
4 1 ASN R 187 ? ? -161.46 74.52   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   SER 
_pdbx_validate_peptide_omega.auth_asym_id_1   R 
_pdbx_validate_peptide_omega.auth_seq_id_1    1 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   SER 
_pdbx_validate_peptide_omega.auth_asym_id_2   R 
_pdbx_validate_peptide_omega.auth_seq_id_2    2 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -148.78 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 R ARG 109 ? CG  ? C ARG 111 CG  
2 1 Y 1 R ARG 109 ? CD  ? C ARG 111 CD  
3 1 Y 1 R ARG 109 ? NE  ? C ARG 111 NE  
4 1 Y 1 R ARG 109 ? CZ  ? C ARG 111 CZ  
5 1 Y 1 R ARG 109 ? NH1 ? C ARG 111 NH1 
6 1 Y 1 R ARG 109 ? NH2 ? C ARG 111 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 R GLY -1  ? C GLY 1   
2  1 Y 1 R PRO 0   ? C PRO 2   
3  1 Y 1 R THR 90  ? C THR 92  
4  1 Y 1 R HIS 91  ? C HIS 93  
5  1 Y 1 R ASP 92  ? C ASP 94  
6  1 Y 1 R LEU 93  ? C LEU 95  
7  1 Y 1 R PRO 94  ? C PRO 96  
8  1 Y 1 R LEU 95  ? C LEU 97  
9  1 Y 1 R ASP 128 ? C ASP 130 
10 1 Y 1 R PRO 129 ? C PRO 131 
11 1 Y 1 R LYS 190 ? C LYS 192 
12 1 Y 1 R ASN 191 ? C ASN 193 
13 1 Y 1 R ASN 192 ? C ASN 194 
14 1 Y 1 R GLU 193 ? C GLU 195 
15 1 Y 1 R ARG 194 ? C ARG 196 
16 1 Y 1 R GLY 195 ? C GLY 197 
17 1 Y 1 R ARG 196 ? C ARG 198 
18 1 Y 1 R THR 197 ? C THR 199 
19 1 Y 1 R LYS 198 ? C LYS 200 
20 1 Y 1 R ALA 199 ? C ALA 201 
21 1 Y 1 R HIS 200 ? C HIS 202 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4M8B 'double helix'        
4M8B 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC 19 1_555 0.150  -0.101 -0.168 -18.540 -8.398  -0.585 1  A_DG1:DC20_B  A 1  ? B 20 ? 19 1 
1 A DC 2  1_555 B DG 18 1_555 -0.274 -0.237 0.249  -3.972  -8.249  0.042  2  A_DC2:DG19_B  A 2  ? B 19 ? 19 1 
1 A DG 3  1_555 B DC 17 1_555 0.467  -0.212 0.467  4.894   -9.105  -2.307 3  A_DG3:DC18_B  A 3  ? B 18 ? 19 1 
1 A DC 4  1_555 B DG 16 1_555 -0.188 -0.299 0.073  -1.208  -6.285  -1.007 4  A_DC4:DG17_B  A 4  ? B 17 ? 19 1 
1 A DG 5  1_555 B DC 15 1_555 0.397  0.079  0.230  3.584   -12.845 -2.931 5  A_DG5:DC16_B  A 5  ? B 16 ? 19 1 
1 A DT 6  1_555 B DA 14 1_555 -0.355 -0.337 0.293  -3.522  -20.446 -4.704 6  A_DT6:DA15_B  A 6  ? B 15 ? 20 1 
1 A DT 7  1_555 B DA 13 1_555 -0.518 -0.500 0.365  -9.075  -26.455 -9.702 7  A_DT7:DA14_B  A 7  ? B 14 ? 20 1 
1 A DA 8  1_555 B DT 12 1_555 0.073  -0.146 -0.295 -12.255 -6.519  12.017 8  A_DA8:DT13_B  A 8  ? B 13 ? 20 1 
1 A DG 9  1_555 B DC 11 1_555 -0.052 0.131  0.054  -2.302  -11.607 8.382  9  A_DG9:DC12_B  A 9  ? B 12 ? 19 1 
1 A DT 10 1_555 B DA 10 1_555 -1.794 0.019  0.018  4.085   -9.394  -0.174 10 A_DT10:DA11_B A 10 ? B 11 ? 20 1 
1 A DG 11 1_555 B DC 9  1_555 0.691  -0.150 0.407  3.788   -14.572 -7.067 11 A_DG11:DC10_B A 11 ? B 10 ? 19 1 
1 A DT 12 1_555 B DA 8  1_555 -0.254 -0.461 0.134  2.577   -12.275 -1.568 12 A_DT12:DA9_B  A 12 ? B 9  ? 20 1 
1 A DT 13 1_555 B DA 7  1_555 0.025  -0.470 0.346  -2.598  -18.758 -7.026 13 A_DT13:DA8_B  A 13 ? B 8  ? 20 1 
1 A DT 14 1_555 B DA 6  1_555 -0.460 -0.171 0.333  -1.964  -8.449  -3.072 14 A_DT14:DA7_B  A 14 ? B 7  ? 20 1 
1 A DA 15 1_555 B DT 5  1_555 0.144  -0.155 0.369  2.228   -8.756  -2.798 15 A_DA15:DT6_B  A 15 ? B 6  ? 20 1 
1 A DC 16 1_555 B DG 4  1_555 -0.636 -0.155 0.191  -6.442  -6.181  -2.232 16 A_DC16:DG5_B  A 16 ? B 5  ? 19 1 
1 A DG 17 1_555 B DC 3  1_555 0.435  -0.003 0.042  -6.486  -5.436  4.517  17 A_DG17:DC4_B  A 17 ? B 4  ? 19 1 
1 A DC 18 1_555 B DG 2  1_555 0.042  -0.157 0.232  -1.793  -4.842  2.069  18 A_DC18:DG3_B  A 18 ? B 3  ? 19 1 
1 A DG 19 1_555 B DC 1  1_555 0.034  -0.220 0.508  0.119   -16.291 -1.709 19 A_DG19:DC2_B  A 19 ? B 2  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC 19 1_555 A DC 2  1_555 B DG 18 1_555 -0.765 -0.629 2.968 -1.727 4.210  27.314 -2.233 1.222  2.882 8.837   
3.626  27.683 1  AA_DG1DC2:DG19DC20_BB   A 1  ? B 20 ? A 2  ? B 19 ? 
1 A DC 2  1_555 B DG 18 1_555 A DG 3  1_555 B DC 17 1_555 -0.356 0.305  3.174 -2.280 2.776  39.401 0.132  0.264  3.202 4.107   
3.373  39.558 2  AA_DC2DG3:DC18DG19_BB   A 2  ? B 19 ? A 3  ? B 18 ? 
1 A DG 3  1_555 B DC 17 1_555 A DC 4  1_555 B DG 16 1_555 0.499  -0.247 3.445 5.121  1.749  30.277 -0.831 0.127  3.461 3.316   
-9.707 30.745 3  AA_DG3DC4:DG17DC18_BB   A 3  ? B 18 ? A 4  ? B 17 ? 
1 A DC 4  1_555 B DG 16 1_555 A DG 5  1_555 B DC 15 1_555 -0.613 0.569  3.343 -3.059 2.569  37.652 0.536  0.539  3.410 3.967   
4.723  37.855 4  AA_DC4DG5:DC16DG17_BB   A 4  ? B 17 ? A 5  ? B 16 ? 
1 A DG 5  1_555 B DC 15 1_555 A DT 6  1_555 B DA 14 1_555 -0.391 -1.044 3.351 1.028  -4.055 32.912 -1.120 0.865  3.438 -7.120  
-1.806 33.170 5  AA_DG5DT6:DA15DC16_BB   A 5  ? B 16 ? A 6  ? B 15 ? 
1 A DT 6  1_555 B DA 14 1_555 A DT 7  1_555 B DA 13 1_555 -0.466 -0.526 3.309 -1.265 -1.394 34.286 -0.669 0.588  3.342 -2.363  
2.144  34.336 6  AA_DT6DT7:DA14DA15_BB   A 6  ? B 15 ? A 7  ? B 14 ? 
1 A DT 7  1_555 B DA 13 1_555 A DA 8  1_555 B DT 12 1_555 1.660  1.214  3.535 6.173  -9.502 47.078 2.280  -1.509 3.422 -11.699 
-7.599 48.347 7  AA_DT7DA8:DT13DA14_BB   A 7  ? B 14 ? A 8  ? B 13 ? 
1 A DA 8  1_555 B DT 12 1_555 A DG 9  1_555 B DC 11 1_555 -1.470 0.646  3.183 -4.464 8.122  31.154 -0.312 1.823  3.412 14.719  
8.089  32.471 8  AA_DA8DG9:DC12DT13_BB   A 8  ? B 13 ? A 9  ? B 12 ? 
1 A DG 9  1_555 B DC 11 1_555 A DT 10 1_555 B DA 10 1_555 -0.036 -0.850 3.177 -1.441 1.448  22.140 -2.730 -0.431 3.111 3.760   
3.742  22.233 9  AA_DG9DT10:DA11DC12_BB  A 9  ? B 12 ? A 10 ? B 11 ? 
1 A DT 10 1_555 B DA 10 1_555 A DG 11 1_555 B DC 9  1_555 0.856  0.062  3.384 -2.901 -1.315 39.603 0.248  -1.606 3.312 -1.938  
4.274  39.726 10 AA_DT10DG11:DC10DA11_BB A 10 ? B 11 ? A 11 ? B 10 ? 
1 A DG 11 1_555 B DC 9  1_555 A DT 12 1_555 B DA 8  1_555 -0.277 -1.008 3.328 5.287  -5.210 33.560 -0.863 1.326  3.361 -8.887  
-9.020 34.348 11 AA_DG11DT12:DA9DC10_BB  A 11 ? B 10 ? A 12 ? B 9  ? 
1 A DT 12 1_555 B DA 8  1_555 A DT 13 1_555 B DA 7  1_555 0.164  -0.682 3.312 1.296  -5.700 42.057 -0.347 -0.092 3.375 -7.897  
-1.796 42.443 12 AA_DT12DT13:DA8DA9_BB   A 12 ? B 9  ? A 13 ? B 8  ? 
1 A DT 13 1_555 B DA 7  1_555 A DT 14 1_555 B DA 6  1_555 0.919  -0.552 3.154 3.471  -5.840 32.564 0.006  -1.029 3.279 -10.275 
-6.107 33.246 13 AA_DT13DT14:DA7DA8_BB   A 13 ? B 8  ? A 14 ? B 7  ? 
1 A DT 14 1_555 B DA 6  1_555 A DA 15 1_555 B DT 5  1_555 -0.113 -0.938 2.994 -0.807 0.667  33.380 -1.732 0.074  2.977 1.161   
1.405  33.396 14 AA_DT14DA15:DT6DA7_BB   A 14 ? B 7  ? A 15 ? B 6  ? 
1 A DA 15 1_555 B DT 5  1_555 A DC 16 1_555 B DG 4  1_555 -0.102 -1.690 3.375 -0.021 -0.594 32.387 -2.921 0.178  3.404 -1.066  
0.039  32.392 15 AA_DA15DC16:DG5DT6_BB   A 15 ? B 6  ? A 16 ? B 5  ? 
1 A DC 16 1_555 B DG 4  1_555 A DG 17 1_555 B DC 3  1_555 -0.328 -0.614 3.244 -1.576 8.487  35.476 -2.126 0.312  3.034 13.679  
2.540  36.479 16 AA_DC16DG17:DC4DG5_BB   A 16 ? B 5  ? A 17 ? B 4  ? 
1 A DG 17 1_555 B DC 3  1_555 A DC 18 1_555 B DG 2  1_555 -0.403 -0.736 3.106 -1.328 4.367  26.064 -2.691 0.552  2.962 9.590   
2.917  26.454 17 AA_DG17DC18:DG3DC4_BB   A 17 ? B 4  ? A 18 ? B 3  ? 
1 A DC 18 1_555 B DG 2  1_555 A DG 19 1_555 B DC 1  1_555 -0.999 0.702  3.380 -3.944 -2.710 38.118 1.419  1.006  3.407 -4.130  
6.010  38.406 18 AA_DC18DG19:DC2DG3_BB   A 18 ? B 3  ? A 19 ? B 2  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 1,2-ETHANEDIOL EDO 
5 water          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 EDO 1  301 21  EDO EDO R . 
E 5 HOH 1  101 22  HOH HOH A . 
E 5 HOH 2  102 23  HOH HOH A . 
E 5 HOH 3  103 25  HOH HOH A . 
E 5 HOH 4  104 26  HOH HOH A . 
E 5 HOH 5  105 27  HOH HOH A . 
E 5 HOH 6  106 28  HOH HOH A . 
E 5 HOH 7  107 29  HOH HOH A . 
E 5 HOH 8  108 31  HOH HOH A . 
E 5 HOH 9  109 32  HOH HOH A . 
E 5 HOH 10 110 33  HOH HOH A . 
E 5 HOH 11 111 34  HOH HOH A . 
E 5 HOH 12 112 35  HOH HOH A . 
E 5 HOH 13 113 36  HOH HOH A . 
E 5 HOH 14 114 37  HOH HOH A . 
E 5 HOH 15 115 38  HOH HOH A . 
E 5 HOH 16 116 25  HOH HOH A . 
E 5 HOH 17 117 199 HOH HOH A . 
E 5 HOH 18 118 2   HOH HOH A . 
F 5 HOH 1  101 22  HOH HOH B . 
F 5 HOH 2  102 24  HOH HOH B . 
F 5 HOH 3  103 26  HOH HOH B . 
F 5 HOH 4  104 27  HOH HOH B . 
F 5 HOH 5  105 28  HOH HOH B . 
F 5 HOH 6  106 29  HOH HOH B . 
F 5 HOH 7  107 31  HOH HOH B . 
F 5 HOH 8  108 33  HOH HOH B . 
F 5 HOH 9  109 35  HOH HOH B . 
F 5 HOH 10 110 36  HOH HOH B . 
F 5 HOH 11 111 37  HOH HOH B . 
F 5 HOH 12 112 38  HOH HOH B . 
F 5 HOH 13 113 39  HOH HOH B . 
F 5 HOH 14 114 201 HOH HOH B . 
F 5 HOH 15 115 202 HOH HOH B . 
F 5 HOH 16 116 205 HOH HOH B . 
G 5 HOH 1  401 24  HOH HOH R . 
G 5 HOH 2  402 30  HOH HOH R . 
G 5 HOH 3  403 30  HOH HOH R . 
G 5 HOH 4  404 190 HOH HOH R . 
G 5 HOH 5  405 191 HOH HOH R . 
G 5 HOH 6  406 192 HOH HOH R . 
G 5 HOH 7  407 193 HOH HOH R . 
G 5 HOH 8  408 194 HOH HOH R . 
G 5 HOH 9  409 196 HOH HOH R . 
G 5 HOH 10 410 197 HOH HOH R . 
G 5 HOH 11 411 198 HOH HOH R . 
G 5 HOH 12 412 200 HOH HOH R . 
G 5 HOH 13 413 203 HOH HOH R . 
G 5 HOH 14 414 204 HOH HOH R . 
G 5 HOH 15 415 206 HOH HOH R . 
G 5 HOH 16 416 207 HOH HOH R . 
G 5 HOH 17 417 208 HOH HOH R . 
G 5 HOH 18 418 209 HOH HOH R . 
G 5 HOH 19 419 210 HOH HOH R . 
G 5 HOH 20 420 211 HOH HOH R . 
G 5 HOH 21 421 212 HOH HOH R . 
G 5 HOH 22 422 213 HOH HOH R . 
G 5 HOH 23 423 214 HOH HOH R . 
G 5 HOH 24 424 215 HOH HOH R . 
G 5 HOH 25 425 216 HOH HOH R . 
G 5 HOH 26 426 217 HOH HOH R . 
G 5 HOH 27 427 218 HOH HOH R . 
G 5 HOH 28 428 219 HOH HOH R . 
G 5 HOH 29 429 220 HOH HOH R . 
G 5 HOH 30 430 221 HOH HOH R . 
G 5 HOH 31 431 222 HOH HOH R . 
G 5 HOH 32 432 223 HOH HOH R . 
G 5 HOH 33 433 224 HOH HOH R . 
G 5 HOH 34 434 225 HOH HOH R . 
G 5 HOH 35 435 227 HOH HOH R . 
G 5 HOH 36 436 228 HOH HOH R . 
G 5 HOH 37 437 229 HOH HOH R . 
G 5 HOH 38 438 230 HOH HOH R . 
G 5 HOH 39 439 231 HOH HOH R . 
G 5 HOH 40 440 232 HOH HOH R . 
G 5 HOH 41 441 233 HOH HOH R . 
G 5 HOH 42 442 234 HOH HOH R . 
G 5 HOH 43 443 235 HOH HOH R . 
G 5 HOH 44 444 236 HOH HOH R . 
G 5 HOH 45 445 237 HOH HOH R . 
G 5 HOH 46 446 238 HOH HOH R . 
G 5 HOH 47 447 239 HOH HOH R . 
G 5 HOH 48 448 240 HOH HOH R . 
G 5 HOH 49 449 241 HOH HOH R . 
G 5 HOH 50 450 242 HOH HOH R . 
G 5 HOH 51 451 244 HOH HOH R . 
G 5 HOH 52 452 246 HOH HOH R . 
G 5 HOH 53 453 247 HOH HOH R . 
G 5 HOH 54 454 248 HOH HOH R . 
G 5 HOH 55 455 250 HOH HOH R . 
G 5 HOH 56 456 1   HOH HOH R . 
G 5 HOH 57 457 3   HOH HOH R . 
G 5 HOH 58 458 4   HOH HOH R . 
#