data_4MCA
# 
_entry.id   4MCA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4MCA         
RCSB  RCSB081731   
WWPDB D_1000081731 
# 
_pdbx_database_status.entry_id                        4MCA 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-08-21 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Musille, P.M.' 1 
'Ortlund, E.A.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structure of glycerol dehydrogenase from Serratia' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.F' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1744-3091 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Musille, P.M.' 1 
primary 'Ortlund, E.A.' 2 
# 
_cell.length_a           117.507 
_cell.length_b           117.507 
_cell.length_c           259.863 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4MCA 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              32 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.entry_id                         4MCA 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                97 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Glycerol dehydrogenase' 38802.645 2   1.1.1.6 ? ? ? 
2 non-polymer syn 'ZINC ION'               65.409    4   ?       ? ? ? 
3 non-polymer syn GLYCEROL                 92.094    4   ?       ? ? ? 
4 non-polymer syn 'SODIUM ION'             22.990    2   ?       ? ? ? 
5 water       nat water                    18.015    365 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MLRIIQSPGKYIQGANALAAVGQYAKSLADHYLVIADDFVMKLAGDTLMGSLQQHGVKHHAALFNGECCHKEIDRLGREL
KAHGCRGVIGVGGGKTLDTAKAIAHYQQLPVVLIPTIASTDAPTSALSVIYTEQGEFAEYLIYPRNPDMVVMDVAIIAKA
PVRLLVAGMGDALSTYFEAQACFDAQATSMAGGKSTLAALSLARLCYDTLLAEGVKAKLAVEAGVVTEAVERIIEANTYL
SGIGFESSGLAAAHAIHNGFTVLEECHHLYHGEKVAFGTLAQLVLQNSPMAQIETVLAFCHRIGLPITLAEMGVSGDAVE
KIMAVAQASCAAGETIHNMPFKVTPAGVQAAILTADRLGSAWLQQHQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MLRIIQSPGKYIQGANALAAVGQYAKSLADHYLVIADDFVMKLAGDTLMGSLQQHGVKHHAALFNGECCHKEIDRLGREL
KAHGCRGVIGVGGGKTLDTAKAIAHYQQLPVVLIPTIASTDAPTSALSVIYTEQGEFAEYLIYPRNPDMVVMDVAIIAKA
PVRLLVAGMGDALSTYFEAQACFDAQATSMAGGKSTLAALSLARLCYDTLLAEGVKAKLAVEAGVVTEAVERIIEANTYL
SGIGFESSGLAAAHAIHNGFTVLEECHHLYHGEKVAFGTLAQLVLQNSPMAQIETVLAFCHRIGLPITLAEMGVSGDAVE
KIMAVAQASCAAGETIHNMPFKVTPAGVQAAILTADRLGSAWLQQHQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LEU n 
1 3   ARG n 
1 4   ILE n 
1 5   ILE n 
1 6   GLN n 
1 7   SER n 
1 8   PRO n 
1 9   GLY n 
1 10  LYS n 
1 11  TYR n 
1 12  ILE n 
1 13  GLN n 
1 14  GLY n 
1 15  ALA n 
1 16  ASN n 
1 17  ALA n 
1 18  LEU n 
1 19  ALA n 
1 20  ALA n 
1 21  VAL n 
1 22  GLY n 
1 23  GLN n 
1 24  TYR n 
1 25  ALA n 
1 26  LYS n 
1 27  SER n 
1 28  LEU n 
1 29  ALA n 
1 30  ASP n 
1 31  HIS n 
1 32  TYR n 
1 33  LEU n 
1 34  VAL n 
1 35  ILE n 
1 36  ALA n 
1 37  ASP n 
1 38  ASP n 
1 39  PHE n 
1 40  VAL n 
1 41  MET n 
1 42  LYS n 
1 43  LEU n 
1 44  ALA n 
1 45  GLY n 
1 46  ASP n 
1 47  THR n 
1 48  LEU n 
1 49  MET n 
1 50  GLY n 
1 51  SER n 
1 52  LEU n 
1 53  GLN n 
1 54  GLN n 
1 55  HIS n 
1 56  GLY n 
1 57  VAL n 
1 58  LYS n 
1 59  HIS n 
1 60  HIS n 
1 61  ALA n 
1 62  ALA n 
1 63  LEU n 
1 64  PHE n 
1 65  ASN n 
1 66  GLY n 
1 67  GLU n 
1 68  CYS n 
1 69  CYS n 
1 70  HIS n 
1 71  LYS n 
1 72  GLU n 
1 73  ILE n 
1 74  ASP n 
1 75  ARG n 
1 76  LEU n 
1 77  GLY n 
1 78  ARG n 
1 79  GLU n 
1 80  LEU n 
1 81  LYS n 
1 82  ALA n 
1 83  HIS n 
1 84  GLY n 
1 85  CYS n 
1 86  ARG n 
1 87  GLY n 
1 88  VAL n 
1 89  ILE n 
1 90  GLY n 
1 91  VAL n 
1 92  GLY n 
1 93  GLY n 
1 94  GLY n 
1 95  LYS n 
1 96  THR n 
1 97  LEU n 
1 98  ASP n 
1 99  THR n 
1 100 ALA n 
1 101 LYS n 
1 102 ALA n 
1 103 ILE n 
1 104 ALA n 
1 105 HIS n 
1 106 TYR n 
1 107 GLN n 
1 108 GLN n 
1 109 LEU n 
1 110 PRO n 
1 111 VAL n 
1 112 VAL n 
1 113 LEU n 
1 114 ILE n 
1 115 PRO n 
1 116 THR n 
1 117 ILE n 
1 118 ALA n 
1 119 SER n 
1 120 THR n 
1 121 ASP n 
1 122 ALA n 
1 123 PRO n 
1 124 THR n 
1 125 SER n 
1 126 ALA n 
1 127 LEU n 
1 128 SER n 
1 129 VAL n 
1 130 ILE n 
1 131 TYR n 
1 132 THR n 
1 133 GLU n 
1 134 GLN n 
1 135 GLY n 
1 136 GLU n 
1 137 PHE n 
1 138 ALA n 
1 139 GLU n 
1 140 TYR n 
1 141 LEU n 
1 142 ILE n 
1 143 TYR n 
1 144 PRO n 
1 145 ARG n 
1 146 ASN n 
1 147 PRO n 
1 148 ASP n 
1 149 MET n 
1 150 VAL n 
1 151 VAL n 
1 152 MET n 
1 153 ASP n 
1 154 VAL n 
1 155 ALA n 
1 156 ILE n 
1 157 ILE n 
1 158 ALA n 
1 159 LYS n 
1 160 ALA n 
1 161 PRO n 
1 162 VAL n 
1 163 ARG n 
1 164 LEU n 
1 165 LEU n 
1 166 VAL n 
1 167 ALA n 
1 168 GLY n 
1 169 MET n 
1 170 GLY n 
1 171 ASP n 
1 172 ALA n 
1 173 LEU n 
1 174 SER n 
1 175 THR n 
1 176 TYR n 
1 177 PHE n 
1 178 GLU n 
1 179 ALA n 
1 180 GLN n 
1 181 ALA n 
1 182 CYS n 
1 183 PHE n 
1 184 ASP n 
1 185 ALA n 
1 186 GLN n 
1 187 ALA n 
1 188 THR n 
1 189 SER n 
1 190 MET n 
1 191 ALA n 
1 192 GLY n 
1 193 GLY n 
1 194 LYS n 
1 195 SER n 
1 196 THR n 
1 197 LEU n 
1 198 ALA n 
1 199 ALA n 
1 200 LEU n 
1 201 SER n 
1 202 LEU n 
1 203 ALA n 
1 204 ARG n 
1 205 LEU n 
1 206 CYS n 
1 207 TYR n 
1 208 ASP n 
1 209 THR n 
1 210 LEU n 
1 211 LEU n 
1 212 ALA n 
1 213 GLU n 
1 214 GLY n 
1 215 VAL n 
1 216 LYS n 
1 217 ALA n 
1 218 LYS n 
1 219 LEU n 
1 220 ALA n 
1 221 VAL n 
1 222 GLU n 
1 223 ALA n 
1 224 GLY n 
1 225 VAL n 
1 226 VAL n 
1 227 THR n 
1 228 GLU n 
1 229 ALA n 
1 230 VAL n 
1 231 GLU n 
1 232 ARG n 
1 233 ILE n 
1 234 ILE n 
1 235 GLU n 
1 236 ALA n 
1 237 ASN n 
1 238 THR n 
1 239 TYR n 
1 240 LEU n 
1 241 SER n 
1 242 GLY n 
1 243 ILE n 
1 244 GLY n 
1 245 PHE n 
1 246 GLU n 
1 247 SER n 
1 248 SER n 
1 249 GLY n 
1 250 LEU n 
1 251 ALA n 
1 252 ALA n 
1 253 ALA n 
1 254 HIS n 
1 255 ALA n 
1 256 ILE n 
1 257 HIS n 
1 258 ASN n 
1 259 GLY n 
1 260 PHE n 
1 261 THR n 
1 262 VAL n 
1 263 LEU n 
1 264 GLU n 
1 265 GLU n 
1 266 CYS n 
1 267 HIS n 
1 268 HIS n 
1 269 LEU n 
1 270 TYR n 
1 271 HIS n 
1 272 GLY n 
1 273 GLU n 
1 274 LYS n 
1 275 VAL n 
1 276 ALA n 
1 277 PHE n 
1 278 GLY n 
1 279 THR n 
1 280 LEU n 
1 281 ALA n 
1 282 GLN n 
1 283 LEU n 
1 284 VAL n 
1 285 LEU n 
1 286 GLN n 
1 287 ASN n 
1 288 SER n 
1 289 PRO n 
1 290 MET n 
1 291 ALA n 
1 292 GLN n 
1 293 ILE n 
1 294 GLU n 
1 295 THR n 
1 296 VAL n 
1 297 LEU n 
1 298 ALA n 
1 299 PHE n 
1 300 CYS n 
1 301 HIS n 
1 302 ARG n 
1 303 ILE n 
1 304 GLY n 
1 305 LEU n 
1 306 PRO n 
1 307 ILE n 
1 308 THR n 
1 309 LEU n 
1 310 ALA n 
1 311 GLU n 
1 312 MET n 
1 313 GLY n 
1 314 VAL n 
1 315 SER n 
1 316 GLY n 
1 317 ASP n 
1 318 ALA n 
1 319 VAL n 
1 320 GLU n 
1 321 LYS n 
1 322 ILE n 
1 323 MET n 
1 324 ALA n 
1 325 VAL n 
1 326 ALA n 
1 327 GLN n 
1 328 ALA n 
1 329 SER n 
1 330 CYS n 
1 331 ALA n 
1 332 ALA n 
1 333 GLY n 
1 334 GLU n 
1 335 THR n 
1 336 ILE n 
1 337 HIS n 
1 338 ASN n 
1 339 MET n 
1 340 PRO n 
1 341 PHE n 
1 342 LYS n 
1 343 VAL n 
1 344 THR n 
1 345 PRO n 
1 346 ALA n 
1 347 GLY n 
1 348 VAL n 
1 349 GLN n 
1 350 ALA n 
1 351 ALA n 
1 352 ILE n 
1 353 LEU n 
1 354 THR n 
1 355 ALA n 
1 356 ASP n 
1 357 ARG n 
1 358 LEU n 
1 359 GLY n 
1 360 SER n 
1 361 ALA n 
1 362 TRP n 
1 363 LEU n 
1 364 GLN n 
1 365 GLN n 
1 366 HIS n 
1 367 GLN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Serratia plymuthica A30' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      1206776 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    L0VUH7_SERPL 
_struct_ref.pdbx_db_accession          L0VUH7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MLRIIQSPGKYIQGANALVAVGQYAKALADHYFVIADDFVMKLAGDTLMGSLQQHGVKHHACLFNGECCHKEIDRLGREL
KAHGCRGVIGVGGGKTLDTAKAIAHYQQLPVVLIPTIASTDAPTSALSVIYTEQGEFAEYLIYPRNPDMVVMDSAIIAKA
PVRLLVAGMGDALSTYFEAQACFDAQATSMAGGKSTLAALSLARLCYETLLAEGVKAKLAVEAGVVTEAVERIIEANTYL
SGIGFESSGLAAAHAIHNGFTVLEECHHLYHGEKVAFGTLAQLVLQNSSMAQIETVLDFCHRIGLPVTLAEMGVSGDAAE
KIMAVAQASCAAGETIHNMPFKVTPASVQAAILTADRLGSAWLQQHQ
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4MCA A 1 ? 367 ? L0VUH7 1 ? 367 ? 1 367 
2 1 4MCA B 1 ? 367 ? L0VUH7 1 ? 367 ? 1 367 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4MCA ALA A 19  ? UNP L0VUH7 VAL 19  CONFLICT 19  1  
1 4MCA SER A 27  ? UNP L0VUH7 ALA 27  CONFLICT 27  2  
1 4MCA LEU A 33  ? UNP L0VUH7 PHE 33  CONFLICT 33  3  
1 4MCA ALA A 62  ? UNP L0VUH7 CYS 62  CONFLICT 62  4  
1 4MCA VAL A 154 ? UNP L0VUH7 SER 154 CONFLICT 154 5  
1 4MCA ASP A 208 ? UNP L0VUH7 GLU 208 CONFLICT 208 6  
1 4MCA PRO A 289 ? UNP L0VUH7 SER 289 CONFLICT 289 7  
1 4MCA ALA A 298 ? UNP L0VUH7 ASP 298 CONFLICT 298 8  
1 4MCA ILE A 307 ? UNP L0VUH7 VAL 307 CONFLICT 307 9  
1 4MCA VAL A 319 ? UNP L0VUH7 ALA 319 CONFLICT 319 10 
1 4MCA GLY A 347 ? UNP L0VUH7 SER 347 CONFLICT 347 11 
2 4MCA ALA B 19  ? UNP L0VUH7 VAL 19  CONFLICT 19  12 
2 4MCA SER B 27  ? UNP L0VUH7 ALA 27  CONFLICT 27  13 
2 4MCA LEU B 33  ? UNP L0VUH7 PHE 33  CONFLICT 33  14 
2 4MCA ALA B 62  ? UNP L0VUH7 CYS 62  CONFLICT 62  15 
2 4MCA VAL B 154 ? UNP L0VUH7 SER 154 CONFLICT 154 16 
2 4MCA ASP B 208 ? UNP L0VUH7 GLU 208 CONFLICT 208 17 
2 4MCA PRO B 289 ? UNP L0VUH7 SER 289 CONFLICT 289 18 
2 4MCA ALA B 298 ? UNP L0VUH7 ASP 298 CONFLICT 298 19 
2 4MCA ILE B 307 ? UNP L0VUH7 VAL 307 CONFLICT 307 20 
2 4MCA VAL B 319 ? UNP L0VUH7 ALA 319 CONFLICT 319 21 
2 4MCA GLY B 347 ? UNP L0VUH7 SER 347 CONFLICT 347 22 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ?                               'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ?                               'Zn 2'           65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          4MCA 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.89 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   57.44 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;5-10% PEG 3350, 0.2M Calcium Acetate, 4% 2,2,2 trifluoroethanol, 4% glycerol, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2013-03-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
# 
_reflns.entry_id                     4MCA 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.9 
_reflns.d_resolution_low             50 
_reflns.number_all                   71425 
_reflns.number_obs                   65891 
_reflns.percent_possible_obs         91.6 
_reflns.pdbx_Rmerge_I_obs            0.099 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   52.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    2.46 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        4.0 
_reflns_shell.number_unique_all      3706 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4MCA 
_refine.ls_d_res_high                            1.9000 
_refine.ls_d_res_low                             39.6000 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    91.5300 
_refine.ls_number_reflns_obs                     65855 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1790 
_refine.ls_R_factor_R_work                       0.1771 
_refine.ls_wR_factor_R_work                      0.1647 
_refine.ls_R_factor_R_free                       0.2153 
_refine.ls_wR_factor_R_free                      0.2009 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_number_reflns_R_free                  3341 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               30.0239 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            1.6500 
_refine.aniso_B[2][2]                            1.6500 
_refine.aniso_B[3][3]                            -3.3000 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9600 
_refine.correlation_coeff_Fo_to_Fc_free          0.9410 
_refine.overall_SU_R_Cruickshank_DPI             0.1353 
_refine.overall_SU_R_free                        0.1304 
_refine.pdbx_overall_ESU_R                       0.1350 
_refine.pdbx_overall_ESU_R_Free                  0.1300 
_refine.overall_SU_ML                            0.0870 
_refine.overall_SU_B                             3.0370 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8584 
_refine.B_iso_max                                101.780 
_refine.B_iso_min                                11.410 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.150 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5397 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             365 
_refine_hist.number_atoms_total               5792 
_refine_hist.d_res_high                       1.9000 
_refine_hist.d_res_low                        39.6000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       5515  0.020  0.019  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         5395  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    7478  1.863  1.961  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      12380 0.913  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 729   6.119  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 209   35.734 24.593 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 896   14.886 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 20    24.039 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         887   0.125  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   6290  0.009  0.020  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     1200  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            2919  2.650  2.670  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_other         2918  2.643  2.669  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           3644  3.688  3.985  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       1.8980 
_refine_ls_shell.d_res_low                        1.9480 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               49.3300 
_refine_ls_shell.number_reflns_R_work             2473 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2580 
_refine_ls_shell.R_factor_R_free                  0.2980 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             110 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2583 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4MCA 
_struct.title                     'Crystal Structure of Glycerol Dehydrogenase from Serratia to 1.9A' 
_struct.pdbx_descriptor           'Glycerol dehydrogenase (E.C.1.1.1.6)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4MCA 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'Glycerol metabolism, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 2 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 16  ? ALA A 19  ? ASN A 16  ALA A 19  5 ? 4  
HELX_P HELX_P2  2  ALA A 20  ? SER A 27  ? ALA A 20  SER A 27  1 ? 8  
HELX_P HELX_P3  3  ASP A 37  ? HIS A 55  ? ASP A 37  HIS A 55  1 ? 19 
HELX_P HELX_P4  4  CYS A 69  ? GLY A 84  ? CYS A 69  GLY A 84  1 ? 16 
HELX_P HELX_P5  5  GLY A 93  ? GLN A 107 ? GLY A 93  GLN A 107 1 ? 15 
HELX_P HELX_P6  6  VAL A 154 ? ALA A 160 ? VAL A 154 ALA A 160 1 ? 7  
HELX_P HELX_P7  7  PRO A 161 ? GLN A 186 ? PRO A 161 GLN A 186 1 ? 26 
HELX_P HELX_P8  8  THR A 196 ? ALA A 223 ? THR A 196 ALA A 223 1 ? 28 
HELX_P HELX_P9  9  THR A 227 ? SER A 248 ? THR A 227 SER A 248 1 ? 22 
HELX_P HELX_P10 10 ALA A 251 ? THR A 261 ? ALA A 251 THR A 261 1 ? 11 
HELX_P HELX_P11 11 VAL A 262 ? HIS A 267 ? VAL A 262 HIS A 267 5 ? 6  
HELX_P HELX_P12 12 TYR A 270 ? GLN A 286 ? TYR A 270 GLN A 286 1 ? 17 
HELX_P HELX_P13 13 PRO A 289 ? GLY A 304 ? PRO A 289 GLY A 304 1 ? 16 
HELX_P HELX_P14 14 LEU A 309 ? GLY A 313 ? LEU A 309 GLY A 313 5 ? 5  
HELX_P HELX_P15 15 ALA A 318 ? CYS A 330 ? ALA A 318 CYS A 330 1 ? 13 
HELX_P HELX_P16 16 GLU A 334 ? MET A 339 ? GLU A 334 MET A 339 5 ? 6  
HELX_P HELX_P17 17 THR A 344 ? GLN A 365 ? THR A 344 GLN A 365 1 ? 22 
HELX_P HELX_P18 18 ASN B 16  ? ALA B 19  ? ASN B 16  ALA B 19  5 ? 4  
HELX_P HELX_P19 19 ALA B 20  ? ALA B 29  ? ALA B 20  ALA B 29  1 ? 10 
HELX_P HELX_P20 20 ASP B 37  ? HIS B 55  ? ASP B 37  HIS B 55  1 ? 19 
HELX_P HELX_P21 21 HIS B 70  ? GLY B 84  ? HIS B 70  GLY B 84  1 ? 15 
HELX_P HELX_P22 22 GLY B 93  ? GLN B 108 ? GLY B 93  GLN B 108 1 ? 16 
HELX_P HELX_P23 23 ASP B 121 ? SER B 125 ? ASP B 121 SER B 125 5 ? 5  
HELX_P HELX_P24 24 VAL B 154 ? ALA B 160 ? VAL B 154 ALA B 160 1 ? 7  
HELX_P HELX_P25 25 PRO B 161 ? GLN B 186 ? PRO B 161 GLN B 186 1 ? 26 
HELX_P HELX_P26 26 THR B 196 ? ALA B 223 ? THR B 196 ALA B 223 1 ? 28 
HELX_P HELX_P27 27 THR B 227 ? SER B 248 ? THR B 227 SER B 248 1 ? 22 
HELX_P HELX_P28 28 ALA B 251 ? THR B 261 ? ALA B 251 THR B 261 1 ? 11 
HELX_P HELX_P29 29 VAL B 262 ? HIS B 267 ? VAL B 262 HIS B 267 5 ? 6  
HELX_P HELX_P30 30 TYR B 270 ? GLN B 286 ? TYR B 270 GLN B 286 1 ? 17 
HELX_P HELX_P31 31 PRO B 289 ? GLY B 304 ? PRO B 289 GLY B 304 1 ? 16 
HELX_P HELX_P32 32 LEU B 309 ? GLY B 313 ? LEU B 309 GLY B 313 5 ? 5  
HELX_P HELX_P33 33 ALA B 318 ? CYS B 330 ? ALA B 318 CYS B 330 1 ? 13 
HELX_P HELX_P34 34 GLU B 334 ? MET B 339 ? GLU B 334 MET B 339 5 ? 6  
HELX_P HELX_P35 35 THR B 344 ? HIS B 366 ? THR B 344 HIS B 366 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 254 NE2 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 254  A ZN  1000 1_555 ? ? ? ? ? ? ? 1.945 ? 
metalc2  metalc ? ? B ASP 171 OD1 ? ? ? 1_555 H ZN  . ZN ? ? B ASP 171  B ZN  1000 1_555 ? ? ? ? ? ? ? 1.997 ? 
metalc3  metalc ? ? A ASP 171 OD1 ? ? ? 1_555 C ZN  . ZN ? ? A ASP 171  A ZN  1000 1_555 ? ? ? ? ? ? ? 2.013 ? 
metalc4  metalc ? ? B HIS 254 NE2 ? ? ? 1_555 H ZN  . ZN ? ? B HIS 254  B ZN  1000 1_555 ? ? ? ? ? ? ? 2.080 ? 
metalc5  metalc ? ? H ZN  .   ZN  ? ? ? 1_555 I GOL . O3 ? ? B ZN  1000 B GOL 1001 1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc6  metalc ? ? A HIS 271 NE2 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 271  A ZN  1000 1_555 ? ? ? ? ? ? ? 2.157 ? 
metalc7  metalc ? ? B CYS 85  SG  ? ? ? 1_555 K ZN  . ZN ? ? B CYS 85   B ZN  1003 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc8  metalc ? ? B HIS 271 NE2 ? ? ? 1_555 H ZN  . ZN ? ? B HIS 271  B ZN  1000 1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc9  metalc ? ? C ZN  .   ZN  ? ? ? 1_555 E GOL . O1 ? ? A ZN  1000 A GOL 1002 1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc10 metalc ? ? A CYS 85  SG  ? ? ? 1_555 D ZN  . ZN ? ? A CYS 85   A ZN  1001 1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc11 metalc ? ? H ZN  .   ZN  ? ? ? 1_555 I GOL . O1 ? ? B ZN  1000 B GOL 1001 1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc12 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 E GOL . O3 ? ? A ZN  1000 A GOL 1002 1_555 ? ? ? ? ? ? ? 2.432 ? 
metalc13 metalc ? ? B ASP 121 OD2 ? ? ? 1_555 L NA  . NA ? ? B ASP 121  B NA  1004 1_555 ? ? ? ? ? ? ? 2.497 ? 
metalc14 metalc ? ? B HIS 31  NE2 ? ? ? 1_555 K ZN  . ZN ? ? B HIS 31   B ZN  1003 1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc15 metalc ? ? A HIS 31  NE2 ? ? ? 1_555 D ZN  . ZN ? ? A HIS 31   A ZN  1001 1_555 ? ? ? ? ? ? ? 2.567 ? 
metalc16 metalc ? ? A ASP 171 OD2 ? ? ? 1_555 C ZN  . ZN ? ? A ASP 171  A ZN  1000 1_555 ? ? ? ? ? ? ? 2.632 ? 
metalc17 metalc ? ? A ASP 121 OD2 ? ? ? 1_555 G NA  . NA ? ? A ASP 121  A NA  1004 1_555 ? ? ? ? ? ? ? 2.716 ? 
metalc18 metalc ? ? B THR 175 OG1 ? ? ? 1_555 L NA  . NA ? ? B THR 175  B NA  1004 1_555 ? ? ? ? ? ? ? 2.888 ? 
metalc19 metalc ? ? A ASP 171 O   ? ? ? 1_555 G NA  . NA ? ? A ASP 171  A NA  1004 1_555 ? ? ? ? ? ? ? 2.929 ? 
metalc20 metalc ? ? B ASP 171 O   ? ? ? 1_555 L NA  . NA ? ? B ASP 171  B NA  1004 1_555 ? ? ? ? ? ? ? 2.963 ? 
metalc21 metalc ? ? A THR 175 OG1 ? ? ? 1_555 G NA  . NA ? ? A THR 175  A NA  1004 1_555 ? ? ? ? ? ? ? 2.969 ? 
metalc22 metalc ? ? A SER 174 OG  ? ? ? 1_555 G NA  . NA ? ? A SER 174  A NA  1004 1_555 ? ? ? ? ? ? ? 3.163 ? 
metalc23 metalc ? ? B SER 174 OG  ? ? ? 1_555 L NA  . NA ? ? B SER 174  B NA  1004 1_555 ? ? ? ? ? ? ? 3.193 ? 
metalc24 metalc ? ? G NA  .   NA  ? ? ? 1_555 M HOH . O  ? ? A NA  1004 A HOH 1132 1_555 ? ? ? ? ? ? ? 2.515 ? 
metalc25 metalc ? ? L NA  .   NA  ? ? ? 1_555 N HOH . O  ? ? B NA  1004 B HOH 1106 1_555 ? ? ? ? ? ? ? 2.631 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 6 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 10  ? GLY A 14  ? LYS A 10  GLY A 14  
A 2 MET A 149 ? ASP A 153 ? MET A 149 ASP A 153 
A 3 VAL A 111 ? PRO A 115 ? VAL A 111 PRO A 115 
A 4 VAL A 88  ? GLY A 92  ? VAL A 88  GLY A 92  
A 5 HIS A 31  ? ALA A 36  ? HIS A 31  ALA A 36  
A 6 LYS A 58  ? LEU A 63  ? LYS A 58  LEU A 63  
B 1 LEU A 127 ? TYR A 131 ? LEU A 127 TYR A 131 
B 2 PHE A 137 ? ILE A 142 ? PHE A 137 ILE A 142 
C 1 LYS B 10  ? GLY B 14  ? LYS B 10  GLY B 14  
C 2 MET B 149 ? ASP B 153 ? MET B 149 ASP B 153 
C 3 VAL B 111 ? PRO B 115 ? VAL B 111 PRO B 115 
C 4 VAL B 88  ? GLY B 92  ? VAL B 88  GLY B 92  
C 5 HIS B 31  ? ALA B 36  ? HIS B 31  ALA B 36  
C 6 LYS B 58  ? LEU B 63  ? LYS B 58  LEU B 63  
D 1 LEU B 127 ? TYR B 131 ? LEU B 127 TYR B 131 
D 2 PHE B 137 ? ILE B 142 ? PHE B 137 ILE B 142 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 12  ? N ILE A 12  O MET A 152 ? O MET A 152 
A 2 3 O VAL A 151 ? O VAL A 151 N LEU A 113 ? N LEU A 113 
A 3 4 O ILE A 114 ? O ILE A 114 N GLY A 90  ? N GLY A 90  
A 4 5 O ILE A 89  ? O ILE A 89  N ILE A 35  ? N ILE A 35  
A 5 6 N VAL A 34  ? N VAL A 34  O ALA A 62  ? O ALA A 62  
B 1 2 N SER A 128 ? N SER A 128 O LEU A 141 ? O LEU A 141 
C 1 2 N ILE B 12  ? N ILE B 12  O VAL B 150 ? O VAL B 150 
C 2 3 O VAL B 151 ? O VAL B 151 N LEU B 113 ? N LEU B 113 
C 3 4 O ILE B 114 ? O ILE B 114 N GLY B 90  ? N GLY B 90  
C 4 5 O ILE B 89  ? O ILE B 89  N ILE B 35  ? N ILE B 35  
C 5 6 N VAL B 34  ? N VAL B 34  O ALA B 62  ? O ALA B 62  
D 1 2 N SER B 128 ? N SER B 128 O LEU B 141 ? O LEU B 141 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1000'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1001'  
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 1002' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL A 1003' 
AC5 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE NA A 1004'  
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 1000'  
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL B 1001' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL B 1002' 
AC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ZN B 1003'  
BC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA B 1004'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ASP A 171 ? ASP A 171  . ? 1_555 ? 
2  AC1 4 HIS A 254 ? HIS A 254  . ? 1_555 ? 
3  AC1 4 HIS A 271 ? HIS A 271  . ? 1_555 ? 
4  AC1 4 GOL E .   ? GOL A 1002 . ? 1_555 ? 
5  AC2 4 HIS A 31  ? HIS A 31   . ? 1_555 ? 
6  AC2 4 HIS A 60  ? HIS A 60   . ? 1_555 ? 
7  AC2 4 HIS A 83  ? HIS A 83   . ? 1_555 ? 
8  AC2 4 CYS A 85  ? CYS A 85   . ? 1_555 ? 
9  AC3 7 ASP A 121 ? ASP A 121  . ? 1_555 ? 
10 AC3 7 ASP A 171 ? ASP A 171  . ? 1_555 ? 
11 AC3 7 PHE A 245 ? PHE A 245  . ? 1_555 ? 
12 AC3 7 HIS A 254 ? HIS A 254  . ? 1_555 ? 
13 AC3 7 HIS A 271 ? HIS A 271  . ? 1_555 ? 
14 AC3 7 ZN  C .   ? ZN  A 1000 . ? 1_555 ? 
15 AC3 7 NA  G .   ? NA  A 1004 . ? 1_555 ? 
16 AC4 5 ARG A 232 ? ARG A 232  . ? 1_555 ? 
17 AC4 5 HOH M .   ? HOH A 1111 . ? 1_555 ? 
18 AC4 5 HOH M .   ? HOH A 1188 . ? 1_555 ? 
19 AC4 5 HOH M .   ? HOH A 1201 . ? 1_555 ? 
20 AC4 5 GLN B 180 ? GLN B 180  . ? 4_555 ? 
21 AC5 8 ASP A 121 ? ASP A 121  . ? 1_555 ? 
22 AC5 8 ASP A 171 ? ASP A 171  . ? 1_555 ? 
23 AC5 8 SER A 174 ? SER A 174  . ? 1_555 ? 
24 AC5 8 THR A 175 ? THR A 175  . ? 1_555 ? 
25 AC5 8 SER A 241 ? SER A 241  . ? 1_555 ? 
26 AC5 8 HIS A 254 ? HIS A 254  . ? 1_555 ? 
27 AC5 8 GOL E .   ? GOL A 1002 . ? 1_555 ? 
28 AC5 8 HOH M .   ? HOH A 1132 . ? 1_555 ? 
29 AC6 4 ASP B 171 ? ASP B 171  . ? 1_555 ? 
30 AC6 4 HIS B 254 ? HIS B 254  . ? 1_555 ? 
31 AC6 4 HIS B 271 ? HIS B 271  . ? 1_555 ? 
32 AC6 4 GOL I .   ? GOL B 1001 . ? 1_555 ? 
33 AC7 6 ASP B 121 ? ASP B 121  . ? 1_555 ? 
34 AC7 6 ASP B 171 ? ASP B 171  . ? 1_555 ? 
35 AC7 6 PHE B 245 ? PHE B 245  . ? 1_555 ? 
36 AC7 6 HIS B 254 ? HIS B 254  . ? 1_555 ? 
37 AC7 6 HIS B 271 ? HIS B 271  . ? 1_555 ? 
38 AC7 6 ZN  H .   ? ZN  B 1000 . ? 1_555 ? 
39 AC8 4 GLN A 180 ? GLN A 180  . ? 3_555 ? 
40 AC8 4 ARG B 232 ? ARG B 232  . ? 1_555 ? 
41 AC8 4 HOH N .   ? HOH B 1114 . ? 1_555 ? 
42 AC8 4 HOH N .   ? HOH B 1214 . ? 1_555 ? 
43 AC9 3 HIS B 31  ? HIS B 31   . ? 1_555 ? 
44 AC9 3 HIS B 83  ? HIS B 83   . ? 1_555 ? 
45 AC9 3 CYS B 85  ? CYS B 85   . ? 1_555 ? 
46 BC1 7 ASP B 121 ? ASP B 121  . ? 1_555 ? 
47 BC1 7 ASP B 171 ? ASP B 171  . ? 1_555 ? 
48 BC1 7 SER B 174 ? SER B 174  . ? 1_555 ? 
49 BC1 7 THR B 175 ? THR B 175  . ? 1_555 ? 
50 BC1 7 SER B 241 ? SER B 241  . ? 1_555 ? 
51 BC1 7 HIS B 254 ? HIS B 254  . ? 1_555 ? 
52 BC1 7 HOH N .   ? HOH B 1106 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4MCA 
_atom_sites.fract_transf_matrix[1][1]   0.008510 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008510 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003848 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? 20.785  32.605 89.446  1.00 53.07  ? 1    MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? 21.140  32.391 88.000  1.00 50.92  ? 1    MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? 22.395  31.538 87.700  1.00 35.45  ? 1    MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? 22.294  30.650 86.881  1.00 43.68  ? 1    MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? 21.180  33.720 87.247  1.00 64.10  ? 1    MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? 19.807  34.390 87.107  1.00 79.03  ? 1    MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? 18.693  33.573 85.927  1.00 98.40  ? 1    MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? 17.484  34.839 85.595  1.00 84.71  ? 1    MET A CE  1 
ATOM   9    N  N   . LEU A 1 2   ? 23.561  31.771 88.291  1.00 25.44  ? 2    LEU A N   1 
ATOM   10   C  CA  . LEU A 1 2   ? 24.546  30.735 88.280  1.00 22.13  ? 2    LEU A CA  1 
ATOM   11   C  C   . LEU A 1 2   ? 24.245  29.696 89.419  1.00 21.93  ? 2    LEU A C   1 
ATOM   12   O  O   . LEU A 1 2   ? 23.756  30.061 90.485  1.00 21.14  ? 2    LEU A O   1 
ATOM   13   C  CB  . LEU A 1 2   ? 25.972  31.252 88.399  1.00 22.75  ? 2    LEU A CB  1 
ATOM   14   C  CG  . LEU A 1 2   ? 26.428  32.201 87.286  1.00 28.23  ? 2    LEU A CG  1 
ATOM   15   C  CD1 . LEU A 1 2   ? 27.822  32.739 87.565  1.00 31.64  ? 2    LEU A CD1 1 
ATOM   16   C  CD2 . LEU A 1 2   ? 26.409  31.525 85.934  1.00 30.65  ? 2    LEU A CD2 1 
ATOM   17   N  N   . ARG A 1 3   ? 24.519  28.440 89.144  1.00 20.37  ? 3    ARG A N   1 
ATOM   18   C  CA  . ARG A 1 3   ? 24.460  27.324 90.115  1.00 20.50  ? 3    ARG A CA  1 
ATOM   19   C  C   . ARG A 1 3   ? 25.850  27.082 90.444  1.00 20.15  ? 3    ARG A C   1 
ATOM   20   O  O   . ARG A 1 3   ? 26.640  26.924 89.529  1.00 21.89  ? 3    ARG A O   1 
ATOM   21   C  CB  . ARG A 1 3   ? 24.001  26.009 89.484  1.00 22.02  ? 3    ARG A CB  1 
ATOM   22   C  CG  . ARG A 1 3   ? 22.571  25.928 89.222  1.00 27.65  ? 3    ARG A CG  1 
ATOM   23   C  CD  . ARG A 1 3   ? 22.272  25.069 88.005  1.00 32.09  ? 3    ARG A CD  1 
ATOM   24   N  NE  . ARG A 1 3   ? 21.122  25.723 87.419  1.00 32.56  ? 3    ARG A NE  1 
ATOM   25   C  CZ  . ARG A 1 3   ? 19.920  25.206 87.257  1.00 33.29  ? 3    ARG A CZ  1 
ATOM   26   N  NH1 . ARG A 1 3   ? 19.646  23.851 87.510  1.00 27.42  ? 3    ARG A NH1 1 
ATOM   27   N  NH2 . ARG A 1 3   ? 19.018  26.088 86.744  1.00 32.12  ? 3    ARG A NH2 1 
ATOM   28   N  N   . ILE A 1 4   ? 26.203  26.953 91.733  1.00 17.00  ? 4    ILE A N   1 
ATOM   29   C  CA  . ILE A 1 4   ? 27.564  26.764 92.098  1.00 17.05  ? 4    ILE A CA  1 
ATOM   30   C  C   . ILE A 1 4   ? 27.599  25.741 93.227  1.00 17.68  ? 4    ILE A C   1 
ATOM   31   O  O   . ILE A 1 4   ? 26.754  25.802 94.107  1.00 17.44  ? 4    ILE A O   1 
ATOM   32   C  CB  . ILE A 1 4   ? 28.154  28.091 92.606  1.00 17.96  ? 4    ILE A CB  1 
ATOM   33   C  CG1 . ILE A 1 4   ? 28.096  29.221 91.527  1.00 19.96  ? 4    ILE A CG1 1 
ATOM   34   C  CG2 . ILE A 1 4   ? 29.524  27.828 93.157  1.00 19.69  ? 4    ILE A CG2 1 
ATOM   35   C  CD1 . ILE A 1 4   ? 28.505  30.597 92.101  1.00 21.77  ? 4    ILE A CD1 1 
ATOM   36   N  N   . ILE A 1 5   ? 28.554  24.866 93.163  1.00 16.74  ? 5    ILE A N   1 
ATOM   37   C  CA  . ILE A 1 5   ? 28.845  23.881 94.223  1.00 18.94  ? 5    ILE A CA  1 
ATOM   38   C  C   . ILE A 1 5   ? 30.338  23.994 94.517  1.00 21.90  ? 5    ILE A C   1 
ATOM   39   O  O   . ILE A 1 5   ? 31.161  24.104 93.591  1.00 21.63  ? 5    ILE A O   1 
ATOM   40   C  CB  . ILE A 1 5   ? 28.382  22.457 93.902  1.00 17.17  ? 5    ILE A CB  1 
ATOM   41   C  CG1 . ILE A 1 5   ? 28.588  21.495 95.102  1.00 17.55  ? 5    ILE A CG1 1 
ATOM   42   C  CG2 . ILE A 1 5   ? 29.139  21.756 92.728  1.00 18.86  ? 5    ILE A CG2 1 
ATOM   43   C  CD1 . ILE A 1 5   ? 27.814  20.170 95.040  1.00 17.57  ? 5    ILE A CD1 1 
ATOM   44   N  N   . GLN A 1 6   ? 30.692  24.035 95.803  1.00 20.59  ? 6    GLN A N   1 
ATOM   45   C  CA  . GLN A 1 6   ? 32.084  23.974 96.192  1.00 23.07  ? 6    GLN A CA  1 
ATOM   46   C  C   . GLN A 1 6   ? 32.342  22.904 97.211  1.00 22.99  ? 6    GLN A C   1 
ATOM   47   O  O   . GLN A 1 6   ? 31.430  22.364 97.846  1.00 20.97  ? 6    GLN A O   1 
ATOM   48   C  CB  . GLN A 1 6   ? 32.601  25.321 96.656  1.00 28.37  ? 6    GLN A CB  1 
ATOM   49   C  CG  . GLN A 1 6   ? 31.843  25.890 97.813  1.00 30.76  ? 6    GLN A CG  1 
ATOM   50   C  CD  . GLN A 1 6   ? 32.296  27.313 98.113  1.00 33.38  ? 6    GLN A CD  1 
ATOM   51   O  OE1 . GLN A 1 6   ? 32.053  28.250 97.355  1.00 33.85  ? 6    GLN A OE1 1 
ATOM   52   N  NE2 . GLN A 1 6   ? 32.968  27.460 99.212  1.00 36.86  ? 6    GLN A NE2 1 
ATOM   53   N  N   . SER A 1 7   ? 33.585  22.535 97.317  1.00 21.86  ? 7    SER A N   1 
ATOM   54   C  CA  . SER A 1 7   ? 33.873  21.356 98.078  1.00 25.71  ? 7    SER A CA  1 
ATOM   55   C  C   . SER A 1 7   ? 35.310  21.355 98.523  1.00 24.26  ? 7    SER A C   1 
ATOM   56   O  O   . SER A 1 7   ? 36.170  21.953 97.847  1.00 22.23  ? 7    SER A O   1 
ATOM   57   C  CB  . SER A 1 7   ? 33.596  20.138 97.200  1.00 28.17  ? 7    SER A CB  1 
ATOM   58   O  OG  . SER A 1 7   ? 33.978  18.916 97.849  1.00 35.62  ? 7    SER A OG  1 
ATOM   59   N  N   . PRO A 1 8   ? 35.595  20.677 99.661  1.00 24.71  ? 8    PRO A N   1 
ATOM   60   C  CA  . PRO A 1 8   ? 36.975  20.392 99.989  1.00 24.15  ? 8    PRO A CA  1 
ATOM   61   C  C   . PRO A 1 8   ? 37.554  19.535 98.909  1.00 24.94  ? 8    PRO A C   1 
ATOM   62   O  O   . PRO A 1 8   ? 36.821  18.777 98.287  1.00 26.77  ? 8    PRO A O   1 
ATOM   63   C  CB  . PRO A 1 8   ? 36.871  19.616 101.317 1.00 24.82  ? 8    PRO A CB  1 
ATOM   64   C  CG  . PRO A 1 8   ? 35.547  19.025 101.302 1.00 26.07  ? 8    PRO A CG  1 
ATOM   65   C  CD  . PRO A 1 8   ? 34.657  19.946 100.546 1.00 24.42  ? 8    PRO A CD  1 
ATOM   66   N  N   . GLY A 1 9   ? 38.851  19.637 98.676  1.00 24.98  ? 9    GLY A N   1 
ATOM   67   C  CA  . GLY A 1 9   ? 39.472  18.845 97.639  1.00 26.32  ? 9    GLY A CA  1 
ATOM   68   C  C   . GLY A 1 9   ? 39.308  17.363 97.803  1.00 24.52  ? 9    GLY A C   1 
ATOM   69   O  O   . GLY A 1 9   ? 39.032  16.642 96.834  1.00 21.50  ? 9    GLY A O   1 
ATOM   70   N  N   . LYS A 1 10  ? 39.489  16.887 99.045  1.00 21.57  ? 10   LYS A N   1 
ATOM   71   C  CA  . LYS A 1 10  ? 39.406  15.485 99.332  1.00 20.32  ? 10   LYS A CA  1 
ATOM   72   C  C   . LYS A 1 10  ? 38.867  15.250 100.756 1.00 21.42  ? 10   LYS A C   1 
ATOM   73   O  O   . LYS A 1 10  ? 39.213  15.997 101.682 1.00 20.30  ? 10   LYS A O   1 
ATOM   74   C  CB  . LYS A 1 10  ? 40.752  14.903 99.171  1.00 25.29  ? 10   LYS A CB  1 
ATOM   75   C  CG  . LYS A 1 10  ? 40.740  13.437 99.136  1.00 29.97  ? 10   LYS A CG  1 
ATOM   76   C  CD  . LYS A 1 10  ? 42.122  12.914 98.805  1.00 37.09  ? 10   LYS A CD  1 
ATOM   77   C  CE  . LYS A 1 10  ? 42.435  13.131 97.346  1.00 38.41  ? 10   LYS A CE  1 
ATOM   78   N  NZ  . LYS A 1 10  ? 43.632  12.315 97.020  1.00 39.86  ? 10   LYS A NZ  1 
ATOM   79   N  N   . TYR A 1 11  ? 37.974  14.288 100.874 1.00 19.70  ? 11   TYR A N   1 
ATOM   80   C  CA  . TYR A 1 11  ? 37.381  13.914 102.153 1.00 19.36  ? 11   TYR A CA  1 
ATOM   81   C  C   . TYR A 1 11  ? 37.656  12.448 102.275 1.00 18.04  ? 11   TYR A C   1 
ATOM   82   O  O   . TYR A 1 11  ? 37.394  11.613 101.395 1.00 16.97  ? 11   TYR A O   1 
ATOM   83   C  CB  . TYR A 1 11  ? 35.909  14.242 102.198 1.00 18.68  ? 11   TYR A CB  1 
ATOM   84   C  CG  . TYR A 1 11  ? 35.181  13.602 103.366 1.00 18.05  ? 11   TYR A CG  1 
ATOM   85   C  CD1 . TYR A 1 11  ? 34.687  12.290 103.318 1.00 19.85  ? 11   TYR A CD1 1 
ATOM   86   C  CD2 . TYR A 1 11  ? 34.996  14.314 104.540 1.00 18.84  ? 11   TYR A CD2 1 
ATOM   87   C  CE1 . TYR A 1 11  ? 33.998  11.727 104.399 1.00 18.75  ? 11   TYR A CE1 1 
ATOM   88   C  CE2 . TYR A 1 11  ? 34.280  13.746 105.628 1.00 19.88  ? 11   TYR A CE2 1 
ATOM   89   C  CZ  . TYR A 1 11  ? 33.825  12.471 105.556 1.00 19.99  ? 11   TYR A CZ  1 
ATOM   90   O  OH  . TYR A 1 11  ? 33.167  11.927 106.650 1.00 19.99  ? 11   TYR A OH  1 
ATOM   91   N  N   . ILE A 1 12  ? 38.264  12.123 103.385 1.00 15.85  ? 12   ILE A N   1 
ATOM   92   C  CA  . ILE A 1 12  ? 38.718  10.829 103.641 1.00 16.59  ? 12   ILE A CA  1 
ATOM   93   C  C   . ILE A 1 12  ? 38.124  10.332 104.980 1.00 16.93  ? 12   ILE A C   1 
ATOM   94   O  O   . ILE A 1 12  ? 38.189  11.062 105.967 1.00 17.44  ? 12   ILE A O   1 
ATOM   95   C  CB  . ILE A 1 12  ? 40.247  10.847 103.743 1.00 18.92  ? 12   ILE A CB  1 
ATOM   96   C  CG1 . ILE A 1 12  ? 40.898  11.185 102.377 1.00 21.75  ? 12   ILE A CG1 1 
ATOM   97   C  CG2 . ILE A 1 12  ? 40.754  9.521  104.189 1.00 18.67  ? 12   ILE A CG2 1 
ATOM   98   C  CD1 . ILE A 1 12  ? 42.178  11.956 102.562 1.00 26.66  ? 12   ILE A CD1 1 
ATOM   99   N  N   . GLN A 1 13  ? 37.620  9.115  105.006 1.00 18.02  ? 13   GLN A N   1 
ATOM   100  C  CA  . GLN A 1 13  ? 36.999  8.592  106.254 1.00 19.55  ? 13   GLN A CA  1 
ATOM   101  C  C   . GLN A 1 13  ? 37.255  7.157  106.446 1.00 19.22  ? 13   GLN A C   1 
ATOM   102  O  O   . GLN A 1 13  ? 37.123  6.390  105.526 1.00 19.03  ? 13   GLN A O   1 
ATOM   103  C  CB  . GLN A 1 13  ? 35.501  8.808  106.204 1.00 20.06  ? 13   GLN A CB  1 
ATOM   104  C  CG  . GLN A 1 13  ? 34.675  8.271  107.398 1.00 19.42  ? 13   GLN A CG  1 
ATOM   105  C  CD  . GLN A 1 13  ? 33.188  8.434  107.136 1.00 18.17  ? 13   GLN A CD  1 
ATOM   106  O  OE1 . GLN A 1 13  ? 32.685  9.474  106.621 1.00 17.51  ? 13   GLN A OE1 1 
ATOM   107  N  NE2 . GLN A 1 13  ? 32.469  7.380  107.449 1.00 22.05  ? 13   GLN A NE2 1 
ATOM   108  N  N   . GLY A 1 14  ? 37.589  6.745  107.670 1.00 18.41  ? 14   GLY A N   1 
ATOM   109  C  CA  . GLY A 1 14  ? 37.505  5.357  108.014 1.00 16.69  ? 14   GLY A CA  1 
ATOM   110  C  C   . GLY A 1 14  ? 38.279  5.062  109.316 1.00 20.38  ? 14   GLY A C   1 
ATOM   111  O  O   . GLY A 1 14  ? 38.863  5.964  109.931 1.00 18.79  ? 14   GLY A O   1 
ATOM   112  N  N   . ALA A 1 15  ? 38.202  3.820  109.750 1.00 23.23  ? 15   ALA A N   1 
ATOM   113  C  CA  . ALA A 1 15  ? 38.683  3.435  111.072 1.00 27.70  ? 15   ALA A CA  1 
ATOM   114  C  C   . ALA A 1 15  ? 40.162  3.524  111.004 1.00 29.34  ? 15   ALA A C   1 
ATOM   115  O  O   . ALA A 1 15  ? 40.778  2.978  110.076 1.00 26.66  ? 15   ALA A O   1 
ATOM   116  C  CB  . ALA A 1 15  ? 38.269  2.008  111.416 1.00 28.96  ? 15   ALA A CB  1 
ATOM   117  N  N   . ASN A 1 16  ? 40.745  4.216  111.974 1.00 28.94  ? 16   ASN A N   1 
ATOM   118  C  CA  . ASN A 1 16  ? 42.181  4.342  112.021 1.00 30.25  ? 16   ASN A CA  1 
ATOM   119  C  C   . ASN A 1 16  ? 42.759  5.126  110.819 1.00 31.46  ? 16   ASN A C   1 
ATOM   120  O  O   . ASN A 1 16  ? 43.944  4.984  110.489 1.00 29.80  ? 16   ASN A O   1 
ATOM   121  C  CB  . ASN A 1 16  ? 42.856  2.972  112.125 1.00 35.50  ? 16   ASN A CB  1 
ATOM   122  C  CG  . ASN A 1 16  ? 42.328  2.122  113.298 1.00 47.50  ? 16   ASN A CG  1 
ATOM   123  O  OD1 . ASN A 1 16  ? 41.999  2.623  114.397 1.00 49.88  ? 16   ASN A OD1 1 
ATOM   124  N  ND2 . ASN A 1 16  ? 42.265  0.813  113.072 1.00 48.97  ? 16   ASN A ND2 1 
ATOM   125  N  N   . ALA A 1 17  ? 41.956  5.998  110.210 1.00 28.01  ? 17   ALA A N   1 
ATOM   126  C  CA  . ALA A 1 17  ? 42.490  6.940  109.193 1.00 29.22  ? 17   ALA A CA  1 
ATOM   127  C  C   . ALA A 1 17  ? 43.644  7.806  109.670 1.00 31.69  ? 17   ALA A C   1 
ATOM   128  O  O   . ALA A 1 17  ? 44.382  8.329  108.829 1.00 26.56  ? 17   ALA A O   1 
ATOM   129  C  CB  . ALA A 1 17  ? 41.414  7.870  108.682 1.00 26.12  ? 17   ALA A CB  1 
ATOM   130  N  N   . LEU A 1 18  ? 43.740  8.055  110.990 1.00 30.07  ? 18   LEU A N   1 
ATOM   131  C  CA  . LEU A 1 18  ? 44.774  8.946  111.505 1.00 29.82  ? 18   LEU A CA  1 
ATOM   132  C  C   . LEU A 1 18  ? 46.135  8.365  111.185 1.00 27.85  ? 18   LEU A C   1 
ATOM   133  O  O   . LEU A 1 18  ? 47.068  9.086  110.864 1.00 29.43  ? 18   LEU A O   1 
ATOM   134  C  CB  . LEU A 1 18  ? 44.646  9.134  113.001 1.00 29.86  ? 18   LEU A CB  1 
ATOM   135  C  CG  . LEU A 1 18  ? 45.525  10.173 113.697 1.00 32.27  ? 18   LEU A CG  1 
ATOM   136  C  CD1 . LEU A 1 18  ? 45.185  11.560 113.211 1.00 35.23  ? 18   LEU A CD1 1 
ATOM   137  C  CD2 . LEU A 1 18  ? 45.285  10.066 115.205 1.00 35.17  ? 18   LEU A CD2 1 
ATOM   138  N  N   . ALA A 1 19  ? 46.235  7.050  111.263 1.00 29.37  ? 19   ALA A N   1 
ATOM   139  C  CA  . ALA A 1 19  ? 47.483  6.365  110.991 1.00 31.37  ? 19   ALA A CA  1 
ATOM   140  C  C   . ALA A 1 19  ? 47.842  6.422  109.510 1.00 36.96  ? 19   ALA A C   1 
ATOM   141  O  O   . ALA A 1 19  ? 48.906  6.008  109.159 1.00 36.89  ? 19   ALA A O   1 
ATOM   142  C  CB  . ALA A 1 19  ? 47.420  4.903  111.474 1.00 31.73  ? 19   ALA A CB  1 
ATOM   143  N  N   . ALA A 1 20  ? 46.967  6.919  108.630 1.00 38.30  ? 20   ALA A N   1 
ATOM   144  C  CA  . ALA A 1 20  ? 47.298  6.971  107.191 1.00 36.49  ? 20   ALA A CA  1 
ATOM   145  C  C   . ALA A 1 20  ? 47.357  8.394  106.719 1.00 36.11  ? 20   ALA A C   1 
ATOM   146  O  O   . ALA A 1 20  ? 47.494  8.650  105.530 1.00 37.27  ? 20   ALA A O   1 
ATOM   147  C  CB  . ALA A 1 20  ? 46.264  6.201  106.392 1.00 37.93  ? 20   ALA A CB  1 
ATOM   148  N  N   . VAL A 1 21  ? 47.265  9.346  107.640 1.00 33.21  ? 21   VAL A N   1 
ATOM   149  C  CA  . VAL A 1 21  ? 47.228  10.733 107.229 1.00 35.89  ? 21   VAL A CA  1 
ATOM   150  C  C   . VAL A 1 21  ? 48.487  11.142 106.424 1.00 38.02  ? 21   VAL A C   1 
ATOM   151  O  O   . VAL A 1 21  ? 48.366  11.918 105.521 1.00 33.16  ? 21   VAL A O   1 
ATOM   152  C  CB  . VAL A 1 21  ? 47.007  11.692 108.407 1.00 37.32  ? 21   VAL A CB  1 
ATOM   153  C  CG1 . VAL A 1 21  ? 47.418  13.111 108.058 1.00 37.63  ? 21   VAL A CG1 1 
ATOM   154  C  CG2 . VAL A 1 21  ? 45.542  11.712 108.810 1.00 38.56  ? 21   VAL A CG2 1 
ATOM   155  N  N   . GLY A 1 22  ? 49.670  10.615 106.750 1.00 38.29  ? 22   GLY A N   1 
ATOM   156  C  CA  . GLY A 1 22  ? 50.892  11.001 106.025 1.00 36.22  ? 22   GLY A CA  1 
ATOM   157  C  C   . GLY A 1 22  ? 50.873  10.830 104.513 1.00 34.11  ? 22   GLY A C   1 
ATOM   158  O  O   . GLY A 1 22  ? 51.334  11.717 103.784 1.00 32.99  ? 22   GLY A O   1 
ATOM   159  N  N   . GLN A 1 23  ? 50.332  9.731  103.989 1.00 38.04  ? 23   GLN A N   1 
ATOM   160  C  CA  . GLN A 1 23  ? 50.274  9.628  102.501 1.00 44.26  ? 23   GLN A CA  1 
ATOM   161  C  C   . GLN A 1 23  ? 49.503  10.801 101.896 1.00 44.46  ? 23   GLN A C   1 
ATOM   162  O  O   . GLN A 1 23  ? 49.974  11.440 100.962 1.00 45.70  ? 23   GLN A O   1 
ATOM   163  C  CB  . GLN A 1 23  ? 49.602  8.378  101.966 1.00 50.54  ? 23   GLN A CB  1 
ATOM   164  C  CG  . GLN A 1 23  ? 49.490  7.198  102.869 1.00 57.70  ? 23   GLN A CG  1 
ATOM   165  C  CD  . GLN A 1 23  ? 48.623  6.131  102.230 1.00 67.95  ? 23   GLN A CD  1 
ATOM   166  O  OE1 . GLN A 1 23  ? 48.303  6.201  101.031 1.00 67.76  ? 23   GLN A OE1 1 
ATOM   167  N  NE2 . GLN A 1 23  ? 48.223  5.141  103.029 1.00 73.11  ? 23   GLN A NE2 1 
ATOM   168  N  N   . TYR A 1 24  ? 48.324  11.099 102.460 1.00 36.14  ? 24   TYR A N   1 
ATOM   169  C  CA  . TYR A 1 24  ? 47.492  12.124 101.894 1.00 34.43  ? 24   TYR A CA  1 
ATOM   170  C  C   . TYR A 1 24  ? 48.077  13.490 102.148 1.00 32.97  ? 24   TYR A C   1 
ATOM   171  O  O   . TYR A 1 24  ? 48.066  14.299 101.258 1.00 35.53  ? 24   TYR A O   1 
ATOM   172  C  CB  . TYR A 1 24  ? 45.999  11.983 102.364 1.00 33.76  ? 24   TYR A CB  1 
ATOM   173  C  CG  . TYR A 1 24  ? 45.500  10.606 102.097 1.00 31.75  ? 24   TYR A CG  1 
ATOM   174  C  CD1 . TYR A 1 24  ? 45.208  10.187 100.798 1.00 34.27  ? 24   TYR A CD1 1 
ATOM   175  C  CD2 . TYR A 1 24  ? 45.473  9.678  103.093 1.00 34.12  ? 24   TYR A CD2 1 
ATOM   176  C  CE1 . TYR A 1 24  ? 44.838  8.877  100.536 1.00 34.88  ? 24   TYR A CE1 1 
ATOM   177  C  CE2 . TYR A 1 24  ? 45.090  8.371  102.841 1.00 34.73  ? 24   TYR A CE2 1 
ATOM   178  C  CZ  . TYR A 1 24  ? 44.767  7.976  101.571 1.00 35.04  ? 24   TYR A CZ  1 
ATOM   179  O  OH  . TYR A 1 24  ? 44.419  6.656  101.373 1.00 34.06  ? 24   TYR A OH  1 
ATOM   180  N  N   . ALA A 1 25  ? 48.585  13.781 103.350 1.00 33.33  ? 25   ALA A N   1 
ATOM   181  C  CA  . ALA A 1 25  ? 49.136  15.127 103.607 1.00 34.48  ? 25   ALA A CA  1 
ATOM   182  C  C   . ALA A 1 25  ? 50.387  15.476 102.745 1.00 36.07  ? 25   ALA A C   1 
ATOM   183  O  O   . ALA A 1 25  ? 50.612  16.655 102.367 1.00 34.29  ? 25   ALA A O   1 
ATOM   184  C  CB  . ALA A 1 25  ? 49.477  15.293 105.079 1.00 36.94  ? 25   ALA A CB  1 
ATOM   185  N  N   . LYS A 1 26  ? 51.204  14.453 102.531 1.00 38.17  ? 26   LYS A N   1 
ATOM   186  C  CA  . LYS A 1 26  ? 52.428  14.541 101.719 1.00 40.55  ? 26   LYS A CA  1 
ATOM   187  C  C   . LYS A 1 26  ? 52.119  15.117 100.346 1.00 39.04  ? 26   LYS A C   1 
ATOM   188  O  O   . LYS A 1 26  ? 52.919  15.843 99.811  1.00 39.63  ? 26   LYS A O   1 
ATOM   189  C  CB  . LYS A 1 26  ? 53.069  13.156 101.562 1.00 45.59  ? 26   LYS A CB  1 
ATOM   190  C  CG  . LYS A 1 26  ? 54.306  13.092 100.681 1.00 55.14  ? 26   LYS A CG  1 
ATOM   191  C  CD  . LYS A 1 26  ? 55.391  14.028 101.196 1.00 62.25  ? 26   LYS A CD  1 
ATOM   192  C  CE  . LYS A 1 26  ? 56.784  13.704 100.634 1.00 66.59  ? 26   LYS A CE  1 
ATOM   193  N  NZ  . LYS A 1 26  ? 57.852  14.448 101.377 1.00 63.84  ? 26   LYS A NZ  1 
ATOM   194  N  N   . SER A 1 27  ? 50.949  14.817 99.798  1.00 35.55  ? 27   SER A N   1 
ATOM   195  C  CA  . SER A 1 27  ? 50.601  15.243 98.432  1.00 36.51  ? 27   SER A CA  1 
ATOM   196  C  C   . SER A 1 27  ? 50.379  16.739 98.333  1.00 34.63  ? 27   SER A C   1 
ATOM   197  O  O   . SER A 1 27  ? 50.380  17.324 97.258  1.00 36.19  ? 27   SER A O   1 
ATOM   198  C  CB  . SER A 1 27  ? 49.355  14.494 97.966  1.00 38.89  ? 27   SER A CB  1 
ATOM   199  O  OG  . SER A 1 27  ? 48.221  14.902 98.736  1.00 36.67  ? 27   SER A OG  1 
ATOM   200  N  N   . LEU A 1 28  ? 50.177  17.386 99.466  1.00 35.06  ? 28   LEU A N   1 
ATOM   201  C  CA  . LEU A 1 28  ? 49.984  18.828 99.484  1.00 33.31  ? 28   LEU A CA  1 
ATOM   202  C  C   . LEU A 1 28  ? 51.200  19.608 99.959  1.00 35.23  ? 28   LEU A C   1 
ATOM   203  O  O   . LEU A 1 28  ? 51.303  20.808 99.682  1.00 33.56  ? 28   LEU A O   1 
ATOM   204  C  CB  . LEU A 1 28  ? 48.833  19.174 100.429 1.00 32.75  ? 28   LEU A CB  1 
ATOM   205  C  CG  . LEU A 1 28  ? 47.441  18.699 100.035 1.00 35.54  ? 28   LEU A CG  1 
ATOM   206  C  CD1 . LEU A 1 28  ? 46.530  18.855 101.239 1.00 38.17  ? 28   LEU A CD1 1 
ATOM   207  C  CD2 . LEU A 1 28  ? 46.882  19.480 98.864  1.00 39.07  ? 28   LEU A CD2 1 
ATOM   208  N  N   . ALA A 1 29  ? 52.073  18.980 100.741 1.00 37.41  ? 29   ALA A N   1 
ATOM   209  C  CA  . ALA A 1 29  ? 53.174  19.721 101.364 1.00 36.60  ? 29   ALA A CA  1 
ATOM   210  C  C   . ALA A 1 29  ? 54.023  18.748 102.149 1.00 42.13  ? 29   ALA A C   1 
ATOM   211  O  O   . ALA A 1 29  ? 53.563  17.648 102.527 1.00 42.84  ? 29   ALA A O   1 
ATOM   212  C  CB  . ALA A 1 29  ? 52.664  20.851 102.264 1.00 38.97  ? 29   ALA A CB  1 
ATOM   213  N  N   . ASP A 1 30  ? 55.279  19.117 102.377 1.00 43.33  ? 30   ASP A N   1 
ATOM   214  C  CA  . ASP A 1 30  ? 56.197  18.192 103.053 1.00 45.69  ? 30   ASP A CA  1 
ATOM   215  C  C   . ASP A 1 30  ? 56.603  18.715 104.420 1.00 42.60  ? 30   ASP A C   1 
ATOM   216  O  O   . ASP A 1 30  ? 57.483  18.145 105.077 1.00 42.16  ? 30   ASP A O   1 
ATOM   217  C  CB  . ASP A 1 30  ? 57.405  17.859 102.172 1.00 51.34  ? 30   ASP A CB  1 
ATOM   218  C  CG  . ASP A 1 30  ? 58.279  19.060 101.898 1.00 55.04  ? 30   ASP A CG  1 
ATOM   219  O  OD1 . ASP A 1 30  ? 58.085  20.117 102.540 1.00 51.08  ? 30   ASP A OD1 1 
ATOM   220  O  OD2 . ASP A 1 30  ? 59.147  18.938 101.007 1.00 68.52  ? 30   ASP A OD2 1 
ATOM   221  N  N   . HIS A 1 31  ? 55.914  19.766 104.856 1.00 39.83  ? 31   HIS A N   1 
ATOM   222  C  CA  . HIS A 1 31  ? 56.220  20.425 106.105 1.00 42.07  ? 31   HIS A CA  1 
ATOM   223  C  C   . HIS A 1 31  ? 54.994  21.150 106.680 1.00 35.26  ? 31   HIS A C   1 
ATOM   224  O  O   . HIS A 1 31  ? 54.533  22.154 106.082 1.00 32.85  ? 31   HIS A O   1 
ATOM   225  C  CB  . HIS A 1 31  ? 57.366  21.421 105.882 1.00 47.99  ? 31   HIS A CB  1 
ATOM   226  C  CG  . HIS A 1 31  ? 57.892  22.026 107.148 1.00 54.38  ? 31   HIS A CG  1 
ATOM   227  N  ND1 . HIS A 1 31  ? 58.590  23.218 107.176 1.00 57.46  ? 31   HIS A ND1 1 
ATOM   228  C  CD2 . HIS A 1 31  ? 57.803  21.613 108.435 1.00 60.50  ? 31   HIS A CD2 1 
ATOM   229  C  CE1 . HIS A 1 31  ? 58.912  23.505 108.423 1.00 58.99  ? 31   HIS A CE1 1 
ATOM   230  N  NE2 . HIS A 1 31  ? 58.443  22.549 109.208 1.00 60.54  ? 31   HIS A NE2 1 
ATOM   231  N  N   . TYR A 1 32  ? 54.530  20.679 107.853 1.00 32.48  ? 32   TYR A N   1 
ATOM   232  C  CA  . TYR A 1 32  ? 53.310  21.208 108.526 1.00 35.35  ? 32   TYR A CA  1 
ATOM   233  C  C   . TYR A 1 32  ? 53.465  21.751 109.975 1.00 34.22  ? 32   TYR A C   1 
ATOM   234  O  O   . TYR A 1 32  ? 54.125  21.147 110.801 1.00 40.61  ? 32   TYR A O   1 
ATOM   235  C  CB  . TYR A 1 32  ? 52.242  20.112 108.573 1.00 35.37  ? 32   TYR A CB  1 
ATOM   236  C  CG  . TYR A 1 32  ? 51.546  19.764 107.234 1.00 35.92  ? 32   TYR A CG  1 
ATOM   237  C  CD1 . TYR A 1 32  ? 52.084  18.825 106.358 1.00 37.18  ? 32   TYR A CD1 1 
ATOM   238  C  CD2 . TYR A 1 32  ? 50.337  20.374 106.874 1.00 32.71  ? 32   TYR A CD2 1 
ATOM   239  C  CE1 . TYR A 1 32  ? 51.440  18.497 105.163 1.00 37.00  ? 32   TYR A CE1 1 
ATOM   240  C  CE2 . TYR A 1 32  ? 49.712  20.084 105.674 1.00 32.58  ? 32   TYR A CE2 1 
ATOM   241  C  CZ  . TYR A 1 32  ? 50.259  19.146 104.828 1.00 34.89  ? 32   TYR A CZ  1 
ATOM   242  O  OH  . TYR A 1 32  ? 49.610  18.860 103.660 1.00 32.93  ? 32   TYR A OH  1 
ATOM   243  N  N   . LEU A 1 33  ? 52.835  22.884 110.258 1.00 34.21  ? 33   LEU A N   1 
ATOM   244  C  CA  . LEU A 1 33  ? 52.439  23.240 111.623 1.00 32.53  ? 33   LEU A CA  1 
ATOM   245  C  C   . LEU A 1 33  ? 51.221  22.335 112.039 1.00 34.17  ? 33   LEU A C   1 
ATOM   246  O  O   . LEU A 1 33  ? 50.211  22.250 111.309 1.00 32.87  ? 33   LEU A O   1 
ATOM   247  C  CB  . LEU A 1 33  ? 51.981  24.683 111.620 1.00 34.54  ? 33   LEU A CB  1 
ATOM   248  C  CG  . LEU A 1 33  ? 51.549  25.291 112.933 1.00 33.61  ? 33   LEU A CG  1 
ATOM   249  C  CD1 . LEU A 1 33  ? 52.822  25.528 113.727 1.00 41.07  ? 33   LEU A CD1 1 
ATOM   250  C  CD2 . LEU A 1 33  ? 50.843  26.601 112.660 1.00 35.23  ? 33   LEU A CD2 1 
ATOM   251  N  N   . VAL A 1 34  ? 51.299  21.680 113.179 1.00 33.47  ? 34   VAL A N   1 
ATOM   252  C  CA  . VAL A 1 34  ? 50.180  20.878 113.732 1.00 31.16  ? 34   VAL A CA  1 
ATOM   253  C  C   . VAL A 1 34  ? 49.600  21.613 114.927 1.00 34.05  ? 34   VAL A C   1 
ATOM   254  O  O   . VAL A 1 34  ? 50.289  21.827 115.946 1.00 31.90  ? 34   VAL A O   1 
ATOM   255  C  CB  . VAL A 1 34  ? 50.696  19.500 114.130 1.00 32.93  ? 34   VAL A CB  1 
ATOM   256  C  CG1 . VAL A 1 34  ? 49.576  18.607 114.651 1.00 33.26  ? 34   VAL A CG1 1 
ATOM   257  C  CG2 . VAL A 1 34  ? 51.393  18.875 112.925 1.00 35.20  ? 34   VAL A CG2 1 
ATOM   258  N  N   . ILE A 1 35  ? 48.367  22.065 114.784 1.00 32.91  ? 35   ILE A N   1 
ATOM   259  C  CA  . ILE A 1 35  ? 47.664  22.796 115.823 1.00 32.26  ? 35   ILE A CA  1 
ATOM   260  C  C   . ILE A 1 35  ? 46.735  21.834 116.525 1.00 36.31  ? 35   ILE A C   1 
ATOM   261  O  O   . ILE A 1 35  ? 45.833  21.229 115.888 1.00 29.41  ? 35   ILE A O   1 
ATOM   262  C  CB  . ILE A 1 35  ? 46.863  23.904 115.218 1.00 32.99  ? 35   ILE A CB  1 
ATOM   263  C  CG1 . ILE A 1 35  ? 47.800  24.816 114.427 1.00 32.67  ? 35   ILE A CG1 1 
ATOM   264  C  CG2 . ILE A 1 35  ? 46.051  24.639 116.297 1.00 33.36  ? 35   ILE A CG2 1 
ATOM   265  C  CD1 . ILE A 1 35  ? 47.035  25.847 113.590 1.00 35.74  ? 35   ILE A CD1 1 
ATOM   266  N  N   . ALA A 1 36  ? 46.976  21.655 117.826 1.00 35.30  ? 36   ALA A N   1 
ATOM   267  C  CA  . ALA A 1 36  ? 46.141  20.811 118.654 1.00 39.98  ? 36   ALA A CA  1 
ATOM   268  C  C   . ALA A 1 36  ? 46.283  21.232 120.110 1.00 47.06  ? 36   ALA A C   1 
ATOM   269  O  O   . ALA A 1 36  ? 47.403  21.516 120.570 1.00 45.70  ? 36   ALA A O   1 
ATOM   270  C  CB  . ALA A 1 36  ? 46.599  19.370 118.525 1.00 42.56  ? 36   ALA A CB  1 
ATOM   271  N  N   . ASP A 1 37  ? 45.182  21.211 120.856 1.00 46.88  ? 37   ASP A N   1 
ATOM   272  C  CA  . ASP A 1 37  ? 45.285  21.413 122.300 1.00 46.68  ? 37   ASP A CA  1 
ATOM   273  C  C   . ASP A 1 37  ? 45.956  20.196 122.945 1.00 45.12  ? 37   ASP A C   1 
ATOM   274  O  O   . ASP A 1 37  ? 46.239  19.177 122.272 1.00 40.13  ? 37   ASP A O   1 
ATOM   275  C  CB  . ASP A 1 37  ? 43.916  21.709 122.910 1.00 49.00  ? 37   ASP A CB  1 
ATOM   276  C  CG  . ASP A 1 37  ? 43.021  20.461 123.027 1.00 49.71  ? 37   ASP A CG  1 
ATOM   277  O  OD1 . ASP A 1 37  ? 43.511  19.312 123.172 1.00 50.37  ? 37   ASP A OD1 1 
ATOM   278  O  OD2 . ASP A 1 37  ? 41.800  20.649 122.986 1.00 55.97  ? 37   ASP A OD2 1 
ATOM   279  N  N   . ASP A 1 38  ? 46.214  20.279 124.255 1.00 46.60  ? 38   ASP A N   1 
ATOM   280  C  CA  . ASP A 1 38  ? 46.996  19.229 124.931 1.00 42.03  ? 38   ASP A CA  1 
ATOM   281  C  C   . ASP A 1 38  ? 46.254  17.909 125.053 1.00 42.53  ? 38   ASP A C   1 
ATOM   282  O  O   . ASP A 1 38  ? 46.839  16.831 124.854 1.00 45.66  ? 38   ASP A O   1 
ATOM   283  C  CB  . ASP A 1 38  ? 47.447  19.702 126.324 1.00 53.06  ? 38   ASP A CB  1 
ATOM   284  C  CG  . ASP A 1 38  ? 48.212  21.024 126.282 1.00 60.73  ? 38   ASP A CG  1 
ATOM   285  O  OD1 . ASP A 1 38  ? 49.125  21.163 125.423 1.00 63.25  ? 38   ASP A OD1 1 
ATOM   286  O  OD2 . ASP A 1 38  ? 47.897  21.917 127.115 1.00 65.49  ? 38   ASP A OD2 1 
ATOM   287  N  N   . PHE A 1 39  ? 44.965  17.965 125.376 1.00 41.29  ? 39   PHE A N   1 
ATOM   288  C  CA  . PHE A 1 39  ? 44.170  16.728 125.465 1.00 45.59  ? 39   PHE A CA  1 
ATOM   289  C  C   . PHE A 1 39  ? 44.218  15.923 124.145 1.00 38.05  ? 39   PHE A C   1 
ATOM   290  O  O   . PHE A 1 39  ? 44.362  14.698 124.135 1.00 35.03  ? 39   PHE A O   1 
ATOM   291  C  CB  . PHE A 1 39  ? 42.707  17.017 125.806 1.00 50.30  ? 39   PHE A CB  1 
ATOM   292  C  CG  . PHE A 1 39  ? 41.871  15.757 125.967 1.00 65.14  ? 39   PHE A CG  1 
ATOM   293  C  CD1 . PHE A 1 39  ? 42.030  14.932 127.107 1.00 67.18  ? 39   PHE A CD1 1 
ATOM   294  C  CD2 . PHE A 1 39  ? 40.933  15.377 124.985 1.00 67.78  ? 39   PHE A CD2 1 
ATOM   295  C  CE1 . PHE A 1 39  ? 41.276  13.775 127.265 1.00 66.96  ? 39   PHE A CE1 1 
ATOM   296  C  CE2 . PHE A 1 39  ? 40.183  14.212 125.140 1.00 68.78  ? 39   PHE A CE2 1 
ATOM   297  C  CZ  . PHE A 1 39  ? 40.351  13.416 126.282 1.00 73.39  ? 39   PHE A CZ  1 
ATOM   298  N  N   . VAL A 1 40  ? 44.083  16.647 123.039 1.00 36.84  ? 40   VAL A N   1 
ATOM   299  C  CA  . VAL A 1 40  ? 44.104  16.016 121.704 1.00 35.52  ? 40   VAL A CA  1 
ATOM   300  C  C   . VAL A 1 40  ? 45.491  15.490 121.342 1.00 36.08  ? 40   VAL A C   1 
ATOM   301  O  O   . VAL A 1 40  ? 45.624  14.403 120.782 1.00 35.46  ? 40   VAL A O   1 
ATOM   302  C  CB  . VAL A 1 40  ? 43.597  16.965 120.617 1.00 31.55  ? 40   VAL A CB  1 
ATOM   303  C  CG1 . VAL A 1 40  ? 43.787  16.330 119.241 1.00 28.25  ? 40   VAL A CG1 1 
ATOM   304  C  CG2 . VAL A 1 40  ? 42.146  17.318 120.885 1.00 32.53  ? 40   VAL A CG2 1 
ATOM   305  N  N   . MET A 1 41  ? 46.530  16.249 121.666 1.00 43.48  ? 41   MET A N   1 
ATOM   306  C  CA  . MET A 1 41  ? 47.887  15.752 121.453 1.00 48.62  ? 41   MET A CA  1 
ATOM   307  C  C   . MET A 1 41  ? 48.118  14.437 122.220 1.00 47.94  ? 41   MET A C   1 
ATOM   308  O  O   . MET A 1 41  ? 48.703  13.497 121.701 1.00 49.20  ? 41   MET A O   1 
ATOM   309  C  CB  . MET A 1 41  ? 48.910  16.829 121.846 1.00 53.85  ? 41   MET A CB  1 
ATOM   310  C  CG  . MET A 1 41  ? 50.174  16.769 121.008 1.00 61.21  ? 41   MET A CG  1 
ATOM   311  S  SD  . MET A 1 41  ? 49.955  17.333 119.301 1.00 62.26  ? 41   MET A SD  1 
ATOM   312  C  CE  . MET A 1 41  ? 50.187  19.107 119.466 1.00 64.81  ? 41   MET A CE  1 
ATOM   313  N  N   . LYS A 1 42  ? 47.618  14.347 123.446 1.00 56.38  ? 42   LYS A N   1 
ATOM   314  C  CA  . LYS A 1 42  ? 47.793  13.120 124.245 1.00 58.68  ? 42   LYS A CA  1 
ATOM   315  C  C   . LYS A 1 42  ? 47.002  11.975 123.645 1.00 57.27  ? 42   LYS A C   1 
ATOM   316  O  O   . LYS A 1 42  ? 47.467  10.839 123.605 1.00 57.96  ? 42   LYS A O   1 
ATOM   317  C  CB  . LYS A 1 42  ? 47.403  13.331 125.729 1.00 62.17  ? 42   LYS A CB  1 
ATOM   318  C  CG  . LYS A 1 42  ? 48.612  13.368 126.671 1.00 66.75  ? 42   LYS A CG  1 
ATOM   319  C  CD  . LYS A 1 42  ? 49.253  11.977 126.775 1.00 68.72  ? 42   LYS A CD  1 
ATOM   320  C  CE  . LYS A 1 42  ? 50.174  11.839 127.977 1.00 69.24  ? 42   LYS A CE  1 
ATOM   321  N  NZ  . LYS A 1 42  ? 51.405  12.668 127.829 1.00 71.79  ? 42   LYS A NZ  1 
ATOM   322  N  N   . LEU A 1 43  ? 45.801  12.279 123.172 1.00 47.77  ? 43   LEU A N   1 
ATOM   323  C  CA  . LEU A 1 43  ? 44.977  11.263 122.540 1.00 48.58  ? 43   LEU A CA  1 
ATOM   324  C  C   . LEU A 1 43  ? 45.570  10.777 121.177 1.00 47.76  ? 43   LEU A C   1 
ATOM   325  O  O   . LEU A 1 43  ? 45.753  9.571  120.949 1.00 50.52  ? 43   LEU A O   1 
ATOM   326  C  CB  . LEU A 1 43  ? 43.565  11.833 122.345 1.00 50.70  ? 43   LEU A CB  1 
ATOM   327  C  CG  . LEU A 1 43  ? 42.616  11.010 121.487 1.00 52.80  ? 43   LEU A CG  1 
ATOM   328  C  CD1 . LEU A 1 43  ? 42.462  9.612  122.102 1.00 56.42  ? 43   LEU A CD1 1 
ATOM   329  C  CD2 . LEU A 1 43  ? 41.310  11.781 121.345 1.00 53.17  ? 43   LEU A CD2 1 
ATOM   330  N  N   . ALA A 1 44  ? 45.865  11.729 120.294 1.00 42.23  ? 44   ALA A N   1 
ATOM   331  C  CA  . ALA A 1 44  ? 46.122  11.441 118.852 1.00 44.15  ? 44   ALA A CA  1 
ATOM   332  C  C   . ALA A 1 44  ? 47.544  11.724 118.353 1.00 41.77  ? 44   ALA A C   1 
ATOM   333  O  O   . ALA A 1 44  ? 47.885  11.318 117.235 1.00 42.91  ? 44   ALA A O   1 
ATOM   334  C  CB  . ALA A 1 44  ? 45.141  12.239 118.009 1.00 41.30  ? 44   ALA A CB  1 
ATOM   335  N  N   . GLY A 1 45  ? 48.349  12.419 119.169 1.00 38.23  ? 45   GLY A N   1 
ATOM   336  C  CA  . GLY A 1 45  ? 49.657  12.938 118.751 1.00 37.87  ? 45   GLY A CA  1 
ATOM   337  C  C   . GLY A 1 45  ? 50.686  11.930 118.255 1.00 39.85  ? 45   GLY A C   1 
ATOM   338  O  O   . GLY A 1 45  ? 51.289  12.153 117.207 1.00 42.62  ? 45   GLY A O   1 
ATOM   339  N  N   . ASP A 1 46  ? 50.892  10.838 118.995 1.00 42.04  ? 46   ASP A N   1 
ATOM   340  C  CA  . ASP A 1 46  ? 51.849  9.788  118.603 1.00 45.11  ? 46   ASP A CA  1 
ATOM   341  C  C   . ASP A 1 46  ? 51.437  9.109  117.275 1.00 44.55  ? 46   ASP A C   1 
ATOM   342  O  O   . ASP A 1 46  ? 52.284  8.837  116.453 1.00 40.86  ? 46   ASP A O   1 
ATOM   343  C  CB  . ASP A 1 46  ? 52.020  8.693  119.692 1.00 51.00  ? 46   ASP A CB  1 
ATOM   344  C  CG  . ASP A 1 46  ? 52.919  9.135  120.892 1.00 58.88  ? 46   ASP A CG  1 
ATOM   345  O  OD1 . ASP A 1 46  ? 53.369  10.294 120.955 1.00 58.37  ? 46   ASP A OD1 1 
ATOM   346  O  OD2 . ASP A 1 46  ? 53.166  8.308  121.797 1.00 64.64  ? 46   ASP A OD2 1 
ATOM   347  N  N   . THR A 1 47  ? 50.150  8.803  117.082 1.00 42.08  ? 47   THR A N   1 
ATOM   348  C  CA  . THR A 1 47  ? 49.702  8.212  115.810 1.00 35.74  ? 47   THR A CA  1 
ATOM   349  C  C   . THR A 1 47  ? 49.909  9.179  114.650 1.00 31.13  ? 47   THR A C   1 
ATOM   350  O  O   . THR A 1 47  ? 50.444  8.840  113.613 1.00 31.95  ? 47   THR A O   1 
ATOM   351  C  CB  . THR A 1 47  ? 48.231  7.775  115.880 1.00 37.84  ? 47   THR A CB  1 
ATOM   352  O  OG1 . THR A 1 47  ? 48.084  6.830  116.931 1.00 39.75  ? 47   THR A OG1 1 
ATOM   353  C  CG2 . THR A 1 47  ? 47.789  7.075  114.573 1.00 35.32  ? 47   THR A CG2 1 
ATOM   354  N  N   . LEU A 1 48  ? 49.479  10.407 114.817 1.00 30.89  ? 48   LEU A N   1 
ATOM   355  C  CA  . LEU A 1 48  ? 49.622  11.364 113.752 1.00 33.75  ? 48   LEU A CA  1 
ATOM   356  C  C   . LEU A 1 48  ? 51.112  11.624 113.413 1.00 39.49  ? 48   LEU A C   1 
ATOM   357  O  O   . LEU A 1 48  ? 51.515  11.499 112.250 1.00 34.89  ? 48   LEU A O   1 
ATOM   358  C  CB  . LEU A 1 48  ? 48.920  12.665 114.118 1.00 32.73  ? 48   LEU A CB  1 
ATOM   359  C  CG  . LEU A 1 48  ? 49.065  13.783 113.083 1.00 35.14  ? 48   LEU A CG  1 
ATOM   360  C  CD1 . LEU A 1 48  ? 48.576  13.280 111.714 1.00 34.40  ? 48   LEU A CD1 1 
ATOM   361  C  CD2 . LEU A 1 48  ? 48.336  15.038 113.523 1.00 38.08  ? 48   LEU A CD2 1 
ATOM   362  N  N   . MET A 1 49  ? 51.927  11.979 114.409 1.00 43.62  ? 49   MET A N   1 
ATOM   363  C  CA  . MET A 1 49  ? 53.347  12.318 114.121 1.00 48.51  ? 49   MET A CA  1 
ATOM   364  C  C   . MET A 1 49  ? 54.044  11.101 113.556 1.00 41.66  ? 49   MET A C   1 
ATOM   365  O  O   . MET A 1 49  ? 54.814  11.229 112.617 1.00 46.50  ? 49   MET A O   1 
ATOM   366  C  CB  . MET A 1 49  ? 54.115  12.833 115.346 1.00 51.92  ? 49   MET A CB  1 
ATOM   367  C  CG  . MET A 1 49  ? 53.547  14.092 115.990 1.00 57.67  ? 49   MET A CG  1 
ATOM   368  S  SD  . MET A 1 49  ? 52.825  15.307 114.868 1.00 62.98  ? 49   MET A SD  1 
ATOM   369  C  CE  . MET A 1 49  ? 53.055  16.824 115.793 1.00 61.61  ? 49   MET A CE  1 
ATOM   370  N  N   . GLY A 1 50  ? 53.718  9.926  114.093 1.00 42.03  ? 50   GLY A N   1 
ATOM   371  C  CA  . GLY A 1 50  ? 54.157  8.648  113.525 1.00 40.54  ? 50   GLY A CA  1 
ATOM   372  C  C   . GLY A 1 50  ? 53.860  8.522  112.034 1.00 44.12  ? 50   GLY A C   1 
ATOM   373  O  O   . GLY A 1 50  ? 54.740  8.146  111.249 1.00 40.01  ? 50   GLY A O   1 
ATOM   374  N  N   . SER A 1 51  ? 52.620  8.839  111.626 1.00 39.50  ? 51   SER A N   1 
ATOM   375  C  CA  . SER A 1 51  ? 52.240  8.706  110.236 1.00 34.73  ? 51   SER A CA  1 
ATOM   376  C  C   . SER A 1 51  ? 53.025  9.674  109.386 1.00 33.97  ? 51   SER A C   1 
ATOM   377  O  O   . SER A 1 51  ? 53.463  9.325  108.304 1.00 37.26  ? 51   SER A O   1 
ATOM   378  C  CB  . SER A 1 51  ? 50.731  8.982  110.033 1.00 39.52  ? 51   SER A CB  1 
ATOM   379  O  OG  . SER A 1 51  ? 50.382  8.839  108.666 1.00 32.81  ? 51   SER A OG  1 
ATOM   380  N  N   . LEU A 1 52  ? 53.158  10.895 109.864 1.00 32.57  ? 52   LEU A N   1 
ATOM   381  C  CA  . LEU A 1 52  ? 53.828  11.934 109.125 1.00 40.41  ? 52   LEU A CA  1 
ATOM   382  C  C   . LEU A 1 52  ? 55.309  11.601 108.913 1.00 45.86  ? 52   LEU A C   1 
ATOM   383  O  O   . LEU A 1 52  ? 55.836  11.742 107.804 1.00 43.92  ? 52   LEU A O   1 
ATOM   384  C  CB  . LEU A 1 52  ? 53.719  13.223 109.901 1.00 38.66  ? 52   LEU A CB  1 
ATOM   385  C  CG  . LEU A 1 52  ? 52.326  13.838 109.880 1.00 36.67  ? 52   LEU A CG  1 
ATOM   386  C  CD1 . LEU A 1 52  ? 52.398  15.193 110.538 1.00 34.84  ? 52   LEU A CD1 1 
ATOM   387  C  CD2 . LEU A 1 52  ? 51.790  14.014 108.457 1.00 33.95  ? 52   LEU A CD2 1 
ATOM   388  N  N   . GLN A 1 53  ? 55.954  11.153 109.993 1.00 48.65  ? 53   GLN A N   1 
ATOM   389  C  CA  . GLN A 1 53  ? 57.361  10.768 109.955 1.00 53.59  ? 53   GLN A CA  1 
ATOM   390  C  C   . GLN A 1 53  ? 57.542  9.675  108.902 1.00 53.22  ? 53   GLN A C   1 
ATOM   391  O  O   . GLN A 1 53  ? 58.326  9.825  107.958 1.00 50.53  ? 53   GLN A O   1 
ATOM   392  C  CB  . GLN A 1 53  ? 57.813  10.328 111.358 1.00 57.61  ? 53   GLN A CB  1 
ATOM   393  C  CG  . GLN A 1 53  ? 59.192  9.683  111.450 1.00 59.42  ? 53   GLN A CG  1 
ATOM   394  C  CD  . GLN A 1 53  ? 60.315  10.579 110.946 1.00 62.78  ? 53   GLN A CD  1 
ATOM   395  O  OE1 . GLN A 1 53  ? 60.132  11.771 110.684 1.00 59.81  ? 53   GLN A OE1 1 
ATOM   396  N  NE2 . GLN A 1 53  ? 61.496  9.999  110.813 1.00 70.95  ? 53   GLN A NE2 1 
ATOM   397  N  N   . GLN A 1 54  ? 56.743  8.618  109.015 1.00 49.19  ? 54   GLN A N   1 
ATOM   398  C  CA  . GLN A 1 54  ? 56.801  7.495  108.081 1.00 46.34  ? 54   GLN A CA  1 
ATOM   399  C  C   . GLN A 1 54  ? 56.693  7.837  106.576 1.00 46.72  ? 54   GLN A C   1 
ATOM   400  O  O   . GLN A 1 54  ? 57.100  7.039  105.742 1.00 49.16  ? 54   GLN A O   1 
ATOM   401  C  CB  . GLN A 1 54  ? 55.739  6.476  108.489 1.00 51.29  ? 54   GLN A CB  1 
ATOM   402  C  CG  . GLN A 1 54  ? 55.526  5.337  107.510 1.00 57.30  ? 54   GLN A CG  1 
ATOM   403  C  CD  . GLN A 1 54  ? 54.635  4.251  108.088 1.00 67.99  ? 54   GLN A CD  1 
ATOM   404  O  OE1 . GLN A 1 54  ? 53.960  4.455  109.117 1.00 67.02  ? 54   GLN A OE1 1 
ATOM   405  N  NE2 . GLN A 1 54  ? 54.619  3.092  107.430 1.00 65.10  ? 54   GLN A NE2 1 
ATOM   406  N  N   . HIS A 1 55  ? 56.156  9.008  106.232 1.00 46.77  ? 55   HIS A N   1 
ATOM   407  C  CA  . HIS A 1 55  ? 56.018  9.433  104.837 1.00 47.28  ? 55   HIS A CA  1 
ATOM   408  C  C   . HIS A 1 55  ? 56.919  10.617 104.528 1.00 51.64  ? 55   HIS A C   1 
ATOM   409  O  O   . HIS A 1 55  ? 56.714  11.322 103.537 1.00 51.98  ? 55   HIS A O   1 
ATOM   410  C  CB  . HIS A 1 55  ? 54.555  9.794  104.541 1.00 47.36  ? 55   HIS A CB  1 
ATOM   411  C  CG  . HIS A 1 55  ? 53.706  8.600  104.320 1.00 42.86  ? 55   HIS A CG  1 
ATOM   412  N  ND1 . HIS A 1 55  ? 53.058  7.953  105.350 1.00 47.02  ? 55   HIS A ND1 1 
ATOM   413  C  CD2 . HIS A 1 55  ? 53.476  7.872  103.205 1.00 43.59  ? 55   HIS A CD2 1 
ATOM   414  C  CE1 . HIS A 1 55  ? 52.444  6.884  104.872 1.00 47.21  ? 55   HIS A CE1 1 
ATOM   415  N  NE2 . HIS A 1 55  ? 52.687  6.816  103.572 1.00 45.29  ? 55   HIS A NE2 1 
ATOM   416  N  N   . GLY A 1 56  ? 57.916  10.834 105.382 1.00 49.15  ? 56   GLY A N   1 
ATOM   417  C  CA  . GLY A 1 56  ? 58.871  11.926 105.185 1.00 48.95  ? 56   GLY A CA  1 
ATOM   418  C  C   . GLY A 1 56  ? 58.255  13.299 105.278 1.00 45.00  ? 56   GLY A C   1 
ATOM   419  O  O   . GLY A 1 56  ? 58.682  14.209 104.590 1.00 46.83  ? 56   GLY A O   1 
ATOM   420  N  N   . VAL A 1 57  ? 57.250  13.470 106.134 1.00 42.43  ? 57   VAL A N   1 
ATOM   421  C  CA  . VAL A 1 57  ? 56.644  14.779 106.312 1.00 41.36  ? 57   VAL A CA  1 
ATOM   422  C  C   . VAL A 1 57  ? 57.142  15.391 107.630 1.00 45.40  ? 57   VAL A C   1 
ATOM   423  O  O   . VAL A 1 57  ? 57.019  14.795 108.723 1.00 37.60  ? 57   VAL A O   1 
ATOM   424  C  CB  . VAL A 1 57  ? 55.083  14.709 106.296 1.00 43.71  ? 57   VAL A CB  1 
ATOM   425  C  CG1 . VAL A 1 57  ? 54.479  16.092 106.510 1.00 44.32  ? 57   VAL A CG1 1 
ATOM   426  C  CG2 . VAL A 1 57  ? 54.571  14.128 104.981 1.00 42.56  ? 57   VAL A CG2 1 
ATOM   427  N  N   . LYS A 1 58  ? 57.683  16.593 107.513 1.00 48.09  ? 58   LYS A N   1 
ATOM   428  C  CA  . LYS A 1 58  ? 58.231  17.317 108.644 1.00 56.69  ? 58   LYS A CA  1 
ATOM   429  C  C   . LYS A 1 58  ? 57.084  17.978 109.369 1.00 52.37  ? 58   LYS A C   1 
ATOM   430  O  O   . LYS A 1 58  ? 56.089  18.312 108.749 1.00 53.50  ? 58   LYS A O   1 
ATOM   431  C  CB  . LYS A 1 58  ? 59.250  18.380 108.173 1.00 60.98  ? 58   LYS A CB  1 
ATOM   432  C  CG  . LYS A 1 58  ? 60.527  17.801 107.547 1.00 70.90  ? 58   LYS A CG  1 
ATOM   433  C  CD  . LYS A 1 58  ? 61.412  17.079 108.576 1.00 76.13  ? 58   LYS A CD  1 
ATOM   434  C  CE  . LYS A 1 58  ? 62.437  16.140 107.940 1.00 75.87  ? 58   LYS A CE  1 
ATOM   435  N  NZ  . LYS A 1 58  ? 63.590  16.916 107.414 1.00 78.37  ? 58   LYS A NZ  1 
ATOM   436  N  N   . HIS A 1 59  ? 57.238  18.181 110.672 1.00 48.71  ? 59   HIS A N   1 
ATOM   437  C  CA  . HIS A 1 59  ? 56.172  18.724 111.506 1.00 50.48  ? 59   HIS A CA  1 
ATOM   438  C  C   . HIS A 1 59  ? 56.663  19.367 112.814 1.00 56.17  ? 59   HIS A C   1 
ATOM   439  O  O   . HIS A 1 59  ? 57.496  18.806 113.541 1.00 50.92  ? 59   HIS A O   1 
ATOM   440  C  CB  . HIS A 1 59  ? 55.223  17.585 111.866 1.00 50.55  ? 59   HIS A CB  1 
ATOM   441  C  CG  . HIS A 1 59  ? 55.924  16.390 112.423 1.00 49.97  ? 59   HIS A CG  1 
ATOM   442  N  ND1 . HIS A 1 59  ? 56.211  16.264 113.763 1.00 50.64  ? 59   HIS A ND1 1 
ATOM   443  C  CD2 . HIS A 1 59  ? 56.444  15.295 111.816 1.00 49.43  ? 59   HIS A CD2 1 
ATOM   444  C  CE1 . HIS A 1 59  ? 56.861  15.128 113.960 1.00 54.67  ? 59   HIS A CE1 1 
ATOM   445  N  NE2 . HIS A 1 59  ? 56.991  14.509 112.796 1.00 50.83  ? 59   HIS A NE2 1 
ATOM   446  N  N   . HIS A 1 60  ? 56.077  20.513 113.114 1.00 55.24  ? 60   HIS A N   1 
ATOM   447  C  CA  . HIS A 1 60  ? 56.261  21.230 114.346 1.00 57.10  ? 60   HIS A CA  1 
ATOM   448  C  C   . HIS A 1 60  ? 54.890  21.244 115.071 1.00 53.27  ? 60   HIS A C   1 
ATOM   449  O  O   . HIS A 1 60  ? 53.937  21.821 114.557 1.00 46.96  ? 60   HIS A O   1 
ATOM   450  C  CB  . HIS A 1 60  ? 56.696  22.648 113.969 1.00 57.81  ? 60   HIS A CB  1 
ATOM   451  C  CG  . HIS A 1 60  ? 56.796  23.590 115.124 1.00 71.50  ? 60   HIS A CG  1 
ATOM   452  N  ND1 . HIS A 1 60  ? 57.682  23.401 116.166 1.00 78.89  ? 60   HIS A ND1 1 
ATOM   453  C  CD2 . HIS A 1 60  ? 56.162  24.760 115.377 1.00 77.09  ? 60   HIS A CD2 1 
ATOM   454  C  CE1 . HIS A 1 60  ? 57.572  24.402 117.023 1.00 76.25  ? 60   HIS A CE1 1 
ATOM   455  N  NE2 . HIS A 1 60  ? 56.660  25.242 116.565 1.00 77.36  ? 60   HIS A NE2 1 
ATOM   456  N  N   . ALA A 1 61  ? 54.783  20.624 116.245 1.00 50.10  ? 61   ALA A N   1 
ATOM   457  C  CA  . ALA A 1 61  ? 53.559  20.730 117.059 1.00 51.59  ? 61   ALA A CA  1 
ATOM   458  C  C   . ALA A 1 61  ? 53.431  22.135 117.656 1.00 51.30  ? 61   ALA A C   1 
ATOM   459  O  O   . ALA A 1 61  ? 54.410  22.704 118.112 1.00 62.98  ? 61   ALA A O   1 
ATOM   460  C  CB  . ALA A 1 61  ? 53.559  19.686 118.166 1.00 52.94  ? 61   ALA A CB  1 
ATOM   461  N  N   . ALA A 1 62  ? 52.241  22.703 117.641 1.00 45.51  ? 62   ALA A N   1 
ATOM   462  C  CA  . ALA A 1 62  ? 51.966  23.935 118.348 1.00 47.87  ? 62   ALA A CA  1 
ATOM   463  C  C   . ALA A 1 62  ? 50.716  23.762 119.220 1.00 54.93  ? 62   ALA A C   1 
ATOM   464  O  O   . ALA A 1 62  ? 49.686  23.256 118.761 1.00 51.81  ? 62   ALA A O   1 
ATOM   465  C  CB  . ALA A 1 62  ? 51.780  25.085 117.380 1.00 46.92  ? 62   ALA A CB  1 
ATOM   466  N  N   . LEU A 1 63  ? 50.836  24.196 120.472 1.00 55.43  ? 63   LEU A N   1 
ATOM   467  C  CA  . LEU A 1 63  ? 49.826  24.023 121.501 1.00 54.18  ? 63   LEU A CA  1 
ATOM   468  C  C   . LEU A 1 63  ? 48.813  25.130 121.238 1.00 54.30  ? 63   LEU A C   1 
ATOM   469  O  O   . LEU A 1 63  ? 49.135  26.323 121.140 1.00 54.55  ? 63   LEU A O   1 
ATOM   470  C  CB  . LEU A 1 63  ? 50.465  24.102 122.925 1.00 60.26  ? 63   LEU A CB  1 
ATOM   471  C  CG  . LEU A 1 63  ? 49.707  24.070 124.294 1.00 70.89  ? 63   LEU A CG  1 
ATOM   472  C  CD1 . LEU A 1 63  ? 50.661  23.851 125.472 1.00 67.73  ? 63   LEU A CD1 1 
ATOM   473  C  CD2 . LEU A 1 63  ? 48.886  25.324 124.600 1.00 73.47  ? 63   LEU A CD2 1 
ATOM   474  N  N   . PHE A 1 64  ? 47.575  24.712 121.089 1.00 49.45  ? 64   PHE A N   1 
ATOM   475  C  CA  . PHE A 1 64  ? 46.495  25.614 120.829 1.00 48.75  ? 64   PHE A CA  1 
ATOM   476  C  C   . PHE A 1 64  ? 45.923  26.056 122.179 1.00 53.15  ? 64   PHE A C   1 
ATOM   477  O  O   . PHE A 1 64  ? 45.675  25.200 123.037 1.00 46.04  ? 64   PHE A O   1 
ATOM   478  C  CB  . PHE A 1 64  ? 45.453  24.822 120.046 1.00 47.45  ? 64   PHE A CB  1 
ATOM   479  C  CG  . PHE A 1 64  ? 44.142  25.506 119.918 1.00 42.79  ? 64   PHE A CG  1 
ATOM   480  C  CD1 . PHE A 1 64  ? 44.070  26.734 119.327 1.00 40.28  ? 64   PHE A CD1 1 
ATOM   481  C  CD2 . PHE A 1 64  ? 42.973  24.886 120.349 1.00 45.47  ? 64   PHE A CD2 1 
ATOM   482  C  CE1 . PHE A 1 64  ? 42.875  27.379 119.194 1.00 44.14  ? 64   PHE A CE1 1 
ATOM   483  C  CE2 . PHE A 1 64  ? 41.755  25.519 120.217 1.00 43.55  ? 64   PHE A CE2 1 
ATOM   484  C  CZ  . PHE A 1 64  ? 41.704  26.774 119.646 1.00 46.82  ? 64   PHE A CZ  1 
ATOM   485  N  N   . ASN A 1 65  ? 45.672  27.359 122.365 1.00 56.81  ? 65   ASN A N   1 
ATOM   486  C  CA  . ASN A 1 65  ? 45.164  27.854 123.657 1.00 60.34  ? 65   ASN A CA  1 
ATOM   487  C  C   . ASN A 1 65  ? 43.635  27.952 123.757 1.00 65.51  ? 65   ASN A C   1 
ATOM   488  O  O   . ASN A 1 65  ? 43.094  28.800 124.457 1.00 64.78  ? 65   ASN A O   1 
ATOM   489  C  CB  . ASN A 1 65  ? 45.862  29.163 124.039 1.00 64.48  ? 65   ASN A CB  1 
ATOM   490  C  CG  . ASN A 1 65  ? 47.342  28.952 124.349 1.00 68.64  ? 65   ASN A CG  1 
ATOM   491  O  OD1 . ASN A 1 65  ? 48.212  29.552 123.721 1.00 65.49  ? 65   ASN A OD1 1 
ATOM   492  N  ND2 . ASN A 1 65  ? 47.633  28.066 125.304 1.00 73.11  ? 65   ASN A ND2 1 
ATOM   493  N  N   . GLY A 1 66  ? 42.948  27.045 123.065 1.00 63.30  ? 66   GLY A N   1 
ATOM   494  C  CA  . GLY A 1 66  ? 41.552  26.760 123.332 1.00 57.02  ? 66   GLY A CA  1 
ATOM   495  C  C   . GLY A 1 66  ? 40.577  27.622 122.565 1.00 58.08  ? 66   GLY A C   1 
ATOM   496  O  O   . GLY A 1 66  ? 39.494  27.147 122.203 1.00 59.03  ? 66   GLY A O   1 
ATOM   497  N  N   . GLU A 1 67  ? 40.939  28.882 122.315 1.00 55.81  ? 67   GLU A N   1 
ATOM   498  C  CA  . GLU A 1 67  ? 40.002  29.840 121.710 1.00 59.85  ? 67   GLU A CA  1 
ATOM   499  C  C   . GLU A 1 67  ? 40.436  30.239 120.304 1.00 58.60  ? 67   GLU A C   1 
ATOM   500  O  O   . GLU A 1 67  ? 41.633  30.319 119.994 1.00 53.59  ? 67   GLU A O   1 
ATOM   501  C  CB  . GLU A 1 67  ? 39.787  31.089 122.606 1.00 62.62  ? 67   GLU A CB  1 
ATOM   502  C  CG  . GLU A 1 67  ? 38.993  30.824 123.896 1.00 69.55  ? 67   GLU A CG  1 
ATOM   503  C  CD  . GLU A 1 67  ? 37.606  30.190 123.663 1.00 76.72  ? 67   GLU A CD  1 
ATOM   504  O  OE1 . GLU A 1 67  ? 36.822  30.745 122.843 1.00 75.79  ? 67   GLU A OE1 1 
ATOM   505  O  OE2 . GLU A 1 67  ? 37.295  29.141 124.303 1.00 67.29  ? 67   GLU A OE2 1 
ATOM   506  N  N   . CYS A 1 68  ? 39.435  30.450 119.450 1.00 62.64  ? 68   CYS A N   1 
ATOM   507  C  CA  . CYS A 1 68  ? 39.648  30.920 118.077 1.00 64.21  ? 68   CYS A CA  1 
ATOM   508  C  C   . CYS A 1 68  ? 39.520  32.466 118.075 1.00 63.57  ? 68   CYS A C   1 
ATOM   509  O  O   . CYS A 1 68  ? 38.437  33.007 117.846 1.00 61.71  ? 68   CYS A O   1 
ATOM   510  C  CB  . CYS A 1 68  ? 38.638  30.227 117.131 1.00 58.26  ? 68   CYS A CB  1 
ATOM   511  S  SG  . CYS A 1 68  ? 38.576  30.824 115.428 1.00 56.54  ? 68   CYS A SG  1 
ATOM   512  N  N   . CYS A 1 69  ? 40.620  33.160 118.363 1.00 59.54  ? 69   CYS A N   1 
ATOM   513  C  CA  . CYS A 1 69  ? 40.631  34.632 118.436 1.00 63.34  ? 69   CYS A CA  1 
ATOM   514  C  C   . CYS A 1 69  ? 41.758  35.161 117.580 1.00 59.68  ? 69   CYS A C   1 
ATOM   515  O  O   . CYS A 1 69  ? 42.772  34.473 117.400 1.00 62.09  ? 69   CYS A O   1 
ATOM   516  C  CB  . CYS A 1 69  ? 40.836  35.099 119.887 1.00 65.39  ? 69   CYS A CB  1 
ATOM   517  S  SG  . CYS A 1 69  ? 42.161  34.216 120.754 1.00 70.82  ? 69   CYS A SG  1 
ATOM   518  N  N   . HIS A 1 70  ? 41.602  36.379 117.068 1.00 64.44  ? 70   HIS A N   1 
ATOM   519  C  CA  . HIS A 1 70  ? 42.659  36.996 116.253 1.00 67.42  ? 70   HIS A CA  1 
ATOM   520  C  C   . HIS A 1 70  ? 44.029  36.908 116.922 1.00 67.87  ? 70   HIS A C   1 
ATOM   521  O  O   . HIS A 1 70  ? 45.024  36.688 116.236 1.00 59.62  ? 70   HIS A O   1 
ATOM   522  C  CB  . HIS A 1 70  ? 42.340  38.449 115.837 1.00 72.41  ? 70   HIS A CB  1 
ATOM   523  C  CG  . HIS A 1 70  ? 42.198  38.625 114.352 1.00 83.69  ? 70   HIS A CG  1 
ATOM   524  N  ND1 . HIS A 1 70  ? 43.236  38.391 113.468 1.00 83.10  ? 70   HIS A ND1 1 
ATOM   525  C  CD2 . HIS A 1 70  ? 41.135  38.990 113.594 1.00 86.00  ? 70   HIS A CD2 1 
ATOM   526  C  CE1 . HIS A 1 70  ? 42.819  38.608 112.233 1.00 85.23  ? 70   HIS A CE1 1 
ATOM   527  N  NE2 . HIS A 1 70  ? 41.547  38.971 112.281 1.00 89.08  ? 70   HIS A NE2 1 
ATOM   528  N  N   . LYS A 1 71  ? 44.086  37.046 118.249 1.00 70.79  ? 71   LYS A N   1 
ATOM   529  C  CA  . LYS A 1 71  ? 45.371  37.003 118.951 1.00 68.84  ? 71   LYS A CA  1 
ATOM   530  C  C   . LYS A 1 71  ? 46.058  35.655 118.724 1.00 67.77  ? 71   LYS A C   1 
ATOM   531  O  O   . LYS A 1 71  ? 47.217  35.595 118.280 1.00 61.99  ? 71   LYS A O   1 
ATOM   532  C  CB  . LYS A 1 71  ? 45.221  37.273 120.456 1.00 70.18  ? 71   LYS A CB  1 
ATOM   533  C  CG  . LYS A 1 71  ? 46.535  37.730 121.097 1.00 77.59  ? 71   LYS A CG  1 
ATOM   534  C  CD  . LYS A 1 71  ? 46.597  37.595 122.625 1.00 77.54  ? 71   LYS A CD  1 
ATOM   535  C  CE  . LYS A 1 71  ? 46.713  36.147 123.110 1.00 79.14  ? 71   LYS A CE  1 
ATOM   536  N  NZ  . LYS A 1 71  ? 47.676  35.287 122.349 1.00 80.75  ? 71   LYS A NZ  1 
ATOM   537  N  N   . GLU A 1 72  ? 45.325  34.575 119.003 1.00 61.89  ? 72   GLU A N   1 
ATOM   538  C  CA  . GLU A 1 72  ? 45.859  33.219 118.860 1.00 54.97  ? 72   GLU A CA  1 
ATOM   539  C  C   . GLU A 1 72  ? 46.215  32.933 117.400 1.00 49.38  ? 72   GLU A C   1 
ATOM   540  O  O   . GLU A 1 72  ? 47.211  32.272 117.119 1.00 45.43  ? 72   GLU A O   1 
ATOM   541  C  CB  . GLU A 1 72  ? 44.832  32.210 119.390 1.00 59.59  ? 72   GLU A CB  1 
ATOM   542  C  CG  . GLU A 1 72  ? 45.256  30.750 119.402 1.00 59.35  ? 72   GLU A CG  1 
ATOM   543  C  CD  . GLU A 1 72  ? 46.367  30.433 120.384 1.00 64.76  ? 72   GLU A CD  1 
ATOM   544  O  OE1 . GLU A 1 72  ? 46.839  31.368 121.065 1.00 68.23  ? 72   GLU A OE1 1 
ATOM   545  O  OE2 . GLU A 1 72  ? 46.779  29.234 120.462 1.00 63.81  ? 72   GLU A OE2 1 
ATOM   546  N  N   . ILE A 1 73  ? 45.397  33.463 116.494 1.00 48.85  ? 73   ILE A N   1 
ATOM   547  C  CA  . ILE A 1 73  ? 45.605  33.326 115.053 1.00 54.10  ? 73   ILE A CA  1 
ATOM   548  C  C   . ILE A 1 73  ? 46.882  34.032 114.583 1.00 56.79  ? 73   ILE A C   1 
ATOM   549  O  O   . ILE A 1 73  ? 47.715  33.438 113.883 1.00 55.40  ? 73   ILE A O   1 
ATOM   550  C  CB  . ILE A 1 73  ? 44.347  33.797 114.277 1.00 46.89  ? 73   ILE A CB  1 
ATOM   551  C  CG1 . ILE A 1 73  ? 43.267  32.708 114.374 1.00 43.53  ? 73   ILE A CG1 1 
ATOM   552  C  CG2 . ILE A 1 73  ? 44.650  34.086 112.810 1.00 51.26  ? 73   ILE A CG2 1 
ATOM   553  C  CD1 . ILE A 1 73  ? 41.877  33.200 114.117 1.00 36.39  ? 73   ILE A CD1 1 
ATOM   554  N  N   . ASP A 1 74  ? 47.041  35.288 114.994 1.00 58.61  ? 74   ASP A N   1 
ATOM   555  C  CA  . ASP A 1 74  ? 48.244  36.069 114.661 1.00 53.40  ? 74   ASP A CA  1 
ATOM   556  C  C   . ASP A 1 74  ? 49.452  35.428 115.288 1.00 47.84  ? 74   ASP A C   1 
ATOM   557  O  O   . ASP A 1 74  ? 50.480  35.278 114.636 1.00 47.28  ? 74   ASP A O   1 
ATOM   558  C  CB  . ASP A 1 74  ? 48.090  37.522 115.108 1.00 56.51  ? 74   ASP A CB  1 
ATOM   559  C  CG  . ASP A 1 74  ? 46.919  38.236 114.411 1.00 61.06  ? 74   ASP A CG  1 
ATOM   560  O  OD1 . ASP A 1 74  ? 46.629  37.963 113.217 1.00 67.81  ? 74   ASP A OD1 1 
ATOM   561  O  OD2 . ASP A 1 74  ? 46.264  39.078 115.067 1.00 77.37  ? 74   ASP A OD2 1 
ATOM   562  N  N   . ARG A 1 75  ? 49.321  34.982 116.540 1.00 50.64  ? 75   ARG A N   1 
ATOM   563  C  CA  . ARG A 1 75  ? 50.415  34.271 117.187 1.00 49.01  ? 75   ARG A CA  1 
ATOM   564  C  C   . ARG A 1 75  ? 50.846  33.050 116.393 1.00 51.48  ? 75   ARG A C   1 
ATOM   565  O  O   . ARG A 1 75  ? 52.023  32.903 116.073 1.00 52.17  ? 75   ARG A O   1 
ATOM   566  C  CB  . ARG A 1 75  ? 50.045  33.849 118.610 1.00 55.26  ? 75   ARG A CB  1 
ATOM   567  C  CG  . ARG A 1 75  ? 51.155  33.056 119.300 1.00 58.52  ? 75   ARG A CG  1 
ATOM   568  C  CD  . ARG A 1 75  ? 50.806  32.686 120.732 1.00 60.95  ? 75   ARG A CD  1 
ATOM   569  N  NE  . ARG A 1 75  ? 50.011  31.464 120.796 1.00 56.56  ? 75   ARG A NE  1 
ATOM   570  C  CZ  . ARG A 1 75  ? 50.506  30.242 120.654 1.00 60.89  ? 75   ARG A CZ  1 
ATOM   571  N  NH1 . ARG A 1 75  ? 51.808  30.050 120.438 1.00 61.52  ? 75   ARG A NH1 1 
ATOM   572  N  NH2 . ARG A 1 75  ? 49.699  29.199 120.729 1.00 63.13  ? 75   ARG A NH2 1 
ATOM   573  N  N   . LEU A 1 76  ? 49.897  32.161 116.071 1.00 52.22  ? 76   LEU A N   1 
ATOM   574  C  CA  . LEU A 1 76  ? 50.239  30.904 115.376 1.00 47.47  ? 76   LEU A CA  1 
ATOM   575  C  C   . LEU A 1 76  ? 50.780  31.186 113.973 1.00 44.40  ? 76   LEU A C   1 
ATOM   576  O  O   . LEU A 1 76  ? 51.648  30.451 113.490 1.00 41.66  ? 76   LEU A O   1 
ATOM   577  C  CB  . LEU A 1 76  ? 49.045  29.942 115.319 1.00 47.90  ? 76   LEU A CB  1 
ATOM   578  C  CG  . LEU A 1 76  ? 48.658  29.240 116.628 1.00 45.63  ? 76   LEU A CG  1 
ATOM   579  C  CD1 . LEU A 1 76  ? 47.242  28.696 116.519 1.00 48.05  ? 76   LEU A CD1 1 
ATOM   580  C  CD2 . LEU A 1 76  ? 49.605  28.114 116.985 1.00 40.45  ? 76   LEU A CD2 1 
ATOM   581  N  N   . GLY A 1 77  ? 50.265  32.238 113.329 1.00 43.97  ? 77   GLY A N   1 
ATOM   582  C  CA  . GLY A 1 77  ? 50.871  32.750 112.091 1.00 49.18  ? 77   GLY A CA  1 
ATOM   583  C  C   . GLY A 1 77  ? 52.388  33.018 112.177 1.00 55.71  ? 77   GLY A C   1 
ATOM   584  O  O   . GLY A 1 77  ? 53.195  32.508 111.340 1.00 44.25  ? 77   GLY A O   1 
ATOM   585  N  N   . ARG A 1 78  ? 52.787  33.806 113.186 1.00 58.07  ? 78   ARG A N   1 
ATOM   586  C  CA  . ARG A 1 78  ? 54.218  34.114 113.391 1.00 59.70  ? 78   ARG A CA  1 
ATOM   587  C  C   . ARG A 1 78  ? 55.018  32.854 113.605 1.00 54.84  ? 78   ARG A C   1 
ATOM   588  O  O   . ARG A 1 78  ? 56.090  32.699 113.032 1.00 52.67  ? 78   ARG A O   1 
ATOM   589  C  CB  . ARG A 1 78  ? 54.469  35.028 114.593 1.00 66.33  ? 78   ARG A CB  1 
ATOM   590  C  CG  . ARG A 1 78  ? 53.778  36.370 114.544 1.00 67.83  ? 78   ARG A CG  1 
ATOM   591  C  CD  . ARG A 1 78  ? 54.308  37.305 113.461 1.00 67.38  ? 78   ARG A CD  1 
ATOM   592  N  NE  . ARG A 1 78  ? 53.216  38.063 112.852 1.00 72.48  ? 78   ARG A NE  1 
ATOM   593  C  CZ  . ARG A 1 78  ? 52.183  38.616 113.506 1.00 82.26  ? 78   ARG A CZ  1 
ATOM   594  N  NH1 . ARG A 1 78  ? 52.078  38.580 114.834 1.00 85.23  ? 78   ARG A NH1 1 
ATOM   595  N  NH2 . ARG A 1 78  ? 51.239  39.259 112.826 1.00 87.22  ? 78   ARG A NH2 1 
ATOM   596  N  N   . GLU A 1 79  ? 54.497  31.942 114.417 1.00 53.98  ? 79   GLU A N   1 
ATOM   597  C  CA  . GLU A 1 79  ? 55.236  30.720 114.721 1.00 60.34  ? 79   GLU A CA  1 
ATOM   598  C  C   . GLU A 1 79  ? 55.493  29.908 113.465 1.00 57.57  ? 79   GLU A C   1 
ATOM   599  O  O   . GLU A 1 79  ? 56.585  29.381 113.264 1.00 61.34  ? 79   GLU A O   1 
ATOM   600  C  CB  . GLU A 1 79  ? 54.492  29.870 115.751 1.00 65.01  ? 79   GLU A CB  1 
ATOM   601  C  CG  . GLU A 1 79  ? 55.246  28.602 116.121 1.00 69.99  ? 79   GLU A CG  1 
ATOM   602  C  CD  . GLU A 1 79  ? 54.786  27.994 117.427 1.00 71.60  ? 79   GLU A CD  1 
ATOM   603  O  OE1 . GLU A 1 79  ? 54.346  28.737 118.320 1.00 67.15  ? 79   GLU A OE1 1 
ATOM   604  O  OE2 . GLU A 1 79  ? 54.875  26.756 117.558 1.00 76.82  ? 79   GLU A OE2 1 
ATOM   605  N  N   . LEU A 1 80  ? 54.467  29.824 112.624 1.00 57.93  ? 80   LEU A N   1 
ATOM   606  C  CA  . LEU A 1 80  ? 54.560  29.116 111.362 1.00 55.06  ? 80   LEU A CA  1 
ATOM   607  C  C   . LEU A 1 80  ? 55.683  29.690 110.508 1.00 53.03  ? 80   LEU A C   1 
ATOM   608  O  O   . LEU A 1 80  ? 56.499  28.945 109.974 1.00 46.10  ? 80   LEU A O   1 
ATOM   609  C  CB  . LEU A 1 80  ? 53.228  29.216 110.587 1.00 53.12  ? 80   LEU A CB  1 
ATOM   610  C  CG  . LEU A 1 80  ? 53.258  28.595 109.180 1.00 52.36  ? 80   LEU A CG  1 
ATOM   611  C  CD1 . LEU A 1 80  ? 51.967  27.829 108.899 1.00 51.85  ? 80   LEU A CD1 1 
ATOM   612  C  CD2 . LEU A 1 80  ? 53.515  29.661 108.121 1.00 51.05  ? 80   LEU A CD2 1 
ATOM   613  N  N   . LYS A 1 81  ? 55.662  31.013 110.344 1.00 57.36  ? 81   LYS A N   1 
ATOM   614  C  CA  . LYS A 1 81  ? 56.641  31.719 109.526 1.00 65.25  ? 81   LYS A CA  1 
ATOM   615  C  C   . LYS A 1 81  ? 58.087  31.466 109.967 1.00 66.76  ? 81   LYS A C   1 
ATOM   616  O  O   . LYS A 1 81  ? 58.991  31.466 109.135 1.00 65.85  ? 81   LYS A O   1 
ATOM   617  C  CB  . LYS A 1 81  ? 56.323  33.225 109.467 1.00 65.95  ? 81   LYS A CB  1 
ATOM   618  C  CG  . LYS A 1 81  ? 55.363  33.578 108.348 1.00 70.99  ? 81   LYS A CG  1 
ATOM   619  C  CD  . LYS A 1 81  ? 55.739  32.831 107.065 1.00 76.25  ? 81   LYS A CD  1 
ATOM   620  C  CE  . LYS A 1 81  ? 54.930  33.271 105.850 1.00 82.43  ? 81   LYS A CE  1 
ATOM   621  N  NZ  . LYS A 1 81  ? 53.607  32.581 105.740 1.00 75.97  ? 81   LYS A NZ  1 
ATOM   622  N  N   . ALA A 1 82  ? 58.273  31.180 111.255 1.00 65.56  ? 82   ALA A N   1 
ATOM   623  C  CA  . ALA A 1 82  ? 59.587  31.120 111.865 1.00 66.82  ? 82   ALA A CA  1 
ATOM   624  C  C   . ALA A 1 82  ? 60.219  29.766 111.683 1.00 67.64  ? 82   ALA A C   1 
ATOM   625  O  O   . ALA A 1 82  ? 61.434  29.682 111.658 1.00 63.48  ? 82   ALA A O   1 
ATOM   626  C  CB  . ALA A 1 82  ? 59.503  31.472 113.352 1.00 66.12  ? 82   ALA A CB  1 
ATOM   627  N  N   . HIS A 1 83  ? 59.415  28.702 111.578 1.00 68.91  ? 83   HIS A N   1 
ATOM   628  C  CA  . HIS A 1 83  ? 59.974  27.384 111.279 1.00 65.40  ? 83   HIS A CA  1 
ATOM   629  C  C   . HIS A 1 83  ? 59.901  27.054 109.795 1.00 61.74  ? 83   HIS A C   1 
ATOM   630  O  O   . HIS A 1 83  ? 60.421  26.025 109.387 1.00 60.82  ? 83   HIS A O   1 
ATOM   631  C  CB  . HIS A 1 83  ? 59.297  26.290 112.082 1.00 70.39  ? 83   HIS A CB  1 
ATOM   632  C  CG  . HIS A 1 83  ? 59.439  26.451 113.562 1.00 81.05  ? 83   HIS A CG  1 
ATOM   633  N  ND1 . HIS A 1 83  ? 60.145  25.561 114.343 1.00 84.45  ? 83   HIS A ND1 1 
ATOM   634  C  CD2 . HIS A 1 83  ? 58.962  27.399 114.406 1.00 86.98  ? 83   HIS A CD2 1 
ATOM   635  C  CE1 . HIS A 1 83  ? 60.095  25.952 115.606 1.00 86.78  ? 83   HIS A CE1 1 
ATOM   636  N  NE2 . HIS A 1 83  ? 59.385  27.066 115.670 1.00 87.38  ? 83   HIS A NE2 1 
ATOM   637  N  N   . GLY A 1 84  ? 59.271  27.923 108.997 1.00 62.18  ? 84   GLY A N   1 
ATOM   638  C  CA  . GLY A 1 84  ? 59.154  27.728 107.534 1.00 61.40  ? 84   GLY A CA  1 
ATOM   639  C  C   . GLY A 1 84  ? 58.138  26.687 107.036 1.00 58.46  ? 84   GLY A C   1 
ATOM   640  O  O   . GLY A 1 84  ? 58.317  26.104 105.969 1.00 61.68  ? 84   GLY A O   1 
ATOM   641  N  N   . CYS A 1 85  ? 57.058  26.469 107.787 1.00 57.36  ? 85   CYS A N   1 
ATOM   642  C  CA  . CYS A 1 85  ? 56.085  25.383 107.490 1.00 48.51  ? 85   CYS A CA  1 
ATOM   643  C  C   . CYS A 1 85  ? 55.385  25.712 106.207 1.00 41.34  ? 85   CYS A C   1 
ATOM   644  O  O   . CYS A 1 85  ? 55.202  26.862 105.936 1.00 35.76  ? 85   CYS A O   1 
ATOM   645  C  CB  . CYS A 1 85  ? 55.054  25.280 108.616 1.00 54.91  ? 85   CYS A CB  1 
ATOM   646  S  SG  . CYS A 1 85  ? 55.740  25.681 110.244 1.00 64.71  ? 85   CYS A SG  1 
ATOM   647  N  N   . ARG A 1 86  ? 55.003  24.711 105.420 1.00 43.68  ? 86   ARG A N   1 
ATOM   648  C  CA  . ARG A 1 86  ? 54.326  24.925 104.126 1.00 41.42  ? 86   ARG A CA  1 
ATOM   649  C  C   . ARG A 1 86  ? 52.878  24.374 104.098 1.00 38.48  ? 86   ARG A C   1 
ATOM   650  O  O   . ARG A 1 86  ? 52.325  24.101 103.042 1.00 33.54  ? 86   ARG A O   1 
ATOM   651  C  CB  . ARG A 1 86  ? 55.183  24.267 103.025 1.00 45.73  ? 86   ARG A CB  1 
ATOM   652  C  CG  . ARG A 1 86  ? 56.426  25.111 102.654 1.00 51.99  ? 86   ARG A CG  1 
ATOM   653  C  CD  . ARG A 1 86  ? 57.708  24.307 102.804 1.00 60.09  ? 86   ARG A CD  1 
ATOM   654  N  NE  . ARG A 1 86  ? 57.826  23.243 101.806 1.00 68.01  ? 86   ARG A NE  1 
ATOM   655  C  CZ  . ARG A 1 86  ? 58.669  23.243 100.764 1.00 82.00  ? 86   ARG A CZ  1 
ATOM   656  N  NH1 . ARG A 1 86  ? 59.513  24.256 100.552 1.00 87.74  ? 86   ARG A NH1 1 
ATOM   657  N  NH2 . ARG A 1 86  ? 58.679  22.207 99.918  1.00 81.34  ? 86   ARG A NH2 1 
ATOM   658  N  N   . GLY A 1 87  ? 52.296  24.207 105.279 1.00 38.49  ? 87   GLY A N   1 
ATOM   659  C  CA  . GLY A 1 87  ? 50.979  23.625 105.450 1.00 35.43  ? 87   GLY A CA  1 
ATOM   660  C  C   . GLY A 1 87  ? 50.571  23.615 106.929 1.00 36.68  ? 87   GLY A C   1 
ATOM   661  O  O   . GLY A 1 87  ? 51.426  23.584 107.831 1.00 34.47  ? 87   GLY A O   1 
ATOM   662  N  N   . VAL A 1 88  ? 49.261  23.594 107.181 1.00 32.03  ? 88   VAL A N   1 
ATOM   663  C  CA  . VAL A 1 88  ? 48.701  23.576 108.546 1.00 30.37  ? 88   VAL A CA  1 
ATOM   664  C  C   . VAL A 1 88  ? 47.868  22.294 108.703 1.00 34.20  ? 88   VAL A C   1 
ATOM   665  O  O   . VAL A 1 88  ? 47.159  21.893 107.743 1.00 31.19  ? 88   VAL A O   1 
ATOM   666  C  CB  . VAL A 1 88  ? 47.746  24.753 108.729 1.00 33.29  ? 88   VAL A CB  1 
ATOM   667  C  CG1 . VAL A 1 88  ? 47.100  24.773 110.118 1.00 33.95  ? 88   VAL A CG1 1 
ATOM   668  C  CG2 . VAL A 1 88  ? 48.385  26.073 108.331 1.00 36.88  ? 88   VAL A CG2 1 
ATOM   669  N  N   . ILE A 1 89  ? 47.967  21.635 109.869 1.00 30.45  ? 89   ILE A N   1 
ATOM   670  C  CA  . ILE A 1 89  ? 47.083  20.547 110.227 1.00 26.98  ? 89   ILE A CA  1 
ATOM   671  C  C   . ILE A 1 89  ? 46.363  20.990 111.484 1.00 29.04  ? 89   ILE A C   1 
ATOM   672  O  O   . ILE A 1 89  ? 46.990  21.513 112.432 1.00 29.94  ? 89   ILE A O   1 
ATOM   673  C  CB  . ILE A 1 89  ? 47.809  19.238 110.430 1.00 30.96  ? 89   ILE A CB  1 
ATOM   674  C  CG1 . ILE A 1 89  ? 48.418  18.739 109.106 1.00 28.52  ? 89   ILE A CG1 1 
ATOM   675  C  CG2 . ILE A 1 89  ? 46.870  18.206 111.064 1.00 33.36  ? 89   ILE A CG2 1 
ATOM   676  C  CD1 . ILE A 1 89  ? 49.243  17.464 109.234 1.00 32.43  ? 89   ILE A CD1 1 
ATOM   677  N  N   . GLY A 1 90  ? 45.039  20.896 111.461 1.00 25.46  ? 90   GLY A N   1 
ATOM   678  C  CA  . GLY A 1 90  ? 44.198  21.178 112.638 1.00 25.90  ? 90   GLY A CA  1 
ATOM   679  C  C   . GLY A 1 90  ? 43.697  19.872 113.164 1.00 27.96  ? 90   GLY A C   1 
ATOM   680  O  O   . GLY A 1 90  ? 43.165  19.064 112.367 1.00 24.85  ? 90   GLY A O   1 
ATOM   681  N  N   . VAL A 1 91  ? 43.803  19.612 114.478 1.00 26.44  ? 91   VAL A N   1 
ATOM   682  C  CA  . VAL A 1 91  ? 43.319  18.336 114.983 1.00 25.20  ? 91   VAL A CA  1 
ATOM   683  C  C   . VAL A 1 91  ? 42.569  18.575 116.236 1.00 27.56  ? 91   VAL A C   1 
ATOM   684  O  O   . VAL A 1 91  ? 43.164  19.130 117.162 1.00 25.26  ? 91   VAL A O   1 
ATOM   685  C  CB  . VAL A 1 91  ? 44.416  17.371 115.407 1.00 31.09  ? 91   VAL A CB  1 
ATOM   686  C  CG1 . VAL A 1 91  ? 43.832  15.958 115.604 1.00 29.01  ? 91   VAL A CG1 1 
ATOM   687  C  CG2 . VAL A 1 91  ? 45.553  17.414 114.432 1.00 34.15  ? 91   VAL A CG2 1 
ATOM   688  N  N   . GLY A 1 92  ? 41.300  18.166 116.261 1.00 26.18  ? 92   GLY A N   1 
ATOM   689  C  CA  . GLY A 1 92  ? 40.458  18.206 117.440 1.00 27.04  ? 92   GLY A CA  1 
ATOM   690  C  C   . GLY A 1 92  ? 39.085  18.773 117.182 1.00 28.77  ? 92   GLY A C   1 
ATOM   691  O  O   . GLY A 1 92  ? 38.410  18.422 116.218 1.00 30.50  ? 92   GLY A O   1 
ATOM   692  N  N   . GLY A 1 93  ? 38.661  19.664 118.072 1.00 28.61  ? 93   GLY A N   1 
ATOM   693  C  CA  . GLY A 1 93  ? 37.306  20.130 118.073 1.00 26.63  ? 93   GLY A CA  1 
ATOM   694  C  C   . GLY A 1 93  ? 37.193  21.370 117.244 1.00 27.30  ? 93   GLY A C   1 
ATOM   695  O  O   . GLY A 1 93  ? 38.199  21.846 116.655 1.00 28.55  ? 93   GLY A O   1 
ATOM   696  N  N   . GLY A 1 94  ? 35.973  21.885 117.189 1.00 24.37  ? 94   GLY A N   1 
ATOM   697  C  CA  . GLY A 1 94  ? 35.610  23.010 116.320 1.00 28.16  ? 94   GLY A CA  1 
ATOM   698  C  C   . GLY A 1 94  ? 36.487  24.259 116.429 1.00 32.14  ? 94   GLY A C   1 
ATOM   699  O  O   . GLY A 1 94  ? 36.856  24.874 115.396 1.00 29.97  ? 94   GLY A O   1 
ATOM   700  N  N   . LYS A 1 95  ? 36.803  24.679 117.660 1.00 29.12  ? 95   LYS A N   1 
ATOM   701  C  CA  . LYS A 1 95  ? 37.630  25.860 117.800 1.00 35.04  ? 95   LYS A CA  1 
ATOM   702  C  C   . LYS A 1 95  ? 39.061  25.586 117.278 1.00 28.54  ? 95   LYS A C   1 
ATOM   703  O  O   . LYS A 1 95  ? 39.620  26.428 116.618 1.00 32.15  ? 95   LYS A O   1 
ATOM   704  C  CB  . LYS A 1 95  ? 37.628  26.395 119.216 1.00 40.70  ? 95   LYS A CB  1 
ATOM   705  C  CG  . LYS A 1 95  ? 36.229  26.802 119.684 1.00 45.65  ? 95   LYS A CG  1 
ATOM   706  C  CD  . LYS A 1 95  ? 36.319  27.414 121.085 1.00 53.73  ? 95   LYS A CD  1 
ATOM   707  C  CE  . LYS A 1 95  ? 34.970  27.552 121.751 1.00 54.93  ? 95   LYS A CE  1 
ATOM   708  N  NZ  . LYS A 1 95  ? 34.234  28.667 121.098 1.00 58.70  ? 95   LYS A NZ  1 
ATOM   709  N  N   . THR A 1 96  ? 39.580  24.396 117.459 1.00 26.60  ? 96   THR A N   1 
ATOM   710  C  CA  . THR A 1 96  ? 40.892  24.091 116.932 1.00 27.80  ? 96   THR A CA  1 
ATOM   711  C  C   . THR A 1 96  ? 40.793  24.142 115.406 1.00 31.41  ? 96   THR A C   1 
ATOM   712  O  O   . THR A 1 96  ? 41.597  24.799 114.756 1.00 28.86  ? 96   THR A O   1 
ATOM   713  C  CB  . THR A 1 96  ? 41.388  22.701 117.324 1.00 31.36  ? 96   THR A CB  1 
ATOM   714  O  OG1 . THR A 1 96  ? 41.510  22.553 118.747 1.00 35.35  ? 96   THR A OG1 1 
ATOM   715  C  CG2 . THR A 1 96  ? 42.762  22.394 116.654 1.00 32.02  ? 96   THR A CG2 1 
ATOM   716  N  N   . LEU A 1 97  ? 39.772  23.491 114.834 1.00 29.40  ? 97   LEU A N   1 
ATOM   717  C  CA  . LEU A 1 97  ? 39.637  23.469 113.349 1.00 28.98  ? 97   LEU A CA  1 
ATOM   718  C  C   . LEU A 1 97  ? 39.464  24.852 112.759 1.00 30.58  ? 97   LEU A C   1 
ATOM   719  O  O   . LEU A 1 97  ? 40.092  25.126 111.729 1.00 26.89  ? 97   LEU A O   1 
ATOM   720  C  CB  . LEU A 1 97  ? 38.484  22.606 112.861 1.00 25.10  ? 97   LEU A CB  1 
ATOM   721  C  CG  . LEU A 1 97  ? 38.463  21.188 113.392 1.00 27.31  ? 97   LEU A CG  1 
ATOM   722  C  CD1 . LEU A 1 97  ? 37.304  20.401 112.765 1.00 31.53  ? 97   LEU A CD1 1 
ATOM   723  C  CD2 . LEU A 1 97  ? 39.750  20.475 113.142 1.00 26.46  ? 97   LEU A CD2 1 
ATOM   724  N  N   . ASP A 1 98  ? 38.626  25.698 113.378 1.00 33.01  ? 98   ASP A N   1 
ATOM   725  C  CA  . ASP A 1 98  ? 38.390  27.052 112.878 1.00 35.08  ? 98   ASP A CA  1 
ATOM   726  C  C   . ASP A 1 98  ? 39.640  27.908 112.962 1.00 36.86  ? 98   ASP A C   1 
ATOM   727  O  O   . ASP A 1 98  ? 39.926  28.702 112.095 1.00 33.77  ? 98   ASP A O   1 
ATOM   728  C  CB  . ASP A 1 98  ? 37.242  27.731 113.598 1.00 42.20  ? 98   ASP A CB  1 
ATOM   729  C  CG  . ASP A 1 98  ? 35.856  27.223 113.117 1.00 48.57  ? 98   ASP A CG  1 
ATOM   730  O  OD1 . ASP A 1 98  ? 35.727  26.554 112.025 1.00 46.62  ? 98   ASP A OD1 1 
ATOM   731  O  OD2 . ASP A 1 98  ? 34.897  27.529 113.857 1.00 48.55  ? 98   ASP A OD2 1 
ATOM   732  N  N   . THR A 1 99  ? 40.421  27.686 113.983 1.00 33.09  ? 99   THR A N   1 
ATOM   733  C  CA  . THR A 1 99  ? 41.698  28.322 114.056 1.00 36.54  ? 99   THR A CA  1 
ATOM   734  C  C   . THR A 1 99  ? 42.634  27.879 112.942 1.00 34.97  ? 99   THR A C   1 
ATOM   735  O  O   . THR A 1 99  ? 43.299  28.740 112.334 1.00 34.52  ? 99   THR A O   1 
ATOM   736  C  CB  . THR A 1 99  ? 42.266  28.101 115.453 1.00 37.85  ? 99   THR A CB  1 
ATOM   737  O  OG1 . THR A 1 99  ? 41.410  28.800 116.357 1.00 34.12  ? 99   THR A OG1 1 
ATOM   738  C  CG2 . THR A 1 99  ? 43.691  28.584 115.565 1.00 40.67  ? 99   THR A CG2 1 
ATOM   739  N  N   . ALA A 1 100 ? 42.701  26.581 112.653 1.00 31.72  ? 100  ALA A N   1 
ATOM   740  C  CA  . ALA A 1 100 ? 43.604  26.118 111.595 1.00 30.51  ? 100  ALA A CA  1 
ATOM   741  C  C   . ALA A 1 100 ? 43.182  26.682 110.223 1.00 33.65  ? 100  ALA A C   1 
ATOM   742  O  O   . ALA A 1 100 ? 44.042  27.089 109.406 1.00 31.80  ? 100  ALA A O   1 
ATOM   743  C  CB  . ALA A 1 100 ? 43.700  24.631 111.565 1.00 28.07  ? 100  ALA A CB  1 
ATOM   744  N  N   . LYS A 1 101 ? 41.881  26.757 109.968 1.00 31.77  ? 101  LYS A N   1 
ATOM   745  C  CA  . LYS A 1 101 ? 41.407  27.381 108.693 1.00 32.46  ? 101  LYS A CA  1 
ATOM   746  C  C   . LYS A 1 101 ? 41.907  28.824 108.531 1.00 34.37  ? 101  LYS A C   1 
ATOM   747  O  O   . LYS A 1 101 ? 42.214  29.264 107.429 1.00 32.28  ? 101  LYS A O   1 
ATOM   748  C  CB  . LYS A 1 101 ? 39.872  27.405 108.586 1.00 31.73  ? 101  LYS A CB  1 
ATOM   749  C  CG  . LYS A 1 101 ? 39.248  26.041 108.324 1.00 32.16  ? 101  LYS A CG  1 
ATOM   750  C  CD  . LYS A 1 101 ? 37.756  26.175 108.100 1.00 30.23  ? 101  LYS A CD  1 
ATOM   751  C  CE  . LYS A 1 101 ? 37.049  24.875 108.389 1.00 31.76  ? 101  LYS A CE  1 
ATOM   752  N  NZ  . LYS A 1 101 ? 35.562  25.066 108.375 1.00 30.56  ? 101  LYS A NZ  1 
ATOM   753  N  N   . ALA A 1 102 ? 41.880  29.579 109.616 1.00 31.22  ? 102  ALA A N   1 
ATOM   754  C  CA  . ALA A 1 102 ? 42.254  30.973 109.585 1.00 36.51  ? 102  ALA A CA  1 
ATOM   755  C  C   . ALA A 1 102 ? 43.756  31.068 109.392 1.00 34.50  ? 102  ALA A C   1 
ATOM   756  O  O   . ALA A 1 102 ? 44.213  31.824 108.563 1.00 35.44  ? 102  ALA A O   1 
ATOM   757  C  CB  . ALA A 1 102 ? 41.827  31.672 110.870 1.00 36.20  ? 102  ALA A CB  1 
ATOM   758  N  N   . ILE A 1 103 ? 44.520  30.242 110.096 1.00 37.75  ? 103  ILE A N   1 
ATOM   759  C  CA  . ILE A 1 103 ? 45.974  30.297 109.979 1.00 39.00  ? 103  ILE A CA  1 
ATOM   760  C  C   . ILE A 1 103 ? 46.330  30.034 108.534 1.00 41.19  ? 103  ILE A C   1 
ATOM   761  O  O   . ILE A 1 103 ? 47.135  30.773 107.984 1.00 38.36  ? 103  ILE A O   1 
ATOM   762  C  CB  . ILE A 1 103 ? 46.727  29.279 110.853 1.00 42.30  ? 103  ILE A CB  1 
ATOM   763  C  CG1 . ILE A 1 103 ? 46.646  29.597 112.347 1.00 46.47  ? 103  ILE A CG1 1 
ATOM   764  C  CG2 . ILE A 1 103 ? 48.222  29.279 110.516 1.00 46.65  ? 103  ILE A CG2 1 
ATOM   765  C  CD1 . ILE A 1 103 ? 45.819  30.791 112.733 1.00 45.79  ? 103  ILE A CD1 1 
ATOM   766  N  N   . ALA A 1 104 ? 45.732  28.991 107.930 1.00 34.47  ? 104  ALA A N   1 
ATOM   767  C  CA  . ALA A 1 104 ? 46.039  28.626 106.560 1.00 34.77  ? 104  ALA A CA  1 
ATOM   768  C  C   . ALA A 1 104 ? 45.582  29.693 105.589 1.00 35.00  ? 104  ALA A C   1 
ATOM   769  O  O   . ALA A 1 104 ? 46.257  29.952 104.586 1.00 31.45  ? 104  ALA A O   1 
ATOM   770  C  CB  . ALA A 1 104 ? 45.432  27.273 106.184 1.00 34.12  ? 104  ALA A CB  1 
ATOM   771  N  N   . HIS A 1 105 ? 44.437  30.301 105.864 1.00 37.91  ? 105  HIS A N   1 
ATOM   772  C  CA  . HIS A 1 105 ? 43.981  31.408 105.050 1.00 39.78  ? 105  HIS A CA  1 
ATOM   773  C  C   . HIS A 1 105 ? 45.000  32.567 105.031 1.00 43.83  ? 105  HIS A C   1 
ATOM   774  O  O   . HIS A 1 105 ? 45.490  32.942 103.970 1.00 43.47  ? 105  HIS A O   1 
ATOM   775  C  CB  . HIS A 1 105 ? 42.662  31.918 105.554 1.00 38.35  ? 105  HIS A CB  1 
ATOM   776  C  CG  . HIS A 1 105 ? 42.207  33.167 104.888 1.00 42.85  ? 105  HIS A CG  1 
ATOM   777  N  ND1 . HIS A 1 105 ? 42.016  33.255 103.525 1.00 47.01  ? 105  HIS A ND1 1 
ATOM   778  C  CD2 . HIS A 1 105 ? 41.902  34.385 105.392 1.00 46.53  ? 105  HIS A CD2 1 
ATOM   779  C  CE1 . HIS A 1 105 ? 41.608  34.474 103.219 1.00 45.56  ? 105  HIS A CE1 1 
ATOM   780  N  NE2 . HIS A 1 105 ? 41.525  35.178 104.333 1.00 44.66  ? 105  HIS A NE2 1 
ATOM   781  N  N   . TYR A 1 106 ? 45.326  33.112 106.197 1.00 43.26  ? 106  TYR A N   1 
ATOM   782  C  CA  . TYR A 1 106 ? 46.233  34.272 106.265 1.00 46.69  ? 106  TYR A CA  1 
ATOM   783  C  C   . TYR A 1 106 ? 47.619  33.984 105.704 1.00 45.23  ? 106  TYR A C   1 
ATOM   784  O  O   . TYR A 1 106 ? 48.166  34.807 105.026 1.00 49.40  ? 106  TYR A O   1 
ATOM   785  C  CB  . TYR A 1 106 ? 46.317  34.829 107.688 1.00 45.48  ? 106  TYR A CB  1 
ATOM   786  C  CG  . TYR A 1 106 ? 45.030  35.499 108.026 1.00 50.49  ? 106  TYR A CG  1 
ATOM   787  C  CD1 . TYR A 1 106 ? 44.590  36.599 107.290 1.00 49.24  ? 106  TYR A CD1 1 
ATOM   788  C  CD2 . TYR A 1 106 ? 44.203  35.001 109.028 1.00 54.46  ? 106  TYR A CD2 1 
ATOM   789  C  CE1 . TYR A 1 106 ? 43.391  37.205 107.567 1.00 52.30  ? 106  TYR A CE1 1 
ATOM   790  C  CE2 . TYR A 1 106 ? 42.988  35.600 109.311 1.00 51.22  ? 106  TYR A CE2 1 
ATOM   791  C  CZ  . TYR A 1 106 ? 42.592  36.696 108.587 1.00 51.22  ? 106  TYR A CZ  1 
ATOM   792  O  OH  . TYR A 1 106 ? 41.394  37.285 108.869 1.00 56.51  ? 106  TYR A OH  1 
ATOM   793  N  N   . GLN A 1 107 ? 48.147  32.789 105.937 1.00 45.16  ? 107  GLN A N   1 
ATOM   794  C  CA  . GLN A 1 107 ? 49.435  32.394 105.386 1.00 43.24  ? 107  GLN A CA  1 
ATOM   795  C  C   . GLN A 1 107 ? 49.360  31.876 103.968 1.00 40.15  ? 107  GLN A C   1 
ATOM   796  O  O   . GLN A 1 107 ? 50.372  31.455 103.425 1.00 40.67  ? 107  GLN A O   1 
ATOM   797  C  CB  . GLN A 1 107 ? 50.077  31.327 106.278 1.00 47.35  ? 107  GLN A CB  1 
ATOM   798  C  CG  . GLN A 1 107 ? 50.204  31.745 107.745 1.00 48.17  ? 107  GLN A CG  1 
ATOM   799  C  CD  . GLN A 1 107 ? 50.849  33.126 107.889 1.00 54.04  ? 107  GLN A CD  1 
ATOM   800  O  OE1 . GLN A 1 107 ? 51.726  33.488 107.094 1.00 49.56  ? 107  GLN A OE1 1 
ATOM   801  N  NE2 . GLN A 1 107 ? 50.390  33.911 108.862 1.00 48.56  ? 107  GLN A NE2 1 
ATOM   802  N  N   . GLN A 1 108 ? 48.158  31.845 103.399 1.00 39.11  ? 108  GLN A N   1 
ATOM   803  C  CA  . GLN A 1 108 ? 47.898  31.236 102.096 1.00 37.86  ? 108  GLN A CA  1 
ATOM   804  C  C   . GLN A 1 108 ? 48.569  29.888 101.925 1.00 36.27  ? 108  GLN A C   1 
ATOM   805  O  O   . GLN A 1 108 ? 49.283  29.660 100.964 1.00 40.45  ? 108  GLN A O   1 
ATOM   806  C  CB  . GLN A 1 108 ? 48.308  32.206 100.995 1.00 42.67  ? 108  GLN A CB  1 
ATOM   807  C  CG  . GLN A 1 108 ? 47.451  33.456 100.981 1.00 49.17  ? 108  GLN A CG  1 
ATOM   808  C  CD  . GLN A 1 108 ? 47.907  34.506 99.972  1.00 58.17  ? 108  GLN A CD  1 
ATOM   809  O  OE1 . GLN A 1 108 ? 48.008  35.684 100.307 1.00 67.16  ? 108  GLN A OE1 1 
ATOM   810  N  NE2 . GLN A 1 108 ? 48.184  34.085 98.733  1.00 64.20  ? 108  GLN A NE2 1 
ATOM   811  N  N   . LEU A 1 109 ? 48.324  28.967 102.845 1.00 31.87  ? 109  LEU A N   1 
ATOM   812  C  CA  . LEU A 1 109 ? 48.839  27.610 102.703 1.00 32.44  ? 109  LEU A CA  1 
ATOM   813  C  C   . LEU A 1 109 ? 47.731  26.558 102.730 1.00 32.47  ? 109  LEU A C   1 
ATOM   814  O  O   . LEU A 1 109 ? 46.636  26.847 103.248 1.00 29.86  ? 109  LEU A O   1 
ATOM   815  C  CB  . LEU A 1 109 ? 49.756  27.345 103.886 1.00 37.68  ? 109  LEU A CB  1 
ATOM   816  C  CG  . LEU A 1 109 ? 50.994  28.258 103.922 1.00 39.28  ? 109  LEU A CG  1 
ATOM   817  C  CD1 . LEU A 1 109 ? 51.642  28.084 105.281 1.00 40.54  ? 109  LEU A CD1 1 
ATOM   818  C  CD2 . LEU A 1 109 ? 51.936  27.934 102.753 1.00 38.50  ? 109  LEU A CD2 1 
ATOM   819  N  N   . PRO A 1 110 ? 48.028  25.333 102.245 1.00 31.01  ? 110  PRO A N   1 
ATOM   820  C  CA  . PRO A 1 110 ? 47.072  24.244 102.281 1.00 31.06  ? 110  PRO A CA  1 
ATOM   821  C  C   . PRO A 1 110 ? 46.788  23.806 103.721 1.00 31.79  ? 110  PRO A C   1 
ATOM   822  O  O   . PRO A 1 110 ? 47.678  23.904 104.579 1.00 30.03  ? 110  PRO A O   1 
ATOM   823  C  CB  . PRO A 1 110 ? 47.781  23.113 101.548 1.00 31.25  ? 110  PRO A CB  1 
ATOM   824  C  CG  . PRO A 1 110 ? 49.258  23.475 101.658 1.00 32.44  ? 110  PRO A CG  1 
ATOM   825  C  CD  . PRO A 1 110 ? 49.266  24.942 101.531 1.00 32.87  ? 110  PRO A CD  1 
ATOM   826  N  N   . VAL A 1 111 ? 45.544  23.364 103.974 1.00 27.55  ? 111  VAL A N   1 
ATOM   827  C  CA  . VAL A 1 111 ? 45.101  22.907 105.312 1.00 24.81  ? 111  VAL A CA  1 
ATOM   828  C  C   . VAL A 1 111 ? 44.433  21.534 105.272 1.00 27.64  ? 111  VAL A C   1 
ATOM   829  O  O   . VAL A 1 111 ? 43.625  21.247 104.343 1.00 27.27  ? 111  VAL A O   1 
ATOM   830  C  CB  . VAL A 1 111 ? 44.206  23.984 105.943 1.00 26.52  ? 111  VAL A CB  1 
ATOM   831  C  CG1 . VAL A 1 111 ? 42.977  24.267 105.085 1.00 26.21  ? 111  VAL A CG1 1 
ATOM   832  C  CG2 . VAL A 1 111 ? 43.858  23.686 107.413 1.00 26.24  ? 111  VAL A CG2 1 
ATOM   833  N  N   . VAL A 1 112 ? 44.832  20.675 106.236 1.00 22.78  ? 112  VAL A N   1 
ATOM   834  C  CA  . VAL A 1 112 ? 44.270  19.339 106.458 1.00 26.61  ? 112  VAL A CA  1 
ATOM   835  C  C   . VAL A 1 112 ? 43.566  19.470 107.830 1.00 27.49  ? 112  VAL A C   1 
ATOM   836  O  O   . VAL A 1 112 ? 44.240  19.857 108.810 1.00 29.50  ? 112  VAL A O   1 
ATOM   837  C  CB  . VAL A 1 112 ? 45.366  18.278 106.503 1.00 26.04  ? 112  VAL A CB  1 
ATOM   838  C  CG1 . VAL A 1 112 ? 44.831  16.872 106.847 1.00 27.19  ? 112  VAL A CG1 1 
ATOM   839  C  CG2 . VAL A 1 112 ? 46.108  18.207 105.170 1.00 29.48  ? 112  VAL A CG2 1 
ATOM   840  N  N   . LEU A 1 113 ? 42.251  19.241 107.872 1.00 23.75  ? 113  LEU A N   1 
ATOM   841  C  CA  . LEU A 1 113 ? 41.468  19.192 109.130 1.00 22.45  ? 113  LEU A CA  1 
ATOM   842  C  C   . LEU A 1 113 ? 41.183  17.778 109.608 1.00 24.19  ? 113  LEU A C   1 
ATOM   843  O  O   . LEU A 1 113 ? 40.788  16.919 108.800 1.00 25.70  ? 113  LEU A O   1 
ATOM   844  C  CB  . LEU A 1 113 ? 40.207  19.971 108.939 1.00 23.57  ? 113  LEU A CB  1 
ATOM   845  C  CG  . LEU A 1 113 ? 40.389  21.401 108.548 1.00 23.98  ? 113  LEU A CG  1 
ATOM   846  C  CD1 . LEU A 1 113 ? 39.107  22.155 108.244 1.00 25.52  ? 113  LEU A CD1 1 
ATOM   847  C  CD2 . LEU A 1 113 ? 41.217  22.134 109.624 1.00 27.04  ? 113  LEU A CD2 1 
ATOM   848  N  N   . ILE A 1 114 ? 41.459  17.478 110.895 1.00 19.03  ? 114  ILE A N   1 
ATOM   849  C  CA  . ILE A 1 114 ? 41.239  16.166 111.451 1.00 19.99  ? 114  ILE A CA  1 
ATOM   850  C  C   . ILE A 1 114 ? 40.294  16.275 112.663 1.00 23.67  ? 114  ILE A C   1 
ATOM   851  O  O   . ILE A 1 114 ? 40.770  16.391 113.818 1.00 22.32  ? 114  ILE A O   1 
ATOM   852  C  CB  . ILE A 1 114 ? 42.566  15.510 111.825 1.00 21.20  ? 114  ILE A CB  1 
ATOM   853  C  CG1 . ILE A 1 114 ? 43.570  15.709 110.660 1.00 20.58  ? 114  ILE A CG1 1 
ATOM   854  C  CG2 . ILE A 1 114 ? 42.370  14.053 112.241 1.00 21.19  ? 114  ILE A CG2 1 
ATOM   855  C  CD1 . ILE A 1 114 ? 44.860  14.954 110.856 1.00 22.33  ? 114  ILE A CD1 1 
ATOM   856  N  N   . PRO A 1 115 ? 38.977  16.276 112.411 1.00 23.19  ? 115  PRO A N   1 
ATOM   857  C  CA  . PRO A 1 115 ? 38.029  16.362 113.536 1.00 25.18  ? 115  PRO A CA  1 
ATOM   858  C  C   . PRO A 1 115 ? 38.066  15.114 114.381 1.00 23.38  ? 115  PRO A C   1 
ATOM   859  O  O   . PRO A 1 115 ? 38.033  13.992 113.847 1.00 25.19  ? 115  PRO A O   1 
ATOM   860  C  CB  . PRO A 1 115 ? 36.641  16.516 112.854 1.00 25.34  ? 115  PRO A CB  1 
ATOM   861  C  CG  . PRO A 1 115 ? 36.975  16.918 111.417 1.00 24.20  ? 115  PRO A CG  1 
ATOM   862  C  CD  . PRO A 1 115 ? 38.298  16.303 111.105 1.00 22.37  ? 115  PRO A CD  1 
ATOM   863  N  N   . THR A 1 116 ? 38.122  15.287 115.705 1.00 22.29  ? 116  THR A N   1 
ATOM   864  C  CA  . THR A 1 116 ? 38.162  14.118 116.610 1.00 22.60  ? 116  THR A CA  1 
ATOM   865  C  C   . THR A 1 116 ? 36.765  13.817 117.183 1.00 23.67  ? 116  THR A C   1 
ATOM   866  O  O   . THR A 1 116 ? 36.576  12.810 117.902 1.00 26.35  ? 116  THR A O   1 
ATOM   867  C  CB  . THR A 1 116 ? 39.150  14.350 117.778 1.00 23.95  ? 116  THR A CB  1 
ATOM   868  O  OG1 . THR A 1 116 ? 38.863  15.619 118.373 1.00 22.43  ? 116  THR A OG1 1 
ATOM   869  C  CG2 . THR A 1 116 ? 40.591  14.353 117.235 1.00 26.46  ? 116  THR A CG2 1 
ATOM   870  N  N   . ILE A 1 117 ? 35.816  14.661 116.815 1.00 25.03  ? 117  ILE A N   1 
ATOM   871  C  CA  . ILE A 1 117 ? 34.341  14.527 117.098 1.00 26.39  ? 117  ILE A CA  1 
ATOM   872  C  C   . ILE A 1 117 ? 33.535  14.835 115.835 1.00 28.32  ? 117  ILE A C   1 
ATOM   873  O  O   . ILE A 1 117 ? 34.046  15.536 114.943 1.00 23.68  ? 117  ILE A O   1 
ATOM   874  C  CB  . ILE A 1 117 ? 33.884  15.507 118.182 1.00 26.80  ? 117  ILE A CB  1 
ATOM   875  C  CG1 . ILE A 1 117 ? 34.264  16.914 117.790 1.00 31.51  ? 117  ILE A CG1 1 
ATOM   876  C  CG2 . ILE A 1 117 ? 34.599  15.167 119.513 1.00 29.32  ? 117  ILE A CG2 1 
ATOM   877  C  CD1 . ILE A 1 117 ? 33.772  17.994 118.749 1.00 36.22  ? 117  ILE A CD1 1 
ATOM   878  N  N   . ALA A 1 118 ? 32.327  14.262 115.738 1.00 27.81  ? 118  ALA A N   1 
ATOM   879  C  CA  . ALA A 1 118 ? 31.435  14.522 114.594 1.00 27.13  ? 118  ALA A CA  1 
ATOM   880  C  C   . ALA A 1 118 ? 30.175  15.197 115.077 1.00 23.51  ? 118  ALA A C   1 
ATOM   881  O  O   . ALA A 1 118 ? 29.072  14.678 114.877 1.00 24.89  ? 118  ALA A O   1 
ATOM   882  C  CB  . ALA A 1 118 ? 31.126  13.235 113.862 1.00 29.73  ? 118  ALA A CB  1 
ATOM   883  N  N   . SER A 1 119 ? 30.328  16.347 115.741 1.00 21.12  ? 119  SER A N   1 
ATOM   884  C  CA  . SER A 1 119 ? 29.201  17.036 116.365 1.00 21.43  ? 119  SER A CA  1 
ATOM   885  C  C   . SER A 1 119 ? 28.641  18.241 115.621 1.00 23.21  ? 119  SER A C   1 
ATOM   886  O  O   . SER A 1 119 ? 27.620  18.832 116.044 1.00 20.97  ? 119  SER A O   1 
ATOM   887  C  CB  . SER A 1 119 ? 29.604  17.510 117.747 1.00 25.25  ? 119  SER A CB  1 
ATOM   888  O  OG  . SER A 1 119 ? 30.713  18.385 117.637 1.00 30.48  ? 119  SER A OG  1 
ATOM   889  N  N   . THR A 1 120 ? 29.296  18.649 114.528 1.00 25.68  ? 120  THR A N   1 
ATOM   890  C  CA  . THR A 1 120 ? 28.742  19.715 113.660 1.00 25.86  ? 120  THR A CA  1 
ATOM   891  C  C   . THR A 1 120 ? 29.205  19.446 112.190 1.00 23.47  ? 120  THR A C   1 
ATOM   892  O  O   . THR A 1 120 ? 30.092  18.626 111.955 1.00 24.94  ? 120  THR A O   1 
ATOM   893  C  CB  . THR A 1 120 ? 29.190  21.176 113.967 1.00 27.93  ? 120  THR A CB  1 
ATOM   894  O  OG1 . THR A 1 120 ? 30.518  21.364 113.463 1.00 28.91  ? 120  THR A OG1 1 
ATOM   895  C  CG2 . THR A 1 120 ? 29.069  21.582 115.544 1.00 30.73  ? 120  THR A CG2 1 
ATOM   896  N  N   . ASP A 1 121 ? 28.540  20.110 111.253 1.00 25.18  ? 121  ASP A N   1 
ATOM   897  C  CA  . ASP A 1 121 ? 28.949  20.055 109.822 1.00 28.63  ? 121  ASP A CA  1 
ATOM   898  C  C   . ASP A 1 121 ? 29.895  21.180 109.353 1.00 29.91  ? 121  ASP A C   1 
ATOM   899  O  O   . ASP A 1 121 ? 30.084  21.355 108.132 1.00 30.04  ? 121  ASP A O   1 
ATOM   900  C  CB  . ASP A 1 121 ? 27.728  19.991 108.902 1.00 28.09  ? 121  ASP A CB  1 
ATOM   901  C  CG  . ASP A 1 121 ? 26.814  21.151 109.065 1.00 28.25  ? 121  ASP A CG  1 
ATOM   902  O  OD1 . ASP A 1 121 ? 27.222  22.149 109.731 1.00 29.30  ? 121  ASP A OD1 1 
ATOM   903  O  OD2 . ASP A 1 121 ? 25.650  21.073 108.594 1.00 34.52  ? 121  ASP A OD2 1 
ATOM   904  N  N   . ALA A 1 122 ? 30.475  21.914 110.306 1.00 28.81  ? 122  ALA A N   1 
ATOM   905  C  CA  . ALA A 1 122 ? 31.505  22.932 110.048 1.00 32.66  ? 122  ALA A CA  1 
ATOM   906  C  C   . ALA A 1 122 ? 32.764  22.502 109.247 1.00 30.19  ? 122  ALA A C   1 
ATOM   907  O  O   . ALA A 1 122 ? 33.210  23.278 108.404 1.00 28.32  ? 122  ALA A O   1 
ATOM   908  C  CB  . ALA A 1 122 ? 31.971  23.564 111.383 1.00 29.90  ? 122  ALA A CB  1 
ATOM   909  N  N   . PRO A 1 123 ? 33.358  21.319 109.541 1.00 28.48  ? 123  PRO A N   1 
ATOM   910  C  CA  . PRO A 1 123 ? 34.714  20.992 109.054 1.00 26.55  ? 123  PRO A CA  1 
ATOM   911  C  C   . PRO A 1 123 ? 34.968  21.191 107.531 1.00 29.24  ? 123  PRO A C   1 
ATOM   912  O  O   . PRO A 1 123 ? 36.043  21.685 107.149 1.00 26.15  ? 123  PRO A O   1 
ATOM   913  C  CB  . PRO A 1 123 ? 34.875  19.517 109.416 1.00 28.62  ? 123  PRO A CB  1 
ATOM   914  C  CG  . PRO A 1 123 ? 34.000  19.360 110.634 1.00 27.05  ? 123  PRO A CG  1 
ATOM   915  C  CD  . PRO A 1 123 ? 32.798  20.203 110.329 1.00 27.55  ? 123  PRO A CD  1 
ATOM   916  N  N   . THR A 1 124 ? 34.011  20.808 106.685 1.00 25.82  ? 124  THR A N   1 
ATOM   917  C  CA  . THR A 1 124 ? 34.248  20.878 105.233 1.00 27.05  ? 124  THR A CA  1 
ATOM   918  C  C   . THR A 1 124 ? 34.049  22.260 104.638 1.00 24.85  ? 124  THR A C   1 
ATOM   919  O  O   . THR A 1 124 ? 34.385  22.474 103.466 1.00 25.97  ? 124  THR A O   1 
ATOM   920  C  CB  . THR A 1 124 ? 33.323  19.898 104.461 1.00 24.96  ? 124  THR A CB  1 
ATOM   921  O  OG1 . THR A 1 124 ? 31.943  20.225 104.702 1.00 25.91  ? 124  THR A OG1 1 
ATOM   922  C  CG2 . THR A 1 124 ? 33.624  18.471 104.874 1.00 26.40  ? 124  THR A CG2 1 
ATOM   923  N  N   . SER A 1 125 ? 33.478  23.180 105.406 1.00 22.19  ? 125  SER A N   1 
ATOM   924  C  CA  . SER A 1 125 ? 33.013  24.394 104.871 1.00 23.29  ? 125  SER A CA  1 
ATOM   925  C  C   . SER A 1 125 ? 34.115  25.496 104.878 1.00 23.20  ? 125  SER A C   1 
ATOM   926  O  O   . SER A 1 125 ? 35.088  25.432 105.642 1.00 24.51  ? 125  SER A O   1 
ATOM   927  C  CB  . SER A 1 125 ? 31.834  24.871 105.687 1.00 26.03  ? 125  SER A CB  1 
ATOM   928  O  OG  . SER A 1 125 ? 32.285  25.339 106.947 1.00 26.55  ? 125  SER A OG  1 
ATOM   929  N  N   . ALA A 1 126 ? 33.938  26.461 103.993 1.00 25.19  ? 126  ALA A N   1 
ATOM   930  C  CA  . ALA A 1 126 ? 34.817  27.627 103.840 1.00 30.37  ? 126  ALA A CA  1 
ATOM   931  C  C   . ALA A 1 126 ? 34.357  28.697 104.842 1.00 34.04  ? 126  ALA A C   1 
ATOM   932  O  O   . ALA A 1 126 ? 34.184  29.832 104.480 1.00 37.62  ? 126  ALA A O   1 
ATOM   933  C  CB  . ALA A 1 126 ? 34.669  28.173 102.410 1.00 28.98  ? 126  ALA A CB  1 
ATOM   934  N  N   . LEU A 1 127 ? 34.108  28.305 106.085 1.00 41.10  ? 127  LEU A N   1 
ATOM   935  C  CA  . LEU A 1 127 ? 33.330  29.105 107.042 1.00 42.91  ? 127  LEU A CA  1 
ATOM   936  C  C   . LEU A 1 127 ? 33.787  28.919 108.481 1.00 50.32  ? 127  LEU A C   1 
ATOM   937  O  O   . LEU A 1 127 ? 34.356  27.872 108.848 1.00 49.20  ? 127  LEU A O   1 
ATOM   938  C  CB  . LEU A 1 127 ? 31.862  28.744 106.978 1.00 46.97  ? 127  LEU A CB  1 
ATOM   939  C  CG  . LEU A 1 127 ? 30.965  29.482 107.994 1.00 50.60  ? 127  LEU A CG  1 
ATOM   940  C  CD1 . LEU A 1 127 ? 30.576  30.866 107.498 1.00 51.81  ? 127  LEU A CD1 1 
ATOM   941  C  CD2 . LEU A 1 127 ? 29.715  28.734 108.383 1.00 47.67  ? 127  LEU A CD2 1 
ATOM   942  N  N   . SER A 1 128 ? 33.548  29.969 109.273 1.00 51.19  ? 128  SER A N   1 
ATOM   943  C  CA  . SER A 1 128 ? 33.657  29.954 110.741 1.00 56.35  ? 128  SER A CA  1 
ATOM   944  C  C   . SER A 1 128 ? 32.501  30.773 111.308 1.00 54.08  ? 128  SER A C   1 
ATOM   945  O  O   . SER A 1 128 ? 32.093  31.794 110.713 1.00 55.55  ? 128  SER A O   1 
ATOM   946  C  CB  . SER A 1 128 ? 34.974  30.556 111.195 1.00 49.86  ? 128  SER A CB  1 
ATOM   947  O  OG  . SER A 1 128 ? 36.035  29.828 110.589 1.00 58.55  ? 128  SER A OG  1 
ATOM   948  N  N   . VAL A 1 129 ? 31.944  30.324 112.430 1.00 49.73  ? 129  VAL A N   1 
ATOM   949  C  CA  . VAL A 1 129 ? 30.875  31.088 113.079 1.00 47.44  ? 129  VAL A CA  1 
ATOM   950  C  C   . VAL A 1 129 ? 31.457  31.848 114.260 1.00 46.96  ? 129  VAL A C   1 
ATOM   951  O  O   . VAL A 1 129 ? 32.006  31.251 115.170 1.00 42.16  ? 129  VAL A O   1 
ATOM   952  C  CB  . VAL A 1 129 ? 29.688  30.205 113.532 1.00 55.44  ? 129  VAL A CB  1 
ATOM   953  C  CG1 . VAL A 1 129 ? 28.501  31.081 114.005 1.00 51.74  ? 129  VAL A CG1 1 
ATOM   954  C  CG2 . VAL A 1 129 ? 29.259  29.262 112.400 1.00 56.80  ? 129  VAL A CG2 1 
ATOM   955  N  N   . ILE A 1 130 ? 31.353  33.172 114.211 1.00 50.69  ? 130  ILE A N   1 
ATOM   956  C  CA  . ILE A 1 130 ? 31.846  34.031 115.289 1.00 55.74  ? 130  ILE A CA  1 
ATOM   957  C  C   . ILE A 1 130 ? 30.691  34.362 116.229 1.00 50.76  ? 130  ILE A C   1 
ATOM   958  O  O   . ILE A 1 130 ? 29.590  34.727 115.812 1.00 39.29  ? 130  ILE A O   1 
ATOM   959  C  CB  . ILE A 1 130 ? 32.537  35.305 114.756 1.00 60.01  ? 130  ILE A CB  1 
ATOM   960  C  CG1 . ILE A 1 130 ? 33.735  34.884 113.901 1.00 57.86  ? 130  ILE A CG1 1 
ATOM   961  C  CG2 . ILE A 1 130 ? 32.974  36.247 115.899 1.00 60.79  ? 130  ILE A CG2 1 
ATOM   962  C  CD1 . ILE A 1 130 ? 33.769  35.597 112.593 1.00 58.15  ? 130  ILE A CD1 1 
ATOM   963  N  N   . TYR A 1 131 ? 30.971  34.162 117.504 1.00 51.61  ? 131  TYR A N   1 
ATOM   964  C  CA  . TYR A 1 131 ? 30.090  34.547 118.561 1.00 53.98  ? 131  TYR A CA  1 
ATOM   965  C  C   . TYR A 1 131 ? 30.721  35.761 119.285 1.00 56.04  ? 131  TYR A C   1 
ATOM   966  O  O   . TYR A 1 131 ? 31.774  36.266 118.897 1.00 60.57  ? 131  TYR A O   1 
ATOM   967  C  CB  . TYR A 1 131 ? 29.876  33.334 119.475 1.00 54.17  ? 131  TYR A CB  1 
ATOM   968  C  CG  . TYR A 1 131 ? 29.140  32.173 118.803 1.00 54.58  ? 131  TYR A CG  1 
ATOM   969  C  CD1 . TYR A 1 131 ? 27.752  32.183 118.684 1.00 52.89  ? 131  TYR A CD1 1 
ATOM   970  C  CD2 . TYR A 1 131 ? 29.830  31.056 118.300 1.00 54.80  ? 131  TYR A CD2 1 
ATOM   971  C  CE1 . TYR A 1 131 ? 27.063  31.136 118.072 1.00 53.57  ? 131  TYR A CE1 1 
ATOM   972  C  CE2 . TYR A 1 131 ? 29.141  30.001 117.691 1.00 53.66  ? 131  TYR A CE2 1 
ATOM   973  C  CZ  . TYR A 1 131 ? 27.757  30.055 117.580 1.00 47.87  ? 131  TYR A CZ  1 
ATOM   974  O  OH  . TYR A 1 131 ? 27.064  29.022 116.984 1.00 56.72  ? 131  TYR A OH  1 
ATOM   975  N  N   . THR A 1 132 ? 30.012  36.274 120.273 1.00 57.19  ? 132  THR A N   1 
ATOM   976  C  CA  . THR A 1 132 ? 30.527  37.275 121.184 1.00 56.85  ? 132  THR A CA  1 
ATOM   977  C  C   . THR A 1 132 ? 31.203  36.468 122.303 1.00 60.98  ? 132  THR A C   1 
ATOM   978  O  O   . THR A 1 132 ? 31.244  35.240 122.240 1.00 65.53  ? 132  THR A O   1 
ATOM   979  C  CB  . THR A 1 132 ? 29.396  38.196 121.724 1.00 55.92  ? 132  THR A CB  1 
ATOM   980  O  OG1 . THR A 1 132 ? 28.464  37.440 122.543 1.00 54.13  ? 132  THR A OG1 1 
ATOM   981  C  CG2 . THR A 1 132 ? 28.666  38.977 120.549 1.00 47.98  ? 132  THR A CG2 1 
ATOM   982  N  N   . GLU A 1 133 ? 31.749  37.129 123.314 1.00 61.78  ? 133  GLU A N   1 
ATOM   983  C  CA  . GLU A 1 133 ? 32.289  36.389 124.443 1.00 68.51  ? 133  GLU A CA  1 
ATOM   984  C  C   . GLU A 1 133 ? 31.135  35.919 125.330 1.00 64.25  ? 133  GLU A C   1 
ATOM   985  O  O   . GLU A 1 133 ? 31.238  34.889 125.991 1.00 58.39  ? 133  GLU A O   1 
ATOM   986  C  CB  . GLU A 1 133 ? 33.298  37.224 125.243 1.00 75.05  ? 133  GLU A CB  1 
ATOM   987  C  CG  . GLU A 1 133 ? 34.228  36.380 126.125 1.00 74.40  ? 133  GLU A CG  1 
ATOM   988  C  CD  . GLU A 1 133 ? 35.347  37.210 126.718 1.00 73.29  ? 133  GLU A CD  1 
ATOM   989  O  OE1 . GLU A 1 133 ? 36.308  37.515 125.987 1.00 66.45  ? 133  GLU A OE1 1 
ATOM   990  O  OE2 . GLU A 1 133 ? 35.250  37.580 127.906 1.00 74.88  ? 133  GLU A OE2 1 
ATOM   991  N  N   . GLN A 1 134 ? 30.025  36.660 125.324 1.00 65.98  ? 134  GLN A N   1 
ATOM   992  C  CA  . GLN A 1 134 ? 28.821  36.242 126.058 1.00 71.31  ? 134  GLN A CA  1 
ATOM   993  C  C   . GLN A 1 134 ? 28.044  35.072 125.395 1.00 67.85  ? 134  GLN A C   1 
ATOM   994  O  O   . GLN A 1 134 ? 27.022  34.643 125.924 1.00 67.66  ? 134  GLN A O   1 
ATOM   995  C  CB  . GLN A 1 134 ? 27.907  37.456 126.307 1.00 76.62  ? 134  GLN A CB  1 
ATOM   996  C  CG  . GLN A 1 134 ? 28.557  38.532 127.168 1.00 80.35  ? 134  GLN A CG  1 
ATOM   997  C  CD  . GLN A 1 134 ? 29.077  37.984 128.497 1.00 86.38  ? 134  GLN A CD  1 
ATOM   998  O  OE1 . GLN A 1 134 ? 30.285  37.815 128.679 1.00 94.95  ? 134  GLN A OE1 1 
ATOM   999  N  NE2 . GLN A 1 134 ? 28.166  37.689 129.422 1.00 84.39  ? 134  GLN A NE2 1 
ATOM   1000 N  N   . GLY A 1 135 ? 28.545  34.556 124.263 1.00 62.65  ? 135  GLY A N   1 
ATOM   1001 C  CA  . GLY A 1 135 ? 28.003  33.359 123.593 1.00 58.76  ? 135  GLY A CA  1 
ATOM   1002 C  C   . GLY A 1 135 ? 26.943  33.633 122.524 1.00 56.94  ? 135  GLY A C   1 
ATOM   1003 O  O   . GLY A 1 135 ? 26.300  32.706 122.017 1.00 57.12  ? 135  GLY A O   1 
ATOM   1004 N  N   . GLU A 1 136 ? 26.798  34.902 122.151 1.00 50.02  ? 136  GLU A N   1 
ATOM   1005 C  CA  . GLU A 1 136 ? 25.729  35.364 121.290 1.00 48.86  ? 136  GLU A CA  1 
ATOM   1006 C  C   . GLU A 1 136 ? 26.212  35.435 119.826 1.00 51.26  ? 136  GLU A C   1 
ATOM   1007 O  O   . GLU A 1 136 ? 27.250  36.048 119.546 1.00 50.36  ? 136  GLU A O   1 
ATOM   1008 C  CB  . GLU A 1 136 ? 25.284  36.725 121.806 1.00 48.56  ? 136  GLU A CB  1 
ATOM   1009 C  CG  . GLU A 1 136 ? 24.205  37.403 121.005 1.00 57.82  ? 136  GLU A CG  1 
ATOM   1010 C  CD  . GLU A 1 136 ? 23.954  38.838 121.458 1.00 65.76  ? 136  GLU A CD  1 
ATOM   1011 O  OE1 . GLU A 1 136 ? 24.683  39.336 122.366 1.00 73.16  ? 136  GLU A OE1 1 
ATOM   1012 O  OE2 . GLU A 1 136 ? 23.027  39.474 120.887 1.00 62.85  ? 136  GLU A OE2 1 
ATOM   1013 N  N   . PHE A 1 137 ? 25.468  34.823 118.894 1.00 46.91  ? 137  PHE A N   1 
ATOM   1014 C  CA  . PHE A 1 137 ? 25.870  34.782 117.478 1.00 43.52  ? 137  PHE A CA  1 
ATOM   1015 C  C   . PHE A 1 137 ? 26.314  36.169 117.016 1.00 45.08  ? 137  PHE A C   1 
ATOM   1016 O  O   . PHE A 1 137 ? 25.610  37.140 117.243 1.00 43.19  ? 137  PHE A O   1 
ATOM   1017 C  CB  . PHE A 1 137 ? 24.731  34.295 116.581 1.00 43.67  ? 137  PHE A CB  1 
ATOM   1018 C  CG  . PHE A 1 137 ? 25.023  34.406 115.111 1.00 42.48  ? 137  PHE A CG  1 
ATOM   1019 C  CD1 . PHE A 1 137 ? 25.910  33.508 114.494 1.00 43.71  ? 137  PHE A CD1 1 
ATOM   1020 C  CD2 . PHE A 1 137 ? 24.410  35.397 114.330 1.00 46.34  ? 137  PHE A CD2 1 
ATOM   1021 C  CE1 . PHE A 1 137 ? 26.185  33.615 113.125 1.00 46.59  ? 137  PHE A CE1 1 
ATOM   1022 C  CE2 . PHE A 1 137 ? 24.672  35.502 112.959 1.00 44.89  ? 137  PHE A CE2 1 
ATOM   1023 C  CZ  . PHE A 1 137 ? 25.542  34.601 112.354 1.00 41.73  ? 137  PHE A CZ  1 
ATOM   1024 N  N   . ALA A 1 138 ? 27.472  36.235 116.369 1.00 46.78  ? 138  ALA A N   1 
ATOM   1025 C  CA  . ALA A 1 138 ? 28.002  37.494 115.849 1.00 55.72  ? 138  ALA A CA  1 
ATOM   1026 C  C   . ALA A 1 138 ? 27.869  37.559 114.313 1.00 53.83  ? 138  ALA A C   1 
ATOM   1027 O  O   . ALA A 1 138 ? 27.154  38.398 113.774 1.00 52.71  ? 138  ALA A O   1 
ATOM   1028 C  CB  . ALA A 1 138 ? 29.454  37.671 116.285 1.00 55.62  ? 138  ALA A CB  1 
ATOM   1029 N  N   . GLU A 1 139 ? 28.549  36.658 113.626 1.00 49.24  ? 139  GLU A N   1 
ATOM   1030 C  CA  . GLU A 1 139 ? 28.605  36.702 112.160 1.00 52.68  ? 139  GLU A CA  1 
ATOM   1031 C  C   . GLU A 1 139 ? 29.031  35.334 111.607 1.00 45.36  ? 139  GLU A C   1 
ATOM   1032 O  O   . GLU A 1 139 ? 29.716  34.542 112.273 1.00 46.57  ? 139  GLU A O   1 
ATOM   1033 C  CB  . GLU A 1 139 ? 29.605  37.809 111.664 1.00 57.00  ? 139  GLU A CB  1 
ATOM   1034 C  CG  . GLU A 1 139 ? 31.090  37.389 111.749 1.00 65.97  ? 139  GLU A CG  1 
ATOM   1035 C  CD  . GLU A 1 139 ? 32.093  38.554 111.884 1.00 73.03  ? 139  GLU A CD  1 
ATOM   1036 O  OE1 . GLU A 1 139 ? 32.053  39.482 111.050 1.00 70.62  ? 139  GLU A OE1 1 
ATOM   1037 O  OE2 . GLU A 1 139 ? 32.945  38.530 112.809 1.00 68.63  ? 139  GLU A OE2 1 
ATOM   1038 N  N   . TYR A 1 140 ? 28.622  35.068 110.383 1.00 39.89  ? 140  TYR A N   1 
ATOM   1039 C  CA  . TYR A 1 140 ? 29.271  34.032 109.590 1.00 45.61  ? 140  TYR A CA  1 
ATOM   1040 C  C   . TYR A 1 140 ? 30.541  34.700 109.056 1.00 46.45  ? 140  TYR A C   1 
ATOM   1041 O  O   . TYR A 1 140 ? 30.441  35.751 108.438 1.00 53.21  ? 140  TYR A O   1 
ATOM   1042 C  CB  . TYR A 1 140 ? 28.318  33.519 108.444 1.00 41.75  ? 140  TYR A CB  1 
ATOM   1043 C  CG  . TYR A 1 140 ? 27.116  32.732 108.993 1.00 40.95  ? 140  TYR A CG  1 
ATOM   1044 C  CD1 . TYR A 1 140 ? 27.309  31.601 109.785 1.00 40.49  ? 140  TYR A CD1 1 
ATOM   1045 C  CD2 . TYR A 1 140 ? 25.796  33.130 108.731 1.00 39.35  ? 140  TYR A CD2 1 
ATOM   1046 C  CE1 . TYR A 1 140 ? 26.226  30.891 110.325 1.00 39.72  ? 140  TYR A CE1 1 
ATOM   1047 C  CE2 . TYR A 1 140 ? 24.710  32.413 109.240 1.00 37.10  ? 140  TYR A CE2 1 
ATOM   1048 C  CZ  . TYR A 1 140 ? 24.938  31.293 110.055 1.00 36.24  ? 140  TYR A CZ  1 
ATOM   1049 O  OH  . TYR A 1 140 ? 23.892  30.586 110.593 1.00 29.22  ? 140  TYR A OH  1 
ATOM   1050 N  N   . LEU A 1 141 ? 31.725  34.165 109.348 1.00 47.19  ? 141  LEU A N   1 
ATOM   1051 C  CA  . LEU A 1 141 ? 32.941  34.556 108.610 1.00 45.60  ? 141  LEU A CA  1 
ATOM   1052 C  C   . LEU A 1 141 ? 33.295  33.534 107.462 1.00 45.99  ? 141  LEU A C   1 
ATOM   1053 O  O   . LEU A 1 141 ? 33.562  32.361 107.722 1.00 46.48  ? 141  LEU A O   1 
ATOM   1054 C  CB  . LEU A 1 141 ? 34.122  34.764 109.548 1.00 44.47  ? 141  LEU A CB  1 
ATOM   1055 C  CG  . LEU A 1 141 ? 35.501  34.910 108.859 1.00 49.78  ? 141  LEU A CG  1 
ATOM   1056 C  CD1 . LEU A 1 141 ? 35.553  36.217 108.081 1.00 55.10  ? 141  LEU A CD1 1 
ATOM   1057 C  CD2 . LEU A 1 141 ? 36.693  34.847 109.827 1.00 50.33  ? 141  LEU A CD2 1 
ATOM   1058 N  N   . ILE A 1 142 ? 33.345  34.028 106.218 1.00 45.18  ? 142  ILE A N   1 
ATOM   1059 C  CA  . ILE A 1 142 ? 33.489  33.215 104.991 1.00 43.07  ? 142  ILE A CA  1 
ATOM   1060 C  C   . ILE A 1 142 ? 34.866  33.305 104.338 1.00 42.29  ? 142  ILE A C   1 
ATOM   1061 O  O   . ILE A 1 142 ? 35.274  34.369 103.930 1.00 45.08  ? 142  ILE A O   1 
ATOM   1062 C  CB  . ILE A 1 142 ? 32.432  33.675 103.975 1.00 43.24  ? 142  ILE A CB  1 
ATOM   1063 C  CG1 . ILE A 1 142 ? 31.030  33.394 104.567 1.00 48.62  ? 142  ILE A CG1 1 
ATOM   1064 C  CG2 . ILE A 1 142 ? 32.604  32.975 102.632 1.00 41.74  ? 142  ILE A CG2 1 
ATOM   1065 C  CD1 . ILE A 1 142 ? 29.852  33.842 103.733 1.00 49.34  ? 142  ILE A CD1 1 
ATOM   1066 N  N   . TYR A 1 143 ? 35.564  32.190 104.197 1.00 41.22  ? 143  TYR A N   1 
ATOM   1067 C  CA  . TYR A 1 143 ? 36.828  32.152 103.416 1.00 44.52  ? 143  TYR A CA  1 
ATOM   1068 C  C   . TYR A 1 143 ? 36.593  31.978 101.943 1.00 42.35  ? 143  TYR A C   1 
ATOM   1069 O  O   . TYR A 1 143 ? 35.524  31.524 101.529 1.00 47.06  ? 143  TYR A O   1 
ATOM   1070 C  CB  . TYR A 1 143 ? 37.777  31.032 103.891 1.00 46.47  ? 143  TYR A CB  1 
ATOM   1071 C  CG  . TYR A 1 143 ? 38.114  31.224 105.318 1.00 48.60  ? 143  TYR A CG  1 
ATOM   1072 C  CD1 . TYR A 1 143 ? 38.958  32.263 105.708 1.00 47.85  ? 143  TYR A CD1 1 
ATOM   1073 C  CD2 . TYR A 1 143 ? 37.541  30.433 106.297 1.00 45.87  ? 143  TYR A CD2 1 
ATOM   1074 C  CE1 . TYR A 1 143 ? 39.239  32.482 107.027 1.00 48.48  ? 143  TYR A CE1 1 
ATOM   1075 C  CE2 . TYR A 1 143 ? 37.815  30.649 107.627 1.00 45.79  ? 143  TYR A CE2 1 
ATOM   1076 C  CZ  . TYR A 1 143 ? 38.651  31.671 107.982 1.00 46.31  ? 143  TYR A CZ  1 
ATOM   1077 O  OH  . TYR A 1 143 ? 38.933  31.891 109.286 1.00 46.44  ? 143  TYR A OH  1 
ATOM   1078 N  N   . PRO A 1 144 ? 37.594  32.339 101.121 1.00 43.95  ? 144  PRO A N   1 
ATOM   1079 C  CA  . PRO A 1 144 ? 37.359  32.219 99.693  1.00 39.50  ? 144  PRO A CA  1 
ATOM   1080 C  C   . PRO A 1 144 ? 37.586  30.799 99.159  1.00 39.15  ? 144  PRO A C   1 
ATOM   1081 O  O   . PRO A 1 144 ? 37.294  30.542 98.004  1.00 44.96  ? 144  PRO A O   1 
ATOM   1082 C  CB  . PRO A 1 144 ? 38.381  33.221 99.093  1.00 44.42  ? 144  PRO A CB  1 
ATOM   1083 C  CG  . PRO A 1 144 ? 39.522  33.180 100.047 1.00 43.46  ? 144  PRO A CG  1 
ATOM   1084 C  CD  . PRO A 1 144 ? 38.858  33.061 101.411 1.00 45.12  ? 144  PRO A CD  1 
ATOM   1085 N  N   . ARG A 1 145 ? 38.096  29.881 99.973  1.00 41.34  ? 145  ARG A N   1 
ATOM   1086 C  CA  . ARG A 1 145 ? 38.207  28.479 99.545  1.00 39.48  ? 145  ARG A CA  1 
ATOM   1087 C  C   . ARG A 1 145 ? 37.952  27.501 100.685 1.00 31.78  ? 145  ARG A C   1 
ATOM   1088 O  O   . ARG A 1 145 ? 38.112  27.839 101.851 1.00 29.70  ? 145  ARG A O   1 
ATOM   1089 C  CB  . ARG A 1 145 ? 39.583  28.206 98.943  1.00 47.49  ? 145  ARG A CB  1 
ATOM   1090 C  CG  . ARG A 1 145 ? 40.751  28.722 99.777  1.00 53.31  ? 145  ARG A CG  1 
ATOM   1091 C  CD  . ARG A 1 145 ? 42.097  28.537 99.079  1.00 58.65  ? 145  ARG A CD  1 
ATOM   1092 N  NE  . ARG A 1 145 ? 42.238  27.182 98.547  1.00 69.80  ? 145  ARG A NE  1 
ATOM   1093 C  CZ  . ARG A 1 145 ? 42.540  26.091 99.264  1.00 79.93  ? 145  ARG A CZ  1 
ATOM   1094 N  NH1 . ARG A 1 145 ? 42.773  26.158 100.579 1.00 86.41  ? 145  ARG A NH1 1 
ATOM   1095 N  NH2 . ARG A 1 145 ? 42.618  24.910 98.657  1.00 79.23  ? 145  ARG A NH2 1 
ATOM   1096 N  N   . ASN A 1 146 ? 37.597  26.279 100.325 1.00 25.64  ? 146  ASN A N   1 
ATOM   1097 C  CA  . ASN A 1 146 ? 37.353  25.215 101.303 1.00 26.71  ? 146  ASN A CA  1 
ATOM   1098 C  C   . ASN A 1 146 ? 38.669  24.579 101.768 1.00 27.26  ? 146  ASN A C   1 
ATOM   1099 O  O   . ASN A 1 146 ? 39.632  24.570 101.028 1.00 25.69  ? 146  ASN A O   1 
ATOM   1100 C  CB  . ASN A 1 146 ? 36.466  24.113 100.688 1.00 24.11  ? 146  ASN A CB  1 
ATOM   1101 C  CG  . ASN A 1 146 ? 35.047  24.545 100.490 1.00 27.44  ? 146  ASN A CG  1 
ATOM   1102 O  OD1 . ASN A 1 146 ? 34.726  25.350 99.608  1.00 26.12  ? 146  ASN A OD1 1 
ATOM   1103 N  ND2 . ASN A 1 146 ? 34.161  24.038 101.341 1.00 22.96  ? 146  ASN A ND2 1 
ATOM   1104 N  N   . PRO A 1 147 ? 38.674  23.936 102.943 1.00 24.94  ? 147  PRO A N   1 
ATOM   1105 C  CA  . PRO A 1 147 ? 39.821  23.181 103.373 1.00 25.22  ? 147  PRO A CA  1 
ATOM   1106 C  C   . PRO A 1 147 ? 40.247  22.215 102.293 1.00 26.72  ? 147  PRO A C   1 
ATOM   1107 O  O   . PRO A 1 147 ? 39.381  21.713 101.594 1.00 26.84  ? 147  PRO A O   1 
ATOM   1108 C  CB  . PRO A 1 147 ? 39.327  22.419 104.623 1.00 26.41  ? 147  PRO A CB  1 
ATOM   1109 C  CG  . PRO A 1 147 ? 37.871  22.774 104.769 1.00 26.24  ? 147  PRO A CG  1 
ATOM   1110 C  CD  . PRO A 1 147 ? 37.592  23.964 103.949 1.00 26.85  ? 147  PRO A CD  1 
ATOM   1111 N  N   . ASP A 1 148 ? 41.555  21.948 102.151 1.00 26.27  ? 148  ASP A N   1 
ATOM   1112 C  CA  . ASP A 1 148 ? 42.035  21.072 101.115 1.00 26.39  ? 148  ASP A CA  1 
ATOM   1113 C  C   . ASP A 1 148 ? 41.620  19.642 101.353 1.00 27.29  ? 148  ASP A C   1 
ATOM   1114 O  O   . ASP A 1 148 ? 41.218  18.898 100.422 1.00 25.55  ? 148  ASP A O   1 
ATOM   1115 C  CB  . ASP A 1 148 ? 43.563  21.170 101.000 1.00 29.85  ? 148  ASP A CB  1 
ATOM   1116 C  CG  . ASP A 1 148 ? 44.041  22.622 100.686 1.00 34.02  ? 148  ASP A CG  1 
ATOM   1117 O  OD1 . ASP A 1 148 ? 44.023  23.552 101.550 1.00 29.94  ? 148  ASP A OD1 1 
ATOM   1118 O  OD2 . ASP A 1 148 ? 44.412  22.820 99.522  1.00 34.17  ? 148  ASP A OD2 1 
ATOM   1119 N  N   . MET A 1 149 ? 41.672  19.247 102.624 1.00 23.46  ? 149  MET A N   1 
ATOM   1120 C  CA  . MET A 1 149 ? 41.480  17.867 102.972 1.00 26.66  ? 149  MET A CA  1 
ATOM   1121 C  C   . MET A 1 149 ? 40.855  17.757 104.379 1.00 23.62  ? 149  MET A C   1 
ATOM   1122 O  O   . MET A 1 149 ? 41.155  18.586 105.242 1.00 20.34  ? 149  MET A O   1 
ATOM   1123 C  CB  . MET A 1 149 ? 42.810  17.214 102.946 1.00 32.11  ? 149  MET A CB  1 
ATOM   1124 C  CG  . MET A 1 149 ? 42.804  15.720 103.133 1.00 39.43  ? 149  MET A CG  1 
ATOM   1125 S  SD  . MET A 1 149 ? 44.465  15.122 102.773 1.00 49.54  ? 149  MET A SD  1 
ATOM   1126 C  CE  . MET A 1 149 ? 44.594  15.631 101.069 1.00 41.12  ? 149  MET A CE  1 
ATOM   1127 N  N   . VAL A 1 150 ? 39.939  16.809 104.535 1.00 21.08  ? 150  VAL A N   1 
ATOM   1128 C  CA  . VAL A 1 150 ? 39.233  16.567 105.833 1.00 21.96  ? 150  VAL A CA  1 
ATOM   1129 C  C   . VAL A 1 150 ? 39.353  15.112 106.064 1.00 22.77  ? 150  VAL A C   1 
ATOM   1130 O  O   . VAL A 1 150 ? 39.083  14.331 105.156 1.00 22.23  ? 150  VAL A O   1 
ATOM   1131 C  CB  . VAL A 1 150 ? 37.751  16.979 105.797 1.00 21.84  ? 150  VAL A CB  1 
ATOM   1132 C  CG1 . VAL A 1 150 ? 37.065  16.555 107.088 1.00 23.64  ? 150  VAL A CG1 1 
ATOM   1133 C  CG2 . VAL A 1 150 ? 37.633  18.465 105.640 1.00 21.71  ? 150  VAL A CG2 1 
ATOM   1134 N  N   . VAL A 1 151 ? 39.873  14.720 107.235 1.00 21.14  ? 151  VAL A N   1 
ATOM   1135 C  CA  . VAL A 1 151 ? 40.164  13.329 107.516 1.00 19.95  ? 151  VAL A CA  1 
ATOM   1136 C  C   . VAL A 1 151 ? 39.349  12.927 108.786 1.00 22.13  ? 151  VAL A C   1 
ATOM   1137 O  O   . VAL A 1 151 ? 39.549  13.514 109.829 1.00 23.86  ? 151  VAL A O   1 
ATOM   1138 C  CB  . VAL A 1 151 ? 41.663  13.099 107.755 1.00 20.74  ? 151  VAL A CB  1 
ATOM   1139 C  CG1 . VAL A 1 151 ? 41.940  11.662 108.079 1.00 20.27  ? 151  VAL A CG1 1 
ATOM   1140 C  CG2 . VAL A 1 151 ? 42.522  13.587 106.556 1.00 22.76  ? 151  VAL A CG2 1 
ATOM   1141 N  N   . MET A 1 152 ? 38.452  11.946 108.646 1.00 20.52  ? 152  MET A N   1 
ATOM   1142 C  CA  . MET A 1 152 ? 37.578  11.457 109.738 1.00 21.43  ? 152  MET A CA  1 
ATOM   1143 C  C   . MET A 1 152 ? 37.968  10.084 110.155 1.00 21.19  ? 152  MET A C   1 
ATOM   1144 O  O   . MET A 1 152 ? 37.700  9.098  109.434 1.00 18.91  ? 152  MET A O   1 
ATOM   1145 C  CB  . MET A 1 152 ? 36.151  11.413 109.287 1.00 20.39  ? 152  MET A CB  1 
ATOM   1146 C  CG  . MET A 1 152 ? 35.663  12.748 108.818 1.00 19.47  ? 152  MET A CG  1 
ATOM   1147 S  SD  . MET A 1 152 ? 35.673  14.100 109.986 1.00 27.46  ? 152  MET A SD  1 
ATOM   1148 C  CE  . MET A 1 152 ? 34.528  13.589 111.292 1.00 28.07  ? 152  MET A CE  1 
ATOM   1149 N  N   . ASP A 1 153 ? 38.579  9.987  111.345 1.00 19.12  ? 153  ASP A N   1 
ATOM   1150 C  CA  . ASP A 1 153 ? 38.982  8.684  111.866 1.00 19.23  ? 153  ASP A CA  1 
ATOM   1151 C  C   . ASP A 1 153 ? 37.808  8.166  112.686 1.00 20.87  ? 153  ASP A C   1 
ATOM   1152 O  O   . ASP A 1 153 ? 37.494  8.701  113.791 1.00 22.97  ? 153  ASP A O   1 
ATOM   1153 C  CB  . ASP A 1 153 ? 40.255  8.762  112.735 1.00 22.11  ? 153  ASP A CB  1 
ATOM   1154 C  CG  . ASP A 1 153 ? 40.725  7.438  113.160 1.00 24.83  ? 153  ASP A CG  1 
ATOM   1155 O  OD1 . ASP A 1 153 ? 39.840  6.541  113.369 1.00 20.85  ? 153  ASP A OD1 1 
ATOM   1156 O  OD2 . ASP A 1 153 ? 41.981  7.256  113.237 1.00 26.59  ? 153  ASP A OD2 1 
ATOM   1157 N  N   . VAL A 1 154 ? 37.142  7.155  112.164 1.00 19.10  ? 154  VAL A N   1 
ATOM   1158 C  CA  . VAL A 1 154 ? 35.867  6.740  112.713 1.00 20.95  ? 154  VAL A CA  1 
ATOM   1159 C  C   . VAL A 1 154 ? 36.028  6.034  114.089 1.00 21.30  ? 154  VAL A C   1 
ATOM   1160 O  O   . VAL A 1 154 ? 35.108  6.113  114.933 1.00 20.15  ? 154  VAL A O   1 
ATOM   1161 C  CB  . VAL A 1 154 ? 35.072  5.845  111.744 1.00 20.30  ? 154  VAL A CB  1 
ATOM   1162 C  CG1 . VAL A 1 154 ? 34.973  6.476  110.355 1.00 23.65  ? 154  VAL A CG1 1 
ATOM   1163 C  CG2 . VAL A 1 154 ? 35.693  4.580  111.516 1.00 22.11  ? 154  VAL A CG2 1 
ATOM   1164 N  N   . ALA A 1 155 ? 37.163  5.401  114.281 1.00 19.02  ? 155  ALA A N   1 
ATOM   1165 C  CA  . ALA A 1 155 ? 37.526  4.720  115.556 1.00 23.97  ? 155  ALA A CA  1 
ATOM   1166 C  C   . ALA A 1 155 ? 37.669  5.680  116.693 1.00 22.58  ? 155  ALA A C   1 
ATOM   1167 O  O   . ALA A 1 155 ? 37.132  5.442  117.791 1.00 27.90  ? 155  ALA A O   1 
ATOM   1168 C  CB  . ALA A 1 155 ? 38.785  3.864  115.400 1.00 25.17  ? 155  ALA A CB  1 
ATOM   1169 N  N   . ILE A 1 156 ? 38.320  6.797  116.434 1.00 22.05  ? 156  ILE A N   1 
ATOM   1170 C  CA  . ILE A 1 156 ? 38.384  7.906  117.361 1.00 23.23  ? 156  ILE A CA  1 
ATOM   1171 C  C   . ILE A 1 156 ? 36.998  8.520  117.666 1.00 25.19  ? 156  ILE A C   1 
ATOM   1172 O  O   . ILE A 1 156 ? 36.560  8.690  118.837 1.00 19.65  ? 156  ILE A O   1 
ATOM   1173 C  CB  . ILE A 1 156 ? 39.348  8.959  116.806 1.00 25.80  ? 156  ILE A CB  1 
ATOM   1174 C  CG1 . ILE A 1 156 ? 40.751  8.409  116.840 1.00 27.64  ? 156  ILE A CG1 1 
ATOM   1175 C  CG2 . ILE A 1 156 ? 39.281  10.240 117.620 1.00 26.59  ? 156  ILE A CG2 1 
ATOM   1176 C  CD1 . ILE A 1 156 ? 41.776  9.399  116.354 1.00 29.94  ? 156  ILE A CD1 1 
ATOM   1177 N  N   . ILE A 1 157 ? 36.241  8.809  116.617 1.00 21.88  ? 157  ILE A N   1 
ATOM   1178 C  CA  . ILE A 1 157 ? 34.925  9.361  116.787 1.00 19.97  ? 157  ILE A CA  1 
ATOM   1179 C  C   . ILE A 1 157 ? 33.995  8.442  117.619 1.00 19.44  ? 157  ILE A C   1 
ATOM   1180 O  O   . ILE A 1 157 ? 33.265  8.931  118.525 1.00 19.82  ? 157  ILE A O   1 
ATOM   1181 C  CB  . ILE A 1 157 ? 34.353  9.803  115.393 1.00 23.39  ? 157  ILE A CB  1 
ATOM   1182 C  CG1 . ILE A 1 157 ? 35.092  11.078 114.936 1.00 29.26  ? 157  ILE A CG1 1 
ATOM   1183 C  CG2 . ILE A 1 157 ? 32.890  10.092 115.531 1.00 24.19  ? 157  ILE A CG2 1 
ATOM   1184 C  CD1 . ILE A 1 157 ? 35.251  11.213 113.437 1.00 35.05  ? 157  ILE A CD1 1 
ATOM   1185 N  N   . ALA A 1 158 ? 34.046  7.146  117.377 1.00 18.62  ? 158  ALA A N   1 
ATOM   1186 C  CA  . ALA A 1 158 ? 33.171  6.193  118.070 1.00 21.15  ? 158  ALA A CA  1 
ATOM   1187 C  C   . ALA A 1 158 ? 33.539  5.988  119.547 1.00 22.42  ? 158  ALA A C   1 
ATOM   1188 O  O   . ALA A 1 158 ? 32.734  5.431  120.281 1.00 23.39  ? 158  ALA A O   1 
ATOM   1189 C  CB  . ALA A 1 158 ? 33.185  4.834  117.400 1.00 22.38  ? 158  ALA A CB  1 
ATOM   1190 N  N   . LYS A 1 159 ? 34.734  6.414  119.938 1.00 24.55  ? 159  LYS A N   1 
ATOM   1191 C  CA  . LYS A 1 159 ? 35.124  6.446  121.346 1.00 28.08  ? 159  LYS A CA  1 
ATOM   1192 C  C   . LYS A 1 159 ? 34.774  7.756  122.009 1.00 24.37  ? 159  LYS A C   1 
ATOM   1193 O  O   . LYS A 1 159 ? 34.845  7.823  123.219 1.00 24.34  ? 159  LYS A O   1 
ATOM   1194 C  CB  . LYS A 1 159 ? 36.616  6.185  121.513 1.00 30.79  ? 159  LYS A CB  1 
ATOM   1195 C  CG  . LYS A 1 159 ? 37.018  4.775  121.210 1.00 38.06  ? 159  LYS A CG  1 
ATOM   1196 C  CD  . LYS A 1 159 ? 38.535  4.650  121.190 1.00 45.32  ? 159  LYS A CD  1 
ATOM   1197 C  CE  . LYS A 1 159 ? 38.984  3.312  120.594 1.00 54.00  ? 159  LYS A CE  1 
ATOM   1198 N  NZ  . LYS A 1 159 ? 38.116  2.224  121.130 1.00 54.78  ? 159  LYS A NZ  1 
ATOM   1199 N  N   . ALA A 1 160 ? 34.411  8.803  121.265 1.00 23.13  ? 160  ALA A N   1 
ATOM   1200 C  CA  . ALA A 1 160 ? 33.951  10.054 121.867 1.00 24.86  ? 160  ALA A CA  1 
ATOM   1201 C  C   . ALA A 1 160 ? 32.495  9.908  122.433 1.00 22.23  ? 160  ALA A C   1 
ATOM   1202 O  O   . ALA A 1 160 ? 31.747  9.032  122.013 1.00 21.95  ? 160  ALA A O   1 
ATOM   1203 C  CB  . ALA A 1 160 ? 34.055  11.224 120.885 1.00 25.52  ? 160  ALA A CB  1 
ATOM   1204 N  N   . PRO A 1 161 ? 32.138  10.708 123.448 1.00 21.36  ? 161  PRO A N   1 
ATOM   1205 C  CA  . PRO A 1 161 ? 30.809  10.576 124.076 1.00 21.65  ? 161  PRO A CA  1 
ATOM   1206 C  C   . PRO A 1 161 ? 29.669  10.661 123.064 1.00 21.93  ? 161  PRO A C   1 
ATOM   1207 O  O   . PRO A 1 161 ? 29.660  11.556 122.160 1.00 21.98  ? 161  PRO A O   1 
ATOM   1208 C  CB  . PRO A 1 161 ? 30.738  11.784 124.996 1.00 20.97  ? 161  PRO A CB  1 
ATOM   1209 C  CG  . PRO A 1 161 ? 32.148  12.095 125.344 1.00 23.98  ? 161  PRO A CG  1 
ATOM   1210 C  CD  . PRO A 1 161 ? 32.937  11.778 124.097 1.00 23.29  ? 161  PRO A CD  1 
ATOM   1211 N  N   . VAL A 1 162 ? 28.716  9.777  123.232 1.00 18.51  ? 162  VAL A N   1 
ATOM   1212 C  CA  . VAL A 1 162 ? 27.581  9.629  122.320 1.00 19.26  ? 162  VAL A CA  1 
ATOM   1213 C  C   . VAL A 1 162 ? 26.789  10.897 122.177 1.00 17.76  ? 162  VAL A C   1 
ATOM   1214 O  O   . VAL A 1 162 ? 26.219  11.179 121.097 1.00 16.52  ? 162  VAL A O   1 
ATOM   1215 C  CB  . VAL A 1 162 ? 26.681  8.407  122.718 1.00 22.79  ? 162  VAL A CB  1 
ATOM   1216 C  CG1 . VAL A 1 162 ? 25.912  8.619  124.020 1.00 23.25  ? 162  VAL A CG1 1 
ATOM   1217 C  CG2 . VAL A 1 162 ? 25.693  8.087  121.614 1.00 25.73  ? 162  VAL A CG2 1 
ATOM   1218 N  N   . ARG A 1 163 ? 26.801  11.730 123.219 1.00 16.68  ? 163  ARG A N   1 
ATOM   1219 C  CA  . ARG A 1 163 ? 26.093  12.962 123.174 1.00 15.21  ? 163  ARG A CA  1 
ATOM   1220 C  C   . ARG A 1 163 ? 26.642  13.849 121.992 1.00 14.74  ? 163  ARG A C   1 
ATOM   1221 O  O   . ARG A 1 163 ? 25.869  14.600 121.405 1.00 15.19  ? 163  ARG A O   1 
ATOM   1222 C  CB  . ARG A 1 163 ? 26.287  13.762 124.464 1.00 17.55  ? 163  ARG A CB  1 
ATOM   1223 C  CG  . ARG A 1 163 ? 25.409  14.986 124.530 1.00 18.43  ? 163  ARG A CG  1 
ATOM   1224 C  CD  . ARG A 1 163 ? 25.696  15.772 125.801 1.00 22.08  ? 163  ARG A CD  1 
ATOM   1225 N  NE  . ARG A 1 163 ? 25.020  17.022 125.763 1.00 18.69  ? 163  ARG A NE  1 
ATOM   1226 C  CZ  . ARG A 1 163 ? 25.297  18.051 126.529 1.00 20.40  ? 163  ARG A CZ  1 
ATOM   1227 N  NH1 . ARG A 1 163 ? 26.167  17.943 127.538 1.00 18.93  ? 163  ARG A NH1 1 
ATOM   1228 N  NH2 . ARG A 1 163 ? 24.645  19.146 126.310 1.00 18.07  ? 163  ARG A NH2 1 
ATOM   1229 N  N   . LEU A 1 164 ? 27.950  13.783 121.721 1.00 15.73  ? 164  LEU A N   1 
ATOM   1230 C  CA  . LEU A 1 164 ? 28.517  14.611 120.602 1.00 17.21  ? 164  LEU A CA  1 
ATOM   1231 C  C   . LEU A 1 164 ? 28.054  14.088 119.199 1.00 17.75  ? 164  LEU A C   1 
ATOM   1232 O  O   . LEU A 1 164 ? 27.875  14.891 118.276 1.00 18.91  ? 164  LEU A O   1 
ATOM   1233 C  CB  . LEU A 1 164 ? 29.997  14.623 120.670 1.00 18.01  ? 164  LEU A CB  1 
ATOM   1234 C  CG  . LEU A 1 164 ? 30.535  15.374 121.917 1.00 19.95  ? 164  LEU A CG  1 
ATOM   1235 C  CD1 . LEU A 1 164 ? 31.901  14.875 122.275 1.00 22.73  ? 164  LEU A CD1 1 
ATOM   1236 C  CD2 . LEU A 1 164 ? 30.593  16.889 121.786 1.00 22.83  ? 164  LEU A CD2 1 
ATOM   1237 N  N   . LEU A 1 165 ? 27.908  12.788 119.061 1.00 17.07  ? 165  LEU A N   1 
ATOM   1238 C  CA  . LEU A 1 165 ? 27.354  12.207 117.823 1.00 18.33  ? 165  LEU A CA  1 
ATOM   1239 C  C   . LEU A 1 165 ? 25.922  12.603 117.624 1.00 17.16  ? 165  LEU A C   1 
ATOM   1240 O  O   . LEU A 1 165 ? 25.489  12.961 116.509 1.00 17.55  ? 165  LEU A O   1 
ATOM   1241 C  CB  . LEU A 1 165 ? 27.467  10.687 117.810 1.00 17.67  ? 165  LEU A CB  1 
ATOM   1242 C  CG  . LEU A 1 165 ? 27.127  9.964  116.497 1.00 19.71  ? 165  LEU A CG  1 
ATOM   1243 C  CD1 . LEU A 1 165 ? 28.345  9.855  115.636 1.00 21.08  ? 165  LEU A CD1 1 
ATOM   1244 C  CD2 . LEU A 1 165 ? 26.583  8.547  116.695 1.00 22.44  ? 165  LEU A CD2 1 
ATOM   1245 N  N   . VAL A 1 166 ? 25.156  12.601 118.702 1.00 16.68  ? 166  VAL A N   1 
ATOM   1246 C  CA  . VAL A 1 166 ? 23.781  13.011 118.653 1.00 15.40  ? 166  VAL A CA  1 
ATOM   1247 C  C   . VAL A 1 166 ? 23.641  14.459 118.275 1.00 15.08  ? 166  VAL A C   1 
ATOM   1248 O  O   . VAL A 1 166 ? 22.731  14.811 117.488 1.00 12.53  ? 166  VAL A O   1 
ATOM   1249 C  CB  . VAL A 1 166 ? 23.024  12.592 119.957 1.00 14.62  ? 166  VAL A CB  1 
ATOM   1250 C  CG1 . VAL A 1 166 ? 21.669  13.259 120.050 1.00 15.36  ? 166  VAL A CG1 1 
ATOM   1251 C  CG2 . VAL A 1 166 ? 22.928  11.093 120.037 1.00 16.62  ? 166  VAL A CG2 1 
ATOM   1252 N  N   . ALA A 1 167 ? 24.488  15.331 118.842 1.00 14.85  ? 167  ALA A N   1 
ATOM   1253 C  CA  . ALA A 1 167 ? 24.422  16.715 118.528 1.00 14.58  ? 167  ALA A CA  1 
ATOM   1254 C  C   . ALA A 1 167 ? 24.733  16.906 117.003 1.00 15.20  ? 167  ALA A C   1 
ATOM   1255 O  O   . ALA A 1 167 ? 24.110  17.752 116.372 1.00 17.22  ? 167  ALA A O   1 
ATOM   1256 C  CB  . ALA A 1 167 ? 25.410  17.492 119.418 1.00 14.35  ? 167  ALA A CB  1 
ATOM   1257 N  N   . GLY A 1 168 ? 25.690  16.150 116.443 1.00 17.35  ? 168  GLY A N   1 
ATOM   1258 C  CA  . GLY A 1 168 ? 25.998  16.245 115.012 1.00 16.23  ? 168  GLY A CA  1 
ATOM   1259 C  C   . GLY A 1 168 ? 24.784  15.799 114.168 1.00 17.13  ? 168  GLY A C   1 
ATOM   1260 O  O   . GLY A 1 168 ? 24.499  16.445 113.123 1.00 14.46  ? 168  GLY A O   1 
ATOM   1261 N  N   . MET A 1 169 ? 24.010  14.810 114.663 1.00 15.29  ? 169  MET A N   1 
ATOM   1262 C  CA  . MET A 1 169 ? 22.812  14.340 113.948 1.00 15.30  ? 169  MET A CA  1 
ATOM   1263 C  C   . MET A 1 169 ? 21.784  15.408 114.047 1.00 17.38  ? 169  MET A C   1 
ATOM   1264 O  O   . MET A 1 169 ? 21.021  15.643 113.116 1.00 14.80  ? 169  MET A O   1 
ATOM   1265 C  CB  . MET A 1 169 ? 22.277  13.016 114.483 1.00 16.32  ? 169  MET A CB  1 
ATOM   1266 C  CG  . MET A 1 169 ? 23.186  11.881 114.180 1.00 18.42  ? 169  MET A CG  1 
ATOM   1267 S  SD  . MET A 1 169 ? 22.396  10.261 114.361 1.00 19.07  ? 169  MET A SD  1 
ATOM   1268 C  CE  . MET A 1 169 ? 22.883  9.846  116.053 1.00 20.65  ? 169  MET A CE  1 
ATOM   1269 N  N   . GLY A 1 170 ? 21.810  16.170 115.143 1.00 15.01  ? 170  GLY A N   1 
ATOM   1270 C  CA  . GLY A 1 170 ? 20.888  17.284 115.270 1.00 14.73  ? 170  GLY A CA  1 
ATOM   1271 C  C   . GLY A 1 170 ? 21.141  18.421 114.277 1.00 16.00  ? 170  GLY A C   1 
ATOM   1272 O  O   . GLY A 1 170 ? 20.186  18.976 113.681 1.00 16.42  ? 170  GLY A O   1 
ATOM   1273 N  N   . ASP A 1 171 ? 22.419  18.730 114.083 1.00 15.63  ? 171  ASP A N   1 
ATOM   1274 C  CA  . ASP A 1 171 ? 22.831  19.686 113.105 1.00 17.08  ? 171  ASP A CA  1 
ATOM   1275 C  C   . ASP A 1 171 ? 22.522  19.188 111.687 1.00 17.60  ? 171  ASP A C   1 
ATOM   1276 O  O   . ASP A 1 171 ? 21.969  19.950 110.907 1.00 20.44  ? 171  ASP A O   1 
ATOM   1277 C  CB  . ASP A 1 171 ? 24.281  19.989 113.252 1.00 17.10  ? 171  ASP A CB  1 
ATOM   1278 C  CG  . ASP A 1 171 ? 24.682  21.377 112.693 1.00 18.49  ? 171  ASP A CG  1 
ATOM   1279 O  OD1 . ASP A 1 171 ? 23.870  22.245 112.404 1.00 20.45  ? 171  ASP A OD1 1 
ATOM   1280 O  OD2 . ASP A 1 171 ? 25.855  21.625 112.569 1.00 19.98  ? 171  ASP A OD2 1 
ATOM   1281 N  N   . ALA A 1 172 ? 22.780  17.931 111.439 1.00 16.43  ? 172  ALA A N   1 
ATOM   1282 C  CA  . ALA A 1 172 ? 22.527  17.313 110.138 1.00 17.14  ? 172  ALA A CA  1 
ATOM   1283 C  C   . ALA A 1 172 ? 21.050  17.267 109.827 1.00 18.37  ? 172  ALA A C   1 
ATOM   1284 O  O   . ALA A 1 172 ? 20.622  17.407 108.682 1.00 19.18  ? 172  ALA A O   1 
ATOM   1285 C  CB  . ALA A 1 172 ? 23.155  15.953 110.097 1.00 16.64  ? 172  ALA A CB  1 
ATOM   1286 N  N   . LEU A 1 173 ? 20.212  17.112 110.863 1.00 14.46  ? 173  LEU A N   1 
ATOM   1287 C  CA  . LEU A 1 173 ? 18.819  17.012 110.695 1.00 14.88  ? 173  LEU A CA  1 
ATOM   1288 C  C   . LEU A 1 173 ? 18.214  18.249 109.970 1.00 13.04  ? 173  LEU A C   1 
ATOM   1289 O  O   . LEU A 1 173 ? 17.303  18.101 109.230 1.00 14.99  ? 173  LEU A O   1 
ATOM   1290 C  CB  . LEU A 1 173 ? 18.141  16.756 112.069 1.00 14.91  ? 173  LEU A CB  1 
ATOM   1291 C  CG  . LEU A 1 173 ? 16.640  16.796 112.102 1.00 16.55  ? 173  LEU A CG  1 
ATOM   1292 C  CD1 . LEU A 1 173 ? 16.042  15.547 111.448 1.00 16.22  ? 173  LEU A CD1 1 
ATOM   1293 C  CD2 . LEU A 1 173 ? 16.076  16.849 113.516 1.00 18.60  ? 173  LEU A CD2 1 
ATOM   1294 N  N   . SER A 1 174 ? 18.722  19.426 110.191 1.00 11.59  ? 174  SER A N   1 
ATOM   1295 C  CA  . SER A 1 174 ? 18.143  20.601 109.624 1.00 13.59  ? 174  SER A CA  1 
ATOM   1296 C  C   . SER A 1 174 ? 18.488  20.654 108.077 1.00 14.01  ? 174  SER A C   1 
ATOM   1297 O  O   . SER A 1 174 ? 17.853  21.386 107.389 1.00 15.68  ? 174  SER A O   1 
ATOM   1298 C  CB  . SER A 1 174 ? 18.733  21.859 110.231 1.00 13.31  ? 174  SER A CB  1 
ATOM   1299 O  OG  . SER A 1 174 ? 20.102  21.950 110.017 1.00 15.87  ? 174  SER A OG  1 
ATOM   1300 N  N   . THR A 1 175 ? 19.465  19.898 107.623 1.00 13.11  ? 175  THR A N   1 
ATOM   1301 C  CA  . THR A 1 175 ? 20.114  20.186 106.334 1.00 15.19  ? 175  THR A CA  1 
ATOM   1302 C  C   . THR A 1 175 ? 19.091  20.095 105.189 1.00 16.48  ? 175  THR A C   1 
ATOM   1303 O  O   . THR A 1 175 ? 18.972  21.011 104.380 1.00 13.00  ? 175  THR A O   1 
ATOM   1304 C  CB  . THR A 1 175 ? 21.324  19.270 106.074 1.00 17.84  ? 175  THR A CB  1 
ATOM   1305 O  OG1 . THR A 1 175 ? 22.243  19.386 107.168 1.00 20.84  ? 175  THR A OG1 1 
ATOM   1306 C  CG2 . THR A 1 175 ? 22.101  19.703 104.732 1.00 17.07  ? 175  THR A CG2 1 
ATOM   1307 N  N   . TYR A 1 176 ? 18.314  19.024 105.188 1.00 14.43  ? 176  TYR A N   1 
ATOM   1308 C  CA  . TYR A 1 176 ? 17.330  18.831 104.120 1.00 15.36  ? 176  TYR A CA  1 
ATOM   1309 C  C   . TYR A 1 176 ? 16.297  19.856 104.132 1.00 15.75  ? 176  TYR A C   1 
ATOM   1310 O  O   . TYR A 1 176 ? 15.935  20.418 103.071 1.00 13.71  ? 176  TYR A O   1 
ATOM   1311 C  CB  . TYR A 1 176 ? 16.736  17.419 104.099 1.00 15.78  ? 176  TYR A CB  1 
ATOM   1312 C  CG  . TYR A 1 176 ? 15.538  17.322 103.174 1.00 17.57  ? 176  TYR A CG  1 
ATOM   1313 C  CD1 . TYR A 1 176 ? 15.695  17.516 101.811 1.00 20.74  ? 176  TYR A CD1 1 
ATOM   1314 C  CD2 . TYR A 1 176 ? 14.283  17.116 103.650 1.00 21.15  ? 176  TYR A CD2 1 
ATOM   1315 C  CE1 . TYR A 1 176 ? 14.606  17.485 100.960 1.00 23.82  ? 176  TYR A CE1 1 
ATOM   1316 C  CE2 . TYR A 1 176 ? 13.176  17.084 102.812 1.00 24.28  ? 176  TYR A CE2 1 
ATOM   1317 C  CZ  . TYR A 1 176 ? 13.365  17.282 101.460 1.00 28.46  ? 176  TYR A CZ  1 
ATOM   1318 O  OH  . TYR A 1 176 ? 12.330  17.304 100.558 1.00 34.15  ? 176  TYR A OH  1 
ATOM   1319 N  N   . PHE A 1 177 ? 15.759  20.172 105.313 1.00 13.59  ? 177  PHE A N   1 
ATOM   1320 C  CA  . PHE A 1 177 ? 14.709  21.114 105.357 1.00 12.58  ? 177  PHE A CA  1 
ATOM   1321 C  C   . PHE A 1 177 ? 15.139  22.521 104.977 1.00 12.21  ? 177  PHE A C   1 
ATOM   1322 O  O   . PHE A 1 177 ? 14.369  23.240 104.306 1.00 13.94  ? 177  PHE A O   1 
ATOM   1323 C  CB  . PHE A 1 177 ? 14.005  21.097 106.726 1.00 13.31  ? 177  PHE A CB  1 
ATOM   1324 C  CG  . PHE A 1 177 ? 13.483  19.761 107.085 1.00 15.27  ? 177  PHE A CG  1 
ATOM   1325 C  CD1 . PHE A 1 177 ? 12.326  19.290 106.482 1.00 15.74  ? 177  PHE A CD1 1 
ATOM   1326 C  CD2 . PHE A 1 177 ? 14.211  18.925 107.924 1.00 16.67  ? 177  PHE A CD2 1 
ATOM   1327 C  CE1 . PHE A 1 177 ? 11.811  18.024 106.764 1.00 17.31  ? 177  PHE A CE1 1 
ATOM   1328 C  CE2 . PHE A 1 177 ? 13.717  17.673 108.198 1.00 16.22  ? 177  PHE A CE2 1 
ATOM   1329 C  CZ  . PHE A 1 177 ? 12.493  17.243 107.661 1.00 18.61  ? 177  PHE A CZ  1 
ATOM   1330 N  N   . GLU A 1 178 ? 16.321  22.925 105.357 1.00 11.94  ? 178  GLU A N   1 
ATOM   1331 C  CA  . GLU A 1 178 ? 16.792  24.251 104.994 1.00 13.23  ? 178  GLU A CA  1 
ATOM   1332 C  C   . GLU A 1 178 ? 17.151  24.315 103.465 1.00 13.69  ? 178  GLU A C   1 
ATOM   1333 O  O   . GLU A 1 178 ? 16.862  25.317 102.804 1.00 15.51  ? 178  GLU A O   1 
ATOM   1334 C  CB  . GLU A 1 178 ? 17.983  24.640 105.876 1.00 15.53  ? 178  GLU A CB  1 
ATOM   1335 C  CG  . GLU A 1 178 ? 17.575  24.818 107.377 1.00 16.74  ? 178  GLU A CG  1 
ATOM   1336 C  CD  . GLU A 1 178 ? 18.728  25.353 108.230 1.00 19.85  ? 178  GLU A CD  1 
ATOM   1337 O  OE1 . GLU A 1 178 ? 19.654  24.556 108.644 1.00 20.90  ? 178  GLU A OE1 1 
ATOM   1338 O  OE2 . GLU A 1 178 ? 18.709  26.589 108.421 1.00 18.19  ? 178  GLU A OE2 1 
ATOM   1339 N  N   . ALA A 1 179 ? 17.799  23.276 102.978 1.00 15.28  ? 179  ALA A N   1 
ATOM   1340 C  CA  . ALA A 1 179 ? 18.182  23.194 101.570 1.00 16.17  ? 179  ALA A CA  1 
ATOM   1341 C  C   . ALA A 1 179 ? 16.979  23.229 100.628 1.00 17.41  ? 179  ALA A C   1 
ATOM   1342 O  O   . ALA A 1 179 ? 17.012  23.979 99.642  1.00 17.43  ? 179  ALA A O   1 
ATOM   1343 C  CB  . ALA A 1 179 ? 18.987  21.998 101.322 1.00 14.52  ? 179  ALA A CB  1 
ATOM   1344 N  N   . GLN A 1 180 ? 15.908  22.531 100.989 1.00 16.65  ? 180  GLN A N   1 
ATOM   1345 C  CA  . GLN A 1 180 ? 14.720  22.427 100.168 1.00 16.68  ? 180  GLN A CA  1 
ATOM   1346 C  C   . GLN A 1 180 ? 13.914  23.678 100.253 1.00 16.29  ? 180  GLN A C   1 
ATOM   1347 O  O   . GLN A 1 180 ? 13.404  24.162 99.252  1.00 15.12  ? 180  GLN A O   1 
ATOM   1348 C  CB  . GLN A 1 180 ? 13.858  21.262 100.562 1.00 17.31  ? 180  GLN A CB  1 
ATOM   1349 C  CG  . GLN A 1 180 ? 12.585  21.053 99.762  1.00 17.93  ? 180  GLN A CG  1 
ATOM   1350 C  CD  . GLN A 1 180 ? 12.968  20.532 98.362  1.00 22.06  ? 180  GLN A CD  1 
ATOM   1351 O  OE1 . GLN A 1 180 ? 13.652  19.516 98.224  1.00 21.25  ? 180  GLN A OE1 1 
ATOM   1352 N  NE2 . GLN A 1 180 ? 12.603  21.260 97.366  1.00 23.37  ? 180  GLN A NE2 1 
ATOM   1353 N  N   . ALA A 1 181 ? 13.876  24.299 101.428 1.00 16.39  ? 181  ALA A N   1 
ATOM   1354 C  CA  . ALA A 1 181 ? 13.313  25.628 101.511 1.00 16.76  ? 181  ALA A CA  1 
ATOM   1355 C  C   . ALA A 1 181 ? 14.033  26.695 100.624 1.00 16.62  ? 181  ALA A C   1 
ATOM   1356 O  O   . ALA A 1 181 ? 13.372  27.508 99.941  1.00 17.03  ? 181  ALA A O   1 
ATOM   1357 C  CB  . ALA A 1 181 ? 13.263  26.086 102.976 1.00 15.92  ? 181  ALA A CB  1 
ATOM   1358 N  N   . CYS A 1 182 ? 15.351  26.726 100.659 1.00 16.69  ? 182  CYS A N   1 
ATOM   1359 C  CA  . CYS A 1 182 ? 16.157  27.605 99.808  1.00 18.30  ? 182  CYS A CA  1 
ATOM   1360 C  C   . CYS A 1 182 ? 15.944  27.304 98.320  1.00 18.25  ? 182  CYS A C   1 
ATOM   1361 O  O   . CYS A 1 182 ? 15.837  28.160 97.540  1.00 20.02  ? 182  CYS A O   1 
ATOM   1362 C  CB  . CYS A 1 182 ? 17.639  27.474 100.124 1.00 17.79  ? 182  CYS A CB  1 
ATOM   1363 S  SG  . CYS A 1 182 ? 18.183  28.223 101.673 1.00 20.63  ? 182  CYS A SG  1 
ATOM   1364 N  N   . PHE A 1 183 ? 15.919  26.039 98.007  1.00 19.33  ? 183  PHE A N   1 
ATOM   1365 C  CA  . PHE A 1 183 ? 15.770  25.608 96.652  1.00 22.95  ? 183  PHE A CA  1 
ATOM   1366 C  C   . PHE A 1 183 ? 14.439  26.138 96.131  1.00 23.84  ? 183  PHE A C   1 
ATOM   1367 O  O   . PHE A 1 183 ? 14.382  26.743 95.100  1.00 20.87  ? 183  PHE A O   1 
ATOM   1368 C  CB  . PHE A 1 183 ? 15.864  24.113 96.548  1.00 20.95  ? 183  PHE A CB  1 
ATOM   1369 C  CG  . PHE A 1 183 ? 16.058  23.622 95.146  1.00 22.90  ? 183  PHE A CG  1 
ATOM   1370 C  CD1 . PHE A 1 183 ? 14.989  23.427 94.323  1.00 24.06  ? 183  PHE A CD1 1 
ATOM   1371 C  CD2 . PHE A 1 183 ? 17.304  23.335 94.672  1.00 23.68  ? 183  PHE A CD2 1 
ATOM   1372 C  CE1 . PHE A 1 183 ? 15.164  22.977 93.037  1.00 25.93  ? 183  PHE A CE1 1 
ATOM   1373 C  CE2 . PHE A 1 183 ? 17.492  22.886 93.384  1.00 26.50  ? 183  PHE A CE2 1 
ATOM   1374 C  CZ  . PHE A 1 183 ? 16.415  22.698 92.577  1.00 25.65  ? 183  PHE A CZ  1 
ATOM   1375 N  N   . ASP A 1 184 ? 13.395  25.937 96.913  1.00 21.14  ? 184  ASP A N   1 
ATOM   1376 C  CA  . ASP A 1 184 ? 12.074  26.445 96.605  1.00 22.90  ? 184  ASP A CA  1 
ATOM   1377 C  C   . ASP A 1 184 ? 11.981  27.956 96.456  1.00 23.89  ? 184  ASP A C   1 
ATOM   1378 O  O   . ASP A 1 184 ? 11.187  28.410 95.707  1.00 19.58  ? 184  ASP A O   1 
ATOM   1379 C  CB  . ASP A 1 184 ? 11.045  26.069 97.643  1.00 23.93  ? 184  ASP A CB  1 
ATOM   1380 C  CG  . ASP A 1 184 ? 10.794  24.587 97.720  1.00 26.51  ? 184  ASP A CG  1 
ATOM   1381 O  OD1 . ASP A 1 184 ? 11.230  23.826 96.875  1.00 24.75  ? 184  ASP A OD1 1 
ATOM   1382 O  OD2 . ASP A 1 184 ? 10.143  24.216 98.682  1.00 29.47  ? 184  ASP A OD2 1 
ATOM   1383 N  N   . ALA A 1 185 ? 12.787  28.676 97.217  1.00 20.44  ? 185  ALA A N   1 
ATOM   1384 C  CA  . ALA A 1 185 ? 12.821  30.121 97.177  1.00 21.72  ? 185  ALA A CA  1 
ATOM   1385 C  C   . ALA A 1 185 ? 13.754  30.641 96.096  1.00 21.55  ? 185  ALA A C   1 
ATOM   1386 O  O   . ALA A 1 185 ? 13.837  31.801 95.888  1.00 21.17  ? 185  ALA A O   1 
ATOM   1387 C  CB  . ALA A 1 185 ? 13.273  30.667 98.507  1.00 20.17  ? 185  ALA A CB  1 
ATOM   1388 N  N   . GLN A 1 186 ? 14.503  29.751 95.473  1.00 22.82  ? 186  GLN A N   1 
ATOM   1389 C  CA  . GLN A 1 186 ? 15.528  30.175 94.547  1.00 27.15  ? 186  GLN A CA  1 
ATOM   1390 C  C   . GLN A 1 186 ? 16.512  31.086 95.290  1.00 27.51  ? 186  GLN A C   1 
ATOM   1391 O  O   . GLN A 1 186 ? 16.957  32.039 94.759  1.00 23.03  ? 186  GLN A O   1 
ATOM   1392 C  CB  . GLN A 1 186 ? 14.898  30.954 93.371  1.00 30.86  ? 186  GLN A CB  1 
ATOM   1393 C  CG  . GLN A 1 186 ? 14.694  30.210 92.069  1.00 36.68  ? 186  GLN A CG  1 
ATOM   1394 C  CD  . GLN A 1 186 ? 15.085  31.001 90.804  1.00 34.94  ? 186  GLN A CD  1 
ATOM   1395 O  OE1 . GLN A 1 186 ? 14.871  32.221 90.650  1.00 27.07  ? 186  GLN A OE1 1 
ATOM   1396 N  NE2 . GLN A 1 186 ? 15.609  30.278 89.880  1.00 32.64  ? 186  GLN A NE2 1 
ATOM   1397 N  N   . ALA A 1 187 ? 16.841  30.766 96.527  1.00 22.50  ? 187  ALA A N   1 
ATOM   1398 C  CA  . ALA A 1 187 ? 17.783  31.569 97.286  1.00 21.86  ? 187  ALA A CA  1 
ATOM   1399 C  C   . ALA A 1 187 ? 19.214  31.248 96.983  1.00 22.88  ? 187  ALA A C   1 
ATOM   1400 O  O   . ALA A 1 187 ? 19.531  30.195 96.567  1.00 23.51  ? 187  ALA A O   1 
ATOM   1401 C  CB  . ALA A 1 187 ? 17.536  31.476 98.761  1.00 25.87  ? 187  ALA A CB  1 
ATOM   1402 N  N   . THR A 1 188 ? 20.061  32.204 97.247  1.00 23.08  ? 188  THR A N   1 
ATOM   1403 C  CA  . THR A 1 188 ? 21.462  32.099 96.997  1.00 24.00  ? 188  THR A CA  1 
ATOM   1404 C  C   . THR A 1 188 ? 22.150  31.455 98.196  1.00 23.12  ? 188  THR A C   1 
ATOM   1405 O  O   . THR A 1 188 ? 21.930  31.854 99.285  1.00 26.33  ? 188  THR A O   1 
ATOM   1406 C  CB  . THR A 1 188 ? 22.038  33.509 96.797  1.00 25.32  ? 188  THR A CB  1 
ATOM   1407 O  OG1 . THR A 1 188 ? 21.400  34.139 95.693  1.00 28.37  ? 188  THR A OG1 1 
ATOM   1408 C  CG2 . THR A 1 188 ? 23.449  33.459 96.552  1.00 28.21  ? 188  THR A CG2 1 
ATOM   1409 N  N   . SER A 1 189 ? 22.981  30.473 97.962  1.00 21.45  ? 189  SER A N   1 
ATOM   1410 C  CA  . SER A 1 189 ? 23.686  29.741 99.006  1.00 24.42  ? 189  SER A CA  1 
ATOM   1411 C  C   . SER A 1 189 ? 24.937  30.512 99.446  1.00 29.40  ? 189  SER A C   1 
ATOM   1412 O  O   . SER A 1 189 ? 25.304  31.514 98.813  1.00 26.07  ? 189  SER A O   1 
ATOM   1413 C  CB  . SER A 1 189 ? 24.092  28.419 98.445  1.00 23.80  ? 189  SER A CB  1 
ATOM   1414 O  OG  . SER A 1 189 ? 25.320  28.530 97.757  1.00 21.87  ? 189  SER A OG  1 
ATOM   1415 N  N   . MET A 1 190 ? 25.647  30.016 100.461 1.00 28.51  ? 190  MET A N   1 
ATOM   1416 C  CA  . MET A 1 190 ? 26.955  30.594 100.796 1.00 32.18  ? 190  MET A CA  1 
ATOM   1417 C  C   . MET A 1 190 ? 28.028  30.310 99.714  1.00 32.92  ? 190  MET A C   1 
ATOM   1418 O  O   . MET A 1 190 ? 29.057  30.941 99.693  1.00 33.98  ? 190  MET A O   1 
ATOM   1419 C  CB  . MET A 1 190 ? 27.465  30.075 102.143 1.00 36.34  ? 190  MET A CB  1 
ATOM   1420 C  CG  . MET A 1 190 ? 26.896  30.784 103.371 1.00 40.41  ? 190  MET A CG  1 
ATOM   1421 S  SD  . MET A 1 190 ? 27.409  29.924 104.907 1.00 45.71  ? 190  MET A SD  1 
ATOM   1422 C  CE  . MET A 1 190 ? 29.070  29.353 104.506 1.00 50.03  ? 190  MET A CE  1 
ATOM   1423 N  N   . ALA A 1 191 ? 27.812  29.357 98.825  1.00 27.29  ? 191  ALA A N   1 
ATOM   1424 C  CA  . ALA A 1 191 ? 28.739  29.149 97.736  1.00 25.72  ? 191  ALA A CA  1 
ATOM   1425 C  C   . ALA A 1 191 ? 28.574  30.269 96.674  1.00 26.00  ? 191  ALA A C   1 
ATOM   1426 O  O   . ALA A 1 191 ? 29.389  30.357 95.798  1.00 25.41  ? 191  ALA A O   1 
ATOM   1427 C  CB  . ALA A 1 191 ? 28.553  27.776 97.099  1.00 24.80  ? 191  ALA A CB  1 
ATOM   1428 N  N   . GLY A 1 192 ? 27.502  31.057 96.725  1.00 26.56  ? 192  GLY A N   1 
ATOM   1429 C  CA  . GLY A 1 192 ? 27.378  32.295 95.916  1.00 28.89  ? 192  GLY A CA  1 
ATOM   1430 C  C   . GLY A 1 192 ? 26.364  32.205 94.759  1.00 28.70  ? 192  GLY A C   1 
ATOM   1431 O  O   . GLY A 1 192 ? 26.166  33.163 94.020  1.00 27.88  ? 192  GLY A O   1 
ATOM   1432 N  N   . GLY A 1 193 ? 25.738  31.050 94.561  1.00 24.25  ? 193  GLY A N   1 
ATOM   1433 C  CA  . GLY A 1 193 ? 24.724  30.920 93.529  1.00 22.25  ? 193  GLY A CA  1 
ATOM   1434 C  C   . GLY A 1 193 ? 23.498  30.174 94.003  1.00 21.62  ? 193  GLY A C   1 
ATOM   1435 O  O   . GLY A 1 193 ? 23.298  29.993 95.184  1.00 20.60  ? 193  GLY A O   1 
ATOM   1436 N  N   . LYS A 1 194 ? 22.659  29.832 93.067  1.00 19.79  ? 194  LYS A N   1 
ATOM   1437 C  CA  . LYS A 1 194 ? 21.568  28.943 93.246  1.00 21.80  ? 194  LYS A CA  1 
ATOM   1438 C  C   . LYS A 1 194 ? 22.127  27.525 93.515  1.00 18.40  ? 194  LYS A C   1 
ATOM   1439 O  O   . LYS A 1 194 ? 23.220  27.226 93.176  1.00 17.90  ? 194  LYS A O   1 
ATOM   1440 C  CB  . LYS A 1 194 ? 20.682  29.036 92.004  1.00 26.69  ? 194  LYS A CB  1 
ATOM   1441 C  CG  . LYS A 1 194 ? 19.579  28.025 91.840  1.00 34.57  ? 194  LYS A CG  1 
ATOM   1442 C  CD  . LYS A 1 194 ? 19.033  27.980 90.410  1.00 41.73  ? 194  LYS A CD  1 
ATOM   1443 C  CE  . LYS A 1 194 ? 17.671  27.318 90.280  1.00 41.72  ? 194  LYS A CE  1 
ATOM   1444 N  NZ  . LYS A 1 194 ? 17.448  26.121 91.138  1.00 40.15  ? 194  LYS A NZ  1 
ATOM   1445 N  N   . SER A 1 195 ? 21.354  26.675 94.160  1.00 17.57  ? 195  SER A N   1 
ATOM   1446 C  CA  . SER A 1 195 ? 21.785  25.328 94.429  1.00 18.59  ? 195  SER A CA  1 
ATOM   1447 C  C   . SER A 1 195 ? 21.811  24.469 93.163  1.00 18.35  ? 195  SER A C   1 
ATOM   1448 O  O   . SER A 1 195 ? 20.906  24.537 92.382  1.00 20.18  ? 195  SER A O   1 
ATOM   1449 C  CB  . SER A 1 195 ? 20.800  24.643 95.369  1.00 19.22  ? 195  SER A CB  1 
ATOM   1450 O  OG  . SER A 1 195 ? 21.288  23.315 95.646  1.00 17.07  ? 195  SER A OG  1 
ATOM   1451 N  N   . THR A 1 196 ? 22.834  23.650 93.049  1.00 17.95  ? 196  THR A N   1 
ATOM   1452 C  CA  . THR A 1 196 ? 22.867  22.567 92.110  1.00 18.19  ? 196  THR A CA  1 
ATOM   1453 C  C   . THR A 1 196 ? 21.886  21.503 92.554  1.00 20.07  ? 196  THR A C   1 
ATOM   1454 O  O   . THR A 1 196 ? 21.452  21.478 93.719  1.00 15.90  ? 196  THR A O   1 
ATOM   1455 C  CB  . THR A 1 196 ? 24.268  21.910 92.041  1.00 18.20  ? 196  THR A CB  1 
ATOM   1456 O  OG1 . THR A 1 196 ? 24.735  21.427 93.329  1.00 17.74  ? 196  THR A OG1 1 
ATOM   1457 C  CG2 . THR A 1 196 ? 25.278  22.855 91.424  1.00 18.17  ? 196  THR A CG2 1 
ATOM   1458 N  N   . LEU A 1 197 ? 21.522  20.652 91.623  1.00 17.75  ? 197  LEU A N   1 
ATOM   1459 C  CA  . LEU A 1 197 ? 20.871  19.412 91.952  1.00 18.36  ? 197  LEU A CA  1 
ATOM   1460 C  C   . LEU A 1 197 ? 21.708  18.526 92.904  1.00 17.55  ? 197  LEU A C   1 
ATOM   1461 O  O   . LEU A 1 197 ? 21.121  17.887 93.743  1.00 17.73  ? 197  LEU A O   1 
ATOM   1462 C  CB  . LEU A 1 197 ? 20.673  18.541 90.712  1.00 20.27  ? 197  LEU A CB  1 
ATOM   1463 C  CG  . LEU A 1 197 ? 19.818  19.069 89.579  1.00 23.16  ? 197  LEU A CG  1 
ATOM   1464 C  CD1 . LEU A 1 197 ? 19.815  17.960 88.486  1.00 24.76  ? 197  LEU A CD1 1 
ATOM   1465 C  CD2 . LEU A 1 197 ? 18.458  19.380 90.147  1.00 20.79  ? 197  LEU A CD2 1 
ATOM   1466 N  N   . ALA A 1 198 ? 23.027  18.453 92.683  1.00 15.28  ? 198  ALA A N   1 
ATOM   1467 C  CA  . ALA A 1 198 ? 23.945  17.708 93.493  1.00 15.99  ? 198  ALA A CA  1 
ATOM   1468 C  C   . ALA A 1 198 ? 23.842  18.093 95.019  1.00 15.33  ? 198  ALA A C   1 
ATOM   1469 O  O   . ALA A 1 198 ? 23.630  17.219 95.861  1.00 14.63  ? 198  ALA A O   1 
ATOM   1470 C  CB  . ALA A 1 198 ? 25.347  17.866 93.013  1.00 15.60  ? 198  ALA A CB  1 
ATOM   1471 N  N   . ALA A 1 199 ? 23.952  19.371 95.315  1.00 16.18  ? 199  ALA A N   1 
ATOM   1472 C  CA  . ALA A 1 199 ? 23.946  19.842 96.743  1.00 18.17  ? 199  ALA A CA  1 
ATOM   1473 C  C   . ALA A 1 199 ? 22.599  19.548 97.388  1.00 18.10  ? 199  ALA A C   1 
ATOM   1474 O  O   . ALA A 1 199 ? 22.567  19.103 98.510  1.00 17.05  ? 199  ALA A O   1 
ATOM   1475 C  CB  . ALA A 1 199 ? 24.229  21.296 96.820  1.00 16.81  ? 199  ALA A CB  1 
ATOM   1476 N  N   . LEU A 1 200 ? 21.496  19.724 96.661  1.00 18.57  ? 200  LEU A N   1 
ATOM   1477 C  CA  . LEU A 1 200 ? 20.192  19.395 97.219  1.00 19.38  ? 200  LEU A CA  1 
ATOM   1478 C  C   . LEU A 1 200 ? 20.057  17.918 97.473  1.00 18.24  ? 200  LEU A C   1 
ATOM   1479 O  O   . LEU A 1 200 ? 19.489  17.520 98.521  1.00 16.32  ? 200  LEU A O   1 
ATOM   1480 C  CB  . LEU A 1 200 ? 19.007  19.911 96.383  1.00 20.57  ? 200  LEU A CB  1 
ATOM   1481 C  CG  . LEU A 1 200 ? 17.606  19.567 96.854  1.00 22.95  ? 200  LEU A CG  1 
ATOM   1482 C  CD1 . LEU A 1 200 ? 17.283  20.355 98.134  1.00 23.59  ? 200  LEU A CD1 1 
ATOM   1483 C  CD2 . LEU A 1 200 ? 16.525  19.873 95.801  1.00 25.14  ? 200  LEU A CD2 1 
ATOM   1484 N  N   . SER A 1 201 ? 20.559  17.094 96.569  1.00 16.44  ? 201  SER A N   1 
ATOM   1485 C  CA  . SER A 1 201 ? 20.407  15.660 96.703  1.00 16.58  ? 201  SER A CA  1 
ATOM   1486 C  C   . SER A 1 201 ? 21.249  15.148 97.861  1.00 14.73  ? 201  SER A C   1 
ATOM   1487 O  O   . SER A 1 201 ? 20.796  14.199 98.509  1.00 14.28  ? 201  SER A O   1 
ATOM   1488 C  CB  . SER A 1 201 ? 20.781  14.830 95.482  1.00 18.89  ? 201  SER A CB  1 
ATOM   1489 O  OG  . SER A 1 201 ? 22.153  14.961 95.296  1.00 28.50  ? 201  SER A OG  1 
ATOM   1490 N  N   . LEU A 1 202 ? 22.414  15.731 98.088  1.00 12.80  ? 202  LEU A N   1 
ATOM   1491 C  CA  . LEU A 1 202 ? 23.249  15.332 99.208  1.00 14.42  ? 202  LEU A CA  1 
ATOM   1492 C  C   . LEU A 1 202 ? 22.529  15.702 100.515 1.00 13.83  ? 202  LEU A C   1 
ATOM   1493 O  O   . LEU A 1 202 ? 22.642  14.985 101.534 1.00 15.72  ? 202  LEU A O   1 
ATOM   1494 C  CB  . LEU A 1 202 ? 24.594  15.995 99.145  1.00 15.88  ? 202  LEU A CB  1 
ATOM   1495 C  CG  . LEU A 1 202 ? 25.408  15.435 97.952  1.00 17.47  ? 202  LEU A CG  1 
ATOM   1496 C  CD1 . LEU A 1 202 ? 26.696  16.101 97.931  1.00 19.49  ? 202  LEU A CD1 1 
ATOM   1497 C  CD2 . LEU A 1 202 ? 25.622  13.921 97.893  1.00 17.40  ? 202  LEU A CD2 1 
ATOM   1498 N  N   . ALA A 1 203 ? 21.881  16.853 100.519 1.00 14.15  ? 203  ALA A N   1 
ATOM   1499 C  CA  . ALA A 1 203 ? 21.122  17.251 101.676 1.00 16.60  ? 203  ALA A CA  1 
ATOM   1500 C  C   . ALA A 1 203 ? 19.961  16.292 101.982 1.00 16.17  ? 203  ALA A C   1 
ATOM   1501 O  O   . ALA A 1 203 ? 19.693  15.967 103.168 1.00 14.63  ? 203  ALA A O   1 
ATOM   1502 C  CB  . ALA A 1 203 ? 20.618  18.652 101.496 1.00 15.22  ? 203  ALA A CB  1 
ATOM   1503 N  N   . ARG A 1 204 ? 19.270  15.801 100.949 1.00 16.00  ? 204  ARG A N   1 
ATOM   1504 C  CA  . ARG A 1 204 ? 18.196  14.869 101.149 1.00 15.54  ? 204  ARG A CA  1 
ATOM   1505 C  C   . ARG A 1 204 ? 18.747  13.543 101.635 1.00 16.38  ? 204  ARG A C   1 
ATOM   1506 O  O   . ARG A 1 204 ? 18.045  12.828 102.428 1.00 13.87  ? 204  ARG A O   1 
ATOM   1507 C  CB  . ARG A 1 204 ? 17.373  14.669 99.881  1.00 17.55  ? 204  ARG A CB  1 
ATOM   1508 C  CG  . ARG A 1 204 ? 16.355  13.542 99.910  1.00 22.32  ? 204  ARG A CG  1 
ATOM   1509 C  CD  . ARG A 1 204 ? 15.204  13.837 100.850 1.00 29.80  ? 204  ARG A CD  1 
ATOM   1510 N  NE  . ARG A 1 204 ? 14.386  12.650 101.226 1.00 32.69  ? 204  ARG A NE  1 
ATOM   1511 C  CZ  . ARG A 1 204 ? 13.199  12.688 101.817 1.00 30.86  ? 204  ARG A CZ  1 
ATOM   1512 N  NH1 . ARG A 1 204 ? 12.572  13.815 102.059 1.00 40.63  ? 204  ARG A NH1 1 
ATOM   1513 N  NH2 . ARG A 1 204 ? 12.621  11.576 102.170 1.00 33.56  ? 204  ARG A NH2 1 
ATOM   1514 N  N   . LEU A 1 205 ? 19.921  13.167 101.122 1.00 14.19  ? 205  LEU A N   1 
ATOM   1515 C  CA  . LEU A 1 205 ? 20.549  11.916 101.421 1.00 15.96  ? 205  LEU A CA  1 
ATOM   1516 C  C   . LEU A 1 205 ? 20.959  11.955 102.894 1.00 15.59  ? 205  LEU A C   1 
ATOM   1517 O  O   . LEU A 1 205 ? 20.874  10.986 103.576 1.00 15.77  ? 205  LEU A O   1 
ATOM   1518 C  CB  . LEU A 1 205 ? 21.781  11.694 100.530 1.00 18.08  ? 205  LEU A CB  1 
ATOM   1519 C  CG  . LEU A 1 205 ? 22.598  10.453 100.832 1.00 19.88  ? 205  LEU A CG  1 
ATOM   1520 C  CD1 . LEU A 1 205 ? 21.774  9.179  100.654 1.00 22.61  ? 205  LEU A CD1 1 
ATOM   1521 C  CD2 . LEU A 1 205 ? 23.853  10.394 100.008 1.00 18.62  ? 205  LEU A CD2 1 
ATOM   1522 N  N   . CYS A 1 206 ? 21.376  13.106 103.338 1.00 16.92  ? 206  CYS A N   1 
ATOM   1523 C  CA  . CYS A 1 206 ? 21.632  13.370 104.774 1.00 17.99  ? 206  CYS A CA  1 
ATOM   1524 C  C   . CYS A 1 206 ? 20.409  12.977 105.650 1.00 18.65  ? 206  CYS A C   1 
ATOM   1525 O  O   . CYS A 1 206 ? 20.518  12.080 106.518 1.00 19.33  ? 206  CYS A O   1 
ATOM   1526 C  CB  . CYS A 1 206 ? 21.976  14.819 104.940 1.00 20.60  ? 206  CYS A CB  1 
ATOM   1527 S  SG  . CYS A 1 206 ? 22.495  15.161 106.635 1.00 20.21  ? 206  CYS A SG  1 
ATOM   1528 N  N   . TYR A 1 207 ? 19.252  13.560 105.366 1.00 16.54  ? 207  TYR A N   1 
ATOM   1529 C  CA  . TYR A 1 207 ? 18.049  13.278 106.092 1.00 16.29  ? 207  TYR A CA  1 
ATOM   1530 C  C   . TYR A 1 207 ? 17.710  11.812 106.027 1.00 16.96  ? 207  TYR A C   1 
ATOM   1531 O  O   . TYR A 1 207 ? 17.431  11.185 107.062 1.00 12.14  ? 207  TYR A O   1 
ATOM   1532 C  CB  . TYR A 1 207 ? 16.923  14.110 105.565 1.00 18.14  ? 207  TYR A CB  1 
ATOM   1533 C  CG  . TYR A 1 207 ? 15.577  13.799 106.125 1.00 16.80  ? 207  TYR A CG  1 
ATOM   1534 C  CD1 . TYR A 1 207 ? 15.228  14.206 107.407 1.00 19.30  ? 207  TYR A CD1 1 
ATOM   1535 C  CD2 . TYR A 1 207 ? 14.656  13.097 105.419 1.00 20.96  ? 207  TYR A CD2 1 
ATOM   1536 C  CE1 . TYR A 1 207 ? 13.972  13.924 107.946 1.00 19.66  ? 207  TYR A CE1 1 
ATOM   1537 C  CE2 . TYR A 1 207 ? 13.417  12.820 105.939 1.00 23.04  ? 207  TYR A CE2 1 
ATOM   1538 C  CZ  . TYR A 1 207 ? 13.071  13.289 107.229 1.00 22.44  ? 207  TYR A CZ  1 
ATOM   1539 O  OH  . TYR A 1 207 ? 11.854  13.015 107.816 1.00 22.08  ? 207  TYR A OH  1 
ATOM   1540 N  N   . ASP A 1 208 ? 17.792  11.219 104.820 1.00 15.13  ? 208  ASP A N   1 
ATOM   1541 C  CA  . ASP A 1 208 ? 17.431  9.823  104.686 1.00 16.56  ? 208  ASP A CA  1 
ATOM   1542 C  C   . ASP A 1 208 ? 18.429  8.857  105.433 1.00 14.39  ? 208  ASP A C   1 
ATOM   1543 O  O   . ASP A 1 208 ? 18.002  7.847  105.991 1.00 14.60  ? 208  ASP A O   1 
ATOM   1544 C  CB  . ASP A 1 208 ? 17.301  9.381  103.231 1.00 16.87  ? 208  ASP A CB  1 
ATOM   1545 C  CG  . ASP A 1 208 ? 16.124  9.977  102.524 1.00 19.85  ? 208  ASP A CG  1 
ATOM   1546 O  OD1 . ASP A 1 208 ? 15.043  10.228 103.074 1.00 20.39  ? 208  ASP A OD1 1 
ATOM   1547 O  OD2 . ASP A 1 208 ? 16.265  10.077 101.301 1.00 22.89  ? 208  ASP A OD2 1 
ATOM   1548 N  N   . THR A 1 209 ? 19.706  9.185  105.456 1.00 14.30  ? 209  THR A N   1 
ATOM   1549 C  CA  . THR A 1 209 ? 20.694  8.403  106.165 1.00 13.39  ? 209  THR A CA  1 
ATOM   1550 C  C   . THR A 1 209 ? 20.395  8.493  107.692 1.00 14.02  ? 209  THR A C   1 
ATOM   1551 O  O   . THR A 1 209 ? 20.479  7.479  108.402 1.00 15.84  ? 209  THR A O   1 
ATOM   1552 C  CB  . THR A 1 209 ? 22.101  8.841  105.785 1.00 14.86  ? 209  THR A CB  1 
ATOM   1553 O  OG1 . THR A 1 209 ? 22.212  8.697  104.346 1.00 14.72  ? 209  THR A OG1 1 
ATOM   1554 C  CG2 . THR A 1 209 ? 23.192  7.975  106.463 1.00 14.31  ? 209  THR A CG2 1 
ATOM   1555 N  N   . LEU A 1 210 ? 20.067  9.672  108.176 1.00 13.68  ? 210  LEU A N   1 
ATOM   1556 C  CA  . LEU A 1 210 ? 19.793  9.849  109.639 1.00 14.82  ? 210  LEU A CA  1 
ATOM   1557 C  C   . LEU A 1 210 ? 18.628  8.929  110.053 1.00 15.56  ? 210  LEU A C   1 
ATOM   1558 O  O   . LEU A 1 210 ? 18.687  8.186  111.041 1.00 14.08  ? 210  LEU A O   1 
ATOM   1559 C  CB  . LEU A 1 210 ? 19.485  11.303 109.963 1.00 14.92  ? 210  LEU A CB  1 
ATOM   1560 C  CG  . LEU A 1 210 ? 20.629  12.281 109.853 1.00 17.51  ? 210  LEU A CG  1 
ATOM   1561 C  CD1 . LEU A 1 210 ? 20.054  13.687 110.021 1.00 18.78  ? 210  LEU A CD1 1 
ATOM   1562 C  CD2 . LEU A 1 210 ? 21.830  12.065 110.739 1.00 19.32  ? 210  LEU A CD2 1 
ATOM   1563 N  N   . LEU A 1 211 ? 17.573  8.918  109.253 1.00 14.80  ? 211  LEU A N   1 
ATOM   1564 C  CA  . LEU A 1 211 ? 16.422  8.105  109.553 1.00 17.13  ? 211  LEU A CA  1 
ATOM   1565 C  C   . LEU A 1 211 ? 16.744  6.623  109.469 1.00 18.27  ? 211  LEU A C   1 
ATOM   1566 O  O   . LEU A 1 211 ? 16.299  5.881  110.313 1.00 16.85  ? 211  LEU A O   1 
ATOM   1567 C  CB  . LEU A 1 211 ? 15.214  8.438  108.705 1.00 18.22  ? 211  LEU A CB  1 
ATOM   1568 C  CG  . LEU A 1 211 ? 14.583  9.824  108.718 1.00 21.11  ? 211  LEU A CG  1 
ATOM   1569 C  CD1 . LEU A 1 211 ? 13.278  9.737  107.899 1.00 20.17  ? 211  LEU A CD1 1 
ATOM   1570 C  CD2 . LEU A 1 211 ? 14.257  10.276 110.111 1.00 25.20  ? 211  LEU A CD2 1 
ATOM   1571 N  N   . ALA A 1 212 ? 17.506  6.177  108.474 1.00 16.31  ? 212  ALA A N   1 
ATOM   1572 C  CA  . ALA A 1 212 ? 17.874  4.781  108.386 1.00 17.05  ? 212  ALA A CA  1 
ATOM   1573 C  C   . ALA A 1 212 ? 18.912  4.300  109.446 1.00 15.75  ? 212  ALA A C   1 
ATOM   1574 O  O   . ALA A 1 212 ? 18.868  3.148  109.895 1.00 17.83  ? 212  ALA A O   1 
ATOM   1575 C  CB  . ALA A 1 212 ? 18.452  4.495  106.986 1.00 18.18  ? 212  ALA A CB  1 
ATOM   1576 N  N   . GLU A 1 213 ? 19.889  5.141  109.742 1.00 14.06  ? 213  GLU A N   1 
ATOM   1577 C  CA  . GLU A 1 213 ? 21.088  4.685  110.423 1.00 14.37  ? 213  GLU A CA  1 
ATOM   1578 C  C   . GLU A 1 213 ? 21.330  5.280  111.836 1.00 13.38  ? 213  GLU A C   1 
ATOM   1579 O  O   . GLU A 1 213 ? 22.250  4.847  112.477 1.00 11.89  ? 213  GLU A O   1 
ATOM   1580 C  CB  . GLU A 1 213 ? 22.338  4.923  109.608 1.00 16.20  ? 213  GLU A CB  1 
ATOM   1581 C  CG  . GLU A 1 213 ? 22.357  4.496  108.113 1.00 19.93  ? 213  GLU A CG  1 
ATOM   1582 C  CD  . GLU A 1 213 ? 22.324  3.009  107.921 1.00 23.23  ? 213  GLU A CD  1 
ATOM   1583 O  OE1 . GLU A 1 213 ? 22.416  2.298  108.955 1.00 30.59  ? 213  GLU A OE1 1 
ATOM   1584 O  OE2 . GLU A 1 213 ? 22.125  2.540  106.770 1.00 24.65  ? 213  GLU A OE2 1 
ATOM   1585 N  N   . GLY A 1 214 ? 20.586  6.314  112.192 1.00 12.66  ? 214  GLY A N   1 
ATOM   1586 C  CA  . GLY A 1 214 ? 20.867  7.127  113.361 1.00 15.01  ? 214  GLY A CA  1 
ATOM   1587 C  C   . GLY A 1 214 ? 20.820  6.322  114.692 1.00 16.46  ? 214  GLY A C   1 
ATOM   1588 O  O   . GLY A 1 214 ? 21.773  6.412  115.498 1.00 15.20  ? 214  GLY A O   1 
ATOM   1589 N  N   . VAL A 1 215 ? 19.774  5.521  114.845 1.00 15.44  ? 215  VAL A N   1 
ATOM   1590 C  CA  . VAL A 1 215 ? 19.632  4.680  116.067 1.00 15.97  ? 215  VAL A CA  1 
ATOM   1591 C  C   . VAL A 1 215 ? 20.645  3.609  116.080 1.00 14.95  ? 215  VAL A C   1 
ATOM   1592 O  O   . VAL A 1 215 ? 21.345  3.405  117.097 1.00 16.17  ? 215  VAL A O   1 
ATOM   1593 C  CB  . VAL A 1 215 ? 18.211  4.107  116.214 1.00 16.88  ? 215  VAL A CB  1 
ATOM   1594 C  CG1 . VAL A 1 215 ? 18.136  3.094  117.377 1.00 20.14  ? 215  VAL A CG1 1 
ATOM   1595 C  CG2 . VAL A 1 215 ? 17.259  5.204  116.467 1.00 17.69  ? 215  VAL A CG2 1 
ATOM   1596 N  N   . LYS A 1 216 ? 20.878  2.928  114.962 1.00 14.50  ? 216  LYS A N   1 
ATOM   1597 C  CA  . LYS A 1 216 ? 21.887  1.931  114.924 1.00 14.97  ? 216  LYS A CA  1 
ATOM   1598 C  C   . LYS A 1 216 ? 23.268  2.433  115.216 1.00 16.43  ? 216  LYS A C   1 
ATOM   1599 O  O   . LYS A 1 216 ? 24.093  1.720  115.810 1.00 16.24  ? 216  LYS A O   1 
ATOM   1600 C  CB  . LYS A 1 216 ? 21.916  1.149  113.570 1.00 17.24  ? 216  LYS A CB  1 
ATOM   1601 C  CG  . LYS A 1 216 ? 20.665  0.308  113.229 1.00 19.04  ? 216  LYS A CG  1 
ATOM   1602 C  CD  . LYS A 1 216 ? 20.951  -0.500 111.918 1.00 20.88  ? 216  LYS A CD  1 
ATOM   1603 C  CE  . LYS A 1 216 ? 20.757  0.298  110.708 1.00 20.00  ? 216  LYS A CE  1 
ATOM   1604 N  NZ  . LYS A 1 216 ? 21.241  -0.348 109.434 1.00 19.64  ? 216  LYS A NZ  1 
ATOM   1605 N  N   . ALA A 1 217 ? 23.565  3.631  114.745 1.00 14.85  ? 217  ALA A N   1 
ATOM   1606 C  CA  . ALA A 1 217 ? 24.873  4.205  114.972 1.00 14.78  ? 217  ALA A CA  1 
ATOM   1607 C  C   . ALA A 1 217 ? 25.041  4.634  116.483 1.00 15.32  ? 217  ALA A C   1 
ATOM   1608 O  O   . ALA A 1 217 ? 26.130  4.477  117.079 1.00 13.76  ? 217  ALA A O   1 
ATOM   1609 C  CB  . ALA A 1 217 ? 25.030  5.418  114.071 1.00 15.79  ? 217  ALA A CB  1 
ATOM   1610 N  N   . LYS A 1 218 ? 23.977  5.237  117.001 1.00 13.95  ? 218  LYS A N   1 
ATOM   1611 C  CA  . LYS A 1 218 ? 23.951  5.692  118.403 1.00 16.60  ? 218  LYS A CA  1 
ATOM   1612 C  C   . LYS A 1 218 ? 24.275  4.449  119.287 1.00 15.41  ? 218  LYS A C   1 
ATOM   1613 O  O   . LYS A 1 218 ? 25.124  4.542  120.143 1.00 17.79  ? 218  LYS A O   1 
ATOM   1614 C  CB  . LYS A 1 218 ? 22.606  6.206  118.800 1.00 17.95  ? 218  LYS A CB  1 
ATOM   1615 C  CG  . LYS A 1 218 ? 22.534  6.724  120.291 1.00 21.28  ? 218  LYS A CG  1 
ATOM   1616 C  CD  . LYS A 1 218 ? 21.185  7.317  120.660 1.00 24.12  ? 218  LYS A CD  1 
ATOM   1617 C  CE  . LYS A 1 218 ? 20.878  7.394  122.191 1.00 31.67  ? 218  LYS A CE  1 
ATOM   1618 N  NZ  . LYS A 1 218 ? 20.988  8.797  122.814 1.00 37.72  ? 218  LYS A NZ  1 
ATOM   1619 N  N   . LEU A 1 219 ? 23.607  3.333  119.050 1.00 16.58  ? 219  LEU A N   1 
ATOM   1620 C  CA  . LEU A 1 219 ? 23.814  2.085  119.833 1.00 18.21  ? 219  LEU A CA  1 
ATOM   1621 C  C   . LEU A 1 219 ? 25.239  1.583  119.758 1.00 20.94  ? 219  LEU A C   1 
ATOM   1622 O  O   . LEU A 1 219 ? 25.835  1.148  120.781 1.00 18.42  ? 219  LEU A O   1 
ATOM   1623 C  CB  . LEU A 1 219 ? 22.824  1.006  119.489 1.00 20.07  ? 219  LEU A CB  1 
ATOM   1624 C  CG  . LEU A 1 219 ? 21.370  1.313  119.860 1.00 24.34  ? 219  LEU A CG  1 
ATOM   1625 C  CD1 . LEU A 1 219 ? 20.438  0.228  119.365 1.00 26.03  ? 219  LEU A CD1 1 
ATOM   1626 C  CD2 . LEU A 1 219 ? 21.119  1.475  121.340 1.00 28.59  ? 219  LEU A CD2 1 
ATOM   1627 N  N   . ALA A 1 220 ? 25.837  1.678  118.565 1.00 18.29  ? 220  ALA A N   1 
ATOM   1628 C  CA  . ALA A 1 220 ? 27.212  1.241  118.399 1.00 16.88  ? 220  ALA A CA  1 
ATOM   1629 C  C   . ALA A 1 220 ? 28.184  2.136  119.149 1.00 16.41  ? 220  ALA A C   1 
ATOM   1630 O  O   . ALA A 1 220 ? 29.158  1.660  119.775 1.00 17.23  ? 220  ALA A O   1 
ATOM   1631 C  CB  . ALA A 1 220 ? 27.552  1.178  116.905 1.00 16.31  ? 220  ALA A CB  1 
ATOM   1632 N  N   . VAL A 1 221 ? 27.971  3.422  119.077 1.00 15.40  ? 221  VAL A N   1 
ATOM   1633 C  CA  . VAL A 1 221 ? 28.890  4.400  119.696 1.00 17.34  ? 221  VAL A CA  1 
ATOM   1634 C  C   . VAL A 1 221 ? 28.714  4.289  121.257 1.00 17.48  ? 221  VAL A C   1 
ATOM   1635 O  O   . VAL A 1 221 ? 29.701  4.424  121.938 1.00 17.97  ? 221  VAL A O   1 
ATOM   1636 C  CB  . VAL A 1 221 ? 28.646  5.847  119.224 1.00 16.41  ? 221  VAL A CB  1 
ATOM   1637 C  CG1 . VAL A 1 221 ? 29.404  6.898  119.991 1.00 17.58  ? 221  VAL A CG1 1 
ATOM   1638 C  CG2 . VAL A 1 221 ? 29.000  5.970  117.744 1.00 19.44  ? 221  VAL A CG2 1 
ATOM   1639 N  N   . GLU A 1 222 ? 27.503  4.025  121.755 1.00 16.53  ? 222  GLU A N   1 
ATOM   1640 C  CA  . GLU A 1 222 ? 27.280  3.749  123.186 1.00 19.97  ? 222  GLU A CA  1 
ATOM   1641 C  C   . GLU A 1 222 ? 28.143  2.553  123.612 1.00 22.11  ? 222  GLU A C   1 
ATOM   1642 O  O   . GLU A 1 222 ? 28.613  2.527  124.770 1.00 20.93  ? 222  GLU A O   1 
ATOM   1643 C  CB  . GLU A 1 222 ? 25.772  3.411  123.514 1.00 19.09  ? 222  GLU A CB  1 
ATOM   1644 C  CG  . GLU A 1 222 ? 24.886  4.602  123.466 1.00 22.62  ? 222  GLU A CG  1 
ATOM   1645 C  CD  . GLU A 1 222 ? 23.376  4.319  123.630 1.00 23.60  ? 222  GLU A CD  1 
ATOM   1646 O  OE1 . GLU A 1 222 ? 22.900  3.174  123.556 1.00 34.29  ? 222  GLU A OE1 1 
ATOM   1647 O  OE2 . GLU A 1 222 ? 22.665  5.281  123.875 1.00 34.60  ? 222  GLU A OE2 1 
ATOM   1648 N  N   . ALA A 1 223 ? 28.350  1.571  122.719 1.00 19.59  ? 223  ALA A N   1 
ATOM   1649 C  CA  . ALA A 1 223 ? 29.291  0.483  122.966 1.00 19.17  ? 223  ALA A CA  1 
ATOM   1650 C  C   . ALA A 1 223 ? 30.731  0.801  122.626 1.00 20.65  ? 223  ALA A C   1 
ATOM   1651 O  O   . ALA A 1 223 ? 31.580  -0.078 122.752 1.00 23.38  ? 223  ALA A O   1 
ATOM   1652 C  CB  . ALA A 1 223 ? 28.853  -0.819 122.296 1.00 21.12  ? 223  ALA A CB  1 
ATOM   1653 N  N   . GLY A 1 224 ? 31.026  2.020  122.166 1.00 21.06  ? 224  GLY A N   1 
ATOM   1654 C  CA  . GLY A 1 224 ? 32.394  2.361  121.796 1.00 21.56  ? 224  GLY A CA  1 
ATOM   1655 C  C   . GLY A 1 224 ? 32.994  1.810  120.499 1.00 22.18  ? 224  GLY A C   1 
ATOM   1656 O  O   . GLY A 1 224 ? 34.192  1.897  120.282 1.00 22.48  ? 224  GLY A O   1 
ATOM   1657 N  N   . VAL A 1 225 ? 32.164  1.304  119.599 1.00 19.79  ? 225  VAL A N   1 
ATOM   1658 C  CA  . VAL A 1 225 ? 32.640  0.613  118.402 1.00 18.85  ? 225  VAL A CA  1 
ATOM   1659 C  C   . VAL A 1 225 ? 32.130  1.234  117.082 1.00 18.24  ? 225  VAL A C   1 
ATOM   1660 O  O   . VAL A 1 225 ? 31.171  2.059  117.072 1.00 18.31  ? 225  VAL A O   1 
ATOM   1661 C  CB  . VAL A 1 225 ? 32.222  -0.847 118.450 1.00 17.38  ? 225  VAL A CB  1 
ATOM   1662 C  CG1 . VAL A 1 225 ? 32.840  -1.506 119.703 1.00 20.22  ? 225  VAL A CG1 1 
ATOM   1663 C  CG2 . VAL A 1 225 ? 30.701  -0.984 118.444 1.00 17.75  ? 225  VAL A CG2 1 
ATOM   1664 N  N   . VAL A 1 226 ? 32.758  0.801  116.005 1.00 19.11  ? 226  VAL A N   1 
ATOM   1665 C  CA  . VAL A 1 226 ? 32.405  1.277  114.631 1.00 19.09  ? 226  VAL A CA  1 
ATOM   1666 C  C   . VAL A 1 226 ? 31.768  0.158  113.870 1.00 17.24  ? 226  VAL A C   1 
ATOM   1667 O  O   . VAL A 1 226 ? 32.360  -0.886 113.614 1.00 18.80  ? 226  VAL A O   1 
ATOM   1668 C  CB  . VAL A 1 226 ? 33.659  1.670  113.822 1.00 22.20  ? 226  VAL A CB  1 
ATOM   1669 C  CG1 . VAL A 1 226 ? 33.319  2.186  112.399 1.00 21.08  ? 226  VAL A CG1 1 
ATOM   1670 C  CG2 . VAL A 1 226 ? 34.506  2.630  114.589 1.00 22.48  ? 226  VAL A CG2 1 
ATOM   1671 N  N   . THR A 1 227 ? 30.530  0.395  113.451 1.00 16.65  ? 227  THR A N   1 
ATOM   1672 C  CA  . THR A 1 227 ? 29.871  -0.436 112.495 1.00 16.64  ? 227  THR A CA  1 
ATOM   1673 C  C   . THR A 1 227 ? 29.667  0.380  111.205 1.00 16.31  ? 227  THR A C   1 
ATOM   1674 O  O   . THR A 1 227 ? 29.995  1.534  111.162 1.00 14.57  ? 227  THR A O   1 
ATOM   1675 C  CB  . THR A 1 227 ? 28.491  -0.827 112.990 1.00 15.60  ? 227  THR A CB  1 
ATOM   1676 O  OG1 . THR A 1 227 ? 27.760  0.392  113.222 1.00 18.75  ? 227  THR A OG1 1 
ATOM   1677 C  CG2 . THR A 1 227 ? 28.653  -1.643 114.294 1.00 18.62  ? 227  THR A CG2 1 
ATOM   1678 N  N   . GLU A 1 228 ? 29.037  -0.247 110.193 1.00 18.31  ? 228  GLU A N   1 
ATOM   1679 C  CA  . GLU A 1 228 ? 28.792  0.472  108.922 1.00 18.94  ? 228  GLU A CA  1 
ATOM   1680 C  C   . GLU A 1 228 ? 27.803  1.607  109.171 1.00 16.50  ? 228  GLU A C   1 
ATOM   1681 O  O   . GLU A 1 228 ? 27.914  2.708  108.594 1.00 15.85  ? 228  GLU A O   1 
ATOM   1682 C  CB  . GLU A 1 228 ? 28.340  -0.475 107.865 1.00 19.14  ? 228  GLU A CB  1 
ATOM   1683 C  CG  . GLU A 1 228 ? 27.897  0.213  106.545 1.00 21.76  ? 228  GLU A CG  1 
ATOM   1684 C  CD  . GLU A 1 228 ? 29.009  1.007  105.833 1.00 23.97  ? 228  GLU A CD  1 
ATOM   1685 O  OE1 . GLU A 1 228 ? 30.225  0.777  106.099 1.00 25.26  ? 228  GLU A OE1 1 
ATOM   1686 O  OE2 . GLU A 1 228 ? 28.658  1.898  104.983 1.00 26.15  ? 228  GLU A OE2 1 
ATOM   1687 N  N   . ALA A 1 229 ? 26.842  1.386  110.091 1.00 14.97  ? 229  ALA A N   1 
ATOM   1688 C  CA  . ALA A 1 229 ? 25.922  2.447  110.448 1.00 14.67  ? 229  ALA A CA  1 
ATOM   1689 C  C   . ALA A 1 229 ? 26.623  3.693  110.997 1.00 14.12  ? 229  ALA A C   1 
ATOM   1690 O  O   . ALA A 1 229 ? 26.230  4.825  110.687 1.00 14.28  ? 229  ALA A O   1 
ATOM   1691 C  CB  . ALA A 1 229 ? 24.810  1.960  111.414 1.00 15.81  ? 229  ALA A CB  1 
ATOM   1692 N  N   . VAL A 1 230 ? 27.623  3.497  111.848 1.00 13.01  ? 230  VAL A N   1 
ATOM   1693 C  CA  . VAL A 1 230 ? 28.413  4.595  112.338 1.00 13.77  ? 230  VAL A CA  1 
ATOM   1694 C  C   . VAL A 1 230 ? 29.195  5.344  111.169 1.00 13.63  ? 230  VAL A C   1 
ATOM   1695 O  O   . VAL A 1 230 ? 29.150  6.577  111.109 1.00 15.53  ? 230  VAL A O   1 
ATOM   1696 C  CB  . VAL A 1 230 ? 29.446  4.145  113.364 1.00 14.62  ? 230  VAL A CB  1 
ATOM   1697 C  CG1 . VAL A 1 230 ? 30.325  5.351  113.779 1.00 14.10  ? 230  VAL A CG1 1 
ATOM   1698 C  CG2 . VAL A 1 230 ? 28.753  3.577  114.591 1.00 15.26  ? 230  VAL A CG2 1 
ATOM   1699 N  N   . GLU A 1 231 ? 29.756  4.576  110.255 1.00 15.39  ? 231  GLU A N   1 
ATOM   1700 C  CA  . GLU A 1 231 ? 30.473  5.136  109.088 1.00 18.18  ? 231  GLU A CA  1 
ATOM   1701 C  C   . GLU A 1 231 ? 29.528  6.037  108.261 1.00 16.45  ? 231  GLU A C   1 
ATOM   1702 O  O   . GLU A 1 231 ? 29.908  7.143  107.868 1.00 16.38  ? 231  GLU A O   1 
ATOM   1703 C  CB  . GLU A 1 231 ? 31.079  4.052  108.217 1.00 19.55  ? 231  GLU A CB  1 
ATOM   1704 C  CG  . GLU A 1 231 ? 32.093  3.103  108.838 1.00 22.32  ? 231  GLU A CG  1 
ATOM   1705 C  CD  . GLU A 1 231 ? 33.486  3.740  109.005 1.00 23.22  ? 231  GLU A CD  1 
ATOM   1706 O  OE1 . GLU A 1 231 ? 33.596  4.969  108.863 1.00 22.05  ? 231  GLU A OE1 1 
ATOM   1707 O  OE2 . GLU A 1 231 ? 34.471  3.025  109.316 1.00 26.26  ? 231  GLU A OE2 1 
ATOM   1708 N  N   . ARG A 1 232 ? 28.275  5.613  108.126 1.00 15.49  ? 232  ARG A N   1 
ATOM   1709 C  CA  . ARG A 1 232 ? 27.264  6.341  107.393 1.00 14.88  ? 232  ARG A CA  1 
ATOM   1710 C  C   . ARG A 1 232 ? 26.811  7.582  108.058 1.00 15.80  ? 232  ARG A C   1 
ATOM   1711 O  O   . ARG A 1 232 ? 26.616  8.579  107.430 1.00 13.16  ? 232  ARG A O   1 
ATOM   1712 C  CB  . ARG A 1 232 ? 26.070  5.423  106.983 1.00 14.27  ? 232  ARG A CB  1 
ATOM   1713 C  CG  . ARG A 1 232 ? 26.525  4.324  106.072 1.00 14.32  ? 232  ARG A CG  1 
ATOM   1714 C  CD  . ARG A 1 232 ? 25.398  3.477  105.515 1.00 15.37  ? 232  ARG A CD  1 
ATOM   1715 N  NE  . ARG A 1 232 ? 25.894  2.590  104.497 1.00 17.38  ? 232  ARG A NE  1 
ATOM   1716 C  CZ  . ARG A 1 232 ? 25.207  2.081  103.452 1.00 19.72  ? 232  ARG A CZ  1 
ATOM   1717 N  NH1 . ARG A 1 232 ? 23.956  2.371  103.228 1.00 21.40  ? 232  ARG A NH1 1 
ATOM   1718 N  NH2 . ARG A 1 232 ? 25.823  1.315  102.576 1.00 20.74  ? 232  ARG A NH2 1 
ATOM   1719 N  N   . ILE A 1 233 ? 26.659  7.542  109.396 1.00 13.82  ? 233  ILE A N   1 
ATOM   1720 C  CA  . ILE A 1 233 ? 26.313  8.702  110.098 1.00 11.83  ? 233  ILE A CA  1 
ATOM   1721 C  C   . ILE A 1 233 ? 27.417  9.689  110.149 1.00 11.53  ? 233  ILE A C   1 
ATOM   1722 O  O   . ILE A 1 233 ? 27.156  10.874 110.092 1.00 12.24  ? 233  ILE A O   1 
ATOM   1723 C  CB  . ILE A 1 233 ? 25.795  8.322  111.552 1.00 11.41  ? 233  ILE A CB  1 
ATOM   1724 C  CG1 . ILE A 1 233 ? 24.385  7.741  111.441 1.00 12.87  ? 233  ILE A CG1 1 
ATOM   1725 C  CG2 . ILE A 1 233 ? 25.749  9.505  112.437 1.00 13.40  ? 233  ILE A CG2 1 
ATOM   1726 C  CD1 . ILE A 1 233 ? 23.336  8.612  110.857 1.00 12.37  ? 233  ILE A CD1 1 
ATOM   1727 N  N   . ILE A 1 234 ? 28.653  9.238  110.267 1.00 12.78  ? 234  ILE A N   1 
ATOM   1728 C  CA  . ILE A 1 234 ? 29.741  10.185 110.303 1.00 13.71  ? 234  ILE A CA  1 
ATOM   1729 C  C   . ILE A 1 234 ? 29.819  10.958 108.930 1.00 13.95  ? 234  ILE A C   1 
ATOM   1730 O  O   . ILE A 1 234 ? 29.992  12.156 108.883 1.00 12.11  ? 234  ILE A O   1 
ATOM   1731 C  CB  . ILE A 1 234 ? 31.079  9.441  110.550 1.00 14.94  ? 234  ILE A CB  1 
ATOM   1732 C  CG1 . ILE A 1 234 ? 31.193  9.037  112.046 1.00 18.59  ? 234  ILE A CG1 1 
ATOM   1733 C  CG2 . ILE A 1 234 ? 32.241  10.358 110.222 1.00 16.26  ? 234  ILE A CG2 1 
ATOM   1734 C  CD1 . ILE A 1 234 ? 32.360  8.117  112.298 1.00 19.90  ? 234  ILE A CD1 1 
ATOM   1735 N  N   . GLU A 1 235 ? 29.687  10.206 107.843 1.00 15.21  ? 235  GLU A N   1 
ATOM   1736 C  CA  . GLU A 1 235 ? 29.550  10.861 106.486 1.00 13.92  ? 235  GLU A CA  1 
ATOM   1737 C  C   . GLU A 1 235 ? 28.398  11.796 106.422 1.00 13.30  ? 235  GLU A C   1 
ATOM   1738 O  O   . GLU A 1 235 ? 28.527  12.948 106.010 1.00 14.73  ? 235  GLU A O   1 
ATOM   1739 C  CB  . GLU A 1 235 ? 29.446  9.799  105.429 1.00 15.17  ? 235  GLU A CB  1 
ATOM   1740 C  CG  . GLU A 1 235 ? 29.542  10.445 104.019 1.00 17.50  ? 235  GLU A CG  1 
ATOM   1741 C  CD  . GLU A 1 235 ? 29.439  9.498  102.829 1.00 20.69  ? 235  GLU A CD  1 
ATOM   1742 O  OE1 . GLU A 1 235 ? 29.856  8.300  102.930 1.00 20.19  ? 235  GLU A OE1 1 
ATOM   1743 O  OE2 . GLU A 1 235 ? 29.026  10.072 101.727 1.00 21.46  ? 235  GLU A OE2 1 
ATOM   1744 N  N   . ALA A 1 236 ? 27.239  11.371 106.929 1.00 13.61  ? 236  ALA A N   1 
ATOM   1745 C  CA  . ALA A 1 236 ? 26.109  12.265 106.970 1.00 14.45  ? 236  ALA A CA  1 
ATOM   1746 C  C   . ALA A 1 236 ? 26.273  13.572 107.783 1.00 16.96  ? 236  ALA A C   1 
ATOM   1747 O  O   . ALA A 1 236 ? 25.885  14.683 107.326 1.00 16.27  ? 236  ALA A O   1 
ATOM   1748 C  CB  . ALA A 1 236 ? 24.862  11.497 107.432 1.00 14.55  ? 236  ALA A CB  1 
ATOM   1749 N  N   . ASN A 1 237 ? 26.824  13.448 108.996 1.00 15.96  ? 237  ASN A N   1 
ATOM   1750 C  CA  . ASN A 1 237 ? 27.077  14.604 109.854 1.00 16.25  ? 237  ASN A CA  1 
ATOM   1751 C  C   . ASN A 1 237 ? 28.181  15.554 109.305 1.00 17.76  ? 237  ASN A C   1 
ATOM   1752 O  O   . ASN A 1 237 ? 28.318  16.701 109.734 1.00 18.95  ? 237  ASN A O   1 
ATOM   1753 C  CB  . ASN A 1 237 ? 27.584  14.074 111.233 1.00 14.36  ? 237  ASN A CB  1 
ATOM   1754 C  CG  . ASN A 1 237 ? 26.459  13.462 112.110 1.00 16.49  ? 237  ASN A CG  1 
ATOM   1755 O  OD1 . ASN A 1 237 ? 25.332  13.192 111.644 1.00 15.76  ? 237  ASN A OD1 1 
ATOM   1756 N  ND2 . ASN A 1 237 ? 26.800  13.207 113.413 1.00 14.34  ? 237  ASN A ND2 1 
ATOM   1757 N  N   . THR A 1 238 ? 29.008  15.030 108.408 1.00 18.48  ? 238  THR A N   1 
ATOM   1758 C  CA  . THR A 1 238 ? 30.226  15.760 108.017 1.00 19.10  ? 238  THR A CA  1 
ATOM   1759 C  C   . THR A 1 238 ? 30.200  16.192 106.529 1.00 19.08  ? 238  THR A C   1 
ATOM   1760 O  O   . THR A 1 238 ? 30.031  17.365 106.234 1.00 21.50  ? 238  THR A O   1 
ATOM   1761 C  CB  . THR A 1 238 ? 31.433  14.893 108.296 1.00 19.71  ? 238  THR A CB  1 
ATOM   1762 O  OG1 . THR A 1 238 ? 31.300  14.319 109.611 1.00 22.94  ? 238  THR A OG1 1 
ATOM   1763 C  CG2 . THR A 1 238 ? 32.680  15.751 108.264 1.00 19.81  ? 238  THR A CG2 1 
ATOM   1764 N  N   . TYR A 1 239 ? 30.280  15.222 105.646 1.00 20.30  ? 239  TYR A N   1 
ATOM   1765 C  CA  . TYR A 1 239 ? 30.304  15.554 104.206 1.00 21.34  ? 239  TYR A CA  1 
ATOM   1766 C  C   . TYR A 1 239 ? 28.915  15.906 103.655 1.00 21.51  ? 239  TYR A C   1 
ATOM   1767 O  O   . TYR A 1 239 ? 28.732  16.993 103.050 1.00 21.44  ? 239  TYR A O   1 
ATOM   1768 C  CB  . TYR A 1 239 ? 31.031  14.476 103.405 1.00 19.70  ? 239  TYR A CB  1 
ATOM   1769 C  CG  . TYR A 1 239 ? 31.357  14.935 102.004 1.00 20.66  ? 239  TYR A CG  1 
ATOM   1770 C  CD1 . TYR A 1 239 ? 32.517  15.671 101.744 1.00 22.00  ? 239  TYR A CD1 1 
ATOM   1771 C  CD2 . TYR A 1 239 ? 30.466  14.688 100.943 1.00 20.79  ? 239  TYR A CD2 1 
ATOM   1772 C  CE1 . TYR A 1 239 ? 32.830  16.092 100.459 1.00 22.93  ? 239  TYR A CE1 1 
ATOM   1773 C  CE2 . TYR A 1 239 ? 30.783  15.104 99.645  1.00 21.07  ? 239  TYR A CE2 1 
ATOM   1774 C  CZ  . TYR A 1 239 ? 31.940  15.830 99.415  1.00 22.46  ? 239  TYR A CZ  1 
ATOM   1775 O  OH  . TYR A 1 239 ? 32.271  16.280 98.126  1.00 25.74  ? 239  TYR A OH  1 
ATOM   1776 N  N   . LEU A 1 240 ? 27.914  15.059 103.896 1.00 18.99  ? 240  LEU A N   1 
ATOM   1777 C  CA  . LEU A 1 240 ? 26.616  15.344 103.332 1.00 18.33  ? 240  LEU A CA  1 
ATOM   1778 C  C   . LEU A 1 240 ? 26.005  16.600 103.847 1.00 20.08  ? 240  LEU A C   1 
ATOM   1779 O  O   . LEU A 1 240 ? 25.543  17.486 103.066 1.00 18.55  ? 240  LEU A O   1 
ATOM   1780 C  CB  . LEU A 1 240 ? 25.618  14.204 103.512 1.00 17.96  ? 240  LEU A CB  1 
ATOM   1781 C  CG  . LEU A 1 240 ? 26.080  12.836 103.034 1.00 17.23  ? 240  LEU A CG  1 
ATOM   1782 C  CD1 . LEU A 1 240 ? 24.948  11.862 103.280 1.00 16.37  ? 240  LEU A CD1 1 
ATOM   1783 C  CD2 . LEU A 1 240 ? 26.588  12.801 101.586 1.00 19.06  ? 240  LEU A CD2 1 
ATOM   1784 N  N   . SER A 1 241 ? 26.010  16.750 105.168 1.00 17.67  ? 241  SER A N   1 
ATOM   1785 C  CA  . SER A 1 241 ? 25.481  17.919 105.748 1.00 16.91  ? 241  SER A CA  1 
ATOM   1786 C  C   . SER A 1 241 ? 26.357  19.181 105.357 1.00 16.53  ? 241  SER A C   1 
ATOM   1787 O  O   . SER A 1 241 ? 25.852  20.256 105.259 1.00 18.57  ? 241  SER A O   1 
ATOM   1788 C  CB  . SER A 1 241 ? 25.513  17.782 107.310 1.00 20.23  ? 241  SER A CB  1 
ATOM   1789 O  OG  . SER A 1 241 ? 24.786  18.904 107.835 1.00 23.12  ? 241  SER A OG  1 
ATOM   1790 N  N   . GLY A 1 242 ? 27.662  19.026 105.255 1.00 16.87  ? 242  GLY A N   1 
ATOM   1791 C  CA  . GLY A 1 242 ? 28.570  20.181 105.089 1.00 16.82  ? 242  GLY A CA  1 
ATOM   1792 C  C   . GLY A 1 242 ? 28.348  20.752 103.686 1.00 17.65  ? 242  GLY A C   1 
ATOM   1793 O  O   . GLY A 1 242 ? 28.188  21.943 103.565 1.00 17.77  ? 242  GLY A O   1 
ATOM   1794 N  N   . ILE A 1 243 ? 28.236  19.900 102.686 1.00 17.09  ? 243  ILE A N   1 
ATOM   1795 C  CA  . ILE A 1 243 ? 28.000  20.370 101.306 1.00 18.30  ? 243  ILE A CA  1 
ATOM   1796 C  C   . ILE A 1 243 ? 26.558  20.862 101.172 1.00 19.88  ? 243  ILE A C   1 
ATOM   1797 O  O   . ILE A 1 243 ? 26.276  21.904 100.571 1.00 18.94  ? 243  ILE A O   1 
ATOM   1798 C  CB  . ILE A 1 243 ? 28.186  19.253 100.265 1.00 22.07  ? 243  ILE A CB  1 
ATOM   1799 C  CG1 . ILE A 1 243 ? 29.599  18.669 100.281 1.00 23.68  ? 243  ILE A CG1 1 
ATOM   1800 C  CG2 . ILE A 1 243 ? 27.768  19.780 98.857  1.00 23.40  ? 243  ILE A CG2 1 
ATOM   1801 C  CD1 . ILE A 1 243 ? 30.731  19.622 100.020 1.00 26.06  ? 243  ILE A CD1 1 
ATOM   1802 N  N   . GLY A 1 244 ? 25.619  20.127 101.770 1.00 19.49  ? 244  GLY A N   1 
ATOM   1803 C  CA  . GLY A 1 244 ? 24.246  20.529 101.759 1.00 20.22  ? 244  GLY A CA  1 
ATOM   1804 C  C   . GLY A 1 244 ? 24.031  21.906 102.295 1.00 21.98  ? 244  GLY A C   1 
ATOM   1805 O  O   . GLY A 1 244 ? 23.284  22.726 101.712 1.00 20.18  ? 244  GLY A O   1 
ATOM   1806 N  N   . PHE A 1 245 ? 24.634  22.221 103.443 1.00 20.28  ? 245  PHE A N   1 
ATOM   1807 C  CA  . PHE A 1 245 ? 24.333  23.505 104.011 1.00 19.59  ? 245  PHE A CA  1 
ATOM   1808 C  C   . PHE A 1 245 ? 25.105  24.653 103.289 1.00 19.65  ? 245  PHE A C   1 
ATOM   1809 O  O   . PHE A 1 245 ? 24.585  25.722 103.149 1.00 19.03  ? 245  PHE A O   1 
ATOM   1810 C  CB  . PHE A 1 245 ? 24.589  23.560 105.538 1.00 21.90  ? 245  PHE A CB  1 
ATOM   1811 C  CG  . PHE A 1 245 ? 25.907  24.129 105.904 1.00 20.78  ? 245  PHE A CG  1 
ATOM   1812 C  CD1 . PHE A 1 245 ? 26.112  25.510 105.924 1.00 22.77  ? 245  PHE A CD1 1 
ATOM   1813 C  CD2 . PHE A 1 245 ? 26.940  23.304 106.294 1.00 22.51  ? 245  PHE A CD2 1 
ATOM   1814 C  CE1 . PHE A 1 245 ? 27.341  26.042 106.296 1.00 21.86  ? 245  PHE A CE1 1 
ATOM   1815 C  CE2 . PHE A 1 245 ? 28.192  23.831 106.630 1.00 22.55  ? 245  PHE A CE2 1 
ATOM   1816 C  CZ  . PHE A 1 245 ? 28.392  25.196 106.655 1.00 20.86  ? 245  PHE A CZ  1 
ATOM   1817 N  N   . GLU A 1 246 ? 26.332  24.435 102.898 1.00 18.16  ? 246  GLU A N   1 
ATOM   1818 C  CA  . GLU A 1 246 ? 27.113  25.510 102.299 1.00 20.38  ? 246  GLU A CA  1 
ATOM   1819 C  C   . GLU A 1 246 ? 26.691  25.811 100.859 1.00 19.55  ? 246  GLU A C   1 
ATOM   1820 O  O   . GLU A 1 246 ? 26.672  26.965 100.454 1.00 18.90  ? 246  GLU A O   1 
ATOM   1821 C  CB  . GLU A 1 246 ? 28.586  25.157 102.280 1.00 23.22  ? 246  GLU A CB  1 
ATOM   1822 C  CG  . GLU A 1 246 ? 29.486  26.285 101.744 1.00 26.24  ? 246  GLU A CG  1 
ATOM   1823 C  CD  . GLU A 1 246 ? 30.936  25.923 101.850 1.00 29.38  ? 246  GLU A CD  1 
ATOM   1824 O  OE1 . GLU A 1 246 ? 31.312  24.814 101.388 1.00 31.51  ? 246  GLU A OE1 1 
ATOM   1825 O  OE2 . GLU A 1 246 ? 31.679  26.701 102.473 1.00 33.84  ? 246  GLU A OE2 1 
ATOM   1826 N  N   . SER A 1 247 ? 26.431  24.751 100.103 1.00 18.26  ? 247  SER A N   1 
ATOM   1827 C  CA  . SER A 1 247 ? 26.179  24.859 98.625  1.00 17.65  ? 247  SER A CA  1 
ATOM   1828 C  C   . SER A 1 247 ? 24.722  24.730 98.291  1.00 20.29  ? 247  SER A C   1 
ATOM   1829 O  O   . SER A 1 247 ? 24.324  25.008 97.131  1.00 16.88  ? 247  SER A O   1 
ATOM   1830 C  CB  . SER A 1 247 ? 27.001  23.848 97.883  1.00 16.64  ? 247  SER A CB  1 
ATOM   1831 O  OG  . SER A 1 247 ? 28.391  24.233 97.827  1.00 17.32  ? 247  SER A OG  1 
ATOM   1832 N  N   . SER A 1 248 ? 23.877  24.345 99.289  1.00 19.00  ? 248  SER A N   1 
ATOM   1833 C  CA  . SER A 1 248 ? 22.476  24.309 99.045  1.00 19.74  ? 248  SER A CA  1 
ATOM   1834 C  C   . SER A 1 248 ? 21.725  25.379 99.781  1.00 24.43  ? 248  SER A C   1 
ATOM   1835 O  O   . SER A 1 248 ? 20.995  26.094 99.141  1.00 24.23  ? 248  SER A O   1 
ATOM   1836 C  CB  . SER A 1 248 ? 21.918  22.869 99.159  1.00 23.01  ? 248  SER A CB  1 
ATOM   1837 O  OG  . SER A 1 248 ? 20.770  22.728 98.356  1.00 20.27  ? 248  SER A OG  1 
ATOM   1838 N  N   . GLY A 1 249 ? 21.926  25.573 101.096 1.00 23.10  ? 249  GLY A N   1 
ATOM   1839 C  CA  . GLY A 1 249 ? 21.445  26.771 101.723 1.00 23.89  ? 249  GLY A CA  1 
ATOM   1840 C  C   . GLY A 1 249 ? 21.039  26.578 103.193 1.00 23.04  ? 249  GLY A C   1 
ATOM   1841 O  O   . GLY A 1 249 ? 20.635  25.494 103.592 1.00 23.90  ? 249  GLY A O   1 
ATOM   1842 N  N   . LEU A 1 250 ? 21.179  27.643 103.963 1.00 21.42  ? 250  LEU A N   1 
ATOM   1843 C  CA  . LEU A 1 250 ? 20.576  27.785 105.339 1.00 20.83  ? 250  LEU A CA  1 
ATOM   1844 C  C   . LEU A 1 250 ? 19.294  28.547 105.286 1.00 21.58  ? 250  LEU A C   1 
ATOM   1845 O  O   . LEU A 1 250 ? 19.113  29.353 104.373 1.00 18.62  ? 250  LEU A O   1 
ATOM   1846 C  CB  . LEU A 1 250 ? 21.560  28.557 106.231 1.00 21.81  ? 250  LEU A CB  1 
ATOM   1847 C  CG  . LEU A 1 250 ? 22.870  27.848 106.516 1.00 20.08  ? 250  LEU A CG  1 
ATOM   1848 C  CD1 . LEU A 1 250 ? 23.783  28.661 107.414 1.00 25.26  ? 250  LEU A CD1 1 
ATOM   1849 C  CD2 . LEU A 1 250 ? 22.657  26.499 107.161 1.00 24.07  ? 250  LEU A CD2 1 
ATOM   1850 N  N   . ALA A 1 251 ? 18.395  28.334 106.266 1.00 15.77  ? 251  ALA A N   1 
ATOM   1851 C  CA  . ALA A 1 251 ? 17.132  29.022 106.259 1.00 16.51  ? 251  ALA A CA  1 
ATOM   1852 C  C   . ALA A 1 251 ? 16.659  29.243 107.691 1.00 16.17  ? 251  ALA A C   1 
ATOM   1853 O  O   . ALA A 1 251 ? 17.469  29.752 108.528 1.00 18.15  ? 251  ALA A O   1 
ATOM   1854 C  CB  . ALA A 1 251 ? 16.123  28.258 105.402 1.00 16.69  ? 251  ALA A CB  1 
ATOM   1855 N  N   . ALA A 1 252 ? 15.424  28.835 108.028 1.00 15.86  ? 252  ALA A N   1 
ATOM   1856 C  CA  . ALA A 1 252 ? 14.895  29.206 109.340 1.00 16.65  ? 252  ALA A CA  1 
ATOM   1857 C  C   . ALA A 1 252 ? 15.617  28.521 110.475 1.00 17.98  ? 252  ALA A C   1 
ATOM   1858 O  O   . ALA A 1 252 ? 15.873  29.175 111.508 1.00 17.48  ? 252  ALA A O   1 
ATOM   1859 C  CB  . ALA A 1 252 ? 13.414  28.996 109.437 1.00 18.16  ? 252  ALA A CB  1 
ATOM   1860 N  N   . ALA A 1 253 ? 15.956  27.233 110.361 1.00 18.71  ? 253  ALA A N   1 
ATOM   1861 C  CA  . ALA A 1 253 ? 16.419  26.498 111.562 1.00 18.09  ? 253  ALA A CA  1 
ATOM   1862 C  C   . ALA A 1 253 ? 17.700  27.091 112.153 1.00 18.32  ? 253  ALA A C   1 
ATOM   1863 O  O   . ALA A 1 253 ? 17.811  27.261 113.382 1.00 18.55  ? 253  ALA A O   1 
ATOM   1864 C  CB  . ALA A 1 253 ? 16.634  25.050 111.261 1.00 16.98  ? 253  ALA A CB  1 
ATOM   1865 N  N   . HIS A 1 254 ? 18.677  27.406 111.307 1.00 16.19  ? 254  HIS A N   1 
ATOM   1866 C  CA  . HIS A 1 254 ? 19.889  28.025 111.784 1.00 17.31  ? 254  HIS A CA  1 
ATOM   1867 C  C   . HIS A 1 254 ? 19.694  29.488 112.256 1.00 19.54  ? 254  HIS A C   1 
ATOM   1868 O  O   . HIS A 1 254 ? 20.386  29.890 113.178 1.00 20.58  ? 254  HIS A O   1 
ATOM   1869 C  CB  . HIS A 1 254 ? 21.068  27.884 110.809 1.00 15.86  ? 254  HIS A CB  1 
ATOM   1870 C  CG  . HIS A 1 254 ? 21.859  26.627 111.009 1.00 15.38  ? 254  HIS A CG  1 
ATOM   1871 N  ND1 . HIS A 1 254 ? 21.422  25.396 110.585 1.00 14.95  ? 254  HIS A ND1 1 
ATOM   1872 C  CD2 . HIS A 1 254 ? 23.066  26.418 111.582 1.00 15.40  ? 254  HIS A CD2 1 
ATOM   1873 C  CE1 . HIS A 1 254 ? 22.304  24.472 110.935 1.00 16.49  ? 254  HIS A CE1 1 
ATOM   1874 N  NE2 . HIS A 1 254 ? 23.321  25.068 111.557 1.00 14.21  ? 254  HIS A NE2 1 
ATOM   1875 N  N   . ALA A 1 255 ? 18.771  30.244 111.646 1.00 19.36  ? 255  ALA A N   1 
ATOM   1876 C  CA  . ALA A 1 255 ? 18.450  31.595 112.084 1.00 19.33  ? 255  ALA A CA  1 
ATOM   1877 C  C   . ALA A 1 255 ? 17.808  31.528 113.506 1.00 19.58  ? 255  ALA A C   1 
ATOM   1878 O  O   . ALA A 1 255 ? 18.068  32.369 114.369 1.00 19.72  ? 255  ALA A O   1 
ATOM   1879 C  CB  . ALA A 1 255 ? 17.459  32.230 111.144 1.00 18.56  ? 255  ALA A CB  1 
ATOM   1880 N  N   . ILE A 1 256 ? 16.957  30.541 113.697 1.00 17.77  ? 256  ILE A N   1 
ATOM   1881 C  CA  . ILE A 1 256 ? 16.302  30.317 115.009 1.00 18.90  ? 256  ILE A CA  1 
ATOM   1882 C  C   . ILE A 1 256 ? 17.331  29.877 116.041 1.00 19.46  ? 256  ILE A C   1 
ATOM   1883 O  O   . ILE A 1 256 ? 17.323  30.408 117.167 1.00 20.98  ? 256  ILE A O   1 
ATOM   1884 C  CB  . ILE A 1 256 ? 15.100  29.384 114.929 1.00 18.84  ? 256  ILE A CB  1 
ATOM   1885 C  CG1 . ILE A 1 256 ? 14.004  30.094 114.212 1.00 18.67  ? 256  ILE A CG1 1 
ATOM   1886 C  CG2 . ILE A 1 256 ? 14.577  28.921 116.332 1.00 18.76  ? 256  ILE A CG2 1 
ATOM   1887 C  CD1 . ILE A 1 256 ? 12.912  29.193 113.752 1.00 18.38  ? 256  ILE A CD1 1 
ATOM   1888 N  N   . HIS A 1 257 ? 18.221  28.966 115.684 1.00 18.19  ? 257  HIS A N   1 
ATOM   1889 C  CA  . HIS A 1 257 ? 19.385  28.687 116.515 1.00 20.39  ? 257  HIS A CA  1 
ATOM   1890 C  C   . HIS A 1 257 ? 20.149  29.948 116.959 1.00 20.94  ? 257  HIS A C   1 
ATOM   1891 O  O   . HIS A 1 257 ? 20.504  30.098 118.161 1.00 16.86  ? 257  HIS A O   1 
ATOM   1892 C  CB  . HIS A 1 257 ? 20.378  27.737 115.846 1.00 21.70  ? 257  HIS A CB  1 
ATOM   1893 C  CG  . HIS A 1 257 ? 21.749  27.771 116.464 1.00 22.89  ? 257  HIS A CG  1 
ATOM   1894 N  ND1 . HIS A 1 257 ? 22.676  28.747 116.166 1.00 24.68  ? 257  HIS A ND1 1 
ATOM   1895 C  CD2 . HIS A 1 257 ? 22.352  26.960 117.363 1.00 23.63  ? 257  HIS A CD2 1 
ATOM   1896 C  CE1 . HIS A 1 257 ? 23.784  28.552 116.858 1.00 24.97  ? 257  HIS A CE1 1 
ATOM   1897 N  NE2 . HIS A 1 257 ? 23.618  27.472 117.603 1.00 25.07  ? 257  HIS A NE2 1 
ATOM   1898 N  N   . ASN A 1 258 ? 20.440  30.826 115.998 1.00 19.35  ? 258  ASN A N   1 
ATOM   1899 C  CA  . ASN A 1 258 ? 21.096  32.087 116.298 1.00 21.64  ? 258  ASN A CA  1 
ATOM   1900 C  C   . ASN A 1 258 ? 20.313  32.952 117.203 1.00 20.75  ? 258  ASN A C   1 
ATOM   1901 O  O   . ASN A 1 258 ? 20.903  33.551 118.090 1.00 20.70  ? 258  ASN A O   1 
ATOM   1902 C  CB  . ASN A 1 258 ? 21.483  32.861 115.052 1.00 20.22  ? 258  ASN A CB  1 
ATOM   1903 C  CG  . ASN A 1 258 ? 22.492  32.134 114.233 1.00 19.50  ? 258  ASN A CG  1 
ATOM   1904 O  OD1 . ASN A 1 258 ? 23.114  31.134 114.650 1.00 23.79  ? 258  ASN A OD1 1 
ATOM   1905 N  ND2 . ASN A 1 258 ? 22.701  32.640 113.039 1.00 23.26  ? 258  ASN A ND2 1 
ATOM   1906 N  N   . GLY A 1 259 ? 18.998  32.966 117.042 1.00 18.71  ? 259  GLY A N   1 
ATOM   1907 C  CA  . GLY A 1 259 ? 18.171  33.742 117.878 1.00 18.89  ? 259  GLY A CA  1 
ATOM   1908 C  C   . GLY A 1 259 ? 18.162  33.259 119.326 1.00 20.95  ? 259  GLY A C   1 
ATOM   1909 O  O   . GLY A 1 259 ? 18.072  34.094 120.243 1.00 21.06  ? 259  GLY A O   1 
ATOM   1910 N  N   . PHE A 1 260 ? 18.263  31.938 119.526 1.00 19.80  ? 260  PHE A N   1 
ATOM   1911 C  CA  . PHE A 1 260 ? 18.298  31.344 120.876 1.00 22.19  ? 260  PHE A CA  1 
ATOM   1912 C  C   . PHE A 1 260 ? 19.572  31.704 121.658 1.00 26.26  ? 260  PHE A C   1 
ATOM   1913 O  O   . PHE A 1 260 ? 19.610  31.607 122.919 1.00 22.15  ? 260  PHE A O   1 
ATOM   1914 C  CB  . PHE A 1 260 ? 18.149  29.824 120.850 1.00 21.22  ? 260  PHE A CB  1 
ATOM   1915 C  CG  . PHE A 1 260 ? 16.753  29.386 120.979 1.00 22.49  ? 260  PHE A CG  1 
ATOM   1916 C  CD1 . PHE A 1 260 ? 16.078  29.487 122.218 1.00 23.04  ? 260  PHE A CD1 1 
ATOM   1917 C  CD2 . PHE A 1 260 ? 16.052  28.901 119.878 1.00 22.89  ? 260  PHE A CD2 1 
ATOM   1918 C  CE1 . PHE A 1 260 ? 14.777  29.106 122.325 1.00 22.02  ? 260  PHE A CE1 1 
ATOM   1919 C  CE2 . PHE A 1 260 ? 14.745  28.524 119.999 1.00 24.33  ? 260  PHE A CE2 1 
ATOM   1920 C  CZ  . PHE A 1 260 ? 14.092  28.626 121.237 1.00 25.45  ? 260  PHE A CZ  1 
ATOM   1921 N  N   . THR A 1 261 ? 20.597  32.128 120.935 1.00 27.76  ? 261  THR A N   1 
ATOM   1922 C  CA  . THR A 1 261 ? 21.841  32.521 121.560 1.00 28.30  ? 261  THR A CA  1 
ATOM   1923 C  C   . THR A 1 261 ? 21.648  33.838 122.337 1.00 27.74  ? 261  THR A C   1 
ATOM   1924 O  O   . THR A 1 261 ? 22.478  34.166 123.119 1.00 29.33  ? 261  THR A O   1 
ATOM   1925 C  CB  . THR A 1 261 ? 23.082  32.551 120.603 1.00 28.92  ? 261  THR A CB  1 
ATOM   1926 O  OG1 . THR A 1 261 ? 22.978  33.649 119.677 1.00 28.82  ? 261  THR A OG1 1 
ATOM   1927 C  CG2 . THR A 1 261 ? 23.212  31.230 119.842 1.00 28.21  ? 261  THR A CG2 1 
ATOM   1928 N  N   . VAL A 1 262 ? 20.546  34.559 122.226 1.00 27.25  ? 262  VAL A N   1 
ATOM   1929 C  CA  . VAL A 1 262 ? 20.370  35.679 123.126 1.00 27.73  ? 262  VAL A CA  1 
ATOM   1930 C  C   . VAL A 1 262 ? 19.837  35.227 124.490 1.00 28.01  ? 262  VAL A C   1 
ATOM   1931 O  O   . VAL A 1 262 ? 19.716  36.057 125.351 1.00 29.28  ? 262  VAL A O   1 
ATOM   1932 C  CB  . VAL A 1 262 ? 19.434  36.772 122.573 1.00 29.53  ? 262  VAL A CB  1 
ATOM   1933 C  CG1 . VAL A 1 262 ? 19.874  37.160 121.167 1.00 32.71  ? 262  VAL A CG1 1 
ATOM   1934 C  CG2 . VAL A 1 262 ? 17.989  36.335 122.599 1.00 27.59  ? 262  VAL A CG2 1 
ATOM   1935 N  N   . LEU A 1 263 ? 19.483  33.948 124.700 1.00 25.68  ? 263  LEU A N   1 
ATOM   1936 C  CA  . LEU A 1 263 ? 18.996  33.559 126.036 1.00 28.69  ? 263  LEU A CA  1 
ATOM   1937 C  C   . LEU A 1 263 ? 20.110  32.869 126.816 1.00 30.65  ? 263  LEU A C   1 
ATOM   1938 O  O   . LEU A 1 263 ? 20.737  31.961 126.297 1.00 28.92  ? 263  LEU A O   1 
ATOM   1939 C  CB  . LEU A 1 263 ? 17.820  32.623 125.951 1.00 25.33  ? 263  LEU A CB  1 
ATOM   1940 C  CG  . LEU A 1 263 ? 16.616  33.156 125.166 1.00 24.08  ? 263  LEU A CG  1 
ATOM   1941 C  CD1 . LEU A 1 263 ? 15.519  32.109 125.206 1.00 22.87  ? 263  LEU A CD1 1 
ATOM   1942 C  CD2 . LEU A 1 263 ? 16.106  34.498 125.694 1.00 23.55  ? 263  LEU A CD2 1 
ATOM   1943 N  N   . GLU A 1 264 ? 20.317  33.241 128.079 1.00 30.60  ? 264  GLU A N   1 
ATOM   1944 C  CA  . GLU A 1 264 ? 21.347  32.535 128.924 1.00 34.19  ? 264  GLU A CA  1 
ATOM   1945 C  C   . GLU A 1 264 ? 20.949  31.069 129.246 1.00 25.54  ? 264  GLU A C   1 
ATOM   1946 O  O   . GLU A 1 264 ? 21.786  30.202 129.312 1.00 27.63  ? 264  GLU A O   1 
ATOM   1947 C  CB  . GLU A 1 264 ? 21.642  33.304 130.240 1.00 38.57  ? 264  GLU A CB  1 
ATOM   1948 C  CG  . GLU A 1 264 ? 22.710  34.388 130.117 1.00 48.14  ? 264  GLU A CG  1 
ATOM   1949 C  CD  . GLU A 1 264 ? 22.463  35.560 131.084 1.00 60.81  ? 264  GLU A CD  1 
ATOM   1950 O  OE1 . GLU A 1 264 ? 22.309  35.327 132.309 1.00 60.32  ? 264  GLU A OE1 1 
ATOM   1951 O  OE2 . GLU A 1 264 ? 22.410  36.729 130.628 1.00 71.36  ? 264  GLU A OE2 1 
ATOM   1952 N  N   . GLU A 1 265 ? 19.673  30.802 129.373 1.00 25.26  ? 265  GLU A N   1 
ATOM   1953 C  CA  . GLU A 1 265 ? 19.194  29.466 129.753 1.00 30.49  ? 265  GLU A CA  1 
ATOM   1954 C  C   . GLU A 1 265 ? 19.692  28.319 128.856 1.00 35.47  ? 265  GLU A C   1 
ATOM   1955 O  O   . GLU A 1 265 ? 19.676  27.193 129.309 1.00 35.81  ? 265  GLU A O   1 
ATOM   1956 C  CB  . GLU A 1 265 ? 17.675  29.430 129.697 1.00 33.35  ? 265  GLU A CB  1 
ATOM   1957 C  CG  . GLU A 1 265 ? 16.925  30.301 130.674 1.00 36.40  ? 265  GLU A CG  1 
ATOM   1958 C  CD  . GLU A 1 265 ? 16.681  31.720 130.189 1.00 37.30  ? 265  GLU A CD  1 
ATOM   1959 O  OE1 . GLU A 1 265 ? 17.427  32.199 129.304 1.00 34.12  ? 265  GLU A OE1 1 
ATOM   1960 O  OE2 . GLU A 1 265 ? 15.783  32.385 130.768 1.00 45.14  ? 265  GLU A OE2 1 
ATOM   1961 N  N   . CYS A 1 266 ? 20.046  28.614 127.591 1.00 35.55  ? 266  CYS A N   1 
ATOM   1962 C  CA  . CYS A 1 266 ? 20.437  27.631 126.547 1.00 42.31  ? 266  CYS A CA  1 
ATOM   1963 C  C   . CYS A 1 266 ? 21.888  27.511 126.311 1.00 48.91  ? 266  CYS A C   1 
ATOM   1964 O  O   . CYS A 1 266 ? 22.292  26.567 125.647 1.00 44.57  ? 266  CYS A O   1 
ATOM   1965 C  CB  . CYS A 1 266 ? 20.002  28.175 125.151 1.00 40.23  ? 266  CYS A CB  1 
ATOM   1966 S  SG  . CYS A 1 266 ? 18.299  28.408 125.175 1.00 45.39  ? 266  CYS A SG  1 
ATOM   1967 N  N   . HIS A 1 267 ? 22.632  28.538 126.750 1.00 55.80  ? 267  HIS A N   1 
ATOM   1968 C  CA  . HIS A 1 267 ? 23.942  28.945 126.186 1.00 51.37  ? 267  HIS A CA  1 
ATOM   1969 C  C   . HIS A 1 267 ? 25.006  27.823 126.250 1.00 47.42  ? 267  HIS A C   1 
ATOM   1970 O  O   . HIS A 1 267 ? 25.980  27.758 125.402 1.00 39.78  ? 267  HIS A O   1 
ATOM   1971 C  CB  . HIS A 1 267 ? 24.409  30.293 126.820 1.00 58.80  ? 267  HIS A CB  1 
ATOM   1972 C  CG  . HIS A 1 267 ? 25.892  30.444 126.913 1.00 68.63  ? 267  HIS A CG  1 
ATOM   1973 N  ND1 . HIS A 1 267 ? 26.658  30.909 125.866 1.00 73.99  ? 267  HIS A ND1 1 
ATOM   1974 C  CD2 . HIS A 1 267 ? 26.761  30.156 127.913 1.00 74.79  ? 267  HIS A CD2 1 
ATOM   1975 C  CE1 . HIS A 1 267 ? 27.934  30.908 126.216 1.00 70.81  ? 267  HIS A CE1 1 
ATOM   1976 N  NE2 . HIS A 1 267 ? 28.024  30.459 127.454 1.00 72.74  ? 267  HIS A NE2 1 
ATOM   1977 N  N   . HIS A 1 268 ? 24.795  26.882 127.171 1.00 35.31  ? 268  HIS A N   1 
ATOM   1978 C  CA  . HIS A 1 268 ? 25.672  25.751 127.200 1.00 26.97  ? 268  HIS A CA  1 
ATOM   1979 C  C   . HIS A 1 268 ? 25.196  24.467 126.477 1.00 36.09  ? 268  HIS A C   1 
ATOM   1980 O  O   . HIS A 1 268 ? 25.985  23.484 126.473 1.00 36.89  ? 268  HIS A O   1 
ATOM   1981 C  CB  . HIS A 1 268 ? 26.091  25.421 128.640 1.00 35.28  ? 268  HIS A CB  1 
ATOM   1982 N  N   . LEU A 1 269 ? 23.966  24.408 125.917 1.00 32.28  ? 269  LEU A N   1 
ATOM   1983 C  CA  . LEU A 1 269 ? 23.482  23.197 125.114 1.00 28.82  ? 269  LEU A CA  1 
ATOM   1984 C  C   . LEU A 1 269 ? 24.377  23.152 123.890 1.00 23.23  ? 269  LEU A C   1 
ATOM   1985 O  O   . LEU A 1 269 ? 24.825  24.176 123.531 1.00 21.73  ? 269  LEU A O   1 
ATOM   1986 C  CB  . LEU A 1 269 ? 22.075  23.409 124.604 1.00 34.92  ? 269  LEU A CB  1 
ATOM   1987 C  CG  . LEU A 1 269 ? 20.918  23.305 125.598 1.00 42.69  ? 269  LEU A CG  1 
ATOM   1988 C  CD1 . LEU A 1 269 ? 19.720  24.014 124.995 1.00 45.33  ? 269  LEU A CD1 1 
ATOM   1989 C  CD2 . LEU A 1 269 ? 20.591  21.837 125.799 1.00 44.05  ? 269  LEU A CD2 1 
ATOM   1990 N  N   . TYR A 1 270 ? 24.581  22.015 123.220 1.00 19.07  ? 270  TYR A N   1 
ATOM   1991 C  CA  . TYR A 1 270 ? 25.450  21.980 122.047 1.00 17.98  ? 270  TYR A CA  1 
ATOM   1992 C  C   . TYR A 1 270 ? 24.681  22.568 120.822 1.00 17.94  ? 270  TYR A C   1 
ATOM   1993 O  O   . TYR A 1 270 ? 23.449  22.595 120.770 1.00 16.22  ? 270  TYR A O   1 
ATOM   1994 C  CB  . TYR A 1 270 ? 25.888  20.608 121.770 1.00 20.06  ? 270  TYR A CB  1 
ATOM   1995 C  CG  . TYR A 1 270 ? 26.796  19.993 122.809 1.00 21.34  ? 270  TYR A CG  1 
ATOM   1996 C  CD1 . TYR A 1 270 ? 27.482  20.758 123.744 1.00 27.85  ? 270  TYR A CD1 1 
ATOM   1997 C  CD2 . TYR A 1 270 ? 26.974  18.648 122.833 1.00 22.04  ? 270  TYR A CD2 1 
ATOM   1998 C  CE1 . TYR A 1 270 ? 28.304  20.148 124.700 1.00 27.09  ? 270  TYR A CE1 1 
ATOM   1999 C  CE2 . TYR A 1 270 ? 27.778  18.023 123.784 1.00 24.36  ? 270  TYR A CE2 1 
ATOM   2000 C  CZ  . TYR A 1 270 ? 28.463  18.776 124.692 1.00 24.17  ? 270  TYR A CZ  1 
ATOM   2001 O  OH  . TYR A 1 270 ? 29.322  18.132 125.570 1.00 28.73  ? 270  TYR A OH  1 
ATOM   2002 N  N   . HIS A 1 271 ? 25.429  23.170 119.946 1.00 18.45  ? 271  HIS A N   1 
ATOM   2003 C  CA  . HIS A 1 271 ? 24.884  23.747 118.693 1.00 17.86  ? 271  HIS A CA  1 
ATOM   2004 C  C   . HIS A 1 271 ? 23.825  22.844 118.061 1.00 15.31  ? 271  HIS A C   1 
ATOM   2005 O  O   . HIS A 1 271 ? 22.735  23.259 117.780 1.00 16.70  ? 271  HIS A O   1 
ATOM   2006 C  CB  . HIS A 1 271 ? 26.072  23.906 117.731 1.00 21.36  ? 271  HIS A CB  1 
ATOM   2007 C  CG  . HIS A 1 271 ? 25.679  24.363 116.373 1.00 21.80  ? 271  HIS A CG  1 
ATOM   2008 N  ND1 . HIS A 1 271 ? 25.334  25.670 116.115 1.00 22.56  ? 271  HIS A ND1 1 
ATOM   2009 C  CD2 . HIS A 1 271 ? 25.597  23.711 115.191 1.00 21.21  ? 271  HIS A CD2 1 
ATOM   2010 C  CE1 . HIS A 1 271 ? 25.046  25.799 114.835 1.00 22.35  ? 271  HIS A CE1 1 
ATOM   2011 N  NE2 . HIS A 1 271 ? 25.213  24.639 114.266 1.00 19.70  ? 271  HIS A NE2 1 
ATOM   2012 N  N   . GLY A 1 272 ? 24.136  21.593 117.823 1.00 16.67  ? 272  GLY A N   1 
ATOM   2013 C  CA  . GLY A 1 272 ? 23.182  20.672 117.150 1.00 16.66  ? 272  GLY A CA  1 
ATOM   2014 C  C   . GLY A 1 272 ? 21.933  20.338 117.893 1.00 18.97  ? 272  GLY A C   1 
ATOM   2015 O  O   . GLY A 1 272 ? 20.900  20.030 117.281 1.00 17.00  ? 272  GLY A O   1 
ATOM   2016 N  N   . GLU A 1 273 ? 21.994  20.384 119.249 1.00 18.52  ? 273  GLU A N   1 
ATOM   2017 C  CA  . GLU A 1 273 ? 20.813  20.260 120.073 1.00 19.28  ? 273  GLU A CA  1 
ATOM   2018 C  C   . GLU A 1 273 ? 19.860  21.411 119.820 1.00 18.69  ? 273  GLU A C   1 
ATOM   2019 O  O   . GLU A 1 273 ? 18.637  21.204 119.624 1.00 22.54  ? 273  GLU A O   1 
ATOM   2020 C  CB  . GLU A 1 273 ? 21.217  20.068 121.570 1.00 19.41  ? 273  GLU A CB  1 
ATOM   2021 C  CG  . GLU A 1 273 ? 22.054  18.750 121.821 1.00 21.53  ? 273  GLU A CG  1 
ATOM   2022 C  CD  . GLU A 1 273 ? 22.815  18.687 123.212 1.00 20.76  ? 273  GLU A CD  1 
ATOM   2023 O  OE1 . GLU A 1 273 ? 22.968  19.708 123.895 1.00 18.96  ? 273  GLU A OE1 1 
ATOM   2024 O  OE2 . GLU A 1 273 ? 23.353  17.607 123.542 1.00 22.28  ? 273  GLU A OE2 1 
ATOM   2025 N  N   . LYS A 1 274 ? 20.390  22.630 119.760 1.00 16.97  ? 274  LYS A N   1 
ATOM   2026 C  CA  . LYS A 1 274 ? 19.548  23.756 119.534 1.00 17.54  ? 274  LYS A CA  1 
ATOM   2027 C  C   . LYS A 1 274 ? 18.999  23.770 118.111 1.00 16.03  ? 274  LYS A C   1 
ATOM   2028 O  O   . LYS A 1 274 ? 17.848  24.190 117.899 1.00 14.78  ? 274  LYS A O   1 
ATOM   2029 C  CB  . LYS A 1 274 ? 20.308  25.039 119.796 1.00 22.22  ? 274  LYS A CB  1 
ATOM   2030 C  CG  . LYS A 1 274 ? 20.520  25.237 121.318 1.00 29.95  ? 274  LYS A CG  1 
ATOM   2031 C  CD  . LYS A 1 274 ? 21.182  26.578 121.666 1.00 34.60  ? 274  LYS A CD  1 
ATOM   2032 C  CE  . LYS A 1 274 ? 22.648  26.559 121.279 1.00 41.03  ? 274  LYS A CE  1 
ATOM   2033 N  NZ  . LYS A 1 274 ? 23.563  26.228 122.402 1.00 48.11  ? 274  LYS A NZ  1 
ATOM   2034 N  N   . VAL A 1 275 ? 19.846  23.360 117.168 1.00 15.83  ? 275  VAL A N   1 
ATOM   2035 C  CA  . VAL A 1 275 ? 19.449  23.354 115.743 1.00 17.56  ? 275  VAL A CA  1 
ATOM   2036 C  C   . VAL A 1 275 ? 18.320  22.341 115.545 1.00 17.02  ? 275  VAL A C   1 
ATOM   2037 O  O   . VAL A 1 275 ? 17.445  22.570 114.769 1.00 17.00  ? 275  VAL A O   1 
ATOM   2038 C  CB  . VAL A 1 275 ? 20.663  23.043 114.838 1.00 17.79  ? 275  VAL A CB  1 
ATOM   2039 C  CG1 . VAL A 1 275 ? 20.274  22.526 113.455 1.00 20.10  ? 275  VAL A CG1 1 
ATOM   2040 C  CG2 . VAL A 1 275 ? 21.572  24.268 114.736 1.00 20.22  ? 275  VAL A CG2 1 
ATOM   2041 N  N   . ALA A 1 276 ? 18.351  21.210 116.232 1.00 16.60  ? 276  ALA A N   1 
ATOM   2042 C  CA  . ALA A 1 276 ? 17.233  20.263 116.152 1.00 15.92  ? 276  ALA A CA  1 
ATOM   2043 C  C   . ALA A 1 276 ? 15.905  20.864 116.494 1.00 15.98  ? 276  ALA A C   1 
ATOM   2044 O  O   . ALA A 1 276 ? 14.892  20.683 115.765 1.00 15.24  ? 276  ALA A O   1 
ATOM   2045 C  CB  . ALA A 1 276 ? 17.485  19.013 117.026 1.00 16.17  ? 276  ALA A CB  1 
ATOM   2046 N  N   . PHE A 1 277 ? 15.845  21.624 117.580 1.00 16.92  ? 277  PHE A N   1 
ATOM   2047 C  CA  . PHE A 1 277 ? 14.617  22.305 117.956 1.00 17.60  ? 277  PHE A CA  1 
ATOM   2048 C  C   . PHE A 1 277 ? 14.228  23.402 116.931 1.00 15.92  ? 277  PHE A C   1 
ATOM   2049 O  O   . PHE A 1 277 ? 13.013  23.622 116.621 1.00 15.03  ? 277  PHE A O   1 
ATOM   2050 C  CB  . PHE A 1 277 ? 14.710  22.925 119.381 1.00 19.59  ? 277  PHE A CB  1 
ATOM   2051 C  CG  . PHE A 1 277 ? 13.402  23.474 119.862 1.00 20.18  ? 277  PHE A CG  1 
ATOM   2052 C  CD1 . PHE A 1 277 ? 12.365  22.626 120.274 1.00 17.95  ? 277  PHE A CD1 1 
ATOM   2053 C  CD2 . PHE A 1 277 ? 13.163  24.822 119.861 1.00 20.77  ? 277  PHE A CD2 1 
ATOM   2054 C  CE1 . PHE A 1 277 ? 11.146  23.121 120.654 1.00 21.13  ? 277  PHE A CE1 1 
ATOM   2055 C  CE2 . PHE A 1 277 ? 11.918  25.304 120.226 1.00 21.77  ? 277  PHE A CE2 1 
ATOM   2056 C  CZ  . PHE A 1 277 ? 10.916  24.468 120.643 1.00 20.74  ? 277  PHE A CZ  1 
ATOM   2057 N  N   . GLY A 1 278 ? 15.227  24.169 116.492 1.00 17.34  ? 278  GLY A N   1 
ATOM   2058 C  CA  . GLY A 1 278 ? 15.049  25.154 115.432 1.00 15.86  ? 278  GLY A CA  1 
ATOM   2059 C  C   . GLY A 1 278 ? 14.451  24.506 114.136 1.00 14.64  ? 278  GLY A C   1 
ATOM   2060 O  O   . GLY A 1 278 ? 13.614  25.099 113.481 1.00 17.27  ? 278  GLY A O   1 
ATOM   2061 N  N   . THR A 1 279 ? 14.819  23.268 113.850 1.00 15.52  ? 279  THR A N   1 
ATOM   2062 C  CA  . THR A 1 279 ? 14.235  22.467 112.717 1.00 15.37  ? 279  THR A CA  1 
ATOM   2063 C  C   . THR A 1 279 ? 12.760  22.197 112.934 1.00 15.99  ? 279  THR A C   1 
ATOM   2064 O  O   . THR A 1 279 ? 11.885  22.451 112.063 1.00 14.23  ? 279  THR A O   1 
ATOM   2065 C  CB  . THR A 1 279 ? 15.032  21.195 112.469 1.00 14.74  ? 279  THR A CB  1 
ATOM   2066 O  OG1 . THR A 1 279 ? 16.384  21.548 112.185 1.00 14.80  ? 279  THR A OG1 1 
ATOM   2067 C  CG2 . THR A 1 279 ? 14.548  20.465 111.353 1.00 16.10  ? 279  THR A CG2 1 
ATOM   2068 N  N   . LEU A 1 280 ? 12.408  21.809 114.170 1.00 14.41  ? 280  LEU A N   1 
ATOM   2069 C  CA  . LEU A 1 280 ? 11.034  21.658 114.515 1.00 15.83  ? 280  LEU A CA  1 
ATOM   2070 C  C   . LEU A 1 280 ? 10.283  22.911 114.373 1.00 15.22  ? 280  LEU A C   1 
ATOM   2071 O  O   . LEU A 1 280 ? 9.163   22.913 113.853 1.00 14.44  ? 280  LEU A O   1 
ATOM   2072 C  CB  . LEU A 1 280 ? 10.896  21.062 115.950 1.00 18.93  ? 280  LEU A CB  1 
ATOM   2073 C  CG  . LEU A 1 280 ? 9.491   20.824 116.488 1.00 23.73  ? 280  LEU A CG  1 
ATOM   2074 C  CD1 . LEU A 1 280 ? 8.748   19.743 115.667 1.00 29.04  ? 280  LEU A CD1 1 
ATOM   2075 C  CD2 . LEU A 1 280 ? 9.502   20.417 117.999 1.00 25.18  ? 280  LEU A CD2 1 
ATOM   2076 N  N   . ALA A 1 281 ? 10.847  24.016 114.842 1.00 14.16  ? 281  ALA A N   1 
ATOM   2077 C  CA  . ALA A 1 281 ? 10.157  25.237 114.680 1.00 15.59  ? 281  ALA A CA  1 
ATOM   2078 C  C   . ALA A 1 281 ? 9.964   25.632 113.182 1.00 14.32  ? 281  ALA A C   1 
ATOM   2079 O  O   . ALA A 1 281 ? 8.928   26.210 112.866 1.00 11.85  ? 281  ALA A O   1 
ATOM   2080 C  CB  . ALA A 1 281 ? 10.849  26.358 115.394 1.00 14.89  ? 281  ALA A CB  1 
ATOM   2081 N  N   . GLN A 1 282 ? 10.980  25.390 112.370 1.00 14.70  ? 282  GLN A N   1 
ATOM   2082 C  CA  . GLN A 1 282 ? 10.882  25.535 110.904 1.00 15.18  ? 282  GLN A CA  1 
ATOM   2083 C  C   . GLN A 1 282 ? 9.718   24.709 110.312 1.00 15.54  ? 282  GLN A C   1 
ATOM   2084 O  O   . GLN A 1 282 ? 8.943   25.238 109.495 1.00 15.83  ? 282  GLN A O   1 
ATOM   2085 C  CB  . GLN A 1 282 ? 12.183  25.224 110.167 1.00 16.31  ? 282  GLN A CB  1 
ATOM   2086 C  CG  . GLN A 1 282 ? 11.986  25.503 108.663 1.00 17.57  ? 282  GLN A CG  1 
ATOM   2087 C  CD  . GLN A 1 282 ? 13.212  25.387 107.808 1.00 17.72  ? 282  GLN A CD  1 
ATOM   2088 O  OE1 . GLN A 1 282 ? 14.318  25.801 108.186 1.00 15.81  ? 282  GLN A OE1 1 
ATOM   2089 N  NE2 . GLN A 1 282 ? 13.020  24.783 106.594 1.00 16.39  ? 282  GLN A NE2 1 
ATOM   2090 N  N   . LEU A 1 283 ? 9.515   23.481 110.777 1.00 17.06  ? 283  LEU A N   1 
ATOM   2091 C  CA  . LEU A 1 283 ? 8.388   22.675 110.322 1.00 16.38  ? 283  LEU A CA  1 
ATOM   2092 C  C   . LEU A 1 283 ? 7.025   23.326 110.573 1.00 16.80  ? 283  LEU A C   1 
ATOM   2093 O  O   . LEU A 1 283 ? 6.179   23.282 109.720 1.00 13.54  ? 283  LEU A O   1 
ATOM   2094 C  CB  . LEU A 1 283 ? 8.393   21.238 110.832 1.00 17.38  ? 283  LEU A CB  1 
ATOM   2095 C  CG  . LEU A 1 283 ? 9.631   20.431 110.628 1.00 17.75  ? 283  LEU A CG  1 
ATOM   2096 C  CD1 . LEU A 1 283 ? 9.504   19.020 111.191 1.00 20.94  ? 283  LEU A CD1 1 
ATOM   2097 C  CD2 . LEU A 1 283 ? 9.997   20.286 109.161 1.00 20.49  ? 283  LEU A CD2 1 
ATOM   2098 N  N   . VAL A 1 284 ? 6.850   23.980 111.719 1.00 15.69  ? 284  VAL A N   1 
ATOM   2099 C  CA  . VAL A 1 284 ? 5.640   24.657 112.014 1.00 16.22  ? 284  VAL A CA  1 
ATOM   2100 C  C   . VAL A 1 284 ? 5.565   25.924 111.170 1.00 15.95  ? 284  VAL A C   1 
ATOM   2101 O  O   . VAL A 1 284 ? 4.507   26.230 110.652 1.00 16.93  ? 284  VAL A O   1 
ATOM   2102 C  CB  . VAL A 1 284 ? 5.592   25.020 113.529 1.00 17.32  ? 284  VAL A CB  1 
ATOM   2103 C  CG1 . VAL A 1 284 ? 4.336   25.833 113.849 1.00 17.12  ? 284  VAL A CG1 1 
ATOM   2104 C  CG2 . VAL A 1 284 ? 5.699   23.724 114.358 1.00 18.94  ? 284  VAL A CG2 1 
ATOM   2105 N  N   . LEU A 1 285 ? 6.678   26.638 111.013 1.00 15.45  ? 285  LEU A N   1 
ATOM   2106 C  CA  . LEU A 1 285 ? 6.699   27.895 110.257 1.00 17.39  ? 285  LEU A CA  1 
ATOM   2107 C  C   . LEU A 1 285 ? 6.192   27.653 108.786 1.00 16.50  ? 285  LEU A C   1 
ATOM   2108 O  O   . LEU A 1 285 ? 5.375   28.395 108.279 1.00 20.25  ? 285  LEU A O   1 
ATOM   2109 C  CB  . LEU A 1 285 ? 8.132   28.487 110.274 1.00 18.93  ? 285  LEU A CB  1 
ATOM   2110 C  CG  . LEU A 1 285 ? 8.294   29.924 109.825 1.00 20.08  ? 285  LEU A CG  1 
ATOM   2111 C  CD1 . LEU A 1 285 ? 7.531   30.931 110.715 1.00 19.44  ? 285  LEU A CD1 1 
ATOM   2112 C  CD2 . LEU A 1 285 ? 9.741   30.327 109.638 1.00 23.07  ? 285  LEU A CD2 1 
ATOM   2113 N  N   . GLN A 1 286 ? 6.669   26.590 108.171 1.00 17.46  ? 286  GLN A N   1 
ATOM   2114 C  CA  . GLN A 1 286 ? 6.311   26.247 106.767 1.00 16.84  ? 286  GLN A CA  1 
ATOM   2115 C  C   . GLN A 1 286 ? 5.138   25.314 106.654 1.00 17.83  ? 286  GLN A C   1 
ATOM   2116 O  O   . GLN A 1 286 ? 4.792   24.887 105.568 1.00 16.99  ? 286  GLN A O   1 
ATOM   2117 C  CB  . GLN A 1 286 ? 7.534   25.630 106.094 1.00 16.93  ? 286  GLN A CB  1 
ATOM   2118 C  CG  . GLN A 1 286 ? 7.945   24.234 106.459 1.00 14.85  ? 286  GLN A CG  1 
ATOM   2119 C  CD  . GLN A 1 286 ? 9.339   23.910 105.949 1.00 17.31  ? 286  GLN A CD  1 
ATOM   2120 O  OE1 . GLN A 1 286 ? 10.219  24.752 105.804 1.00 16.04  ? 286  GLN A OE1 1 
ATOM   2121 N  NE2 . GLN A 1 286 ? 9.535   22.691 105.649 1.00 19.67  ? 286  GLN A NE2 1 
ATOM   2122 N  N   . ASN A 1 287 ? 4.481   25.005 107.783 1.00 19.07  ? 287  ASN A N   1 
ATOM   2123 C  CA  . ASN A 1 287 ? 3.296   24.180 107.842 1.00 17.53  ? 287  ASN A CA  1 
ATOM   2124 C  C   . ASN A 1 287 ? 3.425   22.760 107.295 1.00 16.80  ? 287  ASN A C   1 
ATOM   2125 O  O   . ASN A 1 287 ? 2.537   22.288 106.561 1.00 16.71  ? 287  ASN A O   1 
ATOM   2126 C  CB  . ASN A 1 287 ? 2.114   24.897 107.221 1.00 19.99  ? 287  ASN A CB  1 
ATOM   2127 C  CG  . ASN A 1 287 ? 0.776   24.358 107.714 1.00 22.57  ? 287  ASN A CG  1 
ATOM   2128 O  OD1 . ASN A 1 287 ? 0.577   24.142 108.902 1.00 25.07  ? 287  ASN A OD1 1 
ATOM   2129 N  ND2 . ASN A 1 287 ? -0.076  24.018 106.787 1.00 24.43  ? 287  ASN A ND2 1 
ATOM   2130 N  N   . SER A 1 288 ? 4.519   22.084 107.612 1.00 16.37  ? 288  SER A N   1 
ATOM   2131 C  CA  . SER A 1 288 ? 4.701   20.682 107.278 1.00 16.14  ? 288  SER A CA  1 
ATOM   2132 C  C   . SER A 1 288 ? 3.548   19.875 107.745 1.00 15.35  ? 288  SER A C   1 
ATOM   2133 O  O   . SER A 1 288 ? 2.995   20.166 108.788 1.00 15.68  ? 288  SER A O   1 
ATOM   2134 C  CB  . SER A 1 288 ? 5.966   20.061 107.965 1.00 18.76  ? 288  SER A CB  1 
ATOM   2135 O  OG  . SER A 1 288 ? 7.052   20.774 107.570 1.00 22.10  ? 288  SER A OG  1 
ATOM   2136 N  N   . PRO A 1 289 ? 3.218   18.799 107.033 1.00 16.64  ? 289  PRO A N   1 
ATOM   2137 C  CA  . PRO A 1 289 ? 2.077   18.020 107.483 1.00 18.20  ? 289  PRO A CA  1 
ATOM   2138 C  C   . PRO A 1 289 ? 2.408   17.312 108.821 1.00 17.75  ? 289  PRO A C   1 
ATOM   2139 O  O   . PRO A 1 289 ? 3.586   17.049 109.113 1.00 16.70  ? 289  PRO A O   1 
ATOM   2140 C  CB  . PRO A 1 289 ? 1.871   16.968 106.372 1.00 20.18  ? 289  PRO A CB  1 
ATOM   2141 C  CG  . PRO A 1 289 ? 2.791   17.352 105.240 1.00 22.59  ? 289  PRO A CG  1 
ATOM   2142 C  CD  . PRO A 1 289 ? 3.828   18.304 105.775 1.00 20.61  ? 289  PRO A CD  1 
ATOM   2143 N  N   . MET A 1 290 ? 1.358   16.897 109.514 1.00 19.94  ? 290  MET A N   1 
ATOM   2144 C  CA  . MET A 1 290 ? 1.538   16.257 110.822 1.00 18.76  ? 290  MET A CA  1 
ATOM   2145 C  C   . MET A 1 290 ? 2.410   15.002 110.705 1.00 18.22  ? 290  MET A C   1 
ATOM   2146 O  O   . MET A 1 290 ? 3.239   14.777 111.571 1.00 18.78  ? 290  MET A O   1 
ATOM   2147 C  CB  . MET A 1 290 ? 0.177   15.976 111.493 1.00 19.25  ? 290  MET A CB  1 
ATOM   2148 C  CG  . MET A 1 290 ? 0.354   15.584 112.964 1.00 19.29  ? 290  MET A CG  1 
ATOM   2149 S  SD  . MET A 1 290 ? 1.054   16.979 113.971 1.00 20.79  ? 290  MET A SD  1 
ATOM   2150 C  CE  . MET A 1 290 ? -0.465  17.450 114.783 1.00 21.46  ? 290  MET A CE  1 
ATOM   2151 N  N   . ALA A 1 291 ? 2.248   14.172 109.650 1.00 16.34  ? 291  ALA A N   1 
ATOM   2152 C  CA  . ALA A 1 291 ? 3.046   12.936 109.504 1.00 17.02  ? 291  ALA A CA  1 
ATOM   2153 C  C   . ALA A 1 291 ? 4.560   13.276 109.509 1.00 16.01  ? 291  ALA A C   1 
ATOM   2154 O  O   . ALA A 1 291 ? 5.371   12.587 110.142 1.00 15.43  ? 291  ALA A O   1 
ATOM   2155 C  CB  . ALA A 1 291 ? 2.652   12.119 108.221 1.00 18.88  ? 291  ALA A CB  1 
ATOM   2156 N  N   . GLN A 1 292 ? 4.951   14.344 108.848 1.00 15.76  ? 292  GLN A N   1 
ATOM   2157 C  CA  . GLN A 1 292 ? 6.345   14.742 108.838 1.00 15.25  ? 292  GLN A CA  1 
ATOM   2158 C  C   . GLN A 1 292 ? 6.866   15.294 110.197 1.00 15.16  ? 292  GLN A C   1 
ATOM   2159 O  O   . GLN A 1 292 ? 7.964   15.028 110.585 1.00 12.52  ? 292  GLN A O   1 
ATOM   2160 C  CB  . GLN A 1 292 ? 6.606   15.795 107.802 1.00 17.92  ? 292  GLN A CB  1 
ATOM   2161 C  CG  . GLN A 1 292 ? 8.055   16.245 107.802 1.00 23.69  ? 292  GLN A CG  1 
ATOM   2162 C  CD  . GLN A 1 292 ? 8.622   16.288 106.416 1.00 31.48  ? 292  GLN A CD  1 
ATOM   2163 O  OE1 . GLN A 1 292 ? 9.512   15.544 106.075 1.00 28.64  ? 292  GLN A OE1 1 
ATOM   2164 N  NE2 . GLN A 1 292 ? 8.036   17.133 105.572 1.00 43.93  ? 292  GLN A NE2 1 
ATOM   2165 N  N   . ILE A 1 293 ? 6.043   16.066 110.857 1.00 14.57  ? 293  ILE A N   1 
ATOM   2166 C  CA  . ILE A 1 293 ? 6.314   16.458 112.240 1.00 14.85  ? 293  ILE A CA  1 
ATOM   2167 C  C   . ILE A 1 293 ? 6.470   15.258 113.163 1.00 14.98  ? 293  ILE A C   1 
ATOM   2168 O  O   . ILE A 1 293 ? 7.475   15.195 113.878 1.00 14.21  ? 293  ILE A O   1 
ATOM   2169 C  CB  . ILE A 1 293 ? 5.223   17.415 112.749 1.00 16.65  ? 293  ILE A CB  1 
ATOM   2170 C  CG1 . ILE A 1 293 ? 5.366   18.770 112.016 1.00 17.02  ? 293  ILE A CG1 1 
ATOM   2171 C  CG2 . ILE A 1 293 ? 5.388   17.646 114.245 1.00 19.01  ? 293  ILE A CG2 1 
ATOM   2172 C  CD1 . ILE A 1 293 ? 4.184   19.649 112.214 1.00 16.31  ? 293  ILE A CD1 1 
ATOM   2173 N  N   . GLU A 1 294 ? 5.518   14.332 113.139 1.00 14.51  ? 294  GLU A N   1 
ATOM   2174 C  CA  . GLU A 1 294 ? 5.654   13.050 113.855 1.00 17.63  ? 294  GLU A CA  1 
ATOM   2175 C  C   . GLU A 1 294 ? 6.946   12.297 113.609 1.00 18.43  ? 294  GLU A C   1 
ATOM   2176 O  O   . GLU A 1 294 ? 7.567   11.833 114.573 1.00 17.77  ? 294  GLU A O   1 
ATOM   2177 C  CB  . GLU A 1 294 ? 4.461   12.131 113.638 1.00 18.44  ? 294  GLU A CB  1 
ATOM   2178 C  CG  . GLU A 1 294 ? 3.175   12.698 114.232 1.00 21.93  ? 294  GLU A CG  1 
ATOM   2179 C  CD  . GLU A 1 294 ? 3.059   12.353 115.723 1.00 28.82  ? 294  GLU A CD  1 
ATOM   2180 O  OE1 . GLU A 1 294 ? 3.342   11.193 116.108 1.00 36.31  ? 294  GLU A OE1 1 
ATOM   2181 O  OE2 . GLU A 1 294 ? 2.691   13.245 116.522 1.00 33.82  ? 294  GLU A OE2 1 
ATOM   2182 N  N   . THR A 1 295 ? 7.374   12.175 112.337 1.00 15.55  ? 295  THR A N   1 
ATOM   2183 C  CA  . THR A 1 295 ? 8.584   11.554 112.019 1.00 14.60  ? 295  THR A CA  1 
ATOM   2184 C  C   . THR A 1 295 ? 9.784   12.223 112.661 1.00 15.04  ? 295  THR A C   1 
ATOM   2185 O  O   . THR A 1 295 ? 10.643  11.564 113.240 1.00 13.79  ? 295  THR A O   1 
ATOM   2186 C  CB  . THR A 1 295 ? 8.810   11.568 110.484 1.00 16.60  ? 295  THR A CB  1 
ATOM   2187 O  OG1 . THR A 1 295 ? 7.794   10.789 109.930 1.00 15.25  ? 295  THR A OG1 1 
ATOM   2188 C  CG2 . THR A 1 295 ? 10.099  10.899 110.113 1.00 21.05  ? 295  THR A CG2 1 
ATOM   2189 N  N   . VAL A 1 296 ? 9.796   13.520 112.645 1.00 14.55  ? 296  VAL A N   1 
ATOM   2190 C  CA  . VAL A 1 296 ? 10.909  14.241 113.222 1.00 15.01  ? 296  VAL A CA  1 
ATOM   2191 C  C   . VAL A 1 296 ? 10.852  14.160 114.772 1.00 15.82  ? 296  VAL A C   1 
ATOM   2192 O  O   . VAL A 1 296 ? 11.882  13.932 115.375 1.00 15.17  ? 296  VAL A O   1 
ATOM   2193 C  CB  . VAL A 1 296 ? 10.950  15.652 112.664 1.00 15.22  ? 296  VAL A CB  1 
ATOM   2194 C  CG1 . VAL A 1 296 ? 11.875  16.565 113.472 1.00 16.29  ? 296  VAL A CG1 1 
ATOM   2195 C  CG2 . VAL A 1 296 ? 11.418  15.570 111.216 1.00 16.77  ? 296  VAL A CG2 1 
ATOM   2196 N  N   . LEU A 1 297 ? 9.689   14.383 115.365 1.00 15.61  ? 297  LEU A N   1 
ATOM   2197 C  CA  . LEU A 1 297 ? 9.573   14.227 116.799 1.00 17.14  ? 297  LEU A CA  1 
ATOM   2198 C  C   . LEU A 1 297 ? 10.040  12.842 117.287 1.00 17.34  ? 297  LEU A C   1 
ATOM   2199 O  O   . LEU A 1 297 ? 10.809  12.767 118.239 1.00 17.28  ? 297  LEU A O   1 
ATOM   2200 C  CB  . LEU A 1 297 ? 8.183   14.525 117.233 1.00 15.31  ? 297  LEU A CB  1 
ATOM   2201 C  CG  . LEU A 1 297 ? 7.738   15.969 117.194 1.00 16.19  ? 297  LEU A CG  1 
ATOM   2202 C  CD1 . LEU A 1 297 ? 6.250   16.063 117.435 1.00 17.73  ? 297  LEU A CD1 1 
ATOM   2203 C  CD2 . LEU A 1 297 ? 8.460   16.950 118.119 1.00 18.01  ? 297  LEU A CD2 1 
ATOM   2204 N  N   . ALA A 1 298 ? 9.643   11.763 116.605 1.00 19.32  ? 298  ALA A N   1 
ATOM   2205 C  CA  . ALA A 1 298 ? 10.030  10.424 116.966 1.00 19.59  ? 298  ALA A CA  1 
ATOM   2206 C  C   . ALA A 1 298 ? 11.543  10.212 116.792 1.00 19.35  ? 298  ALA A C   1 
ATOM   2207 O  O   . ALA A 1 298 ? 12.195  9.598  117.622 1.00 16.63  ? 298  ALA A O   1 
ATOM   2208 C  CB  . ALA A 1 298 ? 9.249   9.380  116.160 1.00 19.05  ? 298  ALA A CB  1 
ATOM   2209 N  N   . PHE A 1 299 ? 12.111  10.734 115.718 1.00 16.68  ? 299  PHE A N   1 
ATOM   2210 C  CA  . PHE A 1 299 ? 13.569  10.694 115.564 1.00 16.69  ? 299  PHE A CA  1 
ATOM   2211 C  C   . PHE A 1 299 ? 14.304  11.440 116.690 1.00 16.40  ? 299  PHE A C   1 
ATOM   2212 O  O   . PHE A 1 299 ? 15.195  10.847 117.337 1.00 16.51  ? 299  PHE A O   1 
ATOM   2213 C  CB  . PHE A 1 299 ? 13.987  11.256 114.208 1.00 16.00  ? 299  PHE A CB  1 
ATOM   2214 C  CG  . PHE A 1 299 ? 15.487  11.343 114.028 1.00 16.38  ? 299  PHE A CG  1 
ATOM   2215 C  CD1 . PHE A 1 299 ? 16.208  10.243 113.724 1.00 16.98  ? 299  PHE A CD1 1 
ATOM   2216 C  CD2 . PHE A 1 299 ? 16.131  12.534 114.147 1.00 16.25  ? 299  PHE A CD2 1 
ATOM   2217 C  CE1 . PHE A 1 299 ? 17.580  10.309 113.591 1.00 16.92  ? 299  PHE A CE1 1 
ATOM   2218 C  CE2 . PHE A 1 299 ? 17.485  12.618 113.983 1.00 18.10  ? 299  PHE A CE2 1 
ATOM   2219 C  CZ  . PHE A 1 299 ? 18.214  11.490 113.731 1.00 16.10  ? 299  PHE A CZ  1 
ATOM   2220 N  N   . CYS A 1 300 ? 13.927  12.680 116.965 1.00 15.28  ? 300  CYS A N   1 
ATOM   2221 C  CA  . CYS A 1 300 ? 14.633  13.454 117.984 1.00 16.51  ? 300  CYS A CA  1 
ATOM   2222 C  C   . CYS A 1 300 ? 14.488  12.788 119.366 1.00 18.40  ? 300  CYS A C   1 
ATOM   2223 O  O   . CYS A 1 300 ? 15.486  12.579 120.070 1.00 18.16  ? 300  CYS A O   1 
ATOM   2224 C  CB  . CYS A 1 300 ? 14.089  14.852 118.075 1.00 17.87  ? 300  CYS A CB  1 
ATOM   2225 S  SG  . CYS A 1 300 ? 14.559  15.883 116.640 1.00 17.77  ? 300  CYS A SG  1 
ATOM   2226 N  N   . HIS A 1 301 ? 13.268  12.390 119.683 1.00 20.42  ? 301  HIS A N   1 
ATOM   2227 C  CA  . HIS A 1 301 ? 13.045  11.703 120.970 1.00 22.56  ? 301  HIS A CA  1 
ATOM   2228 C  C   . HIS A 1 301 ? 13.818  10.395 121.051 1.00 20.70  ? 301  HIS A C   1 
ATOM   2229 O  O   . HIS A 1 301 ? 14.452  10.111 122.080 1.00 22.03  ? 301  HIS A O   1 
ATOM   2230 C  CB  . HIS A 1 301 ? 11.571  11.497 121.269 1.00 23.49  ? 301  HIS A CB  1 
ATOM   2231 C  CG  . HIS A 1 301 ? 11.334  10.904 122.631 1.00 28.41  ? 301  HIS A CG  1 
ATOM   2232 N  ND1 . HIS A 1 301 ? 11.463  11.641 123.793 1.00 28.79  ? 301  HIS A ND1 1 
ATOM   2233 C  CD2 . HIS A 1 301 ? 11.087  9.629  123.016 1.00 33.17  ? 301  HIS A CD2 1 
ATOM   2234 C  CE1 . HIS A 1 301 ? 11.249  10.859 124.837 1.00 30.04  ? 301  HIS A CE1 1 
ATOM   2235 N  NE2 . HIS A 1 301 ? 11.016  9.636  124.394 1.00 35.28  ? 301  HIS A NE2 1 
ATOM   2236 N  N   . ARG A 1 302 ? 13.884  9.642  119.982 1.00 24.08  ? 302  ARG A N   1 
ATOM   2237 C  CA  . ARG A 1 302 ? 14.580  8.344  119.960 1.00 29.27  ? 302  ARG A CA  1 
ATOM   2238 C  C   . ARG A 1 302 ? 16.104  8.494  120.077 1.00 29.75  ? 302  ARG A C   1 
ATOM   2239 O  O   . ARG A 1 302 ? 16.741  7.604  120.572 1.00 26.57  ? 302  ARG A O   1 
ATOM   2240 C  CB  . ARG A 1 302 ? 14.243  7.539  118.662 1.00 51.84  ? 302  ARG A CB  1 
ATOM   2241 C  CG  . ARG A 1 302 ? 14.061  5.978  118.731 1.00 60.67  ? 302  ARG A CG  1 
ATOM   2242 C  CD  . ARG A 1 302 ? 13.324  5.436  117.475 1.00 62.66  ? 302  ARG A CD  1 
ATOM   2243 N  NE  . ARG A 1 302 ? 13.903  5.971  116.226 1.00 64.41  ? 302  ARG A NE  1 
ATOM   2244 C  CZ  . ARG A 1 302 ? 13.258  6.578  115.213 1.00 72.78  ? 302  ARG A CZ  1 
ATOM   2245 N  NH1 . ARG A 1 302 ? 11.928  6.743  115.208 1.00 69.59  ? 302  ARG A NH1 1 
ATOM   2246 N  NH2 . ARG A 1 302 ? 13.972  7.021  114.163 1.00 64.29  ? 302  ARG A NH2 1 
ATOM   2247 N  N   . ILE A 1 303 ? 16.715  9.590  119.610 1.00 21.36  ? 303  ILE A N   1 
ATOM   2248 C  CA  . ILE A 1 303 ? 18.113  9.689  119.792 1.00 19.37  ? 303  ILE A CA  1 
ATOM   2249 C  C   . ILE A 1 303 ? 18.534  10.616 120.900 1.00 18.76  ? 303  ILE A C   1 
ATOM   2250 O  O   . ILE A 1 303 ? 19.711  10.643 121.172 1.00 19.45  ? 303  ILE A O   1 
ATOM   2251 C  CB  . ILE A 1 303 ? 18.932  10.031 118.505 1.00 21.66  ? 303  ILE A CB  1 
ATOM   2252 C  CG1 . ILE A 1 303 ? 18.423  11.334 117.922 1.00 21.17  ? 303  ILE A CG1 1 
ATOM   2253 C  CG2 . ILE A 1 303 ? 18.979  8.840  117.563 1.00 22.03  ? 303  ILE A CG2 1 
ATOM   2254 C  CD1 . ILE A 1 303 ? 19.450  11.903 116.938 1.00 25.14  ? 303  ILE A CD1 1 
ATOM   2255 N  N   . GLY A 1 304 ? 17.631  11.394 121.481 1.00 20.68  ? 304  GLY A N   1 
ATOM   2256 C  CA  . GLY A 1 304 ? 17.924  12.250 122.594 1.00 19.76  ? 304  GLY A CA  1 
ATOM   2257 C  C   . GLY A 1 304 ? 18.116  13.707 122.283 1.00 21.52  ? 304  GLY A C   1 
ATOM   2258 O  O   . GLY A 1 304 ? 18.932  14.369 122.935 1.00 20.36  ? 304  GLY A O   1 
ATOM   2259 N  N   . LEU A 1 305 ? 17.417  14.227 121.255 1.00 19.05  ? 305  LEU A N   1 
ATOM   2260 C  CA  . LEU A 1 305 ? 17.475  15.640 120.935 1.00 17.64  ? 305  LEU A CA  1 
ATOM   2261 C  C   . LEU A 1 305 ? 16.252  16.392 121.530 1.00 16.97  ? 305  LEU A C   1 
ATOM   2262 O  O   . LEU A 1 305 ? 15.169  15.844 121.630 1.00 17.98  ? 305  LEU A O   1 
ATOM   2263 C  CB  . LEU A 1 305 ? 17.503  15.804 119.383 1.00 16.78  ? 305  LEU A CB  1 
ATOM   2264 C  CG  . LEU A 1 305 ? 18.708  15.321 118.605 1.00 15.81  ? 305  LEU A CG  1 
ATOM   2265 C  CD1 . LEU A 1 305 ? 18.533  15.316 117.078 1.00 17.45  ? 305  LEU A CD1 1 
ATOM   2266 C  CD2 . LEU A 1 305 ? 19.849  16.214 118.981 1.00 16.33  ? 305  LEU A CD2 1 
ATOM   2267 N  N   . PRO A 1 306 ? 16.414  17.632 121.927 1.00 19.87  ? 306  PRO A N   1 
ATOM   2268 C  CA  . PRO A 1 306 ? 15.256  18.338 122.524 1.00 19.67  ? 306  PRO A CA  1 
ATOM   2269 C  C   . PRO A 1 306 ? 14.074  18.673 121.636 1.00 20.26  ? 306  PRO A C   1 
ATOM   2270 O  O   . PRO A 1 306 ? 14.258  19.221 120.510 1.00 19.35  ? 306  PRO A O   1 
ATOM   2271 C  CB  . PRO A 1 306 ? 15.828  19.654 122.956 1.00 20.58  ? 306  PRO A CB  1 
ATOM   2272 C  CG  . PRO A 1 306 ? 17.045  19.848 122.114 1.00 23.55  ? 306  PRO A CG  1 
ATOM   2273 C  CD  . PRO A 1 306 ? 17.559  18.517 121.694 1.00 22.15  ? 306  PRO A CD  1 
ATOM   2274 N  N   . ILE A 1 307 ? 12.868  18.447 122.153 1.00 17.33  ? 307  ILE A N   1 
ATOM   2275 C  CA  . ILE A 1 307 ? 11.646  18.727 121.417 1.00 18.54  ? 307  ILE A CA  1 
ATOM   2276 C  C   . ILE A 1 307 ? 10.715  19.677 122.165 1.00 18.27  ? 307  ILE A C   1 
ATOM   2277 O  O   . ILE A 1 307 ? 9.590   19.853 121.752 1.00 15.90  ? 307  ILE A O   1 
ATOM   2278 C  CB  . ILE A 1 307 ? 10.944  17.406 121.029 1.00 19.19  ? 307  ILE A CB  1 
ATOM   2279 C  CG1 . ILE A 1 307 ? 10.552  16.578 122.267 1.00 20.72  ? 307  ILE A CG1 1 
ATOM   2280 C  CG2 . ILE A 1 307 ? 11.851  16.501 120.155 1.00 22.38  ? 307  ILE A CG2 1 
ATOM   2281 C  CD1 . ILE A 1 307 ? 9.653   15.428 121.954 1.00 21.41  ? 307  ILE A CD1 1 
ATOM   2282 N  N   . THR A 1 308 ? 11.202  20.328 123.244 1.00 17.04  ? 308  THR A N   1 
ATOM   2283 C  CA  . THR A 1 308 ? 10.431  21.343 123.962 1.00 15.96  ? 308  THR A CA  1 
ATOM   2284 C  C   . THR A 1 308 ? 11.338  22.446 124.518 1.00 16.15  ? 308  THR A C   1 
ATOM   2285 O  O   . THR A 1 308 ? 12.527  22.243 124.643 1.00 16.15  ? 308  THR A O   1 
ATOM   2286 C  CB  . THR A 1 308 ? 9.668   20.736 125.220 1.00 19.47  ? 308  THR A CB  1 
ATOM   2287 O  OG1 . THR A 1 308 ? 10.640  20.107 126.067 1.00 18.24  ? 308  THR A OG1 1 
ATOM   2288 C  CG2 . THR A 1 308 ? 8.701   19.672 124.814 1.00 18.73  ? 308  THR A CG2 1 
ATOM   2289 N  N   . LEU A 1 309 ? 10.739  23.581 124.855 1.00 15.07  ? 309  LEU A N   1 
ATOM   2290 C  CA  . LEU A 1 309 ? 11.447  24.637 125.453 1.00 16.57  ? 309  LEU A CA  1 
ATOM   2291 C  C   . LEU A 1 309 ? 12.007  24.186 126.782 1.00 16.34  ? 309  LEU A C   1 
ATOM   2292 O  O   . LEU A 1 309 ? 13.135  24.562 127.100 1.00 20.48  ? 309  LEU A O   1 
ATOM   2293 C  CB  . LEU A 1 309 ? 10.588  25.880 125.598 1.00 17.69  ? 309  LEU A CB  1 
ATOM   2294 C  CG  . LEU A 1 309 ? 10.308  26.572 124.229 1.00 17.01  ? 309  LEU A CG  1 
ATOM   2295 C  CD1 . LEU A 1 309 ? 9.204   27.528 124.380 1.00 18.12  ? 309  LEU A CD1 1 
ATOM   2296 C  CD2 . LEU A 1 309 ? 11.542  27.267 123.750 1.00 16.52  ? 309  LEU A CD2 1 
ATOM   2297 N  N   . ALA A 1 310 ? 11.273  23.394 127.524 1.00 17.88  ? 310  ALA A N   1 
ATOM   2298 C  CA  . ALA A 1 310 ? 11.819  22.968 128.816 1.00 18.58  ? 310  ALA A CA  1 
ATOM   2299 C  C   . ALA A 1 310 ? 13.087  22.145 128.632 1.00 20.45  ? 310  ALA A C   1 
ATOM   2300 O  O   . ALA A 1 310 ? 14.049  22.302 129.378 1.00 21.25  ? 310  ALA A O   1 
ATOM   2301 C  CB  . ALA A 1 310 ? 10.758  22.252 129.654 1.00 17.78  ? 310  ALA A CB  1 
ATOM   2302 N  N   . GLU A 1 311 ? 13.183  21.300 127.603 1.00 20.60  ? 311  GLU A N   1 
ATOM   2303 C  CA  . GLU A 1 311 ? 14.435  20.589 127.383 1.00 21.02  ? 311  GLU A CA  1 
ATOM   2304 C  C   . GLU A 1 311 ? 15.540  21.490 126.902 1.00 24.01  ? 311  GLU A C   1 
ATOM   2305 O  O   . GLU A 1 311 ? 16.678  21.144 126.942 1.00 30.88  ? 311  GLU A O   1 
ATOM   2306 C  CB  . GLU A 1 311 ? 14.285  19.479 126.381 1.00 22.44  ? 311  GLU A CB  1 
ATOM   2307 C  CG  . GLU A 1 311 ? 13.350  18.396 126.844 1.00 24.16  ? 311  GLU A CG  1 
ATOM   2308 C  CD  . GLU A 1 311 ? 12.983  17.449 125.650 1.00 28.29  ? 311  GLU A CD  1 
ATOM   2309 O  OE1 . GLU A 1 311 ? 12.425  17.874 124.696 1.00 26.39  ? 311  GLU A OE1 1 
ATOM   2310 O  OE2 . GLU A 1 311 ? 13.287  16.310 125.609 1.00 29.60  ? 311  GLU A OE2 1 
ATOM   2311 N  N   . MET A 1 312 ? 15.222  22.660 126.447 1.00 20.20  ? 312  MET A N   1 
ATOM   2312 C  CA  . MET A 1 312 ? 16.265  23.635 126.263 1.00 27.20  ? 312  MET A CA  1 
ATOM   2313 C  C   . MET A 1 312 ? 16.534  24.593 127.457 1.00 27.77  ? 312  MET A C   1 
ATOM   2314 O  O   . MET A 1 312 ? 17.214  25.599 127.283 1.00 29.51  ? 312  MET A O   1 
ATOM   2315 C  CB  . MET A 1 312 ? 15.811  24.450 125.147 1.00 27.69  ? 312  MET A CB  1 
ATOM   2316 C  CG  . MET A 1 312 ? 15.362  23.430 124.115 1.00 35.33  ? 312  MET A CG  1 
ATOM   2317 S  SD  . MET A 1 312 ? 15.407  24.360 122.672 1.00 40.70  ? 312  MET A SD  1 
ATOM   2318 C  CE  . MET A 1 312 ? 17.047  24.165 122.383 1.00 23.31  ? 312  MET A CE  1 
ATOM   2319 N  N   . GLY A 1 313 ? 15.869  24.354 128.579 1.00 26.56  ? 313  GLY A N   1 
ATOM   2320 C  CA  . GLY A 1 313 ? 16.172  25.085 129.825 1.00 23.52  ? 313  GLY A CA  1 
ATOM   2321 C  C   . GLY A 1 313 ? 15.253  26.243 130.004 1.00 20.67  ? 313  GLY A C   1 
ATOM   2322 O  O   . GLY A 1 313 ? 15.426  27.033 130.957 1.00 20.20  ? 313  GLY A O   1 
ATOM   2323 N  N   . VAL A 1 314 ? 14.322  26.446 129.055 1.00 17.99  ? 314  VAL A N   1 
ATOM   2324 C  CA  . VAL A 1 314 ? 13.427  27.613 129.078 1.00 18.80  ? 314  VAL A CA  1 
ATOM   2325 C  C   . VAL A 1 314 ? 12.053  27.256 129.689 1.00 18.90  ? 314  VAL A C   1 
ATOM   2326 O  O   . VAL A 1 314 ? 11.405  26.343 129.180 1.00 20.76  ? 314  VAL A O   1 
ATOM   2327 C  CB  . VAL A 1 314 ? 13.209  28.145 127.640 1.00 22.59  ? 314  VAL A CB  1 
ATOM   2328 C  CG1 . VAL A 1 314 ? 12.179  29.256 127.618 1.00 21.85  ? 314  VAL A CG1 1 
ATOM   2329 C  CG2 . VAL A 1 314 ? 14.529  28.603 127.061 1.00 23.43  ? 314  VAL A CG2 1 
ATOM   2330 N  N   . SER A 1 315 ? 11.608  27.973 130.750 1.00 18.67  ? 315  SER A N   1 
ATOM   2331 C  CA  A SER A 1 315 ? 10.320  27.687 131.453 0.85 18.49  ? 315  SER A CA  1 
ATOM   2332 C  CA  B SER A 1 315 ? 10.327  27.651 131.379 0.15 18.79  ? 315  SER A CA  1 
ATOM   2333 C  C   . SER A 1 315 ? 9.654   28.943 131.819 1.00 19.44  ? 315  SER A C   1 
ATOM   2334 O  O   . SER A 1 315 ? 10.241  29.987 131.734 1.00 23.34  ? 315  SER A O   1 
ATOM   2335 C  CB  A SER A 1 315 ? 10.556  26.902 132.767 0.85 19.81  ? 315  SER A CB  1 
ATOM   2336 C  CB  B SER A 1 315 ? 10.521  26.676 132.565 0.15 17.88  ? 315  SER A CB  1 
ATOM   2337 O  OG  A SER A 1 315 ? 11.392  27.658 133.682 0.85 15.94  ? 315  SER A OG  1 
ATOM   2338 O  OG  B SER A 1 315 ? 11.481  25.647 132.296 0.15 15.39  ? 315  SER A OG  1 
ATOM   2339 N  N   . GLY A 1 316 ? 8.439   28.827 132.314 1.00 24.77  ? 316  GLY A N   1 
ATOM   2340 C  CA  . GLY A 1 316 ? 7.663   29.964 132.777 1.00 30.87  ? 316  GLY A CA  1 
ATOM   2341 C  C   . GLY A 1 316 ? 7.040   30.741 131.635 1.00 34.81  ? 316  GLY A C   1 
ATOM   2342 O  O   . GLY A 1 316 ? 6.772   30.190 130.554 1.00 34.95  ? 316  GLY A O   1 
ATOM   2343 N  N   . ASP A 1 317 ? 6.839   32.025 131.877 1.00 35.74  ? 317  ASP A N   1 
ATOM   2344 C  CA  . ASP A 1 317 ? 6.199   32.884 130.905 1.00 37.32  ? 317  ASP A CA  1 
ATOM   2345 C  C   . ASP A 1 317 ? 7.305   33.373 130.011 1.00 34.65  ? 317  ASP A C   1 
ATOM   2346 O  O   . ASP A 1 317 ? 7.912   34.434 130.231 1.00 33.31  ? 317  ASP A O   1 
ATOM   2347 C  CB  . ASP A 1 317 ? 5.438   34.036 131.550 1.00 44.79  ? 317  ASP A CB  1 
ATOM   2348 C  CG  . ASP A 1 317 ? 4.714   34.921 130.507 1.00 50.24  ? 317  ASP A CG  1 
ATOM   2349 O  OD1 . ASP A 1 317 ? 4.897   34.694 129.299 1.00 47.17  ? 317  ASP A OD1 1 
ATOM   2350 O  OD2 . ASP A 1 317 ? 3.966   35.837 130.904 1.00 57.68  ? 317  ASP A OD2 1 
ATOM   2351 N  N   . ALA A 1 318 ? 7.538   32.585 128.974 1.00 32.46  ? 318  ALA A N   1 
ATOM   2352 C  CA  . ALA A 1 318 ? 8.649   32.827 128.077 1.00 35.19  ? 318  ALA A CA  1 
ATOM   2353 C  C   . ALA A 1 318 ? 8.200   33.643 126.845 1.00 39.69  ? 318  ALA A C   1 
ATOM   2354 O  O   . ALA A 1 318 ? 8.935   33.717 125.847 1.00 33.52  ? 318  ALA A O   1 
ATOM   2355 C  CB  . ALA A 1 318 ? 9.246   31.500 127.646 1.00 35.37  ? 318  ALA A CB  1 
ATOM   2356 N  N   . VAL A 1 319 ? 7.023   34.267 126.945 1.00 34.45  ? 319  VAL A N   1 
ATOM   2357 C  CA  . VAL A 1 319 ? 6.446   35.025 125.839 1.00 36.85  ? 319  VAL A CA  1 
ATOM   2358 C  C   . VAL A 1 319 ? 7.406   36.080 125.316 1.00 33.41  ? 319  VAL A C   1 
ATOM   2359 O  O   . VAL A 1 319 ? 7.640   36.168 124.092 1.00 28.09  ? 319  VAL A O   1 
ATOM   2360 C  CB  . VAL A 1 319 ? 5.090   35.657 126.246 1.00 36.57  ? 319  VAL A CB  1 
ATOM   2361 C  CG1 . VAL A 1 319 ? 4.594   36.623 125.185 1.00 39.32  ? 319  VAL A CG1 1 
ATOM   2362 C  CG2 . VAL A 1 319 ? 4.061   34.562 126.379 1.00 38.09  ? 319  VAL A CG2 1 
ATOM   2363 N  N   . GLU A 1 320 ? 7.956   36.858 126.241 1.00 26.21  ? 320  GLU A N   1 
ATOM   2364 C  CA  . GLU A 1 320 ? 8.901   37.915 125.951 1.00 33.40  ? 320  GLU A CA  1 
ATOM   2365 C  C   . GLU A 1 320 ? 10.246  37.393 125.515 1.00 31.12  ? 320  GLU A C   1 
ATOM   2366 O  O   . GLU A 1 320 ? 10.926  38.033 124.718 1.00 30.97  ? 320  GLU A O   1 
ATOM   2367 C  CB  . GLU A 1 320 ? 9.065   38.819 127.215 1.00 40.76  ? 320  GLU A CB  1 
ATOM   2368 C  CG  . GLU A 1 320 ? 10.414  39.556 127.410 1.00 51.33  ? 320  GLU A CG  1 
ATOM   2369 C  CD  . GLU A 1 320 ? 10.540  40.439 128.717 1.00 69.38  ? 320  GLU A CD  1 
ATOM   2370 O  OE1 . GLU A 1 320 ? 11.394  40.110 129.597 1.00 73.86  ? 320  GLU A OE1 1 
ATOM   2371 O  OE2 . GLU A 1 320 ? 9.827   41.487 128.877 1.00 69.40  ? 320  GLU A OE2 1 
ATOM   2372 N  N   . LYS A 1 321 ? 10.722  36.321 126.143 1.00 27.51  ? 321  LYS A N   1 
ATOM   2373 C  CA  . LYS A 1 321 ? 12.018  35.760 125.760 1.00 26.72  ? 321  LYS A CA  1 
ATOM   2374 C  C   . LYS A 1 321 ? 11.948  35.185 124.321 1.00 22.89  ? 321  LYS A C   1 
ATOM   2375 O  O   . LYS A 1 321 ? 12.922  35.330 123.560 1.00 22.99  ? 321  LYS A O   1 
ATOM   2376 C  CB  . LYS A 1 321 ? 12.445  34.624 126.675 1.00 27.99  ? 321  LYS A CB  1 
ATOM   2377 C  CG  . LYS A 1 321 ? 12.910  35.093 128.075 1.00 31.29  ? 321  LYS A CG  1 
ATOM   2378 C  CD  . LYS A 1 321 ? 12.960  33.842 128.956 1.00 36.86  ? 321  LYS A CD  1 
ATOM   2379 C  CE  . LYS A 1 321 ? 13.306  34.172 130.406 1.00 44.33  ? 321  LYS A CE  1 
ATOM   2380 N  NZ  . LYS A 1 321 ? 14.682  34.727 130.476 1.00 42.60  ? 321  LYS A NZ  1 
ATOM   2381 N  N   . ILE A 1 322 ? 10.851  34.518 123.994 1.00 22.13  ? 322  ILE A N   1 
ATOM   2382 C  CA  . ILE A 1 322 ? 10.730  33.928 122.650 1.00 20.48  ? 322  ILE A CA  1 
ATOM   2383 C  C   . ILE A 1 322 ? 10.548  35.079 121.603 1.00 21.64  ? 322  ILE A C   1 
ATOM   2384 O  O   . ILE A 1 322 ? 11.009  34.956 120.444 1.00 22.61  ? 322  ILE A O   1 
ATOM   2385 C  CB  . ILE A 1 322 ? 9.664   32.831 122.623 1.00 20.63  ? 322  ILE A CB  1 
ATOM   2386 C  CG1 . ILE A 1 322 ? 10.056  31.666 123.575 1.00 21.84  ? 322  ILE A CG1 1 
ATOM   2387 C  CG2 . ILE A 1 322 ? 9.520   32.284 121.206 1.00 18.68  ? 322  ILE A CG2 1 
ATOM   2388 C  CD1 . ILE A 1 322 ? 11.542  31.252 123.466 1.00 19.07  ? 322  ILE A CD1 1 
ATOM   2389 N  N   . MET A 1 323 ? 9.917   36.195 121.986 1.00 20.14  ? 323  MET A N   1 
ATOM   2390 C  CA  . MET A 1 323 ? 9.843   37.368 121.098 1.00 22.68  ? 323  MET A CA  1 
ATOM   2391 C  C   . MET A 1 323 ? 11.209  37.948 120.833 1.00 24.13  ? 323  MET A C   1 
ATOM   2392 O  O   . MET A 1 323 ? 11.516  38.271 119.698 1.00 23.74  ? 323  MET A O   1 
ATOM   2393 C  CB  . MET A 1 323 ? 8.851   38.469 121.593 1.00 26.34  ? 323  MET A CB  1 
ATOM   2394 C  CG  . MET A 1 323 ? 8.614   39.546 120.545 1.00 29.29  ? 323  MET A CG  1 
ATOM   2395 S  SD  . MET A 1 323 ? 7.937   38.904 118.939 1.00 35.67  ? 323  MET A SD  1 
ATOM   2396 C  CE  . MET A 1 323 ? 6.204   38.987 119.274 1.00 37.66  ? 323  MET A CE  1 
ATOM   2397 N  N   . ALA A 1 324 ? 12.083  37.969 121.842 1.00 22.52  ? 324  ALA A N   1 
ATOM   2398 C  CA  . ALA A 1 324 ? 13.482  38.307 121.651 1.00 21.12  ? 324  ALA A CA  1 
ATOM   2399 C  C   . ALA A 1 324 ? 14.237  37.325 120.744 1.00 21.02  ? 324  ALA A C   1 
ATOM   2400 O  O   . ALA A 1 324 ? 15.035  37.743 119.881 1.00 21.83  ? 324  ALA A O   1 
ATOM   2401 C  CB  . ALA A 1 324 ? 14.211  38.395 122.995 1.00 23.36  ? 324  ALA A CB  1 
ATOM   2402 N  N   . VAL A 1 325 ? 14.008  36.032 120.934 1.00 18.26  ? 325  VAL A N   1 
ATOM   2403 C  CA  . VAL A 1 325 ? 14.583  34.998 120.005 1.00 19.63  ? 325  VAL A CA  1 
ATOM   2404 C  C   . VAL A 1 325 ? 14.139  35.299 118.581 1.00 19.13  ? 325  VAL A C   1 
ATOM   2405 O  O   . VAL A 1 325 ? 14.966  35.336 117.694 1.00 18.58  ? 325  VAL A O   1 
ATOM   2406 C  CB  . VAL A 1 325 ? 14.246  33.584 120.448 1.00 20.86  ? 325  VAL A CB  1 
ATOM   2407 C  CG1 . VAL A 1 325 ? 14.581  32.529 119.370 1.00 19.82  ? 325  VAL A CG1 1 
ATOM   2408 C  CG2 . VAL A 1 325 ? 14.926  33.309 121.785 1.00 21.67  ? 325  VAL A CG2 1 
ATOM   2409 N  N   . ALA A 1 326 ? 12.846  35.557 118.430 1.00 19.51  ? 326  ALA A N   1 
ATOM   2410 C  CA  . ALA A 1 326 ? 12.205  35.771 117.121 1.00 20.53  ? 326  ALA A CA  1 
ATOM   2411 C  C   . ALA A 1 326 ? 12.714  37.013 116.417 1.00 22.97  ? 326  ALA A C   1 
ATOM   2412 O  O   . ALA A 1 326 ? 12.999  36.975 115.228 1.00 22.48  ? 326  ALA A O   1 
ATOM   2413 C  CB  . ALA A 1 326 ? 10.730  35.836 117.310 1.00 18.69  ? 326  ALA A CB  1 
ATOM   2414 N  N   . GLN A 1 327 ? 12.898  38.113 117.160 1.00 22.84  ? 327  GLN A N   1 
ATOM   2415 C  CA  . GLN A 1 327 ? 13.472  39.335 116.590 1.00 24.75  ? 327  GLN A CA  1 
ATOM   2416 C  C   . GLN A 1 327 ? 14.885  39.131 116.113 1.00 21.70  ? 327  GLN A C   1 
ATOM   2417 O  O   . GLN A 1 327 ? 15.262  39.539 115.020 1.00 24.65  ? 327  GLN A O   1 
ATOM   2418 C  CB  . GLN A 1 327 ? 13.442  40.463 117.633 1.00 27.67  ? 327  GLN A CB  1 
ATOM   2419 C  CG  . GLN A 1 327 ? 12.048  40.927 117.949 1.00 31.29  ? 327  GLN A CG  1 
ATOM   2420 C  CD  . GLN A 1 327 ? 11.480  41.869 116.886 1.00 36.35  ? 327  GLN A CD  1 
ATOM   2421 O  OE1 . GLN A 1 327 ? 12.158  42.278 115.935 1.00 36.77  ? 327  GLN A OE1 1 
ATOM   2422 N  NE2 . GLN A 1 327 ? 10.211  42.196 117.035 1.00 44.80  ? 327  GLN A NE2 1 
ATOM   2423 N  N   . ALA A 1 328 ? 15.692  38.471 116.919 1.00 21.89  ? 328  ALA A N   1 
ATOM   2424 C  CA  . ALA A 1 328 ? 17.050  38.217 116.568 1.00 23.05  ? 328  ALA A CA  1 
ATOM   2425 C  C   . ALA A 1 328 ? 17.102  37.269 115.336 1.00 22.70  ? 328  ALA A C   1 
ATOM   2426 O  O   . ALA A 1 328 ? 17.996  37.388 114.524 1.00 23.74  ? 328  ALA A O   1 
ATOM   2427 C  CB  . ALA A 1 328 ? 17.795  37.607 117.714 1.00 23.25  ? 328  ALA A CB  1 
ATOM   2428 N  N   . SER A 1 329 ? 16.174  36.314 115.234 1.00 21.94  ? 329  SER A N   1 
ATOM   2429 C  CA  . SER A 1 329 ? 16.246  35.340 114.118 1.00 23.20  ? 329  SER A CA  1 
ATOM   2430 C  C   . SER A 1 329 ? 15.910  36.026 112.807 1.00 22.91  ? 329  SER A C   1 
ATOM   2431 O  O   . SER A 1 329 ? 16.320  35.530 111.761 1.00 21.02  ? 329  SER A O   1 
ATOM   2432 C  CB  . SER A 1 329 ? 15.308  34.163 114.341 1.00 24.85  ? 329  SER A CB  1 
ATOM   2433 O  OG  . SER A 1 329 ? 13.966  34.563 114.115 1.00 28.70  ? 329  SER A OG  1 
ATOM   2434 N  N   . CYS A 1 330 ? 15.112  37.110 112.883 1.00 20.35  ? 330  CYS A N   1 
ATOM   2435 C  CA  . CYS A 1 330 ? 14.687  37.883 111.730 1.00 23.26  ? 330  CYS A CA  1 
ATOM   2436 C  C   . CYS A 1 330 ? 15.565  39.114 111.401 1.00 25.43  ? 330  CYS A C   1 
ATOM   2437 O  O   . CYS A 1 330 ? 15.199  39.859 110.545 1.00 26.06  ? 330  CYS A O   1 
ATOM   2438 C  CB  . CYS A 1 330 ? 13.243  38.315 111.866 1.00 22.28  ? 330  CYS A CB  1 
ATOM   2439 S  SG  . CYS A 1 330 ? 12.069  36.924 111.870 1.00 25.22  ? 330  CYS A SG  1 
ATOM   2440 N  N   . ALA A 1 331 ? 16.728  39.265 112.024 1.00 26.33  ? 331  ALA A N   1 
ATOM   2441 C  CA  . ALA A 1 331 ? 17.568  40.427 111.790 1.00 33.88  ? 331  ALA A CA  1 
ATOM   2442 C  C   . ALA A 1 331 ? 17.901  40.469 110.309 1.00 37.40  ? 331  ALA A C   1 
ATOM   2443 O  O   . ALA A 1 331 ? 17.767  39.451 109.602 1.00 32.24  ? 331  ALA A O   1 
ATOM   2444 C  CB  . ALA A 1 331 ? 18.845  40.370 112.603 1.00 32.89  ? 331  ALA A CB  1 
ATOM   2445 N  N   . ALA A 1 332 ? 18.280  41.661 109.837 1.00 38.58  ? 332  ALA A N   1 
ATOM   2446 C  CA  . ALA A 1 332 ? 18.635  41.853 108.440 1.00 38.73  ? 332  ALA A CA  1 
ATOM   2447 C  C   . ALA A 1 332 ? 19.824  40.975 108.182 1.00 33.48  ? 332  ALA A C   1 
ATOM   2448 O  O   . ALA A 1 332 ? 20.747  40.901 109.000 1.00 36.25  ? 332  ALA A O   1 
ATOM   2449 C  CB  . ALA A 1 332 ? 19.001  43.315 108.134 1.00 41.70  ? 332  ALA A CB  1 
ATOM   2450 N  N   . GLY A 1 333 ? 19.800  40.291 107.056 1.00 32.07  ? 333  GLY A N   1 
ATOM   2451 C  CA  . GLY A 1 333 ? 20.936  39.482 106.701 1.00 32.04  ? 333  GLY A CA  1 
ATOM   2452 C  C   . GLY A 1 333 ? 20.816  38.048 107.218 1.00 32.90  ? 333  GLY A C   1 
ATOM   2453 O  O   . GLY A 1 333 ? 21.637  37.188 106.830 1.00 29.76  ? 333  GLY A O   1 
ATOM   2454 N  N   . GLU A 1 334 ? 19.868  37.772 108.130 1.00 26.80  ? 334  GLU A N   1 
ATOM   2455 C  CA  . GLU A 1 334 ? 19.762  36.387 108.635 1.00 26.83  ? 334  GLU A CA  1 
ATOM   2456 C  C   . GLU A 1 334 ? 19.197  35.475 107.538 1.00 25.07  ? 334  GLU A C   1 
ATOM   2457 O  O   . GLU A 1 334 ? 18.505  35.919 106.632 1.00 26.03  ? 334  GLU A O   1 
ATOM   2458 C  CB  . GLU A 1 334 ? 18.843  36.293 109.873 1.00 29.38  ? 334  GLU A CB  1 
ATOM   2459 C  CG  . GLU A 1 334 ? 19.589  36.197 111.197 1.00 32.11  ? 334  GLU A CG  1 
ATOM   2460 C  CD  . GLU A 1 334 ? 20.494  34.968 111.322 1.00 32.62  ? 334  GLU A CD  1 
ATOM   2461 O  OE1 . GLU A 1 334 ? 20.656  34.137 110.365 1.00 32.82  ? 334  GLU A OE1 1 
ATOM   2462 O  OE2 . GLU A 1 334 ? 21.116  34.845 112.404 1.00 32.73  ? 334  GLU A OE2 1 
ATOM   2463 N  N   . THR A 1 335 ? 19.439  34.192 107.697 1.00 22.44  ? 335  THR A N   1 
ATOM   2464 C  CA  . THR A 1 335 ? 19.083  33.204 106.730 1.00 20.52  ? 335  THR A CA  1 
ATOM   2465 C  C   . THR A 1 335 ? 17.622  32.884 106.682 1.00 19.62  ? 335  THR A C   1 
ATOM   2466 O  O   . THR A 1 335 ? 17.164  32.273 105.728 1.00 19.03  ? 335  THR A O   1 
ATOM   2467 C  CB  . THR A 1 335 ? 19.933  31.923 106.925 1.00 21.95  ? 335  THR A CB  1 
ATOM   2468 O  OG1 . THR A 1 335 ? 19.696  31.335 108.230 1.00 20.41  ? 335  THR A OG1 1 
ATOM   2469 C  CG2 . THR A 1 335 ? 21.429  32.239 106.673 1.00 22.58  ? 335  THR A CG2 1 
ATOM   2470 N  N   . ILE A 1 336 ? 16.847  33.345 107.655 1.00 18.96  ? 336  ILE A N   1 
ATOM   2471 C  CA  . ILE A 1 336 ? 15.425  33.030 107.673 1.00 18.83  ? 336  ILE A CA  1 
ATOM   2472 C  C   . ILE A 1 336 ? 14.649  33.659 106.505 1.00 19.15  ? 336  ILE A C   1 
ATOM   2473 O  O   . ILE A 1 336 ? 13.586  33.180 106.118 1.00 16.92  ? 336  ILE A O   1 
ATOM   2474 C  CB  . ILE A 1 336 ? 14.774  33.484 108.978 1.00 19.84  ? 336  ILE A CB  1 
ATOM   2475 C  CG1 . ILE A 1 336 ? 13.523  32.673 109.235 1.00 21.38  ? 336  ILE A CG1 1 
ATOM   2476 C  CG2 . ILE A 1 336 ? 14.486  34.969 108.975 1.00 21.95  ? 336  ILE A CG2 1 
ATOM   2477 C  CD1 . ILE A 1 336 ? 13.168  32.684 110.710 1.00 23.77  ? 336  ILE A CD1 1 
ATOM   2478 N  N   . HIS A 1 337 ? 15.205  34.705 105.916 1.00 21.47  ? 337  HIS A N   1 
ATOM   2479 C  CA  . HIS A 1 337 ? 14.610  35.347 104.735 1.00 21.71  ? 337  HIS A CA  1 
ATOM   2480 C  C   . HIS A 1 337 ? 14.801  34.522 103.466 1.00 22.53  ? 337  HIS A C   1 
ATOM   2481 O  O   . HIS A 1 337 ? 14.258  34.859 102.434 1.00 21.01  ? 337  HIS A O   1 
ATOM   2482 C  CB  . HIS A 1 337 ? 15.141  36.799 104.605 1.00 23.04  ? 337  HIS A CB  1 
ATOM   2483 C  CG  . HIS A 1 337 ? 14.867  37.600 105.838 1.00 24.88  ? 337  HIS A CG  1 
ATOM   2484 N  ND1 . HIS A 1 337 ? 13.583  37.831 106.291 1.00 29.32  ? 337  HIS A ND1 1 
ATOM   2485 C  CD2 . HIS A 1 337 ? 15.695  38.070 106.806 1.00 28.36  ? 337  HIS A CD2 1 
ATOM   2486 C  CE1 . HIS A 1 337 ? 13.634  38.499 107.431 1.00 29.69  ? 337  HIS A CE1 1 
ATOM   2487 N  NE2 . HIS A 1 337 ? 14.899  38.650 107.772 1.00 27.15  ? 337  HIS A NE2 1 
ATOM   2488 N  N   . ASN A 1 338 ? 15.565  33.443 103.552 1.00 19.95  ? 338  ASN A N   1 
ATOM   2489 C  CA  . ASN A 1 338 ? 15.665  32.438 102.489 1.00 20.09  ? 338  ASN A CA  1 
ATOM   2490 C  C   . ASN A 1 338 ? 14.494  31.489 102.385 1.00 19.60  ? 338  ASN A C   1 
ATOM   2491 O  O   . ASN A 1 338 ? 14.489  30.677 101.482 1.00 19.25  ? 338  ASN A O   1 
ATOM   2492 C  CB  . ASN A 1 338 ? 16.918  31.628 102.590 1.00 18.38  ? 338  ASN A CB  1 
ATOM   2493 C  CG  . ASN A 1 338 ? 18.181  32.441 102.379 1.00 20.42  ? 338  ASN A CG  1 
ATOM   2494 O  OD1 . ASN A 1 338 ? 18.170  33.455 101.689 1.00 22.08  ? 338  ASN A OD1 1 
ATOM   2495 N  ND2 . ASN A 1 338 ? 19.289  31.940 102.890 1.00 18.42  ? 338  ASN A ND2 1 
ATOM   2496 N  N   . MET A 1 339 ? 13.504  31.616 103.282 1.00 19.55  ? 339  MET A N   1 
ATOM   2497 C  CA  . MET A 1 339 ? 12.323  30.813 103.237 1.00 19.92  ? 339  MET A CA  1 
ATOM   2498 C  C   . MET A 1 339 ? 11.545  31.301 102.010 1.00 20.60  ? 339  MET A C   1 
ATOM   2499 O  O   . MET A 1 339 ? 11.653  32.449 101.702 1.00 19.82  ? 339  MET A O   1 
ATOM   2500 C  CB  . MET A 1 339 ? 11.448  31.006 104.489 1.00 18.29  ? 339  MET A CB  1 
ATOM   2501 C  CG  . MET A 1 339 ? 12.045  30.343 105.731 1.00 18.42  ? 339  MET A CG  1 
ATOM   2502 S  SD  . MET A 1 339 ? 12.516  28.602 105.659 1.00 18.35  ? 339  MET A SD  1 
ATOM   2503 C  CE  . MET A 1 339 ? 10.928  27.971 105.898 1.00 17.02  ? 339  MET A CE  1 
ATOM   2504 N  N   . PRO A 1 340 ? 10.720  30.442 101.414 1.00 19.54  ? 340  PRO A N   1 
ATOM   2505 C  CA  . PRO A 1 340 ? 9.992   30.773 100.187 1.00 22.62  ? 340  PRO A CA  1 
ATOM   2506 C  C   . PRO A 1 340 ? 8.726   31.560 100.468 1.00 22.37  ? 340  PRO A C   1 
ATOM   2507 O  O   . PRO A 1 340 ? 7.778   31.478 99.726  1.00 27.29  ? 340  PRO A O   1 
ATOM   2508 C  CB  . PRO A 1 340 ? 9.644   29.391 99.587  1.00 21.94  ? 340  PRO A CB  1 
ATOM   2509 C  CG  . PRO A 1 340 ? 9.714   28.428 100.760 1.00 21.50  ? 340  PRO A CG  1 
ATOM   2510 C  CD  . PRO A 1 340 ? 10.646  29.002 101.748 1.00 20.30  ? 340  PRO A CD  1 
ATOM   2511 N  N   . PHE A 1 341 ? 8.692   32.273 101.571 1.00 21.28  ? 341  PHE A N   1 
ATOM   2512 C  CA  . PHE A 1 341 ? 7.589   33.109 101.940 1.00 19.07  ? 341  PHE A CA  1 
ATOM   2513 C  C   . PHE A 1 341 ? 8.099   34.159 102.908 1.00 20.52  ? 341  PHE A C   1 
ATOM   2514 O  O   . PHE A 1 341 ? 9.166   34.047 103.426 1.00 18.93  ? 341  PHE A O   1 
ATOM   2515 C  CB  . PHE A 1 341 ? 6.448   32.302 102.546 1.00 21.21  ? 341  PHE A CB  1 
ATOM   2516 C  CG  . PHE A 1 341 ? 6.881   31.378 103.654 1.00 21.87  ? 341  PHE A CG  1 
ATOM   2517 C  CD1 . PHE A 1 341 ? 7.095   31.853 104.909 1.00 21.65  ? 341  PHE A CD1 1 
ATOM   2518 C  CD2 . PHE A 1 341 ? 7.134   30.054 103.409 1.00 23.04  ? 341  PHE A CD2 1 
ATOM   2519 C  CE1 . PHE A 1 341 ? 7.525   31.019 105.915 1.00 24.50  ? 341  PHE A CE1 1 
ATOM   2520 C  CE2 . PHE A 1 341 ? 7.566   29.213 104.397 1.00 25.21  ? 341  PHE A CE2 1 
ATOM   2521 C  CZ  . PHE A 1 341 ? 7.769   29.692 105.659 1.00 22.86  ? 341  PHE A CZ  1 
ATOM   2522 N  N   . LYS A 1 342 ? 7.308   35.188 103.112 1.00 22.80  ? 342  LYS A N   1 
ATOM   2523 C  CA  . LYS A 1 342 ? 7.687   36.277 103.974 1.00 24.93  ? 342  LYS A CA  1 
ATOM   2524 C  C   . LYS A 1 342 ? 7.658   35.827 105.435 1.00 23.10  ? 342  LYS A C   1 
ATOM   2525 O  O   . LYS A 1 342 ? 6.739   35.247 105.846 1.00 20.92  ? 342  LYS A O   1 
ATOM   2526 C  CB  . LYS A 1 342 ? 6.726   37.428 103.784 1.00 29.38  ? 342  LYS A CB  1 
ATOM   2527 C  CG  . LYS A 1 342 ? 6.947   38.560 104.751 1.00 36.44  ? 342  LYS A CG  1 
ATOM   2528 C  CD  . LYS A 1 342 ? 6.718   39.908 104.137 1.00 48.97  ? 342  LYS A CD  1 
ATOM   2529 C  CE  . LYS A 1 342 ? 6.607   41.028 105.163 1.00 51.73  ? 342  LYS A CE  1 
ATOM   2530 N  NZ  . LYS A 1 342 ? 5.491   40.842 106.119 1.00 54.34  ? 342  LYS A NZ  1 
ATOM   2531 N  N   . VAL A 1 343 ? 8.694   36.120 106.189 1.00 24.45  ? 343  VAL A N   1 
ATOM   2532 C  CA  . VAL A 1 343 ? 8.701   35.706 107.608 1.00 24.33  ? 343  VAL A CA  1 
ATOM   2533 C  C   . VAL A 1 343 ? 8.784   36.976 108.467 1.00 23.54  ? 343  VAL A C   1 
ATOM   2534 O  O   . VAL A 1 343 ? 9.570   37.864 108.151 1.00 22.01  ? 343  VAL A O   1 
ATOM   2535 C  CB  . VAL A 1 343 ? 9.952   34.876 107.844 1.00 23.69  ? 343  VAL A CB  1 
ATOM   2536 C  CG1 . VAL A 1 343 ? 10.099  34.535 109.326 1.00 24.20  ? 343  VAL A CG1 1 
ATOM   2537 C  CG2 . VAL A 1 343 ? 9.920   33.613 106.998 1.00 24.47  ? 343  VAL A CG2 1 
ATOM   2538 N  N   . THR A 1 344 ? 7.993   37.054 109.522 1.00 20.62  ? 344  THR A N   1 
ATOM   2539 C  CA  . THR A 1 344 ? 8.062   38.129 110.485 1.00 22.78  ? 344  THR A CA  1 
ATOM   2540 C  C   . THR A 1 344 ? 8.385   37.556 111.932 1.00 22.90  ? 344  THR A C   1 
ATOM   2541 O  O   . THR A 1 344 ? 8.128   36.384 112.225 1.00 20.62  ? 344  THR A O   1 
ATOM   2542 C  CB  . THR A 1 344 ? 6.727   38.866 110.614 1.00 23.73  ? 344  THR A CB  1 
ATOM   2543 O  OG1 . THR A 1 344 ? 5.751   37.941 111.116 1.00 27.22  ? 344  THR A OG1 1 
ATOM   2544 C  CG2 . THR A 1 344 ? 6.224   39.534 109.261 1.00 25.01  ? 344  THR A CG2 1 
ATOM   2545 N  N   . PRO A 1 345 ? 8.906   38.423 112.835 1.00 22.36  ? 345  PRO A N   1 
ATOM   2546 C  CA  . PRO A 1 345 ? 9.116   37.987 114.235 1.00 19.79  ? 345  PRO A CA  1 
ATOM   2547 C  C   . PRO A 1 345 ? 7.870   37.358 114.819 1.00 18.40  ? 345  PRO A C   1 
ATOM   2548 O  O   . PRO A 1 345 ? 7.938   36.354 115.485 1.00 18.70  ? 345  PRO A O   1 
ATOM   2549 C  CB  . PRO A 1 345 ? 9.473   39.304 114.948 1.00 21.70  ? 345  PRO A CB  1 
ATOM   2550 C  CG  . PRO A 1 345 ? 10.245  40.061 113.862 1.00 23.20  ? 345  PRO A CG  1 
ATOM   2551 C  CD  . PRO A 1 345 ? 9.493   39.749 112.580 1.00 23.01  ? 345  PRO A CD  1 
ATOM   2552 N  N   . ALA A 1 346 ? 6.703   37.898 114.558 1.00 17.38  ? 346  ALA A N   1 
ATOM   2553 C  CA  . ALA A 1 346 ? 5.509   37.310 115.140 1.00 20.40  ? 346  ALA A CA  1 
ATOM   2554 C  C   . ALA A 1 346 ? 5.268   35.879 114.645 1.00 20.35  ? 346  ALA A C   1 
ATOM   2555 O  O   . ALA A 1 346 ? 4.800   35.005 115.417 1.00 18.95  ? 346  ALA A O   1 
ATOM   2556 C  CB  . ALA A 1 346 ? 4.291   38.189 114.865 1.00 21.09  ? 346  ALA A CB  1 
ATOM   2557 N  N   . GLY A 1 347 ? 5.606   35.620 113.375 1.00 18.63  ? 347  GLY A N   1 
ATOM   2558 C  CA  . GLY A 1 347 ? 5.437   34.284 112.819 1.00 20.50  ? 347  GLY A CA  1 
ATOM   2559 C  C   . GLY A 1 347 ? 6.423   33.279 113.407 1.00 19.75  ? 347  GLY A C   1 
ATOM   2560 O  O   . GLY A 1 347 ? 6.078   32.135 113.634 1.00 17.53  ? 347  GLY A O   1 
ATOM   2561 N  N   . VAL A 1 348 ? 7.637   33.735 113.680 1.00 16.79  ? 348  VAL A N   1 
ATOM   2562 C  CA  . VAL A 1 348 ? 8.663   32.932 114.246 1.00 18.32  ? 348  VAL A CA  1 
ATOM   2563 C  C   . VAL A 1 348 ? 8.323   32.588 115.713 1.00 18.07  ? 348  VAL A C   1 
ATOM   2564 O  O   . VAL A 1 348 ? 8.515   31.441 116.165 1.00 17.20  ? 348  VAL A O   1 
ATOM   2565 C  CB  . VAL A 1 348 ? 10.036  33.617 114.147 1.00 18.26  ? 348  VAL A CB  1 
ATOM   2566 C  CG1 . VAL A 1 348 ? 11.107  32.837 114.876 1.00 21.69  ? 348  VAL A CG1 1 
ATOM   2567 C  CG2 . VAL A 1 348 ? 10.487  33.770 112.665 1.00 19.41  ? 348  VAL A CG2 1 
ATOM   2568 N  N   . GLN A 1 349 ? 7.901   33.598 116.436 1.00 18.42  ? 349  GLN A N   1 
ATOM   2569 C  CA  . GLN A 1 349 ? 7.420   33.378 117.828 1.00 18.62  ? 349  GLN A CA  1 
ATOM   2570 C  C   . GLN A 1 349 ? 6.298   32.356 117.868 1.00 17.81  ? 349  GLN A C   1 
ATOM   2571 O  O   . GLN A 1 349 ? 6.301   31.450 118.695 1.00 16.78  ? 349  GLN A O   1 
ATOM   2572 C  CB  . GLN A 1 349 ? 6.912   34.696 118.417 1.00 19.28  ? 349  GLN A CB  1 
ATOM   2573 C  CG  . GLN A 1 349 ? 6.673   34.607 119.934 1.00 20.01  ? 349  GLN A CG  1 
ATOM   2574 C  CD  . GLN A 1 349 ? 5.680   35.607 120.453 1.00 24.68  ? 349  GLN A CD  1 
ATOM   2575 O  OE1 . GLN A 1 349 ? 4.676   35.917 119.809 1.00 29.92  ? 349  GLN A OE1 1 
ATOM   2576 N  NE2 . GLN A 1 349 ? 5.937   36.111 121.665 1.00 26.62  ? 349  GLN A NE2 1 
ATOM   2577 N  N   . ALA A 1 350 ? 5.327   32.491 116.956 1.00 15.19  ? 350  ALA A N   1 
ATOM   2578 C  CA  . ALA A 1 350 ? 4.284   31.547 116.820 1.00 15.91  ? 350  ALA A CA  1 
ATOM   2579 C  C   . ALA A 1 350 ? 4.763   30.155 116.549 1.00 16.66  ? 350  ALA A C   1 
ATOM   2580 O  O   . ALA A 1 350 ? 4.229   29.220 117.164 1.00 16.18  ? 350  ALA A O   1 
ATOM   2581 C  CB  . ALA A 1 350 ? 3.286   31.952 115.759 1.00 18.42  ? 350  ALA A CB  1 
ATOM   2582 N  N   . ALA A 1 351 ? 5.746   30.003 115.656 1.00 16.27  ? 351  ALA A N   1 
ATOM   2583 C  CA  . ALA A 1 351 ? 6.220   28.689 115.291 1.00 16.56  ? 351  ALA A CA  1 
ATOM   2584 C  C   . ALA A 1 351 ? 6.963   28.025 116.485 1.00 17.35  ? 351  ALA A C   1 
ATOM   2585 O  O   . ALA A 1 351 ? 6.836   26.864 116.742 1.00 16.00  ? 351  ALA A O   1 
ATOM   2586 C  CB  . ALA A 1 351 ? 7.210   28.823 114.192 1.00 16.23  ? 351  ALA A CB  1 
ATOM   2587 N  N   . ILE A 1 352 ? 7.767   28.811 117.164 1.00 16.44  ? 352  ILE A N   1 
ATOM   2588 C  CA  . ILE A 1 352 ? 8.481   28.315 118.348 1.00 16.94  ? 352  ILE A CA  1 
ATOM   2589 C  C   . ILE A 1 352 ? 7.524   27.861 119.442 1.00 15.42  ? 352  ILE A C   1 
ATOM   2590 O  O   . ILE A 1 352 ? 7.676   26.726 119.911 1.00 17.84  ? 352  ILE A O   1 
ATOM   2591 C  CB  . ILE A 1 352 ? 9.499   29.346 118.855 1.00 16.69  ? 352  ILE A CB  1 
ATOM   2592 C  CG1 . ILE A 1 352 ? 10.620  29.445 117.832 1.00 19.07  ? 352  ILE A CG1 1 
ATOM   2593 C  CG2 . ILE A 1 352 ? 10.183  28.880 120.174 1.00 18.64  ? 352  ILE A CG2 1 
ATOM   2594 C  CD1 . ILE A 1 352 ? 11.594  30.565 118.072 1.00 17.76  ? 352  ILE A CD1 1 
ATOM   2595 N  N   . LEU A 1 353 ? 6.604   28.737 119.867 1.00 14.69  ? 353  LEU A N   1 
ATOM   2596 C  CA  . LEU A 1 353 ? 5.678   28.438 120.932 1.00 16.39  ? 353  LEU A CA  1 
ATOM   2597 C  C   . LEU A 1 353 ? 4.810   27.245 120.570 1.00 18.19  ? 353  LEU A C   1 
ATOM   2598 O  O   . LEU A 1 353 ? 4.490   26.382 121.391 1.00 13.71  ? 353  LEU A O   1 
ATOM   2599 C  CB  . LEU A 1 353 ? 4.813   29.636 121.310 1.00 16.39  ? 353  LEU A CB  1 
ATOM   2600 C  CG  . LEU A 1 353 ? 5.564   30.790 121.935 1.00 17.15  ? 353  LEU A CG  1 
ATOM   2601 C  CD1 . LEU A 1 353 ? 4.759   32.087 122.039 1.00 18.47  ? 353  LEU A CD1 1 
ATOM   2602 C  CD2 . LEU A 1 353 ? 6.068   30.352 123.319 1.00 16.37  ? 353  LEU A CD2 1 
ATOM   2603 N  N   . THR A 1 354 ? 4.474   27.122 119.288 1.00 16.22  ? 354  THR A N   1 
ATOM   2604 C  CA  . THR A 1 354 ? 3.659   26.020 118.862 1.00 13.77  ? 354  THR A CA  1 
ATOM   2605 C  C   . THR A 1 354 ? 4.462   24.712 118.797 1.00 12.90  ? 354  THR A C   1 
ATOM   2606 O  O   . THR A 1 354 ? 3.930   23.626 119.119 1.00 13.72  ? 354  THR A O   1 
ATOM   2607 C  CB  . THR A 1 354 ? 2.960   26.335 117.506 1.00 14.45  ? 354  THR A CB  1 
ATOM   2608 O  OG1 . THR A 1 354 ? 2.087   27.463 117.644 1.00 16.18  ? 354  THR A OG1 1 
ATOM   2609 C  CG2 . THR A 1 354 ? 2.156   25.181 117.038 1.00 16.01  ? 354  THR A CG2 1 
ATOM   2610 N  N   . ALA A 1 355 ? 5.696   24.765 118.309 1.00 12.61  ? 355  ALA A N   1 
ATOM   2611 C  CA  . ALA A 1 355 ? 6.555   23.595 118.273 1.00 14.19  ? 355  ALA A CA  1 
ATOM   2612 C  C   . ALA A 1 355 ? 6.719   22.998 119.705 1.00 14.19  ? 355  ALA A C   1 
ATOM   2613 O  O   . ALA A 1 355 ? 6.692   21.797 119.914 1.00 14.74  ? 355  ALA A O   1 
ATOM   2614 C  CB  . ALA A 1 355 ? 7.921   23.984 117.752 1.00 13.89  ? 355  ALA A CB  1 
ATOM   2615 N  N   . ASP A 1 356 ? 6.929   23.893 120.661 1.00 15.85  ? 356  ASP A N   1 
ATOM   2616 C  CA  . ASP A 1 356 ? 7.008   23.464 122.078 1.00 16.11  ? 356  ASP A CA  1 
ATOM   2617 C  C   . ASP A 1 356 ? 5.763   22.671 122.475 1.00 14.72  ? 356  ASP A C   1 
ATOM   2618 O  O   . ASP A 1 356 ? 5.838   21.604 123.104 1.00 16.40  ? 356  ASP A O   1 
ATOM   2619 C  CB  . ASP A 1 356 ? 7.209   24.697 122.939 1.00 16.82  ? 356  ASP A CB  1 
ATOM   2620 C  CG  . ASP A 1 356 ? 7.149   24.386 124.485 1.00 19.62  ? 356  ASP A CG  1 
ATOM   2621 O  OD1 . ASP A 1 356 ? 7.959   23.589 124.977 1.00 22.78  ? 356  ASP A OD1 1 
ATOM   2622 O  OD2 . ASP A 1 356 ? 6.231   24.919 125.093 1.00 21.23  ? 356  ASP A OD2 1 
ATOM   2623 N  N   . ARG A 1 357 ? 4.592   23.177 122.096 1.00 16.04  ? 357  ARG A N   1 
ATOM   2624 C  CA  . ARG A 1 357 ? 3.387   22.481 122.407 1.00 16.48  ? 357  ARG A CA  1 
ATOM   2625 C  C   . ARG A 1 357 ? 3.231   21.167 121.749 1.00 15.29  ? 357  ARG A C   1 
ATOM   2626 O  O   . ARG A 1 357 ? 2.678   20.229 122.335 1.00 12.30  ? 357  ARG A O   1 
ATOM   2627 C  CB  . ARG A 1 357 ? 2.145   23.292 122.104 1.00 18.20  ? 357  ARG A CB  1 
ATOM   2628 C  CG  . ARG A 1 357 ? 1.957   24.577 122.813 1.00 23.68  ? 357  ARG A CG  1 
ATOM   2629 C  CD  . ARG A 1 357 ? 2.061   24.425 124.235 1.00 27.57  ? 357  ARG A CD  1 
ATOM   2630 N  NE  . ARG A 1 357 ? 1.769   25.717 124.874 1.00 35.49  ? 357  ARG A NE  1 
ATOM   2631 C  CZ  . ARG A 1 357 ? 0.659   26.014 125.552 1.00 28.60  ? 357  ARG A CZ  1 
ATOM   2632 N  NH1 . ARG A 1 357 ? -0.304  25.129 125.710 1.00 27.01  ? 357  ARG A NH1 1 
ATOM   2633 N  NH2 . ARG A 1 357 ? 0.582   27.209 126.120 1.00 29.94  ? 357  ARG A NH2 1 
ATOM   2634 N  N   . LEU A 1 358 ? 3.619   21.075 120.471 1.00 15.17  ? 358  LEU A N   1 
ATOM   2635 C  CA  . LEU A 1 358 ? 3.646   19.785 119.781 1.00 14.42  ? 358  LEU A CA  1 
ATOM   2636 C  C   . LEU A 1 358 ? 4.561   18.740 120.464 1.00 13.27  ? 358  LEU A C   1 
ATOM   2637 O  O   . LEU A 1 358 ? 4.263   17.578 120.539 1.00 14.58  ? 358  LEU A O   1 
ATOM   2638 C  CB  . LEU A 1 358 ? 4.117   20.018 118.298 1.00 15.58  ? 358  LEU A CB  1 
ATOM   2639 C  CG  . LEU A 1 358 ? 3.022   20.643 117.407 1.00 16.99  ? 358  LEU A CG  1 
ATOM   2640 C  CD1 . LEU A 1 358 ? 3.618   21.247 116.112 1.00 17.17  ? 358  LEU A CD1 1 
ATOM   2641 C  CD2 . LEU A 1 358 ? 2.054   19.539 117.049 1.00 17.53  ? 358  LEU A CD2 1 
ATOM   2642 N  N   . GLY A 1 359 ? 5.758   19.144 120.804 1.00 12.98  ? 359  GLY A N   1 
ATOM   2643 C  CA  . GLY A 1 359 ? 6.697   18.260 121.400 1.00 13.49  ? 359  GLY A CA  1 
ATOM   2644 C  C   . GLY A 1 359 ? 6.197   17.862 122.815 1.00 15.31  ? 359  GLY A C   1 
ATOM   2645 O  O   . GLY A 1 359 ? 6.389   16.730 123.198 1.00 15.39  ? 359  GLY A O   1 
ATOM   2646 N  N   . SER A 1 360 ? 5.589   18.782 123.551 1.00 16.80  ? 360  SER A N   1 
ATOM   2647 C  CA  . SER A 1 360 ? 5.046   18.426 124.902 1.00 20.15  ? 360  SER A CA  1 
ATOM   2648 C  C   . SER A 1 360 ? 3.885   17.438 124.827 1.00 21.04  ? 360  SER A C   1 
ATOM   2649 O  O   . SER A 1 360 ? 3.846   16.466 125.594 1.00 19.06  ? 360  SER A O   1 
ATOM   2650 C  CB  . SER A 1 360 ? 4.698   19.644 125.691 1.00 21.22  ? 360  SER A CB  1 
ATOM   2651 O  OG  . SER A 1 360 ? 3.634   20.224 125.043 1.00 36.37  ? 360  SER A OG  1 
ATOM   2652 N  N   . ALA A 1 361 ? 3.020   17.585 123.822 1.00 19.25  ? 361  ALA A N   1 
ATOM   2653 C  CA  . ALA A 1 361 ? 1.956   16.617 123.611 1.00 18.84  ? 361  ALA A CA  1 
ATOM   2654 C  C   . ALA A 1 361 ? 2.511   15.299 123.177 1.00 18.08  ? 361  ALA A C   1 
ATOM   2655 O  O   . ALA A 1 361 ? 2.019   14.251 123.601 1.00 20.29  ? 361  ALA A O   1 
ATOM   2656 C  CB  . ALA A 1 361 ? 0.933   17.094 122.604 1.00 19.54  ? 361  ALA A CB  1 
ATOM   2657 N  N   . TRP A 1 362 ? 3.515   15.298 122.310 1.00 18.61  ? 362  TRP A N   1 
ATOM   2658 C  CA  . TRP A 1 362 ? 4.144   14.057 121.927 1.00 18.51  ? 362  TRP A CA  1 
ATOM   2659 C  C   . TRP A 1 362 ? 4.759   13.302 123.187 1.00 20.82  ? 362  TRP A C   1 
ATOM   2660 O  O   . TRP A 1 362 ? 4.635   12.068 123.369 1.00 19.99  ? 362  TRP A O   1 
ATOM   2661 C  CB  . TRP A 1 362 ? 5.218   14.331 120.872 1.00 22.10  ? 362  TRP A CB  1 
ATOM   2662 C  CG  . TRP A 1 362 ? 5.612   13.111 120.108 1.00 21.99  ? 362  TRP A CG  1 
ATOM   2663 C  CD1 . TRP A 1 362 ? 5.075   12.611 118.895 1.00 20.99  ? 362  TRP A CD1 1 
ATOM   2664 C  CD2 . TRP A 1 362 ? 6.592   12.241 120.497 1.00 24.71  ? 362  TRP A CD2 1 
ATOM   2665 N  NE1 . TRP A 1 362 ? 5.767   11.469 118.546 1.00 24.76  ? 362  TRP A NE1 1 
ATOM   2666 C  CE2 . TRP A 1 362 ? 6.689   11.222 119.514 1.00 22.84  ? 362  TRP A CE2 1 
ATOM   2667 C  CE3 . TRP A 1 362 ? 7.422   12.197 121.601 1.00 29.35  ? 362  TRP A CE3 1 
ATOM   2668 C  CZ2 . TRP A 1 362 ? 7.543   10.196 119.624 1.00 29.45  ? 362  TRP A CZ2 1 
ATOM   2669 C  CZ3 . TRP A 1 362 ? 8.257   11.154 121.732 1.00 33.55  ? 362  TRP A CZ3 1 
ATOM   2670 C  CH2 . TRP A 1 362 ? 8.339   10.153 120.730 1.00 34.70  ? 362  TRP A CH2 1 
ATOM   2671 N  N   . LEU A 1 363 ? 5.456   14.047 124.012 1.00 19.48  ? 363  LEU A N   1 
ATOM   2672 C  CA  . LEU A 1 363 ? 6.011   13.469 125.253 1.00 23.28  ? 363  LEU A CA  1 
ATOM   2673 C  C   . LEU A 1 363 ? 4.934   12.817 126.136 1.00 24.64  ? 363  LEU A C   1 
ATOM   2674 O  O   . LEU A 1 363 ? 5.098   11.668 126.531 1.00 29.96  ? 363  LEU A O   1 
ATOM   2675 C  CB  . LEU A 1 363 ? 6.795   14.476 126.032 1.00 24.31  ? 363  LEU A CB  1 
ATOM   2676 C  CG  . LEU A 1 363 ? 8.099   14.900 125.414 1.00 26.06  ? 363  LEU A CG  1 
ATOM   2677 C  CD1 . LEU A 1 363 ? 8.726   15.979 126.245 1.00 27.03  ? 363  LEU A CD1 1 
ATOM   2678 C  CD2 . LEU A 1 363 ? 9.032   13.722 125.316 1.00 30.29  ? 363  LEU A CD2 1 
ATOM   2679 N  N   . GLN A 1 364 ? 3.785   13.452 126.292 1.00 29.67  ? 364  GLN A N   1 
ATOM   2680 C  CA  . GLN A 1 364 ? 2.646   12.880 127.020 1.00 32.16  ? 364  GLN A CA  1 
ATOM   2681 C  C   . GLN A 1 364 ? 2.067   11.590 126.447 1.00 36.77  ? 364  GLN A C   1 
ATOM   2682 O  O   . GLN A 1 364 ? 1.495   10.786 127.182 1.00 31.57  ? 364  GLN A O   1 
ATOM   2683 C  CB  . GLN A 1 364 ? 1.534   13.923 127.111 1.00 35.36  ? 364  GLN A CB  1 
ATOM   2684 C  CG  . GLN A 1 364 ? 1.847   14.975 128.139 1.00 41.07  ? 364  GLN A CG  1 
ATOM   2685 C  CD  . GLN A 1 364 ? 1.566   14.472 129.558 1.00 50.75  ? 364  GLN A CD  1 
ATOM   2686 O  OE1 . GLN A 1 364 ? 1.316   13.277 129.779 1.00 56.54  ? 364  GLN A OE1 1 
ATOM   2687 N  NE2 . GLN A 1 364 ? 1.569   15.394 130.528 1.00 73.26  ? 364  GLN A NE2 1 
ATOM   2688 N  N   . GLN A 1 365 ? 2.188   11.366 125.146 1.00 30.34  ? 365  GLN A N   1 
ATOM   2689 C  CA  . GLN A 1 365 ? 1.775   10.093 124.573 1.00 31.73  ? 365  GLN A CA  1 
ATOM   2690 C  C   . GLN A 1 365 ? 2.932   9.079  124.584 1.00 29.82  ? 365  GLN A C   1 
ATOM   2691 O  O   . GLN A 1 365 ? 2.764   8.002  124.102 1.00 33.76  ? 365  GLN A O   1 
ATOM   2692 C  CB  . GLN A 1 365 ? 1.390   10.244 123.099 1.00 34.49  ? 365  GLN A CB  1 
ATOM   2693 C  CG  . GLN A 1 365 ? 0.511   11.397 122.707 1.00 37.50  ? 365  GLN A CG  1 
ATOM   2694 C  CD  . GLN A 1 365 ? 0.086   11.274 121.237 1.00 41.25  ? 365  GLN A CD  1 
ATOM   2695 O  OE1 . GLN A 1 365 ? 0.753   11.739 120.262 1.00 39.49  ? 365  GLN A OE1 1 
ATOM   2696 N  NE2 . GLN A 1 365 ? -1.053  10.665 121.071 1.00 49.73  ? 365  GLN A NE2 1 
ATOM   2697 N  N   . HIS A 1 366 ? 4.094   9.544  124.995 1.00 32.29  ? 366  HIS A N   1 
ATOM   2698 C  CA  . HIS A 1 366 ? 5.411   8.919  125.096 1.00 44.13  ? 366  HIS A CA  1 
ATOM   2699 C  C   . HIS A 1 366 ? 6.076   8.436  123.812 1.00 45.22  ? 366  HIS A C   1 
ATOM   2700 O  O   . HIS A 1 366 ? 7.225   8.035  123.866 1.00 62.51  ? 366  HIS A O   1 
ATOM   2701 C  CB  . HIS A 1 366 ? 5.564   7.907  126.291 1.00 46.11  ? 366  HIS A CB  1 
ATOM   2702 C  CG  . HIS A 1 366 ? 4.964   8.380  127.591 1.00 60.36  ? 366  HIS A CG  1 
ATOM   2703 N  ND1 . HIS A 1 366 ? 3.662   8.093  127.966 1.00 70.80  ? 366  HIS A ND1 1 
ATOM   2704 C  CD2 . HIS A 1 366 ? 5.501   9.083  128.627 1.00 79.26  ? 366  HIS A CD2 1 
ATOM   2705 C  CE1 . HIS A 1 366 ? 3.418   8.616  129.159 1.00 79.68  ? 366  HIS A CE1 1 
ATOM   2706 N  NE2 . HIS A 1 366 ? 4.516   9.224  129.580 1.00 84.31  ? 366  HIS A NE2 1 
ATOM   2707 N  N   . GLN A 1 367 ? 5.427   8.608  122.664 1.00 48.00  ? 367  GLN A N   1 
ATOM   2708 C  CA  . GLN A 1 367 ? 5.678   7.824  121.443 1.00 42.39  ? 367  GLN A CA  1 
ATOM   2709 C  C   . GLN A 1 367 ? 4.639   8.449  120.630 1.00 34.30  ? 367  GLN A C   1 
ATOM   2710 O  O   . GLN A 1 367 ? 4.362   9.606  120.965 1.00 35.23  ? 367  GLN A O   1 
ATOM   2711 C  CB  . GLN A 1 367 ? 5.419   6.307  121.591 1.00 59.20  ? 367  GLN A CB  1 
ATOM   2712 C  CG  . GLN A 1 367 ? 6.487   5.455  122.340 1.00 65.43  ? 367  GLN A CG  1 
ATOM   2713 C  CD  . GLN A 1 367 ? 7.906   5.520  121.732 1.00 70.40  ? 367  GLN A CD  1 
ATOM   2714 O  OE1 . GLN A 1 367 ? 8.132   5.030  120.617 1.00 78.72  ? 367  GLN A OE1 1 
ATOM   2715 N  NE2 . GLN A 1 367 ? 8.873   6.095  122.481 1.00 61.63  ? 367  GLN A NE2 1 
ATOM   2716 N  N   . LEU B 1 2   ? -2.819  39.434 103.808 1.00 22.51  ? 2    LEU B N   1 
ATOM   2717 C  CA  . LEU B 1 2   ? -4.258  39.098 103.733 1.00 22.11  ? 2    LEU B CA  1 
ATOM   2718 C  C   . LEU B 1 2   ? -4.525  38.113 102.613 1.00 22.55  ? 2    LEU B C   1 
ATOM   2719 O  O   . LEU B 1 2   ? -3.984  38.241 101.537 1.00 23.49  ? 2    LEU B O   1 
ATOM   2720 C  CB  . LEU B 1 2   ? -5.152  40.320 103.605 1.00 23.69  ? 2    LEU B CB  1 
ATOM   2721 C  CG  . LEU B 1 2   ? -5.011  41.378 104.730 1.00 24.94  ? 2    LEU B CG  1 
ATOM   2722 C  CD1 . LEU B 1 2   ? -6.043  42.475 104.558 1.00 27.99  ? 2    LEU B CD1 1 
ATOM   2723 C  CD2 . LEU B 1 2   ? -5.091  40.780 106.117 1.00 26.73  ? 2    LEU B CD2 1 
ATOM   2724 N  N   . ARG B 1 3   ? -5.360  37.140 102.891 1.00 21.55  ? 3    ARG B N   1 
ATOM   2725 C  CA  . ARG B 1 3   ? -5.948  36.231 101.840 1.00 21.57  ? 3    ARG B CA  1 
ATOM   2726 C  C   . ARG B 1 3   ? -7.289  36.733 101.484 1.00 19.74  ? 3    ARG B C   1 
ATOM   2727 O  O   . ARG B 1 3   ? -8.069  37.088 102.374 1.00 20.90  ? 3    ARG B O   1 
ATOM   2728 C  CB  . ARG B 1 3   ? -6.223  34.859 102.409 1.00 25.94  ? 3    ARG B CB  1 
ATOM   2729 C  CG  . ARG B 1 3   ? -5.046  34.184 102.910 1.00 27.71  ? 3    ARG B CG  1 
ATOM   2730 C  CD  . ARG B 1 3   ? -5.341  33.229 104.077 1.00 31.72  ? 3    ARG B CD  1 
ATOM   2731 N  NE  . ARG B 1 3   ? -4.019  33.140 104.612 1.00 29.76  ? 3    ARG B NE  1 
ATOM   2732 C  CZ  . ARG B 1 3   ? -3.235  32.085 104.675 1.00 33.13  ? 3    ARG B CZ  1 
ATOM   2733 N  NH1 . ARG B 1 3   ? -3.657  30.787 104.416 1.00 29.68  ? 3    ARG B NH1 1 
ATOM   2734 N  NH2 . ARG B 1 3   ? -2.006  32.386 105.108 1.00 30.58  ? 3    ARG B NH2 1 
ATOM   2735 N  N   . ILE B 1 4   ? -7.587  36.837 100.186 1.00 16.65  ? 4    ILE B N   1 
ATOM   2736 C  CA  . ILE B 1 4   ? -8.845  37.444 99.767  1.00 16.88  ? 4    ILE B CA  1 
ATOM   2737 C  C   . ILE B 1 4   ? -9.435  36.622 98.642  1.00 15.68  ? 4    ILE B C   1 
ATOM   2738 O  O   . ILE B 1 4   ? -8.711  36.156 97.764  1.00 16.22  ? 4    ILE B O   1 
ATOM   2739 C  CB  . ILE B 1 4   ? -8.639  38.868 99.261  1.00 18.67  ? 4    ILE B CB  1 
ATOM   2740 C  CG1 . ILE B 1 4   ? -7.972  39.755 100.347 1.00 20.21  ? 4    ILE B CG1 1 
ATOM   2741 C  CG2 . ILE B 1 4   ? -9.932  39.390 98.662  1.00 17.80  ? 4    ILE B CG2 1 
ATOM   2742 C  CD1 . ILE B 1 4   ? -7.608  41.170 99.948  1.00 20.55  ? 4    ILE B CD1 1 
ATOM   2743 N  N   . ILE B 1 5   ? -10.721 36.352 98.748  1.00 16.35  ? 5    ILE B N   1 
ATOM   2744 C  CA  . ILE B 1 5   ? -11.455 35.700 97.705  1.00 17.70  ? 5    ILE B CA  1 
ATOM   2745 C  C   . ILE B 1 5   ? -12.631 36.581 97.366  1.00 20.16  ? 5    ILE B C   1 
ATOM   2746 O  O   . ILE B 1 5   ? -13.289 37.111 98.277  1.00 18.18  ? 5    ILE B O   1 
ATOM   2747 C  CB  . ILE B 1 5   ? -11.831 34.247 98.048  1.00 18.41  ? 5    ILE B CB  1 
ATOM   2748 C  CG1 . ILE B 1 5   ? -12.474 33.599 96.835  1.00 20.14  ? 5    ILE B CG1 1 
ATOM   2749 C  CG2 . ILE B 1 5   ? -12.787 34.076 99.250  1.00 18.37  ? 5    ILE B CG2 1 
ATOM   2750 C  CD1 . ILE B 1 5   ? -12.541 32.092 96.972  1.00 21.96  ? 5    ILE B CD1 1 
ATOM   2751 N  N   . GLN B 1 6   ? -12.902 36.751 96.051  1.00 17.93  ? 6    GLN B N   1 
ATOM   2752 C  CA  . GLN B 1 6   ? -14.101 37.437 95.636  1.00 21.39  ? 6    GLN B CA  1 
ATOM   2753 C  C   . GLN B 1 6   ? -14.907 36.605 94.664  1.00 22.08  ? 6    GLN B C   1 
ATOM   2754 O  O   . GLN B 1 6   ? -14.379 35.693 94.045  1.00 18.64  ? 6    GLN B O   1 
ATOM   2755 C  CB  . GLN B 1 6   ? -13.822 38.849 95.126  1.00 27.13  ? 6    GLN B CB  1 
ATOM   2756 C  CG  . GLN B 1 6   ? -12.736 38.972 94.124  1.00 30.45  ? 6    GLN B CG  1 
ATOM   2757 C  CD  . GLN B 1 6   ? -12.376 40.434 93.802  1.00 32.60  ? 6    GLN B CD  1 
ATOM   2758 O  OE1 . GLN B 1 6   ? -11.716 41.138 94.562  1.00 32.37  ? 6    GLN B OE1 1 
ATOM   2759 N  NE2 . GLN B 1 6   ? -12.742 40.845 92.626  1.00 35.10  ? 6    GLN B NE2 1 
ATOM   2760 N  N   . SER B 1 7   ? -16.182 36.926 94.538  1.00 21.97  ? 7    SER B N   1 
ATOM   2761 C  CA  . SER B 1 7   ? -17.070 36.121 93.729  1.00 25.11  ? 7    SER B CA  1 
ATOM   2762 C  C   . SER B 1 7   ? -18.267 36.966 93.292  1.00 23.60  ? 7    SER B C   1 
ATOM   2763 O  O   . SER B 1 7   ? -18.613 37.955 93.984  1.00 23.37  ? 7    SER B O   1 
ATOM   2764 C  CB  . SER B 1 7   ? -17.551 34.946 94.604  1.00 27.81  ? 7    SER B CB  1 
ATOM   2765 O  OG  . SER B 1 7   ? -18.625 34.191 93.983  1.00 33.64  ? 7    SER B OG  1 
ATOM   2766 N  N   . PRO B 1 8   ? -18.924 36.586 92.184  1.00 20.65  ? 8    PRO B N   1 
ATOM   2767 C  CA  . PRO B 1 8   ? -20.221 37.178 91.876  1.00 22.23  ? 8    PRO B CA  1 
ATOM   2768 C  C   . PRO B 1 8   ? -21.144 36.738 92.960  1.00 23.42  ? 8    PRO B C   1 
ATOM   2769 O  O   . PRO B 1 8   ? -20.860 35.718 93.607  1.00 22.12  ? 8    PRO B O   1 
ATOM   2770 C  CB  . PRO B 1 8   ? -20.641 36.466 90.562  1.00 23.22  ? 8    PRO B CB  1 
ATOM   2771 C  CG  . PRO B 1 8   ? -19.870 35.196 90.557  1.00 23.10  ? 8    PRO B CG  1 
ATOM   2772 C  CD  . PRO B 1 8   ? -18.552 35.556 91.180  1.00 22.98  ? 8    PRO B CD  1 
ATOM   2773 N  N   . GLY B 1 9   ? -22.265 37.412 93.149  1.00 21.91  ? 9    GLY B N   1 
ATOM   2774 C  CA  . GLY B 1 9   ? -23.123 37.057 94.245  1.00 22.39  ? 9    GLY B CA  1 
ATOM   2775 C  C   . GLY B 1 9   ? -23.849 35.773 94.057  1.00 24.14  ? 9    GLY B C   1 
ATOM   2776 O  O   . GLY B 1 9   ? -24.143 35.050 95.018  1.00 22.46  ? 9    GLY B O   1 
ATOM   2777 N  N   . LYS B 1 10  ? -24.164 35.448 92.805  1.00 19.93  ? 10   LYS B N   1 
ATOM   2778 C  CA  . LYS B 1 10  ? -24.888 34.287 92.540  1.00 18.96  ? 10   LYS B CA  1 
ATOM   2779 C  C   . LYS B 1 10  ? -24.486 33.786 91.133  1.00 20.81  ? 10   LYS B C   1 
ATOM   2780 O  O   . LYS B 1 10  ? -24.409 34.601 90.188  1.00 21.13  ? 10   LYS B O   1 
ATOM   2781 C  CB  . LYS B 1 10  ? -26.353 34.621 92.657  1.00 23.33  ? 10   LYS B CB  1 
ATOM   2782 C  CG  . LYS B 1 10  ? -27.181 33.387 92.848  1.00 29.13  ? 10   LYS B CG  1 
ATOM   2783 C  CD  . LYS B 1 10  ? -28.641 33.698 93.188  1.00 36.17  ? 10   LYS B CD  1 
ATOM   2784 C  CE  . LYS B 1 10  ? -28.781 34.451 94.485  1.00 38.04  ? 10   LYS B CE  1 
ATOM   2785 N  NZ  . LYS B 1 10  ? -30.148 34.220 95.003  1.00 41.98  ? 10   LYS B NZ  1 
ATOM   2786 N  N   . TYR B 1 11  ? -24.196 32.483 91.036  1.00 21.64  ? 11   TYR B N   1 
ATOM   2787 C  CA  . TYR B 1 11  ? -23.971 31.764 89.759  1.00 18.94  ? 11   TYR B CA  1 
ATOM   2788 C  C   . TYR B 1 11  ? -25.034 30.714 89.637  1.00 21.23  ? 11   TYR B C   1 
ATOM   2789 O  O   . TYR B 1 11  ? -25.215 29.876 90.550  1.00 20.27  ? 11   TYR B O   1 
ATOM   2790 C  CB  . TYR B 1 11  ? -22.567 31.179 89.746  1.00 18.09  ? 11   TYR B CB  1 
ATOM   2791 C  CG  . TYR B 1 11  ? -22.283 30.260 88.586  1.00 16.50  ? 11   TYR B CG  1 
ATOM   2792 C  CD1 . TYR B 1 11  ? -22.568 28.905 88.661  1.00 16.01  ? 11   TYR B CD1 1 
ATOM   2793 C  CD2 . TYR B 1 11  ? -21.731 30.772 87.400  1.00 17.32  ? 11   TYR B CD2 1 
ATOM   2794 C  CE1 . TYR B 1 11  ? -22.294 28.097 87.586  1.00 16.03  ? 11   TYR B CE1 1 
ATOM   2795 C  CE2 . TYR B 1 11  ? -21.449 29.940 86.309  1.00 17.88  ? 11   TYR B CE2 1 
ATOM   2796 C  CZ  . TYR B 1 11  ? -21.715 28.633 86.406  1.00 16.63  ? 11   TYR B CZ  1 
ATOM   2797 O  OH  . TYR B 1 11  ? -21.431 27.855 85.286  1.00 18.24  ? 11   TYR B OH  1 
ATOM   2798 N  N   . ILE B 1 12  ? -25.754 30.720 88.505  1.00 16.59  ? 12   ILE B N   1 
ATOM   2799 C  CA  . ILE B 1 12  ? -26.865 29.835 88.274  1.00 16.90  ? 12   ILE B CA  1 
ATOM   2800 C  C   . ILE B 1 12  ? -26.627 29.126 86.943  1.00 16.42  ? 12   ILE B C   1 
ATOM   2801 O  O   . ILE B 1 12  ? -26.263 29.792 85.953  1.00 17.16  ? 12   ILE B O   1 
ATOM   2802 C  CB  . ILE B 1 12  ? -28.141 30.681 88.150  1.00 19.97  ? 12   ILE B CB  1 
ATOM   2803 C  CG1 . ILE B 1 12  ? -28.450 31.388 89.478  1.00 23.84  ? 12   ILE B CG1 1 
ATOM   2804 C  CG2 . ILE B 1 12  ? -29.351 29.860 87.738  1.00 19.87  ? 12   ILE B CG2 1 
ATOM   2805 C  CD1 . ILE B 1 12  ? -29.371 32.539 89.338  1.00 25.10  ? 12   ILE B CD1 1 
ATOM   2806 N  N   . GLN B 1 13  ? -26.884 27.826 86.896  1.00 15.88  ? 13   GLN B N   1 
ATOM   2807 C  CA  . GLN B 1 13  ? -26.585 27.045 85.732  1.00 18.35  ? 13   GLN B CA  1 
ATOM   2808 C  C   . GLN B 1 13  ? -27.573 25.958 85.578  1.00 18.85  ? 13   GLN B C   1 
ATOM   2809 O  O   . GLN B 1 13  ? -27.927 25.226 86.532  1.00 18.94  ? 13   GLN B O   1 
ATOM   2810 C  CB  . GLN B 1 13  ? -25.153 26.500 85.796  1.00 18.84  ? 13   GLN B CB  1 
ATOM   2811 C  CG  . GLN B 1 13  ? -24.763 25.620 84.637  1.00 19.60  ? 13   GLN B CG  1 
ATOM   2812 C  CD  . GLN B 1 13  ? -23.432 24.932 84.859  1.00 18.40  ? 13   GLN B CD  1 
ATOM   2813 O  OE1 . GLN B 1 13  ? -22.419 25.532 85.289  1.00 19.61  ? 13   GLN B OE1 1 
ATOM   2814 N  NE2 . GLN B 1 13  ? -23.390 23.745 84.423  1.00 17.96  ? 13   GLN B NE2 1 
ATOM   2815 N  N   . GLY B 1 14  ? -28.059 25.825 84.343  1.00 17.64  ? 14   GLY B N   1 
ATOM   2816 C  CA  . GLY B 1 14  ? -28.785 24.633 83.979  1.00 15.91  ? 14   GLY B CA  1 
ATOM   2817 C  C   . GLY B 1 14  ? -29.542 24.818 82.653  1.00 17.73  ? 14   GLY B C   1 
ATOM   2818 O  O   . GLY B 1 14  ? -29.543 25.881 82.032  1.00 17.82  ? 14   GLY B O   1 
ATOM   2819 N  N   . ALA B 1 15  ? -30.149 23.753 82.232  1.00 19.27  ? 15   ALA B N   1 
ATOM   2820 C  CA  . ALA B 1 15  ? -30.774 23.693 80.933  1.00 24.45  ? 15   ALA B CA  1 
ATOM   2821 C  C   . ALA B 1 15  ? -32.024 24.552 81.008  1.00 24.34  ? 15   ALA B C   1 
ATOM   2822 O  O   . ALA B 1 15  ? -32.797 24.412 81.922  1.00 23.56  ? 15   ALA B O   1 
ATOM   2823 C  CB  . ALA B 1 15  ? -31.163 22.242 80.622  1.00 23.75  ? 15   ALA B CB  1 
ATOM   2824 N  N   . ASN B 1 16  ? -32.234 25.426 80.050  1.00 25.38  ? 16   ASN B N   1 
ATOM   2825 C  CA  . ASN B 1 16  ? -33.372 26.351 80.109  1.00 26.10  ? 16   ASN B CA  1 
ATOM   2826 C  C   . ASN B 1 16  ? -33.376 27.286 81.291  1.00 27.33  ? 16   ASN B C   1 
ATOM   2827 O  O   . ASN B 1 16  ? -34.440 27.820 81.648  1.00 24.01  ? 16   ASN B O   1 
ATOM   2828 C  CB  . ASN B 1 16  ? -34.734 25.625 80.020  1.00 29.17  ? 16   ASN B CB  1 
ATOM   2829 C  CG  . ASN B 1 16  ? -35.835 26.524 79.393  1.00 36.13  ? 16   ASN B CG  1 
ATOM   2830 O  OD1 . ASN B 1 16  ? -35.534 27.518 78.699  1.00 35.00  ? 16   ASN B OD1 1 
ATOM   2831 N  ND2 . ASN B 1 16  ? -37.109 26.201 79.666  1.00 41.18  ? 16   ASN B ND2 1 
ATOM   2832 N  N   . ALA B 1 17  ? -32.188 27.571 81.842  1.00 25.23  ? 17   ALA B N   1 
ATOM   2833 C  CA  . ALA B 1 17  ? -32.051 28.580 82.894  1.00 25.47  ? 17   ALA B CA  1 
ATOM   2834 C  C   . ALA B 1 17  ? -32.519 29.935 82.420  1.00 27.10  ? 17   ALA B C   1 
ATOM   2835 O  O   . ALA B 1 17  ? -32.950 30.739 83.222  1.00 22.92  ? 17   ALA B O   1 
ATOM   2836 C  CB  . ALA B 1 17  ? -30.620 28.688 83.393  1.00 23.75  ? 17   ALA B CB  1 
ATOM   2837 N  N   . LEU B 1 18  ? -32.485 30.209 81.103  1.00 26.67  ? 18   LEU B N   1 
ATOM   2838 C  CA  . LEU B 1 18  ? -32.989 31.523 80.607  1.00 26.22  ? 18   LEU B CA  1 
ATOM   2839 C  C   . LEU B 1 18  ? -34.470 31.775 80.957  1.00 23.50  ? 18   LEU B C   1 
ATOM   2840 O  O   . LEU B 1 18  ? -34.842 32.897 81.277  1.00 26.16  ? 18   LEU B O   1 
ATOM   2841 C  CB  . LEU B 1 18  ? -32.784 31.637 79.106  1.00 29.86  ? 18   LEU B CB  1 
ATOM   2842 C  CG  . LEU B 1 18  ? -32.926 33.001 78.465  1.00 33.03  ? 18   LEU B CG  1 
ATOM   2843 C  CD1 . LEU B 1 18  ? -31.958 34.022 78.985  1.00 36.95  ? 18   LEU B CD1 1 
ATOM   2844 C  CD2 . LEU B 1 18  ? -32.770 32.862 76.947  1.00 39.07  ? 18   LEU B CD2 1 
ATOM   2845 N  N   . ALA B 1 19  ? -35.268 30.727 80.971  1.00 25.61  ? 19   ALA B N   1 
ATOM   2846 C  CA  . ALA B 1 19  ? -36.680 30.820 81.302  1.00 31.09  ? 19   ALA B CA  1 
ATOM   2847 C  C   . ALA B 1 19  ? -36.962 31.040 82.785  1.00 32.45  ? 19   ALA B C   1 
ATOM   2848 O  O   . ALA B 1 19  ? -38.085 31.360 83.107  1.00 39.70  ? 19   ALA B O   1 
ATOM   2849 C  CB  . ALA B 1 19  ? -37.433 29.581 80.828  1.00 28.14  ? 19   ALA B CB  1 
ATOM   2850 N  N   . ALA B 1 20  ? -35.946 30.950 83.639  1.00 33.38  ? 20   ALA B N   1 
ATOM   2851 C  CA  . ALA B 1 20  ? -36.099 31.189 85.088  1.00 33.97  ? 20   ALA B CA  1 
ATOM   2852 C  C   . ALA B 1 20  ? -35.429 32.470 85.522  1.00 34.59  ? 20   ALA B C   1 
ATOM   2853 O  O   . ALA B 1 20  ? -35.404 32.754 86.718  1.00 35.19  ? 20   ALA B O   1 
ATOM   2854 C  CB  . ALA B 1 20  ? -35.511 30.035 85.866  1.00 34.67  ? 20   ALA B CB  1 
ATOM   2855 N  N   . VAL B 1 21  ? -34.885 33.263 84.586  1.00 28.65  ? 21   VAL B N   1 
ATOM   2856 C  CA  . VAL B 1 21  ? -34.120 34.429 84.976  1.00 28.21  ? 21   VAL B CA  1 
ATOM   2857 C  C   . VAL B 1 21  ? -34.901 35.448 85.783  1.00 31.60  ? 21   VAL B C   1 
ATOM   2858 O  O   . VAL B 1 21  ? -34.310 36.112 86.645  1.00 32.32  ? 21   VAL B O   1 
ATOM   2859 C  CB  . VAL B 1 21  ? -33.529 35.163 83.756  1.00 29.65  ? 21   VAL B CB  1 
ATOM   2860 C  CG1 . VAL B 1 21  ? -32.973 36.523 84.103  1.00 32.59  ? 21   VAL B CG1 1 
ATOM   2861 C  CG2 . VAL B 1 21  ? -32.407 34.356 83.140  1.00 31.55  ? 21   VAL B CG2 1 
ATOM   2862 N  N   . GLY B 1 22  ? -36.181 35.646 85.467  1.00 31.16  ? 22   GLY B N   1 
ATOM   2863 C  CA  . GLY B 1 22  ? -36.984 36.723 86.115  1.00 32.57  ? 22   GLY B CA  1 
ATOM   2864 C  C   . GLY B 1 22  ? -37.039 36.644 87.638  1.00 32.00  ? 22   GLY B C   1 
ATOM   2865 O  O   . GLY B 1 22  ? -36.891 37.639 88.332  1.00 30.00  ? 22   GLY B O   1 
ATOM   2866 N  N   . GLN B 1 23  ? -37.198 35.436 88.132  1.00 35.55  ? 23   GLN B N   1 
ATOM   2867 C  CA  . GLN B 1 23  ? -37.159 35.161 89.577  1.00 43.21  ? 23   GLN B CA  1 
ATOM   2868 C  C   . GLN B 1 23  ? -35.876 35.601 90.312  1.00 45.12  ? 23   GLN B C   1 
ATOM   2869 O  O   . GLN B 1 23  ? -35.940 35.956 91.476  1.00 49.18  ? 23   GLN B O   1 
ATOM   2870 C  CB  . GLN B 1 23  ? -37.318 33.667 89.786  1.00 48.86  ? 23   GLN B CB  1 
ATOM   2871 C  CG  . GLN B 1 23  ? -37.563 33.295 91.229  1.00 58.85  ? 23   GLN B CG  1 
ATOM   2872 C  CD  . GLN B 1 23  ? -37.700 31.807 91.402  1.00 65.10  ? 23   GLN B CD  1 
ATOM   2873 O  OE1 . GLN B 1 23  ? -37.126 31.036 90.641  1.00 67.04  ? 23   GLN B OE1 1 
ATOM   2874 N  NE2 . GLN B 1 23  ? -38.465 31.392 92.409  1.00 69.01  ? 23   GLN B NE2 1 
ATOM   2875 N  N   . TYR B 1 24  ? -34.715 35.546 89.659  1.00 36.97  ? 24   TYR B N   1 
ATOM   2876 C  CA  . TYR B 1 24  ? -33.467 35.974 90.304  1.00 34.59  ? 24   TYR B CA  1 
ATOM   2877 C  C   . TYR B 1 24  ? -33.191 37.409 90.040  1.00 32.00  ? 24   TYR B C   1 
ATOM   2878 O  O   . TYR B 1 24  ? -32.741 38.168 90.920  1.00 31.44  ? 24   TYR B O   1 
ATOM   2879 C  CB  . TYR B 1 24  ? -32.303 35.050 89.866  1.00 35.90  ? 24   TYR B CB  1 
ATOM   2880 C  CG  . TYR B 1 24  ? -32.685 33.601 90.087  1.00 37.93  ? 24   TYR B CG  1 
ATOM   2881 C  CD1 . TYR B 1 24  ? -32.618 33.023 91.359  1.00 38.31  ? 24   TYR B CD1 1 
ATOM   2882 C  CD2 . TYR B 1 24  ? -33.176 32.824 89.061  1.00 39.61  ? 24   TYR B CD2 1 
ATOM   2883 C  CE1 . TYR B 1 24  ? -33.028 31.729 91.584  1.00 35.52  ? 24   TYR B CE1 1 
ATOM   2884 C  CE2 . TYR B 1 24  ? -33.554 31.508 89.282  1.00 37.93  ? 24   TYR B CE2 1 
ATOM   2885 C  CZ  . TYR B 1 24  ? -33.469 30.981 90.556  1.00 39.63  ? 24   TYR B CZ  1 
ATOM   2886 O  OH  . TYR B 1 24  ? -33.876 29.692 90.810  1.00 44.24  ? 24   TYR B OH  1 
ATOM   2887 N  N   . ALA B 1 25  ? -33.493 37.856 88.829  1.00 29.32  ? 25   ALA B N   1 
ATOM   2888 C  CA  . ALA B 1 25  ? -33.243 39.237 88.470  1.00 27.86  ? 25   ALA B CA  1 
ATOM   2889 C  C   . ALA B 1 25  ? -34.129 40.206 89.277  1.00 27.39  ? 25   ALA B C   1 
ATOM   2890 O  O   . ALA B 1 25  ? -33.732 41.351 89.567  1.00 23.73  ? 25   ALA B O   1 
ATOM   2891 C  CB  . ALA B 1 25  ? -33.553 39.421 86.995  1.00 30.51  ? 25   ALA B CB  1 
ATOM   2892 N  N   . LYS B 1 26  ? -35.353 39.755 89.504  1.00 30.41  ? 26   LYS B N   1 
ATOM   2893 C  CA  . LYS B 1 26  ? -36.347 40.485 90.329  1.00 37.73  ? 26   LYS B CA  1 
ATOM   2894 C  C   . LYS B 1 26  ? -35.788 40.855 91.727  1.00 39.99  ? 26   LYS B C   1 
ATOM   2895 O  O   . LYS B 1 26  ? -36.045 41.959 92.226  1.00 38.33  ? 26   LYS B O   1 
ATOM   2896 C  CB  . LYS B 1 26  ? -37.601 39.617 90.461  1.00 40.67  ? 26   LYS B CB  1 
ATOM   2897 C  CG  . LYS B 1 26  ? -38.721 40.206 91.286  1.00 50.42  ? 26   LYS B CG  1 
ATOM   2898 C  CD  . LYS B 1 26  ? -39.066 41.615 90.846  1.00 56.89  ? 26   LYS B CD  1 
ATOM   2899 C  CE  . LYS B 1 26  ? -40.498 42.022 91.210  1.00 60.64  ? 26   LYS B CE  1 
ATOM   2900 N  NZ  . LYS B 1 26  ? -40.558 43.474 90.947  1.00 65.68  ? 26   LYS B NZ  1 
ATOM   2901 N  N   . SER B 1 27  ? -34.984 39.955 92.324  1.00 34.38  ? 27   SER B N   1 
ATOM   2902 C  CA  . SER B 1 27  ? -34.437 40.184 93.666  1.00 37.52  ? 27   SER B CA  1 
ATOM   2903 C  C   . SER B 1 27  ? -33.484 41.372 93.642  1.00 34.93  ? 27   SER B C   1 
ATOM   2904 O  O   . SER B 1 27  ? -33.316 42.038 94.640  1.00 39.59  ? 27   SER B O   1 
ATOM   2905 C  CB  . SER B 1 27  ? -33.738 38.921 94.206  1.00 38.23  ? 27   SER B CB  1 
ATOM   2906 O  OG  . SER B 1 27  ? -32.520 38.715 93.484  1.00 38.99  ? 27   SER B OG  1 
ATOM   2907 N  N   . LEU B 1 28  ? -32.874 41.679 92.491  1.00 35.01  ? 28   LEU B N   1 
ATOM   2908 C  CA  . LEU B 1 28  ? -31.957 42.811 92.379  1.00 31.08  ? 28   LEU B CA  1 
ATOM   2909 C  C   . LEU B 1 28  ? -32.564 44.125 91.886  1.00 29.80  ? 28   LEU B C   1 
ATOM   2910 O  O   . LEU B 1 28  ? -32.060 45.191 92.201  1.00 29.46  ? 28   LEU B O   1 
ATOM   2911 C  CB  . LEU B 1 28  ? -30.811 42.490 91.421  1.00 33.77  ? 28   LEU B CB  1 
ATOM   2912 C  CG  . LEU B 1 28  ? -29.898 41.351 91.868  1.00 36.90  ? 28   LEU B CG  1 
ATOM   2913 C  CD1 . LEU B 1 28  ? -29.068 40.904 90.687  1.00 34.20  ? 28   LEU B CD1 1 
ATOM   2914 C  CD2 . LEU B 1 28  ? -29.060 41.874 93.046  1.00 34.47  ? 28   LEU B CD2 1 
ATOM   2915 N  N   . ALA B 1 29  ? -33.556 44.046 91.020  1.00 30.20  ? 29   ALA B N   1 
ATOM   2916 C  CA  . ALA B 1 29  ? -34.164 45.281 90.491  1.00 30.37  ? 29   ALA B CA  1 
ATOM   2917 C  C   . ALA B 1 29  ? -35.418 44.942 89.743  1.00 30.47  ? 29   ALA B C   1 
ATOM   2918 O  O   . ALA B 1 29  ? -35.665 43.775 89.390  1.00 31.33  ? 29   ALA B O   1 
ATOM   2919 C  CB  . ALA B 1 29  ? -33.175 46.046 89.620  1.00 31.38  ? 29   ALA B CB  1 
ATOM   2920 N  N   . ASP B 1 30  ? -36.253 45.962 89.526  1.00 36.03  ? 30   ASP B N   1 
ATOM   2921 C  CA  . ASP B 1 30  ? -37.548 45.739 88.895  1.00 40.14  ? 30   ASP B CA  1 
ATOM   2922 C  C   . ASP B 1 30  ? -37.609 46.355 87.491  1.00 37.73  ? 30   ASP B C   1 
ATOM   2923 O  O   . ASP B 1 30  ? -38.665 46.444 86.891  1.00 35.22  ? 30   ASP B O   1 
ATOM   2924 C  CB  . ASP B 1 30  ? -38.686 46.242 89.799  1.00 46.12  ? 30   ASP B CB  1 
ATOM   2925 C  CG  . ASP B 1 30  ? -38.718 47.750 89.951  1.00 45.60  ? 30   ASP B CG  1 
ATOM   2926 O  OD1 . ASP B 1 30  ? -37.908 48.494 89.342  1.00 46.07  ? 30   ASP B OD1 1 
ATOM   2927 O  OD2 . ASP B 1 30  ? -39.590 48.190 90.710  1.00 57.73  ? 30   ASP B OD2 1 
ATOM   2928 N  N   . HIS B 1 31  ? -36.461 46.721 86.953  1.00 35.97  ? 31   HIS B N   1 
ATOM   2929 C  CA  . HIS B 1 31  ? -36.430 47.399 85.659  1.00 34.22  ? 31   HIS B CA  1 
ATOM   2930 C  C   . HIS B 1 31  ? -35.059 47.290 85.051  1.00 28.09  ? 31   HIS B C   1 
ATOM   2931 O  O   . HIS B 1 31  ? -34.150 47.877 85.571  1.00 29.63  ? 31   HIS B O   1 
ATOM   2932 C  CB  . HIS B 1 31  ? -36.744 48.889 85.900  1.00 38.66  ? 31   HIS B CB  1 
ATOM   2933 C  CG  . HIS B 1 31  ? -36.953 49.675 84.659  1.00 46.79  ? 31   HIS B CG  1 
ATOM   2934 N  ND1 . HIS B 1 31  ? -37.374 50.990 84.682  1.00 52.45  ? 31   HIS B ND1 1 
ATOM   2935 C  CD2 . HIS B 1 31  ? -36.830 49.338 83.352  1.00 50.43  ? 31   HIS B CD2 1 
ATOM   2936 C  CE1 . HIS B 1 31  ? -37.485 51.431 83.441  1.00 53.93  ? 31   HIS B CE1 1 
ATOM   2937 N  NE2 . HIS B 1 31  ? -37.165 50.447 82.617  1.00 51.77  ? 31   HIS B NE2 1 
ATOM   2938 N  N   . TYR B 1 32  ? -34.897 46.560 83.943  1.00 27.93  ? 32   TYR B N   1 
ATOM   2939 C  CA  . TYR B 1 32  ? -33.569 46.408 83.327  1.00 25.82  ? 32   TYR B CA  1 
ATOM   2940 C  C   . TYR B 1 32  ? -33.462 46.939 81.912  1.00 25.49  ? 32   TYR B C   1 
ATOM   2941 O  O   . TYR B 1 32  ? -34.391 46.801 81.141  1.00 28.48  ? 32   TYR B O   1 
ATOM   2942 C  CB  . TYR B 1 32  ? -33.199 44.919 83.258  1.00 26.78  ? 32   TYR B CB  1 
ATOM   2943 C  CG  . TYR B 1 32  ? -32.848 44.285 84.623  1.00 27.94  ? 32   TYR B CG  1 
ATOM   2944 C  CD1 . TYR B 1 32  ? -33.839 43.783 85.448  1.00 30.46  ? 32   TYR B CD1 1 
ATOM   2945 C  CD2 . TYR B 1 32  ? -31.519 44.202 85.052  1.00 27.26  ? 32   TYR B CD2 1 
ATOM   2946 C  CE1 . TYR B 1 32  ? -33.535 43.197 86.673  1.00 30.47  ? 32   TYR B CE1 1 
ATOM   2947 C  CE2 . TYR B 1 32  ? -31.186 43.601 86.265  1.00 31.37  ? 32   TYR B CE2 1 
ATOM   2948 C  CZ  . TYR B 1 32  ? -32.202 43.111 87.080  1.00 32.83  ? 32   TYR B CZ  1 
ATOM   2949 O  OH  . TYR B 1 32  ? -31.860 42.534 88.287  1.00 32.78  ? 32   TYR B OH  1 
ATOM   2950 N  N   . LEU B 1 33  ? -32.284 47.424 81.600  1.00 23.18  ? 33   LEU B N   1 
ATOM   2951 C  CA  . LEU B 1 33  ? -31.796 47.592 80.247  1.00 25.36  ? 33   LEU B CA  1 
ATOM   2952 C  C   . LEU B 1 33  ? -31.214 46.271 79.789  1.00 28.35  ? 33   LEU B C   1 
ATOM   2953 O  O   . LEU B 1 33  ? -30.357 45.720 80.510  1.00 23.07  ? 33   LEU B O   1 
ATOM   2954 C  CB  . LEU B 1 33  ? -30.692 48.626 80.251  1.00 24.36  ? 33   LEU B CB  1 
ATOM   2955 C  CG  . LEU B 1 33  ? -30.049 48.788 78.845  1.00 29.24  ? 33   LEU B CG  1 
ATOM   2956 C  CD1 . LEU B 1 33  ? -30.979 49.600 77.976  1.00 31.39  ? 33   LEU B CD1 1 
ATOM   2957 C  CD2 . LEU B 1 33  ? -28.741 49.537 78.878  1.00 30.08  ? 33   LEU B CD2 1 
ATOM   2958 N  N   . VAL B 1 34  ? -31.647 45.738 78.641  1.00 23.41  ? 34   VAL B N   1 
ATOM   2959 C  CA  . VAL B 1 34  ? -31.099 44.459 78.127  1.00 24.19  ? 34   VAL B CA  1 
ATOM   2960 C  C   . VAL B 1 34  ? -30.293 44.756 76.916  1.00 29.13  ? 34   VAL B C   1 
ATOM   2961 O  O   . VAL B 1 34  ? -30.822 45.366 75.956  1.00 26.61  ? 34   VAL B O   1 
ATOM   2962 C  CB  . VAL B 1 34  ? -32.184 43.527 77.761  1.00 25.52  ? 34   VAL B CB  1 
ATOM   2963 C  CG1 . VAL B 1 34  ? -31.631 42.247 77.149  1.00 27.61  ? 34   VAL B CG1 1 
ATOM   2964 C  CG2 . VAL B 1 34  ? -33.104 43.292 78.946  1.00 29.33  ? 34   VAL B CG2 1 
ATOM   2965 N  N   . ILE B 1 35  ? -29.014 44.407 76.998  1.00 23.82  ? 35   ILE B N   1 
ATOM   2966 C  CA  . ILE B 1 35  ? -28.066 44.604 75.961  1.00 26.16  ? 35   ILE B CA  1 
ATOM   2967 C  C   . ILE B 1 35  ? -27.779 43.274 75.264  1.00 28.63  ? 35   ILE B C   1 
ATOM   2968 O  O   . ILE B 1 35  ? -27.319 42.236 75.876  1.00 22.67  ? 35   ILE B O   1 
ATOM   2969 C  CB  . ILE B 1 35  ? -26.795 45.172 76.497  1.00 26.07  ? 35   ILE B CB  1 
ATOM   2970 C  CG1 . ILE B 1 35  ? -27.078 46.410 77.345  1.00 29.86  ? 35   ILE B CG1 1 
ATOM   2971 C  CG2 . ILE B 1 35  ? -25.843 45.452 75.358  1.00 28.23  ? 35   ILE B CG2 1 
ATOM   2972 C  CD1 . ILE B 1 35  ? -25.799 46.985 77.946  1.00 29.12  ? 35   ILE B CD1 1 
ATOM   2973 N  N   . ALA B 1 36  ? -28.072 43.248 73.960  1.00 24.25  ? 36   ALA B N   1 
ATOM   2974 C  CA  . ALA B 1 36  ? -27.824 42.048 73.188  1.00 21.38  ? 36   ALA B CA  1 
ATOM   2975 C  C   . ALA B 1 36  ? -27.799 42.368 71.685  1.00 25.32  ? 36   ALA B C   1 
ATOM   2976 O  O   . ALA B 1 36  ? -28.554 43.246 71.277  1.00 26.80  ? 36   ALA B O   1 
ATOM   2977 C  CB  . ALA B 1 36  ? -28.924 41.084 73.441  1.00 22.47  ? 36   ALA B CB  1 
ATOM   2978 N  N   . ASP B 1 37  ? -27.005 41.649 70.898  1.00 25.61  ? 37   ASP B N   1 
ATOM   2979 C  CA  . ASP B 1 37  ? -27.031 41.842 69.428  1.00 27.12  ? 37   ASP B CA  1 
ATOM   2980 C  C   . ASP B 1 37  ? -28.293 41.225 68.828  1.00 24.05  ? 37   ASP B C   1 
ATOM   2981 O  O   . ASP B 1 37  ? -29.067 40.495 69.503  1.00 19.19  ? 37   ASP B O   1 
ATOM   2982 C  CB  . ASP B 1 37  ? -25.688 41.411 68.756  1.00 27.07  ? 37   ASP B CB  1 
ATOM   2983 C  CG  . ASP B 1 37  ? -25.556 39.917 68.546  1.00 29.71  ? 37   ASP B CG  1 
ATOM   2984 O  OD1 . ASP B 1 37  ? -26.556 39.175 68.398  1.00 32.14  ? 37   ASP B OD1 1 
ATOM   2985 O  OD2 . ASP B 1 37  ? -24.400 39.458 68.573  1.00 36.67  ? 37   ASP B OD2 1 
ATOM   2986 N  N   . ASP B 1 38  ? -28.497 41.411 67.519  1.00 25.32  ? 38   ASP B N   1 
ATOM   2987 C  CA  . ASP B 1 38  ? -29.781 41.006 66.936  1.00 21.84  ? 38   ASP B CA  1 
ATOM   2988 C  C   . ASP B 1 38  ? -29.892 39.516 66.828  1.00 18.76  ? 38   ASP B C   1 
ATOM   2989 O  O   . ASP B 1 38  ? -31.002 38.943 66.911  1.00 20.38  ? 38   ASP B O   1 
ATOM   2990 C  CB  . ASP B 1 38  ? -29.921 41.593 65.508  1.00 26.08  ? 38   ASP B CB  1 
ATOM   2991 C  CG  . ASP B 1 38  ? -29.974 43.098 65.515  1.00 31.12  ? 38   ASP B CG  1 
ATOM   2992 O  OD1 . ASP B 1 38  ? -30.761 43.656 66.292  1.00 31.84  ? 38   ASP B OD1 1 
ATOM   2993 O  OD2 . ASP B 1 38  ? -29.198 43.714 64.778  1.00 40.09  ? 38   ASP B OD2 1 
ATOM   2994 N  N   . PHE B 1 39  ? -28.769 38.846 66.616  1.00 18.45  ? 39   PHE B N   1 
ATOM   2995 C  CA  . PHE B 1 39  ? -28.844 37.411 66.520  1.00 21.88  ? 39   PHE B CA  1 
ATOM   2996 C  C   . PHE B 1 39  ? -29.181 36.748 67.878  1.00 21.60  ? 39   PHE B C   1 
ATOM   2997 O  O   . PHE B 1 39  ? -29.954 35.778 67.965  1.00 19.42  ? 39   PHE B O   1 
ATOM   2998 C  CB  . PHE B 1 39  ? -27.537 36.875 65.973  1.00 26.63  ? 39   PHE B CB  1 
ATOM   2999 C  CG  . PHE B 1 39  ? -27.350 37.163 64.508  1.00 32.33  ? 39   PHE B CG  1 
ATOM   3000 C  CD1 . PHE B 1 39  ? -27.874 36.302 63.572  1.00 32.90  ? 39   PHE B CD1 1 
ATOM   3001 C  CD2 . PHE B 1 39  ? -26.689 38.296 64.099  1.00 39.20  ? 39   PHE B CD2 1 
ATOM   3002 C  CE1 . PHE B 1 39  ? -27.690 36.534 62.226  1.00 38.57  ? 39   PHE B CE1 1 
ATOM   3003 C  CE2 . PHE B 1 39  ? -26.510 38.540 62.755  1.00 41.41  ? 39   PHE B CE2 1 
ATOM   3004 C  CZ  . PHE B 1 39  ? -27.033 37.670 61.832  1.00 33.71  ? 39   PHE B CZ  1 
ATOM   3005 N  N   . VAL B 1 40  ? -28.536 37.253 68.927  1.00 22.97  ? 40   VAL B N   1 
ATOM   3006 C  CA  . VAL B 1 40  ? -28.834 36.781 70.300  1.00 21.12  ? 40   VAL B CA  1 
ATOM   3007 C  C   . VAL B 1 40  ? -30.247 37.159 70.712  1.00 20.97  ? 40   VAL B C   1 
ATOM   3008 O  O   . VAL B 1 40  ? -31.011 36.348 71.294  1.00 22.35  ? 40   VAL B O   1 
ATOM   3009 C  CB  . VAL B 1 40  ? -27.800 37.368 71.276  1.00 21.00  ? 40   VAL B CB  1 
ATOM   3010 C  CG1 . VAL B 1 40  ? -28.245 37.170 72.716  1.00 23.23  ? 40   VAL B CG1 1 
ATOM   3011 C  CG2 . VAL B 1 40  ? -26.466 36.771 71.027  1.00 25.55  ? 40   VAL B CG2 1 
ATOM   3012 N  N   . MET B 1 41  ? -30.676 38.370 70.349  1.00 25.45  ? 41   MET B N   1 
ATOM   3013 C  CA  . MET B 1 41  ? -32.106 38.745 70.618  1.00 28.42  ? 41   MET B CA  1 
ATOM   3014 C  C   . MET B 1 41  ? -33.073 37.812 69.958  1.00 26.40  ? 41   MET B C   1 
ATOM   3015 O  O   . MET B 1 41  ? -34.061 37.363 70.571  1.00 25.59  ? 41   MET B O   1 
ATOM   3016 C  CB  . MET B 1 41  ? -32.427 40.201 70.204  1.00 32.30  ? 41   MET B CB  1 
ATOM   3017 C  CG  . MET B 1 41  ? -32.006 41.265 71.191  1.00 38.66  ? 41   MET B CG  1 
ATOM   3018 S  SD  . MET B 1 41  ? -32.879 41.171 72.784  1.00 40.50  ? 41   MET B SD  1 
ATOM   3019 C  CE  . MET B 1 41  ? -34.552 40.770 72.288  1.00 45.26  ? 41   MET B CE  1 
ATOM   3020 N  N   . LYS B 1 42  ? -32.752 37.392 68.743  1.00 27.88  ? 42   LYS B N   1 
ATOM   3021 C  CA  . LYS B 1 42  ? -33.595 36.419 68.058  1.00 28.00  ? 42   LYS B CA  1 
ATOM   3022 C  C   . LYS B 1 42  ? -33.638 35.043 68.770  1.00 28.92  ? 42   LYS B C   1 
ATOM   3023 O  O   . LYS B 1 42  ? -34.679 34.475 68.935  1.00 25.59  ? 42   LYS B O   1 
ATOM   3024 C  CB  . LYS B 1 42  ? -33.145 36.302 66.567  1.00 28.60  ? 42   LYS B CB  1 
ATOM   3025 C  CG  . LYS B 1 42  ? -33.402 34.972 65.917  1.00 30.02  ? 42   LYS B CG  1 
ATOM   3026 C  CD  . LYS B 1 42  ? -32.669 34.834 64.549  1.00 24.10  ? 42   LYS B CD  1 
ATOM   3027 C  CE  . LYS B 1 42  ? -33.671 35.361 63.605  1.00 26.84  ? 42   LYS B CE  1 
ATOM   3028 N  NZ  . LYS B 1 42  ? -34.838 34.547 63.427  1.00 29.90  ? 42   LYS B NZ  1 
ATOM   3029 N  N   . LEU B 1 43  ? -32.503 34.521 69.205  1.00 28.82  ? 43   LEU B N   1 
ATOM   3030 C  CA  . LEU B 1 43  ? -32.449 33.249 69.888  1.00 27.59  ? 43   LEU B CA  1 
ATOM   3031 C  C   . LEU B 1 43  ? -33.110 33.345 71.299  1.00 30.32  ? 43   LEU B C   1 
ATOM   3032 O  O   . LEU B 1 43  ? -33.942 32.531 71.663  1.00 32.66  ? 43   LEU B O   1 
ATOM   3033 C  CB  . LEU B 1 43  ? -30.988 32.939 70.059  1.00 30.92  ? 43   LEU B CB  1 
ATOM   3034 C  CG  . LEU B 1 43  ? -30.581 31.684 70.787  1.00 37.87  ? 43   LEU B CG  1 
ATOM   3035 C  CD1 . LEU B 1 43  ? -30.657 30.521 69.817  1.00 43.57  ? 43   LEU B CD1 1 
ATOM   3036 C  CD2 . LEU B 1 43  ? -29.176 31.895 71.270  1.00 39.98  ? 43   LEU B CD2 1 
ATOM   3037 N  N   . ALA B 1 44  ? -32.752 34.388 72.052  1.00 28.59  ? 44   ALA B N   1 
ATOM   3038 C  CA  . ALA B 1 44  ? -32.959 34.406 73.514  1.00 27.96  ? 44   ALA B CA  1 
ATOM   3039 C  C   . ALA B 1 44  ? -34.049 35.378 73.990  1.00 28.31  ? 44   ALA B C   1 
ATOM   3040 O  O   . ALA B 1 44  ? -34.531 35.283 75.119  1.00 31.07  ? 44   ALA B O   1 
ATOM   3041 C  CB  . ALA B 1 44  ? -31.633 34.817 74.135  1.00 29.26  ? 44   ALA B CB  1 
ATOM   3042 N  N   . GLY B 1 45  ? -34.444 36.324 73.140  1.00 26.58  ? 45   GLY B N   1 
ATOM   3043 C  CA  . GLY B 1 45  ? -35.221 37.465 73.566  1.00 25.72  ? 45   GLY B CA  1 
ATOM   3044 C  C   . GLY B 1 45  ? -36.608 37.146 74.007  1.00 27.24  ? 45   GLY B C   1 
ATOM   3045 O  O   . GLY B 1 45  ? -37.031 37.618 75.048  1.00 28.01  ? 45   GLY B O   1 
ATOM   3046 N  N   . ASP B 1 46  ? -37.358 36.338 73.272  1.00 29.21  ? 46   ASP B N   1 
ATOM   3047 C  CA  . ASP B 1 46  ? -38.689 36.042 73.763  1.00 33.46  ? 46   ASP B CA  1 
ATOM   3048 C  C   . ASP B 1 46  ? -38.634 35.263 75.096  1.00 32.91  ? 46   ASP B C   1 
ATOM   3049 O  O   . ASP B 1 46  ? -39.470 35.489 75.960  1.00 28.90  ? 46   ASP B O   1 
ATOM   3050 C  CB  . ASP B 1 46  ? -39.510 35.221 72.792  1.00 37.68  ? 46   ASP B CB  1 
ATOM   3051 C  CG  . ASP B 1 46  ? -39.771 35.950 71.466  1.00 49.34  ? 46   ASP B CG  1 
ATOM   3052 O  OD1 . ASP B 1 46  ? -39.753 37.219 71.411  1.00 47.06  ? 46   ASP B OD1 1 
ATOM   3053 O  OD2 . ASP B 1 46  ? -39.987 35.213 70.474  1.00 55.77  ? 46   ASP B OD2 1 
ATOM   3054 N  N   . THR B 1 47  ? -37.726 34.283 75.206  1.00 30.33  ? 47   THR B N   1 
ATOM   3055 C  CA  . THR B 1 47  ? -37.603 33.509 76.432  1.00 29.58  ? 47   THR B CA  1 
ATOM   3056 C  C   . THR B 1 47  ? -37.285 34.458 77.591  1.00 24.98  ? 47   THR B C   1 
ATOM   3057 O  O   . THR B 1 47  ? -37.953 34.479 78.592  1.00 26.16  ? 47   THR B O   1 
ATOM   3058 C  CB  . THR B 1 47  ? -36.550 32.430 76.292  1.00 31.41  ? 47   THR B CB  1 
ATOM   3059 O  OG1 . THR B 1 47  ? -36.945 31.541 75.243  1.00 39.54  ? 47   THR B OG1 1 
ATOM   3060 C  CG2 . THR B 1 47  ? -36.422 31.626 77.604  1.00 31.45  ? 47   THR B CG2 1 
ATOM   3061 N  N   . LEU B 1 48  ? -36.308 35.298 77.425  1.00 23.35  ? 48   LEU B N   1 
ATOM   3062 C  CA  . LEU B 1 48  ? -35.912 36.154 78.483  1.00 27.37  ? 48   LEU B CA  1 
ATOM   3063 C  C   . LEU B 1 48  ? -37.004 37.171 78.827  1.00 33.27  ? 48   LEU B C   1 
ATOM   3064 O  O   . LEU B 1 48  ? -37.363 37.332 80.006  1.00 29.89  ? 48   LEU B O   1 
ATOM   3065 C  CB  . LEU B 1 48  ? -34.583 36.828 78.172  1.00 27.97  ? 48   LEU B CB  1 
ATOM   3066 C  CG  . LEU B 1 48  ? -34.169 37.947 79.132  1.00 30.31  ? 48   LEU B CG  1 
ATOM   3067 C  CD1 . LEU B 1 48  ? -33.946 37.381 80.510  1.00 30.16  ? 48   LEU B CD1 1 
ATOM   3068 C  CD2 . LEU B 1 48  ? -32.917 38.672 78.698  1.00 32.84  ? 48   LEU B CD2 1 
ATOM   3069 N  N   . MET B 1 49  ? -37.516 37.881 77.828  1.00 32.33  ? 49   MET B N   1 
ATOM   3070 C  CA  . MET B 1 49  ? -38.496 38.928 78.076  1.00 35.80  ? 49   MET B CA  1 
ATOM   3071 C  C   . MET B 1 49  ? -39.758 38.332 78.692  1.00 32.18  ? 49   MET B C   1 
ATOM   3072 O  O   . MET B 1 49  ? -40.325 38.929 79.591  1.00 32.86  ? 49   MET B O   1 
ATOM   3073 C  CB  . MET B 1 49  ? -38.850 39.707 76.803  1.00 38.75  ? 49   MET B CB  1 
ATOM   3074 C  CG  . MET B 1 49  ? -37.686 40.349 76.076  1.00 42.08  ? 49   MET B CG  1 
ATOM   3075 S  SD  . MET B 1 49  ? -36.502 41.253 77.071  1.00 48.84  ? 49   MET B SD  1 
ATOM   3076 C  CE  . MET B 1 49  ? -35.532 41.936 75.738  1.00 54.18  ? 49   MET B CE  1 
ATOM   3077 N  N   . GLY B 1 50  ? -40.140 37.135 78.271  1.00 30.50  ? 50   GLY B N   1 
ATOM   3078 C  CA  . GLY B 1 50  ? -41.248 36.449 78.870  1.00 32.77  ? 50   GLY B CA  1 
ATOM   3079 C  C   . GLY B 1 50  ? -41.039 36.079 80.337  1.00 38.77  ? 50   GLY B C   1 
ATOM   3080 O  O   . GLY B 1 50  ? -41.990 36.095 81.138  1.00 36.75  ? 50   GLY B O   1 
ATOM   3081 N  N   . SER B 1 51  ? -39.796 35.748 80.713  1.00 36.34  ? 51   SER B N   1 
ATOM   3082 C  CA  . SER B 1 51  ? -39.484 35.474 82.118  1.00 34.07  ? 51   SER B CA  1 
ATOM   3083 C  C   . SER B 1 51  ? -39.566 36.745 82.980  1.00 30.74  ? 51   SER B C   1 
ATOM   3084 O  O   . SER B 1 51  ? -40.076 36.697 84.099  1.00 34.16  ? 51   SER B O   1 
ATOM   3085 C  CB  . SER B 1 51  ? -38.086 34.801 82.272  1.00 35.31  ? 51   SER B CB  1 
ATOM   3086 O  OG  . SER B 1 51  ? -37.743 34.638 83.629  1.00 29.95  ? 51   SER B OG  1 
ATOM   3087 N  N   . LEU B 1 52  ? -39.032 37.843 82.466  1.00 28.81  ? 52   LEU B N   1 
ATOM   3088 C  CA  . LEU B 1 52  ? -39.003 39.112 83.133  1.00 30.82  ? 52   LEU B CA  1 
ATOM   3089 C  C   . LEU B 1 52  ? -40.452 39.594 83.392  1.00 37.35  ? 52   LEU B C   1 
ATOM   3090 O  O   . LEU B 1 52  ? -40.777 40.021 84.511  1.00 36.57  ? 52   LEU B O   1 
ATOM   3091 C  CB  . LEU B 1 52  ? -38.209 40.139 82.338  1.00 29.17  ? 52   LEU B CB  1 
ATOM   3092 C  CG  . LEU B 1 52  ? -36.712 39.837 82.176  1.00 28.17  ? 52   LEU B CG  1 
ATOM   3093 C  CD1 . LEU B 1 52  ? -35.997 40.978 81.529  1.00 28.58  ? 52   LEU B CD1 1 
ATOM   3094 C  CD2 . LEU B 1 52  ? -36.010 39.545 83.497  1.00 27.35  ? 52   LEU B CD2 1 
ATOM   3095 N  N   . GLN B 1 53  ? -41.306 39.450 82.386  1.00 39.99  ? 53   GLN B N   1 
ATOM   3096 C  CA  . GLN B 1 53  ? -42.717 39.835 82.506  1.00 42.61  ? 53   GLN B CA  1 
ATOM   3097 C  C   . GLN B 1 53  ? -43.432 39.026 83.547  1.00 41.47  ? 53   GLN B C   1 
ATOM   3098 O  O   . GLN B 1 53  ? -44.177 39.575 84.336  1.00 38.48  ? 53   GLN B O   1 
ATOM   3099 C  CB  . GLN B 1 53  ? -43.452 39.677 81.173  1.00 50.93  ? 53   GLN B CB  1 
ATOM   3100 C  CG  . GLN B 1 53  ? -43.901 40.999 80.542  1.00 59.05  ? 53   GLN B CG  1 
ATOM   3101 C  CD  . GLN B 1 53  ? -43.930 40.905 79.022  1.00 66.34  ? 53   GLN B CD  1 
ATOM   3102 O  OE1 . GLN B 1 53  ? -43.271 41.678 78.315  1.00 71.45  ? 53   GLN B OE1 1 
ATOM   3103 N  NE2 . GLN B 1 53  ? -44.662 39.923 78.512  1.00 64.30  ? 53   GLN B NE2 1 
ATOM   3104 N  N   . GLN B 1 54  ? -43.207 37.717 83.561  1.00 40.18  ? 54   GLN B N   1 
ATOM   3105 C  CA  . GLN B 1 54  ? -43.844 36.856 84.541  1.00 42.37  ? 54   GLN B CA  1 
ATOM   3106 C  C   . GLN B 1 54  ? -43.557 37.233 85.983  1.00 42.68  ? 54   GLN B C   1 
ATOM   3107 O  O   . GLN B 1 54  ? -44.322 36.886 86.851  1.00 45.34  ? 54   GLN B O   1 
ATOM   3108 C  CB  . GLN B 1 54  ? -43.410 35.412 84.358  1.00 50.99  ? 54   GLN B CB  1 
ATOM   3109 C  CG  . GLN B 1 54  ? -44.033 34.730 83.170  1.00 58.49  ? 54   GLN B CG  1 
ATOM   3110 C  CD  . GLN B 1 54  ? -43.312 33.438 82.823  1.00 69.38  ? 54   GLN B CD  1 
ATOM   3111 O  OE1 . GLN B 1 54  ? -42.796 33.282 81.721  1.00 68.61  ? 54   GLN B OE1 1 
ATOM   3112 N  NE2 . GLN B 1 54  ? -43.254 32.516 83.779  1.00 76.68  ? 54   GLN B NE2 1 
ATOM   3113 N  N   . HIS B 1 55  ? -42.453 37.913 86.248  1.00 40.08  ? 55   HIS B N   1 
ATOM   3114 C  CA  . HIS B 1 55  ? -42.087 38.237 87.627  1.00 38.56  ? 55   HIS B CA  1 
ATOM   3115 C  C   . HIS B 1 55  ? -42.155 39.725 87.861  1.00 39.09  ? 55   HIS B C   1 
ATOM   3116 O  O   . HIS B 1 55  ? -41.551 40.229 88.807  1.00 35.79  ? 55   HIS B O   1 
ATOM   3117 C  CB  . HIS B 1 55  ? -40.684 37.728 87.900  1.00 41.38  ? 55   HIS B CB  1 
ATOM   3118 C  CG  . HIS B 1 55  ? -40.612 36.252 87.921  1.00 36.53  ? 55   HIS B CG  1 
ATOM   3119 N  ND1 . HIS B 1 55  ? -40.879 35.528 89.053  1.00 40.07  ? 55   HIS B ND1 1 
ATOM   3120 C  CD2 . HIS B 1 55  ? -40.404 35.351 86.935  1.00 37.80  ? 55   HIS B CD2 1 
ATOM   3121 C  CE1 . HIS B 1 55  ? -40.785 34.240 88.782  1.00 40.03  ? 55   HIS B CE1 1 
ATOM   3122 N  NE2 . HIS B 1 55  ? -40.517 34.106 87.500  1.00 39.60  ? 55   HIS B NE2 1 
ATOM   3123 N  N   . GLY B 1 56  ? -42.878 40.436 86.991  1.00 39.24  ? 56   GLY B N   1 
ATOM   3124 C  CA  . GLY B 1 56  ? -43.132 41.858 87.199  1.00 37.45  ? 56   GLY B CA  1 
ATOM   3125 C  C   . GLY B 1 56  ? -41.878 42.680 87.034  1.00 38.86  ? 56   GLY B C   1 
ATOM   3126 O  O   . GLY B 1 56  ? -41.680 43.682 87.702  1.00 38.36  ? 56   GLY B O   1 
ATOM   3127 N  N   . VAL B 1 57  ? -41.016 42.289 86.111  1.00 38.86  ? 57   VAL B N   1 
ATOM   3128 C  CA  . VAL B 1 57  ? -39.832 43.079 85.870  1.00 33.10  ? 57   VAL B CA  1 
ATOM   3129 C  C   . VAL B 1 57  ? -39.937 43.821 84.569  1.00 35.65  ? 57   VAL B C   1 
ATOM   3130 O  O   . VAL B 1 57  ? -40.093 43.195 83.521  1.00 37.72  ? 57   VAL B O   1 
ATOM   3131 C  CB  . VAL B 1 57  ? -38.603 42.185 85.782  1.00 31.89  ? 57   VAL B CB  1 
ATOM   3132 C  CG1 . VAL B 1 57  ? -37.374 43.028 85.561  1.00 30.45  ? 57   VAL B CG1 1 
ATOM   3133 C  CG2 . VAL B 1 57  ? -38.497 41.303 87.024  1.00 32.10  ? 57   VAL B CG2 1 
ATOM   3134 N  N   . LYS B 1 58  ? -39.757 45.133 84.634  1.00 38.12  ? 58   LYS B N   1 
ATOM   3135 C  CA  . LYS B 1 58  ? -39.793 45.989 83.453  1.00 41.92  ? 58   LYS B CA  1 
ATOM   3136 C  C   . LYS B 1 58  ? -38.515 45.809 82.660  1.00 37.27  ? 58   LYS B C   1 
ATOM   3137 O  O   . LYS B 1 58  ? -37.478 45.534 83.228  1.00 38.24  ? 58   LYS B O   1 
ATOM   3138 C  CB  . LYS B 1 58  ? -39.937 47.483 83.836  1.00 44.88  ? 58   LYS B CB  1 
ATOM   3139 C  CG  . LYS B 1 58  ? -41.358 47.921 84.205  1.00 54.46  ? 58   LYS B CG  1 
ATOM   3140 C  CD  . LYS B 1 58  ? -41.499 49.443 84.377  1.00 58.41  ? 58   LYS B CD  1 
ATOM   3141 C  CE  . LYS B 1 58  ? -40.719 50.021 85.573  1.00 66.35  ? 58   LYS B CE  1 
ATOM   3142 N  NZ  . LYS B 1 58  ? -41.061 49.432 86.914  1.00 68.33  ? 58   LYS B NZ  1 
ATOM   3143 N  N   . HIS B 1 59  ? -38.590 45.972 81.347  1.00 35.82  ? 59   HIS B N   1 
ATOM   3144 C  CA  . HIS B 1 59  ? -37.423 45.796 80.499  1.00 38.04  ? 59   HIS B CA  1 
ATOM   3145 C  C   . HIS B 1 59  ? -37.466 46.613 79.227  1.00 41.87  ? 59   HIS B C   1 
ATOM   3146 O  O   . HIS B 1 59  ? -38.506 46.774 78.622  1.00 41.57  ? 59   HIS B O   1 
ATOM   3147 C  CB  . HIS B 1 59  ? -37.244 44.336 80.154  1.00 36.16  ? 59   HIS B CB  1 
ATOM   3148 C  CG  . HIS B 1 59  ? -38.484 43.670 79.661  1.00 39.70  ? 59   HIS B CG  1 
ATOM   3149 N  ND1 . HIS B 1 59  ? -39.467 43.195 80.513  1.00 41.35  ? 59   HIS B ND1 1 
ATOM   3150 C  CD2 . HIS B 1 59  ? -38.920 43.419 78.398  1.00 42.84  ? 59   HIS B CD2 1 
ATOM   3151 C  CE1 . HIS B 1 59  ? -40.437 42.650 79.798  1.00 44.28  ? 59   HIS B CE1 1 
ATOM   3152 N  NE2 . HIS B 1 59  ? -40.126 42.763 78.515  1.00 44.93  ? 59   HIS B NE2 1 
ATOM   3153 N  N   . HIS B 1 60  ? -36.304 47.095 78.829  1.00 42.91  ? 60   HIS B N   1 
ATOM   3154 C  CA  . HIS B 1 60  ? -36.149 47.860 77.616  1.00 47.48  ? 60   HIS B CA  1 
ATOM   3155 C  C   . HIS B 1 60  ? -34.959 47.206 76.933  1.00 41.78  ? 60   HIS B C   1 
ATOM   3156 O  O   . HIS B 1 60  ? -33.933 47.019 77.559  1.00 41.25  ? 60   HIS B O   1 
ATOM   3157 C  CB  . HIS B 1 60  ? -35.873 49.323 78.011  1.00 44.54  ? 60   HIS B CB  1 
ATOM   3158 C  CG  . HIS B 1 60  ? -35.247 50.139 76.937  1.00 55.78  ? 60   HIS B CG  1 
ATOM   3159 N  ND1 . HIS B 1 60  ? -35.868 50.384 75.727  1.00 66.99  ? 60   HIS B ND1 1 
ATOM   3160 C  CD2 . HIS B 1 60  ? -34.068 50.804 76.894  1.00 61.35  ? 60   HIS B CD2 1 
ATOM   3161 C  CE1 . HIS B 1 60  ? -35.085 51.143 74.976  1.00 63.05  ? 60   HIS B CE1 1 
ATOM   3162 N  NE2 . HIS B 1 60  ? -33.983 51.405 75.658  1.00 62.37  ? 60   HIS B NE2 1 
ATOM   3163 N  N   . ALA B 1 61  ? -35.089 46.830 75.675  1.00 40.44  ? 61   ALA B N   1 
ATOM   3164 C  CA  . ALA B 1 61  ? -33.991 46.212 74.906  1.00 37.37  ? 61   ALA B CA  1 
ATOM   3165 C  C   . ALA B 1 61  ? -33.240 47.257 74.097  1.00 35.40  ? 61   ALA B C   1 
ATOM   3166 O  O   . ALA B 1 61  ? -33.835 48.102 73.498  1.00 39.31  ? 61   ALA B O   1 
ATOM   3167 C  CB  . ALA B 1 61  ? -34.539 45.118 74.008  1.00 39.15  ? 61   ALA B CB  1 
ATOM   3168 N  N   . ALA B 1 62  ? -31.924 47.246 74.097  1.00 33.17  ? 62   ALA B N   1 
ATOM   3169 C  CA  . ALA B 1 62  ? -31.189 48.226 73.335  1.00 38.58  ? 62   ALA B CA  1 
ATOM   3170 C  C   . ALA B 1 62  ? -30.561 47.601 72.094  1.00 49.95  ? 62   ALA B C   1 
ATOM   3171 O  O   . ALA B 1 62  ? -30.067 46.478 72.149  1.00 51.22  ? 62   ALA B O   1 
ATOM   3172 C  CB  . ALA B 1 62  ? -30.121 48.848 74.172  1.00 37.67  ? 62   ALA B CB  1 
ATOM   3173 N  N   . LEU B 1 63  ? -30.569 48.372 71.000  1.00 61.09  ? 63   LEU B N   1 
ATOM   3174 C  CA  . LEU B 1 63  ? -29.897 48.016 69.753  1.00 64.31  ? 63   LEU B CA  1 
ATOM   3175 C  C   . LEU B 1 63  ? -28.411 47.961 70.062  1.00 57.38  ? 63   LEU B C   1 
ATOM   3176 O  O   . LEU B 1 63  ? -27.808 48.970 70.410  1.00 67.88  ? 63   LEU B O   1 
ATOM   3177 C  CB  . LEU B 1 63  ? -30.152 49.086 68.651  1.00 69.38  ? 63   LEU B CB  1 
ATOM   3178 C  CG  . LEU B 1 63  ? -31.565 49.454 68.133  1.00 70.58  ? 63   LEU B CG  1 
ATOM   3179 C  CD1 . LEU B 1 63  ? -31.643 50.942 67.776  1.00 72.88  ? 63   LEU B CD1 1 
ATOM   3180 C  CD2 . LEU B 1 63  ? -32.022 48.596 66.952  1.00 67.71  ? 63   LEU B CD2 1 
ATOM   3181 N  N   . PHE B 1 64  ? -27.828 46.782 69.992  1.00 53.83  ? 64   PHE B N   1 
ATOM   3182 C  CA  . PHE B 1 64  ? -26.407 46.653 70.208  1.00 49.49  ? 64   PHE B CA  1 
ATOM   3183 C  C   . PHE B 1 64  ? -25.717 46.004 68.980  1.00 59.02  ? 64   PHE B C   1 
ATOM   3184 O  O   . PHE B 1 64  ? -26.297 45.137 68.309  1.00 59.88  ? 64   PHE B O   1 
ATOM   3185 C  CB  . PHE B 1 64  ? -26.156 45.875 71.477  1.00 45.73  ? 64   PHE B CB  1 
ATOM   3186 C  CG  . PHE B 1 64  ? -24.696 45.718 71.793  1.00 43.49  ? 64   PHE B CG  1 
ATOM   3187 C  CD1 . PHE B 1 64  ? -23.905 46.827 72.064  1.00 41.09  ? 64   PHE B CD1 1 
ATOM   3188 C  CD2 . PHE B 1 64  ? -24.096 44.479 71.767  1.00 41.20  ? 64   PHE B CD2 1 
ATOM   3189 C  CE1 . PHE B 1 64  ? -22.551 46.692 72.319  1.00 43.21  ? 64   PHE B CE1 1 
ATOM   3190 C  CE2 . PHE B 1 64  ? -22.728 44.355 72.009  1.00 43.41  ? 64   PHE B CE2 1 
ATOM   3191 C  CZ  . PHE B 1 64  ? -21.958 45.456 72.301  1.00 39.51  ? 64   PHE B CZ  1 
ATOM   3192 N  N   . ASN B 1 65  ? -24.498 46.456 68.684  1.00 58.95  ? 65   ASN B N   1 
ATOM   3193 C  CA  . ASN B 1 65  ? -23.726 46.016 67.515  1.00 67.04  ? 65   ASN B CA  1 
ATOM   3194 C  C   . ASN B 1 65  ? -22.328 45.603 68.007  1.00 70.80  ? 65   ASN B C   1 
ATOM   3195 O  O   . ASN B 1 65  ? -21.838 46.126 69.010  1.00 75.07  ? 65   ASN B O   1 
ATOM   3196 C  CB  . ASN B 1 65  ? -23.639 47.181 66.486  1.00 68.95  ? 65   ASN B CB  1 
ATOM   3197 C  CG  . ASN B 1 65  ? -23.819 46.721 65.033  1.00 68.82  ? 65   ASN B CG  1 
ATOM   3198 O  OD1 . ASN B 1 65  ? -23.319 45.670 64.645  1.00 67.78  ? 65   ASN B OD1 1 
ATOM   3199 N  ND2 . ASN B 1 65  ? -24.519 47.524 64.219  1.00 60.75  ? 65   ASN B ND2 1 
ATOM   3200 N  N   . GLY B 1 66  ? -21.699 44.654 67.322  1.00 72.52  ? 66   GLY B N   1 
ATOM   3201 C  CA  . GLY B 1 66  ? -20.363 44.168 67.699  1.00 70.46  ? 66   GLY B CA  1 
ATOM   3202 C  C   . GLY B 1 66  ? -19.348 45.241 68.053  1.00 68.84  ? 66   GLY B C   1 
ATOM   3203 O  O   . GLY B 1 66  ? -19.083 45.476 69.234  1.00 62.93  ? 66   GLY B O   1 
ATOM   3204 N  N   . CYS B 1 69  ? -15.781 49.846 72.695  1.00 80.05  ? 69   CYS B N   1 
ATOM   3205 C  CA  . CYS B 1 69  ? -15.448 51.257 72.619  1.00 81.03  ? 69   CYS B CA  1 
ATOM   3206 C  C   . CYS B 1 69  ? -16.129 51.971 73.776  1.00 85.74  ? 69   CYS B C   1 
ATOM   3207 O  O   . CYS B 1 69  ? -17.331 51.760 74.002  1.00 75.33  ? 69   CYS B O   1 
ATOM   3208 C  CB  . CYS B 1 69  ? -15.906 51.852 71.275  1.00 81.38  ? 69   CYS B CB  1 
ATOM   3209 S  SG  . CYS B 1 69  ? -17.523 51.277 70.715  1.00 85.18  ? 69   CYS B SG  1 
ATOM   3210 N  N   . HIS B 1 70  ? -15.382 52.817 74.502  1.00 86.42  ? 70   HIS B N   1 
ATOM   3211 C  CA  . HIS B 1 70  ? -15.953 53.576 75.632  1.00 88.49  ? 70   HIS B CA  1 
ATOM   3212 C  C   . HIS B 1 70  ? -17.192 54.390 75.189  1.00 81.64  ? 70   HIS B C   1 
ATOM   3213 O  O   . HIS B 1 70  ? -17.936 54.897 76.026  1.00 75.76  ? 70   HIS B O   1 
ATOM   3214 C  CB  . HIS B 1 70  ? -14.898 54.479 76.325  1.00 92.55  ? 70   HIS B CB  1 
ATOM   3215 C  CG  . HIS B 1 70  ? -15.303 54.948 77.698  1.00 97.56  ? 70   HIS B CG  1 
ATOM   3216 N  ND1 . HIS B 1 70  ? -15.908 56.168 77.925  1.00 101.78 ? 70   HIS B ND1 1 
ATOM   3217 C  CD2 . HIS B 1 70  ? -15.204 54.353 78.912  1.00 95.52  ? 70   HIS B CD2 1 
ATOM   3218 C  CE1 . HIS B 1 70  ? -16.163 56.307 79.215  1.00 96.11  ? 70   HIS B CE1 1 
ATOM   3219 N  NE2 . HIS B 1 70  ? -15.745 55.221 79.837  1.00 96.48  ? 70   HIS B NE2 1 
ATOM   3220 N  N   . LYS B 1 71  ? -17.450 54.440 73.880  1.00 74.07  ? 71   LYS B N   1 
ATOM   3221 C  CA  . LYS B 1 71  ? -18.478 55.308 73.309  1.00 74.89  ? 71   LYS B CA  1 
ATOM   3222 C  C   . LYS B 1 71  ? -19.815 54.589 73.018  1.00 61.77  ? 71   LYS B C   1 
ATOM   3223 O  O   . LYS B 1 71  ? -20.859 55.215 73.113  1.00 61.26  ? 71   LYS B O   1 
ATOM   3224 C  CB  . LYS B 1 71  ? -17.937 56.093 72.076  1.00 84.59  ? 71   LYS B CB  1 
ATOM   3225 C  CG  . LYS B 1 71  ? -16.503 55.770 71.596  1.00 90.01  ? 71   LYS B CG  1 
ATOM   3226 C  CD  . LYS B 1 71  ? -15.595 57.006 71.586  1.00 93.31  ? 71   LYS B CD  1 
ATOM   3227 C  CE  . LYS B 1 71  ? -15.123 57.371 72.994  1.00 92.37  ? 71   LYS B CE  1 
ATOM   3228 N  NZ  . LYS B 1 71  ? -15.121 58.839 73.247  1.00 93.79  ? 71   LYS B NZ  1 
ATOM   3229 N  N   . GLU B 1 72  ? -19.788 53.297 72.675  1.00 55.81  ? 72   GLU B N   1 
ATOM   3230 C  CA  . GLU B 1 72  ? -21.008 52.449 72.725  1.00 52.12  ? 72   GLU B CA  1 
ATOM   3231 C  C   . GLU B 1 72  ? -21.461 52.276 74.179  1.00 44.40  ? 72   GLU B C   1 
ATOM   3232 O  O   . GLU B 1 72  ? -22.640 52.137 74.464  1.00 46.26  ? 72   GLU B O   1 
ATOM   3233 C  CB  . GLU B 1 72  ? -20.760 51.092 72.082  1.00 49.44  ? 72   GLU B CB  1 
ATOM   3234 C  CG  . GLU B 1 72  ? -22.018 50.271 71.804  1.00 54.38  ? 72   GLU B CG  1 
ATOM   3235 C  CD  . GLU B 1 72  ? -22.720 50.643 70.488  1.00 63.69  ? 72   GLU B CD  1 
ATOM   3236 O  OE1 . GLU B 1 72  ? -22.801 51.876 70.169  1.00 60.08  ? 72   GLU B OE1 1 
ATOM   3237 O  OE2 . GLU B 1 72  ? -23.190 49.700 69.774  1.00 65.13  ? 72   GLU B OE2 1 
ATOM   3238 N  N   . ILE B 1 73  ? -20.488 52.307 75.081  1.00 43.40  ? 73   ILE B N   1 
ATOM   3239 C  CA  . ILE B 1 73  ? -20.720 52.317 76.507  1.00 44.41  ? 73   ILE B CA  1 
ATOM   3240 C  C   . ILE B 1 73  ? -21.376 53.627 76.904  1.00 43.77  ? 73   ILE B C   1 
ATOM   3241 O  O   . ILE B 1 73  ? -22.313 53.624 77.660  1.00 41.17  ? 73   ILE B O   1 
ATOM   3242 C  CB  . ILE B 1 73  ? -19.384 52.117 77.299  1.00 48.33  ? 73   ILE B CB  1 
ATOM   3243 C  CG1 . ILE B 1 73  ? -18.811 50.709 77.012  1.00 47.02  ? 73   ILE B CG1 1 
ATOM   3244 C  CG2 . ILE B 1 73  ? -19.578 52.348 78.810  1.00 42.34  ? 73   ILE B CG2 1 
ATOM   3245 C  CD1 . ILE B 1 73  ? -17.398 50.475 77.493  1.00 50.77  ? 73   ILE B CD1 1 
ATOM   3246 N  N   . ASP B 1 74  ? -20.882 54.758 76.417  1.00 50.49  ? 74   ASP B N   1 
ATOM   3247 C  CA  . ASP B 1 74  ? -21.503 56.056 76.818  1.00 50.71  ? 74   ASP B CA  1 
ATOM   3248 C  C   . ASP B 1 74  ? -22.907 56.134 76.258  1.00 40.73  ? 74   ASP B C   1 
ATOM   3249 O  O   . ASP B 1 74  ? -23.871 56.347 76.979  1.00 49.05  ? 74   ASP B O   1 
ATOM   3250 C  CB  . ASP B 1 74  ? -20.670 57.262 76.363  1.00 56.19  ? 74   ASP B CB  1 
ATOM   3251 C  CG  . ASP B 1 74  ? -19.289 57.326 77.041  1.00 64.61  ? 74   ASP B CG  1 
ATOM   3252 O  OD1 . ASP B 1 74  ? -19.213 57.419 78.297  1.00 71.63  ? 74   ASP B OD1 1 
ATOM   3253 O  OD2 . ASP B 1 74  ? -18.268 57.290 76.307  1.00 61.91  ? 74   ASP B OD2 1 
ATOM   3254 N  N   . ARG B 1 75  ? -23.039 55.892 74.972  1.00 43.94  ? 75   ARG B N   1 
ATOM   3255 C  CA  . ARG B 1 75  ? -24.368 55.856 74.329  1.00 39.34  ? 75   ARG B CA  1 
ATOM   3256 C  C   . ARG B 1 75  ? -25.375 54.983 75.062  1.00 35.43  ? 75   ARG B C   1 
ATOM   3257 O  O   . ARG B 1 75  ? -26.529 55.350 75.183  1.00 36.14  ? 75   ARG B O   1 
ATOM   3258 C  CB  . ARG B 1 75  ? -24.245 55.378 72.879  1.00 42.74  ? 75   ARG B CB  1 
ATOM   3259 C  CG  . ARG B 1 75  ? -25.571 54.969 72.238  1.00 42.98  ? 75   ARG B CG  1 
ATOM   3260 C  CD  . ARG B 1 75  ? -25.323 54.389 70.844  1.00 48.30  ? 75   ARG B CD  1 
ATOM   3261 N  NE  . ARG B 1 75  ? -25.290 52.925 70.779  1.00 41.27  ? 75   ARG B NE  1 
ATOM   3262 C  CZ  . ARG B 1 75  ? -26.346 52.132 70.899  1.00 39.29  ? 75   ARG B CZ  1 
ATOM   3263 N  NH1 . ARG B 1 75  ? -27.540 52.617 71.146  1.00 49.41  ? 75   ARG B NH1 1 
ATOM   3264 N  NH2 . ARG B 1 75  ? -26.208 50.827 70.796  1.00 45.38  ? 75   ARG B NH2 1 
ATOM   3265 N  N   . LEU B 1 76  ? -24.970 53.795 75.521  1.00 35.76  ? 76   LEU B N   1 
ATOM   3266 C  CA  . LEU B 1 76  ? -25.904 52.909 76.227  1.00 30.61  ? 76   LEU B CA  1 
ATOM   3267 C  C   . LEU B 1 76  ? -26.120 53.451 77.671  1.00 34.07  ? 76   LEU B C   1 
ATOM   3268 O  O   . LEU B 1 76  ? -27.184 53.266 78.260  1.00 32.42  ? 76   LEU B O   1 
ATOM   3269 C  CB  . LEU B 1 76  ? -25.373 51.445 76.279  1.00 32.26  ? 76   LEU B CB  1 
ATOM   3270 C  CG  . LEU B 1 76  ? -25.492 50.639 74.976  1.00 33.68  ? 76   LEU B CG  1 
ATOM   3271 C  CD1 . LEU B 1 76  ? -24.532 49.449 74.922  1.00 37.33  ? 76   LEU B CD1 1 
ATOM   3272 C  CD2 . LEU B 1 76  ? -26.918 50.185 74.700  1.00 32.17  ? 76   LEU B CD2 1 
ATOM   3273 N  N   . GLY B 1 77  ? -25.094 54.096 78.218  1.00 36.67  ? 77   GLY B N   1 
ATOM   3274 C  CA  . GLY B 1 77  ? -25.204 54.852 79.462  1.00 41.56  ? 77   GLY B CA  1 
ATOM   3275 C  C   . GLY B 1 77  ? -26.336 55.881 79.398  1.00 45.27  ? 77   GLY B C   1 
ATOM   3276 O  O   . GLY B 1 77  ? -27.257 55.857 80.245  1.00 45.35  ? 77   GLY B O   1 
ATOM   3277 N  N   . ARG B 1 78  ? -26.325 56.742 78.373  1.00 50.14  ? 78   ARG B N   1 
ATOM   3278 C  CA  . ARG B 1 78  ? -27.399 57.775 78.264  1.00 52.72  ? 78   ARG B CA  1 
ATOM   3279 C  C   . ARG B 1 78  ? -28.774 57.138 78.070  1.00 45.73  ? 78   ARG B C   1 
ATOM   3280 O  O   . ARG B 1 78  ? -29.741 57.546 78.711  1.00 47.36  ? 78   ARG B O   1 
ATOM   3281 C  CB  . ARG B 1 78  ? -27.189 58.808 77.152  1.00 56.61  ? 78   ARG B CB  1 
ATOM   3282 C  CG  . ARG B 1 78  ? -25.777 59.129 76.772  1.00 62.09  ? 78   ARG B CG  1 
ATOM   3283 C  CD  . ARG B 1 78  ? -25.150 60.252 77.579  1.00 68.54  ? 78   ARG B CD  1 
ATOM   3284 N  NE  . ARG B 1 78  ? -23.715 60.245 77.312  1.00 75.44  ? 78   ARG B NE  1 
ATOM   3285 C  CZ  . ARG B 1 78  ? -23.155 60.446 76.112  1.00 87.43  ? 78   ARG B CZ  1 
ATOM   3286 N  NH1 . ARG B 1 78  ? -23.892 60.711 75.034  1.00 93.55  ? 78   ARG B NH1 1 
ATOM   3287 N  NH2 . ARG B 1 78  ? -21.832 60.395 75.982  1.00 90.80  ? 78   ARG B NH2 1 
ATOM   3288 N  N   . GLU B 1 79  ? -28.872 56.124 77.212  1.00 42.99  ? 79   GLU B N   1 
ATOM   3289 C  CA  . GLU B 1 79  ? -30.173 55.466 76.978  1.00 48.84  ? 79   GLU B CA  1 
ATOM   3290 C  C   . GLU B 1 79  ? -30.782 54.855 78.252  1.00 48.71  ? 79   GLU B C   1 
ATOM   3291 O  O   . GLU B 1 79  ? -32.016 54.816 78.454  1.00 45.93  ? 79   GLU B O   1 
ATOM   3292 C  CB  . GLU B 1 79  ? -30.011 54.382 75.916  1.00 53.67  ? 79   GLU B CB  1 
ATOM   3293 C  CG  . GLU B 1 79  ? -31.300 53.660 75.543  1.00 59.51  ? 79   GLU B CG  1 
ATOM   3294 C  CD  . GLU B 1 79  ? -31.185 52.915 74.202  1.00 67.25  ? 79   GLU B CD  1 
ATOM   3295 O  OE1 . GLU B 1 79  ? -30.168 53.132 73.471  1.00 57.66  ? 79   GLU B OE1 1 
ATOM   3296 O  OE2 . GLU B 1 79  ? -32.117 52.122 73.880  1.00 63.12  ? 79   GLU B OE2 1 
ATOM   3297 N  N   . LEU B 1 80  ? -29.889 54.362 79.110  1.00 45.43  ? 80   LEU B N   1 
ATOM   3298 C  CA  . LEU B 1 80  ? -30.284 53.817 80.387  1.00 46.95  ? 80   LEU B CA  1 
ATOM   3299 C  C   . LEU B 1 80  ? -30.956 54.913 81.245  1.00 39.89  ? 80   LEU B C   1 
ATOM   3300 O  O   . LEU B 1 80  ? -32.044 54.710 81.725  1.00 36.29  ? 80   LEU B O   1 
ATOM   3301 C  CB  . LEU B 1 80  ? -29.047 53.251 81.088  1.00 43.98  ? 80   LEU B CB  1 
ATOM   3302 C  CG  . LEU B 1 80  ? -29.251 52.378 82.302  1.00 50.14  ? 80   LEU B CG  1 
ATOM   3303 C  CD1 . LEU B 1 80  ? -28.064 51.419 82.417  1.00 49.74  ? 80   LEU B CD1 1 
ATOM   3304 C  CD2 . LEU B 1 80  ? -29.441 53.241 83.550  1.00 50.35  ? 80   LEU B CD2 1 
ATOM   3305 N  N   . LYS B 1 81  ? -30.275 56.031 81.442  1.00 43.46  ? 81   LYS B N   1 
ATOM   3306 C  CA  . LYS B 1 81  ? -30.835 57.187 82.195  1.00 52.59  ? 81   LYS B CA  1 
ATOM   3307 C  C   . LYS B 1 81  ? -32.157 57.639 81.592  1.00 53.87  ? 81   LYS B C   1 
ATOM   3308 O  O   . LYS B 1 81  ? -33.173 57.710 82.286  1.00 58.91  ? 81   LYS B O   1 
ATOM   3309 C  CB  . LYS B 1 81  ? -29.854 58.356 82.192  1.00 53.63  ? 81   LYS B CB  1 
ATOM   3310 C  CG  . LYS B 1 81  ? -28.545 58.077 82.914  1.00 51.73  ? 81   LYS B CG  1 
ATOM   3311 C  CD  . LYS B 1 81  ? -28.745 57.999 84.432  1.00 57.97  ? 81   LYS B CD  1 
ATOM   3312 C  CE  . LYS B 1 81  ? -29.093 56.597 84.947  1.00 59.14  ? 81   LYS B CE  1 
ATOM   3313 N  NZ  . LYS B 1 81  ? -28.227 56.173 86.091  1.00 58.28  ? 81   LYS B NZ  1 
ATOM   3314 N  N   . ALA B 1 82  ? -32.152 57.870 80.283  1.00 57.80  ? 82   ALA B N   1 
ATOM   3315 C  CA  . ALA B 1 82  ? -33.376 58.229 79.558  1.00 59.21  ? 82   ALA B CA  1 
ATOM   3316 C  C   . ALA B 1 82  ? -34.553 57.371 79.990  1.00 56.68  ? 82   ALA B C   1 
ATOM   3317 O  O   . ALA B 1 82  ? -35.571 57.929 80.367  1.00 61.58  ? 82   ALA B O   1 
ATOM   3318 C  CB  . ALA B 1 82  ? -33.182 58.142 78.043  1.00 59.08  ? 82   ALA B CB  1 
ATOM   3319 N  N   . HIS B 1 83  ? -34.444 56.039 79.976  1.00 49.42  ? 83   HIS B N   1 
ATOM   3320 C  CA  . HIS B 1 83  ? -35.627 55.200 80.380  1.00 51.31  ? 83   HIS B CA  1 
ATOM   3321 C  C   . HIS B 1 83  ? -35.716 54.940 81.878  1.00 46.80  ? 83   HIS B C   1 
ATOM   3322 O  O   . HIS B 1 83  ? -36.659 54.287 82.313  1.00 47.58  ? 83   HIS B O   1 
ATOM   3323 C  CB  . HIS B 1 83  ? -35.738 53.864 79.635  1.00 56.33  ? 83   HIS B CB  1 
ATOM   3324 C  CG  . HIS B 1 83  ? -36.148 53.992 78.195  1.00 69.19  ? 83   HIS B CG  1 
ATOM   3325 N  ND1 . HIS B 1 83  ? -35.311 54.511 77.222  1.00 72.57  ? 83   HIS B ND1 1 
ATOM   3326 C  CD2 . HIS B 1 83  ? -37.288 53.630 77.558  1.00 70.73  ? 83   HIS B CD2 1 
ATOM   3327 C  CE1 . HIS B 1 83  ? -35.930 54.489 76.056  1.00 74.21  ? 83   HIS B CE1 1 
ATOM   3328 N  NE2 . HIS B 1 83  ? -37.128 53.956 76.231  1.00 74.53  ? 83   HIS B NE2 1 
ATOM   3329 N  N   . GLY B 1 84  ? -34.749 55.462 82.644  1.00 43.84  ? 84   GLY B N   1 
ATOM   3330 C  CA  . GLY B 1 84  ? -34.709 55.324 84.121  1.00 45.15  ? 84   GLY B CA  1 
ATOM   3331 C  C   . GLY B 1 84  ? -34.421 53.903 84.607  1.00 44.96  ? 84   GLY B C   1 
ATOM   3332 O  O   . GLY B 1 84  ? -35.030 53.443 85.576  1.00 38.87  ? 84   GLY B O   1 
ATOM   3333 N  N   . CYS B 1 85  ? -33.543 53.168 83.913  1.00 38.82  ? 85   CYS B N   1 
ATOM   3334 C  CA  . CYS B 1 85  ? -33.424 51.730 84.238  1.00 39.94  ? 85   CYS B CA  1 
ATOM   3335 C  C   . CYS B 1 85  ? -32.659 51.554 85.545  1.00 31.11  ? 85   CYS B C   1 
ATOM   3336 O  O   . CYS B 1 85  ? -31.761 52.340 85.859  1.00 33.25  ? 85   CYS B O   1 
ATOM   3337 C  CB  . CYS B 1 85  ? -32.737 50.922 83.133  1.00 45.18  ? 85   CYS B CB  1 
ATOM   3338 S  SG  . CYS B 1 85  ? -33.091 51.514 81.451  1.00 58.56  ? 85   CYS B SG  1 
ATOM   3339 N  N   . ARG B 1 86  ? -32.977 50.482 86.267  1.00 31.94  ? 86   ARG B N   1 
ATOM   3340 C  CA  . ARG B 1 86  ? -32.386 50.206 87.609  1.00 32.60  ? 86   ARG B CA  1 
ATOM   3341 C  C   . ARG B 1 86  ? -31.337 49.022 87.611  1.00 33.71  ? 86   ARG B C   1 
ATOM   3342 O  O   . ARG B 1 86  ? -30.831 48.606 88.669  1.00 27.50  ? 86   ARG B O   1 
ATOM   3343 C  CB  . ARG B 1 86  ? -33.540 49.905 88.577  1.00 34.82  ? 86   ARG B CB  1 
ATOM   3344 C  CG  . ARG B 1 86  ? -34.639 51.006 88.682  1.00 44.33  ? 86   ARG B CG  1 
ATOM   3345 C  CD  . ARG B 1 86  ? -34.058 52.317 89.146  1.00 47.21  ? 86   ARG B CD  1 
ATOM   3346 N  NE  . ARG B 1 86  ? -33.218 52.053 90.323  1.00 57.05  ? 86   ARG B NE  1 
ATOM   3347 C  CZ  . ARG B 1 86  ? -32.149 52.753 90.723  1.00 57.74  ? 86   ARG B CZ  1 
ATOM   3348 N  NH1 . ARG B 1 86  ? -31.745 53.845 90.090  1.00 57.49  ? 86   ARG B NH1 1 
ATOM   3349 N  NH2 . ARG B 1 86  ? -31.483 52.346 91.798  1.00 60.10  ? 86   ARG B NH2 1 
ATOM   3350 N  N   . GLY B 1 87  ? -30.952 48.550 86.417  1.00 29.31  ? 87   GLY B N   1 
ATOM   3351 C  CA  . GLY B 1 87  ? -30.283 47.250 86.243  1.00 28.56  ? 87   GLY B CA  1 
ATOM   3352 C  C   . GLY B 1 87  ? -29.820 47.052 84.788  1.00 28.22  ? 87   GLY B C   1 
ATOM   3353 O  O   . GLY B 1 87  ? -30.388 47.660 83.849  1.00 26.18  ? 87   GLY B O   1 
ATOM   3354 N  N   . VAL B 1 88  ? -28.795 46.236 84.601  1.00 22.71  ? 88   VAL B N   1 
ATOM   3355 C  CA  . VAL B 1 88  ? -28.311 45.870 83.243  1.00 23.36  ? 88   VAL B CA  1 
ATOM   3356 C  C   . VAL B 1 88  ? -28.287 44.357 83.134  1.00 25.68  ? 88   VAL B C   1 
ATOM   3357 O  O   . VAL B 1 88  ? -27.866 43.638 84.123  1.00 20.50  ? 88   VAL B O   1 
ATOM   3358 C  CB  . VAL B 1 88  ? -26.915 46.454 82.980  1.00 26.63  ? 88   VAL B CB  1 
ATOM   3359 C  CG1 . VAL B 1 88  ? -26.419 46.161 81.558  1.00 27.44  ? 88   VAL B CG1 1 
ATOM   3360 C  CG2 . VAL B 1 88  ? -26.870 47.951 83.221  1.00 27.72  ? 88   VAL B CG2 1 
ATOM   3361 N  N   . ILE B 1 89  ? -28.820 43.829 82.014  1.00 21.11  ? 89   ILE B N   1 
ATOM   3362 C  CA  . ILE B 1 89  ? -28.609 42.449 81.599  1.00 19.45  ? 89   ILE B CA  1 
ATOM   3363 C  C   . ILE B 1 89  ? -27.800 42.427 80.290  1.00 24.39  ? 89   ILE B C   1 
ATOM   3364 O  O   . ILE B 1 89  ? -28.180 43.121 79.313  1.00 23.01  ? 89   ILE B O   1 
ATOM   3365 C  CB  . ILE B 1 89  ? -29.940 41.770 81.431  1.00 19.97  ? 89   ILE B CB  1 
ATOM   3366 C  CG1 . ILE B 1 89  ? -30.742 41.815 82.722  1.00 20.15  ? 89   ILE B CG1 1 
ATOM   3367 C  CG2 . ILE B 1 89  ? -29.812 40.371 80.854  1.00 21.91  ? 89   ILE B CG2 1 
ATOM   3368 C  CD1 . ILE B 1 89  ? -32.092 41.179 82.722  1.00 22.40  ? 89   ILE B CD1 1 
ATOM   3369 N  N   . GLY B 1 90  ? -26.641 41.755 80.282  1.00 22.05  ? 90   GLY B N   1 
ATOM   3370 C  CA  . GLY B 1 90  ? -25.906 41.482 79.051  1.00 21.97  ? 90   GLY B CA  1 
ATOM   3371 C  C   . GLY B 1 90  ? -26.189 40.075 78.603  1.00 23.27  ? 90   GLY B C   1 
ATOM   3372 O  O   . GLY B 1 90  ? -26.144 39.132 79.422  1.00 19.46  ? 90   GLY B O   1 
ATOM   3373 N  N   . VAL B 1 91  ? -26.490 39.864 77.323  1.00 19.55  ? 91   VAL B N   1 
ATOM   3374 C  CA  . VAL B 1 91  ? -26.750 38.507 76.831  1.00 20.25  ? 91   VAL B CA  1 
ATOM   3375 C  C   . VAL B 1 91  ? -25.916 38.283 75.594  1.00 22.58  ? 91   VAL B C   1 
ATOM   3376 O  O   . VAL B 1 91  ? -26.021 39.046 74.650  1.00 21.03  ? 91   VAL B O   1 
ATOM   3377 C  CB  . VAL B 1 91  ? -28.167 38.283 76.447  1.00 23.69  ? 91   VAL B CB  1 
ATOM   3378 C  CG1 . VAL B 1 91  ? -28.440 36.806 76.267  1.00 22.86  ? 91   VAL B CG1 1 
ATOM   3379 C  CG2 . VAL B 1 91  ? -29.091 38.954 77.415  1.00 26.71  ? 91   VAL B CG2 1 
ATOM   3380 N  N   . GLY B 1 92  ? -25.072 37.266 75.580  1.00 21.74  ? 92   GLY B N   1 
ATOM   3381 C  CA  . GLY B 1 92  ? -24.316 36.984 74.362  1.00 23.16  ? 92   GLY B CA  1 
ATOM   3382 C  C   . GLY B 1 92  ? -22.888 36.643 74.634  1.00 24.21  ? 92   GLY B C   1 
ATOM   3383 O  O   . GLY B 1 92  ? -22.617 36.143 75.691  1.00 22.57  ? 92   GLY B O   1 
ATOM   3384 N  N   . GLY B 1 93  ? -21.992 36.970 73.691  1.00 22.73  ? 93   GLY B N   1 
ATOM   3385 C  CA  . GLY B 1 93  ? -20.571 36.667 73.776  1.00 24.73  ? 93   GLY B CA  1 
ATOM   3386 C  C   . GLY B 1 93  ? -19.839 37.753 74.532  1.00 26.13  ? 93   GLY B C   1 
ATOM   3387 O  O   . GLY B 1 93  ? -20.432 38.692 75.077  1.00 25.83  ? 93   GLY B O   1 
ATOM   3388 N  N   . GLY B 1 94  ? -18.540 37.617 74.572  1.00 27.22  ? 94   GLY B N   1 
ATOM   3389 C  CA  . GLY B 1 94  ? -17.697 38.433 75.417  1.00 27.33  ? 94   GLY B CA  1 
ATOM   3390 C  C   . GLY B 1 94  ? -17.813 39.924 75.259  1.00 30.77  ? 94   GLY B C   1 
ATOM   3391 O  O   . GLY B 1 94  ? -17.859 40.631 76.220  1.00 26.44  ? 94   GLY B O   1 
ATOM   3392 N  N   . LYS B 1 95  ? -17.800 40.432 74.032  1.00 29.49  ? 95   LYS B N   1 
ATOM   3393 C  CA  . LYS B 1 95  ? -17.924 41.865 73.858  1.00 30.43  ? 95   LYS B CA  1 
ATOM   3394 C  C   . LYS B 1 95  ? -19.170 42.453 74.468  1.00 24.60  ? 95   LYS B C   1 
ATOM   3395 O  O   . LYS B 1 95  ? -19.112 43.547 75.057  1.00 25.12  ? 95   LYS B O   1 
ATOM   3396 C  CB  . LYS B 1 95  ? -17.846 42.207 72.368  1.00 36.70  ? 95   LYS B CB  1 
ATOM   3397 C  CG  . LYS B 1 95  ? -16.402 42.048 71.911  1.00 42.72  ? 95   LYS B CG  1 
ATOM   3398 C  CD  . LYS B 1 95  ? -16.226 42.284 70.418  1.00 53.72  ? 95   LYS B CD  1 
ATOM   3399 C  CE  . LYS B 1 95  ? -14.766 42.569 70.106  1.00 55.76  ? 95   LYS B CE  1 
ATOM   3400 N  NZ  . LYS B 1 95  ? -14.658 43.264 68.804  1.00 59.54  ? 95   LYS B NZ  1 
ATOM   3401 N  N   . THR B 1 96  ? -20.283 41.747 74.337  1.00 22.61  ? 96   THR B N   1 
ATOM   3402 C  CA  . THR B 1 96  ? -21.529 42.184 74.915  1.00 24.99  ? 96   THR B CA  1 
ATOM   3403 C  C   . THR B 1 96  ? -21.411 42.189 76.453  1.00 25.75  ? 96   THR B C   1 
ATOM   3404 O  O   . THR B 1 96  ? -21.806 43.168 77.100  1.00 23.02  ? 96   THR B O   1 
ATOM   3405 C  CB  . THR B 1 96  ? -22.683 41.266 74.504  1.00 25.54  ? 96   THR B CB  1 
ATOM   3406 O  OG1 . THR B 1 96  ? -22.865 41.333 73.086  1.00 28.36  ? 96   THR B OG1 1 
ATOM   3407 C  CG2 . THR B 1 96  ? -23.947 41.715 75.143  1.00 26.71  ? 96   THR B CG2 1 
ATOM   3408 N  N   . LEU B 1 97  ? -20.850 41.108 77.018  1.00 25.13  ? 97   LEU B N   1 
ATOM   3409 C  CA  . LEU B 1 97  ? -20.832 40.958 78.494  1.00 26.14  ? 97   LEU B CA  1 
ATOM   3410 C  C   . LEU B 1 97  ? -19.908 42.049 78.998  1.00 24.02  ? 97   LEU B C   1 
ATOM   3411 O  O   . LEU B 1 97  ? -20.202 42.661 80.000  1.00 25.43  ? 97   LEU B O   1 
ATOM   3412 C  CB  . LEU B 1 97  ? -20.356 39.570 78.919  1.00 28.21  ? 97   LEU B CB  1 
ATOM   3413 C  CG  . LEU B 1 97  ? -21.075 38.361 78.331  1.00 27.48  ? 97   LEU B CG  1 
ATOM   3414 C  CD1 . LEU B 1 97  ? -20.393 37.086 78.738  1.00 30.53  ? 97   LEU B CD1 1 
ATOM   3415 C  CD2 . LEU B 1 97  ? -22.525 38.323 78.748  1.00 26.21  ? 97   LEU B CD2 1 
ATOM   3416 N  N   . ASP B 1 98  ? -18.808 42.306 78.300  1.00 21.99  ? 98   ASP B N   1 
ATOM   3417 C  CA  . ASP B 1 98  ? -17.889 43.370 78.710  1.00 26.03  ? 98   ASP B CA  1 
ATOM   3418 C  C   . ASP B 1 98  ? -18.521 44.752 78.679  1.00 27.69  ? 98   ASP B C   1 
ATOM   3419 O  O   . ASP B 1 98  ? -18.247 45.570 79.525  1.00 25.87  ? 98   ASP B O   1 
ATOM   3420 C  CB  . ASP B 1 98  ? -16.657 43.447 77.812  1.00 30.60  ? 98   ASP B CB  1 
ATOM   3421 C  CG  . ASP B 1 98  ? -15.647 42.330 78.114  1.00 42.38  ? 98   ASP B CG  1 
ATOM   3422 O  OD1 . ASP B 1 98  ? -15.691 41.795 79.274  1.00 54.36  ? 98   ASP B OD1 1 
ATOM   3423 O  OD2 . ASP B 1 98  ? -14.808 42.007 77.219  1.00 44.56  ? 98   ASP B OD2 1 
ATOM   3424 N  N   . THR B 1 99  ? -19.375 44.985 77.692  1.00 26.35  ? 99   THR B N   1 
ATOM   3425 C  CA  . THR B 1 99  ? -20.037 46.251 77.555  1.00 26.61  ? 99   THR B CA  1 
ATOM   3426 C  C   . THR B 1 99  ? -21.041 46.344 78.671  1.00 25.31  ? 99   THR B C   1 
ATOM   3427 O  O   . THR B 1 99  ? -21.110 47.410 79.264  1.00 27.46  ? 99   THR B O   1 
ATOM   3428 C  CB  . THR B 1 99  ? -20.760 46.359 76.192  1.00 26.36  ? 99   THR B CB  1 
ATOM   3429 O  OG1 . THR B 1 99  ? -19.772 46.257 75.174  1.00 23.47  ? 99   THR B OG1 1 
ATOM   3430 C  CG2 . THR B 1 99  ? -21.445 47.671 76.059  1.00 29.67  ? 99   THR B CG2 1 
ATOM   3431 N  N   . ALA B 1 100 ? -21.749 45.241 78.997  1.00 23.59  ? 100  ALA B N   1 
ATOM   3432 C  CA  . ALA B 1 100 ? -22.729 45.274 80.097  1.00 23.52  ? 100  ALA B CA  1 
ATOM   3433 C  C   . ALA B 1 100 ? -22.111 45.556 81.453  1.00 25.40  ? 100  ALA B C   1 
ATOM   3434 O  O   . ALA B 1 100 ? -22.699 46.347 82.258  1.00 23.71  ? 100  ALA B O   1 
ATOM   3435 C  CB  . ALA B 1 100 ? -23.567 44.021 80.151  1.00 24.52  ? 100  ALA B CB  1 
ATOM   3436 N  N   . LYS B 1 101 ? -20.922 44.999 81.695  1.00 24.46  ? 101  LYS B N   1 
ATOM   3437 C  CA  . LYS B 1 101 ? -20.177 45.284 82.943  1.00 27.67  ? 101  LYS B CA  1 
ATOM   3438 C  C   . LYS B 1 101 ? -19.746 46.744 82.987  1.00 26.33  ? 101  LYS B C   1 
ATOM   3439 O  O   . LYS B 1 101 ? -19.766 47.379 84.046  1.00 24.59  ? 101  LYS B O   1 
ATOM   3440 C  CB  . LYS B 1 101 ? -18.870 44.488 83.056  1.00 27.15  ? 101  LYS B CB  1 
ATOM   3441 C  CG  . LYS B 1 101 ? -18.991 42.977 83.254  1.00 27.53  ? 101  LYS B CG  1 
ATOM   3442 C  CD  . LYS B 1 101 ? -17.608 42.324 83.241  1.00 27.11  ? 101  LYS B CD  1 
ATOM   3443 C  CE  . LYS B 1 101 ? -17.693 40.882 83.654  1.00 24.89  ? 101  LYS B CE  1 
ATOM   3444 N  NZ  . LYS B 1 101 ? -16.375 40.184 83.502  1.00 23.10  ? 101  LYS B NZ  1 
ATOM   3445 N  N   . ALA B 1 102 ? -19.265 47.248 81.870  1.00 23.00  ? 102  ALA B N   1 
ATOM   3446 C  CA  . ALA B 1 102 ? -18.831 48.649 81.858  1.00 26.73  ? 102  ALA B CA  1 
ATOM   3447 C  C   . ALA B 1 102 ? -20.021 49.569 82.143  1.00 28.03  ? 102  ALA B C   1 
ATOM   3448 O  O   . ALA B 1 102 ? -19.949 50.455 83.011  1.00 28.91  ? 102  ALA B O   1 
ATOM   3449 C  CB  . ALA B 1 102 ? -18.121 49.013 80.558  1.00 29.11  ? 102  ALA B CB  1 
ATOM   3450 N  N   . ILE B 1 103 ? -21.159 49.300 81.520  1.00 30.27  ? 103  ILE B N   1 
ATOM   3451 C  CA  . ILE B 1 103 ? -22.298 50.219 81.692  1.00 29.56  ? 103  ILE B CA  1 
ATOM   3452 C  C   . ILE B 1 103 ? -22.763 50.210 83.115  1.00 32.96  ? 103  ILE B C   1 
ATOM   3453 O  O   . ILE B 1 103 ? -23.054 51.269 83.669  1.00 30.79  ? 103  ILE B O   1 
ATOM   3454 C  CB  . ILE B 1 103 ? -23.496 49.859 80.806  1.00 31.83  ? 103  ILE B CB  1 
ATOM   3455 C  CG1 . ILE B 1 103 ? -23.313 50.405 79.424  1.00 38.09  ? 103  ILE B CG1 1 
ATOM   3456 C  CG2 . ILE B 1 103 ? -24.783 50.502 81.280  1.00 33.33  ? 103  ILE B CG2 1 
ATOM   3457 C  CD1 . ILE B 1 103 ? -22.455 49.583 78.533  1.00 44.27  ? 103  ILE B CD1 1 
ATOM   3458 N  N   . ALA B 1 104 ? -22.949 49.005 83.652  1.00 30.85  ? 104  ALA B N   1 
ATOM   3459 C  CA  . ALA B 1 104 ? -23.372 48.824 85.014  1.00 27.97  ? 104  ALA B CA  1 
ATOM   3460 C  C   . ALA B 1 104 ? -22.421 49.551 85.987  1.00 29.05  ? 104  ALA B C   1 
ATOM   3461 O  O   . ALA B 1 104 ? -22.861 50.215 86.929  1.00 29.33  ? 104  ALA B O   1 
ATOM   3462 C  CB  . ALA B 1 104 ? -23.420 47.350 85.344  1.00 30.24  ? 104  ALA B CB  1 
ATOM   3463 N  N   . HIS B 1 105 ? -21.126 49.415 85.757  1.00 27.99  ? 105  HIS B N   1 
ATOM   3464 C  CA  . HIS B 1 105 ? -20.150 50.074 86.585  1.00 31.96  ? 105  HIS B CA  1 
ATOM   3465 C  C   . HIS B 1 105 ? -20.311 51.592 86.517  1.00 34.79  ? 105  HIS B C   1 
ATOM   3466 O  O   . HIS B 1 105 ? -20.482 52.218 87.555  1.00 34.71  ? 105  HIS B O   1 
ATOM   3467 C  CB  . HIS B 1 105 ? -18.758 49.710 86.174  1.00 30.76  ? 105  HIS B CB  1 
ATOM   3468 C  CG  . HIS B 1 105 ? -17.723 50.676 86.655  1.00 33.25  ? 105  HIS B CG  1 
ATOM   3469 N  ND1 . HIS B 1 105 ? -17.273 50.699 87.959  1.00 33.67  ? 105  HIS B ND1 1 
ATOM   3470 C  CD2 . HIS B 1 105 ? -17.009 51.615 85.994  1.00 36.85  ? 105  HIS B CD2 1 
ATOM   3471 C  CE1 . HIS B 1 105 ? -16.349 51.631 88.087  1.00 36.49  ? 105  HIS B CE1 1 
ATOM   3472 N  NE2 . HIS B 1 105 ? -16.164 52.201 86.909  1.00 36.76  ? 105  HIS B NE2 1 
ATOM   3473 N  N   . TYR B 1 106 ? -20.286 52.176 85.313  1.00 32.40  ? 106  TYR B N   1 
ATOM   3474 C  CA  . TYR B 1 106 ? -20.337 53.651 85.207  1.00 38.70  ? 106  TYR B CA  1 
ATOM   3475 C  C   . TYR B 1 106 ? -21.636 54.235 85.736  1.00 38.85  ? 106  TYR B C   1 
ATOM   3476 O  O   . TYR B 1 106 ? -21.624 55.325 86.291  1.00 37.03  ? 106  TYR B O   1 
ATOM   3477 C  CB  . TYR B 1 106 ? -20.031 54.135 83.777  1.00 38.97  ? 106  TYR B CB  1 
ATOM   3478 C  CG  . TYR B 1 106 ? -18.571 54.000 83.448  1.00 41.86  ? 106  TYR B CG  1 
ATOM   3479 C  CD1 . TYR B 1 106 ? -17.632 54.871 83.999  1.00 46.30  ? 106  TYR B CD1 1 
ATOM   3480 C  CD2 . TYR B 1 106 ? -18.107 52.976 82.613  1.00 43.41  ? 106  TYR B CD2 1 
ATOM   3481 C  CE1 . TYR B 1 106 ? -16.274 54.740 83.728  1.00 45.02  ? 106  TYR B CE1 1 
ATOM   3482 C  CE2 . TYR B 1 106 ? -16.764 52.839 82.326  1.00 44.34  ? 106  TYR B CE2 1 
ATOM   3483 C  CZ  . TYR B 1 106 ? -15.845 53.722 82.891  1.00 49.33  ? 106  TYR B CZ  1 
ATOM   3484 O  OH  . TYR B 1 106 ? -14.506 53.602 82.587  1.00 54.41  ? 106  TYR B OH  1 
ATOM   3485 N  N   . GLN B 1 107 ? -22.734 53.481 85.641  1.00 38.74  ? 107  GLN B N   1 
ATOM   3486 C  CA  . GLN B 1 107 ? -24.023 53.887 86.211  1.00 41.49  ? 107  GLN B CA  1 
ATOM   3487 C  C   . GLN B 1 107 ? -24.268 53.411 87.651  1.00 39.77  ? 107  GLN B C   1 
ATOM   3488 O  O   . GLN B 1 107 ? -25.304 53.701 88.232  1.00 34.75  ? 107  GLN B O   1 
ATOM   3489 C  CB  . GLN B 1 107 ? -25.157 53.325 85.343  1.00 41.95  ? 107  GLN B CB  1 
ATOM   3490 C  CG  . GLN B 1 107 ? -25.053 53.741 83.879  1.00 45.92  ? 107  GLN B CG  1 
ATOM   3491 C  CD  . GLN B 1 107 ? -25.127 55.253 83.730  1.00 49.01  ? 107  GLN B CD  1 
ATOM   3492 O  OE1 . GLN B 1 107 ? -25.996 55.907 84.336  1.00 45.13  ? 107  GLN B OE1 1 
ATOM   3493 N  NE2 . GLN B 1 107 ? -24.197 55.816 82.970  1.00 45.15  ? 107  GLN B NE2 1 
ATOM   3494 N  N   . GLN B 1 108 ? -23.366 52.617 88.207  1.00 40.46  ? 108  GLN B N   1 
ATOM   3495 C  CA  . GLN B 1 108 ? -23.555 52.056 89.567  1.00 38.68  ? 108  GLN B CA  1 
ATOM   3496 C  C   . GLN B 1 108 ? -24.836 51.278 89.752  1.00 36.20  ? 108  GLN B C   1 
ATOM   3497 O  O   . GLN B 1 108 ? -25.597 51.551 90.679  1.00 35.15  ? 108  GLN B O   1 
ATOM   3498 C  CB  . GLN B 1 108 ? -23.523 53.180 90.603  1.00 41.30  ? 108  GLN B CB  1 
ATOM   3499 C  CG  . GLN B 1 108 ? -22.334 54.093 90.433  1.00 44.40  ? 108  GLN B CG  1 
ATOM   3500 C  CD  . GLN B 1 108 ? -21.077 53.444 90.946  1.00 58.27  ? 108  GLN B CD  1 
ATOM   3501 O  OE1 . GLN B 1 108 ? -20.177 53.079 90.169  1.00 68.62  ? 108  GLN B OE1 1 
ATOM   3502 N  NE2 . GLN B 1 108 ? -21.005 53.270 92.272  1.00 63.51  ? 108  GLN B NE2 1 
ATOM   3503 N  N   . LEU B 1 109 ? -25.092 50.308 88.877  1.00 31.35  ? 109  LEU B N   1 
ATOM   3504 C  CA  . LEU B 1 109 ? -26.268 49.480 88.991  1.00 27.60  ? 109  LEU B CA  1 
ATOM   3505 C  C   . LEU B 1 109 ? -25.922 47.999 88.990  1.00 24.52  ? 109  LEU B C   1 
ATOM   3506 O  O   . LEU B 1 109 ? -24.898 47.609 88.523  1.00 26.60  ? 109  LEU B O   1 
ATOM   3507 C  CB  . LEU B 1 109 ? -27.226 49.762 87.827  1.00 31.38  ? 109  LEU B CB  1 
ATOM   3508 C  CG  . LEU B 1 109 ? -27.709 51.225 87.730  1.00 33.96  ? 109  LEU B CG  1 
ATOM   3509 C  CD1 . LEU B 1 109 ? -28.369 51.437 86.385  1.00 33.98  ? 109  LEU B CD1 1 
ATOM   3510 C  CD2 . LEU B 1 109 ? -28.640 51.593 88.882  1.00 38.34  ? 109  LEU B CD2 1 
ATOM   3511 N  N   . PRO B 1 110 ? -26.820 47.161 89.476  1.00 26.71  ? 110  PRO B N   1 
ATOM   3512 C  CA  . PRO B 1 110 ? -26.541 45.777 89.437  1.00 25.72  ? 110  PRO B CA  1 
ATOM   3513 C  C   . PRO B 1 110 ? -26.528 45.253 87.982  1.00 29.17  ? 110  PRO B C   1 
ATOM   3514 O  O   . PRO B 1 110 ? -27.190 45.844 87.085  1.00 24.63  ? 110  PRO B O   1 
ATOM   3515 C  CB  . PRO B 1 110 ? -27.696 45.153 90.205  1.00 27.77  ? 110  PRO B CB  1 
ATOM   3516 C  CG  . PRO B 1 110 ? -28.785 46.162 90.136  1.00 29.55  ? 110  PRO B CG  1 
ATOM   3517 C  CD  . PRO B 1 110 ? -28.047 47.456 90.252  1.00 28.96  ? 110  PRO B CD  1 
ATOM   3518 N  N   . VAL B 1 111 ? -25.758 44.187 87.776  1.00 23.26  ? 111  VAL B N   1 
ATOM   3519 C  CA  . VAL B 1 111 ? -25.597 43.586 86.441  1.00 22.75  ? 111  VAL B CA  1 
ATOM   3520 C  C   . VAL B 1 111 ? -25.787 42.104 86.528  1.00 23.36  ? 111  VAL B C   1 
ATOM   3521 O  O   . VAL B 1 111 ? -25.278 41.454 87.490  1.00 23.75  ? 111  VAL B O   1 
ATOM   3522 C  CB  . VAL B 1 111 ? -24.258 43.989 85.822  1.00 23.09  ? 111  VAL B CB  1 
ATOM   3523 C  CG1 . VAL B 1 111 ? -23.074 43.446 86.620  1.00 24.98  ? 111  VAL B CG1 1 
ATOM   3524 C  CG2 . VAL B 1 111 ? -24.160 43.552 84.375  1.00 23.31  ? 111  VAL B CG2 1 
ATOM   3525 N  N   . VAL B 1 112 ? -26.523 41.564 85.554  1.00 20.92  ? 112  VAL B N   1 
ATOM   3526 C  CA  . VAL B 1 112 ? -26.801 40.170 85.381  1.00 20.79  ? 112  VAL B CA  1 
ATOM   3527 C  C   . VAL B 1 112 ? -26.204 39.798 84.002  1.00 23.38  ? 112  VAL B C   1 
ATOM   3528 O  O   . VAL B 1 112 ? -26.494 40.521 82.957  1.00 21.92  ? 112  VAL B O   1 
ATOM   3529 C  CB  . VAL B 1 112 ? -28.290 39.910 85.389  1.00 21.76  ? 112  VAL B CB  1 
ATOM   3530 C  CG1 . VAL B 1 112 ? -28.579 38.482 84.979  1.00 24.05  ? 112  VAL B CG1 1 
ATOM   3531 C  CG2 . VAL B 1 112 ? -28.923 40.215 86.722  1.00 24.72  ? 112  VAL B CG2 1 
ATOM   3532 N  N   . LEU B 1 113 ? -25.317 38.803 83.970  1.00 20.06  ? 113  LEU B N   1 
ATOM   3533 C  CA  . LEU B 1 113 ? -24.691 38.339 82.741  1.00 17.79  ? 113  LEU B CA  1 
ATOM   3534 C  C   . LEU B 1 113 ? -25.167 37.021 82.303  1.00 21.09  ? 113  LEU B C   1 
ATOM   3535 O  O   . LEU B 1 113 ? -25.235 36.029 83.096  1.00 18.59  ? 113  LEU B O   1 
ATOM   3536 C  CB  . LEU B 1 113 ? -23.177 38.387 82.827  1.00 19.57  ? 113  LEU B CB  1 
ATOM   3537 C  CG  . LEU B 1 113 ? -22.560 39.716 83.192  1.00 19.85  ? 113  LEU B CG  1 
ATOM   3538 C  CD1 . LEU B 1 113 ? -21.069 39.539 83.467  1.00 20.37  ? 113  LEU B CD1 1 
ATOM   3539 C  CD2 . LEU B 1 113 ? -22.821 40.736 82.073  1.00 21.53  ? 113  LEU B CD2 1 
ATOM   3540 N  N   . ILE B 1 114 ? -25.456 36.900 80.996  1.00 17.48  ? 114  ILE B N   1 
ATOM   3541 C  CA  . ILE B 1 114 ? -26.041 35.672 80.496  1.00 17.28  ? 114  ILE B CA  1 
ATOM   3542 C  C   . ILE B 1 114 ? -25.248 35.281 79.232  1.00 21.91  ? 114  ILE B C   1 
ATOM   3543 O  O   . ILE B 1 114 ? -25.593 35.697 78.091  1.00 21.39  ? 114  ILE B O   1 
ATOM   3544 C  CB  . ILE B 1 114 ? -27.494 35.828 80.144  1.00 18.58  ? 114  ILE B CB  1 
ATOM   3545 C  CG1 . ILE B 1 114 ? -28.285 36.507 81.294  1.00 21.60  ? 114  ILE B CG1 1 
ATOM   3546 C  CG2 . ILE B 1 114 ? -28.091 34.501 79.751  1.00 19.47  ? 114  ILE B CG2 1 
ATOM   3547 C  CD1 . ILE B 1 114 ? -29.771 36.568 81.094  1.00 20.35  ? 114  ILE B CD1 1 
ATOM   3548 N  N   . PRO B 1 115 ? -24.183 34.536 79.423  1.00 20.88  ? 115  PRO B N   1 
ATOM   3549 C  CA  . PRO B 1 115 ? -23.346 34.064 78.323  1.00 21.14  ? 115  PRO B CA  1 
ATOM   3550 C  C   . PRO B 1 115 ? -24.076 32.979 77.482  1.00 19.19  ? 115  PRO B C   1 
ATOM   3551 O  O   . PRO B 1 115 ? -24.696 32.096 78.016  1.00 20.11  ? 115  PRO B O   1 
ATOM   3552 C  CB  . PRO B 1 115 ? -22.073 33.542 79.024  1.00 21.02  ? 115  PRO B CB  1 
ATOM   3553 C  CG  . PRO B 1 115 ? -22.140 34.052 80.419  1.00 20.12  ? 115  PRO B CG  1 
ATOM   3554 C  CD  . PRO B 1 115 ? -23.598 34.190 80.745  1.00 24.15  ? 115  PRO B CD  1 
ATOM   3555 N  N   . THR B 1 116 ? -24.051 33.140 76.158  1.00 19.96  ? 116  THR B N   1 
ATOM   3556 C  CA  . THR B 1 116 ? -24.658 32.195 75.225  1.00 20.91  ? 116  THR B CA  1 
ATOM   3557 C  C   . THR B 1 116 ? -23.597 31.215 74.644  1.00 20.63  ? 116  THR B C   1 
ATOM   3558 O  O   . THR B 1 116 ? -23.934 30.242 73.900  1.00 19.48  ? 116  THR B O   1 
ATOM   3559 C  CB  . THR B 1 116 ? -25.340 32.977 74.053  1.00 20.59  ? 116  THR B CB  1 
ATOM   3560 O  OG1 . THR B 1 116 ? -24.393 33.854 73.478  1.00 21.04  ? 116  THR B OG1 1 
ATOM   3561 C  CG2 . THR B 1 116 ? -26.477 33.772 74.581  1.00 22.31  ? 116  THR B CG2 1 
ATOM   3562 N  N   . ILE B 1 117 ? -22.348 31.460 75.003  1.00 19.44  ? 117  ILE B N   1 
ATOM   3563 C  CA  . ILE B 1 117 ? -21.231 30.548 74.743  1.00 22.46  ? 117  ILE B CA  1 
ATOM   3564 C  C   . ILE B 1 117 ? -20.361 30.339 76.017  1.00 23.45  ? 117  ILE B C   1 
ATOM   3565 O  O   . ILE B 1 117 ? -20.435 31.162 76.932  1.00 24.61  ? 117  ILE B O   1 
ATOM   3566 C  CB  . ILE B 1 117 ? -20.326 31.080 73.638  1.00 23.82  ? 117  ILE B CB  1 
ATOM   3567 C  CG1 . ILE B 1 117 ? -19.849 32.464 73.951  1.00 26.16  ? 117  ILE B CG1 1 
ATOM   3568 C  CG2 . ILE B 1 117 ? -21.100 31.115 72.327  1.00 26.06  ? 117  ILE B CG2 1 
ATOM   3569 C  CD1 . ILE B 1 117 ? -18.846 32.990 72.913  1.00 28.42  ? 117  ILE B CD1 1 
ATOM   3570 N  N   . ALA B 1 118 ? -19.623 29.233 76.098  1.00 23.58  ? 118  ALA B N   1 
ATOM   3571 C  CA  . ALA B 1 118 ? -18.753 29.011 77.283  1.00 24.35  ? 118  ALA B CA  1 
ATOM   3572 C  C   . ALA B 1 118 ? -17.333 28.943 76.857  1.00 23.52  ? 118  ALA B C   1 
ATOM   3573 O  O   . ALA B 1 118 ? -16.701 27.914 77.027  1.00 25.32  ? 118  ALA B O   1 
ATOM   3574 C  CB  . ALA B 1 118 ? -19.158 27.770 78.080  1.00 25.05  ? 118  ALA B CB  1 
ATOM   3575 N  N   . SER B 1 119 ? -16.825 30.051 76.340  1.00 21.89  ? 119  SER B N   1 
ATOM   3576 C  CA  . SER B 1 119 ? -15.545 30.090 75.652  1.00 24.33  ? 119  SER B CA  1 
ATOM   3577 C  C   . SER B 1 119 ? -14.381 30.770 76.375  1.00 25.50  ? 119  SER B C   1 
ATOM   3578 O  O   . SER B 1 119 ? -13.240 30.698 75.897  1.00 27.21  ? 119  SER B O   1 
ATOM   3579 C  CB  . SER B 1 119 ? -15.709 30.772 74.269  1.00 30.57  ? 119  SER B CB  1 
ATOM   3580 O  OG  . SER B 1 119 ? -16.112 32.104 74.477  1.00 35.19  ? 119  SER B OG  1 
ATOM   3581 N  N   . THR B 1 120 ? -14.632 31.491 77.473  1.00 27.46  ? 120  THR B N   1 
ATOM   3582 C  CA  . THR B 1 120 ? -13.569 32.042 78.317  1.00 25.59  ? 120  THR B CA  1 
ATOM   3583 C  C   . THR B 1 120 ? -14.101 32.034 79.774  1.00 26.96  ? 120  THR B C   1 
ATOM   3584 O  O   . THR B 1 120 ? -15.324 31.879 79.999  1.00 25.89  ? 120  THR B O   1 
ATOM   3585 C  CB  . THR B 1 120 ? -13.229 33.539 78.025  1.00 28.44  ? 120  THR B CB  1 
ATOM   3586 O  OG1 . THR B 1 120 ? -14.307 34.355 78.502  1.00 24.29  ? 120  THR B OG1 1 
ATOM   3587 C  CG2 . THR B 1 120 ? -12.910 33.823 76.482  1.00 32.30  ? 120  THR B CG2 1 
ATOM   3588 N  N   . ASP B 1 121 ? -13.192 32.285 80.710  1.00 24.90  ? 121  ASP B N   1 
ATOM   3589 C  CA  . ASP B 1 121 ? -13.569 32.369 82.139  1.00 30.23  ? 121  ASP B CA  1 
ATOM   3590 C  C   . ASP B 1 121 ? -13.879 33.814 82.608  1.00 32.65  ? 121  ASP B C   1 
ATOM   3591 O  O   . ASP B 1 121 ? -14.003 34.084 83.823  1.00 29.07  ? 121  ASP B O   1 
ATOM   3592 C  CB  . ASP B 1 121 ? -12.501 31.667 83.023  1.00 32.68  ? 121  ASP B CB  1 
ATOM   3593 C  CG  . ASP B 1 121 ? -11.111 32.212 82.859  1.00 32.24  ? 121  ASP B CG  1 
ATOM   3594 O  OD1 . ASP B 1 121 ? -10.996 33.353 82.329  1.00 29.15  ? 121  ASP B OD1 1 
ATOM   3595 O  OD2 . ASP B 1 121 ? -10.114 31.515 83.290  1.00 37.21  ? 121  ASP B OD2 1 
ATOM   3596 N  N   . ALA B 1 122 ? -13.989 34.741 81.644  1.00 32.28  ? 122  ALA B N   1 
ATOM   3597 C  CA  . ALA B 1 122 ? -14.187 36.173 81.937  1.00 30.36  ? 122  ALA B CA  1 
ATOM   3598 C  C   . ALA B 1 122 ? -15.460 36.539 82.715  1.00 26.18  ? 122  ALA B C   1 
ATOM   3599 O  O   . ALA B 1 122 ? -15.410 37.461 83.525  1.00 24.48  ? 122  ALA B O   1 
ATOM   3600 C  CB  . ALA B 1 122 ? -14.144 37.009 80.630  1.00 31.38  ? 122  ALA B CB  1 
ATOM   3601 N  N   . PRO B 1 123 ? -16.593 35.824 82.501  1.00 25.83  ? 123  PRO B N   1 
ATOM   3602 C  CA  . PRO B 1 123 ? -17.894 36.376 82.952  1.00 23.73  ? 123  PRO B CA  1 
ATOM   3603 C  C   . PRO B 1 123 ? -18.048 36.596 84.453  1.00 24.20  ? 123  PRO B C   1 
ATOM   3604 O  O   . PRO B 1 123 ? -18.730 37.549 84.858  1.00 25.55  ? 123  PRO B O   1 
ATOM   3605 C  CB  . PRO B 1 123 ? -18.921 35.331 82.510  1.00 23.19  ? 123  PRO B CB  1 
ATOM   3606 C  CG  . PRO B 1 123 ? -18.249 34.651 81.357  1.00 25.82  ? 123  PRO B CG  1 
ATOM   3607 C  CD  . PRO B 1 123 ? -16.794 34.599 81.705  1.00 27.36  ? 123  PRO B CD  1 
ATOM   3608 N  N   . THR B 1 124 ? -17.480 35.712 85.273  1.00 21.57  ? 124  THR B N   1 
ATOM   3609 C  CA  . THR B 1 124 ? -17.637 35.876 86.745  1.00 21.63  ? 124  THR B CA  1 
ATOM   3610 C  C   . THR B 1 124 ? -16.789 36.971 87.290  1.00 17.94  ? 124  THR B C   1 
ATOM   3611 O  O   . THR B 1 124 ? -16.972 37.362 88.461  1.00 17.83  ? 124  THR B O   1 
ATOM   3612 C  CB  . THR B 1 124 ? -17.293 34.588 87.543  1.00 20.22  ? 124  THR B CB  1 
ATOM   3613 O  OG1 . THR B 1 124 ? -15.936 34.209 87.291  1.00 21.61  ? 124  THR B OG1 1 
ATOM   3614 C  CG2 . THR B 1 124 ? -18.222 33.434 87.141  1.00 23.47  ? 124  THR B CG2 1 
ATOM   3615 N  N   . SER B 1 125 ? -15.845 37.465 86.525  1.00 19.04  ? 125  SER B N   1 
ATOM   3616 C  CA  . SER B 1 125 ? -14.782 38.284 87.042  1.00 20.16  ? 125  SER B CA  1 
ATOM   3617 C  C   . SER B 1 125 ? -15.102 39.775 87.050  1.00 24.34  ? 125  SER B C   1 
ATOM   3618 O  O   . SER B 1 125 ? -15.971 40.232 86.317  1.00 23.16  ? 125  SER B O   1 
ATOM   3619 C  CB  . SER B 1 125 ? -13.484 38.079 86.247  1.00 21.33  ? 125  SER B CB  1 
ATOM   3620 O  OG  . SER B 1 125 ? -13.552 38.597 84.920  1.00 22.96  ? 125  SER B OG  1 
ATOM   3621 N  N   . ALA B 1 126 ? -14.350 40.509 87.854  1.00 21.26  ? 126  ALA B N   1 
ATOM   3622 C  CA  . ALA B 1 126 ? -14.437 41.978 87.926  1.00 28.44  ? 126  ALA B CA  1 
ATOM   3623 C  C   . ALA B 1 126 ? -13.413 42.653 86.975  1.00 30.36  ? 126  ALA B C   1 
ATOM   3624 O  O   . ALA B 1 126 ? -12.754 43.612 87.332  1.00 36.12  ? 126  ALA B O   1 
ATOM   3625 C  CB  . ALA B 1 126 ? -14.184 42.416 89.374  1.00 28.59  ? 126  ALA B CB  1 
ATOM   3626 N  N   . LEU B 1 127 ? -13.260 42.103 85.782  1.00 31.75  ? 127  LEU B N   1 
ATOM   3627 C  CA  . LEU B 1 127 ? -12.092 42.339 84.942  1.00 34.73  ? 127  LEU B CA  1 
ATOM   3628 C  C   . LEU B 1 127 ? -12.571 42.367 83.519  1.00 33.26  ? 127  LEU B C   1 
ATOM   3629 O  O   . LEU B 1 127 ? -13.419 41.560 83.155  1.00 32.11  ? 127  LEU B O   1 
ATOM   3630 C  CB  . LEU B 1 127 ? -11.082 41.195 85.057  1.00 35.33  ? 127  LEU B CB  1 
ATOM   3631 C  CG  . LEU B 1 127 ? -9.965  41.195 84.018  1.00 38.38  ? 127  LEU B CG  1 
ATOM   3632 C  CD1 . LEU B 1 127 ? -8.922  42.193 84.428  1.00 45.34  ? 127  LEU B CD1 1 
ATOM   3633 C  CD2 . LEU B 1 127 ? -9.302  39.866 83.797  1.00 40.53  ? 127  LEU B CD2 1 
ATOM   3634 N  N   . SER B 1 128 ? -12.010 43.257 82.724  1.00 29.78  ? 128  SER B N   1 
ATOM   3635 C  CA  . SER B 1 128 ? -12.162 43.143 81.273  1.00 32.04  ? 128  SER B CA  1 
ATOM   3636 C  C   . SER B 1 128 ? -10.790 43.328 80.703  1.00 29.43  ? 128  SER B C   1 
ATOM   3637 O  O   . SER B 1 128 ? -10.008 44.140 81.203  1.00 30.62  ? 128  SER B O   1 
ATOM   3638 C  CB  . SER B 1 128 ? -13.137 44.197 80.691  1.00 30.21  ? 128  SER B CB  1 
ATOM   3639 O  OG  . SER B 1 128 ? -14.482 43.904 81.093  1.00 36.98  ? 128  SER B OG  1 
ATOM   3640 N  N   . VAL B 1 129 ? -10.503 42.565 79.659  1.00 30.57  ? 129  VAL B N   1 
ATOM   3641 C  CA  . VAL B 1 129 ? -9.224  42.672 78.975  1.00 32.77  ? 129  VAL B CA  1 
ATOM   3642 C  C   . VAL B 1 129 ? -9.370  43.625 77.804  1.00 34.60  ? 129  VAL B C   1 
ATOM   3643 O  O   . VAL B 1 129 ? -10.201 43.406 76.943  1.00 32.92  ? 129  VAL B O   1 
ATOM   3644 C  CB  . VAL B 1 129 ? -8.752  41.327 78.411  1.00 35.38  ? 129  VAL B CB  1 
ATOM   3645 C  CG1 . VAL B 1 129 ? -7.351  41.494 77.874  1.00 33.02  ? 129  VAL B CG1 1 
ATOM   3646 C  CG2 . VAL B 1 129 ? -8.852  40.216 79.459  1.00 38.46  ? 129  VAL B CG2 1 
ATOM   3647 N  N   . ILE B 1 130 ? -8.526  44.636 77.754  1.00 36.97  ? 130  ILE B N   1 
ATOM   3648 C  CA  . ILE B 1 130 ? -8.573  45.627 76.688  1.00 39.55  ? 130  ILE B CA  1 
ATOM   3649 C  C   . ILE B 1 130 ? -7.467  45.323 75.672  1.00 38.59  ? 130  ILE B C   1 
ATOM   3650 O  O   . ILE B 1 130 ? -6.346  44.988 76.047  1.00 33.86  ? 130  ILE B O   1 
ATOM   3651 C  CB  . ILE B 1 130 ? -8.431  47.059 77.266  1.00 43.71  ? 130  ILE B CB  1 
ATOM   3652 C  CG1 . ILE B 1 130 ? -9.608  47.402 78.223  1.00 43.94  ? 130  ILE B CG1 1 
ATOM   3653 C  CG2 . ILE B 1 130 ? -8.263  48.090 76.145  1.00 51.00  ? 130  ILE B CG2 1 
ATOM   3654 C  CD1 . ILE B 1 130 ? -10.999 47.166 77.666  1.00 47.11  ? 130  ILE B CD1 1 
ATOM   3655 N  N   . TYR B 1 131 ? -7.811  45.448 74.381  1.00 36.96  ? 131  TYR B N   1 
ATOM   3656 C  CA  . TYR B 1 131 ? -6.910  45.232 73.284  1.00 38.27  ? 131  TYR B CA  1 
ATOM   3657 C  C   . TYR B 1 131 ? -6.814  46.523 72.425  1.00 40.08  ? 131  TYR B C   1 
ATOM   3658 O  O   . TYR B 1 131 ? -7.753  47.279 72.373  1.00 37.33  ? 131  TYR B O   1 
ATOM   3659 C  CB  . TYR B 1 131 ? -7.479  44.089 72.449  1.00 37.63  ? 131  TYR B CB  1 
ATOM   3660 C  CG  . TYR B 1 131 ? -7.423  42.738 73.127  1.00 38.09  ? 131  TYR B CG  1 
ATOM   3661 C  CD1 . TYR B 1 131 ? -6.254  41.964 73.068  1.00 38.61  ? 131  TYR B CD1 1 
ATOM   3662 C  CD2 . TYR B 1 131 ? -8.531  42.218 73.792  1.00 36.46  ? 131  TYR B CD2 1 
ATOM   3663 C  CE1 . TYR B 1 131 ? -6.177  40.720 73.689  1.00 40.20  ? 131  TYR B CE1 1 
ATOM   3664 C  CE2 . TYR B 1 131 ? -8.479  40.963 74.400  1.00 36.58  ? 131  TYR B CE2 1 
ATOM   3665 C  CZ  . TYR B 1 131 ? -7.282  40.225 74.348  1.00 39.18  ? 131  TYR B CZ  1 
ATOM   3666 O  OH  . TYR B 1 131 ? -7.196  38.990 74.934  1.00 43.75  ? 131  TYR B OH  1 
ATOM   3667 N  N   . THR B 1 132 ? -5.702  46.759 71.744  1.00 42.26  ? 132  THR B N   1 
ATOM   3668 C  CA  . THR B 1 132 ? -5.645  47.858 70.762  1.00 42.46  ? 132  THR B CA  1 
ATOM   3669 C  C   . THR B 1 132 ? -6.497  47.553 69.549  1.00 45.64  ? 132  THR B C   1 
ATOM   3670 O  O   . THR B 1 132 ? -7.138  46.492 69.458  1.00 40.73  ? 132  THR B O   1 
ATOM   3671 C  CB  . THR B 1 132 ? -4.221  48.117 70.289  1.00 42.02  ? 132  THR B CB  1 
ATOM   3672 O  OG1 . THR B 1 132 ? -3.749  47.018 69.461  1.00 41.58  ? 132  THR B OG1 1 
ATOM   3673 C  CG2 . THR B 1 132 ? -3.320  48.384 71.516  1.00 40.82  ? 132  THR B CG2 1 
ATOM   3674 N  N   . GLU B 1 133 ? -6.506  48.500 68.611  1.00 55.28  ? 133  GLU B N   1 
ATOM   3675 C  CA  . GLU B 1 133 ? -7.263  48.369 67.368  1.00 56.47  ? 133  GLU B CA  1 
ATOM   3676 C  C   . GLU B 1 133 ? -6.683  47.221 66.510  1.00 49.89  ? 133  GLU B C   1 
ATOM   3677 O  O   . GLU B 1 133 ? -7.426  46.444 65.887  1.00 49.17  ? 133  GLU B O   1 
ATOM   3678 C  CB  . GLU B 1 133 ? -7.269  49.713 66.599  1.00 62.85  ? 133  GLU B CB  1 
ATOM   3679 C  CG  . GLU B 1 133 ? -7.703  50.944 67.406  1.00 69.90  ? 133  GLU B CG  1 
ATOM   3680 C  CD  . GLU B 1 133 ? -9.198  50.978 67.744  1.00 79.61  ? 133  GLU B CD  1 
ATOM   3681 O  OE1 . GLU B 1 133 ? -9.881  49.941 67.600  1.00 88.95  ? 133  GLU B OE1 1 
ATOM   3682 O  OE2 . GLU B 1 133 ? -9.707  52.046 68.166  1.00 81.95  ? 133  GLU B OE2 1 
ATOM   3683 N  N   . GLN B 1 134 ? -5.365  47.060 66.572  1.00 51.07  ? 134  GLN B N   1 
ATOM   3684 C  CA  . GLN B 1 134 ? -4.665  45.992 65.844  1.00 53.64  ? 134  GLN B CA  1 
ATOM   3685 C  C   . GLN B 1 134 ? -4.696  44.632 66.558  1.00 55.85  ? 134  GLN B C   1 
ATOM   3686 O  O   . GLN B 1 134 ? -3.953  43.735 66.162  1.00 61.00  ? 134  GLN B O   1 
ATOM   3687 C  CB  . GLN B 1 134 ? -3.206  46.410 65.603  1.00 58.01  ? 134  GLN B CB  1 
ATOM   3688 C  CG  . GLN B 1 134 ? -3.041  47.766 64.932  1.00 64.76  ? 134  GLN B CG  1 
ATOM   3689 C  CD  . GLN B 1 134 ? -3.896  47.886 63.678  1.00 71.27  ? 134  GLN B CD  1 
ATOM   3690 O  OE1 . GLN B 1 134 ? -4.752  48.777 63.564  1.00 82.88  ? 134  GLN B OE1 1 
ATOM   3691 N  NE2 . GLN B 1 134 ? -3.696  46.964 62.744  1.00 74.28  ? 134  GLN B NE2 1 
ATOM   3692 N  N   . GLY B 1 135 ? -5.500  44.484 67.625  1.00 47.70  ? 135  GLY B N   1 
ATOM   3693 C  CA  . GLY B 1 135 ? -5.658  43.173 68.294  1.00 45.72  ? 135  GLY B CA  1 
ATOM   3694 C  C   . GLY B 1 135 ? -4.607  42.823 69.359  1.00 34.92  ? 135  GLY B C   1 
ATOM   3695 O  O   . GLY B 1 135 ? -4.661  41.747 69.925  1.00 37.77  ? 135  GLY B O   1 
ATOM   3696 N  N   . GLU B 1 136 ? -3.694  43.742 69.655  1.00 32.22  ? 136  GLU B N   1 
ATOM   3697 C  CA  . GLU B 1 136 ? -2.622  43.514 70.621  1.00 36.13  ? 136  GLU B CA  1 
ATOM   3698 C  C   . GLU B 1 136 ? -3.121  43.725 72.048  1.00 36.36  ? 136  GLU B C   1 
ATOM   3699 O  O   . GLU B 1 136 ? -3.888  44.676 72.303  1.00 29.19  ? 136  GLU B O   1 
ATOM   3700 C  CB  . GLU B 1 136 ? -1.427  44.437 70.393  1.00 41.27  ? 136  GLU B CB  1 
ATOM   3701 C  CG  . GLU B 1 136 ? -0.466  43.948 69.342  1.00 52.91  ? 136  GLU B CG  1 
ATOM   3702 C  CD  . GLU B 1 136 ? 0.767   44.828 69.208  1.00 62.27  ? 136  GLU B CD  1 
ATOM   3703 O  OE1 . GLU B 1 136 ? 1.023   45.640 70.130  1.00 67.77  ? 136  GLU B OE1 1 
ATOM   3704 O  OE2 . GLU B 1 136 ? 1.476   44.700 68.176  1.00 71.13  ? 136  GLU B OE2 1 
ATOM   3705 N  N   . PHE B 1 137 ? -2.662  42.865 72.980  1.00 31.82  ? 137  PHE B N   1 
ATOM   3706 C  CA  . PHE B 1 137 ? -3.070  43.012 74.379  1.00 31.06  ? 137  PHE B CA  1 
ATOM   3707 C  C   . PHE B 1 137 ? -2.675  44.413 74.798  1.00 29.38  ? 137  PHE B C   1 
ATOM   3708 O  O   . PHE B 1 137 ? -1.540  44.804 74.593  1.00 30.07  ? 137  PHE B O   1 
ATOM   3709 C  CB  . PHE B 1 137 ? -2.352  42.012 75.310  1.00 28.65  ? 137  PHE B CB  1 
ATOM   3710 C  CG  . PHE B 1 137 ? -2.510  42.346 76.755  1.00 28.24  ? 137  PHE B CG  1 
ATOM   3711 C  CD1 . PHE B 1 137 ? -3.711  42.114 77.372  1.00 29.34  ? 137  PHE B CD1 1 
ATOM   3712 C  CD2 . PHE B 1 137 ? -1.488  42.941 77.478  1.00 29.47  ? 137  PHE B CD2 1 
ATOM   3713 C  CE1 . PHE B 1 137 ? -3.867  42.406 78.724  1.00 29.80  ? 137  PHE B CE1 1 
ATOM   3714 C  CE2 . PHE B 1 137 ? -1.630  43.213 78.838  1.00 28.70  ? 137  PHE B CE2 1 
ATOM   3715 C  CZ  . PHE B 1 137 ? -2.820  42.949 79.450  1.00 29.41  ? 137  PHE B CZ  1 
ATOM   3716 N  N   . ALA B 1 138 ? -3.581  45.134 75.428  1.00 30.62  ? 138  ALA B N   1 
ATOM   3717 C  CA  . ALA B 1 138 ? -3.264  46.461 76.003  1.00 30.05  ? 138  ALA B CA  1 
ATOM   3718 C  C   . ALA B 1 138 ? -3.162  46.463 77.526  1.00 31.25  ? 138  ALA B C   1 
ATOM   3719 O  O   . ALA B 1 138 ? -2.135  46.818 78.083  1.00 33.95  ? 138  ALA B O   1 
ATOM   3720 C  CB  . ALA B 1 138 ? -4.343  47.472 75.574  1.00 30.73  ? 138  ALA B CB  1 
ATOM   3721 N  N   . GLU B 1 139 ? -4.250  46.126 78.203  1.00 30.63  ? 139  GLU B N   1 
ATOM   3722 C  CA  . GLU B 1 139 ? -4.254  46.116 79.659  1.00 32.54  ? 139  GLU B CA  1 
ATOM   3723 C  C   . GLU B 1 139 ? -5.382  45.318 80.234  1.00 30.59  ? 139  GLU B C   1 
ATOM   3724 O  O   . GLU B 1 139 ? -6.399  45.084 79.574  1.00 34.63  ? 139  GLU B O   1 
ATOM   3725 C  CB  . GLU B 1 139 ? -4.362  47.547 80.203  1.00 39.24  ? 139  GLU B CB  1 
ATOM   3726 C  CG  . GLU B 1 139 ? -5.718  48.204 79.991  1.00 45.63  ? 139  GLU B CG  1 
ATOM   3727 C  CD  . GLU B 1 139 ? -5.902  49.446 80.875  1.00 53.25  ? 139  GLU B CD  1 
ATOM   3728 O  OE1 . GLU B 1 139 ? -6.962  49.585 81.534  1.00 53.23  ? 139  GLU B OE1 1 
ATOM   3729 O  OE2 . GLU B 1 139 ? -4.963  50.258 80.946  1.00 54.80  ? 139  GLU B OE2 1 
ATOM   3730 N  N   . TYR B 1 140 ? -5.228  44.945 81.498  1.00 29.85  ? 140  TYR B N   1 
ATOM   3731 C  CA  . TYR B 1 140 ? -6.316  44.382 82.291  1.00 28.35  ? 140  TYR B CA  1 
ATOM   3732 C  C   . TYR B 1 140 ? -7.041  45.557 82.971  1.00 29.94  ? 140  TYR B C   1 
ATOM   3733 O  O   . TYR B 1 140 ? -6.439  46.285 83.713  1.00 30.21  ? 140  TYR B O   1 
ATOM   3734 C  CB  . TYR B 1 140 ? -5.756  43.435 83.379  1.00 27.56  ? 140  TYR B CB  1 
ATOM   3735 C  CG  . TYR B 1 140 ? -5.140  42.151 82.851  1.00 26.46  ? 140  TYR B CG  1 
ATOM   3736 C  CD1 . TYR B 1 140 ? -5.916  41.222 82.152  1.00 30.25  ? 140  TYR B CD1 1 
ATOM   3737 C  CD2 . TYR B 1 140 ? -3.787  41.872 83.017  1.00 27.45  ? 140  TYR B CD2 1 
ATOM   3738 C  CE1 . TYR B 1 140 ? -5.354  40.045 81.642  1.00 28.57  ? 140  TYR B CE1 1 
ATOM   3739 C  CE2 . TYR B 1 140 ? -3.220  40.711 82.516  1.00 24.34  ? 140  TYR B CE2 1 
ATOM   3740 C  CZ  . TYR B 1 140 ? -4.025  39.804 81.807  1.00 26.61  ? 140  TYR B CZ  1 
ATOM   3741 O  OH  . TYR B 1 140 ? -3.535  38.621 81.303  1.00 22.82  ? 140  TYR B OH  1 
ATOM   3742 N  N   . LEU B 1 141 ? -8.323  45.729 82.732  1.00 29.64  ? 141  LEU B N   1 
ATOM   3743 C  CA  . LEU B 1 141 ? -9.088  46.826 83.364  1.00 33.77  ? 141  LEU B CA  1 
ATOM   3744 C  C   . LEU B 1 141 ? -9.849  46.187 84.551  1.00 31.88  ? 141  LEU B C   1 
ATOM   3745 O  O   . LEU B 1 141 ? -10.627 45.284 84.322  1.00 30.55  ? 141  LEU B O   1 
ATOM   3746 C  CB  . LEU B 1 141 ? -10.097 47.384 82.331  1.00 36.58  ? 141  LEU B CB  1 
ATOM   3747 C  CG  . LEU B 1 141 ? -11.269 48.291 82.749  1.00 43.82  ? 141  LEU B CG  1 
ATOM   3748 C  CD1 . LEU B 1 141 ? -10.901 49.436 83.686  1.00 44.33  ? 141  LEU B CD1 1 
ATOM   3749 C  CD2 . LEU B 1 141 ? -11.912 48.847 81.478  1.00 47.04  ? 141  LEU B CD2 1 
ATOM   3750 N  N   . ILE B 1 142 ? -9.578  46.602 85.797  1.00 31.39  ? 142  ILE B N   1 
ATOM   3751 C  CA  . ILE B 1 142 ? -10.200 45.977 86.984  1.00 33.45  ? 142  ILE B CA  1 
ATOM   3752 C  C   . ILE B 1 142 ? -11.362 46.825 87.487  1.00 31.27  ? 142  ILE B C   1 
ATOM   3753 O  O   . ILE B 1 142 ? -11.192 47.995 87.766  1.00 33.34  ? 142  ILE B O   1 
ATOM   3754 C  CB  . ILE B 1 142 ? -9.210  45.868 88.182  1.00 34.52  ? 142  ILE B CB  1 
ATOM   3755 C  CG1 . ILE B 1 142 ? -7.844  45.330 87.766  1.00 39.89  ? 142  ILE B CG1 1 
ATOM   3756 C  CG2 . ILE B 1 142 ? -9.818  45.037 89.297  1.00 34.57  ? 142  ILE B CG2 1 
ATOM   3757 C  CD1 . ILE B 1 142 ? -7.883  43.916 87.266  1.00 39.23  ? 142  ILE B CD1 1 
ATOM   3758 N  N   . TYR B 1 143 ? -12.526 46.242 87.627  1.00 29.36  ? 143  TYR B N   1 
ATOM   3759 C  CA  . TYR B 1 143 ? -13.616 46.955 88.171  1.00 28.96  ? 143  TYR B CA  1 
ATOM   3760 C  C   . TYR B 1 143 ? -13.629 46.709 89.665  1.00 32.22  ? 143  TYR B C   1 
ATOM   3761 O  O   . TYR B 1 143 ? -13.076 45.700 90.108  1.00 27.99  ? 143  TYR B O   1 
ATOM   3762 C  CB  . TYR B 1 143 ? -14.893 46.454 87.581  1.00 29.85  ? 143  TYR B CB  1 
ATOM   3763 C  CG  . TYR B 1 143 ? -15.033 46.815 86.143  1.00 31.98  ? 143  TYR B CG  1 
ATOM   3764 C  CD1 . TYR B 1 143 ? -15.353 48.123 85.770  1.00 35.74  ? 143  TYR B CD1 1 
ATOM   3765 C  CD2 . TYR B 1 143 ? -14.868 45.859 85.150  1.00 31.23  ? 143  TYR B CD2 1 
ATOM   3766 C  CE1 . TYR B 1 143 ? -15.496 48.473 84.439  1.00 36.53  ? 143  TYR B CE1 1 
ATOM   3767 C  CE2 . TYR B 1 143 ? -15.032 46.185 83.817  1.00 35.23  ? 143  TYR B CE2 1 
ATOM   3768 C  CZ  . TYR B 1 143 ? -15.346 47.494 83.464  1.00 35.96  ? 143  TYR B CZ  1 
ATOM   3769 O  OH  . TYR B 1 143 ? -15.469 47.831 82.144  1.00 39.25  ? 143  TYR B OH  1 
ATOM   3770 N  N   . PRO B 1 144 ? -14.264 47.623 90.441  1.00 32.33  ? 144  PRO B N   1 
ATOM   3771 C  CA  . PRO B 1 144 ? -14.331 47.429 91.888  1.00 35.30  ? 144  PRO B CA  1 
ATOM   3772 C  C   . PRO B 1 144 ? -15.295 46.312 92.342  1.00 34.93  ? 144  PRO B C   1 
ATOM   3773 O  O   . PRO B 1 144 ? -15.182 45.864 93.473  1.00 35.55  ? 144  PRO B O   1 
ATOM   3774 C  CB  . PRO B 1 144 ? -14.784 48.822 92.424  1.00 40.68  ? 144  PRO B CB  1 
ATOM   3775 C  CG  . PRO B 1 144 ? -15.383 49.552 91.258  1.00 39.85  ? 144  PRO B CG  1 
ATOM   3776 C  CD  . PRO B 1 144 ? -14.695 48.988 90.024  1.00 37.79  ? 144  PRO B CD  1 
ATOM   3777 N  N   . ARG B 1 145 ? -16.255 45.884 91.506  1.00 30.84  ? 145  ARG B N   1 
ATOM   3778 C  CA  . ARG B 1 145 ? -17.176 44.817 91.885  1.00 30.27  ? 145  ARG B CA  1 
ATOM   3779 C  C   . ARG B 1 145 ? -17.182 43.674 90.897  1.00 29.48  ? 145  ARG B C   1 
ATOM   3780 O  O   . ARG B 1 145 ? -16.984 43.902 89.687  1.00 24.09  ? 145  ARG B O   1 
ATOM   3781 C  CB  . ARG B 1 145 ? -18.616 45.312 91.941  1.00 34.00  ? 145  ARG B CB  1 
ATOM   3782 C  CG  . ARG B 1 145 ? -18.839 46.576 92.733  1.00 36.37  ? 145  ARG B CG  1 
ATOM   3783 C  CD  . ARG B 1 145 ? -20.293 46.973 92.578  1.00 39.67  ? 145  ARG B CD  1 
ATOM   3784 N  NE  . ARG B 1 145 ? -21.151 45.863 93.007  1.00 43.34  ? 145  ARG B NE  1 
ATOM   3785 C  CZ  . ARG B 1 145 ? -21.399 45.524 94.279  1.00 52.83  ? 145  ARG B CZ  1 
ATOM   3786 N  NH1 . ARG B 1 145 ? -20.923 46.235 95.313  1.00 49.73  ? 145  ARG B NH1 1 
ATOM   3787 N  NH2 . ARG B 1 145 ? -22.173 44.474 94.523  1.00 51.85  ? 145  ARG B NH2 1 
ATOM   3788 N  N   . ASN B 1 146 ? -17.492 42.461 91.377  1.00 23.51  ? 146  ASN B N   1 
ATOM   3789 C  CA  . ASN B 1 146 ? -17.852 41.369 90.449  1.00 24.72  ? 146  ASN B CA  1 
ATOM   3790 C  C   . ASN B 1 146 ? -19.293 41.550 89.996  1.00 24.56  ? 146  ASN B C   1 
ATOM   3791 O  O   . ASN B 1 146 ? -20.056 42.208 90.685  1.00 23.45  ? 146  ASN B O   1 
ATOM   3792 C  CB  . ASN B 1 146 ? -17.735 40.003 91.114  1.00 24.64  ? 146  ASN B CB  1 
ATOM   3793 C  CG  . ASN B 1 146 ? -16.312 39.591 91.346  1.00 22.70  ? 146  ASN B CG  1 
ATOM   3794 O  OD1 . ASN B 1 146 ? -15.605 40.128 92.189  1.00 20.89  ? 146  ASN B OD1 1 
ATOM   3795 N  ND2 . ASN B 1 146 ? -15.875 38.621 90.580  1.00 21.22  ? 146  ASN B ND2 1 
ATOM   3796 N  N   . PRO B 1 147 ? -19.700 40.893 88.899  1.00 23.00  ? 147  PRO B N   1 
ATOM   3797 C  CA  . PRO B 1 147 ? -21.125 40.906 88.540  1.00 23.36  ? 147  PRO B CA  1 
ATOM   3798 C  C   . PRO B 1 147 ? -21.966 40.357 89.617  1.00 22.98  ? 147  PRO B C   1 
ATOM   3799 O  O   . PRO B 1 147 ? -21.587 39.396 90.296  1.00 21.74  ? 147  PRO B O   1 
ATOM   3800 C  CB  . PRO B 1 147 ? -21.265 39.961 87.337  1.00 21.38  ? 147  PRO B CB  1 
ATOM   3801 C  CG  . PRO B 1 147 ? -19.882 39.723 86.883  1.00 24.71  ? 147  PRO B CG  1 
ATOM   3802 C  CD  . PRO B 1 147 ? -18.867 40.251 87.866  1.00 26.12  ? 147  PRO B CD  1 
ATOM   3803 N  N   . ASP B 1 148 ? -23.159 40.876 89.714  1.00 21.25  ? 148  ASP B N   1 
ATOM   3804 C  CA  . ASP B 1 148 ? -24.087 40.405 90.725  1.00 22.84  ? 148  ASP B CA  1 
ATOM   3805 C  C   . ASP B 1 148 ? -24.534 39.005 90.456  1.00 23.44  ? 148  ASP B C   1 
ATOM   3806 O  O   . ASP B 1 148 ? -24.742 38.185 91.381  1.00 19.54  ? 148  ASP B O   1 
ATOM   3807 C  CB  . ASP B 1 148 ? -25.270 41.360 90.802  1.00 25.19  ? 148  ASP B CB  1 
ATOM   3808 C  CG  . ASP B 1 148 ? -24.847 42.741 91.139  1.00 28.44  ? 148  ASP B CG  1 
ATOM   3809 O  OD1 . ASP B 1 148 ? -24.373 43.516 90.267  1.00 28.16  ? 148  ASP B OD1 1 
ATOM   3810 O  OD2 . ASP B 1 148 ? -24.849 43.017 92.365  1.00 30.45  ? 148  ASP B OD2 1 
ATOM   3811 N  N   . MET B 1 149 ? -24.709 38.677 89.176  1.00 20.44  ? 149  MET B N   1 
ATOM   3812 C  CA  . MET B 1 149 ? -25.283 37.390 88.871  1.00 20.91  ? 149  MET B CA  1 
ATOM   3813 C  C   . MET B 1 149 ? -24.799 36.903 87.495  1.00 21.61  ? 149  MET B C   1 
ATOM   3814 O  O   . MET B 1 149 ? -24.676 37.715 86.541  1.00 18.83  ? 149  MET B O   1 
ATOM   3815 C  CB  . MET B 1 149 ? -26.771 37.526 88.887  1.00 26.57  ? 149  MET B CB  1 
ATOM   3816 C  CG  . MET B 1 149 ? -27.584 36.269 88.759  1.00 35.40  ? 149  MET B CG  1 
ATOM   3817 S  SD  . MET B 1 149 ? -29.326 36.598 89.152  1.00 50.64  ? 149  MET B SD  1 
ATOM   3818 C  CE  . MET B 1 149 ? -29.206 36.928 90.913  1.00 42.49  ? 149  MET B CE  1 
ATOM   3819 N  N   . VAL B 1 150 ? -24.552 35.605 87.406  1.00 18.06  ? 150  VAL B N   1 
ATOM   3820 C  CA  . VAL B 1 150 ? -24.176 34.990 86.138  1.00 18.30  ? 150  VAL B CA  1 
ATOM   3821 C  C   . VAL B 1 150 ? -25.090 33.837 85.936  1.00 18.83  ? 150  VAL B C   1 
ATOM   3822 O  O   . VAL B 1 150 ? -25.253 32.948 86.815  1.00 17.53  ? 150  VAL B O   1 
ATOM   3823 C  CB  . VAL B 1 150 ? -22.744 34.559 86.119  1.00 18.72  ? 150  VAL B CB  1 
ATOM   3824 C  CG1 . VAL B 1 150 ? -22.416 33.827 84.812  1.00 22.28  ? 150  VAL B CG1 1 
ATOM   3825 C  CG2 . VAL B 1 150 ? -21.879 35.777 86.296  1.00 18.52  ? 150  VAL B CG2 1 
ATOM   3826 N  N   . VAL B 1 151 ? -25.698 33.798 84.751  1.00 17.45  ? 151  VAL B N   1 
ATOM   3827 C  CA  . VAL B 1 151 ? -26.664 32.763 84.457  1.00 16.69  ? 151  VAL B CA  1 
ATOM   3828 C  C   . VAL B 1 151 ? -26.211 32.027 83.193  1.00 19.76  ? 151  VAL B C   1 
ATOM   3829 O  O   . VAL B 1 151 ? -26.104 32.658 82.125  1.00 19.03  ? 151  VAL B O   1 
ATOM   3830 C  CB  . VAL B 1 151 ? -28.054 33.365 84.218  1.00 18.13  ? 151  VAL B CB  1 
ATOM   3831 C  CG1 . VAL B 1 151 ? -29.098 32.261 84.067  1.00 18.86  ? 151  VAL B CG1 1 
ATOM   3832 C  CG2 . VAL B 1 151 ? -28.461 34.286 85.355  1.00 20.65  ? 151  VAL B CG2 1 
ATOM   3833 N  N   . MET B 1 152 ? -26.030 30.721 83.298  1.00 18.24  ? 152  MET B N   1 
ATOM   3834 C  CA  . MET B 1 152 ? -25.562 29.893 82.223  1.00 21.49  ? 152  MET B CA  1 
ATOM   3835 C  C   . MET B 1 152 ? -26.615 28.924 81.819  1.00 20.21  ? 152  MET B C   1 
ATOM   3836 O  O   . MET B 1 152 ? -26.882 27.956 82.549  1.00 19.33  ? 152  MET B O   1 
ATOM   3837 C  CB  . MET B 1 152 ? -24.343 29.063 82.644  1.00 24.40  ? 152  MET B CB  1 
ATOM   3838 C  CG  . MET B 1 152 ? -23.188 29.890 83.125  1.00 23.62  ? 152  MET B CG  1 
ATOM   3839 S  SD  . MET B 1 152 ? -22.469 31.033 81.941  1.00 27.60  ? 152  MET B SD  1 
ATOM   3840 C  CE  . MET B 1 152 ? -21.495 30.044 80.827  1.00 24.35  ? 152  MET B CE  1 
ATOM   3841 N  N   . ASP B 1 153 ? -27.193 29.141 80.619  1.00 18.41  ? 153  ASP B N   1 
ATOM   3842 C  CA  . ASP B 1 153 ? -28.200 28.226 80.144  1.00 17.96  ? 153  ASP B CA  1 
ATOM   3843 C  C   . ASP B 1 153 ? -27.495 27.151 79.337  1.00 19.10  ? 153  ASP B C   1 
ATOM   3844 O  O   . ASP B 1 153 ? -27.038 27.374 78.196  1.00 17.52  ? 153  ASP B O   1 
ATOM   3845 C  CB  . ASP B 1 153 ? -29.216 28.963 79.249  1.00 20.34  ? 153  ASP B CB  1 
ATOM   3846 C  CG  . ASP B 1 153 ? -30.355 28.040 78.788  1.00 22.21  ? 153  ASP B CG  1 
ATOM   3847 O  OD1 . ASP B 1 153 ? -30.147 26.827 78.530  1.00 22.89  ? 153  ASP B OD1 1 
ATOM   3848 O  OD2 . ASP B 1 153 ? -31.503 28.518 78.817  1.00 24.31  ? 153  ASP B OD2 1 
ATOM   3849 N  N   . VAL B 1 154 ? -27.461 25.942 79.864  1.00 20.70  ? 154  VAL B N   1 
ATOM   3850 C  CA  . VAL B 1 154 ? -26.673 24.877 79.248  1.00 20.32  ? 154  VAL B CA  1 
ATOM   3851 C  C   . VAL B 1 154 ? -27.187 24.413 77.857  1.00 18.80  ? 154  VAL B C   1 
ATOM   3852 O  O   . VAL B 1 154 ? -26.397 23.978 77.021  1.00 16.72  ? 154  VAL B O   1 
ATOM   3853 C  CB  . VAL B 1 154 ? -26.505 23.694 80.225  1.00 21.78  ? 154  VAL B CB  1 
ATOM   3854 C  CG1 . VAL B 1 154 ? -26.187 24.239 81.570  1.00 25.48  ? 154  VAL B CG1 1 
ATOM   3855 C  CG2 . VAL B 1 154 ? -27.709 22.897 80.413  1.00 27.63  ? 154  VAL B CG2 1 
ATOM   3856 N  N   . ALA B 1 155 ? -28.485 24.515 77.642  1.00 19.50  ? 155  ALA B N   1 
ATOM   3857 C  CA  . ALA B 1 155 ? -29.129 24.110 76.371  1.00 20.63  ? 155  ALA B CA  1 
ATOM   3858 C  C   . ALA B 1 155 ? -28.688 25.046 75.270  1.00 19.71  ? 155  ALA B C   1 
ATOM   3859 O  O   . ALA B 1 155 ? -28.354 24.601 74.182  1.00 25.98  ? 155  ALA B O   1 
ATOM   3860 C  CB  . ALA B 1 155 ? -30.675 24.030 76.484  1.00 20.56  ? 155  ALA B CB  1 
ATOM   3861 N  N   . ILE B 1 156 ? -28.636 26.320 75.551  1.00 22.27  ? 156  ILE B N   1 
ATOM   3862 C  CA  . ILE B 1 156 ? -28.136 27.289 74.590  1.00 22.40  ? 156  ILE B CA  1 
ATOM   3863 C  C   . ILE B 1 156 ? -26.666 27.077 74.301  1.00 23.71  ? 156  ILE B C   1 
ATOM   3864 O  O   . ILE B 1 156 ? -26.208 27.010 73.130  1.00 21.51  ? 156  ILE B O   1 
ATOM   3865 C  CB  . ILE B 1 156 ? -28.409 28.710 75.110  1.00 23.60  ? 156  ILE B CB  1 
ATOM   3866 C  CG1 . ILE B 1 156 ? -29.922 28.960 75.085  1.00 25.00  ? 156  ILE B CG1 1 
ATOM   3867 C  CG2 . ILE B 1 156 ? -27.666 29.758 74.300  1.00 22.91  ? 156  ILE B CG2 1 
ATOM   3868 C  CD1 . ILE B 1 156 ? -30.302 30.324 75.623  1.00 27.93  ? 156  ILE B CD1 1 
ATOM   3869 N  N   . ILE B 1 157 ? -25.875 26.907 75.364  1.00 20.39  ? 157  ILE B N   1 
ATOM   3870 C  CA  . ILE B 1 157 ? -24.452 26.682 75.202  1.00 19.74  ? 157  ILE B CA  1 
ATOM   3871 C  C   . ILE B 1 157 ? -24.111 25.430 74.433  1.00 16.68  ? 157  ILE B C   1 
ATOM   3872 O  O   . ILE B 1 157 ? -23.226 25.470 73.584  1.00 19.09  ? 157  ILE B O   1 
ATOM   3873 C  CB  . ILE B 1 157 ? -23.728 26.726 76.617  1.00 21.25  ? 157  ILE B CB  1 
ATOM   3874 C  CG1 . ILE B 1 157 ? -23.759 28.199 77.121  1.00 23.60  ? 157  ILE B CG1 1 
ATOM   3875 C  CG2 . ILE B 1 157 ? -22.331 26.200 76.483  1.00 21.02  ? 157  ILE B CG2 1 
ATOM   3876 C  CD1 . ILE B 1 157 ? -23.841 28.411 78.645  1.00 25.63  ? 157  ILE B CD1 1 
ATOM   3877 N  N   . ALA B 1 158 ? -24.837 24.342 74.643  1.00 17.68  ? 158  ALA B N   1 
ATOM   3878 C  CA  . ALA B 1 158 ? -24.519 23.102 74.008  1.00 20.15  ? 158  ALA B CA  1 
ATOM   3879 C  C   . ALA B 1 158 ? -24.893 23.134 72.498  1.00 23.02  ? 158  ALA B C   1 
ATOM   3880 O  O   . ALA B 1 158 ? -24.466 22.234 71.780  1.00 18.72  ? 158  ALA B O   1 
ATOM   3881 C  CB  . ALA B 1 158 ? -25.268 21.959 74.607  1.00 21.05  ? 158  ALA B CB  1 
ATOM   3882 N  N   . LYS B 1 159 ? -25.694 24.111 72.097  1.00 21.49  ? 159  LYS B N   1 
ATOM   3883 C  CA  . LYS B 1 159 ? -26.048 24.323 70.672  1.00 23.55  ? 159  LYS B CA  1 
ATOM   3884 C  C   . LYS B 1 159 ? -25.080 25.261 69.993  1.00 21.52  ? 159  LYS B C   1 
ATOM   3885 O  O   . LYS B 1 159 ? -25.073 25.367 68.792  1.00 21.55  ? 159  LYS B O   1 
ATOM   3886 C  CB  . LYS B 1 159 ? -27.454 24.852 70.537  1.00 24.79  ? 159  LYS B CB  1 
ATOM   3887 C  CG  . LYS B 1 159 ? -28.506 23.826 70.883  1.00 29.27  ? 159  LYS B CG  1 
ATOM   3888 C  CD  . LYS B 1 159 ? -29.877 24.489 70.873  1.00 36.37  ? 159  LYS B CD  1 
ATOM   3889 C  CE  . LYS B 1 159 ? -30.913 23.765 71.717  1.00 47.31  ? 159  LYS B CE  1 
ATOM   3890 N  NZ  . LYS B 1 159 ? -31.647 22.743 70.923  1.00 49.59  ? 159  LYS B NZ  1 
ATOM   3891 N  N   . ALA B 1 160 ? -24.222 25.943 70.714  1.00 19.33  ? 160  ALA B N   1 
ATOM   3892 C  CA  . ALA B 1 160 ? -23.224 26.772 70.079  1.00 19.50  ? 160  ALA B CA  1 
ATOM   3893 C  C   . ALA B 1 160 ? -22.124 25.874 69.448  1.00 21.38  ? 160  ALA B C   1 
ATOM   3894 O  O   . ALA B 1 160 ? -21.996 24.686 69.800  1.00 20.03  ? 160  ALA B O   1 
ATOM   3895 C  CB  . ALA B 1 160 ? -22.637 27.778 71.076  1.00 20.83  ? 160  ALA B CB  1 
ATOM   3896 N  N   . PRO B 1 161 ? -21.387 26.405 68.472  1.00 22.29  ? 161  PRO B N   1 
ATOM   3897 C  CA  . PRO B 1 161 ? -20.323 25.617 67.800  1.00 22.57  ? 161  PRO B CA  1 
ATOM   3898 C  C   . PRO B 1 161 ? -19.371 25.002 68.829  1.00 21.68  ? 161  PRO B C   1 
ATOM   3899 O  O   . PRO B 1 161 ? -18.870 25.733 69.725  1.00 19.22  ? 161  PRO B O   1 
ATOM   3900 C  CB  . PRO B 1 161 ? -19.554 26.633 67.015  1.00 22.97  ? 161  PRO B CB  1 
ATOM   3901 C  CG  . PRO B 1 161 ? -20.514 27.748 66.777  1.00 27.16  ? 161  PRO B CG  1 
ATOM   3902 C  CD  . PRO B 1 161 ? -21.486 27.779 67.951  1.00 25.99  ? 161  PRO B CD  1 
ATOM   3903 N  N   . VAL B 1 162 ? -19.084 23.713 68.656  1.00 21.16  ? 162  VAL B N   1 
ATOM   3904 C  CA  . VAL B 1 162 ? -18.206 22.970 69.583  1.00 21.11  ? 162  VAL B CA  1 
ATOM   3905 C  C   . VAL B 1 162 ? -16.847 23.590 69.704  1.00 21.53  ? 162  VAL B C   1 
ATOM   3906 O  O   . VAL B 1 162 ? -16.198 23.545 70.768  1.00 20.51  ? 162  VAL B O   1 
ATOM   3907 C  CB  . VAL B 1 162 ? -18.111 21.462 69.233  1.00 25.19  ? 162  VAL B CB  1 
ATOM   3908 C  CG1 . VAL B 1 162 ? -17.308 21.228 67.960  1.00 23.36  ? 162  VAL B CG1 1 
ATOM   3909 C  CG2 . VAL B 1 162 ? -17.466 20.635 70.384  1.00 25.62  ? 162  VAL B CG2 1 
ATOM   3910 N  N   . ARG B 1 163 ? -16.363 24.191 68.630  1.00 19.20  ? 163  ARG B N   1 
ATOM   3911 C  CA  . ARG B 1 163 ? -15.092 24.851 68.701  1.00 19.98  ? 163  ARG B CA  1 
ATOM   3912 C  C   . ARG B 1 163 ? -15.024 25.929 69.837  1.00 18.04  ? 163  ARG B C   1 
ATOM   3913 O  O   . ARG B 1 163 ? -13.941 26.169 70.398  1.00 16.94  ? 163  ARG B O   1 
ATOM   3914 C  CB  . ARG B 1 163 ? -14.721 25.549 67.365  1.00 23.81  ? 163  ARG B CB  1 
ATOM   3915 C  CG  . ARG B 1 163 ? -13.388 26.269 67.407  1.00 28.11  ? 163  ARG B CG  1 
ATOM   3916 C  CD  . ARG B 1 163 ? -12.938 26.931 66.069  1.00 33.81  ? 163  ARG B CD  1 
ATOM   3917 N  NE  . ARG B 1 163 ? -11.671 27.681 66.226  1.00 33.31  ? 163  ARG B NE  1 
ATOM   3918 C  CZ  . ARG B 1 163 ? -11.236 28.693 65.446  1.00 36.14  ? 163  ARG B CZ  1 
ATOM   3919 N  NH1 . ARG B 1 163 ? -11.970 29.163 64.406  1.00 31.86  ? 163  ARG B NH1 1 
ATOM   3920 N  NH2 . ARG B 1 163 ? -10.075 29.276 65.719  1.00 32.99  ? 163  ARG B NH2 1 
ATOM   3921 N  N   . LEU B 1 164 ? -16.136 26.545 70.174  1.00 16.80  ? 164  LEU B N   1 
ATOM   3922 C  CA  . LEU B 1 164 ? -16.157 27.496 71.255  1.00 19.76  ? 164  LEU B CA  1 
ATOM   3923 C  C   . LEU B 1 164 ? -16.123 26.816 72.672  1.00 19.49  ? 164  LEU B C   1 
ATOM   3924 O  O   . LEU B 1 164 ? -15.529 27.381 73.595  1.00 19.64  ? 164  LEU B O   1 
ATOM   3925 C  CB  . LEU B 1 164 ? -17.399 28.378 71.183  1.00 21.54  ? 164  LEU B CB  1 
ATOM   3926 C  CG  . LEU B 1 164 ? -17.295 29.469 70.091  1.00 26.41  ? 164  LEU B CG  1 
ATOM   3927 C  CD1 . LEU B 1 164 ? -18.653 30.103 69.892  1.00 30.78  ? 164  LEU B CD1 1 
ATOM   3928 C  CD2 . LEU B 1 164 ? -16.359 30.595 70.504  1.00 26.77  ? 164  LEU B CD2 1 
ATOM   3929 N  N   . LEU B 1 165 ? -16.785 25.690 72.829  1.00 17.07  ? 165  LEU B N   1 
ATOM   3930 C  CA  . LEU B 1 165 ? -16.617 24.924 74.091  1.00 18.17  ? 165  LEU B CA  1 
ATOM   3931 C  C   . LEU B 1 165 ? -15.115 24.522 74.274  1.00 17.17  ? 165  LEU B C   1 
ATOM   3932 O  O   . LEU B 1 165 ? -14.523 24.704 75.353  1.00 16.31  ? 165  LEU B O   1 
ATOM   3933 C  CB  . LEU B 1 165 ? -17.489 23.710 74.057  1.00 19.07  ? 165  LEU B CB  1 
ATOM   3934 C  CG  . LEU B 1 165 ? -17.436 22.910 75.394  1.00 19.21  ? 165  LEU B CG  1 
ATOM   3935 C  CD1 . LEU B 1 165 ? -18.470 23.479 76.312  1.00 19.84  ? 165  LEU B CD1 1 
ATOM   3936 C  CD2 . LEU B 1 165 ? -17.640 21.441 75.089  1.00 20.32  ? 165  LEU B CD2 1 
ATOM   3937 N  N   . VAL B 1 166 ? -14.487 24.041 73.213  1.00 16.10  ? 166  VAL B N   1 
ATOM   3938 C  CA  . VAL B 1 166 ? -13.081 23.677 73.204  1.00 16.64  ? 166  VAL B CA  1 
ATOM   3939 C  C   . VAL B 1 166 ? -12.156 24.832 73.560  1.00 18.64  ? 166  VAL B C   1 
ATOM   3940 O  O   . VAL B 1 166 ? -11.203 24.656 74.381  1.00 15.36  ? 166  VAL B O   1 
ATOM   3941 C  CB  . VAL B 1 166 ? -12.648 23.037 71.876  1.00 17.74  ? 166  VAL B CB  1 
ATOM   3942 C  CG1 . VAL B 1 166 ? -11.144 22.817 71.761  1.00 17.57  ? 166  VAL B CG1 1 
ATOM   3943 C  CG2 . VAL B 1 166 ? -13.410 21.766 71.667  1.00 18.53  ? 166  VAL B CG2 1 
ATOM   3944 N  N   . ALA B 1 167 ? -12.428 25.996 72.993  1.00 16.78  ? 167  ALA B N   1 
ATOM   3945 C  CA  . ALA B 1 167 ? -11.682 27.175 73.350  1.00 17.41  ? 167  ALA B CA  1 
ATOM   3946 C  C   . ALA B 1 167 ? -11.832 27.475 74.860  1.00 16.74  ? 167  ALA B C   1 
ATOM   3947 O  O   . ALA B 1 167 ? -10.847 27.817 75.497  1.00 16.65  ? 167  ALA B O   1 
ATOM   3948 C  CB  . ALA B 1 167 ? -12.141 28.353 72.532  1.00 18.12  ? 167  ALA B CB  1 
ATOM   3949 N  N   . GLY B 1 168 ? -13.055 27.393 75.394  1.00 15.20  ? 168  GLY B N   1 
ATOM   3950 C  CA  . GLY B 1 168 ? -13.278 27.658 76.821  1.00 15.79  ? 168  GLY B CA  1 
ATOM   3951 C  C   . GLY B 1 168 ? -12.437 26.638 77.644  1.00 16.59  ? 168  GLY B C   1 
ATOM   3952 O  O   . GLY B 1 168 ? -11.892 26.970 78.720  1.00 14.59  ? 168  GLY B O   1 
ATOM   3953 N  N   . MET B 1 169 ? -12.312 25.404 77.154  1.00 15.47  ? 169  MET B N   1 
ATOM   3954 C  CA  . MET B 1 169 ? -11.506 24.402 77.871  1.00 16.17  ? 169  MET B CA  1 
ATOM   3955 C  C   . MET B 1 169 ? -10.040 24.707 77.823  1.00 17.51  ? 169  MET B C   1 
ATOM   3956 O  O   . MET B 1 169 ? -9.346  24.454 78.783  1.00 13.53  ? 169  MET B O   1 
ATOM   3957 C  CB  . MET B 1 169 ? -11.760 22.990 77.376  1.00 16.21  ? 169  MET B CB  1 
ATOM   3958 C  CG  . MET B 1 169 ? -13.103 22.475 77.756  1.00 16.39  ? 169  MET B CG  1 
ATOM   3959 S  SD  . MET B 1 169 ? -13.463 20.709 77.517  1.00 18.28  ? 169  MET B SD  1 
ATOM   3960 C  CE  . MET B 1 169 ? -13.712 20.490 75.751  1.00 21.94  ? 169  MET B CE  1 
ATOM   3961 N  N   . GLY B 1 170 ? -9.571  25.351 76.743  1.00 15.17  ? 170  GLY B N   1 
ATOM   3962 C  CA  . GLY B 1 170 ? -8.219  25.785 76.653  1.00 14.86  ? 170  GLY B CA  1 
ATOM   3963 C  C   . GLY B 1 170 ? -7.918  26.903 77.602  1.00 15.92  ? 170  GLY B C   1 
ATOM   3964 O  O   . GLY B 1 170 ? -6.841  26.930 78.241  1.00 17.72  ? 170  GLY B O   1 
ATOM   3965 N  N   . ASP B 1 171 ? -8.896  27.782 77.803  1.00 16.15  ? 171  ASP B N   1 
ATOM   3966 C  CA  . ASP B 1 171 ? -8.692  28.864 78.773  1.00 16.91  ? 171  ASP B CA  1 
ATOM   3967 C  C   . ASP B 1 171 ? -8.650  28.241 80.202  1.00 16.01  ? 171  ASP B C   1 
ATOM   3968 O  O   . ASP B 1 171 ? -7.798  28.599 81.045  1.00 19.05  ? 171  ASP B O   1 
ATOM   3969 C  CB  . ASP B 1 171 ? -9.819  29.899 78.672  1.00 16.35  ? 171  ASP B CB  1 
ATOM   3970 C  CG  . ASP B 1 171 ? -9.446  31.260 79.218  1.00 19.21  ? 171  ASP B CG  1 
ATOM   3971 O  OD1 . ASP B 1 171 ? -8.279  31.564 79.436  1.00 17.19  ? 171  ASP B OD1 1 
ATOM   3972 O  OD2 . ASP B 1 171 ? -10.363 32.072 79.419  1.00 24.89  ? 171  ASP B OD2 1 
ATOM   3973 N  N   . ALA B 1 172 ? -9.608  27.373 80.454  1.00 16.75  ? 172  ALA B N   1 
ATOM   3974 C  CA  . ALA B 1 172 ? -9.711  26.699 81.744  1.00 17.51  ? 172  ALA B CA  1 
ATOM   3975 C  C   . ALA B 1 172 ? -8.510  25.785 82.044  1.00 19.67  ? 172  ALA B C   1 
ATOM   3976 O  O   . ALA B 1 172 ? -8.155  25.626 83.235  1.00 17.02  ? 172  ALA B O   1 
ATOM   3977 C  CB  . ALA B 1 172 ? -10.994 25.916 81.849  1.00 17.54  ? 172  ALA B CB  1 
ATOM   3978 N  N   . LEU B 1 173 ? -7.889  25.189 81.013  1.00 16.97  ? 173  LEU B N   1 
ATOM   3979 C  CA  . LEU B 1 173 ? -6.657  24.389 81.196  1.00 16.91  ? 173  LEU B CA  1 
ATOM   3980 C  C   . LEU B 1 173 ? -5.505  25.087 81.927  1.00 17.18  ? 173  LEU B C   1 
ATOM   3981 O  O   . LEU B 1 173 ? -4.742  24.456 82.688  1.00 15.77  ? 173  LEU B O   1 
ATOM   3982 C  CB  . LEU B 1 173 ? -6.150  23.903 79.840  1.00 18.03  ? 173  LEU B CB  1 
ATOM   3983 C  CG  . LEU B 1 173 ? -4.915  23.047 79.829  1.00 19.00  ? 173  LEU B CG  1 
ATOM   3984 C  CD1 . LEU B 1 173 ? -5.248  21.747 80.567  1.00 18.37  ? 173  LEU B CD1 1 
ATOM   3985 C  CD2 . LEU B 1 173 ? -4.359  22.762 78.433  1.00 21.14  ? 173  LEU B CD2 1 
ATOM   3986 N  N   . SER B 1 174 ? -5.363  26.384 81.727  1.00 15.21  ? 174  SER B N   1 
ATOM   3987 C  CA  . SER B 1 174 ? -4.286  27.124 82.330  1.00 14.70  ? 174  SER B CA  1 
ATOM   3988 C  C   . SER B 1 174 ? -4.498  27.360 83.844  1.00 15.23  ? 174  SER B C   1 
ATOM   3989 O  O   . SER B 1 174 ? -3.493  27.562 84.553  1.00 14.31  ? 174  SER B O   1 
ATOM   3990 C  CB  . SER B 1 174 ? -4.057  28.497 81.686  1.00 14.82  ? 174  SER B CB  1 
ATOM   3991 O  OG  . SER B 1 174 ? -5.132  29.351 81.940  1.00 18.08  ? 174  SER B OG  1 
ATOM   3992 N  N   . THR B 1 175 ? -5.734  27.276 84.287  1.00 13.68  ? 175  THR B N   1 
ATOM   3993 C  CA  . THR B 1 175 ? -6.091  27.832 85.615  1.00 15.46  ? 175  THR B CA  1 
ATOM   3994 C  C   . THR B 1 175 ? -5.324  27.162 86.773  1.00 14.52  ? 175  THR B C   1 
ATOM   3995 O  O   . THR B 1 175 ? -4.728  27.885 87.555  1.00 14.41  ? 175  THR B O   1 
ATOM   3996 C  CB  . THR B 1 175 ? -7.547  27.726 85.891  1.00 17.80  ? 175  THR B CB  1 
ATOM   3997 O  OG1 . THR B 1 175 ? -8.243  28.308 84.786  1.00 22.30  ? 175  THR B OG1 1 
ATOM   3998 C  CG2 . THR B 1 175 ? -7.863  28.548 87.184  1.00 19.99  ? 175  THR B CG2 1 
ATOM   3999 N  N   . TYR B 1 176 ? -5.261  25.844 86.795  1.00 13.57  ? 176  TYR B N   1 
ATOM   4000 C  CA  . TYR B 1 176 ? -4.548  25.143 87.900  1.00 14.26  ? 176  TYR B CA  1 
ATOM   4001 C  C   . TYR B 1 176 ? -3.048  25.459 87.919  1.00 14.76  ? 176  TYR B C   1 
ATOM   4002 O  O   . TYR B 1 176 ? -2.412  25.774 88.937  1.00 13.62  ? 176  TYR B O   1 
ATOM   4003 C  CB  . TYR B 1 176 ? -4.784  23.674 87.805  1.00 15.99  ? 176  TYR B CB  1 
ATOM   4004 C  CG  . TYR B 1 176 ? -3.826  22.965 88.751  1.00 20.34  ? 176  TYR B CG  1 
ATOM   4005 C  CD1 . TYR B 1 176 ? -3.896  23.230 90.146  1.00 21.06  ? 176  TYR B CD1 1 
ATOM   4006 C  CD2 . TYR B 1 176 ? -2.843  22.142 88.281  1.00 22.67  ? 176  TYR B CD2 1 
ATOM   4007 C  CE1 . TYR B 1 176 ? -2.972  22.668 91.012  1.00 27.60  ? 176  TYR B CE1 1 
ATOM   4008 C  CE2 . TYR B 1 176 ? -1.903  21.537 89.159  1.00 28.48  ? 176  TYR B CE2 1 
ATOM   4009 C  CZ  . TYR B 1 176 ? -1.998  21.809 90.514  1.00 28.56  ? 176  TYR B CZ  1 
ATOM   4010 O  OH  . TYR B 1 176 ? -1.098  21.285 91.373  1.00 42.95  ? 176  TYR B OH  1 
ATOM   4011 N  N   . PHE B 1 177 ? -2.445  25.380 86.746  1.00 15.16  ? 177  PHE B N   1 
ATOM   4012 C  CA  . PHE B 1 177 ? -1.076  25.632 86.603  1.00 14.67  ? 177  PHE B CA  1 
ATOM   4013 C  C   . PHE B 1 177 ? -0.694  27.025 86.982  1.00 14.43  ? 177  PHE B C   1 
ATOM   4014 O  O   . PHE B 1 177 ? 0.386   27.262 87.640  1.00 14.40  ? 177  PHE B O   1 
ATOM   4015 C  CB  . PHE B 1 177 ? -0.635  25.255 85.190  1.00 15.57  ? 177  PHE B CB  1 
ATOM   4016 C  CG  . PHE B 1 177 ? -0.783  23.836 84.903  1.00 15.73  ? 177  PHE B CG  1 
ATOM   4017 C  CD1 . PHE B 1 177 ? 0.035   22.918 85.520  1.00 18.25  ? 177  PHE B CD1 1 
ATOM   4018 C  CD2 . PHE B 1 177 ? -1.764  23.394 84.067  1.00 17.22  ? 177  PHE B CD2 1 
ATOM   4019 C  CE1 . PHE B 1 177 ? -0.111  21.551 85.275  1.00 18.38  ? 177  PHE B CE1 1 
ATOM   4020 C  CE2 . PHE B 1 177 ? -1.978  22.062 83.862  1.00 17.73  ? 177  PHE B CE2 1 
ATOM   4021 C  CZ  . PHE B 1 177 ? -1.124  21.124 84.448  1.00 19.87  ? 177  PHE B CZ  1 
ATOM   4022 N  N   . GLU B 1 178 ? -1.512  27.983 86.592  1.00 14.27  ? 178  GLU B N   1 
ATOM   4023 C  CA  . GLU B 1 178 ? -1.203  29.371 86.923  1.00 14.65  ? 178  GLU B CA  1 
ATOM   4024 C  C   . GLU B 1 178 ? -1.423  29.658 88.427  1.00 15.85  ? 178  GLU B C   1 
ATOM   4025 O  O   . GLU B 1 178 ? -0.619  30.348 89.054  1.00 15.67  ? 178  GLU B O   1 
ATOM   4026 C  CB  . GLU B 1 178 ? -1.999  30.357 86.062  1.00 15.59  ? 178  GLU B CB  1 
ATOM   4027 C  CG  . GLU B 1 178 ? -1.389  30.445 84.643  1.00 17.25  ? 178  GLU B CG  1 
ATOM   4028 C  CD  . GLU B 1 178 ? -2.085  31.491 83.737  1.00 17.98  ? 178  GLU B CD  1 
ATOM   4029 O  OE1 . GLU B 1 178 ? -3.264  31.296 83.433  1.00 22.08  ? 178  GLU B OE1 1 
ATOM   4030 O  OE2 . GLU B 1 178 ? -1.501  32.568 83.452  1.00 19.53  ? 178  GLU B OE2 1 
ATOM   4031 N  N   . ALA B 1 179 ? -2.528  29.159 88.952  1.00 15.76  ? 179  ALA B N   1 
ATOM   4032 C  CA  . ALA B 1 179 ? -2.833  29.346 90.351  1.00 14.91  ? 179  ALA B CA  1 
ATOM   4033 C  C   . ALA B 1 179 ? -1.768  28.683 91.244  1.00 14.51  ? 179  ALA B C   1 
ATOM   4034 O  O   . ALA B 1 179 ? -1.428  29.266 92.269  1.00 14.40  ? 179  ALA B O   1 
ATOM   4035 C  CB  . ALA B 1 179 ? -4.164  28.773 90.637  1.00 12.79  ? 179  ALA B CB  1 
ATOM   4036 N  N   . GLN B 1 180 ? -1.330  27.472 90.911  1.00 15.12  ? 180  GLN B N   1 
ATOM   4037 C  CA  . GLN B 1 180 ? -0.320  26.734 91.746  1.00 15.68  ? 180  GLN B CA  1 
ATOM   4038 C  C   . GLN B 1 180 ? 0.999   27.449 91.717  1.00 16.18  ? 180  GLN B C   1 
ATOM   4039 O  O   . GLN B 1 180 ? 1.680   27.569 92.780  1.00 15.47  ? 180  GLN B O   1 
ATOM   4040 C  CB  . GLN B 1 180 ? -0.154  25.257 91.354  1.00 16.79  ? 180  GLN B CB  1 
ATOM   4041 C  CG  . GLN B 1 180 ? 0.777   24.376 92.239  1.00 19.61  ? 180  GLN B CG  1 
ATOM   4042 C  CD  . GLN B 1 180 ? 0.145   24.226 93.631  1.00 20.01  ? 180  GLN B CD  1 
ATOM   4043 O  OE1 . GLN B 1 180 ? -0.937  23.683 93.741  1.00 23.82  ? 180  GLN B OE1 1 
ATOM   4044 N  NE2 . GLN B 1 180 ? 0.816   24.726 94.669  1.00 23.18  ? 180  GLN B NE2 1 
ATOM   4045 N  N   . ALA B 1 181 ? 1.397   27.974 90.549  1.00 15.29  ? 181  ALA B N   1 
ATOM   4046 C  CA  . ALA B 1 181 ? 2.638   28.801 90.446  1.00 14.74  ? 181  ALA B CA  1 
ATOM   4047 C  C   . ALA B 1 181 ? 2.588   30.069 91.317  1.00 14.70  ? 181  ALA B C   1 
ATOM   4048 O  O   . ALA B 1 181 ? 3.528   30.337 92.064  1.00 13.95  ? 181  ALA B O   1 
ATOM   4049 C  CB  . ALA B 1 181 ? 2.880   29.203 88.978  1.00 16.45  ? 181  ALA B CB  1 
ATOM   4050 N  N   . CYS B 1 182 ? 1.477   30.790 91.282  1.00 14.23  ? 182  CYS B N   1 
ATOM   4051 C  CA  . CYS B 1 182 ? 1.275   31.968 92.106  1.00 15.87  ? 182  CYS B CA  1 
ATOM   4052 C  C   . CYS B 1 182 ? 1.292   31.593 93.601  1.00 17.79  ? 182  CYS B C   1 
ATOM   4053 O  O   . CYS B 1 182 ? 1.867   32.273 94.396  1.00 17.93  ? 182  CYS B O   1 
ATOM   4054 C  CB  . CYS B 1 182 ? -0.050  32.644 91.799  1.00 14.85  ? 182  CYS B CB  1 
ATOM   4055 S  SG  . CYS B 1 182 ? -0.142  33.564 90.239  1.00 18.47  ? 182  CYS B SG  1 
ATOM   4056 N  N   . PHE B 1 183 ? 0.611   30.515 93.912  1.00 16.45  ? 183  PHE B N   1 
ATOM   4057 C  CA  . PHE B 1 183 ? 0.557   30.036 95.279  1.00 18.89  ? 183  PHE B CA  1 
ATOM   4058 C  C   . PHE B 1 183 ? 1.970   29.767 95.772  1.00 19.41  ? 183  PHE B C   1 
ATOM   4059 O  O   . PHE B 1 183 ? 2.340   30.231 96.766  1.00 20.20  ? 183  PHE B O   1 
ATOM   4060 C  CB  . PHE B 1 183 ? -0.320  28.808 95.403  1.00 20.49  ? 183  PHE B CB  1 
ATOM   4061 C  CG  . PHE B 1 183 ? -0.771  28.533 96.811  1.00 21.36  ? 183  PHE B CG  1 
ATOM   4062 C  CD1 . PHE B 1 183 ? 0.011   27.851 97.670  1.00 23.99  ? 183  PHE B CD1 1 
ATOM   4063 C  CD2 . PHE B 1 183 ? -1.967  28.991 97.264  1.00 22.91  ? 183  PHE B CD2 1 
ATOM   4064 C  CE1 . PHE B 1 183 ? -0.404  27.593 98.963  1.00 23.27  ? 183  PHE B CE1 1 
ATOM   4065 C  CE2 . PHE B 1 183 ? -2.393  28.747 98.541  1.00 25.04  ? 183  PHE B CE2 1 
ATOM   4066 C  CZ  . PHE B 1 183 ? -1.595  28.053 99.394  1.00 21.08  ? 183  PHE B CZ  1 
ATOM   4067 N  N   . ASP B 1 184 ? 2.746   29.032 95.006  1.00 20.41  ? 184  ASP B N   1 
ATOM   4068 C  CA  . ASP B 1 184 ? 4.131   28.733 95.315  1.00 23.53  ? 184  ASP B CA  1 
ATOM   4069 C  C   . ASP B 1 184 ? 4.990   29.978 95.458  1.00 24.36  ? 184  ASP B C   1 
ATOM   4070 O  O   . ASP B 1 184 ? 5.882   30.001 96.236  1.00 22.20  ? 184  ASP B O   1 
ATOM   4071 C  CB  . ASP B 1 184 ? 4.765   27.835 94.268  1.00 23.40  ? 184  ASP B CB  1 
ATOM   4072 C  CG  . ASP B 1 184 ? 4.129   26.476 94.194  1.00 26.61  ? 184  ASP B CG  1 
ATOM   4073 O  OD1 . ASP B 1 184 ? 3.339   26.161 95.051  1.00 28.55  ? 184  ASP B OD1 1 
ATOM   4074 O  OD2 . ASP B 1 184 ? 4.405   25.734 93.279  1.00 28.07  ? 184  ASP B OD2 1 
ATOM   4075 N  N   . ALA B 1 185 ? 4.698   30.991 94.668  1.00 20.00  ? 185  ALA B N   1 
ATOM   4076 C  CA  . ALA B 1 185 ? 5.412   32.235 94.700  1.00 19.09  ? 185  ALA B CA  1 
ATOM   4077 C  C   . ALA B 1 185 ? 4.911   33.219 95.746  1.00 18.65  ? 185  ALA B C   1 
ATOM   4078 O  O   . ALA B 1 185 ? 5.495   34.235 95.932  1.00 18.37  ? 185  ALA B O   1 
ATOM   4079 C  CB  . ALA B 1 185 ? 5.320   32.896 93.348  1.00 19.97  ? 185  ALA B CB  1 
ATOM   4080 N  N   . GLN B 1 186 ? 3.800   32.910 96.379  1.00 19.97  ? 186  GLN B N   1 
ATOM   4081 C  CA  . GLN B 1 186 ? 3.145   33.843 97.270  1.00 23.12  ? 186  GLN B CA  1 
ATOM   4082 C  C   . GLN B 1 186 ? 2.825   35.134 96.536  1.00 24.73  ? 186  GLN B C   1 
ATOM   4083 O  O   . GLN B 1 186 ? 3.035   36.192 97.019  1.00 23.90  ? 186  GLN B O   1 
ATOM   4084 C  CB  . GLN B 1 186 ? 4.017   34.158 98.500  1.00 27.94  ? 186  GLN B CB  1 
ATOM   4085 C  CG  . GLN B 1 186 ? 3.676   33.415 99.758  1.00 35.01  ? 186  GLN B CG  1 
ATOM   4086 C  CD  . GLN B 1 186 ? 3.834   34.235 101.054 1.00 33.88  ? 186  GLN B CD  1 
ATOM   4087 O  OE1 . GLN B 1 186 ? 4.725   35.073 101.232 1.00 27.74  ? 186  GLN B OE1 1 
ATOM   4088 N  NE2 . GLN B 1 186 ? 2.971   33.951 101.964 1.00 33.40  ? 186  GLN B NE2 1 
ATOM   4089 N  N   . ALA B 1 187 ? 2.309   35.011 95.338  1.00 26.71  ? 187  ALA B N   1 
ATOM   4090 C  CA  . ALA B 1 187 ? 1.947   36.178 94.547  1.00 24.98  ? 187  ALA B CA  1 
ATOM   4091 C  C   . ALA B 1 187 ? 0.591   36.716 94.917  1.00 22.69  ? 187  ALA B C   1 
ATOM   4092 O  O   . ALA B 1 187 ? -0.245  35.998 95.342  1.00 22.86  ? 187  ALA B O   1 
ATOM   4093 C  CB  . ALA B 1 187 ? 1.987   35.856 93.083  1.00 25.72  ? 187  ALA B CB  1 
ATOM   4094 N  N   . THR B 1 188 ? 0.388   37.990 94.695  1.00 21.20  ? 188  THR B N   1 
ATOM   4095 C  CA  . THR B 1 188 ? -0.879  38.643 94.932  1.00 23.93  ? 188  THR B CA  1 
ATOM   4096 C  C   . THR B 1 188 ? -1.843  38.446 93.766  1.00 23.57  ? 188  THR B C   1 
ATOM   4097 O  O   . THR B 1 188 ? -1.459  38.628 92.661  1.00 28.33  ? 188  THR B O   1 
ATOM   4098 C  CB  . THR B 1 188 ? -0.632  40.138 95.071  1.00 25.41  ? 188  THR B CB  1 
ATOM   4099 O  OG1 . THR B 1 188 ? 0.208   40.357 96.184  1.00 28.68  ? 188  THR B OG1 1 
ATOM   4100 C  CG2 . THR B 1 188 ? -1.905  40.885 95.247  1.00 28.75  ? 188  THR B CG2 1 
ATOM   4101 N  N   . SER B 1 189 ? -3.073  38.061 94.011  1.00 22.47  ? 189  SER B N   1 
ATOM   4102 C  CA  . SER B 1 189 ? -3.989  37.778 92.934  1.00 22.46  ? 189  SER B CA  1 
ATOM   4103 C  C   . SER B 1 189 ? -4.623  39.134 92.436  1.00 27.42  ? 189  SER B C   1 
ATOM   4104 O  O   . SER B 1 189 ? -4.388  40.210 93.036  1.00 25.73  ? 189  SER B O   1 
ATOM   4105 C  CB  . SER B 1 189 ? -5.044  36.868 93.500  1.00 23.59  ? 189  SER B CB  1 
ATOM   4106 O  OG  . SER B 1 189 ? -5.993  37.660 94.229  1.00 21.72  ? 189  SER B OG  1 
ATOM   4107 N  N   . MET B 1 190 ? -5.519  39.112 91.449  1.00 27.41  ? 190  MET B N   1 
ATOM   4108 C  CA  . MET B 1 190 ? -6.284  40.340 91.137  1.00 30.00  ? 190  MET B CA  1 
ATOM   4109 C  C   . MET B 1 190 ? -7.305  40.666 92.169  1.00 32.27  ? 190  MET B C   1 
ATOM   4110 O  O   . MET B 1 190 ? -7.837  41.775 92.185  1.00 38.17  ? 190  MET B O   1 
ATOM   4111 C  CB  . MET B 1 190 ? -7.028  40.230 89.820  1.00 34.18  ? 190  MET B CB  1 
ATOM   4112 C  CG  . MET B 1 190 ? -6.068  40.369 88.676  1.00 41.45  ? 190  MET B CG  1 
ATOM   4113 S  SD  . MET B 1 190 ? -6.894  39.912 87.143  1.00 48.58  ? 190  MET B SD  1 
ATOM   4114 C  CE  . MET B 1 190 ? -5.555  40.486 86.072  1.00 43.42  ? 190  MET B CE  1 
ATOM   4115 N  N   . ALA B 1 191 ? -7.651  39.696 93.002  1.00 28.63  ? 191  ALA B N   1 
ATOM   4116 C  CA  . ALA B 1 191 ? -8.525  40.025 94.081  1.00 26.99  ? 191  ALA B CA  1 
ATOM   4117 C  C   . ALA B 1 191 ? -7.801  40.854 95.145  1.00 27.42  ? 191  ALA B C   1 
ATOM   4118 O  O   . ALA B 1 191 ? -8.463  41.360 96.028  1.00 26.83  ? 191  ALA B O   1 
ATOM   4119 C  CB  . ALA B 1 191 ? -9.171  38.793 94.686  1.00 24.28  ? 191  ALA B CB  1 
ATOM   4120 N  N   . GLY B 1 192 ? -6.475  40.923 95.090  1.00 28.89  ? 192  GLY B N   1 
ATOM   4121 C  CA  . GLY B 1 192 ? -5.697  41.840 95.904  1.00 28.58  ? 192  GLY B CA  1 
ATOM   4122 C  C   . GLY B 1 192 ? -5.031  41.245 97.139  1.00 29.07  ? 192  GLY B C   1 
ATOM   4123 O  O   . GLY B 1 192 ? -4.447  41.986 97.902  1.00 27.50  ? 192  GLY B O   1 
ATOM   4124 N  N   . GLY B 1 193 ? -5.078  39.927 97.355  1.00 24.77  ? 193  GLY B N   1 
ATOM   4125 C  CA  . GLY B 1 193 ? -4.308  39.362 98.447  1.00 24.22  ? 193  GLY B CA  1 
ATOM   4126 C  C   . GLY B 1 193 ? -3.556  38.149 97.956  1.00 25.25  ? 193  GLY B C   1 
ATOM   4127 O  O   . GLY B 1 193 ? -3.449  37.943 96.761  1.00 23.06  ? 193  GLY B O   1 
ATOM   4128 N  N   . LYS B 1 194 ? -3.066  37.367 98.901  1.00 21.14  ? 194  LYS B N   1 
ATOM   4129 C  CA  . LYS B 1 194 ? -2.608  36.027 98.730  1.00 22.48  ? 194  LYS B CA  1 
ATOM   4130 C  C   . LYS B 1 194 ? -3.845  35.119 98.422  1.00 19.10  ? 194  LYS B C   1 
ATOM   4131 O  O   . LYS B 1 194 ? -4.924  35.458 98.743  1.00 16.47  ? 194  LYS B O   1 
ATOM   4132 C  CB  . LYS B 1 194 ? -1.882  35.614 100.023 1.00 25.70  ? 194  LYS B CB  1 
ATOM   4133 C  CG  . LYS B 1 194 ? -1.282  34.221 100.096 1.00 35.38  ? 194  LYS B CG  1 
ATOM   4134 C  CD  . LYS B 1 194 ? -0.852  33.793 101.525 1.00 38.37  ? 194  LYS B CD  1 
ATOM   4135 C  CE  . LYS B 1 194 ? -0.113  32.467 101.566 1.00 39.97  ? 194  LYS B CE  1 
ATOM   4136 N  NZ  . LYS B 1 194 ? -0.857  31.307 100.980 1.00 39.04  ? 194  LYS B NZ  1 
ATOM   4137 N  N   . SER B 1 195 ? -3.643  33.994 97.771  1.00 17.40  ? 195  SER B N   1 
ATOM   4138 C  CA  . SER B 1 195 ? -4.753  33.055 97.536  1.00 18.40  ? 195  SER B CA  1 
ATOM   4139 C  C   . SER B 1 195 ? -5.226  32.383 98.825  1.00 19.10  ? 195  SER B C   1 
ATOM   4140 O  O   . SER B 1 195 ? -4.400  31.944 99.623  1.00 21.26  ? 195  SER B O   1 
ATOM   4141 C  CB  . SER B 1 195 ? -4.333  31.910 96.578  1.00 17.34  ? 195  SER B CB  1 
ATOM   4142 O  OG  . SER B 1 195 ? -5.425  31.047 96.284  1.00 17.08  ? 195  SER B OG  1 
ATOM   4143 N  N   . THR B 1 196 ? -6.536  32.281 98.973  1.00 18.14  ? 196  THR B N   1 
ATOM   4144 C  CA  . THR B 1 196 ? -7.130  31.354 99.875  1.00 19.36  ? 196  THR B CA  1 
ATOM   4145 C  C   . THR B 1 196 ? -6.904  29.908 99.427  1.00 20.26  ? 196  THR B C   1 
ATOM   4146 O  O   . THR B 1 196 ? -6.515  29.633 98.231  1.00 16.02  ? 196  THR B O   1 
ATOM   4147 C  CB  . THR B 1 196 ? -8.625  31.557 99.949  1.00 19.14  ? 196  THR B CB  1 
ATOM   4148 O  OG1 . THR B 1 196 ? -9.221  31.364 98.647  1.00 17.41  ? 196  THR B OG1 1 
ATOM   4149 C  CG2 . THR B 1 196 ? -8.970  32.996 100.468 1.00 20.36  ? 196  THR B CG2 1 
ATOM   4150 N  N   . LEU B 1 197 ? -7.183  28.989 100.352 1.00 18.78  ? 197  LEU B N   1 
ATOM   4151 C  CA  . LEU B 1 197 ? -7.245  27.559 100.031 1.00 19.19  ? 197  LEU B CA  1 
ATOM   4152 C  C   . LEU B 1 197 ? -8.376  27.340 99.038  1.00 16.83  ? 197  LEU B C   1 
ATOM   4153 O  O   . LEU B 1 197 ? -8.268  26.500 98.179  1.00 17.61  ? 197  LEU B O   1 
ATOM   4154 C  CB  . LEU B 1 197 ? -7.576  26.653 101.253 1.00 19.37  ? 197  LEU B CB  1 
ATOM   4155 C  CG  . LEU B 1 197 ? -6.553  26.717 102.353 1.00 20.09  ? 197  LEU B CG  1 
ATOM   4156 C  CD1 . LEU B 1 197 ? -7.072  25.866 103.538 1.00 24.30  ? 197  LEU B CD1 1 
ATOM   4157 C  CD2 . LEU B 1 197 ? -5.193  26.296 101.838 1.00 21.27  ? 197  LEU B CD2 1 
ATOM   4158 N  N   . ALA B 1 198 ? -9.456  28.079 99.219  1.00 14.91  ? 198  ALA B N   1 
ATOM   4159 C  CA  . ALA B 1 198 ? -10.663 27.858 98.444  1.00 16.75  ? 198  ALA B CA  1 
ATOM   4160 C  C   . ALA B 1 198 ? -10.354 28.074 96.920  1.00 14.98  ? 198  ALA B C   1 
ATOM   4161 O  O   . ALA B 1 198 ? -10.622 27.180 96.090  1.00 14.35  ? 198  ALA B O   1 
ATOM   4162 C  CB  . ALA B 1 198 ? -11.774 28.780 98.923  1.00 17.90  ? 198  ALA B CB  1 
ATOM   4163 N  N   . ALA B 1 199 ? -9.706  29.188 96.595  1.00 17.60  ? 199  ALA B N   1 
ATOM   4164 C  CA  . ALA B 1 199 ? -9.488  29.558 95.192  1.00 17.74  ? 199  ALA B CA  1 
ATOM   4165 C  C   . ALA B 1 199 ? -8.561  28.573 94.546  1.00 16.69  ? 199  ALA B C   1 
ATOM   4166 O  O   . ALA B 1 199 ? -8.790  28.180 93.403  1.00 15.01  ? 199  ALA B O   1 
ATOM   4167 C  CB  . ALA B 1 199 ? -8.930  30.943 95.106  1.00 17.32  ? 199  ALA B CB  1 
ATOM   4168 N  N   . LEU B 1 200 ? -7.426  28.272 95.204  1.00 16.34  ? 200  LEU B N   1 
ATOM   4169 C  CA  . LEU B 1 200 ? -6.521  27.276 94.702  1.00 16.16  ? 200  LEU B CA  1 
ATOM   4170 C  C   . LEU B 1 200 ? -7.208  25.939 94.480  1.00 16.67  ? 200  LEU B C   1 
ATOM   4171 O  O   . LEU B 1 200 ? -6.951  25.220 93.492  1.00 12.61  ? 200  LEU B O   1 
ATOM   4172 C  CB  . LEU B 1 200 ? -5.331  27.051 95.651  1.00 18.57  ? 200  LEU B CB  1 
ATOM   4173 C  CG  . LEU B 1 200 ? -4.336  25.974 95.259  1.00 18.24  ? 200  LEU B CG  1 
ATOM   4174 C  CD1 . LEU B 1 200 ? -3.643  26.381 93.971  1.00 21.10  ? 200  LEU B CD1 1 
ATOM   4175 C  CD2 . LEU B 1 200 ? -3.284  25.796 96.344  1.00 21.16  ? 200  LEU B CD2 1 
ATOM   4176 N  N   . SER B 1 201 ? -8.082  25.559 95.401  1.00 15.44  ? 201  SER B N   1 
ATOM   4177 C  CA  . SER B 1 201 ? -8.712  24.274 95.279  1.00 15.88  ? 201  SER B CA  1 
ATOM   4178 C  C   . SER B 1 201 ? -9.718  24.216 94.078  1.00 14.18  ? 201  SER B C   1 
ATOM   4179 O  O   . SER B 1 201 ? -9.853  23.204 93.442  1.00 13.86  ? 201  SER B O   1 
ATOM   4180 C  CB  . SER B 1 201 ? -9.512  24.060 96.549  1.00 19.64  ? 201  SER B CB  1 
ATOM   4181 O  OG  . SER B 1 201 ? -10.007 22.789 96.572  1.00 26.95  ? 201  SER B OG  1 
ATOM   4182 N  N   . LEU B 1 202 ? -10.441 25.304 93.829  1.00 13.98  ? 202  LEU B N   1 
ATOM   4183 C  CA  . LEU B 1 202 ? -11.349 25.378 92.667  1.00 15.48  ? 202  LEU B CA  1 
ATOM   4184 C  C   . LEU B 1 202 ? -10.522 25.359 91.389  1.00 15.23  ? 202  LEU B C   1 
ATOM   4185 O  O   . LEU B 1 202 ? -10.954 24.753 90.353  1.00 16.34  ? 202  LEU B O   1 
ATOM   4186 C  CB  . LEU B 1 202 ? -12.178 26.641 92.747  1.00 15.80  ? 202  LEU B CB  1 
ATOM   4187 C  CG  . LEU B 1 202 ? -13.134 26.688 93.936  1.00 18.93  ? 202  LEU B CG  1 
ATOM   4188 C  CD1 . LEU B 1 202 ? -13.947 27.927 94.091  1.00 20.33  ? 202  LEU B CD1 1 
ATOM   4189 C  CD2 . LEU B 1 202 ? -14.126 25.588 93.879  1.00 17.23  ? 202  LEU B CD2 1 
ATOM   4190 N  N   . ALA B 1 203 ? -9.346  25.995 91.425  1.00 15.42  ? 203  ALA B N   1 
ATOM   4191 C  CA  . ALA B 1 203 ? -8.463  25.913 90.259  1.00 15.71  ? 203  ALA B CA  1 
ATOM   4192 C  C   . ALA B 1 203 ? -8.046  24.484 89.936  1.00 16.03  ? 203  ALA B C   1 
ATOM   4193 O  O   . ALA B 1 203 ? -7.993  24.076 88.774  1.00 14.85  ? 203  ALA B O   1 
ATOM   4194 C  CB  . ALA B 1 203 ? -7.273  26.799 90.435  1.00 15.67  ? 203  ALA B CB  1 
ATOM   4195 N  N   . ARG B 1 204 ? -7.777  23.667 90.977  1.00 15.18  ? 204  ARG B N   1 
ATOM   4196 C  CA  . ARG B 1 204 ? -7.396  22.338 90.788  1.00 14.57  ? 204  ARG B CA  1 
ATOM   4197 C  C   . ARG B 1 204 ? -8.554  21.483 90.335  1.00 13.81  ? 204  ARG B C   1 
ATOM   4198 O  O   . ARG B 1 204 ? -8.359  20.521 89.546  1.00 12.95  ? 204  ARG B O   1 
ATOM   4199 C  CB  . ARG B 1 204 ? -6.700  21.760 92.080  1.00 16.67  ? 204  ARG B CB  1 
ATOM   4200 C  CG  . ARG B 1 204 ? -6.361  20.307 92.018  1.00 20.60  ? 204  ARG B CG  1 
ATOM   4201 C  CD  . ARG B 1 204 ? -5.256  19.930 91.018  1.00 27.41  ? 204  ARG B CD  1 
ATOM   4202 N  NE  . ARG B 1 204 ? -5.287  18.482 90.619  1.00 31.04  ? 204  ARG B NE  1 
ATOM   4203 C  CZ  . ARG B 1 204 ? -4.312  17.794 90.050  1.00 30.69  ? 204  ARG B CZ  1 
ATOM   4204 N  NH1 . ARG B 1 204 ? -3.092  18.281 89.825  1.00 39.47  ? 204  ARG B NH1 1 
ATOM   4205 N  NH2 . ARG B 1 204 ? -4.535  16.570 89.715  1.00 31.47  ? 204  ARG B NH2 1 
ATOM   4206 N  N   . LEU B 1 205 ? -9.728  21.763 90.884  1.00 13.70  ? 205  LEU B N   1 
ATOM   4207 C  CA  . LEU B 1 205 ? -10.938 21.046 90.518  1.00 14.90  ? 205  LEU B CA  1 
ATOM   4208 C  C   . LEU B 1 205 ? -11.287 21.293 89.012  1.00 14.91  ? 205  LEU B C   1 
ATOM   4209 O  O   . LEU B 1 205 ? -11.758 20.407 88.311  1.00 14.73  ? 205  LEU B O   1 
ATOM   4210 C  CB  . LEU B 1 205 ? -12.099 21.485 91.402  1.00 15.09  ? 205  LEU B CB  1 
ATOM   4211 C  CG  . LEU B 1 205 ? -13.453 20.797 91.158  1.00 17.84  ? 205  LEU B CG  1 
ATOM   4212 C  CD1 . LEU B 1 205 ? -13.394 19.262 91.312  1.00 18.71  ? 205  LEU B CD1 1 
ATOM   4213 C  CD2 . LEU B 1 205 ? -14.541 21.455 92.013  1.00 16.85  ? 205  LEU B CD2 1 
ATOM   4214 N  N   . CYS B 1 206 ? -11.069 22.526 88.603  1.00 16.28  ? 206  CYS B N   1 
ATOM   4215 C  CA  . CYS B 1 206 ? -11.090 22.923 87.200  1.00 16.93  ? 206  CYS B CA  1 
ATOM   4216 C  C   . CYS B 1 206 ? -10.287 21.956 86.327  1.00 17.65  ? 206  CYS B C   1 
ATOM   4217 O  O   . CYS B 1 206 ? -10.876 21.314 85.478  1.00 14.78  ? 206  CYS B O   1 
ATOM   4218 C  CB  . CYS B 1 206 ? -10.596 24.312 87.032  1.00 18.39  ? 206  CYS B CB  1 
ATOM   4219 S  SG  . CYS B 1 206 ? -10.816 24.839 85.319  1.00 19.66  ? 206  CYS B SG  1 
ATOM   4220 N  N   . TYR B 1 207 ? -9.018  21.757 86.624  1.00 17.29  ? 207  TYR B N   1 
ATOM   4221 C  CA  . TYR B 1 207 ? -8.145  20.844 85.860  1.00 17.32  ? 207  TYR B CA  1 
ATOM   4222 C  C   . TYR B 1 207 ? -8.590  19.411 85.911  1.00 15.90  ? 207  TYR B C   1 
ATOM   4223 O  O   . TYR B 1 207 ? -8.705  18.728 84.873  1.00 14.02  ? 207  TYR B O   1 
ATOM   4224 C  CB  . TYR B 1 207 ? -6.720  20.971 86.345  1.00 16.81  ? 207  TYR B CB  1 
ATOM   4225 C  CG  . TYR B 1 207 ? -5.755  20.011 85.799  1.00 18.70  ? 207  TYR B CG  1 
ATOM   4226 C  CD1 . TYR B 1 207 ? -5.252  20.184 84.516  1.00 23.11  ? 207  TYR B CD1 1 
ATOM   4227 C  CD2 . TYR B 1 207 ? -5.296  18.916 86.544  1.00 22.33  ? 207  TYR B CD2 1 
ATOM   4228 C  CE1 . TYR B 1 207 ? -4.341  19.328 83.971  1.00 24.96  ? 207  TYR B CE1 1 
ATOM   4229 C  CE2 . TYR B 1 207 ? -4.340  18.040 86.003  1.00 25.99  ? 207  TYR B CE2 1 
ATOM   4230 C  CZ  . TYR B 1 207 ? -3.855  18.276 84.708  1.00 27.54  ? 207  TYR B CZ  1 
ATOM   4231 O  OH  . TYR B 1 207 ? -2.966  17.472 84.067  1.00 23.69  ? 207  TYR B OH  1 
ATOM   4232 N  N   . ASP B 1 208 ? -8.887  18.917 87.115  1.00 14.90  ? 208  ASP B N   1 
ATOM   4233 C  CA  . ASP B 1 208 ? -9.405  17.565 87.264  1.00 14.59  ? 208  ASP B CA  1 
ATOM   4234 C  C   . ASP B 1 208 ? -10.731 17.354 86.494  1.00 14.44  ? 208  ASP B C   1 
ATOM   4235 O  O   . ASP B 1 208 ? -10.978 16.301 85.972  1.00 13.75  ? 208  ASP B O   1 
ATOM   4236 C  CB  . ASP B 1 208 ? -9.562  17.138 88.752  1.00 16.13  ? 208  ASP B CB  1 
ATOM   4237 C  CG  . ASP B 1 208 ? -8.195  17.073 89.506  1.00 18.82  ? 208  ASP B CG  1 
ATOM   4238 O  OD1 . ASP B 1 208 ? -7.144  16.747 88.895  1.00 20.63  ? 208  ASP B OD1 1 
ATOM   4239 O  OD2 . ASP B 1 208 ? -8.248  17.278 90.753  1.00 24.70  ? 208  ASP B OD2 1 
ATOM   4240 N  N   . THR B 1 209 ? -11.619 18.331 86.498  1.00 14.43  ? 209  THR B N   1 
ATOM   4241 C  CA  . THR B 1 209 ? -12.835 18.195 85.781  1.00 13.59  ? 209  THR B CA  1 
ATOM   4242 C  C   . THR B 1 209 ? -12.622 18.107 84.252  1.00 14.34  ? 209  THR B C   1 
ATOM   4243 O  O   . THR B 1 209 ? -13.287 17.333 83.572  1.00 14.16  ? 209  THR B O   1 
ATOM   4244 C  CB  . THR B 1 209 ? -13.794 19.320 86.151  1.00 14.90  ? 209  THR B CB  1 
ATOM   4245 O  OG1 . THR B 1 209 ? -13.967 19.264 87.572  1.00 15.66  ? 209  THR B OG1 1 
ATOM   4246 C  CG2 . THR B 1 209 ? -15.138 19.121 85.453  1.00 14.89  ? 209  THR B CG2 1 
ATOM   4247 N  N   . LEU B 1 210 ? -11.697 18.879 83.758  1.00 15.13  ? 210  LEU B N   1 
ATOM   4248 C  CA  . LEU B 1 210 ? -11.393 18.885 82.327  1.00 16.01  ? 210  LEU B CA  1 
ATOM   4249 C  C   . LEU B 1 210 ? -10.908 17.518 81.884  1.00 16.38  ? 210  LEU B C   1 
ATOM   4250 O  O   . LEU B 1 210 ? -11.431 16.945 80.899  1.00 13.17  ? 210  LEU B O   1 
ATOM   4251 C  CB  . LEU B 1 210 ? -10.369 19.978 82.006  1.00 15.48  ? 210  LEU B CB  1 
ATOM   4252 C  CG  . LEU B 1 210 ? -10.822 21.435 82.104  1.00 17.90  ? 210  LEU B CG  1 
ATOM   4253 C  CD1 . LEU B 1 210 ? -9.562  22.246 81.942  1.00 17.94  ? 210  LEU B CD1 1 
ATOM   4254 C  CD2 . LEU B 1 210 ? -11.830 21.842 81.028  1.00 20.14  ? 210  LEU B CD2 1 
ATOM   4255 N  N   . LEU B 1 211 ? -9.979  16.941 82.670  1.00 15.01  ? 211  LEU B N   1 
ATOM   4256 C  CA  . LEU B 1 211 ? -9.468  15.633 82.388  1.00 16.53  ? 211  LEU B CA  1 
ATOM   4257 C  C   . LEU B 1 211 ? -10.507 14.587 82.493  1.00 16.96  ? 211  LEU B C   1 
ATOM   4258 O  O   . LEU B 1 211 ? -10.499 13.712 81.657  1.00 17.34  ? 211  LEU B O   1 
ATOM   4259 C  CB  . LEU B 1 211 ? -8.310  15.270 83.290  1.00 18.53  ? 211  LEU B CB  1 
ATOM   4260 C  CG  . LEU B 1 211 ? -7.063  16.139 83.172  1.00 21.42  ? 211  LEU B CG  1 
ATOM   4261 C  CD1 . LEU B 1 211 ? -6.003  15.498 84.037  1.00 25.35  ? 211  LEU B CD1 1 
ATOM   4262 C  CD2 . LEU B 1 211 ? -6.492  16.159 81.773  1.00 22.27  ? 211  LEU B CD2 1 
ATOM   4263 N  N   . ALA B 1 212 ? -11.440 14.679 83.441  1.00 15.83  ? 212  ALA B N   1 
ATOM   4264 C  CA  . ALA B 1 212 ? -12.511 13.679 83.574  1.00 15.62  ? 212  ALA B CA  1 
ATOM   4265 C  C   . ALA B 1 212 ? -13.631 13.843 82.526  1.00 16.23  ? 212  ALA B C   1 
ATOM   4266 O  O   . ALA B 1 212 ? -14.169 12.826 82.082  1.00 17.58  ? 212  ALA B O   1 
ATOM   4267 C  CB  . ALA B 1 212 ? -13.158 13.690 84.963  1.00 15.91  ? 212  ALA B CB  1 
ATOM   4268 N  N   . GLU B 1 213 ? -13.992 15.084 82.173  1.00 14.84  ? 213  GLU B N   1 
ATOM   4269 C  CA  . GLU B 1 213 ? -15.259 15.350 81.463  1.00 15.41  ? 213  GLU B CA  1 
ATOM   4270 C  C   . GLU B 1 213 ? -15.131 15.963 80.067  1.00 15.51  ? 213  GLU B C   1 
ATOM   4271 O  O   . GLU B 1 213 ? -16.166 16.047 79.409  1.00 14.15  ? 213  GLU B O   1 
ATOM   4272 C  CB  . GLU B 1 213 ? -16.209 16.258 82.248  1.00 18.33  ? 213  GLU B CB  1 
ATOM   4273 C  CG  . GLU B 1 213 ? -16.451 15.821 83.724  1.00 21.49  ? 213  GLU B CG  1 
ATOM   4274 C  CD  . GLU B 1 213 ? -17.147 14.492 83.910  1.00 28.62  ? 213  GLU B CD  1 
ATOM   4275 O  OE1 . GLU B 1 213 ? -17.622 13.926 82.902  1.00 32.72  ? 213  GLU B OE1 1 
ATOM   4276 O  OE2 . GLU B 1 213 ? -17.202 13.970 85.086  1.00 28.77  ? 213  GLU B OE2 1 
ATOM   4277 N  N   . GLY B 1 214 ? -13.921 16.370 79.700  1.00 15.36  ? 214  GLY B N   1 
ATOM   4278 C  CA  . GLY B 1 214 ? -13.649 17.212 78.524  1.00 18.10  ? 214  GLY B CA  1 
ATOM   4279 C  C   . GLY B 1 214 ? -14.158 16.522 77.240  1.00 16.53  ? 214  GLY B C   1 
ATOM   4280 O  O   . GLY B 1 214 ? -14.896 17.137 76.447  1.00 15.07  ? 214  GLY B O   1 
ATOM   4281 N  N   . VAL B 1 215 ? -13.705 15.297 77.045  1.00 17.51  ? 215  VAL B N   1 
ATOM   4282 C  CA  . VAL B 1 215 ? -14.061 14.478 75.856  1.00 17.73  ? 215  VAL B CA  1 
ATOM   4283 C  C   . VAL B 1 215 ? -15.507 14.098 75.795  1.00 18.17  ? 215  VAL B C   1 
ATOM   4284 O  O   . VAL B 1 215 ? -16.187 14.306 74.788  1.00 20.05  ? 215  VAL B O   1 
ATOM   4285 C  CB  . VAL B 1 215 ? -13.145 13.241 75.701  1.00 19.89  ? 215  VAL B CB  1 
ATOM   4286 C  CG1 . VAL B 1 215 ? -13.548 12.444 74.425  1.00 21.64  ? 215  VAL B CG1 1 
ATOM   4287 C  CG2 . VAL B 1 215 ? -11.709 13.649 75.585  1.00 20.54  ? 215  VAL B CG2 1 
ATOM   4288 N  N   . LYS B 1 216 ? -16.049 13.594 76.900  1.00 17.98  ? 216  LYS B N   1 
ATOM   4289 C  CA  . LYS B 1 216 ? -17.396 13.344 77.027  1.00 18.83  ? 216  LYS B CA  1 
ATOM   4290 C  C   . LYS B 1 216 ? -18.300 14.559 76.747  1.00 18.69  ? 216  LYS B C   1 
ATOM   4291 O  O   . LYS B 1 216 ? -19.349 14.414 76.114  1.00 20.39  ? 216  LYS B O   1 
ATOM   4292 C  CB  . LYS B 1 216 ? -17.709 12.852 78.444  1.00 20.09  ? 216  LYS B CB  1 
ATOM   4293 C  CG  . LYS B 1 216 ? -17.299 11.426 78.716  1.00 23.07  ? 216  LYS B CG  1 
ATOM   4294 C  CD  . LYS B 1 216 ? -17.878 10.895 80.031  1.00 23.32  ? 216  LYS B CD  1 
ATOM   4295 C  CE  . LYS B 1 216 ? -17.199 11.386 81.268  1.00 25.57  ? 216  LYS B CE  1 
ATOM   4296 N  NZ  . LYS B 1 216 ? -18.132 11.134 82.443  1.00 23.40  ? 216  LYS B NZ  1 
ATOM   4297 N  N   . ALA B 1 217 ? -17.949 15.731 77.271  1.00 16.11  ? 217  ALA B N   1 
ATOM   4298 C  CA  . ALA B 1 217 ? -18.693 16.910 76.997  1.00 15.58  ? 217  ALA B CA  1 
ATOM   4299 C  C   . ALA B 1 217 ? -18.619 17.316 75.476  1.00 17.38  ? 217  ALA B C   1 
ATOM   4300 O  O   . ALA B 1 217 ? -19.616 17.817 74.884  1.00 17.36  ? 217  ALA B O   1 
ATOM   4301 C  CB  . ALA B 1 217 ? -18.136 18.073 77.796  1.00 16.22  ? 217  ALA B CB  1 
ATOM   4302 N  N   . LYS B 1 218 ? -17.416 17.220 74.916  1.00 15.96  ? 218  LYS B N   1 
ATOM   4303 C  CA  . LYS B 1 218 ? -17.189 17.617 73.531  1.00 18.42  ? 218  LYS B CA  1 
ATOM   4304 C  C   . LYS B 1 218 ? -18.087 16.765 72.608  1.00 19.07  ? 218  LYS B C   1 
ATOM   4305 O  O   . LYS B 1 218 ? -18.744 17.302 71.665  1.00 18.40  ? 218  LYS B O   1 
ATOM   4306 C  CB  . LYS B 1 218 ? -15.734 17.467 73.178  1.00 18.06  ? 218  LYS B CB  1 
ATOM   4307 C  CG  . LYS B 1 218 ? -15.407 17.902 71.747  1.00 21.67  ? 218  LYS B CG  1 
ATOM   4308 C  CD  . LYS B 1 218 ? -13.996 17.576 71.337  1.00 24.36  ? 218  LYS B CD  1 
ATOM   4309 C  CE  . LYS B 1 218 ? -13.893 17.597 69.808  1.00 31.71  ? 218  LYS B CE  1 
ATOM   4310 N  NZ  . LYS B 1 218 ? -12.833 18.463 69.237  1.00 39.15  ? 218  LYS B NZ  1 
ATOM   4311 N  N   . LEU B 1 219 ? -18.115 15.474 72.876  1.00 17.70  ? 219  LEU B N   1 
ATOM   4312 C  CA  . LEU B 1 219 ? -18.969 14.549 72.101  1.00 19.74  ? 219  LEU B CA  1 
ATOM   4313 C  C   . LEU B 1 219 ? -20.462 14.869 72.247  1.00 19.95  ? 219  LEU B C   1 
ATOM   4314 O  O   . LEU B 1 219 ? -21.214 14.832 71.239  1.00 18.60  ? 219  LEU B O   1 
ATOM   4315 C  CB  . LEU B 1 219 ? -18.641 13.120 72.399  1.00 21.46  ? 219  LEU B CB  1 
ATOM   4316 C  CG  . LEU B 1 219 ? -17.285 12.628 71.925  1.00 27.10  ? 219  LEU B CG  1 
ATOM   4317 C  CD1 . LEU B 1 219 ? -17.190 11.143 72.157  1.00 30.14  ? 219  LEU B CD1 1 
ATOM   4318 C  CD2 . LEU B 1 219 ? -17.009 12.897 70.498  1.00 32.54  ? 219  LEU B CD2 1 
ATOM   4319 N  N   . ALA B 1 220 ? -20.918 15.256 73.462  1.00 16.74  ? 220  ALA B N   1 
ATOM   4320 C  CA  . ALA B 1 220 ? -22.287 15.671 73.614  1.00 16.95  ? 220  ALA B CA  1 
ATOM   4321 C  C   . ALA B 1 220 ? -22.584 16.966 72.827  1.00 17.87  ? 220  ALA B C   1 
ATOM   4322 O  O   . ALA B 1 220 ? -23.615 17.074 72.131  1.00 19.54  ? 220  ALA B O   1 
ATOM   4323 C  CB  . ALA B 1 220 ? -22.649 15.806 75.090  1.00 17.20  ? 220  ALA B CB  1 
ATOM   4324 N  N   . VAL B 1 221 ? -21.688 17.919 72.923  1.00 16.80  ? 221  VAL B N   1 
ATOM   4325 C  CA  . VAL B 1 221 ? -21.913 19.209 72.283  1.00 20.97  ? 221  VAL B CA  1 
ATOM   4326 C  C   . VAL B 1 221 ? -21.827 19.076 70.718  1.00 21.90  ? 221  VAL B C   1 
ATOM   4327 O  O   . VAL B 1 221 ? -22.522 19.799 69.972  1.00 21.72  ? 221  VAL B O   1 
ATOM   4328 C  CB  . VAL B 1 221 ? -20.988 20.276 72.841  1.00 19.38  ? 221  VAL B CB  1 
ATOM   4329 C  CG1 . VAL B 1 221 ? -21.051 21.562 72.040  1.00 21.66  ? 221  VAL B CG1 1 
ATOM   4330 C  CG2 . VAL B 1 221 ? -21.374 20.563 74.309  1.00 18.95  ? 221  VAL B CG2 1 
ATOM   4331 N  N   . GLU B 1 222 ? -21.029 18.137 70.255  1.00 20.53  ? 222  GLU B N   1 
ATOM   4332 C  CA  . GLU B 1 222 ? -21.033 17.834 68.813  1.00 22.88  ? 222  GLU B CA  1 
ATOM   4333 C  C   . GLU B 1 222 ? -22.428 17.401 68.357  1.00 23.04  ? 222  GLU B C   1 
ATOM   4334 O  O   . GLU B 1 222 ? -22.781 17.641 67.203  1.00 24.45  ? 222  GLU B O   1 
ATOM   4335 C  CB  . GLU B 1 222 ? -20.016 16.778 68.461  1.00 20.23  ? 222  GLU B CB  1 
ATOM   4336 C  CG  . GLU B 1 222 ? -18.610 17.298 68.439  1.00 24.19  ? 222  GLU B CG  1 
ATOM   4337 C  CD  . GLU B 1 222 ? -17.526 16.206 68.330  1.00 23.62  ? 222  GLU B CD  1 
ATOM   4338 O  OE1 . GLU B 1 222 ? -17.803 14.989 68.387  1.00 26.81  ? 222  GLU B OE1 1 
ATOM   4339 O  OE2 . GLU B 1 222 ? -16.352 16.568 68.222  1.00 26.78  ? 222  GLU B OE2 1 
ATOM   4340 N  N   . ALA B 1 223 ? -23.223 16.770 69.218  1.00 21.13  ? 223  ALA B N   1 
ATOM   4341 C  CA  . ALA B 1 223 ? -24.590 16.369 68.847  1.00 23.43  ? 223  ALA B CA  1 
ATOM   4342 C  C   . ALA B 1 223 ? -25.604 17.390 69.266  1.00 20.53  ? 223  ALA B C   1 
ATOM   4343 O  O   . ALA B 1 223 ? -26.783 17.161 69.156  1.00 23.47  ? 223  ALA B O   1 
ATOM   4344 C  CB  . ALA B 1 223 ? -24.921 15.031 69.467  1.00 27.20  ? 223  ALA B CB  1 
ATOM   4345 N  N   . GLY B 1 224 ? -25.150 18.470 69.858  1.00 20.55  ? 224  GLY B N   1 
ATOM   4346 C  CA  . GLY B 1 224 ? -26.018 19.579 70.232  1.00 21.08  ? 224  GLY B CA  1 
ATOM   4347 C  C   . GLY B 1 224 ? -26.826 19.396 71.509  1.00 21.60  ? 224  GLY B C   1 
ATOM   4348 O  O   . GLY B 1 224 ? -27.796 20.128 71.716  1.00 21.96  ? 224  GLY B O   1 
ATOM   4349 N  N   . VAL B 1 225 ? -26.382 18.489 72.409  1.00 20.73  ? 225  VAL B N   1 
ATOM   4350 C  CA  . VAL B 1 225 ? -27.187 18.067 73.558  1.00 18.60  ? 225  VAL B CA  1 
ATOM   4351 C  C   . VAL B 1 225 ? -26.435 18.297 74.927  1.00 19.62  ? 225  VAL B C   1 
ATOM   4352 O  O   . VAL B 1 225 ? -25.257 18.574 74.942  1.00 16.77  ? 225  VAL B O   1 
ATOM   4353 C  CB  . VAL B 1 225 ? -27.586 16.622 73.468  1.00 18.84  ? 225  VAL B CB  1 
ATOM   4354 C  CG1 . VAL B 1 225 ? -28.475 16.366 72.220  1.00 20.13  ? 225  VAL B CG1 1 
ATOM   4355 C  CG2 . VAL B 1 225 ? -26.353 15.678 73.456  1.00 18.53  ? 225  VAL B CG2 1 
ATOM   4356 N  N   . VAL B 1 226 ? -27.191 18.241 75.997  1.00 19.35  ? 226  VAL B N   1 
ATOM   4357 C  CA  . VAL B 1 226 ? -26.710 18.468 77.370  1.00 19.68  ? 226  VAL B CA  1 
ATOM   4358 C  C   . VAL B 1 226 ? -26.739 17.164 78.142  1.00 18.14  ? 226  VAL B C   1 
ATOM   4359 O  O   . VAL B 1 226 ? -27.770 16.538 78.357  1.00 18.42  ? 226  VAL B O   1 
ATOM   4360 C  CB  . VAL B 1 226 ? -27.568 19.450 78.126  1.00 20.12  ? 226  VAL B CB  1 
ATOM   4361 C  CG1 . VAL B 1 226 ? -26.881 19.802 79.491  1.00 19.77  ? 226  VAL B CG1 1 
ATOM   4362 C  CG2 . VAL B 1 226 ? -27.751 20.709 77.312  1.00 19.59  ? 226  VAL B CG2 1 
ATOM   4363 N  N   . THR B 1 227 ? -25.565 16.707 78.492  1.00 19.55  ? 227  THR B N   1 
ATOM   4364 C  CA  . THR B 1 227 ? -25.445 15.656 79.461  1.00 17.83  ? 227  THR B CA  1 
ATOM   4365 C  C   . THR B 1 227 ? -24.812 16.247 80.753  1.00 15.59  ? 227  THR B C   1 
ATOM   4366 O  O   . THR B 1 227 ? -24.371 17.401 80.808  1.00 13.76  ? 227  THR B O   1 
ATOM   4367 C  CB  . THR B 1 227 ? -24.496 14.576 78.899  1.00 17.27  ? 227  THR B CB  1 
ATOM   4368 O  OG1 . THR B 1 227 ? -23.211 15.144 78.707  1.00 17.71  ? 227  THR B OG1 1 
ATOM   4369 C  CG2 . THR B 1 227 ? -24.968 14.060 77.569  1.00 19.43  ? 227  THR B CG2 1 
ATOM   4370 N  N   . GLU B 1 228 ? -24.712 15.406 81.794  1.00 16.40  ? 228  GLU B N   1 
ATOM   4371 C  CA  . GLU B 1 228 ? -24.019 15.845 83.033  1.00 16.72  ? 228  GLU B CA  1 
ATOM   4372 C  C   . GLU B 1 228 ? -22.565 16.256 82.755  1.00 15.31  ? 228  GLU B C   1 
ATOM   4373 O  O   . GLU B 1 228 ? -22.052 17.213 83.352  1.00 17.06  ? 228  GLU B O   1 
ATOM   4374 C  CB  . GLU B 1 228 ? -24.047 14.726 84.064  1.00 18.50  ? 228  GLU B CB  1 
ATOM   4375 C  CG  . GLU B 1 228 ? -23.326 15.035 85.385  1.00 20.00  ? 228  GLU B CG  1 
ATOM   4376 C  CD  . GLU B 1 228 ? -23.903 16.257 86.138  1.00 22.87  ? 228  GLU B CD  1 
ATOM   4377 O  OE1 . GLU B 1 228 ? -25.082 16.676 85.909  1.00 26.45  ? 228  GLU B OE1 1 
ATOM   4378 O  OE2 . GLU B 1 228 ? -23.167 16.748 87.037  1.00 22.84  ? 228  GLU B OE2 1 
ATOM   4379 N  N   . ALA B 1 229 ? -21.850 15.541 81.879  1.00 14.26  ? 229  ALA B N   1 
ATOM   4380 C  CA  . ALA B 1 229 ? -20.492 16.020 81.507  1.00 15.28  ? 229  ALA B CA  1 
ATOM   4381 C  C   . ALA B 1 229 ? -20.408 17.426 80.942  1.00 14.76  ? 229  ALA B C   1 
ATOM   4382 O  O   . ALA B 1 229 ? -19.439 18.213 81.226  1.00 14.27  ? 229  ALA B O   1 
ATOM   4383 C  CB  . ALA B 1 229 ? -19.763 15.007 80.594  1.00 17.45  ? 229  ALA B CB  1 
ATOM   4384 N  N   . VAL B 1 230 ? -21.410 17.787 80.125  1.00 15.21  ? 230  VAL B N   1 
ATOM   4385 C  CA  . VAL B 1 230 ? -21.473 19.143 79.622  1.00 15.13  ? 230  VAL B CA  1 
ATOM   4386 C  C   . VAL B 1 230 ? -21.708 20.140 80.788  1.00 13.20  ? 230  VAL B C   1 
ATOM   4387 O  O   . VAL B 1 230 ? -21.093 21.137 80.833  1.00 13.42  ? 230  VAL B O   1 
ATOM   4388 C  CB  . VAL B 1 230 ? -22.647 19.265 78.601  1.00 16.71  ? 230  VAL B CB  1 
ATOM   4389 C  CG1 . VAL B 1 230 ? -22.877 20.698 78.214  1.00 16.51  ? 230  VAL B CG1 1 
ATOM   4390 C  CG2 . VAL B 1 230 ? -22.376 18.334 77.417  1.00 17.03  ? 230  VAL B CG2 1 
ATOM   4391 N  N   . GLU B 1 231 ? -22.629 19.846 81.681  1.00 13.20  ? 231  GLU B N   1 
ATOM   4392 C  CA  . GLU B 1 231 ? -22.864 20.762 82.812  1.00 15.60  ? 231  GLU B CA  1 
ATOM   4393 C  C   . GLU B 1 231 ? -21.553 20.959 83.630  1.00 15.31  ? 231  GLU B C   1 
ATOM   4394 O  O   . GLU B 1 231 ? -21.266 22.054 84.157  1.00 13.76  ? 231  GLU B O   1 
ATOM   4395 C  CB  . GLU B 1 231 ? -23.922 20.178 83.734  1.00 17.93  ? 231  GLU B CB  1 
ATOM   4396 C  CG  . GLU B 1 231 ? -25.282 19.903 83.080  1.00 20.00  ? 231  GLU B CG  1 
ATOM   4397 C  CD  . GLU B 1 231 ? -26.143 21.183 83.003  1.00 23.69  ? 231  GLU B CD  1 
ATOM   4398 O  OE1 . GLU B 1 231 ? -25.613 22.309 83.269  1.00 23.06  ? 231  GLU B OE1 1 
ATOM   4399 O  OE2 . GLU B 1 231 ? -27.343 21.086 82.697  1.00 30.10  ? 231  GLU B OE2 1 
ATOM   4400 N  N   . ARG B 1 232 ? -20.777 19.864 83.773  1.00 15.41  ? 232  ARG B N   1 
ATOM   4401 C  CA  . ARG B 1 232 ? -19.569 19.948 84.574  1.00 15.84  ? 232  ARG B CA  1 
ATOM   4402 C  C   . ARG B 1 232 ? -18.523 20.791 83.868  1.00 15.75  ? 232  ARG B C   1 
ATOM   4403 O  O   . ARG B 1 232 ? -17.834 21.525 84.486  1.00 12.07  ? 232  ARG B O   1 
ATOM   4404 C  CB  . ARG B 1 232 ? -19.033 18.554 84.962  1.00 16.36  ? 232  ARG B CB  1 
ATOM   4405 C  CG  . ARG B 1 232 ? -19.946 17.777 85.899  1.00 15.52  ? 232  ARG B CG  1 
ATOM   4406 C  CD  . ARG B 1 232 ? -19.457 16.440 86.392  1.00 17.97  ? 232  ARG B CD  1 
ATOM   4407 N  NE  . ARG B 1 232 ? -20.388 15.971 87.407  1.00 18.44  ? 232  ARG B NE  1 
ATOM   4408 C  CZ  . ARG B 1 232 ? -20.072 15.282 88.504  1.00 22.08  ? 232  ARG B CZ  1 
ATOM   4409 N  NH1 . ARG B 1 232 ? -18.839 14.939 88.734  1.00 20.82  ? 232  ARG B NH1 1 
ATOM   4410 N  NH2 . ARG B 1 232 ? -20.992 14.955 89.398  1.00 23.21  ? 232  ARG B NH2 1 
ATOM   4411 N  N   . ILE B 1 233 ? -18.400 20.674 82.533  1.00 14.56  ? 233  ILE B N   1 
ATOM   4412 C  CA  . ILE B 1 233 ? -17.426 21.473 81.822  1.00 13.91  ? 233  ILE B CA  1 
ATOM   4413 C  C   . ILE B 1 233 ? -17.850 22.926 81.770  1.00 12.93  ? 233  ILE B C   1 
ATOM   4414 O  O   . ILE B 1 233 ? -16.979 23.800 81.842  1.00 13.53  ? 233  ILE B O   1 
ATOM   4415 C  CB  . ILE B 1 233 ? -17.235 20.910 80.396  1.00 14.13  ? 233  ILE B CB  1 
ATOM   4416 C  CG1 . ILE B 1 233 ? -16.432 19.607 80.518  1.00 14.92  ? 233  ILE B CG1 1 
ATOM   4417 C  CG2 . ILE B 1 233 ? -16.594 21.863 79.452  1.00 13.25  ? 233  ILE B CG2 1 
ATOM   4418 C  CD1 . ILE B 1 233 ? -15.044 19.755 81.077  1.00 16.10  ? 233  ILE B CD1 1 
ATOM   4419 N  N   . ILE B 1 234 ? -19.153 23.207 81.677  1.00 13.82  ? 234  ILE B N   1 
ATOM   4420 C  CA  . ILE B 1 234 ? -19.583 24.607 81.625  1.00 14.49  ? 234  ILE B CA  1 
ATOM   4421 C  C   . ILE B 1 234 ? -19.184 25.244 82.997  1.00 14.39  ? 234  ILE B C   1 
ATOM   4422 O  O   . ILE B 1 234 ? -18.712 26.353 83.093  1.00 12.56  ? 234  ILE B O   1 
ATOM   4423 C  CB  . ILE B 1 234 ? -21.069 24.715 81.367  1.00 14.77  ? 234  ILE B CB  1 
ATOM   4424 C  CG1 . ILE B 1 234 ? -21.386 24.384 79.878  1.00 17.59  ? 234  ILE B CG1 1 
ATOM   4425 C  CG2 . ILE B 1 234 ? -21.687 26.056 81.762  1.00 15.00  ? 234  ILE B CG2 1 
ATOM   4426 C  CD1 . ILE B 1 234 ? -22.865 24.223 79.662  1.00 18.69  ? 234  ILE B CD1 1 
ATOM   4427 N  N   . GLU B 1 235 ? -19.474 24.510 84.050  1.00 16.24  ? 235  GLU B N   1 
ATOM   4428 C  CA  . GLU B 1 235 ? -19.092 24.981 85.409  1.00 15.67  ? 235  GLU B CA  1 
ATOM   4429 C  C   . GLU B 1 235 ? -17.605 25.162 85.479  1.00 13.16  ? 235  GLU B C   1 
ATOM   4430 O  O   . GLU B 1 235 ? -17.134 26.201 85.957  1.00 16.43  ? 235  GLU B O   1 
ATOM   4431 C  CB  . GLU B 1 235 ? -19.603 24.040 86.503  1.00 16.42  ? 235  GLU B CB  1 
ATOM   4432 C  CG  . GLU B 1 235 ? -19.356 24.668 87.868  1.00 18.30  ? 235  GLU B CG  1 
ATOM   4433 C  CD  . GLU B 1 235 ? -19.689 23.833 89.102  1.00 22.08  ? 235  GLU B CD  1 
ATOM   4434 O  OE1 . GLU B 1 235 ? -20.680 22.973 89.071  1.00 19.51  ? 235  GLU B OE1 1 
ATOM   4435 O  OE2 . GLU B 1 235 ? -18.982 24.195 90.154  1.00 20.87  ? 235  GLU B OE2 1 
ATOM   4436 N  N   . ALA B 1 236 ? -16.835 24.197 84.994  1.00 14.99  ? 236  ALA B N   1 
ATOM   4437 C  CA  . ALA B 1 236 ? -15.386 24.293 84.974  1.00 14.64  ? 236  ALA B CA  1 
ATOM   4438 C  C   . ALA B 1 236 ? -14.903 25.520 84.198  1.00 17.58  ? 236  ALA B C   1 
ATOM   4439 O  O   . ALA B 1 236 ? -14.001 26.330 84.622  1.00 15.35  ? 236  ALA B O   1 
ATOM   4440 C  CB  . ALA B 1 236 ? -14.792 23.019 84.395  1.00 16.39  ? 236  ALA B CB  1 
ATOM   4441 N  N   . ASN B 1 237 ? -15.486 25.680 83.018  1.00 15.34  ? 237  ASN B N   1 
ATOM   4442 C  CA  . ASN B 1 237 ? -15.051 26.745 82.154  1.00 15.47  ? 237  ASN B CA  1 
ATOM   4443 C  C   . ASN B 1 237 ? -15.415 28.089 82.661  1.00 15.77  ? 237  ASN B C   1 
ATOM   4444 O  O   . ASN B 1 237 ? -14.816 29.055 82.258  1.00 18.24  ? 237  ASN B O   1 
ATOM   4445 C  CB  . ASN B 1 237 ? -15.718 26.605 80.775  1.00 14.47  ? 237  ASN B CB  1 
ATOM   4446 C  CG  . ASN B 1 237 ? -15.060 25.568 79.896  1.00 14.38  ? 237  ASN B CG  1 
ATOM   4447 O  OD1 . ASN B 1 237 ? -14.151 24.805 80.294  1.00 15.30  ? 237  ASN B OD1 1 
ATOM   4448 N  ND2 . ASN B 1 237 ? -15.521 25.551 78.589  1.00 13.23  ? 237  ASN B ND2 1 
ATOM   4449 N  N   . THR B 1 238 ? -16.426 28.185 83.526  1.00 16.83  ? 238  THR B N   1 
ATOM   4450 C  CA  . THR B 1 238 ? -16.938 29.449 83.888  1.00 16.91  ? 238  THR B CA  1 
ATOM   4451 C  C   . THR B 1 238 ? -16.751 29.809 85.410  1.00 18.38  ? 238  THR B C   1 
ATOM   4452 O  O   . THR B 1 238 ? -16.001 30.705 85.706  1.00 18.50  ? 238  THR B O   1 
ATOM   4453 C  CB  . THR B 1 238 ? -18.435 29.439 83.578  1.00 18.86  ? 238  THR B CB  1 
ATOM   4454 O  OG1 . THR B 1 238 ? -18.605 28.968 82.233  1.00 17.37  ? 238  THR B OG1 1 
ATOM   4455 C  CG2 . THR B 1 238 ? -19.012 30.780 83.726  1.00 19.38  ? 238  THR B CG2 1 
ATOM   4456 N  N   . TYR B 1 239 ? -17.420 29.104 86.312  1.00 16.80  ? 239  TYR B N   1 
ATOM   4457 C  CA  . TYR B 1 239 ? -17.245 29.365 87.771  1.00 17.72  ? 239  TYR B CA  1 
ATOM   4458 C  C   . TYR B 1 239 ? -15.853 28.965 88.269  1.00 17.16  ? 239  TYR B C   1 
ATOM   4459 O  O   . TYR B 1 239 ? -15.097 29.799 88.854  1.00 20.23  ? 239  TYR B O   1 
ATOM   4460 C  CB  . TYR B 1 239 ? -18.418 28.766 88.602  1.00 17.30  ? 239  TYR B CB  1 
ATOM   4461 C  CG  . TYR B 1 239 ? -18.459 29.361 89.996  1.00 18.40  ? 239  TYR B CG  1 
ATOM   4462 C  CD1 . TYR B 1 239 ? -19.034 30.606 90.219  1.00 18.83  ? 239  TYR B CD1 1 
ATOM   4463 C  CD2 . TYR B 1 239 ? -17.829 28.704 91.076  1.00 20.14  ? 239  TYR B CD2 1 
ATOM   4464 C  CE1 . TYR B 1 239 ? -19.026 31.213 91.459  1.00 20.06  ? 239  TYR B CE1 1 
ATOM   4465 C  CE2 . TYR B 1 239 ? -17.814 29.299 92.334  1.00 18.73  ? 239  TYR B CE2 1 
ATOM   4466 C  CZ  . TYR B 1 239 ? -18.437 30.511 92.534  1.00 20.95  ? 239  TYR B CZ  1 
ATOM   4467 O  OH  . TYR B 1 239 ? -18.436 31.142 93.757  1.00 22.78  ? 239  TYR B OH  1 
ATOM   4468 N  N   . LEU B 1 240 ? -15.457 27.723 88.038  1.00 19.08  ? 240  LEU B N   1 
ATOM   4469 C  CA  . LEU B 1 240 ? -14.183 27.209 88.618  1.00 19.24  ? 240  LEU B CA  1 
ATOM   4470 C  C   . LEU B 1 240 ? -12.986 27.959 88.083  1.00 19.47  ? 240  LEU B C   1 
ATOM   4471 O  O   . LEU B 1 240 ? -12.094 28.515 88.811  1.00 17.52  ? 240  LEU B O   1 
ATOM   4472 C  CB  . LEU B 1 240 ? -14.014 25.692 88.458  1.00 18.86  ? 240  LEU B CB  1 
ATOM   4473 C  CG  . LEU B 1 240 ? -15.162 24.781 88.851  1.00 19.49  ? 240  LEU B CG  1 
ATOM   4474 C  CD1 . LEU B 1 240 ? -14.695 23.362 88.556  1.00 19.98  ? 240  LEU B CD1 1 
ATOM   4475 C  CD2 . LEU B 1 240 ? -15.590 24.925 90.280  1.00 19.42  ? 240  LEU B CD2 1 
ATOM   4476 N  N   . SER B 1 241 ? -12.956 28.066 86.777  1.00 17.93  ? 241  SER B N   1 
ATOM   4477 C  CA  . SER B 1 241 ? -11.890 28.833 86.155  1.00 17.98  ? 241  SER B CA  1 
ATOM   4478 C  C   . SER B 1 241 ? -11.917 30.294 86.538  1.00 16.35  ? 241  SER B C   1 
ATOM   4479 O  O   . SER B 1 241 ? -10.842 30.961 86.756  1.00 19.36  ? 241  SER B O   1 
ATOM   4480 C  CB  . SER B 1 241 ? -11.973 28.645 84.638  1.00 21.17  ? 241  SER B CB  1 
ATOM   4481 O  OG  . SER B 1 241 ? -10.828 29.130 84.030  1.00 23.71  ? 241  SER B OG  1 
ATOM   4482 N  N   . GLY B 1 242 ? -13.089 30.871 86.614  1.00 16.22  ? 242  GLY B N   1 
ATOM   4483 C  CA  . GLY B 1 242 ? -13.178 32.327 86.892  1.00 17.06  ? 242  GLY B CA  1 
ATOM   4484 C  C   . GLY B 1 242 ? -12.684 32.683 88.313  1.00 17.01  ? 242  GLY B C   1 
ATOM   4485 O  O   . GLY B 1 242 ? -11.826 33.549 88.481  1.00 19.06  ? 242  GLY B O   1 
ATOM   4486 N  N   . ILE B 1 243 ? -13.162 31.939 89.306  1.00 19.81  ? 243  ILE B N   1 
ATOM   4487 C  CA  . ILE B 1 243 ? -12.690 32.129 90.712  1.00 18.16  ? 243  ILE B CA  1 
ATOM   4488 C  C   . ILE B 1 243 ? -11.185 31.841 90.804  1.00 18.53  ? 243  ILE B C   1 
ATOM   4489 O  O   . ILE B 1 243 ? -10.400 32.598 91.408  1.00 18.20  ? 243  ILE B O   1 
ATOM   4490 C  CB  . ILE B 1 243 ? -13.428 31.230 91.726  1.00 20.55  ? 243  ILE B CB  1 
ATOM   4491 C  CG1 . ILE B 1 243 ? -14.930 31.504 91.736  1.00 22.69  ? 243  ILE B CG1 1 
ATOM   4492 C  CG2 . ILE B 1 243 ? -12.917 31.516 93.146  1.00 23.04  ? 243  ILE B CG2 1 
ATOM   4493 C  CD1 . ILE B 1 243 ? -15.363 32.962 91.795  1.00 26.24  ? 243  ILE B CD1 1 
ATOM   4494 N  N   . GLY B 1 244 ? -10.770 30.735 90.210  1.00 19.13  ? 244  GLY B N   1 
ATOM   4495 C  CA  . GLY B 1 244 ? -9.377  30.306 90.159  1.00 19.24  ? 244  GLY B CA  1 
ATOM   4496 C  C   . GLY B 1 244 ? -8.436  31.352 89.639  1.00 21.16  ? 244  GLY B C   1 
ATOM   4497 O  O   . GLY B 1 244 ? -7.422  31.687 90.262  1.00 18.61  ? 244  GLY B O   1 
ATOM   4498 N  N   . PHE B 1 245 ? -8.762  31.928 88.469  1.00 20.79  ? 245  PHE B N   1 
ATOM   4499 C  CA  . PHE B 1 245 ? -7.838  32.844 87.900  1.00 19.66  ? 245  PHE B CA  1 
ATOM   4500 C  C   . PHE B 1 245 ? -7.825  34.202 88.648  1.00 19.33  ? 245  PHE B C   1 
ATOM   4501 O  O   . PHE B 1 245 ? -6.769  34.800 88.832  1.00 17.78  ? 245  PHE B O   1 
ATOM   4502 C  CB  . PHE B 1 245 ? -8.071  32.997 86.387  1.00 23.10  ? 245  PHE B CB  1 
ATOM   4503 C  CG  . PHE B 1 245 ? -8.814  34.225 86.027  1.00 23.18  ? 245  PHE B CG  1 
ATOM   4504 C  CD1 . PHE B 1 245 ? -8.195  35.456 86.082  1.00 24.68  ? 245  PHE B CD1 1 
ATOM   4505 C  CD2 . PHE B 1 245 ? -10.156 34.165 85.692  1.00 26.36  ? 245  PHE B CD2 1 
ATOM   4506 C  CE1 . PHE B 1 245 ? -8.874  36.619 85.744  1.00 26.73  ? 245  PHE B CE1 1 
ATOM   4507 C  CE2 . PHE B 1 245 ? -10.857 35.333 85.355  1.00 25.24  ? 245  PHE B CE2 1 
ATOM   4508 C  CZ  . PHE B 1 245 ? -10.212 36.561 85.411  1.00 26.95  ? 245  PHE B CZ  1 
ATOM   4509 N  N   . GLU B 1 246 ? -8.984  34.713 89.072  1.00 17.90  ? 246  GLU B N   1 
ATOM   4510 C  CA  . GLU B 1 246 ? -9.050  36.030 89.632  1.00 18.21  ? 246  GLU B CA  1 
ATOM   4511 C  C   . GLU B 1 246 ? -8.573  36.085 91.117  1.00 17.35  ? 246  GLU B C   1 
ATOM   4512 O  O   . GLU B 1 246 ? -7.959  37.064 91.522  1.00 19.64  ? 246  GLU B O   1 
ATOM   4513 C  CB  . GLU B 1 246 ? -10.501 36.475 89.637  1.00 18.93  ? 246  GLU B CB  1 
ATOM   4514 C  CG  . GLU B 1 246 ? -10.702 37.873 90.141  1.00 21.36  ? 246  GLU B CG  1 
ATOM   4515 C  CD  . GLU B 1 246 ? -12.137 38.349 90.037  1.00 23.69  ? 246  GLU B CD  1 
ATOM   4516 O  OE1 . GLU B 1 246 ? -13.105 37.660 90.505  1.00 27.90  ? 246  GLU B OE1 1 
ATOM   4517 O  OE2 . GLU B 1 246 ? -12.286 39.442 89.426  1.00 29.47  ? 246  GLU B OE2 1 
ATOM   4518 N  N   . SER B 1 247 ? -8.994  35.083 91.870  1.00 17.85  ? 247  SER B N   1 
ATOM   4519 C  CA  . SER B 1 247 ? -8.700  34.967 93.319  1.00 18.09  ? 247  SER B CA  1 
ATOM   4520 C  C   . SER B 1 247 ? -7.501  34.114 93.654  1.00 18.58  ? 247  SER B C   1 
ATOM   4521 O  O   . SER B 1 247 ? -7.071  34.097 94.839  1.00 18.29  ? 247  SER B O   1 
ATOM   4522 C  CB  . SER B 1 247 ? -9.944  34.488 94.068  1.00 15.44  ? 247  SER B CB  1 
ATOM   4523 O  OG  . SER B 1 247 ? -10.934 35.502 94.022  1.00 17.17  ? 247  SER B OG  1 
ATOM   4524 N  N   . SER B 1 248 ? -6.936  33.383 92.675  1.00 17.55  ? 248  SER B N   1 
ATOM   4525 C  CA  . SER B 1 248 ? -5.774  32.544 92.958  1.00 20.15  ? 248  SER B CA  1 
ATOM   4526 C  C   . SER B 1 248 ? -4.588  33.024 92.219  1.00 21.93  ? 248  SER B C   1 
ATOM   4527 O  O   . SER B 1 248 ? -3.600  33.370 92.844  1.00 21.30  ? 248  SER B O   1 
ATOM   4528 C  CB  . SER B 1 248 ? -6.074  31.022 92.869  1.00 20.59  ? 248  SER B CB  1 
ATOM   4529 O  OG  . SER B 1 248 ? -5.111  30.296 93.643  1.00 19.75  ? 248  SER B OG  1 
ATOM   4530 N  N   . GLY B 1 249 ? -4.690  33.235 90.914  1.00 23.60  ? 249  GLY B N   1 
ATOM   4531 C  CA  . GLY B 1 249 ? -3.763  34.140 90.233  1.00 22.65  ? 249  GLY B CA  1 
ATOM   4532 C  C   . GLY B 1 249 ? -3.457  33.736 88.781  1.00 23.58  ? 249  GLY B C   1 
ATOM   4533 O  O   . GLY B 1 249 ? -3.749  32.596 88.372  1.00 19.99  ? 249  GLY B O   1 
ATOM   4534 N  N   . LEU B 1 250 ? -2.939  34.687 88.016  1.00 22.42  ? 250  LEU B N   1 
ATOM   4535 C  CA  . LEU B 1 250 ? -2.449  34.469 86.658  1.00 21.98  ? 250  LEU B CA  1 
ATOM   4536 C  C   . LEU B 1 250 ? -0.924  34.428 86.705  1.00 22.03  ? 250  LEU B C   1 
ATOM   4537 O  O   . LEU B 1 250 ? -0.287  34.985 87.622  1.00 19.21  ? 250  LEU B O   1 
ATOM   4538 C  CB  . LEU B 1 250 ? -2.863  35.627 85.733  1.00 22.56  ? 250  LEU B CB  1 
ATOM   4539 C  CG  . LEU B 1 250 ? -4.346  35.733 85.451  1.00 23.64  ? 250  LEU B CG  1 
ATOM   4540 C  CD1 . LEU B 1 250 ? -4.552  36.961 84.601  1.00 27.36  ? 250  LEU B CD1 1 
ATOM   4541 C  CD2 . LEU B 1 250 ? -4.976  34.541 84.766  1.00 24.09  ? 250  LEU B CD2 1 
ATOM   4542 N  N   . ALA B 1 251 ? -0.343  33.777 85.691  1.00 17.45  ? 251  ALA B N   1 
ATOM   4543 C  CA  . ALA B 1 251 ? 1.054   33.646 85.609  1.00 17.50  ? 251  ALA B CA  1 
ATOM   4544 C  C   . ALA B 1 251 ? 1.590   33.578 84.210  1.00 17.61  ? 251  ALA B C   1 
ATOM   4545 O  O   . ALA B 1 251 ? 1.287   34.471 83.407  1.00 18.25  ? 251  ALA B O   1 
ATOM   4546 C  CB  . ALA B 1 251 ? 1.496   32.540 86.518  1.00 17.95  ? 251  ALA B CB  1 
ATOM   4547 N  N   . ALA B 1 252 ? 2.412   32.596 83.876  1.00 18.21  ? 252  ALA B N   1 
ATOM   4548 C  CA  . ALA B 1 252 ? 3.098   32.608 82.588  1.00 16.57  ? 252  ALA B CA  1 
ATOM   4549 C  C   . ALA B 1 252 ? 2.156   32.313 81.427  1.00 19.78  ? 252  ALA B C   1 
ATOM   4550 O  O   . ALA B 1 252 ? 2.342   32.921 80.363  1.00 19.48  ? 252  ALA B O   1 
ATOM   4551 C  CB  . ALA B 1 252 ? 4.270   31.660 82.549  1.00 17.37  ? 252  ALA B CB  1 
ATOM   4552 N  N   . ALA B 1 253 ? 1.230   31.362 81.567  1.00 18.85  ? 253  ALA B N   1 
ATOM   4553 C  CA  . ALA B 1 253 ? 0.352   31.058 80.407  1.00 20.97  ? 253  ALA B CA  1 
ATOM   4554 C  C   . ALA B 1 253 ? -0.377  32.277 79.853  1.00 19.76  ? 253  ALA B C   1 
ATOM   4555 O  O   . ALA B 1 253 ? -0.433  32.435 78.632  1.00 18.58  ? 253  ALA B O   1 
ATOM   4556 C  CB  . ALA B 1 253 ? -0.627  29.976 80.711  1.00 19.25  ? 253  ALA B CB  1 
ATOM   4557 N  N   . HIS B 1 254 ? -1.039  33.066 80.687  1.00 17.26  ? 254  HIS B N   1 
ATOM   4558 C  CA  . HIS B 1 254 ? -1.654  34.298 80.175  1.00 17.19  ? 254  HIS B CA  1 
ATOM   4559 C  C   . HIS B 1 254 ? -0.700  35.369 79.671  1.00 19.35  ? 254  HIS B C   1 
ATOM   4560 O  O   . HIS B 1 254 ? -1.040  36.100 78.680  1.00 17.88  ? 254  HIS B O   1 
ATOM   4561 C  CB  . HIS B 1 254 ? -2.659  34.879 81.130  1.00 15.43  ? 254  HIS B CB  1 
ATOM   4562 C  CG  . HIS B 1 254 ? -3.986  34.232 81.000  1.00 16.92  ? 254  HIS B CG  1 
ATOM   4563 N  ND1 . HIS B 1 254 ? -4.235  32.950 81.447  1.00 15.93  ? 254  HIS B ND1 1 
ATOM   4564 C  CD2 . HIS B 1 254 ? -5.103  34.629 80.366  1.00 17.22  ? 254  HIS B CD2 1 
ATOM   4565 C  CE1 . HIS B 1 254 ? -5.480  32.626 81.174  1.00 16.40  ? 254  HIS B CE1 1 
ATOM   4566 N  NE2 . HIS B 1 254 ? -6.037  33.637 80.519  1.00 17.71  ? 254  HIS B NE2 1 
ATOM   4567 N  N   . ALA B 1 255 ? 0.468   35.479 80.277  1.00 17.19  ? 255  ALA B N   1 
ATOM   4568 C  CA  . ALA B 1 255 ? 1.419   36.416 79.810  1.00 18.87  ? 255  ALA B CA  1 
ATOM   4569 C  C   . ALA B 1 255 ? 1.920   36.006 78.409  1.00 21.89  ? 255  ALA B C   1 
ATOM   4570 O  O   . ALA B 1 255 ? 2.104   36.869 77.571  1.00 19.49  ? 255  ALA B O   1 
ATOM   4571 C  CB  . ALA B 1 255 ? 2.556   36.567 80.747  1.00 18.65  ? 255  ALA B CB  1 
ATOM   4572 N  N   . ILE B 1 256 ? 2.082   34.708 78.166  1.00 20.06  ? 256  ILE B N   1 
ATOM   4573 C  CA  . ILE B 1 256 ? 2.477   34.225 76.870  1.00 20.46  ? 256  ILE B CA  1 
ATOM   4574 C  C   . ILE B 1 256 ? 1.349   34.446 75.828  1.00 21.63  ? 256  ILE B C   1 
ATOM   4575 O  O   . ILE B 1 256 ? 1.653   34.849 74.699  1.00 19.32  ? 256  ILE B O   1 
ATOM   4576 C  CB  . ILE B 1 256 ? 3.034   32.814 76.987  1.00 19.27  ? 256  ILE B CB  1 
ATOM   4577 C  CG1 . ILE B 1 256 ? 4.343   32.916 77.754  1.00 18.59  ? 256  ILE B CG1 1 
ATOM   4578 C  CG2 . ILE B 1 256 ? 3.309   32.163 75.629  1.00 20.88  ? 256  ILE B CG2 1 
ATOM   4579 C  CD1 . ILE B 1 256 ? 4.934   31.588 78.138  1.00 17.55  ? 256  ILE B CD1 1 
ATOM   4580 N  N   . HIS B 1 257 ? 0.105   34.138 76.174  1.00 19.61  ? 257  HIS B N   1 
ATOM   4581 C  CA  . HIS B 1 257 ? -1.017  34.512 75.338  1.00 21.79  ? 257  HIS B CA  1 
ATOM   4582 C  C   . HIS B 1 257 ? -0.878  35.986 74.907  1.00 24.63  ? 257  HIS B C   1 
ATOM   4583 O  O   . HIS B 1 257 ? -0.937  36.266 73.699  1.00 21.00  ? 257  HIS B O   1 
ATOM   4584 C  CB  . HIS B 1 257 ? -2.332  34.323 76.025  1.00 21.31  ? 257  HIS B CB  1 
ATOM   4585 C  CG  . HIS B 1 257 ? -3.435  35.103 75.420  1.00 19.92  ? 257  HIS B CG  1 
ATOM   4586 N  ND1 . HIS B 1 257 ? -3.700  36.400 75.759  1.00 21.26  ? 257  HIS B ND1 1 
ATOM   4587 C  CD2 . HIS B 1 257 ? -4.351  34.765 74.479  1.00 20.70  ? 257  HIS B CD2 1 
ATOM   4588 C  CE1 . HIS B 1 257 ? -4.735  36.841 75.062  1.00 22.72  ? 257  HIS B CE1 1 
ATOM   4589 N  NE2 . HIS B 1 257 ? -5.147  35.858 74.274  1.00 22.34  ? 257  HIS B NE2 1 
ATOM   4590 N  N   . ASN B 1 258 ? -0.636  36.891 75.857  1.00 20.66  ? 258  ASN B N   1 
ATOM   4591 C  CA  . ASN B 1 258 ? -0.567  38.344 75.557  1.00 24.60  ? 258  ASN B CA  1 
ATOM   4592 C  C   . ASN B 1 258 ? 0.589   38.646 74.622  1.00 25.20  ? 258  ASN B C   1 
ATOM   4593 O  O   . ASN B 1 258 ? 0.468   39.501 73.769  1.00 26.26  ? 258  ASN B O   1 
ATOM   4594 C  CB  . ASN B 1 258 ? -0.461  39.191 76.830  1.00 22.79  ? 258  ASN B CB  1 
ATOM   4595 C  CG  . ASN B 1 258 ? -1.691  39.120 77.655  1.00 22.74  ? 258  ASN B CG  1 
ATOM   4596 O  OD1 . ASN B 1 258 ? -2.718  38.576 77.243  1.00 23.39  ? 258  ASN B OD1 1 
ATOM   4597 N  ND2 . ASN B 1 258 ? -1.606  39.641 78.849  1.00 26.06  ? 258  ASN B ND2 1 
ATOM   4598 N  N   . GLY B 1 259 ? 1.701   37.936 74.806  1.00 23.06  ? 259  GLY B N   1 
ATOM   4599 C  CA  . GLY B 1 259 ? 2.814   38.028 73.923  1.00 24.14  ? 259  GLY B CA  1 
ATOM   4600 C  C   . GLY B 1 259 ? 2.486   37.676 72.491  1.00 24.98  ? 259  GLY B C   1 
ATOM   4601 O  O   . GLY B 1 259 ? 2.950   38.389 71.558  1.00 24.50  ? 259  GLY B O   1 
ATOM   4602 N  N   . PHE B 1 260 ? 1.778   36.554 72.324  1.00 22.52  ? 260  PHE B N   1 
ATOM   4603 C  CA  . PHE B 1 260 ? 1.310   36.077 71.003  1.00 27.51  ? 260  PHE B CA  1 
ATOM   4604 C  C   . PHE B 1 260 ? 0.391   37.087 70.247  1.00 27.26  ? 260  PHE B C   1 
ATOM   4605 O  O   . PHE B 1 260 ? 0.376   37.121 69.010  1.00 27.79  ? 260  PHE B O   1 
ATOM   4606 C  CB  . PHE B 1 260 ? 0.650   34.685 71.073  1.00 23.03  ? 260  PHE B CB  1 
ATOM   4607 C  CG  . PHE B 1 260 ? 1.629   33.555 70.994  1.00 27.43  ? 260  PHE B CG  1 
ATOM   4608 C  CD1 . PHE B 1 260 ? 2.232   33.231 69.786  1.00 28.76  ? 260  PHE B CD1 1 
ATOM   4609 C  CD2 . PHE B 1 260 ? 1.944   32.792 72.111  1.00 27.39  ? 260  PHE B CD2 1 
ATOM   4610 C  CE1 . PHE B 1 260 ? 3.131   32.187 69.702  1.00 30.21  ? 260  PHE B CE1 1 
ATOM   4611 C  CE2 . PHE B 1 260 ? 2.848   31.753 72.030  1.00 30.31  ? 260  PHE B CE2 1 
ATOM   4612 C  CZ  . PHE B 1 260 ? 3.436   31.435 70.826  1.00 30.92  ? 260  PHE B CZ  1 
ATOM   4613 N  N   . THR B 1 261 ? -0.292  37.944 70.972  1.00 26.75  ? 261  THR B N   1 
ATOM   4614 C  CA  . THR B 1 261 ? -1.092  38.984 70.334  1.00 27.88  ? 261  THR B CA  1 
ATOM   4615 C  C   . THR B 1 261 ? -0.260  40.006 69.530  1.00 31.78  ? 261  THR B C   1 
ATOM   4616 O  O   . THR B 1 261 ? -0.845  40.779 68.773  1.00 28.97  ? 261  THR B O   1 
ATOM   4617 C  CB  . THR B 1 261 ? -2.015  39.739 71.333  1.00 29.19  ? 261  THR B CB  1 
ATOM   4618 O  OG1 . THR B 1 261 ? -1.229  40.613 72.169  1.00 27.43  ? 261  THR B OG1 1 
ATOM   4619 C  CG2 . THR B 1 261 ? -2.904  38.747 72.095  1.00 29.60  ? 261  THR B CG2 1 
ATOM   4620 N  N   . VAL B 1 262 ? 1.074   40.035 69.699  1.00 29.16  ? 262  VAL B N   1 
ATOM   4621 C  CA  . VAL B 1 262 ? 1.905   40.902 68.877  1.00 33.41  ? 262  VAL B CA  1 
ATOM   4622 C  C   . VAL B 1 262 ? 2.229   40.311 67.499  1.00 33.67  ? 262  VAL B C   1 
ATOM   4623 O  O   . VAL B 1 262 ? 2.857   40.975 66.707  1.00 34.34  ? 262  VAL B O   1 
ATOM   4624 C  CB  . VAL B 1 262 ? 3.220   41.377 69.558  1.00 29.73  ? 262  VAL B CB  1 
ATOM   4625 C  CG1 . VAL B 1 262 ? 2.981   41.696 71.023  1.00 34.41  ? 262  VAL B CG1 1 
ATOM   4626 C  CG2 . VAL B 1 262 ? 4.339   40.383 69.388  1.00 31.06  ? 262  VAL B CG2 1 
ATOM   4627 N  N   . LEU B 1 263 ? 1.844   39.076 67.236  1.00 30.29  ? 263  LEU B N   1 
ATOM   4628 C  CA  . LEU B 1 263 ? 2.030   38.473 65.914  1.00 35.53  ? 263  LEU B CA  1 
ATOM   4629 C  C   . LEU B 1 263 ? 0.702   38.474 65.143  1.00 39.87  ? 263  LEU B C   1 
ATOM   4630 O  O   . LEU B 1 263 ? -0.316  38.020 65.649  1.00 41.16  ? 263  LEU B O   1 
ATOM   4631 C  CB  . LEU B 1 263 ? 2.477   37.031 66.063  1.00 33.80  ? 263  LEU B CB  1 
ATOM   4632 C  CG  . LEU B 1 263 ? 3.802   36.771 66.794  1.00 30.60  ? 263  LEU B CG  1 
ATOM   4633 C  CD1 . LEU B 1 263 ? 4.130   35.316 66.644  1.00 31.81  ? 263  LEU B CD1 1 
ATOM   4634 C  CD2 . LEU B 1 263 ? 4.930   37.621 66.252  1.00 33.79  ? 263  LEU B CD2 1 
ATOM   4635 N  N   . GLU B 1 264 ? 0.707   38.946 63.903  1.00 43.65  ? 264  GLU B N   1 
ATOM   4636 C  CA  . GLU B 1 264 ? -0.508  38.920 63.081  1.00 41.69  ? 264  GLU B CA  1 
ATOM   4637 C  C   . GLU B 1 264 ? -0.992  37.508 62.744  1.00 36.00  ? 264  GLU B C   1 
ATOM   4638 O  O   . GLU B 1 264 ? -2.219  37.266 62.621  1.00 33.83  ? 264  GLU B O   1 
ATOM   4639 C  CB  . GLU B 1 264 ? -0.283  39.691 61.784  1.00 50.98  ? 264  GLU B CB  1 
ATOM   4640 C  CG  . GLU B 1 264 ? -0.308  41.197 61.994  1.00 63.91  ? 264  GLU B CG  1 
ATOM   4641 C  CD  . GLU B 1 264 ? 0.813   41.906 61.264  1.00 77.66  ? 264  GLU B CD  1 
ATOM   4642 O  OE1 . GLU B 1 264 ? 1.922   41.319 61.165  1.00 80.52  ? 264  GLU B OE1 1 
ATOM   4643 O  OE2 . GLU B 1 264 ? 0.580   43.048 60.800  1.00 86.11  ? 264  GLU B OE2 1 
ATOM   4644 N  N   . GLU B 1 265 ? -0.032  36.598 62.617  1.00 31.70  ? 265  GLU B N   1 
ATOM   4645 C  CA  . GLU B 1 265 ? -0.285  35.213 62.256  1.00 38.33  ? 265  GLU B CA  1 
ATOM   4646 C  C   . GLU B 1 265 ? -1.300  34.457 63.141  1.00 37.79  ? 265  GLU B C   1 
ATOM   4647 O  O   . GLU B 1 265 ? -1.921  33.528 62.644  1.00 37.80  ? 265  GLU B O   1 
ATOM   4648 C  CB  . GLU B 1 265 ? 1.000   34.407 62.326  1.00 43.09  ? 265  GLU B CB  1 
ATOM   4649 C  CG  . GLU B 1 265 ? 2.069   34.795 61.350  1.00 48.62  ? 265  GLU B CG  1 
ATOM   4650 C  CD  . GLU B 1 265 ? 3.061   35.786 61.927  1.00 50.44  ? 265  GLU B CD  1 
ATOM   4651 O  OE1 . GLU B 1 265 ? 2.679   36.818 62.517  1.00 45.23  ? 265  GLU B OE1 1 
ATOM   4652 O  OE2 . GLU B 1 265 ? 4.254   35.515 61.776  1.00 68.53  ? 265  GLU B OE2 1 
ATOM   4653 N  N   . CYS B 1 266 ? -1.433  34.822 64.426  1.00 33.16  ? 266  CYS B N   1 
ATOM   4654 C  CA  . CYS B 1 266 ? -2.350  34.118 65.409  1.00 35.31  ? 266  CYS B CA  1 
ATOM   4655 C  C   . CYS B 1 266 ? -3.682  34.780 65.717  1.00 32.32  ? 266  CYS B C   1 
ATOM   4656 O  O   . CYS B 1 266 ? -4.451  34.281 66.567  1.00 26.37  ? 266  CYS B O   1 
ATOM   4657 C  CB  . CYS B 1 266 ? -1.654  34.018 66.756  1.00 38.07  ? 266  CYS B CB  1 
ATOM   4658 S  SG  . CYS B 1 266 ? -0.038  33.373 66.532  1.00 44.76  ? 266  CYS B SG  1 
ATOM   4659 N  N   . HIS B 1 267 ? -4.011  35.867 65.012  1.00 32.18  ? 267  HIS B N   1 
ATOM   4660 C  CA  . HIS B 1 267 ? -5.208  36.617 65.359  1.00 30.21  ? 267  HIS B CA  1 
ATOM   4661 C  C   . HIS B 1 267 ? -6.473  35.842 65.013  1.00 25.73  ? 267  HIS B C   1 
ATOM   4662 O  O   . HIS B 1 267 ? -7.539  36.155 65.494  1.00 28.70  ? 267  HIS B O   1 
ATOM   4663 C  CB  . HIS B 1 267 ? -5.217  38.032 64.739  1.00 35.65  ? 267  HIS B CB  1 
ATOM   4664 C  CG  . HIS B 1 267 ? -4.322  39.010 65.446  1.00 49.29  ? 267  HIS B CG  1 
ATOM   4665 N  ND1 . HIS B 1 267 ? -3.703  40.062 64.803  1.00 56.53  ? 267  HIS B ND1 1 
ATOM   4666 C  CD2 . HIS B 1 267 ? -3.932  39.089 66.744  1.00 55.09  ? 267  HIS B CD2 1 
ATOM   4667 C  CE1 . HIS B 1 267 ? -2.974  40.744 65.673  1.00 56.64  ? 267  HIS B CE1 1 
ATOM   4668 N  NE2 . HIS B 1 267 ? -3.091  40.169 66.856  1.00 52.81  ? 267  HIS B NE2 1 
ATOM   4669 N  N   . HIS B 1 268 ? -6.371  34.813 64.206  1.00 23.15  ? 268  HIS B N   1 
ATOM   4670 C  CA  . HIS B 1 268 ? -7.524  34.010 63.887  1.00 23.54  ? 268  HIS B CA  1 
ATOM   4671 C  C   . HIS B 1 268 ? -7.849  32.914 64.956  1.00 26.44  ? 268  HIS B C   1 
ATOM   4672 O  O   . HIS B 1 268 ? -8.856  32.248 64.850  1.00 25.12  ? 268  HIS B O   1 
ATOM   4673 C  CB  . HIS B 1 268 ? -7.273  33.324 62.563  1.00 28.04  ? 268  HIS B CB  1 
ATOM   4674 C  CG  . HIS B 1 268 ? -6.213  32.269 62.609  1.00 26.25  ? 268  HIS B CG  1 
ATOM   4675 N  ND1 . HIS B 1 268 ? -4.873  32.553 62.695  1.00 27.94  ? 268  HIS B ND1 1 
ATOM   4676 C  CD2 . HIS B 1 268 ? -6.313  30.929 62.566  1.00 26.35  ? 268  HIS B CD2 1 
ATOM   4677 C  CE1 . HIS B 1 268 ? -4.181  31.428 62.698  1.00 29.76  ? 268  HIS B CE1 1 
ATOM   4678 N  NE2 . HIS B 1 268 ? -5.035  30.424 62.632  1.00 30.07  ? 268  HIS B NE2 1 
ATOM   4679 N  N   . LEU B 1 269 ? -6.982  32.702 65.946  1.00 26.63  ? 269  LEU B N   1 
ATOM   4680 C  CA  . LEU B 1 269 ? -7.309  31.723 67.024  1.00 22.52  ? 269  LEU B CA  1 
ATOM   4681 C  C   . LEU B 1 269 ? -8.109  32.379 68.126  1.00 21.90  ? 269  LEU B C   1 
ATOM   4682 O  O   . LEU B 1 269 ? -7.923  33.536 68.393  1.00 24.03  ? 269  LEU B O   1 
ATOM   4683 C  CB  . LEU B 1 269 ? -6.006  31.155 67.598  1.00 24.99  ? 269  LEU B CB  1 
ATOM   4684 C  CG  . LEU B 1 269 ? -5.101  30.405 66.627  1.00 30.84  ? 269  LEU B CG  1 
ATOM   4685 C  CD1 . LEU B 1 269 ? -3.766  30.092 67.300  1.00 36.54  ? 269  LEU B CD1 1 
ATOM   4686 C  CD2 . LEU B 1 269 ? -5.768  29.129 66.125  1.00 31.95  ? 269  LEU B CD2 1 
ATOM   4687 N  N   . TYR B 1 270 ? -8.981  31.626 68.785  1.00 19.12  ? 270  TYR B N   1 
ATOM   4688 C  CA  . TYR B 1 270 ? -9.663  32.099 70.008  1.00 21.85  ? 270  TYR B CA  1 
ATOM   4689 C  C   . TYR B 1 270 ? -8.674  32.258 71.181  1.00 21.36  ? 270  TYR B C   1 
ATOM   4690 O  O   . TYR B 1 270 ? -7.617  31.584 71.244  1.00 20.55  ? 270  TYR B O   1 
ATOM   4691 C  CB  . TYR B 1 270 ? -10.753 31.120 70.374  1.00 23.01  ? 270  TYR B CB  1 
ATOM   4692 C  CG  . TYR B 1 270 ? -11.907 31.121 69.416  1.00 25.09  ? 270  TYR B CG  1 
ATOM   4693 C  CD1 . TYR B 1 270 ? -12.683 32.284 69.251  1.00 34.60  ? 270  TYR B CD1 1 
ATOM   4694 C  CD2 . TYR B 1 270 ? -12.237 30.007 68.685  1.00 32.07  ? 270  TYR B CD2 1 
ATOM   4695 C  CE1 . TYR B 1 270 ? -13.758 32.319 68.369  1.00 37.61  ? 270  TYR B CE1 1 
ATOM   4696 C  CE2 . TYR B 1 270 ? -13.297 30.033 67.761  1.00 30.27  ? 270  TYR B CE2 1 
ATOM   4697 C  CZ  . TYR B 1 270 ? -14.049 31.196 67.632  1.00 36.98  ? 270  TYR B CZ  1 
ATOM   4698 O  OH  . TYR B 1 270 ? -15.124 31.236 66.795  1.00 36.63  ? 270  TYR B OH  1 
ATOM   4699 N  N   . HIS B 1 271 ? -9.002  33.178 72.066  1.00 19.39  ? 271  HIS B N   1 
ATOM   4700 C  CA  . HIS B 1 271 ? -8.247  33.407 73.325  1.00 19.99  ? 271  HIS B CA  1 
ATOM   4701 C  C   . HIS B 1 271 ? -7.797  32.050 73.967  1.00 17.33  ? 271  HIS B C   1 
ATOM   4702 O  O   . HIS B 1 271 ? -6.606  31.809 74.201  1.00 17.40  ? 271  HIS B O   1 
ATOM   4703 C  CB  . HIS B 1 271 ? -9.165  34.182 74.263  1.00 21.54  ? 271  HIS B CB  1 
ATOM   4704 C  CG  . HIS B 1 271 ? -8.591  34.376 75.621  1.00 22.56  ? 271  HIS B CG  1 
ATOM   4705 N  ND1 . HIS B 1 271 ? -7.595  35.285 75.852  1.00 21.95  ? 271  HIS B ND1 1 
ATOM   4706 C  CD2 . HIS B 1 271 ? -8.836  33.764 76.815  1.00 21.16  ? 271  HIS B CD2 1 
ATOM   4707 C  CE1 . HIS B 1 271 ? -7.252  35.246 77.125  1.00 23.48  ? 271  HIS B CE1 1 
ATOM   4708 N  NE2 . HIS B 1 271 ? -7.989  34.334 77.714  1.00 21.97  ? 271  HIS B NE2 1 
ATOM   4709 N  N   . GLY B 1 272 ? -8.739  31.152 74.143  1.00 18.44  ? 272  GLY B N   1 
ATOM   4710 C  CA  . GLY B 1 272 ? -8.481  29.891 74.846  1.00 19.43  ? 272  GLY B CA  1 
ATOM   4711 C  C   . GLY B 1 272 ? -7.586  28.920 74.123  1.00 20.33  ? 272  GLY B C   1 
ATOM   4712 O  O   . GLY B 1 272 ? -6.862  28.126 74.739  1.00 18.02  ? 272  GLY B O   1 
ATOM   4713 N  N   . GLU B 1 273 ? -7.593  28.967 72.781  1.00 19.79  ? 273  GLU B N   1 
ATOM   4714 C  CA  . GLU B 1 273 ? -6.667  28.167 71.989  1.00 17.70  ? 273  GLU B CA  1 
ATOM   4715 C  C   . GLU B 1 273 ? -5.289  28.670 72.191  1.00 18.30  ? 273  GLU B C   1 
ATOM   4716 O  O   . GLU B 1 273 ? -4.352  27.876 72.388  1.00 17.94  ? 273  GLU B O   1 
ATOM   4717 C  CB  . GLU B 1 273 ? -7.043  28.145 70.469  1.00 18.21  ? 273  GLU B CB  1 
ATOM   4718 C  CG  . GLU B 1 273 ? -8.392  27.573 70.185  1.00 19.51  ? 273  GLU B CG  1 
ATOM   4719 C  CD  . GLU B 1 273 ? -8.949  27.874 68.762  1.00 23.84  ? 273  GLU B CD  1 
ATOM   4720 O  OE1 . GLU B 1 273 ? -8.654  28.925 68.127  1.00 23.31  ? 273  GLU B OE1 1 
ATOM   4721 O  OE2 . GLU B 1 273 ? -9.780  27.075 68.349  1.00 25.54  ? 273  GLU B OE2 1 
ATOM   4722 N  N   . LYS B 1 274 ? -5.098  29.985 72.247  1.00 17.85  ? 274  LYS B N   1 
ATOM   4723 C  CA  . LYS B 1 274 ? -3.751  30.431 72.493  1.00 19.39  ? 274  LYS B CA  1 
ATOM   4724 C  C   . LYS B 1 274 ? -3.255  30.220 73.953  1.00 19.45  ? 274  LYS B C   1 
ATOM   4725 O  O   . LYS B 1 274 ? -2.088  29.996 74.177  1.00 18.31  ? 274  LYS B O   1 
ATOM   4726 C  CB  . LYS B 1 274 ? -3.569  31.913 72.139  1.00 24.01  ? 274  LYS B CB  1 
ATOM   4727 C  CG  . LYS B 1 274 ? -3.433  32.162 70.619  1.00 28.59  ? 274  LYS B CG  1 
ATOM   4728 C  CD  . LYS B 1 274 ? -3.662  33.649 70.298  1.00 30.39  ? 274  LYS B CD  1 
ATOM   4729 C  CE  . LYS B 1 274 ? -5.001  34.098 70.777  1.00 33.91  ? 274  LYS B CE  1 
ATOM   4730 N  NZ  . LYS B 1 274 ? -5.836  34.830 69.778  1.00 36.29  ? 274  LYS B NZ  1 
ATOM   4731 N  N   . VAL B 1 275 ? -4.130  30.428 74.916  1.00 19.46  ? 275  VAL B N   1 
ATOM   4732 C  CA  . VAL B 1 275 ? -3.814  30.118 76.339  1.00 19.28  ? 275  VAL B CA  1 
ATOM   4733 C  C   . VAL B 1 275 ? -3.398  28.632 76.497  1.00 18.76  ? 275  VAL B C   1 
ATOM   4734 O  O   . VAL B 1 275 ? -2.464  28.283 77.268  1.00 20.00  ? 275  VAL B O   1 
ATOM   4735 C  CB  . VAL B 1 275 ? -5.023  30.491 77.208  1.00 17.93  ? 275  VAL B CB  1 
ATOM   4736 C  CG1 . VAL B 1 275 ? -4.909  29.878 78.643  1.00 19.21  ? 275  VAL B CG1 1 
ATOM   4737 C  CG2 . VAL B 1 275 ? -5.203  32.010 77.255  1.00 17.00  ? 275  VAL B CG2 1 
ATOM   4738 N  N   . ALA B 1 276 ? -4.034  27.728 75.762  1.00 18.70  ? 276  ALA B N   1 
ATOM   4739 C  CA  . ALA B 1 276 ? -3.653  26.329 75.840  1.00 18.77  ? 276  ALA B CA  1 
ATOM   4740 C  C   . ALA B 1 276 ? -2.186  26.109 75.480  1.00 19.87  ? 276  ALA B C   1 
ATOM   4741 O  O   . ALA B 1 276 ? -1.427  25.412 76.206  1.00 16.56  ? 276  ALA B O   1 
ATOM   4742 C  CB  . ALA B 1 276 ? -4.616  25.444 75.057  1.00 21.18  ? 276  ALA B CB  1 
ATOM   4743 N  N   . PHE B 1 277 ? -1.708  26.740 74.395  1.00 17.65  ? 277  PHE B N   1 
ATOM   4744 C  CA  . PHE B 1 277 ? -0.314  26.562 74.017  1.00 17.38  ? 277  PHE B CA  1 
ATOM   4745 C  C   . PHE B 1 277 ? 0.574   27.310 75.078  1.00 16.81  ? 277  PHE B C   1 
ATOM   4746 O  O   . PHE B 1 277 ? 1.693   26.894 75.388  1.00 17.53  ? 277  PHE B O   1 
ATOM   4747 C  CB  . PHE B 1 277 ? -0.054  27.106 72.600  1.00 17.25  ? 277  PHE B CB  1 
ATOM   4748 C  CG  . PHE B 1 277 ? 1.334   26.858 72.106  1.00 19.17  ? 277  PHE B CG  1 
ATOM   4749 C  CD1 . PHE B 1 277 ? 1.695   25.651 71.613  1.00 20.24  ? 277  PHE B CD1 1 
ATOM   4750 C  CD2 . PHE B 1 277 ? 2.294   27.802 72.221  1.00 20.31  ? 277  PHE B CD2 1 
ATOM   4751 C  CE1 . PHE B 1 277 ? 2.995   25.391 71.240  1.00 19.52  ? 277  PHE B CE1 1 
ATOM   4752 C  CE2 . PHE B 1 277 ? 3.599   27.562 71.800  1.00 20.85  ? 277  PHE B CE2 1 
ATOM   4753 C  CZ  . PHE B 1 277 ? 3.945   26.353 71.348  1.00 20.52  ? 277  PHE B CZ  1 
ATOM   4754 N  N   . GLY B 1 278 ? 0.123   28.480 75.518  1.00 16.10  ? 278  GLY B N   1 
ATOM   4755 C  CA  . GLY B 1 278 ? 0.802   29.211 76.547  1.00 17.76  ? 278  GLY B CA  1 
ATOM   4756 C  C   . GLY B 1 278 ? 0.982   28.373 77.839  1.00 16.75  ? 278  GLY B C   1 
ATOM   4757 O  O   . GLY B 1 278 ? 1.993   28.500 78.543  1.00 14.23  ? 278  GLY B O   1 
ATOM   4758 N  N   . THR B 1 279 ? 0.051   27.467 78.050  1.00 15.94  ? 279  THR B N   1 
ATOM   4759 C  CA  . THR B 1 279 ? 0.093   26.544 79.205  1.00 17.45  ? 279  THR B CA  1 
ATOM   4760 C  C   . THR B 1 279 ? 1.164   25.501 79.014  1.00 18.19  ? 279  THR B C   1 
ATOM   4761 O  O   . THR B 1 279 ? 2.009   25.206 79.905  1.00 14.10  ? 279  THR B O   1 
ATOM   4762 C  CB  . THR B 1 279 ? -1.228  25.901 79.449  1.00 15.46  ? 279  THR B CB  1 
ATOM   4763 O  OG1 . THR B 1 279 ? -2.171  26.920 79.723  1.00 16.26  ? 279  THR B OG1 1 
ATOM   4764 C  CG2 . THR B 1 279 ? -1.124  24.948 80.699  1.00 16.28  ? 279  THR B CG2 1 
ATOM   4765 N  N   . LEU B 1 280 ? 1.190   24.982 77.816  1.00 17.45  ? 280  LEU B N   1 
ATOM   4766 C  CA  . LEU B 1 280 ? 2.267   24.108 77.443  1.00 17.00  ? 280  LEU B CA  1 
ATOM   4767 C  C   . LEU B 1 280 ? 3.649   24.712 77.564  1.00 15.56  ? 280  LEU B C   1 
ATOM   4768 O  O   . LEU B 1 280 ? 4.615   24.037 78.066  1.00 13.98  ? 280  LEU B O   1 
ATOM   4769 C  CB  . LEU B 1 280 ? 1.973   23.540 76.048  1.00 22.51  ? 280  LEU B CB  1 
ATOM   4770 C  CG  . LEU B 1 280 ? 2.900   22.455 75.576  1.00 29.75  ? 280  LEU B CG  1 
ATOM   4771 C  CD1 . LEU B 1 280 ? 2.490   21.127 76.255  1.00 34.37  ? 280  LEU B CD1 1 
ATOM   4772 C  CD2 . LEU B 1 280 ? 2.834   22.314 74.030  1.00 34.99  ? 280  LEU B CD2 1 
ATOM   4773 N  N   . ALA B 1 281 ? 3.808   25.957 77.112  1.00 15.96  ? 281  ALA B N   1 
ATOM   4774 C  CA  . ALA B 1 281 ? 5.064   26.687 77.240  1.00 14.01  ? 281  ALA B CA  1 
ATOM   4775 C  C   . ALA B 1 281 ? 5.413   26.851 78.739  1.00 15.04  ? 281  ALA B C   1 
ATOM   4776 O  O   . ALA B 1 281 ? 6.599   26.739 79.148  1.00 15.89  ? 281  ALA B O   1 
ATOM   4777 C  CB  . ALA B 1 281 ? 5.002   28.071 76.573  1.00 14.33  ? 281  ALA B CB  1 
ATOM   4778 N  N   . GLN B 1 282 ? 4.411   27.157 79.532  1.00 15.32  ? 282  GLN B N   1 
ATOM   4779 C  CA  . GLN B 1 282 ? 4.641   27.297 80.986  1.00 14.79  ? 282  GLN B CA  1 
ATOM   4780 C  C   . GLN B 1 282 ? 5.151   25.985 81.622  1.00 14.85  ? 282  GLN B C   1 
ATOM   4781 O  O   . GLN B 1 282 ? 6.051   26.028 82.495  1.00 15.37  ? 282  GLN B O   1 
ATOM   4782 C  CB  . GLN B 1 282 ? 3.411   27.837 81.683  1.00 16.10  ? 282  GLN B CB  1 
ATOM   4783 C  CG  . GLN B 1 282 ? 3.616   27.898 83.197  1.00 16.99  ? 282  GLN B CG  1 
ATOM   4784 C  CD  . GLN B 1 282 ? 2.465   28.448 84.042  1.00 18.23  ? 282  GLN B CD  1 
ATOM   4785 O  OE1 . GLN B 1 282 ? 1.770   29.398 83.682  1.00 19.18  ? 282  GLN B OE1 1 
ATOM   4786 N  NE2 . GLN B 1 282 ? 2.369   27.927 85.288  1.00 17.88  ? 282  GLN B NE2 1 
ATOM   4787 N  N   . LEU B 1 283 ? 4.617   24.842 81.170  1.00 15.93  ? 283  LEU B N   1 
ATOM   4788 C  CA  . LEU B 1 283 ? 5.062   23.544 81.634  1.00 18.15  ? 283  LEU B CA  1 
ATOM   4789 C  C   . LEU B 1 283 ? 6.526   23.334 81.365  1.00 17.93  ? 283  LEU B C   1 
ATOM   4790 O  O   . LEU B 1 283 ? 7.276   22.823 82.220  1.00 13.21  ? 283  LEU B O   1 
ATOM   4791 C  CB  . LEU B 1 283 ? 4.267   22.375 81.076  1.00 16.79  ? 283  LEU B CB  1 
ATOM   4792 C  CG  . LEU B 1 283 ? 2.812   22.392 81.388  1.00 19.28  ? 283  LEU B CG  1 
ATOM   4793 C  CD1 . LEU B 1 283 ? 2.189   21.162 80.715  1.00 18.92  ? 283  LEU B CD1 1 
ATOM   4794 C  CD2 . LEU B 1 283 ? 2.492   22.456 82.855  1.00 20.82  ? 283  LEU B CD2 1 
ATOM   4795 N  N   . VAL B 1 284 ? 7.001   23.828 80.213  1.00 16.02  ? 284  VAL B N   1 
ATOM   4796 C  CA  . VAL B 1 284 ? 8.418   23.803 79.956  1.00 15.43  ? 284  VAL B CA  1 
ATOM   4797 C  C   . VAL B 1 284 ? 9.192   24.810 80.799  1.00 16.35  ? 284  VAL B C   1 
ATOM   4798 O  O   . VAL B 1 284 ? 10.261  24.496 81.332  1.00 16.73  ? 284  VAL B O   1 
ATOM   4799 C  CB  . VAL B 1 284 ? 8.734   24.131 78.453  1.00 16.16  ? 284  VAL B CB  1 
ATOM   4800 C  CG1 . VAL B 1 284 ? 10.215  24.144 78.259  1.00 18.22  ? 284  VAL B CG1 1 
ATOM   4801 C  CG2 . VAL B 1 284 ? 8.128   23.066 77.596  1.00 18.81  ? 284  VAL B CG2 1 
ATOM   4802 N  N   . LEU B 1 285 ? 8.683   26.027 80.926  1.00 16.89  ? 285  LEU B N   1 
ATOM   4803 C  CA  . LEU B 1 285 ? 9.360   27.038 81.685  1.00 18.27  ? 285  LEU B CA  1 
ATOM   4804 C  C   . LEU B 1 285 ? 9.640   26.528 83.156  1.00 19.91  ? 285  LEU B C   1 
ATOM   4805 O  O   . LEU B 1 285 ? 10.701  26.736 83.746  1.00 20.51  ? 285  LEU B O   1 
ATOM   4806 C  CB  . LEU B 1 285 ? 8.477   28.244 81.763  1.00 21.59  ? 285  LEU B CB  1 
ATOM   4807 C  CG  . LEU B 1 285 ? 9.096   29.557 82.195  1.00 20.45  ? 285  LEU B CG  1 
ATOM   4808 C  CD1 . LEU B 1 285 ? 10.186  29.975 81.221  1.00 21.31  ? 285  LEU B CD1 1 
ATOM   4809 C  CD2 . LEU B 1 285 ? 7.974   30.571 82.310  1.00 22.02  ? 285  LEU B CD2 1 
ATOM   4810 N  N   . GLN B 1 286 ? 8.627   25.887 83.728  1.00 19.30  ? 286  GLN B N   1 
ATOM   4811 C  CA  . GLN B 1 286 ? 8.724   25.431 85.152  1.00 19.22  ? 286  GLN B CA  1 
ATOM   4812 C  C   . GLN B 1 286 ? 9.263   24.028 85.291  1.00 18.65  ? 286  GLN B C   1 
ATOM   4813 O  O   . GLN B 1 286 ? 9.355   23.470 86.402  1.00 17.95  ? 286  GLN B O   1 
ATOM   4814 C  CB  . GLN B 1 286 ? 7.374   25.645 85.833  1.00 18.52  ? 286  GLN B CB  1 
ATOM   4815 C  CG  . GLN B 1 286 ? 6.265   24.695 85.465  1.00 16.89  ? 286  GLN B CG  1 
ATOM   4816 C  CD  . GLN B 1 286 ? 4.935   25.144 86.045  1.00 18.08  ? 286  GLN B CD  1 
ATOM   4817 O  OE1 . GLN B 1 286 ? 4.602   26.353 86.255  1.00 17.80  ? 286  GLN B OE1 1 
ATOM   4818 N  NE2 . GLN B 1 286 ? 4.177   24.180 86.385  1.00 23.56  ? 286  GLN B NE2 1 
ATOM   4819 N  N   . ASN B 1 287 ? 9.642   23.438 84.156  1.00 18.94  ? 287  ASN B N   1 
ATOM   4820 C  CA  . ASN B 1 287 ? 10.230  22.130 84.055  1.00 19.55  ? 287  ASN B CA  1 
ATOM   4821 C  C   . ASN B 1 287 ? 9.321   21.028 84.637  1.00 20.38  ? 287  ASN B C   1 
ATOM   4822 O  O   . ASN B 1 287 ? 9.803   20.168 85.392  1.00 23.51  ? 287  ASN B O   1 
ATOM   4823 C  CB  . ASN B 1 287 ? 11.608  22.096 84.703  1.00 20.04  ? 287  ASN B CB  1 
ATOM   4824 C  CG  . ASN B 1 287 ? 12.408  20.852 84.331  1.00 22.41  ? 287  ASN B CG  1 
ATOM   4825 O  OD1 . ASN B 1 287 ? 12.484  20.465 83.164  1.00 26.08  ? 287  ASN B OD1 1 
ATOM   4826 N  ND2 . ASN B 1 287 ? 12.997  20.223 85.328  1.00 25.04  ? 287  ASN B ND2 1 
ATOM   4827 N  N   . SER B 1 288 ? 8.038   21.075 84.334  1.00 17.73  ? 288  SER B N   1 
ATOM   4828 C  CA  . SER B 1 288 ? 7.166   19.954 84.697  1.00 21.15  ? 288  SER B CA  1 
ATOM   4829 C  C   . SER B 1 288 ? 7.704   18.611 84.198  1.00 19.50  ? 288  SER B C   1 
ATOM   4830 O  O   . SER B 1 288 ? 8.387   18.526 83.174  1.00 17.16  ? 288  SER B O   1 
ATOM   4831 C  CB  . SER B 1 288 ? 5.741   20.187 84.185  1.00 23.48  ? 288  SER B CB  1 
ATOM   4832 O  OG  . SER B 1 288 ? 5.200   21.355 84.766  1.00 28.99  ? 288  SER B OG  1 
ATOM   4833 N  N   . PRO B 1 289 ? 7.387   17.533 84.904  1.00 19.24  ? 289  PRO B N   1 
ATOM   4834 C  CA  . PRO B 1 289 ? 7.834   16.209 84.499  1.00 18.97  ? 289  PRO B CA  1 
ATOM   4835 C  C   . PRO B 1 289 ? 7.157   15.786 83.199  1.00 17.25  ? 289  PRO B C   1 
ATOM   4836 O  O   . PRO B 1 289 ? 6.090   16.290 82.888  1.00 16.48  ? 289  PRO B O   1 
ATOM   4837 C  CB  . PRO B 1 289 ? 7.331   15.303 85.632  1.00 20.46  ? 289  PRO B CB  1 
ATOM   4838 C  CG  . PRO B 1 289 ? 7.167   16.244 86.802  1.00 23.87  ? 289  PRO B CG  1 
ATOM   4839 C  CD  . PRO B 1 289 ? 6.597   17.481 86.158  1.00 22.10  ? 289  PRO B CD  1 
ATOM   4840 N  N   . MET B 1 290 ? 7.860   14.959 82.425  1.00 16.88  ? 290  MET B N   1 
ATOM   4841 C  CA  . MET B 1 290 ? 7.393   14.502 81.110  1.00 18.46  ? 290  MET B CA  1 
ATOM   4842 C  C   . MET B 1 290 ? 6.005   13.890 81.179  1.00 20.11  ? 290  MET B C   1 
ATOM   4843 O  O   . MET B 1 290 ? 5.177   14.110 80.284  1.00 19.65  ? 290  MET B O   1 
ATOM   4844 C  CB  . MET B 1 290 ? 8.421   13.530 80.467  1.00 19.64  ? 290  MET B CB  1 
ATOM   4845 C  CG  . MET B 1 290 ? 8.119   13.270 78.991  1.00 20.46  ? 290  MET B CG  1 
ATOM   4846 S  SD  . MET B 1 290 ? 8.215   14.830 78.015  1.00 21.01  ? 290  MET B SD  1 
ATOM   4847 C  CE  . MET B 1 290 ? 9.560   14.310 76.978  1.00 20.29  ? 290  MET B CE  1 
ATOM   4848 N  N   . ALA B 1 291 ? 5.704   13.143 82.262  1.00 18.73  ? 291  ALA B N   1 
ATOM   4849 C  CA  . ALA B 1 291 ? 4.402   12.531 82.408  1.00 17.37  ? 291  ALA B CA  1 
ATOM   4850 C  C   . ALA B 1 291 ? 3.296   13.615 82.397  1.00 16.63  ? 291  ALA B C   1 
ATOM   4851 O  O   . ALA B 1 291 ? 2.276   13.442 81.781  1.00 16.70  ? 291  ALA B O   1 
ATOM   4852 C  CB  . ALA B 1 291 ? 4.315   11.620 83.675  1.00 18.56  ? 291  ALA B CB  1 
ATOM   4853 N  N   . GLN B 1 292 ? 3.530   14.740 83.041  1.00 15.64  ? 292  GLN B N   1 
ATOM   4854 C  CA  . GLN B 1 292 ? 2.537   15.768 83.084  1.00 16.59  ? 292  GLN B CA  1 
ATOM   4855 C  C   . GLN B 1 292 ? 2.427   16.488 81.731  1.00 16.56  ? 292  GLN B C   1 
ATOM   4856 O  O   . GLN B 1 292 ? 1.354   16.920 81.379  1.00 15.62  ? 292  GLN B O   1 
ATOM   4857 C  CB  . GLN B 1 292 ? 2.895   16.729 84.184  1.00 19.39  ? 292  GLN B CB  1 
ATOM   4858 C  CG  . GLN B 1 292 ? 2.207   18.076 84.236  1.00 24.21  ? 292  GLN B CG  1 
ATOM   4859 C  CD  . GLN B 1 292 ? 0.841   18.022 84.792  1.00 28.53  ? 292  GLN B CD  1 
ATOM   4860 O  OE1 . GLN B 1 292 ? 0.628   18.220 86.029  1.00 30.30  ? 292  GLN B OE1 1 
ATOM   4861 N  NE2 . GLN B 1 292 ? -0.139  17.772 83.903  1.00 29.13  ? 292  GLN B NE2 1 
ATOM   4862 N  N   . ILE B 1 293 ? 3.554   16.686 81.073  1.00 15.82  ? 293  ILE B N   1 
ATOM   4863 C  CA  . ILE B 1 293 ? 3.550   17.183 79.677  1.00 15.81  ? 293  ILE B CA  1 
ATOM   4864 C  C   . ILE B 1 293 ? 2.740   16.264 78.795  1.00 15.80  ? 293  ILE B C   1 
ATOM   4865 O  O   . ILE B 1 293 ? 1.884   16.737 78.087  1.00 15.79  ? 293  ILE B O   1 
ATOM   4866 C  CB  . ILE B 1 293 ? 4.940   17.428 79.172  1.00 14.84  ? 293  ILE B CB  1 
ATOM   4867 C  CG1 . ILE B 1 293 ? 5.568   18.553 79.975  1.00 16.26  ? 293  ILE B CG1 1 
ATOM   4868 C  CG2 . ILE B 1 293 ? 4.956   17.758 77.670  1.00 14.84  ? 293  ILE B CG2 1 
ATOM   4869 C  CD1 . ILE B 1 293 ? 6.992   18.778 79.709  1.00 17.97  ? 293  ILE B CD1 1 
ATOM   4870 N  N   . GLU B 1 294 ? 2.981   14.972 78.857  1.00 15.10  ? 294  GLU B N   1 
ATOM   4871 C  CA  . GLU B 1 294 ? 2.186   13.980 78.104  1.00 19.06  ? 294  GLU B CA  1 
ATOM   4872 C  C   . GLU B 1 294 ? 0.698   14.016 78.358  1.00 17.93  ? 294  GLU B C   1 
ATOM   4873 O  O   . GLU B 1 294 ? -0.123  13.974 77.384  1.00 17.30  ? 294  GLU B O   1 
ATOM   4874 C  CB  . GLU B 1 294 ? 2.718   12.547 78.295  1.00 20.82  ? 294  GLU B CB  1 
ATOM   4875 C  CG  . GLU B 1 294 ? 4.094   12.391 77.652  1.00 27.43  ? 294  GLU B CG  1 
ATOM   4876 C  CD  . GLU B 1 294 ? 4.061   11.952 76.168  1.00 36.45  ? 294  GLU B CD  1 
ATOM   4877 O  OE1 . GLU B 1 294 ? 3.203   11.116 75.768  1.00 38.23  ? 294  GLU B OE1 1 
ATOM   4878 O  OE2 . GLU B 1 294 ? 4.953   12.399 75.385  1.00 40.28  ? 294  GLU B OE2 1 
ATOM   4879 N  N   . THR B 1 295 ? 0.311   14.218 79.624  1.00 17.06  ? 295  THR B N   1 
ATOM   4880 C  CA  . THR B 1 295 ? -1.089  14.301 79.944  1.00 16.61  ? 295  THR B CA  1 
ATOM   4881 C  C   . THR B 1 295 ? -1.715  15.547 79.261  1.00 16.90  ? 295  THR B C   1 
ATOM   4882 O  O   . THR B 1 295 ? -2.840  15.467 78.757  1.00 17.25  ? 295  THR B O   1 
ATOM   4883 C  CB  . THR B 1 295 ? -1.353  14.337 81.476  1.00 18.39  ? 295  THR B CB  1 
ATOM   4884 O  OG1 . THR B 1 295 ? -0.833  13.139 82.039  1.00 16.94  ? 295  THR B OG1 1 
ATOM   4885 C  CG2 . THR B 1 295 ? -2.805  14.510 81.807  1.00 20.22  ? 295  THR B CG2 1 
ATOM   4886 N  N   . VAL B 1 296 ? -1.029  16.659 79.280  1.00 15.59  ? 296  VAL B N   1 
ATOM   4887 C  CA  . VAL B 1 296 ? -1.614  17.899 78.783  1.00 16.53  ? 296  VAL B CA  1 
ATOM   4888 C  C   . VAL B 1 296 ? -1.623  17.833 77.209  1.00 16.77  ? 296  VAL B C   1 
ATOM   4889 O  O   . VAL B 1 296 ? -2.628  18.204 76.607  1.00 15.39  ? 296  VAL B O   1 
ATOM   4890 C  CB  . VAL B 1 296 ? -0.853  19.128 79.345  1.00 18.03  ? 296  VAL B CB  1 
ATOM   4891 C  CG1 . VAL B 1 296 ? -1.121  20.357 78.535  1.00 19.75  ? 296  VAL B CG1 1 
ATOM   4892 C  CG2 . VAL B 1 296 ? -1.295  19.334 80.818  1.00 20.40  ? 296  VAL B CG2 1 
ATOM   4893 N  N   . LEU B 1 297 ? -0.573  17.259 76.635  1.00 14.63  ? 297  LEU B N   1 
ATOM   4894 C  CA  . LEU B 1 297 ? -0.478  17.079 75.160  1.00 16.33  ? 297  LEU B CA  1 
ATOM   4895 C  C   . LEU B 1 297 ? -1.611  16.165 74.663  1.00 16.55  ? 297  LEU B C   1 
ATOM   4896 O  O   . LEU B 1 297 ? -2.308  16.492 73.701  1.00 18.45  ? 297  LEU B O   1 
ATOM   4897 C  CB  . LEU B 1 297 ? 0.826   16.565 74.741  1.00 16.08  ? 297  LEU B CB  1 
ATOM   4898 C  CG  . LEU B 1 297 ? 2.046   17.489 74.773  1.00 17.15  ? 297  LEU B CG  1 
ATOM   4899 C  CD1 . LEU B 1 297 ? 3.272   16.673 74.532  1.00 17.32  ? 297  LEU B CD1 1 
ATOM   4900 C  CD2 . LEU B 1 297 ? 1.980   18.606 73.753  1.00 20.31  ? 297  LEU B CD2 1 
ATOM   4901 N  N   . ALA B 1 298 ? -1.875  15.069 75.379  1.00 17.75  ? 298  ALA B N   1 
ATOM   4902 C  CA  . ALA B 1 298 ? -2.913  14.143 74.989  1.00 18.44  ? 298  ALA B CA  1 
ATOM   4903 C  C   . ALA B 1 298 ? -4.303  14.761 75.142  1.00 19.21  ? 298  ALA B C   1 
ATOM   4904 O  O   . ALA B 1 298 ? -5.229  14.507 74.324  1.00 15.63  ? 298  ALA B O   1 
ATOM   4905 C  CB  . ALA B 1 298 ? -2.789  12.822 75.766  1.00 20.39  ? 298  ALA B CB  1 
ATOM   4906 N  N   . PHE B 1 299 ? -4.517  15.501 76.227  1.00 18.02  ? 299  PHE B N   1 
ATOM   4907 C  CA  . PHE B 1 299 ? -5.774  16.190 76.407  1.00 18.16  ? 299  PHE B CA  1 
ATOM   4908 C  C   . PHE B 1 299 ? -6.004  17.258 75.271  1.00 18.24  ? 299  PHE B C   1 
ATOM   4909 O  O   . PHE B 1 299 ? -7.052  17.275 74.649  1.00 20.87  ? 299  PHE B O   1 
ATOM   4910 C  CB  . PHE B 1 299 ? -5.794  16.871 77.783  1.00 17.60  ? 299  PHE B CB  1 
ATOM   4911 C  CG  . PHE B 1 299 ? -6.981  17.758 77.988  1.00 17.43  ? 299  PHE B CG  1 
ATOM   4912 C  CD1 . PHE B 1 299 ? -8.208  17.209 78.227  1.00 18.00  ? 299  PHE B CD1 1 
ATOM   4913 C  CD2 . PHE B 1 299 ? -6.848  19.108 77.873  1.00 17.46  ? 299  PHE B CD2 1 
ATOM   4914 C  CE1 . PHE B 1 299 ? -9.345  18.004 78.349  1.00 19.09  ? 299  PHE B CE1 1 
ATOM   4915 C  CE2 . PHE B 1 299 ? -7.950  19.920 77.991  1.00 19.26  ? 299  PHE B CE2 1 
ATOM   4916 C  CZ  . PHE B 1 299 ? -9.187  19.375 78.244  1.00 17.84  ? 299  PHE B CZ  1 
ATOM   4917 N  N   . CYS B 1 300 ? -5.017  18.093 74.990  1.00 18.35  ? 300  CYS B N   1 
ATOM   4918 C  CA  . CYS B 1 300 ? -5.121  19.143 73.931  1.00 19.18  ? 300  CYS B CA  1 
ATOM   4919 C  C   . CYS B 1 300 ? -5.383  18.524 72.554  1.00 20.44  ? 300  CYS B C   1 
ATOM   4920 O  O   . CYS B 1 300 ? -6.301  18.913 71.818  1.00 18.87  ? 300  CYS B O   1 
ATOM   4921 C  CB  . CYS B 1 300 ? -3.862  19.982 73.881  1.00 17.86  ? 300  CYS B CB  1 
ATOM   4922 S  SG  . CYS B 1 300 ? -3.764  21.102 75.287  1.00 18.29  ? 300  CYS B SG  1 
ATOM   4923 N  N   . HIS B 1 301 ? -4.612  17.525 72.238  1.00 20.96  ? 301  HIS B N   1 
ATOM   4924 C  CA  . HIS B 1 301 ? -4.843  16.768 70.996  1.00 24.10  ? 301  HIS B CA  1 
ATOM   4925 C  C   . HIS B 1 301 ? -6.231  16.090 70.905  1.00 23.58  ? 301  HIS B C   1 
ATOM   4926 O  O   . HIS B 1 301 ? -6.901  16.189 69.878  1.00 21.27  ? 301  HIS B O   1 
ATOM   4927 C  CB  . HIS B 1 301 ? -3.738  15.769 70.718  1.00 26.36  ? 301  HIS B CB  1 
ATOM   4928 C  CG  . HIS B 1 301 ? -3.742  15.304 69.290  1.00 36.00  ? 301  HIS B CG  1 
ATOM   4929 N  ND1 . HIS B 1 301 ? -4.318  14.114 68.903  1.00 39.10  ? 301  HIS B ND1 1 
ATOM   4930 C  CD2 . HIS B 1 301 ? -3.363  15.931 68.145  1.00 34.87  ? 301  HIS B CD2 1 
ATOM   4931 C  CE1 . HIS B 1 301 ? -4.249  14.000 67.588  1.00 36.68  ? 301  HIS B CE1 1 
ATOM   4932 N  NE2 . HIS B 1 301 ? -3.669  15.086 67.109  1.00 38.44  ? 301  HIS B NE2 1 
ATOM   4933 N  N   . ARG B 1 302 ? -6.687  15.489 71.986  1.00 23.05  ? 302  ARG B N   1 
ATOM   4934 C  CA  . ARG B 1 302 ? -7.949  14.837 72.087  1.00 29.01  ? 302  ARG B CA  1 
ATOM   4935 C  C   . ARG B 1 302 ? -9.147  15.751 71.911  1.00 26.66  ? 302  ARG B C   1 
ATOM   4936 O  O   . ARG B 1 302 ? -10.216 15.266 71.600  1.00 26.47  ? 302  ARG B O   1 
ATOM   4937 C  CB  . ARG B 1 302 ? -8.168  14.222 73.492  1.00 44.92  ? 302  ARG B CB  1 
ATOM   4938 C  CG  . ARG B 1 302 ? -7.780  12.739 73.767  1.00 55.46  ? 302  ARG B CG  1 
ATOM   4939 C  CD  . ARG B 1 302 ? -8.460  12.292 75.067  1.00 56.88  ? 302  ARG B CD  1 
ATOM   4940 N  NE  . ARG B 1 302 ? -7.626  11.472 75.934  1.00 69.31  ? 302  ARG B NE  1 
ATOM   4941 C  CZ  . ARG B 1 302 ? -7.176  11.819 77.145  1.00 76.31  ? 302  ARG B CZ  1 
ATOM   4942 N  NH1 . ARG B 1 302 ? -7.466  13.004 77.707  1.00 75.88  ? 302  ARG B NH1 1 
ATOM   4943 N  NH2 . ARG B 1 302 ? -6.424  10.948 77.811  1.00 76.72  ? 302  ARG B NH2 1 
ATOM   4944 N  N   . ILE B 1 303 ? -9.027  17.011 72.271  1.00 21.55  ? 303  ILE B N   1 
ATOM   4945 C  CA  . ILE B 1 303 ? -10.153 17.889 72.138  1.00 19.39  ? 303  ILE B CA  1 
ATOM   4946 C  C   . ILE B 1 303 ? -9.920  18.874 70.976  1.00 23.09  ? 303  ILE B C   1 
ATOM   4947 O  O   . ILE B 1 303 ? -10.805 19.559 70.609  1.00 23.28  ? 303  ILE B O   1 
ATOM   4948 C  CB  . ILE B 1 303 ? -10.514 18.629 73.448  1.00 20.15  ? 303  ILE B CB  1 
ATOM   4949 C  CG1 . ILE B 1 303 ? -9.389  19.505 73.978  1.00 19.31  ? 303  ILE B CG1 1 
ATOM   4950 C  CG2 . ILE B 1 303 ? -11.248 17.717 74.460  1.00 20.34  ? 303  ILE B CG2 1 
ATOM   4951 C  CD1 . ILE B 1 303 ? -10.046 20.437 75.015  1.00 22.55  ? 303  ILE B CD1 1 
ATOM   4952 N  N   . GLY B 1 304 ? -8.735  18.955 70.390  1.00 23.73  ? 304  GLY B N   1 
ATOM   4953 C  CA  . GLY B 1 304 ? -8.535  19.927 69.312  1.00 23.22  ? 304  GLY B CA  1 
ATOM   4954 C  C   . GLY B 1 304 ? -7.930  21.266 69.674  1.00 24.03  ? 304  GLY B C   1 
ATOM   4955 O  O   . GLY B 1 304 ? -8.151  22.225 69.006  1.00 20.31  ? 304  GLY B O   1 
ATOM   4956 N  N   . LEU B 1 305 ? -7.149  21.353 70.730  1.00 20.84  ? 305  LEU B N   1 
ATOM   4957 C  CA  . LEU B 1 305 ? -6.353  22.564 71.024  1.00 19.24  ? 305  LEU B CA  1 
ATOM   4958 C  C   . LEU B 1 305 ? -4.956  22.515 70.386  1.00 18.45  ? 305  LEU B C   1 
ATOM   4959 O  O   . LEU B 1 305 ? -4.381  21.461 70.251  1.00 18.80  ? 305  LEU B O   1 
ATOM   4960 C  CB  . LEU B 1 305 ? -6.176  22.665 72.542  1.00 19.03  ? 305  LEU B CB  1 
ATOM   4961 C  CG  . LEU B 1 305 ? -7.461  22.962 73.260  1.00 18.66  ? 305  LEU B CG  1 
ATOM   4962 C  CD1 . LEU B 1 305 ? -7.317  22.740 74.788  1.00 20.24  ? 305  LEU B CD1 1 
ATOM   4963 C  CD2 . LEU B 1 305 ? -7.987  24.353 72.955  1.00 19.04  ? 305  LEU B CD2 1 
ATOM   4964 N  N   . PRO B 1 306 ? -4.365  23.656 70.067  1.00 21.92  ? 306  PRO B N   1 
ATOM   4965 C  CA  . PRO B 1 306 ? -3.085  23.607 69.385  1.00 21.48  ? 306  PRO B CA  1 
ATOM   4966 C  C   . PRO B 1 306 ? -1.901  23.210 70.307  1.00 21.55  ? 306  PRO B C   1 
ATOM   4967 O  O   . PRO B 1 306 ? -1.800  23.681 71.444  1.00 21.49  ? 306  PRO B O   1 
ATOM   4968 C  CB  . PRO B 1 306 ? -2.894  25.023 68.886  1.00 21.76  ? 306  PRO B CB  1 
ATOM   4969 C  CG  . PRO B 1 306 ? -3.639  25.855 69.807  1.00 22.55  ? 306  PRO B CG  1 
ATOM   4970 C  CD  . PRO B 1 306 ? -4.861  25.032 70.163  1.00 23.11  ? 306  PRO B CD  1 
ATOM   4971 N  N   . ILE B 1 307 ? -1.049  22.361 69.795  1.00 18.78  ? 307  ILE B N   1 
ATOM   4972 C  CA  . ILE B 1 307 ? 0.177   21.882 70.501  1.00 20.98  ? 307  ILE B CA  1 
ATOM   4973 C  C   . ILE B 1 307 ? 1.448   22.171 69.732  1.00 20.22  ? 307  ILE B C   1 
ATOM   4974 O  O   . ILE B 1 307 ? 2.570   21.789 70.176  1.00 16.45  ? 307  ILE B O   1 
ATOM   4975 C  CB  . ILE B 1 307 ? 0.053   20.389 70.863  1.00 20.24  ? 307  ILE B CB  1 
ATOM   4976 C  CG1 . ILE B 1 307 ? -0.059  19.447 69.658  1.00 22.21  ? 307  ILE B CG1 1 
ATOM   4977 C  CG2 . ILE B 1 307 ? -1.174  20.197 71.686  1.00 20.29  ? 307  ILE B CG2 1 
ATOM   4978 C  CD1 . ILE B 1 307 ? 0.049   17.983 70.015  1.00 24.35  ? 307  ILE B CD1 1 
ATOM   4979 N  N   . THR B 1 308 ? 1.324   22.910 68.595  1.00 18.39  ? 308  THR B N   1 
ATOM   4980 C  CA  . THR B 1 308 ? 2.533   23.373 67.881  1.00 19.09  ? 308  THR B CA  1 
ATOM   4981 C  C   . THR B 1 308 ? 2.345   24.771 67.320  1.00 20.55  ? 308  THR B C   1 
ATOM   4982 O  O   . THR B 1 308 ? 1.214   25.271 67.176  1.00 22.15  ? 308  THR B O   1 
ATOM   4983 C  CB  . THR B 1 308 ? 2.890   22.495 66.634  1.00 22.92  ? 308  THR B CB  1 
ATOM   4984 O  OG1 . THR B 1 308 ? 1.814   22.538 65.706  1.00 19.45  ? 308  THR B OG1 1 
ATOM   4985 C  CG2 . THR B 1 308 ? 3.145   21.028 67.005  1.00 23.61  ? 308  THR B CG2 1 
ATOM   4986 N  N   . LEU B 1 309 ? 3.459   25.385 67.010  1.00 18.81  ? 309  LEU B N   1 
ATOM   4987 C  CA  . LEU B 1 309 ? 3.471   26.715 66.464  1.00 20.57  ? 309  LEU B CA  1 
ATOM   4988 C  C   . LEU B 1 309 ? 2.783   26.661 65.058  1.00 22.34  ? 309  LEU B C   1 
ATOM   4989 O  O   . LEU B 1 309 ? 2.037   27.552 64.711  1.00 25.48  ? 309  LEU B O   1 
ATOM   4990 C  CB  . LEU B 1 309 ? 4.871   27.222 66.355  1.00 19.03  ? 309  LEU B CB  1 
ATOM   4991 C  CG  . LEU B 1 309 ? 5.462   27.741 67.681  1.00 21.21  ? 309  LEU B CG  1 
ATOM   4992 C  CD1 . LEU B 1 309 ? 6.935   28.065 67.574  1.00 22.70  ? 309  LEU B CD1 1 
ATOM   4993 C  CD2 . LEU B 1 309 ? 4.655   28.904 68.194  1.00 22.05  ? 309  LEU B CD2 1 
ATOM   4994 N  N   . ALA B 1 310 ? 3.004   25.600 64.305  1.00 24.31  ? 310  ALA B N   1 
ATOM   4995 C  CA  . ALA B 1 310 ? 2.295   25.523 62.991  1.00 27.11  ? 310  ALA B CA  1 
ATOM   4996 C  C   . ALA B 1 310 ? 0.768   25.492 63.166  1.00 28.23  ? 310  ALA B C   1 
ATOM   4997 O  O   . ALA B 1 310 ? 0.005   26.146 62.417  1.00 26.56  ? 310  ALA B O   1 
ATOM   4998 C  CB  . ALA B 1 310 ? 2.808   24.363 62.183  1.00 25.91  ? 310  ALA B CB  1 
ATOM   4999 N  N   . GLU B 1 311 ? 0.273   24.781 64.174  1.00 27.90  ? 311  GLU B N   1 
ATOM   5000 C  CA  . GLU B 1 311 ? -1.179  24.778 64.403  1.00 25.67  ? 311  GLU B CA  1 
ATOM   5001 C  C   . GLU B 1 311 ? -1.611  26.144 64.841  1.00 26.98  ? 311  GLU B C   1 
ATOM   5002 O  O   . GLU B 1 311 ? -2.762  26.473 64.790  1.00 33.65  ? 311  GLU B O   1 
ATOM   5003 C  CB  . GLU B 1 311 ? -1.608  23.737 65.436  1.00 24.47  ? 311  GLU B CB  1 
ATOM   5004 C  CG  . GLU B 1 311 ? -1.461  22.307 64.934  1.00 28.98  ? 311  GLU B CG  1 
ATOM   5005 C  CD  . GLU B 1 311 ? -1.753  21.211 65.978  1.00 30.86  ? 311  GLU B CD  1 
ATOM   5006 O  OE1 . GLU B 1 311 ? -1.600  21.451 67.166  1.00 32.93  ? 311  GLU B OE1 1 
ATOM   5007 O  OE2 . GLU B 1 311 ? -2.065  20.072 65.592  1.00 36.25  ? 311  GLU B OE2 1 
ATOM   5008 N  N   . MET B 1 312 ? -0.699  26.960 65.310  1.00 29.30  ? 312  MET B N   1 
ATOM   5009 C  CA  . MET B 1 312 ? -1.079  28.302 65.584  1.00 32.58  ? 312  MET B CA  1 
ATOM   5010 C  C   . MET B 1 312 ? -0.922  29.299 64.431  1.00 30.63  ? 312  MET B C   1 
ATOM   5011 O  O   . MET B 1 312 ? -1.263  30.466 64.590  1.00 32.41  ? 312  MET B O   1 
ATOM   5012 C  CB  . MET B 1 312 ? -0.294  28.762 66.746  1.00 31.97  ? 312  MET B CB  1 
ATOM   5013 C  CG  . MET B 1 312 ? -0.759  27.924 67.904  1.00 39.16  ? 312  MET B CG  1 
ATOM   5014 S  SD  . MET B 1 312 ? 0.127   28.602 69.214  1.00 37.21  ? 312  MET B SD  1 
ATOM   5015 C  CE  . MET B 1 312 ? -0.945  29.875 69.772  1.00 27.75  ? 312  MET B CE  1 
ATOM   5016 N  N   . GLY B 1 313 ? -0.450  28.816 63.301  1.00 31.69  ? 313  GLY B N   1 
ATOM   5017 C  CA  . GLY B 1 313 ? -0.336  29.630 62.064  1.00 29.25  ? 313  GLY B CA  1 
ATOM   5018 C  C   . GLY B 1 313 ? 1.017   30.240 61.979  1.00 29.63  ? 313  GLY B C   1 
ATOM   5019 O  O   . GLY B 1 313 ? 1.219   31.153 61.173  1.00 27.28  ? 313  GLY B O   1 
ATOM   5020 N  N   . VAL B 1 314 ? 1.967   29.786 62.816  1.00 28.35  ? 314  VAL B N   1 
ATOM   5021 C  CA  . VAL B 1 314 ? 3.305   30.352 62.809  1.00 31.37  ? 314  VAL B CA  1 
ATOM   5022 C  C   . VAL B 1 314 ? 4.218   29.342 62.144  1.00 38.43  ? 314  VAL B C   1 
ATOM   5023 O  O   . VAL B 1 314 ? 4.547   28.318 62.746  1.00 36.04  ? 314  VAL B O   1 
ATOM   5024 C  CB  . VAL B 1 314 ? 3.836   30.667 64.217  1.00 31.86  ? 314  VAL B CB  1 
ATOM   5025 C  CG1 . VAL B 1 314 ? 5.301   31.039 64.176  1.00 32.43  ? 314  VAL B CG1 1 
ATOM   5026 C  CG2 . VAL B 1 314 ? 3.062   31.775 64.908  1.00 34.06  ? 314  VAL B CG2 1 
ATOM   5027 N  N   . SER B 1 315 ? 4.660   29.638 60.917  1.00 42.23  ? 315  SER B N   1 
ATOM   5028 C  CA  . SER B 1 315 ? 5.458   28.690 60.109  1.00 44.31  ? 315  SER B CA  1 
ATOM   5029 C  C   . SER B 1 315 ? 6.822   29.212 59.782  1.00 43.93  ? 315  SER B C   1 
ATOM   5030 O  O   . SER B 1 315 ? 7.098   30.383 59.938  1.00 40.08  ? 315  SER B O   1 
ATOM   5031 C  CB  . SER B 1 315 ? 4.727   28.325 58.803  1.00 44.54  ? 315  SER B CB  1 
ATOM   5032 O  OG  . SER B 1 315 ? 3.835   27.242 59.095  1.00 46.92  ? 315  SER B OG  1 
ATOM   5033 N  N   . GLY B 1 316 ? 7.684   28.327 59.309  1.00 45.02  ? 316  GLY B N   1 
ATOM   5034 C  CA  . GLY B 1 316 ? 9.020   28.765 58.898  1.00 49.50  ? 316  GLY B CA  1 
ATOM   5035 C  C   . GLY B 1 316 ? 9.915   28.990 60.098  1.00 47.95  ? 316  GLY B C   1 
ATOM   5036 O  O   . GLY B 1 316 ? 9.694   28.433 61.151  1.00 45.07  ? 316  GLY B O   1 
ATOM   5037 N  N   . ASP B 1 317 ? 10.951  29.788 59.929  1.00 47.58  ? 317  ASP B N   1 
ATOM   5038 C  CA  . ASP B 1 317 ? 11.875  30.056 61.010  1.00 49.42  ? 317  ASP B CA  1 
ATOM   5039 C  C   . ASP B 1 317 ? 11.162  31.114 61.914  1.00 45.56  ? 317  ASP B C   1 
ATOM   5040 O  O   . ASP B 1 317 ? 10.910  32.255 61.525  1.00 43.88  ? 317  ASP B O   1 
ATOM   5041 C  CB  . ASP B 1 317 ? 13.231  30.474 60.428  1.00 55.72  ? 317  ASP B CB  1 
ATOM   5042 C  CG  . ASP B 1 317 ? 14.118  31.156 61.427  1.00 61.40  ? 317  ASP B CG  1 
ATOM   5043 O  OD1 . ASP B 1 317 ? 14.216  30.699 62.588  1.00 65.08  ? 317  ASP B OD1 1 
ATOM   5044 O  OD2 . ASP B 1 317 ? 14.711  32.174 61.035  1.00 69.11  ? 317  ASP B OD2 1 
ATOM   5045 N  N   . ALA B 1 318 ? 10.770  30.672 63.103  1.00 42.85  ? 318  ALA B N   1 
ATOM   5046 C  CA  . ALA B 1 318 ? 9.896   31.440 63.981  1.00 40.61  ? 318  ALA B CA  1 
ATOM   5047 C  C   . ALA B 1 318 ? 10.731  32.125 65.067  1.00 37.54  ? 318  ALA B C   1 
ATOM   5048 O  O   . ALA B 1 318 ? 10.215  32.776 65.976  1.00 37.30  ? 318  ALA B O   1 
ATOM   5049 C  CB  . ALA B 1 318 ? 8.882   30.482 64.598  1.00 42.44  ? 318  ALA B CB  1 
ATOM   5050 N  N   . VAL B 1 319 ? 12.031  31.986 64.967  1.00 32.90  ? 319  VAL B N   1 
ATOM   5051 C  CA  . VAL B 1 319 ? 12.912  32.290 66.092  1.00 36.66  ? 319  VAL B CA  1 
ATOM   5052 C  C   . VAL B 1 319 ? 12.791  33.757 66.500  1.00 36.33  ? 319  VAL B C   1 
ATOM   5053 O  O   . VAL B 1 319 ? 12.641  34.070 67.698  1.00 28.40  ? 319  VAL B O   1 
ATOM   5054 C  CB  . VAL B 1 319 ? 14.383  31.854 65.783  1.00 37.95  ? 319  VAL B CB  1 
ATOM   5055 C  CG1 . VAL B 1 319 ? 15.367  32.382 66.821  1.00 39.87  ? 319  VAL B CG1 1 
ATOM   5056 C  CG2 . VAL B 1 319 ? 14.482  30.347 65.745  1.00 36.35  ? 319  VAL B CG2 1 
ATOM   5057 N  N   . GLU B 1 320 ? 12.849  34.677 65.529  1.00 35.12  ? 320  GLU B N   1 
ATOM   5058 C  CA  . GLU B 1 320 ? 12.746  36.085 65.876  1.00 36.19  ? 320  GLU B CA  1 
ATOM   5059 C  C   . GLU B 1 320 ? 11.325  36.486 66.227  1.00 33.31  ? 320  GLU B C   1 
ATOM   5060 O  O   . GLU B 1 320 ? 11.130  37.363 67.064  1.00 32.67  ? 320  GLU B O   1 
ATOM   5061 C  CB  . GLU B 1 320 ? 13.227  37.004 64.756  1.00 42.01  ? 320  GLU B CB  1 
ATOM   5062 C  CG  . GLU B 1 320 ? 13.090  38.525 65.077  1.00 54.55  ? 320  GLU B CG  1 
ATOM   5063 C  CD  . GLU B 1 320 ? 13.522  39.015 66.510  1.00 59.00  ? 320  GLU B CD  1 
ATOM   5064 O  OE1 . GLU B 1 320 ? 14.745  38.902 66.844  1.00 57.95  ? 320  GLU B OE1 1 
ATOM   5065 O  OE2 . GLU B 1 320 ? 12.649  39.581 67.277  1.00 46.06  ? 320  GLU B OE2 1 
ATOM   5066 N  N   . LYS B 1 321 ? 10.341  35.913 65.552  1.00 27.23  ? 321  LYS B N   1 
ATOM   5067 C  CA  . LYS B 1 321 ? 8.971   36.126 65.966  1.00 28.78  ? 321  LYS B CA  1 
ATOM   5068 C  C   . LYS B 1 321 ? 8.696   35.725 67.490  1.00 25.04  ? 321  LYS B C   1 
ATOM   5069 O  O   . LYS B 1 321 ? 8.019   36.429 68.235  1.00 23.38  ? 321  LYS B O   1 
ATOM   5070 C  CB  . LYS B 1 321 ? 8.087   35.311 65.083  1.00 29.51  ? 321  LYS B CB  1 
ATOM   5071 C  CG  . LYS B 1 321 ? 7.783   36.064 63.778  1.00 37.29  ? 321  LYS B CG  1 
ATOM   5072 C  CD  . LYS B 1 321 ? 7.045   35.178 62.794  1.00 37.67  ? 321  LYS B CD  1 
ATOM   5073 C  CE  . LYS B 1 321 ? 6.900   35.905 61.457  1.00 41.21  ? 321  LYS B CE  1 
ATOM   5074 N  NZ  . LYS B 1 321 ? 6.511   34.891 60.441  1.00 41.38  ? 321  LYS B NZ  1 
ATOM   5075 N  N   . ILE B 1 322 ? 9.213   34.578 67.855  1.00 23.47  ? 322  ILE B N   1 
ATOM   5076 C  CA  . ILE B 1 322 ? 9.020   34.094 69.219  1.00 24.74  ? 322  ILE B CA  1 
ATOM   5077 C  C   . ILE B 1 322 ? 9.874   34.953 70.177  1.00 25.15  ? 322  ILE B C   1 
ATOM   5078 O  O   . ILE B 1 322 ? 9.458   35.184 71.302  1.00 25.23  ? 322  ILE B O   1 
ATOM   5079 C  CB  . ILE B 1 322 ? 9.252   32.583 69.293  1.00 25.94  ? 322  ILE B CB  1 
ATOM   5080 C  CG1 . ILE B 1 322 ? 8.220   31.863 68.397  1.00 25.70  ? 322  ILE B CG1 1 
ATOM   5081 C  CG2 . ILE B 1 322 ? 9.123   32.073 70.746  1.00 24.53  ? 322  ILE B CG2 1 
ATOM   5082 C  CD1 . ILE B 1 322 ? 6.783   32.352 68.592  1.00 25.28  ? 322  ILE B CD1 1 
ATOM   5083 N  N   . MET B 1 323 ? 11.011  35.479 69.734  1.00 24.38  ? 323  MET B N   1 
ATOM   5084 C  CA  . MET B 1 323 ? 11.705  36.470 70.554  1.00 25.83  ? 323  MET B CA  1 
ATOM   5085 C  C   . MET B 1 323 ? 10.815  37.661 70.842  1.00 25.92  ? 323  MET B C   1 
ATOM   5086 O  O   . MET B 1 323 ? 10.751  38.087 72.007  1.00 25.26  ? 323  MET B O   1 
ATOM   5087 C  CB  . MET B 1 323 ? 13.089  36.915 70.025  1.00 28.94  ? 323  MET B CB  1 
ATOM   5088 C  CG  . MET B 1 323 ? 13.932  37.658 71.065  1.00 32.50  ? 323  MET B CG  1 
ATOM   5089 S  SD  . MET B 1 323 ? 14.366  36.729 72.633  1.00 40.34  ? 323  MET B SD  1 
ATOM   5090 C  CE  . MET B 1 323 ? 15.757  35.833 72.026  1.00 43.68  ? 323  MET B CE  1 
ATOM   5091 N  N   . ALA B 1 324 ? 10.099  38.201 69.844  1.00 24.03  ? 324  ALA B N   1 
ATOM   5092 C  CA  . ALA B 1 324 ? 9.189   39.295 70.102  1.00 22.37  ? 324  ALA B CA  1 
ATOM   5093 C  C   . ALA B 1 324 ? 8.031   38.934 71.047  1.00 22.19  ? 324  ALA B C   1 
ATOM   5094 O  O   . ALA B 1 324 ? 7.614   39.775 71.849  1.00 22.43  ? 324  ALA B O   1 
ATOM   5095 C  CB  . ALA B 1 324 ? 8.620   39.881 68.784  1.00 23.68  ? 324  ALA B CB  1 
ATOM   5096 N  N   . VAL B 1 325 ? 7.452   37.753 70.880  1.00 22.21  ? 325  VAL B N   1 
ATOM   5097 C  CA  . VAL B 1 325 ? 6.434   37.209 71.807  1.00 21.30  ? 325  VAL B CA  1 
ATOM   5098 C  C   . VAL B 1 325 ? 6.981   37.160 73.268  1.00 19.54  ? 325  VAL B C   1 
ATOM   5099 O  O   . VAL B 1 325 ? 6.316   37.589 74.212  1.00 19.94  ? 325  VAL B O   1 
ATOM   5100 C  CB  . VAL B 1 325 ? 6.004   35.806 71.365  1.00 24.86  ? 325  VAL B CB  1 
ATOM   5101 C  CG1 . VAL B 1 325 ? 5.201   35.038 72.461  1.00 22.83  ? 325  VAL B CG1 1 
ATOM   5102 C  CG2 . VAL B 1 325 ? 5.168   35.868 70.112  1.00 21.93  ? 325  VAL B CG2 1 
ATOM   5103 N  N   . ALA B 1 326 ? 8.230   36.767 73.414  1.00 21.76  ? 326  ALA B N   1 
ATOM   5104 C  CA  . ALA B 1 326 ? 8.864   36.603 74.747  1.00 22.26  ? 326  ALA B CA  1 
ATOM   5105 C  C   . ALA B 1 326 ? 9.160   37.934 75.396  1.00 26.87  ? 326  ALA B C   1 
ATOM   5106 O  O   . ALA B 1 326 ? 8.930   38.107 76.595  1.00 25.07  ? 326  ALA B O   1 
ATOM   5107 C  CB  . ALA B 1 326 ? 10.117  35.806 74.598  1.00 22.37  ? 326  ALA B CB  1 
ATOM   5108 N  N   . GLN B 1 327 ? 9.706   38.897 74.617  1.00 23.32  ? 327  GLN B N   1 
ATOM   5109 C  CA  . GLN B 1 327 ? 9.879   40.282 75.109  1.00 25.69  ? 327  GLN B CA  1 
ATOM   5110 C  C   . GLN B 1 327 ? 8.579   40.842 75.609  1.00 22.30  ? 327  GLN B C   1 
ATOM   5111 O  O   . GLN B 1 327 ? 8.528   41.354 76.729  1.00 23.42  ? 327  GLN B O   1 
ATOM   5112 C  CB  . GLN B 1 327 ? 10.487  41.201 74.013  1.00 27.89  ? 327  GLN B CB  1 
ATOM   5113 C  CG  . GLN B 1 327 ? 11.930  40.866 73.668  1.00 31.39  ? 327  GLN B CG  1 
ATOM   5114 C  CD  . GLN B 1 327 ? 12.893  41.215 74.797  1.00 39.15  ? 327  GLN B CD  1 
ATOM   5115 O  OE1 . GLN B 1 327 ? 12.595  42.044 75.687  1.00 42.06  ? 327  GLN B OE1 1 
ATOM   5116 N  NE2 . GLN B 1 327 ? 14.069  40.588 74.769  1.00 43.78  ? 327  GLN B NE2 1 
ATOM   5117 N  N   . ALA B 1 328 ? 7.511   40.706 74.829  1.00 20.18  ? 328  ALA B N   1 
ATOM   5118 C  CA  . ALA B 1 328 ? 6.198   41.195 75.236  1.00 23.07  ? 328  ALA B CA  1 
ATOM   5119 C  C   . ALA B 1 328 ? 5.597   40.449 76.451  1.00 25.29  ? 328  ALA B C   1 
ATOM   5120 O  O   . ALA B 1 328 ? 4.890   41.058 77.272  1.00 28.00  ? 328  ALA B O   1 
ATOM   5121 C  CB  . ALA B 1 328 ? 5.221   41.111 74.074  1.00 22.83  ? 328  ALA B CB  1 
ATOM   5122 N  N   . SER B 1 329 ? 5.839   39.146 76.556  1.00 25.33  ? 329  SER B N   1 
ATOM   5123 C  CA  . SER B 1 329 ? 5.263   38.407 77.685  1.00 24.51  ? 329  SER B CA  1 
ATOM   5124 C  C   . SER B 1 329 ? 5.979   38.789 78.995  1.00 23.57  ? 329  SER B C   1 
ATOM   5125 O  O   . SER B 1 329 ? 5.422   38.525 80.084  1.00 21.81  ? 329  SER B O   1 
ATOM   5126 C  CB  . SER B 1 329 ? 5.365   36.922 77.412  1.00 25.60  ? 329  SER B CB  1 
ATOM   5127 O  OG  . SER B 1 329 ? 6.679   36.598 77.739  1.00 27.41  ? 329  SER B OG  1 
ATOM   5128 N  N   . CYS B 1 330 ? 7.199   39.353 78.902  1.00 20.20  ? 330  CYS B N   1 
ATOM   5129 C  CA  . CYS B 1 330 ? 7.965   39.775 80.041  1.00 22.93  ? 330  CYS B CA  1 
ATOM   5130 C  C   . CYS B 1 330 ? 7.938   41.256 80.402  1.00 25.99  ? 330  CYS B C   1 
ATOM   5131 O  O   . CYS B 1 330 ? 8.699   41.627 81.252  1.00 25.77  ? 330  CYS B O   1 
ATOM   5132 C  CB  . CYS B 1 330 ? 9.410   39.370 79.895  1.00 21.90  ? 330  CYS B CB  1 
ATOM   5133 S  SG  . CYS B 1 330 ? 9.604   37.593 79.929  1.00 24.05  ? 330  CYS B SG  1 
ATOM   5134 N  N   . ALA B 1 331 ? 7.099   42.056 79.748  1.00 26.84  ? 331  ALA B N   1 
ATOM   5135 C  CA  . ALA B 1 331 ? 6.972   43.457 80.037  1.00 30.79  ? 331  ALA B CA  1 
ATOM   5136 C  C   . ALA B 1 331 ? 6.809   43.634 81.530  1.00 38.53  ? 331  ALA B C   1 
ATOM   5137 O  O   . ALA B 1 331 ? 6.310   42.733 82.246  1.00 34.75  ? 331  ALA B O   1 
ATOM   5138 C  CB  . ALA B 1 331 ? 5.750   44.048 79.330  1.00 30.82  ? 331  ALA B CB  1 
ATOM   5139 N  N   . ALA B 1 332 ? 7.229   44.802 82.014  1.00 38.54  ? 332  ALA B N   1 
ATOM   5140 C  CA  . ALA B 1 332 ? 6.989   45.135 83.411  1.00 41.25  ? 332  ALA B CA  1 
ATOM   5141 C  C   . ALA B 1 332 ? 5.476   45.142 83.616  1.00 35.26  ? 332  ALA B C   1 
ATOM   5142 O  O   . ALA B 1 332 ? 4.724   45.569 82.767  1.00 36.21  ? 332  ALA B O   1 
ATOM   5143 C  CB  . ALA B 1 332 ? 7.612   46.484 83.779  1.00 43.41  ? 332  ALA B CB  1 
ATOM   5144 N  N   . GLY B 1 333 ? 5.016   44.630 84.739  1.00 34.46  ? 333  GLY B N   1 
ATOM   5145 C  CA  . GLY B 1 333 ? 3.570   44.564 84.937  1.00 33.13  ? 333  GLY B CA  1 
ATOM   5146 C  C   . GLY B 1 333 ? 2.990   43.211 84.577  1.00 31.42  ? 333  GLY B C   1 
ATOM   5147 O  O   . GLY B 1 333 ? 1.947   42.847 85.101  1.00 31.17  ? 333  GLY B O   1 
ATOM   5148 N  N   . GLU B 1 334 ? 3.628   42.457 83.673  1.00 27.65  ? 334  GLU B N   1 
ATOM   5149 C  CA  . GLU B 1 334 ? 3.012   41.221 83.217  1.00 26.25  ? 334  GLU B CA  1 
ATOM   5150 C  C   . GLU B 1 334 ? 2.963   40.162 84.316  1.00 24.22  ? 334  GLU B C   1 
ATOM   5151 O  O   . GLU B 1 334 ? 3.829   40.118 85.186  1.00 24.13  ? 334  GLU B O   1 
ATOM   5152 C  CB  . GLU B 1 334 ? 3.741   40.638 82.022  1.00 25.78  ? 334  GLU B CB  1 
ATOM   5153 C  CG  . GLU B 1 334 ? 3.057   41.036 80.729  1.00 28.66  ? 334  GLU B CG  1 
ATOM   5154 C  CD  . GLU B 1 334 ? 1.673   40.375 80.538  1.00 30.99  ? 334  GLU B CD  1 
ATOM   5155 O  OE1 . GLU B 1 334 ? 1.058   39.755 81.473  1.00 28.65  ? 334  GLU B OE1 1 
ATOM   5156 O  OE2 . GLU B 1 334 ? 1.163   40.531 79.420  1.00 26.14  ? 334  GLU B OE2 1 
ATOM   5157 N  N   . THR B 1 335 ? 2.028   39.254 84.169  1.00 22.95  ? 335  THR B N   1 
ATOM   5158 C  CA  . THR B 1 335 ? 1.807   38.221 85.182  1.00 20.52  ? 335  THR B CA  1 
ATOM   5159 C  C   . THR B 1 335 ? 2.823   37.127 85.216  1.00 20.82  ? 335  THR B C   1 
ATOM   5160 O  O   . THR B 1 335 ? 2.831   36.269 86.154  1.00 21.14  ? 335  THR B O   1 
ATOM   5161 C  CB  . THR B 1 335 ? 0.432   37.626 85.016  1.00 19.56  ? 335  THR B CB  1 
ATOM   5162 O  OG1 . THR B 1 335 ? 0.286   37.037 83.710  1.00 16.92  ? 335  THR B OG1 1 
ATOM   5163 C  CG2 . THR B 1 335 ? -0.605  38.730 85.259  1.00 20.67  ? 335  THR B CG2 1 
ATOM   5164 N  N   . ILE B 1 336 ? 3.729   37.141 84.266  1.00 19.54  ? 336  ILE B N   1 
ATOM   5165 C  CA  . ILE B 1 336 ? 4.684   36.095 84.188  1.00 17.69  ? 336  ILE B CA  1 
ATOM   5166 C  C   . ILE B 1 336 ? 5.681   36.203 85.369  1.00 19.38  ? 336  ILE B C   1 
ATOM   5167 O  O   . ILE B 1 336 ? 6.334   35.253 85.711  1.00 18.26  ? 336  ILE B O   1 
ATOM   5168 C  CB  . ILE B 1 336 ? 5.447   36.100 82.861  1.00 19.81  ? 336  ILE B CB  1 
ATOM   5169 C  CG1 . ILE B 1 336 ? 6.207   34.796 82.705  1.00 20.68  ? 336  ILE B CG1 1 
ATOM   5170 C  CG2 . ILE B 1 336 ? 6.416   37.289 82.783  1.00 20.86  ? 336  ILE B CG2 1 
ATOM   5171 C  CD1 . ILE B 1 336 ? 6.405   34.502 81.223  1.00 20.55  ? 336  ILE B CD1 1 
ATOM   5172 N  N   . HIS B 1 337 ? 5.790   37.383 85.956  1.00 19.40  ? 337  HIS B N   1 
ATOM   5173 C  CA  . HIS B 1 337 ? 6.674   37.589 87.064  1.00 21.70  ? 337  HIS B CA  1 
ATOM   5174 C  C   . HIS B 1 337 ? 6.085   37.058 88.391  1.00 21.88  ? 337  HIS B C   1 
ATOM   5175 O  O   . HIS B 1 337 ? 6.737   37.141 89.415  1.00 20.87  ? 337  HIS B O   1 
ATOM   5176 C  CB  . HIS B 1 337 ? 6.975   39.079 87.179  1.00 24.03  ? 337  HIS B CB  1 
ATOM   5177 C  CG  . HIS B 1 337 ? 7.656   39.631 85.951  1.00 27.47  ? 337  HIS B CG  1 
ATOM   5178 N  ND1 . HIS B 1 337 ? 8.856   39.137 85.480  1.00 29.51  ? 337  HIS B ND1 1 
ATOM   5179 C  CD2 . HIS B 1 337 ? 7.267   40.583 85.068  1.00 28.16  ? 337  HIS B CD2 1 
ATOM   5180 C  CE1 . HIS B 1 337 ? 9.196   39.776 84.371  1.00 29.36  ? 337  HIS B CE1 1 
ATOM   5181 N  NE2 . HIS B 1 337 ? 8.251   40.663 84.103  1.00 31.04  ? 337  HIS B NE2 1 
ATOM   5182 N  N   . ASN B 1 338 ? 4.874   36.520 88.351  1.00 20.74  ? 338  ASN B N   1 
ATOM   5183 C  CA  . ASN B 1 338 ? 4.308   35.788 89.472  1.00 21.22  ? 338  ASN B CA  1 
ATOM   5184 C  C   . ASN B 1 338 ? 4.778   34.335 89.570  1.00 19.59  ? 338  ASN B C   1 
ATOM   5185 O  O   . ASN B 1 338 ? 4.393   33.655 90.492  1.00 18.99  ? 338  ASN B O   1 
ATOM   5186 C  CB  . ASN B 1 338 ? 2.800   35.797 89.370  1.00 19.12  ? 338  ASN B CB  1 
ATOM   5187 C  CG  . ASN B 1 338 ? 2.200   37.155 89.554  1.00 20.70  ? 338  ASN B CG  1 
ATOM   5188 O  OD1 . ASN B 1 338 ? 2.792   38.049 90.146  1.00 24.17  ? 338  ASN B OD1 1 
ATOM   5189 N  ND2 . ASN B 1 338 ? 1.019   37.313 89.089  1.00 21.27  ? 338  ASN B ND2 1 
ATOM   5190 N  N   . MET B 1 339 ? 5.541   33.855 88.590  1.00 21.07  ? 339  MET B N   1 
ATOM   5191 C  CA  . MET B 1 339 ? 6.178   32.578 88.683  1.00 21.74  ? 339  MET B CA  1 
ATOM   5192 C  C   . MET B 1 339 ? 7.124   32.620 89.941  1.00 22.14  ? 339  MET B C   1 
ATOM   5193 O  O   . MET B 1 339 ? 7.704   33.657 90.259  1.00 19.27  ? 339  MET B O   1 
ATOM   5194 C  CB  . MET B 1 339 ? 7.007   32.247 87.444  1.00 20.15  ? 339  MET B CB  1 
ATOM   5195 C  CG  . MET B 1 339 ? 6.180   32.043 86.140  1.00 19.42  ? 339  MET B CG  1 
ATOM   5196 S  SD  . MET B 1 339 ? 4.888   30.828 86.257  1.00 19.70  ? 339  MET B SD  1 
ATOM   5197 C  CE  . MET B 1 339 ? 5.806   29.362 86.011  1.00 19.04  ? 339  MET B CE  1 
ATOM   5198 N  N   . PRO B 1 340 ? 7.308   31.471 90.592  1.00 21.10  ? 340  PRO B N   1 
ATOM   5199 C  CA  . PRO B 1 340 ? 8.212   31.331 91.757  1.00 22.09  ? 340  PRO B CA  1 
ATOM   5200 C  C   . PRO B 1 340 ? 9.689   31.220 91.412  1.00 23.23  ? 340  PRO B C   1 
ATOM   5201 O  O   . PRO B 1 340 ? 10.438  30.570 92.093  1.00 29.67  ? 340  PRO B O   1 
ATOM   5202 C  CB  . PRO B 1 340 ? 7.717   29.996 92.381  1.00 22.41  ? 340  PRO B CB  1 
ATOM   5203 C  CG  . PRO B 1 340 ? 7.320   29.164 91.182  1.00 22.31  ? 340  PRO B CG  1 
ATOM   5204 C  CD  . PRO B 1 340 ? 6.654   30.188 90.265  1.00 21.14  ? 340  PRO B CD  1 
ATOM   5205 N  N   . PHE B 1 341 ? 10.094  31.828 90.325  1.00 24.08  ? 341  PHE B N   1 
ATOM   5206 C  CA  . PHE B 1 341 ? 11.460  31.897 89.919  1.00 20.83  ? 341  PHE B CA  1 
ATOM   5207 C  C   . PHE B 1 341 ? 11.557  33.062 88.957  1.00 20.78  ? 341  PHE B C   1 
ATOM   5208 O  O   . PHE B 1 341 ? 10.579  33.511 88.440  1.00 20.99  ? 341  PHE B O   1 
ATOM   5209 C  CB  . PHE B 1 341 ? 11.942  30.593 89.303  1.00 20.72  ? 341  PHE B CB  1 
ATOM   5210 C  CG  . PHE B 1 341 ? 11.046  30.042 88.223  1.00 21.90  ? 341  PHE B CG  1 
ATOM   5211 C  CD1 . PHE B 1 341 ? 11.109  30.531 86.948  1.00 20.77  ? 341  PHE B CD1 1 
ATOM   5212 C  CD2 . PHE B 1 341 ? 10.150  29.041 88.485  1.00 22.29  ? 341  PHE B CD2 1 
ATOM   5213 C  CE1 . PHE B 1 341 ? 10.298  30.021 85.961  1.00 19.76  ? 341  PHE B CE1 1 
ATOM   5214 C  CE2 . PHE B 1 341 ? 9.321   28.541 87.507  1.00 22.20  ? 341  PHE B CE2 1 
ATOM   5215 C  CZ  . PHE B 1 341 ? 9.391   29.042 86.244  1.00 20.90  ? 341  PHE B CZ  1 
ATOM   5216 N  N   . LYS B 1 342 ? 12.742  33.581 88.782  1.00 23.92  ? 342  LYS B N   1 
ATOM   5217 C  CA  . LYS B 1 342 ? 12.944  34.695 87.880  1.00 26.78  ? 342  LYS B CA  1 
ATOM   5218 C  C   . LYS B 1 342 ? 12.802  34.249 86.424  1.00 22.45  ? 342  LYS B C   1 
ATOM   5219 O  O   . LYS B 1 342 ? 13.254  33.215 86.043  1.00 21.49  ? 342  LYS B O   1 
ATOM   5220 C  CB  . LYS B 1 342 ? 14.313  35.300 88.117  1.00 33.18  ? 342  LYS B CB  1 
ATOM   5221 C  CG  . LYS B 1 342 ? 14.767  36.218 87.030  1.00 43.85  ? 342  LYS B CG  1 
ATOM   5222 C  CD  . LYS B 1 342 ? 16.059  36.933 87.300  1.00 53.19  ? 342  LYS B CD  1 
ATOM   5223 C  CE  . LYS B 1 342 ? 16.214  38.151 86.411  1.00 57.94  ? 342  LYS B CE  1 
ATOM   5224 N  NZ  . LYS B 1 342 ? 14.920  38.703 85.924  1.00 65.42  ? 342  LYS B NZ  1 
ATOM   5225 N  N   . VAL B 1 343 ? 12.201  35.100 85.631  1.00 23.20  ? 343  VAL B N   1 
ATOM   5226 C  CA  . VAL B 1 343 ? 11.922  34.777 84.237  1.00 22.95  ? 343  VAL B CA  1 
ATOM   5227 C  C   . VAL B 1 343 ? 12.466  35.924 83.378  1.00 25.98  ? 343  VAL B C   1 
ATOM   5228 O  O   . VAL B 1 343 ? 12.260  37.056 83.721  1.00 25.39  ? 343  VAL B O   1 
ATOM   5229 C  CB  . VAL B 1 343 ? 10.415  34.744 84.015  1.00 22.84  ? 343  VAL B CB  1 
ATOM   5230 C  CG1 . VAL B 1 343 ? 10.120  34.491 82.560  1.00 23.37  ? 343  VAL B CG1 1 
ATOM   5231 C  CG2 . VAL B 1 343 ? 9.747   33.668 84.887  1.00 25.55  ? 343  VAL B CG2 1 
ATOM   5232 N  N   . THR B 1 344 ? 13.119  35.595 82.273  1.00 25.39  ? 344  THR B N   1 
ATOM   5233 C  CA  . THR B 1 344 ? 13.642  36.576 81.337  1.00 24.71  ? 344  THR B CA  1 
ATOM   5234 C  C   . THR B 1 344 ? 13.129  36.201 79.909  1.00 22.89  ? 344  THR B C   1 
ATOM   5235 O  O   . THR B 1 344 ? 12.689  35.066 79.652  1.00 20.97  ? 344  THR B O   1 
ATOM   5236 C  CB  . THR B 1 344 ? 15.158  36.460 81.220  1.00 26.70  ? 344  THR B CB  1 
ATOM   5237 O  OG1 . THR B 1 344 ? 15.447  35.151 80.727  1.00 25.85  ? 344  THR B OG1 1 
ATOM   5238 C  CG2 . THR B 1 344 ? 15.846  36.657 82.506  1.00 27.39  ? 344  THR B CG2 1 
ATOM   5239 N  N   . PRO B 1 345 ? 13.221  37.150 78.960  1.00 23.53  ? 345  PRO B N   1 
ATOM   5240 C  CA  . PRO B 1 345 ? 12.779  36.842 77.587  1.00 21.22  ? 345  PRO B CA  1 
ATOM   5241 C  C   . PRO B 1 345 ? 13.472  35.626 77.014  1.00 18.66  ? 345  PRO B C   1 
ATOM   5242 O  O   . PRO B 1 345 ? 12.853  34.827 76.379  1.00 21.46  ? 345  PRO B O   1 
ATOM   5243 C  CB  . PRO B 1 345 ? 13.159  38.095 76.800  1.00 23.57  ? 345  PRO B CB  1 
ATOM   5244 C  CG  . PRO B 1 345 ? 13.022  39.178 77.845  1.00 26.20  ? 345  PRO B CG  1 
ATOM   5245 C  CD  . PRO B 1 345 ? 13.518  38.586 79.136  1.00 23.46  ? 345  PRO B CD  1 
ATOM   5246 N  N   . ALA B 1 346 ? 14.751  35.473 77.221  1.00 19.14  ? 346  ALA B N   1 
ATOM   5247 C  CA  . ALA B 1 346 ? 15.449  34.327 76.677  1.00 22.37  ? 346  ALA B CA  1 
ATOM   5248 C  C   . ALA B 1 346 ? 14.827  32.993 77.159  1.00 23.10  ? 346  ALA B C   1 
ATOM   5249 O  O   . ALA B 1 346 ? 14.658  32.036 76.389  1.00 20.29  ? 346  ALA B O   1 
ATOM   5250 C  CB  . ALA B 1 346 ? 16.908  34.406 77.025  1.00 23.76  ? 346  ALA B CB  1 
ATOM   5251 N  N   . GLY B 1 347 ? 14.475  32.929 78.444  1.00 22.85  ? 347  GLY B N   1 
ATOM   5252 C  CA  . GLY B 1 347 ? 13.854  31.703 79.022  1.00 19.43  ? 347  GLY B CA  1 
ATOM   5253 C  C   . GLY B 1 347 ? 12.484  31.449 78.458  1.00 19.37  ? 347  GLY B C   1 
ATOM   5254 O  O   . GLY B 1 347 ? 12.129  30.318 78.188  1.00 17.81  ? 347  GLY B O   1 
ATOM   5255 N  N   . VAL B 1 348 ? 11.741  32.506 78.166  1.00 18.64  ? 348  VAL B N   1 
ATOM   5256 C  CA  . VAL B 1 348 ? 10.434  32.333 77.608  1.00 19.00  ? 348  VAL B CA  1 
ATOM   5257 C  C   . VAL B 1 348 ? 10.549  31.861 76.169  1.00 20.12  ? 348  VAL B C   1 
ATOM   5258 O  O   . VAL B 1 348 ? 9.785   31.014 75.721  1.00 18.01  ? 348  VAL B O   1 
ATOM   5259 C  CB  . VAL B 1 348 ? 9.553   33.588 77.742  1.00 20.09  ? 348  VAL B CB  1 
ATOM   5260 C  CG1 . VAL B 1 348 ? 8.179   33.396 77.092  1.00 22.47  ? 348  VAL B CG1 1 
ATOM   5261 C  CG2 . VAL B 1 348 ? 9.369   33.919 79.216  1.00 22.54  ? 348  VAL B CG2 1 
ATOM   5262 N  N   . GLN B 1 349 ? 11.448  32.459 75.417  1.00 19.47  ? 349  GLN B N   1 
ATOM   5263 C  CA  . GLN B 1 349 ? 11.600  32.042 74.037  1.00 18.78  ? 349  GLN B CA  1 
ATOM   5264 C  C   . GLN B 1 349 ? 11.998  30.563 73.988  1.00 17.92  ? 349  GLN B C   1 
ATOM   5265 O  O   . GLN B 1 349 ? 11.468  29.774 73.212  1.00 17.44  ? 349  GLN B O   1 
ATOM   5266 C  CB  . GLN B 1 349 ? 12.668  32.940 73.336  1.00 20.33  ? 349  GLN B CB  1 
ATOM   5267 C  CG  . GLN B 1 349 ? 12.886  32.482 71.925  1.00 21.44  ? 349  GLN B CG  1 
ATOM   5268 C  CD  . GLN B 1 349 ? 14.248  32.863 71.376  1.00 26.37  ? 349  GLN B CD  1 
ATOM   5269 O  OE1 . GLN B 1 349 ? 15.261  32.754 72.048  1.00 26.57  ? 349  GLN B OE1 1 
ATOM   5270 N  NE2 . GLN B 1 349 ? 14.260  33.365 70.143  1.00 24.91  ? 349  GLN B NE2 1 
ATOM   5271 N  N   . ALA B 1 350 ? 12.905  30.160 74.882  1.00 16.93  ? 350  ALA B N   1 
ATOM   5272 C  CA  . ALA B 1 350 ? 13.312  28.781 74.976  1.00 16.15  ? 350  ALA B CA  1 
ATOM   5273 C  C   . ALA B 1 350 ? 12.163  27.845 75.337  1.00 15.88  ? 350  ALA B C   1 
ATOM   5274 O  O   . ALA B 1 350 ? 12.013  26.787 74.734  1.00 18.86  ? 350  ALA B O   1 
ATOM   5275 C  CB  . ALA B 1 350 ? 14.418  28.649 76.010  1.00 18.25  ? 350  ALA B CB  1 
ATOM   5276 N  N   . ALA B 1 351 ? 11.324  28.246 76.284  1.00 15.96  ? 351  ALA B N   1 
ATOM   5277 C  CA  . ALA B 1 351 ? 10.157  27.415 76.679  1.00 16.87  ? 351  ALA B CA  1 
ATOM   5278 C  C   . ALA B 1 351 ? 9.206   27.241 75.462  1.00 17.02  ? 351  ALA B C   1 
ATOM   5279 O  O   . ALA B 1 351 ? 8.737   26.183 75.212  1.00 15.90  ? 351  ALA B O   1 
ATOM   5280 C  CB  . ALA B 1 351 ? 9.391   28.062 77.780  1.00 16.34  ? 351  ALA B CB  1 
ATOM   5281 N  N   . ILE B 1 352 ? 8.932   28.328 74.758  1.00 17.88  ? 352  ILE B N   1 
ATOM   5282 C  CA  . ILE B 1 352 ? 7.988   28.284 73.599  1.00 17.76  ? 352  ILE B CA  1 
ATOM   5283 C  C   . ILE B 1 352 ? 8.503   27.419 72.479  1.00 16.50  ? 352  ILE B C   1 
ATOM   5284 O  O   . ILE B 1 352 ? 7.780   26.577 71.947  1.00 19.71  ? 352  ILE B O   1 
ATOM   5285 C  CB  . ILE B 1 352 ? 7.731   29.724 73.078  1.00 19.35  ? 352  ILE B CB  1 
ATOM   5286 C  CG1 . ILE B 1 352 ? 6.856   30.470 74.071  1.00 20.05  ? 352  ILE B CG1 1 
ATOM   5287 C  CG2 . ILE B 1 352 ? 7.024   29.681 71.746  1.00 21.06  ? 352  ILE B CG2 1 
ATOM   5288 C  CD1 . ILE B 1 352 ? 6.752   31.955 73.880  1.00 20.36  ? 352  ILE B CD1 1 
ATOM   5289 N  N   . LEU B 1 353 ? 9.733   27.661 72.072  1.00 17.49  ? 353  LEU B N   1 
ATOM   5290 C  CA  . LEU B 1 353 ? 10.355  26.859 71.008  1.00 18.32  ? 353  LEU B CA  1 
ATOM   5291 C  C   . LEU B 1 353 ? 10.478  25.398 71.359  1.00 19.60  ? 353  LEU B C   1 
ATOM   5292 O  O   . LEU B 1 353 ? 10.345  24.488 70.498  1.00 16.75  ? 353  LEU B O   1 
ATOM   5293 C  CB  . LEU B 1 353 ? 11.719  27.401 70.661  1.00 18.61  ? 353  LEU B CB  1 
ATOM   5294 C  CG  . LEU B 1 353 ? 11.715  28.764 69.956  1.00 20.37  ? 353  LEU B CG  1 
ATOM   5295 C  CD1 . LEU B 1 353 ? 13.151  29.094 69.697  1.00 23.12  ? 353  LEU B CD1 1 
ATOM   5296 C  CD2 . LEU B 1 353 ? 10.914  28.719 68.643  1.00 22.69  ? 353  LEU B CD2 1 
ATOM   5297 N  N   . THR B 1 354 ? 10.734  25.122 72.662  1.00 17.22  ? 354  THR B N   1 
ATOM   5298 C  CA  . THR B 1 354 ? 10.820  23.750 73.044  1.00 15.48  ? 354  THR B CA  1 
ATOM   5299 C  C   . THR B 1 354 ? 9.481   23.099 73.108  1.00 14.61  ? 354  THR B C   1 
ATOM   5300 O  O   . THR B 1 354 ? 9.360   21.901 72.804  1.00 16.58  ? 354  THR B O   1 
ATOM   5301 C  CB  . THR B 1 354 ? 11.570  23.644 74.437  1.00 16.69  ? 354  THR B CB  1 
ATOM   5302 O  OG1 . THR B 1 354 ? 12.883  24.184 74.276  1.00 15.59  ? 354  THR B OG1 1 
ATOM   5303 C  CG2 . THR B 1 354 ? 11.679  22.201 74.866  1.00 18.22  ? 354  THR B CG2 1 
ATOM   5304 N  N   . ALA B 1 355 ? 8.465   23.825 73.578  1.00 14.51  ? 355  ALA B N   1 
ATOM   5305 C  CA  . ALA B 1 355 ? 7.142   23.267 73.623  1.00 15.48  ? 355  ALA B CA  1 
ATOM   5306 C  C   . ALA B 1 355 ? 6.652   22.863 72.223  1.00 18.07  ? 355  ALA B C   1 
ATOM   5307 O  O   . ALA B 1 355 ? 5.947   21.874 72.026  1.00 15.67  ? 355  ALA B O   1 
ATOM   5308 C  CB  . ALA B 1 355 ? 6.160   24.262 74.193  1.00 16.13  ? 355  ALA B CB  1 
ATOM   5309 N  N   . ASP B 1 356 ? 7.031   23.686 71.269  1.00 19.41  ? 356  ASP B N   1 
ATOM   5310 C  CA  . ASP B 1 356 ? 6.706   23.381 69.854  1.00 19.65  ? 356  ASP B CA  1 
ATOM   5311 C  C   . ASP B 1 356 ? 7.343   22.063 69.432  1.00 18.59  ? 356  ASP B C   1 
ATOM   5312 O  O   . ASP B 1 356 ? 6.696   21.222 68.808  1.00 19.94  ? 356  ASP B O   1 
ATOM   5313 C  CB  . ASP B 1 356 ? 7.131   24.574 68.972  1.00 19.34  ? 356  ASP B CB  1 
ATOM   5314 C  CG  . ASP B 1 356 ? 7.056   24.212 67.455  1.00 23.01  ? 356  ASP B CG  1 
ATOM   5315 O  OD1 . ASP B 1 356 ? 5.962   23.893 66.988  1.00 23.61  ? 356  ASP B OD1 1 
ATOM   5316 O  OD2 . ASP B 1 356 ? 8.126   24.077 66.851  1.00 24.60  ? 356  ASP B OD2 1 
ATOM   5317 N  N   . ARG B 1 357 ? 8.619   21.844 69.773  1.00 18.04  ? 357  ARG B N   1 
ATOM   5318 C  CA  . ARG B 1 357 ? 9.250   20.594 69.478  1.00 17.97  ? 357  ARG B CA  1 
ATOM   5319 C  C   . ARG B 1 357 ? 8.664   19.406 70.160  1.00 18.79  ? 357  ARG B C   1 
ATOM   5320 O  O   . ARG B 1 357 ? 8.546   18.325 69.575  1.00 15.67  ? 357  ARG B O   1 
ATOM   5321 C  CB  . ARG B 1 357 ? 10.732  20.685 69.679  1.00 20.35  ? 357  ARG B CB  1 
ATOM   5322 C  CG  . ARG B 1 357 ? 11.323  21.626 68.649  1.00 23.97  ? 357  ARG B CG  1 
ATOM   5323 C  CD  . ARG B 1 357 ? 12.785  21.707 68.716  1.00 27.30  ? 357  ARG B CD  1 
ATOM   5324 N  NE  . ARG B 1 357 ? 13.341  20.594 67.946  1.00 40.21  ? 357  ARG B NE  1 
ATOM   5325 C  CZ  . ARG B 1 357 ? 13.728  20.698 66.671  1.00 41.70  ? 357  ARG B CZ  1 
ATOM   5326 N  NH1 . ARG B 1 357 ? 13.662  21.865 66.031  1.00 34.16  ? 357  ARG B NH1 1 
ATOM   5327 N  NH2 . ARG B 1 357 ? 14.178  19.625 66.060  1.00 43.35  ? 357  ARG B NH2 1 
ATOM   5328 N  N   . LEU B 1 358 ? 8.207   19.595 71.395  1.00 18.54  ? 358  LEU B N   1 
ATOM   5329 C  CA  . LEU B 1 358 ? 7.587   18.526 72.139  1.00 17.23  ? 358  LEU B CA  1 
ATOM   5330 C  C   . LEU B 1 358 ? 6.214   18.169 71.529  1.00 17.57  ? 358  LEU B C   1 
ATOM   5331 O  O   . LEU B 1 358 ? 5.878   17.007 71.372  1.00 14.94  ? 358  LEU B O   1 
ATOM   5332 C  CB  . LEU B 1 358 ? 7.335   19.010 73.611  1.00 17.72  ? 358  LEU B CB  1 
ATOM   5333 C  CG  . LEU B 1 358 ? 8.587   18.928 74.482  1.00 18.18  ? 358  LEU B CG  1 
ATOM   5334 C  CD1 . LEU B 1 358 ? 8.308   19.815 75.676  1.00 19.64  ? 358  LEU B CD1 1 
ATOM   5335 C  CD2 . LEU B 1 358 ? 8.865   17.522 74.883  1.00 17.89  ? 358  LEU B CD2 1 
ATOM   5336 N  N   . GLY B 1 359 ? 5.450   19.193 71.159  1.00 18.49  ? 359  GLY B N   1 
ATOM   5337 C  CA  . GLY B 1 359 ? 4.139   18.979 70.504  1.00 19.82  ? 359  GLY B CA  1 
ATOM   5338 C  C   . GLY B 1 359 ? 4.299   18.335 69.107  1.00 19.85  ? 359  GLY B C   1 
ATOM   5339 O  O   . GLY B 1 359 ? 3.616   17.374 68.783  1.00 17.69  ? 359  GLY B O   1 
ATOM   5340 N  N   . SER B 1 360 ? 5.313   18.754 68.370  1.00 21.77  ? 360  SER B N   1 
ATOM   5341 C  CA  . SER B 1 360 ? 5.539   18.136 67.060  1.00 24.10  ? 360  SER B CA  1 
ATOM   5342 C  C   . SER B 1 360 ? 6.007   16.680 67.151  1.00 24.69  ? 360  SER B C   1 
ATOM   5343 O  O   . SER B 1 360 ? 5.492   15.859 66.411  1.00 22.41  ? 360  SER B O   1 
ATOM   5344 C  CB  . SER B 1 360 ? 6.442   18.966 66.221  1.00 28.03  ? 360  SER B CB  1 
ATOM   5345 O  OG  . SER B 1 360 ? 7.721   18.458 66.392  1.00 46.98  ? 360  SER B OG  1 
ATOM   5346 N  N   . ALA B 1 361 ? 6.839   16.323 68.135  1.00 20.49  ? 361  ALA B N   1 
ATOM   5347 C  CA  . ALA B 1 361 ? 7.254   14.949 68.384  1.00 21.23  ? 361  ALA B CA  1 
ATOM   5348 C  C   . ALA B 1 361 ? 6.060   14.116 68.827  1.00 22.55  ? 361  ALA B C   1 
ATOM   5349 O  O   . ALA B 1 361 ? 5.914   12.987 68.399  1.00 19.75  ? 361  ALA B O   1 
ATOM   5350 C  CB  . ALA B 1 361 ? 8.335   14.869 69.439  1.00 23.14  ? 361  ALA B CB  1 
ATOM   5351 N  N   . TRP B 1 362 ? 5.163   14.695 69.626  1.00 22.76  ? 362  TRP B N   1 
ATOM   5352 C  CA  . TRP B 1 362 ? 3.993   13.983 70.041  1.00 22.45  ? 362  TRP B CA  1 
ATOM   5353 C  C   . TRP B 1 362 ? 3.115   13.658 68.811  1.00 24.46  ? 362  TRP B C   1 
ATOM   5354 O  O   . TRP B 1 362 ? 2.561   12.540 68.700  1.00 28.13  ? 362  TRP B O   1 
ATOM   5355 C  CB  . TRP B 1 362 ? 3.211   14.814 71.077  1.00 23.40  ? 362  TRP B CB  1 
ATOM   5356 C  CG  . TRP B 1 362 ? 2.177   14.008 71.838  1.00 23.59  ? 362  TRP B CG  1 
ATOM   5357 C  CD1 . TRP B 1 362 ? 2.307   13.415 73.061  1.00 23.05  ? 362  TRP B CD1 1 
ATOM   5358 C  CD2 . TRP B 1 362 ? 0.840   13.811 71.433  1.00 25.32  ? 362  TRP B CD2 1 
ATOM   5359 N  NE1 . TRP B 1 362 ? 1.112   12.814 73.419  1.00 25.61  ? 362  TRP B NE1 1 
ATOM   5360 C  CE2 . TRP B 1 362 ? 0.196   13.064 72.439  1.00 24.24  ? 362  TRP B CE2 1 
ATOM   5361 C  CE3 . TRP B 1 362 ? 0.134   14.157 70.299  1.00 28.20  ? 362  TRP B CE3 1 
ATOM   5362 C  CZ2 . TRP B 1 362 ? -1.051  12.600 72.308  1.00 26.62  ? 362  TRP B CZ2 1 
ATOM   5363 C  CZ3 . TRP B 1 362 ? -1.177  13.711 70.178  1.00 32.56  ? 362  TRP B CZ3 1 
ATOM   5364 C  CH2 . TRP B 1 362 ? -1.767  12.962 71.198  1.00 32.91  ? 362  TRP B CH2 1 
ATOM   5365 N  N   . LEU B 1 363 ? 2.920   14.633 67.940  1.00 26.93  ? 363  LEU B N   1 
ATOM   5366 C  CA  . LEU B 1 363 ? 2.125   14.402 66.730  1.00 30.57  ? 363  LEU B CA  1 
ATOM   5367 C  C   . LEU B 1 363 ? 2.709   13.263 65.933  1.00 30.66  ? 363  LEU B C   1 
ATOM   5368 O  O   . LEU B 1 363 ? 1.983   12.346 65.566  1.00 30.08  ? 363  LEU B O   1 
ATOM   5369 C  CB  . LEU B 1 363 ? 2.005   15.631 65.845  1.00 29.44  ? 363  LEU B CB  1 
ATOM   5370 C  CG  . LEU B 1 363 ? 1.130   16.688 66.461  1.00 30.09  ? 363  LEU B CG  1 
ATOM   5371 C  CD1 . LEU B 1 363 ? 1.177   17.936 65.591  1.00 31.47  ? 363  LEU B CD1 1 
ATOM   5372 C  CD2 . LEU B 1 363 ? -0.280  16.115 66.614  1.00 31.83  ? 363  LEU B CD2 1 
ATOM   5373 N  N   . GLN B 1 364 ? 4.014   13.252 65.745  1.00 29.27  ? 364  GLN B N   1 
ATOM   5374 C  CA  . GLN B 1 364 ? 4.647   12.106 65.060  1.00 32.30  ? 364  GLN B CA  1 
ATOM   5375 C  C   . GLN B 1 364 ? 4.331   10.756 65.623  1.00 33.73  ? 364  GLN B C   1 
ATOM   5376 O  O   . GLN B 1 364 ? 4.264   9.819  64.879  1.00 35.86  ? 364  GLN B O   1 
ATOM   5377 C  CB  . GLN B 1 364 ? 6.163   12.210 65.061  1.00 36.86  ? 364  GLN B CB  1 
ATOM   5378 C  CG  . GLN B 1 364 ? 6.689   13.377 64.264  1.00 46.12  ? 364  GLN B CG  1 
ATOM   5379 C  CD  . GLN B 1 364 ? 5.937   13.551 62.990  1.00 56.60  ? 364  GLN B CD  1 
ATOM   5380 O  OE1 . GLN B 1 364 ? 5.246   14.545 62.811  1.00 67.66  ? 364  GLN B OE1 1 
ATOM   5381 N  NE2 . GLN B 1 364 ? 6.029   12.561 62.101  1.00 61.25  ? 364  GLN B NE2 1 
ATOM   5382 N  N   . GLN B 1 365 ? 4.208   10.624 66.940  1.00 32.15  ? 365  GLN B N   1 
ATOM   5383 C  CA  . GLN B 1 365 ? 3.975   9.339  67.592  1.00 32.07  ? 365  GLN B CA  1 
ATOM   5384 C  C   . GLN B 1 365 ? 2.489   9.001  67.450  1.00 32.86  ? 365  GLN B C   1 
ATOM   5385 O  O   . GLN B 1 365 ? 2.089   7.921  67.812  1.00 31.86  ? 365  GLN B O   1 
ATOM   5386 C  CB  . GLN B 1 365 ? 4.298   9.354  69.155  1.00 34.73  ? 365  GLN B CB  1 
ATOM   5387 C  CG  . GLN B 1 365 ? 5.759   9.340  69.672  1.00 38.06  ? 365  GLN B CG  1 
ATOM   5388 C  CD  . GLN B 1 365 ? 5.909   9.613  71.224  1.00 40.43  ? 365  GLN B CD  1 
ATOM   5389 O  OE1 . GLN B 1 365 ? 5.756   10.736 71.760  1.00 41.11  ? 365  GLN B OE1 1 
ATOM   5390 N  NE2 . GLN B 1 365 ? 6.276   8.582  71.923  1.00 49.51  ? 365  GLN B NE2 1 
ATOM   5391 N  N   . HIS B 1 366 ? 1.632   9.937  67.028  1.00 33.81  ? 366  HIS B N   1 
ATOM   5392 C  CA  . HIS B 1 366 ? 0.189   9.670  67.045  1.00 36.40  ? 366  HIS B CA  1 
ATOM   5393 C  C   . HIS B 1 366 ? -0.430  9.755  65.635  1.00 39.88  ? 366  HIS B C   1 
ATOM   5394 O  O   . HIS B 1 366 ? -1.348  10.532 65.448  1.00 50.01  ? 366  HIS B O   1 
ATOM   5395 C  CB  . HIS B 1 366 ? -0.512  10.563 68.098  1.00 34.66  ? 366  HIS B CB  1 
ATOM   5396 C  CG  . HIS B 1 366 ? -0.127  10.182 69.494  1.00 36.71  ? 366  HIS B CG  1 
ATOM   5397 N  ND1 . HIS B 1 366 ? 1.060   10.601 70.079  1.00 34.41  ? 366  HIS B ND1 1 
ATOM   5398 C  CD2 . HIS B 1 366 ? -0.673  9.291  70.356  1.00 35.48  ? 366  HIS B CD2 1 
ATOM   5399 C  CE1 . HIS B 1 366 ? 1.202   10.011 71.255  1.00 35.77  ? 366  HIS B CE1 1 
ATOM   5400 N  NE2 . HIS B 1 366 ? 0.165   9.207  71.443  1.00 33.81  ? 366  HIS B NE2 1 
HETATM 5401 ZN ZN  . ZN  C 2 .   ? 24.809  24.018 112.240 1.00 21.92  ? 1000 ZN  A ZN  1 
HETATM 5402 ZN ZN  . ZN  D 2 .   ? 57.369  24.251 110.801 1.00 95.95  ? 1001 ZN  A ZN  1 
HETATM 5403 C  C1  . GOL E 3 .   ? 25.759  24.763 109.647 1.00 38.40  ? 1002 GOL A C1  1 
HETATM 5404 O  O1  . GOL E 3 .   ? 25.798  23.483 110.320 1.00 32.36  ? 1002 GOL A O1  1 
HETATM 5405 C  C2  . GOL E 3 .   ? 26.946  25.705 109.918 1.00 45.17  ? 1002 GOL A C2  1 
HETATM 5406 O  O2  . GOL E 3 .   ? 28.161  25.091 110.432 1.00 51.50  ? 1002 GOL A O2  1 
HETATM 5407 C  C3  . GOL E 3 .   ? 26.521  26.782 110.863 1.00 47.63  ? 1002 GOL A C3  1 
HETATM 5408 O  O3  . GOL E 3 .   ? 26.034  26.106 112.003 1.00 42.47  ? 1002 GOL A O3  1 
HETATM 5409 C  C1  . GOL F 3 .   ? 23.327  2.674  99.351  1.00 31.28  ? 1003 GOL A C1  1 
HETATM 5410 O  O1  . GOL F 3 .   ? 22.699  2.867  100.582 1.00 28.15  ? 1003 GOL A O1  1 
HETATM 5411 C  C2  . GOL F 3 .   ? 23.930  1.307  99.174  1.00 32.12  ? 1003 GOL A C2  1 
HETATM 5412 O  O2  . GOL F 3 .   ? 24.104  0.480  100.348 1.00 29.21  ? 1003 GOL A O2  1 
HETATM 5413 C  C3  . GOL F 3 .   ? 23.160  0.588  98.091  1.00 38.51  ? 1003 GOL A C3  1 
HETATM 5414 O  O3  . GOL F 3 .   ? 23.999  -0.476 97.630  1.00 34.47  ? 1003 GOL A O3  1 
HETATM 5415 NA NA  . NA  G 4 .   ? 23.023  21.722 108.826 1.00 43.76  ? 1004 NA  A NA  1 
HETATM 5416 ZN ZN  . ZN  H 2 .   ? -7.964  33.511 79.746  1.00 21.70  ? 1000 ZN  B ZN  1 
HETATM 5417 C  C1  . GOL I 3 .   ? -8.125  36.878 80.910  1.00 39.56  ? 1001 GOL B C1  1 
HETATM 5418 O  O1  . GOL I 3 .   ? -8.130  35.748 80.072  1.00 34.10  ? 1001 GOL B O1  1 
HETATM 5419 C  C2  . GOL I 3 .   ? -9.038  36.428 81.989  1.00 40.66  ? 1001 GOL B C2  1 
HETATM 5420 O  O2  . GOL I 3 .   ? -10.380 36.358 81.421  1.00 46.29  ? 1001 GOL B O2  1 
HETATM 5421 C  C3  . GOL I 3 .   ? -8.492  35.079 82.424  1.00 37.23  ? 1001 GOL B C3  1 
HETATM 5422 O  O3  . GOL I 3 .   ? -8.925  34.001 81.584  1.00 31.36  ? 1001 GOL B O3  1 
HETATM 5423 C  C1  . GOL J 3 .   ? -18.220 14.775 92.589  1.00 32.55  ? 1002 GOL B C1  1 
HETATM 5424 O  O1  . GOL J 3 .   ? -17.511 14.562 91.384  1.00 27.08  ? 1002 GOL B O1  1 
HETATM 5425 C  C2  . GOL J 3 .   ? -19.492 13.927 92.727  1.00 35.32  ? 1002 GOL B C2  1 
HETATM 5426 O  O2  . GOL J 3 .   ? -20.071 13.379 91.521  1.00 28.85  ? 1002 GOL B O2  1 
HETATM 5427 C  C3  . GOL J 3 .   ? -19.289 12.809 93.747  1.00 37.92  ? 1002 GOL B C3  1 
HETATM 5428 O  O3  . GOL J 3 .   ? -20.529 12.656 94.450  1.00 31.83  ? 1002 GOL B O3  1 
HETATM 5429 ZN ZN  . ZN  K 2 .   ? -35.214 51.228 81.159  1.00 80.28  ? 1003 ZN  B ZN  1 
HETATM 5430 NA NA  . NA  L 4 .   ? -7.771  30.658 83.175  1.00 48.93  ? 1004 NA  B NA  1 
HETATM 5431 O  O   . HOH M 5 .   ? 26.790  20.403 118.134 1.00 18.20  ? 1101 HOH A O   1 
HETATM 5432 O  O   . HOH M 5 .   ? 35.113  -0.877 116.518 1.00 22.10  ? 1102 HOH A O   1 
HETATM 5433 O  O   . HOH M 5 .   ? 18.916  27.561 95.551  1.00 23.92  ? 1103 HOH A O   1 
HETATM 5434 O  O   . HOH M 5 .   ? 20.410  0.725  106.960 1.00 26.27  ? 1104 HOH A O   1 
HETATM 5435 O  O   . HOH M 5 .   ? 25.422  27.673 94.980  1.00 23.30  ? 1105 HOH A O   1 
HETATM 5436 O  O   . HOH M 5 .   ? 17.840  1.216  108.443 1.00 23.26  ? 1106 HOH A O   1 
HETATM 5437 O  O   . HOH M 5 .   ? -0.500  16.556 119.132 1.00 21.23  ? 1107 HOH A O   1 
HETATM 5438 O  O   . HOH M 5 .   ? 21.662  14.134 123.446 1.00 23.68  ? 1108 HOH A O   1 
HETATM 5439 O  O   . HOH M 5 .   ? 8.750   25.414 129.011 1.00 21.89  ? 1109 HOH A O   1 
HETATM 5440 O  O   . HOH M 5 .   ? 37.905  9.577  120.978 1.00 23.24  ? 1110 HOH A O   1 
HETATM 5441 O  O   . HOH M 5 .   ? 22.768  5.579  100.537 1.00 20.41  ? 1111 HOH A O   1 
HETATM 5442 O  O   . HOH M 5 .   ? 30.824  10.300 119.307 1.00 22.58  ? 1112 HOH A O   1 
HETATM 5443 O  O   . HOH M 5 .   ? 16.986  15.944 95.818  1.00 26.59  ? 1113 HOH A O   1 
HETATM 5444 O  O   . HOH M 5 .   ? 11.041  37.298 104.902 1.00 20.32  ? 1114 HOH A O   1 
HETATM 5445 O  O   . HOH M 5 .   ? 21.947  6.235  103.137 1.00 18.57  ? 1115 HOH A O   1 
HETATM 5446 O  O   . HOH M 5 .   ? 21.505  31.588 110.093 1.00 22.99  ? 1116 HOH A O   1 
HETATM 5447 O  O   . HOH M 5 .   ? 37.677  12.076 120.458 1.00 28.79  ? 1117 HOH A O   1 
HETATM 5448 O  O   . HOH M 5 .   ? 10.509  23.746 101.601 1.00 24.38  ? 1118 HOH A O   1 
HETATM 5449 O  O   . HOH M 5 .   ? 31.492  19.403 107.416 1.00 23.69  ? 1119 HOH A O   1 
HETATM 5450 O  O   . HOH M 5 .   ? 3.236   35.359 117.571 1.00 23.83  ? 1120 HOH A O   1 
HETATM 5451 O  O   . HOH M 5 .   ? 2.756   15.723 116.448 1.00 20.88  ? 1121 HOH A O   1 
HETATM 5452 O  O   . HOH M 5 .   ? 42.686  20.419 119.599 1.00 29.61  ? 1122 HOH A O   1 
HETATM 5453 O  O   . HOH M 5 .   ? -1.733  14.754 117.377 1.00 22.79  ? 1123 HOH A O   1 
HETATM 5454 O  O   . HOH M 5 .   ? 0.972   20.532 124.329 1.00 21.67  ? 1124 HOH A O   1 
HETATM 5455 O  O   . HOH M 5 .   ? 30.835  22.573 103.464 1.00 26.72  ? 1125 HOH A O   1 
HETATM 5456 O  O   . HOH M 5 .   ? -1.857  15.844 106.700 1.00 27.53  ? 1126 HOH A O   1 
HETATM 5457 O  O   . HOH M 5 .   ? 3.155   28.822 110.337 1.00 26.27  ? 1127 HOH A O   1 
HETATM 5458 O  O   . HOH M 5 .   ? 32.884  17.359 113.396 1.00 26.56  ? 1128 HOH A O   1 
HETATM 5459 O  O   . HOH M 5 .   ? 7.407   25.953 102.124 1.00 28.20  ? 1129 HOH A O   1 
HETATM 5460 O  O   . HOH M 5 .   ? 24.417  28.361 102.184 1.00 29.67  ? 1130 HOH A O   1 
HETATM 5461 O  O   . HOH M 5 .   ? 9.876   18.830 128.233 1.00 28.38  ? 1131 HOH A O   1 
HETATM 5462 O  O   . HOH M 5 .   ? 21.553  23.124 107.343 1.00 25.82  ? 1132 HOH A O   1 
HETATM 5463 O  O   . HOH M 5 .   ? 31.046  12.823 117.644 1.00 27.20  ? 1133 HOH A O   1 
HETATM 5464 O  O   . HOH M 5 .   ? 2.231   10.201 111.718 1.00 33.05  ? 1134 HOH A O   1 
HETATM 5465 O  O   . HOH M 5 .   ? 18.699  25.524 97.817  1.00 32.47  ? 1135 HOH A O   1 
HETATM 5466 O  O   . HOH M 5 .   ? 28.137  23.613 120.499 1.00 28.45  ? 1136 HOH A O   1 
HETATM 5467 O  O   . HOH M 5 .   ? 13.798  14.519 123.418 1.00 25.58  ? 1137 HOH A O   1 
HETATM 5468 O  O   . HOH M 5 .   ? 15.149  3.158  110.654 1.00 28.64  ? 1138 HOH A O   1 
HETATM 5469 O  O   . HOH M 5 .   ? 4.933   16.896 128.055 1.00 24.14  ? 1139 HOH A O   1 
HETATM 5470 O  O   . HOH M 5 .   ? 21.441  36.154 117.023 1.00 27.44  ? 1140 HOH A O   1 
HETATM 5471 O  O   . HOH M 5 .   ? 3.499   33.441 109.374 1.00 35.99  ? 1141 HOH A O   1 
HETATM 5472 O  O   . HOH M 5 .   ? 0.250   12.229 111.554 1.00 33.01  ? 1142 HOH A O   1 
HETATM 5473 O  O   . HOH M 5 .   ? 19.680  2.948  103.524 1.00 31.65  ? 1143 HOH A O   1 
HETATM 5474 O  O   . HOH M 5 .   ? 4.755   9.901  110.751 1.00 25.69  ? 1144 HOH A O   1 
HETATM 5475 O  O   . HOH M 5 .   ? 1.169   20.725 104.882 1.00 37.97  ? 1145 HOH A O   1 
HETATM 5476 O  O   . HOH M 5 .   ? 11.541  35.225 102.998 1.00 32.63  ? 1146 HOH A O   1 
HETATM 5477 O  O   . HOH M 5 .   ? 22.855  12.531 95.431  1.00 41.65  ? 1147 HOH A O   1 
HETATM 5478 O  O   . HOH M 5 .   ? 16.203  3.648  113.040 1.00 29.48  ? 1148 HOH A O   1 
HETATM 5479 O  O   . HOH M 5 .   ? 13.895  41.624 113.879 1.00 33.21  ? 1149 HOH A O   1 
HETATM 5480 O  O   . HOH M 5 .   ? 14.194  23.228 132.000 1.00 26.91  ? 1150 HOH A O   1 
HETATM 5481 O  O   . HOH M 5 .   ? 14.512  2.929  115.112 1.00 31.42  ? 1151 HOH A O   1 
HETATM 5482 O  O   . HOH M 5 .   ? 38.839  22.743 119.978 1.00 37.60  ? 1152 HOH A O   1 
HETATM 5483 O  O   . HOH M 5 .   ? 14.599  4.599  107.014 1.00 33.30  ? 1153 HOH A O   1 
HETATM 5484 O  O   . HOH M 5 .   ? 36.673  1.981  108.064 1.00 29.18  ? 1154 HOH A O   1 
HETATM 5485 O  O   . HOH M 5 .   ? 16.742  27.206 93.577  1.00 28.32  ? 1155 HOH A O   1 
HETATM 5486 O  O   . HOH M 5 .   ? 20.986  23.122 104.648 1.00 29.58  ? 1156 HOH A O   1 
HETATM 5487 O  O   . HOH M 5 .   ? 19.198  11.946 97.747  1.00 28.18  ? 1157 HOH A O   1 
HETATM 5488 O  O   . HOH M 5 .   ? 30.844  19.907 126.873 1.00 35.46  ? 1158 HOH A O   1 
HETATM 5489 O  O   . HOH M 5 .   ? 52.582  24.990 100.709 1.00 39.45  ? 1159 HOH A O   1 
HETATM 5490 O  O   . HOH M 5 .   ? 43.563  21.291 97.708  1.00 43.75  ? 1160 HOH A O   1 
HETATM 5491 O  O   . HOH M 5 .   ? 43.193  18.625 98.490  1.00 33.54  ? 1161 HOH A O   1 
HETATM 5492 O  O   . HOH M 5 .   ? 36.129  3.048  118.232 1.00 31.62  ? 1162 HOH A O   1 
HETATM 5493 O  O   . HOH M 5 .   ? 6.142   23.436 103.116 1.00 43.95  ? 1163 HOH A O   1 
HETATM 5494 O  O   . HOH M 5 .   ? 3.902   31.060 108.313 1.00 38.27  ? 1164 HOH A O   1 
HETATM 5495 O  O   . HOH M 5 .   ? 17.032  5.034  103.327 1.00 39.04  ? 1165 HOH A O   1 
HETATM 5496 O  O   . HOH M 5 .   ? 9.093   21.645 98.285  1.00 34.96  ? 1166 HOH A O   1 
HETATM 5497 O  O   . HOH M 5 .   ? 18.967  34.867 98.054  1.00 38.14  ? 1167 HOH A O   1 
HETATM 5498 O  O   . HOH M 5 .   ? 5.581   11.991 105.819 1.00 37.63  ? 1168 HOH A O   1 
HETATM 5499 O  O   . HOH M 5 .   ? 31.392  6.655  122.943 1.00 28.17  ? 1169 HOH A O   1 
HETATM 5500 O  O   . HOH M 5 .   ? 10.870  40.522 123.892 1.00 30.57  ? 1170 HOH A O   1 
HETATM 5501 O  O   . HOH M 5 .   ? 4.025   30.764 112.412 1.00 32.12  ? 1171 HOH A O   1 
HETATM 5502 O  O   . HOH M 5 .   ? 43.210  5.966  115.063 1.00 40.80  ? 1172 HOH A O   1 
HETATM 5503 O  O   . HOH M 5 .   ? 10.175  11.627 106.259 1.00 32.34  ? 1173 HOH A O   1 
HETATM 5504 O  O   . HOH M 5 .   ? 39.821  20.258 120.544 1.00 34.36  ? 1174 HOH A O   1 
HETATM 5505 O  O   . HOH M 5 .   ? 18.408  7.395  100.049 1.00 35.31  ? 1175 HOH A O   1 
HETATM 5506 O  O   . HOH M 5 .   ? 46.173  12.853 98.400  1.00 32.51  ? 1176 HOH A O   1 
HETATM 5507 O  O   . HOH M 5 .   ? 32.497  19.727 114.230 1.00 39.60  ? 1177 HOH A O   1 
HETATM 5508 O  O   . HOH M 5 .   ? 19.024  6.508  102.671 1.00 47.12  ? 1178 HOH A O   1 
HETATM 5509 O  O   . HOH M 5 .   ? 35.672  16.226 98.098  1.00 31.71  ? 1179 HOH A O   1 
HETATM 5510 O  O   . HOH M 5 .   ? 7.155   18.937 128.184 1.00 40.62  ? 1180 HOH A O   1 
HETATM 5511 O  O   . HOH M 5 .   ? 20.395  5.998  99.180  1.00 33.56  ? 1181 HOH A O   1 
HETATM 5512 O  O   . HOH M 5 .   ? -1.195  12.287 113.847 1.00 37.17  ? 1182 HOH A O   1 
HETATM 5513 O  O   . HOH M 5 .   ? 11.058  9.359  105.439 1.00 48.40  ? 1183 HOH A O   1 
HETATM 5514 O  O   . HOH M 5 .   ? 5.678   30.760 127.722 1.00 39.29  ? 1184 HOH A O   1 
HETATM 5515 O  O   . HOH M 5 .   ? 2.132   32.934 111.142 1.00 39.87  ? 1185 HOH A O   1 
HETATM 5516 O  O   . HOH M 5 .   ? 7.897   25.476 99.587  1.00 35.70  ? 1186 HOH A O   1 
HETATM 5517 O  O   . HOH M 5 .   ? 38.679  22.772 97.521  1.00 36.16  ? 1187 HOH A O   1 
HETATM 5518 O  O   . HOH M 5 .   ? 21.413  -0.961 96.756  1.00 50.07  ? 1188 HOH A O   1 
HETATM 5519 O  O   . HOH M 5 .   ? 51.063  6.471  113.289 1.00 40.25  ? 1189 HOH A O   1 
HETATM 5520 O  O   . HOH M 5 .   ? 36.031  23.350 120.145 1.00 38.04  ? 1190 HOH A O   1 
HETATM 5521 O  O   . HOH M 5 .   ? 32.798  -0.286 109.831 1.00 45.38  ? 1191 HOH A O   1 
HETATM 5522 O  O   . HOH M 5 .   ? 21.440  29.947 102.150 1.00 40.13  ? 1192 HOH A O   1 
HETATM 5523 O  O   . HOH M 5 .   ? 18.438  34.999 129.164 1.00 40.88  ? 1193 HOH A O   1 
HETATM 5524 O  O   . HOH M 5 .   ? 1.312   36.804 112.237 1.00 51.22  ? 1194 HOH A O   1 
HETATM 5525 O  O   . HOH M 5 .   ? 1.048   16.400 134.002 1.00 39.57  ? 1195 HOH A O   1 
HETATM 5526 O  O   . HOH M 5 .   ? 8.292   8.086  109.844 1.00 37.97  ? 1196 HOH A O   1 
HETATM 5527 O  O   . HOH M 5 .   ? 1.943   34.767 113.909 1.00 33.22  ? 1197 HOH A O   1 
HETATM 5528 O  O   . HOH M 5 .   ? 31.992  -0.721 107.554 1.00 30.81  ? 1198 HOH A O   1 
HETATM 5529 O  O   . HOH M 5 .   ? 31.071  -2.167 124.810 1.00 36.34  ? 1199 HOH A O   1 
HETATM 5530 O  O   . HOH M 5 .   ? 22.206  38.683 113.406 1.00 38.67  ? 1200 HOH A O   1 
HETATM 5531 O  O   . HOH M 5 .   ? 20.373  2.096  101.088 1.00 38.26  ? 1201 HOH A O   1 
HETATM 5532 O  O   . HOH M 5 .   ? 35.952  1.436  122.313 1.00 36.77  ? 1202 HOH A O   1 
HETATM 5533 O  O   . HOH M 5 .   ? 15.750  6.391  105.320 1.00 19.93  ? 1203 HOH A O   1 
HETATM 5534 O  O   . HOH M 5 .   ? 9.690   26.032 103.052 1.00 21.40  ? 1204 HOH A O   1 
HETATM 5535 O  O   . HOH M 5 .   ? -2.345  17.165 121.012 1.00 25.42  ? 1205 HOH A O   1 
HETATM 5536 O  O   . HOH M 5 .   ? 1.373   13.417 105.227 1.00 38.70  ? 1206 HOH A O   1 
HETATM 5537 O  O   . HOH M 5 .   ? 29.407  7.139  124.303 1.00 32.94  ? 1207 HOH A O   1 
HETATM 5538 O  O   . HOH M 5 .   ? 18.972  36.662 103.798 1.00 60.39  ? 1208 HOH A O   1 
HETATM 5539 O  O   . HOH M 5 .   ? 11.868  33.447 96.682  1.00 43.86  ? 1209 HOH A O   1 
HETATM 5540 O  O   . HOH M 5 .   ? 51.206  15.341 94.656  1.00 45.67  ? 1210 HOH A O   1 
HETATM 5541 O  O   . HOH M 5 .   ? 4.419   18.803 102.245 1.00 41.38  ? 1211 HOH A O   1 
HETATM 5542 O  O   . HOH M 5 .   ? 4.053   14.051 105.254 1.00 49.40  ? 1212 HOH A O   1 
HETATM 5543 O  O   . HOH M 5 .   ? 12.806  26.024 92.598  1.00 46.57  ? 1213 HOH A O   1 
HETATM 5544 O  O   . HOH M 5 .   ? 25.273  27.187 119.931 1.00 33.59  ? 1214 HOH A O   1 
HETATM 5545 O  O   . HOH M 5 .   ? 13.823  5.956  111.581 1.00 41.64  ? 1215 HOH A O   1 
HETATM 5546 O  O   . HOH M 5 .   ? 33.125  8.172  125.590 1.00 33.75  ? 1216 HOH A O   1 
HETATM 5547 O  O   . HOH M 5 .   ? 22.317  39.185 110.639 1.00 46.35  ? 1217 HOH A O   1 
HETATM 5548 O  O   . HOH M 5 .   ? -1.094  12.558 109.415 1.00 42.67  ? 1218 HOH A O   1 
HETATM 5549 O  O   . HOH M 5 .   ? 50.632  12.964 95.121  1.00 46.08  ? 1219 HOH A O   1 
HETATM 5550 O  O   . HOH M 5 .   ? 14.583  41.702 121.028 1.00 38.48  ? 1220 HOH A O   1 
HETATM 5551 O  O   . HOH M 5 .   ? 16.738  34.786 99.746  1.00 50.85  ? 1221 HOH A O   1 
HETATM 5552 O  O   . HOH M 5 .   ? 5.455   21.255 103.903 1.00 45.50  ? 1222 HOH A O   1 
HETATM 5553 O  O   . HOH M 5 .   ? 6.047   16.374 103.735 1.00 41.05  ? 1223 HOH A O   1 
HETATM 5554 O  O   . HOH M 5 .   ? 25.084  23.800 94.797  1.00 18.52  ? 1224 HOH A O   1 
HETATM 5555 O  O   . HOH M 5 .   ? 13.890  28.455 132.624 1.00 12.94  ? 1225 HOH A O   1 
HETATM 5556 O  O   . HOH M 5 .   ? 23.045  15.588 121.994 1.00 17.35  ? 1226 HOH A O   1 
HETATM 5557 O  O   . HOH M 5 .   ? 2.168   16.450 118.973 1.00 17.82  ? 1227 HOH A O   1 
HETATM 5558 O  O   . HOH M 5 .   ? 7.562   11.794 107.372 1.00 21.65  ? 1228 HOH A O   1 
HETATM 5559 O  O   . HOH M 5 .   ? 25.304  -0.099 114.217 1.00 15.46  ? 1229 HOH A O   1 
HETATM 5560 O  O   . HOH M 5 .   ? 39.443  12.392 112.452 1.00 17.51  ? 1230 HOH A O   1 
HETATM 5561 O  O   . HOH M 5 .   ? 29.746  23.141 99.940  1.00 19.02  ? 1231 HOH A O   1 
HETATM 5562 O  O   . HOH M 5 .   ? 8.308   23.270 127.439 1.00 19.02  ? 1232 HOH A O   1 
HETATM 5563 O  O   . HOH M 5 .   ? 18.829  3.095  112.668 1.00 14.24  ? 1233 HOH A O   1 
HETATM 5564 O  O   . HOH M 5 .   ? 0.053   14.280 107.771 1.00 18.41  ? 1234 HOH A O   1 
HETATM 5565 O  O   . HOH M 5 .   ? 18.486  16.745 106.961 1.00 16.96  ? 1235 HOH A O   1 
HETATM 5566 O  O   . HOH M 5 .   ? 29.768  15.579 125.600 1.00 21.99  ? 1236 HOH A O   1 
HETATM 5567 O  O   . HOH M 5 .   ? 26.628  17.750 111.879 1.00 22.22  ? 1237 HOH A O   1 
HETATM 5568 O  O   . HOH M 5 .   ? 17.168  6.191  113.116 1.00 20.54  ? 1238 HOH A O   1 
HETATM 5569 O  O   . HOH M 5 .   ? 18.339  17.131 93.536  1.00 20.35  ? 1239 HOH A O   1 
HETATM 5570 O  O   . HOH M 5 .   ? 31.022  16.063 111.839 1.00 25.47  ? 1240 HOH A O   1 
HETATM 5571 O  O   . HOH M 5 .   ? 1.795   36.145 121.944 1.00 51.58  ? 1241 HOH A O   1 
HETATM 5572 O  O   . HOH M 5 .   ? 48.074  8.757  119.464 1.00 46.91  ? 1242 HOH A O   1 
HETATM 5573 O  O   . HOH M 5 .   ? 17.122  16.779 125.204 1.00 43.86  ? 1243 HOH A O   1 
HETATM 5574 O  O   . HOH M 5 .   ? 52.053  11.403 99.186  1.00 47.79  ? 1244 HOH A O   1 
HETATM 5575 O  O   . HOH M 5 .   ? 4.522   26.954 124.059 1.00 17.86  ? 1245 HOH A O   1 
HETATM 5576 O  O   . HOH M 5 .   ? 24.478  29.191 112.950 1.00 30.29  ? 1246 HOH A O   1 
HETATM 5577 O  O   . HOH M 5 .   ? 3.592   28.279 106.148 1.00 31.32  ? 1247 HOH A O   1 
HETATM 5578 O  O   . HOH M 5 .   ? 13.704  8.153  104.515 1.00 33.16  ? 1248 HOH A O   1 
HETATM 5579 O  O   . HOH M 5 .   ? 1.137   23.682 103.860 1.00 34.44  ? 1249 HOH A O   1 
HETATM 5580 O  O   . HOH M 5 .   ? 0.653   9.300  128.876 1.00 42.93  ? 1250 HOH A O   1 
HETATM 5581 O  O   . HOH M 5 .   ? 11.155  7.600  119.120 1.00 24.32  ? 1251 HOH A O   1 
HETATM 5582 O  O   . HOH M 5 .   ? 28.509  26.398 116.450 1.00 46.17  ? 1252 HOH A O   1 
HETATM 5583 O  O   . HOH M 5 .   ? 20.390  34.301 100.143 1.00 41.88  ? 1253 HOH A O   1 
HETATM 5584 O  O   . HOH M 5 .   ? 6.102   7.174  116.892 1.00 41.18  ? 1254 HOH A O   1 
HETATM 5585 O  O   . HOH M 5 .   ? 28.881  21.743 119.113 1.00 35.01  ? 1255 HOH A O   1 
HETATM 5586 O  O   . HOH M 5 .   ? 7.774   28.176 128.690 1.00 46.57  ? 1256 HOH A O   1 
HETATM 5587 O  O   . HOH M 5 .   ? 9.731   34.513 95.896  1.00 48.53  ? 1257 HOH A O   1 
HETATM 5588 O  O   . HOH M 5 .   ? 15.706  32.520 133.750 1.00 36.43  ? 1258 HOH A O   1 
HETATM 5589 O  O   . HOH M 5 .   ? 8.213   6.672  118.663 1.00 47.90  ? 1259 HOH A O   1 
HETATM 5590 O  O   . HOH M 5 .   ? 21.861  3.986  104.677 1.00 24.86  ? 1260 HOH A O   1 
HETATM 5591 O  O   . HOH M 5 .   ? 11.017  8.899  112.957 1.00 22.28  ? 1261 HOH A O   1 
HETATM 5592 O  O   . HOH M 5 .   ? 6.054   40.660 113.737 1.00 26.07  ? 1262 HOH A O   1 
HETATM 5593 O  O   . HOH M 5 .   ? 16.197  40.277 120.396 1.00 24.59  ? 1263 HOH A O   1 
HETATM 5594 O  O   . HOH M 5 .   ? 29.836  6.322  104.860 1.00 23.87  ? 1264 HOH A O   1 
HETATM 5595 O  O   . HOH M 5 .   ? 1.613   25.665 110.787 1.00 25.24  ? 1265 HOH A O   1 
HETATM 5596 O  O   . HOH M 5 .   ? 11.840  22.373 103.624 1.00 16.70  ? 1266 HOH A O   1 
HETATM 5597 O  O   . HOH M 5 .   ? 6.783   21.369 128.384 1.00 32.77  ? 1267 HOH A O   1 
HETATM 5598 O  O   . HOH M 5 .   ? 2.187   10.545 118.670 1.00 36.45  ? 1268 HOH A O   1 
HETATM 5599 O  O   . HOH M 5 .   ? 18.284  10.132 99.558  1.00 28.43  ? 1269 HOH A O   1 
HETATM 5600 O  O   . HOH M 5 .   ? 2.727   28.541 125.449 1.00 39.77  ? 1270 HOH A O   1 
HETATM 5601 O  O   . HOH M 5 .   ? 10.274  13.720 104.133 1.00 35.74  ? 1271 HOH A O   1 
HETATM 5602 O  O   . HOH M 5 .   ? 38.674  15.039 121.078 1.00 37.69  ? 1272 HOH A O   1 
HETATM 5603 O  O   . HOH M 5 .   ? 17.473  13.662 95.383  1.00 38.04  ? 1273 HOH A O   1 
HETATM 5604 O  O   . HOH M 5 .   ? 4.502   23.490 126.726 1.00 31.83  ? 1274 HOH A O   1 
HETATM 5605 O  O   . HOH N 5 .   ? -15.077 17.045 88.664  1.00 19.23  ? 1101 HOH B O   1 
HETATM 5606 O  O   . HOH N 5 .   ? -11.623 31.717 73.901  1.00 18.06  ? 1102 HOH B O   1 
HETATM 5607 O  O   . HOH N 5 .   ? 6.138   14.679 75.595  1.00 21.47  ? 1103 HOH B O   1 
HETATM 5608 O  O   . HOH N 5 .   ? -0.206  13.843 84.624  1.00 22.17  ? 1104 HOH B O   1 
HETATM 5609 O  O   . HOH N 5 .   ? -24.979 30.447 71.389  1.00 25.17  ? 1105 HOH B O   1 
HETATM 5610 O  O   . HOH N 5 .   ? -5.609  31.044 84.623  1.00 24.95  ? 1106 HOH B O   1 
HETATM 5611 O  O   . HOH N 5 .   ? -30.252 18.110 75.429  1.00 23.41  ? 1107 HOH B O   1 
HETATM 5612 O  O   . HOH N 5 .   ? -1.252  38.189 81.708  1.00 25.82  ? 1108 HOH B O   1 
HETATM 5613 O  O   . HOH N 5 .   ? -26.625 28.445 70.878  1.00 23.50  ? 1109 HOH B O   1 
HETATM 5614 O  O   . HOH N 5 .   ? -12.717 35.459 92.089  1.00 19.19  ? 1110 HOH B O   1 
HETATM 5615 O  O   . HOH N 5 .   ? -23.090 22.325 69.037  1.00 26.94  ? 1111 HOH B O   1 
HETATM 5616 O  O   . HOH N 5 .   ? -6.498  37.125 96.754  1.00 21.78  ? 1112 HOH B O   1 
HETATM 5617 O  O   . HOH N 5 .   ? -17.318 30.232 80.158  1.00 24.10  ? 1113 HOH B O   1 
HETATM 5618 O  O   . HOH N 5 .   ? -16.143 16.890 91.365  1.00 26.32  ? 1114 HOH B O   1 
HETATM 5619 O  O   . HOH N 5 .   ? 1.188   11.041 81.260  1.00 29.30  ? 1115 HOH B O   1 
HETATM 5620 O  O   . HOH N 5 .   ? 10.655  37.242 86.984  1.00 27.60  ? 1116 HOH B O   1 
HETATM 5621 O  O   . HOH N 5 .   ? 16.185  31.457 74.285  1.00 21.79  ? 1117 HOH B O   1 
HETATM 5622 O  O   . HOH N 5 .   ? -10.033 11.804 84.920  1.00 28.29  ? 1118 HOH B O   1 
HETATM 5623 O  O   . HOH N 5 .   ? 5.332   23.873 64.501  1.00 20.75  ? 1119 HOH B O   1 
HETATM 5624 O  O   . HOH N 5 .   ? 5.697   26.966 88.986  1.00 21.90  ? 1120 HOH B O   1 
HETATM 5625 O  O   . HOH N 5 .   ? 1.691   41.704 74.824  1.00 30.01  ? 1121 HOH B O   1 
HETATM 5626 O  O   . HOH N 5 .   ? -18.288 32.295 78.360  1.00 27.59  ? 1122 HOH B O   1 
HETATM 5627 O  O   . HOH N 5 .   ? 10.199  17.889 67.558  1.00 24.42  ? 1123 HOH B O   1 
HETATM 5628 O  O   . HOH N 5 .   ? 16.712  37.426 78.206  1.00 31.23  ? 1124 HOH B O   1 
HETATM 5629 O  O   . HOH N 5 .   ? -20.740 39.824 71.868  1.00 37.85  ? 1125 HOH B O   1 
HETATM 5630 O  O   . HOH N 5 .   ? -24.579 33.241 70.721  1.00 30.60  ? 1126 HOH B O   1 
HETATM 5631 O  O   . HOH N 5 .   ? -12.743 33.843 72.614  1.00 32.71  ? 1127 HOH B O   1 
HETATM 5632 O  O   . HOH N 5 .   ? 0.393   32.001 98.530  1.00 25.92  ? 1128 HOH B O   1 
HETATM 5633 O  O   . HOH N 5 .   ? -5.772  22.590 96.185  1.00 26.75  ? 1129 HOH B O   1 
HETATM 5634 O  O   . HOH N 5 .   ? -4.905  37.650 79.038  1.00 29.77  ? 1130 HOH B O   1 
HETATM 5635 O  O   . HOH N 5 .   ? -23.025 38.205 71.166  1.00 29.10  ? 1131 HOH B O   1 
HETATM 5636 O  O   . HOH N 5 .   ? 3.878   25.514 90.401  1.00 21.12  ? 1132 HOH B O   1 
HETATM 5637 O  O   . HOH N 5 .   ? -20.811 22.075 67.063  1.00 22.94  ? 1133 HOH B O   1 
HETATM 5638 O  O   . HOH N 5 .   ? -9.687  20.343 94.161  1.00 26.90  ? 1134 HOH B O   1 
HETATM 5639 O  O   . HOH N 5 .   ? -20.406 25.255 72.730  1.00 26.28  ? 1135 HOH B O   1 
HETATM 5640 O  O   . HOH N 5 .   ? 10.136  12.459 85.254  1.00 29.78  ? 1136 HOH B O   1 
HETATM 5641 O  O   . HOH N 5 .   ? -14.058 35.514 88.648  1.00 32.88  ? 1137 HOH B O   1 
HETATM 5642 O  O   . HOH N 5 .   ? -17.277 24.250 65.788  1.00 23.30  ? 1138 HOH B O   1 
HETATM 5643 O  O   . HOH N 5 .   ? -11.072 35.118 71.308  1.00 25.19  ? 1139 HOH B O   1 
HETATM 5644 O  O   . HOH N 5 .   ? -30.425 17.107 77.991  1.00 26.17  ? 1140 HOH B O   1 
HETATM 5645 O  O   . HOH N 5 .   ? 1.884   21.021 63.505  1.00 24.89  ? 1141 HOH B O   1 
HETATM 5646 O  O   . HOH N 5 .   ? -11.137 10.873 81.201  1.00 33.68  ? 1142 HOH B O   1 
HETATM 5647 O  O   . HOH N 5 .   ? -13.275 11.359 70.892  1.00 24.81  ? 1143 HOH B O   1 
HETATM 5648 O  O   . HOH N 5 .   ? -33.380 40.300 66.341  1.00 26.71  ? 1144 HOH B O   1 
HETATM 5649 O  O   . HOH N 5 .   ? -2.257  31.741 94.201  1.00 27.65  ? 1145 HOH B O   1 
HETATM 5650 O  O   . HOH N 5 .   ? -30.007 21.394 84.009  1.00 27.50  ? 1146 HOH B O   1 
HETATM 5651 O  O   . HOH N 5 .   ? -2.279  15.449 85.584  1.00 37.20  ? 1147 HOH B O   1 
HETATM 5652 O  O   . HOH N 5 .   ? 9.378   35.887 88.717  1.00 31.26  ? 1148 HOH B O   1 
HETATM 5653 O  O   . HOH N 5 .   ? -16.704 11.383 84.996  1.00 28.66  ? 1149 HOH B O   1 
HETATM 5654 O  O   . HOH N 5 .   ? 3.984   23.077 93.581  1.00 33.29  ? 1150 HOH B O   1 
HETATM 5655 O  O   . HOH N 5 .   ? -5.356  30.697 87.443  1.00 26.82  ? 1151 HOH B O   1 
HETATM 5656 O  O   . HOH N 5 .   ? -5.335  36.968 89.810  1.00 30.32  ? 1152 HOH B O   1 
HETATM 5657 O  O   . HOH N 5 .   ? 8.659   21.849 65.022  1.00 35.16  ? 1153 HOH B O   1 
HETATM 5658 O  O   . HOH N 5 .   ? 2.377   41.789 77.413  1.00 28.71  ? 1154 HOH B O   1 
HETATM 5659 O  O   . HOH N 5 .   ? -3.924  19.644 68.433  1.00 26.07  ? 1155 HOH B O   1 
HETATM 5660 O  O   . HOH N 5 .   ? -21.110 32.921 94.017  1.00 31.06  ? 1156 HOH B O   1 
HETATM 5661 O  O   . HOH N 5 .   ? -30.948 49.401 91.135  1.00 37.38  ? 1157 HOH B O   1 
HETATM 5662 O  O   . HOH N 5 .   ? -1.035  33.439 96.348  1.00 27.19  ? 1158 HOH B O   1 
HETATM 5663 O  O   . HOH N 5 .   ? 7.948   10.253 82.319  1.00 37.64  ? 1159 HOH B O   1 
HETATM 5664 O  O   . HOH N 5 .   ? 10.058  17.973 87.052  1.00 39.45  ? 1160 HOH B O   1 
HETATM 5665 O  O   . HOH N 5 .   ? -2.837  22.251 94.964  1.00 35.20  ? 1161 HOH B O   1 
HETATM 5666 O  O   . HOH N 5 .   ? -31.175 20.658 74.928  1.00 32.09  ? 1162 HOH B O   1 
HETATM 5667 O  O   . HOH N 5 .   ? -16.817 43.932 96.779  1.00 36.88  ? 1163 HOH B O   1 
HETATM 5668 O  O   . HOH N 5 .   ? -39.825 32.669 79.184  1.00 31.95  ? 1164 HOH B O   1 
HETATM 5669 O  O   . HOH N 5 .   ? -7.174  36.553 72.160  1.00 33.18  ? 1165 HOH B O   1 
HETATM 5670 O  O   . HOH N 5 .   ? -15.741 45.895 80.486  1.00 35.61  ? 1166 HOH B O   1 
HETATM 5671 O  O   . HOH N 5 .   ? 14.889  30.128 82.831  1.00 39.27  ? 1167 HOH B O   1 
HETATM 5672 O  O   . HOH N 5 .   ? -16.626 34.512 77.604  1.00 30.81  ? 1168 HOH B O   1 
HETATM 5673 O  O   . HOH N 5 .   ? -28.832 21.747 73.862  1.00 28.82  ? 1169 HOH B O   1 
HETATM 5674 O  O   . HOH N 5 .   ? 7.744   42.420 71.475  1.00 25.13  ? 1170 HOH B O   1 
HETATM 5675 O  O   . HOH N 5 .   ? 10.142  19.818 65.326  1.00 30.68  ? 1171 HOH B O   1 
HETATM 5676 O  O   . HOH N 5 .   ? 7.058   25.439 92.525  1.00 34.19  ? 1172 HOH B O   1 
HETATM 5677 O  O   . HOH N 5 .   ? -13.917 16.253 92.862  1.00 32.19  ? 1173 HOH B O   1 
HETATM 5678 O  O   . HOH N 5 .   ? -1.009  32.184 60.015  1.00 38.73  ? 1174 HOH B O   1 
HETATM 5679 O  O   . HOH N 5 .   ? -14.045 11.649 68.492  1.00 34.90  ? 1175 HOH B O   1 
HETATM 5680 O  O   . HOH N 5 .   ? -1.138  17.018 87.722  1.00 39.60  ? 1176 HOH B O   1 
HETATM 5681 O  O   . HOH N 5 .   ? -10.877 23.208 68.272  1.00 33.00  ? 1177 HOH B O   1 
HETATM 5682 O  O   . HOH N 5 .   ? -11.715 13.451 88.625  1.00 32.62  ? 1178 HOH B O   1 
HETATM 5683 O  O   . HOH N 5 .   ? -5.869  39.521 69.378  1.00 43.25  ? 1179 HOH B O   1 
HETATM 5684 O  O   . HOH N 5 .   ? -27.142 16.664 84.368  1.00 31.58  ? 1180 HOH B O   1 
HETATM 5685 O  O   . HOH N 5 .   ? -28.377 18.501 82.542  1.00 37.61  ? 1181 HOH B O   1 
HETATM 5686 O  O   . HOH N 5 .   ? 3.877   14.411 86.709  1.00 38.04  ? 1182 HOH B O   1 
HETATM 5687 O  O   . HOH N 5 .   ? 5.859   21.394 63.383  1.00 41.42  ? 1183 HOH B O   1 
HETATM 5688 O  O   . HOH N 5 .   ? 12.975  27.997 79.528  1.00 27.01  ? 1184 HOH B O   1 
HETATM 5689 O  O   . HOH N 5 .   ? 6.327   10.539 80.287  1.00 31.35  ? 1185 HOH B O   1 
HETATM 5690 O  O   . HOH N 5 .   ? 7.599   35.697 91.899  1.00 34.89  ? 1186 HOH B O   1 
HETATM 5691 O  O   . HOH N 5 .   ? 9.922   13.349 66.468  1.00 46.04  ? 1187 HOH B O   1 
HETATM 5692 O  O   . HOH N 5 .   ? -11.141 25.460 69.861  1.00 32.30  ? 1188 HOH B O   1 
HETATM 5693 O  O   . HOH N 5 .   ? -11.675 11.790 78.871  1.00 30.79  ? 1189 HOH B O   1 
HETATM 5694 O  O   . HOH N 5 .   ? -26.311 38.838 93.419  1.00 36.31  ? 1190 HOH B O   1 
HETATM 5695 O  O   . HOH N 5 .   ? -22.191 44.613 90.442  1.00 42.87  ? 1191 HOH B O   1 
HETATM 5696 O  O   . HOH N 5 .   ? -12.560 15.783 89.605  1.00 40.90  ? 1192 HOH B O   1 
HETATM 5697 O  O   . HOH N 5 .   ? 8.160   11.495 67.625  1.00 28.57  ? 1193 HOH B O   1 
HETATM 5698 O  O   . HOH N 5 .   ? 0.277   26.815 59.929  1.00 38.49  ? 1194 HOH B O   1 
HETATM 5699 O  O   . HOH N 5 .   ? -36.787 35.478 70.668  1.00 43.86  ? 1195 HOH B O   1 
HETATM 5700 O  O   . HOH N 5 .   ? -26.585 43.597 66.180  1.00 33.04  ? 1196 HOH B O   1 
HETATM 5701 O  O   . HOH N 5 .   ? -32.067 20.766 77.377  1.00 37.48  ? 1197 HOH B O   1 
HETATM 5702 O  O   . HOH N 5 .   ? -7.323  20.809 96.519  1.00 36.83  ? 1198 HOH B O   1 
HETATM 5703 O  O   . HOH N 5 .   ? -12.074 43.944 91.881  1.00 38.28  ? 1199 HOH B O   1 
HETATM 5704 O  O   . HOH N 5 .   ? 7.649   25.947 89.773  1.00 33.09  ? 1200 HOH B O   1 
HETATM 5705 O  O   . HOH N 5 .   ? -19.627 27.159 74.138  1.00 28.43  ? 1201 HOH B O   1 
HETATM 5706 O  O   . HOH N 5 .   ? 10.504  42.408 78.051  1.00 40.81  ? 1202 HOH B O   1 
HETATM 5707 O  O   . HOH N 5 .   ? -14.688 13.069 88.492  1.00 32.11  ? 1203 HOH B O   1 
HETATM 5708 O  O   . HOH N 5 .   ? -3.728  17.271 64.999  1.00 42.97  ? 1204 HOH B O   1 
HETATM 5709 O  O   . HOH N 5 .   ? -10.433 42.273 91.165  1.00 38.64  ? 1205 HOH B O   1 
HETATM 5710 O  O   . HOH N 5 .   ? 2.148   44.453 78.248  1.00 45.22  ? 1206 HOH B O   1 
HETATM 5711 O  O   . HOH N 5 .   ? -7.736  48.815 86.431  1.00 32.70  ? 1207 HOH B O   1 
HETATM 5712 O  O   . HOH N 5 .   ? -9.588  37.315 72.349  1.00 42.40  ? 1208 HOH B O   1 
HETATM 5713 O  O   . HOH N 5 .   ? -2.746  45.606 82.636  1.00 37.67  ? 1209 HOH B O   1 
HETATM 5714 O  O   . HOH N 5 .   ? -15.378 33.579 72.479  1.00 39.48  ? 1210 HOH B O   1 
HETATM 5715 O  O   . HOH N 5 .   ? -36.166 33.210 72.969  1.00 29.14  ? 1211 HOH B O   1 
HETATM 5716 O  O   . HOH N 5 .   ? -4.896  11.804 83.520  1.00 44.47  ? 1212 HOH B O   1 
HETATM 5717 O  O   . HOH N 5 .   ? -37.194 44.353 92.333  1.00 49.45  ? 1213 HOH B O   1 
HETATM 5718 O  O   . HOH N 5 .   ? -15.923 12.438 90.976  1.00 40.97  ? 1214 HOH B O   1 
HETATM 5719 O  O   . HOH N 5 .   ? -33.163 28.057 76.869  1.00 38.39  ? 1215 HOH B O   1 
HETATM 5720 O  O   . HOH N 5 .   ? 8.506   26.514 94.037  1.00 32.47  ? 1216 HOH B O   1 
HETATM 5721 O  O   . HOH N 5 .   ? 3.801   16.837 88.364  1.00 42.80  ? 1217 HOH B O   1 
HETATM 5722 O  O   . HOH N 5 .   ? -0.510  10.654 78.622  1.00 43.31  ? 1218 HOH B O   1 
HETATM 5723 O  O   . HOH N 5 .   ? -10.469 10.423 76.674  1.00 41.37  ? 1219 HOH B O   1 
HETATM 5724 O  O   . HOH N 5 .   ? 12.239  25.821 85.822  1.00 32.15  ? 1220 HOH B O   1 
HETATM 5725 O  O   . HOH N 5 .   ? 3.122   28.700 99.111  1.00 37.34  ? 1221 HOH B O   1 
HETATM 5726 O  O   . HOH N 5 .   ? 8.410   46.706 80.233  1.00 37.65  ? 1222 HOH B O   1 
HETATM 5727 O  O   . HOH N 5 .   ? 0.499   14.848 88.445  1.00 47.43  ? 1223 HOH B O   1 
HETATM 5728 O  O   . HOH N 5 .   ? -4.053  35.453 61.869  1.00 33.46  ? 1224 HOH B O   1 
HETATM 5729 O  O   . HOH N 5 .   ? 3.946   19.448 63.477  1.00 44.98  ? 1225 HOH B O   1 
HETATM 5730 O  O   . HOH N 5 .   ? 1.636   44.554 80.713  1.00 49.94  ? 1226 HOH B O   1 
HETATM 5731 O  O   . HOH N 5 .   ? -21.987 40.383 95.774  1.00 37.28  ? 1227 HOH B O   1 
HETATM 5732 O  O   . HOH N 5 .   ? -34.458 30.167 74.715  1.00 50.24  ? 1228 HOH B O   1 
HETATM 5733 O  O   . HOH N 5 .   ? -9.717  13.875 86.582  1.00 18.15  ? 1229 HOH B O   1 
HETATM 5734 O  O   . HOH N 5 .   ? 10.536  25.195 67.894  1.00 21.00  ? 1230 HOH B O   1 
HETATM 5735 O  O   . HOH N 5 .   ? -26.028 12.888 81.611  1.00 21.64  ? 1231 HOH B O   1 
HETATM 5736 O  O   . HOH N 5 .   ? 9.312   11.620 74.584  1.00 26.10  ? 1232 HOH B O   1 
HETATM 5737 O  O   . HOH N 5 .   ? 9.187   13.552 72.820  1.00 24.30  ? 1233 HOH B O   1 
HETATM 5738 O  O   . HOH N 5 .   ? -30.343 34.003 65.991  1.00 29.80  ? 1234 HOH B O   1 
HETATM 5739 O  O   . HOH N 5 .   ? -26.676 32.289 66.976  1.00 49.32  ? 1235 HOH B O   1 
HETATM 5740 O  O   . HOH N 5 .   ? -2.536  36.955 89.642  1.00 40.65  ? 1236 HOH B O   1 
HETATM 5741 O  O   . HOH N 5 .   ? -10.556 45.844 73.687  1.00 45.96  ? 1237 HOH B O   1 
HETATM 5742 O  O   . HOH N 5 .   ? -29.577 20.383 69.613  1.00 41.74  ? 1238 HOH B O   1 
HETATM 5743 O  O   . HOH N 5 .   ? 13.155  28.635 83.784  1.00 39.13  ? 1239 HOH B O   1 
HETATM 5744 O  O   . HOH N 5 .   ? 8.808   10.110 69.066  1.00 39.37  ? 1240 HOH B O   1 
HETATM 5745 O  O   . HOH N 5 .   ? -23.973 15.794 89.367  1.00 32.08  ? 1241 HOH B O   1 
HETATM 5746 O  O   . HOH N 5 .   ? 10.512  27.777 92.545  1.00 40.73  ? 1242 HOH B O   1 
HETATM 5747 O  O   . HOH N 5 .   ? 7.573   9.550  77.829  1.00 40.84  ? 1243 HOH B O   1 
HETATM 5748 O  O   . HOH N 5 .   ? -4.407  13.525 86.266  1.00 47.33  ? 1244 HOH B O   1 
HETATM 5749 O  O   . HOH N 5 .   ? -3.529  42.434 92.500  1.00 46.05  ? 1245 HOH B O   1 
HETATM 5750 O  O   . HOH N 5 .   ? -36.099 28.317 89.323  1.00 44.44  ? 1246 HOH B O   1 
HETATM 5751 O  O   . HOH N 5 .   ? -26.668 31.541 79.510  1.00 18.96  ? 1247 HOH B O   1 
HETATM 5752 O  O   . HOH N 5 .   ? -6.644  23.998 85.048  1.00 16.37  ? 1248 HOH B O   1 
HETATM 5753 O  O   . HOH N 5 .   ? 7.540   11.943 84.161  1.00 18.10  ? 1249 HOH B O   1 
HETATM 5754 O  O   . HOH N 5 .   ? -14.396 10.483 83.446  1.00 18.30  ? 1250 HOH B O   1 
HETATM 5755 O  O   . HOH N 5 .   ? -8.319  33.589 97.115  1.00 17.00  ? 1251 HOH B O   1 
HETATM 5756 O  O   . HOH N 5 .   ? -21.373 13.356 77.797  1.00 18.63  ? 1252 HOH B O   1 
HETATM 5757 O  O   . HOH N 5 .   ? -25.130 39.992 72.222  1.00 20.00  ? 1253 HOH B O   1 
HETATM 5758 O  O   . HOH N 5 .   ? -6.249  24.333 98.417  1.00 20.77  ? 1254 HOH B O   1 
HETATM 5759 O  O   . HOH N 5 .   ? -11.410 14.520 78.894  1.00 22.48  ? 1255 HOH B O   1 
HETATM 5760 O  O   . HOH N 5 .   ? 6.938   14.903 72.968  1.00 19.94  ? 1256 HOH B O   1 
HETATM 5761 O  O   . HOH N 5 .   ? -14.229 12.759 79.233  1.00 15.16  ? 1257 HOH B O   1 
HETATM 5762 O  O   . HOH N 5 .   ? -15.601 21.563 65.085  1.00 46.77  ? 1258 HOH B O   1 
HETATM 5763 O  O   . HOH N 5 .   ? -16.258 33.208 84.496  1.00 25.30  ? 1259 HOH B O   1 
HETATM 5764 O  O   . HOH N 5 .   ? -12.859 29.122 80.157  1.00 30.14  ? 1260 HOH B O   1 
HETATM 5765 O  O   . HOH N 5 .   ? -6.808  12.392 89.676  1.00 44.16  ? 1261 HOH B O   1 
HETATM 5766 O  O   . HOH N 5 .   ? 3.593   9.884  73.551  1.00 39.03  ? 1262 HOH B O   1 
HETATM 5767 O  O   . HOH N 5 .   ? 6.184   11.788 86.766  1.00 32.98  ? 1263 HOH B O   1 
HETATM 5768 O  O   . HOH N 5 .   ? -19.683 45.928 86.879  1.00 42.86  ? 1264 HOH B O   1 
HETATM 5769 O  O   . HOH N 5 .   ? -12.361 20.785 68.416  1.00 49.70  ? 1265 HOH B O   1 
HETATM 5770 O  O   . HOH N 5 .   ? 18.561  31.628 79.634  1.00 45.11  ? 1266 HOH B O   1 
HETATM 5771 O  O   . HOH N 5 .   ? -25.391 41.128 94.383  1.00 43.39  ? 1267 HOH B O   1 
HETATM 5772 O  O   . HOH N 5 .   ? 9.065   15.634 65.566  1.00 43.82  ? 1268 HOH B O   1 
HETATM 5773 O  O   . HOH N 5 .   ? -41.255 46.387 80.356  1.00 43.28  ? 1269 HOH B O   1 
HETATM 5774 O  O   . HOH N 5 .   ? -22.946 34.828 70.407  1.00 47.69  ? 1270 HOH B O   1 
HETATM 5775 O  O   . HOH N 5 .   ? -1.445  47.337 68.552  1.00 49.55  ? 1271 HOH B O   1 
HETATM 5776 O  O   . HOH N 5 .   ? -1.124  40.539 98.577  1.00 52.04  ? 1272 HOH B O   1 
HETATM 5777 O  O   . HOH N 5 .   ? -3.939  28.011 62.686  1.00 41.49  ? 1273 HOH B O   1 
HETATM 5778 O  O   . HOH N 5 .   ? -10.548 12.343 71.370  1.00 44.39  ? 1274 HOH B O   1 
HETATM 5779 O  O   . HOH N 5 .   ? -37.077 33.333 62.223  1.00 28.73  ? 1275 HOH B O   1 
HETATM 5780 O  O   . HOH N 5 .   ? 1.898   25.188 88.247  1.00 20.16  ? 1276 HOH B O   1 
HETATM 5781 O  O   . HOH N 5 .   ? 12.523  22.430 81.159  1.00 21.89  ? 1277 HOH B O   1 
HETATM 5782 O  O   . HOH N 5 .   ? -16.222 15.038 87.172  1.00 23.91  ? 1278 HOH B O   1 
HETATM 5783 O  O   . HOH N 5 .   ? -9.776  18.484 92.341  1.00 23.42  ? 1279 HOH B O   1 
HETATM 5784 O  O   . HOH N 5 .   ? -4.648  13.218 79.024  1.00 24.97  ? 1280 HOH B O   1 
HETATM 5785 O  O   . HOH N 5 .   ? -21.587 21.398 87.090  1.00 24.88  ? 1281 HOH B O   1 
HETATM 5786 O  O   . HOH N 5 .   ? -40.345 31.999 81.559  1.00 36.53  ? 1282 HOH B O   1 
HETATM 5787 O  O   . HOH N 5 .   ? -20.195 40.114 94.186  1.00 32.42  ? 1283 HOH B O   1 
HETATM 5788 O  O   . HOH N 5 .   ? 11.537  21.175 79.686  1.00 25.92  ? 1284 HOH B O   1 
HETATM 5789 O  O   . HOH N 5 .   ? 4.422   21.029 86.807  1.00 24.79  ? 1285 HOH B O   1 
HETATM 5790 O  O   . HOH N 5 .   ? -18.629 42.491 93.991  1.00 35.46  ? 1286 HOH B O   1 
HETATM 5791 O  O   . HOH N 5 .   ? 11.657  20.352 88.130  1.00 35.39  ? 1287 HOH B O   1 
HETATM 5792 O  O   . HOH N 5 .   ? 13.503  32.403 82.490  1.00 30.41  ? 1288 HOH B O   1 
HETATM 5793 O  O   . HOH N 5 .   ? 4.888   16.830 63.882  1.00 27.04  ? 1289 HOH B O   1 
HETATM 5794 O  O   . HOH N 5 .   ? -7.197  14.261 87.490  1.00 32.71  ? 1290 HOH B O   1 
HETATM 5795 O  O   . HOH N 5 .   ? 1.579   13.334 86.117  1.00 35.62  ? 1291 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   LEU 2   2   2   LEU LEU A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   GLN 6   6   6   GLN GLN A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  TYR 11  11  11  TYR TYR A . n 
A 1 12  ILE 12  12  12  ILE ILE A . n 
A 1 13  GLN 13  13  13  GLN GLN A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  ASN 16  16  16  ASN ASN A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  SER 27  27  27  SER SER A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  TYR 32  32  32  TYR TYR A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  ASP 37  37  37  ASP ASP A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  MET 41  41  41  MET MET A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  MET 49  49  49  MET MET A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  GLN 53  53  53  GLN GLN A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  HIS 55  55  55  HIS HIS A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  HIS 59  59  59  HIS HIS A . n 
A 1 60  HIS 60  60  60  HIS HIS A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  CYS 68  68  68  CYS CYS A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  HIS 70  70  70  HIS HIS A . n 
A 1 71  LYS 71  71  71  LYS LYS A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  ARG 75  75  75  ARG ARG A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  HIS 83  83  83  HIS HIS A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  CYS 85  85  85  CYS CYS A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 HIS 105 105 105 HIS HIS A . n 
A 1 106 TYR 106 106 106 TYR TYR A . n 
A 1 107 GLN 107 107 107 GLN GLN A . n 
A 1 108 GLN 108 108 108 GLN GLN A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 ILE 117 117 117 ILE ILE A . n 
A 1 118 ALA 118 118 118 ALA ALA A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 PRO 123 123 123 PRO PRO A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 SER 128 128 128 SER SER A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 ILE 130 130 130 ILE ILE A . n 
A 1 131 TYR 131 131 131 TYR TYR A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 GLN 134 134 134 GLN GLN A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 TYR 140 140 140 TYR TYR A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 PRO 147 147 147 PRO PRO A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 MET 152 152 152 MET MET A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 VAL 154 154 154 VAL VAL A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 ILE 157 157 157 ILE ILE A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 PRO 161 161 161 PRO PRO A . n 
A 1 162 VAL 162 162 162 VAL VAL A . n 
A 1 163 ARG 163 163 163 ARG ARG A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 VAL 166 166 166 VAL VAL A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 MET 169 169 169 MET MET A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 ASP 171 171 171 ASP ASP A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 TYR 176 176 176 TYR TYR A . n 
A 1 177 PHE 177 177 177 PHE PHE A . n 
A 1 178 GLU 178 178 178 GLU GLU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 GLN 180 180 180 GLN GLN A . n 
A 1 181 ALA 181 181 181 ALA ALA A . n 
A 1 182 CYS 182 182 182 CYS CYS A . n 
A 1 183 PHE 183 183 183 PHE PHE A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 ALA 185 185 185 ALA ALA A . n 
A 1 186 GLN 186 186 186 GLN GLN A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 THR 188 188 188 THR THR A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 MET 190 190 190 MET MET A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 LYS 194 194 194 LYS LYS A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 THR 196 196 196 THR THR A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 SER 201 201 201 SER SER A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 ARG 204 204 204 ARG ARG A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 CYS 206 206 206 CYS CYS A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 ASP 208 208 208 ASP ASP A . n 
A 1 209 THR 209 209 209 THR THR A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 GLU 213 213 213 GLU GLU A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 LYS 216 216 216 LYS LYS A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 LYS 218 218 218 LYS LYS A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 ALA 220 220 220 ALA ALA A . n 
A 1 221 VAL 221 221 221 VAL VAL A . n 
A 1 222 GLU 222 222 222 GLU GLU A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 GLY 224 224 224 GLY GLY A . n 
A 1 225 VAL 225 225 225 VAL VAL A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 THR 227 227 227 THR THR A . n 
A 1 228 GLU 228 228 228 GLU GLU A . n 
A 1 229 ALA 229 229 229 ALA ALA A . n 
A 1 230 VAL 230 230 230 VAL VAL A . n 
A 1 231 GLU 231 231 231 GLU GLU A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 ILE 233 233 233 ILE ILE A . n 
A 1 234 ILE 234 234 234 ILE ILE A . n 
A 1 235 GLU 235 235 235 GLU GLU A . n 
A 1 236 ALA 236 236 236 ALA ALA A . n 
A 1 237 ASN 237 237 237 ASN ASN A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 TYR 239 239 239 TYR TYR A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 ILE 243 243 243 ILE ILE A . n 
A 1 244 GLY 244 244 244 GLY GLY A . n 
A 1 245 PHE 245 245 245 PHE PHE A . n 
A 1 246 GLU 246 246 246 GLU GLU A . n 
A 1 247 SER 247 247 247 SER SER A . n 
A 1 248 SER 248 248 248 SER SER A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 ALA 251 251 251 ALA ALA A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 HIS 254 254 254 HIS HIS A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 ILE 256 256 256 ILE ILE A . n 
A 1 257 HIS 257 257 257 HIS HIS A . n 
A 1 258 ASN 258 258 258 ASN ASN A . n 
A 1 259 GLY 259 259 259 GLY GLY A . n 
A 1 260 PHE 260 260 260 PHE PHE A . n 
A 1 261 THR 261 261 261 THR THR A . n 
A 1 262 VAL 262 262 262 VAL VAL A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 GLU 265 265 265 GLU GLU A . n 
A 1 266 CYS 266 266 266 CYS CYS A . n 
A 1 267 HIS 267 267 267 HIS HIS A . n 
A 1 268 HIS 268 268 268 HIS HIS A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 TYR 270 270 270 TYR TYR A . n 
A 1 271 HIS 271 271 271 HIS HIS A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LYS 274 274 274 LYS LYS A . n 
A 1 275 VAL 275 275 275 VAL VAL A . n 
A 1 276 ALA 276 276 276 ALA ALA A . n 
A 1 277 PHE 277 277 277 PHE PHE A . n 
A 1 278 GLY 278 278 278 GLY GLY A . n 
A 1 279 THR 279 279 279 THR THR A . n 
A 1 280 LEU 280 280 280 LEU LEU A . n 
A 1 281 ALA 281 281 281 ALA ALA A . n 
A 1 282 GLN 282 282 282 GLN GLN A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 VAL 284 284 284 VAL VAL A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 GLN 286 286 286 GLN GLN A . n 
A 1 287 ASN 287 287 287 ASN ASN A . n 
A 1 288 SER 288 288 288 SER SER A . n 
A 1 289 PRO 289 289 289 PRO PRO A . n 
A 1 290 MET 290 290 290 MET MET A . n 
A 1 291 ALA 291 291 291 ALA ALA A . n 
A 1 292 GLN 292 292 292 GLN GLN A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 GLU 294 294 294 GLU GLU A . n 
A 1 295 THR 295 295 295 THR THR A . n 
A 1 296 VAL 296 296 296 VAL VAL A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 CYS 300 300 300 CYS CYS A . n 
A 1 301 HIS 301 301 301 HIS HIS A . n 
A 1 302 ARG 302 302 302 ARG ARG A . n 
A 1 303 ILE 303 303 303 ILE ILE A . n 
A 1 304 GLY 304 304 304 GLY GLY A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 PRO 306 306 306 PRO PRO A . n 
A 1 307 ILE 307 307 307 ILE ILE A . n 
A 1 308 THR 308 308 308 THR THR A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ALA 310 310 310 ALA ALA A . n 
A 1 311 GLU 311 311 311 GLU GLU A . n 
A 1 312 MET 312 312 312 MET MET A . n 
A 1 313 GLY 313 313 313 GLY GLY A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 SER 315 315 315 SER SER A . n 
A 1 316 GLY 316 316 316 GLY GLY A . n 
A 1 317 ASP 317 317 317 ASP ASP A . n 
A 1 318 ALA 318 318 318 ALA ALA A . n 
A 1 319 VAL 319 319 319 VAL VAL A . n 
A 1 320 GLU 320 320 320 GLU GLU A . n 
A 1 321 LYS 321 321 321 LYS LYS A . n 
A 1 322 ILE 322 322 322 ILE ILE A . n 
A 1 323 MET 323 323 323 MET MET A . n 
A 1 324 ALA 324 324 324 ALA ALA A . n 
A 1 325 VAL 325 325 325 VAL VAL A . n 
A 1 326 ALA 326 326 326 ALA ALA A . n 
A 1 327 GLN 327 327 327 GLN GLN A . n 
A 1 328 ALA 328 328 328 ALA ALA A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 CYS 330 330 330 CYS CYS A . n 
A 1 331 ALA 331 331 331 ALA ALA A . n 
A 1 332 ALA 332 332 332 ALA ALA A . n 
A 1 333 GLY 333 333 333 GLY GLY A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 THR 335 335 335 THR THR A . n 
A 1 336 ILE 336 336 336 ILE ILE A . n 
A 1 337 HIS 337 337 337 HIS HIS A . n 
A 1 338 ASN 338 338 338 ASN ASN A . n 
A 1 339 MET 339 339 339 MET MET A . n 
A 1 340 PRO 340 340 340 PRO PRO A . n 
A 1 341 PHE 341 341 341 PHE PHE A . n 
A 1 342 LYS 342 342 342 LYS LYS A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 THR 344 344 344 THR THR A . n 
A 1 345 PRO 345 345 345 PRO PRO A . n 
A 1 346 ALA 346 346 346 ALA ALA A . n 
A 1 347 GLY 347 347 347 GLY GLY A . n 
A 1 348 VAL 348 348 348 VAL VAL A . n 
A 1 349 GLN 349 349 349 GLN GLN A . n 
A 1 350 ALA 350 350 350 ALA ALA A . n 
A 1 351 ALA 351 351 351 ALA ALA A . n 
A 1 352 ILE 352 352 352 ILE ILE A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 THR 354 354 354 THR THR A . n 
A 1 355 ALA 355 355 355 ALA ALA A . n 
A 1 356 ASP 356 356 356 ASP ASP A . n 
A 1 357 ARG 357 357 357 ARG ARG A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 GLY 359 359 359 GLY GLY A . n 
A 1 360 SER 360 360 360 SER SER A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 TRP 362 362 362 TRP TRP A . n 
A 1 363 LEU 363 363 363 LEU LEU A . n 
A 1 364 GLN 364 364 364 GLN GLN A . n 
A 1 365 GLN 365 365 365 GLN GLN A . n 
A 1 366 HIS 366 366 366 HIS HIS A . n 
A 1 367 GLN 367 367 367 GLN GLN A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   LEU 2   2   2   LEU LEU B . n 
B 1 3   ARG 3   3   3   ARG ARG B . n 
B 1 4   ILE 4   4   4   ILE ILE B . n 
B 1 5   ILE 5   5   5   ILE ILE B . n 
B 1 6   GLN 6   6   6   GLN GLN B . n 
B 1 7   SER 7   7   7   SER SER B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   GLY 9   9   9   GLY GLY B . n 
B 1 10  LYS 10  10  10  LYS LYS B . n 
B 1 11  TYR 11  11  11  TYR TYR B . n 
B 1 12  ILE 12  12  12  ILE ILE B . n 
B 1 13  GLN 13  13  13  GLN GLN B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  ALA 15  15  15  ALA ALA B . n 
B 1 16  ASN 16  16  16  ASN ASN B . n 
B 1 17  ALA 17  17  17  ALA ALA B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  ALA 19  19  19  ALA ALA B . n 
B 1 20  ALA 20  20  20  ALA ALA B . n 
B 1 21  VAL 21  21  21  VAL VAL B . n 
B 1 22  GLY 22  22  22  GLY GLY B . n 
B 1 23  GLN 23  23  23  GLN GLN B . n 
B 1 24  TYR 24  24  24  TYR TYR B . n 
B 1 25  ALA 25  25  25  ALA ALA B . n 
B 1 26  LYS 26  26  26  LYS LYS B . n 
B 1 27  SER 27  27  27  SER SER B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  ALA 29  29  29  ALA ALA B . n 
B 1 30  ASP 30  30  30  ASP ASP B . n 
B 1 31  HIS 31  31  31  HIS HIS B . n 
B 1 32  TYR 32  32  32  TYR TYR B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  VAL 34  34  34  VAL VAL B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  ASP 37  37  37  ASP ASP B . n 
B 1 38  ASP 38  38  38  ASP ASP B . n 
B 1 39  PHE 39  39  39  PHE PHE B . n 
B 1 40  VAL 40  40  40  VAL VAL B . n 
B 1 41  MET 41  41  41  MET MET B . n 
B 1 42  LYS 42  42  42  LYS LYS B . n 
B 1 43  LEU 43  43  43  LEU LEU B . n 
B 1 44  ALA 44  44  44  ALA ALA B . n 
B 1 45  GLY 45  45  45  GLY GLY B . n 
B 1 46  ASP 46  46  46  ASP ASP B . n 
B 1 47  THR 47  47  47  THR THR B . n 
B 1 48  LEU 48  48  48  LEU LEU B . n 
B 1 49  MET 49  49  49  MET MET B . n 
B 1 50  GLY 50  50  50  GLY GLY B . n 
B 1 51  SER 51  51  51  SER SER B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  GLN 53  53  53  GLN GLN B . n 
B 1 54  GLN 54  54  54  GLN GLN B . n 
B 1 55  HIS 55  55  55  HIS HIS B . n 
B 1 56  GLY 56  56  56  GLY GLY B . n 
B 1 57  VAL 57  57  57  VAL VAL B . n 
B 1 58  LYS 58  58  58  LYS LYS B . n 
B 1 59  HIS 59  59  59  HIS HIS B . n 
B 1 60  HIS 60  60  60  HIS HIS B . n 
B 1 61  ALA 61  61  61  ALA ALA B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  PHE 64  64  64  PHE PHE B . n 
B 1 65  ASN 65  65  65  ASN ASN B . n 
B 1 66  GLY 66  66  66  GLY GLY B . n 
B 1 67  GLU 67  67  ?   ?   ?   B . n 
B 1 68  CYS 68  68  ?   ?   ?   B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  HIS 70  70  70  HIS HIS B . n 
B 1 71  LYS 71  71  71  LYS LYS B . n 
B 1 72  GLU 72  72  72  GLU GLU B . n 
B 1 73  ILE 73  73  73  ILE ILE B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  ARG 75  75  75  ARG ARG B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  ARG 78  78  78  ARG ARG B . n 
B 1 79  GLU 79  79  79  GLU GLU B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  LYS 81  81  81  LYS LYS B . n 
B 1 82  ALA 82  82  82  ALA ALA B . n 
B 1 83  HIS 83  83  83  HIS HIS B . n 
B 1 84  GLY 84  84  84  GLY GLY B . n 
B 1 85  CYS 85  85  85  CYS CYS B . n 
B 1 86  ARG 86  86  86  ARG ARG B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  VAL 88  88  88  VAL VAL B . n 
B 1 89  ILE 89  89  89  ILE ILE B . n 
B 1 90  GLY 90  90  90  GLY GLY B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  GLY 92  92  92  GLY GLY B . n 
B 1 93  GLY 93  93  93  GLY GLY B . n 
B 1 94  GLY 94  94  94  GLY GLY B . n 
B 1 95  LYS 95  95  95  LYS LYS B . n 
B 1 96  THR 96  96  96  THR THR B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  ASP 98  98  98  ASP ASP B . n 
B 1 99  THR 99  99  99  THR THR B . n 
B 1 100 ALA 100 100 100 ALA ALA B . n 
B 1 101 LYS 101 101 101 LYS LYS B . n 
B 1 102 ALA 102 102 102 ALA ALA B . n 
B 1 103 ILE 103 103 103 ILE ILE B . n 
B 1 104 ALA 104 104 104 ALA ALA B . n 
B 1 105 HIS 105 105 105 HIS HIS B . n 
B 1 106 TYR 106 106 106 TYR TYR B . n 
B 1 107 GLN 107 107 107 GLN GLN B . n 
B 1 108 GLN 108 108 108 GLN GLN B . n 
B 1 109 LEU 109 109 109 LEU LEU B . n 
B 1 110 PRO 110 110 110 PRO PRO B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 VAL 112 112 112 VAL VAL B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 ILE 114 114 114 ILE ILE B . n 
B 1 115 PRO 115 115 115 PRO PRO B . n 
B 1 116 THR 116 116 116 THR THR B . n 
B 1 117 ILE 117 117 117 ILE ILE B . n 
B 1 118 ALA 118 118 118 ALA ALA B . n 
B 1 119 SER 119 119 119 SER SER B . n 
B 1 120 THR 120 120 120 THR THR B . n 
B 1 121 ASP 121 121 121 ASP ASP B . n 
B 1 122 ALA 122 122 122 ALA ALA B . n 
B 1 123 PRO 123 123 123 PRO PRO B . n 
B 1 124 THR 124 124 124 THR THR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 ALA 126 126 126 ALA ALA B . n 
B 1 127 LEU 127 127 127 LEU LEU B . n 
B 1 128 SER 128 128 128 SER SER B . n 
B 1 129 VAL 129 129 129 VAL VAL B . n 
B 1 130 ILE 130 130 130 ILE ILE B . n 
B 1 131 TYR 131 131 131 TYR TYR B . n 
B 1 132 THR 132 132 132 THR THR B . n 
B 1 133 GLU 133 133 133 GLU GLU B . n 
B 1 134 GLN 134 134 134 GLN GLN B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 GLU 136 136 136 GLU GLU B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 ALA 138 138 138 ALA ALA B . n 
B 1 139 GLU 139 139 139 GLU GLU B . n 
B 1 140 TYR 140 140 140 TYR TYR B . n 
B 1 141 LEU 141 141 141 LEU LEU B . n 
B 1 142 ILE 142 142 142 ILE ILE B . n 
B 1 143 TYR 143 143 143 TYR TYR B . n 
B 1 144 PRO 144 144 144 PRO PRO B . n 
B 1 145 ARG 145 145 145 ARG ARG B . n 
B 1 146 ASN 146 146 146 ASN ASN B . n 
B 1 147 PRO 147 147 147 PRO PRO B . n 
B 1 148 ASP 148 148 148 ASP ASP B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 VAL 150 150 150 VAL VAL B . n 
B 1 151 VAL 151 151 151 VAL VAL B . n 
B 1 152 MET 152 152 152 MET MET B . n 
B 1 153 ASP 153 153 153 ASP ASP B . n 
B 1 154 VAL 154 154 154 VAL VAL B . n 
B 1 155 ALA 155 155 155 ALA ALA B . n 
B 1 156 ILE 156 156 156 ILE ILE B . n 
B 1 157 ILE 157 157 157 ILE ILE B . n 
B 1 158 ALA 158 158 158 ALA ALA B . n 
B 1 159 LYS 159 159 159 LYS LYS B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 PRO 161 161 161 PRO PRO B . n 
B 1 162 VAL 162 162 162 VAL VAL B . n 
B 1 163 ARG 163 163 163 ARG ARG B . n 
B 1 164 LEU 164 164 164 LEU LEU B . n 
B 1 165 LEU 165 165 165 LEU LEU B . n 
B 1 166 VAL 166 166 166 VAL VAL B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 GLY 168 168 168 GLY GLY B . n 
B 1 169 MET 169 169 169 MET MET B . n 
B 1 170 GLY 170 170 170 GLY GLY B . n 
B 1 171 ASP 171 171 171 ASP ASP B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 SER 174 174 174 SER SER B . n 
B 1 175 THR 175 175 175 THR THR B . n 
B 1 176 TYR 176 176 176 TYR TYR B . n 
B 1 177 PHE 177 177 177 PHE PHE B . n 
B 1 178 GLU 178 178 178 GLU GLU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 GLN 180 180 180 GLN GLN B . n 
B 1 181 ALA 181 181 181 ALA ALA B . n 
B 1 182 CYS 182 182 182 CYS CYS B . n 
B 1 183 PHE 183 183 183 PHE PHE B . n 
B 1 184 ASP 184 184 184 ASP ASP B . n 
B 1 185 ALA 185 185 185 ALA ALA B . n 
B 1 186 GLN 186 186 186 GLN GLN B . n 
B 1 187 ALA 187 187 187 ALA ALA B . n 
B 1 188 THR 188 188 188 THR THR B . n 
B 1 189 SER 189 189 189 SER SER B . n 
B 1 190 MET 190 190 190 MET MET B . n 
B 1 191 ALA 191 191 191 ALA ALA B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 GLY 193 193 193 GLY GLY B . n 
B 1 194 LYS 194 194 194 LYS LYS B . n 
B 1 195 SER 195 195 195 SER SER B . n 
B 1 196 THR 196 196 196 THR THR B . n 
B 1 197 LEU 197 197 197 LEU LEU B . n 
B 1 198 ALA 198 198 198 ALA ALA B . n 
B 1 199 ALA 199 199 199 ALA ALA B . n 
B 1 200 LEU 200 200 200 LEU LEU B . n 
B 1 201 SER 201 201 201 SER SER B . n 
B 1 202 LEU 202 202 202 LEU LEU B . n 
B 1 203 ALA 203 203 203 ALA ALA B . n 
B 1 204 ARG 204 204 204 ARG ARG B . n 
B 1 205 LEU 205 205 205 LEU LEU B . n 
B 1 206 CYS 206 206 206 CYS CYS B . n 
B 1 207 TYR 207 207 207 TYR TYR B . n 
B 1 208 ASP 208 208 208 ASP ASP B . n 
B 1 209 THR 209 209 209 THR THR B . n 
B 1 210 LEU 210 210 210 LEU LEU B . n 
B 1 211 LEU 211 211 211 LEU LEU B . n 
B 1 212 ALA 212 212 212 ALA ALA B . n 
B 1 213 GLU 213 213 213 GLU GLU B . n 
B 1 214 GLY 214 214 214 GLY GLY B . n 
B 1 215 VAL 215 215 215 VAL VAL B . n 
B 1 216 LYS 216 216 216 LYS LYS B . n 
B 1 217 ALA 217 217 217 ALA ALA B . n 
B 1 218 LYS 218 218 218 LYS LYS B . n 
B 1 219 LEU 219 219 219 LEU LEU B . n 
B 1 220 ALA 220 220 220 ALA ALA B . n 
B 1 221 VAL 221 221 221 VAL VAL B . n 
B 1 222 GLU 222 222 222 GLU GLU B . n 
B 1 223 ALA 223 223 223 ALA ALA B . n 
B 1 224 GLY 224 224 224 GLY GLY B . n 
B 1 225 VAL 225 225 225 VAL VAL B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 THR 227 227 227 THR THR B . n 
B 1 228 GLU 228 228 228 GLU GLU B . n 
B 1 229 ALA 229 229 229 ALA ALA B . n 
B 1 230 VAL 230 230 230 VAL VAL B . n 
B 1 231 GLU 231 231 231 GLU GLU B . n 
B 1 232 ARG 232 232 232 ARG ARG B . n 
B 1 233 ILE 233 233 233 ILE ILE B . n 
B 1 234 ILE 234 234 234 ILE ILE B . n 
B 1 235 GLU 235 235 235 GLU GLU B . n 
B 1 236 ALA 236 236 236 ALA ALA B . n 
B 1 237 ASN 237 237 237 ASN ASN B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 TYR 239 239 239 TYR TYR B . n 
B 1 240 LEU 240 240 240 LEU LEU B . n 
B 1 241 SER 241 241 241 SER SER B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 ILE 243 243 243 ILE ILE B . n 
B 1 244 GLY 244 244 244 GLY GLY B . n 
B 1 245 PHE 245 245 245 PHE PHE B . n 
B 1 246 GLU 246 246 246 GLU GLU B . n 
B 1 247 SER 247 247 247 SER SER B . n 
B 1 248 SER 248 248 248 SER SER B . n 
B 1 249 GLY 249 249 249 GLY GLY B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 ALA 251 251 251 ALA ALA B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ALA 253 253 253 ALA ALA B . n 
B 1 254 HIS 254 254 254 HIS HIS B . n 
B 1 255 ALA 255 255 255 ALA ALA B . n 
B 1 256 ILE 256 256 256 ILE ILE B . n 
B 1 257 HIS 257 257 257 HIS HIS B . n 
B 1 258 ASN 258 258 258 ASN ASN B . n 
B 1 259 GLY 259 259 259 GLY GLY B . n 
B 1 260 PHE 260 260 260 PHE PHE B . n 
B 1 261 THR 261 261 261 THR THR B . n 
B 1 262 VAL 262 262 262 VAL VAL B . n 
B 1 263 LEU 263 263 263 LEU LEU B . n 
B 1 264 GLU 264 264 264 GLU GLU B . n 
B 1 265 GLU 265 265 265 GLU GLU B . n 
B 1 266 CYS 266 266 266 CYS CYS B . n 
B 1 267 HIS 267 267 267 HIS HIS B . n 
B 1 268 HIS 268 268 268 HIS HIS B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 TYR 270 270 270 TYR TYR B . n 
B 1 271 HIS 271 271 271 HIS HIS B . n 
B 1 272 GLY 272 272 272 GLY GLY B . n 
B 1 273 GLU 273 273 273 GLU GLU B . n 
B 1 274 LYS 274 274 274 LYS LYS B . n 
B 1 275 VAL 275 275 275 VAL VAL B . n 
B 1 276 ALA 276 276 276 ALA ALA B . n 
B 1 277 PHE 277 277 277 PHE PHE B . n 
B 1 278 GLY 278 278 278 GLY GLY B . n 
B 1 279 THR 279 279 279 THR THR B . n 
B 1 280 LEU 280 280 280 LEU LEU B . n 
B 1 281 ALA 281 281 281 ALA ALA B . n 
B 1 282 GLN 282 282 282 GLN GLN B . n 
B 1 283 LEU 283 283 283 LEU LEU B . n 
B 1 284 VAL 284 284 284 VAL VAL B . n 
B 1 285 LEU 285 285 285 LEU LEU B . n 
B 1 286 GLN 286 286 286 GLN GLN B . n 
B 1 287 ASN 287 287 287 ASN ASN B . n 
B 1 288 SER 288 288 288 SER SER B . n 
B 1 289 PRO 289 289 289 PRO PRO B . n 
B 1 290 MET 290 290 290 MET MET B . n 
B 1 291 ALA 291 291 291 ALA ALA B . n 
B 1 292 GLN 292 292 292 GLN GLN B . n 
B 1 293 ILE 293 293 293 ILE ILE B . n 
B 1 294 GLU 294 294 294 GLU GLU B . n 
B 1 295 THR 295 295 295 THR THR B . n 
B 1 296 VAL 296 296 296 VAL VAL B . n 
B 1 297 LEU 297 297 297 LEU LEU B . n 
B 1 298 ALA 298 298 298 ALA ALA B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 CYS 300 300 300 CYS CYS B . n 
B 1 301 HIS 301 301 301 HIS HIS B . n 
B 1 302 ARG 302 302 302 ARG ARG B . n 
B 1 303 ILE 303 303 303 ILE ILE B . n 
B 1 304 GLY 304 304 304 GLY GLY B . n 
B 1 305 LEU 305 305 305 LEU LEU B . n 
B 1 306 PRO 306 306 306 PRO PRO B . n 
B 1 307 ILE 307 307 307 ILE ILE B . n 
B 1 308 THR 308 308 308 THR THR B . n 
B 1 309 LEU 309 309 309 LEU LEU B . n 
B 1 310 ALA 310 310 310 ALA ALA B . n 
B 1 311 GLU 311 311 311 GLU GLU B . n 
B 1 312 MET 312 312 312 MET MET B . n 
B 1 313 GLY 313 313 313 GLY GLY B . n 
B 1 314 VAL 314 314 314 VAL VAL B . n 
B 1 315 SER 315 315 315 SER SER B . n 
B 1 316 GLY 316 316 316 GLY GLY B . n 
B 1 317 ASP 317 317 317 ASP ASP B . n 
B 1 318 ALA 318 318 318 ALA ALA B . n 
B 1 319 VAL 319 319 319 VAL VAL B . n 
B 1 320 GLU 320 320 320 GLU GLU B . n 
B 1 321 LYS 321 321 321 LYS LYS B . n 
B 1 322 ILE 322 322 322 ILE ILE B . n 
B 1 323 MET 323 323 323 MET MET B . n 
B 1 324 ALA 324 324 324 ALA ALA B . n 
B 1 325 VAL 325 325 325 VAL VAL B . n 
B 1 326 ALA 326 326 326 ALA ALA B . n 
B 1 327 GLN 327 327 327 GLN GLN B . n 
B 1 328 ALA 328 328 328 ALA ALA B . n 
B 1 329 SER 329 329 329 SER SER B . n 
B 1 330 CYS 330 330 330 CYS CYS B . n 
B 1 331 ALA 331 331 331 ALA ALA B . n 
B 1 332 ALA 332 332 332 ALA ALA B . n 
B 1 333 GLY 333 333 333 GLY GLY B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 THR 335 335 335 THR THR B . n 
B 1 336 ILE 336 336 336 ILE ILE B . n 
B 1 337 HIS 337 337 337 HIS HIS B . n 
B 1 338 ASN 338 338 338 ASN ASN B . n 
B 1 339 MET 339 339 339 MET MET B . n 
B 1 340 PRO 340 340 340 PRO PRO B . n 
B 1 341 PHE 341 341 341 PHE PHE B . n 
B 1 342 LYS 342 342 342 LYS LYS B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 THR 344 344 344 THR THR B . n 
B 1 345 PRO 345 345 345 PRO PRO B . n 
B 1 346 ALA 346 346 346 ALA ALA B . n 
B 1 347 GLY 347 347 347 GLY GLY B . n 
B 1 348 VAL 348 348 348 VAL VAL B . n 
B 1 349 GLN 349 349 349 GLN GLN B . n 
B 1 350 ALA 350 350 350 ALA ALA B . n 
B 1 351 ALA 351 351 351 ALA ALA B . n 
B 1 352 ILE 352 352 352 ILE ILE B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 THR 354 354 354 THR THR B . n 
B 1 355 ALA 355 355 355 ALA ALA B . n 
B 1 356 ASP 356 356 356 ASP ASP B . n 
B 1 357 ARG 357 357 357 ARG ARG B . n 
B 1 358 LEU 358 358 358 LEU LEU B . n 
B 1 359 GLY 359 359 359 GLY GLY B . n 
B 1 360 SER 360 360 360 SER SER B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 TRP 362 362 362 TRP TRP B . n 
B 1 363 LEU 363 363 363 LEU LEU B . n 
B 1 364 GLN 364 364 364 GLN GLN B . n 
B 1 365 GLN 365 365 365 GLN GLN B . n 
B 1 366 HIS 366 366 366 HIS HIS B . n 
B 1 367 GLN 367 367 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PISA hexadecameric 16 
2 software_defined_assembly PISA octameric     8  
3 software_defined_assembly PISA dimeric       2  
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2,3,4,5,6,7,8 A,B,C,D,E,F,G,H,I,J,K,L,M,N 
2 1,2,3,4         A,B,C,D,E,F,G,H,I,J,K,L,M,N 
3 1               A,C,D,E,F,G,M               
3 4               B,H,I,J,K,L,N               
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 58910  ? 
1 MORE         -1084  ? 
1 'SSA (A^2)'  190240 ? 
2 'ABSA (A^2)' 27400  ? 
2 MORE         -535   ? 
2 'SSA (A^2)'  97170  ? 
3 'ABSA (A^2)' 4420   ? 
3 MORE         -120   ? 
3 'SSA (A^2)'  26720  ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z      1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 2_555 -x,-y,z    -1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
3 'crystal symmetry operation' 3_555 -y,x,z     0.0000000000  -1.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
4 'crystal symmetry operation' 4_555 y,-x,z     0.0000000000  1.0000000000  0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
5 'crystal symmetry operation' 5_556 -x,y,-z+1  -1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 259.8630000000 
6 'crystal symmetry operation' 6_556 x,-y,-z+1  1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 259.8630000000 
7 'crystal symmetry operation' 7_556 y,x,-z+1   0.0000000000  1.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 259.8630000000 
8 'crystal symmetry operation' 8_556 -y,-x,-z+1 0.0000000000  -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 259.8630000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 254 ? A HIS 254  ? 1_555 ZN ? C ZN . ? A ZN 1000 ? 1_555 OD1 ? A ASP 171 ? A ASP 171  ? 1_555 98.5  ? 
2  NE2 ? A HIS 254 ? A HIS 254  ? 1_555 ZN ? C ZN . ? A ZN 1000 ? 1_555 NE2 ? A HIS 271 ? A HIS 271  ? 1_555 108.5 ? 
3  OD1 ? A ASP 171 ? A ASP 171  ? 1_555 ZN ? C ZN . ? A ZN 1000 ? 1_555 NE2 ? A HIS 271 ? A HIS 271  ? 1_555 105.3 ? 
4  NE2 ? A HIS 254 ? A HIS 254  ? 1_555 ZN ? C ZN . ? A ZN 1000 ? 1_555 O1  ? E GOL .   ? A GOL 1002 ? 1_555 99.6  ? 
5  OD1 ? A ASP 171 ? A ASP 171  ? 1_555 ZN ? C ZN . ? A ZN 1000 ? 1_555 O1  ? E GOL .   ? A GOL 1002 ? 1_555 93.8  ? 
6  NE2 ? A HIS 271 ? A HIS 271  ? 1_555 ZN ? C ZN . ? A ZN 1000 ? 1_555 O1  ? E GOL .   ? A GOL 1002 ? 1_555 142.8 ? 
7  NE2 ? A HIS 254 ? A HIS 254  ? 1_555 ZN ? C ZN . ? A ZN 1000 ? 1_555 O3  ? E GOL .   ? A GOL 1002 ? 1_555 83.5  ? 
8  OD1 ? A ASP 171 ? A ASP 171  ? 1_555 ZN ? C ZN . ? A ZN 1000 ? 1_555 O3  ? E GOL .   ? A GOL 1002 ? 1_555 177.4 ? 
9  NE2 ? A HIS 271 ? A HIS 271  ? 1_555 ZN ? C ZN . ? A ZN 1000 ? 1_555 O3  ? E GOL .   ? A GOL 1002 ? 1_555 75.5  ? 
10 O1  ? E GOL .   ? A GOL 1002 ? 1_555 ZN ? C ZN . ? A ZN 1000 ? 1_555 O3  ? E GOL .   ? A GOL 1002 ? 1_555 84.2  ? 
11 NE2 ? A HIS 254 ? A HIS 254  ? 1_555 ZN ? C ZN . ? A ZN 1000 ? 1_555 OD2 ? A ASP 171 ? A ASP 171  ? 1_555 147.0 ? 
12 OD1 ? A ASP 171 ? A ASP 171  ? 1_555 ZN ? C ZN . ? A ZN 1000 ? 1_555 OD2 ? A ASP 171 ? A ASP 171  ? 1_555 51.3  ? 
13 NE2 ? A HIS 271 ? A HIS 271  ? 1_555 ZN ? C ZN . ? A ZN 1000 ? 1_555 OD2 ? A ASP 171 ? A ASP 171  ? 1_555 94.0  ? 
14 O1  ? E GOL .   ? A GOL 1002 ? 1_555 ZN ? C ZN . ? A ZN 1000 ? 1_555 OD2 ? A ASP 171 ? A ASP 171  ? 1_555 73.3  ? 
15 O3  ? E GOL .   ? A GOL 1002 ? 1_555 ZN ? C ZN . ? A ZN 1000 ? 1_555 OD2 ? A ASP 171 ? A ASP 171  ? 1_555 126.3 ? 
16 OD1 ? B ASP 171 ? B ASP 171  ? 1_555 ZN ? H ZN . ? B ZN 1000 ? 1_555 NE2 ? B HIS 254 ? B HIS 254  ? 1_555 105.2 ? 
17 OD1 ? B ASP 171 ? B ASP 171  ? 1_555 ZN ? H ZN . ? B ZN 1000 ? 1_555 O3  ? I GOL .   ? B GOL 1001 ? 1_555 106.7 ? 
18 NE2 ? B HIS 254 ? B HIS 254  ? 1_555 ZN ? H ZN . ? B ZN 1000 ? 1_555 O3  ? I GOL .   ? B GOL 1001 ? 1_555 94.8  ? 
19 OD1 ? B ASP 171 ? B ASP 171  ? 1_555 ZN ? H ZN . ? B ZN 1000 ? 1_555 NE2 ? B HIS 271 ? B HIS 271  ? 1_555 102.7 ? 
20 NE2 ? B HIS 254 ? B HIS 254  ? 1_555 ZN ? H ZN . ? B ZN 1000 ? 1_555 NE2 ? B HIS 271 ? B HIS 271  ? 1_555 109.4 ? 
21 O3  ? I GOL .   ? B GOL 1001 ? 1_555 ZN ? H ZN . ? B ZN 1000 ? 1_555 NE2 ? B HIS 271 ? B HIS 271  ? 1_555 135.1 ? 
22 OD1 ? B ASP 171 ? B ASP 171  ? 1_555 ZN ? H ZN . ? B ZN 1000 ? 1_555 O1  ? I GOL .   ? B GOL 1001 ? 1_555 166.7 ? 
23 NE2 ? B HIS 254 ? B HIS 254  ? 1_555 ZN ? H ZN . ? B ZN 1000 ? 1_555 O1  ? I GOL .   ? B GOL 1001 ? 1_555 87.4  ? 
24 O3  ? I GOL .   ? B GOL 1001 ? 1_555 ZN ? H ZN . ? B ZN 1000 ? 1_555 O1  ? I GOL .   ? B GOL 1001 ? 1_555 67.4  ? 
25 NE2 ? B HIS 271 ? B HIS 271  ? 1_555 ZN ? H ZN . ? B ZN 1000 ? 1_555 O1  ? I GOL .   ? B GOL 1001 ? 1_555 76.2  ? 
26 SG  ? B CYS 85  ? B CYS 85   ? 1_555 ZN ? K ZN . ? B ZN 1003 ? 1_555 NE2 ? B HIS 31  ? B HIS 31   ? 1_555 135.4 ? 
27 SG  ? A CYS 85  ? A CYS 85   ? 1_555 ZN ? D ZN . ? A ZN 1001 ? 1_555 NE2 ? A HIS 31  ? A HIS 31   ? 1_555 125.0 ? 
28 OD2 ? B ASP 121 ? B ASP 121  ? 1_555 NA ? L NA . ? B NA 1004 ? 1_555 OG1 ? B THR 175 ? B THR 175  ? 1_555 95.8  ? 
29 OD2 ? B ASP 121 ? B ASP 121  ? 1_555 NA ? L NA . ? B NA 1004 ? 1_555 O   ? B ASP 171 ? B ASP 171  ? 1_555 105.3 ? 
30 OG1 ? B THR 175 ? B THR 175  ? 1_555 NA ? L NA . ? B NA 1004 ? 1_555 O   ? B ASP 171 ? B ASP 171  ? 1_555 80.4  ? 
31 OD2 ? B ASP 121 ? B ASP 121  ? 1_555 NA ? L NA . ? B NA 1004 ? 1_555 OG  ? B SER 174 ? B SER 174  ? 1_555 159.0 ? 
32 OG1 ? B THR 175 ? B THR 175  ? 1_555 NA ? L NA . ? B NA 1004 ? 1_555 OG  ? B SER 174 ? B SER 174  ? 1_555 91.0  ? 
33 O   ? B ASP 171 ? B ASP 171  ? 1_555 NA ? L NA . ? B NA 1004 ? 1_555 OG  ? B SER 174 ? B SER 174  ? 1_555 56.3  ? 
34 OD2 ? B ASP 121 ? B ASP 121  ? 1_555 NA ? L NA . ? B NA 1004 ? 1_555 O   ? N HOH .   ? B HOH 1106 ? 1_555 134.1 ? 
35 OG1 ? B THR 175 ? B THR 175  ? 1_555 NA ? L NA . ? B NA 1004 ? 1_555 O   ? N HOH .   ? B HOH 1106 ? 1_555 86.9  ? 
36 O   ? B ASP 171 ? B ASP 171  ? 1_555 NA ? L NA . ? B NA 1004 ? 1_555 O   ? N HOH .   ? B HOH 1106 ? 1_555 120.3 ? 
37 OG  ? B SER 174 ? B SER 174  ? 1_555 NA ? L NA . ? B NA 1004 ? 1_555 O   ? N HOH .   ? B HOH 1106 ? 1_555 66.0  ? 
38 OD2 ? A ASP 121 ? A ASP 121  ? 1_555 NA ? G NA . ? A NA 1004 ? 1_555 O   ? A ASP 171 ? A ASP 171  ? 1_555 105.3 ? 
39 OD2 ? A ASP 121 ? A ASP 121  ? 1_555 NA ? G NA . ? A NA 1004 ? 1_555 OG1 ? A THR 175 ? A THR 175  ? 1_555 91.1  ? 
40 O   ? A ASP 171 ? A ASP 171  ? 1_555 NA ? G NA . ? A NA 1004 ? 1_555 OG1 ? A THR 175 ? A THR 175  ? 1_555 80.0  ? 
41 OD2 ? A ASP 121 ? A ASP 121  ? 1_555 NA ? G NA . ? A NA 1004 ? 1_555 OG  ? A SER 174 ? A SER 174  ? 1_555 160.5 ? 
42 O   ? A ASP 171 ? A ASP 171  ? 1_555 NA ? G NA . ? A NA 1004 ? 1_555 OG  ? A SER 174 ? A SER 174  ? 1_555 56.2  ? 
43 OG1 ? A THR 175 ? A THR 175  ? 1_555 NA ? G NA . ? A NA 1004 ? 1_555 OG  ? A SER 174 ? A SER 174  ? 1_555 91.4  ? 
44 OD2 ? A ASP 121 ? A ASP 121  ? 1_555 NA ? G NA . ? A NA 1004 ? 1_555 O   ? M HOH .   ? A HOH 1132 ? 1_555 130.4 ? 
45 O   ? A ASP 171 ? A ASP 171  ? 1_555 NA ? G NA . ? A NA 1004 ? 1_555 O   ? M HOH .   ? A HOH 1132 ? 1_555 123.1 ? 
46 OG1 ? A THR 175 ? A THR 175  ? 1_555 NA ? G NA . ? A NA 1004 ? 1_555 O   ? M HOH .   ? A HOH 1132 ? 1_555 87.5  ? 
47 OG  ? A SER 174 ? A SER 174  ? 1_555 NA ? G NA . ? A NA 1004 ? 1_555 O   ? M HOH .   ? A HOH 1132 ? 1_555 69.0  ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2014-02-12 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALEPACK   .     ?                                 program 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
2 PHASER      2.5.3 'Wed Feb 27 05:44:50 2013 (svn )' program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
3 REFMAC      .     ?                                 program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.11  'April 22, 2011'                  package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 SERGUI      .     ?                                 ?       ?                    ?                           'data collection' ? 
?          ? 
6 HKL-2000    .     ?                                 ?       ?                    ?                           'data reduction'  ? 
?          ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD1 A ASP 121  ? ? O1 A GOL 1002 ? ? 2.04 
2 1 O   B HOH 1193 ? ? O  B HOH 1240 ? ? 2.10 
3 1 O   B HOH 1277 ? ? O  B HOH 1284 ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CZ A ARG 3   ? ? NH1 A ARG 3   ? ? 1.405 1.326 0.079  0.013 N 
2 1 CD A GLU 311 ? ? OE1 A GLU 311 ? ? 1.184 1.252 -0.068 0.011 N 
3 1 CD A GLU 311 ? ? OE2 A GLU 311 ? ? 1.180 1.252 -0.072 0.011 N 
4 1 CD B GLU 235 ? ? OE2 B GLU 235 ? ? 1.318 1.252 0.066  0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 3   ? ? CZ A ARG 3   ? ? NH2 A ARG 3   ? ? 113.34 120.30 -6.96  0.50 N 
2 1 CB A ASP 208 ? ? CG A ASP 208 ? ? OD1 A ASP 208 ? ? 123.87 118.30 5.57   0.90 N 
3 1 CG B ARG 3   ? ? CD B ARG 3   ? ? NE  B ARG 3   ? ? 98.36  111.80 -13.44 2.10 N 
4 1 NE B ARG 3   ? ? CZ B ARG 3   ? ? NH1 B ARG 3   ? ? 124.00 120.30 3.70   0.50 N 
5 1 NE B ARG 3   ? ? CZ B ARG 3   ? ? NH2 B ARG 3   ? ? 112.49 120.30 -7.81  0.50 N 
6 1 NE B ARG 204 ? ? CZ B ARG 204 ? ? NH1 B ARG 204 ? ? 123.89 120.30 3.59   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 65  ? ? -93.05  32.18   
2  1 ALA A 118 ? ? -116.82 57.40   
3  1 ALA A 126 ? ? -85.43  46.10   
4  1 ALA A 138 ? ? -106.22 -63.32  
5  1 ALA A 251 ? ? -149.17 -127.16 
6  1 HIS B 31  ? ? -160.68 112.67  
7  1 HIS B 70  ? ? -54.83  -8.66   
8  1 ALA B 118 ? ? -117.95 64.73   
9  1 ALA B 126 ? ? -93.21  40.91   
10 1 ALA B 138 ? ? -106.34 -61.53  
11 1 ALA B 251 ? ? -149.39 -128.90 
12 1 ALA B 331 ? ? -48.95  153.03  
13 1 PRO B 340 ? ? -78.94  30.01   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A HIS 268 ? CG  ? A HIS 268 CG  
2 1 Y 1 A HIS 268 ? ND1 ? A HIS 268 ND1 
3 1 Y 1 A HIS 268 ? CD2 ? A HIS 268 CD2 
4 1 Y 1 A HIS 268 ? CE1 ? A HIS 268 CE1 
5 1 Y 1 A HIS 268 ? NE2 ? A HIS 268 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B MET 1   ? B MET 1   
2 1 Y 1 B GLU 67  ? B GLU 67  
3 1 Y 1 B CYS 68  ? B CYS 68  
4 1 Y 1 B GLN 367 ? B GLN 367 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'   ZN  
3 GLYCEROL     GOL 
4 'SODIUM ION' NA  
5 water        HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1   1000 1000 ZN  ZN  A . 
D 2 ZN  1   1001 1001 ZN  ZN  A . 
E 3 GOL 1   1002 1002 GOL GOL A . 
F 3 GOL 1   1003 1003 GOL GOL A . 
G 4 NA  1   1004 1004 NA  NA  A . 
H 2 ZN  1   1000 1000 ZN  ZN  B . 
I 3 GOL 1   1001 1001 GOL GOL B . 
J 3 GOL 1   1002 1002 GOL GOL B . 
K 2 ZN  1   1003 1003 ZN  ZN  B . 
L 4 NA  1   1004 1004 NA  NA  B . 
M 5 HOH 1   1101 2    HOH HOH A . 
M 5 HOH 2   1102 3    HOH HOH A . 
M 5 HOH 3   1103 4    HOH HOH A . 
M 5 HOH 4   1104 6    HOH HOH A . 
M 5 HOH 5   1105 7    HOH HOH A . 
M 5 HOH 6   1106 8    HOH HOH A . 
M 5 HOH 7   1107 10   HOH HOH A . 
M 5 HOH 8   1108 11   HOH HOH A . 
M 5 HOH 9   1109 15   HOH HOH A . 
M 5 HOH 10  1110 16   HOH HOH A . 
M 5 HOH 11  1111 17   HOH HOH A . 
M 5 HOH 12  1112 20   HOH HOH A . 
M 5 HOH 13  1113 21   HOH HOH A . 
M 5 HOH 14  1114 22   HOH HOH A . 
M 5 HOH 15  1115 25   HOH HOH A . 
M 5 HOH 16  1116 27   HOH HOH A . 
M 5 HOH 17  1117 28   HOH HOH A . 
M 5 HOH 18  1118 30   HOH HOH A . 
M 5 HOH 19  1119 32   HOH HOH A . 
M 5 HOH 20  1120 33   HOH HOH A . 
M 5 HOH 21  1121 38   HOH HOH A . 
M 5 HOH 22  1122 39   HOH HOH A . 
M 5 HOH 23  1123 40   HOH HOH A . 
M 5 HOH 24  1124 42   HOH HOH A . 
M 5 HOH 25  1125 44   HOH HOH A . 
M 5 HOH 26  1126 46   HOH HOH A . 
M 5 HOH 27  1127 47   HOH HOH A . 
M 5 HOH 28  1128 49   HOH HOH A . 
M 5 HOH 29  1129 52   HOH HOH A . 
M 5 HOH 30  1130 53   HOH HOH A . 
M 5 HOH 31  1131 58   HOH HOH A . 
M 5 HOH 32  1132 59   HOH HOH A . 
M 5 HOH 33  1133 60   HOH HOH A . 
M 5 HOH 34  1134 67   HOH HOH A . 
M 5 HOH 35  1135 69   HOH HOH A . 
M 5 HOH 36  1136 72   HOH HOH A . 
M 5 HOH 37  1137 74   HOH HOH A . 
M 5 HOH 38  1138 76   HOH HOH A . 
M 5 HOH 39  1139 81   HOH HOH A . 
M 5 HOH 40  1140 82   HOH HOH A . 
M 5 HOH 41  1141 83   HOH HOH A . 
M 5 HOH 42  1142 86   HOH HOH A . 
M 5 HOH 43  1143 87   HOH HOH A . 
M 5 HOH 44  1144 88   HOH HOH A . 
M 5 HOH 45  1145 89   HOH HOH A . 
M 5 HOH 46  1146 91   HOH HOH A . 
M 5 HOH 47  1147 92   HOH HOH A . 
M 5 HOH 48  1148 99   HOH HOH A . 
M 5 HOH 49  1149 100  HOH HOH A . 
M 5 HOH 50  1150 104  HOH HOH A . 
M 5 HOH 51  1151 107  HOH HOH A . 
M 5 HOH 52  1152 111  HOH HOH A . 
M 5 HOH 53  1153 119  HOH HOH A . 
M 5 HOH 54  1154 123  HOH HOH A . 
M 5 HOH 55  1155 125  HOH HOH A . 
M 5 HOH 56  1156 127  HOH HOH A . 
M 5 HOH 57  1157 128  HOH HOH A . 
M 5 HOH 58  1158 129  HOH HOH A . 
M 5 HOH 59  1159 131  HOH HOH A . 
M 5 HOH 60  1160 136  HOH HOH A . 
M 5 HOH 61  1161 137  HOH HOH A . 
M 5 HOH 62  1162 142  HOH HOH A . 
M 5 HOH 63  1163 146  HOH HOH A . 
M 5 HOH 64  1164 150  HOH HOH A . 
M 5 HOH 65  1165 152  HOH HOH A . 
M 5 HOH 66  1166 154  HOH HOH A . 
M 5 HOH 67  1167 155  HOH HOH A . 
M 5 HOH 68  1168 157  HOH HOH A . 
M 5 HOH 69  1169 159  HOH HOH A . 
M 5 HOH 70  1170 160  HOH HOH A . 
M 5 HOH 71  1171 164  HOH HOH A . 
M 5 HOH 72  1172 165  HOH HOH A . 
M 5 HOH 73  1173 166  HOH HOH A . 
M 5 HOH 74  1174 167  HOH HOH A . 
M 5 HOH 75  1175 168  HOH HOH A . 
M 5 HOH 76  1176 169  HOH HOH A . 
M 5 HOH 77  1177 171  HOH HOH A . 
M 5 HOH 78  1178 172  HOH HOH A . 
M 5 HOH 79  1179 175  HOH HOH A . 
M 5 HOH 80  1180 177  HOH HOH A . 
M 5 HOH 81  1181 179  HOH HOH A . 
M 5 HOH 82  1182 184  HOH HOH A . 
M 5 HOH 83  1183 186  HOH HOH A . 
M 5 HOH 84  1184 189  HOH HOH A . 
M 5 HOH 85  1185 190  HOH HOH A . 
M 5 HOH 86  1186 191  HOH HOH A . 
M 5 HOH 87  1187 192  HOH HOH A . 
M 5 HOH 88  1188 194  HOH HOH A . 
M 5 HOH 89  1189 195  HOH HOH A . 
M 5 HOH 90  1190 197  HOH HOH A . 
M 5 HOH 91  1191 199  HOH HOH A . 
M 5 HOH 92  1192 201  HOH HOH A . 
M 5 HOH 93  1193 203  HOH HOH A . 
M 5 HOH 94  1194 210  HOH HOH A . 
M 5 HOH 95  1195 211  HOH HOH A . 
M 5 HOH 96  1196 216  HOH HOH A . 
M 5 HOH 97  1197 220  HOH HOH A . 
M 5 HOH 98  1198 222  HOH HOH A . 
M 5 HOH 99  1199 223  HOH HOH A . 
M 5 HOH 100 1200 224  HOH HOH A . 
M 5 HOH 101 1201 229  HOH HOH A . 
M 5 HOH 102 1202 230  HOH HOH A . 
M 5 HOH 103 1203 232  HOH HOH A . 
M 5 HOH 104 1204 233  HOH HOH A . 
M 5 HOH 105 1205 236  HOH HOH A . 
M 5 HOH 106 1206 238  HOH HOH A . 
M 5 HOH 107 1207 241  HOH HOH A . 
M 5 HOH 108 1208 242  HOH HOH A . 
M 5 HOH 109 1209 244  HOH HOH A . 
M 5 HOH 110 1210 245  HOH HOH A . 
M 5 HOH 111 1211 247  HOH HOH A . 
M 5 HOH 112 1212 248  HOH HOH A . 
M 5 HOH 113 1213 253  HOH HOH A . 
M 5 HOH 114 1214 255  HOH HOH A . 
M 5 HOH 115 1215 256  HOH HOH A . 
M 5 HOH 116 1216 259  HOH HOH A . 
M 5 HOH 117 1217 260  HOH HOH A . 
M 5 HOH 118 1218 261  HOH HOH A . 
M 5 HOH 119 1219 263  HOH HOH A . 
M 5 HOH 120 1220 264  HOH HOH A . 
M 5 HOH 121 1221 265  HOH HOH A . 
M 5 HOH 122 1222 267  HOH HOH A . 
M 5 HOH 123 1223 268  HOH HOH A . 
M 5 HOH 124 1224 271  HOH HOH A . 
M 5 HOH 125 1225 272  HOH HOH A . 
M 5 HOH 126 1226 273  HOH HOH A . 
M 5 HOH 127 1227 274  HOH HOH A . 
M 5 HOH 128 1228 279  HOH HOH A . 
M 5 HOH 129 1229 280  HOH HOH A . 
M 5 HOH 130 1230 282  HOH HOH A . 
M 5 HOH 131 1231 284  HOH HOH A . 
M 5 HOH 132 1232 286  HOH HOH A . 
M 5 HOH 133 1233 288  HOH HOH A . 
M 5 HOH 134 1234 289  HOH HOH A . 
M 5 HOH 135 1235 290  HOH HOH A . 
M 5 HOH 136 1236 293  HOH HOH A . 
M 5 HOH 137 1237 294  HOH HOH A . 
M 5 HOH 138 1238 295  HOH HOH A . 
M 5 HOH 139 1239 296  HOH HOH A . 
M 5 HOH 140 1240 298  HOH HOH A . 
M 5 HOH 141 1241 301  HOH HOH A . 
M 5 HOH 142 1242 303  HOH HOH A . 
M 5 HOH 143 1243 304  HOH HOH A . 
M 5 HOH 144 1244 310  HOH HOH A . 
M 5 HOH 145 1245 311  HOH HOH A . 
M 5 HOH 146 1246 312  HOH HOH A . 
M 5 HOH 147 1247 313  HOH HOH A . 
M 5 HOH 148 1248 314  HOH HOH A . 
M 5 HOH 149 1249 315  HOH HOH A . 
M 5 HOH 150 1250 316  HOH HOH A . 
M 5 HOH 151 1251 318  HOH HOH A . 
M 5 HOH 152 1252 323  HOH HOH A . 
M 5 HOH 153 1253 324  HOH HOH A . 
M 5 HOH 154 1254 325  HOH HOH A . 
M 5 HOH 155 1255 326  HOH HOH A . 
M 5 HOH 156 1256 330  HOH HOH A . 
M 5 HOH 157 1257 331  HOH HOH A . 
M 5 HOH 158 1258 332  HOH HOH A . 
M 5 HOH 159 1259 333  HOH HOH A . 
M 5 HOH 160 1260 335  HOH HOH A . 
M 5 HOH 161 1261 337  HOH HOH A . 
M 5 HOH 162 1262 340  HOH HOH A . 
M 5 HOH 163 1263 342  HOH HOH A . 
M 5 HOH 164 1264 345  HOH HOH A . 
M 5 HOH 165 1265 346  HOH HOH A . 
M 5 HOH 166 1266 347  HOH HOH A . 
M 5 HOH 167 1267 350  HOH HOH A . 
M 5 HOH 168 1268 351  HOH HOH A . 
M 5 HOH 169 1269 352  HOH HOH A . 
M 5 HOH 170 1270 355  HOH HOH A . 
M 5 HOH 171 1271 356  HOH HOH A . 
M 5 HOH 172 1272 358  HOH HOH A . 
M 5 HOH 173 1273 359  HOH HOH A . 
M 5 HOH 174 1274 361  HOH HOH A . 
N 5 HOH 1   1101 1    HOH HOH B . 
N 5 HOH 2   1102 5    HOH HOH B . 
N 5 HOH 3   1103 9    HOH HOH B . 
N 5 HOH 4   1104 12   HOH HOH B . 
N 5 HOH 5   1105 13   HOH HOH B . 
N 5 HOH 6   1106 14   HOH HOH B . 
N 5 HOH 7   1107 18   HOH HOH B . 
N 5 HOH 8   1108 19   HOH HOH B . 
N 5 HOH 9   1109 23   HOH HOH B . 
N 5 HOH 10  1110 24   HOH HOH B . 
N 5 HOH 11  1111 26   HOH HOH B . 
N 5 HOH 12  1112 29   HOH HOH B . 
N 5 HOH 13  1113 31   HOH HOH B . 
N 5 HOH 14  1114 34   HOH HOH B . 
N 5 HOH 15  1115 35   HOH HOH B . 
N 5 HOH 16  1116 36   HOH HOH B . 
N 5 HOH 17  1117 37   HOH HOH B . 
N 5 HOH 18  1118 41   HOH HOH B . 
N 5 HOH 19  1119 43   HOH HOH B . 
N 5 HOH 20  1120 45   HOH HOH B . 
N 5 HOH 21  1121 48   HOH HOH B . 
N 5 HOH 22  1122 50   HOH HOH B . 
N 5 HOH 23  1123 51   HOH HOH B . 
N 5 HOH 24  1124 54   HOH HOH B . 
N 5 HOH 25  1125 55   HOH HOH B . 
N 5 HOH 26  1126 56   HOH HOH B . 
N 5 HOH 27  1127 57   HOH HOH B . 
N 5 HOH 28  1128 61   HOH HOH B . 
N 5 HOH 29  1129 62   HOH HOH B . 
N 5 HOH 30  1130 63   HOH HOH B . 
N 5 HOH 31  1131 64   HOH HOH B . 
N 5 HOH 32  1132 65   HOH HOH B . 
N 5 HOH 33  1133 66   HOH HOH B . 
N 5 HOH 34  1134 68   HOH HOH B . 
N 5 HOH 35  1135 70   HOH HOH B . 
N 5 HOH 36  1136 71   HOH HOH B . 
N 5 HOH 37  1137 73   HOH HOH B . 
N 5 HOH 38  1138 75   HOH HOH B . 
N 5 HOH 39  1139 77   HOH HOH B . 
N 5 HOH 40  1140 78   HOH HOH B . 
N 5 HOH 41  1141 79   HOH HOH B . 
N 5 HOH 42  1142 80   HOH HOH B . 
N 5 HOH 43  1143 84   HOH HOH B . 
N 5 HOH 44  1144 85   HOH HOH B . 
N 5 HOH 45  1145 90   HOH HOH B . 
N 5 HOH 46  1146 93   HOH HOH B . 
N 5 HOH 47  1147 94   HOH HOH B . 
N 5 HOH 48  1148 95   HOH HOH B . 
N 5 HOH 49  1149 96   HOH HOH B . 
N 5 HOH 50  1150 97   HOH HOH B . 
N 5 HOH 51  1151 98   HOH HOH B . 
N 5 HOH 52  1152 101  HOH HOH B . 
N 5 HOH 53  1153 102  HOH HOH B . 
N 5 HOH 54  1154 103  HOH HOH B . 
N 5 HOH 55  1155 105  HOH HOH B . 
N 5 HOH 56  1156 106  HOH HOH B . 
N 5 HOH 57  1157 108  HOH HOH B . 
N 5 HOH 58  1158 109  HOH HOH B . 
N 5 HOH 59  1159 110  HOH HOH B . 
N 5 HOH 60  1160 112  HOH HOH B . 
N 5 HOH 61  1161 113  HOH HOH B . 
N 5 HOH 62  1162 114  HOH HOH B . 
N 5 HOH 63  1163 115  HOH HOH B . 
N 5 HOH 64  1164 116  HOH HOH B . 
N 5 HOH 65  1165 117  HOH HOH B . 
N 5 HOH 66  1166 118  HOH HOH B . 
N 5 HOH 67  1167 120  HOH HOH B . 
N 5 HOH 68  1168 121  HOH HOH B . 
N 5 HOH 69  1169 122  HOH HOH B . 
N 5 HOH 70  1170 124  HOH HOH B . 
N 5 HOH 71  1171 126  HOH HOH B . 
N 5 HOH 72  1172 130  HOH HOH B . 
N 5 HOH 73  1173 132  HOH HOH B . 
N 5 HOH 74  1174 133  HOH HOH B . 
N 5 HOH 75  1175 134  HOH HOH B . 
N 5 HOH 76  1176 135  HOH HOH B . 
N 5 HOH 77  1177 138  HOH HOH B . 
N 5 HOH 78  1178 139  HOH HOH B . 
N 5 HOH 79  1179 140  HOH HOH B . 
N 5 HOH 80  1180 141  HOH HOH B . 
N 5 HOH 81  1181 143  HOH HOH B . 
N 5 HOH 82  1182 144  HOH HOH B . 
N 5 HOH 83  1183 145  HOH HOH B . 
N 5 HOH 84  1184 147  HOH HOH B . 
N 5 HOH 85  1185 148  HOH HOH B . 
N 5 HOH 86  1186 149  HOH HOH B . 
N 5 HOH 87  1187 151  HOH HOH B . 
N 5 HOH 88  1188 153  HOH HOH B . 
N 5 HOH 89  1189 156  HOH HOH B . 
N 5 HOH 90  1190 158  HOH HOH B . 
N 5 HOH 91  1191 161  HOH HOH B . 
N 5 HOH 92  1192 162  HOH HOH B . 
N 5 HOH 93  1193 163  HOH HOH B . 
N 5 HOH 94  1194 170  HOH HOH B . 
N 5 HOH 95  1195 173  HOH HOH B . 
N 5 HOH 96  1196 174  HOH HOH B . 
N 5 HOH 97  1197 176  HOH HOH B . 
N 5 HOH 98  1198 178  HOH HOH B . 
N 5 HOH 99  1199 180  HOH HOH B . 
N 5 HOH 100 1200 181  HOH HOH B . 
N 5 HOH 101 1201 182  HOH HOH B . 
N 5 HOH 102 1202 183  HOH HOH B . 
N 5 HOH 103 1203 185  HOH HOH B . 
N 5 HOH 104 1204 187  HOH HOH B . 
N 5 HOH 105 1205 188  HOH HOH B . 
N 5 HOH 106 1206 193  HOH HOH B . 
N 5 HOH 107 1207 196  HOH HOH B . 
N 5 HOH 108 1208 198  HOH HOH B . 
N 5 HOH 109 1209 200  HOH HOH B . 
N 5 HOH 110 1210 202  HOH HOH B . 
N 5 HOH 111 1211 204  HOH HOH B . 
N 5 HOH 112 1212 205  HOH HOH B . 
N 5 HOH 113 1213 206  HOH HOH B . 
N 5 HOH 114 1214 207  HOH HOH B . 
N 5 HOH 115 1215 208  HOH HOH B . 
N 5 HOH 116 1216 209  HOH HOH B . 
N 5 HOH 117 1217 212  HOH HOH B . 
N 5 HOH 118 1218 213  HOH HOH B . 
N 5 HOH 119 1219 214  HOH HOH B . 
N 5 HOH 120 1220 215  HOH HOH B . 
N 5 HOH 121 1221 217  HOH HOH B . 
N 5 HOH 122 1222 218  HOH HOH B . 
N 5 HOH 123 1223 219  HOH HOH B . 
N 5 HOH 124 1224 221  HOH HOH B . 
N 5 HOH 125 1225 225  HOH HOH B . 
N 5 HOH 126 1226 226  HOH HOH B . 
N 5 HOH 127 1227 227  HOH HOH B . 
N 5 HOH 128 1228 228  HOH HOH B . 
N 5 HOH 129 1229 231  HOH HOH B . 
N 5 HOH 130 1230 234  HOH HOH B . 
N 5 HOH 131 1231 235  HOH HOH B . 
N 5 HOH 132 1232 237  HOH HOH B . 
N 5 HOH 133 1233 239  HOH HOH B . 
N 5 HOH 134 1234 240  HOH HOH B . 
N 5 HOH 135 1235 243  HOH HOH B . 
N 5 HOH 136 1236 246  HOH HOH B . 
N 5 HOH 137 1237 249  HOH HOH B . 
N 5 HOH 138 1238 250  HOH HOH B . 
N 5 HOH 139 1239 251  HOH HOH B . 
N 5 HOH 140 1240 252  HOH HOH B . 
N 5 HOH 141 1241 254  HOH HOH B . 
N 5 HOH 142 1242 257  HOH HOH B . 
N 5 HOH 143 1243 258  HOH HOH B . 
N 5 HOH 144 1244 262  HOH HOH B . 
N 5 HOH 145 1245 266  HOH HOH B . 
N 5 HOH 146 1246 269  HOH HOH B . 
N 5 HOH 147 1247 270  HOH HOH B . 
N 5 HOH 148 1248 275  HOH HOH B . 
N 5 HOH 149 1249 276  HOH HOH B . 
N 5 HOH 150 1250 277  HOH HOH B . 
N 5 HOH 151 1251 278  HOH HOH B . 
N 5 HOH 152 1252 281  HOH HOH B . 
N 5 HOH 153 1253 283  HOH HOH B . 
N 5 HOH 154 1254 285  HOH HOH B . 
N 5 HOH 155 1255 287  HOH HOH B . 
N 5 HOH 156 1256 291  HOH HOH B . 
N 5 HOH 157 1257 292  HOH HOH B . 
N 5 HOH 158 1258 297  HOH HOH B . 
N 5 HOH 159 1259 299  HOH HOH B . 
N 5 HOH 160 1260 300  HOH HOH B . 
N 5 HOH 161 1261 302  HOH HOH B . 
N 5 HOH 162 1262 305  HOH HOH B . 
N 5 HOH 163 1263 306  HOH HOH B . 
N 5 HOH 164 1264 307  HOH HOH B . 
N 5 HOH 165 1265 308  HOH HOH B . 
N 5 HOH 166 1266 309  HOH HOH B . 
N 5 HOH 167 1267 317  HOH HOH B . 
N 5 HOH 168 1268 319  HOH HOH B . 
N 5 HOH 169 1269 320  HOH HOH B . 
N 5 HOH 170 1270 321  HOH HOH B . 
N 5 HOH 171 1271 322  HOH HOH B . 
N 5 HOH 172 1272 327  HOH HOH B . 
N 5 HOH 173 1273 328  HOH HOH B . 
N 5 HOH 174 1274 329  HOH HOH B . 
N 5 HOH 175 1275 334  HOH HOH B . 
N 5 HOH 176 1276 336  HOH HOH B . 
N 5 HOH 177 1277 338  HOH HOH B . 
N 5 HOH 178 1278 339  HOH HOH B . 
N 5 HOH 179 1279 341  HOH HOH B . 
N 5 HOH 180 1280 343  HOH HOH B . 
N 5 HOH 181 1281 344  HOH HOH B . 
N 5 HOH 182 1282 348  HOH HOH B . 
N 5 HOH 183 1283 349  HOH HOH B . 
N 5 HOH 184 1284 353  HOH HOH B . 
N 5 HOH 185 1285 354  HOH HOH B . 
N 5 HOH 186 1286 357  HOH HOH B . 
N 5 HOH 187 1287 360  HOH HOH B . 
N 5 HOH 188 1288 362  HOH HOH B . 
N 5 HOH 189 1289 363  HOH HOH B . 
N 5 HOH 190 1290 364  HOH HOH B . 
N 5 HOH 191 1291 365  HOH HOH B . 
#